data_1XFB
# 
_entry.id   1XFB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XFB         
RCSB  RCSB030296   
WWPDB D_1000030296 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1J4E 
_pdbx_database_related.details        'Rabbit muscle Aldolase A isozyme' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1XFB 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-14 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arakaki, T.L.' 1 
'Pezza, J.A.'   2 
'Cronin, M.A.'  3 
'Hopkins, C.E.' 4 
'Zimmer, D.B.'  5 
'Tolan, D.R.'   6 
'Allen, K.N.'   7 
# 
_citation.id                        primary 
_citation.title                     
'Structure of human brain fructose 1,6-(bis)phosphate aldolase: linking isozyme structure with function' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            13 
_citation.page_first                3077 
_citation.page_last                 3084 
_citation.year                      2004 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15537755 
_citation.pdbx_database_id_DOI      10.1110/ps.04915904 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Arakaki, T.L.' 1 
primary 'Pezza, J.A.'   2 
primary 'Cronin, M.A.'  3 
primary 'Hopkins, C.E.' 4 
primary 'Zimmer, D.B.'  5 
primary 'Tolan, D.R.'   6 
primary 'Allen, K.N.'   7 
# 
_cell.entry_id           1XFB 
_cell.length_a           83.872 
_cell.length_b           121.986 
_cell.length_c           129.517 
_cell.angle_alpha        107.96 
_cell.angle_beta         108.58 
_cell.angle_gamma        97.39 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
# 
_symmetry.entry_id                         1XFB 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                1 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Aldolase C' 
_entity.formula_weight             39616.973 
_entity.pdbx_number_of_molecules   12 
_entity.pdbx_ec                    4.1.2.13 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Fructose 1,6-(bis)phosphate Aldolase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFF
HETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPS
ALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDN
AGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAYL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFF
HETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPS
ALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDN
AGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAYL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   HIS n 
1 4   SER n 
1 5   TYR n 
1 6   PRO n 
1 7   ALA n 
1 8   LEU n 
1 9   SER n 
1 10  ALA n 
1 11  GLU n 
1 12  GLN n 
1 13  LYS n 
1 14  LYS n 
1 15  GLU n 
1 16  LEU n 
1 17  SER n 
1 18  ASP n 
1 19  ILE n 
1 20  ALA n 
1 21  LEU n 
1 22  ARG n 
1 23  ILE n 
1 24  VAL n 
1 25  ALA n 
1 26  PRO n 
1 27  GLY n 
1 28  LYS n 
1 29  GLY n 
1 30  ILE n 
1 31  LEU n 
1 32  ALA n 
1 33  ALA n 
1 34  ASP n 
1 35  GLU n 
1 36  SER n 
1 37  VAL n 
1 38  GLY n 
1 39  SER n 
1 40  MET n 
1 41  ALA n 
1 42  LYS n 
1 43  ARG n 
1 44  LEU n 
1 45  SER n 
1 46  GLN n 
1 47  ILE n 
1 48  GLY n 
1 49  VAL n 
1 50  GLU n 
1 51  ASN n 
1 52  THR n 
1 53  GLU n 
1 54  GLU n 
1 55  ASN n 
1 56  ARG n 
1 57  ARG n 
1 58  LEU n 
1 59  TYR n 
1 60  ARG n 
1 61  GLN n 
1 62  VAL n 
1 63  LEU n 
1 64  PHE n 
1 65  SER n 
1 66  ALA n 
1 67  ASP n 
1 68  ASP n 
1 69  ARG n 
1 70  VAL n 
1 71  LYS n 
1 72  LYS n 
1 73  CYS n 
1 74  ILE n 
1 75  GLY n 
1 76  GLY n 
1 77  VAL n 
1 78  ILE n 
1 79  PHE n 
1 80  PHE n 
1 81  HIS n 
1 82  GLU n 
1 83  THR n 
1 84  LEU n 
1 85  TYR n 
1 86  GLN n 
1 87  LYS n 
1 88  ASP n 
1 89  ASP n 
1 90  ASN n 
1 91  GLY n 
1 92  VAL n 
1 93  PRO n 
1 94  PHE n 
1 95  VAL n 
1 96  ARG n 
1 97  THR n 
1 98  ILE n 
1 99  GLN n 
1 100 ASP n 
1 101 LYS n 
1 102 GLY n 
1 103 ILE n 
1 104 VAL n 
1 105 VAL n 
1 106 GLY n 
1 107 ILE n 
1 108 LYS n 
1 109 VAL n 
1 110 ASP n 
1 111 LYS n 
1 112 GLY n 
1 113 VAL n 
1 114 VAL n 
1 115 PRO n 
1 116 LEU n 
1 117 ALA n 
1 118 GLY n 
1 119 THR n 
1 120 ASP n 
1 121 GLY n 
1 122 GLU n 
1 123 THR n 
1 124 THR n 
1 125 THR n 
1 126 GLN n 
1 127 GLY n 
1 128 LEU n 
1 129 ASP n 
1 130 GLY n 
1 131 LEU n 
1 132 SER n 
1 133 GLU n 
1 134 ARG n 
1 135 CYS n 
1 136 ALA n 
1 137 GLN n 
1 138 TYR n 
1 139 LYS n 
1 140 LYS n 
1 141 ASP n 
1 142 GLY n 
1 143 ALA n 
1 144 ASP n 
1 145 PHE n 
1 146 ALA n 
1 147 LYS n 
1 148 TRP n 
1 149 ARG n 
1 150 CYS n 
1 151 VAL n 
1 152 LEU n 
1 153 LYS n 
1 154 ILE n 
1 155 SER n 
1 156 GLU n 
1 157 ARG n 
1 158 THR n 
1 159 PRO n 
1 160 SER n 
1 161 ALA n 
1 162 LEU n 
1 163 ALA n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 ASN n 
1 168 ALA n 
1 169 ASN n 
1 170 VAL n 
1 171 LEU n 
1 172 ALA n 
1 173 ARG n 
1 174 TYR n 
1 175 ALA n 
1 176 SER n 
1 177 ILE n 
1 178 CYS n 
1 179 GLN n 
1 180 GLN n 
1 181 ASN n 
1 182 GLY n 
1 183 ILE n 
1 184 VAL n 
1 185 PRO n 
1 186 ILE n 
1 187 VAL n 
1 188 GLU n 
1 189 PRO n 
1 190 GLU n 
1 191 ILE n 
1 192 LEU n 
1 193 PRO n 
1 194 ASP n 
1 195 GLY n 
1 196 ASP n 
1 197 HIS n 
1 198 ASP n 
1 199 LEU n 
1 200 LYS n 
1 201 ARG n 
1 202 CYS n 
1 203 GLN n 
1 204 TYR n 
1 205 VAL n 
1 206 THR n 
1 207 GLU n 
1 208 LYS n 
1 209 VAL n 
1 210 LEU n 
1 211 ALA n 
1 212 ALA n 
1 213 VAL n 
1 214 TYR n 
1 215 LYS n 
1 216 ALA n 
1 217 LEU n 
1 218 SER n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 VAL n 
1 223 TYR n 
1 224 LEU n 
1 225 GLU n 
1 226 GLY n 
1 227 THR n 
1 228 LEU n 
1 229 LEU n 
1 230 LYS n 
1 231 PRO n 
1 232 ASN n 
1 233 MET n 
1 234 VAL n 
1 235 THR n 
1 236 PRO n 
1 237 GLY n 
1 238 HIS n 
1 239 ALA n 
1 240 CYS n 
1 241 PRO n 
1 242 ILE n 
1 243 LYS n 
1 244 TYR n 
1 245 THR n 
1 246 PRO n 
1 247 GLU n 
1 248 GLU n 
1 249 ILE n 
1 250 ALA n 
1 251 MET n 
1 252 ALA n 
1 253 THR n 
1 254 VAL n 
1 255 THR n 
1 256 ALA n 
1 257 LEU n 
1 258 ARG n 
1 259 ARG n 
1 260 THR n 
1 261 VAL n 
1 262 PRO n 
1 263 PRO n 
1 264 ALA n 
1 265 VAL n 
1 266 PRO n 
1 267 GLY n 
1 268 VAL n 
1 269 THR n 
1 270 PHE n 
1 271 LEU n 
1 272 SER n 
1 273 GLY n 
1 274 GLY n 
1 275 GLN n 
1 276 SER n 
1 277 GLU n 
1 278 GLU n 
1 279 GLU n 
1 280 ALA n 
1 281 SER n 
1 282 PHE n 
1 283 ASN n 
1 284 LEU n 
1 285 ASN n 
1 286 ALA n 
1 287 ILE n 
1 288 ASN n 
1 289 ARG n 
1 290 CYS n 
1 291 PRO n 
1 292 LEU n 
1 293 PRO n 
1 294 ARG n 
1 295 PRO n 
1 296 TRP n 
1 297 ALA n 
1 298 LEU n 
1 299 THR n 
1 300 PHE n 
1 301 SER n 
1 302 TYR n 
1 303 GLY n 
1 304 ARG n 
1 305 ALA n 
1 306 LEU n 
1 307 GLN n 
1 308 ALA n 
1 309 SER n 
1 310 ALA n 
1 311 LEU n 
1 312 ASN n 
1 313 ALA n 
1 314 TRP n 
1 315 ARG n 
1 316 GLY n 
1 317 GLN n 
1 318 ARG n 
1 319 ASP n 
1 320 ASN n 
1 321 ALA n 
1 322 GLY n 
1 323 ALA n 
1 324 ALA n 
1 325 THR n 
1 326 GLU n 
1 327 GLU n 
1 328 PHE n 
1 329 ILE n 
1 330 LYS n 
1 331 ARG n 
1 332 ALA n 
1 333 GLU n 
1 334 VAL n 
1 335 ASN n 
1 336 GLY n 
1 337 LEU n 
1 338 ALA n 
1 339 ALA n 
1 340 GLN n 
1 341 GLY n 
1 342 LYS n 
1 343 TYR n 
1 344 GLU n 
1 345 GLY n 
1 346 SER n 
1 347 GLY n 
1 348 GLU n 
1 349 ASP n 
1 350 GLY n 
1 351 GLY n 
1 352 ALA n 
1 353 ALA n 
1 354 ALA n 
1 355 GLN n 
1 356 SER n 
1 357 LEU n 
1 358 TYR n 
1 359 ILE n 
1 360 ALA n 
1 361 ASN n 
1 362 HIS n 
1 363 ALA n 
1 364 TYR n 
1 365 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5alpha 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ALDOC_HUMAN 
_struct_ref.pdbx_db_accession          P09972 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFF
HETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPS
ALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDN
AGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAYL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1XFB A 1 ? 365 ? P09972 1 ? 365 ? 1 365 
2  1 1XFB B 1 ? 365 ? P09972 1 ? 365 ? 1 365 
3  1 1XFB C 1 ? 365 ? P09972 1 ? 365 ? 1 365 
4  1 1XFB D 1 ? 365 ? P09972 1 ? 365 ? 1 365 
5  1 1XFB E 1 ? 365 ? P09972 1 ? 365 ? 1 365 
6  1 1XFB F 1 ? 365 ? P09972 1 ? 365 ? 1 365 
7  1 1XFB G 1 ? 365 ? P09972 1 ? 365 ? 1 365 
8  1 1XFB H 1 ? 365 ? P09972 1 ? 365 ? 1 365 
9  1 1XFB I 1 ? 365 ? P09972 1 ? 365 ? 1 365 
10 1 1XFB J 1 ? 365 ? P09972 1 ? 365 ? 1 365 
11 1 1XFB K 1 ? 365 ? P09972 1 ? 365 ? 1 365 
12 1 1XFB L 1 ? 365 ? P09972 1 ? 365 ? 1 365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XFB 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, Calcium Acetate, Tris, glucose, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2003-02-01 
_diffrn_detector.details                'osmic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'osmic mirrors' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     1XFB 
_reflns.d_resolution_high            3.0 
_reflns.d_resolution_low             79.24 
_reflns.limit_h_max                  27 
_reflns.limit_h_min                  -29 
_reflns.limit_k_max                  41 
_reflns.limit_k_min                  -29 
_reflns.limit_l_max                  46 
_reflns.limit_l_min                  0 
_reflns.number_all                   89550 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_F_max     1989158.51 
_reflns.observed_criterion_F_min     6.400000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.number_obs                   89550 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.097 
_reflns.pdbx_netI_over_sigmaI        5.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.15 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   95.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_Rsym_value        0.34 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XFB 
_refine.ls_number_reflns_all                     89706 
_refine.ls_number_reflns_obs                     87177 
_refine.ls_percent_reflns_obs                    97.2 
_refine.ls_d_res_high                            3.00 
_refine.ls_d_res_low                             79.24 
_refine.B_iso_min                                0.51 
_refine.B_iso_max                                99.51 
_refine.B_iso_mean                               35.37 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -3.52 
_refine.aniso_B[2][2]                            9.79 
_refine.aniso_B[3][3]                            -6.27 
_refine.aniso_B[1][2]                            7.22 
_refine.aniso_B[1][3]                            2.25 
_refine.aniso_B[2][3]                            8.67 
_refine.solvent_model_param_bsol                 30.8274 
_refine.solvent_model_param_ksol                 0.370575 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.255 
_refine.ls_R_factor_R_free                       0.261 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_number_reflns_R_free                  8700 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          0.257 
_refine.ls_R_factor_obs                          0.257 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB Entry 1J4E' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1XFB 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     3.00 
_refine_analyze.Luzzati_coordinate_error_obs    0.43 
_refine_analyze.Luzzati_sigma_a_obs             0.67 
_refine_analyze.Luzzati_coordinate_error_free   0.44 
_refine_analyze.Luzzati_sigma_a_free            0.65 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31476 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               31476 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        79.24 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.007 . ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.4   . ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_deg      21.9  . ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_impr_deg 0.99  . ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
3.00 3.14  11220 10720 9602 95.5 0.385 0.382 0.011 1118 10.4 8 . 'X-RAY DIFFRACTION' . 
3.14 3.30  11219 10782 9754 96.1 0.339 0.33  0.010 1028 9.5  8 . 'X-RAY DIFFRACTION' . 
3.30 3.51  11273 10874 9761 96.5 0.3   0.313 0.009 1113 10.2 8 . 'X-RAY DIFFRACTION' . 
3.51 3.78  11180 10854 9800 97.1 0.273 0.281 0.009 1054 9.7  8 . 'X-RAY DIFFRACTION' . 
3.78 4.16  11208 10929 9825 97.5 0.24  0.25  0.008 1104 10.1 8 . 'X-RAY DIFFRACTION' . 
4.16 4.76  11259 11028 9954 97.9 0.207 0.222 0.007 1074 9.7  8 . 'X-RAY DIFFRACTION' . 
4.76 6.00  11208 11013 9915 98.3 0.217 0.218 0.007 1098 10.0 8 . 'X-RAY DIFFRACTION' . 
6.00 79.24 11207 10977 9866 97.9 0.209 0.212 0.006 1111 10.1 8 . 'X-RAY DIFFRACTION' . 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       protein_rep.param 
_pdbx_xplor_file.topol_file       protein.top 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1XFB 
_struct.title                     'Human Brain Fructose 1,6-(bis)phosphate Aldolase (C isozyme)' 
_struct.pdbx_descriptor           'Human Aldolase C (E.C.4.1.2.13)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XFB 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            
'isozyme specificity, structural enzymology, protein-protein interactions, isozyme specific residues, structure/function, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 1 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'Tetramer of molecules A, B, C, D' ? 
2 'Tetramer of molecules E, F, G, H' ? 
3 'Tetramer of molecules I, J, K, L' ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 9   ? VAL A 24  ? SER A 9   VAL A 24  1 ? 16 
HELX_P HELX_P2   2   SER A 36  ? GLN A 46  ? SER A 36  GLN A 46  1 ? 11 
HELX_P HELX_P3   3   THR A 52  ? SER A 65  ? THR A 52  SER A 65  1 ? 14 
HELX_P HELX_P4   4   ASP A 67  ? LYS A 71  ? ASP A 67  LYS A 71  5 ? 5  
HELX_P HELX_P5   5   HIS A 81  ? GLN A 86  ? HIS A 81  GLN A 86  5 ? 6  
HELX_P HELX_P6   6   PRO A 93  ? LYS A 101 ? PRO A 93  LYS A 101 1 ? 9  
HELX_P HELX_P7   7   GLY A 130 ? ASP A 141 ? GLY A 130 ASP A 141 1 ? 12 
HELX_P HELX_P8   8   SER A 160 ? GLN A 180 ? SER A 160 GLN A 180 1 ? 21 
HELX_P HELX_P9   9   ASP A 198 ? HIS A 220 ? ASP A 198 HIS A 220 1 ? 23 
HELX_P HELX_P10  10  TYR A 223 ? THR A 227 ? TYR A 223 THR A 227 5 ? 5  
HELX_P HELX_P11  11  THR A 245 ? ARG A 258 ? THR A 245 ARG A 258 1 ? 14 
HELX_P HELX_P12  12  SER A 276 ? ARG A 289 ? SER A 276 ARG A 289 1 ? 14 
HELX_P HELX_P13  13  GLY A 303 ? ARG A 315 ? GLY A 303 ARG A 315 1 ? 13 
HELX_P HELX_P14  14  ASN A 320 ? ALA A 339 ? ASN A 320 ALA A 339 1 ? 20 
HELX_P HELX_P15  15  SER B 9   ? VAL B 24  ? SER B 9   VAL B 24  1 ? 16 
HELX_P HELX_P16  16  SER B 36  ? GLN B 46  ? SER B 36  GLN B 46  1 ? 11 
HELX_P HELX_P17  17  THR B 52  ? SER B 65  ? THR B 52  SER B 65  1 ? 14 
HELX_P HELX_P18  18  ASP B 67  ? LYS B 71  ? ASP B 67  LYS B 71  5 ? 5  
HELX_P HELX_P19  19  HIS B 81  ? GLN B 86  ? HIS B 81  GLN B 86  5 ? 6  
HELX_P HELX_P20  20  PRO B 93  ? LYS B 101 ? PRO B 93  LYS B 101 1 ? 9  
HELX_P HELX_P21  21  GLY B 130 ? ASP B 141 ? GLY B 130 ASP B 141 1 ? 12 
HELX_P HELX_P22  22  SER B 160 ? GLN B 180 ? SER B 160 GLN B 180 1 ? 21 
HELX_P HELX_P23  23  ASP B 198 ? HIS B 220 ? ASP B 198 HIS B 220 1 ? 23 
HELX_P HELX_P24  24  TYR B 223 ? THR B 227 ? TYR B 223 THR B 227 5 ? 5  
HELX_P HELX_P25  25  THR B 245 ? ARG B 258 ? THR B 245 ARG B 258 1 ? 14 
HELX_P HELX_P26  26  SER B 276 ? ARG B 289 ? SER B 276 ARG B 289 1 ? 14 
HELX_P HELX_P27  27  GLY B 303 ? ARG B 315 ? GLY B 303 ARG B 315 1 ? 13 
HELX_P HELX_P28  28  ASN B 320 ? ALA B 339 ? ASN B 320 ALA B 339 1 ? 20 
HELX_P HELX_P29  29  SER C 9   ? VAL C 24  ? SER C 9   VAL C 24  1 ? 16 
HELX_P HELX_P30  30  SER C 36  ? GLN C 46  ? SER C 36  GLN C 46  1 ? 11 
HELX_P HELX_P31  31  THR C 52  ? SER C 65  ? THR C 52  SER C 65  1 ? 14 
HELX_P HELX_P32  32  ASP C 67  ? LYS C 71  ? ASP C 67  LYS C 71  5 ? 5  
HELX_P HELX_P33  33  HIS C 81  ? GLN C 86  ? HIS C 81  GLN C 86  5 ? 6  
HELX_P HELX_P34  34  PRO C 93  ? LYS C 101 ? PRO C 93  LYS C 101 1 ? 9  
HELX_P HELX_P35  35  GLY C 130 ? ASP C 141 ? GLY C 130 ASP C 141 1 ? 12 
HELX_P HELX_P36  36  SER C 160 ? GLN C 180 ? SER C 160 GLN C 180 1 ? 21 
HELX_P HELX_P37  37  ASP C 198 ? HIS C 220 ? ASP C 198 HIS C 220 1 ? 23 
HELX_P HELX_P38  38  TYR C 223 ? THR C 227 ? TYR C 223 THR C 227 5 ? 5  
HELX_P HELX_P39  39  THR C 245 ? ARG C 258 ? THR C 245 ARG C 258 1 ? 14 
HELX_P HELX_P40  40  SER C 276 ? ARG C 289 ? SER C 276 ARG C 289 1 ? 14 
HELX_P HELX_P41  41  GLY C 303 ? ARG C 315 ? GLY C 303 ARG C 315 1 ? 13 
HELX_P HELX_P42  42  ASN C 320 ? ALA C 339 ? ASN C 320 ALA C 339 1 ? 20 
HELX_P HELX_P43  43  SER D 9   ? VAL D 24  ? SER D 9   VAL D 24  1 ? 16 
HELX_P HELX_P44  44  SER D 36  ? GLN D 46  ? SER D 36  GLN D 46  1 ? 11 
HELX_P HELX_P45  45  THR D 52  ? SER D 65  ? THR D 52  SER D 65  1 ? 14 
HELX_P HELX_P46  46  ASP D 67  ? LYS D 71  ? ASP D 67  LYS D 71  5 ? 5  
HELX_P HELX_P47  47  HIS D 81  ? GLN D 86  ? HIS D 81  GLN D 86  5 ? 6  
HELX_P HELX_P48  48  PRO D 93  ? LYS D 101 ? PRO D 93  LYS D 101 1 ? 9  
HELX_P HELX_P49  49  GLY D 130 ? ASP D 141 ? GLY D 130 ASP D 141 1 ? 12 
HELX_P HELX_P50  50  SER D 160 ? GLN D 180 ? SER D 160 GLN D 180 1 ? 21 
HELX_P HELX_P51  51  ASP D 198 ? HIS D 220 ? ASP D 198 HIS D 220 1 ? 23 
HELX_P HELX_P52  52  TYR D 223 ? THR D 227 ? TYR D 223 THR D 227 5 ? 5  
HELX_P HELX_P53  53  THR D 245 ? ARG D 258 ? THR D 245 ARG D 258 1 ? 14 
HELX_P HELX_P54  54  SER D 276 ? ARG D 289 ? SER D 276 ARG D 289 1 ? 14 
HELX_P HELX_P55  55  GLY D 303 ? ARG D 315 ? GLY D 303 ARG D 315 1 ? 13 
HELX_P HELX_P56  56  ASN D 320 ? ALA D 339 ? ASN D 320 ALA D 339 1 ? 20 
HELX_P HELX_P57  57  SER E 9   ? VAL E 24  ? SER E 9   VAL E 24  1 ? 16 
HELX_P HELX_P58  58  SER E 36  ? GLN E 46  ? SER E 36  GLN E 46  1 ? 11 
HELX_P HELX_P59  59  THR E 52  ? SER E 65  ? THR E 52  SER E 65  1 ? 14 
HELX_P HELX_P60  60  ASP E 67  ? LYS E 71  ? ASP E 67  LYS E 71  5 ? 5  
HELX_P HELX_P61  61  HIS E 81  ? GLN E 86  ? HIS E 81  GLN E 86  5 ? 6  
HELX_P HELX_P62  62  PRO E 93  ? LYS E 101 ? PRO E 93  LYS E 101 1 ? 9  
HELX_P HELX_P63  63  GLY E 130 ? ASP E 141 ? GLY E 130 ASP E 141 1 ? 12 
HELX_P HELX_P64  64  SER E 160 ? GLN E 180 ? SER E 160 GLN E 180 1 ? 21 
HELX_P HELX_P65  65  ASP E 198 ? HIS E 220 ? ASP E 198 HIS E 220 1 ? 23 
HELX_P HELX_P66  66  TYR E 223 ? THR E 227 ? TYR E 223 THR E 227 5 ? 5  
HELX_P HELX_P67  67  THR E 245 ? ARG E 258 ? THR E 245 ARG E 258 1 ? 14 
HELX_P HELX_P68  68  SER E 276 ? ARG E 289 ? SER E 276 ARG E 289 1 ? 14 
HELX_P HELX_P69  69  GLY E 303 ? ARG E 315 ? GLY E 303 ARG E 315 1 ? 13 
HELX_P HELX_P70  70  ASN E 320 ? ALA E 339 ? ASN E 320 ALA E 339 1 ? 20 
HELX_P HELX_P71  71  SER F 9   ? VAL F 24  ? SER F 9   VAL F 24  1 ? 16 
HELX_P HELX_P72  72  SER F 36  ? GLN F 46  ? SER F 36  GLN F 46  1 ? 11 
HELX_P HELX_P73  73  THR F 52  ? SER F 65  ? THR F 52  SER F 65  1 ? 14 
HELX_P HELX_P74  74  ASP F 67  ? LYS F 71  ? ASP F 67  LYS F 71  5 ? 5  
HELX_P HELX_P75  75  HIS F 81  ? GLN F 86  ? HIS F 81  GLN F 86  5 ? 6  
HELX_P HELX_P76  76  PRO F 93  ? LYS F 101 ? PRO F 93  LYS F 101 1 ? 9  
HELX_P HELX_P77  77  GLY F 130 ? ASP F 141 ? GLY F 130 ASP F 141 1 ? 12 
HELX_P HELX_P78  78  SER F 160 ? GLN F 180 ? SER F 160 GLN F 180 1 ? 21 
HELX_P HELX_P79  79  ASP F 198 ? HIS F 220 ? ASP F 198 HIS F 220 1 ? 23 
HELX_P HELX_P80  80  TYR F 223 ? THR F 227 ? TYR F 223 THR F 227 5 ? 5  
HELX_P HELX_P81  81  THR F 245 ? ARG F 258 ? THR F 245 ARG F 258 1 ? 14 
HELX_P HELX_P82  82  SER F 276 ? ARG F 289 ? SER F 276 ARG F 289 1 ? 14 
HELX_P HELX_P83  83  GLY F 303 ? ARG F 315 ? GLY F 303 ARG F 315 1 ? 13 
HELX_P HELX_P84  84  ASN F 320 ? ALA F 339 ? ASN F 320 ALA F 339 1 ? 20 
HELX_P HELX_P85  85  SER G 9   ? VAL G 24  ? SER G 9   VAL G 24  1 ? 16 
HELX_P HELX_P86  86  SER G 36  ? GLN G 46  ? SER G 36  GLN G 46  1 ? 11 
HELX_P HELX_P87  87  THR G 52  ? SER G 65  ? THR G 52  SER G 65  1 ? 14 
HELX_P HELX_P88  88  ASP G 67  ? LYS G 71  ? ASP G 67  LYS G 71  5 ? 5  
HELX_P HELX_P89  89  HIS G 81  ? GLN G 86  ? HIS G 81  GLN G 86  5 ? 6  
HELX_P HELX_P90  90  PRO G 93  ? LYS G 101 ? PRO G 93  LYS G 101 1 ? 9  
HELX_P HELX_P91  91  GLY G 130 ? ASP G 141 ? GLY G 130 ASP G 141 1 ? 12 
HELX_P HELX_P92  92  SER G 160 ? GLN G 180 ? SER G 160 GLN G 180 1 ? 21 
HELX_P HELX_P93  93  ASP G 198 ? HIS G 220 ? ASP G 198 HIS G 220 1 ? 23 
HELX_P HELX_P94  94  TYR G 223 ? THR G 227 ? TYR G 223 THR G 227 5 ? 5  
HELX_P HELX_P95  95  THR G 245 ? ARG G 258 ? THR G 245 ARG G 258 1 ? 14 
HELX_P HELX_P96  96  SER G 276 ? ARG G 289 ? SER G 276 ARG G 289 1 ? 14 
HELX_P HELX_P97  97  GLY G 303 ? ARG G 315 ? GLY G 303 ARG G 315 1 ? 13 
HELX_P HELX_P98  98  ASN G 320 ? ALA G 339 ? ASN G 320 ALA G 339 1 ? 20 
HELX_P HELX_P99  99  SER H 9   ? VAL H 24  ? SER H 9   VAL H 24  1 ? 16 
HELX_P HELX_P100 100 SER H 36  ? GLN H 46  ? SER H 36  GLN H 46  1 ? 11 
HELX_P HELX_P101 101 THR H 52  ? SER H 65  ? THR H 52  SER H 65  1 ? 14 
HELX_P HELX_P102 102 ASP H 67  ? LYS H 71  ? ASP H 67  LYS H 71  5 ? 5  
HELX_P HELX_P103 103 HIS H 81  ? GLN H 86  ? HIS H 81  GLN H 86  5 ? 6  
HELX_P HELX_P104 104 PRO H 93  ? LYS H 101 ? PRO H 93  LYS H 101 1 ? 9  
HELX_P HELX_P105 105 GLY H 130 ? ASP H 141 ? GLY H 130 ASP H 141 1 ? 12 
HELX_P HELX_P106 106 SER H 160 ? GLN H 180 ? SER H 160 GLN H 180 1 ? 21 
HELX_P HELX_P107 107 ASP H 198 ? HIS H 220 ? ASP H 198 HIS H 220 1 ? 23 
HELX_P HELX_P108 108 TYR H 223 ? THR H 227 ? TYR H 223 THR H 227 5 ? 5  
HELX_P HELX_P109 109 THR H 245 ? ARG H 258 ? THR H 245 ARG H 258 1 ? 14 
HELX_P HELX_P110 110 SER H 276 ? ARG H 289 ? SER H 276 ARG H 289 1 ? 14 
HELX_P HELX_P111 111 GLY H 303 ? ARG H 315 ? GLY H 303 ARG H 315 1 ? 13 
HELX_P HELX_P112 112 ASN H 320 ? ALA H 339 ? ASN H 320 ALA H 339 1 ? 20 
HELX_P HELX_P113 113 SER I 9   ? VAL I 24  ? SER I 9   VAL I 24  1 ? 16 
HELX_P HELX_P114 114 SER I 36  ? GLN I 46  ? SER I 36  GLN I 46  1 ? 11 
HELX_P HELX_P115 115 THR I 52  ? SER I 65  ? THR I 52  SER I 65  1 ? 14 
HELX_P HELX_P116 116 ASP I 67  ? LYS I 71  ? ASP I 67  LYS I 71  5 ? 5  
HELX_P HELX_P117 117 HIS I 81  ? GLN I 86  ? HIS I 81  GLN I 86  5 ? 6  
HELX_P HELX_P118 118 PRO I 93  ? LYS I 101 ? PRO I 93  LYS I 101 1 ? 9  
HELX_P HELX_P119 119 GLY I 130 ? ASP I 141 ? GLY I 130 ASP I 141 1 ? 12 
HELX_P HELX_P120 120 SER I 160 ? GLN I 180 ? SER I 160 GLN I 180 1 ? 21 
HELX_P HELX_P121 121 ASP I 198 ? HIS I 220 ? ASP I 198 HIS I 220 1 ? 23 
HELX_P HELX_P122 122 TYR I 223 ? THR I 227 ? TYR I 223 THR I 227 5 ? 5  
HELX_P HELX_P123 123 THR I 245 ? ARG I 258 ? THR I 245 ARG I 258 1 ? 14 
HELX_P HELX_P124 124 SER I 276 ? ARG I 289 ? SER I 276 ARG I 289 1 ? 14 
HELX_P HELX_P125 125 GLY I 303 ? ARG I 315 ? GLY I 303 ARG I 315 1 ? 13 
HELX_P HELX_P126 126 ASN I 320 ? ALA I 339 ? ASN I 320 ALA I 339 1 ? 20 
HELX_P HELX_P127 127 SER J 9   ? VAL J 24  ? SER J 9   VAL J 24  1 ? 16 
HELX_P HELX_P128 128 SER J 36  ? GLN J 46  ? SER J 36  GLN J 46  1 ? 11 
HELX_P HELX_P129 129 THR J 52  ? SER J 65  ? THR J 52  SER J 65  1 ? 14 
HELX_P HELX_P130 130 ASP J 67  ? LYS J 71  ? ASP J 67  LYS J 71  5 ? 5  
HELX_P HELX_P131 131 HIS J 81  ? GLN J 86  ? HIS J 81  GLN J 86  5 ? 6  
HELX_P HELX_P132 132 PRO J 93  ? LYS J 101 ? PRO J 93  LYS J 101 1 ? 9  
HELX_P HELX_P133 133 GLY J 130 ? ASP J 141 ? GLY J 130 ASP J 141 1 ? 12 
HELX_P HELX_P134 134 SER J 160 ? GLN J 180 ? SER J 160 GLN J 180 1 ? 21 
HELX_P HELX_P135 135 ASP J 198 ? HIS J 220 ? ASP J 198 HIS J 220 1 ? 23 
HELX_P HELX_P136 136 TYR J 223 ? THR J 227 ? TYR J 223 THR J 227 5 ? 5  
HELX_P HELX_P137 137 THR J 245 ? ARG J 258 ? THR J 245 ARG J 258 1 ? 14 
HELX_P HELX_P138 138 SER J 276 ? ARG J 289 ? SER J 276 ARG J 289 1 ? 14 
HELX_P HELX_P139 139 GLY J 303 ? ARG J 315 ? GLY J 303 ARG J 315 1 ? 13 
HELX_P HELX_P140 140 ASN J 320 ? ALA J 339 ? ASN J 320 ALA J 339 1 ? 20 
HELX_P HELX_P141 141 SER K 9   ? VAL K 24  ? SER K 9   VAL K 24  1 ? 16 
HELX_P HELX_P142 142 SER K 36  ? GLN K 46  ? SER K 36  GLN K 46  1 ? 11 
HELX_P HELX_P143 143 THR K 52  ? SER K 65  ? THR K 52  SER K 65  1 ? 14 
HELX_P HELX_P144 144 ASP K 67  ? LYS K 71  ? ASP K 67  LYS K 71  5 ? 5  
HELX_P HELX_P145 145 HIS K 81  ? GLN K 86  ? HIS K 81  GLN K 86  5 ? 6  
HELX_P HELX_P146 146 PRO K 93  ? LYS K 101 ? PRO K 93  LYS K 101 1 ? 9  
HELX_P HELX_P147 147 GLY K 130 ? ASP K 141 ? GLY K 130 ASP K 141 1 ? 12 
HELX_P HELX_P148 148 SER K 160 ? GLN K 180 ? SER K 160 GLN K 180 1 ? 21 
HELX_P HELX_P149 149 ASP K 198 ? HIS K 220 ? ASP K 198 HIS K 220 1 ? 23 
HELX_P HELX_P150 150 TYR K 223 ? THR K 227 ? TYR K 223 THR K 227 5 ? 5  
HELX_P HELX_P151 151 THR K 245 ? ARG K 258 ? THR K 245 ARG K 258 1 ? 14 
HELX_P HELX_P152 152 SER K 276 ? ARG K 289 ? SER K 276 ARG K 289 1 ? 14 
HELX_P HELX_P153 153 GLY K 303 ? ARG K 315 ? GLY K 303 ARG K 315 1 ? 13 
HELX_P HELX_P154 154 ASN K 320 ? ALA K 339 ? ASN K 320 ALA K 339 1 ? 20 
HELX_P HELX_P155 155 SER L 9   ? VAL L 24  ? SER L 9   VAL L 24  1 ? 16 
HELX_P HELX_P156 156 SER L 36  ? GLN L 46  ? SER L 36  GLN L 46  1 ? 11 
HELX_P HELX_P157 157 THR L 52  ? SER L 65  ? THR L 52  SER L 65  1 ? 14 
HELX_P HELX_P158 158 ASP L 67  ? LYS L 71  ? ASP L 67  LYS L 71  5 ? 5  
HELX_P HELX_P159 159 HIS L 81  ? GLN L 86  ? HIS L 81  GLN L 86  5 ? 6  
HELX_P HELX_P160 160 PRO L 93  ? LYS L 101 ? PRO L 93  LYS L 101 1 ? 9  
HELX_P HELX_P161 161 GLY L 130 ? ASP L 141 ? GLY L 130 ASP L 141 1 ? 12 
HELX_P HELX_P162 162 SER L 160 ? GLN L 180 ? SER L 160 GLN L 180 1 ? 21 
HELX_P HELX_P163 163 ASP L 198 ? HIS L 220 ? ASP L 198 HIS L 220 1 ? 23 
HELX_P HELX_P164 164 TYR L 223 ? THR L 227 ? TYR L 223 THR L 227 5 ? 5  
HELX_P HELX_P165 165 THR L 245 ? ARG L 258 ? THR L 245 ARG L 258 1 ? 14 
HELX_P HELX_P166 166 SER L 276 ? ARG L 289 ? SER L 276 ARG L 289 1 ? 14 
HELX_P HELX_P167 167 GLY L 303 ? ARG L 315 ? GLY L 303 ARG L 315 1 ? 13 
HELX_P HELX_P168 168 ASN L 320 ? ALA L 339 ? ASN L 320 ALA L 339 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 2 ? 
C ? 9 ? 
D ? 2 ? 
E ? 9 ? 
F ? 2 ? 
G ? 9 ? 
H ? 2 ? 
I ? 9 ? 
J ? 2 ? 
K ? 9 ? 
L ? 2 ? 
M ? 9 ? 
N ? 2 ? 
O ? 9 ? 
P ? 2 ? 
Q ? 9 ? 
R ? 2 ? 
S ? 9 ? 
T ? 2 ? 
U ? 9 ? 
V ? 2 ? 
W ? 9 ? 
X ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
A 8 9 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? parallel      
C 8 9 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? parallel      
E 8 9 ? parallel      
F 1 2 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
G 7 8 ? parallel      
G 8 9 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? parallel      
I 6 7 ? parallel      
I 7 8 ? parallel      
I 8 9 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
K 7 8 ? parallel      
K 8 9 ? parallel      
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
M 5 6 ? parallel      
M 6 7 ? parallel      
M 7 8 ? parallel      
M 8 9 ? parallel      
N 1 2 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? parallel      
O 3 4 ? parallel      
O 4 5 ? parallel      
O 5 6 ? parallel      
O 6 7 ? parallel      
O 7 8 ? parallel      
O 8 9 ? parallel      
P 1 2 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? parallel      
Q 3 4 ? parallel      
Q 4 5 ? parallel      
Q 5 6 ? parallel      
Q 6 7 ? parallel      
Q 7 8 ? parallel      
Q 8 9 ? parallel      
R 1 2 ? anti-parallel 
S 1 2 ? parallel      
S 2 3 ? parallel      
S 3 4 ? parallel      
S 4 5 ? parallel      
S 5 6 ? parallel      
S 6 7 ? parallel      
S 7 8 ? parallel      
S 8 9 ? parallel      
T 1 2 ? anti-parallel 
U 1 2 ? parallel      
U 2 3 ? parallel      
U 3 4 ? parallel      
U 4 5 ? parallel      
U 5 6 ? parallel      
U 6 7 ? parallel      
U 7 8 ? parallel      
U 8 9 ? parallel      
V 1 2 ? anti-parallel 
W 1 2 ? parallel      
W 2 3 ? parallel      
W 3 4 ? parallel      
W 4 5 ? parallel      
W 5 6 ? parallel      
W 6 7 ? parallel      
W 7 8 ? parallel      
W 8 9 ? parallel      
X 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 29  ? ALA A 33  ? GLY A 29  ALA A 33  
A 2 ILE A 74  ? PHE A 79  ? ILE A 74  PHE A 79  
A 3 VAL A 104 ? LYS A 108 ? VAL A 104 LYS A 108 
A 4 PHE A 145 ? LEU A 152 ? PHE A 145 LEU A 152 
A 5 VAL A 184 ? ILE A 191 ? VAL A 184 ILE A 191 
A 6 LEU A 228 ? LEU A 229 ? LEU A 228 LEU A 229 
A 7 GLY A 267 ? PHE A 270 ? GLY A 267 PHE A 270 
A 8 ALA A 297 ? TYR A 302 ? ALA A 297 TYR A 302 
A 9 GLY A 29  ? ALA A 33  ? GLY A 29  ALA A 33  
B 1 VAL A 113 ? PRO A 115 ? VAL A 113 PRO A 115 
B 2 THR A 123 ? THR A 125 ? THR A 123 THR A 125 
C 1 GLY B 29  ? ALA B 33  ? GLY B 29  ALA B 33  
C 2 ILE B 74  ? PHE B 79  ? ILE B 74  PHE B 79  
C 3 VAL B 104 ? LYS B 108 ? VAL B 104 LYS B 108 
C 4 PHE B 145 ? LEU B 152 ? PHE B 145 LEU B 152 
C 5 VAL B 184 ? ILE B 191 ? VAL B 184 ILE B 191 
C 6 LEU B 228 ? LEU B 229 ? LEU B 228 LEU B 229 
C 7 GLY B 267 ? PHE B 270 ? GLY B 267 PHE B 270 
C 8 ALA B 297 ? TYR B 302 ? ALA B 297 TYR B 302 
C 9 GLY B 29  ? ALA B 33  ? GLY B 29  ALA B 33  
D 1 VAL B 113 ? PRO B 115 ? VAL B 113 PRO B 115 
D 2 THR B 123 ? THR B 125 ? THR B 123 THR B 125 
E 1 GLY C 29  ? ALA C 33  ? GLY C 29  ALA C 33  
E 2 ILE C 74  ? PHE C 79  ? ILE C 74  PHE C 79  
E 3 VAL C 104 ? LYS C 108 ? VAL C 104 LYS C 108 
E 4 PHE C 145 ? LEU C 152 ? PHE C 145 LEU C 152 
E 5 VAL C 184 ? ILE C 191 ? VAL C 184 ILE C 191 
E 6 LEU C 228 ? LEU C 229 ? LEU C 228 LEU C 229 
E 7 GLY C 267 ? PHE C 270 ? GLY C 267 PHE C 270 
E 8 ALA C 297 ? TYR C 302 ? ALA C 297 TYR C 302 
E 9 GLY C 29  ? ALA C 33  ? GLY C 29  ALA C 33  
F 1 VAL C 113 ? PRO C 115 ? VAL C 113 PRO C 115 
F 2 THR C 123 ? THR C 125 ? THR C 123 THR C 125 
G 1 GLY D 29  ? ALA D 33  ? GLY D 29  ALA D 33  
G 2 ILE D 74  ? PHE D 79  ? ILE D 74  PHE D 79  
G 3 VAL D 104 ? LYS D 108 ? VAL D 104 LYS D 108 
G 4 PHE D 145 ? LEU D 152 ? PHE D 145 LEU D 152 
G 5 VAL D 184 ? ILE D 191 ? VAL D 184 ILE D 191 
G 6 LEU D 228 ? LEU D 229 ? LEU D 228 LEU D 229 
G 7 GLY D 267 ? PHE D 270 ? GLY D 267 PHE D 270 
G 8 ALA D 297 ? TYR D 302 ? ALA D 297 TYR D 302 
G 9 GLY D 29  ? ALA D 33  ? GLY D 29  ALA D 33  
H 1 VAL D 113 ? PRO D 115 ? VAL D 113 PRO D 115 
H 2 THR D 123 ? THR D 125 ? THR D 123 THR D 125 
I 1 GLY E 29  ? ALA E 33  ? GLY E 29  ALA E 33  
I 2 ILE E 74  ? PHE E 79  ? ILE E 74  PHE E 79  
I 3 VAL E 104 ? LYS E 108 ? VAL E 104 LYS E 108 
I 4 PHE E 145 ? LEU E 152 ? PHE E 145 LEU E 152 
I 5 VAL E 184 ? ILE E 191 ? VAL E 184 ILE E 191 
I 6 LEU E 228 ? LEU E 229 ? LEU E 228 LEU E 229 
I 7 GLY E 267 ? PHE E 270 ? GLY E 267 PHE E 270 
I 8 ALA E 297 ? TYR E 302 ? ALA E 297 TYR E 302 
I 9 GLY E 29  ? ALA E 33  ? GLY E 29  ALA E 33  
J 1 VAL E 113 ? PRO E 115 ? VAL E 113 PRO E 115 
J 2 THR E 123 ? THR E 125 ? THR E 123 THR E 125 
K 1 GLY F 29  ? ALA F 33  ? GLY F 29  ALA F 33  
K 2 ILE F 74  ? PHE F 79  ? ILE F 74  PHE F 79  
K 3 VAL F 104 ? LYS F 108 ? VAL F 104 LYS F 108 
K 4 PHE F 145 ? LEU F 152 ? PHE F 145 LEU F 152 
K 5 VAL F 184 ? ILE F 191 ? VAL F 184 ILE F 191 
K 6 LEU F 228 ? LEU F 229 ? LEU F 228 LEU F 229 
K 7 GLY F 267 ? PHE F 270 ? GLY F 267 PHE F 270 
K 8 ALA F 297 ? TYR F 302 ? ALA F 297 TYR F 302 
K 9 GLY F 29  ? ALA F 33  ? GLY F 29  ALA F 33  
L 1 VAL F 113 ? PRO F 115 ? VAL F 113 PRO F 115 
L 2 THR F 123 ? THR F 125 ? THR F 123 THR F 125 
M 1 GLY G 29  ? ALA G 33  ? GLY G 29  ALA G 33  
M 2 ILE G 74  ? PHE G 79  ? ILE G 74  PHE G 79  
M 3 VAL G 104 ? LYS G 108 ? VAL G 104 LYS G 108 
M 4 PHE G 145 ? LEU G 152 ? PHE G 145 LEU G 152 
M 5 VAL G 184 ? ILE G 191 ? VAL G 184 ILE G 191 
M 6 LEU G 228 ? LEU G 229 ? LEU G 228 LEU G 229 
M 7 GLY G 267 ? PHE G 270 ? GLY G 267 PHE G 270 
M 8 ALA G 297 ? TYR G 302 ? ALA G 297 TYR G 302 
M 9 GLY G 29  ? ALA G 33  ? GLY G 29  ALA G 33  
N 1 VAL G 113 ? PRO G 115 ? VAL G 113 PRO G 115 
N 2 THR G 123 ? THR G 125 ? THR G 123 THR G 125 
O 1 GLY H 29  ? ALA H 33  ? GLY H 29  ALA H 33  
O 2 ILE H 74  ? PHE H 79  ? ILE H 74  PHE H 79  
O 3 VAL H 104 ? LYS H 108 ? VAL H 104 LYS H 108 
O 4 PHE H 145 ? LEU H 152 ? PHE H 145 LEU H 152 
O 5 VAL H 184 ? ILE H 191 ? VAL H 184 ILE H 191 
O 6 LEU H 228 ? LEU H 229 ? LEU H 228 LEU H 229 
O 7 GLY H 267 ? PHE H 270 ? GLY H 267 PHE H 270 
O 8 ALA H 297 ? TYR H 302 ? ALA H 297 TYR H 302 
O 9 GLY H 29  ? ALA H 33  ? GLY H 29  ALA H 33  
P 1 VAL H 113 ? PRO H 115 ? VAL H 113 PRO H 115 
P 2 THR H 123 ? THR H 125 ? THR H 123 THR H 125 
Q 1 GLY I 29  ? ALA I 33  ? GLY I 29  ALA I 33  
Q 2 ILE I 74  ? PHE I 79  ? ILE I 74  PHE I 79  
Q 3 VAL I 104 ? LYS I 108 ? VAL I 104 LYS I 108 
Q 4 PHE I 145 ? LEU I 152 ? PHE I 145 LEU I 152 
Q 5 VAL I 184 ? ILE I 191 ? VAL I 184 ILE I 191 
Q 6 LEU I 228 ? LEU I 229 ? LEU I 228 LEU I 229 
Q 7 GLY I 267 ? PHE I 270 ? GLY I 267 PHE I 270 
Q 8 ALA I 297 ? TYR I 302 ? ALA I 297 TYR I 302 
Q 9 GLY I 29  ? ALA I 33  ? GLY I 29  ALA I 33  
R 1 VAL I 113 ? PRO I 115 ? VAL I 113 PRO I 115 
R 2 THR I 123 ? THR I 125 ? THR I 123 THR I 125 
S 1 GLY J 29  ? ALA J 33  ? GLY J 29  ALA J 33  
S 2 ILE J 74  ? PHE J 79  ? ILE J 74  PHE J 79  
S 3 VAL J 104 ? LYS J 108 ? VAL J 104 LYS J 108 
S 4 PHE J 145 ? LEU J 152 ? PHE J 145 LEU J 152 
S 5 VAL J 184 ? ILE J 191 ? VAL J 184 ILE J 191 
S 6 LEU J 228 ? LEU J 229 ? LEU J 228 LEU J 229 
S 7 GLY J 267 ? PHE J 270 ? GLY J 267 PHE J 270 
S 8 ALA J 297 ? TYR J 302 ? ALA J 297 TYR J 302 
S 9 GLY J 29  ? ALA J 33  ? GLY J 29  ALA J 33  
T 1 VAL J 113 ? PRO J 115 ? VAL J 113 PRO J 115 
T 2 THR J 123 ? THR J 125 ? THR J 123 THR J 125 
U 1 GLY K 29  ? ALA K 33  ? GLY K 29  ALA K 33  
U 2 ILE K 74  ? PHE K 79  ? ILE K 74  PHE K 79  
U 3 VAL K 104 ? LYS K 108 ? VAL K 104 LYS K 108 
U 4 PHE K 145 ? LEU K 152 ? PHE K 145 LEU K 152 
U 5 VAL K 184 ? ILE K 191 ? VAL K 184 ILE K 191 
U 6 LEU K 228 ? LEU K 229 ? LEU K 228 LEU K 229 
U 7 GLY K 267 ? PHE K 270 ? GLY K 267 PHE K 270 
U 8 ALA K 297 ? TYR K 302 ? ALA K 297 TYR K 302 
U 9 GLY K 29  ? ALA K 33  ? GLY K 29  ALA K 33  
V 1 VAL K 113 ? PRO K 115 ? VAL K 113 PRO K 115 
V 2 THR K 123 ? THR K 125 ? THR K 123 THR K 125 
W 1 GLY L 29  ? ALA L 33  ? GLY L 29  ALA L 33  
W 2 ILE L 74  ? PHE L 79  ? ILE L 74  PHE L 79  
W 3 VAL L 104 ? LYS L 108 ? VAL L 104 LYS L 108 
W 4 PHE L 145 ? LEU L 152 ? PHE L 145 LEU L 152 
W 5 VAL L 184 ? ILE L 191 ? VAL L 184 ILE L 191 
W 6 LEU L 228 ? LEU L 229 ? LEU L 228 LEU L 229 
W 7 GLY L 267 ? PHE L 270 ? GLY L 267 PHE L 270 
W 8 ALA L 297 ? TYR L 302 ? ALA L 297 TYR L 302 
W 9 GLY L 29  ? ALA L 33  ? GLY L 29  ALA L 33  
X 1 VAL L 113 ? PRO L 115 ? VAL L 113 PRO L 115 
X 2 THR L 123 ? THR L 125 ? THR L 123 THR L 125 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 31  ? N LEU A 31  O ILE A 78  ? O ILE A 78  
A 2 3 N PHE A 79  ? N PHE A 79  O GLY A 106 ? O GLY A 106 
A 3 4 N ILE A 107 ? N ILE A 107 O LYS A 147 ? O LYS A 147 
A 4 5 N LEU A 152 ? N LEU A 152 O GLU A 190 ? O GLU A 190 
A 5 6 N VAL A 187 ? N VAL A 187 O LEU A 228 ? O LEU A 228 
A 6 7 N LEU A 229 ? N LEU A 229 O THR A 269 ? O THR A 269 
A 7 8 N VAL A 268 ? N VAL A 268 O ALA A 297 ? O ALA A 297 
A 8 9 O TYR A 302 ? O TYR A 302 N ALA A 32  ? N ALA A 32  
B 1 2 N VAL A 114 ? N VAL A 114 O THR A 124 ? O THR A 124 
C 1 2 N LEU B 31  ? N LEU B 31  O ILE B 78  ? O ILE B 78  
C 2 3 N PHE B 79  ? N PHE B 79  O GLY B 106 ? O GLY B 106 
C 3 4 N ILE B 107 ? N ILE B 107 O LYS B 147 ? O LYS B 147 
C 4 5 N LEU B 152 ? N LEU B 152 O GLU B 190 ? O GLU B 190 
C 5 6 N VAL B 187 ? N VAL B 187 O LEU B 228 ? O LEU B 228 
C 6 7 N LEU B 229 ? N LEU B 229 O THR B 269 ? O THR B 269 
C 7 8 N VAL B 268 ? N VAL B 268 O ALA B 297 ? O ALA B 297 
C 8 9 O TYR B 302 ? O TYR B 302 N ALA B 32  ? N ALA B 32  
D 1 2 N VAL B 114 ? N VAL B 114 O THR B 124 ? O THR B 124 
E 1 2 N LEU C 31  ? N LEU C 31  O ILE C 78  ? O ILE C 78  
E 2 3 N PHE C 79  ? N PHE C 79  O GLY C 106 ? O GLY C 106 
E 3 4 N ILE C 107 ? N ILE C 107 O LYS C 147 ? O LYS C 147 
E 4 5 N LEU C 152 ? N LEU C 152 O GLU C 190 ? O GLU C 190 
E 5 6 N VAL C 187 ? N VAL C 187 O LEU C 228 ? O LEU C 228 
E 6 7 N LEU C 229 ? N LEU C 229 O THR C 269 ? O THR C 269 
E 7 8 N VAL C 268 ? N VAL C 268 O ALA C 297 ? O ALA C 297 
E 8 9 O TYR C 302 ? O TYR C 302 N ALA C 32  ? N ALA C 32  
F 1 2 N VAL C 114 ? N VAL C 114 O THR C 124 ? O THR C 124 
G 1 2 N LEU D 31  ? N LEU D 31  O ILE D 78  ? O ILE D 78  
G 2 3 N PHE D 79  ? N PHE D 79  O GLY D 106 ? O GLY D 106 
G 3 4 N ILE D 107 ? N ILE D 107 O LYS D 147 ? O LYS D 147 
G 4 5 N LEU D 152 ? N LEU D 152 O GLU D 190 ? O GLU D 190 
G 5 6 N VAL D 187 ? N VAL D 187 O LEU D 228 ? O LEU D 228 
G 6 7 N LEU D 229 ? N LEU D 229 O THR D 269 ? O THR D 269 
G 7 8 N VAL D 268 ? N VAL D 268 O ALA D 297 ? O ALA D 297 
G 8 9 O TYR D 302 ? O TYR D 302 N ALA D 32  ? N ALA D 32  
H 1 2 N VAL D 114 ? N VAL D 114 O THR D 124 ? O THR D 124 
I 1 2 N LEU E 31  ? N LEU E 31  O ILE E 78  ? O ILE E 78  
I 2 3 N PHE E 79  ? N PHE E 79  O GLY E 106 ? O GLY E 106 
I 3 4 N ILE E 107 ? N ILE E 107 O LYS E 147 ? O LYS E 147 
I 4 5 N LEU E 152 ? N LEU E 152 O GLU E 190 ? O GLU E 190 
I 5 6 N VAL E 187 ? N VAL E 187 O LEU E 228 ? O LEU E 228 
I 6 7 N LEU E 229 ? N LEU E 229 O THR E 269 ? O THR E 269 
I 7 8 N VAL E 268 ? N VAL E 268 O ALA E 297 ? O ALA E 297 
I 8 9 O TYR E 302 ? O TYR E 302 N ALA E 32  ? N ALA E 32  
J 1 2 N VAL E 114 ? N VAL E 114 O THR E 124 ? O THR E 124 
K 1 2 N LEU F 31  ? N LEU F 31  O ILE F 78  ? O ILE F 78  
K 2 3 N PHE F 79  ? N PHE F 79  O GLY F 106 ? O GLY F 106 
K 3 4 N ILE F 107 ? N ILE F 107 O LYS F 147 ? O LYS F 147 
K 4 5 N LEU F 152 ? N LEU F 152 O GLU F 190 ? O GLU F 190 
K 5 6 N VAL F 187 ? N VAL F 187 O LEU F 228 ? O LEU F 228 
K 6 7 N LEU F 229 ? N LEU F 229 O THR F 269 ? O THR F 269 
K 7 8 N VAL F 268 ? N VAL F 268 O ALA F 297 ? O ALA F 297 
K 8 9 O TYR F 302 ? O TYR F 302 N ALA F 32  ? N ALA F 32  
L 1 2 N VAL F 114 ? N VAL F 114 O THR F 124 ? O THR F 124 
M 1 2 N LEU G 31  ? N LEU G 31  O ILE G 78  ? O ILE G 78  
M 2 3 N PHE G 79  ? N PHE G 79  O GLY G 106 ? O GLY G 106 
M 3 4 N ILE G 107 ? N ILE G 107 O LYS G 147 ? O LYS G 147 
M 4 5 N LEU G 152 ? N LEU G 152 O GLU G 190 ? O GLU G 190 
M 5 6 N VAL G 187 ? N VAL G 187 O LEU G 228 ? O LEU G 228 
M 6 7 N LEU G 229 ? N LEU G 229 O THR G 269 ? O THR G 269 
M 7 8 N VAL G 268 ? N VAL G 268 O ALA G 297 ? O ALA G 297 
M 8 9 O TYR G 302 ? O TYR G 302 N ALA G 32  ? N ALA G 32  
N 1 2 N VAL G 114 ? N VAL G 114 O THR G 124 ? O THR G 124 
O 1 2 N LEU H 31  ? N LEU H 31  O ILE H 78  ? O ILE H 78  
O 2 3 N PHE H 79  ? N PHE H 79  O GLY H 106 ? O GLY H 106 
O 3 4 N ILE H 107 ? N ILE H 107 O LYS H 147 ? O LYS H 147 
O 4 5 N LEU H 152 ? N LEU H 152 O GLU H 190 ? O GLU H 190 
O 5 6 N VAL H 187 ? N VAL H 187 O LEU H 228 ? O LEU H 228 
O 6 7 N LEU H 229 ? N LEU H 229 O THR H 269 ? O THR H 269 
O 7 8 N VAL H 268 ? N VAL H 268 O ALA H 297 ? O ALA H 297 
O 8 9 O TYR H 302 ? O TYR H 302 N ALA H 32  ? N ALA H 32  
P 1 2 N VAL H 114 ? N VAL H 114 O THR H 124 ? O THR H 124 
Q 1 2 N LEU I 31  ? N LEU I 31  O ILE I 78  ? O ILE I 78  
Q 2 3 N PHE I 79  ? N PHE I 79  O GLY I 106 ? O GLY I 106 
Q 3 4 N ILE I 107 ? N ILE I 107 O LYS I 147 ? O LYS I 147 
Q 4 5 N LEU I 152 ? N LEU I 152 O GLU I 190 ? O GLU I 190 
Q 5 6 N VAL I 187 ? N VAL I 187 O LEU I 228 ? O LEU I 228 
Q 6 7 N LEU I 229 ? N LEU I 229 O THR I 269 ? O THR I 269 
Q 7 8 N VAL I 268 ? N VAL I 268 O ALA I 297 ? O ALA I 297 
Q 8 9 O TYR I 302 ? O TYR I 302 N ALA I 32  ? N ALA I 32  
R 1 2 N VAL I 114 ? N VAL I 114 O THR I 124 ? O THR I 124 
S 1 2 N LEU J 31  ? N LEU J 31  O ILE J 78  ? O ILE J 78  
S 2 3 N PHE J 79  ? N PHE J 79  O GLY J 106 ? O GLY J 106 
S 3 4 N ILE J 107 ? N ILE J 107 O LYS J 147 ? O LYS J 147 
S 4 5 N LEU J 152 ? N LEU J 152 O GLU J 190 ? O GLU J 190 
S 5 6 N VAL J 187 ? N VAL J 187 O LEU J 228 ? O LEU J 228 
S 6 7 N LEU J 229 ? N LEU J 229 O THR J 269 ? O THR J 269 
S 7 8 N VAL J 268 ? N VAL J 268 O ALA J 297 ? O ALA J 297 
S 8 9 O TYR J 302 ? O TYR J 302 N ALA J 32  ? N ALA J 32  
T 1 2 N VAL J 114 ? N VAL J 114 O THR J 124 ? O THR J 124 
U 1 2 N LEU K 31  ? N LEU K 31  O ILE K 78  ? O ILE K 78  
U 2 3 N PHE K 79  ? N PHE K 79  O GLY K 106 ? O GLY K 106 
U 3 4 N ILE K 107 ? N ILE K 107 O LYS K 147 ? O LYS K 147 
U 4 5 N LEU K 152 ? N LEU K 152 O GLU K 190 ? O GLU K 190 
U 5 6 N VAL K 187 ? N VAL K 187 O LEU K 228 ? O LEU K 228 
U 6 7 N LEU K 229 ? N LEU K 229 O THR K 269 ? O THR K 269 
U 7 8 N VAL K 268 ? N VAL K 268 O ALA K 297 ? O ALA K 297 
U 8 9 O TYR K 302 ? O TYR K 302 N ALA K 32  ? N ALA K 32  
V 1 2 N VAL K 114 ? N VAL K 114 O THR K 124 ? O THR K 124 
W 1 2 N LEU L 31  ? N LEU L 31  O ILE L 78  ? O ILE L 78  
W 2 3 N PHE L 79  ? N PHE L 79  O GLY L 106 ? O GLY L 106 
W 3 4 N ILE L 107 ? N ILE L 107 O LYS L 147 ? O LYS L 147 
W 4 5 N LEU L 152 ? N LEU L 152 O GLU L 190 ? O GLU L 190 
W 5 6 N VAL L 187 ? N VAL L 187 O LEU L 228 ? O LEU L 228 
W 6 7 N LEU L 229 ? N LEU L 229 O THR L 269 ? O THR L 269 
W 7 8 N VAL L 268 ? N VAL L 268 O ALA L 297 ? O ALA L 297 
W 8 9 O TYR L 302 ? O TYR L 302 N ALA L 32  ? N ALA L 32  
X 1 2 N VAL L 114 ? N VAL L 114 O THR L 124 ? O THR L 124 
# 
_atom_sites.entry_id                    1XFB 
_atom_sites.fract_transf_matrix[1][1]   0.011923 
_atom_sites.fract_transf_matrix[1][2]   0.001547 
_atom_sites.fract_transf_matrix[1][3]   0.004936 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008266 
_atom_sites.fract_transf_matrix[2][3]   0.003309 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008774 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . HIS A 1 3   ? 4.968   1.741   -19.139 1.00 96.43 ? 3   HIS A N   1 
ATOM 2     C CA  . HIS A 1 3   ? 4.749   2.569   -17.923 1.00 96.43 ? 3   HIS A CA  1 
ATOM 3     C C   . HIS A 1 3   ? 5.995   3.361   -17.552 1.00 96.43 ? 3   HIS A C   1 
ATOM 4     O O   . HIS A 1 3   ? 6.058   3.980   -16.486 1.00 96.43 ? 3   HIS A O   1 
ATOM 5     C CB  . HIS A 1 3   ? 4.296   1.688   -16.741 1.00 91.83 ? 3   HIS A CB  1 
ATOM 6     C CG  . HIS A 1 3   ? 4.862   0.295   -16.747 1.00 91.83 ? 3   HIS A CG  1 
ATOM 7     N ND1 . HIS A 1 3   ? 4.355   -0.712  -15.950 1.00 91.83 ? 3   HIS A ND1 1 
ATOM 8     C CD2 . HIS A 1 3   ? 5.879   -0.260  -17.450 1.00 91.83 ? 3   HIS A CD2 1 
ATOM 9     C CE1 . HIS A 1 3   ? 5.032   -1.826  -16.164 1.00 91.83 ? 3   HIS A CE1 1 
ATOM 10    N NE2 . HIS A 1 3   ? 5.963   -1.579  -17.070 1.00 91.83 ? 3   HIS A NE2 1 
ATOM 11    N N   . SER A 1 4   ? 6.978   3.346   -18.451 1.00 81.35 ? 4   SER A N   1 
ATOM 12    C CA  . SER A 1 4   ? 8.239   4.060   -18.251 1.00 81.35 ? 4   SER A CA  1 
ATOM 13    C C   . SER A 1 4   ? 8.380   5.268   -19.189 1.00 81.35 ? 4   SER A C   1 
ATOM 14    O O   . SER A 1 4   ? 8.804   5.133   -20.342 1.00 81.35 ? 4   SER A O   1 
ATOM 15    C CB  . SER A 1 4   ? 9.425   3.096   -18.438 1.00 93.97 ? 4   SER A CB  1 
ATOM 16    O OG  . SER A 1 4   ? 9.197   2.157   -19.484 1.00 93.97 ? 4   SER A OG  1 
ATOM 17    N N   . TYR A 1 5   ? 8.009   6.445   -18.688 1.00 85.47 ? 5   TYR A N   1 
ATOM 18    C CA  . TYR A 1 5   ? 8.094   7.684   -19.462 1.00 85.47 ? 5   TYR A CA  1 
ATOM 19    C C   . TYR A 1 5   ? 9.125   8.604   -18.814 1.00 85.47 ? 5   TYR A C   1 
ATOM 20    O O   . TYR A 1 5   ? 8.777   9.490   -18.028 1.00 85.47 ? 5   TYR A O   1 
ATOM 21    C CB  . TYR A 1 5   ? 6.729   8.372   -19.516 1.00 87.62 ? 5   TYR A CB  1 
ATOM 22    C CG  . TYR A 1 5   ? 5.683   7.556   -20.235 1.00 87.62 ? 5   TYR A CG  1 
ATOM 23    C CD1 . TYR A 1 5   ? 5.166   6.387   -19.670 1.00 87.62 ? 5   TYR A CD1 1 
ATOM 24    C CD2 . TYR A 1 5   ? 5.244   7.924   -21.501 1.00 87.62 ? 5   TYR A CD2 1 
ATOM 25    C CE1 . TYR A 1 5   ? 4.239   5.602   -20.356 1.00 87.62 ? 5   TYR A CE1 1 
ATOM 26    C CE2 . TYR A 1 5   ? 4.322   7.150   -22.195 1.00 87.62 ? 5   TYR A CE2 1 
ATOM 27    C CZ  . TYR A 1 5   ? 3.824   5.991   -21.621 1.00 87.62 ? 5   TYR A CZ  1 
ATOM 28    O OH  . TYR A 1 5   ? 2.926   5.228   -22.328 1.00 87.62 ? 5   TYR A OH  1 
ATOM 29    N N   . PRO A 1 6   ? 10.412  8.406   -19.157 1.00 57.19 ? 6   PRO A N   1 
ATOM 30    C CA  . PRO A 1 6   ? 11.578  9.145   -18.668 1.00 57.19 ? 6   PRO A CA  1 
ATOM 31    C C   . PRO A 1 6   ? 11.317  10.500  -18.018 1.00 57.19 ? 6   PRO A C   1 
ATOM 32    O O   . PRO A 1 6   ? 11.070  11.505  -18.692 1.00 57.19 ? 6   PRO A O   1 
ATOM 33    C CB  . PRO A 1 6   ? 12.453  9.234   -19.907 1.00 68.88 ? 6   PRO A CB  1 
ATOM 34    C CG  . PRO A 1 6   ? 12.284  7.863   -20.468 1.00 68.88 ? 6   PRO A CG  1 
ATOM 35    C CD  . PRO A 1 6   ? 10.777  7.634   -20.361 1.00 68.88 ? 6   PRO A CD  1 
ATOM 36    N N   . ALA A 1 7   ? 11.385  10.506  -16.691 1.00 53.78 ? 7   ALA A N   1 
ATOM 37    C CA  . ALA A 1 7   ? 11.170  11.717  -15.916 1.00 53.78 ? 7   ALA A CA  1 
ATOM 38    C C   . ALA A 1 7   ? 12.294  12.710  -16.183 1.00 53.78 ? 7   ALA A C   1 
ATOM 39    O O   . ALA A 1 7   ? 12.060  13.916  -16.303 1.00 53.78 ? 7   ALA A O   1 
ATOM 40    C CB  . ALA A 1 7   ? 11.118  11.376  -14.433 1.00 16.90 ? 7   ALA A CB  1 
ATOM 41    N N   . LEU A 1 8   ? 13.515  12.192  -16.282 1.00 34.82 ? 8   LEU A N   1 
ATOM 42    C CA  . LEU A 1 8   ? 14.681  13.026  -16.517 1.00 34.82 ? 8   LEU A CA  1 
ATOM 43    C C   . LEU A 1 8   ? 15.510  12.547  -17.689 1.00 34.82 ? 8   LEU A C   1 
ATOM 44    O O   . LEU A 1 8   ? 15.600  11.346  -17.949 1.00 34.82 ? 8   LEU A O   1 
ATOM 45    C CB  . LEU A 1 8   ? 15.569  13.039  -15.278 1.00 22.47 ? 8   LEU A CB  1 
ATOM 46    C CG  . LEU A 1 8   ? 14.955  13.582  -13.992 1.00 22.47 ? 8   LEU A CG  1 
ATOM 47    C CD1 . LEU A 1 8   ? 15.895  13.292  -12.837 1.00 22.47 ? 8   LEU A CD1 1 
ATOM 48    C CD2 . LEU A 1 8   ? 14.698  15.079  -14.127 1.00 22.47 ? 8   LEU A CD2 1 
ATOM 49    N N   . SER A 1 9   ? 16.123  13.501  -18.382 1.00 31.44 ? 9   SER A N   1 
ATOM 50    C CA  . SER A 1 9   ? 16.983  13.200  -19.513 1.00 31.44 ? 9   SER A CA  1 
ATOM 51    C C   . SER A 1 9   ? 18.315  12.777  -18.926 1.00 31.44 ? 9   SER A C   1 
ATOM 52    O O   . SER A 1 9   ? 18.549  12.922  -17.723 1.00 31.44 ? 9   SER A O   1 
ATOM 53    C CB  . SER A 1 9   ? 17.204  14.438  -20.366 1.00 27.92 ? 9   SER A CB  1 
ATOM 54    O OG  . SER A 1 9   ? 18.074  15.333  -19.705 1.00 27.92 ? 9   SER A OG  1 
ATOM 55    N N   . ALA A 1 10  ? 19.194  12.267  -19.777 1.00 25.48 ? 10  ALA A N   1 
ATOM 56    C CA  . ALA A 1 10  ? 20.504  11.825  -19.319 1.00 25.48 ? 10  ALA A CA  1 
ATOM 57    C C   . ALA A 1 10  ? 21.284  13.011  -18.783 1.00 25.48 ? 10  ALA A C   1 
ATOM 58    O O   . ALA A 1 10  ? 21.959  12.917  -17.760 1.00 25.48 ? 10  ALA A O   1 
ATOM 59    C CB  . ALA A 1 10  ? 21.257  11.180  -20.459 1.00 12.72 ? 10  ALA A CB  1 
ATOM 60    N N   . GLU A 1 11  ? 21.179  14.131  -19.485 1.00 31.95 ? 11  GLU A N   1 
ATOM 61    C CA  . GLU A 1 11  ? 21.874  15.343  -19.091 1.00 31.95 ? 11  GLU A CA  1 
ATOM 62    C C   . GLU A 1 11  ? 21.429  15.746  -17.696 1.00 31.95 ? 11  GLU A C   1 
ATOM 63    O O   . GLU A 1 11  ? 22.251  16.011  -16.822 1.00 31.95 ? 11  GLU A O   1 
ATOM 64    C CB  . GLU A 1 11  ? 21.538  16.464  -20.064 1.00 99.51 ? 11  GLU A CB  1 
ATOM 65    C CG  . GLU A 1 11  ? 21.155  15.970  -21.440 1.00 99.51 ? 11  GLU A CG  1 
ATOM 66    C CD  . GLU A 1 11  ? 22.163  16.365  -22.492 1.00 99.51 ? 11  GLU A CD  1 
ATOM 67    O OE1 . GLU A 1 11  ? 22.384  17.587  -22.676 1.00 99.51 ? 11  GLU A OE1 1 
ATOM 68    O OE2 . GLU A 1 11  ? 22.730  15.452  -23.132 1.00 99.51 ? 11  GLU A OE2 1 
ATOM 69    N N   . GLN A 1 12  ? 20.116  15.784  -17.497 1.00 34.90 ? 12  GLN A N   1 
ATOM 70    C CA  . GLN A 1 12  ? 19.534  16.179  -16.222 1.00 34.90 ? 12  GLN A CA  1 
ATOM 71    C C   . GLN A 1 12  ? 19.957  15.292  -15.069 1.00 34.90 ? 12  GLN A C   1 
ATOM 72    O O   . GLN A 1 12  ? 20.303  15.786  -13.995 1.00 34.90 ? 12  GLN A O   1 
ATOM 73    C CB  . GLN A 1 12  ? 18.018  16.183  -16.328 1.00 42.60 ? 12  GLN A CB  1 
ATOM 74    C CG  . GLN A 1 12  ? 17.502  17.082  -17.418 1.00 42.60 ? 12  GLN A CG  1 
ATOM 75    C CD  . GLN A 1 12  ? 16.006  17.027  -17.535 1.00 42.60 ? 12  GLN A CD  1 
ATOM 76    O OE1 . GLN A 1 12  ? 15.427  15.964  -17.750 1.00 42.60 ? 12  GLN A OE1 1 
ATOM 77    N NE2 . GLN A 1 12  ? 15.364  18.175  -17.392 1.00 42.60 ? 12  GLN A NE2 1 
ATOM 78    N N   . LYS A 1 13  ? 19.911  13.982  -15.283 1.00 36.32 ? 13  LYS A N   1 
ATOM 79    C CA  . LYS A 1 13  ? 20.309  13.056  -14.239 1.00 36.32 ? 13  LYS A CA  1 
ATOM 80    C C   . LYS A 1 13  ? 21.742  13.381  -13.844 1.00 36.32 ? 13  LYS A C   1 
ATOM 81    O O   . LYS A 1 13  ? 22.087  13.387  -12.660 1.00 36.32 ? 13  LYS A O   1 
ATOM 82    C CB  . LYS A 1 13  ? 20.238  11.619  -14.738 1.00 34.25 ? 13  LYS A CB  1 
ATOM 83    C CG  . LYS A 1 13  ? 18.851  11.093  -15.043 1.00 34.25 ? 13  LYS A CG  1 
ATOM 84    C CD  . LYS A 1 13  ? 18.975  9.637   -15.451 1.00 34.25 ? 13  LYS A CD  1 
ATOM 85    C CE  . LYS A 1 13  ? 17.654  9.007   -15.840 1.00 34.25 ? 13  LYS A CE  1 
ATOM 86    N NZ  . LYS A 1 13  ? 17.840  7.541   -16.149 1.00 34.25 ? 13  LYS A NZ  1 
ATOM 87    N N   . LYS A 1 14  ? 22.575  13.653  -14.846 1.00 27.36 ? 14  LYS A N   1 
ATOM 88    C CA  . LYS A 1 14  ? 23.978  13.987  -14.615 1.00 27.36 ? 14  LYS A CA  1 
ATOM 89    C C   . LYS A 1 14  ? 24.077  15.182  -13.679 1.00 27.36 ? 14  LYS A C   1 
ATOM 90    O O   . LYS A 1 14  ? 24.646  15.079  -12.595 1.00 27.36 ? 14  LYS A O   1 
ATOM 91    C CB  . LYS A 1 14  ? 24.676  14.308  -15.941 1.00 63.46 ? 14  LYS A CB  1 
ATOM 92    C CG  . LYS A 1 14  ? 26.161  14.638  -15.817 1.00 63.46 ? 14  LYS A CG  1 
ATOM 93    C CD  . LYS A 1 14  ? 26.908  13.559  -15.043 1.00 63.46 ? 14  LYS A CD  1 
ATOM 94    C CE  . LYS A 1 14  ? 26.630  12.158  -15.610 1.00 63.46 ? 14  LYS A CE  1 
ATOM 95    N NZ  . LYS A 1 14  ? 27.087  11.041  -14.713 1.00 63.46 ? 14  LYS A NZ  1 
ATOM 96    N N   . GLU A 1 15  ? 23.504  16.310  -14.095 1.00 21.49 ? 15  GLU A N   1 
ATOM 97    C CA  . GLU A 1 15  ? 23.537  17.526  -13.294 1.00 21.49 ? 15  GLU A CA  1 
ATOM 98    C C   . GLU A 1 15  ? 23.145  17.288  -11.845 1.00 21.49 ? 15  GLU A C   1 
ATOM 99    O O   . GLU A 1 15  ? 23.792  17.797  -10.928 1.00 21.49 ? 15  GLU A O   1 
ATOM 100   C CB  . GLU A 1 15  ? 22.617  18.594  -13.883 1.00 41.22 ? 15  GLU A CB  1 
ATOM 101   C CG  . GLU A 1 15  ? 22.429  19.772  -12.941 1.00 41.22 ? 15  GLU A CG  1 
ATOM 102   C CD  . GLU A 1 15  ? 21.607  20.899  -13.541 1.00 41.22 ? 15  GLU A CD  1 
ATOM 103   O OE1 . GLU A 1 15  ? 20.585  20.605  -14.205 1.00 41.22 ? 15  GLU A OE1 1 
ATOM 104   O OE2 . GLU A 1 15  ? 21.978  22.080  -13.333 1.00 41.22 ? 15  GLU A OE2 1 
ATOM 105   N N   . LEU A 1 16  ? 22.083  16.521  -11.634 1.00 30.94 ? 16  LEU A N   1 
ATOM 106   C CA  . LEU A 1 16  ? 21.632  16.253  -10.280 1.00 30.94 ? 16  LEU A CA  1 
ATOM 107   C C   . LEU A 1 16  ? 22.682  15.453  -9.522  1.00 30.94 ? 16  LEU A C   1 
ATOM 108   O O   . LEU A 1 16  ? 23.105  15.844  -8.432  1.00 30.94 ? 16  LEU A O   1 
ATOM 109   C CB  . LEU A 1 16  ? 20.294  15.509  -10.309 1.00 18.37 ? 16  LEU A CB  1 
ATOM 110   C CG  . LEU A 1 16  ? 19.108  16.342  -10.817 1.00 18.37 ? 16  LEU A CG  1 
ATOM 111   C CD1 . LEU A 1 16  ? 17.899  15.447  -11.030 1.00 18.37 ? 16  LEU A CD1 1 
ATOM 112   C CD2 . LEU A 1 16  ? 18.792  17.451  -9.816  1.00 18.37 ? 16  LEU A CD2 1 
ATOM 113   N N   . SER A 1 17  ? 23.118  14.344  -10.112 1.00 27.91 ? 17  SER A N   1 
ATOM 114   C CA  . SER A 1 17  ? 24.119  13.500  -9.476  1.00 27.91 ? 17  SER A CA  1 
ATOM 115   C C   . SER A 1 17  ? 25.370  14.276  -9.097  1.00 27.91 ? 17  SER A C   1 
ATOM 116   O O   . SER A 1 17  ? 25.889  14.122  -7.991  1.00 27.91 ? 17  SER A O   1 
ATOM 117   C CB  . SER A 1 17  ? 24.516  12.355  -10.389 1.00 25.50 ? 17  SER A CB  1 
ATOM 118   O OG  . SER A 1 17  ? 25.510  11.593  -9.739  1.00 25.50 ? 17  SER A OG  1 
ATOM 119   N N   . ASP A 1 18  ? 25.860  15.100  -10.020 1.00 26.62 ? 18  ASP A N   1 
ATOM 120   C CA  . ASP A 1 18  ? 27.047  15.897  -9.755  1.00 26.62 ? 18  ASP A CA  1 
ATOM 121   C C   . ASP A 1 18  ? 26.790  16.771  -8.536  1.00 26.62 ? 18  ASP A C   1 
ATOM 122   O O   . ASP A 1 18  ? 27.483  16.654  -7.526  1.00 26.62 ? 18  ASP A O   1 
ATOM 123   C CB  . ASP A 1 18  ? 27.406  16.765  -10.966 1.00 48.84 ? 18  ASP A CB  1 
ATOM 124   C CG  . ASP A 1 18  ? 27.833  15.937  -12.184 1.00 48.84 ? 18  ASP A CG  1 
ATOM 125   O OD1 . ASP A 1 18  ? 28.291  14.779  -12.004 1.00 48.84 ? 18  ASP A OD1 1 
ATOM 126   O OD2 . ASP A 1 18  ? 27.726  16.451  -13.325 1.00 48.84 ? 18  ASP A OD2 1 
ATOM 127   N N   . ILE A 1 19  ? 25.783  17.631  -8.621  1.00 19.21 ? 19  ILE A N   1 
ATOM 128   C CA  . ILE A 1 19  ? 25.443  18.502  -7.505  1.00 19.21 ? 19  ILE A CA  1 
ATOM 129   C C   . ILE A 1 19  ? 25.409  17.735  -6.190  1.00 19.21 ? 19  ILE A C   1 
ATOM 130   O O   . ILE A 1 19  ? 25.948  18.181  -5.185  1.00 19.21 ? 19  ILE A O   1 
ATOM 131   C CB  . ILE A 1 19  ? 24.066  19.138  -7.701  1.00 8.45  ? 19  ILE A CB  1 
ATOM 132   C CG1 . ILE A 1 19  ? 24.071  19.982  -8.966  1.00 8.45  ? 19  ILE A CG1 1 
ATOM 133   C CG2 . ILE A 1 19  ? 23.700  19.976  -6.489  1.00 8.45  ? 19  ILE A CG2 1 
ATOM 134   C CD1 . ILE A 1 19  ? 22.769  20.695  -9.224  1.00 8.45  ? 19  ILE A CD1 1 
ATOM 135   N N   . ALA A 1 20  ? 24.765  16.577  -6.200  1.00 29.37 ? 20  ALA A N   1 
ATOM 136   C CA  . ALA A 1 20  ? 24.656  15.778  -4.994  1.00 29.37 ? 20  ALA A CA  1 
ATOM 137   C C   . ALA A 1 20  ? 26.021  15.415  -4.440  1.00 29.37 ? 20  ALA A C   1 
ATOM 138   O O   . ALA A 1 20  ? 26.309  15.644  -3.263  1.00 29.37 ? 20  ALA A O   1 
ATOM 139   C CB  . ALA A 1 20  ? 23.869  14.521  -5.277  1.00 27.16 ? 20  ALA A CB  1 
ATOM 140   N N   . LEU A 1 21  ? 26.858  14.847  -5.299  1.00 34.30 ? 21  LEU A N   1 
ATOM 141   C CA  . LEU A 1 21  ? 28.195  14.428  -4.907  1.00 34.30 ? 21  LEU A CA  1 
ATOM 142   C C   . LEU A 1 21  ? 29.085  15.564  -4.422  1.00 34.30 ? 21  LEU A C   1 
ATOM 143   O O   . LEU A 1 21  ? 29.890  15.374  -3.512  1.00 34.30 ? 21  LEU A O   1 
ATOM 144   C CB  . LEU A 1 21  ? 28.860  13.708  -6.068  1.00 8.52  ? 21  LEU A CB  1 
ATOM 145   C CG  . LEU A 1 21  ? 28.147  12.401  -6.413  1.00 8.52  ? 21  LEU A CG  1 
ATOM 146   C CD1 . LEU A 1 21  ? 28.610  11.891  -7.760  1.00 8.52  ? 21  LEU A CD1 1 
ATOM 147   C CD2 . LEU A 1 21  ? 28.401  11.385  -5.319  1.00 8.52  ? 21  LEU A CD2 1 
ATOM 148   N N   . ARG A 1 22  ? 28.954  16.742  -5.023  1.00 30.02 ? 22  ARG A N   1 
ATOM 149   C CA  . ARG A 1 22  ? 29.765  17.869  -4.593  1.00 30.02 ? 22  ARG A CA  1 
ATOM 150   C C   . ARG A 1 22  ? 29.452  18.182  -3.147  1.00 30.02 ? 22  ARG A C   1 
ATOM 151   O O   . ARG A 1 22  ? 30.350  18.412  -2.337  1.00 30.02 ? 22  ARG A O   1 
ATOM 152   C CB  . ARG A 1 22  ? 29.479  19.102  -5.436  1.00 51.33 ? 22  ARG A CB  1 
ATOM 153   C CG  . ARG A 1 22  ? 29.935  18.987  -6.867  1.00 51.33 ? 22  ARG A CG  1 
ATOM 154   C CD  . ARG A 1 22  ? 29.613  20.263  -7.580  1.00 51.33 ? 22  ARG A CD  1 
ATOM 155   N NE  . ARG A 1 22  ? 30.125  21.397  -6.819  1.00 51.33 ? 22  ARG A NE  1 
ATOM 156   C CZ  . ARG A 1 22  ? 29.689  22.645  -6.963  1.00 51.33 ? 22  ARG A CZ  1 
ATOM 157   N NH1 . ARG A 1 22  ? 28.725  22.911  -7.842  1.00 51.33 ? 22  ARG A NH1 1 
ATOM 158   N NH2 . ARG A 1 22  ? 30.219  23.629  -6.238  1.00 51.33 ? 22  ARG A NH2 1 
ATOM 159   N N   . ILE A 1 23  ? 28.167  18.185  -2.824  1.00 30.88 ? 23  ILE A N   1 
ATOM 160   C CA  . ILE A 1 23  ? 27.732  18.489  -1.476  1.00 30.88 ? 23  ILE A CA  1 
ATOM 161   C C   . ILE A 1 23  ? 28.293  17.514  -0.446  1.00 30.88 ? 23  ILE A C   1 
ATOM 162   O O   . ILE A 1 23  ? 28.840  17.942  0.563   1.00 30.88 ? 23  ILE A O   1 
ATOM 163   C CB  . ILE A 1 23  ? 26.192  18.514  -1.397  1.00 20.53 ? 23  ILE A CB  1 
ATOM 164   C CG1 . ILE A 1 23  ? 25.657  19.549  -2.390  1.00 20.53 ? 23  ILE A CG1 1 
ATOM 165   C CG2 . ILE A 1 23  ? 25.737  18.850  0.017   1.00 20.53 ? 23  ILE A CG2 1 
ATOM 166   C CD1 . ILE A 1 23  ? 24.157  19.592  -2.497  1.00 20.53 ? 23  ILE A CD1 1 
ATOM 167   N N   . VAL A 1 24  ? 28.185  16.214  -0.692  1.00 35.21 ? 24  VAL A N   1 
ATOM 168   C CA  . VAL A 1 24  ? 28.690  15.258  0.284   1.00 35.21 ? 24  VAL A CA  1 
ATOM 169   C C   . VAL A 1 24  ? 30.117  14.790  0.070   1.00 35.21 ? 24  VAL A C   1 
ATOM 170   O O   . VAL A 1 24  ? 30.533  13.782  0.637   1.00 35.21 ? 24  VAL A O   1 
ATOM 171   C CB  . VAL A 1 24  ? 27.780  14.028  0.388   1.00 20.36 ? 24  VAL A CB  1 
ATOM 172   C CG1 . VAL A 1 24  ? 26.473  14.429  1.041   1.00 20.36 ? 24  VAL A CG1 1 
ATOM 173   C CG2 . VAL A 1 24  ? 27.535  13.434  -0.982  1.00 20.36 ? 24  VAL A CG2 1 
ATOM 174   N N   . ALA A 1 25  ? 30.869  15.528  -0.739  1.00 35.46 ? 25  ALA A N   1 
ATOM 175   C CA  . ALA A 1 25  ? 32.264  15.189  -0.998  1.00 35.46 ? 25  ALA A CA  1 
ATOM 176   C C   . ALA A 1 25  ? 32.971  14.959  0.333   1.00 35.46 ? 25  ALA A C   1 
ATOM 177   O O   . ALA A 1 25  ? 32.640  15.591  1.339   1.00 35.46 ? 25  ALA A O   1 
ATOM 178   C CB  . ALA A 1 25  ? 32.938  16.306  -1.746  1.00 25.78 ? 25  ALA A CB  1 
ATOM 179   N N   . PRO A 1 26  ? 33.966  14.058  0.348   1.00 23.85 ? 26  PRO A N   1 
ATOM 180   C CA  . PRO A 1 26  ? 34.763  13.683  1.521   1.00 23.85 ? 26  PRO A CA  1 
ATOM 181   C C   . PRO A 1 26  ? 35.095  14.812  2.481   1.00 23.85 ? 26  PRO A C   1 
ATOM 182   O O   . PRO A 1 26  ? 35.487  15.898  2.064   1.00 23.85 ? 26  PRO A O   1 
ATOM 183   C CB  . PRO A 1 26  ? 36.005  13.076  0.897   1.00 17.34 ? 26  PRO A CB  1 
ATOM 184   C CG  . PRO A 1 26  ? 35.439  12.377  -0.295  1.00 17.34 ? 26  PRO A CG  1 
ATOM 185   C CD  . PRO A 1 26  ? 34.520  13.433  -0.867  1.00 17.34 ? 26  PRO A CD  1 
ATOM 186   N N   . GLY A 1 27  ? 34.926  14.549  3.773   1.00 37.36 ? 27  GLY A N   1 
ATOM 187   C CA  . GLY A 1 27  ? 35.229  15.553  4.775   1.00 37.36 ? 27  GLY A CA  1 
ATOM 188   C C   . GLY A 1 27  ? 34.390  16.814  4.701   1.00 37.36 ? 27  GLY A C   1 
ATOM 189   O O   . GLY A 1 27  ? 34.687  17.797  5.386   1.00 37.36 ? 27  GLY A O   1 
ATOM 190   N N   . LYS A 1 28  ? 33.347  16.789  3.874   1.00 28.92 ? 28  LYS A N   1 
ATOM 191   C CA  . LYS A 1 28  ? 32.453  17.933  3.722   1.00 28.92 ? 28  LYS A CA  1 
ATOM 192   C C   . LYS A 1 28  ? 31.037  17.655  4.254   1.00 28.92 ? 28  LYS A C   1 
ATOM 193   O O   . LYS A 1 28  ? 30.520  16.530  4.163   1.00 28.92 ? 28  LYS A O   1 
ATOM 194   C CB  . LYS A 1 28  ? 32.384  18.347  2.252   1.00 28.40 ? 28  LYS A CB  1 
ATOM 195   C CG  . LYS A 1 28  ? 33.580  19.149  1.760   1.00 28.40 ? 28  LYS A CG  1 
ATOM 196   C CD  . LYS A 1 28  ? 33.641  19.133  0.232   1.00 28.40 ? 28  LYS A CD  1 
ATOM 197   C CE  . LYS A 1 28  ? 34.640  20.135  -0.336  1.00 28.40 ? 28  LYS A CE  1 
ATOM 198   N NZ  . LYS A 1 28  ? 34.118  21.523  -0.217  1.00 28.40 ? 28  LYS A NZ  1 
ATOM 199   N N   . GLY A 1 29  ? 30.428  18.694  4.818   1.00 29.81 ? 29  GLY A N   1 
ATOM 200   C CA  . GLY A 1 29  ? 29.090  18.588  5.362   1.00 29.81 ? 29  GLY A CA  1 
ATOM 201   C C   . GLY A 1 29  ? 28.253  19.789  4.961   1.00 29.81 ? 29  GLY A C   1 
ATOM 202   O O   . GLY A 1 29  ? 28.671  20.602  4.129   1.00 29.81 ? 29  GLY A O   1 
ATOM 203   N N   . ILE A 1 30  ? 27.075  19.917  5.564   1.00 25.97 ? 30  ILE A N   1 
ATOM 204   C CA  . ILE A 1 30  ? 26.160  21.008  5.240   1.00 25.97 ? 30  ILE A CA  1 
ATOM 205   C C   . ILE A 1 30  ? 25.873  21.938  6.406   1.00 25.97 ? 30  ILE A C   1 
ATOM 206   O O   . ILE A 1 30  ? 25.622  21.483  7.522   1.00 25.97 ? 30  ILE A O   1 
ATOM 207   C CB  . ILE A 1 30  ? 24.791  20.459  4.752   1.00 13.86 ? 30  ILE A CB  1 
ATOM 208   C CG1 . ILE A 1 30  ? 24.954  19.713  3.427   1.00 13.86 ? 30  ILE A CG1 1 
ATOM 209   C CG2 . ILE A 1 30  ? 23.805  21.595  4.587   1.00 13.86 ? 30  ILE A CG2 1 
ATOM 210   C CD1 . ILE A 1 30  ? 23.716  18.975  2.991   1.00 13.86 ? 30  ILE A CD1 1 
ATOM 211   N N   . LEU A 1 31  ? 25.912  23.241  6.147   1.00 32.85 ? 31  LEU A N   1 
ATOM 212   C CA  . LEU A 1 31  ? 25.580  24.206  7.180   1.00 32.85 ? 31  LEU A CA  1 
ATOM 213   C C   . LEU A 1 31  ? 24.113  24.506  6.969   1.00 32.85 ? 31  LEU A C   1 
ATOM 214   O O   . LEU A 1 31  ? 23.723  25.017  5.917   1.00 32.85 ? 31  LEU A O   1 
ATOM 215   C CB  . LEU A 1 31  ? 26.356  25.508  7.027   1.00 18.31 ? 31  LEU A CB  1 
ATOM 216   C CG  . LEU A 1 31  ? 25.722  26.626  7.872   1.00 18.31 ? 31  LEU A CG  1 
ATOM 217   C CD1 . LEU A 1 31  ? 25.767  26.246  9.342   1.00 18.31 ? 31  LEU A CD1 1 
ATOM 218   C CD2 . LEU A 1 31  ? 26.437  27.941  7.635   1.00 18.31 ? 31  LEU A CD2 1 
ATOM 219   N N   . ALA A 1 32  ? 23.299  24.188  7.964   1.00 31.25 ? 32  ALA A N   1 
ATOM 220   C CA  . ALA A 1 32  ? 21.872  24.429  7.862   1.00 31.25 ? 32  ALA A CA  1 
ATOM 221   C C   . ALA A 1 32  ? 21.508  25.743  8.539   1.00 31.25 ? 32  ALA A C   1 
ATOM 222   O O   . ALA A 1 32  ? 21.272  25.785  9.749   1.00 31.25 ? 32  ALA A O   1 
ATOM 223   C CB  . ALA A 1 32  ? 21.106  23.280  8.497   1.00 27.14 ? 32  ALA A CB  1 
ATOM 224   N N   . ALA A 1 33  ? 21.465  26.815  7.753   1.00 38.49 ? 33  ALA A N   1 
ATOM 225   C CA  . ALA A 1 33  ? 21.120  28.128  8.277   1.00 38.49 ? 33  ALA A CA  1 
ATOM 226   C C   . ALA A 1 33  ? 19.748  28.547  7.742   1.00 38.49 ? 33  ALA A C   1 
ATOM 227   O O   . ALA A 1 33  ? 19.506  29.723  7.441   1.00 38.49 ? 33  ALA A O   1 
ATOM 228   C CB  . ALA A 1 33  ? 22.181  29.130  7.866   1.00 29.51 ? 33  ALA A CB  1 
ATOM 229   N N   . ASP A 1 34  ? 18.850  27.574  7.633   1.00 40.98 ? 34  ASP A N   1 
ATOM 230   C CA  . ASP A 1 34  ? 17.506  27.816  7.117   1.00 40.98 ? 34  ASP A CA  1 
ATOM 231   C C   . ASP A 1 34  ? 16.481  28.093  8.220   1.00 40.98 ? 34  ASP A C   1 
ATOM 232   O O   . ASP A 1 34  ? 15.295  27.787  8.069   1.00 40.98 ? 34  ASP A O   1 
ATOM 233   C CB  . ASP A 1 34  ? 17.056  26.616  6.268   1.00 46.35 ? 34  ASP A CB  1 
ATOM 234   C CG  . ASP A 1 34  ? 16.986  25.313  7.070   1.00 46.35 ? 34  ASP A CG  1 
ATOM 235   O OD1 . ASP A 1 34  ? 17.959  24.995  7.789   1.00 46.35 ? 34  ASP A OD1 1 
ATOM 236   O OD2 . ASP A 1 34  ? 15.962  24.592  6.977   1.00 46.35 ? 34  ASP A OD2 1 
ATOM 237   N N   . GLU A 1 35  ? 16.930  28.686  9.323   1.00 44.79 ? 35  GLU A N   1 
ATOM 238   C CA  . GLU A 1 35  ? 16.025  28.981  10.433  1.00 44.79 ? 35  GLU A CA  1 
ATOM 239   C C   . GLU A 1 35  ? 14.926  29.976  10.066  1.00 44.79 ? 35  GLU A C   1 
ATOM 240   O O   . GLU A 1 35  ? 15.195  31.124  9.684   1.00 44.79 ? 35  GLU A O   1 
ATOM 241   C CB  . GLU A 1 35  ? 16.791  29.520  11.650  1.00 43.44 ? 35  GLU A CB  1 
ATOM 242   C CG  . GLU A 1 35  ? 17.707  28.525  12.344  1.00 43.44 ? 35  GLU A CG  1 
ATOM 243   C CD  . GLU A 1 35  ? 19.115  28.495  11.765  1.00 43.44 ? 35  GLU A CD  1 
ATOM 244   O OE1 . GLU A 1 35  ? 20.014  27.960  12.448  1.00 43.44 ? 35  GLU A OE1 1 
ATOM 245   O OE2 . GLU A 1 35  ? 19.333  28.996  10.637  1.00 43.44 ? 35  GLU A OE2 1 
ATOM 246   N N   . SER A 1 36  ? 13.681  29.524  10.188  1.00 53.59 ? 36  SER A N   1 
ATOM 247   C CA  . SER A 1 36  ? 12.523  30.367  9.903   1.00 53.59 ? 36  SER A CA  1 
ATOM 248   C C   . SER A 1 36  ? 12.585  31.604  10.793  1.00 53.59 ? 36  SER A C   1 
ATOM 249   O O   . SER A 1 36  ? 13.159  31.567  11.885  1.00 53.59 ? 36  SER A O   1 
ATOM 250   C CB  . SER A 1 36  ? 11.225  29.596  10.178  1.00 49.24 ? 36  SER A CB  1 
ATOM 251   O OG  . SER A 1 36  ? 11.241  28.992  11.464  1.00 49.24 ? 36  SER A OG  1 
ATOM 252   N N   . VAL A 1 37  ? 12.007  32.704  10.325  1.00 44.24 ? 37  VAL A N   1 
ATOM 253   C CA  . VAL A 1 37  ? 12.010  33.932  11.111  1.00 44.24 ? 37  VAL A CA  1 
ATOM 254   C C   . VAL A 1 37  ? 11.404  33.654  12.486  1.00 44.24 ? 37  VAL A C   1 
ATOM 255   O O   . VAL A 1 37  ? 11.689  34.347  13.461  1.00 44.24 ? 37  VAL A O   1 
ATOM 256   C CB  . VAL A 1 37  ? 11.210  35.032  10.397  1.00 34.20 ? 37  VAL A CB  1 
ATOM 257   C CG1 . VAL A 1 37  ? 9.892   34.457  9.901   1.00 34.20 ? 37  VAL A CG1 1 
ATOM 258   C CG2 . VAL A 1 37  ? 10.988  36.211  11.338  1.00 34.20 ? 37  VAL A CG2 1 
ATOM 259   N N   . GLY A 1 38  ? 10.576  32.618  12.551  1.00 45.78 ? 38  GLY A N   1 
ATOM 260   C CA  . GLY A 1 38  ? 9.953   32.253  13.806  1.00 45.78 ? 38  GLY A CA  1 
ATOM 261   C C   . GLY A 1 38  ? 10.940  31.600  14.752  1.00 45.78 ? 38  GLY A C   1 
ATOM 262   O O   . GLY A 1 38  ? 11.202  32.117  15.840  1.00 45.78 ? 38  GLY A O   1 
ATOM 263   N N   . SER A 1 39  ? 11.491  30.459  14.346  1.00 51.21 ? 39  SER A N   1 
ATOM 264   C CA  . SER A 1 39  ? 12.457  29.752  15.182  1.00 51.21 ? 39  SER A CA  1 
ATOM 265   C C   . SER A 1 39  ? 13.669  30.640  15.445  1.00 51.21 ? 39  SER A C   1 
ATOM 266   O O   . SER A 1 39  ? 14.346  30.506  16.466  1.00 51.21 ? 39  SER A O   1 
ATOM 267   C CB  . SER A 1 39  ? 12.884  28.438  14.516  1.00 43.89 ? 39  SER A CB  1 
ATOM 268   O OG  . SER A 1 39  ? 13.182  28.621  13.145  1.00 43.89 ? 39  SER A OG  1 
ATOM 269   N N   . MET A 1 40  ? 13.925  31.565  14.527  1.00 48.67 ? 40  MET A N   1 
ATOM 270   C CA  . MET A 1 40  ? 15.047  32.472  14.672  1.00 48.67 ? 40  MET A CA  1 
ATOM 271   C C   . MET A 1 40  ? 14.800  33.412  15.849  1.00 48.67 ? 40  MET A C   1 
ATOM 272   O O   . MET A 1 40  ? 15.737  33.882  16.492  1.00 48.67 ? 40  MET A O   1 
ATOM 273   C CB  . MET A 1 40  ? 15.242  33.281  13.394  1.00 46.14 ? 40  MET A CB  1 
ATOM 274   C CG  . MET A 1 40  ? 16.658  33.803  13.232  1.00 46.14 ? 40  MET A CG  1 
ATOM 275   S SD  . MET A 1 40  ? 17.856  32.458  13.014  1.00 46.14 ? 40  MET A SD  1 
ATOM 276   C CE  . MET A 1 40  ? 18.440  32.219  14.681  1.00 46.14 ? 40  MET A CE  1 
ATOM 277   N N   . ALA A 1 41  ? 13.535  33.688  16.132  1.00 51.47 ? 41  ALA A N   1 
ATOM 278   C CA  . ALA A 1 41  ? 13.201  34.567  17.242  1.00 51.47 ? 41  ALA A CA  1 
ATOM 279   C C   . ALA A 1 41  ? 13.647  33.917  18.540  1.00 51.47 ? 41  ALA A C   1 
ATOM 280   O O   . ALA A 1 41  ? 14.248  34.564  19.394  1.00 51.47 ? 41  ALA A O   1 
ATOM 281   C CB  . ALA A 1 41  ? 11.713  34.822  17.275  1.00 31.36 ? 41  ALA A CB  1 
ATOM 282   N N   . LYS A 1 42  ? 13.357  32.629  18.684  1.00 51.21 ? 42  LYS A N   1 
ATOM 283   C CA  . LYS A 1 42  ? 13.735  31.910  19.890  1.00 51.21 ? 42  LYS A CA  1 
ATOM 284   C C   . LYS A 1 42  ? 15.240  31.884  20.100  1.00 51.21 ? 42  LYS A C   1 
ATOM 285   O O   . LYS A 1 42  ? 15.720  32.137  21.205  1.00 51.21 ? 42  LYS A O   1 
ATOM 286   C CB  . LYS A 1 42  ? 13.200  30.478  19.854  1.00 92.04 ? 42  LYS A CB  1 
ATOM 287   C CG  . LYS A 1 42  ? 11.699  30.396  20.006  1.00 92.04 ? 42  LYS A CG  1 
ATOM 288   C CD  . LYS A 1 42  ? 11.262  29.014  20.455  1.00 92.04 ? 42  LYS A CD  1 
ATOM 289   C CE  . LYS A 1 42  ? 9.794   29.017  20.882  1.00 92.04 ? 42  LYS A CE  1 
ATOM 290   N NZ  . LYS A 1 42  ? 9.355   27.709  21.459  1.00 92.04 ? 42  LYS A NZ  1 
ATOM 291   N N   . ARG A 1 43  ? 15.988  31.584  19.044  1.00 57.50 ? 43  ARG A N   1 
ATOM 292   C CA  . ARG A 1 43  ? 17.438  31.524  19.161  1.00 57.50 ? 43  ARG A CA  1 
ATOM 293   C C   . ARG A 1 43  ? 18.045  32.870  19.502  1.00 57.50 ? 43  ARG A C   1 
ATOM 294   O O   . ARG A 1 43  ? 18.947  32.952  20.336  1.00 57.50 ? 43  ARG A O   1 
ATOM 295   C CB  . ARG A 1 43  ? 18.051  30.978  17.882  1.00 80.36 ? 43  ARG A CB  1 
ATOM 296   C CG  . ARG A 1 43  ? 17.627  29.566  17.626  1.00 80.36 ? 43  ARG A CG  1 
ATOM 297   C CD  . ARG A 1 43  ? 18.517  28.913  16.623  1.00 80.36 ? 43  ARG A CD  1 
ATOM 298   N NE  . ARG A 1 43  ? 18.039  27.573  16.299  1.00 80.36 ? 43  ARG A NE  1 
ATOM 299   C CZ  . ARG A 1 43  ? 18.657  26.746  15.458  1.00 80.36 ? 43  ARG A CZ  1 
ATOM 300   N NH1 . ARG A 1 43  ? 19.786  27.128  14.859  1.00 80.36 ? 43  ARG A NH1 1 
ATOM 301   N NH2 . ARG A 1 43  ? 18.143  25.543  15.207  1.00 80.36 ? 43  ARG A NH2 1 
ATOM 302   N N   . LEU A 1 44  ? 17.551  33.926  18.868  1.00 49.44 ? 44  LEU A N   1 
ATOM 303   C CA  . LEU A 1 44  ? 18.066  35.255  19.148  1.00 49.44 ? 44  LEU A CA  1 
ATOM 304   C C   . LEU A 1 44  ? 17.717  35.693  20.565  1.00 49.44 ? 44  LEU A C   1 
ATOM 305   O O   . LEU A 1 44  ? 18.536  36.313  21.242  1.00 49.44 ? 44  LEU A O   1 
ATOM 306   C CB  . LEU A 1 44  ? 17.524  36.268  18.141  1.00 29.02 ? 44  LEU A CB  1 
ATOM 307   C CG  . LEU A 1 44  ? 18.182  36.147  16.774  1.00 29.02 ? 44  LEU A CG  1 
ATOM 308   C CD1 . LEU A 1 44  ? 17.663  37.236  15.865  1.00 29.02 ? 44  LEU A CD1 1 
ATOM 309   C CD2 . LEU A 1 44  ? 19.693  36.250  16.929  1.00 29.02 ? 44  LEU A CD2 1 
ATOM 310   N N   . SER A 1 45  ? 16.513  35.361  21.020  1.00 54.79 ? 45  SER A N   1 
ATOM 311   C CA  . SER A 1 45  ? 16.090  35.743  22.362  1.00 54.79 ? 45  SER A CA  1 
ATOM 312   C C   . SER A 1 45  ? 17.055  35.218  23.426  1.00 54.79 ? 45  SER A C   1 
ATOM 313   O O   . SER A 1 45  ? 17.348  35.913  24.398  1.00 54.79 ? 45  SER A O   1 
ATOM 314   C CB  . SER A 1 45  ? 14.684  35.215  22.661  1.00 66.02 ? 45  SER A CB  1 
ATOM 315   O OG  . SER A 1 45  ? 14.725  33.886  23.156  1.00 66.02 ? 45  SER A OG  1 
ATOM 316   N N   . GLN A 1 46  ? 17.551  33.997  23.244  1.00 57.46 ? 46  GLN A N   1 
ATOM 317   C CA  . GLN A 1 46  ? 18.465  33.406  24.212  1.00 57.46 ? 46  GLN A CA  1 
ATOM 318   C C   . GLN A 1 46  ? 19.745  34.208  24.419  1.00 57.46 ? 46  GLN A C   1 
ATOM 319   O O   . GLN A 1 46  ? 20.419  34.041  25.438  1.00 57.46 ? 46  GLN A O   1 
ATOM 320   C CB  . GLN A 1 46  ? 18.835  31.995  23.794  1.00 91.65 ? 46  GLN A CB  1 
ATOM 321   C CG  . GLN A 1 46  ? 17.655  31.092  23.600  1.00 91.65 ? 46  GLN A CG  1 
ATOM 322   C CD  . GLN A 1 46  ? 18.087  29.665  23.383  1.00 91.65 ? 46  GLN A CD  1 
ATOM 323   O OE1 . GLN A 1 46  ? 18.526  28.988  24.317  1.00 91.65 ? 46  GLN A OE1 1 
ATOM 324   N NE2 . GLN A 1 46  ? 17.987  29.198  22.142  1.00 91.65 ? 46  GLN A NE2 1 
ATOM 325   N N   . ILE A 1 47  ? 20.086  35.069  23.462  1.00 54.21 ? 47  ILE A N   1 
ATOM 326   C CA  . ILE A 1 47  ? 21.293  35.888  23.566  1.00 54.21 ? 47  ILE A CA  1 
ATOM 327   C C   . ILE A 1 47  ? 20.933  37.372  23.544  1.00 54.21 ? 47  ILE A C   1 
ATOM 328   O O   . ILE A 1 47  ? 21.776  38.222  23.237  1.00 54.21 ? 47  ILE A O   1 
ATOM 329   C CB  . ILE A 1 47  ? 22.261  35.607  22.393  1.00 40.32 ? 47  ILE A CB  1 
ATOM 330   C CG1 . ILE A 1 47  ? 21.640  36.055  21.071  1.00 40.32 ? 47  ILE A CG1 1 
ATOM 331   C CG2 . ILE A 1 47  ? 22.554  34.133  22.312  1.00 40.32 ? 47  ILE A CG2 1 
ATOM 332   C CD1 . ILE A 1 47  ? 22.553  35.886  19.881  1.00 40.32 ? 47  ILE A CD1 1 
ATOM 333   N N   . GLY A 1 48  ? 19.685  37.679  23.896  1.00 72.56 ? 48  GLY A N   1 
ATOM 334   C CA  . GLY A 1 48  ? 19.215  39.055  23.856  1.00 72.56 ? 48  GLY A CA  1 
ATOM 335   C C   . GLY A 1 48  ? 18.785  39.247  22.411  1.00 72.56 ? 48  GLY A C   1 
ATOM 336   O O   . GLY A 1 48  ? 17.908  38.528  21.921  1.00 72.56 ? 48  GLY A O   1 
ATOM 337   N N   . VAL A 1 49  ? 19.391  40.205  21.721  1.00 57.74 ? 49  VAL A N   1 
ATOM 338   C CA  . VAL A 1 49  ? 19.102  40.441  20.304  1.00 57.74 ? 49  VAL A CA  1 
ATOM 339   C C   . VAL A 1 49  ? 17.628  40.435  19.857  1.00 57.74 ? 49  VAL A C   1 
ATOM 340   O O   . VAL A 1 49  ? 16.967  39.384  19.839  1.00 57.74 ? 49  VAL A O   1 
ATOM 341   C CB  . VAL A 1 49  ? 19.851  39.404  19.428  1.00 47.32 ? 49  VAL A CB  1 
ATOM 342   C CG1 . VAL A 1 49  ? 19.798  39.825  17.962  1.00 47.32 ? 49  VAL A CG1 1 
ATOM 343   C CG2 . VAL A 1 49  ? 21.291  39.250  19.909  1.00 47.32 ? 49  VAL A CG2 1 
ATOM 344   N N   . GLU A 1 50  ? 17.127  41.608  19.474  1.00 54.46 ? 50  GLU A N   1 
ATOM 345   C CA  . GLU A 1 50  ? 15.757  41.718  18.991  1.00 54.46 ? 50  GLU A CA  1 
ATOM 346   C C   . GLU A 1 50  ? 15.690  40.935  17.694  1.00 54.46 ? 50  GLU A C   1 
ATOM 347   O O   . GLU A 1 50  ? 16.650  40.927  16.924  1.00 54.46 ? 50  GLU A O   1 
ATOM 348   C CB  . GLU A 1 50  ? 15.397  43.180  18.725  1.00 99.51 ? 50  GLU A CB  1 
ATOM 349   C CG  . GLU A 1 50  ? 14.442  43.756  19.740  1.00 99.51 ? 50  GLU A CG  1 
ATOM 350   C CD  . GLU A 1 50  ? 14.812  43.360  21.160  1.00 99.51 ? 50  GLU A CD  1 
ATOM 351   O OE1 . GLU A 1 50  ? 15.940  43.683  21.604  1.00 99.51 ? 50  GLU A OE1 1 
ATOM 352   O OE2 . GLU A 1 50  ? 13.973  42.717  21.830  1.00 99.51 ? 50  GLU A OE2 1 
ATOM 353   N N   . ASN A 1 51  ? 14.566  40.273  17.446  1.00 50.70 ? 51  ASN A N   1 
ATOM 354   C CA  . ASN A 1 51  ? 14.430  39.496  16.224  1.00 50.70 ? 51  ASN A CA  1 
ATOM 355   C C   . ASN A 1 51  ? 14.023  40.371  15.034  1.00 50.70 ? 51  ASN A C   1 
ATOM 356   O O   . ASN A 1 51  ? 12.875  40.351  14.598  1.00 50.70 ? 51  ASN A O   1 
ATOM 357   C CB  . ASN A 1 51  ? 13.423  38.366  16.442  1.00 47.84 ? 51  ASN A CB  1 
ATOM 358   C CG  . ASN A 1 51  ? 13.396  37.379  15.292  1.00 47.84 ? 51  ASN A CG  1 
ATOM 359   O OD1 . ASN A 1 51  ? 14.416  37.120  14.655  1.00 47.84 ? 51  ASN A OD1 1 
ATOM 360   N ND2 . ASN A 1 51  ? 12.229  36.810  15.030  1.00 47.84 ? 51  ASN A ND2 1 
ATOM 361   N N   . THR A 1 52  ? 14.984  41.142  14.525  1.00 48.74 ? 52  THR A N   1 
ATOM 362   C CA  . THR A 1 52  ? 14.789  42.039  13.381  1.00 48.74 ? 52  THR A CA  1 
ATOM 363   C C   . THR A 1 52  ? 15.264  41.339  12.119  1.00 48.74 ? 52  THR A C   1 
ATOM 364   O O   . THR A 1 52  ? 15.932  40.311  12.193  1.00 48.74 ? 52  THR A O   1 
ATOM 365   C CB  . THR A 1 52  ? 15.663  43.296  13.505  1.00 52.73 ? 52  THR A CB  1 
ATOM 366   O OG1 . THR A 1 52  ? 15.433  43.911  14.770  1.00 52.73 ? 52  THR A OG1 1 
ATOM 367   C CG2 . THR A 1 52  ? 15.355  44.291  12.384  1.00 52.73 ? 52  THR A CG2 1 
ATOM 368   N N   . GLU A 1 53  ? 14.928  41.888  10.959  1.00 55.43 ? 53  GLU A N   1 
ATOM 369   C CA  . GLU A 1 53  ? 15.416  41.298  9.728   1.00 55.43 ? 53  GLU A CA  1 
ATOM 370   C C   . GLU A 1 53  ? 16.892  41.621  9.716   1.00 55.43 ? 53  GLU A C   1 
ATOM 371   O O   . GLU A 1 53  ? 17.716  40.816  9.286   1.00 55.43 ? 53  GLU A O   1 
ATOM 372   C CB  . GLU A 1 53  ? 14.750  41.925  8.519   1.00 98.82 ? 53  GLU A CB  1 
ATOM 373   C CG  . GLU A 1 53  ? 13.371  41.372  8.273   1.00 98.82 ? 53  GLU A CG  1 
ATOM 374   C CD  . GLU A 1 53  ? 12.547  42.252  7.350   1.00 98.82 ? 53  GLU A CD  1 
ATOM 375   O OE1 . GLU A 1 53  ? 13.087  42.647  6.279   1.00 98.82 ? 53  GLU A OE1 1 
ATOM 376   O OE2 . GLU A 1 53  ? 11.366  42.536  7.702   1.00 98.82 ? 53  GLU A OE2 1 
ATOM 377   N N   . GLU A 1 54  ? 17.221  42.805  10.215  1.00 48.98 ? 54  GLU A N   1 
ATOM 378   C CA  . GLU A 1 54  ? 18.606  43.231  10.261  1.00 48.98 ? 54  GLU A CA  1 
ATOM 379   C C   . GLU A 1 54  ? 19.431  42.350  11.183  1.00 48.98 ? 54  GLU A C   1 
ATOM 380   O O   . GLU A 1 54  ? 20.469  41.826  10.781  1.00 48.98 ? 54  GLU A O   1 
ATOM 381   C CB  . GLU A 1 54  ? 18.698  44.684  10.710  1.00 54.59 ? 54  GLU A CB  1 
ATOM 382   C CG  . GLU A 1 54  ? 19.306  45.588  9.655   1.00 54.59 ? 54  GLU A CG  1 
ATOM 383   C CD  . GLU A 1 54  ? 20.746  45.233  9.344   1.00 54.59 ? 54  GLU A CD  1 
ATOM 384   O OE1 . GLU A 1 54  ? 21.319  45.824  8.405   1.00 54.59 ? 54  GLU A OE1 1 
ATOM 385   O OE2 . GLU A 1 54  ? 21.307  44.366  10.043  1.00 54.59 ? 54  GLU A OE2 1 
ATOM 386   N N   . ASN A 1 55  ? 18.978  42.177  12.417  1.00 45.30 ? 55  ASN A N   1 
ATOM 387   C CA  . ASN A 1 55  ? 19.727  41.341  13.342  1.00 45.30 ? 55  ASN A CA  1 
ATOM 388   C C   . ASN A 1 55  ? 19.957  39.950  12.782  1.00 45.30 ? 55  ASN A C   1 
ATOM 389   O O   . ASN A 1 55  ? 20.962  39.306  13.093  1.00 45.30 ? 55  ASN A O   1 
ATOM 390   C CB  . ASN A 1 55  ? 19.017  41.244  14.685  1.00 51.98 ? 55  ASN A CB  1 
ATOM 391   C CG  . ASN A 1 55  ? 19.105  42.524  15.463  1.00 51.98 ? 55  ASN A CG  1 
ATOM 392   O OD1 . ASN A 1 55  ? 20.086  43.260  15.345  1.00 51.98 ? 55  ASN A OD1 1 
ATOM 393   N ND2 . ASN A 1 55  ? 18.094  42.799  16.275  1.00 51.98 ? 55  ASN A ND2 1 
ATOM 394   N N   . ARG A 1 56  ? 19.025  39.481  11.959  1.00 32.51 ? 56  ARG A N   1 
ATOM 395   C CA  . ARG A 1 56  ? 19.173  38.167  11.354  1.00 32.51 ? 56  ARG A CA  1 
ATOM 396   C C   . ARG A 1 56  ? 20.237  38.262  10.267  1.00 32.51 ? 56  ARG A C   1 
ATOM 397   O O   . ARG A 1 56  ? 21.153  37.447  10.216  1.00 32.51 ? 56  ARG A O   1 
ATOM 398   C CB  . ARG A 1 56  ? 17.846  37.682  10.766  1.00 38.78 ? 56  ARG A CB  1 
ATOM 399   C CG  . ARG A 1 56  ? 16.842  37.192  11.806  1.00 38.78 ? 56  ARG A CG  1 
ATOM 400   C CD  . ARG A 1 56  ? 15.712  36.408  11.141  1.00 38.78 ? 56  ARG A CD  1 
ATOM 401   N NE  . ARG A 1 56  ? 14.854  37.250  10.310  1.00 38.78 ? 56  ARG A NE  1 
ATOM 402   C CZ  . ARG A 1 56  ? 13.855  37.991  10.784  1.00 38.78 ? 56  ARG A CZ  1 
ATOM 403   N NH1 . ARG A 1 56  ? 13.584  37.991  12.085  1.00 38.78 ? 56  ARG A NH1 1 
ATOM 404   N NH2 . ARG A 1 56  ? 13.128  38.736  9.961   1.00 38.78 ? 56  ARG A NH2 1 
ATOM 405   N N   . ARG A 1 57  ? 20.128  39.271  9.410   1.00 45.29 ? 57  ARG A N   1 
ATOM 406   C CA  . ARG A 1 57  ? 21.106  39.455  8.347   1.00 45.29 ? 57  ARG A CA  1 
ATOM 407   C C   . ARG A 1 57  ? 22.494  39.530  8.976   1.00 45.29 ? 57  ARG A C   1 
ATOM 408   O O   . ARG A 1 57  ? 23.446  38.913  8.496   1.00 45.29 ? 57  ARG A O   1 
ATOM 409   C CB  . ARG A 1 57  ? 20.830  40.748  7.589   1.00 38.75 ? 57  ARG A CB  1 
ATOM 410   C CG  . ARG A 1 57  ? 21.707  40.945  6.369   1.00 38.75 ? 57  ARG A CG  1 
ATOM 411   C CD  . ARG A 1 57  ? 21.626  42.382  5.900   1.00 38.75 ? 57  ARG A CD  1 
ATOM 412   N NE  . ARG A 1 57  ? 22.144  43.282  6.922   1.00 38.75 ? 57  ARG A NE  1 
ATOM 413   C CZ  . ARG A 1 57  ? 23.432  43.577  7.070   1.00 38.75 ? 57  ARG A CZ  1 
ATOM 414   N NH1 . ARG A 1 57  ? 24.339  43.052  6.251   1.00 38.75 ? 57  ARG A NH1 1 
ATOM 415   N NH2 . ARG A 1 57  ? 23.818  44.380  8.053   1.00 38.75 ? 57  ARG A NH2 1 
ATOM 416   N N   . LEU A 1 58  ? 22.597  40.291  10.060  1.00 36.95 ? 58  LEU A N   1 
ATOM 417   C CA  . LEU A 1 58  ? 23.862  40.451  10.760  1.00 36.95 ? 58  LEU A CA  1 
ATOM 418   C C   . LEU A 1 58  ? 24.410  39.111  11.197  1.00 36.95 ? 58  LEU A C   1 
ATOM 419   O O   . LEU A 1 58  ? 25.567  38.786  10.922  1.00 36.95 ? 58  LEU A O   1 
ATOM 420   C CB  . LEU A 1 58  ? 23.683  41.345  11.984  1.00 28.18 ? 58  LEU A CB  1 
ATOM 421   C CG  . LEU A 1 58  ? 23.375  42.810  11.672  1.00 28.18 ? 58  LEU A CG  1 
ATOM 422   C CD1 . LEU A 1 58  ? 23.062  43.554  12.957  1.00 28.18 ? 58  LEU A CD1 1 
ATOM 423   C CD2 . LEU A 1 58  ? 24.558  43.433  10.943  1.00 28.18 ? 58  LEU A CD2 1 
ATOM 424   N N   . TYR A 1 59  ? 23.581  38.333  11.881  1.00 36.09 ? 59  TYR A N   1 
ATOM 425   C CA  . TYR A 1 59  ? 24.019  37.028  12.346  1.00 36.09 ? 59  TYR A CA  1 
ATOM 426   C C   . TYR A 1 59  ? 24.394  36.086  11.205  1.00 36.09 ? 59  TYR A C   1 
ATOM 427   O O   . TYR A 1 59  ? 25.432  35.433  11.264  1.00 36.09 ? 59  TYR A O   1 
ATOM 428   C CB  . TYR A 1 59  ? 22.952  36.368  13.214  1.00 39.21 ? 59  TYR A CB  1 
ATOM 429   C CG  . TYR A 1 59  ? 23.320  34.952  13.577  1.00 39.21 ? 59  TYR A CG  1 
ATOM 430   C CD1 . TYR A 1 59  ? 24.509  34.675  14.242  1.00 39.21 ? 59  TYR A CD1 1 
ATOM 431   C CD2 . TYR A 1 59  ? 22.508  33.883  13.212  1.00 39.21 ? 59  TYR A CD2 1 
ATOM 432   C CE1 . TYR A 1 59  ? 24.882  33.368  14.530  1.00 39.21 ? 59  TYR A CE1 1 
ATOM 433   C CE2 . TYR A 1 59  ? 22.873  32.570  13.497  1.00 39.21 ? 59  TYR A CE2 1 
ATOM 434   C CZ  . TYR A 1 59  ? 24.060  32.323  14.154  1.00 39.21 ? 59  TYR A CZ  1 
ATOM 435   O OH  . TYR A 1 59  ? 24.429  31.033  14.431  1.00 39.21 ? 59  TYR A OH  1 
ATOM 436   N N   . ARG A 1 60  ? 23.559  36.004  10.173  1.00 48.69 ? 60  ARG A N   1 
ATOM 437   C CA  . ARG A 1 60  ? 23.863  35.123  9.047   1.00 48.69 ? 60  ARG A CA  1 
ATOM 438   C C   . ARG A 1 60  ? 25.202  35.538  8.454   1.00 48.69 ? 60  ARG A C   1 
ATOM 439   O O   . ARG A 1 60  ? 25.960  34.711  7.936   1.00 48.69 ? 60  ARG A O   1 
ATOM 440   C CB  . ARG A 1 60  ? 22.800  35.230  7.955   1.00 46.85 ? 60  ARG A CB  1 
ATOM 441   C CG  . ARG A 1 60  ? 21.368  35.066  8.414   1.00 46.85 ? 60  ARG A CG  1 
ATOM 442   C CD  . ARG A 1 60  ? 21.052  33.683  8.945   1.00 46.85 ? 60  ARG A CD  1 
ATOM 443   N NE  . ARG A 1 60  ? 19.602  33.506  8.990   1.00 46.85 ? 60  ARG A NE  1 
ATOM 444   C CZ  . ARG A 1 60  ? 18.990  32.451  9.512   1.00 46.85 ? 60  ARG A CZ  1 
ATOM 445   N NH1 . ARG A 1 60  ? 19.705  31.465  10.044  1.00 46.85 ? 60  ARG A NH1 1 
ATOM 446   N NH2 . ARG A 1 60  ? 17.665  32.381  9.491   1.00 46.85 ? 60  ARG A NH2 1 
ATOM 447   N N   . GLN A 1 61  ? 25.479  36.834  8.525   1.00 48.41 ? 61  GLN A N   1 
ATOM 448   C CA  . GLN A 1 61  ? 26.719  37.375  8.002   1.00 48.41 ? 61  GLN A CA  1 
ATOM 449   C C   . GLN A 1 61  ? 27.889  36.795  8.782   1.00 48.41 ? 61  GLN A C   1 
ATOM 450   O O   . GLN A 1 61  ? 28.910  36.428  8.203   1.00 48.41 ? 61  GLN A O   1 
ATOM 451   C CB  . GLN A 1 61  ? 26.702  38.889  8.123   1.00 37.76 ? 61  GLN A CB  1 
ATOM 452   C CG  . GLN A 1 61  ? 27.855  39.579  7.443   1.00 37.76 ? 61  GLN A CG  1 
ATOM 453   C CD  . GLN A 1 61  ? 27.721  41.087  7.516   1.00 37.76 ? 61  GLN A CD  1 
ATOM 454   O OE1 . GLN A 1 61  ? 27.553  41.652  8.604   1.00 37.76 ? 61  GLN A OE1 1 
ATOM 455   N NE2 . GLN A 1 61  ? 27.786  41.750  6.361   1.00 37.76 ? 61  GLN A NE2 1 
ATOM 456   N N   . VAL A 1 62  ? 27.735  36.710  10.098  1.00 36.58 ? 62  VAL A N   1 
ATOM 457   C CA  . VAL A 1 62  ? 28.777  36.148  10.944  1.00 36.58 ? 62  VAL A CA  1 
ATOM 458   C C   . VAL A 1 62  ? 29.179  34.778  10.422  1.00 36.58 ? 62  VAL A C   1 
ATOM 459   O O   . VAL A 1 62  ? 30.350  34.421  10.443  1.00 36.58 ? 62  VAL A O   1 
ATOM 460   C CB  . VAL A 1 62  ? 28.299  35.960  12.393  1.00 25.14 ? 62  VAL A CB  1 
ATOM 461   C CG1 . VAL A 1 62  ? 29.368  35.250  13.201  1.00 25.14 ? 62  VAL A CG1 1 
ATOM 462   C CG2 . VAL A 1 62  ? 27.968  37.307  13.011  1.00 25.14 ? 62  VAL A CG2 1 
ATOM 463   N N   . LEU A 1 63  ? 28.199  34.009  9.960   1.00 31.55 ? 63  LEU A N   1 
ATOM 464   C CA  . LEU A 1 63  ? 28.466  32.674  9.444   1.00 31.55 ? 63  LEU A CA  1 
ATOM 465   C C   . LEU A 1 63  ? 29.075  32.710  8.052   1.00 31.55 ? 63  LEU A C   1 
ATOM 466   O O   . LEU A 1 63  ? 30.136  32.134  7.825   1.00 31.55 ? 63  LEU A O   1 
ATOM 467   C CB  . LEU A 1 63  ? 27.178  31.845  9.413   1.00 27.54 ? 63  LEU A CB  1 
ATOM 468   C CG  . LEU A 1 63  ? 26.460  31.667  10.753  1.00 27.54 ? 63  LEU A CG  1 
ATOM 469   C CD1 . LEU A 1 63  ? 25.261  30.764  10.569  1.00 27.54 ? 63  LEU A CD1 1 
ATOM 470   C CD2 . LEU A 1 63  ? 27.402  31.061  11.771  1.00 27.54 ? 63  LEU A CD2 1 
ATOM 471   N N   . PHE A 1 64  ? 28.414  33.407  7.132   1.00 33.03 ? 64  PHE A N   1 
ATOM 472   C CA  . PHE A 1 64  ? 28.872  33.481  5.749   1.00 33.03 ? 64  PHE A CA  1 
ATOM 473   C C   . PHE A 1 64  ? 30.174  34.215  5.507   1.00 33.03 ? 64  PHE A C   1 
ATOM 474   O O   . PHE A 1 64  ? 30.765  34.116  4.425   1.00 33.03 ? 64  PHE A O   1 
ATOM 475   C CB  . PHE A 1 64  ? 27.784  34.092  4.871   1.00 32.15 ? 64  PHE A CB  1 
ATOM 476   C CG  . PHE A 1 64  ? 26.472  33.390  4.982   1.00 32.15 ? 64  PHE A CG  1 
ATOM 477   C CD1 . PHE A 1 64  ? 26.422  32.035  5.298   1.00 32.15 ? 64  PHE A CD1 1 
ATOM 478   C CD2 . PHE A 1 64  ? 25.286  34.076  4.784   1.00 32.15 ? 64  PHE A CD2 1 
ATOM 479   C CE1 . PHE A 1 64  ? 25.214  31.374  5.420   1.00 32.15 ? 64  PHE A CE1 1 
ATOM 480   C CE2 . PHE A 1 64  ? 24.071  33.423  4.902   1.00 32.15 ? 64  PHE A CE2 1 
ATOM 481   C CZ  . PHE A 1 64  ? 24.037  32.068  5.223   1.00 32.15 ? 64  PHE A CZ  1 
ATOM 482   N N   . SER A 1 65  ? 30.632  34.956  6.502   1.00 47.92 ? 65  SER A N   1 
ATOM 483   C CA  . SER A 1 65  ? 31.875  35.679  6.335   1.00 47.92 ? 65  SER A CA  1 
ATOM 484   C C   . SER A 1 65  ? 33.065  34.806  6.716   1.00 47.92 ? 65  SER A C   1 
ATOM 485   O O   . SER A 1 65  ? 34.196  35.278  6.728   1.00 47.92 ? 65  SER A O   1 
ATOM 486   C CB  . SER A 1 65  ? 31.852  36.961  7.165   1.00 46.93 ? 65  SER A CB  1 
ATOM 487   O OG  . SER A 1 65  ? 31.486  36.685  8.503   1.00 46.93 ? 65  SER A OG  1 
ATOM 488   N N   . ALA A 1 66  ? 32.814  33.535  7.026   1.00 40.81 ? 66  ALA A N   1 
ATOM 489   C CA  . ALA A 1 66  ? 33.898  32.622  7.382   1.00 40.81 ? 66  ALA A CA  1 
ATOM 490   C C   . ALA A 1 66  ? 34.883  32.600  6.214   1.00 40.81 ? 66  ALA A C   1 
ATOM 491   O O   . ALA A 1 66  ? 34.482  32.747  5.055   1.00 40.81 ? 66  ALA A O   1 
ATOM 492   C CB  . ALA A 1 66  ? 33.355  31.220  7.639   1.00 39.17 ? 66  ALA A CB  1 
ATOM 493   N N   . ASP A 1 67  ? 36.166  32.423  6.520   1.00 51.08 ? 67  ASP A N   1 
ATOM 494   C CA  . ASP A 1 67  ? 37.205  32.404  5.491   1.00 51.08 ? 67  ASP A CA  1 
ATOM 495   C C   . ASP A 1 67  ? 37.299  31.073  4.742   1.00 51.08 ? 67  ASP A C   1 
ATOM 496   O O   . ASP A 1 67  ? 36.450  30.192  4.901   1.00 51.08 ? 67  ASP A O   1 
ATOM 497   C CB  . ASP A 1 67  ? 38.566  32.754  6.111   1.00 45.68 ? 67  ASP A CB  1 
ATOM 498   C CG  . ASP A 1 67  ? 39.048  31.705  7.099   1.00 45.68 ? 67  ASP A CG  1 
ATOM 499   O OD1 . ASP A 1 67  ? 39.418  32.071  8.241   1.00 45.68 ? 67  ASP A OD1 1 
ATOM 500   O OD2 . ASP A 1 67  ? 39.058  30.510  6.723   1.00 45.68 ? 67  ASP A OD2 1 
ATOM 501   N N   . ASP A 1 68  ? 38.352  30.933  3.942   1.00 45.23 ? 68  ASP A N   1 
ATOM 502   C CA  . ASP A 1 68  ? 38.571  29.741  3.125   1.00 45.23 ? 68  ASP A CA  1 
ATOM 503   C C   . ASP A 1 68  ? 38.760  28.383  3.788   1.00 45.23 ? 68  ASP A C   1 
ATOM 504   O O   . ASP A 1 68  ? 38.659  27.358  3.112   1.00 45.23 ? 68  ASP A O   1 
ATOM 505   C CB  . ASP A 1 68  ? 39.743  29.978  2.173   1.00 69.35 ? 68  ASP A CB  1 
ATOM 506   C CG  . ASP A 1 68  ? 39.333  30.727  0.923   1.00 69.35 ? 68  ASP A CG  1 
ATOM 507   O OD1 . ASP A 1 68  ? 40.215  30.993  0.078   1.00 69.35 ? 68  ASP A OD1 1 
ATOM 508   O OD2 . ASP A 1 68  ? 38.131  31.045  0.780   1.00 69.35 ? 68  ASP A OD2 1 
ATOM 509   N N   . ARG A 1 69  ? 39.036  28.332  5.084   1.00 48.85 ? 69  ARG A N   1 
ATOM 510   C CA  . ARG A 1 69  ? 39.221  27.015  5.677   1.00 48.85 ? 69  ARG A CA  1 
ATOM 511   C C   . ARG A 1 69  ? 37.886  26.325  5.836   1.00 48.85 ? 69  ARG A C   1 
ATOM 512   O O   . ARG A 1 69  ? 37.818  25.151  6.201   1.00 48.85 ? 69  ARG A O   1 
ATOM 513   C CB  . ARG A 1 69  ? 39.955  27.102  7.018   1.00 25.17 ? 69  ARG A CB  1 
ATOM 514   C CG  . ARG A 1 69  ? 39.404  28.103  7.979   1.00 25.17 ? 69  ARG A CG  1 
ATOM 515   C CD  . ARG A 1 69  ? 40.417  28.420  9.056   1.00 25.17 ? 69  ARG A CD  1 
ATOM 516   N NE  . ARG A 1 69  ? 40.180  29.768  9.548   1.00 25.17 ? 69  ARG A NE  1 
ATOM 517   C CZ  . ARG A 1 69  ? 39.985  30.079  10.823  1.00 25.17 ? 69  ARG A CZ  1 
ATOM 518   N NH1 . ARG A 1 69  ? 40.006  29.124  11.756  1.00 25.17 ? 69  ARG A NH1 1 
ATOM 519   N NH2 . ARG A 1 69  ? 39.752  31.343  11.161  1.00 25.17 ? 69  ARG A NH2 1 
ATOM 520   N N   . VAL A 1 70  ? 36.823  27.061  5.533   1.00 35.00 ? 70  VAL A N   1 
ATOM 521   C CA  . VAL A 1 70  ? 35.471  26.531  5.622   1.00 35.00 ? 70  VAL A CA  1 
ATOM 522   C C   . VAL A 1 70  ? 35.198  25.715  4.361   1.00 35.00 ? 70  VAL A C   1 
ATOM 523   O O   . VAL A 1 70  ? 34.286  24.900  4.330   1.00 35.00 ? 70  VAL A O   1 
ATOM 524   C CB  . VAL A 1 70  ? 34.449  27.682  5.740   1.00 17.57 ? 70  VAL A CB  1 
ATOM 525   C CG1 . VAL A 1 70  ? 33.866  28.016  4.372   1.00 17.57 ? 70  VAL A CG1 1 
ATOM 526   C CG2 . VAL A 1 70  ? 33.386  27.325  6.749   1.00 17.57 ? 70  VAL A CG2 1 
ATOM 527   N N   . LYS A 1 71  ? 36.015  25.944  3.333   1.00 33.29 ? 71  LYS A N   1 
ATOM 528   C CA  . LYS A 1 71  ? 35.906  25.255  2.044   1.00 33.29 ? 71  LYS A CA  1 
ATOM 529   C C   . LYS A 1 71  ? 36.187  23.761  2.101   1.00 33.29 ? 71  LYS A C   1 
ATOM 530   O O   . LYS A 1 71  ? 35.640  22.996  1.315   1.00 33.29 ? 71  LYS A O   1 
ATOM 531   C CB  . LYS A 1 71  ? 36.862  25.871  1.015   1.00 34.68 ? 71  LYS A CB  1 
ATOM 532   C CG  . LYS A 1 71  ? 36.508  27.283  0.588   1.00 34.68 ? 71  LYS A CG  1 
ATOM 533   C CD  . LYS A 1 71  ? 37.580  27.908  -0.308  1.00 34.68 ? 71  LYS A CD  1 
ATOM 534   C CE  . LYS A 1 71  ? 37.635  27.258  -1.685  1.00 34.68 ? 71  LYS A CE  1 
ATOM 535   N NZ  . LYS A 1 71  ? 38.599  27.950  -2.607  1.00 34.68 ? 71  LYS A NZ  1 
ATOM 536   N N   . LYS A 1 72  ? 37.047  23.338  3.016   1.00 33.75 ? 72  LYS A N   1 
ATOM 537   C CA  . LYS A 1 72  ? 37.379  21.924  3.109   1.00 33.75 ? 72  LYS A CA  1 
ATOM 538   C C   . LYS A 1 72  ? 36.322  21.092  3.829   1.00 33.75 ? 72  LYS A C   1 
ATOM 539   O O   . LYS A 1 72  ? 36.205  19.886  3.586   1.00 33.75 ? 72  LYS A O   1 
ATOM 540   C CB  . LYS A 1 72  ? 38.727  21.742  3.813   1.00 34.86 ? 72  LYS A CB  1 
ATOM 541   C CG  . LYS A 1 72  ? 38.780  22.353  5.197   1.00 34.86 ? 72  LYS A CG  1 
ATOM 542   C CD  . LYS A 1 72  ? 39.995  21.883  5.976   1.00 34.86 ? 72  LYS A CD  1 
ATOM 543   C CE  . LYS A 1 72  ? 40.063  22.557  7.339   1.00 34.86 ? 72  LYS A CE  1 
ATOM 544   N NZ  . LYS A 1 72  ? 40.158  24.039  7.209   1.00 34.86 ? 72  LYS A NZ  1 
ATOM 545   N N   . CYS A 1 73  ? 35.547  21.730  4.704   1.00 34.08 ? 73  CYS A N   1 
ATOM 546   C CA  . CYS A 1 73  ? 34.538  21.005  5.469   1.00 34.08 ? 73  CYS A CA  1 
ATOM 547   C C   . CYS A 1 73  ? 33.073  21.329  5.168   1.00 34.08 ? 73  CYS A C   1 
ATOM 548   O O   . CYS A 1 73  ? 32.174  20.645  5.659   1.00 34.08 ? 73  CYS A O   1 
ATOM 549   C CB  . CYS A 1 73  ? 34.813  21.194  6.963   1.00 40.22 ? 73  CYS A CB  1 
ATOM 550   S SG  . CYS A 1 73  ? 35.117  22.912  7.425   1.00 40.22 ? 73  CYS A SG  1 
ATOM 551   N N   . ILE A 1 74  ? 32.820  22.359  4.372   1.00 28.57 ? 74  ILE A N   1 
ATOM 552   C CA  . ILE A 1 74  ? 31.445  22.713  4.050   1.00 28.57 ? 74  ILE A CA  1 
ATOM 553   C C   . ILE A 1 74  ? 31.152  22.548  2.568   1.00 28.57 ? 74  ILE A C   1 
ATOM 554   O O   . ILE A 1 74  ? 31.621  23.337  1.741   1.00 28.57 ? 74  ILE A O   1 
ATOM 555   C CB  . ILE A 1 74  ? 31.138  24.160  4.436   1.00 19.31 ? 74  ILE A CB  1 
ATOM 556   C CG1 . ILE A 1 74  ? 31.347  24.358  5.938   1.00 19.31 ? 74  ILE A CG1 1 
ATOM 557   C CG2 . ILE A 1 74  ? 29.719  24.503  4.037   1.00 19.31 ? 74  ILE A CG2 1 
ATOM 558   C CD1 . ILE A 1 74  ? 30.441  23.529  6.808   1.00 19.31 ? 74  ILE A CD1 1 
ATOM 559   N N   . GLY A 1 75  ? 30.367  21.527  2.237   1.00 30.46 ? 75  GLY A N   1 
ATOM 560   C CA  . GLY A 1 75  ? 30.020  21.280  0.849   1.00 30.46 ? 75  GLY A CA  1 
ATOM 561   C C   . GLY A 1 75  ? 28.823  22.096  0.391   1.00 30.46 ? 75  GLY A C   1 
ATOM 562   O O   . GLY A 1 75  ? 28.682  22.401  -0.800  1.00 30.46 ? 75  GLY A O   1 
ATOM 563   N N   . GLY A 1 76  ? 27.961  22.456  1.340   1.00 28.63 ? 76  GLY A N   1 
ATOM 564   C CA  . GLY A 1 76  ? 26.780  23.235  1.006   1.00 28.63 ? 76  GLY A CA  1 
ATOM 565   C C   . GLY A 1 76  ? 26.181  24.000  2.175   1.00 28.63 ? 76  GLY A C   1 
ATOM 566   O O   . GLY A 1 76  ? 26.415  23.681  3.347   1.00 28.63 ? 76  GLY A O   1 
ATOM 567   N N   . VAL A 1 77  ? 25.396  25.020  1.848   1.00 31.06 ? 77  VAL A N   1 
ATOM 568   C CA  . VAL A 1 77  ? 24.751  25.846  2.856   1.00 31.06 ? 77  VAL A CA  1 
ATOM 569   C C   . VAL A 1 77  ? 23.264  25.950  2.536   1.00 31.06 ? 77  VAL A C   1 
ATOM 570   O O   . VAL A 1 77  ? 22.889  26.316  1.424   1.00 31.06 ? 77  VAL A O   1 
ATOM 571   C CB  . VAL A 1 77  ? 25.358  27.258  2.870   1.00 25.72 ? 77  VAL A CB  1 
ATOM 572   C CG1 . VAL A 1 77  ? 24.829  28.039  4.048   1.00 25.72 ? 77  VAL A CG1 1 
ATOM 573   C CG2 . VAL A 1 77  ? 26.867  27.166  2.926   1.00 25.72 ? 77  VAL A CG2 1 
ATOM 574   N N   . ILE A 1 78  ? 22.421  25.612  3.505   1.00 30.51 ? 78  ILE A N   1 
ATOM 575   C CA  . ILE A 1 78  ? 20.977  25.685  3.309   1.00 30.51 ? 78  ILE A CA  1 
ATOM 576   C C   . ILE A 1 78  ? 20.486  27.048  3.788   1.00 30.51 ? 78  ILE A C   1 
ATOM 577   O O   . ILE A 1 78  ? 20.604  27.375  4.971   1.00 30.51 ? 78  ILE A O   1 
ATOM 578   C CB  . ILE A 1 78  ? 20.232  24.593  4.114   1.00 24.98 ? 78  ILE A CB  1 
ATOM 579   C CG1 . ILE A 1 78  ? 20.750  23.202  3.746   1.00 24.98 ? 78  ILE A CG1 1 
ATOM 580   C CG2 . ILE A 1 78  ? 18.749  24.662  3.821   1.00 24.98 ? 78  ILE A CG2 1 
ATOM 581   C CD1 . ILE A 1 78  ? 20.172  22.093  4.612   1.00 24.98 ? 78  ILE A CD1 1 
ATOM 582   N N   . PHE A 1 79  ? 19.937  27.833  2.864   1.00 29.78 ? 79  PHE A N   1 
ATOM 583   C CA  . PHE A 1 79  ? 19.422  29.172  3.162   1.00 29.78 ? 79  PHE A CA  1 
ATOM 584   C C   . PHE A 1 79  ? 17.942  29.211  3.498   1.00 29.78 ? 79  PHE A C   1 
ATOM 585   O O   . PHE A 1 79  ? 17.166  28.369  3.055   1.00 29.78 ? 79  PHE A O   1 
ATOM 586   C CB  . PHE A 1 79  ? 19.590  30.106  1.960   1.00 41.40 ? 79  PHE A CB  1 
ATOM 587   C CG  . PHE A 1 79  ? 20.984  30.570  1.727   1.00 41.40 ? 79  PHE A CG  1 
ATOM 588   C CD1 . PHE A 1 79  ? 21.951  29.701  1.247   1.00 41.40 ? 79  PHE A CD1 1 
ATOM 589   C CD2 . PHE A 1 79  ? 21.327  31.893  1.967   1.00 41.40 ? 79  PHE A CD2 1 
ATOM 590   C CE1 . PHE A 1 79  ? 23.244  30.144  1.008   1.00 41.40 ? 79  PHE A CE1 1 
ATOM 591   C CE2 . PHE A 1 79  ? 22.615  32.345  1.733   1.00 41.40 ? 79  PHE A CE2 1 
ATOM 592   C CZ  . PHE A 1 79  ? 23.577  31.469  1.252   1.00 41.40 ? 79  PHE A CZ  1 
ATOM 593   N N   . PHE A 1 80  ? 17.553  30.207  4.278   1.00 38.85 ? 80  PHE A N   1 
ATOM 594   C CA  . PHE A 1 80  ? 16.147  30.402  4.565   1.00 38.85 ? 80  PHE A CA  1 
ATOM 595   C C   . PHE A 1 80  ? 15.785  31.438  3.501   1.00 38.85 ? 80  PHE A C   1 
ATOM 596   O O   . PHE A 1 80  ? 16.564  32.359  3.257   1.00 38.85 ? 80  PHE A O   1 
ATOM 597   C CB  . PHE A 1 80  ? 15.942  31.003  5.938   1.00 48.84 ? 80  PHE A CB  1 
ATOM 598   C CG  . PHE A 1 80  ? 14.557  31.518  6.153   1.00 48.84 ? 80  PHE A CG  1 
ATOM 599   C CD1 . PHE A 1 80  ? 13.493  30.642  6.303   1.00 48.84 ? 80  PHE A CD1 1 
ATOM 600   C CD2 . PHE A 1 80  ? 14.310  32.885  6.190   1.00 48.84 ? 80  PHE A CD2 1 
ATOM 601   C CE1 . PHE A 1 80  ? 12.195  31.122  6.489   1.00 48.84 ? 80  PHE A CE1 1 
ATOM 602   C CE2 . PHE A 1 80  ? 13.020  33.375  6.375   1.00 48.84 ? 80  PHE A CE2 1 
ATOM 603   C CZ  . PHE A 1 80  ? 11.960  32.492  6.526   1.00 48.84 ? 80  PHE A CZ  1 
ATOM 604   N N   . HIS A 1 81  ? 14.626  31.296  2.869   1.00 29.31 ? 81  HIS A N   1 
ATOM 605   C CA  . HIS A 1 81  ? 14.217  32.224  1.809   1.00 29.31 ? 81  HIS A CA  1 
ATOM 606   C C   . HIS A 1 81  ? 14.746  33.652  1.944   1.00 29.31 ? 81  HIS A C   1 
ATOM 607   O O   . HIS A 1 81  ? 15.516  34.128  1.109   1.00 29.31 ? 81  HIS A O   1 
ATOM 608   C CB  . HIS A 1 81  ? 12.699  32.297  1.709   1.00 29.23 ? 81  HIS A CB  1 
ATOM 609   C CG  . HIS A 1 81  ? 12.222  33.151  0.578   1.00 29.23 ? 81  HIS A CG  1 
ATOM 610   N ND1 . HIS A 1 81  ? 12.202  32.710  -0.727  1.00 29.23 ? 81  HIS A ND1 1 
ATOM 611   C CD2 . HIS A 1 81  ? 11.827  34.446  0.543   1.00 29.23 ? 81  HIS A CD2 1 
ATOM 612   C CE1 . HIS A 1 81  ? 11.818  33.696  -1.518  1.00 29.23 ? 81  HIS A CE1 1 
ATOM 613   N NE2 . HIS A 1 81  ? 11.585  34.761  -0.773  1.00 29.23 ? 81  HIS A NE2 1 
ATOM 614   N N   . GLU A 1 82  ? 14.284  34.336  2.984   1.00 27.19 ? 82  GLU A N   1 
ATOM 615   C CA  . GLU A 1 82  ? 14.686  35.707  3.279   1.00 27.19 ? 82  GLU A CA  1 
ATOM 616   C C   . GLU A 1 82  ? 16.178  35.887  3.026   1.00 27.19 ? 82  GLU A C   1 
ATOM 617   O O   . GLU A 1 82  ? 16.599  36.687  2.184   1.00 27.19 ? 82  GLU A O   1 
ATOM 618   C CB  . GLU A 1 82  ? 14.378  36.002  4.747   1.00 51.28 ? 82  GLU A CB  1 
ATOM 619   C CG  . GLU A 1 82  ? 14.905  37.314  5.266   1.00 51.28 ? 82  GLU A CG  1 
ATOM 620   C CD  . GLU A 1 82  ? 15.021  37.329  6.783   1.00 51.28 ? 82  GLU A CD  1 
ATOM 621   O OE1 . GLU A 1 82  ? 15.927  36.649  7.323   1.00 51.28 ? 82  GLU A OE1 1 
ATOM 622   O OE2 . GLU A 1 82  ? 14.204  38.017  7.435   1.00 51.28 ? 82  GLU A OE2 1 
ATOM 623   N N   . THR A 1 83  ? 16.963  35.111  3.767   1.00 30.66 ? 83  THR A N   1 
ATOM 624   C CA  . THR A 1 83  ? 18.415  35.132  3.700   1.00 30.66 ? 83  THR A CA  1 
ATOM 625   C C   . THR A 1 83  ? 18.999  34.981  2.289   1.00 30.66 ? 83  THR A C   1 
ATOM 626   O O   . THR A 1 83  ? 19.999  35.616  1.954   1.00 30.66 ? 83  THR A O   1 
ATOM 627   C CB  . THR A 1 83  ? 18.988  34.042  4.621   1.00 32.63 ? 83  THR A CB  1 
ATOM 628   O OG1 . THR A 1 83  ? 18.543  34.278  5.964   1.00 32.63 ? 83  THR A OG1 1 
ATOM 629   C CG2 . THR A 1 83  ? 20.499  34.062  4.593   1.00 32.63 ? 83  THR A CG2 1 
ATOM 630   N N   . LEU A 1 84  ? 18.376  34.147  1.463   1.00 25.47 ? 84  LEU A N   1 
ATOM 631   C CA  . LEU A 1 84  ? 18.845  33.917  0.095   1.00 25.47 ? 84  LEU A CA  1 
ATOM 632   C C   . LEU A 1 84  ? 18.888  35.206  -0.718  1.00 25.47 ? 84  LEU A C   1 
ATOM 633   O O   . LEU A 1 84  ? 19.451  35.247  -1.815  1.00 25.47 ? 84  LEU A O   1 
ATOM 634   C CB  . LEU A 1 84  ? 17.923  32.923  -0.611  1.00 28.75 ? 84  LEU A CB  1 
ATOM 635   C CG  . LEU A 1 84  ? 18.310  32.525  -2.031  1.00 28.75 ? 84  LEU A CG  1 
ATOM 636   C CD1 . LEU A 1 84  ? 19.498  31.591  -1.970  1.00 28.75 ? 84  LEU A CD1 1 
ATOM 637   C CD2 . LEU A 1 84  ? 17.140  31.845  -2.718  1.00 28.75 ? 84  LEU A CD2 1 
ATOM 638   N N   . TYR A 1 85  ? 18.281  36.260  -0.190  1.00 31.61 ? 85  TYR A N   1 
ATOM 639   C CA  . TYR A 1 85  ? 18.266  37.521  -0.912  1.00 31.61 ? 85  TYR A CA  1 
ATOM 640   C C   . TYR A 1 85  ? 18.885  38.670  -0.123  1.00 31.61 ? 85  TYR A C   1 
ATOM 641   O O   . TYR A 1 85  ? 18.751  39.839  -0.504  1.00 31.61 ? 85  TYR A O   1 
ATOM 642   C CB  . TYR A 1 85  ? 16.834  37.871  -1.329  1.00 31.26 ? 85  TYR A CB  1 
ATOM 643   C CG  . TYR A 1 85  ? 16.216  36.840  -2.245  1.00 31.26 ? 85  TYR A CG  1 
ATOM 644   C CD1 . TYR A 1 85  ? 15.504  35.757  -1.732  1.00 31.26 ? 85  TYR A CD1 1 
ATOM 645   C CD2 . TYR A 1 85  ? 16.417  36.899  -3.623  1.00 31.26 ? 85  TYR A CD2 1 
ATOM 646   C CE1 . TYR A 1 85  ? 15.015  34.755  -2.571  1.00 31.26 ? 85  TYR A CE1 1 
ATOM 647   C CE2 . TYR A 1 85  ? 15.932  35.904  -4.471  1.00 31.26 ? 85  TYR A CE2 1 
ATOM 648   C CZ  . TYR A 1 85  ? 15.238  34.837  -3.938  1.00 31.26 ? 85  TYR A CZ  1 
ATOM 649   O OH  . TYR A 1 85  ? 14.788  33.841  -4.766  1.00 31.26 ? 85  TYR A OH  1 
ATOM 650   N N   . GLN A 1 86  ? 19.566  38.340  0.970   1.00 41.21 ? 86  GLN A N   1 
ATOM 651   C CA  . GLN A 1 86  ? 20.210  39.363  1.779   1.00 41.21 ? 86  GLN A CA  1 
ATOM 652   C C   . GLN A 1 86  ? 21.652  39.560  1.325   1.00 41.21 ? 86  GLN A C   1 
ATOM 653   O O   . GLN A 1 86  ? 22.230  38.707  0.642   1.00 41.21 ? 86  GLN A O   1 
ATOM 654   C CB  . GLN A 1 86  ? 20.168  38.983  3.259   1.00 35.65 ? 86  GLN A CB  1 
ATOM 655   C CG  . GLN A 1 86  ? 18.764  38.850  3.795   1.00 35.65 ? 86  GLN A CG  1 
ATOM 656   C CD  . GLN A 1 86  ? 18.720  38.660  5.299   1.00 35.65 ? 86  GLN A CD  1 
ATOM 657   O OE1 . GLN A 1 86  ? 19.251  37.679  5.842   1.00 35.65 ? 86  GLN A OE1 1 
ATOM 658   N NE2 . GLN A 1 86  ? 18.074  39.597  5.987   1.00 35.65 ? 86  GLN A NE2 1 
ATOM 659   N N   . LYS A 1 87  ? 22.225  40.696  1.703   1.00 45.22 ? 87  LYS A N   1 
ATOM 660   C CA  . LYS A 1 87  ? 23.593  41.019  1.339   1.00 45.22 ? 87  LYS A CA  1 
ATOM 661   C C   . LYS A 1 87  ? 24.395  41.408  2.571   1.00 45.22 ? 87  LYS A C   1 
ATOM 662   O O   . LYS A 1 87  ? 23.824  41.800  3.594   1.00 45.22 ? 87  LYS A O   1 
ATOM 663   C CB  . LYS A 1 87  ? 23.591  42.161  0.327   1.00 46.73 ? 87  LYS A CB  1 
ATOM 664   C CG  . LYS A 1 87  ? 22.935  41.777  -0.979  1.00 46.73 ? 87  LYS A CG  1 
ATOM 665   C CD  . LYS A 1 87  ? 22.867  42.933  -1.970  1.00 46.73 ? 87  LYS A CD  1 
ATOM 666   C CE  . LYS A 1 87  ? 21.693  43.860  -1.695  1.00 46.73 ? 87  LYS A CE  1 
ATOM 667   N NZ  . LYS A 1 87  ? 21.418  44.743  -2.872  1.00 46.73 ? 87  LYS A NZ  1 
ATOM 668   N N   . ASP A 1 88  ? 25.716  41.280  2.477   1.00 59.67 ? 88  ASP A N   1 
ATOM 669   C CA  . ASP A 1 88  ? 26.594  41.641  3.584   1.00 59.67 ? 88  ASP A CA  1 
ATOM 670   C C   . ASP A 1 88  ? 26.746  43.158  3.597   1.00 59.67 ? 88  ASP A C   1 
ATOM 671   O O   . ASP A 1 88  ? 26.189  43.854  2.744   1.00 59.67 ? 88  ASP A O   1 
ATOM 672   C CB  . ASP A 1 88  ? 27.963  40.963  3.439   1.00 56.32 ? 88  ASP A CB  1 
ATOM 673   C CG  . ASP A 1 88  ? 28.717  41.409  2.199   1.00 56.32 ? 88  ASP A CG  1 
ATOM 674   O OD1 . ASP A 1 88  ? 29.739  40.772  1.873   1.00 56.32 ? 88  ASP A OD1 1 
ATOM 675   O OD2 . ASP A 1 88  ? 28.300  42.393  1.551   1.00 56.32 ? 88  ASP A OD2 1 
ATOM 676   N N   . ASP A 1 89  ? 27.505  43.672  4.553   1.00 53.28 ? 89  ASP A N   1 
ATOM 677   C CA  . ASP A 1 89  ? 27.680  45.109  4.661   1.00 53.28 ? 89  ASP A CA  1 
ATOM 678   C C   . ASP A 1 89  ? 28.331  45.762  3.451   1.00 53.28 ? 89  ASP A C   1 
ATOM 679   O O   . ASP A 1 89  ? 28.251  46.980  3.289   1.00 53.28 ? 89  ASP A O   1 
ATOM 680   C CB  . ASP A 1 89  ? 28.471  45.441  5.918   1.00 50.79 ? 89  ASP A CB  1 
ATOM 681   C CG  . ASP A 1 89  ? 27.843  44.851  7.164   1.00 50.79 ? 89  ASP A CG  1 
ATOM 682   O OD1 . ASP A 1 89  ? 26.594  44.786  7.226   1.00 50.79 ? 89  ASP A OD1 1 
ATOM 683   O OD2 . ASP A 1 89  ? 28.597  44.461  8.081   1.00 50.79 ? 89  ASP A OD2 1 
ATOM 684   N N   . ASN A 1 90  ? 28.967  44.964  2.598   1.00 49.35 ? 90  ASN A N   1 
ATOM 685   C CA  . ASN A 1 90  ? 29.616  45.508  1.408   1.00 49.35 ? 90  ASN A CA  1 
ATOM 686   C C   . ASN A 1 90  ? 28.664  45.483  0.225   1.00 49.35 ? 90  ASN A C   1 
ATOM 687   O O   . ASN A 1 90  ? 29.045  45.834  -0.896  1.00 49.35 ? 90  ASN A O   1 
ATOM 688   C CB  . ASN A 1 90  ? 30.866  44.704  1.064   1.00 75.74 ? 90  ASN A CB  1 
ATOM 689   C CG  . ASN A 1 90  ? 31.826  44.612  2.223   1.00 75.74 ? 90  ASN A CG  1 
ATOM 690   O OD1 . ASN A 1 90  ? 32.265  45.629  2.765   1.00 75.74 ? 90  ASN A OD1 1 
ATOM 691   N ND2 . ASN A 1 90  ? 32.161  43.386  2.616   1.00 75.74 ? 90  ASN A ND2 1 
ATOM 692   N N   . GLY A 1 91  ? 27.427  45.066  0.481   1.00 56.59 ? 91  GLY A N   1 
ATOM 693   C CA  . GLY A 1 91  ? 26.432  44.996  -0.574  1.00 56.59 ? 91  GLY A CA  1 
ATOM 694   C C   . GLY A 1 91  ? 26.598  43.753  -1.426  1.00 56.59 ? 91  GLY A C   1 
ATOM 695   O O   . GLY A 1 91  ? 26.097  43.684  -2.549  1.00 56.59 ? 91  GLY A O   1 
ATOM 696   N N   . VAL A 1 92  ? 27.307  42.763  -0.892  1.00 58.57 ? 92  VAL A N   1 
ATOM 697   C CA  . VAL A 1 92  ? 27.530  41.524  -1.617  1.00 58.57 ? 92  VAL A CA  1 
ATOM 698   C C   . VAL A 1 92  ? 26.581  40.419  -1.186  1.00 58.57 ? 92  VAL A C   1 
ATOM 699   O O   . VAL A 1 92  ? 26.554  40.011  -0.022  1.00 58.57 ? 92  VAL A O   1 
ATOM 700   C CB  . VAL A 1 92  ? 28.956  41.014  -1.434  1.00 43.01 ? 92  VAL A CB  1 
ATOM 701   C CG1 . VAL A 1 92  ? 29.135  39.705  -2.197  1.00 43.01 ? 92  VAL A CG1 1 
ATOM 702   C CG2 . VAL A 1 92  ? 29.936  42.063  -1.915  1.00 43.01 ? 92  VAL A CG2 1 
ATOM 703   N N   . PRO A 1 93  ? 25.800  39.904  -2.137  1.00 39.94 ? 93  PRO A N   1 
ATOM 704   C CA  . PRO A 1 93  ? 24.826  38.837  -1.916  1.00 39.94 ? 93  PRO A CA  1 
ATOM 705   C C   . PRO A 1 93  ? 25.451  37.656  -1.190  1.00 39.94 ? 93  PRO A C   1 
ATOM 706   O O   . PRO A 1 93  ? 26.459  37.111  -1.640  1.00 39.94 ? 93  PRO A O   1 
ATOM 707   C CB  . PRO A 1 93  ? 24.410  38.463  -3.330  1.00 28.98 ? 93  PRO A CB  1 
ATOM 708   C CG  . PRO A 1 93  ? 24.572  39.746  -4.078  1.00 28.98 ? 93  PRO A CG  1 
ATOM 709   C CD  . PRO A 1 93  ? 25.880  40.254  -3.563  1.00 28.98 ? 93  PRO A CD  1 
ATOM 710   N N   . PHE A 1 94  ? 24.859  37.268  -0.065  1.00 36.83 ? 94  PHE A N   1 
ATOM 711   C CA  . PHE A 1 94  ? 25.357  36.130  0.694   1.00 36.83 ? 94  PHE A CA  1 
ATOM 712   C C   . PHE A 1 94  ? 25.521  34.940  -0.253  1.00 36.83 ? 94  PHE A C   1 
ATOM 713   O O   . PHE A 1 94  ? 26.464  34.159  -0.135  1.00 36.83 ? 94  PHE A O   1 
ATOM 714   C CB  . PHE A 1 94  ? 24.368  35.760  1.800   1.00 35.42 ? 94  PHE A CB  1 
ATOM 715   C CG  . PHE A 1 94  ? 24.359  36.710  2.960   1.00 35.42 ? 94  PHE A CG  1 
ATOM 716   C CD1 . PHE A 1 94  ? 23.182  36.945  3.665   1.00 35.42 ? 94  PHE A CD1 1 
ATOM 717   C CD2 . PHE A 1 94  ? 25.527  37.319  3.391   1.00 35.42 ? 94  PHE A CD2 1 
ATOM 718   C CE1 . PHE A 1 94  ? 23.168  37.772  4.787   1.00 35.42 ? 94  PHE A CE1 1 
ATOM 719   C CE2 . PHE A 1 94  ? 25.526  38.147  4.513   1.00 35.42 ? 94  PHE A CE2 1 
ATOM 720   C CZ  . PHE A 1 94  ? 24.342  38.373  5.213   1.00 35.42 ? 94  PHE A CZ  1 
ATOM 721   N N   . VAL A 1 95  ? 24.590  34.804  -1.193  1.00 39.08 ? 95  VAL A N   1 
ATOM 722   C CA  . VAL A 1 95  ? 24.642  33.705  -2.149  1.00 39.08 ? 95  VAL A CA  1 
ATOM 723   C C   . VAL A 1 95  ? 25.929  33.786  -2.952  1.00 39.08 ? 95  VAL A C   1 
ATOM 724   O O   . VAL A 1 95  ? 26.633  32.791  -3.115  1.00 39.08 ? 95  VAL A O   1 
ATOM 725   C CB  . VAL A 1 95  ? 23.446  33.740  -3.123  1.00 36.13 ? 95  VAL A CB  1 
ATOM 726   C CG1 . VAL A 1 95  ? 23.587  32.635  -4.148  1.00 36.13 ? 95  VAL A CG1 1 
ATOM 727   C CG2 . VAL A 1 95  ? 22.146  33.575  -2.358  1.00 36.13 ? 95  VAL A CG2 1 
ATOM 728   N N   . ARG A 1 96  ? 26.228  34.984  -3.444  1.00 44.26 ? 96  ARG A N   1 
ATOM 729   C CA  . ARG A 1 96  ? 27.432  35.232  -4.229  1.00 44.26 ? 96  ARG A CA  1 
ATOM 730   C C   . ARG A 1 96  ? 28.658  34.725  -3.477  1.00 44.26 ? 96  ARG A C   1 
ATOM 731   O O   . ARG A 1 96  ? 29.438  33.928  -3.997  1.00 44.26 ? 96  ARG A O   1 
ATOM 732   C CB  . ARG A 1 96  ? 27.579  36.726  -4.476  1.00 95.18 ? 96  ARG A CB  1 
ATOM 733   C CG  . ARG A 1 96  ? 28.753  37.081  -5.336  1.00 95.18 ? 96  ARG A CG  1 
ATOM 734   C CD  . ARG A 1 96  ? 28.534  36.623  -6.756  1.00 95.18 ? 96  ARG A CD  1 
ATOM 735   N NE  . ARG A 1 96  ? 29.053  37.616  -7.688  1.00 95.18 ? 96  ARG A NE  1 
ATOM 736   C CZ  . ARG A 1 96  ? 28.681  38.895  -7.697  1.00 95.18 ? 96  ARG A CZ  1 
ATOM 737   N NH1 . ARG A 1 96  ? 27.784  39.344  -6.824  1.00 95.18 ? 96  ARG A NH1 1 
ATOM 738   N NH2 . ARG A 1 96  ? 29.212  39.731  -8.579  1.00 95.18 ? 96  ARG A NH2 1 
ATOM 739   N N   . THR A 1 97  ? 28.814  35.199  -2.246  1.00 38.00 ? 97  THR A N   1 
ATOM 740   C CA  . THR A 1 97  ? 29.929  34.807  -1.398  1.00 38.00 ? 97  THR A CA  1 
ATOM 741   C C   . THR A 1 97  ? 30.073  33.289  -1.304  1.00 38.00 ? 97  THR A C   1 
ATOM 742   O O   . THR A 1 97  ? 31.098  32.740  -1.708  1.00 38.00 ? 97  THR A O   1 
ATOM 743   C CB  . THR A 1 97  ? 29.759  35.368  0.020   1.00 34.32 ? 97  THR A CB  1 
ATOM 744   O OG1 . THR A 1 97  ? 29.646  36.797  -0.042  1.00 34.32 ? 97  THR A OG1 1 
ATOM 745   C CG2 . THR A 1 97  ? 30.946  34.974  0.893   1.00 34.32 ? 97  THR A CG2 1 
ATOM 746   N N   . ILE A 1 98  ? 29.058  32.612  -0.764  1.00 29.65 ? 98  ILE A N   1 
ATOM 747   C CA  . ILE A 1 98  ? 29.116  31.161  -0.638  1.00 29.65 ? 98  ILE A CA  1 
ATOM 748   C C   . ILE A 1 98  ? 29.456  30.529  -1.988  1.00 29.65 ? 98  ILE A C   1 
ATOM 749   O O   . ILE A 1 98  ? 30.259  29.597  -2.055  1.00 29.65 ? 98  ILE A O   1 
ATOM 750   C CB  . ILE A 1 98  ? 27.780  30.568  -0.106  1.00 28.10 ? 98  ILE A CB  1 
ATOM 751   C CG1 . ILE A 1 98  ? 27.734  30.653  1.417   1.00 28.10 ? 98  ILE A CG1 1 
ATOM 752   C CG2 . ILE A 1 98  ? 27.665  29.098  -0.477  1.00 28.10 ? 98  ILE A CG2 1 
ATOM 753   C CD1 . ILE A 1 98  ? 27.600  32.038  1.946   1.00 28.10 ? 98  ILE A CD1 1 
ATOM 754   N N   . GLN A 1 99  ? 28.860  31.042  -3.060  1.00 37.84 ? 99  GLN A N   1 
ATOM 755   C CA  . GLN A 1 99  ? 29.118  30.508  -4.394  1.00 37.84 ? 99  GLN A CA  1 
ATOM 756   C C   . GLN A 1 99  ? 30.569  30.629  -4.806  1.00 37.84 ? 99  GLN A C   1 
ATOM 757   O O   . GLN A 1 99  ? 31.145  29.691  -5.358  1.00 37.84 ? 99  GLN A O   1 
ATOM 758   C CB  . GLN A 1 99  ? 28.274  31.219  -5.436  1.00 57.96 ? 99  GLN A CB  1 
ATOM 759   C CG  . GLN A 1 99  ? 26.818  30.887  -5.362  1.00 57.96 ? 99  GLN A CG  1 
ATOM 760   C CD  . GLN A 1 99  ? 26.070  31.450  -6.534  1.00 57.96 ? 99  GLN A CD  1 
ATOM 761   O OE1 . GLN A 1 99  ? 26.108  32.656  -6.783  1.00 57.96 ? 99  GLN A OE1 1 
ATOM 762   N NE2 . GLN A 1 99  ? 25.386  30.583  -7.273  1.00 57.96 ? 99  GLN A NE2 1 
ATOM 763   N N   . ASP A 1 100 ? 31.156  31.794  -4.551  1.00 47.35 ? 100 ASP A N   1 
ATOM 764   C CA  . ASP A 1 100 ? 32.545  32.026  -4.911  1.00 47.35 ? 100 ASP A CA  1 
ATOM 765   C C   . ASP A 1 100 ? 33.502  31.077  -4.198  1.00 47.35 ? 100 ASP A C   1 
ATOM 766   O O   . ASP A 1 100 ? 34.548  30.744  -4.741  1.00 47.35 ? 100 ASP A O   1 
ATOM 767   C CB  . ASP A 1 100 ? 32.929  33.483  -4.642  1.00 60.48 ? 100 ASP A CB  1 
ATOM 768   C CG  . ASP A 1 100 ? 32.253  34.457  -5.609  1.00 60.48 ? 100 ASP A CG  1 
ATOM 769   O OD1 . ASP A 1 100 ? 31.720  34.009  -6.657  1.00 60.48 ? 100 ASP A OD1 1 
ATOM 770   O OD2 . ASP A 1 100 ? 32.268  35.678  -5.325  1.00 60.48 ? 100 ASP A OD2 1 
ATOM 771   N N   . LYS A 1 101 ? 33.154  30.638  -2.990  1.00 29.96 ? 101 LYS A N   1 
ATOM 772   C CA  . LYS A 1 101 ? 34.012  29.702  -2.264  1.00 29.96 ? 101 LYS A CA  1 
ATOM 773   C C   . LYS A 1 101 ? 33.788  28.295  -2.804  1.00 29.96 ? 101 LYS A C   1 
ATOM 774   O O   . LYS A 1 101 ? 34.358  27.326  -2.296  1.00 29.96 ? 101 LYS A O   1 
ATOM 775   C CB  . LYS A 1 101 ? 33.712  29.709  -0.763  1.00 42.27 ? 101 LYS A CB  1 
ATOM 776   C CG  . LYS A 1 101 ? 34.099  30.979  -0.048  1.00 42.27 ? 101 LYS A CG  1 
ATOM 777   C CD  . LYS A 1 101 ? 33.932  30.802  1.446   1.00 42.27 ? 101 LYS A CD  1 
ATOM 778   C CE  . LYS A 1 101 ? 34.051  32.125  2.187   1.00 42.27 ? 101 LYS A CE  1 
ATOM 779   N NZ  . LYS A 1 101 ? 35.447  32.642  2.160   1.00 42.27 ? 101 LYS A NZ  1 
ATOM 780   N N   . GLY A 1 102 ? 32.946  28.187  -3.829  1.00 35.49 ? 102 GLY A N   1 
ATOM 781   C CA  . GLY A 1 102 ? 32.672  26.894  -4.424  1.00 35.49 ? 102 GLY A CA  1 
ATOM 782   C C   . GLY A 1 102 ? 31.734  26.017  -3.614  1.00 35.49 ? 102 GLY A C   1 
ATOM 783   O O   . GLY A 1 102 ? 31.586  24.825  -3.899  1.00 35.49 ? 102 GLY A O   1 
ATOM 784   N N   . ILE A 1 103 ? 31.100  26.597  -2.600  1.00 31.59 ? 103 ILE A N   1 
ATOM 785   C CA  . ILE A 1 103 ? 30.166  25.854  -1.766  1.00 31.59 ? 103 ILE A CA  1 
ATOM 786   C C   . ILE A 1 103 ? 28.815  25.871  -2.476  1.00 31.59 ? 103 ILE A C   1 
ATOM 787   O O   . ILE A 1 103 ? 28.489  26.841  -3.156  1.00 31.59 ? 103 ILE A O   1 
ATOM 788   C CB  . ILE A 1 103 ? 30.061  26.506  -0.382  1.00 25.82 ? 103 ILE A CB  1 
ATOM 789   C CG1 . ILE A 1 103 ? 31.466  26.621  0.215   1.00 25.82 ? 103 ILE A CG1 1 
ATOM 790   C CG2 . ILE A 1 103 ? 29.167  25.683  0.524   1.00 25.82 ? 103 ILE A CG2 1 
ATOM 791   C CD1 . ILE A 1 103 ? 31.521  27.250  1.579   1.00 25.82 ? 103 ILE A CD1 1 
ATOM 792   N N   . VAL A 1 104 ? 28.037  24.800  -2.340  1.00 27.21 ? 104 VAL A N   1 
ATOM 793   C CA  . VAL A 1 104 ? 26.738  24.738  -3.008  1.00 27.21 ? 104 VAL A CA  1 
ATOM 794   C C   . VAL A 1 104 ? 25.646  25.455  -2.212  1.00 27.21 ? 104 VAL A C   1 
ATOM 795   O O   . VAL A 1 104 ? 25.635  25.408  -0.979  1.00 27.21 ? 104 VAL A O   1 
ATOM 796   C CB  . VAL A 1 104 ? 26.302  23.278  -3.249  1.00 22.18 ? 104 VAL A CB  1 
ATOM 797   C CG1 . VAL A 1 104 ? 25.107  23.250  -4.175  1.00 22.18 ? 104 VAL A CG1 1 
ATOM 798   C CG2 . VAL A 1 104 ? 27.441  22.481  -3.850  1.00 22.18 ? 104 VAL A CG2 1 
ATOM 799   N N   . VAL A 1 105 ? 24.728  26.109  -2.925  1.00 33.21 ? 105 VAL A N   1 
ATOM 800   C CA  . VAL A 1 105 ? 23.631  26.849  -2.298  1.00 33.21 ? 105 VAL A CA  1 
ATOM 801   C C   . VAL A 1 105 ? 22.293  26.097  -2.304  1.00 33.21 ? 105 VAL A C   1 
ATOM 802   O O   . VAL A 1 105 ? 21.914  25.496  -3.314  1.00 33.21 ? 105 VAL A O   1 
ATOM 803   C CB  . VAL A 1 105 ? 23.423  28.203  -3.005  1.00 24.70 ? 105 VAL A CB  1 
ATOM 804   C CG1 . VAL A 1 105 ? 22.341  28.996  -2.306  1.00 24.70 ? 105 VAL A CG1 1 
ATOM 805   C CG2 . VAL A 1 105 ? 24.717  28.981  -3.015  1.00 24.70 ? 105 VAL A CG2 1 
ATOM 806   N N   . GLY A 1 106 ? 21.578  26.140  -1.179  1.00 27.53 ? 106 GLY A N   1 
ATOM 807   C CA  . GLY A 1 106 ? 20.289  25.471  -1.091  1.00 27.53 ? 106 GLY A CA  1 
ATOM 808   C C   . GLY A 1 106 ? 19.248  26.277  -0.327  1.00 27.53 ? 106 GLY A C   1 
ATOM 809   O O   . GLY A 1 106 ? 19.615  27.195  0.404   1.00 27.53 ? 106 GLY A O   1 
ATOM 810   N N   . ILE A 1 107 ? 17.961  25.945  -0.495  1.00 25.43 ? 107 ILE A N   1 
ATOM 811   C CA  . ILE A 1 107 ? 16.855  26.634  0.199   1.00 25.43 ? 107 ILE A CA  1 
ATOM 812   C C   . ILE A 1 107 ? 15.867  25.665  0.806   1.00 25.43 ? 107 ILE A C   1 
ATOM 813   O O   . ILE A 1 107 ? 15.580  24.614  0.226   1.00 25.43 ? 107 ILE A O   1 
ATOM 814   C CB  . ILE A 1 107 ? 15.957  27.495  -0.735  1.00 19.43 ? 107 ILE A CB  1 
ATOM 815   C CG1 . ILE A 1 107 ? 16.462  27.400  -2.158  1.00 19.43 ? 107 ILE A CG1 1 
ATOM 816   C CG2 . ILE A 1 107 ? 15.847  28.915  -0.224  1.00 19.43 ? 107 ILE A CG2 1 
ATOM 817   C CD1 . ILE A 1 107 ? 16.429  25.984  -2.681  1.00 19.43 ? 107 ILE A CD1 1 
ATOM 818   N N   . LYS A 1 108 ? 15.340  26.043  1.967   1.00 31.75 ? 108 LYS A N   1 
ATOM 819   C CA  . LYS A 1 108 ? 14.299  25.277  2.649   1.00 31.75 ? 108 LYS A CA  1 
ATOM 820   C C   . LYS A 1 108 ? 13.083  25.670  1.799   1.00 31.75 ? 108 LYS A C   1 
ATOM 821   O O   . LYS A 1 108 ? 12.891  26.854  1.522   1.00 31.75 ? 108 LYS A O   1 
ATOM 822   C CB  . LYS A 1 108 ? 14.133  25.796  4.081   1.00 30.21 ? 108 LYS A CB  1 
ATOM 823   C CG  . LYS A 1 108 ? 12.952  25.258  4.877   1.00 30.21 ? 108 LYS A CG  1 
ATOM 824   C CD  . LYS A 1 108 ? 12.850  26.010  6.210   1.00 30.21 ? 108 LYS A CD  1 
ATOM 825   C CE  . LYS A 1 108 ? 12.201  25.177  7.328   1.00 30.21 ? 108 LYS A CE  1 
ATOM 826   N NZ  . LYS A 1 108 ? 12.374  25.796  8.713   1.00 30.21 ? 108 LYS A NZ  1 
ATOM 827   N N   . VAL A 1 109 ? 12.285  24.706  1.354   1.00 24.58 ? 109 VAL A N   1 
ATOM 828   C CA  . VAL A 1 109 ? 11.125  25.045  0.537   1.00 24.58 ? 109 VAL A CA  1 
ATOM 829   C C   . VAL A 1 109 ? 9.791   24.653  1.159   1.00 24.58 ? 109 VAL A C   1 
ATOM 830   O O   . VAL A 1 109 ? 8.749   25.173  0.766   1.00 24.58 ? 109 VAL A O   1 
ATOM 831   C CB  . VAL A 1 109 ? 11.221  24.410  -0.860  1.00 13.41 ? 109 VAL A CB  1 
ATOM 832   C CG1 . VAL A 1 109 ? 12.479  24.889  -1.548  1.00 13.41 ? 109 VAL A CG1 1 
ATOM 833   C CG2 . VAL A 1 109 ? 11.203  22.897  -0.753  1.00 13.41 ? 109 VAL A CG2 1 
ATOM 834   N N   . ASP A 1 110 ? 9.817   23.740  2.128   1.00 19.03 ? 110 ASP A N   1 
ATOM 835   C CA  . ASP A 1 110 ? 8.581   23.321  2.776   1.00 19.03 ? 110 ASP A CA  1 
ATOM 836   C C   . ASP A 1 110 ? 7.967   24.546  3.437   1.00 19.03 ? 110 ASP A C   1 
ATOM 837   O O   . ASP A 1 110 ? 8.672   25.486  3.789   1.00 19.03 ? 110 ASP A O   1 
ATOM 838   C CB  . ASP A 1 110 ? 8.834   22.229  3.825   1.00 34.88 ? 110 ASP A CB  1 
ATOM 839   C CG  . ASP A 1 110 ? 9.444   22.767  5.103   1.00 34.88 ? 110 ASP A CG  1 
ATOM 840   O OD1 . ASP A 1 110 ? 10.666  22.615  5.286   1.00 34.88 ? 110 ASP A OD1 1 
ATOM 841   O OD2 . ASP A 1 110 ? 8.701   23.339  5.928   1.00 34.88 ? 110 ASP A OD2 1 
ATOM 842   N N   . LYS A 1 111 ? 6.651   24.541  3.586   1.00 26.53 ? 111 LYS A N   1 
ATOM 843   C CA  . LYS A 1 111 ? 5.966   25.661  4.192   1.00 26.53 ? 111 LYS A CA  1 
ATOM 844   C C   . LYS A 1 111 ? 5.409   25.276  5.547   1.00 26.53 ? 111 LYS A C   1 
ATOM 845   O O   . LYS A 1 111 ? 4.266   25.588  5.872   1.00 26.53 ? 111 LYS A O   1 
ATOM 846   C CB  . LYS A 1 111 ? 4.838   26.157  3.289   1.00 35.56 ? 111 LYS A CB  1 
ATOM 847   C CG  . LYS A 1 111 ? 5.285   26.679  1.931   1.00 35.56 ? 111 LYS A CG  1 
ATOM 848   C CD  . LYS A 1 111 ? 4.501   27.940  1.558   1.00 35.56 ? 111 LYS A CD  1 
ATOM 849   C CE  . LYS A 1 111 ? 4.333   28.135  0.046   1.00 35.56 ? 111 LYS A CE  1 
ATOM 850   N NZ  . LYS A 1 111 ? 3.365   27.164  -0.592  1.00 35.56 ? 111 LYS A NZ  1 
ATOM 851   N N   . GLY A 1 112 ? 6.210   24.572  6.334   1.00 19.08 ? 112 GLY A N   1 
ATOM 852   C CA  . GLY A 1 112 ? 5.762   24.209  7.663   1.00 19.08 ? 112 GLY A CA  1 
ATOM 853   C C   . GLY A 1 112 ? 4.963   22.937  7.833   1.00 19.08 ? 112 GLY A C   1 
ATOM 854   O O   . GLY A 1 112 ? 4.375   22.386  6.899   1.00 19.08 ? 112 GLY A O   1 
ATOM 855   N N   . VAL A 1 113 ? 4.938   22.484  9.076   1.00 19.10 ? 113 VAL A N   1 
ATOM 856   C CA  . VAL A 1 113 ? 4.252   21.270  9.451   1.00 19.10 ? 113 VAL A CA  1 
ATOM 857   C C   . VAL A 1 113 ? 2.799   21.591  9.753   1.00 19.10 ? 113 VAL A C   1 
ATOM 858   O O   . VAL A 1 113 ? 2.489   22.697  10.185  1.00 19.10 ? 113 VAL A O   1 
ATOM 859   C CB  . VAL A 1 113 ? 4.906   20.692  10.707  1.00 14.43 ? 113 VAL A CB  1 
ATOM 860   C CG1 . VAL A 1 113 ? 4.428   21.439  11.927  1.00 14.43 ? 113 VAL A CG1 1 
ATOM 861   C CG2 . VAL A 1 113 ? 4.607   19.242  10.823  1.00 14.43 ? 113 VAL A CG2 1 
ATOM 862   N N   . VAL A 1 114 ? 1.911   20.630  9.525   1.00 27.90 ? 114 VAL A N   1 
ATOM 863   C CA  . VAL A 1 114 ? 0.491   20.823  9.804   1.00 27.90 ? 114 VAL A CA  1 
ATOM 864   C C   . VAL A 1 114 ? -0.105  19.543  10.386  1.00 27.90 ? 114 VAL A C   1 
ATOM 865   O O   . VAL A 1 114 ? 0.422   18.450  10.181  1.00 27.90 ? 114 VAL A O   1 
ATOM 866   C CB  . VAL A 1 114 ? -0.292  21.218  8.545   1.00 10.04 ? 114 VAL A CB  1 
ATOM 867   C CG1 . VAL A 1 114 ? 0.268   22.501  7.962   1.00 10.04 ? 114 VAL A CG1 1 
ATOM 868   C CG2 . VAL A 1 114 ? -0.221  20.107  7.522   1.00 10.04 ? 114 VAL A CG2 1 
ATOM 869   N N   . PRO A 1 115 ? -1.226  19.666  11.110  1.00 26.03 ? 115 PRO A N   1 
ATOM 870   C CA  . PRO A 1 115 ? -1.974  18.598  11.780  1.00 26.03 ? 115 PRO A CA  1 
ATOM 871   C C   . PRO A 1 115 ? -2.623  17.548  10.920  1.00 26.03 ? 115 PRO A C   1 
ATOM 872   O O   . PRO A 1 115 ? -3.213  17.851  9.882   1.00 26.03 ? 115 PRO A O   1 
ATOM 873   C CB  . PRO A 1 115 ? -3.045  19.351  12.552  1.00 4.91  ? 115 PRO A CB  1 
ATOM 874   C CG  . PRO A 1 115 ? -2.516  20.740  12.654  1.00 4.91  ? 115 PRO A CG  1 
ATOM 875   C CD  . PRO A 1 115 ? -1.906  20.951  11.316  1.00 4.91  ? 115 PRO A CD  1 
ATOM 876   N N   . LEU A 1 116 ? -2.526  16.307  11.373  1.00 22.10 ? 116 LEU A N   1 
ATOM 877   C CA  . LEU A 1 116 ? -3.170  15.206  10.687  1.00 22.10 ? 116 LEU A CA  1 
ATOM 878   C C   . LEU A 1 116 ? -4.409  14.898  11.519  1.00 22.10 ? 116 LEU A C   1 
ATOM 879   O O   . LEU A 1 116 ? -4.319  14.298  12.595  1.00 22.10 ? 116 LEU A O   1 
ATOM 880   C CB  . LEU A 1 116 ? -2.269  13.971  10.620  1.00 11.95 ? 116 LEU A CB  1 
ATOM 881   C CG  . LEU A 1 116 ? -1.175  13.972  9.558   1.00 11.95 ? 116 LEU A CG  1 
ATOM 882   C CD1 . LEU A 1 116 ? -0.623  12.569  9.437   1.00 11.95 ? 116 LEU A CD1 1 
ATOM 883   C CD2 . LEU A 1 116 ? -1.728  14.424  8.218   1.00 11.95 ? 116 LEU A CD2 1 
ATOM 884   N N   . ALA A 1 117 ? -5.565  15.331  11.031  1.00 24.61 ? 117 ALA A N   1 
ATOM 885   C CA  . ALA A 1 117 ? -6.809  15.094  11.739  1.00 24.61 ? 117 ALA A CA  1 
ATOM 886   C C   . ALA A 1 117 ? -6.948  13.613  12.035  1.00 24.61 ? 117 ALA A C   1 
ATOM 887   O O   . ALA A 1 117 ? -6.654  12.775  11.179  1.00 24.61 ? 117 ALA A O   1 
ATOM 888   C CB  . ALA A 1 117 ? -7.974  15.565  10.896  1.00 47.74 ? 117 ALA A CB  1 
ATOM 889   N N   . GLY A 1 118 ? -7.375  13.294  13.252  1.00 19.53 ? 118 GLY A N   1 
ATOM 890   C CA  . GLY A 1 118 ? -7.584  11.906  13.622  1.00 19.53 ? 118 GLY A CA  1 
ATOM 891   C C   . GLY A 1 118 ? -6.404  11.163  14.205  1.00 19.53 ? 118 GLY A C   1 
ATOM 892   O O   . GLY A 1 118 ? -6.505  9.963   14.496  1.00 19.53 ? 118 GLY A O   1 
ATOM 893   N N   . THR A 1 119 ? -5.288  11.862  14.382  1.00 26.17 ? 119 THR A N   1 
ATOM 894   C CA  . THR A 1 119 ? -4.085  11.242  14.928  1.00 26.17 ? 119 THR A CA  1 
ATOM 895   C C   . THR A 1 119 ? -3.781  11.821  16.289  1.00 26.17 ? 119 THR A C   1 
ATOM 896   O O   . THR A 1 119 ? -4.397  12.803  16.702  1.00 26.17 ? 119 THR A O   1 
ATOM 897   C CB  . THR A 1 119 ? -2.858  11.501  14.043  1.00 28.40 ? 119 THR A CB  1 
ATOM 898   O OG1 . THR A 1 119 ? -2.553  12.901  14.062  1.00 28.40 ? 119 THR A OG1 1 
ATOM 899   C CG2 . THR A 1 119 ? -3.122  11.060  12.603  1.00 28.40 ? 119 THR A CG2 1 
ATOM 900   N N   . ASP A 1 120 ? -2.819  11.216  16.977  1.00 25.44 ? 120 ASP A N   1 
ATOM 901   C CA  . ASP A 1 120 ? -2.424  11.687  18.299  1.00 25.44 ? 120 ASP A CA  1 
ATOM 902   C C   . ASP A 1 120 ? -1.387  12.796  18.159  1.00 25.44 ? 120 ASP A C   1 
ATOM 903   O O   . ASP A 1 120 ? -0.197  12.596  18.410  1.00 25.44 ? 120 ASP A O   1 
ATOM 904   C CB  . ASP A 1 120 ? -1.847  10.537  19.123  1.00 43.11 ? 120 ASP A CB  1 
ATOM 905   C CG  . ASP A 1 120 ? -1.505  10.952  20.545  1.00 43.11 ? 120 ASP A CG  1 
ATOM 906   O OD1 . ASP A 1 120 ? -1.045  10.081  21.314  1.00 43.11 ? 120 ASP A OD1 1 
ATOM 907   O OD2 . ASP A 1 120 ? -1.691  12.139  20.902  1.00 43.11 ? 120 ASP A OD2 1 
ATOM 908   N N   . GLY A 1 121 ? -1.849  13.968  17.740  1.00 30.42 ? 121 GLY A N   1 
ATOM 909   C CA  . GLY A 1 121 ? -0.960  15.101  17.575  1.00 30.42 ? 121 GLY A CA  1 
ATOM 910   C C   . GLY A 1 121 ? 0.136   14.885  16.554  1.00 30.42 ? 121 GLY A C   1 
ATOM 911   O O   . GLY A 1 121 ? 1.246   15.381  16.713  1.00 30.42 ? 121 GLY A O   1 
ATOM 912   N N   . GLU A 1 122 ? -0.162  14.139  15.502  1.00 21.47 ? 122 GLU A N   1 
ATOM 913   C CA  . GLU A 1 122 ? 0.826   13.896  14.473  1.00 21.47 ? 122 GLU A CA  1 
ATOM 914   C C   . GLU A 1 122 ? 0.665   14.913  13.374  1.00 21.47 ? 122 GLU A C   1 
ATOM 915   O O   . GLU A 1 122 ? -0.352  15.592  13.299  1.00 21.47 ? 122 GLU A O   1 
ATOM 916   C CB  . GLU A 1 122 ? 0.659   12.512  13.916  1.00 23.41 ? 122 GLU A CB  1 
ATOM 917   C CG  . GLU A 1 122 ? 0.713   11.484  14.975  1.00 23.41 ? 122 GLU A CG  1 
ATOM 918   C CD  . GLU A 1 122 ? 0.794   10.134  14.368  1.00 23.41 ? 122 GLU A CD  1 
ATOM 919   O OE1 . GLU A 1 122 ? 1.850   9.850   13.765  1.00 23.41 ? 122 GLU A OE1 1 
ATOM 920   O OE2 . GLU A 1 122 ? -0.197  9.374   14.472  1.00 23.41 ? 122 GLU A OE2 1 
ATOM 921   N N   . THR A 1 123 ? 1.660   15.006  12.505  1.00 24.81 ? 123 THR A N   1 
ATOM 922   C CA  . THR A 1 123 ? 1.603   15.992  11.445  1.00 24.81 ? 123 THR A CA  1 
ATOM 923   C C   . THR A 1 123 ? 2.043   15.487  10.097  1.00 24.81 ? 123 THR A C   1 
ATOM 924   O O   . THR A 1 123 ? 2.309   14.305  9.895   1.00 24.81 ? 123 THR A O   1 
ATOM 925   C CB  . THR A 1 123 ? 2.514   17.180  11.757  1.00 24.30 ? 123 THR A CB  1 
ATOM 926   O OG1 . THR A 1 123 ? 3.837   16.693  12.008  1.00 24.30 ? 123 THR A OG1 1 
ATOM 927   C CG2 . THR A 1 123 ? 2.029   17.944  12.961  1.00 24.30 ? 123 THR A CG2 1 
ATOM 928   N N   . THR A 1 124 ? 2.118   16.440  9.182   1.00 29.49 ? 124 THR A N   1 
ATOM 929   C CA  . THR A 1 124 ? 2.570   16.222  7.827   1.00 29.49 ? 124 THR A CA  1 
ATOM 930   C C   . THR A 1 124 ? 3.101   17.601  7.461   1.00 29.49 ? 124 THR A C   1 
ATOM 931   O O   . THR A 1 124 ? 3.033   18.526  8.273   1.00 29.49 ? 124 THR A O   1 
ATOM 932   C CB  . THR A 1 124 ? 1.422   15.809  6.890   1.00 20.48 ? 124 THR A CB  1 
ATOM 933   O OG1 . THR A 1 124 ? 1.943   15.542  5.580   1.00 20.48 ? 124 THR A OG1 1 
ATOM 934   C CG2 . THR A 1 124 ? 0.386   16.906  6.808   1.00 20.48 ? 124 THR A CG2 1 
ATOM 935   N N   . THR A 1 125 ? 3.612   17.757  6.251   1.00 16.44 ? 125 THR A N   1 
ATOM 936   C CA  . THR A 1 125 ? 4.186   19.035  5.869   1.00 16.44 ? 125 THR A CA  1 
ATOM 937   C C   . THR A 1 125 ? 3.559   19.609  4.616   1.00 16.44 ? 125 THR A C   1 
ATOM 938   O O   . THR A 1 125 ? 3.188   18.875  3.706   1.00 16.44 ? 125 THR A O   1 
ATOM 939   C CB  . THR A 1 125 ? 5.701   18.881  5.627   1.00 25.91 ? 125 THR A CB  1 
ATOM 940   O OG1 . THR A 1 125 ? 6.311   18.297  6.783   1.00 25.91 ? 125 THR A OG1 1 
ATOM 941   C CG2 . THR A 1 125 ? 6.338   20.219  5.343   1.00 25.91 ? 125 THR A CG2 1 
ATOM 942   N N   . GLN A 1 126 ? 3.443   20.927  4.567   1.00 19.90 ? 126 GLN A N   1 
ATOM 943   C CA  . GLN A 1 126 ? 2.891   21.558  3.391   1.00 19.90 ? 126 GLN A CA  1 
ATOM 944   C C   . GLN A 1 126 ? 3.958   22.369  2.681   1.00 19.90 ? 126 GLN A C   1 
ATOM 945   O O   . GLN A 1 126 ? 5.003   22.653  3.258   1.00 19.90 ? 126 GLN A O   1 
ATOM 946   C CB  . GLN A 1 126 ? 1.737   22.456  3.773   1.00 21.79 ? 126 GLN A CB  1 
ATOM 947   C CG  . GLN A 1 126 ? 2.024   23.430  4.865   1.00 21.79 ? 126 GLN A CG  1 
ATOM 948   C CD  . GLN A 1 126 ? 0.888   24.404  4.999   1.00 21.79 ? 126 GLN A CD  1 
ATOM 949   O OE1 . GLN A 1 126 ? -0.263  24.065  4.714   1.00 21.79 ? 126 GLN A OE1 1 
ATOM 950   N NE2 . GLN A 1 126 ? 1.190   25.617  5.432   1.00 21.79 ? 126 GLN A NE2 1 
ATOM 951   N N   . GLY A 1 127 ? 3.693   22.734  1.429   1.00 23.26 ? 127 GLY A N   1 
ATOM 952   C CA  . GLY A 1 127 ? 4.645   23.514  0.666   1.00 23.26 ? 127 GLY A CA  1 
ATOM 953   C C   . GLY A 1 127 ? 4.608   23.166  -0.808  1.00 23.26 ? 127 GLY A C   1 
ATOM 954   O O   . GLY A 1 127 ? 5.196   23.873  -1.637  1.00 23.26 ? 127 GLY A O   1 
ATOM 955   N N   . LEU A 1 128 ? 3.903   22.088  -1.142  1.00 15.02 ? 128 LEU A N   1 
ATOM 956   C CA  . LEU A 1 128 ? 3.803   21.634  -2.526  1.00 15.02 ? 128 LEU A CA  1 
ATOM 957   C C   . LEU A 1 128 ? 3.153   22.618  -3.496  1.00 15.02 ? 128 LEU A C   1 
ATOM 958   O O   . LEU A 1 128 ? 3.482   22.625  -4.679  1.00 15.02 ? 128 LEU A O   1 
ATOM 959   C CB  . LEU A 1 128 ? 3.043   20.309  -2.597  1.00 8.50  ? 128 LEU A CB  1 
ATOM 960   C CG  . LEU A 1 128 ? 3.676   19.058  -1.994  1.00 8.50  ? 128 LEU A CG  1 
ATOM 961   C CD1 . LEU A 1 128 ? 2.810   17.857  -2.293  1.00 8.50  ? 128 LEU A CD1 1 
ATOM 962   C CD2 . LEU A 1 128 ? 5.045   18.844  -2.588  1.00 8.50  ? 128 LEU A CD2 1 
ATOM 963   N N   . ASP A 1 129 ? 2.221   23.438  -3.023  1.00 19.13 ? 129 ASP A N   1 
ATOM 964   C CA  . ASP A 1 129 ? 1.567   24.378  -3.924  1.00 19.13 ? 129 ASP A CA  1 
ATOM 965   C C   . ASP A 1 129 ? 2.560   25.363  -4.536  1.00 19.13 ? 129 ASP A C   1 
ATOM 966   O O   . ASP A 1 129 ? 3.265   26.096  -3.825  1.00 19.13 ? 129 ASP A O   1 
ATOM 967   C CB  . ASP A 1 129 ? 0.456   25.136  -3.201  1.00 26.31 ? 129 ASP A CB  1 
ATOM 968   C CG  . ASP A 1 129 ? -0.686  24.232  -2.773  1.00 26.31 ? 129 ASP A CG  1 
ATOM 969   O OD1 . ASP A 1 129 ? -0.796  23.110  -3.315  1.00 26.31 ? 129 ASP A OD1 1 
ATOM 970   O OD2 . ASP A 1 129 ? -1.483  24.652  -1.900  1.00 26.31 ? 129 ASP A OD2 1 
ATOM 971   N N   . GLY A 1 130 ? 2.620   25.358  -5.863  1.00 21.53 ? 130 GLY A N   1 
ATOM 972   C CA  . GLY A 1 130 ? 3.517   26.245  -6.578  1.00 21.53 ? 130 GLY A CA  1 
ATOM 973   C C   . GLY A 1 130 ? 4.999   25.934  -6.441  1.00 21.53 ? 130 GLY A C   1 
ATOM 974   O O   . GLY A 1 130 ? 5.837   26.682  -6.953  1.00 21.53 ? 130 GLY A O   1 
ATOM 975   N N   . LEU A 1 131 ? 5.336   24.836  -5.771  1.00 28.28 ? 131 LEU A N   1 
ATOM 976   C CA  . LEU A 1 131 ? 6.734   24.475  -5.576  1.00 28.28 ? 131 LEU A CA  1 
ATOM 977   C C   . LEU A 1 131 ? 7.543   24.429  -6.866  1.00 28.28 ? 131 LEU A C   1 
ATOM 978   O O   . LEU A 1 131 ? 8.706   24.827  -6.883  1.00 28.28 ? 131 LEU A O   1 
ATOM 979   C CB  . LEU A 1 131 ? 6.847   23.127  -4.868  1.00 21.08 ? 131 LEU A CB  1 
ATOM 980   C CG  . LEU A 1 131 ? 8.272   22.680  -4.540  1.00 21.08 ? 131 LEU A CG  1 
ATOM 981   C CD1 . LEU A 1 131 ? 8.889   23.618  -3.519  1.00 21.08 ? 131 LEU A CD1 1 
ATOM 982   C CD2 . LEU A 1 131 ? 8.240   21.267  -3.998  1.00 21.08 ? 131 LEU A CD2 1 
ATOM 983   N N   . SER A 1 132 ? 6.945   23.954  -7.950  1.00 21.73 ? 132 SER A N   1 
ATOM 984   C CA  . SER A 1 132 ? 7.687   23.873  -9.198  1.00 21.73 ? 132 SER A CA  1 
ATOM 985   C C   . SER A 1 132 ? 8.151   25.251  -9.679  1.00 21.73 ? 132 SER A C   1 
ATOM 986   O O   . SER A 1 132 ? 9.310   25.421  -10.053 1.00 21.73 ? 132 SER A O   1 
ATOM 987   C CB  . SER A 1 132 ? 6.845   23.196  -10.273 1.00 21.83 ? 132 SER A CB  1 
ATOM 988   O OG  . SER A 1 132 ? 7.671   22.765  -11.336 1.00 21.83 ? 132 SER A OG  1 
ATOM 989   N N   . GLU A 1 133 ? 7.252   26.233  -9.664  1.00 30.13 ? 133 GLU A N   1 
ATOM 990   C CA  . GLU A 1 133 ? 7.587   27.593  -10.086 1.00 30.13 ? 133 GLU A CA  1 
ATOM 991   C C   . GLU A 1 133 ? 8.673   28.131  -9.174  1.00 30.13 ? 133 GLU A C   1 
ATOM 992   O O   . GLU A 1 133 ? 9.636   28.750  -9.625  1.00 30.13 ? 133 GLU A O   1 
ATOM 993   C CB  . GLU A 1 133 ? 6.373   28.518  -9.977  1.00 84.38 ? 133 GLU A CB  1 
ATOM 994   C CG  . GLU A 1 133 ? 5.258   28.235  -10.958 1.00 84.38 ? 133 GLU A CG  1 
ATOM 995   C CD  . GLU A 1 133 ? 4.711   26.820  -10.839 1.00 84.38 ? 133 GLU A CD  1 
ATOM 996   O OE1 . GLU A 1 133 ? 4.192   26.452  -9.755  1.00 84.38 ? 133 GLU A OE1 1 
ATOM 997   O OE2 . GLU A 1 133 ? 4.800   26.071  -11.839 1.00 84.38 ? 133 GLU A OE2 1 
ATOM 998   N N   . ARG A 1 134 ? 8.505   27.891  -7.880  1.00 28.09 ? 134 ARG A N   1 
ATOM 999   C CA  . ARG A 1 134 ? 9.460   28.361  -6.895  1.00 28.09 ? 134 ARG A CA  1 
ATOM 1000  C C   . ARG A 1 134 ? 10.837  27.767  -7.107  1.00 28.09 ? 134 ARG A C   1 
ATOM 1001  O O   . ARG A 1 134 ? 11.839  28.474  -7.009  1.00 28.09 ? 134 ARG A O   1 
ATOM 1002  C CB  . ARG A 1 134 ? 8.970   28.026  -5.495  1.00 32.27 ? 134 ARG A CB  1 
ATOM 1003  C CG  . ARG A 1 134 ? 7.693   28.721  -5.133  1.00 32.27 ? 134 ARG A CG  1 
ATOM 1004  C CD  . ARG A 1 134 ? 7.176   28.196  -3.835  1.00 32.27 ? 134 ARG A CD  1 
ATOM 1005  N NE  . ARG A 1 134 ? 8.163   28.348  -2.777  1.00 32.27 ? 134 ARG A NE  1 
ATOM 1006  C CZ  . ARG A 1 134 ? 8.192   27.577  -1.695  1.00 32.27 ? 134 ARG A CZ  1 
ATOM 1007  N NH1 . ARG A 1 134 ? 7.276   26.608  -1.564  1.00 32.27 ? 134 ARG A NH1 1 
ATOM 1008  N NH2 . ARG A 1 134 ? 9.127   27.768  -0.756  1.00 32.27 ? 134 ARG A NH2 1 
ATOM 1009  N N   . CYS A 1 135 ? 10.894  26.468  -7.384  1.00 28.15 ? 135 CYS A N   1 
ATOM 1010  C CA  . CYS A 1 135 ? 12.178  25.823  -7.600  1.00 28.15 ? 135 CYS A CA  1 
ATOM 1011  C C   . CYS A 1 135 ? 12.837  26.456  -8.803  1.00 28.15 ? 135 CYS A C   1 
ATOM 1012  O O   . CYS A 1 135 ? 13.998  26.857  -8.753  1.00 28.15 ? 135 CYS A O   1 
ATOM 1013  C CB  . CYS A 1 135 ? 12.001  24.327  -7.834  1.00 24.53 ? 135 CYS A CB  1 
ATOM 1014  S SG  . CYS A 1 135 ? 11.656  23.402  -6.325  1.00 24.53 ? 135 CYS A SG  1 
ATOM 1015  N N   . ALA A 1 136 ? 12.085  26.553  -9.887  1.00 23.07 ? 136 ALA A N   1 
ATOM 1016  C CA  . ALA A 1 136 ? 12.605  27.152  -11.097 1.00 23.07 ? 136 ALA A CA  1 
ATOM 1017  C C   . ALA A 1 136 ? 13.259  28.502  -10.778 1.00 23.07 ? 136 ALA A C   1 
ATOM 1018  O O   . ALA A 1 136 ? 14.327  28.823  -11.302 1.00 23.07 ? 136 ALA A O   1 
ATOM 1019  C CB  . ALA A 1 136 ? 11.486  27.329  -12.078 1.00 6.77  ? 136 ALA A CB  1 
ATOM 1020  N N   . GLN A 1 137 ? 12.610  29.277  -9.911  1.00 25.71 ? 137 GLN A N   1 
ATOM 1021  C CA  . GLN A 1 137 ? 13.106  30.587  -9.503  1.00 25.71 ? 137 GLN A CA  1 
ATOM 1022  C C   . GLN A 1 137 ? 14.372  30.475  -8.667  1.00 25.71 ? 137 GLN A C   1 
ATOM 1023  O O   . GLN A 1 137 ? 15.376  31.125  -8.943  1.00 25.71 ? 137 GLN A O   1 
ATOM 1024  C CB  . GLN A 1 137 ? 12.048  31.325  -8.681  1.00 46.54 ? 137 GLN A CB  1 
ATOM 1025  C CG  . GLN A 1 137 ? 11.474  32.550  -9.366  1.00 46.54 ? 137 GLN A CG  1 
ATOM 1026  C CD  . GLN A 1 137 ? 12.552  33.455  -9.925  1.00 46.54 ? 137 GLN A CD  1 
ATOM 1027  O OE1 . GLN A 1 137 ? 13.377  33.990  -9.184  1.00 46.54 ? 137 GLN A OE1 1 
ATOM 1028  N NE2 . GLN A 1 137 ? 12.557  33.624  -11.247 1.00 46.54 ? 137 GLN A NE2 1 
ATOM 1029  N N   . TYR A 1 138 ? 14.306  29.661  -7.625  1.00 29.03 ? 138 TYR A N   1 
ATOM 1030  C CA  . TYR A 1 138 ? 15.440  29.463  -6.746  1.00 29.03 ? 138 TYR A CA  1 
ATOM 1031  C C   . TYR A 1 138 ? 16.655  28.996  -7.528  1.00 29.03 ? 138 TYR A C   1 
ATOM 1032  O O   . TYR A 1 138 ? 17.775  29.425  -7.263  1.00 29.03 ? 138 TYR A O   1 
ATOM 1033  C CB  . TYR A 1 138 ? 15.078  28.442  -5.679  1.00 25.68 ? 138 TYR A CB  1 
ATOM 1034  C CG  . TYR A 1 138 ? 14.119  28.970  -4.646  1.00 25.68 ? 138 TYR A CG  1 
ATOM 1035  C CD1 . TYR A 1 138 ? 13.231  28.118  -4.004  1.00 25.68 ? 138 TYR A CD1 1 
ATOM 1036  C CD2 . TYR A 1 138 ? 14.123  30.315  -4.280  1.00 25.68 ? 138 TYR A CD2 1 
ATOM 1037  C CE1 . TYR A 1 138 ? 12.370  28.583  -3.024  1.00 25.68 ? 138 TYR A CE1 1 
ATOM 1038  C CE2 . TYR A 1 138 ? 13.264  30.792  -3.297  1.00 25.68 ? 138 TYR A CE2 1 
ATOM 1039  C CZ  . TYR A 1 138 ? 12.390  29.917  -2.674  1.00 25.68 ? 138 TYR A CZ  1 
ATOM 1040  O OH  . TYR A 1 138 ? 11.520  30.357  -1.701  1.00 25.68 ? 138 TYR A OH  1 
ATOM 1041  N N   . LYS A 1 139 ? 16.438  28.111  -8.491  1.00 30.51 ? 139 LYS A N   1 
ATOM 1042  C CA  . LYS A 1 139 ? 17.541  27.616  -9.299  1.00 30.51 ? 139 LYS A CA  1 
ATOM 1043  C C   . LYS A 1 139 ? 18.126  28.817  -10.013 1.00 30.51 ? 139 LYS A C   1 
ATOM 1044  O O   . LYS A 1 139 ? 19.336  29.038  -10.000 1.00 30.51 ? 139 LYS A O   1 
ATOM 1045  C CB  . LYS A 1 139 ? 17.042  26.611  -10.334 1.00 17.21 ? 139 LYS A CB  1 
ATOM 1046  C CG  . LYS A 1 139 ? 18.126  26.058  -11.243 1.00 17.21 ? 139 LYS A CG  1 
ATOM 1047  C CD  . LYS A 1 139 ? 19.044  25.094  -10.514 1.00 17.21 ? 139 LYS A CD  1 
ATOM 1048  C CE  . LYS A 1 139 ? 19.942  24.369  -11.518 1.00 17.21 ? 139 LYS A CE  1 
ATOM 1049  N NZ  . LYS A 1 139 ? 20.794  23.269  -10.945 1.00 17.21 ? 139 LYS A NZ  1 
ATOM 1050  N N   . LYS A 1 140 ? 17.240  29.597  -10.622 1.00 33.22 ? 140 LYS A N   1 
ATOM 1051  C CA  . LYS A 1 140 ? 17.621  30.793  -11.361 1.00 33.22 ? 140 LYS A CA  1 
ATOM 1052  C C   . LYS A 1 140 ? 18.370  31.783  -10.461 1.00 33.22 ? 140 LYS A C   1 
ATOM 1053  O O   . LYS A 1 140 ? 19.077  32.669  -10.941 1.00 33.22 ? 140 LYS A O   1 
ATOM 1054  C CB  . LYS A 1 140 ? 16.363  31.446  -11.943 1.00 50.52 ? 140 LYS A CB  1 
ATOM 1055  C CG  . LYS A 1 140 ? 16.590  32.242  -13.213 1.00 50.52 ? 140 LYS A CG  1 
ATOM 1056  C CD  . LYS A 1 140 ? 15.274  32.774  -13.780 1.00 50.52 ? 140 LYS A CD  1 
ATOM 1057  C CE  . LYS A 1 140 ? 14.314  31.644  -14.146 1.00 50.52 ? 140 LYS A CE  1 
ATOM 1058  N NZ  . LYS A 1 140 ? 12.996  32.150  -14.631 1.00 50.52 ? 140 LYS A NZ  1 
ATOM 1059  N N   . ASP A 1 141 ? 18.225  31.631  -9.151  1.00 24.32 ? 141 ASP A N   1 
ATOM 1060  C CA  . ASP A 1 141 ? 18.905  32.532  -8.237  1.00 24.32 ? 141 ASP A CA  1 
ATOM 1061  C C   . ASP A 1 141 ? 20.134  31.920  -7.574  1.00 24.32 ? 141 ASP A C   1 
ATOM 1062  O O   . ASP A 1 141 ? 20.670  32.482  -6.618  1.00 24.32 ? 141 ASP A O   1 
ATOM 1063  C CB  . ASP A 1 141 ? 17.931  33.052  -7.177  1.00 40.23 ? 141 ASP A CB  1 
ATOM 1064  C CG  . ASP A 1 141 ? 16.833  33.914  -7.775  1.00 40.23 ? 141 ASP A CG  1 
ATOM 1065  O OD1 . ASP A 1 141 ? 17.077  34.548  -8.828  1.00 40.23 ? 141 ASP A OD1 1 
ATOM 1066  O OD2 . ASP A 1 141 ? 15.734  33.970  -7.188  1.00 40.23 ? 141 ASP A OD2 1 
ATOM 1067  N N   . GLY A 1 142 ? 20.574  30.765  -8.073  1.00 41.56 ? 142 GLY A N   1 
ATOM 1068  C CA  . GLY A 1 142 ? 21.769  30.142  -7.530  1.00 41.56 ? 142 GLY A CA  1 
ATOM 1069  C C   . GLY A 1 142 ? 21.649  28.905  -6.661  1.00 41.56 ? 142 GLY A C   1 
ATOM 1070  O O   . GLY A 1 142 ? 22.668  28.364  -6.213  1.00 41.56 ? 142 GLY A O   1 
ATOM 1071  N N   . ALA A 1 143 ? 20.431  28.447  -6.408  1.00 29.06 ? 143 ALA A N   1 
ATOM 1072  C CA  . ALA A 1 143 ? 20.260  27.262  -5.579  1.00 29.06 ? 143 ALA A CA  1 
ATOM 1073  C C   . ALA A 1 143 ? 20.365  26.009  -6.437  1.00 29.06 ? 143 ALA A C   1 
ATOM 1074  O O   . ALA A 1 143 ? 19.942  26.002  -7.599  1.00 29.06 ? 143 ALA A O   1 
ATOM 1075  C CB  . ALA A 1 143 ? 18.922  27.309  -4.879  1.00 10.85 ? 143 ALA A CB  1 
ATOM 1076  N N   . ASP A 1 144 ? 20.942  24.953  -5.871  1.00 27.02 ? 144 ASP A N   1 
ATOM 1077  C CA  . ASP A 1 144 ? 21.090  23.705  -6.604  1.00 27.02 ? 144 ASP A CA  1 
ATOM 1078  C C   . ASP A 1 144 ? 20.528  22.536  -5.826  1.00 27.02 ? 144 ASP A C   1 
ATOM 1079  O O   . ASP A 1 144 ? 20.466  21.415  -6.327  1.00 27.02 ? 144 ASP A O   1 
ATOM 1080  C CB  . ASP A 1 144 ? 22.554  23.459  -6.947  1.00 44.82 ? 144 ASP A CB  1 
ATOM 1081  C CG  . ASP A 1 144 ? 23.091  24.479  -7.927  1.00 44.82 ? 144 ASP A CG  1 
ATOM 1082  O OD1 . ASP A 1 144 ? 22.565  24.549  -9.061  1.00 44.82 ? 144 ASP A OD1 1 
ATOM 1083  O OD2 . ASP A 1 144 ? 24.033  25.218  -7.561  1.00 44.82 ? 144 ASP A OD2 1 
ATOM 1084  N N   . PHE A 1 145 ? 20.122  22.797  -4.592  1.00 17.70 ? 145 PHE A N   1 
ATOM 1085  C CA  . PHE A 1 145 ? 19.528  21.753  -3.778  1.00 17.70 ? 145 PHE A CA  1 
ATOM 1086  C C   . PHE A 1 145 ? 18.535  22.368  -2.799  1.00 17.70 ? 145 PHE A C   1 
ATOM 1087  O O   . PHE A 1 145 ? 18.600  23.564  -2.509  1.00 17.70 ? 145 PHE A O   1 
ATOM 1088  C CB  . PHE A 1 145 ? 20.621  20.936  -3.067  1.00 26.82 ? 145 PHE A CB  1 
ATOM 1089  C CG  . PHE A 1 145 ? 21.249  21.618  -1.882  1.00 26.82 ? 145 PHE A CG  1 
ATOM 1090  C CD1 . PHE A 1 145 ? 20.858  21.287  -0.588  1.00 26.82 ? 145 PHE A CD1 1 
ATOM 1091  C CD2 . PHE A 1 145 ? 22.255  22.557  -2.053  1.00 26.82 ? 145 PHE A CD2 1 
ATOM 1092  C CE1 . PHE A 1 145 ? 21.460  21.878  0.517   1.00 26.82 ? 145 PHE A CE1 1 
ATOM 1093  C CE2 . PHE A 1 145 ? 22.861  23.153  -0.956  1.00 26.82 ? 145 PHE A CE2 1 
ATOM 1094  C CZ  . PHE A 1 145 ? 22.462  22.811  0.333   1.00 26.82 ? 145 PHE A CZ  1 
ATOM 1095  N N   . ALA A 1 146 ? 17.595  21.563  -2.315  1.00 24.23 ? 146 ALA A N   1 
ATOM 1096  C CA  . ALA A 1 146 ? 16.584  22.062  -1.393  1.00 24.23 ? 146 ALA A CA  1 
ATOM 1097  C C   . ALA A 1 146 ? 16.395  21.148  -0.193  1.00 24.23 ? 146 ALA A C   1 
ATOM 1098  O O   . ALA A 1 146 ? 16.938  20.043  -0.146  1.00 24.23 ? 146 ALA A O   1 
ATOM 1099  C CB  . ALA A 1 146 ? 15.274  22.225  -2.125  1.00 13.42 ? 146 ALA A CB  1 
ATOM 1100  N N   . LYS A 1 147 ? 15.631  21.624  0.783   1.00 26.25 ? 147 LYS A N   1 
ATOM 1101  C CA  . LYS A 1 147 ? 15.348  20.844  1.978   1.00 26.25 ? 147 LYS A CA  1 
ATOM 1102  C C   . LYS A 1 147 ? 13.863  20.952  2.306   1.00 26.25 ? 147 LYS A C   1 
ATOM 1103  O O   . LYS A 1 147 ? 13.268  22.020  2.172   1.00 26.25 ? 147 LYS A O   1 
ATOM 1104  C CB  . LYS A 1 147 ? 16.172  21.346  3.168   1.00 29.72 ? 147 LYS A CB  1 
ATOM 1105  C CG  . LYS A 1 147 ? 15.690  20.807  4.508   1.00 29.72 ? 147 LYS A CG  1 
ATOM 1106  C CD  . LYS A 1 147 ? 16.398  21.464  5.673   1.00 29.72 ? 147 LYS A CD  1 
ATOM 1107  C CE  . LYS A 1 147 ? 15.524  21.441  6.922   1.00 29.72 ? 147 LYS A CE  1 
ATOM 1108  N NZ  . LYS A 1 147 ? 16.297  21.688  8.189   1.00 29.72 ? 147 LYS A NZ  1 
ATOM 1109  N N   . TRP A 1 148 ? 13.276  19.836  2.728   1.00 22.94 ? 148 TRP A N   1 
ATOM 1110  C CA  . TRP A 1 148 ? 11.865  19.763  3.093   1.00 22.94 ? 148 TRP A CA  1 
ATOM 1111  C C   . TRP A 1 148 ? 11.830  18.935  4.362   1.00 22.94 ? 148 TRP A C   1 
ATOM 1112  O O   . TRP A 1 148 ? 12.295  17.795  4.368   1.00 22.94 ? 148 TRP A O   1 
ATOM 1113  C CB  . TRP A 1 148 ? 11.079  19.054  1.985   1.00 24.09 ? 148 TRP A CB  1 
ATOM 1114  C CG  . TRP A 1 148 ? 9.626   18.820  2.286   1.00 24.09 ? 148 TRP A CG  1 
ATOM 1115  C CD1 . TRP A 1 148 ? 9.102   17.991  3.238   1.00 24.09 ? 148 TRP A CD1 1 
ATOM 1116  C CD2 . TRP A 1 148 ? 8.512   19.426  1.626   1.00 24.09 ? 148 TRP A CD2 1 
ATOM 1117  N NE1 . TRP A 1 148 ? 7.731   18.044  3.210   1.00 24.09 ? 148 TRP A NE1 1 
ATOM 1118  C CE2 . TRP A 1 148 ? 7.343   18.918  2.228   1.00 24.09 ? 148 TRP A CE2 1 
ATOM 1119  C CE3 . TRP A 1 148 ? 8.388   20.352  0.582   1.00 24.09 ? 148 TRP A CE3 1 
ATOM 1120  C CZ2 . TRP A 1 148 ? 6.059   19.306  1.819   1.00 24.09 ? 148 TRP A CZ2 1 
ATOM 1121  C CZ3 . TRP A 1 148 ? 7.105   20.739  0.173   1.00 24.09 ? 148 TRP A CZ3 1 
ATOM 1122  C CH2 . TRP A 1 148 ? 5.961   20.214  0.793   1.00 24.09 ? 148 TRP A CH2 1 
ATOM 1123  N N   . ARG A 1 149 ? 11.286  19.477  5.442   1.00 18.77 ? 149 ARG A N   1 
ATOM 1124  C CA  . ARG A 1 149 ? 11.274  18.697  6.676   1.00 18.77 ? 149 ARG A CA  1 
ATOM 1125  C C   . ARG A 1 149 ? 9.943   18.132  7.120   1.00 18.77 ? 149 ARG A C   1 
ATOM 1126  O O   . ARG A 1 149 ? 9.002   18.878  7.364   1.00 18.77 ? 149 ARG A O   1 
ATOM 1127  C CB  . ARG A 1 149 ? 11.854  19.511  7.834   1.00 17.39 ? 149 ARG A CB  1 
ATOM 1128  C CG  . ARG A 1 149 ? 11.813  18.768  9.167   1.00 17.39 ? 149 ARG A CG  1 
ATOM 1129  C CD  . ARG A 1 149 ? 12.619  19.487  10.233  1.00 17.39 ? 149 ARG A CD  1 
ATOM 1130  N NE  . ARG A 1 149 ? 11.787  20.074  11.284  1.00 17.39 ? 149 ARG A NE  1 
ATOM 1131  C CZ  . ARG A 1 149 ? 11.681  19.581  12.517  1.00 17.39 ? 149 ARG A CZ  1 
ATOM 1132  N NH1 . ARG A 1 149 ? 12.353  18.489  12.857  1.00 17.39 ? 149 ARG A NH1 1 
ATOM 1133  N NH2 . ARG A 1 149 ? 10.916  20.187  13.420  1.00 17.39 ? 149 ARG A NH2 1 
ATOM 1134  N N   . CYS A 1 150 ? 9.872   16.809  7.221   1.00 19.13 ? 150 CYS A N   1 
ATOM 1135  C CA  . CYS A 1 150 ? 8.675   16.144  7.708   1.00 19.13 ? 150 CYS A CA  1 
ATOM 1136  C C   . CYS A 1 150 ? 9.042   15.782  9.135   1.00 19.13 ? 150 CYS A C   1 
ATOM 1137  O O   . CYS A 1 150 ? 10.218  15.648  9.454   1.00 19.13 ? 150 CYS A O   1 
ATOM 1138  C CB  . CYS A 1 150 ? 8.380   14.880  6.912   1.00 29.55 ? 150 CYS A CB  1 
ATOM 1139  S SG  . CYS A 1 150 ? 7.622   15.190  5.323   1.00 29.55 ? 150 CYS A SG  1 
ATOM 1140  N N   . VAL A 1 151 ? 8.054   15.628  10.002  1.00 25.06 ? 151 VAL A N   1 
ATOM 1141  C CA  . VAL A 1 151 ? 8.358   15.302  11.379  1.00 25.06 ? 151 VAL A CA  1 
ATOM 1142  C C   . VAL A 1 151 ? 7.521   14.161  11.903  1.00 25.06 ? 151 VAL A C   1 
ATOM 1143  O O   . VAL A 1 151 ? 6.297   14.214  11.865  1.00 25.06 ? 151 VAL A O   1 
ATOM 1144  C CB  . VAL A 1 151 ? 8.126   16.512  12.290  1.00 2.84  ? 151 VAL A CB  1 
ATOM 1145  C CG1 . VAL A 1 151 ? 8.474   16.159  13.722  1.00 2.84  ? 151 VAL A CG1 1 
ATOM 1146  C CG2 . VAL A 1 151 ? 8.957   17.669  11.820  1.00 2.84  ? 151 VAL A CG2 1 
ATOM 1147  N N   . LEU A 1 152 ? 8.183   13.123  12.389  1.00 16.32 ? 152 LEU A N   1 
ATOM 1148  C CA  . LEU A 1 152 ? 7.485   11.984  12.962  1.00 16.32 ? 152 LEU A CA  1 
ATOM 1149  C C   . LEU A 1 152 ? 7.798   11.978  14.461  1.00 16.32 ? 152 LEU A C   1 
ATOM 1150  O O   . LEU A 1 152 ? 8.796   12.553  14.892  1.00 16.32 ? 152 LEU A O   1 
ATOM 1151  C CB  . LEU A 1 152 ? 7.936   10.692  12.290  1.00 16.79 ? 152 LEU A CB  1 
ATOM 1152  C CG  . LEU A 1 152 ? 7.628   10.629  10.790  1.00 16.79 ? 152 LEU A CG  1 
ATOM 1153  C CD1 . LEU A 1 152 ? 7.913   9.237   10.280  1.00 16.79 ? 152 LEU A CD1 1 
ATOM 1154  C CD2 . LEU A 1 152 ? 6.174   10.959  10.535  1.00 16.79 ? 152 LEU A CD2 1 
ATOM 1155  N N   . LYS A 1 153 ? 6.949   11.336  15.255  1.00 20.06 ? 153 LYS A N   1 
ATOM 1156  C CA  . LYS A 1 153 ? 7.119   11.328  16.705  1.00 20.06 ? 153 LYS A CA  1 
ATOM 1157  C C   . LYS A 1 153 ? 7.007   9.908   17.247  1.00 20.06 ? 153 LYS A C   1 
ATOM 1158  O O   . LYS A 1 153 ? 6.248   9.110   16.708  1.00 20.06 ? 153 LYS A O   1 
ATOM 1159  C CB  . LYS A 1 153 ? 6.025   12.209  17.310  1.00 45.75 ? 153 LYS A CB  1 
ATOM 1160  C CG  . LYS A 1 153 ? 6.047   12.346  18.807  1.00 45.75 ? 153 LYS A CG  1 
ATOM 1161  C CD  . LYS A 1 153 ? 4.637   12.174  19.396  1.00 45.75 ? 153 LYS A CD  1 
ATOM 1162  C CE  . LYS A 1 153 ? 3.615   13.166  18.832  1.00 45.75 ? 153 LYS A CE  1 
ATOM 1163  N NZ  . LYS A 1 153 ? 2.315   13.071  19.560  1.00 45.75 ? 153 LYS A NZ  1 
ATOM 1164  N N   . ILE A 1 154 ? 7.759   9.577   18.296  1.00 31.12 ? 154 ILE A N   1 
ATOM 1165  C CA  . ILE A 1 154 ? 7.665   8.230   18.858  1.00 31.12 ? 154 ILE A CA  1 
ATOM 1166  C C   . ILE A 1 154 ? 6.970   8.236   20.215  1.00 31.12 ? 154 ILE A C   1 
ATOM 1167  O O   . ILE A 1 154 ? 7.374   8.963   21.125  1.00 31.12 ? 154 ILE A O   1 
ATOM 1168  C CB  . ILE A 1 154 ? 9.037   7.568   19.041  1.00 18.26 ? 154 ILE A CB  1 
ATOM 1169  C CG1 . ILE A 1 154 ? 9.763   7.492   17.702  1.00 18.26 ? 154 ILE A CG1 1 
ATOM 1170  C CG2 . ILE A 1 154 ? 8.855   6.161   19.603  1.00 18.26 ? 154 ILE A CG2 1 
ATOM 1171  C CD1 . ILE A 1 154 ? 11.100  6.821   17.780  1.00 18.26 ? 154 ILE A CD1 1 
ATOM 1172  N N   . SER A 1 155 ? 5.925   7.417   20.333  1.00 29.04 ? 155 SER A N   1 
ATOM 1173  C CA  . SER A 1 155 ? 5.132   7.279   21.555  1.00 29.04 ? 155 SER A CA  1 
ATOM 1174  C C   . SER A 1 155 ? 4.470   5.896   21.510  1.00 29.04 ? 155 SER A C   1 
ATOM 1175  O O   . SER A 1 155 ? 4.736   5.116   20.585  1.00 29.04 ? 155 SER A O   1 
ATOM 1176  C CB  . SER A 1 155 ? 4.063   8.364   21.629  1.00 29.85 ? 155 SER A CB  1 
ATOM 1177  O OG  . SER A 1 155 ? 2.865   7.909   21.030  1.00 29.85 ? 155 SER A OG  1 
ATOM 1178  N N   . GLU A 1 156 ? 3.615   5.590   22.490  1.00 42.49 ? 156 GLU A N   1 
ATOM 1179  C CA  . GLU A 1 156 ? 2.969   4.278   22.538  1.00 42.49 ? 156 GLU A CA  1 
ATOM 1180  C C   . GLU A 1 156 ? 2.347   3.922   21.201  1.00 42.49 ? 156 GLU A C   1 
ATOM 1181  O O   . GLU A 1 156 ? 2.281   2.751   20.817  1.00 42.49 ? 156 GLU A O   1 
ATOM 1182  C CB  . GLU A 1 156 ? 1.881   4.221   23.608  1.00 99.51 ? 156 GLU A CB  1 
ATOM 1183  C CG  . GLU A 1 156 ? 1.257   2.830   23.718  1.00 99.51 ? 156 GLU A CG  1 
ATOM 1184  C CD  . GLU A 1 156 ? -0.136  2.838   24.332  1.00 99.51 ? 156 GLU A CD  1 
ATOM 1185  O OE1 . GLU A 1 156 ? -0.273  3.253   25.505  1.00 99.51 ? 156 GLU A OE1 1 
ATOM 1186  O OE2 . GLU A 1 156 ? -1.097  2.425   23.638  1.00 99.51 ? 156 GLU A OE2 1 
ATOM 1187  N N   . ARG A 1 157 ? 1.898   4.934   20.478  1.00 49.20 ? 157 ARG A N   1 
ATOM 1188  C CA  . ARG A 1 157 ? 1.279   4.675   19.195  1.00 49.20 ? 157 ARG A CA  1 
ATOM 1189  C C   . ARG A 1 157 ? 1.340   5.914   18.323  1.00 49.20 ? 157 ARG A C   1 
ATOM 1190  O O   . ARG A 1 157 ? 0.307   6.454   17.952  1.00 49.20 ? 157 ARG A O   1 
ATOM 1191  C CB  . ARG A 1 157 ? -0.165  4.263   19.441  1.00 81.54 ? 157 ARG A CB  1 
ATOM 1192  C CG  . ARG A 1 157 ? -0.923  5.219   20.356  1.00 81.54 ? 157 ARG A CG  1 
ATOM 1193  C CD  . ARG A 1 157 ? -2.017  4.479   21.112  1.00 81.54 ? 157 ARG A CD  1 
ATOM 1194  N NE  . ARG A 1 157 ? -2.587  3.391   20.315  1.00 81.54 ? 157 ARG A NE  1 
ATOM 1195  C CZ  . ARG A 1 157 ? -3.599  2.623   20.707  1.00 81.54 ? 157 ARG A CZ  1 
ATOM 1196  N NH1 . ARG A 1 157 ? -4.162  2.832   21.890  1.00 81.54 ? 157 ARG A NH1 1 
ATOM 1197  N NH2 . ARG A 1 157 ? -4.031  1.632   19.931  1.00 81.54 ? 157 ARG A NH2 1 
ATOM 1198  N N   . THR A 1 158 ? 2.540   6.361   17.973  1.00 79.06 ? 158 THR A N   1 
ATOM 1199  C CA  . THR A 1 158 ? 2.633   7.570   17.179  1.00 79.06 ? 158 THR A CA  1 
ATOM 1200  C C   . THR A 1 158 ? 3.006   7.473   15.728  1.00 79.06 ? 158 THR A C   1 
ATOM 1201  O O   . THR A 1 158 ? 2.225   7.883   14.878  1.00 79.06 ? 158 THR A O   1 
ATOM 1202  C CB  . THR A 1 158 ? 3.588   8.543   17.773  1.00 56.82 ? 158 THR A CB  1 
ATOM 1203  O OG1 . THR A 1 158 ? 4.674   7.810   18.342  1.00 56.82 ? 158 THR A OG1 1 
ATOM 1204  C CG2 . THR A 1 158 ? 2.891   9.420   18.788  1.00 56.82 ? 158 THR A CG2 1 
ATOM 1205  N N   . PRO A 1 159 ? 4.209   6.973   15.405  1.00 42.63 ? 159 PRO A N   1 
ATOM 1206  C CA  . PRO A 1 159 ? 4.421   6.952   13.952  1.00 42.63 ? 159 PRO A CA  1 
ATOM 1207  C C   . PRO A 1 159 ? 3.367   5.986   13.429  1.00 42.63 ? 159 PRO A C   1 
ATOM 1208  O O   . PRO A 1 159 ? 3.608   4.785   13.327  1.00 42.63 ? 159 PRO A O   1 
ATOM 1209  C CB  . PRO A 1 159 ? 5.849   6.432   13.803  1.00 12.08 ? 159 PRO A CB  1 
ATOM 1210  C CG  . PRO A 1 159 ? 6.430   6.535   15.209  1.00 12.08 ? 159 PRO A CG  1 
ATOM 1211  C CD  . PRO A 1 159 ? 5.262   6.237   16.110  1.00 12.08 ? 159 PRO A CD  1 
ATOM 1212  N N   . SER A 1 160 ? 2.184   6.531   13.145  1.00 25.27 ? 160 SER A N   1 
ATOM 1213  C CA  . SER A 1 160 ? 1.031   5.770   12.684  1.00 25.27 ? 160 SER A CA  1 
ATOM 1214  C C   . SER A 1 160 ? 1.046   5.529   11.192  1.00 25.27 ? 160 SER A C   1 
ATOM 1215  O O   . SER A 1 160 ? 1.615   6.316   10.423  1.00 25.27 ? 160 SER A O   1 
ATOM 1216  C CB  . SER A 1 160 ? -0.259  6.498   13.059  1.00 15.03 ? 160 SER A CB  1 
ATOM 1217  O OG  . SER A 1 160 ? -0.312  7.782   12.459  1.00 15.03 ? 160 SER A OG  1 
ATOM 1218  N N   . ALA A 1 161 ? 0.405   4.441   10.784  1.00 23.42 ? 161 ALA A N   1 
ATOM 1219  C CA  . ALA A 1 161 ? 0.356   4.101   9.378   1.00 23.42 ? 161 ALA A CA  1 
ATOM 1220  C C   . ALA A 1 161 ? 0.100   5.366   8.578   1.00 23.42 ? 161 ALA A C   1 
ATOM 1221  O O   . ALA A 1 161 ? 0.795   5.638   7.603   1.00 23.42 ? 161 ALA A O   1 
ATOM 1222  C CB  . ALA A 1 161 ? -0.727  3.090   9.128   1.00 4.56  ? 161 ALA A CB  1 
ATOM 1223  N N   . LEU A 1 162 ? -0.876  6.155   9.010   1.00 18.29 ? 162 LEU A N   1 
ATOM 1224  C CA  . LEU A 1 162 ? -1.193  7.380   8.301   1.00 18.29 ? 162 LEU A CA  1 
ATOM 1225  C C   . LEU A 1 162 ? 0.000   8.319   8.246   1.00 18.29 ? 162 LEU A C   1 
ATOM 1226  O O   . LEU A 1 162 ? 0.415   8.741   7.165   1.00 18.29 ? 162 LEU A O   1 
ATOM 1227  C CB  . LEU A 1 162 ? -2.369  8.085   8.963   1.00 17.25 ? 162 LEU A CB  1 
ATOM 1228  C CG  . LEU A 1 162 ? -2.803  9.381   8.273   1.00 17.25 ? 162 LEU A CG  1 
ATOM 1229  C CD1 . LEU A 1 162 ? -3.090  9.137   6.794   1.00 17.25 ? 162 LEU A CD1 1 
ATOM 1230  C CD2 . LEU A 1 162 ? -4.034  9.912   8.973   1.00 17.25 ? 162 LEU A CD2 1 
ATOM 1231  N N   . ALA A 1 163 ? 0.556   8.642   9.408   1.00 23.43 ? 163 ALA A N   1 
ATOM 1232  C CA  . ALA A 1 163 ? 1.707   9.540   9.479   1.00 23.43 ? 163 ALA A CA  1 
ATOM 1233  C C   . ALA A 1 163 ? 2.878   9.062   8.618   1.00 23.43 ? 163 ALA A C   1 
ATOM 1234  O O   . ALA A 1 163 ? 3.567   9.860   7.980   1.00 23.43 ? 163 ALA A O   1 
ATOM 1235  C CB  . ALA A 1 163 ? 2.150   9.681   10.903  1.00 10.77 ? 163 ALA A CB  1 
ATOM 1236  N N   . ILE A 1 164 ? 3.116   7.759   8.607   1.00 10.70 ? 164 ILE A N   1 
ATOM 1237  C CA  . ILE A 1 164 ? 4.197   7.234   7.806   1.00 10.70 ? 164 ILE A CA  1 
ATOM 1238  C C   . ILE A 1 164 ? 3.799   7.286   6.333   1.00 10.70 ? 164 ILE A C   1 
ATOM 1239  O O   . ILE A 1 164 ? 4.586   7.729   5.504   1.00 10.70 ? 164 ILE A O   1 
ATOM 1240  C CB  . ILE A 1 164 ? 4.531   5.799   8.214   1.00 6.16  ? 164 ILE A CB  1 
ATOM 1241  C CG1 . ILE A 1 164 ? 4.986   5.784   9.670   1.00 6.16  ? 164 ILE A CG1 1 
ATOM 1242  C CG2 . ILE A 1 164 ? 5.620   5.245   7.316   1.00 6.16  ? 164 ILE A CG2 1 
ATOM 1243  C CD1 . ILE A 1 164 ? 5.333   4.430   10.169  1.00 6.16  ? 164 ILE A CD1 1 
ATOM 1244  N N   . LEU A 1 165 ? 2.581   6.836   6.021   1.00 20.43 ? 165 LEU A N   1 
ATOM 1245  C CA  . LEU A 1 165 ? 2.040   6.835   4.656   1.00 20.43 ? 165 LEU A CA  1 
ATOM 1246  C C   . LEU A 1 165 ? 2.181   8.240   4.088   1.00 20.43 ? 165 LEU A C   1 
ATOM 1247  O O   . LEU A 1 165 ? 2.902   8.449   3.114   1.00 20.43 ? 165 LEU A O   1 
ATOM 1248  C CB  . LEU A 1 165 ? 0.562   6.422   4.687   1.00 54.82 ? 165 LEU A CB  1 
ATOM 1249  C CG  . LEU A 1 165 ? -0.363  6.530   3.463   1.00 54.82 ? 165 LEU A CG  1 
ATOM 1250  C CD1 . LEU A 1 165 ? -1.658  5.803   3.776   1.00 54.82 ? 165 LEU A CD1 1 
ATOM 1251  C CD2 . LEU A 1 165 ? -0.668  7.983   3.112   1.00 54.82 ? 165 LEU A CD2 1 
ATOM 1252  N N   . GLU A 1 166 ? 1.470   9.198   4.683   1.00 39.03 ? 166 GLU A N   1 
ATOM 1253  C CA  . GLU A 1 166 ? 1.565   10.593  4.269   1.00 39.03 ? 166 GLU A CA  1 
ATOM 1254  C C   . GLU A 1 166 ? 2.978   10.878  4.736   1.00 39.03 ? 166 GLU A C   1 
ATOM 1255  O O   . GLU A 1 166 ? 3.559   10.046  5.430   1.00 39.03 ? 166 GLU A O   1 
ATOM 1256  C CB  . GLU A 1 166 ? 0.565   11.441  5.054   1.00 34.23 ? 166 GLU A CB  1 
ATOM 1257  C CG  . GLU A 1 166 ? 0.636   12.932  4.787   1.00 34.23 ? 166 GLU A CG  1 
ATOM 1258  C CD  . GLU A 1 166 ? 0.109   13.307  3.419   1.00 34.23 ? 166 GLU A CD  1 
ATOM 1259  O OE1 . GLU A 1 166 ? -0.363  12.398  2.706   1.00 34.23 ? 166 GLU A OE1 1 
ATOM 1260  O OE2 . GLU A 1 166 ? 0.159   14.507  3.057   1.00 34.23 ? 166 GLU A OE2 1 
ATOM 1261  N N   . ASN A 1 167 ? 3.542   12.027  4.401   1.00 28.01 ? 167 ASN A N   1 
ATOM 1262  C CA  . ASN A 1 167 ? 4.926   12.318  4.816   1.00 28.01 ? 167 ASN A CA  1 
ATOM 1263  C C   . ASN A 1 167 ? 5.835   11.587  3.838   1.00 28.01 ? 167 ASN A C   1 
ATOM 1264  O O   . ASN A 1 167 ? 6.519   12.211  3.029   1.00 28.01 ? 167 ASN A O   1 
ATOM 1265  C CB  . ASN A 1 167 ? 5.231   11.829  6.248   1.00 15.34 ? 167 ASN A CB  1 
ATOM 1266  C CG  . ASN A 1 167 ? 4.811   12.831  7.333   1.00 15.34 ? 167 ASN A CG  1 
ATOM 1267  O OD1 . ASN A 1 167 ? 5.260   13.987  7.359   1.00 15.34 ? 167 ASN A OD1 1 
ATOM 1268  N ND2 . ASN A 1 167 ? 3.962   12.380  8.246   1.00 15.34 ? 167 ASN A ND2 1 
ATOM 1269  N N   . ALA A 1 168 ? 5.849   10.264  3.908   1.00 14.10 ? 168 ALA A N   1 
ATOM 1270  C CA  . ALA A 1 168 ? 6.666   9.512   2.974   1.00 14.10 ? 168 ALA A CA  1 
ATOM 1271  C C   . ALA A 1 168 ? 6.216   9.937   1.585   1.00 14.10 ? 168 ALA A C   1 
ATOM 1272  O O   . ALA A 1 168 ? 7.034   10.146  0.681   1.00 14.10 ? 168 ALA A O   1 
ATOM 1273  C CB  . ALA A 1 168 ? 6.454   8.018   3.148   1.00 2.04  ? 168 ALA A CB  1 
ATOM 1274  N N   . ASN A 1 169 ? 4.905   10.084  1.425   1.00 26.37 ? 169 ASN A N   1 
ATOM 1275  C CA  . ASN A 1 169 ? 4.354   10.469  0.142   1.00 26.37 ? 169 ASN A CA  1 
ATOM 1276  C C   . ASN A 1 169 ? 4.677   11.918  -0.174  1.00 26.37 ? 169 ASN A C   1 
ATOM 1277  O O   . ASN A 1 169 ? 5.069   12.234  -1.294  1.00 26.37 ? 169 ASN A O   1 
ATOM 1278  C CB  . ASN A 1 169 ? 2.847   10.260  0.131   1.00 29.61 ? 169 ASN A CB  1 
ATOM 1279  C CG  . ASN A 1 169 ? 2.277   10.236  -1.275  1.00 29.61 ? 169 ASN A CG  1 
ATOM 1280  O OD1 . ASN A 1 169 ? 2.605   9.353   -2.074  1.00 29.61 ? 169 ASN A OD1 1 
ATOM 1281  N ND2 . ASN A 1 169 ? 1.419   11.206  -1.588  1.00 29.61 ? 169 ASN A ND2 1 
ATOM 1282  N N   . VAL A 1 170 ? 4.525   12.803  0.808   1.00 23.60 ? 170 VAL A N   1 
ATOM 1283  C CA  . VAL A 1 170 ? 4.811   14.219  0.579   1.00 23.60 ? 170 VAL A CA  1 
ATOM 1284  C C   . VAL A 1 170 ? 6.254   14.399  0.171   1.00 23.60 ? 170 VAL A C   1 
ATOM 1285  O O   . VAL A 1 170 ? 6.557   15.141  -0.760  1.00 23.60 ? 170 VAL A O   1 
ATOM 1286  C CB  . VAL A 1 170 ? 4.594   15.067  1.824   1.00 27.13 ? 170 VAL A CB  1 
ATOM 1287  C CG1 . VAL A 1 170 ? 4.394   16.506  1.424   1.00 27.13 ? 170 VAL A CG1 1 
ATOM 1288  C CG2 . VAL A 1 170 ? 3.410   14.556  2.594   1.00 27.13 ? 170 VAL A CG2 1 
ATOM 1289  N N   . LEU A 1 171 ? 7.148   13.730  0.886   1.00 22.57 ? 171 LEU A N   1 
ATOM 1290  C CA  . LEU A 1 171 ? 8.556   13.822  0.569   1.00 22.57 ? 171 LEU A CA  1 
ATOM 1291  C C   . LEU A 1 171 ? 8.748   13.454  -0.896  1.00 22.57 ? 171 LEU A C   1 
ATOM 1292  O O   . LEU A 1 171 ? 9.369   14.199  -1.655  1.00 22.57 ? 171 LEU A O   1 
ATOM 1293  C CB  . LEU A 1 171 ? 9.370   12.882  1.462   1.00 13.97 ? 171 LEU A CB  1 
ATOM 1294  C CG  . LEU A 1 171 ? 9.523   13.296  2.927   1.00 13.97 ? 171 LEU A CG  1 
ATOM 1295  C CD1 . LEU A 1 171 ? 10.227  12.203  3.716   1.00 13.97 ? 171 LEU A CD1 1 
ATOM 1296  C CD2 . LEU A 1 171 ? 10.304  14.582  3.002   1.00 13.97 ? 171 LEU A CD2 1 
ATOM 1297  N N   . ALA A 1 172 ? 8.192   12.315  -1.297  1.00 16.49 ? 172 ALA A N   1 
ATOM 1298  C CA  . ALA A 1 172 ? 8.321   11.856  -2.675  1.00 16.49 ? 172 ALA A CA  1 
ATOM 1299  C C   . ALA A 1 172 ? 7.825   12.902  -3.662  1.00 16.49 ? 172 ALA A C   1 
ATOM 1300  O O   . ALA A 1 172 ? 8.451   13.122  -4.691  1.00 16.49 ? 172 ALA A O   1 
ATOM 1301  C CB  . ALA A 1 172 ? 7.566   10.549  -2.866  1.00 23.46 ? 172 ALA A CB  1 
ATOM 1302  N N   . ARG A 1 173 ? 6.702   13.543  -3.356  1.00 20.64 ? 173 ARG A N   1 
ATOM 1303  C CA  . ARG A 1 173 ? 6.164   14.575  -4.242  1.00 20.64 ? 173 ARG A CA  1 
ATOM 1304  C C   . ARG A 1 173 ? 7.178   15.696  -4.369  1.00 20.64 ? 173 ARG A C   1 
ATOM 1305  O O   . ARG A 1 173 ? 7.599   16.041  -5.473  1.00 20.64 ? 173 ARG A O   1 
ATOM 1306  C CB  . ARG A 1 173 ? 4.840   15.134  -3.700  1.00 22.08 ? 173 ARG A CB  1 
ATOM 1307  C CG  . ARG A 1 173 ? 3.608   14.308  -4.083  1.00 22.08 ? 173 ARG A CG  1 
ATOM 1308  C CD  . ARG A 1 173 ? 2.766   15.001  -5.144  1.00 22.08 ? 173 ARG A CD  1 
ATOM 1309  N NE  . ARG A 1 173 ? 3.483   15.185  -6.398  1.00 22.08 ? 173 ARG A NE  1 
ATOM 1310  C CZ  . ARG A 1 173 ? 3.268   16.211  -7.216  1.00 22.08 ? 173 ARG A CZ  1 
ATOM 1311  N NH1 . ARG A 1 173 ? 2.360   17.130  -6.896  1.00 22.08 ? 173 ARG A NH1 1 
ATOM 1312  N NH2 . ARG A 1 173 ? 3.961   16.330  -8.346  1.00 22.08 ? 173 ARG A NH2 1 
ATOM 1313  N N   . TYR A 1 174 ? 7.561   16.257  -3.225  1.00 23.08 ? 174 TYR A N   1 
ATOM 1314  C CA  . TYR A 1 174 ? 8.541   17.333  -3.159  1.00 23.08 ? 174 TYR A CA  1 
ATOM 1315  C C   . TYR A 1 174 ? 9.801   16.970  -3.950  1.00 23.08 ? 174 TYR A C   1 
ATOM 1316  O O   . TYR A 1 174 ? 10.256  17.743  -4.799  1.00 23.08 ? 174 TYR A O   1 
ATOM 1317  C CB  . TYR A 1 174 ? 8.874   17.600  -1.691  1.00 24.34 ? 174 TYR A CB  1 
ATOM 1318  C CG  . TYR A 1 174 ? 10.322  17.913  -1.393  1.00 24.34 ? 174 TYR A CG  1 
ATOM 1319  C CD1 . TYR A 1 174 ? 10.874  19.159  -1.691  1.00 24.34 ? 174 TYR A CD1 1 
ATOM 1320  C CD2 . TYR A 1 174 ? 11.133  16.968  -0.766  1.00 24.34 ? 174 TYR A CD2 1 
ATOM 1321  C CE1 . TYR A 1 174 ? 12.204  19.456  -1.358  1.00 24.34 ? 174 TYR A CE1 1 
ATOM 1322  C CE2 . TYR A 1 174 ? 12.457  17.253  -0.435  1.00 24.34 ? 174 TYR A CE2 1 
ATOM 1323  C CZ  . TYR A 1 174 ? 12.982  18.495  -0.727  1.00 24.34 ? 174 TYR A CZ  1 
ATOM 1324  O OH  . TYR A 1 174 ? 14.271  18.775  -0.348  1.00 24.34 ? 174 TYR A OH  1 
ATOM 1325  N N   . ALA A 1 175 ? 10.352  15.789  -3.678  1.00 19.01 ? 175 ALA A N   1 
ATOM 1326  C CA  . ALA A 1 175 ? 11.555  15.325  -4.361  1.00 19.01 ? 175 ALA A CA  1 
ATOM 1327  C C   . ALA A 1 175 ? 11.357  15.321  -5.870  1.00 19.01 ? 175 ALA A C   1 
ATOM 1328  O O   . ALA A 1 175 ? 12.172  15.869  -6.613  1.00 19.01 ? 175 ALA A O   1 
ATOM 1329  C CB  . ALA A 1 175 ? 11.921  13.928  -3.886  1.00 9.96  ? 175 ALA A CB  1 
ATOM 1330  N N   . SER A 1 176 ? 10.269  14.701  -6.318  1.00 19.30 ? 176 SER A N   1 
ATOM 1331  C CA  . SER A 1 176 ? 9.959   14.620  -7.741  1.00 19.30 ? 176 SER A CA  1 
ATOM 1332  C C   . SER A 1 176 ? 9.961   15.996  -8.401  1.00 19.30 ? 176 SER A C   1 
ATOM 1333  O O   . SER A 1 176 ? 10.570  16.181  -9.459  1.00 19.30 ? 176 SER A O   1 
ATOM 1334  C CB  . SER A 1 176 ? 8.597   13.961  -7.945  1.00 21.53 ? 176 SER A CB  1 
ATOM 1335  O OG  . SER A 1 176 ? 8.342   13.735  -9.319  1.00 21.53 ? 176 SER A OG  1 
ATOM 1336  N N   . ILE A 1 177 ? 9.289   16.957  -7.767  1.00 17.76 ? 177 ILE A N   1 
ATOM 1337  C CA  . ILE A 1 177 ? 9.189   18.318  -8.290  1.00 17.76 ? 177 ILE A CA  1 
ATOM 1338  C C   . ILE A 1 177 ? 10.531  19.025  -8.363  1.00 17.76 ? 177 ILE A C   1 
ATOM 1339  O O   . ILE A 1 177 ? 10.813  19.727  -9.335  1.00 17.76 ? 177 ILE A O   1 
ATOM 1340  C CB  . ILE A 1 177 ? 8.236   19.178  -7.437  1.00 14.75 ? 177 ILE A CB  1 
ATOM 1341  C CG1 . ILE A 1 177 ? 6.853   18.530  -7.406  1.00 14.75 ? 177 ILE A CG1 1 
ATOM 1342  C CG2 . ILE A 1 177 ? 8.147   20.599  -8.005  1.00 14.75 ? 177 ILE A CG2 1 
ATOM 1343  C CD1 . ILE A 1 177 ? 5.917   19.162  -6.422  1.00 14.75 ? 177 ILE A CD1 1 
ATOM 1344  N N   . CYS A 1 178 ? 11.353  18.860  -7.333  1.00 22.39 ? 178 CYS A N   1 
ATOM 1345  C CA  . CYS A 1 178 ? 12.668  19.487  -7.323  1.00 22.39 ? 178 CYS A CA  1 
ATOM 1346  C C   . CYS A 1 178 ? 13.502  19.003  -8.503  1.00 22.39 ? 178 CYS A C   1 
ATOM 1347  O O   . CYS A 1 178 ? 14.072  19.797  -9.250  1.00 22.39 ? 178 CYS A O   1 
ATOM 1348  C CB  . CYS A 1 178 ? 13.419  19.151  -6.039  1.00 28.19 ? 178 CYS A CB  1 
ATOM 1349  S SG  . CYS A 1 178 ? 12.842  20.001  -4.587  1.00 28.19 ? 178 CYS A SG  1 
ATOM 1350  N N   . GLN A 1 179 ? 13.573  17.690  -8.671  1.00 18.40 ? 179 GLN A N   1 
ATOM 1351  C CA  . GLN A 1 179 ? 14.382  17.143  -9.738  1.00 18.40 ? 179 GLN A CA  1 
ATOM 1352  C C   . GLN A 1 179 ? 13.978  17.589  -11.133 1.00 18.40 ? 179 GLN A C   1 
ATOM 1353  O O   . GLN A 1 179 ? 14.845  17.794  -11.984 1.00 18.40 ? 179 GLN A O   1 
ATOM 1354  C CB  . GLN A 1 179 ? 14.409  15.620  -9.657  1.00 18.89 ? 179 GLN A CB  1 
ATOM 1355  C CG  . GLN A 1 179 ? 14.989  15.113  -8.359  1.00 18.89 ? 179 GLN A CG  1 
ATOM 1356  C CD  . GLN A 1 179 ? 15.377  13.656  -8.441  1.00 18.89 ? 179 GLN A CD  1 
ATOM 1357  O OE1 . GLN A 1 179 ? 14.636  12.837  -8.982  1.00 18.89 ? 179 GLN A OE1 1 
ATOM 1358  N NE2 . GLN A 1 179 ? 16.543  13.320  -7.898  1.00 18.89 ? 179 GLN A NE2 1 
ATOM 1359  N N   . GLN A 1 180 ? 12.685  17.748  -11.398 1.00 40.28 ? 180 GLN A N   1 
ATOM 1360  C CA  . GLN A 1 180 ? 12.314  18.166  -12.737 1.00 40.28 ? 180 GLN A CA  1 
ATOM 1361  C C   . GLN A 1 180 ? 12.702  19.641  -12.942 1.00 40.28 ? 180 GLN A C   1 
ATOM 1362  O O   . GLN A 1 180 ? 12.575  20.182  -14.035 1.00 40.28 ? 180 GLN A O   1 
ATOM 1363  C CB  . GLN A 1 180 ? 10.829  17.909  -12.998 1.00 99.51 ? 180 GLN A CB  1 
ATOM 1364  C CG  . GLN A 1 180 ? 9.893   18.708  -12.131 1.00 99.51 ? 180 GLN A CG  1 
ATOM 1365  C CD  . GLN A 1 180 ? 8.444   18.595  -12.594 1.00 99.51 ? 180 GLN A CD  1 
ATOM 1366  O OE1 . GLN A 1 180 ? 7.552   19.306  -12.101 1.00 99.51 ? 180 GLN A OE1 1 
ATOM 1367  N NE2 . GLN A 1 180 ? 8.202   17.694  -13.550 1.00 99.51 ? 180 GLN A NE2 1 
ATOM 1368  N N   . ASN A 1 181 ? 13.219  20.269  -11.887 1.00 22.93 ? 181 ASN A N   1 
ATOM 1369  C CA  . ASN A 1 181 ? 13.672  21.670  -11.933 1.00 22.93 ? 181 ASN A CA  1 
ATOM 1370  C C   . ASN A 1 181 ? 15.187  21.793  -11.699 1.00 22.93 ? 181 ASN A C   1 
ATOM 1371  O O   . ASN A 1 181 ? 15.690  22.857  -11.317 1.00 22.93 ? 181 ASN A O   1 
ATOM 1372  C CB  . ASN A 1 181 ? 12.946  22.506  -10.878 1.00 32.83 ? 181 ASN A CB  1 
ATOM 1373  C CG  . ASN A 1 181 ? 11.614  23.008  -11.360 1.00 32.83 ? 181 ASN A CG  1 
ATOM 1374  O OD1 . ASN A 1 181 ? 11.549  23.867  -12.240 1.00 32.83 ? 181 ASN A OD1 1 
ATOM 1375  N ND2 . ASN A 1 181 ? 10.535  22.472  -10.795 1.00 32.83 ? 181 ASN A ND2 1 
ATOM 1376  N N   . GLY A 1 182 ? 15.904  20.694  -11.920 1.00 31.22 ? 182 GLY A N   1 
ATOM 1377  C CA  . GLY A 1 182 ? 17.342  20.694  -11.738 1.00 31.22 ? 182 GLY A CA  1 
ATOM 1378  C C   . GLY A 1 182 ? 17.802  21.004  -10.326 1.00 31.22 ? 182 GLY A C   1 
ATOM 1379  O O   . GLY A 1 182 ? 18.857  21.608  -10.135 1.00 31.22 ? 182 GLY A O   1 
ATOM 1380  N N   . ILE A 1 183 ? 17.027  20.588  -9.331  1.00 26.53 ? 183 ILE A N   1 
ATOM 1381  C CA  . ILE A 1 183 ? 17.397  20.835  -7.946  1.00 26.53 ? 183 ILE A CA  1 
ATOM 1382  C C   . ILE A 1 183 ? 17.438  19.562  -7.121  1.00 26.53 ? 183 ILE A C   1 
ATOM 1383  O O   . ILE A 1 183 ? 16.452  18.837  -7.023  1.00 26.53 ? 183 ILE A O   1 
ATOM 1384  C CB  . ILE A 1 183 ? 16.443  21.857  -7.311  1.00 8.98  ? 183 ILE A CB  1 
ATOM 1385  C CG1 . ILE A 1 183 ? 16.842  23.243  -7.809  1.00 8.98  ? 183 ILE A CG1 1 
ATOM 1386  C CG2 . ILE A 1 183 ? 16.479  21.781  -5.788  1.00 8.98  ? 183 ILE A CG2 1 
ATOM 1387  C CD1 . ILE A 1 183 ? 16.105  24.357  -7.159  1.00 8.98  ? 183 ILE A CD1 1 
ATOM 1388  N N   . VAL A 1 184 ? 18.595  19.280  -6.537  1.00 27.59 ? 184 VAL A N   1 
ATOM 1389  C CA  . VAL A 1 184 ? 18.738  18.085  -5.727  1.00 27.59 ? 184 VAL A CA  1 
ATOM 1390  C C   . VAL A 1 184 ? 17.933  18.254  -4.448  1.00 27.59 ? 184 VAL A C   1 
ATOM 1391  O O   . VAL A 1 184 ? 18.077  19.242  -3.736  1.00 27.59 ? 184 VAL A O   1 
ATOM 1392  C CB  . VAL A 1 184 ? 20.213  17.816  -5.383  1.00 13.49 ? 184 VAL A CB  1 
ATOM 1393  C CG1 . VAL A 1 184 ? 20.315  16.637  -4.429  1.00 13.49 ? 184 VAL A CG1 1 
ATOM 1394  C CG2 . VAL A 1 184 ? 20.991  17.515  -6.655  1.00 13.49 ? 184 VAL A CG2 1 
ATOM 1395  N N   . PRO A 1 185 ? 17.055  17.290  -4.149  1.00 21.06 ? 185 PRO A N   1 
ATOM 1396  C CA  . PRO A 1 185 ? 16.252  17.401  -2.935  1.00 21.06 ? 185 PRO A CA  1 
ATOM 1397  C C   . PRO A 1 185 ? 16.811  16.626  -1.753  1.00 21.06 ? 185 PRO A C   1 
ATOM 1398  O O   . PRO A 1 185 ? 17.241  15.480  -1.900  1.00 21.06 ? 185 PRO A O   1 
ATOM 1399  C CB  . PRO A 1 185 ? 14.912  16.843  -3.383  1.00 14.10 ? 185 PRO A CB  1 
ATOM 1400  C CG  . PRO A 1 185 ? 15.349  15.685  -4.233  1.00 14.10 ? 185 PRO A CG  1 
ATOM 1401  C CD  . PRO A 1 185 ? 16.494  16.267  -5.054  1.00 14.10 ? 185 PRO A CD  1 
ATOM 1402  N N   . ILE A 1 186 ? 16.821  17.255  -0.584  1.00 17.13 ? 186 ILE A N   1 
ATOM 1403  C CA  . ILE A 1 186 ? 17.270  16.573  0.619   1.00 17.13 ? 186 ILE A CA  1 
ATOM 1404  C C   . ILE A 1 186 ? 15.978  16.077  1.247   1.00 17.13 ? 186 ILE A C   1 
ATOM 1405  O O   . ILE A 1 186 ? 15.116  16.870  1.627   1.00 17.13 ? 186 ILE A O   1 
ATOM 1406  C CB  . ILE A 1 186 ? 17.971  17.514  1.626   1.00 18.04 ? 186 ILE A CB  1 
ATOM 1407  C CG1 . ILE A 1 186 ? 19.316  17.981  1.075   1.00 18.04 ? 186 ILE A CG1 1 
ATOM 1408  C CG2 . ILE A 1 186 ? 18.204  16.782  2.939   1.00 18.04 ? 186 ILE A CG2 1 
ATOM 1409  C CD1 . ILE A 1 186 ? 20.029  18.969  1.973   1.00 18.04 ? 186 ILE A CD1 1 
ATOM 1410  N N   . VAL A 1 187 ? 15.835  14.764  1.328   1.00 18.62 ? 187 VAL A N   1 
ATOM 1411  C CA  . VAL A 1 187 ? 14.647  14.169  1.904   1.00 18.62 ? 187 VAL A CA  1 
ATOM 1412  C C   . VAL A 1 187 ? 14.859  14.051  3.406   1.00 18.62 ? 187 VAL A C   1 
ATOM 1413  O O   . VAL A 1 187 ? 15.655  13.232  3.857   1.00 18.62 ? 187 VAL A O   1 
ATOM 1414  C CB  . VAL A 1 187 ? 14.411  12.777  1.308   1.00 7.91  ? 187 VAL A CB  1 
ATOM 1415  C CG1 . VAL A 1 187 ? 13.162  12.165  1.900   1.00 7.91  ? 187 VAL A CG1 1 
ATOM 1416  C CG2 . VAL A 1 187 ? 14.294  12.879  -0.198  1.00 7.91  ? 187 VAL A CG2 1 
ATOM 1417  N N   . GLU A 1 188 ? 14.141  14.857  4.179   1.00 24.80 ? 188 GLU A N   1 
ATOM 1418  C CA  . GLU A 1 188 ? 14.306  14.834  5.621   1.00 24.80 ? 188 GLU A CA  1 
ATOM 1419  C C   . GLU A 1 188 ? 13.134  14.307  6.441   1.00 24.80 ? 188 GLU A C   1 
ATOM 1420  O O   . GLU A 1 188 ? 12.224  15.056  6.814   1.00 24.80 ? 188 GLU A O   1 
ATOM 1421  C CB  . GLU A 1 188 ? 14.676  16.232  6.120   1.00 28.03 ? 188 GLU A CB  1 
ATOM 1422  C CG  . GLU A 1 188 ? 14.737  16.366  7.639   1.00 28.03 ? 188 GLU A CG  1 
ATOM 1423  C CD  . GLU A 1 188 ? 15.192  17.745  8.082   1.00 28.03 ? 188 GLU A CD  1 
ATOM 1424  O OE1 . GLU A 1 188 ? 15.344  18.629  7.207   1.00 28.03 ? 188 GLU A OE1 1 
ATOM 1425  O OE2 . GLU A 1 188 ? 15.396  17.948  9.303   1.00 28.03 ? 188 GLU A OE2 1 
ATOM 1426  N N   . PRO A 1 189 ? 13.140  13.000  6.729   1.00 20.05 ? 189 PRO A N   1 
ATOM 1427  C CA  . PRO A 1 189 ? 12.082  12.379  7.521   1.00 20.05 ? 189 PRO A CA  1 
ATOM 1428  C C   . PRO A 1 189 ? 12.586  12.336  8.957   1.00 20.05 ? 189 PRO A C   1 
ATOM 1429  O O   . PRO A 1 189 ? 13.095  11.309  9.406   1.00 20.05 ? 189 PRO A O   1 
ATOM 1430  C CB  . PRO A 1 189 ? 11.987  10.992  6.913   1.00 6.48  ? 189 PRO A CB  1 
ATOM 1431  C CG  . PRO A 1 189 ? 13.417  10.674  6.651   1.00 6.48  ? 189 PRO A CG  1 
ATOM 1432  C CD  . PRO A 1 189 ? 13.951  11.973  6.052   1.00 6.48  ? 189 PRO A CD  1 
ATOM 1433  N N   . GLU A 1 190 ? 12.461  13.444  9.680   1.00 26.40 ? 190 GLU A N   1 
ATOM 1434  C CA  . GLU A 1 190 ? 12.956  13.475  11.051  1.00 26.40 ? 190 GLU A CA  1 
ATOM 1435  C C   . GLU A 1 190 ? 12.086  12.829  12.100  1.00 26.40 ? 190 GLU A C   1 
ATOM 1436  O O   . GLU A 1 190 ? 10.969  13.267  12.340  1.00 26.40 ? 190 GLU A O   1 
ATOM 1437  C CB  . GLU A 1 190 ? 13.226  14.900  11.522  1.00 32.39 ? 190 GLU A CB  1 
ATOM 1438  C CG  . GLU A 1 190 ? 13.773  14.911  12.947  1.00 32.39 ? 190 GLU A CG  1 
ATOM 1439  C CD  . GLU A 1 190 ? 14.077  16.297  13.469  1.00 32.39 ? 190 GLU A CD  1 
ATOM 1440  O OE1 . GLU A 1 190 ? 14.348  17.204  12.646  1.00 32.39 ? 190 GLU A OE1 1 
ATOM 1441  O OE2 . GLU A 1 190 ? 14.065  16.471  14.708  1.00 32.39 ? 190 GLU A OE2 1 
ATOM 1442  N N   . ILE A 1 191 ? 12.615  11.800  12.745  1.00 19.98 ? 191 ILE A N   1 
ATOM 1443  C CA  . ILE A 1 191 ? 11.903  11.128  13.817  1.00 19.98 ? 191 ILE A CA  1 
ATOM 1444  C C   . ILE A 1 191 ? 12.394  11.773  15.116  1.00 19.98 ? 191 ILE A C   1 
ATOM 1445  O O   . ILE A 1 191 ? 13.497  11.487  15.569  1.00 19.98 ? 191 ILE A O   1 
ATOM 1446  C CB  . ILE A 1 191 ? 12.238  9.630   13.846  1.00 8.06  ? 191 ILE A CB  1 
ATOM 1447  C CG1 . ILE A 1 191 ? 11.715  8.957   12.579  1.00 8.06  ? 191 ILE A CG1 1 
ATOM 1448  C CG2 . ILE A 1 191 ? 11.659  8.990   15.096  1.00 8.06  ? 191 ILE A CG2 1 
ATOM 1449  C CD1 . ILE A 1 191 ? 11.951  7.462   12.540  1.00 8.06  ? 191 ILE A CD1 1 
ATOM 1450  N N   . LEU A 1 192 ? 11.589  12.650  15.708  1.00 24.06 ? 192 LEU A N   1 
ATOM 1451  C CA  . LEU A 1 192 ? 11.969  13.331  16.950  1.00 24.06 ? 192 LEU A CA  1 
ATOM 1452  C C   . LEU A 1 192 ? 12.439  12.395  18.057  1.00 24.06 ? 192 LEU A C   1 
ATOM 1453  O O   . LEU A 1 192 ? 12.016  11.243  18.130  1.00 24.06 ? 192 LEU A O   1 
ATOM 1454  C CB  . LEU A 1 192 ? 10.801  14.145  17.497  1.00 20.04 ? 192 LEU A CB  1 
ATOM 1455  C CG  . LEU A 1 192 ? 10.250  15.257  16.614  1.00 20.04 ? 192 LEU A CG  1 
ATOM 1456  C CD1 . LEU A 1 192 ? 9.022   15.847  17.281  1.00 20.04 ? 192 LEU A CD1 1 
ATOM 1457  C CD2 . LEU A 1 192 ? 11.311  16.315  16.381  1.00 20.04 ? 192 LEU A CD2 1 
ATOM 1458  N N   . PRO A 1 193 ? 13.303  12.899  18.952  1.00 29.20 ? 193 PRO A N   1 
ATOM 1459  C CA  . PRO A 1 193 ? 13.888  12.195  20.096  1.00 29.20 ? 193 PRO A CA  1 
ATOM 1460  C C   . PRO A 1 193 ? 13.002  12.227  21.330  1.00 29.20 ? 193 PRO A C   1 
ATOM 1461  O O   . PRO A 1 193 ? 13.216  11.462  22.262  1.00 29.20 ? 193 PRO A O   1 
ATOM 1462  C CB  . PRO A 1 193 ? 15.182  12.957  20.363  1.00 25.20 ? 193 PRO A CB  1 
ATOM 1463  C CG  . PRO A 1 193 ? 15.348  13.876  19.169  1.00 25.20 ? 193 PRO A CG  1 
ATOM 1464  C CD  . PRO A 1 193 ? 13.953  14.203  18.778  1.00 25.20 ? 193 PRO A CD  1 
ATOM 1465  N N   . ASP A 1 194 ? 12.025  13.127  21.352  1.00 34.70 ? 194 ASP A N   1 
ATOM 1466  C CA  . ASP A 1 194 ? 11.138  13.241  22.503  1.00 34.70 ? 194 ASP A CA  1 
ATOM 1467  C C   . ASP A 1 194 ? 10.596  11.889  22.912  1.00 34.70 ? 194 ASP A C   1 
ATOM 1468  O O   . ASP A 1 194 ? 10.200  11.089  22.065  1.00 34.70 ? 194 ASP A O   1 
ATOM 1469  C CB  . ASP A 1 194 ? 9.973   14.164  22.186  1.00 54.31 ? 194 ASP A CB  1 
ATOM 1470  C CG  . ASP A 1 194 ? 10.414  15.426  21.504  1.00 54.31 ? 194 ASP A CG  1 
ATOM 1471  O OD1 . ASP A 1 194 ? 11.384  16.055  21.979  1.00 54.31 ? 194 ASP A OD1 1 
ATOM 1472  O OD2 . ASP A 1 194 ? 9.788   15.790  20.493  1.00 54.31 ? 194 ASP A OD2 1 
ATOM 1473  N N   . GLY A 1 195 ? 10.579  11.639  24.214  1.00 31.22 ? 195 GLY A N   1 
ATOM 1474  C CA  . GLY A 1 195 ? 10.074  10.374  24.711  1.00 31.22 ? 195 GLY A CA  1 
ATOM 1475  C C   . GLY A 1 195 ? 11.088  9.681   25.595  1.00 31.22 ? 195 GLY A C   1 
ATOM 1476  O O   . GLY A 1 195 ? 12.214  10.154  25.740  1.00 31.22 ? 195 GLY A O   1 
ATOM 1477  N N   . ASP A 1 196 ? 10.690  8.563   26.193  1.00 42.04 ? 196 ASP A N   1 
ATOM 1478  C CA  . ASP A 1 196 ? 11.581  7.803   27.055  1.00 42.04 ? 196 ASP A CA  1 
ATOM 1479  C C   . ASP A 1 196 ? 11.920  6.448   26.438  1.00 42.04 ? 196 ASP A C   1 
ATOM 1480  O O   . ASP A 1 196 ? 12.286  5.519   27.152  1.00 42.04 ? 196 ASP A O   1 
ATOM 1481  C CB  . ASP A 1 196 ? 10.948  7.589   28.435  1.00 69.84 ? 196 ASP A CB  1 
ATOM 1482  C CG  . ASP A 1 196 ? 9.615   6.847   28.371  1.00 69.84 ? 196 ASP A CG  1 
ATOM 1483  O OD1 . ASP A 1 196 ? 9.186   6.315   29.417  1.00 69.84 ? 196 ASP A OD1 1 
ATOM 1484  O OD2 . ASP A 1 196 ? 8.986   6.800   27.291  1.00 69.84 ? 196 ASP A OD2 1 
ATOM 1485  N N   . HIS A 1 197 ? 11.799  6.336   25.115  1.00 33.73 ? 197 HIS A N   1 
ATOM 1486  C CA  . HIS A 1 197 ? 12.095  5.081   24.419  1.00 33.73 ? 197 HIS A CA  1 
ATOM 1487  C C   . HIS A 1 197 ? 13.599  4.810   24.365  1.00 33.73 ? 197 HIS A C   1 
ATOM 1488  O O   . HIS A 1 197 ? 14.406  5.740   24.338  1.00 33.73 ? 197 HIS A O   1 
ATOM 1489  C CB  . HIS A 1 197 ? 11.540  5.121   22.995  1.00 32.36 ? 197 HIS A CB  1 
ATOM 1490  C CG  . HIS A 1 197 ? 11.977  6.319   22.217  1.00 32.36 ? 197 HIS A CG  1 
ATOM 1491  N ND1 . HIS A 1 197 ? 11.338  7.537   22.308  1.00 32.36 ? 197 HIS A ND1 1 
ATOM 1492  C CD2 . HIS A 1 197 ? 13.029  6.507   21.384  1.00 32.36 ? 197 HIS A CD2 1 
ATOM 1493  C CE1 . HIS A 1 197 ? 11.981  8.424   21.567  1.00 32.36 ? 197 HIS A CE1 1 
ATOM 1494  N NE2 . HIS A 1 197 ? 13.011  7.825   20.997  1.00 32.36 ? 197 HIS A NE2 1 
ATOM 1495  N N   . ASP A 1 198 ? 13.971  3.533   24.334  1.00 35.01 ? 198 ASP A N   1 
ATOM 1496  C CA  . ASP A 1 198 ? 15.379  3.153   24.297  1.00 35.01 ? 198 ASP A CA  1 
ATOM 1497  C C   . ASP A 1 198 ? 15.904  3.093   22.872  1.00 35.01 ? 198 ASP A C   1 
ATOM 1498  O O   . ASP A 1 198 ? 15.138  3.176   21.919  1.00 35.01 ? 198 ASP A O   1 
ATOM 1499  C CB  . ASP A 1 198 ? 15.572  1.797   24.964  1.00 49.85 ? 198 ASP A CB  1 
ATOM 1500  C CG  . ASP A 1 198 ? 15.065  0.663   24.116  1.00 49.85 ? 198 ASP A CG  1 
ATOM 1501  O OD1 . ASP A 1 198 ? 13.931  0.757   23.608  1.00 49.85 ? 198 ASP A OD1 1 
ATOM 1502  O OD2 . ASP A 1 198 ? 15.805  -0.327  23.964  1.00 49.85 ? 198 ASP A OD2 1 
ATOM 1503  N N   . LEU A 1 199 ? 17.217  2.933   22.733  1.00 28.78 ? 199 LEU A N   1 
ATOM 1504  C CA  . LEU A 1 199 ? 17.839  2.874   21.420  1.00 28.78 ? 199 LEU A CA  1 
ATOM 1505  C C   . LEU A 1 199 ? 17.157  1.860   20.495  1.00 28.78 ? 199 LEU A C   1 
ATOM 1506  O O   . LEU A 1 199 ? 16.852  2.181   19.346  1.00 28.78 ? 199 LEU A O   1 
ATOM 1507  C CB  . LEU A 1 199 ? 19.326  2.543   21.557  1.00 20.66 ? 199 LEU A CB  1 
ATOM 1508  C CG  . LEU A 1 199 ? 20.150  2.729   20.277  1.00 20.66 ? 199 LEU A CG  1 
ATOM 1509  C CD1 . LEU A 1 199 ? 20.186  4.204   19.893  1.00 20.66 ? 199 LEU A CD1 1 
ATOM 1510  C CD2 . LEU A 1 199 ? 21.557  2.214   20.493  1.00 20.66 ? 199 LEU A CD2 1 
ATOM 1511  N N   . LYS A 1 200 ? 16.919  0.646   20.993  1.00 26.01 ? 200 LYS A N   1 
ATOM 1512  C CA  . LYS A 1 200 ? 16.259  -0.400  20.201  1.00 26.01 ? 200 LYS A CA  1 
ATOM 1513  C C   . LYS A 1 200 ? 15.046  0.150   19.451  1.00 26.01 ? 200 LYS A C   1 
ATOM 1514  O O   . LYS A 1 200 ? 14.956  0.044   18.227  1.00 26.01 ? 200 LYS A O   1 
ATOM 1515  C CB  . LYS A 1 200 ? 15.776  -1.544  21.099  1.00 79.37 ? 200 LYS A CB  1 
ATOM 1516  C CG  . LYS A 1 200 ? 16.835  -2.541  21.535  1.00 79.37 ? 200 LYS A CG  1 
ATOM 1517  C CD  . LYS A 1 200 ? 16.334  -3.418  22.705  1.00 79.37 ? 200 LYS A CD  1 
ATOM 1518  C CE  . LYS A 1 200 ? 15.162  -4.337  22.329  1.00 79.37 ? 200 LYS A CE  1 
ATOM 1519  N NZ  . LYS A 1 200 ? 15.554  -5.491  21.454  1.00 79.37 ? 200 LYS A NZ  1 
ATOM 1520  N N   . ARG A 1 201 ? 14.115  0.741   20.192  1.00 30.17 ? 201 ARG A N   1 
ATOM 1521  C CA  . ARG A 1 201 ? 12.897  1.271   19.593  1.00 30.17 ? 201 ARG A CA  1 
ATOM 1522  C C   . ARG A 1 201 ? 13.132  2.317   18.514  1.00 30.17 ? 201 ARG A C   1 
ATOM 1523  O O   . ARG A 1 201 ? 12.500  2.280   17.455  1.00 30.17 ? 201 ARG A O   1 
ATOM 1524  C CB  . ARG A 1 201 ? 11.976  1.848   20.671  1.00 43.66 ? 201 ARG A CB  1 
ATOM 1525  C CG  . ARG A 1 201 ? 10.652  2.323   20.117  1.00 43.66 ? 201 ARG A CG  1 
ATOM 1526  C CD  . ARG A 1 201 ? 9.608   2.532   21.203  1.00 43.66 ? 201 ARG A CD  1 
ATOM 1527  N NE  . ARG A 1 201 ? 8.337   2.965   20.629  1.00 43.66 ? 201 ARG A NE  1 
ATOM 1528  C CZ  . ARG A 1 201 ? 7.705   2.314   19.656  1.00 43.66 ? 201 ARG A CZ  1 
ATOM 1529  N NH1 . ARG A 1 201 ? 8.228   1.193   19.153  1.00 43.66 ? 201 ARG A NH1 1 
ATOM 1530  N NH2 . ARG A 1 201 ? 6.560   2.793   19.171  1.00 43.66 ? 201 ARG A NH2 1 
ATOM 1531  N N   . CYS A 1 202 ? 14.032  3.256   18.773  1.00 24.69 ? 202 CYS A N   1 
ATOM 1532  C CA  . CYS A 1 202 ? 14.299  4.285   17.787  1.00 24.69 ? 202 CYS A CA  1 
ATOM 1533  C C   . CYS A 1 202 ? 14.825  3.666   16.507  1.00 24.69 ? 202 CYS A C   1 
ATOM 1534  O O   . CYS A 1 202 ? 14.505  4.116   15.405  1.00 24.69 ? 202 CYS A O   1 
ATOM 1535  C CB  . CYS A 1 202 ? 15.319  5.282   18.302  1.00 24.08 ? 202 CYS A CB  1 
ATOM 1536  S SG  . CYS A 1 202 ? 15.732  6.476   17.037  1.00 24.08 ? 202 CYS A SG  1 
ATOM 1537  N N   . GLN A 1 203 ? 15.642  2.632   16.647  1.00 19.99 ? 203 GLN A N   1 
ATOM 1538  C CA  . GLN A 1 203 ? 16.185  1.986   15.475  1.00 19.99 ? 203 GLN A CA  1 
ATOM 1539  C C   . GLN A 1 203 ? 15.038  1.359   14.691  1.00 19.99 ? 203 GLN A C   1 
ATOM 1540  O O   . GLN A 1 203 ? 14.935  1.527   13.475  1.00 19.99 ? 203 GLN A O   1 
ATOM 1541  C CB  . GLN A 1 203 ? 17.181  0.916   15.876  1.00 22.48 ? 203 GLN A CB  1 
ATOM 1542  C CG  . GLN A 1 203 ? 18.129  0.574   14.761  1.00 22.48 ? 203 GLN A CG  1 
ATOM 1543  C CD  . GLN A 1 203 ? 18.834  -0.728  14.995  1.00 22.48 ? 203 GLN A CD  1 
ATOM 1544  O OE1 . GLN A 1 203 ? 19.396  -0.957  16.063  1.00 22.48 ? 203 GLN A OE1 1 
ATOM 1545  N NE2 . GLN A 1 203 ? 18.812  -1.596  13.999  1.00 22.48 ? 203 GLN A NE2 1 
ATOM 1546  N N   . TYR A 1 204 ? 14.170  0.649   15.404  1.00 23.48 ? 204 TYR A N   1 
ATOM 1547  C CA  . TYR A 1 204 ? 13.017  -0.014  14.800  1.00 23.48 ? 204 TYR A CA  1 
ATOM 1548  C C   . TYR A 1 204 ? 12.191  0.975   13.992  1.00 23.48 ? 204 TYR A C   1 
ATOM 1549  O O   . TYR A 1 204 ? 11.988  0.810   12.785  1.00 23.48 ? 204 TYR A O   1 
ATOM 1550  C CB  . TYR A 1 204 ? 12.131  -0.615  15.886  1.00 30.69 ? 204 TYR A CB  1 
ATOM 1551  C CG  . TYR A 1 204 ? 11.005  -1.457  15.346  1.00 30.69 ? 204 TYR A CG  1 
ATOM 1552  C CD1 . TYR A 1 204 ? 11.202  -2.802  15.036  1.00 30.69 ? 204 TYR A CD1 1 
ATOM 1553  C CD2 . TYR A 1 204 ? 9.747   -0.907  15.113  1.00 30.69 ? 204 TYR A CD2 1 
ATOM 1554  C CE1 . TYR A 1 204 ? 10.174  -3.586  14.503  1.00 30.69 ? 204 TYR A CE1 1 
ATOM 1555  C CE2 . TYR A 1 204 ? 8.708   -1.679  14.576  1.00 30.69 ? 204 TYR A CE2 1 
ATOM 1556  C CZ  . TYR A 1 204 ? 8.929   -3.018  14.272  1.00 30.69 ? 204 TYR A CZ  1 
ATOM 1557  O OH  . TYR A 1 204 ? 7.913   -3.783  13.729  1.00 30.69 ? 204 TYR A OH  1 
ATOM 1558  N N   . VAL A 1 205 ? 11.707  2.003   14.675  1.00 16.35 ? 205 VAL A N   1 
ATOM 1559  C CA  . VAL A 1 205 ? 10.900  3.018   14.032  1.00 16.35 ? 205 VAL A CA  1 
ATOM 1560  C C   . VAL A 1 205 ? 11.646  3.645   12.862  1.00 16.35 ? 205 VAL A C   1 
ATOM 1561  O O   . VAL A 1 205 ? 11.071  3.834   11.786  1.00 16.35 ? 205 VAL A O   1 
ATOM 1562  C CB  . VAL A 1 205 ? 10.510  4.118   15.026  1.00 10.15 ? 205 VAL A CB  1 
ATOM 1563  C CG1 . VAL A 1 205 ? 9.628   5.147   14.344  1.00 10.15 ? 205 VAL A CG1 1 
ATOM 1564  C CG2 . VAL A 1 205 ? 9.796   3.505   16.219  1.00 10.15 ? 205 VAL A CG2 1 
ATOM 1565  N N   . THR A 1 206 ? 12.923  3.965   13.057  1.00 18.27 ? 206 THR A N   1 
ATOM 1566  C CA  . THR A 1 206 ? 13.697  4.572   11.981  1.00 18.27 ? 206 THR A CA  1 
ATOM 1567  C C   . THR A 1 206 ? 13.720  3.663   10.765  1.00 18.27 ? 206 THR A C   1 
ATOM 1568  O O   . THR A 1 206 ? 13.554  4.117   9.633   1.00 18.27 ? 206 THR A O   1 
ATOM 1569  C CB  . THR A 1 206 ? 15.142  4.859   12.404  1.00 14.74 ? 206 THR A CB  1 
ATOM 1570  O OG1 . THR A 1 206 ? 15.167  6.005   13.266  1.00 14.74 ? 206 THR A OG1 1 
ATOM 1571  C CG2 . THR A 1 206 ? 16.001  5.137   11.180  1.00 14.74 ? 206 THR A CG2 1 
ATOM 1572  N N   . GLU A 1 207 ? 13.921  2.374   11.000  1.00 23.76 ? 207 GLU A N   1 
ATOM 1573  C CA  . GLU A 1 207 ? 13.957  1.426   9.906   1.00 23.76 ? 207 GLU A CA  1 
ATOM 1574  C C   . GLU A 1 207 ? 12.636  1.383   9.152   1.00 23.76 ? 207 GLU A C   1 
ATOM 1575  O O   . GLU A 1 207 ? 12.627  1.400   7.918   1.00 23.76 ? 207 GLU A O   1 
ATOM 1576  C CB  . GLU A 1 207 ? 14.308  0.044   10.429  1.00 34.23 ? 207 GLU A CB  1 
ATOM 1577  C CG  . GLU A 1 207 ? 15.766  -0.108  10.769  1.00 34.23 ? 207 GLU A CG  1 
ATOM 1578  C CD  . GLU A 1 207 ? 16.068  -1.448  11.399  1.00 34.23 ? 207 GLU A CD  1 
ATOM 1579  O OE1 . GLU A 1 207 ? 15.570  -2.475  10.894  1.00 34.23 ? 207 GLU A OE1 1 
ATOM 1580  O OE2 . GLU A 1 207 ? 16.809  -1.479  12.399  1.00 34.23 ? 207 GLU A OE2 1 
ATOM 1581  N N   . LYS A 1 208 ? 11.521  1.339   9.878   1.00 18.12 ? 208 LYS A N   1 
ATOM 1582  C CA  . LYS A 1 208 ? 10.213  1.294   9.228   1.00 18.12 ? 208 LYS A CA  1 
ATOM 1583  C C   . LYS A 1 208 ? 9.916   2.573   8.451   1.00 18.12 ? 208 LYS A C   1 
ATOM 1584  O O   . LYS A 1 208 ? 9.421   2.526   7.325   1.00 18.12 ? 208 LYS A O   1 
ATOM 1585  C CB  . LYS A 1 208 ? 9.118   1.055   10.260  1.00 18.33 ? 208 LYS A CB  1 
ATOM 1586  C CG  . LYS A 1 208 ? 9.253   -0.268  10.995  1.00 18.33 ? 208 LYS A CG  1 
ATOM 1587  C CD  . LYS A 1 208 ? 9.125   -1.468  10.055  1.00 18.33 ? 208 LYS A CD  1 
ATOM 1588  C CE  . LYS A 1 208 ? 9.418   -2.783  10.787  1.00 18.33 ? 208 LYS A CE  1 
ATOM 1589  N NZ  . LYS A 1 208 ? 9.552   -3.943  9.854   1.00 18.33 ? 208 LYS A NZ  1 
ATOM 1590  N N   . VAL A 1 209 ? 10.219  3.717   9.050   1.00 14.97 ? 209 VAL A N   1 
ATOM 1591  C CA  . VAL A 1 209 ? 9.971   4.984   8.386   1.00 14.97 ? 209 VAL A CA  1 
ATOM 1592  C C   . VAL A 1 209 ? 10.780  5.069   7.099   1.00 14.97 ? 209 VAL A C   1 
ATOM 1593  O O   . VAL A 1 209 ? 10.237  5.346   6.033   1.00 14.97 ? 209 VAL A O   1 
ATOM 1594  C CB  . VAL A 1 209 ? 10.331  6.178   9.297   1.00 8.37  ? 209 VAL A CB  1 
ATOM 1595  C CG1 . VAL A 1 209 ? 10.340  7.474   8.496   1.00 8.37  ? 209 VAL A CG1 1 
ATOM 1596  C CG2 . VAL A 1 209 ? 9.332   6.274   10.434  1.00 8.37  ? 209 VAL A CG2 1 
ATOM 1597  N N   . LEU A 1 210 ? 12.079  4.825   7.184   1.00 22.31 ? 210 LEU A N   1 
ATOM 1598  C CA  . LEU A 1 210 ? 12.897  4.899   5.985   1.00 22.31 ? 210 LEU A CA  1 
ATOM 1599  C C   . LEU A 1 210 ? 12.400  3.925   4.916   1.00 22.31 ? 210 LEU A C   1 
ATOM 1600  O O   . LEU A 1 210 ? 12.248  4.298   3.750   1.00 22.31 ? 210 LEU A O   1 
ATOM 1601  C CB  . LEU A 1 210 ? 14.364  4.635   6.329   1.00 15.58 ? 210 LEU A CB  1 
ATOM 1602  C CG  . LEU A 1 210 ? 15.029  5.778   7.096   1.00 15.58 ? 210 LEU A CG  1 
ATOM 1603  C CD1 . LEU A 1 210 ? 16.443  5.402   7.443   1.00 15.58 ? 210 LEU A CD1 1 
ATOM 1604  C CD2 . LEU A 1 210 ? 15.021  7.038   6.258   1.00 15.58 ? 210 LEU A CD2 1 
ATOM 1605  N N   . ALA A 1 211 ? 12.125  2.687   5.313   1.00 16.85 ? 211 ALA A N   1 
ATOM 1606  C CA  . ALA A 1 211 ? 11.638  1.690   4.365   1.00 16.85 ? 211 ALA A CA  1 
ATOM 1607  C C   . ALA A 1 211 ? 10.444  2.223   3.570   1.00 16.85 ? 211 ALA A C   1 
ATOM 1608  O O   . ALA A 1 211 ? 10.306  1.965   2.376   1.00 16.85 ? 211 ALA A O   1 
ATOM 1609  C CB  . ALA A 1 211 ? 11.249  0.420   5.101   1.00 8.98  ? 211 ALA A CB  1 
ATOM 1610  N N   . ALA A 1 212 ? 9.580   2.971   4.241   1.00 22.83 ? 212 ALA A N   1 
ATOM 1611  C CA  . ALA A 1 212 ? 8.413   3.530   3.591   1.00 22.83 ? 212 ALA A CA  1 
ATOM 1612  C C   . ALA A 1 212 ? 8.829   4.673   2.686   1.00 22.83 ? 212 ALA A C   1 
ATOM 1613  O O   . ALA A 1 212 ? 8.372   4.783   1.549   1.00 22.83 ? 212 ALA A O   1 
ATOM 1614  C CB  . ALA A 1 212 ? 7.448   4.029   4.627   1.00 2.35  ? 212 ALA A CB  1 
ATOM 1615  N N   . VAL A 1 213 ? 9.692   5.534   3.207   1.00 20.50 ? 213 VAL A N   1 
ATOM 1616  C CA  . VAL A 1 213 ? 10.168  6.678   2.453   1.00 20.50 ? 213 VAL A CA  1 
ATOM 1617  C C   . VAL A 1 213 ? 10.757  6.286   1.109   1.00 20.50 ? 213 VAL A C   1 
ATOM 1618  O O   . VAL A 1 213 ? 10.465  6.918   0.094   1.00 20.50 ? 213 VAL A O   1 
ATOM 1619  C CB  . VAL A 1 213 ? 11.250  7.445   3.221   1.00 9.25  ? 213 VAL A CB  1 
ATOM 1620  C CG1 . VAL A 1 213 ? 11.801  8.550   2.357   1.00 9.25  ? 213 VAL A CG1 1 
ATOM 1621  C CG2 . VAL A 1 213 ? 10.675  8.013   4.496   1.00 9.25  ? 213 VAL A CG2 1 
ATOM 1622  N N   . TYR A 1 214 ? 11.589  5.250   1.082   1.00 23.73 ? 214 TYR A N   1 
ATOM 1623  C CA  . TYR A 1 214 ? 12.185  4.883   -0.190  1.00 23.73 ? 214 TYR A CA  1 
ATOM 1624  C C   . TYR A 1 214 ? 11.218  4.219   -1.144  1.00 23.73 ? 214 TYR A C   1 
ATOM 1625  O O   . TYR A 1 214 ? 11.310  4.424   -2.358  1.00 23.73 ? 214 TYR A O   1 
ATOM 1626  C CB  . TYR A 1 214 ? 13.471  4.059   0.009   1.00 17.25 ? 214 TYR A CB  1 
ATOM 1627  C CG  . TYR A 1 214 ? 14.671  4.970   0.253   1.00 17.25 ? 214 TYR A CG  1 
ATOM 1628  C CD1 . TYR A 1 214 ? 15.142  5.215   1.547   1.00 17.25 ? 214 TYR A CD1 1 
ATOM 1629  C CD2 . TYR A 1 214 ? 15.220  5.726   -0.794  1.00 17.25 ? 214 TYR A CD2 1 
ATOM 1630  C CE1 . TYR A 1 214 ? 16.107  6.193   1.795   1.00 17.25 ? 214 TYR A CE1 1 
ATOM 1631  C CE2 . TYR A 1 214 ? 16.181  6.707   -0.552  1.00 17.25 ? 214 TYR A CE2 1 
ATOM 1632  C CZ  . TYR A 1 214 ? 16.614  6.939   0.747   1.00 17.25 ? 214 TYR A CZ  1 
ATOM 1633  O OH  . TYR A 1 214 ? 17.515  7.952   1.003   1.00 17.25 ? 214 TYR A OH  1 
ATOM 1634  N N   . LYS A 1 215 ? 10.271  3.453   -0.612  1.00 22.22 ? 215 LYS A N   1 
ATOM 1635  C CA  . LYS A 1 215 ? 9.283   2.813   -1.476  1.00 22.22 ? 215 LYS A CA  1 
ATOM 1636  C C   . LYS A 1 215 ? 8.475   3.918   -2.144  1.00 22.22 ? 215 LYS A C   1 
ATOM 1637  O O   . LYS A 1 215 ? 8.110   3.813   -3.308  1.00 22.22 ? 215 LYS A O   1 
ATOM 1638  C CB  . LYS A 1 215 ? 8.352   1.912   -0.666  1.00 13.12 ? 215 LYS A CB  1 
ATOM 1639  C CG  . LYS A 1 215 ? 7.147   1.378   -1.450  1.00 13.12 ? 215 LYS A CG  1 
ATOM 1640  C CD  . LYS A 1 215 ? 7.547   0.600   -2.699  1.00 13.12 ? 215 LYS A CD  1 
ATOM 1641  C CE  . LYS A 1 215 ? 6.390   -0.233  -3.254  1.00 13.12 ? 215 LYS A CE  1 
ATOM 1642  N NZ  . LYS A 1 215 ? 5.195   0.562   -3.686  1.00 13.12 ? 215 LYS A NZ  1 
ATOM 1643  N N   . ALA A 1 216 ? 8.211   4.982   -1.393  1.00 16.45 ? 216 ALA A N   1 
ATOM 1644  C CA  . ALA A 1 216 ? 7.459   6.122   -1.903  1.00 16.45 ? 216 ALA A CA  1 
ATOM 1645  C C   . ALA A 1 216 ? 8.244   6.775   -3.025  1.00 16.45 ? 216 ALA A C   1 
ATOM 1646  O O   . ALA A 1 216 ? 7.716   7.015   -4.114  1.00 16.45 ? 216 ALA A O   1 
ATOM 1647  C CB  . ALA A 1 216 ? 7.210   7.132   -0.786  1.00 5.94  ? 216 ALA A CB  1 
ATOM 1648  N N   . LEU A 1 217 ? 9.509   7.069   -2.755  1.00 13.94 ? 217 LEU A N   1 
ATOM 1649  C CA  . LEU A 1 217 ? 10.344  7.688   -3.760  1.00 13.94 ? 217 LEU A CA  1 
ATOM 1650  C C   . LEU A 1 217 ? 10.282  6.862   -5.027  1.00 13.94 ? 217 LEU A C   1 
ATOM 1651  O O   . LEU A 1 217 ? 10.167  7.415   -6.117  1.00 13.94 ? 217 LEU A O   1 
ATOM 1652  C CB  . LEU A 1 217 ? 11.774  7.789   -3.264  1.00 10.86 ? 217 LEU A CB  1 
ATOM 1653  C CG  . LEU A 1 217 ? 11.951  8.863   -2.196  1.00 10.86 ? 217 LEU A CG  1 
ATOM 1654  C CD1 . LEU A 1 217 ? 13.355  8.797   -1.638  1.00 10.86 ? 217 LEU A CD1 1 
ATOM 1655  C CD2 . LEU A 1 217 ? 11.673  10.235  -2.805  1.00 10.86 ? 217 LEU A CD2 1 
ATOM 1656  N N   . SER A 1 218 ? 10.342  5.538   -4.889  1.00 11.83 ? 218 SER A N   1 
ATOM 1657  C CA  . SER A 1 218 ? 10.270  4.665   -6.055  1.00 11.83 ? 218 SER A CA  1 
ATOM 1658  C C   . SER A 1 218 ? 8.978   4.894   -6.817  1.00 11.83 ? 218 SER A C   1 
ATOM 1659  O O   . SER A 1 218 ? 8.982   5.106   -8.028  1.00 11.83 ? 218 SER A O   1 
ATOM 1660  C CB  . SER A 1 218 ? 10.323  3.198   -5.649  1.00 16.54 ? 218 SER A CB  1 
ATOM 1661  O OG  . SER A 1 218 ? 9.956   2.383   -6.753  1.00 16.54 ? 218 SER A OG  1 
ATOM 1662  N N   . ASP A 1 219 ? 7.871   4.838   -6.087  1.00 25.77 ? 219 ASP A N   1 
ATOM 1663  C CA  . ASP A 1 219 ? 6.553   5.025   -6.662  1.00 25.77 ? 219 ASP A CA  1 
ATOM 1664  C C   . ASP A 1 219 ? 6.438   6.323   -7.441  1.00 25.77 ? 219 ASP A C   1 
ATOM 1665  O O   . ASP A 1 219 ? 5.779   6.369   -8.488  1.00 25.77 ? 219 ASP A O   1 
ATOM 1666  C CB  . ASP A 1 219 ? 5.504   5.001   -5.560  1.00 24.91 ? 219 ASP A CB  1 
ATOM 1667  C CG  . ASP A 1 219 ? 5.432   3.661   -4.864  1.00 24.91 ? 219 ASP A CG  1 
ATOM 1668  O OD1 . ASP A 1 219 ? 6.211   2.755   -5.247  1.00 24.91 ? 219 ASP A OD1 1 
ATOM 1669  O OD2 . ASP A 1 219 ? 4.596   3.515   -3.940  1.00 24.91 ? 219 ASP A OD2 1 
ATOM 1670  N N   . HIS A 1 220 ? 7.080   7.373   -6.938  1.00 22.47 ? 220 HIS A N   1 
ATOM 1671  C CA  . HIS A 1 220 ? 7.020   8.667   -7.595  1.00 22.47 ? 220 HIS A CA  1 
ATOM 1672  C C   . HIS A 1 220 ? 8.101   8.897   -8.629  1.00 22.47 ? 220 HIS A C   1 
ATOM 1673  O O   . HIS A 1 220 ? 8.245   10.009  -9.157  1.00 22.47 ? 220 HIS A O   1 
ATOM 1674  C CB  . HIS A 1 220 ? 7.047   9.762   -6.551  1.00 21.63 ? 220 HIS A CB  1 
ATOM 1675  C CG  . HIS A 1 220 ? 5.772   9.864   -5.784  1.00 21.63 ? 220 HIS A CG  1 
ATOM 1676  N ND1 . HIS A 1 220 ? 4.838   10.850  -6.023  1.00 21.63 ? 220 HIS A ND1 1 
ATOM 1677  C CD2 . HIS A 1 220 ? 5.249   9.073   -4.819  1.00 21.63 ? 220 HIS A CD2 1 
ATOM 1678  C CE1 . HIS A 1 220 ? 3.795   10.660  -5.235  1.00 21.63 ? 220 HIS A CE1 1 
ATOM 1679  N NE2 . HIS A 1 220 ? 4.019   9.588   -4.496  1.00 21.63 ? 220 HIS A NE2 1 
ATOM 1680  N N   . HIS A 1 221 ? 8.849   7.839   -8.921  1.00 19.85 ? 221 HIS A N   1 
ATOM 1681  C CA  . HIS A 1 221 ? 9.911   7.893   -9.910  1.00 19.85 ? 221 HIS A CA  1 
ATOM 1682  C C   . HIS A 1 221 ? 11.024  8.876   -9.572  1.00 19.85 ? 221 HIS A C   1 
ATOM 1683  O O   . HIS A 1 221 ? 11.583  9.503   -10.472 1.00 19.85 ? 221 HIS A O   1 
ATOM 1684  C CB  . HIS A 1 221 ? 9.337   8.270   -11.267 1.00 24.27 ? 221 HIS A CB  1 
ATOM 1685  C CG  . HIS A 1 221 ? 8.094   7.522   -11.629 1.00 24.27 ? 221 HIS A CG  1 
ATOM 1686  N ND1 . HIS A 1 221 ? 8.009   6.146   -11.570 1.00 24.27 ? 221 HIS A ND1 1 
ATOM 1687  C CD2 . HIS A 1 221 ? 6.898   7.956   -12.094 1.00 24.27 ? 221 HIS A CD2 1 
ATOM 1688  C CE1 . HIS A 1 221 ? 6.814   5.765   -11.986 1.00 24.27 ? 221 HIS A CE1 1 
ATOM 1689  N NE2 . HIS A 1 221 ? 6.121   6.844   -12.310 1.00 24.27 ? 221 HIS A NE2 1 
ATOM 1690  N N   . VAL A 1 222 ? 11.340  9.031   -8.289  1.00 22.71 ? 222 VAL A N   1 
ATOM 1691  C CA  . VAL A 1 222 ? 12.411  9.937   -7.887  1.00 22.71 ? 222 VAL A CA  1 
ATOM 1692  C C   . VAL A 1 222 ? 13.760  9.291   -8.208  1.00 22.71 ? 222 VAL A C   1 
ATOM 1693  O O   . VAL A 1 222 ? 13.950  8.098   -7.979  1.00 22.71 ? 222 VAL A O   1 
ATOM 1694  C CB  . VAL A 1 222 ? 12.341  10.251  -6.385  1.00 23.77 ? 222 VAL A CB  1 
ATOM 1695  C CG1 . VAL A 1 222 ? 13.606  10.947  -5.944  1.00 23.77 ? 222 VAL A CG1 1 
ATOM 1696  C CG2 . VAL A 1 222 ? 11.148  11.142  -6.104  1.00 23.77 ? 222 VAL A CG2 1 
ATOM 1697  N N   . TYR A 1 223 ? 14.679  10.088  -8.750  1.00 27.30 ? 223 TYR A N   1 
ATOM 1698  C CA  . TYR A 1 223 ? 16.027  9.648   -9.137  1.00 27.30 ? 223 TYR A CA  1 
ATOM 1699  C C   . TYR A 1 223 ? 16.898  9.608   -7.887  1.00 27.30 ? 223 TYR A C   1 
ATOM 1700  O O   . TYR A 1 223 ? 17.408  10.638  -7.448  1.00 27.30 ? 223 TYR A O   1 
ATOM 1701  C CB  . TYR A 1 223 ? 16.578  10.651  -10.152 1.00 31.60 ? 223 TYR A CB  1 
ATOM 1702  C CG  . TYR A 1 223 ? 17.968  10.402  -10.685 1.00 31.60 ? 223 TYR A CG  1 
ATOM 1703  C CD1 . TYR A 1 223 ? 18.266  9.262   -11.424 1.00 31.60 ? 223 TYR A CD1 1 
ATOM 1704  C CD2 . TYR A 1 223 ? 18.970  11.352  -10.509 1.00 31.60 ? 223 TYR A CD2 1 
ATOM 1705  C CE1 . TYR A 1 223 ? 19.520  9.077   -11.980 1.00 31.60 ? 223 TYR A CE1 1 
ATOM 1706  C CE2 . TYR A 1 223 ? 20.226  11.182  -11.056 1.00 31.60 ? 223 TYR A CE2 1 
ATOM 1707  C CZ  . TYR A 1 223 ? 20.498  10.045  -11.791 1.00 31.60 ? 223 TYR A CZ  1 
ATOM 1708  O OH  . TYR A 1 223 ? 21.755  9.886   -12.330 1.00 31.60 ? 223 TYR A OH  1 
ATOM 1709  N N   . LEU A 1 224 ? 17.073  8.419   -7.316  1.00 25.36 ? 224 LEU A N   1 
ATOM 1710  C CA  . LEU A 1 224 ? 17.842  8.286   -6.085  1.00 25.36 ? 224 LEU A CA  1 
ATOM 1711  C C   . LEU A 1 224 ? 19.233  8.885   -6.072  1.00 25.36 ? 224 LEU A C   1 
ATOM 1712  O O   . LEU A 1 224 ? 19.586  9.596   -5.129  1.00 25.36 ? 224 LEU A O   1 
ATOM 1713  C CB  . LEU A 1 224 ? 17.925  6.823   -5.661  1.00 11.84 ? 224 LEU A CB  1 
ATOM 1714  C CG  . LEU A 1 224 ? 16.635  6.223   -5.105  1.00 11.84 ? 224 LEU A CG  1 
ATOM 1715  C CD1 . LEU A 1 224 ? 16.958  4.887   -4.454  1.00 11.84 ? 224 LEU A CD1 1 
ATOM 1716  C CD2 . LEU A 1 224 ? 16.013  7.157   -4.082  1.00 11.84 ? 224 LEU A CD2 1 
ATOM 1717  N N   . GLU A 1 225 ? 20.028  8.606   -7.101  1.00 29.19 ? 225 GLU A N   1 
ATOM 1718  C CA  . GLU A 1 225 ? 21.384  9.129   -7.145  1.00 29.19 ? 225 GLU A CA  1 
ATOM 1719  C C   . GLU A 1 225 ? 21.448  10.646  -7.286  1.00 29.19 ? 225 GLU A C   1 
ATOM 1720  O O   . GLU A 1 225 ? 22.530  11.220  -7.390  1.00 29.19 ? 225 GLU A O   1 
ATOM 1721  C CB  . GLU A 1 225 ? 22.192  8.452   -8.255  1.00 32.59 ? 225 GLU A CB  1 
ATOM 1722  C CG  . GLU A 1 225 ? 21.414  8.052   -9.478  1.00 32.59 ? 225 GLU A CG  1 
ATOM 1723  C CD  . GLU A 1 225 ? 20.786  6.670   -9.364  1.00 32.59 ? 225 GLU A CD  1 
ATOM 1724  O OE1 . GLU A 1 225 ? 19.859  6.504   -8.547  1.00 32.59 ? 225 GLU A OE1 1 
ATOM 1725  O OE2 . GLU A 1 225 ? 21.213  5.742   -10.089 1.00 32.59 ? 225 GLU A OE2 1 
ATOM 1726  N N   . GLY A 1 226 ? 20.286  11.289  -7.270  1.00 17.70 ? 226 GLY A N   1 
ATOM 1727  C CA  . GLY A 1 226 ? 20.220  12.738  -7.371  1.00 17.70 ? 226 GLY A CA  1 
ATOM 1728  C C   . GLY A 1 226 ? 19.477  13.300  -6.165  1.00 17.70 ? 226 GLY A C   1 
ATOM 1729  O O   . GLY A 1 226 ? 18.799  14.329  -6.242  1.00 17.70 ? 226 GLY A O   1 
ATOM 1730  N N   . THR A 1 227 ? 19.613  12.612  -5.037  1.00 15.77 ? 227 THR A N   1 
ATOM 1731  C CA  . THR A 1 227 ? 18.951  13.014  -3.806  1.00 15.77 ? 227 THR A CA  1 
ATOM 1732  C C   . THR A 1 227 ? 19.906  12.846  -2.644  1.00 15.77 ? 227 THR A C   1 
ATOM 1733  O O   . THR A 1 227 ? 21.007  12.341  -2.809  1.00 15.77 ? 227 THR A O   1 
ATOM 1734  C CB  . THR A 1 227 ? 17.750  12.111  -3.503  1.00 19.64 ? 227 THR A CB  1 
ATOM 1735  O OG1 . THR A 1 227 ? 18.223  10.790  -3.195  1.00 19.64 ? 227 THR A OG1 1 
ATOM 1736  C CG2 . THR A 1 227 ? 16.819  12.043  -4.693  1.00 19.64 ? 227 THR A CG2 1 
ATOM 1737  N N   . LEU A 1 228 ? 19.463  13.258  -1.465  1.00 28.38 ? 228 LEU A N   1 
ATOM 1738  C CA  . LEU A 1 228 ? 20.252  13.121  -0.256  1.00 28.38 ? 228 LEU A CA  1 
ATOM 1739  C C   . LEU A 1 228 ? 19.279  12.835  0.873   1.00 28.38 ? 228 LEU A C   1 
ATOM 1740  O O   . LEU A 1 228 ? 18.142  13.306  0.846   1.00 28.38 ? 228 LEU A O   1 
ATOM 1741  C CB  . LEU A 1 228 ? 21.029  14.402  0.039   1.00 21.03 ? 228 LEU A CB  1 
ATOM 1742  C CG  . LEU A 1 228 ? 22.287  14.681  -0.784  1.00 21.03 ? 228 LEU A CG  1 
ATOM 1743  C CD1 . LEU A 1 228 ? 22.913  15.981  -0.310  1.00 21.03 ? 228 LEU A CD1 1 
ATOM 1744  C CD2 . LEU A 1 228 ? 23.270  13.535  -0.625  1.00 21.03 ? 228 LEU A CD2 1 
ATOM 1745  N N   . LEU A 1 229 ? 19.716  12.063  1.859   1.00 17.04 ? 229 LEU A N   1 
ATOM 1746  C CA  . LEU A 1 229 ? 18.859  11.726  2.985   1.00 17.04 ? 229 LEU A CA  1 
ATOM 1747  C C   . LEU A 1 229 ? 19.338  12.427  4.251   1.00 17.04 ? 229 LEU A C   1 
ATOM 1748  O O   . LEU A 1 229 ? 20.502  12.318  4.635   1.00 17.04 ? 229 LEU A O   1 
ATOM 1749  C CB  . LEU A 1 229 ? 18.851  10.212  3.202   1.00 10.07 ? 229 LEU A CB  1 
ATOM 1750  C CG  . LEU A 1 229 ? 18.060  9.684   4.396   1.00 10.07 ? 229 LEU A CG  1 
ATOM 1751  C CD1 . LEU A 1 229 ? 16.594  9.970   4.196   1.00 10.07 ? 229 LEU A CD1 1 
ATOM 1752  C CD2 . LEU A 1 229 ? 18.279  8.198   4.535   1.00 10.07 ? 229 LEU A CD2 1 
ATOM 1753  N N   . LYS A 1 230 ? 18.440  13.161  4.893   1.00 21.15 ? 230 LYS A N   1 
ATOM 1754  C CA  . LYS A 1 230 ? 18.777  13.863  6.120   1.00 21.15 ? 230 LYS A CA  1 
ATOM 1755  C C   . LYS A 1 230 ? 17.931  13.264  7.231   1.00 21.15 ? 230 LYS A C   1 
ATOM 1756  O O   . LYS A 1 230 ? 16.902  13.817  7.605   1.00 21.15 ? 230 LYS A O   1 
ATOM 1757  C CB  . LYS A 1 230 ? 18.479  15.361  5.986   1.00 16.48 ? 230 LYS A CB  1 
ATOM 1758  C CG  . LYS A 1 230 ? 18.791  16.192  7.239   1.00 16.48 ? 230 LYS A CG  1 
ATOM 1759  C CD  . LYS A 1 230 ? 18.595  17.687  6.974   1.00 16.48 ? 230 LYS A CD  1 
ATOM 1760  C CE  . LYS A 1 230 ? 18.928  18.540  8.193   1.00 16.48 ? 230 LYS A CE  1 
ATOM 1761  N NZ  . LYS A 1 230 ? 18.792  20.002  7.900   1.00 16.48 ? 230 LYS A NZ  1 
ATOM 1762  N N   . PRO A 1 231 ? 18.343  12.104  7.755   1.00 26.93 ? 231 PRO A N   1 
ATOM 1763  C CA  . PRO A 1 231 ? 17.602  11.444  8.827   1.00 26.93 ? 231 PRO A CA  1 
ATOM 1764  C C   . PRO A 1 231 ? 18.149  11.814  10.178  1.00 26.93 ? 231 PRO A C   1 
ATOM 1765  O O   . PRO A 1 231 ? 19.122  12.539  10.294  1.00 26.93 ? 231 PRO A O   1 
ATOM 1766  C CB  . PRO A 1 231 ? 17.844  9.981   8.542   1.00 19.68 ? 231 PRO A CB  1 
ATOM 1767  C CG  . PRO A 1 231 ? 19.275  10.003  8.165   1.00 19.68 ? 231 PRO A CG  1 
ATOM 1768  C CD  . PRO A 1 231 ? 19.351  11.185  7.201   1.00 19.68 ? 231 PRO A CD  1 
ATOM 1769  N N   . ASN A 1 232 ? 17.513  11.287  11.201  1.00 25.37 ? 232 ASN A N   1 
ATOM 1770  C CA  . ASN A 1 232 ? 17.929  11.509  12.565  1.00 25.37 ? 232 ASN A CA  1 
ATOM 1771  C C   . ASN A 1 232 ? 18.884  10.354  12.848  1.00 25.37 ? 232 ASN A C   1 
ATOM 1772  O O   . ASN A 1 232 ? 18.766  9.311   12.224  1.00 25.37 ? 232 ASN A O   1 
ATOM 1773  C CB  . ASN A 1 232 ? 16.694  11.406  13.457  1.00 31.63 ? 232 ASN A CB  1 
ATOM 1774  C CG  . ASN A 1 232 ? 15.899  10.119  13.210  1.00 31.63 ? 232 ASN A CG  1 
ATOM 1775  O OD1 . ASN A 1 232 ? 16.250  9.054   13.717  1.00 31.63 ? 232 ASN A OD1 1 
ATOM 1776  N ND2 . ASN A 1 232 ? 14.836  10.215  12.413  1.00 31.63 ? 232 ASN A ND2 1 
ATOM 1777  N N   . MET A 1 233 ? 19.850  10.521  13.740  1.00 23.50 ? 233 MET A N   1 
ATOM 1778  C CA  . MET A 1 233 ? 20.708  9.384   14.048  1.00 23.50 ? 233 MET A CA  1 
ATOM 1779  C C   . MET A 1 233 ? 19.814  8.568   14.956  1.00 23.50 ? 233 MET A C   1 
ATOM 1780  O O   . MET A 1 233 ? 19.012  9.145   15.683  1.00 23.50 ? 233 MET A O   1 
ATOM 1781  C CB  . MET A 1 233 ? 21.934  9.806   14.837  1.00 30.19 ? 233 MET A CB  1 
ATOM 1782  C CG  . MET A 1 233 ? 22.850  10.750  14.117  1.00 30.19 ? 233 MET A CG  1 
ATOM 1783  S SD  . MET A 1 233 ? 24.242  11.184  15.174  1.00 30.19 ? 233 MET A SD  1 
ATOM 1784  C CE  . MET A 1 233 ? 25.017  12.445  14.212  1.00 30.19 ? 233 MET A CE  1 
ATOM 1785  N N   . VAL A 1 234 ? 19.909  7.246   14.932  1.00 16.76 ? 234 VAL A N   1 
ATOM 1786  C CA  . VAL A 1 234 ? 19.046  6.497   15.828  1.00 16.76 ? 234 VAL A CA  1 
ATOM 1787  C C   . VAL A 1 234 ? 19.674  6.602   17.212  1.00 16.76 ? 234 VAL A C   1 
ATOM 1788  O O   . VAL A 1 234 ? 20.845  6.272   17.397  1.00 16.76 ? 234 VAL A O   1 
ATOM 1789  C CB  . VAL A 1 234 ? 18.840  4.999   15.375  1.00 12.03 ? 234 VAL A CB  1 
ATOM 1790  C CG1 . VAL A 1 234 ? 19.456  4.775   14.016  1.00 12.03 ? 234 VAL A CG1 1 
ATOM 1791  C CG2 . VAL A 1 234 ? 19.377  4.023   16.414  1.00 12.03 ? 234 VAL A CG2 1 
ATOM 1792  N N   . THR A 1 235 ? 18.890  7.109   18.164  1.00 30.89 ? 235 THR A N   1 
ATOM 1793  C CA  . THR A 1 235 ? 19.330  7.309   19.540  1.00 30.89 ? 235 THR A CA  1 
ATOM 1794  C C   . THR A 1 235 ? 18.143  7.205   20.492  1.00 30.89 ? 235 THR A C   1 
ATOM 1795  O O   . THR A 1 235 ? 16.988  7.318   20.076  1.00 30.89 ? 235 THR A O   1 
ATOM 1796  C CB  . THR A 1 235 ? 19.920  8.701   19.732  1.00 21.98 ? 235 THR A CB  1 
ATOM 1797  O OG1 . THR A 1 235 ? 18.859  9.661   19.749  1.00 21.98 ? 235 THR A OG1 1 
ATOM 1798  C CG2 . THR A 1 235 ? 20.864  9.039   18.606  1.00 21.98 ? 235 THR A CG2 1 
ATOM 1799  N N   . PRO A 1 236 ? 18.417  7.031   21.793  1.00 24.17 ? 236 PRO A N   1 
ATOM 1800  C CA  . PRO A 1 236 ? 17.372  6.911   22.812  1.00 24.17 ? 236 PRO A CA  1 
ATOM 1801  C C   . PRO A 1 236 ? 16.606  8.211   22.907  1.00 24.17 ? 236 PRO A C   1 
ATOM 1802  O O   . PRO A 1 236 ? 17.084  9.246   22.438  1.00 24.17 ? 236 PRO A O   1 
ATOM 1803  C CB  . PRO A 1 236 ? 18.158  6.651   24.097  1.00 32.79 ? 236 PRO A CB  1 
ATOM 1804  C CG  . PRO A 1 236 ? 19.504  6.202   23.621  1.00 32.79 ? 236 PRO A CG  1 
ATOM 1805  C CD  . PRO A 1 236 ? 19.742  7.055   22.425  1.00 32.79 ? 236 PRO A CD  1 
ATOM 1806  N N   . GLY A 1 237 ? 15.427  8.157   23.520  1.00 34.11 ? 237 GLY A N   1 
ATOM 1807  C CA  . GLY A 1 237 ? 14.628  9.355   23.676  1.00 34.11 ? 237 GLY A CA  1 
ATOM 1808  C C   . GLY A 1 237 ? 15.292  10.267  24.689  1.00 34.11 ? 237 GLY A C   1 
ATOM 1809  O O   . GLY A 1 237 ? 15.999  9.774   25.570  1.00 34.11 ? 237 GLY A O   1 
ATOM 1810  N N   . HIS A 1 238 ? 15.085  11.581  24.570  1.00 40.19 ? 238 HIS A N   1 
ATOM 1811  C CA  . HIS A 1 238 ? 15.684  12.533  25.502  1.00 40.19 ? 238 HIS A CA  1 
ATOM 1812  C C   . HIS A 1 238 ? 15.475  12.070  26.930  1.00 40.19 ? 238 HIS A C   1 
ATOM 1813  O O   . HIS A 1 238 ? 16.356  12.216  27.778  1.00 40.19 ? 238 HIS A O   1 
ATOM 1814  C CB  . HIS A 1 238 ? 15.067  13.925  25.355  1.00 88.73 ? 238 HIS A CB  1 
ATOM 1815  C CG  . HIS A 1 238 ? 15.482  14.643  24.112  1.00 88.73 ? 238 HIS A CG  1 
ATOM 1816  N ND1 . HIS A 1 238 ? 16.791  14.684  23.681  1.00 88.73 ? 238 HIS A ND1 1 
ATOM 1817  C CD2 . HIS A 1 238 ? 14.767  15.367  23.219  1.00 88.73 ? 238 HIS A CD2 1 
ATOM 1818  C CE1 . HIS A 1 238 ? 16.865  15.403  22.574  1.00 88.73 ? 238 HIS A CE1 1 
ATOM 1819  N NE2 . HIS A 1 238 ? 15.651  15.829  22.272  1.00 88.73 ? 238 HIS A NE2 1 
ATOM 1820  N N   . ALA A 1 239 ? 14.305  11.496  27.182  1.00 35.04 ? 239 ALA A N   1 
ATOM 1821  C CA  . ALA A 1 239 ? 13.951  11.027  28.511  1.00 35.04 ? 239 ALA A CA  1 
ATOM 1822  C C   . ALA A 1 239 ? 14.352  9.595   28.835  1.00 35.04 ? 239 ALA A C   1 
ATOM 1823  O O   . ALA A 1 239 ? 13.961  9.076   29.878  1.00 35.04 ? 239 ALA A O   1 
ATOM 1824  C CB  . ALA A 1 239 ? 12.459  11.196  28.725  1.00 29.65 ? 239 ALA A CB  1 
ATOM 1825  N N   . CYS A 1 240 ? 15.108  8.934   27.965  1.00 41.31 ? 240 CYS A N   1 
ATOM 1826  C CA  . CYS A 1 240 ? 15.503  7.572   28.292  1.00 41.31 ? 240 CYS A CA  1 
ATOM 1827  C C   . CYS A 1 240 ? 16.597  7.635   29.343  1.00 41.31 ? 240 CYS A C   1 
ATOM 1828  O O   . CYS A 1 240 ? 17.560  8.389   29.212  1.00 41.31 ? 240 CYS A O   1 
ATOM 1829  C CB  . CYS A 1 240 ? 16.018  6.810   27.081  1.00 36.57 ? 240 CYS A CB  1 
ATOM 1830  S SG  . CYS A 1 240 ? 16.485  5.125   27.552  1.00 36.57 ? 240 CYS A SG  1 
ATOM 1831  N N   . PRO A 1 241 ? 16.464  6.830   30.401  1.00 54.14 ? 241 PRO A N   1 
ATOM 1832  C CA  . PRO A 1 241 ? 17.426  6.774   31.507  1.00 54.14 ? 241 PRO A CA  1 
ATOM 1833  C C   . PRO A 1 241 ? 18.760  6.148   31.110  1.00 54.14 ? 241 PRO A C   1 
ATOM 1834  O O   . PRO A 1 241 ? 19.825  6.576   31.562  1.00 54.14 ? 241 PRO A O   1 
ATOM 1835  C CB  . PRO A 1 241 ? 16.706  5.919   32.552  1.00 49.23 ? 241 PRO A CB  1 
ATOM 1836  C CG  . PRO A 1 241 ? 15.246  5.899   32.099  1.00 49.23 ? 241 PRO A CG  1 
ATOM 1837  C CD  . PRO A 1 241 ? 15.364  5.878   30.613  1.00 49.23 ? 241 PRO A CD  1 
ATOM 1838  N N   . ILE A 1 242 ? 18.683  5.126   30.265  1.00 39.31 ? 242 ILE A N   1 
ATOM 1839  C CA  . ILE A 1 242 ? 19.850  4.387   29.806  1.00 39.31 ? 242 ILE A CA  1 
ATOM 1840  C C   . ILE A 1 242 ? 20.915  5.203   29.090  1.00 39.31 ? 242 ILE A C   1 
ATOM 1841  O O   . ILE A 1 242 ? 20.611  6.079   28.277  1.00 39.31 ? 242 ILE A O   1 
ATOM 1842  C CB  . ILE A 1 242 ? 19.426  3.262   28.878  1.00 30.26 ? 242 ILE A CB  1 
ATOM 1843  C CG1 . ILE A 1 242 ? 18.344  2.420   29.562  1.00 30.26 ? 242 ILE A CG1 1 
ATOM 1844  C CG2 . ILE A 1 242 ? 20.641  2.437   28.500  1.00 30.26 ? 242 ILE A CG2 1 
ATOM 1845  C CD1 . ILE A 1 242 ? 17.762  1.319   28.686  1.00 30.26 ? 242 ILE A CD1 1 
ATOM 1846  N N   . LYS A 1 243 ? 22.170  4.884   29.386  1.00 51.30 ? 243 LYS A N   1 
ATOM 1847  C CA  . LYS A 1 243 ? 23.311  5.572   28.795  1.00 51.30 ? 243 LYS A CA  1 
ATOM 1848  C C   . LYS A 1 243 ? 23.890  4.704   27.682  1.00 51.30 ? 243 LYS A C   1 
ATOM 1849  O O   . LYS A 1 243 ? 24.014  3.483   27.839  1.00 51.30 ? 243 LYS A O   1 
ATOM 1850  C CB  . LYS A 1 243 ? 24.358  5.828   29.881  1.00 99.18 ? 243 LYS A CB  1 
ATOM 1851  C CG  . LYS A 1 243 ? 23.784  6.578   31.081  1.00 99.18 ? 243 LYS A CG  1 
ATOM 1852  C CD  . LYS A 1 243 ? 24.510  6.257   32.385  1.00 99.18 ? 243 LYS A CD  1 
ATOM 1853  C CE  . LYS A 1 243 ? 23.760  6.852   33.577  1.00 99.18 ? 243 LYS A CE  1 
ATOM 1854  N NZ  . LYS A 1 243 ? 24.360  6.473   34.885  1.00 99.18 ? 243 LYS A NZ  1 
ATOM 1855  N N   . TYR A 1 244 ? 24.239  5.331   26.560  1.00 36.26 ? 244 TYR A N   1 
ATOM 1856  C CA  . TYR A 1 244 ? 24.789  4.594   25.426  1.00 36.26 ? 244 TYR A CA  1 
ATOM 1857  C C   . TYR A 1 244 ? 26.100  5.153   24.889  1.00 36.26 ? 244 TYR A C   1 
ATOM 1858  O O   . TYR A 1 244 ? 26.327  6.366   24.903  1.00 36.26 ? 244 TYR A O   1 
ATOM 1859  C CB  . TYR A 1 244 ? 23.786  4.553   24.272  1.00 32.09 ? 244 TYR A CB  1 
ATOM 1860  C CG  . TYR A 1 244 ? 22.523  3.778   24.547  1.00 32.09 ? 244 TYR A CG  1 
ATOM 1861  C CD1 . TYR A 1 244 ? 21.487  4.330   25.296  1.00 32.09 ? 244 TYR A CD1 1 
ATOM 1862  C CD2 . TYR A 1 244 ? 22.354  2.497   24.036  1.00 32.09 ? 244 TYR A CD2 1 
ATOM 1863  C CE1 . TYR A 1 244 ? 20.306  3.623   25.525  1.00 32.09 ? 244 TYR A CE1 1 
ATOM 1864  C CE2 . TYR A 1 244 ? 21.185  1.784   24.260  1.00 32.09 ? 244 TYR A CE2 1 
ATOM 1865  C CZ  . TYR A 1 244 ? 20.162  2.350   25.003  1.00 32.09 ? 244 TYR A CZ  1 
ATOM 1866  O OH  . TYR A 1 244 ? 19.002  1.634   25.211  1.00 32.09 ? 244 TYR A OH  1 
ATOM 1867  N N   . THR A 1 245 ? 26.947  4.255   24.394  1.00 36.12 ? 245 THR A N   1 
ATOM 1868  C CA  . THR A 1 245 ? 28.240  4.619   23.824  1.00 36.12 ? 245 THR A CA  1 
ATOM 1869  C C   . THR A 1 245 ? 28.005  5.224   22.462  1.00 36.12 ? 245 THR A C   1 
ATOM 1870  O O   . THR A 1 245 ? 27.093  4.809   21.745  1.00 36.12 ? 245 THR A O   1 
ATOM 1871  C CB  . THR A 1 245 ? 29.105  3.390   23.534  1.00 48.29 ? 245 THR A CB  1 
ATOM 1872  O OG1 . THR A 1 245 ? 28.801  2.351   24.467  1.00 48.29 ? 245 THR A OG1 1 
ATOM 1873  C CG2 . THR A 1 245 ? 30.567  3.743   23.619  1.00 48.29 ? 245 THR A CG2 1 
ATOM 1874  N N   . PRO A 1 246 ? 28.812  6.220   22.077  1.00 36.10 ? 246 PRO A N   1 
ATOM 1875  C CA  . PRO A 1 246 ? 28.588  6.778   20.744  1.00 36.10 ? 246 PRO A CA  1 
ATOM 1876  C C   . PRO A 1 246 ? 28.868  5.632   19.772  1.00 36.10 ? 246 PRO A C   1 
ATOM 1877  O O   . PRO A 1 246 ? 28.489  5.669   18.606  1.00 36.10 ? 246 PRO A O   1 
ATOM 1878  C CB  . PRO A 1 246 ? 29.613  7.909   20.659  1.00 29.30 ? 246 PRO A CB  1 
ATOM 1879  C CG  . PRO A 1 246 ? 30.643  7.531   21.671  1.00 29.30 ? 246 PRO A CG  1 
ATOM 1880  C CD  . PRO A 1 246 ? 29.828  6.988   22.803  1.00 29.30 ? 246 PRO A CD  1 
ATOM 1881  N N   . GLU A 1 247 ? 29.534  4.603   20.283  1.00 28.34 ? 247 GLU A N   1 
ATOM 1882  C CA  . GLU A 1 247 ? 29.828  3.416   19.494  1.00 28.34 ? 247 GLU A CA  1 
ATOM 1883  C C   . GLU A 1 247 ? 28.493  2.734   19.245  1.00 28.34 ? 247 GLU A C   1 
ATOM 1884  O O   . GLU A 1 247 ? 28.145  2.419   18.105  1.00 28.34 ? 247 GLU A O   1 
ATOM 1885  C CB  . GLU A 1 247 ? 30.738  2.465   20.271  1.00 62.17 ? 247 GLU A CB  1 
ATOM 1886  C CG  . GLU A 1 247 ? 32.222  2.724   20.102  1.00 62.17 ? 247 GLU A CG  1 
ATOM 1887  C CD  . GLU A 1 247 ? 32.631  4.143   20.467  1.00 62.17 ? 247 GLU A CD  1 
ATOM 1888  O OE1 . GLU A 1 247 ? 32.374  4.574   21.617  1.00 62.17 ? 247 GLU A OE1 1 
ATOM 1889  O OE2 . GLU A 1 247 ? 33.222  4.827   19.598  1.00 62.17 ? 247 GLU A OE2 1 
ATOM 1890  N N   . GLU A 1 248 ? 27.751  2.519   20.331  1.00 31.37 ? 248 GLU A N   1 
ATOM 1891  C CA  . GLU A 1 248 ? 26.445  1.871   20.282  1.00 31.37 ? 248 GLU A CA  1 
ATOM 1892  C C   . GLU A 1 248 ? 25.474  2.628   19.381  1.00 31.37 ? 248 GLU A C   1 
ATOM 1893  O O   . GLU A 1 248 ? 24.695  2.030   18.637  1.00 31.37 ? 248 GLU A O   1 
ATOM 1894  C CB  . GLU A 1 248 ? 25.871  1.768   21.693  1.00 46.06 ? 248 GLU A CB  1 
ATOM 1895  C CG  . GLU A 1 248 ? 26.760  1.007   22.646  1.00 46.06 ? 248 GLU A CG  1 
ATOM 1896  C CD  . GLU A 1 248 ? 26.144  0.847   24.020  1.00 46.06 ? 248 GLU A CD  1 
ATOM 1897  O OE1 . GLU A 1 248 ? 25.891  1.876   24.687  1.00 46.06 ? 248 GLU A OE1 1 
ATOM 1898  O OE2 . GLU A 1 248 ? 25.915  -0.313  24.432  1.00 46.06 ? 248 GLU A OE2 1 
ATOM 1899  N N   . ILE A 1 249 ? 25.521  3.950   19.456  1.00 26.07 ? 249 ILE A N   1 
ATOM 1900  C CA  . ILE A 1 249 ? 24.656  4.771   18.638  1.00 26.07 ? 249 ILE A CA  1 
ATOM 1901  C C   . ILE A 1 249 ? 25.034  4.610   17.179  1.00 26.07 ? 249 ILE A C   1 
ATOM 1902  O O   . ILE A 1 249 ? 24.169  4.444   16.321  1.00 26.07 ? 249 ILE A O   1 
ATOM 1903  C CB  . ILE A 1 249 ? 24.779  6.234   19.030  1.00 25.73 ? 249 ILE A CB  1 
ATOM 1904  C CG1 . ILE A 1 249 ? 24.089  6.442   20.373  1.00 25.73 ? 249 ILE A CG1 1 
ATOM 1905  C CG2 . ILE A 1 249 ? 24.190  7.117   17.954  1.00 25.73 ? 249 ILE A CG2 1 
ATOM 1906  C CD1 . ILE A 1 249 ? 24.177  7.850   20.877  1.00 25.73 ? 249 ILE A CD1 1 
ATOM 1907  N N   . ALA A 1 250 ? 26.331  4.651   16.900  1.00 20.79 ? 250 ALA A N   1 
ATOM 1908  C CA  . ALA A 1 250 ? 26.810  4.508   15.533  1.00 20.79 ? 250 ALA A CA  1 
ATOM 1909  C C   . ALA A 1 250 ? 26.410  3.143   14.986  1.00 20.79 ? 250 ALA A C   1 
ATOM 1910  O O   . ALA A 1 250 ? 26.015  3.012   13.826  1.00 20.79 ? 250 ALA A O   1 
ATOM 1911  C CB  . ALA A 1 250 ? 28.325  4.666   15.494  1.00 18.99 ? 250 ALA A CB  1 
ATOM 1912  N N   . MET A 1 251 ? 26.507  2.128   15.836  1.00 23.11 ? 251 MET A N   1 
ATOM 1913  C CA  . MET A 1 251 ? 26.169  0.769   15.442  1.00 23.11 ? 251 MET A CA  1 
ATOM 1914  C C   . MET A 1 251 ? 24.712  0.669   14.994  1.00 23.11 ? 251 MET A C   1 
ATOM 1915  O O   . MET A 1 251 ? 24.422  0.122   13.930  1.00 23.11 ? 251 MET A O   1 
ATOM 1916  C CB  . MET A 1 251 ? 26.437  -0.189  16.607  1.00 54.11 ? 251 MET A CB  1 
ATOM 1917  C CG  . MET A 1 251 ? 26.413  -1.662  16.231  1.00 54.11 ? 251 MET A CG  1 
ATOM 1918  S SD  . MET A 1 251 ? 27.486  -2.040  14.824  1.00 54.11 ? 251 MET A SD  1 
ATOM 1919  C CE  . MET A 1 251 ? 29.143  -1.849  15.559  1.00 54.11 ? 251 MET A CE  1 
ATOM 1920  N N   . ALA A 1 252 ? 23.799  1.211   15.796  1.00 29.46 ? 252 ALA A N   1 
ATOM 1921  C CA  . ALA A 1 252 ? 22.376  1.164   15.470  1.00 29.46 ? 252 ALA A CA  1 
ATOM 1922  C C   . ALA A 1 252 ? 22.043  2.014   14.255  1.00 29.46 ? 252 ALA A C   1 
ATOM 1923  O O   . ALA A 1 252 ? 21.295  1.594   13.370  1.00 29.46 ? 252 ALA A O   1 
ATOM 1924  C CB  . ALA A 1 252 ? 21.568  1.627   16.649  1.00 3.76  ? 252 ALA A CB  1 
ATOM 1925  N N   . THR A 1 253 ? 22.600  3.217   14.223  1.00 20.23 ? 253 THR A N   1 
ATOM 1926  C CA  . THR A 1 253 ? 22.374  4.132   13.121  1.00 20.23 ? 253 THR A CA  1 
ATOM 1927  C C   . THR A 1 253 ? 22.809  3.548   11.790  1.00 20.23 ? 253 THR A C   1 
ATOM 1928  O O   . THR A 1 253 ? 22.065  3.584   10.815  1.00 20.23 ? 253 THR A O   1 
ATOM 1929  C CB  . THR A 1 253 ? 23.119  5.446   13.345  1.00 17.02 ? 253 THR A CB  1 
ATOM 1930  O OG1 . THR A 1 253 ? 22.545  6.123   14.471  1.00 17.02 ? 253 THR A OG1 1 
ATOM 1931  C CG2 . THR A 1 253 ? 23.031  6.327   12.114  1.00 17.02 ? 253 THR A CG2 1 
ATOM 1932  N N   . VAL A 1 254 ? 24.016  3.007   11.735  1.00 25.50 ? 254 VAL A N   1 
ATOM 1933  C CA  . VAL A 1 254 ? 24.487  2.438   10.486  1.00 25.50 ? 254 VAL A CA  1 
ATOM 1934  C C   . VAL A 1 254 ? 23.697  1.182   10.118  1.00 25.50 ? 254 VAL A C   1 
ATOM 1935  O O   . VAL A 1 254 ? 23.384  0.956   8.950   1.00 25.50 ? 254 VAL A O   1 
ATOM 1936  C CB  . VAL A 1 254 ? 25.991  2.130   10.563  1.00 9.84  ? 254 VAL A CB  1 
ATOM 1937  C CG1 . VAL A 1 254 ? 26.460  1.416   9.291   1.00 9.84  ? 254 VAL A CG1 1 
ATOM 1938  C CG2 . VAL A 1 254 ? 26.759  3.427   10.747  1.00 9.84  ? 254 VAL A CG2 1 
ATOM 1939  N N   . THR A 1 255 ? 23.357  0.366   11.106  1.00 23.01 ? 255 THR A N   1 
ATOM 1940  C CA  . THR A 1 255 ? 22.595  -0.831  10.803  1.00 23.01 ? 255 THR A CA  1 
ATOM 1941  C C   . THR A 1 255 ? 21.271  -0.440  10.173  1.00 23.01 ? 255 THR A C   1 
ATOM 1942  O O   . THR A 1 255 ? 20.883  -0.967  9.131   1.00 23.01 ? 255 THR A O   1 
ATOM 1943  C CB  . THR A 1 255 ? 22.289  -1.637  12.048  1.00 20.86 ? 255 THR A CB  1 
ATOM 1944  O OG1 . THR A 1 255 ? 23.510  -2.065  12.651  1.00 20.86 ? 255 THR A OG1 1 
ATOM 1945  C CG2 . THR A 1 255 ? 21.467  -2.847  11.683  1.00 20.86 ? 255 THR A CG2 1 
ATOM 1946  N N   . ALA A 1 256 ? 20.576  0.491   10.813  1.00 22.73 ? 256 ALA A N   1 
ATOM 1947  C CA  . ALA A 1 256 ? 19.292  0.945   10.311  1.00 22.73 ? 256 ALA A CA  1 
ATOM 1948  C C   . ALA A 1 256 ? 19.417  1.413   8.865   1.00 22.73 ? 256 ALA A C   1 
ATOM 1949  O O   . ALA A 1 256 ? 18.693  0.953   7.980   1.00 22.73 ? 256 ALA A O   1 
ATOM 1950  C CB  . ALA A 1 256 ? 18.778  2.067   11.181  1.00 4.99  ? 256 ALA A CB  1 
ATOM 1951  N N   . LEU A 1 257 ? 20.351  2.325   8.629   1.00 23.64 ? 257 LEU A N   1 
ATOM 1952  C CA  . LEU A 1 257 ? 20.561  2.861   7.296   1.00 23.64 ? 257 LEU A CA  1 
ATOM 1953  C C   . LEU A 1 257 ? 20.884  1.801   6.259   1.00 23.64 ? 257 LEU A C   1 
ATOM 1954  O O   . LEU A 1 257 ? 20.374  1.859   5.141   1.00 23.64 ? 257 LEU A O   1 
ATOM 1955  C CB  . LEU A 1 257 ? 21.680  3.907   7.304   1.00 10.29 ? 257 LEU A CB  1 
ATOM 1956  C CG  . LEU A 1 257 ? 21.349  5.277   7.891   1.00 10.29 ? 257 LEU A CG  1 
ATOM 1957  C CD1 . LEU A 1 257 ? 22.558  6.176   7.804   1.00 10.29 ? 257 LEU A CD1 1 
ATOM 1958  C CD2 . LEU A 1 257 ? 20.202  5.893   7.120   1.00 10.29 ? 257 LEU A CD2 1 
ATOM 1959  N N   . ARG A 1 258 ? 21.712  0.826   6.609   1.00 24.63 ? 258 ARG A N   1 
ATOM 1960  C CA  . ARG A 1 258 ? 22.063  -0.171  5.615   1.00 24.63 ? 258 ARG A CA  1 
ATOM 1961  C C   . ARG A 1 258 ? 21.031  -1.266  5.419   1.00 24.63 ? 258 ARG A C   1 
ATOM 1962  O O   . ARG A 1 258 ? 21.249  -2.209  4.655   1.00 24.63 ? 258 ARG A O   1 
ATOM 1963  C CB  . ARG A 1 258 ? 23.453  -0.757  5.896   1.00 30.79 ? 258 ARG A CB  1 
ATOM 1964  C CG  . ARG A 1 258 ? 23.620  -1.532  7.172   1.00 30.79 ? 258 ARG A CG  1 
ATOM 1965  C CD  . ARG A 1 258 ? 25.111  -1.644  7.495   1.00 30.79 ? 258 ARG A CD  1 
ATOM 1966  N NE  . ARG A 1 258 ? 25.912  -2.051  6.337   1.00 30.79 ? 258 ARG A NE  1 
ATOM 1967  C CZ  . ARG A 1 258 ? 26.022  -3.300  5.887   1.00 30.79 ? 258 ARG A CZ  1 
ATOM 1968  N NH1 . ARG A 1 258 ? 25.381  -4.294  6.498   1.00 30.79 ? 258 ARG A NH1 1 
ATOM 1969  N NH2 . ARG A 1 258 ? 26.772  -3.552  4.817   1.00 30.79 ? 258 ARG A NH2 1 
ATOM 1970  N N   . ARG A 1 259 ? 19.895  -1.126  6.090   1.00 25.44 ? 259 ARG A N   1 
ATOM 1971  C CA  . ARG A 1 259 ? 18.806  -2.085  5.945   1.00 25.44 ? 259 ARG A CA  1 
ATOM 1972  C C   . ARG A 1 259 ? 17.702  -1.441  5.133   1.00 25.44 ? 259 ARG A C   1 
ATOM 1973  O O   . ARG A 1 259 ? 16.728  -2.095  4.764   1.00 25.44 ? 259 ARG A O   1 
ATOM 1974  C CB  . ARG A 1 259 ? 18.229  -2.453  7.297   1.00 16.50 ? 259 ARG A CB  1 
ATOM 1975  C CG  . ARG A 1 259 ? 19.049  -3.429  8.055   1.00 16.50 ? 259 ARG A CG  1 
ATOM 1976  C CD  . ARG A 1 259 ? 18.508  -3.583  9.438   1.00 16.50 ? 259 ARG A CD  1 
ATOM 1977  N NE  . ARG A 1 259 ? 19.194  -4.644  10.159  1.00 16.50 ? 259 ARG A NE  1 
ATOM 1978  C CZ  . ARG A 1 259 ? 18.993  -4.904  11.448  1.00 16.50 ? 259 ARG A CZ  1 
ATOM 1979  N NH1 . ARG A 1 259 ? 18.124  -4.172  12.143  1.00 16.50 ? 259 ARG A NH1 1 
ATOM 1980  N NH2 . ARG A 1 259 ? 19.664  -5.887  12.045  1.00 16.50 ? 259 ARG A NH2 1 
ATOM 1981  N N   . THR A 1 260 ? 17.869  -0.155  4.840   1.00 15.63 ? 260 THR A N   1 
ATOM 1982  C CA  . THR A 1 260 ? 16.843  0.584   4.136   1.00 15.63 ? 260 THR A CA  1 
ATOM 1983  C C   . THR A 1 260 ? 17.274  1.498   2.999   1.00 15.63 ? 260 THR A C   1 
ATOM 1984  O O   . THR A 1 260 ? 16.564  1.604   2.002   1.00 15.63 ? 260 THR A O   1 
ATOM 1985  C CB  . THR A 1 260 ? 16.055  1.422   5.142   1.00 12.51 ? 260 THR A CB  1 
ATOM 1986  O OG1 . THR A 1 260 ? 16.935  2.366   5.767   1.00 12.51 ? 260 THR A OG1 1 
ATOM 1987  C CG2 . THR A 1 260 ? 15.473  0.534   6.220   1.00 12.51 ? 260 THR A CG2 1 
ATOM 1988  N N   . VAL A 1 261 ? 18.412  2.168   3.129   1.00 16.75 ? 261 VAL A N   1 
ATOM 1989  C CA  . VAL A 1 261 ? 18.840  3.079   2.066   1.00 16.75 ? 261 VAL A CA  1 
ATOM 1990  C C   . VAL A 1 261 ? 19.535  2.390   0.888   1.00 16.75 ? 261 VAL A C   1 
ATOM 1991  O O   . VAL A 1 261 ? 20.501  1.671   1.063   1.00 16.75 ? 261 VAL A O   1 
ATOM 1992  C CB  . VAL A 1 261 ? 19.777  4.176   2.609   1.00 10.92 ? 261 VAL A CB  1 
ATOM 1993  C CG1 . VAL A 1 261 ? 20.019  5.225   1.530   1.00 10.92 ? 261 VAL A CG1 1 
ATOM 1994  C CG2 . VAL A 1 261 ? 19.170  4.815   3.854   1.00 10.92 ? 261 VAL A CG2 1 
ATOM 1995  N N   . PRO A 1 262 ? 19.024  2.574   -0.333  1.00 23.81 ? 262 PRO A N   1 
ATOM 1996  C CA  . PRO A 1 262 ? 19.721  1.901   -1.435  1.00 23.81 ? 262 PRO A CA  1 
ATOM 1997  C C   . PRO A 1 262 ? 21.101  2.508   -1.684  1.00 23.81 ? 262 PRO A C   1 
ATOM 1998  O O   . PRO A 1 262 ? 21.308  3.701   -1.477  1.00 23.81 ? 262 PRO A O   1 
ATOM 1999  C CB  . PRO A 1 262 ? 18.772  2.102   -2.615  1.00 24.02 ? 262 PRO A CB  1 
ATOM 2000  C CG  . PRO A 1 262 ? 17.426  2.107   -1.946  1.00 24.02 ? 262 PRO A CG  1 
ATOM 2001  C CD  . PRO A 1 262 ? 17.663  2.975   -0.733  1.00 24.02 ? 262 PRO A CD  1 
ATOM 2002  N N   . PRO A 1 263 ? 22.064  1.685   -2.126  1.00 20.27 ? 263 PRO A N   1 
ATOM 2003  C CA  . PRO A 1 263 ? 23.439  2.087   -2.417  1.00 20.27 ? 263 PRO A CA  1 
ATOM 2004  C C   . PRO A 1 263 ? 23.502  3.285   -3.325  1.00 20.27 ? 263 PRO A C   1 
ATOM 2005  O O   . PRO A 1 263 ? 24.458  4.049   -3.274  1.00 20.27 ? 263 PRO A O   1 
ATOM 2006  C CB  . PRO A 1 263 ? 24.015  0.861   -3.097  1.00 21.55 ? 263 PRO A CB  1 
ATOM 2007  C CG  . PRO A 1 263 ? 23.341  -0.223  -2.395  1.00 21.55 ? 263 PRO A CG  1 
ATOM 2008  C CD  . PRO A 1 263 ? 21.906  0.241   -2.350  1.00 21.55 ? 263 PRO A CD  1 
ATOM 2009  N N   . ALA A 1 264 ? 22.481  3.444   -4.158  1.00 14.42 ? 264 ALA A N   1 
ATOM 2010  C CA  . ALA A 1 264 ? 22.434  4.555   -5.106  1.00 14.42 ? 264 ALA A CA  1 
ATOM 2011  C C   . ALA A 1 264 ? 22.378  5.943   -4.467  1.00 14.42 ? 264 ALA A C   1 
ATOM 2012  O O   . ALA A 1 264 ? 22.740  6.934   -5.098  1.00 14.42 ? 264 ALA A O   1 
ATOM 2013  C CB  . ALA A 1 264 ? 21.253  4.377   -6.075  1.00 0.51  ? 264 ALA A CB  1 
ATOM 2014  N N   . VAL A 1 265 ? 21.916  6.032   -3.229  1.00 28.58 ? 265 VAL A N   1 
ATOM 2015  C CA  . VAL A 1 265 ? 21.863  7.330   -2.584  1.00 28.58 ? 265 VAL A CA  1 
ATOM 2016  C C   . VAL A 1 265 ? 23.304  7.749   -2.300  1.00 28.58 ? 265 VAL A C   1 
ATOM 2017  O O   . VAL A 1 265 ? 24.037  7.052   -1.587  1.00 28.58 ? 265 VAL A O   1 
ATOM 2018  C CB  . VAL A 1 265 ? 21.064  7.261   -1.281  1.00 18.47 ? 265 VAL A CB  1 
ATOM 2019  C CG1 . VAL A 1 265 ? 21.071  8.613   -0.602  1.00 18.47 ? 265 VAL A CG1 1 
ATOM 2020  C CG2 . VAL A 1 265 ? 19.645  6.812   -1.574  1.00 18.47 ? 265 VAL A CG2 1 
ATOM 2021  N N   . PRO A 1 266 ? 23.733  8.888   -2.867  1.00 21.11 ? 266 PRO A N   1 
ATOM 2022  C CA  . PRO A 1 266 ? 25.090  9.403   -2.686  1.00 21.11 ? 266 PRO A CA  1 
ATOM 2023  C C   . PRO A 1 266 ? 25.512  9.681   -1.256  1.00 21.11 ? 266 PRO A C   1 
ATOM 2024  O O   . PRO A 1 266 ? 26.638  9.371   -0.875  1.00 21.11 ? 266 PRO A O   1 
ATOM 2025  C CB  . PRO A 1 266 ? 25.107  10.657  -3.556  1.00 24.86 ? 266 PRO A CB  1 
ATOM 2026  C CG  . PRO A 1 266 ? 23.695  11.096  -3.553  1.00 24.86 ? 266 PRO A CG  1 
ATOM 2027  C CD  . PRO A 1 266 ? 22.952  9.795   -3.724  1.00 24.86 ? 266 PRO A CD  1 
ATOM 2028  N N   . GLY A 1 267 ? 24.630  10.254  -0.452  1.00 24.06 ? 267 GLY A N   1 
ATOM 2029  C CA  . GLY A 1 267 ? 25.033  10.529  0.911   1.00 24.06 ? 267 GLY A CA  1 
ATOM 2030  C C   . GLY A 1 267 ? 23.904  10.764  1.883   1.00 24.06 ? 267 GLY A C   1 
ATOM 2031  O O   . GLY A 1 267 ? 22.809  11.171  1.503   1.00 24.06 ? 267 GLY A O   1 
ATOM 2032  N N   . VAL A 1 268 ? 24.185  10.496  3.150   1.00 17.10 ? 268 VAL A N   1 
ATOM 2033  C CA  . VAL A 1 268 ? 23.227  10.680  4.223   1.00 17.10 ? 268 VAL A CA  1 
ATOM 2034  C C   . VAL A 1 268 ? 23.780  11.819  5.061   1.00 17.10 ? 268 VAL A C   1 
ATOM 2035  O O   . VAL A 1 268 ? 24.866  11.699  5.626   1.00 17.10 ? 268 VAL A O   1 
ATOM 2036  C CB  . VAL A 1 268 ? 23.148  9.432   5.104   1.00 20.48 ? 268 VAL A CB  1 
ATOM 2037  C CG1 . VAL A 1 268 ? 22.111  9.627   6.188   1.00 20.48 ? 268 VAL A CG1 1 
ATOM 2038  C CG2 . VAL A 1 268 ? 22.833  8.217   4.258   1.00 20.48 ? 268 VAL A CG2 1 
ATOM 2039  N N   . THR A 1 269 ? 23.054  12.928  5.141   1.00 17.02 ? 269 THR A N   1 
ATOM 2040  C CA  . THR A 1 269 ? 23.526  14.066  5.922   1.00 17.02 ? 269 THR A CA  1 
ATOM 2041  C C   . THR A 1 269 ? 22.728  14.162  7.225   1.00 17.02 ? 269 THR A C   1 
ATOM 2042  O O   . THR A 1 269 ? 21.676  14.801  7.274   1.00 17.02 ? 269 THR A O   1 
ATOM 2043  C CB  . THR A 1 269 ? 23.369  15.373  5.124   1.00 20.90 ? 269 THR A CB  1 
ATOM 2044  O OG1 . THR A 1 269 ? 21.990  15.747  5.096   1.00 20.90 ? 269 THR A OG1 1 
ATOM 2045  C CG2 . THR A 1 269 ? 23.841  15.182  3.687   1.00 20.90 ? 269 THR A CG2 1 
ATOM 2046  N N   . PHE A 1 270 ? 23.234  13.530  8.281   1.00 25.38 ? 270 PHE A N   1 
ATOM 2047  C CA  . PHE A 1 270 ? 22.546  13.527  9.566   1.00 25.38 ? 270 PHE A CA  1 
ATOM 2048  C C   . PHE A 1 270 ? 22.168  14.898  10.101  1.00 25.38 ? 270 PHE A C   1 
ATOM 2049  O O   . PHE A 1 270 ? 22.816  15.905  9.812   1.00 25.38 ? 270 PHE A O   1 
ATOM 2050  C CB  . PHE A 1 270 ? 23.381  12.815  10.625  1.00 23.21 ? 270 PHE A CB  1 
ATOM 2051  C CG  . PHE A 1 270 ? 23.625  11.375  10.331  1.00 23.21 ? 270 PHE A CG  1 
ATOM 2052  C CD1 . PHE A 1 270 ? 24.835  10.958  9.791   1.00 23.21 ? 270 PHE A CD1 1 
ATOM 2053  C CD2 . PHE A 1 270 ? 22.636  10.434  10.558  1.00 23.21 ? 270 PHE A CD2 1 
ATOM 2054  C CE1 . PHE A 1 270 ? 25.054  9.613   9.478   1.00 23.21 ? 270 PHE A CE1 1 
ATOM 2055  C CE2 . PHE A 1 270 ? 22.844  9.096   10.248  1.00 23.21 ? 270 PHE A CE2 1 
ATOM 2056  C CZ  . PHE A 1 270 ? 24.056  8.683   9.706   1.00 23.21 ? 270 PHE A CZ  1 
ATOM 2057  N N   . LEU A 1 271 ? 21.104  14.919  10.891  1.00 23.04 ? 271 LEU A N   1 
ATOM 2058  C CA  . LEU A 1 271 ? 20.630  16.145  11.508  1.00 23.04 ? 271 LEU A CA  1 
ATOM 2059  C C   . LEU A 1 271 ? 21.062  16.099  12.980  1.00 23.04 ? 271 LEU A C   1 
ATOM 2060  O O   . LEU A 1 271 ? 20.921  15.062  13.655  1.00 23.04 ? 271 LEU A O   1 
ATOM 2061  C CB  . LEU A 1 271 ? 19.105  16.248  11.364  1.00 25.05 ? 271 LEU A CB  1 
ATOM 2062  C CG  . LEU A 1 271 ? 18.210  15.095  11.843  1.00 25.05 ? 271 LEU A CG  1 
ATOM 2063  C CD1 . LEU A 1 271 ? 17.850  15.256  13.313  1.00 25.05 ? 271 LEU A CD1 1 
ATOM 2064  C CD2 . LEU A 1 271 ? 16.942  15.087  11.004  1.00 25.05 ? 271 LEU A CD2 1 
ATOM 2065  N N   . SER A 1 272 ? 21.614  17.212  13.463  1.00 49.45 ? 272 SER A N   1 
ATOM 2066  C CA  . SER A 1 272 ? 22.102  17.293  14.838  1.00 49.45 ? 272 SER A CA  1 
ATOM 2067  C C   . SER A 1 272 ? 21.013  17.069  15.868  1.00 49.45 ? 272 SER A C   1 
ATOM 2068  O O   . SER A 1 272 ? 21.288  16.607  16.975  1.00 49.45 ? 272 SER A O   1 
ATOM 2069  C CB  . SER A 1 272 ? 22.784  18.644  15.091  1.00 50.91 ? 272 SER A CB  1 
ATOM 2070  O OG  . SER A 1 272 ? 21.916  19.736  14.844  1.00 50.91 ? 272 SER A OG  1 
ATOM 2071  N N   . GLY A 1 273 ? 19.777  17.393  15.501  1.00 39.25 ? 273 GLY A N   1 
ATOM 2072  C CA  . GLY A 1 273 ? 18.668  17.218  16.421  1.00 39.25 ? 273 GLY A CA  1 
ATOM 2073  C C   . GLY A 1 273 ? 18.854  17.993  17.712  1.00 39.25 ? 273 GLY A C   1 
ATOM 2074  O O   . GLY A 1 273 ? 19.122  19.199  17.690  1.00 39.25 ? 273 GLY A O   1 
ATOM 2075  N N   . GLY A 1 274 ? 18.713  17.303  18.840  1.00 40.93 ? 274 GLY A N   1 
ATOM 2076  C CA  . GLY A 1 274 ? 18.878  17.968  20.121  1.00 40.93 ? 274 GLY A CA  1 
ATOM 2077  C C   . GLY A 1 274 ? 20.260  17.779  20.723  1.00 40.93 ? 274 GLY A C   1 
ATOM 2078  O O   . GLY A 1 274 ? 20.513  18.187  21.857  1.00 40.93 ? 274 GLY A O   1 
ATOM 2079  N N   . GLN A 1 275 ? 21.158  17.163  19.961  1.00 36.04 ? 275 GLN A N   1 
ATOM 2080  C CA  . GLN A 1 275 ? 22.512  16.905  20.423  1.00 36.04 ? 275 GLN A CA  1 
ATOM 2081  C C   . GLN A 1 275 ? 23.293  18.193  20.613  1.00 36.04 ? 275 GLN A C   1 
ATOM 2082  O O   . GLN A 1 275 ? 22.984  19.209  19.988  1.00 36.04 ? 275 GLN A O   1 
ATOM 2083  C CB  . GLN A 1 275 ? 23.244  16.026  19.418  1.00 32.21 ? 275 GLN A CB  1 
ATOM 2084  C CG  . GLN A 1 275 ? 22.515  14.758  19.074  1.00 32.21 ? 275 GLN A CG  1 
ATOM 2085  C CD  . GLN A 1 275 ? 23.341  13.852  18.184  1.00 32.21 ? 275 GLN A CD  1 
ATOM 2086  O OE1 . GLN A 1 275 ? 24.395  13.355  18.589  1.00 32.21 ? 275 GLN A OE1 1 
ATOM 2087  N NE2 . GLN A 1 275 ? 22.871  13.634  16.958  1.00 32.21 ? 275 GLN A NE2 1 
ATOM 2088  N N   . SER A 1 276 ? 24.304  18.133  21.479  1.00 35.88 ? 276 SER A N   1 
ATOM 2089  C CA  . SER A 1 276 ? 25.172  19.272  21.768  1.00 35.88 ? 276 SER A CA  1 
ATOM 2090  C C   . SER A 1 276 ? 26.221  19.338  20.669  1.00 35.88 ? 276 SER A C   1 
ATOM 2091  O O   . SER A 1 276 ? 26.412  18.363  19.938  1.00 35.88 ? 276 SER A O   1 
ATOM 2092  C CB  . SER A 1 276 ? 25.863  19.069  23.107  1.00 40.95 ? 276 SER A CB  1 
ATOM 2093  O OG  . SER A 1 276 ? 26.646  17.893  23.073  1.00 40.95 ? 276 SER A OG  1 
ATOM 2094  N N   . GLU A 1 277 ? 26.911  20.468  20.551  1.00 28.52 ? 277 GLU A N   1 
ATOM 2095  C CA  . GLU A 1 277 ? 27.921  20.591  19.503  1.00 28.52 ? 277 GLU A CA  1 
ATOM 2096  C C   . GLU A 1 277 ? 28.883  19.412  19.516  1.00 28.52 ? 277 GLU A C   1 
ATOM 2097  O O   . GLU A 1 277 ? 29.250  18.895  18.457  1.00 28.52 ? 277 GLU A O   1 
ATOM 2098  C CB  . GLU A 1 277 ? 28.695  21.908  19.635  1.00 39.05 ? 277 GLU A CB  1 
ATOM 2099  C CG  . GLU A 1 277 ? 27.871  23.127  19.257  1.00 39.05 ? 277 GLU A CG  1 
ATOM 2100  C CD  . GLU A 1 277 ? 28.643  24.434  19.337  1.00 39.05 ? 277 GLU A CD  1 
ATOM 2101  O OE1 . GLU A 1 277 ? 29.236  24.708  20.405  1.00 39.05 ? 277 GLU A OE1 1 
ATOM 2102  O OE2 . GLU A 1 277 ? 28.644  25.193  18.333  1.00 39.05 ? 277 GLU A OE2 1 
ATOM 2103  N N   . GLU A 1 278 ? 29.274  18.979  20.713  1.00 38.22 ? 278 GLU A N   1 
ATOM 2104  C CA  . GLU A 1 278 ? 30.196  17.861  20.834  1.00 38.22 ? 278 GLU A CA  1 
ATOM 2105  C C   . GLU A 1 278 ? 29.529  16.530  20.563  1.00 38.22 ? 278 GLU A C   1 
ATOM 2106  O O   . GLU A 1 278 ? 30.031  15.715  19.788  1.00 38.22 ? 278 GLU A O   1 
ATOM 2107  C CB  . GLU A 1 278 ? 30.844  17.849  22.217  1.00 89.82 ? 278 GLU A CB  1 
ATOM 2108  C CG  . GLU A 1 278 ? 32.032  18.784  22.302  1.00 89.82 ? 278 GLU A CG  1 
ATOM 2109  C CD  . GLU A 1 278 ? 33.033  18.550  21.170  1.00 89.82 ? 278 GLU A CD  1 
ATOM 2110  O OE1 . GLU A 1 278 ? 33.691  17.490  21.158  1.00 89.82 ? 278 GLU A OE1 1 
ATOM 2111  O OE2 . GLU A 1 278 ? 33.157  19.422  20.282  1.00 89.82 ? 278 GLU A OE2 1 
ATOM 2112  N N   . GLU A 1 279 ? 28.388  16.322  21.204  1.00 31.46 ? 279 GLU A N   1 
ATOM 2113  C CA  . GLU A 1 279 ? 27.617  15.097  21.050  1.00 31.46 ? 279 GLU A CA  1 
ATOM 2114  C C   . GLU A 1 279 ? 27.446  14.748  19.566  1.00 31.46 ? 279 GLU A C   1 
ATOM 2115  O O   . GLU A 1 279 ? 27.612  13.594  19.156  1.00 31.46 ? 279 GLU A O   1 
ATOM 2116  C CB  . GLU A 1 279 ? 26.262  15.294  21.714  1.00 60.46 ? 279 GLU A CB  1 
ATOM 2117  C CG  . GLU A 1 279 ? 25.467  14.043  21.891  1.00 60.46 ? 279 GLU A CG  1 
ATOM 2118  C CD  . GLU A 1 279 ? 24.225  14.286  22.721  1.00 60.46 ? 279 GLU A CD  1 
ATOM 2119  O OE1 . GLU A 1 279 ? 23.435  13.327  22.886  1.00 60.46 ? 279 GLU A OE1 1 
ATOM 2120  O OE2 . GLU A 1 279 ? 24.043  15.430  23.208  1.00 60.46 ? 279 GLU A OE2 1 
ATOM 2121  N N   . ALA A 1 280 ? 27.126  15.757  18.762  1.00 28.49 ? 280 ALA A N   1 
ATOM 2122  C CA  . ALA A 1 280 ? 26.935  15.562  17.335  1.00 28.49 ? 280 ALA A CA  1 
ATOM 2123  C C   . ALA A 1 280 ? 28.240  15.124  16.689  1.00 28.49 ? 280 ALA A C   1 
ATOM 2124  O O   . ALA A 1 280 ? 28.276  14.145  15.952  1.00 28.49 ? 280 ALA A O   1 
ATOM 2125  C CB  . ALA A 1 280 ? 26.442  16.848  16.698  1.00 31.25 ? 280 ALA A CB  1 
ATOM 2126  N N   . SER A 1 281 ? 29.312  15.852  16.980  1.00 29.03 ? 281 SER A N   1 
ATOM 2127  C CA  . SER A 1 281 ? 30.627  15.548  16.423  1.00 29.03 ? 281 SER A CA  1 
ATOM 2128  C C   . SER A 1 281 ? 31.108  14.147  16.809  1.00 29.03 ? 281 SER A C   1 
ATOM 2129  O O   . SER A 1 281 ? 31.576  13.381  15.959  1.00 29.03 ? 281 SER A O   1 
ATOM 2130  C CB  . SER A 1 281 ? 31.632  16.595  16.898  1.00 33.57 ? 281 SER A CB  1 
ATOM 2131  O OG  . SER A 1 281 ? 31.170  17.902  16.598  1.00 33.57 ? 281 SER A OG  1 
ATOM 2132  N N   . PHE A 1 282 ? 30.992  13.815  18.092  1.00 35.17 ? 282 PHE A N   1 
ATOM 2133  C CA  . PHE A 1 282 ? 31.410  12.507  18.582  1.00 35.17 ? 282 PHE A CA  1 
ATOM 2134  C C   . PHE A 1 282 ? 30.640  11.395  17.903  1.00 35.17 ? 282 PHE A C   1 
ATOM 2135  O O   . PHE A 1 282 ? 31.233  10.459  17.356  1.00 35.17 ? 282 PHE A O   1 
ATOM 2136  C CB  . PHE A 1 282 ? 31.208  12.412  20.090  1.00 73.69 ? 282 PHE A CB  1 
ATOM 2137  C CG  . PHE A 1 282 ? 32.368  12.925  20.876  1.00 73.69 ? 282 PHE A CG  1 
ATOM 2138  C CD1 . PHE A 1 282 ? 32.835  14.220  20.686  1.00 73.69 ? 282 PHE A CD1 1 
ATOM 2139  C CD2 . PHE A 1 282 ? 33.019  12.105  21.788  1.00 73.69 ? 282 PHE A CD2 1 
ATOM 2140  C CE1 . PHE A 1 282 ? 33.937  14.692  21.390  1.00 73.69 ? 282 PHE A CE1 1 
ATOM 2141  C CE2 . PHE A 1 282 ? 34.123  12.567  22.499  1.00 73.69 ? 282 PHE A CE2 1 
ATOM 2142  C CZ  . PHE A 1 282 ? 34.582  13.866  22.297  1.00 73.69 ? 282 PHE A CZ  1 
ATOM 2143  N N   . ASN A 1 283 ? 29.316  11.507  17.941  1.00 27.49 ? 283 ASN A N   1 
ATOM 2144  C CA  . ASN A 1 283 ? 28.445  10.517  17.330  1.00 27.49 ? 283 ASN A CA  1 
ATOM 2145  C C   . ASN A 1 283 ? 28.737  10.386  15.831  1.00 27.49 ? 283 ASN A C   1 
ATOM 2146  O O   . ASN A 1 283 ? 28.871  9.276   15.312  1.00 27.49 ? 283 ASN A O   1 
ATOM 2147  C CB  . ASN A 1 283 ? 26.980  10.895  17.586  1.00 30.08 ? 283 ASN A CB  1 
ATOM 2148  C CG  . ASN A 1 283 ? 26.543  10.606  19.018  1.00 30.08 ? 283 ASN A CG  1 
ATOM 2149  O OD1 . ASN A 1 283 ? 25.559  11.153  19.504  1.00 30.08 ? 283 ASN A OD1 1 
ATOM 2150  N ND2 . ASN A 1 283 ? 27.271  9.730   19.692  1.00 30.08 ? 283 ASN A ND2 1 
ATOM 2151  N N   . LEU A 1 284 ? 28.860  11.507  15.130  1.00 25.69 ? 284 LEU A N   1 
ATOM 2152  C CA  . LEU A 1 284 ? 29.145  11.428  13.704  1.00 25.69 ? 284 LEU A CA  1 
ATOM 2153  C C   . LEU A 1 284 ? 30.457  10.700  13.482  1.00 25.69 ? 284 LEU A C   1 
ATOM 2154  O O   . LEU A 1 284 ? 30.547  9.816   12.629  1.00 25.69 ? 284 LEU A O   1 
ATOM 2155  C CB  . LEU A 1 284 ? 29.222  12.821  13.067  1.00 10.21 ? 284 LEU A CB  1 
ATOM 2156  C CG  . LEU A 1 284 ? 29.638  12.848  11.584  1.00 10.21 ? 284 LEU A CG  1 
ATOM 2157  C CD1 . LEU A 1 284 ? 28.810  11.859  10.771  1.00 10.21 ? 284 LEU A CD1 1 
ATOM 2158  C CD2 . LEU A 1 284 ? 29.467  14.257  11.036  1.00 10.21 ? 284 LEU A CD2 1 
ATOM 2159  N N   . ASN A 1 285 ? 31.474  11.073  14.252  1.00 29.34 ? 285 ASN A N   1 
ATOM 2160  C CA  . ASN A 1 285 ? 32.777  10.441  14.119  1.00 29.34 ? 285 ASN A CA  1 
ATOM 2161  C C   . ASN A 1 285 ? 32.630  8.937   14.328  1.00 29.34 ? 285 ASN A C   1 
ATOM 2162  O O   . ASN A 1 285 ? 33.060  8.133   13.498  1.00 29.34 ? 285 ASN A O   1 
ATOM 2163  C CB  . ASN A 1 285 ? 33.750  11.016  15.143  1.00 44.21 ? 285 ASN A CB  1 
ATOM 2164  C CG  . ASN A 1 285 ? 35.196  10.732  14.790  1.00 44.21 ? 285 ASN A CG  1 
ATOM 2165  O OD1 . ASN A 1 285 ? 35.748  11.304  13.848  1.00 44.21 ? 285 ASN A OD1 1 
ATOM 2166  N ND2 . ASN A 1 285 ? 35.816  9.837   15.541  1.00 44.21 ? 285 ASN A ND2 1 
ATOM 2167  N N   . ALA A 1 286 ? 32.003  8.566   15.438  1.00 25.63 ? 286 ALA A N   1 
ATOM 2168  C CA  . ALA A 1 286 ? 31.785  7.161   15.755  1.00 25.63 ? 286 ALA A CA  1 
ATOM 2169  C C   . ALA A 1 286 ? 31.148  6.436   14.573  1.00 25.63 ? 286 ALA A C   1 
ATOM 2170  O O   . ALA A 1 286 ? 31.567  5.334   14.204  1.00 25.63 ? 286 ALA A O   1 
ATOM 2171  C CB  . ALA A 1 286 ? 30.894  7.038   16.986  1.00 13.74 ? 286 ALA A CB  1 
ATOM 2172  N N   . ILE A 1 287 ? 30.127  7.060   13.990  1.00 26.84 ? 287 ILE A N   1 
ATOM 2173  C CA  . ILE A 1 287 ? 29.425  6.490   12.848  1.00 26.84 ? 287 ILE A CA  1 
ATOM 2174  C C   . ILE A 1 287 ? 30.417  6.197   11.731  1.00 26.84 ? 287 ILE A C   1 
ATOM 2175  O O   . ILE A 1 287 ? 30.445  5.090   11.189  1.00 26.84 ? 287 ILE A O   1 
ATOM 2176  C CB  . ILE A 1 287 ? 28.336  7.465   12.320  1.00 24.79 ? 287 ILE A CB  1 
ATOM 2177  C CG1 . ILE A 1 287 ? 27.158  7.499   13.293  1.00 24.79 ? 287 ILE A CG1 1 
ATOM 2178  C CG2 . ILE A 1 287 ? 27.877  7.055   10.924  1.00 24.79 ? 287 ILE A CG2 1 
ATOM 2179  C CD1 . ILE A 1 287 ? 26.086  8.510   12.919  1.00 24.79 ? 287 ILE A CD1 1 
ATOM 2180  N N   . ASN A 1 288 ? 31.233  7.190   11.391  1.00 38.27 ? 288 ASN A N   1 
ATOM 2181  C CA  . ASN A 1 288 ? 32.213  7.020   10.333  1.00 38.27 ? 288 ASN A CA  1 
ATOM 2182  C C   . ASN A 1 288 ? 33.338  6.069   10.720  1.00 38.27 ? 288 ASN A C   1 
ATOM 2183  O O   . ASN A 1 288 ? 34.237  5.802   9.921   1.00 38.27 ? 288 ASN A O   1 
ATOM 2184  C CB  . ASN A 1 288 ? 32.795  8.367   9.922   1.00 37.49 ? 288 ASN A CB  1 
ATOM 2185  C CG  . ASN A 1 288 ? 31.965  9.058   8.867   1.00 37.49 ? 288 ASN A CG  1 
ATOM 2186  O OD1 . ASN A 1 288 ? 31.849  8.584   7.735   1.00 37.49 ? 288 ASN A OD1 1 
ATOM 2187  N ND2 . ASN A 1 288 ? 31.380  10.187  9.231   1.00 37.49 ? 288 ASN A ND2 1 
ATOM 2188  N N   . ARG A 1 289 ? 33.297  5.561   11.946  1.00 38.53 ? 289 ARG A N   1 
ATOM 2189  C CA  . ARG A 1 289 ? 34.311  4.618   12.390  1.00 38.53 ? 289 ARG A CA  1 
ATOM 2190  C C   . ARG A 1 289 ? 33.674  3.260   12.664  1.00 38.53 ? 289 ARG A C   1 
ATOM 2191  O O   . ARG A 1 289 ? 34.339  2.329   13.116  1.00 38.53 ? 289 ARG A O   1 
ATOM 2192  C CB  . ARG A 1 289 ? 35.026  5.153   13.631  1.00 83.13 ? 289 ARG A CB  1 
ATOM 2193  C CG  . ARG A 1 289 ? 36.304  5.907   13.301  1.00 83.13 ? 289 ARG A CG  1 
ATOM 2194  C CD  . ARG A 1 289 ? 36.570  7.017   14.296  1.00 83.13 ? 289 ARG A CD  1 
ATOM 2195  N NE  . ARG A 1 289 ? 36.668  6.533   15.671  1.00 83.13 ? 289 ARG A NE  1 
ATOM 2196  C CZ  . ARG A 1 289 ? 37.733  5.917   16.178  1.00 83.13 ? 289 ARG A CZ  1 
ATOM 2197  N NH1 . ARG A 1 289 ? 38.804  5.710   15.415  1.00 83.13 ? 289 ARG A NH1 1 
ATOM 2198  N NH2 . ARG A 1 289 ? 37.724  5.506   17.448  1.00 83.13 ? 289 ARG A NH2 1 
ATOM 2199  N N   . CYS A 1 290 ? 32.379  3.150   12.376  1.00 39.66 ? 290 CYS A N   1 
ATOM 2200  C CA  . CYS A 1 290 ? 31.657  1.897   12.572  1.00 39.66 ? 290 CYS A CA  1 
ATOM 2201  C C   . CYS A 1 290 ? 32.238  0.838   11.635  1.00 39.66 ? 290 CYS A C   1 
ATOM 2202  O O   . CYS A 1 290 ? 32.547  1.118   10.480  1.00 39.66 ? 290 CYS A O   1 
ATOM 2203  C CB  . CYS A 1 290 ? 30.161  2.079   12.275  1.00 39.50 ? 290 CYS A CB  1 
ATOM 2204  S SG  . CYS A 1 290 ? 29.155  0.584   12.536  1.00 39.50 ? 290 CYS A SG  1 
ATOM 2205  N N   . PRO A 1 291 ? 32.395  -0.393  12.132  1.00 44.08 ? 291 PRO A N   1 
ATOM 2206  C CA  . PRO A 1 291 ? 32.934  -1.542  11.397  1.00 44.08 ? 291 PRO A CA  1 
ATOM 2207  C C   . PRO A 1 291 ? 32.155  -1.868  10.127  1.00 44.08 ? 291 PRO A C   1 
ATOM 2208  O O   . PRO A 1 291 ? 32.732  -2.228  9.100   1.00 44.08 ? 291 PRO A O   1 
ATOM 2209  C CB  . PRO A 1 291 ? 32.833  -2.672  12.409  1.00 37.68 ? 291 PRO A CB  1 
ATOM 2210  C CG  . PRO A 1 291 ? 32.973  -1.960  13.721  1.00 37.68 ? 291 PRO A CG  1 
ATOM 2211  C CD  . PRO A 1 291 ? 32.103  -0.756  13.529  1.00 37.68 ? 291 PRO A CD  1 
ATOM 2212  N N   . LEU A 1 292 ? 30.837  -1.749  10.209  1.00 38.17 ? 292 LEU A N   1 
ATOM 2213  C CA  . LEU A 1 292 ? 29.967  -2.037  9.079   1.00 38.17 ? 292 LEU A CA  1 
ATOM 2214  C C   . LEU A 1 292 ? 30.289  -1.177  7.861   1.00 38.17 ? 292 LEU A C   1 
ATOM 2215  O O   . LEU A 1 292 ? 30.634  -0.007  7.984   1.00 38.17 ? 292 LEU A O   1 
ATOM 2216  C CB  . LEU A 1 292 ? 28.517  -1.824  9.499   1.00 25.82 ? 292 LEU A CB  1 
ATOM 2217  C CG  . LEU A 1 292 ? 28.135  -2.686  10.698  1.00 25.82 ? 292 LEU A CG  1 
ATOM 2218  C CD1 . LEU A 1 292 ? 26.864  -2.180  11.331  1.00 25.82 ? 292 LEU A CD1 1 
ATOM 2219  C CD2 . LEU A 1 292 ? 27.988  -4.115  10.234  1.00 25.82 ? 292 LEU A CD2 1 
ATOM 2220  N N   . PRO A 1 293 ? 30.182  -1.760  6.665   1.00 33.21 ? 293 PRO A N   1 
ATOM 2221  C CA  . PRO A 1 293 ? 30.446  -1.100  5.383   1.00 33.21 ? 293 PRO A CA  1 
ATOM 2222  C C   . PRO A 1 293 ? 29.356  -0.084  5.051   1.00 33.21 ? 293 PRO A C   1 
ATOM 2223  O O   . PRO A 1 293 ? 28.186  -0.327  5.335   1.00 33.21 ? 293 PRO A O   1 
ATOM 2224  C CB  . PRO A 1 293 ? 30.434  -2.261  4.388   1.00 21.95 ? 293 PRO A CB  1 
ATOM 2225  C CG  . PRO A 1 293 ? 30.742  -3.458  5.227   1.00 21.95 ? 293 PRO A CG  1 
ATOM 2226  C CD  . PRO A 1 293 ? 29.958  -3.198  6.471   1.00 21.95 ? 293 PRO A CD  1 
ATOM 2227  N N   . ARG A 1 294 ? 29.729  1.036   4.438   1.00 35.41 ? 294 ARG A N   1 
ATOM 2228  C CA  . ARG A 1 294 ? 28.753  2.051   4.070   1.00 35.41 ? 294 ARG A CA  1 
ATOM 2229  C C   . ARG A 1 294 ? 28.938  2.533   2.646   1.00 35.41 ? 294 ARG A C   1 
ATOM 2230  O O   . ARG A 1 294 ? 29.902  3.217   2.337   1.00 35.41 ? 294 ARG A O   1 
ATOM 2231  C CB  . ARG A 1 294 ? 28.842  3.235   5.015   1.00 55.54 ? 294 ARG A CB  1 
ATOM 2232  C CG  . ARG A 1 294 ? 28.563  2.853   6.436   1.00 55.54 ? 294 ARG A CG  1 
ATOM 2233  C CD  . ARG A 1 294 ? 29.837  2.569   7.154   1.00 55.54 ? 294 ARG A CD  1 
ATOM 2234  N NE  . ARG A 1 294 ? 30.622  3.789   7.257   1.00 55.54 ? 294 ARG A NE  1 
ATOM 2235  C CZ  . ARG A 1 294 ? 31.720  3.907   7.992   1.00 55.54 ? 294 ARG A CZ  1 
ATOM 2236  N NH1 . ARG A 1 294 ? 32.167  2.872   8.695   1.00 55.54 ? 294 ARG A NH1 1 
ATOM 2237  N NH2 . ARG A 1 294 ? 32.370  5.064   8.025   1.00 55.54 ? 294 ARG A NH2 1 
ATOM 2238  N N   . PRO A 1 295 ? 27.989  2.207   1.763   1.00 34.96 ? 295 PRO A N   1 
ATOM 2239  C CA  . PRO A 1 295 ? 27.992  2.573   0.339   1.00 34.96 ? 295 PRO A CA  1 
ATOM 2240  C C   . PRO A 1 295 ? 27.782  4.058   0.058   1.00 34.96 ? 295 PRO A C   1 
ATOM 2241  O O   . PRO A 1 295 ? 27.850  4.501   -1.100  1.00 34.96 ? 295 PRO A O   1 
ATOM 2242  C CB  . PRO A 1 295 ? 26.832  1.755   -0.238  1.00 28.52 ? 295 PRO A CB  1 
ATOM 2243  C CG  . PRO A 1 295 ? 26.501  0.743   0.837   1.00 28.52 ? 295 PRO A CG  1 
ATOM 2244  C CD  . PRO A 1 295 ? 26.765  1.472   2.105   1.00 28.52 ? 295 PRO A CD  1 
ATOM 2245  N N   . TRP A 1 296 ? 27.534  4.823   1.111   1.00 22.36 ? 296 TRP A N   1 
ATOM 2246  C CA  . TRP A 1 296 ? 27.239  6.247   0.967   1.00 22.36 ? 296 TRP A CA  1 
ATOM 2247  C C   . TRP A 1 296 ? 27.990  7.144   1.940   1.00 22.36 ? 296 TRP A C   1 
ATOM 2248  O O   . TRP A 1 296 ? 28.464  6.702   2.994   1.00 22.36 ? 296 TRP A O   1 
ATOM 2249  C CB  . TRP A 1 296 ? 25.744  6.450   1.189   1.00 29.77 ? 296 TRP A CB  1 
ATOM 2250  C CG  . TRP A 1 296 ? 25.284  5.542   2.280   1.00 29.77 ? 296 TRP A CG  1 
ATOM 2251  C CD1 . TRP A 1 296 ? 25.803  5.437   3.557   1.00 29.77 ? 296 TRP A CD1 1 
ATOM 2252  C CD2 . TRP A 1 296 ? 24.316  4.524   2.165   1.00 29.77 ? 296 TRP A CD2 1 
ATOM 2253  N NE1 . TRP A 1 296 ? 25.212  4.393   4.235   1.00 29.77 ? 296 TRP A NE1 1 
ATOM 2254  C CE2 . TRP A 1 296 ? 24.294  3.815   3.405   1.00 29.77 ? 296 TRP A CE2 1 
ATOM 2255  C CE3 . TRP A 1 296 ? 23.465  4.132   1.141   1.00 29.77 ? 296 TRP A CE3 1 
ATOM 2256  C CZ2 . TRP A 1 296 ? 23.455  2.749   3.636   1.00 29.77 ? 296 TRP A CZ2 1 
ATOM 2257  C CZ3 . TRP A 1 296 ? 22.635  3.083   1.363   1.00 29.77 ? 296 TRP A CZ3 1 
ATOM 2258  C CH2 . TRP A 1 296 ? 22.629  2.390   2.611   1.00 29.77 ? 296 TRP A CH2 1 
ATOM 2259  N N   . ALA A 1 297 ? 28.075  8.419   1.588   1.00 17.98 ? 297 ALA A N   1 
ATOM 2260  C CA  . ALA A 1 297 ? 28.734  9.381   2.445   1.00 17.98 ? 297 ALA A CA  1 
ATOM 2261  C C   . ALA A 1 297 ? 27.933  9.457   3.737   1.00 17.98 ? 297 ALA A C   1 
ATOM 2262  O O   . ALA A 1 297 ? 26.705  9.372   3.720   1.00 17.98 ? 297 ALA A O   1 
ATOM 2263  C CB  . ALA A 1 297 ? 28.753  10.736  1.774   1.00 5.10  ? 297 ALA A CB  1 
ATOM 2264  N N   . LEU A 1 298 ? 28.612  9.594   4.863   1.00 26.13 ? 298 LEU A N   1 
ATOM 2265  C CA  . LEU A 1 298 ? 27.893  9.723   6.111   1.00 26.13 ? 298 LEU A CA  1 
ATOM 2266  C C   . LEU A 1 298 ? 28.386  10.992  6.775   1.00 26.13 ? 298 LEU A C   1 
ATOM 2267  O O   . LEU A 1 298 ? 29.235  10.924  7.655   1.00 26.13 ? 298 LEU A O   1 
ATOM 2268  C CB  . LEU A 1 298 ? 28.154  8.519   7.016   1.00 12.85 ? 298 LEU A CB  1 
ATOM 2269  C CG  . LEU A 1 298 ? 27.587  7.166   6.591   1.00 12.85 ? 298 LEU A CG  1 
ATOM 2270  C CD1 . LEU A 1 298 ? 27.962  6.112   7.618   1.00 12.85 ? 298 LEU A CD1 1 
ATOM 2271  C CD2 . LEU A 1 298 ? 26.086  7.261   6.470   1.00 12.85 ? 298 LEU A CD2 1 
ATOM 2272  N N   . THR A 1 299 ? 27.899  12.156  6.346   1.00 24.62 ? 299 THR A N   1 
ATOM 2273  C CA  . THR A 1 299 ? 28.351  13.385  6.988   1.00 24.62 ? 299 THR A CA  1 
ATOM 2274  C C   . THR A 1 299 ? 27.236  14.048  7.794   1.00 24.62 ? 299 THR A C   1 
ATOM 2275  O O   . THR A 1 299 ? 26.348  13.375  8.331   1.00 24.62 ? 299 THR A O   1 
ATOM 2276  C CB  . THR A 1 299 ? 28.947  14.425  5.991   1.00 29.85 ? 299 THR A CB  1 
ATOM 2277  O OG1 . THR A 1 299 ? 27.919  15.305  5.554   1.00 29.85 ? 299 THR A OG1 1 
ATOM 2278  C CG2 . THR A 1 299 ? 29.544  13.752  4.776   1.00 29.85 ? 299 THR A CG2 1 
ATOM 2279  N N   . PHE A 1 300 ? 27.282  15.373  7.858   1.00 24.91 ? 300 PHE A N   1 
ATOM 2280  C CA  . PHE A 1 300 ? 26.335  16.151  8.642   1.00 24.91 ? 300 PHE A CA  1 
ATOM 2281  C C   . PHE A 1 300 ? 25.580  17.228  7.868   1.00 24.91 ? 300 PHE A C   1 
ATOM 2282  O O   . PHE A 1 300 ? 26.016  17.687  6.814   1.00 24.91 ? 300 PHE A O   1 
ATOM 2283  C CB  . PHE A 1 300 ? 27.110  16.837  9.765   1.00 28.15 ? 300 PHE A CB  1 
ATOM 2284  C CG  . PHE A 1 300 ? 28.174  17.787  9.260   1.00 28.15 ? 300 PHE A CG  1 
ATOM 2285  C CD1 . PHE A 1 300 ? 27.914  19.151  9.137   1.00 28.15 ? 300 PHE A CD1 1 
ATOM 2286  C CD2 . PHE A 1 300 ? 29.419  17.308  8.846   1.00 28.15 ? 300 PHE A CD2 1 
ATOM 2287  C CE1 . PHE A 1 300 ? 28.879  20.022  8.604   1.00 28.15 ? 300 PHE A CE1 1 
ATOM 2288  C CE2 . PHE A 1 300 ? 30.382  18.171  8.315   1.00 28.15 ? 300 PHE A CE2 1 
ATOM 2289  C CZ  . PHE A 1 300 ? 30.109  19.529  8.194   1.00 28.15 ? 300 PHE A CZ  1 
ATOM 2290  N N   . SER A 1 301 ? 24.442  17.628  8.424   1.00 38.83 ? 301 SER A N   1 
ATOM 2291  C CA  . SER A 1 301 ? 23.610  18.711  7.900   1.00 38.83 ? 301 SER A CA  1 
ATOM 2292  C C   . SER A 1 301 ? 23.134  19.281  9.217   1.00 38.83 ? 301 SER A C   1 
ATOM 2293  O O   . SER A 1 301 ? 21.982  19.118  9.609   1.00 38.83 ? 301 SER A O   1 
ATOM 2294  C CB  . SER A 1 301 ? 22.417  18.200  7.097   1.00 22.70 ? 301 SER A CB  1 
ATOM 2295  O OG  . SER A 1 301 ? 21.689  19.299  6.571   1.00 22.70 ? 301 SER A OG  1 
ATOM 2296  N N   . TYR A 1 302 ? 24.067  19.917  9.911   1.00 34.88 ? 302 TYR A N   1 
ATOM 2297  C CA  . TYR A 1 302 ? 23.817  20.481  11.222  1.00 34.88 ? 302 TYR A CA  1 
ATOM 2298  C C   . TYR A 1 302 ? 23.326  21.918  11.256  1.00 34.88 ? 302 TYR A C   1 
ATOM 2299  O O   . TYR A 1 302 ? 23.716  22.759  10.438  1.00 34.88 ? 302 TYR A O   1 
ATOM 2300  C CB  . TYR A 1 302 ? 25.080  20.372  12.064  1.00 26.93 ? 302 TYR A CB  1 
ATOM 2301  C CG  . TYR A 1 302 ? 25.479  18.962  12.424  1.00 26.93 ? 302 TYR A CG  1 
ATOM 2302  C CD1 . TYR A 1 302 ? 26.586  18.737  13.222  1.00 26.93 ? 302 TYR A CD1 1 
ATOM 2303  C CD2 . TYR A 1 302 ? 24.742  17.858  11.995  1.00 26.93 ? 302 TYR A CD2 1 
ATOM 2304  C CE1 . TYR A 1 302 ? 26.959  17.470  13.593  1.00 26.93 ? 302 TYR A CE1 1 
ATOM 2305  C CE2 . TYR A 1 302 ? 25.111  16.572  12.363  1.00 26.93 ? 302 TYR A CE2 1 
ATOM 2306  C CZ  . TYR A 1 302 ? 26.230  16.393  13.168  1.00 26.93 ? 302 TYR A CZ  1 
ATOM 2307  O OH  . TYR A 1 302 ? 26.657  15.146  13.559  1.00 26.93 ? 302 TYR A OH  1 
ATOM 2308  N N   . GLY A 1 303 ? 22.468  22.185  12.232  1.00 37.62 ? 303 GLY A N   1 
ATOM 2309  C CA  . GLY A 1 303 ? 21.924  23.513  12.393  1.00 37.62 ? 303 GLY A CA  1 
ATOM 2310  C C   . GLY A 1 303 ? 22.510  24.124  13.640  1.00 37.62 ? 303 GLY A C   1 
ATOM 2311  O O   . GLY A 1 303 ? 23.443  24.917  13.555  1.00 37.62 ? 303 GLY A O   1 
ATOM 2312  N N   . ARG A 1 304 ? 21.985  23.749  14.802  1.00 39.41 ? 304 ARG A N   1 
ATOM 2313  C CA  . ARG A 1 304 ? 22.498  24.313  16.035  1.00 39.41 ? 304 ARG A CA  1 
ATOM 2314  C C   . ARG A 1 304 ? 23.886  23.774  16.331  1.00 39.41 ? 304 ARG A C   1 
ATOM 2315  O O   . ARG A 1 304 ? 24.765  24.522  16.754  1.00 39.41 ? 304 ARG A O   1 
ATOM 2316  C CB  . ARG A 1 304 ? 21.569  24.016  17.210  1.00 92.06 ? 304 ARG A CB  1 
ATOM 2317  C CG  . ARG A 1 304 ? 21.811  24.962  18.367  1.00 92.06 ? 304 ARG A CG  1 
ATOM 2318  C CD  . ARG A 1 304 ? 20.896  24.701  19.542  1.00 92.06 ? 304 ARG A CD  1 
ATOM 2319  N NE  . ARG A 1 304 ? 20.356  25.950  20.079  1.00 92.06 ? 304 ARG A NE  1 
ATOM 2320  C CZ  . ARG A 1 304 ? 19.255  26.553  19.623  1.00 92.06 ? 304 ARG A CZ  1 
ATOM 2321  N NH1 . ARG A 1 304 ? 18.560  26.022  18.621  1.00 92.06 ? 304 ARG A NH1 1 
ATOM 2322  N NH2 . ARG A 1 304 ? 18.848  27.699  20.161  1.00 92.06 ? 304 ARG A NH2 1 
ATOM 2323  N N   . ALA A 1 305 ? 24.090  22.483  16.082  1.00 38.65 ? 305 ALA A N   1 
ATOM 2324  C CA  . ALA A 1 305 ? 25.379  21.846  16.348  1.00 38.65 ? 305 ALA A CA  1 
ATOM 2325  C C   . ALA A 1 305 ? 26.574  22.516  15.668  1.00 38.65 ? 305 ALA A C   1 
ATOM 2326  O O   . ALA A 1 305 ? 27.730  22.159  15.931  1.00 38.65 ? 305 ALA A O   1 
ATOM 2327  C CB  . ALA A 1 305 ? 25.320  20.383  15.958  1.00 39.62 ? 305 ALA A CB  1 
ATOM 2328  N N   . LEU A 1 306 ? 26.300  23.478  14.796  1.00 36.66 ? 306 LEU A N   1 
ATOM 2329  C CA  . LEU A 1 306 ? 27.356  24.195  14.100  1.00 36.66 ? 306 LEU A CA  1 
ATOM 2330  C C   . LEU A 1 306 ? 27.411  25.647  14.543  1.00 36.66 ? 306 LEU A C   1 
ATOM 2331  O O   . LEU A 1 306 ? 28.459  26.290  14.471  1.00 36.66 ? 306 LEU A O   1 
ATOM 2332  C CB  . LEU A 1 306 ? 27.134  24.150  12.588  1.00 30.61 ? 306 LEU A CB  1 
ATOM 2333  C CG  . LEU A 1 306 ? 27.760  22.991  11.819  1.00 30.61 ? 306 LEU A CG  1 
ATOM 2334  C CD1 . LEU A 1 306 ? 27.411  23.102  10.346  1.00 30.61 ? 306 LEU A CD1 1 
ATOM 2335  C CD2 . LEU A 1 306 ? 29.264  23.024  12.004  1.00 30.61 ? 306 LEU A CD2 1 
ATOM 2336  N N   . GLN A 1 307 ? 26.290  26.171  15.016  1.00 36.55 ? 307 GLN A N   1 
ATOM 2337  C CA  . GLN A 1 307 ? 26.271  27.567  15.410  1.00 36.55 ? 307 GLN A CA  1 
ATOM 2338  C C   . GLN A 1 307 ? 25.891  27.884  16.850  1.00 36.55 ? 307 GLN A C   1 
ATOM 2339  O O   . GLN A 1 307 ? 25.639  29.037  17.182  1.00 36.55 ? 307 GLN A O   1 
ATOM 2340  C CB  . GLN A 1 307 ? 25.378  28.349  14.430  1.00 33.89 ? 307 GLN A CB  1 
ATOM 2341  C CG  . GLN A 1 307 ? 24.021  27.723  14.166  1.00 33.89 ? 307 GLN A CG  1 
ATOM 2342  C CD  . GLN A 1 307 ? 23.333  28.292  12.933  1.00 33.89 ? 307 GLN A CD  1 
ATOM 2343  O OE1 . GLN A 1 307 ? 22.923  29.456  12.903  1.00 33.89 ? 307 GLN A OE1 1 
ATOM 2344  N NE2 . GLN A 1 307 ? 23.206  27.465  11.904  1.00 33.89 ? 307 GLN A NE2 1 
ATOM 2345  N N   . ALA A 1 308 ? 25.867  26.883  17.717  1.00 37.87 ? 308 ALA A N   1 
ATOM 2346  C CA  . ALA A 1 308 ? 25.505  27.140  19.107  1.00 37.87 ? 308 ALA A CA  1 
ATOM 2347  C C   . ALA A 1 308 ? 26.490  28.105  19.740  1.00 37.87 ? 308 ALA A C   1 
ATOM 2348  O O   . ALA A 1 308 ? 26.140  29.234  20.084  1.00 37.87 ? 308 ALA A O   1 
ATOM 2349  C CB  . ALA A 1 308 ? 25.483  25.852  19.895  1.00 15.30 ? 308 ALA A CB  1 
ATOM 2350  N N   . SER A 1 309 ? 27.728  27.650  19.890  1.00 41.00 ? 309 SER A N   1 
ATOM 2351  C CA  . SER A 1 309 ? 28.766  28.467  20.494  1.00 41.00 ? 309 SER A CA  1 
ATOM 2352  C C   . SER A 1 309 ? 28.989  29.734  19.680  1.00 41.00 ? 309 SER A C   1 
ATOM 2353  O O   . SER A 1 309 ? 29.251  30.799  20.236  1.00 41.00 ? 309 SER A O   1 
ATOM 2354  C CB  . SER A 1 309 ? 30.059  27.664  20.592  1.00 53.34 ? 309 SER A CB  1 
ATOM 2355  O OG  . SER A 1 309 ? 30.418  27.168  19.317  1.00 53.34 ? 309 SER A OG  1 
ATOM 2356  N N   . ALA A 1 310 ? 28.878  29.620  18.362  1.00 29.93 ? 310 ALA A N   1 
ATOM 2357  C CA  . ALA A 1 310 ? 29.071  30.780  17.501  1.00 29.93 ? 310 ALA A CA  1 
ATOM 2358  C C   . ALA A 1 310 ? 28.086  31.879  17.884  1.00 29.93 ? 310 ALA A C   1 
ATOM 2359  O O   . ALA A 1 310 ? 28.455  33.039  18.075  1.00 29.93 ? 310 ALA A O   1 
ATOM 2360  C CB  . ALA A 1 310 ? 28.871  30.386  16.045  1.00 38.79 ? 310 ALA A CB  1 
ATOM 2361  N N   . LEU A 1 311 ? 26.824  31.493  17.998  1.00 42.93 ? 311 LEU A N   1 
ATOM 2362  C CA  . LEU A 1 311 ? 25.748  32.410  18.345  1.00 42.93 ? 311 LEU A CA  1 
ATOM 2363  C C   . LEU A 1 311 ? 25.958  32.944  19.755  1.00 42.93 ? 311 LEU A C   1 
ATOM 2364  O O   . LEU A 1 311 ? 25.739  34.121  20.040  1.00 42.93 ? 311 LEU A O   1 
ATOM 2365  C CB  . LEU A 1 311 ? 24.420  31.660  18.250  1.00 52.68 ? 311 LEU A CB  1 
ATOM 2366  C CG  . LEU A 1 311 ? 23.085  32.394  18.252  1.00 52.68 ? 311 LEU A CG  1 
ATOM 2367  C CD1 . LEU A 1 311 ? 23.081  33.533  17.244  1.00 52.68 ? 311 LEU A CD1 1 
ATOM 2368  C CD2 . LEU A 1 311 ? 22.006  31.380  17.917  1.00 52.68 ? 311 LEU A CD2 1 
ATOM 2369  N N   . ASN A 1 312 ? 26.402  32.057  20.632  1.00 41.74 ? 312 ASN A N   1 
ATOM 2370  C CA  . ASN A 1 312 ? 26.643  32.402  22.017  1.00 41.74 ? 312 ASN A CA  1 
ATOM 2371  C C   . ASN A 1 312 ? 27.761  33.426  22.158  1.00 41.74 ? 312 ASN A C   1 
ATOM 2372  O O   . ASN A 1 312 ? 27.732  34.266  23.054  1.00 41.74 ? 312 ASN A O   1 
ATOM 2373  C CB  . ASN A 1 312 ? 26.995  31.145  22.792  1.00 82.36 ? 312 ASN A CB  1 
ATOM 2374  C CG  . ASN A 1 312 ? 26.457  31.176  24.184  1.00 82.36 ? 312 ASN A CG  1 
ATOM 2375  O OD1 . ASN A 1 312 ? 26.763  32.085  24.954  1.00 82.36 ? 312 ASN A OD1 1 
ATOM 2376  N ND2 . ASN A 1 312 ? 25.634  30.190  24.522  1.00 82.36 ? 312 ASN A ND2 1 
ATOM 2377  N N   . ALA A 1 313 ? 28.746  33.347  21.270  1.00 38.36 ? 313 ALA A N   1 
ATOM 2378  C CA  . ALA A 1 313 ? 29.876  34.270  21.277  1.00 38.36 ? 313 ALA A CA  1 
ATOM 2379  C C   . ALA A 1 313 ? 29.449  35.631  20.741  1.00 38.36 ? 313 ALA A C   1 
ATOM 2380  O O   . ALA A 1 313 ? 29.635  36.649  21.399  1.00 38.36 ? 313 ALA A O   1 
ATOM 2381  C CB  . ALA A 1 313 ? 31.011  33.716  20.426  1.00 33.40 ? 313 ALA A CB  1 
ATOM 2382  N N   . TRP A 1 314 ? 28.883  35.640  19.537  1.00 47.91 ? 314 TRP A N   1 
ATOM 2383  C CA  . TRP A 1 314 ? 28.422  36.876  18.909  1.00 47.91 ? 314 TRP A CA  1 
ATOM 2384  C C   . TRP A 1 314 ? 27.633  37.716  19.903  1.00 47.91 ? 314 TRP A C   1 
ATOM 2385  O O   . TRP A 1 314 ? 27.938  38.889  20.130  1.00 47.91 ? 314 TRP A O   1 
ATOM 2386  C CB  . TRP A 1 314 ? 27.536  36.551  17.716  1.00 41.56 ? 314 TRP A CB  1 
ATOM 2387  C CG  . TRP A 1 314 ? 26.945  37.753  17.059  1.00 41.56 ? 314 TRP A CG  1 
ATOM 2388  C CD1 . TRP A 1 314 ? 27.618  38.832  16.566  1.00 41.56 ? 314 TRP A CD1 1 
ATOM 2389  C CD2 . TRP A 1 314 ? 25.565  37.959  16.741  1.00 41.56 ? 314 TRP A CD2 1 
ATOM 2390  N NE1 . TRP A 1 314 ? 26.743  39.696  15.952  1.00 41.56 ? 314 TRP A NE1 1 
ATOM 2391  C CE2 . TRP A 1 314 ? 25.475  39.183  16.045  1.00 41.56 ? 314 TRP A CE2 1 
ATOM 2392  C CE3 . TRP A 1 314 ? 24.394  37.225  16.973  1.00 41.56 ? 314 TRP A CE3 1 
ATOM 2393  C CZ2 . TRP A 1 314 ? 24.259  39.691  15.575  1.00 41.56 ? 314 TRP A CZ2 1 
ATOM 2394  C CZ3 . TRP A 1 314 ? 23.185  37.730  16.506  1.00 41.56 ? 314 TRP A CZ3 1 
ATOM 2395  C CH2 . TRP A 1 314 ? 23.129  38.952  15.814  1.00 41.56 ? 314 TRP A CH2 1 
ATOM 2396  N N   . ARG A 1 315 ? 26.600  37.105  20.472  1.00 48.60 ? 315 ARG A N   1 
ATOM 2397  C CA  . ARG A 1 315 ? 25.772  37.765  21.467  1.00 48.60 ? 315 ARG A CA  1 
ATOM 2398  C C   . ARG A 1 315 ? 25.200  39.108  20.976  1.00 48.60 ? 315 ARG A C   1 
ATOM 2399  O O   . ARG A 1 315 ? 24.822  39.967  21.773  1.00 48.60 ? 315 ARG A O   1 
ATOM 2400  C CB  . ARG A 1 315 ? 26.613  37.945  22.728  1.00 80.02 ? 315 ARG A CB  1 
ATOM 2401  C CG  . ARG A 1 315 ? 25.830  38.145  23.991  1.00 80.02 ? 315 ARG A CG  1 
ATOM 2402  C CD  . ARG A 1 315 ? 26.611  37.597  25.168  1.00 80.02 ? 315 ARG A CD  1 
ATOM 2403  N NE  . ARG A 1 315 ? 26.430  36.155  25.306  1.00 80.02 ? 315 ARG A NE  1 
ATOM 2404  C CZ  . ARG A 1 315 ? 25.291  35.581  25.689  1.00 80.02 ? 315 ARG A CZ  1 
ATOM 2405  N NH1 . ARG A 1 315 ? 24.225  36.327  25.975  1.00 80.02 ? 315 ARG A NH1 1 
ATOM 2406  N NH2 . ARG A 1 315 ? 25.215  34.259  25.793  1.00 80.02 ? 315 ARG A NH2 1 
ATOM 2407  N N   . GLY A 1 316 ? 25.133  39.276  19.656  1.00 50.22 ? 316 GLY A N   1 
ATOM 2408  C CA  . GLY A 1 316 ? 24.598  40.500  19.085  1.00 50.22 ? 316 GLY A CA  1 
ATOM 2409  C C   . GLY A 1 316 ? 25.598  41.635  18.950  1.00 50.22 ? 316 GLY A C   1 
ATOM 2410  O O   . GLY A 1 316 ? 25.313  42.634  18.294  1.00 50.22 ? 316 GLY A O   1 
ATOM 2411  N N   . GLN A 1 317 ? 26.773  41.485  19.555  1.00 53.44 ? 317 GLN A N   1 
ATOM 2412  C CA  . GLN A 1 317 ? 27.804  42.521  19.507  1.00 53.44 ? 317 GLN A CA  1 
ATOM 2413  C C   . GLN A 1 317 ? 28.605  42.548  18.214  1.00 53.44 ? 317 GLN A C   1 
ATOM 2414  O O   . GLN A 1 317 ? 29.112  41.518  17.768  1.00 53.44 ? 317 GLN A O   1 
ATOM 2415  C CB  . GLN A 1 317 ? 28.752  42.356  20.691  1.00 89.59 ? 317 GLN A CB  1 
ATOM 2416  C CG  . GLN A 1 317 ? 28.074  42.630  22.006  1.00 89.59 ? 317 GLN A CG  1 
ATOM 2417  C CD  . GLN A 1 317 ? 27.361  43.962  21.984  1.00 89.59 ? 317 GLN A CD  1 
ATOM 2418  O OE1 . GLN A 1 317 ? 27.996  45.017  21.922  1.00 89.59 ? 317 GLN A OE1 1 
ATOM 2419  N NE2 . GLN A 1 317 ? 26.033  43.923  22.014  1.00 89.59 ? 317 GLN A NE2 1 
ATOM 2420  N N   . ARG A 1 318 ? 28.735  43.734  17.622  1.00 45.23 ? 318 ARG A N   1 
ATOM 2421  C CA  . ARG A 1 318 ? 29.474  43.865  16.371  1.00 45.23 ? 318 ARG A CA  1 
ATOM 2422  C C   . ARG A 1 318 ? 30.944  43.494  16.517  1.00 45.23 ? 318 ARG A C   1 
ATOM 2423  O O   . ARG A 1 318 ? 31.582  43.081  15.547  1.00 45.23 ? 318 ARG A O   1 
ATOM 2424  C CB  . ARG A 1 318 ? 29.379  45.282  15.811  1.00 96.66 ? 318 ARG A CB  1 
ATOM 2425  C CG  . ARG A 1 318 ? 29.978  45.356  14.424  1.00 96.66 ? 318 ARG A CG  1 
ATOM 2426  C CD  . ARG A 1 318 ? 30.133  46.766  13.904  1.00 96.66 ? 318 ARG A CD  1 
ATOM 2427  N NE  . ARG A 1 318 ? 30.684  46.747  12.547  1.00 96.66 ? 318 ARG A NE  1 
ATOM 2428  C CZ  . ARG A 1 318 ? 31.063  47.824  11.861  1.00 96.66 ? 318 ARG A CZ  1 
ATOM 2429  N NH1 . ARG A 1 318 ? 30.958  49.035  12.400  1.00 96.66 ? 318 ARG A NH1 1 
ATOM 2430  N NH2 . ARG A 1 318 ? 31.546  47.691  10.629  1.00 96.66 ? 318 ARG A NH2 1 
ATOM 2431  N N   . ASP A 1 319 ? 31.482  43.645  17.725  1.00 74.18 ? 319 ASP A N   1 
ATOM 2432  C CA  . ASP A 1 319 ? 32.883  43.319  17.976  1.00 74.18 ? 319 ASP A CA  1 
ATOM 2433  C C   . ASP A 1 319 ? 33.069  41.814  18.039  1.00 74.18 ? 319 ASP A C   1 
ATOM 2434  O O   . ASP A 1 319 ? 34.016  41.268  17.464  1.00 74.18 ? 319 ASP A O   1 
ATOM 2435  C CB  . ASP A 1 319 ? 33.364  43.934  19.294  1.00 95.30 ? 319 ASP A CB  1 
ATOM 2436  C CG  . ASP A 1 319 ? 32.282  44.723  20.001  1.00 95.30 ? 319 ASP A CG  1 
ATOM 2437  O OD1 . ASP A 1 319 ? 31.743  45.669  19.386  1.00 95.30 ? 319 ASP A OD1 1 
ATOM 2438  O OD2 . ASP A 1 319 ? 31.977  44.403  21.174  1.00 95.30 ? 319 ASP A OD2 1 
ATOM 2439  N N   . ASN A 1 320 ? 32.152  41.148  18.735  1.00 50.01 ? 320 ASN A N   1 
ATOM 2440  C CA  . ASN A 1 320 ? 32.210  39.700  18.893  1.00 50.01 ? 320 ASN A CA  1 
ATOM 2441  C C   . ASN A 1 320 ? 32.028  38.935  17.581  1.00 50.01 ? 320 ASN A C   1 
ATOM 2442  O O   . ASN A 1 320 ? 32.164  37.710  17.546  1.00 50.01 ? 320 ASN A O   1 
ATOM 2443  C CB  . ASN A 1 320 ? 31.163  39.262  19.908  1.00 67.18 ? 320 ASN A CB  1 
ATOM 2444  C CG  . ASN A 1 320 ? 31.350  39.935  21.247  1.00 67.18 ? 320 ASN A CG  1 
ATOM 2445  O OD1 . ASN A 1 320 ? 30.550  39.752  22.162  1.00 67.18 ? 320 ASN A OD1 1 
ATOM 2446  N ND2 . ASN A 1 320 ? 32.417  40.723  21.372  1.00 67.18 ? 320 ASN A ND2 1 
ATOM 2447  N N   . ALA A 1 321 ? 31.734  39.665  16.507  1.00 49.86 ? 321 ALA A N   1 
ATOM 2448  C CA  . ALA A 1 321 ? 31.539  39.074  15.187  1.00 49.86 ? 321 ALA A CA  1 
ATOM 2449  C C   . ALA A 1 321 ? 32.621  38.053  14.813  1.00 49.86 ? 321 ALA A C   1 
ATOM 2450  O O   . ALA A 1 321 ? 32.322  36.883  14.542  1.00 49.86 ? 321 ALA A O   1 
ATOM 2451  C CB  . ALA A 1 321 ? 31.494  40.174  14.143  1.00 36.69 ? 321 ALA A CB  1 
ATOM 2452  N N   . GLY A 1 322 ? 33.874  38.506  14.800  1.00 37.78 ? 322 GLY A N   1 
ATOM 2453  C CA  . GLY A 1 322 ? 34.988  37.640  14.448  1.00 37.78 ? 322 GLY A CA  1 
ATOM 2454  C C   . GLY A 1 322 ? 35.133  36.420  15.336  1.00 37.78 ? 322 GLY A C   1 
ATOM 2455  O O   . GLY A 1 322 ? 35.461  35.330  14.864  1.00 37.78 ? 322 GLY A O   1 
ATOM 2456  N N   . ALA A 1 323 ? 34.900  36.602  16.630  1.00 47.34 ? 323 ALA A N   1 
ATOM 2457  C CA  . ALA A 1 323 ? 34.997  35.498  17.571  1.00 47.34 ? 323 ALA A CA  1 
ATOM 2458  C C   . ALA A 1 323 ? 33.907  34.490  17.240  1.00 47.34 ? 323 ALA A C   1 
ATOM 2459  O O   . ALA A 1 323 ? 34.147  33.281  17.210  1.00 47.34 ? 323 ALA A O   1 
ATOM 2460  C CB  . ALA A 1 323 ? 34.816  36.009  18.984  1.00 37.01 ? 323 ALA A CB  1 
ATOM 2461  N N   . ALA A 1 324 ? 32.704  35.002  17.000  1.00 48.60 ? 324 ALA A N   1 
ATOM 2462  C CA  . ALA A 1 324 ? 31.567  34.168  16.660  1.00 48.60 ? 324 ALA A CA  1 
ATOM 2463  C C   . ALA A 1 324 ? 31.924  33.352  15.430  1.00 48.60 ? 324 ALA A C   1 
ATOM 2464  O O   . ALA A 1 324 ? 31.768  32.132  15.414  1.00 48.60 ? 324 ALA A O   1 
ATOM 2465  C CB  . ALA A 1 324 ? 30.363  35.035  16.379  1.00 32.68 ? 324 ALA A CB  1 
ATOM 2466  N N   . THR A 1 325 ? 32.414  34.036  14.403  1.00 31.08 ? 325 THR A N   1 
ATOM 2467  C CA  . THR A 1 325 ? 32.804  33.379  13.162  1.00 31.08 ? 325 THR A CA  1 
ATOM 2468  C C   . THR A 1 325 ? 33.829  32.283  13.414  1.00 31.08 ? 325 THR A C   1 
ATOM 2469  O O   . THR A 1 325 ? 33.836  31.256  12.736  1.00 31.08 ? 325 THR A O   1 
ATOM 2470  C CB  . THR A 1 325 ? 33.410  34.376  12.173  1.00 24.25 ? 325 THR A CB  1 
ATOM 2471  O OG1 . THR A 1 325 ? 32.485  35.450  11.963  1.00 24.25 ? 325 THR A OG1 1 
ATOM 2472  C CG2 . THR A 1 325 ? 33.715  33.694  10.837  1.00 24.25 ? 325 THR A CG2 1 
ATOM 2473  N N   . GLU A 1 326 ? 34.708  32.509  14.383  1.00 33.77 ? 326 GLU A N   1 
ATOM 2474  C CA  . GLU A 1 326 ? 35.721  31.514  14.712  1.00 33.77 ? 326 GLU A CA  1 
ATOM 2475  C C   . GLU A 1 326 ? 35.060  30.292  15.323  1.00 33.77 ? 326 GLU A C   1 
ATOM 2476  O O   . GLU A 1 326 ? 35.354  29.158  14.939  1.00 33.77 ? 326 GLU A O   1 
ATOM 2477  C CB  . GLU A 1 326 ? 36.749  32.077  15.698  1.00 51.41 ? 326 GLU A CB  1 
ATOM 2478  C CG  . GLU A 1 326 ? 37.800  32.970  15.065  1.00 51.41 ? 326 GLU A CG  1 
ATOM 2479  C CD  . GLU A 1 326 ? 38.546  32.285  13.930  1.00 51.41 ? 326 GLU A CD  1 
ATOM 2480  O OE1 . GLU A 1 326 ? 39.154  31.213  14.156  1.00 51.41 ? 326 GLU A OE1 1 
ATOM 2481  O OE2 . GLU A 1 326 ? 38.520  32.832  12.807  1.00 51.41 ? 326 GLU A OE2 1 
ATOM 2482  N N   . GLU A 1 327 ? 34.164  30.529  16.275  1.00 43.59 ? 327 GLU A N   1 
ATOM 2483  C CA  . GLU A 1 327 ? 33.475  29.436  16.937  1.00 43.59 ? 327 GLU A CA  1 
ATOM 2484  C C   . GLU A 1 327 ? 32.816  28.529  15.906  1.00 43.59 ? 327 GLU A C   1 
ATOM 2485  O O   . GLU A 1 327 ? 32.830  27.304  16.049  1.00 43.59 ? 327 GLU A O   1 
ATOM 2486  C CB  . GLU A 1 327 ? 32.444  29.987  17.919  1.00 62.31 ? 327 GLU A CB  1 
ATOM 2487  C CG  . GLU A 1 327 ? 32.602  29.394  19.303  1.00 62.31 ? 327 GLU A CG  1 
ATOM 2488  C CD  . GLU A 1 327 ? 34.005  29.577  19.855  1.00 62.31 ? 327 GLU A CD  1 
ATOM 2489  O OE1 . GLU A 1 327 ? 34.339  28.948  20.884  1.00 62.31 ? 327 GLU A OE1 1 
ATOM 2490  O OE2 . GLU A 1 327 ? 34.773  30.358  19.261  1.00 62.31 ? 327 GLU A OE2 1 
ATOM 2491  N N   . PHE A 1 328 ? 32.259  29.139  14.862  1.00 32.24 ? 328 PHE A N   1 
ATOM 2492  C CA  . PHE A 1 328 ? 31.610  28.398  13.789  1.00 32.24 ? 328 PHE A CA  1 
ATOM 2493  C C   . PHE A 1 328 ? 32.645  27.595  13.001  1.00 32.24 ? 328 PHE A C   1 
ATOM 2494  O O   . PHE A 1 328 ? 32.570  26.362  12.934  1.00 32.24 ? 328 PHE A O   1 
ATOM 2495  C CB  . PHE A 1 328 ? 30.856  29.368  12.865  1.00 22.69 ? 328 PHE A CB  1 
ATOM 2496  C CG  . PHE A 1 328 ? 30.508  28.790  11.510  1.00 22.69 ? 328 PHE A CG  1 
ATOM 2497  C CD1 . PHE A 1 328 ? 29.873  27.554  11.398  1.00 22.69 ? 328 PHE A CD1 1 
ATOM 2498  C CD2 . PHE A 1 328 ? 30.832  29.483  10.340  1.00 22.69 ? 328 PHE A CD2 1 
ATOM 2499  C CE1 . PHE A 1 328 ? 29.570  27.014  10.138  1.00 22.69 ? 328 PHE A CE1 1 
ATOM 2500  C CE2 . PHE A 1 328 ? 30.533  28.953  9.081   1.00 22.69 ? 328 PHE A CE2 1 
ATOM 2501  C CZ  . PHE A 1 328 ? 29.902  27.714  8.982   1.00 22.69 ? 328 PHE A CZ  1 
ATOM 2502  N N   . ILE A 1 329 ? 33.613  28.294  12.413  1.00 29.55 ? 329 ILE A N   1 
ATOM 2503  C CA  . ILE A 1 329 ? 34.660  27.635  11.639  1.00 29.55 ? 329 ILE A CA  1 
ATOM 2504  C C   . ILE A 1 329 ? 35.254  26.466  12.419  1.00 29.55 ? 329 ILE A C   1 
ATOM 2505  O O   . ILE A 1 329 ? 35.603  25.437  11.838  1.00 29.55 ? 329 ILE A O   1 
ATOM 2506  C CB  . ILE A 1 329 ? 35.801  28.610  11.275  1.00 25.56 ? 329 ILE A CB  1 
ATOM 2507  C CG1 . ILE A 1 329 ? 35.238  29.790  10.477  1.00 25.56 ? 329 ILE A CG1 1 
ATOM 2508  C CG2 . ILE A 1 329 ? 36.868  27.879  10.462  1.00 25.56 ? 329 ILE A CG2 1 
ATOM 2509  C CD1 . ILE A 1 329 ? 36.287  30.748  9.945   1.00 25.56 ? 329 ILE A CD1 1 
ATOM 2510  N N   . LYS A 1 330 ? 35.362  26.623  13.737  1.00 33.76 ? 330 LYS A N   1 
ATOM 2511  C CA  . LYS A 1 330 ? 35.918  25.567  14.576  1.00 33.76 ? 330 LYS A CA  1 
ATOM 2512  C C   . LYS A 1 330 ? 35.064  24.309  14.449  1.00 33.76 ? 330 LYS A C   1 
ATOM 2513  O O   . LYS A 1 330 ? 35.551  23.262  14.025  1.00 33.76 ? 330 LYS A O   1 
ATOM 2514  C CB  . LYS A 1 330 ? 35.991  26.017  16.042  1.00 79.06 ? 330 LYS A CB  1 
ATOM 2515  C CG  . LYS A 1 330 ? 36.876  25.123  16.915  1.00 79.06 ? 330 LYS A CG  1 
ATOM 2516  C CD  . LYS A 1 330 ? 36.963  25.601  18.373  1.00 79.06 ? 330 LYS A CD  1 
ATOM 2517  C CE  . LYS A 1 330 ? 37.656  26.966  18.517  1.00 79.06 ? 330 LYS A CE  1 
ATOM 2518  N NZ  . LYS A 1 330 ? 37.786  27.398  19.948  1.00 79.06 ? 330 LYS A NZ  1 
ATOM 2519  N N   . ARG A 1 331 ? 33.784  24.424  14.794  1.00 35.22 ? 331 ARG A N   1 
ATOM 2520  C CA  . ARG A 1 331 ? 32.869  23.292  14.720  1.00 35.22 ? 331 ARG A CA  1 
ATOM 2521  C C   . ARG A 1 331 ? 32.770  22.769  13.289  1.00 35.22 ? 331 ARG A C   1 
ATOM 2522  O O   . ARG A 1 331 ? 32.715  21.559  13.063  1.00 35.22 ? 331 ARG A O   1 
ATOM 2523  C CB  . ARG A 1 331 ? 31.491  23.707  15.210  1.00 35.99 ? 331 ARG A CB  1 
ATOM 2524  C CG  . ARG A 1 331 ? 31.530  24.444  16.516  1.00 35.99 ? 331 ARG A CG  1 
ATOM 2525  C CD  . ARG A 1 331 ? 31.226  23.550  17.692  1.00 35.99 ? 331 ARG A CD  1 
ATOM 2526  N NE  . ARG A 1 331 ? 32.211  22.499  17.936  1.00 35.99 ? 331 ARG A NE  1 
ATOM 2527  C CZ  . ARG A 1 331 ? 32.004  21.211  17.679  1.00 35.99 ? 331 ARG A CZ  1 
ATOM 2528  N NH1 . ARG A 1 331 ? 30.843  20.808  17.154  1.00 35.99 ? 331 ARG A NH1 1 
ATOM 2529  N NH2 . ARG A 1 331 ? 32.938  20.318  17.983  1.00 35.99 ? 331 ARG A NH2 1 
ATOM 2530  N N   . ALA A 1 332 ? 32.745  23.676  12.319  1.00 27.05 ? 332 ALA A N   1 
ATOM 2531  C CA  . ALA A 1 332 ? 32.659  23.258  10.928  1.00 27.05 ? 332 ALA A CA  1 
ATOM 2532  C C   . ALA A 1 332 ? 33.839  22.346  10.585  1.00 27.05 ? 332 ALA A C   1 
ATOM 2533  O O   . ALA A 1 332 ? 33.688  21.335  9.895   1.00 27.05 ? 332 ALA A O   1 
ATOM 2534  C CB  . ALA A 1 332 ? 32.650  24.473  10.016  1.00 26.97 ? 332 ALA A CB  1 
ATOM 2535  N N   . GLU A 1 333 ? 35.018  22.699  11.082  1.00 32.34 ? 333 GLU A N   1 
ATOM 2536  C CA  . GLU A 1 333 ? 36.201  21.910  10.804  1.00 32.34 ? 333 GLU A CA  1 
ATOM 2537  C C   . GLU A 1 333 ? 36.195  20.566  11.506  1.00 32.34 ? 333 GLU A C   1 
ATOM 2538  O O   . GLU A 1 333 ? 36.453  19.534  10.880  1.00 32.34 ? 333 GLU A O   1 
ATOM 2539  C CB  . GLU A 1 333 ? 37.447  22.707  11.168  1.00 48.62 ? 333 GLU A CB  1 
ATOM 2540  C CG  . GLU A 1 333 ? 37.931  23.568  10.015  1.00 48.62 ? 333 GLU A CG  1 
ATOM 2541  C CD  . GLU A 1 333 ? 38.963  24.593  10.426  1.00 48.62 ? 333 GLU A CD  1 
ATOM 2542  O OE1 . GLU A 1 333 ? 39.569  25.215  9.527   1.00 48.62 ? 333 GLU A OE1 1 
ATOM 2543  O OE2 . GLU A 1 333 ? 39.161  24.787  11.643  1.00 48.62 ? 333 GLU A OE2 1 
ATOM 2544  N N   . VAL A 1 334 ? 35.891  20.564  12.799  1.00 27.43 ? 334 VAL A N   1 
ATOM 2545  C CA  . VAL A 1 334 ? 35.871  19.307  13.535  1.00 27.43 ? 334 VAL A CA  1 
ATOM 2546  C C   . VAL A 1 334 ? 34.870  18.336  12.928  1.00 27.43 ? 334 VAL A C   1 
ATOM 2547  O O   . VAL A 1 334 ? 35.173  17.153  12.762  1.00 27.43 ? 334 VAL A O   1 
ATOM 2548  C CB  . VAL A 1 334 ? 35.547  19.515  15.048  1.00 17.58 ? 334 VAL A CB  1 
ATOM 2549  C CG1 . VAL A 1 334 ? 34.831  20.819  15.251  1.00 17.58 ? 334 VAL A CG1 1 
ATOM 2550  C CG2 . VAL A 1 334 ? 34.690  18.366  15.575  1.00 17.58 ? 334 VAL A CG2 1 
ATOM 2551  N N   . ASN A 1 335 ? 33.683  18.827  12.587  1.00 31.54 ? 335 ASN A N   1 
ATOM 2552  C CA  . ASN A 1 335 ? 32.675  17.951  12.010  1.00 31.54 ? 335 ASN A CA  1 
ATOM 2553  C C   . ASN A 1 335 ? 33.121  17.480  10.647  1.00 31.54 ? 335 ASN A C   1 
ATOM 2554  O O   . ASN A 1 335 ? 32.763  16.387  10.217  1.00 31.54 ? 335 ASN A O   1 
ATOM 2555  C CB  . ASN A 1 335 ? 31.316  18.653  11.951  1.00 33.72 ? 335 ASN A CB  1 
ATOM 2556  C CG  . ASN A 1 335 ? 30.650  18.722  13.320  1.00 33.72 ? 335 ASN A CG  1 
ATOM 2557  O OD1 . ASN A 1 335 ? 30.473  17.697  13.984  1.00 33.72 ? 335 ASN A OD1 1 
ATOM 2558  N ND2 . ASN A 1 335 ? 30.287  19.926  13.752  1.00 33.72 ? 335 ASN A ND2 1 
ATOM 2559  N N   . GLY A 1 336 ? 33.924  18.300  9.978   1.00 30.02 ? 336 GLY A N   1 
ATOM 2560  C CA  . GLY A 1 336 ? 34.437  17.916  8.675   1.00 30.02 ? 336 GLY A CA  1 
ATOM 2561  C C   . GLY A 1 336 ? 35.366  16.728  8.868   1.00 30.02 ? 336 GLY A C   1 
ATOM 2562  O O   . GLY A 1 336 ? 35.559  15.911  7.965   1.00 30.02 ? 336 GLY A O   1 
ATOM 2563  N N   . LEU A 1 337 ? 35.951  16.643  10.061  1.00 29.38 ? 337 LEU A N   1 
ATOM 2564  C CA  . LEU A 1 337 ? 36.846  15.545  10.403  1.00 29.38 ? 337 LEU A CA  1 
ATOM 2565  C C   . LEU A 1 337 ? 36.018  14.346  10.822  1.00 29.38 ? 337 LEU A C   1 
ATOM 2566  O O   . LEU A 1 337 ? 36.277  13.222  10.395  1.00 29.38 ? 337 LEU A O   1 
ATOM 2567  C CB  . LEU A 1 337 ? 37.766  15.933  11.558  1.00 25.06 ? 337 LEU A CB  1 
ATOM 2568  C CG  . LEU A 1 337 ? 38.935  16.878  11.284  1.00 25.06 ? 337 LEU A CG  1 
ATOM 2569  C CD1 . LEU A 1 337 ? 39.680  17.100  12.589  1.00 25.06 ? 337 LEU A CD1 1 
ATOM 2570  C CD2 . LEU A 1 337 ? 39.864  16.290  10.222  1.00 25.06 ? 337 LEU A CD2 1 
ATOM 2571  N N   . ALA A 1 338 ? 35.027  14.595  11.674  1.00 35.35 ? 338 ALA A N   1 
ATOM 2572  C CA  . ALA A 1 338 ? 34.142  13.542  12.151  1.00 35.35 ? 338 ALA A CA  1 
ATOM 2573  C C   . ALA A 1 338 ? 33.465  12.878  10.959  1.00 35.35 ? 338 ALA A C   1 
ATOM 2574  O O   . ALA A 1 338 ? 33.085  11.710  11.015  1.00 35.35 ? 338 ALA A O   1 
ATOM 2575  C CB  . ALA A 1 338 ? 33.100  14.121  13.081  1.00 18.74 ? 338 ALA A CB  1 
ATOM 2576  N N   . ALA A 1 339 ? 33.320  13.637  9.879   1.00 28.84 ? 339 ALA A N   1 
ATOM 2577  C CA  . ALA A 1 339 ? 32.696  13.137  8.666   1.00 28.84 ? 339 ALA A CA  1 
ATOM 2578  C C   . ALA A 1 339 ? 33.607  12.147  7.954   1.00 28.84 ? 339 ALA A C   1 
ATOM 2579  O O   . ALA A 1 339 ? 33.265  11.645  6.881   1.00 28.84 ? 339 ALA A O   1 
ATOM 2580  C CB  . ALA A 1 339 ? 32.364  14.291  7.737   1.00 30.10 ? 339 ALA A CB  1 
ATOM 2581  N N   . GLN A 1 340 ? 34.773  11.879  8.538   1.00 41.60 ? 340 GLN A N   1 
ATOM 2582  C CA  . GLN A 1 340 ? 35.724  10.935  7.955   1.00 41.60 ? 340 GLN A CA  1 
ATOM 2583  C C   . GLN A 1 340 ? 36.242  10.027  9.055   1.00 41.60 ? 340 GLN A C   1 
ATOM 2584  O O   . GLN A 1 340 ? 37.181  9.256   8.845   1.00 41.60 ? 340 GLN A O   1 
ATOM 2585  C CB  . GLN A 1 340 ? 36.903  11.665  7.331   1.00 54.60 ? 340 GLN A CB  1 
ATOM 2586  C CG  . GLN A 1 340 ? 36.526  12.885  6.542   1.00 54.60 ? 340 GLN A CG  1 
ATOM 2587  C CD  . GLN A 1 340 ? 37.735  13.561  5.944   1.00 54.60 ? 340 GLN A CD  1 
ATOM 2588  O OE1 . GLN A 1 340 ? 38.409  12.991  5.085   1.00 54.60 ? 340 GLN A OE1 1 
ATOM 2589  N NE2 . GLN A 1 340 ? 38.027  14.781  6.398   1.00 54.60 ? 340 GLN A NE2 1 
ATOM 2590  N N   . GLY A 1 341 ? 35.631  10.143  10.232  1.00 50.56 ? 341 GLY A N   1 
ATOM 2591  C CA  . GLY A 1 341 ? 36.019  9.331   11.370  1.00 50.56 ? 341 GLY A CA  1 
ATOM 2592  C C   . GLY A 1 341 ? 37.386  9.688   11.906  1.00 50.56 ? 341 GLY A C   1 
ATOM 2593  O O   . GLY A 1 341 ? 37.914  9.028   12.804  1.00 50.56 ? 341 GLY A O   1 
ATOM 2594  N N   . LYS A 1 342 ? 37.967  10.743  11.355  1.00 37.53 ? 342 LYS A N   1 
ATOM 2595  C CA  . LYS A 1 342 ? 39.283  11.164  11.791  1.00 37.53 ? 342 LYS A CA  1 
ATOM 2596  C C   . LYS A 1 342 ? 39.241  12.407  12.666  1.00 37.53 ? 342 LYS A C   1 
ATOM 2597  O O   . LYS A 1 342 ? 39.859  13.420  12.358  1.00 37.53 ? 342 LYS A O   1 
ATOM 2598  C CB  . LYS A 1 342 ? 40.198  11.381  10.579  1.00 49.78 ? 342 LYS A CB  1 
ATOM 2599  C CG  . LYS A 1 342 ? 39.635  12.293  9.519   1.00 49.78 ? 342 LYS A CG  1 
ATOM 2600  C CD  . LYS A 1 342 ? 40.601  12.454  8.347   1.00 49.78 ? 342 LYS A CD  1 
ATOM 2601  C CE  . LYS A 1 342 ? 40.837  11.139  7.603   1.00 49.78 ? 342 LYS A CE  1 
ATOM 2602  N NZ  . LYS A 1 342 ? 41.695  11.346  6.391   1.00 49.78 ? 342 LYS A NZ  1 
ATOM 2603  N N   . TYR A 1 343 ? 38.498  12.325  13.760  1.00 41.63 ? 343 TYR A N   1 
ATOM 2604  C CA  . TYR A 1 343 ? 38.403  13.435  14.692  1.00 41.63 ? 343 TYR A CA  1 
ATOM 2605  C C   . TYR A 1 343 ? 38.738  12.894  16.060  1.00 41.63 ? 343 TYR A C   1 
ATOM 2606  O O   . TYR A 1 343 ? 38.100  11.950  16.520  1.00 41.63 ? 343 TYR A O   1 
ATOM 2607  C CB  . TYR A 1 343 ? 36.990  14.007  14.732  1.00 39.38 ? 343 TYR A CB  1 
ATOM 2608  C CG  . TYR A 1 343 ? 36.765  14.927  15.917  1.00 39.38 ? 343 TYR A CG  1 
ATOM 2609  C CD1 . TYR A 1 343 ? 37.437  16.145  16.021  1.00 39.38 ? 343 TYR A CD1 1 
ATOM 2610  C CD2 . TYR A 1 343 ? 35.888  14.576  16.942  1.00 39.38 ? 343 TYR A CD2 1 
ATOM 2611  C CE1 . TYR A 1 343 ? 37.237  16.992  17.116  1.00 39.38 ? 343 TYR A CE1 1 
ATOM 2612  C CE2 . TYR A 1 343 ? 35.680  15.418  18.043  1.00 39.38 ? 343 TYR A CE2 1 
ATOM 2613  C CZ  . TYR A 1 343 ? 36.357  16.624  18.119  1.00 39.38 ? 343 TYR A CZ  1 
ATOM 2614  O OH  . TYR A 1 343 ? 36.137  17.468  19.182  1.00 39.38 ? 343 TYR A OH  1 
ATOM 2615  N N   . GLU A 1 344 ? 39.730  13.483  16.717  1.00 65.49 ? 344 GLU A N   1 
ATOM 2616  C CA  . GLU A 1 344 ? 40.110  13.022  18.046  1.00 68.90 ? 344 GLU A CA  1 
ATOM 2617  C C   . GLU A 1 344 ? 39.679  14.046  19.102  1.00 70.86 ? 344 GLU A C   1 
ATOM 2618  O O   . GLU A 1 344 ? 39.468  15.226  18.741  1.00 70.96 ? 344 GLU A O   1 
ATOM 2619  C CB  . GLU A 1 344 ? 41.624  12.810  18.103  1.00 99.51 ? 344 GLU A CB  1 
ATOM 2620  C CG  . GLU A 1 344 ? 42.207  12.047  16.896  1.00 88.63 ? 344 GLU A CG  1 
ATOM 2621  C CD  . GLU A 1 344 ? 42.470  10.539  17.168  1.00 88.63 ? 344 GLU A CD  1 
ATOM 2622  O OE1 . GLU A 1 344 ? 43.157  10.219  18.189  1.00 88.63 ? 344 GLU A OE1 1 
ATOM 2623  O OE2 . GLU A 1 344 ? 42.007  9.675   16.356  1.00 88.63 ? 344 GLU A OE2 1 
ATOM 2624  N N   . HIS B 1 3   ? -5.217  3.503   18.494  1.00 96.43 ? 3   HIS B N   1 
ATOM 2625  C CA  . HIS B 1 3   ? -4.980  4.226   17.216  1.00 96.43 ? 3   HIS B CA  1 
ATOM 2626  C C   . HIS B 1 3   ? -6.210  5.010   16.779  1.00 96.43 ? 3   HIS B C   1 
ATOM 2627  O O   . HIS B 1 3   ? -6.260  5.542   15.666  1.00 96.43 ? 3   HIS B O   1 
ATOM 2628  C CB  . HIS B 1 3   ? -4.543  3.244   16.110  1.00 91.83 ? 3   HIS B CB  1 
ATOM 2629  C CG  . HIS B 1 3   ? -5.136  1.868   16.227  1.00 91.83 ? 3   HIS B CG  1 
ATOM 2630  N ND1 . HIS B 1 3   ? -4.647  0.790   15.515  1.00 91.83 ? 3   HIS B ND1 1 
ATOM 2631  C CD2 . HIS B 1 3   ? -6.164  1.391   16.969  1.00 91.83 ? 3   HIS B CD2 1 
ATOM 2632  C CE1 . HIS B 1 3   ? -5.346  -0.290  15.816  1.00 91.83 ? 3   HIS B CE1 1 
ATOM 2633  N NE2 . HIS B 1 3   ? -6.273  0.047   16.697  1.00 91.83 ? 3   HIS B NE2 1 
ATOM 2634  N N   . SER B 1 4   ? -7.194  5.086   17.674  1.00 81.35 ? 4   SER B N   1 
ATOM 2635  C CA  . SER B 1 4   ? -8.441  5.805   17.413  1.00 81.35 ? 4   SER B CA  1 
ATOM 2636  C C   . SER B 1 4   ? -8.560  7.087   18.251  1.00 81.35 ? 4   SER B C   1 
ATOM 2637  O O   . SER B 1 4   ? -8.988  7.054   19.410  1.00 81.35 ? 4   SER B O   1 
ATOM 2638  C CB  . SER B 1 4   ? -9.646  4.882   17.674  1.00 93.97 ? 4   SER B CB  1 
ATOM 2639  O OG  . SER B 1 4   ? -9.437  4.027   18.793  1.00 93.97 ? 4   SER B OG  1 
ATOM 2640  N N   . TYR B 1 5   ? -8.166  8.213   17.657  1.00 85.47 ? 5   TYR B N   1 
ATOM 2641  C CA  . TYR B 1 5   ? -8.228  9.512   18.329  1.00 85.47 ? 5   TYR B CA  1 
ATOM 2642  C C   . TYR B 1 5   ? -9.240  10.396  17.606  1.00 85.47 ? 5   TYR B C   1 
ATOM 2643  O O   . TYR B 1 5   ? -8.874  11.209  16.752  1.00 85.47 ? 5   TYR B O   1 
ATOM 2644  C CB  . TYR B 1 5   ? -6.850  10.176  18.331  1.00 87.62 ? 5   TYR B CB  1 
ATOM 2645  C CG  . TYR B 1 5   ? -5.821  9.400   19.116  1.00 87.62 ? 5   TYR B CG  1 
ATOM 2646  C CD1 . TYR B 1 5   ? -5.326  8.180   18.649  1.00 87.62 ? 5   TYR B CD1 1 
ATOM 2647  C CD2 . TYR B 1 5   ? -5.376  9.861   20.350  1.00 87.62 ? 5   TYR B CD2 1 
ATOM 2648  C CE1 . TYR B 1 5   ? -4.415  7.435   19.398  1.00 87.62 ? 5   TYR B CE1 1 
ATOM 2649  C CE2 . TYR B 1 5   ? -4.470  9.128   21.106  1.00 87.62 ? 5   TYR B CE2 1 
ATOM 2650  C CZ  . TYR B 1 5   ? -3.994  7.917   20.629  1.00 87.62 ? 5   TYR B CZ  1 
ATOM 2651  O OH  . TYR B 1 5   ? -3.112  7.196   21.398  1.00 87.62 ? 5   TYR B OH  1 
ATOM 2652  N N   . PRO B 1 6   ? -10.531 10.251  17.960  1.00 57.19 ? 6   PRO B N   1 
ATOM 2653  C CA  . PRO B 1 6   ? -11.682 10.970  17.410  1.00 57.19 ? 6   PRO B CA  1 
ATOM 2654  C C   . PRO B 1 6   ? -11.394 12.263  16.654  1.00 57.19 ? 6   PRO B C   1 
ATOM 2655  O O   . PRO B 1 6   ? -11.129 13.314  17.245  1.00 57.19 ? 6   PRO B O   1 
ATOM 2656  C CB  . PRO B 1 6   ? -12.557 11.176  18.636  1.00 68.88 ? 6   PRO B CB  1 
ATOM 2657  C CG  . PRO B 1 6   ? -12.415 9.851   19.306  1.00 68.88 ? 6   PRO B CG  1 
ATOM 2658  C CD  . PRO B 1 6   ? -10.912 9.586   19.222  1.00 68.88 ? 6   PRO B CD  1 
ATOM 2659  N N   . ALA B 1 7   ? -11.461 12.164  15.331  1.00 53.78 ? 7   ALA B N   1 
ATOM 2660  C CA  . ALA B 1 7   ? -11.221 13.304  14.461  1.00 53.78 ? 7   ALA B CA  1 
ATOM 2661  C C   . ALA B 1 7   ? -12.326 14.337  14.644  1.00 53.78 ? 7   ALA B C   1 
ATOM 2662  O O   . ALA B 1 7   ? -12.069 15.544  14.667  1.00 53.78 ? 7   ALA B O   1 
ATOM 2663  C CB  . ALA B 1 7   ? -11.174 12.844  13.011  1.00 16.90 ? 7   ALA B CB  1 
ATOM 2664  N N   . LEU B 1 8   ? -13.557 13.852  14.781  1.00 34.82 ? 8   LEU B N   1 
ATOM 2665  C CA  . LEU B 1 8   ? -14.707 14.724  14.945  1.00 34.82 ? 8   LEU B CA  1 
ATOM 2666  C C   . LEU B 1 8   ? -15.547 14.357  16.150  1.00 34.82 ? 8   LEU B C   1 
ATOM 2667  O O   . LEU B 1 8   ? -15.660 13.183  16.505  1.00 34.82 ? 8   LEU B O   1 
ATOM 2668  C CB  . LEU B 1 8   ? -15.593 14.654  13.707  1.00 22.47 ? 8   LEU B CB  1 
ATOM 2669  C CG  . LEU B 1 8   ? -14.967 15.080  12.383  1.00 22.47 ? 8   LEU B CG  1 
ATOM 2670  C CD1 . LEU B 1 8   ? -15.911 14.716  11.252  1.00 22.47 ? 8   LEU B CD1 1 
ATOM 2671  C CD2 . LEU B 1 8   ? -14.682 16.578  12.397  1.00 22.47 ? 8   LEU B CD2 1 
ATOM 2672  N N   . SER B 1 9   ? -16.142 15.375  16.762  1.00 31.44 ? 9   SER B N   1 
ATOM 2673  C CA  . SER B 1 9   ? -17.009 15.183  17.911  1.00 31.44 ? 9   SER B CA  1 
ATOM 2674  C C   . SER B 1 9   ? -18.348 14.739  17.356  1.00 31.44 ? 9   SER B C   1 
ATOM 2675  O O   . SER B 1 9   ? -18.578 14.791  16.145  1.00 31.44 ? 9   SER B O   1 
ATOM 2676  C CB  . SER B 1 9   ? -17.207 16.489  18.661  1.00 27.92 ? 9   SER B CB  1 
ATOM 2677  O OG  . SER B 1 9   ? -18.059 17.345  17.928  1.00 27.92 ? 9   SER B OG  1 
ATOM 2678  N N   . ALA B 1 10  ? -19.238 14.316  18.243  1.00 25.48 ? 10  ALA B N   1 
ATOM 2679  C CA  . ALA B 1 10  ? -20.556 13.864  17.819  1.00 25.48 ? 10  ALA B CA  1 
ATOM 2680  C C   . ALA B 1 10  ? -21.312 15.018  17.187  1.00 25.48 ? 10  ALA B C   1 
ATOM 2681  O O   . ALA B 1 10  ? -21.987 14.855  16.173  1.00 25.48 ? 10  ALA B O   1 
ATOM 2682  C CB  . ALA B 1 10  ? -21.322 13.328  19.005  1.00 12.72 ? 10  ALA B CB  1 
ATOM 2683  N N   . GLU B 1 11  ? -21.186 16.189  17.797  1.00 31.95 ? 11  GLU B N   1 
ATOM 2684  C CA  . GLU B 1 11  ? -21.857 17.378  17.304  1.00 31.95 ? 11  GLU B CA  1 
ATOM 2685  C C   . GLU B 1 11  ? -21.403 17.659  15.883  1.00 31.95 ? 11  GLU B C   1 
ATOM 2686  O O   . GLU B 1 11  ? -22.219 17.868  14.988  1.00 31.95 ? 11  GLU B O   1 
ATOM 2687  C CB  . GLU B 1 11  ? -21.501 18.567  18.185  1.00 99.51 ? 11  GLU B CB  1 
ATOM 2688  C CG  . GLU B 1 11  ? -21.129 18.178  19.597  1.00 99.51 ? 11  GLU B CG  1 
ATOM 2689  C CD  . GLU B 1 11  ? -22.131 18.676  20.611  1.00 99.51 ? 11  GLU B CD  1 
ATOM 2690  O OE1 . GLU B 1 11  ? -22.328 19.913  20.696  1.00 99.51 ? 11  GLU B OE1 1 
ATOM 2691  O OE2 . GLU B 1 11  ? -22.716 17.828  21.321  1.00 99.51 ? 11  GLU B OE2 1 
ATOM 2692  N N   . GLN B 1 12  ? -20.089 17.655  15.685  1.00 34.90 ? 12  GLN B N   1 
ATOM 2693  C CA  . GLN B 1 12  ? -19.498 17.935  14.384  1.00 34.90 ? 12  GLN B CA  1 
ATOM 2694  C C   . GLN B 1 12  ? -19.937 16.966  13.305  1.00 34.90 ? 12  GLN B C   1 
ATOM 2695  O O   . GLN B 1 12  ? -20.272 17.379  12.194  1.00 34.90 ? 12  GLN B O   1 
ATOM 2696  C CB  . GLN B 1 12  ? -17.983 17.919  14.493  1.00 42.60 ? 12  GLN B CB  1 
ATOM 2697  C CG  . GLN B 1 12  ? -17.451 18.893  15.509  1.00 42.60 ? 12  GLN B CG  1 
ATOM 2698  C CD  . GLN B 1 12  ? -15.956 18.819  15.634  1.00 42.60 ? 12  GLN B CD  1 
ATOM 2699  O OE1 . GLN B 1 12  ? -15.398 17.765  15.935  1.00 42.60 ? 12  GLN B OE1 1 
ATOM 2700  N NE2 . GLN B 1 12  ? -15.292 19.939  15.401  1.00 42.60 ? 12  GLN B NE2 1 
ATOM 2701  N N   . LYS B 1 13  ? -19.916 15.677  13.624  1.00 36.32 ? 13  LYS B N   1 
ATOM 2702  C CA  . LYS B 1 13  ? -20.331 14.678  12.657  1.00 36.32 ? 13  LYS B CA  1 
ATOM 2703  C C   . LYS B 1 13  ? -21.757 14.997  12.233  1.00 36.32 ? 13  LYS B C   1 
ATOM 2704  O O   . LYS B 1 13  ? -22.100 14.914  11.051  1.00 36.32 ? 13  LYS B O   1 
ATOM 2705  C CB  . LYS B 1 13  ? -20.288 13.285  13.270  1.00 34.25 ? 13  LYS B CB  1 
ATOM 2706  C CG  . LYS B 1 13  ? -18.912 12.758  13.620  1.00 34.25 ? 13  LYS B CG  1 
ATOM 2707  C CD  . LYS B 1 13  ? -19.064 11.343  14.144  1.00 34.25 ? 13  LYS B CD  1 
ATOM 2708  C CE  . LYS B 1 13  ? -17.756 10.721  14.586  1.00 34.25 ? 13  LYS B CE  1 
ATOM 2709  N NZ  . LYS B 1 13  ? -17.971 9.288   15.011  1.00 34.25 ? 13  LYS B NZ  1 
ATOM 2710  N N   . LYS B 1 14  ? -22.586 15.365  13.207  1.00 27.36 ? 14  LYS B N   1 
ATOM 2711  C CA  . LYS B 1 14  ? -23.982 15.706  12.946  1.00 27.36 ? 14  LYS B CA  1 
ATOM 2712  C C   . LYS B 1 14  ? -24.057 16.823  11.917  1.00 27.36 ? 14  LYS B C   1 
ATOM 2713  O O   . LYS B 1 14  ? -24.626 16.644  10.843  1.00 27.36 ? 14  LYS B O   1 
ATOM 2714  C CB  . LYS B 1 14  ? -24.675 16.146  14.240  1.00 63.46 ? 14  LYS B CB  1 
ATOM 2715  C CG  . LYS B 1 14  ? -26.153 16.493  14.086  1.00 63.46 ? 14  LYS B CG  1 
ATOM 2716  C CD  . LYS B 1 14  ? -26.920 15.370  13.399  1.00 63.46 ? 14  LYS B CD  1 
ATOM 2717  C CE  . LYS B 1 14  ? -26.670 14.014  14.078  1.00 63.46 ? 14  LYS B CE  1 
ATOM 2718  N NZ  . LYS B 1 14  ? -27.147 12.837  13.273  1.00 63.46 ? 14  LYS B NZ  1 
ATOM 2719  N N   . GLU B 1 15  ? -23.462 17.970  12.242  1.00 21.49 ? 15  GLU B N   1 
ATOM 2720  C CA  . GLU B 1 15  ? -23.471 19.118  11.346  1.00 21.49 ? 15  GLU B CA  1 
ATOM 2721  C C   . GLU B 1 15  ? -23.082 18.757  9.922   1.00 21.49 ? 15  GLU B C   1 
ATOM 2722  O O   . GLU B 1 15  ? -23.718 19.202  8.965   1.00 21.49 ? 15  GLU B O   1 
ATOM 2723  C CB  . GLU B 1 15  ? -22.531 20.212  11.849  1.00 41.22 ? 15  GLU B CB  1 
ATOM 2724  C CG  . GLU B 1 15  ? -22.320 21.307  10.816  1.00 41.22 ? 15  GLU B CG  1 
ATOM 2725  C CD  . GLU B 1 15  ? -21.477 22.462  11.326  1.00 41.22 ? 15  GLU B CD  1 
ATOM 2726  O OE1 . GLU B 1 15  ? -20.461 22.203  12.014  1.00 41.22 ? 15  GLU B OE1 1 
ATOM 2727  O OE2 . GLU B 1 15  ? -21.825 23.630  11.022  1.00 41.22 ? 15  GLU B OE2 1 
ATOM 2728  N N   . LEU B 1 16  ? -22.035 17.955  9.776   1.00 30.94 ? 16  LEU B N   1 
ATOM 2729  C CA  . LEU B 1 16  ? -21.587 17.570  8.449   1.00 30.94 ? 16  LEU B CA  1 
ATOM 2730  C C   . LEU B 1 16  ? -22.652 16.732  7.755   1.00 30.94 ? 16  LEU B C   1 
ATOM 2731  O O   . LEU B 1 16  ? -23.066 17.042  6.636   1.00 30.94 ? 16  LEU B O   1 
ATOM 2732  C CB  . LEU B 1 16  ? -20.264 16.805  8.542   1.00 18.37 ? 16  LEU B CB  1 
ATOM 2733  C CG  . LEU B 1 16  ? -19.063 17.654  8.984   1.00 18.37 ? 16  LEU B CG  1 
ATOM 2734  C CD1 . LEU B 1 16  ? -17.871 16.756  9.272   1.00 18.37 ? 16  LEU B CD1 1 
ATOM 2735  C CD2 . LEU B 1 16  ? -18.724 18.672  7.898   1.00 18.37 ? 16  LEU B CD2 1 
ATOM 2736  N N   . SER B 1 17  ? -23.110 15.683  8.432   1.00 27.91 ? 17  SER B N   1 
ATOM 2737  C CA  . SER B 1 17  ? -24.126 14.809  7.863   1.00 27.91 ? 17  SER B CA  1 
ATOM 2738  C C   . SER B 1 17  ? -25.361 15.576  7.419   1.00 27.91 ? 17  SER B C   1 
ATOM 2739  O O   . SER B 1 17  ? -25.882 15.343  6.328   1.00 27.91 ? 17  SER B O   1 
ATOM 2740  C CB  . SER B 1 17  ? -24.546 13.749  8.864   1.00 25.50 ? 17  SER B CB  1 
ATOM 2741  O OG  . SER B 1 17  ? -25.554 12.957  8.275   1.00 25.50 ? 17  SER B OG  1 
ATOM 2742  N N   . ASP B 1 18  ? -25.836 16.481  8.271   1.00 26.62 ? 18  ASP B N   1 
ATOM 2743  C CA  . ASP B 1 18  ? -27.008 17.277  7.940   1.00 26.62 ? 18  ASP B CA  1 
ATOM 2744  C C   . ASP B 1 18  ? -26.732 18.044  6.655   1.00 26.62 ? 18  ASP B C   1 
ATOM 2745  O O   . ASP B 1 18  ? -27.426 17.860  5.656   1.00 26.62 ? 18  ASP B O   1 
ATOM 2746  C CB  . ASP B 1 18  ? -27.351 18.246  9.076   1.00 48.84 ? 18  ASP B CB  1 
ATOM 2747  C CG  . ASP B 1 18  ? -27.795 17.527  10.356  1.00 48.84 ? 18  ASP B CG  1 
ATOM 2748  O OD1 . ASP B 1 18  ? -28.275 16.367  10.268  1.00 48.84 ? 18  ASP B OD1 1 
ATOM 2749  O OD2 . ASP B 1 18  ? -27.680 18.129  11.452  1.00 48.84 ? 18  ASP B OD2 1 
ATOM 2750  N N   . ILE B 1 19  ? -25.709 18.889  6.673   1.00 19.21 ? 19  ILE B N   1 
ATOM 2751  C CA  . ILE B 1 19  ? -25.351 19.661  5.492   1.00 19.21 ? 19  ILE B CA  1 
ATOM 2752  C C   . ILE B 1 19  ? -25.330 18.790  4.243   1.00 19.21 ? 19  ILE B C   1 
ATOM 2753  O O   . ILE B 1 19  ? -25.859 19.163  3.204   1.00 19.21 ? 19  ILE B O   1 
ATOM 2754  C CB  . ILE B 1 19  ? -23.962 20.284  5.640   1.00 8.45  ? 19  ILE B CB  1 
ATOM 2755  C CG1 . ILE B 1 19  ? -23.952 21.227  6.833   1.00 8.45  ? 19  ILE B CG1 1 
ATOM 2756  C CG2 . ILE B 1 19  ? -23.579 21.014  4.365   1.00 8.45  ? 19  ILE B CG2 1 
ATOM 2757  C CD1 . ILE B 1 19  ? -22.637 21.934  7.036   1.00 8.45  ? 19  ILE B CD1 1 
ATOM 2758  N N   . ALA B 1 20  ? -24.709 17.624  4.348   1.00 29.37 ? 20  ALA B N   1 
ATOM 2759  C CA  . ALA B 1 20  ? -24.614 16.729  3.210   1.00 29.37 ? 20  ALA B CA  1 
ATOM 2760  C C   . ALA B 1 20  ? -25.985 16.348  2.684   1.00 29.37 ? 20  ALA B C   1 
ATOM 2761  O O   . ALA B 1 20  ? -26.267 16.487  1.491   1.00 29.37 ? 20  ALA B O   1 
ATOM 2762  C CB  . ALA B 1 20  ? -23.851 15.484  3.596   1.00 27.16 ? 20  ALA B CB  1 
ATOM 2763  N N   . LEU B 1 21  ? -26.833 15.867  3.583   1.00 34.30 ? 21  LEU B N   1 
ATOM 2764  C CA  . LEU B 1 21  ? -28.178 15.444  3.223   1.00 34.30 ? 21  LEU B CA  1 
ATOM 2765  C C   . LEU B 1 21  ? -29.045 16.554  2.645   1.00 34.30 ? 21  LEU B C   1 
ATOM 2766  O O   . LEU B 1 21  ? -29.853 16.307  1.751   1.00 34.30 ? 21  LEU B O   1 
ATOM 2767  C CB  . LEU B 1 21  ? -28.858 14.833  4.436   1.00 8.52  ? 21  LEU B CB  1 
ATOM 2768  C CG  . LEU B 1 21  ? -28.171 13.544  4.887   1.00 8.52  ? 21  LEU B CG  1 
ATOM 2769  C CD1 . LEU B 1 21  ? -28.645 13.153  6.270   1.00 8.52  ? 21  LEU B CD1 1 
ATOM 2770  C CD2 . LEU B 1 21  ? -28.443 12.448  3.878   1.00 8.52  ? 21  LEU B CD2 1 
ATOM 2771  N N   . ARG B 1 22  ? -28.892 17.774  3.150   1.00 30.02 ? 22  ARG B N   1 
ATOM 2772  C CA  . ARG B 1 22  ? -29.681 18.878  2.628   1.00 30.02 ? 22  ARG B CA  1 
ATOM 2773  C C   . ARG B 1 22  ? -29.360 19.067  1.163   1.00 30.02 ? 22  ARG B C   1 
ATOM 2774  O O   . ARG B 1 22  ? -30.253 19.248  0.334   1.00 30.02 ? 22  ARG B O   1 
ATOM 2775  C CB  . ARG B 1 22  ? -29.372 20.169  3.370   1.00 51.33 ? 22  ARG B CB  1 
ATOM 2776  C CG  . ARG B 1 22  ? -29.832 20.178  4.804   1.00 51.33 ? 22  ARG B CG  1 
ATOM 2777  C CD  . ARG B 1 22  ? -29.486 21.501  5.413   1.00 51.33 ? 22  ARG B CD  1 
ATOM 2778  N NE  . ARG B 1 22  ? -29.975 22.580  4.562   1.00 51.33 ? 22  ARG B NE  1 
ATOM 2779  C CZ  . ARG B 1 22  ? -29.516 23.827  4.606   1.00 51.33 ? 22  ARG B CZ  1 
ATOM 2780  N NH1 . ARG B 1 22  ? -28.548 24.144  5.464   1.00 51.33 ? 22  ARG B NH1 1 
ATOM 2781  N NH2 . ARG B 1 22  ? -30.026 24.759  3.803   1.00 51.33 ? 22  ARG B NH2 1 
ATOM 2782  N N   . ILE B 1 23  ? -28.075 19.020  0.844   1.00 30.88 ? 23  ILE B N   1 
ATOM 2783  C CA  . ILE B 1 23  ? -27.633 19.206  -0.523  1.00 30.88 ? 23  ILE B CA  1 
ATOM 2784  C C   . ILE B 1 23  ? -28.211 18.162  -1.473  1.00 30.88 ? 23  ILE B C   1 
ATOM 2785  O O   . ILE B 1 23  ? -28.748 18.517  -2.514  1.00 30.88 ? 23  ILE B O   1 
ATOM 2786  C CB  . ILE B 1 23  ? -26.092 19.195  -0.599  1.00 20.53 ? 23  ILE B CB  1 
ATOM 2787  C CG1 . ILE B 1 23  ? -25.539 20.296  0.308   1.00 20.53 ? 23  ILE B CG1 1 
ATOM 2788  C CG2 . ILE B 1 23  ? -25.629 19.407  -2.035  1.00 20.53 ? 23  ILE B CG2 1 
ATOM 2789  C CD1 . ILE B 1 23  ? -24.038 20.319  0.416   1.00 20.53 ? 23  ILE B CD1 1 
ATOM 2790  N N   . VAL B 1 24  ? -28.128 16.884  -1.122  1.00 35.21 ? 24  VAL B N   1 
ATOM 2791  C CA  . VAL B 1 24  ? -28.650 15.862  -2.020  1.00 35.21 ? 24  VAL B CA  1 
ATOM 2792  C C   . VAL B 1 24  ? -30.086 15.440  -1.773  1.00 35.21 ? 24  VAL B C   1 
ATOM 2793  O O   . VAL B 1 24  ? -30.521 14.398  -2.258  1.00 35.21 ? 24  VAL B O   1 
ATOM 2794  C CB  . VAL B 1 24  ? -27.764 14.611  -2.022  1.00 20.36 ? 24  VAL B CB  1 
ATOM 2795  C CG1 . VAL B 1 24  ? -26.449 14.933  -2.701  1.00 20.36 ? 24  VAL B CG1 1 
ATOM 2796  C CG2 . VAL B 1 24  ? -27.532 14.124  -0.608  1.00 20.36 ? 24  VAL B CG2 1 
ATOM 2797  N N   . ALA B 1 25  ? -30.825 16.255  -1.028  1.00 35.46 ? 25  ALA B N   1 
ATOM 2798  C CA  . ALA B 1 25  ? -32.227 15.965  -0.746  1.00 35.46 ? 25  ALA B CA  1 
ATOM 2799  C C   . ALA B 1 25  ? -32.936 15.642  -2.056  1.00 35.46 ? 25  ALA B C   1 
ATOM 2800  O O   . ALA B 1 25  ? -32.592 16.185  -3.109  1.00 35.46 ? 25  ALA B O   1 
ATOM 2801  C CB  . ALA B 1 25  ? -32.880 17.151  -0.092  1.00 25.78 ? 25  ALA B CB  1 
ATOM 2802  N N   . PRO B 1 26  ? -33.948 14.762  -2.001  1.00 23.85 ? 26  PRO B N   1 
ATOM 2803  C CA  . PRO B 1 26  ? -34.751 14.309  -3.142  1.00 23.85 ? 26  PRO B CA  1 
ATOM 2804  C C   . PRO B 1 26  ? -35.060 15.363  -4.191  1.00 23.85 ? 26  PRO B C   1 
ATOM 2805  O O   . PRO B 1 26  ? -35.432 16.486  -3.864  1.00 23.85 ? 26  PRO B O   1 
ATOM 2806  C CB  . PRO B 1 26  ? -36.005 13.778  -2.475  1.00 17.34 ? 26  PRO B CB  1 
ATOM 2807  C CG  . PRO B 1 26  ? -35.454 13.167  -1.229  1.00 17.34 ? 26  PRO B CG  1 
ATOM 2808  C CD  . PRO B 1 26  ? -34.516 14.248  -0.741  1.00 17.34 ? 26  PRO B CD  1 
ATOM 2809  N N   . GLY B 1 27  ? -34.895 14.994  -5.457  1.00 37.36 ? 27  GLY B N   1 
ATOM 2810  C CA  . GLY B 1 27  ? -35.177 15.919  -6.538  1.00 37.36 ? 27  GLY B CA  1 
ATOM 2811  C C   . GLY B 1 27  ? -34.314 17.166  -6.563  1.00 37.36 ? 27  GLY B C   1 
ATOM 2812  O O   . GLY B 1 27  ? -34.591 18.096  -7.326  1.00 37.36 ? 27  GLY B O   1 
ATOM 2813  N N   . LYS B 1 28  ? -33.273 17.188  -5.734  1.00 28.92 ? 28  LYS B N   1 
ATOM 2814  C CA  . LYS B 1 28  ? -32.357 18.323  -5.672  1.00 28.92 ? 28  LYS B CA  1 
ATOM 2815  C C   . LYS B 1 28  ? -30.946 17.976  -6.176  1.00 28.92 ? 28  LYS B C   1 
ATOM 2816  O O   . LYS B 1 28  ? -30.451 16.852  -5.993  1.00 28.92 ? 28  LYS B O   1 
ATOM 2817  C CB  . LYS B 1 28  ? -32.282 18.853  -4.240  1.00 28.40 ? 28  LYS B CB  1 
ATOM 2818  C CG  . LYS B 1 28  ? -33.463 19.714  -3.818  1.00 28.40 ? 28  LYS B CG  1 
ATOM 2819  C CD  . LYS B 1 28  ? -33.526 19.823  -2.293  1.00 28.40 ? 28  LYS B CD  1 
ATOM 2820  C CE  . LYS B 1 28  ? -34.506 20.886  -1.811  1.00 28.40 ? 28  LYS B CE  1 
ATOM 2821  N NZ  . LYS B 1 28  ? -33.957 22.250  -2.040  1.00 28.40 ? 28  LYS B NZ  1 
ATOM 2822  N N   . GLY B 1 29  ? -30.317 18.954  -6.820  1.00 29.81 ? 29  GLY B N   1 
ATOM 2823  C CA  . GLY B 1 29  ? -28.980 18.779  -7.350  1.00 29.81 ? 29  GLY B CA  1 
ATOM 2824  C C   . GLY B 1 29  ? -28.121 19.992  -7.045  1.00 29.81 ? 29  GLY B C   1 
ATOM 2825  O O   . GLY B 1 29  ? -28.524 20.878  -6.282  1.00 29.81 ? 29  GLY B O   1 
ATOM 2826  N N   . ILE B 1 30  ? -26.940 20.049  -7.653  1.00 25.97 ? 30  ILE B N   1 
ATOM 2827  C CA  . ILE B 1 30  ? -26.004 21.145  -7.416  1.00 25.97 ? 30  ILE B CA  1 
ATOM 2828  C C   . ILE B 1 30  ? -25.698 21.972  -8.652  1.00 25.97 ? 30  ILE B C   1 
ATOM 2829  O O   . ILE B 1 30  ? -25.454 21.424  -9.727  1.00 25.97 ? 30  ILE B O   1 
ATOM 2830  C CB  . ILE B 1 30  ? -24.647 20.611  -6.881  1.00 13.86 ? 30  ILE B CB  1 
ATOM 2831  C CG1 . ILE B 1 30  ? -24.826 19.977  -5.501  1.00 13.86 ? 30  ILE B CG1 1 
ATOM 2832  C CG2 . ILE B 1 30  ? -23.639 21.737  -6.806  1.00 13.86 ? 30  ILE B CG2 1 
ATOM 2833  C CD1 . ILE B 1 30  ? -23.603 19.253  -5.004  1.00 13.86 ? 30  ILE B CD1 1 
ATOM 2834  N N   . LEU B 1 31  ? -25.712 23.292  -8.499  1.00 32.85 ? 31  LEU B N   1 
ATOM 2835  C CA  . LEU B 1 31  ? -25.360 24.164  -9.605  1.00 32.85 ? 31  LEU B CA  1 
ATOM 2836  C C   . LEU B 1 31  ? -23.888 24.452  -9.415  1.00 32.85 ? 31  LEU B C   1 
ATOM 2837  O O   . LEU B 1 31  ? -23.490 25.039  -8.407  1.00 32.85 ? 31  LEU B O   1 
ATOM 2838  C CB  . LEU B 1 31  ? -26.111 25.489  -9.560  1.00 18.31 ? 31  LEU B CB  1 
ATOM 2839  C CG  . LEU B 1 31  ? -25.455 26.523  -10.490 1.00 18.31 ? 31  LEU B CG  1 
ATOM 2840  C CD1 . LEU B 1 31  ? -25.506 26.027  -11.925 1.00 18.31 ? 31  LEU B CD1 1 
ATOM 2841  C CD2 . LEU B 1 31  ? -26.145 27.866  -10.362 1.00 18.31 ? 31  LEU B CD2 1 
ATOM 2842  N N   . ALA B 1 32  ? -23.079 24.040  -10.379 1.00 31.25 ? 32  ALA B N   1 
ATOM 2843  C CA  . ALA B 1 32  ? -21.648 24.261  -10.293 1.00 31.25 ? 32  ALA B CA  1 
ATOM 2844  C C   . ALA B 1 32  ? -21.258 25.509  -11.072 1.00 31.25 ? 32  ALA B C   1 
ATOM 2845  O O   . ALA B 1 32  ? -21.020 25.449  -12.281 1.00 31.25 ? 32  ALA B O   1 
ATOM 2846  C CB  . ALA B 1 32  ? -20.904 23.050  -10.831 1.00 27.14 ? 32  ALA B CB  1 
ATOM 2847  N N   . ALA B 1 33  ? -21.195 26.640  -10.375 1.00 38.49 ? 33  ALA B N   1 
ATOM 2848  C CA  . ALA B 1 33  ? -20.824 27.899  -11.002 1.00 38.49 ? 33  ALA B CA  1 
ATOM 2849  C C   . ALA B 1 33  ? -19.445 28.334  -10.499 1.00 38.49 ? 33  ALA B C   1 
ATOM 2850  O O   . ALA B 1 33  ? -19.181 29.525  -10.293 1.00 38.49 ? 33  ALA B O   1 
ATOM 2851  C CB  . ALA B 1 33  ? -21.866 28.951  -10.676 1.00 29.51 ? 33  ALA B CB  1 
ATOM 2852  N N   . ASP B 1 34  ? -18.566 27.356  -10.310 1.00 40.98 ? 34  ASP B N   1 
ATOM 2853  C CA  . ASP B 1 34  ? -17.219 27.613  -9.811  1.00 40.98 ? 34  ASP B CA  1 
ATOM 2854  C C   . ASP B 1 34  ? -16.187 27.780  -10.930 1.00 40.98 ? 34  ASP B C   1 
ATOM 2855  O O   . ASP B 1 34  ? -15.007 27.465  -10.752 1.00 40.98 ? 34  ASP B O   1 
ATOM 2856  C CB  . ASP B 1 34  ? -16.793 26.477  -8.867  1.00 46.35 ? 34  ASP B CB  1 
ATOM 2857  C CG  . ASP B 1 34  ? -16.747 25.112  -9.561  1.00 46.35 ? 34  ASP B CG  1 
ATOM 2858  O OD1 . ASP B 1 34  ? -17.725 24.756  -10.255 1.00 46.35 ? 34  ASP B OD1 1 
ATOM 2859  O OD2 . ASP B 1 34  ? -15.737 24.382  -9.408  1.00 46.35 ? 34  ASP B OD2 1 
ATOM 2860  N N   . GLU B 1 35  ? -16.623 28.291  -12.078 1.00 44.79 ? 35  GLU B N   1 
ATOM 2861  C CA  . GLU B 1 35  ? -15.711 28.478  -13.206 1.00 44.79 ? 35  GLU B CA  1 
ATOM 2862  C C   . GLU B 1 35  ? -14.594 29.478  -12.917 1.00 44.79 ? 35  GLU B C   1 
ATOM 2863  O O   . GLU B 1 35  ? -14.841 30.658  -12.630 1.00 44.79 ? 35  GLU B O   1 
ATOM 2864  C CB  . GLU B 1 35  ? -16.465 28.932  -14.465 1.00 43.44 ? 35  GLU B CB  1 
ATOM 2865  C CG  . GLU B 1 35  ? -17.400 27.902  -15.079 1.00 43.44 ? 35  GLU B CG  1 
ATOM 2866  C CD  . GLU B 1 35  ? -18.809 27.946  -14.503 1.00 43.44 ? 35  GLU B CD  1 
ATOM 2867  O OE1 . GLU B 1 35  ? -19.717 27.375  -15.143 1.00 43.44 ? 35  GLU B OE1 1 
ATOM 2868  O OE2 . GLU B 1 35  ? -19.018 28.540  -13.420 1.00 43.44 ? 35  GLU B OE2 1 
ATOM 2869  N N   . SER B 1 36  ? -13.358 28.994  -12.999 1.00 53.59 ? 36  SER B N   1 
ATOM 2870  C CA  . SER B 1 36  ? -12.184 29.835  -12.780 1.00 53.59 ? 36  SER B CA  1 
ATOM 2871  C C   . SER B 1 36  ? -12.221 30.998  -13.767 1.00 53.59 ? 36  SER B C   1 
ATOM 2872  O O   . SER B 1 36  ? -12.794 30.884  -14.854 1.00 53.59 ? 36  SER B O   1 
ATOM 2873  C CB  . SER B 1 36  ? -10.901 29.020  -12.988 1.00 49.24 ? 36  SER B CB  1 
ATOM 2874  O OG  . SER B 1 36  ? -10.927 28.315  -14.221 1.00 49.24 ? 36  SER B OG  1 
ATOM 2875  N N   . VAL B 1 37  ? -11.623 32.120  -13.387 1.00 44.24 ? 37  VAL B N   1 
ATOM 2876  C CA  . VAL B 1 37  ? -11.601 33.281  -14.270 1.00 44.24 ? 37  VAL B CA  1 
ATOM 2877  C C   . VAL B 1 37  ? -10.999 32.882  -15.616 1.00 44.24 ? 37  VAL B C   1 
ATOM 2878  O O   . VAL B 1 37  ? -11.269 33.499  -16.644 1.00 44.24 ? 37  VAL B O   1 
ATOM 2879  C CB  . VAL B 1 37  ? -10.781 34.419  -13.644 1.00 34.20 ? 37  VAL B CB  1 
ATOM 2880  C CG1 . VAL B 1 37  ? -9.475  33.861  -13.100 1.00 34.20 ? 37  VAL B CG1 1 
ATOM 2881  C CG2 . VAL B 1 37  ? -10.535 35.514  -14.677 1.00 34.20 ? 37  VAL B CG2 1 
ATOM 2882  N N   . GLY B 1 38  ? -10.191 31.828  -15.595 1.00 45.78 ? 38  GLY B N   1 
ATOM 2883  C CA  . GLY B 1 38  ? -9.573  31.351  -16.815 1.00 45.78 ? 38  GLY B CA  1 
ATOM 2884  C C   . GLY B 1 38  ? -10.572 30.643  -17.708 1.00 45.78 ? 38  GLY B C   1 
ATOM 2885  O O   . GLY B 1 38  ? -10.822 31.076  -18.835 1.00 45.78 ? 38  GLY B O   1 
ATOM 2886  N N   . SER B 1 39  ? -11.145 29.549  -17.213 1.00 51.21 ? 39  SER B N   1 
ATOM 2887  C CA  . SER B 1 39  ? -12.124 28.796  -17.992 1.00 51.21 ? 39  SER B CA  1 
ATOM 2888  C C   . SER B 1 39  ? -13.318 29.683  -18.329 1.00 51.21 ? 39  SER B C   1 
ATOM 2889  O O   . SER B 1 39  ? -13.996 29.480  -19.338 1.00 51.21 ? 39  SER B O   1 
ATOM 2890  C CB  . SER B 1 39  ? -12.577 27.548  -17.223 1.00 43.89 ? 39  SER B CB  1 
ATOM 2891  O OG  . SER B 1 39  ? -12.873 27.847  -15.872 1.00 43.89 ? 39  SER B OG  1 
ATOM 2892  N N   . MET B 1 40  ? -13.557 30.683  -17.489 1.00 48.67 ? 40  MET B N   1 
ATOM 2893  C CA  . MET B 1 40  ? -14.661 31.597  -17.710 1.00 48.67 ? 40  MET B CA  1 
ATOM 2894  C C   . MET B 1 40  ? -14.395 32.434  -18.958 1.00 48.67 ? 40  MET B C   1 
ATOM 2895  O O   . MET B 1 40  ? -15.322 32.869  -19.639 1.00 48.67 ? 40  MET B O   1 
ATOM 2896  C CB  . MET B 1 40  ? -14.842 32.510  -16.502 1.00 46.14 ? 40  MET B CB  1 
ATOM 2897  C CG  . MET B 1 40  ? -16.248 33.070  -16.386 1.00 46.14 ? 40  MET B CG  1 
ATOM 2898  S SD  . MET B 1 40  ? -17.472 31.770  -16.064 1.00 46.14 ? 40  MET B SD  1 
ATOM 2899  C CE  . MET B 1 40  ? -18.058 31.409  -17.708 1.00 46.14 ? 40  MET B CE  1 
ATOM 2900  N N   . ALA B 1 41  ? -13.124 32.662  -19.259 1.00 51.47 ? 41  ALA B N   1 
ATOM 2901  C CA  . ALA B 1 41  ? -12.772 33.442  -20.435 1.00 51.47 ? 41  ALA B CA  1 
ATOM 2902  C C   . ALA B 1 41  ? -13.229 32.699  -21.678 1.00 51.47 ? 41  ALA B C   1 
ATOM 2903  O O   . ALA B 1 41  ? -13.816 33.286  -22.583 1.00 51.47 ? 41  ALA B O   1 
ATOM 2904  C CB  . ALA B 1 41  ? -11.279 33.666  -20.484 1.00 31.36 ? 41  ALA B CB  1 
ATOM 2905  N N   . LYS B 1 42  ? -12.964 31.398  -21.717 1.00 51.21 ? 42  LYS B N   1 
ATOM 2906  C CA  . LYS B 1 42  ? -13.354 30.591  -22.862 1.00 51.21 ? 42  LYS B CA  1 
ATOM 2907  C C   . LYS B 1 42  ? -14.859 30.577  -23.073 1.00 51.21 ? 42  LYS B C   1 
ATOM 2908  O O   . LYS B 1 42  ? -15.333 30.750  -24.196 1.00 51.21 ? 42  LYS B O   1 
ATOM 2909  C CB  . LYS B 1 42  ? -12.847 29.157  -22.709 1.00 92.04 ? 42  LYS B CB  1 
ATOM 2910  C CG  . LYS B 1 42  ? -11.347 29.034  -22.850 1.00 92.04 ? 42  LYS B CG  1 
ATOM 2911  C CD  . LYS B 1 42  ? -10.937 27.613  -23.185 1.00 92.04 ? 42  LYS B CD  1 
ATOM 2912  C CE  . LYS B 1 42  ? -9.468  27.553  -23.607 1.00 92.04 ? 42  LYS B CE  1 
ATOM 2913  N NZ  . LYS B 1 42  ? -9.054  26.195  -24.075 1.00 92.04 ? 42  LYS B NZ  1 
ATOM 2914  N N   . ARG B 1 43  ? -15.614 30.378  -21.999 1.00 57.50 ? 43  ARG B N   1 
ATOM 2915  C CA  . ARG B 1 43  ? -17.065 30.336  -22.114 1.00 57.50 ? 43  ARG B CA  1 
ATOM 2916  C C   . ARG B 1 43  ? -17.645 31.662  -22.564 1.00 57.50 ? 43  ARG B C   1 
ATOM 2917  O O   . ARG B 1 43  ? -18.544 31.694  -23.405 1.00 57.50 ? 43  ARG B O   1 
ATOM 2918  C CB  . ARG B 1 43  ? -17.690 29.907  -20.797 1.00 80.36 ? 43  ARG B CB  1 
ATOM 2919  C CG  . ARG B 1 43  ? -17.293 28.512  -20.427 1.00 80.36 ? 43  ARG B CG  1 
ATOM 2920  C CD  . ARG B 1 43  ? -18.197 27.959  -19.377 1.00 80.36 ? 43  ARG B CD  1 
ATOM 2921  N NE  . ARG B 1 43  ? -17.745 26.641  -18.945 1.00 80.36 ? 43  ARG B NE  1 
ATOM 2922  C CZ  . ARG B 1 43  ? -18.380 25.896  -18.042 1.00 80.36 ? 43  ARG B CZ  1 
ATOM 2923  N NH1 . ARG B 1 43  ? -19.502 26.347  -17.479 1.00 80.36 ? 43  ARG B NH1 1 
ATOM 2924  N NH2 . ARG B 1 43  ? -17.889 24.708  -17.693 1.00 80.36 ? 43  ARG B NH2 1 
ATOM 2925  N N   . LEU B 1 44  ? -17.132 32.756  -22.016 1.00 49.44 ? 44  LEU B N   1 
ATOM 2926  C CA  . LEU B 1 44  ? -17.621 34.068  -22.404 1.00 49.44 ? 44  LEU B CA  1 
ATOM 2927  C C   . LEU B 1 44  ? -17.262 34.383  -23.850 1.00 49.44 ? 44  LEU B C   1 
ATOM 2928  O O   . LEU B 1 44  ? -18.068 34.962  -24.577 1.00 49.44 ? 44  LEU B O   1 
ATOM 2929  C CB  . LEU B 1 44  ? -17.060 35.148  -21.480 1.00 29.02 ? 44  LEU B CB  1 
ATOM 2930  C CG  . LEU B 1 44  ? -17.722 35.150  -20.110 1.00 29.02 ? 44  LEU B CG  1 
ATOM 2931  C CD1 . LEU B 1 44  ? -17.184 36.299  -19.290 1.00 29.02 ? 44  LEU B CD1 1 
ATOM 2932  C CD2 . LEU B 1 44  ? -19.231 35.269  -20.276 1.00 29.02 ? 44  LEU B CD2 1 
ATOM 2933  N N   . SER B 1 45  ? -16.064 33.993  -24.274 1.00 54.79 ? 45  SER B N   1 
ATOM 2934  C CA  . SER B 1 45  ? -15.632 34.257  -25.641 1.00 54.79 ? 45  SER B CA  1 
ATOM 2935  C C   . SER B 1 45  ? -16.605 33.667  -26.662 1.00 54.79 ? 45  SER B C   1 
ATOM 2936  O O   . SER B 1 45  ? -16.884 34.286  -27.688 1.00 54.79 ? 45  SER B O   1 
ATOM 2937  C CB  . SER B 1 45  ? -14.236 33.680  -25.893 1.00 66.02 ? 45  SER B CB  1 
ATOM 2938  O OG  . SER B 1 45  ? -14.302 32.316  -26.279 1.00 66.02 ? 45  SER B OG  1 
ATOM 2939  N N   . GLN B 1 46  ? -17.125 32.474  -26.384 1.00 57.46 ? 46  GLN B N   1 
ATOM 2940  C CA  . GLN B 1 46  ? -18.049 31.824  -27.303 1.00 57.46 ? 46  GLN B CA  1 
ATOM 2941  C C   . GLN B 1 46  ? -19.313 32.631  -27.578 1.00 57.46 ? 46  GLN B C   1 
ATOM 2942  O O   . GLN B 1 46  ? -19.989 32.396  -28.582 1.00 57.46 ? 46  GLN B O   1 
ATOM 2943  C CB  . GLN B 1 46  ? -18.447 30.459  -26.774 1.00 91.65 ? 46  GLN B CB  1 
ATOM 2944  C CG  . GLN B 1 46  ? -17.285 29.552  -26.505 1.00 91.65 ? 46  GLN B CG  1 
ATOM 2945  C CD  . GLN B 1 46  ? -17.744 28.156  -26.175 1.00 91.65 ? 46  GLN B CD  1 
ATOM 2946  O OE1 . GLN B 1 46  ? -18.195 27.414  -27.052 1.00 91.65 ? 46  GLN B OE1 1 
ATOM 2947  N NE2 . GLN B 1 46  ? -17.655 27.789  -24.900 1.00 91.65 ? 46  GLN B NE2 1 
ATOM 2948  N N   . ILE B 1 47  ? -19.639 33.573  -26.694 1.00 54.21 ? 47  ILE B N   1 
ATOM 2949  C CA  . ILE B 1 47  ? -20.830 34.404  -26.867 1.00 54.21 ? 47  ILE B CA  1 
ATOM 2950  C C   . ILE B 1 47  ? -20.441 35.878  -26.964 1.00 54.21 ? 47  ILE B C   1 
ATOM 2951  O O   . ILE B 1 47  ? -21.268 36.766  -26.729 1.00 54.21 ? 47  ILE B O   1 
ATOM 2952  C CB  . ILE B 1 47  ? -21.804 34.237  -25.678 1.00 40.32 ? 47  ILE B CB  1 
ATOM 2953  C CG1 . ILE B 1 47  ? -21.176 34.778  -24.395 1.00 40.32 ? 47  ILE B CG1 1 
ATOM 2954  C CG2 . ILE B 1 47  ? -22.126 32.780  -25.479 1.00 40.32 ? 47  ILE B CG2 1 
ATOM 2955  C CD1 . ILE B 1 47  ? -22.094 34.723  -23.197 1.00 40.32 ? 47  ILE B CD1 1 
ATOM 2956  N N   . GLY B 1 48  ? -19.187 36.132  -27.336 1.00 72.56 ? 48  GLY B N   1 
ATOM 2957  C CA  . GLY B 1 48  ? -18.691 37.497  -27.406 1.00 72.56 ? 48  GLY B CA  1 
ATOM 2958  C C   . GLY B 1 48  ? -18.259 37.797  -25.980 1.00 72.56 ? 48  GLY B C   1 
ATOM 2959  O O   . GLY B 1 48  ? -17.396 37.103  -25.431 1.00 72.56 ? 48  GLY B O   1 
ATOM 2960  N N   . VAL B 1 49  ? -18.847 38.819  -25.371 1.00 57.74 ? 49  VAL B N   1 
ATOM 2961  C CA  . VAL B 1 49  ? -18.555 39.162  -23.976 1.00 57.74 ? 49  VAL B CA  1 
ATOM 2962  C C   . VAL B 1 49  ? -17.082 39.164  -23.526 1.00 57.74 ? 49  VAL B C   1 
ATOM 2963  O O   . VAL B 1 49  ? -16.442 38.106  -23.422 1.00 57.74 ? 49  VAL B O   1 
ATOM 2964  C CB  . VAL B 1 49  ? -19.325 38.214  -23.022 1.00 47.32 ? 49  VAL B CB  1 
ATOM 2965  C CG1 . VAL B 1 49  ? -19.266 38.751  -21.594 1.00 47.32 ? 49  VAL B CG1 1 
ATOM 2966  C CG2 . VAL B 1 49  ? -20.767 38.049  -23.493 1.00 47.32 ? 49  VAL B CG2 1 
ATOM 2967  N N   . GLU B 1 50  ? -16.559 40.355  -23.238 1.00 54.46 ? 50  GLU B N   1 
ATOM 2968  C CA  . GLU B 1 50  ? -15.188 40.477  -22.761 1.00 54.46 ? 50  GLU B CA  1 
ATOM 2969  C C   . GLU B 1 50  ? -15.137 39.800  -21.405 1.00 54.46 ? 50  GLU B C   1 
ATOM 2970  O O   . GLU B 1 50  ? -16.098 39.872  -20.640 1.00 54.46 ? 50  GLU B O   1 
ATOM 2971  C CB  . GLU B 1 50  ? -14.800 41.948  -22.613 1.00 99.51 ? 50  GLU B CB  1 
ATOM 2972  C CG  . GLU B 1 50  ? -13.833 42.422  -23.668 1.00 99.51 ? 50  GLU B CG  1 
ATOM 2973  C CD  . GLU B 1 50  ? -14.209 41.920  -25.053 1.00 99.51 ? 50  GLU B CD  1 
ATOM 2974  O OE1 . GLU B 1 50  ? -15.330 42.228  -25.525 1.00 99.51 ? 50  GLU B OE1 1 
ATOM 2975  O OE2 . GLU B 1 50  ? -13.382 41.210  -25.667 1.00 99.51 ? 50  GLU B OE2 1 
ATOM 2976  N N   . ASN B 1 51  ? -14.027 39.139  -21.102 1.00 50.70 ? 51  ASN B N   1 
ATOM 2977  C CA  . ASN B 1 51  ? -13.907 38.460  -19.821 1.00 50.70 ? 51  ASN B CA  1 
ATOM 2978  C C   . ASN B 1 51  ? -13.485 39.420  -18.704 1.00 50.70 ? 51  ASN B C   1 
ATOM 2979  O O   . ASN B 1 51  ? -12.338 39.413  -18.265 1.00 50.70 ? 51  ASN B O   1 
ATOM 2980  C CB  . ASN B 1 51  ? -12.922 37.297  -19.944 1.00 47.84 ? 51  ASN B CB  1 
ATOM 2981  C CG  . ASN B 1 51  ? -12.915 36.406  -18.718 1.00 47.84 ? 51  ASN B CG  1 
ATOM 2982  O OD1 . ASN B 1 51  ? -13.941 36.218  -18.065 1.00 47.84 ? 51  ASN B OD1 1 
ATOM 2983  N ND2 . ASN B 1 51  ? -11.760 35.837  -18.408 1.00 47.84 ? 51  ASN B ND2 1 
ATOM 2984  N N   . THR B 1 52  ? -14.431 40.248  -18.261 1.00 48.74 ? 52  THR B N   1 
ATOM 2985  C CA  . THR B 1 52  ? -14.221 41.230  -17.193 1.00 48.74 ? 52  THR B CA  1 
ATOM 2986  C C   . THR B 1 52  ? -14.710 40.643  -15.880 1.00 48.74 ? 52  THR B C   1 
ATOM 2987  O O   . THR B 1 52  ? -15.398 39.626  -15.873 1.00 48.74 ? 52  THR B O   1 
ATOM 2988  C CB  . THR B 1 52  ? -15.070 42.490  -17.420 1.00 52.73 ? 52  THR B CB  1 
ATOM 2989  O OG1 . THR B 1 52  ? -14.827 42.996  -18.730 1.00 52.73 ? 52  THR B OG1 1 
ATOM 2990  C CG2 . THR B 1 52  ? -14.744 43.566  -16.382 1.00 52.73 ? 52  THR B CG2 1 
ATOM 2991  N N   . GLU B 1 53  ? -14.365 41.278  -14.767 1.00 55.43 ? 53  GLU B N   1 
ATOM 2992  C CA  . GLU B 1 53  ? -14.866 40.798  -13.494 1.00 55.43 ? 53  GLU B CA  1 
ATOM 2993  C C   . GLU B 1 53  ? -16.336 41.149  -13.512 1.00 55.43 ? 53  GLU B C   1 
ATOM 2994  O O   . GLU B 1 53  ? -17.175 40.397  -13.021 1.00 55.43 ? 53  GLU B O   1 
ATOM 2995  C CB  . GLU B 1 53  ? -14.190 41.508  -12.337 1.00 98.82 ? 53  GLU B CB  1 
ATOM 2996  C CG  . GLU B 1 53  ? -12.822 40.950  -12.044 1.00 98.82 ? 53  GLU B CG  1 
ATOM 2997  C CD  . GLU B 1 53  ? -11.982 41.886  -11.192 1.00 98.82 ? 53  GLU B CD  1 
ATOM 2998  O OE1 . GLU B 1 53  ? -12.516 42.376  -10.158 1.00 98.82 ? 53  GLU B OE1 1 
ATOM 2999  O OE2 . GLU B 1 53  ? -10.795 42.118  -11.563 1.00 98.82 ? 53  GLU B OE2 1 
ATOM 3000  N N   . GLU B 1 54  ? -16.641 42.295  -14.105 1.00 48.98 ? 54  GLU B N   1 
ATOM 3001  C CA  . GLU B 1 54  ? -18.018 42.743  -14.189 1.00 48.98 ? 54  GLU B CA  1 
ATOM 3002  C C   . GLU B 1 54  ? -18.858 41.806  -15.040 1.00 48.98 ? 54  GLU B C   1 
ATOM 3003  O O   . GLU B 1 54  ? -19.907 41.336  -14.600 1.00 48.98 ? 54  GLU B O   1 
ATOM 3004  C CB  . GLU B 1 54  ? -18.081 44.156  -14.754 1.00 54.59 ? 54  GLU B CB  1 
ATOM 3005  C CG  . GLU B 1 54  ? -18.673 45.154  -13.777 1.00 54.59 ? 54  GLU B CG  1 
ATOM 3006  C CD  . GLU B 1 54  ? -20.120 44.853  -13.443 1.00 54.59 ? 54  GLU B CD  1 
ATOM 3007  O OE1 . GLU B 1 54  ? -20.682 45.528  -12.556 1.00 54.59 ? 54  GLU B OE1 1 
ATOM 3008  O OE2 . GLU B 1 54  ? -20.697 43.943  -14.071 1.00 54.59 ? 54  GLU B OE2 1 
ATOM 3009  N N   . ASN B 1 55  ? -18.407 41.526  -16.255 1.00 45.30 ? 55  ASN B N   1 
ATOM 3010  C CA  . ASN B 1 55  ? -19.171 40.632  -17.111 1.00 45.30 ? 55  ASN B CA  1 
ATOM 3011  C C   . ASN B 1 55  ? -19.429 39.296  -16.442 1.00 45.30 ? 55  ASN B C   1 
ATOM 3012  O O   . ASN B 1 55  ? -20.445 38.648  -16.703 1.00 45.30 ? 55  ASN B O   1 
ATOM 3013  C CB  . ASN B 1 55  ? -18.462 40.414  -18.440 1.00 51.98 ? 55  ASN B CB  1 
ATOM 3014  C CG  . ASN B 1 55  ? -18.524 41.628  -19.319 1.00 51.98 ? 55  ASN B CG  1 
ATOM 3015  O OD1 . ASN B 1 55  ? -19.491 42.390  -19.263 1.00 51.98 ? 55  ASN B OD1 1 
ATOM 3016  N ND2 . ASN B 1 55  ? -17.507 41.818  -20.148 1.00 51.98 ? 55  ASN B ND2 1 
ATOM 3017  N N   . ARG B 1 56  ? -18.507 38.877  -15.581 1.00 32.51 ? 56  ARG B N   1 
ATOM 3018  C CA  . ARG B 1 56  ? -18.681 37.619  -14.873 1.00 32.51 ? 56  ARG B CA  1 
ATOM 3019  C C   . ARG B 1 56  ? -19.744 37.821  -13.800 1.00 32.51 ? 56  ARG B C   1 
ATOM 3020  O O   . ARG B 1 56  ? -20.676 37.031  -13.686 1.00 32.51 ? 56  ARG B O   1 
ATOM 3021  C CB  . ARG B 1 56  ? -17.364 37.157  -14.244 1.00 38.78 ? 56  ARG B CB  1 
ATOM 3022  C CG  . ARG B 1 56  ? -16.368 36.566  -15.238 1.00 38.78 ? 56  ARG B CG  1 
ATOM 3023  C CD  . ARG B 1 56  ? -15.255 35.817  -14.509 1.00 38.78 ? 56  ARG B CD  1 
ATOM 3024  N NE  . ARG B 1 56  ? -14.381 36.706  -13.746 1.00 38.78 ? 56  ARG B NE  1 
ATOM 3025  C CZ  . ARG B 1 56  ? -13.368 37.388  -14.276 1.00 38.78 ? 56  ARG B CZ  1 
ATOM 3026  N NH1 . ARG B 1 56  ? -13.095 37.278  -15.572 1.00 38.78 ? 56  ARG B NH1 1 
ATOM 3027  N NH2 . ARG B 1 56  ? -12.628 38.182  -13.513 1.00 38.78 ? 56  ARG B NH2 1 
ATOM 3028  N N   . ARG B 1 57  ? -19.617 38.894  -13.026 1.00 45.29 ? 57  ARG B N   1 
ATOM 3029  C CA  . ARG B 1 57  ? -20.592 39.182  -11.984 1.00 45.29 ? 57  ARG B CA  1 
ATOM 3030  C C   . ARG B 1 57  ? -21.978 39.232  -12.621 1.00 45.29 ? 57  ARG B C   1 
ATOM 3031  O O   . ARG B 1 57  ? -22.942 38.674  -12.096 1.00 45.29 ? 57  ARG B O   1 
ATOM 3032  C CB  . ARG B 1 57  ? -20.292 40.526  -11.332 1.00 38.75 ? 57  ARG B CB  1 
ATOM 3033  C CG  . ARG B 1 57  ? -21.167 40.837  -10.134 1.00 38.75 ? 57  ARG B CG  1 
ATOM 3034  C CD  . ARG B 1 57  ? -21.059 42.306  -9.783  1.00 38.75 ? 57  ARG B CD  1 
ATOM 3035  N NE  . ARG B 1 57  ? -21.558 43.130  -10.875 1.00 38.75 ? 57  ARG B NE  1 
ATOM 3036  C CZ  . ARG B 1 57  ? -22.840 43.437  -11.050 1.00 38.75 ? 57  ARG B CZ  1 
ATOM 3037  N NH1 . ARG B 1 57  ? -23.758 42.997  -10.194 1.00 38.75 ? 57  ARG B NH1 1 
ATOM 3038  N NH2 . ARG B 1 57  ? -23.209 44.165  -12.095 1.00 38.75 ? 57  ARG B NH2 1 
ATOM 3039  N N   . LEU B 1 58  ? -22.065 39.905  -13.763 1.00 36.95 ? 58  LEU B N   1 
ATOM 3040  C CA  . LEU B 1 58  ? -23.326 40.032  -14.477 1.00 36.95 ? 58  LEU B CA  1 
ATOM 3041  C C   . LEU B 1 58  ? -23.899 38.672  -14.806 1.00 36.95 ? 58  LEU B C   1 
ATOM 3042  O O   . LEU B 1 58  ? -25.062 38.393  -14.509 1.00 36.95 ? 58  LEU B O   1 
ATOM 3043  C CB  . LEU B 1 58  ? -23.128 40.821  -15.769 1.00 28.18 ? 58  LEU B CB  1 
ATOM 3044  C CG  . LEU B 1 58  ? -22.792 42.300  -15.575 1.00 28.18 ? 58  LEU B CG  1 
ATOM 3045  C CD1 . LEU B 1 58  ? -22.463 42.932  -16.915 1.00 28.18 ? 58  LEU B CD1 1 
ATOM 3046  C CD2 . LEU B 1 58  ? -23.964 43.003  -14.902 1.00 28.18 ? 58  LEU B CD2 1 
ATOM 3047  N N   . TYR B 1 59  ? -23.084 37.826  -15.423 1.00 36.09 ? 59  TYR B N   1 
ATOM 3048  C CA  . TYR B 1 59  ? -23.547 36.496  -15.783 1.00 36.09 ? 59  TYR B CA  1 
ATOM 3049  C C   . TYR B 1 59  ? -23.941 35.657  -14.571 1.00 36.09 ? 59  TYR B C   1 
ATOM 3050  O O   . TYR B 1 59  ? -24.991 35.021  -14.580 1.00 36.09 ? 59  TYR B O   1 
ATOM 3051  C CB  . TYR B 1 59  ? -22.491 35.748  -16.592 1.00 39.21 ? 59  TYR B CB  1 
ATOM 3052  C CG  . TYR B 1 59  ? -22.886 34.315  -16.841 1.00 39.21 ? 59  TYR B CG  1 
ATOM 3053  C CD1 . TYR B 1 59  ? -24.080 34.008  -17.485 1.00 39.21 ? 59  TYR B CD1 1 
ATOM 3054  C CD2 . TYR B 1 59  ? -22.095 33.263  -16.389 1.00 39.21 ? 59  TYR B CD2 1 
ATOM 3055  C CE1 . TYR B 1 59  ? -24.477 32.689  -17.667 1.00 39.21 ? 59  TYR B CE1 1 
ATOM 3056  C CE2 . TYR B 1 59  ? -22.485 31.939  -16.568 1.00 39.21 ? 59  TYR B CE2 1 
ATOM 3057  C CZ  . TYR B 1 59  ? -23.676 31.663  -17.206 1.00 39.21 ? 59  TYR B CZ  1 
ATOM 3058  O OH  . TYR B 1 59  ? -24.069 30.362  -17.379 1.00 39.21 ? 59  TYR B OH  1 
ATOM 3059  N N   . ARG B 1 60  ? -23.109 35.642  -13.533 1.00 48.69 ? 60  ARG B N   1 
ATOM 3060  C CA  . ARG B 1 60  ? -23.431 34.861  -12.341 1.00 48.69 ? 60  ARG B CA  1 
ATOM 3061  C C   . ARG B 1 60  ? -24.763 35.348  -11.787 1.00 48.69 ? 60  ARG B C   1 
ATOM 3062  O O   . ARG B 1 60  ? -25.537 34.580  -11.206 1.00 48.69 ? 60  ARG B O   1 
ATOM 3063  C CB  . ARG B 1 60  ? -22.368 35.035  -11.258 1.00 46.85 ? 60  ARG B CB  1 
ATOM 3064  C CG  . ARG B 1 60  ? -20.939 34.807  -11.698 1.00 46.85 ? 60  ARG B CG  1 
ATOM 3065  C CD  . ARG B 1 60  ? -20.649 33.380  -12.115 1.00 46.85 ? 60  ARG B CD  1 
ATOM 3066  N NE  . ARG B 1 60  ? -19.202 33.172  -12.142 1.00 46.85 ? 60  ARG B NE  1 
ATOM 3067  C CZ  . ARG B 1 60  ? -18.610 32.067  -12.576 1.00 46.85 ? 60  ARG B CZ  1 
ATOM 3068  N NH1 . ARG B 1 60  ? -19.343 31.055  -13.028 1.00 46.85 ? 60  ARG B NH1 1 
ATOM 3069  N NH2 . ARG B 1 60  ? -17.287 31.974  -12.545 1.00 46.85 ? 60  ARG B NH2 1 
ATOM 3070  N N   . GLN B 1 61  ? -25.015 36.639  -11.963 1.00 48.41 ? 61  GLN B N   1 
ATOM 3071  C CA  . GLN B 1 61  ? -26.245 37.244  -11.488 1.00 48.41 ? 61  GLN B CA  1 
ATOM 3072  C C   . GLN B 1 61  ? -27.425 36.625  -12.222 1.00 48.41 ? 61  GLN B C   1 
ATOM 3073  O O   . GLN B 1 61  ? -28.453 36.326  -11.619 1.00 48.41 ? 61  GLN B O   1 
ATOM 3074  C CB  . GLN B 1 61  ? -26.198 38.742  -11.731 1.00 37.76 ? 61  GLN B CB  1 
ATOM 3075  C CG  . GLN B 1 61  ? -27.339 39.507  -11.112 1.00 37.76 ? 61  GLN B CG  1 
ATOM 3076  C CD  . GLN B 1 61  ? -27.175 41.001  -11.306 1.00 37.76 ? 61  GLN B CD  1 
ATOM 3077  O OE1 . GLN B 1 61  ? -26.995 41.474  -12.435 1.00 37.76 ? 61  GLN B OE1 1 
ATOM 3078  N NE2 . GLN B 1 61  ? -27.229 41.756  -10.208 1.00 37.76 ? 61  GLN B NE2 1 
ATOM 3079  N N   . VAL B 1 62  ? -27.271 36.432  -13.527 1.00 36.58 ? 62  VAL B N   1 
ATOM 3080  C CA  . VAL B 1 62  ? -28.322 35.823  -14.328 1.00 36.58 ? 62  VAL B CA  1 
ATOM 3081  C C   . VAL B 1 62  ? -28.751 34.508  -13.698 1.00 36.58 ? 62  VAL B C   1 
ATOM 3082  O O   . VAL B 1 62  ? -29.929 34.173  -13.694 1.00 36.58 ? 62  VAL B O   1 
ATOM 3083  C CB  . VAL B 1 62  ? -27.846 35.510  -15.756 1.00 25.14 ? 62  VAL B CB  1 
ATOM 3084  C CG1 . VAL B 1 62  ? -28.928 34.758  -16.507 1.00 25.14 ? 62  VAL B CG1 1 
ATOM 3085  C CG2 . VAL B 1 62  ? -27.489 36.796  -16.479 1.00 25.14 ? 62  VAL B CG2 1 
ATOM 3086  N N   . LEU B 1 63  ? -27.787 33.760  -13.173 1.00 31.55 ? 63  LEU B N   1 
ATOM 3087  C CA  . LEU B 1 63  ? -28.080 32.476  -12.552 1.00 31.55 ? 63  LEU B CA  1 
ATOM 3088  C C   . LEU B 1 63  ? -28.690 32.636  -11.169 1.00 31.55 ? 63  LEU B C   1 
ATOM 3089  O O   . LEU B 1 63  ? -29.762 32.100  -10.899 1.00 31.55 ? 63  LEU B O   1 
ATOM 3090  C CB  . LEU B 1 63  ? -26.808 31.628  -12.451 1.00 27.54 ? 63  LEU B CB  1 
ATOM 3091  C CG  . LEU B 1 63  ? -26.092 31.329  -13.770 1.00 27.54 ? 63  LEU B CG  1 
ATOM 3092  C CD1 . LEU B 1 63  ? -24.911 30.421  -13.511 1.00 27.54 ? 63  LEU B CD1 1 
ATOM 3093  C CD2 . LEU B 1 63  ? -27.045 30.661  -14.739 1.00 27.54 ? 63  LEU B CD2 1 
ATOM 3094  N N   . PHE B 1 64  ? -28.017 33.392  -10.306 1.00 33.03 ? 64  PHE B N   1 
ATOM 3095  C CA  . PHE B 1 64  ? -28.475 33.586  -8.935  1.00 33.03 ? 64  PHE B CA  1 
ATOM 3096  C C   . PHE B 1 64  ? -29.763 34.362  -8.757  1.00 33.03 ? 64  PHE B C   1 
ATOM 3097  O O   . PHE B 1 64  ? -30.357 34.361  -7.672  1.00 33.03 ? 64  PHE B O   1 
ATOM 3098  C CB  . PHE B 1 64  ? -27.376 34.245  -8.106  1.00 32.15 ? 64  PHE B CB  1 
ATOM 3099  C CG  . PHE B 1 64  ? -26.078 33.511  -8.157  1.00 32.15 ? 64  PHE B CG  1 
ATOM 3100  C CD1 . PHE B 1 64  ? -26.054 32.134  -8.362  1.00 32.15 ? 64  PHE B CD1 1 
ATOM 3101  C CD2 . PHE B 1 64  ? -24.879 34.188  -8.011  1.00 32.15 ? 64  PHE B CD2 1 
ATOM 3102  C CE1 . PHE B 1 64  ? -24.859 31.443  -8.427  1.00 32.15 ? 64  PHE B CE1 1 
ATOM 3103  C CE2 . PHE B 1 64  ? -23.677 33.504  -8.073  1.00 32.15 ? 64  PHE B CE2 1 
ATOM 3104  C CZ  . PHE B 1 64  ? -23.669 32.128  -8.284  1.00 32.15 ? 64  PHE B CZ  1 
ATOM 3105  N N   . SER B 1 65  ? -30.205 35.029  -9.809  1.00 47.92 ? 65  SER B N   1 
ATOM 3106  C CA  . SER B 1 65  ? -31.434 35.786  -9.704  1.00 47.92 ? 65  SER B CA  1 
ATOM 3107  C C   . SER B 1 65  ? -32.640 34.908  -10.017 1.00 47.92 ? 65  SER B C   1 
ATOM 3108  O O   . SER B 1 65  ? -33.762 35.399  -10.070 1.00 47.92 ? 65  SER B O   1 
ATOM 3109  C CB  . SER B 1 65  ? -31.386 36.997  -10.635 1.00 46.93 ? 65  SER B CB  1 
ATOM 3110  O OG  . SER B 1 65  ? -31.023 36.607  -11.945 1.00 46.93 ? 65  SER B OG  1 
ATOM 3111  N N   . ALA B 1 66  ? -32.414 33.612  -10.223 1.00 40.81 ? 66  ALA B N   1 
ATOM 3112  C CA  . ALA B 1 66  ? -33.515 32.694  -10.507 1.00 40.81 ? 66  ALA B CA  1 
ATOM 3113  C C   . ALA B 1 66  ? -34.501 32.785  -9.344  1.00 40.81 ? 66  ALA B C   1 
ATOM 3114  O O   . ALA B 1 66  ? -34.099 33.017  -8.200  1.00 40.81 ? 66  ALA B O   1 
ATOM 3115  C CB  . ALA B 1 66  ? -32.998 31.266  -10.649 1.00 39.17 ? 66  ALA B CB  1 
ATOM 3116  N N   . ASP B 1 67  ? -35.787 32.609  -9.638  1.00 51.08 ? 67  ASP B N   1 
ATOM 3117  C CA  . ASP B 1 67  ? -36.827 32.693  -8.614  1.00 51.08 ? 67  ASP B CA  1 
ATOM 3118  C C   . ASP B 1 67  ? -36.948 31.428  -7.761  1.00 51.08 ? 67  ASP B C   1 
ATOM 3119  O O   . ASP B 1 67  ? -36.116 30.521  -7.846  1.00 51.08 ? 67  ASP B O   1 
ATOM 3120  C CB  . ASP B 1 67  ? -38.181 33.017  -9.264  1.00 45.68 ? 67  ASP B CB  1 
ATOM 3121  C CG  . ASP B 1 67  ? -38.682 31.902  -10.166 1.00 45.68 ? 67  ASP B CG  1 
ATOM 3122  O OD1 . ASP B 1 67  ? -39.043 32.181  -11.334 1.00 45.68 ? 67  ASP B OD1 1 
ATOM 3123  O OD2 . ASP B 1 67  ? -38.715 30.741  -9.695  1.00 45.68 ? 67  ASP B OD2 1 
ATOM 3124  N N   . ASP B 1 68  ? -38.004 31.373  -6.955  1.00 45.23 ? 68  ASP B N   1 
ATOM 3125  C CA  . ASP B 1 68  ? -38.247 30.255  -6.045  1.00 45.23 ? 68  ASP B CA  1 
ATOM 3126  C C   . ASP B 1 68  ? -38.462 28.852  -6.597  1.00 45.23 ? 68  ASP B C   1 
ATOM 3127  O O   . ASP B 1 68  ? -38.381 27.883  -5.840  1.00 45.23 ? 68  ASP B O   1 
ATOM 3128  C CB  . ASP B 1 68  ? -39.416 30.591  -5.118  1.00 69.35 ? 68  ASP B CB  1 
ATOM 3129  C CG  . ASP B 1 68  ? -38.993 31.430  -3.932  1.00 69.35 ? 68  ASP B CG  1 
ATOM 3130  O OD1 . ASP B 1 68  ? -39.870 31.780  -3.113  1.00 69.35 ? 68  ASP B OD1 1 
ATOM 3131  O OD2 . ASP B 1 68  ? -37.785 31.735  -3.811  1.00 69.35 ? 68  ASP B OD2 1 
ATOM 3132  N N   . ARG B 1 69  ? -38.737 28.702  -7.885  1.00 48.85 ? 69  ARG B N   1 
ATOM 3133  C CA  . ARG B 1 69  ? -38.947 27.346  -8.371  1.00 48.85 ? 69  ARG B CA  1 
ATOM 3134  C C   . ARG B 1 69  ? -37.625 26.620  -8.470  1.00 48.85 ? 69  ARG B C   1 
ATOM 3135  O O   . ARG B 1 69  ? -37.579 25.419  -8.739  1.00 48.85 ? 69  ARG B O   1 
ATOM 3136  C CB  . ARG B 1 69  ? -39.677 27.338  -9.717  1.00 25.17 ? 69  ARG B CB  1 
ATOM 3137  C CG  . ARG B 1 69  ? -39.106 28.248  -10.754 1.00 25.17 ? 69  ARG B CG  1 
ATOM 3138  C CD  . ARG B 1 69  ? -40.111 28.496  -11.855 1.00 25.17 ? 69  ARG B CD  1 
ATOM 3139  N NE  . ARG B 1 69  ? -39.848 29.795  -12.454 1.00 25.17 ? 69  ARG B NE  1 
ATOM 3140  C CZ  . ARG B 1 69  ? -39.645 29.999  -13.749 1.00 25.17 ? 69  ARG B CZ  1 
ATOM 3141  N NH1 . ARG B 1 69  ? -39.683 28.972  -14.602 1.00 25.17 ? 69  ARG B NH1 1 
ATOM 3142  N NH2 . ARG B 1 69  ? -39.387 31.227  -14.187 1.00 25.17 ? 69  ARG B NH2 1 
ATOM 3143  N N   . VAL B 1 70  ? -36.548 27.357  -8.225  1.00 35.00 ? 70  VAL B N   1 
ATOM 3144  C CA  . VAL B 1 70  ? -35.207 26.796  -8.267  1.00 35.00 ? 70  VAL B CA  1 
ATOM 3145  C C   . VAL B 1 70  ? -34.951 26.079  -6.943  1.00 35.00 ? 70  VAL B C   1 
ATOM 3146  O O   . VAL B 1 70  ? -34.055 25.252  -6.844  1.00 35.00 ? 70  VAL B O   1 
ATOM 3147  C CB  . VAL B 1 70  ? -34.163 27.914  -8.474  1.00 17.57 ? 70  VAL B CB  1 
ATOM 3148  C CG1 . VAL B 1 70  ? -33.575 28.346  -7.136  1.00 17.57 ? 70  VAL B CG1 1 
ATOM 3149  C CG2 . VAL B 1 70  ? -33.105 27.457  -9.448  1.00 17.57 ? 70  VAL B CG2 1 
ATOM 3150  N N   . LYS B 1 71  ? -35.765 26.406  -5.939  1.00 33.29 ? 71  LYS B N   1 
ATOM 3151  C CA  . LYS B 1 71  ? -35.670 25.821  -4.599  1.00 33.29 ? 71  LYS B CA  1 
ATOM 3152  C C   . LYS B 1 71  ? -35.980 24.333  -4.536  1.00 33.29 ? 71  LYS B C   1 
ATOM 3153  O O   . LYS B 1 71  ? -35.449 23.623  -3.690  1.00 33.29 ? 71  LYS B O   1 
ATOM 3154  C CB  . LYS B 1 71  ? -36.616 26.536  -3.625  1.00 34.68 ? 71  LYS B CB  1 
ATOM 3155  C CG  . LYS B 1 71  ? -36.235 27.971  -3.313  1.00 34.68 ? 71  LYS B CG  1 
ATOM 3156  C CD  . LYS B 1 71  ? -37.296 28.686  -2.473  1.00 34.68 ? 71  LYS B CD  1 
ATOM 3157  C CE  . LYS B 1 71  ? -37.365 28.151  -1.048  1.00 34.68 ? 71  LYS B CE  1 
ATOM 3158  N NZ  . LYS B 1 71  ? -38.317 28.933  -0.187  1.00 34.68 ? 71  LYS B NZ  1 
ATOM 3159  N N   . LYS B 1 72  ? -36.847 23.854  -5.416  1.00 33.75 ? 72  LYS B N   1 
ATOM 3160  C CA  . LYS B 1 72  ? -37.206 22.444  -5.396  1.00 33.75 ? 72  LYS B CA  1 
ATOM 3161  C C   . LYS B 1 72  ? -36.164 21.536  -6.044  1.00 33.75 ? 72  LYS B C   1 
ATOM 3162  O O   . LYS B 1 72  ? -36.071 20.352  -5.704  1.00 33.75 ? 72  LYS B O   1 
ATOM 3163  C CB  . LYS B 1 72  ? -38.556 22.231  -6.087  1.00 34.86 ? 72  LYS B CB  1 
ATOM 3164  C CG  . LYS B 1 72  ? -38.596 22.730  -7.516  1.00 34.86 ? 72  LYS B CG  1 
ATOM 3165  C CD  . LYS B 1 72  ? -39.819 22.222  -8.258  1.00 34.86 ? 72  LYS B CD  1 
ATOM 3166  C CE  . LYS B 1 72  ? -39.872 22.785  -9.671  1.00 34.86 ? 72  LYS B CE  1 
ATOM 3167  N NZ  . LYS B 1 72  ? -39.939 24.274  -9.661  1.00 34.86 ? 72  LYS B NZ  1 
ATOM 3168  N N   . CYS B 1 73  ? -35.376 22.087  -6.965  1.00 34.08 ? 73  CYS B N   1 
ATOM 3169  C CA  . CYS B 1 73  ? -34.380 21.283  -7.667  1.00 34.08 ? 73  CYS B CA  1 
ATOM 3170  C C   . CYS B 1 73  ? -32.910 21.603  -7.389  1.00 34.08 ? 73  CYS B C   1 
ATOM 3171  O O   . CYS B 1 73  ? -32.024 20.864  -7.821  1.00 34.08 ? 73  CYS B O   1 
ATOM 3172  C CB  . CYS B 1 73  ? -34.650 21.357  -9.172  1.00 40.22 ? 73  CYS B CB  1 
ATOM 3173  S SG  . CYS B 1 73  ? -34.920 23.037  -9.772  1.00 40.22 ? 73  CYS B SG  1 
ATOM 3174  N N   . ILE B 1 74  ? -32.638 22.688  -6.678  1.00 28.57 ? 74  ILE B N   1 
ATOM 3175  C CA  . ILE B 1 74  ? -31.257 23.041  -6.381  1.00 28.57 ? 74  ILE B CA  1 
ATOM 3176  C C   . ILE B 1 74  ? -30.969 22.990  -4.890  1.00 28.57 ? 74  ILE B C   1 
ATOM 3177  O O   . ILE B 1 74  ? -31.424 23.852  -4.131  1.00 28.57 ? 74  ILE B O   1 
ATOM 3178  C CB  . ILE B 1 74  ? -30.922 24.446  -6.882  1.00 19.31 ? 74  ILE B CB  1 
ATOM 3179  C CG1 . ILE B 1 74  ? -31.125 24.526  -8.395  1.00 19.31 ? 74  ILE B CG1 1 
ATOM 3180  C CG2 . ILE B 1 74  ? -29.497 24.793  -6.508  1.00 19.31 ? 74  ILE B CG2 1 
ATOM 3181  C CD1 . ILE B 1 74  ? -30.234 23.613  -9.193  1.00 19.31 ? 74  ILE B CD1 1 
ATOM 3182  N N   . GLY B 1 75  ? -30.204 21.984  -4.476  1.00 30.46 ? 75  GLY B N   1 
ATOM 3183  C CA  . GLY B 1 75  ? -29.864 21.843  -3.071  1.00 30.46 ? 75  GLY B CA  1 
ATOM 3184  C C   . GLY B 1 75  ? -28.652 22.671  -2.677  1.00 30.46 ? 75  GLY B C   1 
ATOM 3185  O O   . GLY B 1 75  ? -28.506 23.068  -1.514  1.00 30.46 ? 75  GLY B O   1 
ATOM 3186  N N   . GLY B 1 76  ? -27.782 22.936  -3.650  1.00 28.63 ? 76  GLY B N   1 
ATOM 3187  C CA  . GLY B 1 76  ? -26.586 23.717  -3.376  1.00 28.63 ? 76  GLY B CA  1 
ATOM 3188  C C   . GLY B 1 76  ? -25.971 24.374  -4.602  1.00 28.63 ? 76  GLY B C   1 
ATOM 3189  O O   . GLY B 1 76  ? -26.210 23.966  -5.745  1.00 28.63 ? 76  GLY B O   1 
ATOM 3190  N N   . VAL B 1 77  ? -25.167 25.402  -4.356  1.00 31.06 ? 77  VAL B N   1 
ATOM 3191  C CA  . VAL B 1 77  ? -24.505 26.131  -5.425  1.00 31.06 ? 77  VAL B CA  1 
ATOM 3192  C C   . VAL B 1 77  ? -23.017 26.232  -5.111  1.00 31.06 ? 77  VAL B C   1 
ATOM 3193  O O   . VAL B 1 77  ? -22.636 26.680  -4.031  1.00 31.06 ? 77  VAL B O   1 
ATOM 3194  C CB  . VAL B 1 77  ? -25.085 27.549  -5.555  1.00 25.72 ? 77  VAL B CB  1 
ATOM 3195  C CG1 . VAL B 1 77  ? -24.540 28.222  -6.790  1.00 25.72 ? 77  VAL B CG1 1 
ATOM 3196  C CG2 . VAL B 1 77  ? -26.595 27.482  -5.607  1.00 25.72 ? 77  VAL B CG2 1 
ATOM 3197  N N   . ILE B 1 78  ? -22.179 25.801  -6.047  1.00 30.51 ? 78  ILE B N   1 
ATOM 3198  C CA  . ILE B 1 78  ? -20.734 25.862  -5.853  1.00 30.51 ? 78  ILE B CA  1 
ATOM 3199  C C   . ILE B 1 78  ? -20.217 27.173  -6.439  1.00 30.51 ? 78  ILE B C   1 
ATOM 3200  O O   . ILE B 1 78  ? -20.327 27.405  -7.645  1.00 30.51 ? 78  ILE B O   1 
ATOM 3201  C CB  . ILE B 1 78  ? -20.010 24.695  -6.566  1.00 24.98 ? 78  ILE B CB  1 
ATOM 3202  C CG1 . ILE B 1 78  ? -20.555 23.348  -6.088  1.00 24.98 ? 78  ILE B CG1 1 
ATOM 3203  C CG2 . ILE B 1 78  ? -18.526 24.759  -6.275  1.00 24.98 ? 78  ILE B CG2 1 
ATOM 3204  C CD1 . ILE B 1 78  ? -19.997 22.162  -6.861  1.00 24.98 ? 78  ILE B CD1 1 
ATOM 3205  N N   . PHE B 1 79  ? -19.654 28.019  -5.580  1.00 29.78 ? 79  PHE B N   1 
ATOM 3206  C CA  . PHE B 1 79  ? -19.113 29.319  -5.983  1.00 29.78 ? 79  PHE B CA  1 
ATOM 3207  C C   . PHE B 1 79  ? -17.632 29.303  -6.317  1.00 29.78 ? 79  PHE B C   1 
ATOM 3208  O O   . PHE B 1 79  ? -16.873 28.485  -5.806  1.00 29.78 ? 79  PHE B O   1 
ATOM 3209  C CB  . PHE B 1 79  ? -19.264 30.350  -4.861  1.00 41.40 ? 79  PHE B CB  1 
ATOM 3210  C CG  . PHE B 1 79  ? -20.649 30.858  -4.670  1.00 41.40 ? 79  PHE B CG  1 
ATOM 3211  C CD1 . PHE B 1 79  ? -21.633 30.049  -4.124  1.00 41.40 ? 79  PHE B CD1 1 
ATOM 3212  C CD2 . PHE B 1 79  ? -20.966 32.164  -5.017  1.00 41.40 ? 79  PHE B CD2 1 
ATOM 3213  C CE1 . PHE B 1 79  ? -22.918 30.535  -3.925  1.00 41.40 ? 79  PHE B CE1 1 
ATOM 3214  C CE2 . PHE B 1 79  ? -22.246 32.658  -4.823  1.00 41.40 ? 79  PHE B CE2 1 
ATOM 3215  C CZ  . PHE B 1 79  ? -23.225 31.842  -4.276  1.00 41.40 ? 79  PHE B CZ  1 
ATOM 3216  N N   . PHE B 1 80  ? -17.223 30.225  -7.174  1.00 38.85 ? 80  PHE B N   1 
ATOM 3217  C CA  . PHE B 1 80  ? -15.813 30.370  -7.472  1.00 38.85 ? 80  PHE B CA  1 
ATOM 3218  C C   . PHE B 1 80  ? -15.432 31.481  -6.494  1.00 38.85 ? 80  PHE B C   1 
ATOM 3219  O O   . PHE B 1 80  ? -16.194 32.433  -6.327  1.00 38.85 ? 80  PHE B O   1 
ATOM 3220  C CB  . PHE B 1 80  ? -15.595 30.854  -8.888  1.00 48.84 ? 80  PHE B CB  1 
ATOM 3221  C CG  . PHE B 1 80  ? -14.200 31.323  -9.140  1.00 48.84 ? 80  PHE B CG  1 
ATOM 3222  C CD1 . PHE B 1 80  ? -13.153 30.418  -9.216  1.00 48.84 ? 80  PHE B CD1 1 
ATOM 3223  C CD2 . PHE B 1 80  ? -13.927 32.678  -9.287  1.00 48.84 ? 80  PHE B CD2 1 
ATOM 3224  C CE1 . PHE B 1 80  ? -11.846 30.857  -9.437  1.00 48.84 ? 80  PHE B CE1 1 
ATOM 3225  C CE2 . PHE B 1 80  ? -12.627 33.127  -9.507  1.00 48.84 ? 80  PHE B CE2 1 
ATOM 3226  C CZ  . PHE B 1 80  ? -11.584 32.214  -9.583  1.00 48.84 ? 80  PHE B CZ  1 
ATOM 3227  N N   . HIS B 1 81  ? -14.277 31.368  -5.849  1.00 29.31 ? 81  HIS B N   1 
ATOM 3228  C CA  . HIS B 1 81  ? -13.852 32.371  -4.866  1.00 29.31 ? 81  HIS B CA  1 
ATOM 3229  C C   . HIS B 1 81  ? -14.353 33.793  -5.117  1.00 29.31 ? 81  HIS B C   1 
ATOM 3230  O O   . HIS B 1 81  ? -15.115 34.349  -4.325  1.00 29.31 ? 81  HIS B O   1 
ATOM 3231  C CB  . HIS B 1 81  ? -12.333 32.422  -4.768  1.00 29.23 ? 81  HIS B CB  1 
ATOM 3232  C CG  . HIS B 1 81  ? -11.841 33.355  -3.708  1.00 29.23 ? 81  HIS B CG  1 
ATOM 3233  N ND1 . HIS B 1 81  ? -11.831 33.021  -2.372  1.00 29.23 ? 81  HIS B ND1 1 
ATOM 3234  C CD2 . HIS B 1 81  ? -11.421 34.641  -3.777  1.00 29.23 ? 81  HIS B CD2 1 
ATOM 3235  C CE1 . HIS B 1 81  ? -11.429 34.060  -1.662  1.00 29.23 ? 81  HIS B CE1 1 
ATOM 3236  N NE2 . HIS B 1 81  ? -11.174 35.057  -2.490  1.00 29.23 ? 81  HIS B NE2 1 
ATOM 3237  N N   . GLU B 1 82  ? -13.877 34.382  -6.208  1.00 27.19 ? 82  GLU B N   1 
ATOM 3238  C CA  . GLU B 1 82  ? -14.252 35.732  -6.613  1.00 27.19 ? 82  GLU B CA  1 
ATOM 3239  C C   . GLU B 1 82  ? -15.740 35.960  -6.380  1.00 27.19 ? 82  GLU B C   1 
ATOM 3240  O O   . GLU B 1 82  ? -16.147 36.834  -5.606  1.00 27.19 ? 82  GLU B O   1 
ATOM 3241  C CB  . GLU B 1 82  ? -13.936 35.902  -8.099  1.00 51.28 ? 82  GLU B CB  1 
ATOM 3242  C CG  . GLU B 1 82  ? -14.437 37.178  -8.724  1.00 51.28 ? 82  GLU B CG  1 
ATOM 3243  C CD  . GLU B 1 82  ? -14.551 37.073  -10.238 1.00 51.28 ? 82  GLU B CD  1 
ATOM 3244  O OE1 . GLU B 1 82  ? -15.469 36.369  -10.723 1.00 51.28 ? 82  GLU B OE1 1 
ATOM 3245  O OE2 . GLU B 1 82  ? -13.720 37.690  -10.941 1.00 51.28 ? 82  GLU B OE2 1 
ATOM 3246  N N   . THR B 1 83  ? -16.539 35.142  -7.058  1.00 30.66 ? 83  THR B N   1 
ATOM 3247  C CA  . THR B 1 83  ? -17.991 35.196  -6.997  1.00 30.66 ? 83  THR B CA  1 
ATOM 3248  C C   . THR B 1 83  ? -18.579 35.171  -5.580  1.00 30.66 ? 83  THR B C   1 
ATOM 3249  O O   . THR B 1 83  ? -19.567 35.850  -5.300  1.00 30.66 ? 83  THR B O   1 
ATOM 3250  C CB  . THR B 1 83  ? -18.583 34.047  -7.829  1.00 32.63 ? 83  THR B CB  1 
ATOM 3251  O OG1 . THR B 1 83  ? -18.132 34.165  -9.185  1.00 32.63 ? 83  THR B OG1 1 
ATOM 3252  C CG2 . THR B 1 83  ? -20.094 34.098  -7.807  1.00 32.63 ? 83  THR B CG2 1 
ATOM 3253  N N   . LEU B 1 84  ? -17.973 34.394  -4.688  1.00 25.47 ? 84  LEU B N   1 
ATOM 3254  C CA  . LEU B 1 84  ? -18.448 34.284  -3.307  1.00 25.47 ? 84  LEU B CA  1 
ATOM 3255  C C   . LEU B 1 84  ? -18.467 35.635  -2.601  1.00 25.47 ? 84  LEU B C   1 
ATOM 3256  O O   . LEU B 1 84  ? -19.031 35.775  -1.512  1.00 25.47 ? 84  LEU B O   1 
ATOM 3257  C CB  . LEU B 1 84  ? -17.546 33.333  -2.521  1.00 28.75 ? 84  LEU B CB  1 
ATOM 3258  C CG  . LEU B 1 84  ? -17.943 33.058  -1.074  1.00 28.75 ? 84  LEU B CG  1 
ATOM 3259  C CD1 . LEU B 1 84  ? -19.148 32.145  -1.063  1.00 28.75 ? 84  LEU B CD1 1 
ATOM 3260  C CD2 . LEU B 1 84  ? -16.787 32.413  -0.332  1.00 28.75 ? 84  LEU B CD2 1 
ATOM 3261  N N   . TYR B 1 85  ? -17.839 36.631  -3.210  1.00 31.61 ? 85  TYR B N   1 
ATOM 3262  C CA  . TYR B 1 85  ? -17.801 37.946  -2.592  1.00 31.61 ? 85  TYR B CA  1 
ATOM 3263  C C   . TYR B 1 85  ? -18.397 39.039  -3.473  1.00 31.61 ? 85  TYR B C   1 
ATOM 3264  O O   . TYR B 1 85  ? -18.241 40.232  -3.187  1.00 31.61 ? 85  TYR B O   1 
ATOM 3265  C CB  . TYR B 1 85  ? -16.363 38.301  -2.201  1.00 31.26 ? 85  TYR B CB  1 
ATOM 3266  C CG  . TYR B 1 85  ? -15.766 37.336  -1.203  1.00 31.26 ? 85  TYR B CG  1 
ATOM 3267  C CD1 . TYR B 1 85  ? -15.075 36.201  -1.625  1.00 31.26 ? 85  TYR B CD1 1 
ATOM 3268  C CD2 . TYR B 1 85  ? -15.968 37.509  0.165   1.00 31.26 ? 85  TYR B CD2 1 
ATOM 3269  C CE1 . TYR B 1 85  ? -14.606 35.261  -0.707  1.00 31.26 ? 85  TYR B CE1 1 
ATOM 3270  C CE2 . TYR B 1 85  ? -15.503 36.577  1.092   1.00 31.26 ? 85  TYR B CE2 1 
ATOM 3271  C CZ  . TYR B 1 85  ? -14.829 35.457  0.649   1.00 31.26 ? 85  TYR B CZ  1 
ATOM 3272  O OH  . TYR B 1 85  ? -14.399 34.523  1.556   1.00 31.26 ? 85  TYR B OH  1 
ATOM 3273  N N   . GLN B 1 86  ? -19.083 38.635  -4.537  1.00 41.21 ? 86  GLN B N   1 
ATOM 3274  C CA  . GLN B 1 86  ? -19.706 39.602  -5.428  1.00 41.21 ? 86  GLN B CA  1 
ATOM 3275  C C   . GLN B 1 86  ? -21.144 39.862  -4.995  1.00 41.21 ? 86  GLN B C   1 
ATOM 3276  O O   . GLN B 1 86  ? -21.740 39.078  -4.247  1.00 41.21 ? 86  GLN B O   1 
ATOM 3277  C CB  . GLN B 1 86  ? -19.670 39.103  -6.872  1.00 35.65 ? 86  GLN B CB  1 
ATOM 3278  C CG  . GLN B 1 86  ? -18.268 38.901  -7.392  1.00 35.65 ? 86  GLN B CG  1 
ATOM 3279  C CD  . GLN B 1 86  ? -18.226 38.589  -8.876  1.00 35.65 ? 86  GLN B CD  1 
ATOM 3280  O OE1 . GLN B 1 86  ? -18.775 37.578  -9.339  1.00 35.65 ? 86  GLN B OE1 1 
ATOM 3281  N NE2 . GLN B 1 86  ? -17.561 39.455  -9.635  1.00 35.65 ? 86  GLN B NE2 1 
ATOM 3282  N N   . LYS B 1 87  ? -21.695 40.975  -5.465  1.00 45.22 ? 87  LYS B N   1 
ATOM 3283  C CA  . LYS B 1 87  ? -23.057 41.352  -5.132  1.00 45.22 ? 87  LYS B CA  1 
ATOM 3284  C C   . LYS B 1 87  ? -23.850 41.656  -6.393  1.00 45.22 ? 87  LYS B C   1 
ATOM 3285  O O   . LYS B 1 87  ? -23.270 41.953  -7.443  1.00 45.22 ? 87  LYS B O   1 
ATOM 3286  C CB  . LYS B 1 87  ? -23.034 42.572  -4.215  1.00 46.73 ? 87  LYS B CB  1 
ATOM 3287  C CG  . LYS B 1 87  ? -22.387 42.282  -2.881  1.00 46.73 ? 87  LYS B CG  1 
ATOM 3288  C CD  . LYS B 1 87  ? -22.298 43.513  -1.986  1.00 46.73 ? 87  LYS B CD  1 
ATOM 3289  C CE  . LYS B 1 87  ? -21.106 44.392  -2.331  1.00 46.73 ? 87  LYS B CE  1 
ATOM 3290  N NZ  . LYS B 1 87  ? -20.816 45.361  -1.229  1.00 46.73 ? 87  LYS B NZ  1 
ATOM 3291  N N   . ASP B 1 88  ? -25.173 41.561  -6.293  1.00 59.67 ? 88  ASP B N   1 
ATOM 3292  C CA  . ASP B 1 88  ? -26.043 41.849  -7.428  1.00 59.67 ? 88  ASP B CA  1 
ATOM 3293  C C   . ASP B 1 88  ? -26.165 43.362  -7.564  1.00 59.67 ? 88  ASP B C   1 
ATOM 3294  O O   . ASP B 1 88  ? -25.596 44.114  -6.768  1.00 59.67 ? 88  ASP B O   1 
ATOM 3295  C CB  . ASP B 1 88  ? -27.425 41.211  -7.233  1.00 56.32 ? 88  ASP B CB  1 
ATOM 3296  C CG  . ASP B 1 88  ? -28.171 41.770  -6.035  1.00 56.32 ? 88  ASP B CG  1 
ATOM 3297  O OD1 . ASP B 1 88  ? -29.206 41.181  -5.661  1.00 56.32 ? 88  ASP B OD1 1 
ATOM 3298  O OD2 . ASP B 1 88  ? -27.736 42.795  -5.467  1.00 56.32 ? 88  ASP B OD2 1 
ATOM 3299  N N   . ASP B 1 89  ? -26.913 43.812  -8.560  1.00 53.28 ? 89  ASP B N   1 
ATOM 3300  C CA  . ASP B 1 89  ? -27.060 45.239  -8.784  1.00 53.28 ? 89  ASP B CA  1 
ATOM 3301  C C   . ASP B 1 89  ? -27.700 46.000  -7.632  1.00 53.28 ? 89  ASP B C   1 
ATOM 3302  O O   . ASP B 1 89  ? -27.597 47.225  -7.569  1.00 53.28 ? 89  ASP B O   1 
ATOM 3303  C CB  . ASP B 1 89  ? -27.843 45.483  -10.066 1.00 50.79 ? 89  ASP B CB  1 
ATOM 3304  C CG  . ASP B 1 89  ? -27.225 44.783  -11.258 1.00 50.79 ? 89  ASP B CG  1 
ATOM 3305  O OD1 . ASP B 1 89  ? -25.978 44.689  -11.311 1.00 50.79 ? 89  ASP B OD1 1 
ATOM 3306  O OD2 . ASP B 1 89  ? -27.986 44.335  -12.143 1.00 50.79 ? 89  ASP B OD2 1 
ATOM 3307  N N   . ASN B 1 90  ? -28.352 45.285  -6.719  1.00 49.35 ? 90  ASN B N   1 
ATOM 3308  C CA  . ASN B 1 90  ? -28.992 45.936  -5.579  1.00 49.35 ? 90  ASN B CA  1 
ATOM 3309  C C   . ASN B 1 90  ? -28.042 45.988  -4.395  1.00 49.35 ? 90  ASN B C   1 
ATOM 3310  O O   . ASN B 1 90  ? -28.418 46.435  -3.307  1.00 49.35 ? 90  ASN B O   1 
ATOM 3311  C CB  . ASN B 1 90  ? -30.258 45.186  -5.175  1.00 75.74 ? 90  ASN B CB  1 
ATOM 3312  C CG  . ASN B 1 90  ? -31.218 45.019  -6.325  1.00 75.74 ? 90  ASN B CG  1 
ATOM 3313  O OD1 . ASN B 1 90  ? -31.637 45.997  -6.948  1.00 75.74 ? 90  ASN B OD1 1 
ATOM 3314  N ND2 . ASN B 1 90  ? -31.576 43.772  -6.619  1.00 75.74 ? 90  ASN B ND2 1 
ATOM 3315  N N   . GLY B 1 91  ? -26.813 45.528  -4.613  1.00 56.59 ? 91  GLY B N   1 
ATOM 3316  C CA  . GLY B 1 91  ? -25.821 45.524  -3.553  1.00 56.59 ? 91  GLY B CA  1 
ATOM 3317  C C   . GLY B 1 91  ? -26.012 44.357  -2.604  1.00 56.59 ? 91  GLY B C   1 
ATOM 3318  O O   . GLY B 1 91  ? -25.514 44.369  -1.478  1.00 56.59 ? 91  GLY B O   1 
ATOM 3319  N N   . VAL B 1 92  ? -26.739 43.341  -3.059  1.00 58.57 ? 92  VAL B N   1 
ATOM 3320  C CA  . VAL B 1 92  ? -26.987 42.169  -2.237  1.00 58.57 ? 92  VAL B CA  1 
ATOM 3321  C C   . VAL B 1 92  ? -26.059 41.015  -2.575  1.00 58.57 ? 92  VAL B C   1 
ATOM 3322  O O   . VAL B 1 92  ? -26.038 40.514  -3.702  1.00 58.57 ? 92  VAL B O   1 
ATOM 3323  C CB  . VAL B 1 92  ? -28.422 41.673  -2.382  1.00 43.01 ? 92  VAL B CB  1 
ATOM 3324  C CG1 . VAL B 1 92  ? -28.627 40.434  -1.517  1.00 43.01 ? 92  VAL B CG1 1 
ATOM 3325  C CG2 . VAL B 1 92  ? -29.383 42.776  -1.990  1.00 43.01 ? 92  VAL B CG2 1 
ATOM 3326  N N   . PRO B 1 93  ? -25.289 40.564  -1.584  1.00 39.94 ? 93  PRO B N   1 
ATOM 3327  C CA  . PRO B 1 93  ? -24.336 39.464  -1.715  1.00 39.94 ? 93  PRO B CA  1 
ATOM 3328  C C   . PRO B 1 93  ? -24.982 38.240  -2.345  1.00 39.94 ? 93  PRO B C   1 
ATOM 3329  O O   . PRO B 1 93  ? -26.001 37.753  -1.856  1.00 39.94 ? 93  PRO B O   1 
ATOM 3330  C CB  . PRO B 1 93  ? -23.929 39.197  -0.275  1.00 28.98 ? 93  PRO B CB  1 
ATOM 3331  C CG  . PRO B 1 93  ? -24.067 40.539  0.367   1.00 28.98 ? 93  PRO B CG  1 
ATOM 3332  C CD  . PRO B 1 93  ? -25.364 41.029  -0.191  1.00 28.98 ? 93  PRO B CD  1 
ATOM 3333  N N   . PHE B 1 94  ? -24.397 37.752  -3.434  1.00 36.83 ? 94  PHE B N   1 
ATOM 3334  C CA  . PHE B 1 94  ? -24.916 36.566  -4.100  1.00 36.83 ? 94  PHE B CA  1 
ATOM 3335  C C   . PHE B 1 94  ? -25.104 35.459  -3.061  1.00 36.83 ? 94  PHE B C   1 
ATOM 3336  O O   . PHE B 1 94  ? -26.061 34.690  -3.118  1.00 36.83 ? 94  PHE B O   1 
ATOM 3337  C CB  . PHE B 1 94  ? -23.933 36.089  -5.170  1.00 35.42 ? 94  PHE B CB  1 
ATOM 3338  C CG  . PHE B 1 94  ? -23.904 36.942  -6.403  1.00 35.42 ? 94  PHE B CG  1 
ATOM 3339  C CD1 . PHE B 1 94  ? -22.722 37.097  -7.121  1.00 35.42 ? 94  PHE B CD1 1 
ATOM 3340  C CD2 . PHE B 1 94  ? -25.059 37.537  -6.885  1.00 35.42 ? 94  PHE B CD2 1 
ATOM 3341  C CE1 . PHE B 1 94  ? -22.690 37.831  -8.306  1.00 35.42 ? 94  PHE B CE1 1 
ATOM 3342  C CE2 . PHE B 1 94  ? -25.041 38.271  -8.070  1.00 35.42 ? 94  PHE B CE2 1 
ATOM 3343  C CZ  . PHE B 1 94  ? -23.852 38.418  -8.782  1.00 35.42 ? 94  PHE B CZ  1 
ATOM 3344  N N   . VAL B 1 95  ? -24.177 35.382  -2.110  1.00 39.08 ? 95  VAL B N   1 
ATOM 3345  C CA  . VAL B 1 95  ? -24.251 34.365  -1.069  1.00 39.08 ? 95  VAL B CA  1 
ATOM 3346  C C   . VAL B 1 95  ? -25.537 34.535  -0.279  1.00 39.08 ? 95  VAL B C   1 
ATOM 3347  O O   . VAL B 1 95  ? -26.260 33.570  -0.038  1.00 39.08 ? 95  VAL B O   1 
ATOM 3348  C CB  . VAL B 1 95  ? -23.056 34.455  -0.098  1.00 36.13 ? 95  VAL B CB  1 
ATOM 3349  C CG1 . VAL B 1 95  ? -23.219 33.439  1.012   1.00 36.13 ? 95  VAL B CG1 1 
ATOM 3350  C CG2 . VAL B 1 95  ? -21.758 34.204  -0.843  1.00 36.13 ? 95  VAL B CG2 1 
ATOM 3351  N N   . ARG B 1 96  ? -25.813 35.774  0.114   1.00 44.26 ? 96  ARG B N   1 
ATOM 3352  C CA  . ARG B 1 96  ? -27.013 36.107  0.873   1.00 44.26 ? 96  ARG B CA  1 
ATOM 3353  C C   . ARG B 1 96  ? -28.248 35.565  0.161   1.00 44.26 ? 96  ARG B C   1 
ATOM 3354  O O   . ARG B 1 96  ? -29.044 34.827  0.742   1.00 44.26 ? 96  ARG B O   1 
ATOM 3355  C CB  . ARG B 1 96  ? -27.132 37.619  0.999   1.00 95.18 ? 96  ARG B CB  1 
ATOM 3356  C CG  . ARG B 1 96  ? -28.300 38.064  1.824   1.00 95.18 ? 96  ARG B CG  1 
ATOM 3357  C CD  . ARG B 1 96  ? -28.091 37.718  3.277   1.00 95.18 ? 96  ARG B CD  1 
ATOM 3358  N NE  . ARG B 1 96  ? -28.592 38.793  4.125   1.00 95.18 ? 96  ARG B NE  1 
ATOM 3359  C CZ  . ARG B 1 96  ? -28.196 40.061  4.032   1.00 95.18 ? 96  ARG B CZ  1 
ATOM 3360  N NH1 . ARG B 1 96  ? -27.289 40.421  3.128   1.00 95.18 ? 96  ARG B NH1 1 
ATOM 3361  N NH2 . ARG B 1 96  ? -28.712 40.975  4.842   1.00 95.18 ? 96  ARG B NH2 1 
ATOM 3362  N N   . THR B 1 97  ? -28.393 35.941  -1.104  1.00 38.00 ? 97  THR B N   1 
ATOM 3363  C CA  . THR B 1 97  ? -29.515 35.503  -1.921  1.00 38.00 ? 97  THR B CA  1 
ATOM 3364  C C   . THR B 1 97  ? -29.688 33.986  -1.893  1.00 38.00 ? 97  THR B C   1 
ATOM 3365  O O   . THR B 1 97  ? -30.724 33.491  -1.449  1.00 38.00 ? 97  THR B O   1 
ATOM 3366  C CB  . THR B 1 97  ? -29.332 35.945  -3.379  1.00 34.32 ? 97  THR B CB  1 
ATOM 3367  O OG1 . THR B 1 97  ? -29.192 37.372  -3.432  1.00 34.32 ? 97  THR B OG1 1 
ATOM 3368  C CG2 . THR B 1 97  ? -30.526 35.505  -4.221  1.00 34.32 ? 97  THR B CG2 1 
ATOM 3369  N N   . ILE B 1 98  ? -28.685 33.248  -2.374  1.00 29.65 ? 98  ILE B N   1 
ATOM 3370  C CA  . ILE B 1 98  ? -28.771 31.793  -2.383  1.00 29.65 ? 98  ILE B CA  1 
ATOM 3371  C C   . ILE B 1 98  ? -29.125 31.279  -0.987  1.00 29.65 ? 98  ILE B C   1 
ATOM 3372  O O   . ILE B 1 98  ? -29.946 30.370  -0.847  1.00 29.65 ? 98  ILE B O   1 
ATOM 3373  C CB  . ILE B 1 98  ? -27.446 31.134  -2.861  1.00 28.10 ? 98  ILE B CB  1 
ATOM 3374  C CG1 . ILE B 1 98  ? -27.397 31.095  -4.386  1.00 28.10 ? 98  ILE B CG1 1 
ATOM 3375  C CG2 . ILE B 1 98  ? -27.360 29.696  -2.373  1.00 28.10 ? 98  ILE B CG2 1 
ATOM 3376  C CD1 . ILE B 1 98  ? -27.235 32.430  -5.025  1.00 28.10 ? 98  ILE B CD1 1 
ATOM 3377  N N   . GLN B 1 99  ? -28.520 31.865  0.042   1.00 37.84 ? 99  GLN B N   1 
ATOM 3378  C CA  . GLN B 1 99  ? -28.790 31.445  1.414   1.00 37.84 ? 99  GLN B CA  1 
ATOM 3379  C C   . GLN B 1 99  ? -30.239 31.627  1.811   1.00 37.84 ? 99  GLN B C   1 
ATOM 3380  O O   . GLN B 1 99  ? -30.834 30.747  2.435   1.00 37.84 ? 99  GLN B O   1 
ATOM 3381  C CB  . GLN B 1 99  ? -27.934 32.221  2.397   1.00 57.96 ? 99  GLN B CB  1 
ATOM 3382  C CG  . GLN B 1 99  ? -26.485 31.857  2.354   1.00 57.96 ? 99  GLN B CG  1 
ATOM 3383  C CD  . GLN B 1 99  ? -25.727 32.498  3.479   1.00 57.96 ? 99  GLN B CD  1 
ATOM 3384  O OE1 . GLN B 1 99  ? -25.742 33.721  3.630   1.00 57.96 ? 99  GLN B OE1 1 
ATOM 3385  N NE2 . GLN B 1 99  ? -25.061 31.680  4.288   1.00 57.96 ? 99  GLN B NE2 1 
ATOM 3386  N N   . ASP B 1 100 ? -30.803 32.778  1.461   1.00 47.35 ? 100 ASP B N   1 
ATOM 3387  C CA  . ASP B 1 100 ? -32.188 33.065  1.797   1.00 47.35 ? 100 ASP B CA  1 
ATOM 3388  C C   . ASP B 1 100 ? -33.162 32.080  1.161   1.00 47.35 ? 100 ASP B C   1 
ATOM 3389  O O   . ASP B 1 100 ? -34.215 31.812  1.726   1.00 47.35 ? 100 ASP B O   1 
ATOM 3390  C CB  . ASP B 1 100 ? -32.544 34.503  1.411   1.00 60.48 ? 100 ASP B CB  1 
ATOM 3391  C CG  . ASP B 1 100 ? -31.850 35.538  2.298   1.00 60.48 ? 100 ASP B CG  1 
ATOM 3392  O OD1 . ASP B 1 100 ? -31.327 35.166  3.380   1.00 60.48 ? 100 ASP B OD1 1 
ATOM 3393  O OD2 . ASP B 1 100 ? -31.841 36.732  1.917   1.00 60.48 ? 100 ASP B OD2 1 
ATOM 3394  N N   . LYS B 1 101 ? -32.821 31.539  -0.007  1.00 29.96 ? 101 LYS B N   1 
ATOM 3395  C CA  . LYS B 1 101 ? -33.696 30.564  -0.658  1.00 29.96 ? 101 LYS B CA  1 
ATOM 3396  C C   . LYS B 1 101 ? -33.500 29.201  -0.006  1.00 29.96 ? 101 LYS B C   1 
ATOM 3397  O O   . LYS B 1 101 ? -34.088 28.205  -0.436  1.00 29.96 ? 101 LYS B O   1 
ATOM 3398  C CB  . LYS B 1 101 ? -33.394 30.444  -2.154  1.00 42.27 ? 101 LYS B CB  1 
ATOM 3399  C CG  . LYS B 1 101 ? -33.756 31.659  -2.970  1.00 42.27 ? 101 LYS B CG  1 
ATOM 3400  C CD  . LYS B 1 101 ? -33.591 31.359  -4.444  1.00 42.27 ? 101 LYS B CD  1 
ATOM 3401  C CE  . LYS B 1 101 ? -33.683 32.620  -5.290  1.00 42.27 ? 101 LYS B CE  1 
ATOM 3402  N NZ  . LYS B 1 101 ? -35.069 33.165  -5.308  1.00 42.27 ? 101 LYS B NZ  1 
ATOM 3403  N N   . GLY B 1 102 ? -32.662 29.160  1.027   1.00 35.49 ? 102 GLY B N   1 
ATOM 3404  C CA  . GLY B 1 102 ? -32.413 27.914  1.725   1.00 35.49 ? 102 GLY B CA  1 
ATOM 3405  C C   . GLY B 1 102 ? -31.491 26.957  0.991   1.00 35.49 ? 102 GLY B C   1 
ATOM 3406  O O   . GLY B 1 102 ? -31.367 25.789  1.371   1.00 35.49 ? 102 GLY B O   1 
ATOM 3407  N N   . ILE B 1 103 ? -30.845 27.441  -0.065  1.00 31.59 ? 103 ILE B N   1 
ATOM 3408  C CA  . ILE B 1 103 ? -29.925 26.615  -0.834  1.00 31.59 ? 103 ILE B CA  1 
ATOM 3409  C C   . ILE B 1 103 ? -28.574 26.664  -0.124  1.00 31.59 ? 103 ILE B C   1 
ATOM 3410  O O   . ILE B 1 103 ? -28.231 27.679  0.477   1.00 31.59 ? 103 ILE B O   1 
ATOM 3411  C CB  . ILE B 1 103 ? -29.805 27.151  -2.265  1.00 25.82 ? 103 ILE B CB  1 
ATOM 3412  C CG1 . ILE B 1 103 ? -31.207 27.245  -2.874  1.00 25.82 ? 103 ILE B CG1 1 
ATOM 3413  C CG2 . ILE B 1 103 ? -28.926 26.241  -3.100  1.00 25.82 ? 103 ILE B CG2 1 
ATOM 3414  C CD1 . ILE B 1 103 ? -31.248 27.763  -4.284  1.00 25.82 ? 103 ILE B CD1 1 
ATOM 3415  N N   . VAL B 1 104 ? -27.817 25.570  -0.171  1.00 27.21 ? 104 VAL B N   1 
ATOM 3416  C CA  . VAL B 1 104 ? -26.520 25.538  0.504   1.00 27.21 ? 104 VAL B CA  1 
ATOM 3417  C C   . VAL B 1 104 ? -25.414 26.167  -0.345  1.00 27.21 ? 104 VAL B C   1 
ATOM 3418  O O   . VAL B 1 104 ? -25.402 26.021  -1.570  1.00 27.21 ? 104 VAL B O   1 
ATOM 3419  C CB  . VAL B 1 104 ? -26.113 24.094  0.863   1.00 22.18 ? 104 VAL B CB  1 
ATOM 3420  C CG1 . VAL B 1 104 ? -24.920 24.118  1.791   1.00 22.18 ? 104 VAL B CG1 1 
ATOM 3421  C CG2 . VAL B 1 104 ? -27.268 23.370  1.523   1.00 22.18 ? 104 VAL B CG2 1 
ATOM 3422  N N   . VAL B 1 105 ? -24.484 26.859  0.316   1.00 33.21 ? 105 VAL B N   1 
ATOM 3423  C CA  . VAL B 1 105 ? -23.372 27.525  -0.366  1.00 33.21 ? 105 VAL B CA  1 
ATOM 3424  C C   . VAL B 1 105 ? -22.049 26.750  -0.295  1.00 33.21 ? 105 VAL B C   1 
ATOM 3425  O O   . VAL B 1 105 ? -21.683 26.226  0.761   1.00 33.21 ? 105 VAL B O   1 
ATOM 3426  C CB  . VAL B 1 105 ? -23.139 28.927  0.231   1.00 24.70 ? 105 VAL B CB  1 
ATOM 3427  C CG1 . VAL B 1 105 ? -22.041 29.640  -0.527  1.00 24.70 ? 105 VAL B CG1 1 
ATOM 3428  C CG2 . VAL B 1 105 ? -24.418 29.728  0.174   1.00 24.70 ? 105 VAL B CG2 1 
ATOM 3429  N N   . GLY B 1 106 ? -21.332 26.689  -1.418  1.00 27.53 ? 106 GLY B N   1 
ATOM 3430  C CA  . GLY B 1 106 ? -20.056 25.990  -1.449  1.00 27.53 ? 106 GLY B CA  1 
ATOM 3431  C C   . GLY B 1 106 ? -18.999 26.712  -2.272  1.00 27.53 ? 106 GLY B C   1 
ATOM 3432  O O   . GLY B 1 106 ? -19.347 27.575  -3.076  1.00 27.53 ? 106 GLY B O   1 
ATOM 3433  N N   . ILE B 1 107 ? -17.719 26.370  -2.074  1.00 25.43 ? 107 ILE B N   1 
ATOM 3434  C CA  . ILE B 1 107 ? -16.599 26.980  -2.819  1.00 25.43 ? 107 ILE B CA  1 
ATOM 3435  C C   . ILE B 1 107 ? -15.629 25.946  -3.343  1.00 25.43 ? 107 ILE B C   1 
ATOM 3436  O O   . ILE B 1 107 ? -15.363 24.940  -2.679  1.00 25.43 ? 107 ILE B O   1 
ATOM 3437  C CB  . ILE B 1 107 ? -15.685 27.896  -1.954  1.00 19.43 ? 107 ILE B CB  1 
ATOM 3438  C CG1 . ILE B 1 107 ? -16.194 27.926  -0.530  1.00 19.43 ? 107 ILE B CG1 1 
ATOM 3439  C CG2 . ILE B 1 107 ? -15.547 29.268  -2.578  1.00 19.43 ? 107 ILE B CG2 1 
ATOM 3440  C CD1 . ILE B 1 107 ? -16.189 26.556  0.106   1.00 19.43 ? 107 ILE B CD1 1 
ATOM 3441  N N   . LYS B 1 108 ? -15.093 26.219  -4.529  1.00 31.75 ? 108 LYS B N   1 
ATOM 3442  C CA  . LYS B 1 108 ? -14.066 25.381  -5.144  1.00 31.75 ? 108 LYS B CA  1 
ATOM 3443  C C   . LYS B 1 108 ? -12.844 25.818  -4.325  1.00 31.75 ? 108 LYS B C   1 
ATOM 3444  O O   . LYS B 1 108 ? -12.630 27.017  -4.144  1.00 31.75 ? 108 LYS B O   1 
ATOM 3445  C CB  . LYS B 1 108 ? -13.889 25.780  -6.613  1.00 30.21 ? 108 LYS B CB  1 
ATOM 3446  C CG  . LYS B 1 108 ? -12.717 25.157  -7.360  1.00 30.21 ? 108 LYS B CG  1 
ATOM 3447  C CD  . LYS B 1 108 ? -12.599 25.797  -8.749  1.00 30.21 ? 108 LYS B CD  1 
ATOM 3448  C CE  . LYS B 1 108 ? -11.965 24.864  -9.794  1.00 30.21 ? 108 LYS B CE  1 
ATOM 3449  N NZ  . LYS B 1 108 ? -12.124 25.373  -11.225 1.00 30.21 ? 108 LYS B NZ  1 
ATOM 3450  N N   . VAL B 1 109 ? -12.065 24.878  -3.802  1.00 24.58 ? 109 VAL B N   1 
ATOM 3451  C CA  . VAL B 1 109 ? -10.900 25.260  -3.012  1.00 24.58 ? 109 VAL B CA  1 
ATOM 3452  C C   . VAL B 1 109 ? -9.573  24.793  -3.596  1.00 24.58 ? 109 VAL B C   1 
ATOM 3453  O O   . VAL B 1 109 ? -8.522  25.323  -3.244  1.00 24.58 ? 109 VAL B O   1 
ATOM 3454  C CB  . VAL B 1 109 ? -11.010 24.741  -1.568  1.00 13.41 ? 109 VAL B CB  1 
ATOM 3455  C CG1 . VAL B 1 109 ? -12.259 25.298  -0.925  1.00 13.41 ? 109 VAL B CG1 1 
ATOM 3456  C CG2 . VAL B 1 109 ? -11.021 23.224  -1.553  1.00 13.41 ? 109 VAL B CG2 1 
ATOM 3457  N N   . ASP B 1 110 ? -9.615  23.806  -4.489  1.00 19.03 ? 110 ASP B N   1 
ATOM 3458  C CA  . ASP B 1 110 ? -8.387  23.312  -5.098  1.00 19.03 ? 110 ASP B CA  1 
ATOM 3459  C C   . ASP B 1 110 ? -7.749  24.468  -5.853  1.00 19.03 ? 110 ASP B C   1 
ATOM 3460  O O   . ASP B 1 110 ? -8.435  25.390  -6.282  1.00 19.03 ? 110 ASP B O   1 
ATOM 3461  C CB  . ASP B 1 110 ? -8.660  22.144  -6.056  1.00 34.88 ? 110 ASP B CB  1 
ATOM 3462  C CG  . ASP B 1 110 ? -9.258  22.589  -7.375  1.00 34.88 ? 110 ASP B CG  1 
ATOM 3463  O OD1 . ASP B 1 110 ? -10.482 22.446  -7.548  1.00 34.88 ? 110 ASP B OD1 1 
ATOM 3464  O OD2 . ASP B 1 110 ? -8.503  23.079  -8.241  1.00 34.88 ? 110 ASP B OD2 1 
ATOM 3465  N N   . LYS B 1 111 ? -6.433  24.426  -5.998  1.00 26.53 ? 111 LYS B N   1 
ATOM 3466  C CA  . LYS B 1 111 ? -5.726  25.480  -6.690  1.00 26.53 ? 111 LYS B CA  1 
ATOM 3467  C C   . LYS B 1 111 ? -5.175  24.977  -8.008  1.00 26.53 ? 111 LYS B C   1 
ATOM 3468  O O   . LYS B 1 111 ? -4.025  25.240  -8.354  1.00 26.53 ? 111 LYS B O   1 
ATOM 3469  C CB  . LYS B 1 111 ? -4.589  26.026  -5.827  1.00 35.56 ? 111 LYS B CB  1 
ATOM 3470  C CG  . LYS B 1 111 ? -5.028  26.664  -4.517  1.00 35.56 ? 111 LYS B CG  1 
ATOM 3471  C CD  . LYS B 1 111 ? -4.220  27.936  -4.244  1.00 35.56 ? 111 LYS B CD  1 
ATOM 3472  C CE  . LYS B 1 111 ? -4.050  28.249  -2.753  1.00 35.56 ? 111 LYS B CE  1 
ATOM 3473  N NZ  . LYS B 1 111 ? -3.102  27.314  -2.036  1.00 35.56 ? 111 LYS B NZ  1 
ATOM 3474  N N   . GLY B 1 112 ? -5.988  24.227  -8.738  1.00 19.08 ? 112 GLY B N   1 
ATOM 3475  C CA  . GLY B 1 112 ? -5.546  23.750  -10.032 1.00 19.08 ? 112 GLY B CA  1 
ATOM 3476  C C   . GLY B 1 112 ? -4.771  22.453  -10.097 1.00 19.08 ? 112 GLY B C   1 
ATOM 3477  O O   . GLY B 1 112 ? -4.195  21.968  -9.120  1.00 19.08 ? 112 GLY B O   1 
ATOM 3478  N N   . VAL B 1 113 ? -4.753  21.901  -11.300 1.00 19.10 ? 113 VAL B N   1 
ATOM 3479  C CA  . VAL B 1 113 ? -4.090  20.648  -11.574 1.00 19.10 ? 113 VAL B CA  1 
ATOM 3480  C C   . VAL B 1 113 ? -2.631  20.916  -11.897 1.00 19.10 ? 113 VAL B C   1 
ATOM 3481  O O   . VAL B 1 113 ? -2.299  21.977  -12.416 1.00 19.10 ? 113 VAL B O   1 
ATOM 3482  C CB  . VAL B 1 113 ? -4.754  19.983  -12.781 1.00 14.43 ? 113 VAL B CB  1 
ATOM 3483  C CG1 . VAL B 1 113 ? -4.260  20.620  -14.056 1.00 14.43 ? 113 VAL B CG1 1 
ATOM 3484  C CG2 . VAL B 1 113 ? -4.483  18.523  -12.779 1.00 14.43 ? 113 VAL B CG2 1 
ATOM 3485  N N   . VAL B 1 114 ? -1.762  19.959  -11.590 1.00 27.90 ? 114 VAL B N   1 
ATOM 3486  C CA  . VAL B 1 114 ? -0.338  20.102  -11.879 1.00 27.90 ? 114 VAL B CA  1 
ATOM 3487  C C   . VAL B 1 114 ? 0.234   18.768  -12.355 1.00 27.90 ? 114 VAL B C   1 
ATOM 3488  O O   . VAL B 1 114 ? -0.314  17.706  -12.064 1.00 27.90 ? 114 VAL B O   1 
ATOM 3489  C CB  . VAL B 1 114 ? 0.451   20.582  -10.654 1.00 10.04 ? 114 VAL B CB  1 
ATOM 3490  C CG1 . VAL B 1 114 ? -0.085  21.919  -10.178 1.00 10.04 ? 114 VAL B CG1 1 
ATOM 3491  C CG2 . VAL B 1 114 ? 0.357   19.559  -9.545  1.00 10.04 ? 114 VAL B CG2 1 
ATOM 3492  N N   . PRO B 1 115 ? 1.358   18.811  -13.083 1.00 26.03 ? 115 PRO B N   1 
ATOM 3493  C CA  . PRO B 1 115 ? 2.086   17.678  -13.663 1.00 26.03 ? 115 PRO B CA  1 
ATOM 3494  C C   . PRO B 1 115 ? 2.713   16.689  -12.719 1.00 26.03 ? 115 PRO B C   1 
ATOM 3495  O O   . PRO B 1 115 ? 3.308   17.063  -11.708 1.00 26.03 ? 115 PRO B O   1 
ATOM 3496  C CB  . PRO B 1 115 ? 3.172   18.346  -14.490 1.00 4.91  ? 115 PRO B CB  1 
ATOM 3497  C CG  . PRO B 1 115 ? 2.670   19.732  -14.705 1.00 4.91  ? 115 PRO B CG  1 
ATOM 3498  C CD  . PRO B 1 115 ? 2.063   20.062  -13.390 1.00 4.91  ? 115 PRO B CD  1 
ATOM 3499  N N   . LEU B 1 116 ? 2.593   15.417  -13.071 1.00 22.10 ? 116 LEU B N   1 
ATOM 3500  C CA  . LEU B 1 116 ? 3.215   14.363  -12.297 1.00 22.10 ? 116 LEU B CA  1 
ATOM 3501  C C   . LEU B 1 116 ? 4.449   13.966  -13.098 1.00 22.10 ? 116 LEU B C   1 
ATOM 3502  O O   . LEU B 1 116 ? 4.349   13.283  -14.123 1.00 22.10 ? 116 LEU B O   1 
ATOM 3503  C CB  . LEU B 1 116 ? 2.290   13.155  -12.133 1.00 11.95 ? 116 LEU B CB  1 
ATOM 3504  C CG  . LEU B 1 116 ? 1.195   13.263  -11.078 1.00 11.95 ? 116 LEU B CG  1 
ATOM 3505  C CD1 . LEU B 1 116 ? 0.616   11.885  -10.846 1.00 11.95 ? 116 LEU B CD1 1 
ATOM 3506  C CD2 . LEU B 1 116 ? 1.755   13.810  -9.777  1.00 11.95 ? 116 LEU B CD2 1 
ATOM 3507  N N   . ALA B 1 117 ? 5.612   14.414  -12.643 1.00 24.61 ? 117 ALA B N   1 
ATOM 3508  C CA  . ALA B 1 117 ? 6.852   14.097  -13.327 1.00 24.61 ? 117 ALA B CA  1 
ATOM 3509  C C   . ALA B 1 117 ? 6.963   12.595  -13.502 1.00 24.61 ? 117 ALA B C   1 
ATOM 3510  O O   . ALA B 1 117 ? 6.652   11.834  -12.582 1.00 24.61 ? 117 ALA B O   1 
ATOM 3511  C CB  . ALA B 1 117 ? 8.025   14.612  -12.521 1.00 47.74 ? 117 ALA B CB  1 
ATOM 3512  N N   . GLY B 1 118 ? 7.385   12.171  -14.688 1.00 19.53 ? 118 GLY B N   1 
ATOM 3513  C CA  . GLY B 1 118 ? 7.568   10.754  -14.945 1.00 19.53 ? 118 GLY B CA  1 
ATOM 3514  C C   . GLY B 1 118 ? 6.375   9.989   -15.469 1.00 19.53 ? 118 GLY B C   1 
ATOM 3515  O O   . GLY B 1 118 ? 6.453   8.768   -15.662 1.00 19.53 ? 118 GLY B O   1 
ATOM 3516  N N   . THR B 1 119 ? 5.273   10.692  -15.705 1.00 26.17 ? 119 THR B N   1 
ATOM 3517  C CA  . THR B 1 119 ? 4.059   10.054  -16.202 1.00 26.17 ? 119 THR B CA  1 
ATOM 3518  C C   . THR B 1 119 ? 3.767   10.527  -17.606 1.00 26.17 ? 119 THR B C   1 
ATOM 3519  O O   . THR B 1 119 ? 4.403   11.460  -18.096 1.00 26.17 ? 119 THR B O   1 
ATOM 3520  C CB  . THR B 1 119 ? 2.836   10.406  -15.345 1.00 28.40 ? 119 THR B CB  1 
ATOM 3521  O OG1 . THR B 1 119 ? 2.558   11.806  -15.477 1.00 28.40 ? 119 THR B OG1 1 
ATOM 3522  C CG2 . THR B 1 119 ? 3.089   10.078  -13.873 1.00 28.40 ? 119 THR B CG2 1 
ATOM 3523  N N   . ASP B 1 120 ? 2.795   9.887   -18.246 1.00 25.44 ? 120 ASP B N   1 
ATOM 3524  C CA  . ASP B 1 120 ? 2.410   10.257  -19.603 1.00 25.44 ? 120 ASP B CA  1 
ATOM 3525  C C   . ASP B 1 120 ? 1.395   11.393  -19.556 1.00 25.44 ? 120 ASP B C   1 
ATOM 3526  O O   . ASP B 1 120 ? 0.202   11.197  -19.793 1.00 25.44 ? 120 ASP B O   1 
ATOM 3527  C CB  . ASP B 1 120 ? 1.812   9.056   -20.333 1.00 43.11 ? 120 ASP B CB  1 
ATOM 3528  C CG  . ASP B 1 120 ? 1.480   9.361   -21.785 1.00 43.11 ? 120 ASP B CG  1 
ATOM 3529  O OD1 . ASP B 1 120 ? 1.004   8.440   -22.483 1.00 43.11 ? 120 ASP B OD1 1 
ATOM 3530  O OD2 . ASP B 1 120 ? 1.689   10.512  -22.236 1.00 43.11 ? 120 ASP B OD2 1 
ATOM 3531  N N   . GLY B 1 121 ? 1.879   12.586  -19.231 1.00 30.42 ? 121 GLY B N   1 
ATOM 3532  C CA  . GLY B 1 121 ? 1.012   13.746  -19.160 1.00 30.42 ? 121 GLY B CA  1 
ATOM 3533  C C   . GLY B 1 121 ? -0.090  13.634  -18.128 1.00 30.42 ? 121 GLY B C   1 
ATOM 3534  O O   . GLY B 1 121 ? -1.190  14.136  -18.330 1.00 30.42 ? 121 GLY B O   1 
ATOM 3535  N N   . GLU B 1 122 ? 0.193   12.969  -17.019 1.00 21.47 ? 122 GLU B N   1 
ATOM 3536  C CA  . GLU B 1 122 ? -0.801  12.829  -15.976 1.00 21.47 ? 122 GLU B CA  1 
ATOM 3537  C C   . GLU B 1 122 ? -0.622  13.928  -14.962 1.00 21.47 ? 122 GLU B C   1 
ATOM 3538  O O   . GLU B 1 122 ? 0.408   14.591  -14.939 1.00 21.47 ? 122 GLU B O   1 
ATOM 3539  C CB  . GLU B 1 122 ? -0.661  11.491  -15.309 1.00 23.41 ? 122 GLU B CB  1 
ATOM 3540  C CG  . GLU B 1 122 ? -0.734  10.383  -16.282 1.00 23.41 ? 122 GLU B CG  1 
ATOM 3541  C CD  . GLU B 1 122 ? -0.842  9.088   -15.568 1.00 23.41 ? 122 GLU B CD  1 
ATOM 3542  O OE1 . GLU B 1 122 ? -1.904  8.874   -14.947 1.00 23.41 ? 122 GLU B OE1 1 
ATOM 3543  O OE2 . GLU B 1 122 ? 0.135   8.303   -15.608 1.00 23.41 ? 122 GLU B OE2 1 
ATOM 3544  N N   . THR B 1 123 ? -1.616  14.110  -14.106 1.00 24.81 ? 123 THR B N   1 
ATOM 3545  C CA  . THR B 1 123 ? -1.541  15.177  -13.129 1.00 24.81 ? 123 THR B CA  1 
ATOM 3546  C C   . THR B 1 123 ? -1.992  14.790  -11.746 1.00 24.81 ? 123 THR B C   1 
ATOM 3547  O O   . THR B 1 123 ? -2.281  13.634  -11.450 1.00 24.81 ? 123 THR B O   1 
ATOM 3548  C CB  . THR B 1 123 ? -2.429  16.353  -13.538 1.00 24.30 ? 123 THR B CB  1 
ATOM 3549  O OG1 . THR B 1 123 ? -3.760  15.873  -13.753 1.00 24.30 ? 123 THR B OG1 1 
ATOM 3550  C CG2 . THR B 1 123 ? -1.928  17.008  -14.798 1.00 24.30 ? 123 THR B CG2 1 
ATOM 3551  N N   . THR B 1 124 ? -2.050  15.815  -10.911 1.00 29.49 ? 124 THR B N   1 
ATOM 3552  C CA  . THR B 1 124 ? -2.508  15.716  -9.544  1.00 29.49 ? 124 THR B CA  1 
ATOM 3553  C C   . THR B 1 124 ? -3.013  17.130  -9.292  1.00 29.49 ? 124 THR B C   1 
ATOM 3554  O O   . THR B 1 124 ? -2.926  17.985  -10.175 1.00 29.49 ? 124 THR B O   1 
ATOM 3555  C CB  . THR B 1 124 ? -1.369  15.358  -8.574  1.00 20.48 ? 124 THR B CB  1 
ATOM 3556  O OG1 . THR B 1 124 ? -1.897  15.207  -7.248  1.00 20.48 ? 124 THR B OG1 1 
ATOM 3557  C CG2 . THR B 1 124 ? -0.312  16.438  -8.577  1.00 20.48 ? 124 THR B CG2 1 
ATOM 3558  N N   . THR B 1 125 ? -3.522  17.393  -8.100  1.00 16.44 ? 125 THR B N   1 
ATOM 3559  C CA  . THR B 1 125 ? -4.072  18.708  -7.823  1.00 16.44 ? 125 THR B CA  1 
ATOM 3560  C C   . THR B 1 125 ? -3.435  19.369  -6.619  1.00 16.44 ? 125 THR B C   1 
ATOM 3561  O O   . THR B 1 125 ? -3.080  18.704  -5.652  1.00 16.44 ? 125 THR B O   1 
ATOM 3562  C CB  . THR B 1 125 ? -5.590  18.603  -7.574  1.00 25.91 ? 125 THR B CB  1 
ATOM 3563  O OG1 . THR B 1 125 ? -6.209  17.939  -8.681  1.00 25.91 ? 125 THR B OG1 1 
ATOM 3564  C CG2 . THR B 1 125 ? -6.201  19.971  -7.400  1.00 25.91 ? 125 THR B CG2 1 
ATOM 3565  N N   . GLN B 1 126 ? -3.294  20.684  -6.676  1.00 19.90 ? 126 GLN B N   1 
ATOM 3566  C CA  . GLN B 1 126 ? -2.731  21.397  -5.553  1.00 19.90 ? 126 GLN B CA  1 
ATOM 3567  C C   . GLN B 1 126 ? -3.783  22.283  -4.914  1.00 19.90 ? 126 GLN B C   1 
ATOM 3568  O O   . GLN B 1 126 ? -4.822  22.540  -5.514  1.00 19.90 ? 126 GLN B O   1 
ATOM 3569  C CB  . GLN B 1 126 ? -1.560  22.239  -6.003  1.00 21.79 ? 126 GLN B CB  1 
ATOM 3570  C CG  . GLN B 1 126 ? -1.827  23.127  -7.171  1.00 21.79 ? 126 GLN B CG  1 
ATOM 3571  C CD  . GLN B 1 126 ? -0.672  24.066  -7.379  1.00 21.79 ? 126 GLN B CD  1 
ATOM 3572  O OE1 . GLN B 1 126 ? 0.472   23.729  -7.065  1.00 21.79 ? 126 GLN B OE1 1 
ATOM 3573  N NE2 . GLN B 1 126 ? -0.950  25.245  -7.910  1.00 21.79 ? 126 GLN B NE2 1 
ATOM 3574  N N   . GLY B 1 127 ? -3.513  22.743  -3.694  1.00 23.26 ? 127 GLY B N   1 
ATOM 3575  C CA  . GLY B 1 127 ? -4.451  23.600  -2.999  1.00 23.26 ? 127 GLY B CA  1 
ATOM 3576  C C   . GLY B 1 127 ? -4.422  23.371  -1.502  1.00 23.26 ? 127 GLY B C   1 
ATOM 3577  O O   . GLY B 1 127 ? -4.997  24.153  -0.734  1.00 23.26 ? 127 GLY B O   1 
ATOM 3578  N N   . LEU B 1 128 ? -3.738  22.310  -1.080  1.00 15.02 ? 128 LEU B N   1 
ATOM 3579  C CA  . LEU B 1 128 ? -3.649  21.967  0.336   1.00 15.02 ? 128 LEU B CA  1 
ATOM 3580  C C   . LEU B 1 128 ? -2.981  23.014  1.226   1.00 15.02 ? 128 LEU B C   1 
ATOM 3581  O O   . LEU B 1 128 ? -3.311  23.122  2.403   1.00 15.02 ? 128 LEU B O   1 
ATOM 3582  C CB  . LEU B 1 128 ? -2.914  20.638  0.516   1.00 8.50  ? 128 LEU B CB  1 
ATOM 3583  C CG  . LEU B 1 128 ? -3.571  19.355  0.014   1.00 8.50  ? 128 LEU B CG  1 
ATOM 3584  C CD1 . LEU B 1 128 ? -2.728  18.165  0.411   1.00 8.50  ? 128 LEU B CD1 1 
ATOM 3585  C CD2 . LEU B 1 128 ? -4.944  19.215  0.619   1.00 8.50  ? 128 LEU B CD2 1 
ATOM 3586  N N   . ASP B 1 129 ? -2.033  23.775  0.691   1.00 19.13 ? 129 ASP B N   1 
ATOM 3587  C CA  . ASP B 1 129 ? -1.362  24.772  1.515   1.00 19.13 ? 129 ASP B CA  1 
ATOM 3588  C C   . ASP B 1 129 ? -2.337  25.822  2.043   1.00 19.13 ? 129 ASP B C   1 
ATOM 3589  O O   . ASP B 1 129 ? -3.026  26.508  1.273   1.00 19.13 ? 129 ASP B O   1 
ATOM 3590  C CB  . ASP B 1 129 ? -0.236  25.448  0.736   1.00 26.31 ? 129 ASP B CB  1 
ATOM 3591  C CG  . ASP B 1 129 ? 0.889   24.490  0.385   1.00 26.31 ? 129 ASP B CG  1 
ATOM 3592  O OD1 . ASP B 1 129 ? 0.977   23.414  1.016   1.00 26.31 ? 129 ASP B OD1 1 
ATOM 3593  O OD2 . ASP B 1 129 ? 1.695   24.823  -0.516  1.00 26.31 ? 129 ASP B OD2 1 
ATOM 3594  N N   . GLY B 1 130 ? -2.398  25.925  3.366   1.00 21.53 ? 130 GLY B N   1 
ATOM 3595  C CA  . GLY B 1 130 ? -3.279  26.883  4.004   1.00 21.53 ? 130 GLY B CA  1 
ATOM 3596  C C   . GLY B 1 130 ? -4.766  26.591  3.889   1.00 21.53 ? 130 GLY B C   1 
ATOM 3597  O O   . GLY B 1 130 ? -5.590  27.393  4.337   1.00 21.53 ? 130 GLY B O   1 
ATOM 3598  N N   . LEU B 1 131 ? -5.124  25.449  3.309   1.00 28.28 ? 131 LEU B N   1 
ATOM 3599  C CA  . LEU B 1 131 ? -6.528  25.100  3.139   1.00 28.28 ? 131 LEU B CA  1 
ATOM 3600  C C   . LEU B 1 131 ? -7.339  25.174  4.427   1.00 28.28 ? 131 LEU B C   1 
ATOM 3601  O O   . LEU B 1 131 ? -8.495  25.594  4.408   1.00 28.28 ? 131 LEU B O   1 
ATOM 3602  C CB  . LEU B 1 131 ? -6.666  23.702  2.542   1.00 21.08 ? 131 LEU B CB  1 
ATOM 3603  C CG  . LEU B 1 131 ? -8.099  23.257  2.247   1.00 21.08 ? 131 LEU B CG  1 
ATOM 3604  C CD1 . LEU B 1 131 ? -8.697  24.122  1.152   1.00 21.08 ? 131 LEU B CD1 1 
ATOM 3605  C CD2 . LEU B 1 131 ? -8.094  21.805  1.821   1.00 21.08 ? 131 LEU B CD2 1 
ATOM 3606  N N   . SER B 1 132 ? -6.752  24.776  5.547   1.00 21.73 ? 132 SER B N   1 
ATOM 3607  C CA  . SER B 1 132 ? -7.497  24.810  6.795   1.00 21.73 ? 132 SER B CA  1 
ATOM 3608  C C   . SER B 1 132 ? -7.935  26.231  7.163   1.00 21.73 ? 132 SER B C   1 
ATOM 3609  O O   . SER B 1 132 ? -9.091  26.453  7.519   1.00 21.73 ? 132 SER B O   1 
ATOM 3610  C CB  . SER B 1 132 ? -6.669  24.206  7.924   1.00 21.83 ? 132 SER B CB  1 
ATOM 3611  O OG  . SER B 1 132 ? -7.505  23.878  9.016   1.00 21.83 ? 132 SER B OG  1 
ATOM 3612  N N   . GLU B 1 133 ? -7.017  27.191  7.071   1.00 30.13 ? 133 GLU B N   1 
ATOM 3613  C CA  . GLU B 1 133 ? -7.326  28.587  7.381   1.00 30.13 ? 133 GLU B CA  1 
ATOM 3614  C C   . GLU B 1 133 ? -8.401  29.071  6.426   1.00 30.13 ? 133 GLU B C   1 
ATOM 3615  O O   . GLU B 1 133 ? -9.352  29.742  6.823   1.00 30.13 ? 133 GLU B O   1 
ATOM 3616  C CB  . GLU B 1 133 ? -6.095  29.477  7.201   1.00 84.38 ? 133 GLU B CB  1 
ATOM 3617  C CG  . GLU B 1 133 ? -4.986  29.253  8.205   1.00 84.38 ? 133 GLU B CG  1 
ATOM 3618  C CD  . GLU B 1 133 ? -4.467  27.823  8.202   1.00 84.38 ? 133 GLU B CD  1 
ATOM 3619  O OE1 . GLU B 1 133 ? -3.954  27.359  7.153   1.00 84.38 ? 133 GLU B OE1 1 
ATOM 3620  O OE2 . GLU B 1 133 ? -4.571  27.158  9.259   1.00 84.38 ? 133 GLU B OE2 1 
ATOM 3621  N N   . ARG B 1 134 ? -8.236  28.724  5.156   1.00 28.09 ? 134 ARG B N   1 
ATOM 3622  C CA  . ARG B 1 134 ? -9.180  29.131  4.134   1.00 28.09 ? 134 ARG B CA  1 
ATOM 3623  C C   . ARG B 1 134 ? -10.569 28.583  4.389   1.00 28.09 ? 134 ARG B C   1 
ATOM 3624  O O   . ARG B 1 134 ? -11.557 29.299  4.232   1.00 28.09 ? 134 ARG B O   1 
ATOM 3625  C CB  . ARG B 1 134 ? -8.695  28.675  2.766   1.00 32.27 ? 134 ARG B CB  1 
ATOM 3626  C CG  . ARG B 1 134 ? -7.405  29.314  2.353   1.00 32.27 ? 134 ARG B CG  1 
ATOM 3627  C CD  . ARG B 1 134 ? -6.896  28.677  1.103   1.00 32.27 ? 134 ARG B CD  1 
ATOM 3628  N NE  . ARG B 1 134 ? -7.879  28.762  0.034   1.00 32.27 ? 134 ARG B NE  1 
ATOM 3629  C CZ  . ARG B 1 134 ? -7.921  27.907  -0.983  1.00 32.27 ? 134 ARG B CZ  1 
ATOM 3630  N NH1 . ARG B 1 134 ? -7.024  26.913  -1.033  1.00 32.27 ? 134 ARG B NH1 1 
ATOM 3631  N NH2 . ARG B 1 134 ? -8.851  28.039  -1.937  1.00 32.27 ? 134 ARG B NH2 1 
ATOM 3632  N N   . CYS B 1 135 ? -10.651 27.312  4.770   1.00 28.15 ? 135 CYS B N   1 
ATOM 3633  C CA  . CYS B 1 135 ? -11.948 26.711  5.033   1.00 28.15 ? 135 CYS B CA  1 
ATOM 3634  C C   . CYS B 1 135 ? -12.596 27.451  6.180   1.00 28.15 ? 135 CYS B C   1 
ATOM 3635  O O   . CYS B 1 135 ? -13.749 27.869  6.094   1.00 28.15 ? 135 CYS B O   1 
ATOM 3636  C CB  . CYS B 1 135 ? -11.800 25.235  5.387   1.00 24.53 ? 135 CYS B CB  1 
ATOM 3637  S SG  . CYS B 1 135 ? -11.471 24.185  3.959   1.00 24.53 ? 135 CYS B SG  1 
ATOM 3638  N N   . ALA B 1 136 ? -11.843 27.621  7.254   1.00 23.07 ? 136 ALA B N   1 
ATOM 3639  C CA  . ALA B 1 136 ? -12.353 28.325  8.411   1.00 23.07 ? 136 ALA B CA  1 
ATOM 3640  C C   . ALA B 1 136 ? -12.981 29.657  7.982   1.00 23.07 ? 136 ALA B C   1 
ATOM 3641  O O   . ALA B 1 136 ? -14.043 30.040  8.476   1.00 23.07 ? 136 ALA B O   1 
ATOM 3642  C CB  . ALA B 1 136 ? -11.232 28.559  9.377   1.00 6.77  ? 136 ALA B CB  1 
ATOM 3643  N N   . GLN B 1 137 ? -12.316 30.347  7.057   1.00 25.71 ? 137 GLN B N   1 
ATOM 3644  C CA  . GLN B 1 137 ? -12.786 31.629  6.544   1.00 25.71 ? 137 GLN B CA  1 
ATOM 3645  C C   . GLN B 1 137 ? -14.053 31.475  5.716   1.00 25.71 ? 137 GLN B C   1 
ATOM 3646  O O   . GLN B 1 137 ? -15.044 32.164  5.936   1.00 25.71 ? 137 GLN B O   1 
ATOM 3647  C CB  . GLN B 1 137 ? -11.713 32.278  5.668   1.00 46.54 ? 137 GLN B CB  1 
ATOM 3648  C CG  . GLN B 1 137 ? -11.116 33.543  6.254   1.00 46.54 ? 137 GLN B CG  1 
ATOM 3649  C CD  . GLN B 1 137 ? -12.177 34.511  6.735   1.00 46.54 ? 137 GLN B CD  1 
ATOM 3650  O OE1 . GLN B 1 137 ? -12.991 35.000  5.951   1.00 46.54 ? 137 GLN B OE1 1 
ATOM 3651  N NE2 . GLN B 1 137 ? -12.181 34.786  8.039   1.00 46.54 ? 137 GLN B NE2 1 
ATOM 3652  N N   . TYR B 1 138 ? -14.001 30.578  4.743   1.00 29.03 ? 138 TYR B N   1 
ATOM 3653  C CA  . TYR B 1 138 ? -15.138 30.332  3.880   1.00 29.03 ? 138 TYR B CA  1 
ATOM 3654  C C   . TYR B 1 138 ? -16.363 29.953  4.694   1.00 29.03 ? 138 TYR B C   1 
ATOM 3655  O O   . TYR B 1 138 ? -17.474 30.380  4.392   1.00 29.03 ? 138 TYR B O   1 
ATOM 3656  C CB  . TYR B 1 138 ? -14.794 29.221  2.900   1.00 25.68 ? 138 TYR B CB  1 
ATOM 3657  C CG  . TYR B 1 138 ? -13.824 29.646  1.830   1.00 25.68 ? 138 TYR B CG  1 
ATOM 3658  C CD1 . TYR B 1 138 ? -12.952 28.728  1.261   1.00 25.68 ? 138 TYR B CD1 1 
ATOM 3659  C CD2 . TYR B 1 138 ? -13.802 30.957  1.357   1.00 25.68 ? 138 TYR B CD2 1 
ATOM 3660  C CE1 . TYR B 1 138 ? -12.081 29.096  0.249   1.00 25.68 ? 138 TYR B CE1 1 
ATOM 3661  C CE2 . TYR B 1 138 ? -12.932 31.337  0.341   1.00 25.68 ? 138 TYR B CE2 1 
ATOM 3662  C CZ  . TYR B 1 138 ? -12.075 30.398  -0.207  1.00 25.68 ? 138 TYR B CZ  1 
ATOM 3663  O OH  . TYR B 1 138 ? -11.195 30.741  -1.210  1.00 25.68 ? 138 TYR B OH  1 
ATOM 3664  N N   . LYS B 1 139 ? -16.164 29.144  5.725   1.00 30.51 ? 139 LYS B N   1 
ATOM 3665  C CA  . LYS B 1 139 ? -17.277 28.737  6.568   1.00 30.51 ? 139 LYS B CA  1 
ATOM 3666  C C   . LYS B 1 139 ? -17.840 30.003  7.181   1.00 30.51 ? 139 LYS B C   1 
ATOM 3667  O O   . LYS B 1 139 ? -19.045 30.245  7.147   1.00 30.51 ? 139 LYS B O   1 
ATOM 3668  C CB  . LYS B 1 139 ? -16.799 27.809  7.682   1.00 17.21 ? 139 LYS B CB  1 
ATOM 3669  C CG  . LYS B 1 139 ? -17.894 27.352  8.629   1.00 17.21 ? 139 LYS B CG  1 
ATOM 3670  C CD  . LYS B 1 139 ? -18.830 26.350  7.978   1.00 17.21 ? 139 LYS B CD  1 
ATOM 3671  C CE  . LYS B 1 139 ? -19.743 25.726  9.034   1.00 17.21 ? 139 LYS B CE  1 
ATOM 3672  N NZ  . LYS B 1 139 ? -20.615 24.600  8.549   1.00 17.21 ? 139 LYS B NZ  1 
ATOM 3673  N N   . LYS B 1 140 ? -16.940 30.812  7.728   1.00 33.22 ? 140 LYS B N   1 
ATOM 3674  C CA  . LYS B 1 140 ? -17.298 32.071  8.367   1.00 33.22 ? 140 LYS B CA  1 
ATOM 3675  C C   . LYS B 1 140 ? -18.027 32.999  7.388   1.00 33.22 ? 140 LYS B C   1 
ATOM 3676  O O   . LYS B 1 140 ? -18.717 33.934  7.793   1.00 33.22 ? 140 LYS B O   1 
ATOM 3677  C CB  . LYS B 1 140 ? -16.029 32.744  8.898   1.00 50.52 ? 140 LYS B CB  1 
ATOM 3678  C CG  . LYS B 1 140 ? -16.242 33.644  10.099  1.00 50.52 ? 140 LYS B CG  1 
ATOM 3679  C CD  . LYS B 1 140 ? -14.917 34.195  10.625  1.00 50.52 ? 140 LYS B CD  1 
ATOM 3680  C CE  . LYS B 1 140 ? -13.979 33.080  11.083  1.00 50.52 ? 140 LYS B CE  1 
ATOM 3681  N NZ  . LYS B 1 140 ? -12.652 33.598  11.530  1.00 50.52 ? 140 LYS B NZ  1 
ATOM 3682  N N   . ASP B 1 141 ? -17.883 32.739  6.095   1.00 24.32 ? 141 ASP B N   1 
ATOM 3683  C CA  . ASP B 1 141 ? -18.545 33.577  5.109   1.00 24.32 ? 141 ASP B CA  1 
ATOM 3684  C C   . ASP B 1 141 ? -19.785 32.937  4.494   1.00 24.32 ? 141 ASP B C   1 
ATOM 3685  O O   . ASP B 1 141 ? -20.309 33.430  3.495   1.00 24.32 ? 141 ASP B O   1 
ATOM 3686  C CB  . ASP B 1 141 ? -17.560 33.991  4.014   1.00 40.23 ? 141 ASP B CB  1 
ATOM 3687  C CG  . ASP B 1 141 ? -16.446 34.877  4.543   1.00 40.23 ? 141 ASP B CG  1 
ATOM 3688  O OD1 . ASP B 1 141 ? -16.679 35.598  5.541   1.00 40.23 ? 141 ASP B OD1 1 
ATOM 3689  O OD2 . ASP B 1 141 ? -15.345 34.865  3.957   1.00 40.23 ? 141 ASP B OD2 1 
ATOM 3690  N N   . GLY B 1 142 ? -20.247 31.834  5.084   1.00 41.56 ? 142 GLY B N   1 
ATOM 3691  C CA  . GLY B 1 142 ? -21.453 31.193  4.589   1.00 41.56 ? 142 GLY B CA  1 
ATOM 3692  C C   . GLY B 1 142 ? -21.356 29.887  3.823   1.00 41.56 ? 142 GLY B C   1 
ATOM 3693  O O   . GLY B 1 142 ? -22.385 29.332  3.417   1.00 41.56 ? 142 GLY B O   1 
ATOM 3694  N N   . ALA B 1 143 ? -20.147 29.387  3.611   1.00 29.06 ? 143 ALA B N   1 
ATOM 3695  C CA  . ALA B 1 143 ? -19.998 28.136  2.881   1.00 29.06 ? 143 ALA B CA  1 
ATOM 3696  C C   . ALA B 1 143 ? -20.128 26.959  3.837   1.00 29.06 ? 143 ALA B C   1 
ATOM 3697  O O   . ALA B 1 143 ? -19.707 27.037  4.997   1.00 29.06 ? 143 ALA B O   1 
ATOM 3698  C CB  . ALA B 1 143 ? -18.658 28.101  2.183   1.00 10.85 ? 143 ALA B CB  1 
ATOM 3699  N N   . ASP B 1 144 ? -20.725 25.872  3.356   1.00 27.02 ? 144 ASP B N   1 
ATOM 3700  C CA  . ASP B 1 144 ? -20.897 24.690  4.187   1.00 27.02 ? 144 ASP B CA  1 
ATOM 3701  C C   . ASP B 1 144 ? -20.357 23.452  3.507   1.00 27.02 ? 144 ASP B C   1 
ATOM 3702  O O   . ASP B 1 144 ? -20.317 22.374  4.097   1.00 27.02 ? 144 ASP B O   1 
ATOM 3703  C CB  . ASP B 1 144 ? -22.366 24.500  4.544   1.00 44.82 ? 144 ASP B CB  1 
ATOM 3704  C CG  . ASP B 1 144 ? -22.885 25.606  5.437   1.00 44.82 ? 144 ASP B CG  1 
ATOM 3705  O OD1 . ASP B 1 144 ? -22.359 25.757  6.564   1.00 44.82 ? 144 ASP B OD1 1 
ATOM 3706  O OD2 . ASP B 1 144 ? -23.812 26.331  5.011   1.00 44.82 ? 144 ASP B OD2 1 
ATOM 3707  N N   . PHE B 1 145 ? -19.945 23.605  2.257   1.00 17.70 ? 145 PHE B N   1 
ATOM 3708  C CA  . PHE B 1 145 ? -19.370 22.487  1.531   1.00 17.70 ? 145 PHE B CA  1 
ATOM 3709  C C   . PHE B 1 145 ? -18.364 23.002  0.509   1.00 17.70 ? 145 PHE B C   1 
ATOM 3710  O O   . PHE B 1 145 ? -18.406 24.172  0.123   1.00 17.70 ? 145 PHE B O   1 
ATOM 3711  C CB  . PHE B 1 145 ? -20.478 21.637  0.885   1.00 26.82 ? 145 PHE B CB  1 
ATOM 3712  C CG  . PHE B 1 145 ? -21.091 22.233  -0.352  1.00 26.82 ? 145 PHE B CG  1 
ATOM 3713  C CD1 . PHE B 1 145 ? -20.705 21.791  -1.614  1.00 26.82 ? 145 PHE B CD1 1 
ATOM 3714  C CD2 . PHE B 1 145 ? -22.079 23.201  -0.260  1.00 26.82 ? 145 PHE B CD2 1 
ATOM 3715  C CE1 . PHE B 1 145 ? -21.294 22.303  -2.765  1.00 26.82 ? 145 PHE B CE1 1 
ATOM 3716  C CE2 . PHE B 1 145 ? -22.672 23.719  -1.403  1.00 26.82 ? 145 PHE B CE2 1 
ATOM 3717  C CZ  . PHE B 1 145 ? -22.278 23.266  -2.660  1.00 26.82 ? 145 PHE B CZ  1 
ATOM 3718  N N   . ALA B 1 146 ? -17.439 22.143  0.094   1.00 24.23 ? 146 ALA B N   1 
ATOM 3719  C CA  . ALA B 1 146 ? -16.418 22.547  -0.863  1.00 24.23 ? 146 ALA B CA  1 
ATOM 3720  C C   . ALA B 1 146 ? -16.245 21.535  -1.985  1.00 24.23 ? 146 ALA B C   1 
ATOM 3721  O O   . ALA B 1 146 ? -16.809 20.441  -1.944  1.00 24.23 ? 146 ALA B O   1 
ATOM 3722  C CB  . ALA B 1 146 ? -15.106 22.743  -0.143  1.00 13.42 ? 146 ALA B CB  1 
ATOM 3723  N N   . LYS B 1 147 ? -15.471 21.917  -2.994  1.00 26.25 ? 147 LYS B N   1 
ATOM 3724  C CA  . LYS B 1 147 ? -15.201 21.038  -4.121  1.00 26.25 ? 147 LYS B CA  1 
ATOM 3725  C C   . LYS B 1 147 ? -13.714 21.090  -4.453  1.00 26.25 ? 147 LYS B C   1 
ATOM 3726  O O   . LYS B 1 147 ? -13.099 22.154  -4.404  1.00 26.25 ? 147 LYS B O   1 
ATOM 3727  C CB  . LYS B 1 147 ? -16.014 21.458  -5.350  1.00 29.72 ? 147 LYS B CB  1 
ATOM 3728  C CG  . LYS B 1 147 ? -15.541 20.803  -6.641  1.00 29.72 ? 147 LYS B CG  1 
ATOM 3729  C CD  . LYS B 1 147 ? -16.235 21.378  -7.857  1.00 29.72 ? 147 LYS B CD  1 
ATOM 3730  C CE  . LYS B 1 147 ? -15.360 21.237  -9.098  1.00 29.72 ? 147 LYS B CE  1 
ATOM 3731  N NZ  . LYS B 1 147 ? -16.126 21.396  -10.383 1.00 29.72 ? 147 LYS B NZ  1 
ATOM 3732  N N   . TRP B 1 148 ? -13.148 19.933  -4.782  1.00 22.94 ? 148 TRP B N   1 
ATOM 3733  C CA  . TRP B 1 148 ? -11.739 19.804  -5.136  1.00 22.94 ? 148 TRP B CA  1 
ATOM 3734  C C   . TRP B 1 148 ? -11.718 18.876  -6.334  1.00 22.94 ? 148 TRP B C   1 
ATOM 3735  O O   . TRP B 1 148 ? -12.205 17.748  -6.250  1.00 22.94 ? 148 TRP B O   1 
ATOM 3736  C CB  . TRP B 1 148 ? -10.968 19.172  -3.972  1.00 24.09 ? 148 TRP B CB  1 
ATOM 3737  C CG  . TRP B 1 148 ? -9.519  18.886  -4.250  1.00 24.09 ? 148 TRP B CG  1 
ATOM 3738  C CD1 . TRP B 1 148 ? -9.010  17.973  -5.130  1.00 24.09 ? 148 TRP B CD1 1 
ATOM 3739  C CD2 . TRP B 1 148 ? -8.394  19.522  -3.637  1.00 24.09 ? 148 TRP B CD2 1 
ATOM 3740  N NE1 . TRP B 1 148 ? -7.638  18.002  -5.103  1.00 24.09 ? 148 TRP B NE1 1 
ATOM 3741  C CE2 . TRP B 1 148 ? -7.235  18.945  -4.193  1.00 24.09 ? 148 TRP B CE2 1 
ATOM 3742  C CE3 . TRP B 1 148 ? -8.254  20.527  -2.671  1.00 24.09 ? 148 TRP B CE3 1 
ATOM 3743  C CZ2 . TRP B 1 148 ? -5.944  19.340  -3.813  1.00 24.09 ? 148 TRP B CZ2 1 
ATOM 3744  C CZ3 . TRP B 1 148 ? -6.964  20.921  -2.291  1.00 24.09 ? 148 TRP B CZ3 1 
ATOM 3745  C CH2 . TRP B 1 148 ? -5.830  20.326  -2.864  1.00 24.09 ? 148 TRP B CH2 1 
ATOM 3746  N N   . ARG B 1 149 ? -11.162 19.318  -7.453  1.00 18.77 ? 149 ARG B N   1 
ATOM 3747  C CA  . ARG B 1 149 ? -11.164 18.442  -8.620  1.00 18.77 ? 149 ARG B CA  1 
ATOM 3748  C C   . ARG B 1 149 ? -9.843  17.817  -9.013  1.00 18.77 ? 149 ARG B C   1 
ATOM 3749  O O   . ARG B 1 149 ? -8.888  18.523  -9.314  1.00 18.77 ? 149 ARG B O   1 
ATOM 3750  C CB  . ARG B 1 149 ? -11.727 19.170  -9.841  1.00 17.39 ? 149 ARG B CB  1 
ATOM 3751  C CG  . ARG B 1 149 ? -11.698 18.322  -11.110 1.00 17.39 ? 149 ARG B CG  1 
ATOM 3752  C CD  . ARG B 1 149 ? -12.489 18.968  -12.233 1.00 17.39 ? 149 ARG B CD  1 
ATOM 3753  N NE  . ARG B 1 149 ? -11.645 19.452  -13.325 1.00 17.39 ? 149 ARG B NE  1 
ATOM 3754  C CZ  . ARG B 1 149 ? -11.547 18.860  -14.514 1.00 17.39 ? 149 ARG B CZ  1 
ATOM 3755  N NH1 . ARG B 1 149 ? -12.239 17.757  -14.767 1.00 17.39 ? 149 ARG B NH1 1 
ATOM 3756  N NH2 . ARG B 1 149 ? -10.769 19.376  -15.461 1.00 17.39 ? 149 ARG B NH2 1 
ATOM 3757  N N   . CYS B 1 150 ? -9.798  16.489  -9.007  1.00 19.13 ? 150 CYS B N   1 
ATOM 3758  C CA  . CYS B 1 150 ? -8.613  15.764  -9.436  1.00 19.13 ? 150 CYS B CA  1 
ATOM 3759  C C   . CYS B 1 150 ? -8.985  15.296  -10.830 1.00 19.13 ? 150 CYS B C   1 
ATOM 3760  O O   . CYS B 1 150 ? -10.163 15.159  -11.140 1.00 19.13 ? 150 CYS B O   1 
ATOM 3761  C CB  . CYS B 1 150 ? -8.344  14.563  -8.540  1.00 29.55 ? 150 CYS B CB  1 
ATOM 3762  S SG  . CYS B 1 150 ? -7.582  14.986  -6.979  1.00 29.55 ? 150 CYS B SG  1 
ATOM 3763  N N   . VAL B 1 151 ? -8.000  15.053  -11.679 1.00 25.06 ? 151 VAL B N   1 
ATOM 3764  C CA  . VAL B 1 151 ? -8.308  14.623  -13.026 1.00 25.06 ? 151 VAL B CA  1 
ATOM 3765  C C   . VAL B 1 151 ? -7.493  13.428  -13.454 1.00 25.06 ? 151 VAL B C   1 
ATOM 3766  O O   . VAL B 1 151 ? -6.268  13.461  -13.417 1.00 25.06 ? 151 VAL B O   1 
ATOM 3767  C CB  . VAL B 1 151 ? -8.052  15.751  -14.031 1.00 2.84  ? 151 VAL B CB  1 
ATOM 3768  C CG1 . VAL B 1 151 ? -8.405  15.291  -15.431 1.00 2.84  ? 151 VAL B CG1 1 
ATOM 3769  C CG2 . VAL B 1 151 ? -8.861  16.958  -13.658 1.00 2.84  ? 151 VAL B CG2 1 
ATOM 3770  N N   . LEU B 1 152 ? -8.174  12.367  -13.857 1.00 16.32 ? 152 LEU B N   1 
ATOM 3771  C CA  . LEU B 1 152 ? -7.497  11.173  -14.334 1.00 16.32 ? 152 LEU B CA  1 
ATOM 3772  C C   . LEU B 1 152 ? -7.809  11.052  -15.829 1.00 16.32 ? 152 LEU B C   1 
ATOM 3773  O O   . LEU B 1 152 ? -8.795  11.609  -16.308 1.00 16.32 ? 152 LEU B O   1 
ATOM 3774  C CB  . LEU B 1 152 ? -7.974  9.948   -13.562 1.00 16.79 ? 152 LEU B CB  1 
ATOM 3775  C CG  . LEU B 1 152 ? -7.669  10.000  -12.061 1.00 16.79 ? 152 LEU B CG  1 
ATOM 3776  C CD1 . LEU B 1 152 ? -7.981  8.659   -11.441 1.00 16.79 ? 152 LEU B CD1 1 
ATOM 3777  C CD2 . LEU B 1 152 ? -6.209  10.322  -11.829 1.00 16.79 ? 152 LEU B CD2 1 
ATOM 3778  N N   . LYS B 1 153 ? -6.971  10.332  -16.566 1.00 20.06 ? 153 LYS B N   1 
ATOM 3779  C CA  . LYS B 1 153 ? -7.140  10.210  -18.011 1.00 20.06 ? 153 LYS B CA  1 
ATOM 3780  C C   . LYS B 1 153 ? -7.054  8.749   -18.437 1.00 20.06 ? 153 LYS B C   1 
ATOM 3781  O O   . LYS B 1 153 ? -6.311  7.983   -17.833 1.00 20.06 ? 153 LYS B O   1 
ATOM 3782  C CB  . LYS B 1 153 ? -6.028  11.019  -18.682 1.00 45.75 ? 153 LYS B CB  1 
ATOM 3783  C CG  . LYS B 1 153 ? -6.046  11.035  -20.186 1.00 45.75 ? 153 LYS B CG  1 
ATOM 3784  C CD  . LYS B 1 153 ? -4.638  10.789  -20.755 1.00 45.75 ? 153 LYS B CD  1 
ATOM 3785  C CE  . LYS B 1 153 ? -3.598  11.804  -20.270 1.00 45.75 ? 153 LYS B CE  1 
ATOM 3786  N NZ  . LYS B 1 153 ? -2.299  11.625  -20.984 1.00 45.75 ? 153 LYS B NZ  1 
ATOM 3787  N N   . ILE B 1 154 ? -7.811  8.349   -19.458 1.00 31.12 ? 154 ILE B N   1 
ATOM 3788  C CA  . ILE B 1 154 ? -7.743  6.960   -19.909 1.00 31.12 ? 154 ILE B CA  1 
ATOM 3789  C C   . ILE B 1 154 ? -7.046  6.843   -21.261 1.00 31.12 ? 154 ILE B C   1 
ATOM 3790  O O   . ILE B 1 154 ? -7.435  7.502   -22.227 1.00 31.12 ? 154 ILE B O   1 
ATOM 3791  C CB  . ILE B 1 154 ? -9.127  6.312   -20.042 1.00 18.26 ? 154 ILE B CB  1 
ATOM 3792  C CG1 . ILE B 1 154 ? -9.856  6.358   -18.703 1.00 18.26 ? 154 ILE B CG1 1 
ATOM 3793  C CG2 . ILE B 1 154 ? -8.971  4.861   -20.489 1.00 18.26 ? 154 ILE B CG2 1 
ATOM 3794  C CD1 . ILE B 1 154 ? -11.205 5.708   -18.731 1.00 18.26 ? 154 ILE B CD1 1 
ATOM 3795  N N   . SER B 1 155 ? -6.017  5.997   -21.309 1.00 29.04 ? 155 SER B N   1 
ATOM 3796  C CA  . SER B 1 155 ? -5.225  5.746   -22.514 1.00 29.04 ? 155 SER B CA  1 
ATOM 3797  C C   . SER B 1 155 ? -4.590  4.359   -22.356 1.00 29.04 ? 155 SER B C   1 
ATOM 3798  O O   . SER B 1 155 ? -4.872  3.661   -21.372 1.00 29.04 ? 155 SER B O   1 
ATOM 3799  C CB  . SER B 1 155 ? -4.135  6.801   -22.672 1.00 29.85 ? 155 SER B CB  1 
ATOM 3800  O OG  . SER B 1 155 ? -2.947  6.373   -22.035 1.00 29.85 ? 155 SER B OG  1 
ATOM 3801  N N   . GLU B 1 156 ? -3.740  3.959   -23.306 1.00 42.49 ? 156 GLU B N   1 
ATOM 3802  C CA  . GLU B 1 156 ? -3.119  2.635   -23.246 1.00 42.49 ? 156 GLU B CA  1 
ATOM 3803  C C   . GLU B 1 156 ? -2.506  2.376   -21.883 1.00 42.49 ? 156 GLU B C   1 
ATOM 3804  O O   . GLU B 1 156 ? -2.463  1.239   -21.406 1.00 42.49 ? 156 GLU B O   1 
ATOM 3805  C CB  . GLU B 1 156 ? -2.031  2.471   -24.305 1.00 99.51 ? 156 GLU B CB  1 
ATOM 3806  C CG  . GLU B 1 156 ? -1.434  1.064   -24.301 1.00 99.51 ? 156 GLU B CG  1 
ATOM 3807  C CD  . GLU B 1 156 ? -0.040  0.996   -24.910 1.00 99.51 ? 156 GLU B CD  1 
ATOM 3808  O OE1 . GLU B 1 156 ? 0.106   1.313   -26.112 1.00 99.51 ? 156 GLU B OE1 1 
ATOM 3809  O OE2 . GLU B 1 156 ? 0.912   0.622   -24.182 1.00 99.51 ? 156 GLU B OE2 1 
ATOM 3810  N N   . ARG B 1 157 ? -2.038  3.434   -21.243 1.00 49.20 ? 157 ARG B N   1 
ATOM 3811  C CA  . ARG B 1 157 ? -1.426  3.268   -19.941 1.00 49.20 ? 157 ARG B CA  1 
ATOM 3812  C C   . ARG B 1 157 ? -1.464  4.574   -19.172 1.00 49.20 ? 157 ARG B C   1 
ATOM 3813  O O   . ARG B 1 157 ? -0.421  5.122   -18.843 1.00 49.20 ? 157 ARG B O   1 
ATOM 3814  C CB  . ARG B 1 157 ? 0.010   2.810   -20.149 1.00 81.54 ? 157 ARG B CB  1 
ATOM 3815  C CG  . ARG B 1 157 ? 0.788   3.674   -21.136 1.00 81.54 ? 157 ARG B CG  1 
ATOM 3816  C CD  . ARG B 1 157 ? 1.868   2.855   -21.827 1.00 81.54 ? 157 ARG B CD  1 
ATOM 3817  N NE  . ARG B 1 157 ? 2.416   1.824   -20.944 1.00 81.54 ? 157 ARG B NE  1 
ATOM 3818  C CZ  . ARG B 1 157 ? 3.414   1.008   -21.270 1.00 81.54 ? 157 ARG B CZ  1 
ATOM 3819  N NH1 . ARG B 1 157 ? 3.982   1.110   -22.464 1.00 81.54 ? 157 ARG B NH1 1 
ATOM 3820  N NH2 . ARG B 1 157 ? 3.825   0.074   -20.415 1.00 81.54 ? 157 ARG B NH2 1 
ATOM 3821  N N   . THR B 1 158 ? -2.656  5.071   -18.863 1.00 79.06 ? 158 THR B N   1 
ATOM 3822  C CA  . THR B 1 158 ? -2.726  6.341   -18.169 1.00 79.06 ? 158 THR B CA  1 
ATOM 3823  C C   . THR B 1 158 ? -3.103  6.369   -16.716 1.00 79.06 ? 158 THR B C   1 
ATOM 3824  O O   . THR B 1 158 ? -2.315  6.831   -15.899 1.00 79.06 ? 158 THR B O   1 
ATOM 3825  C CB  . THR B 1 158 ? -3.662  7.281   -18.842 1.00 56.82 ? 158 THR B CB  1 
ATOM 3826  O OG1 . THR B 1 158 ? -4.761  6.526   -19.353 1.00 56.82 ? 158 THR B OG1 1 
ATOM 3827  C CG2 . THR B 1 158 ? -2.947  8.060   -19.922 1.00 56.82 ? 158 THR B CG2 1 
ATOM 3828  N N   . PRO B 1 159 ? -4.316  5.919   -16.357 1.00 42.63 ? 159 PRO B N   1 
ATOM 3829  C CA  . PRO B 1 159 ? -4.530  6.020   -14.907 1.00 42.63 ? 159 PRO B CA  1 
ATOM 3830  C C   . PRO B 1 159 ? -3.495  5.079   -14.305 1.00 42.63 ? 159 PRO B C   1 
ATOM 3831  O O   . PRO B 1 159 ? -3.759  3.895   -14.108 1.00 42.63 ? 159 PRO B O   1 
ATOM 3832  C CB  . PRO B 1 159 ? -5.968  5.541   -14.721 1.00 12.08 ? 159 PRO B CB  1 
ATOM 3833  C CG  . PRO B 1 159 ? -6.545  5.541   -16.132 1.00 12.08 ? 159 PRO B CG  1 
ATOM 3834  C CD  . PRO B 1 159 ? -5.382  5.149   -17.003 1.00 12.08 ? 159 PRO B CD  1 
ATOM 3835  N N   . SER B 1 160 ? -2.302  5.622   -14.063 1.00 25.27 ? 160 SER B N   1 
ATOM 3836  C CA  . SER B 1 160 ? -1.165  4.879   -13.539 1.00 25.27 ? 160 SER B CA  1 
ATOM 3837  C C   . SER B 1 160 ? -1.186  4.759   -12.033 1.00 25.27 ? 160 SER B C   1 
ATOM 3838  O O   . SER B 1 160 ? -1.741  5.616   -11.331 1.00 25.27 ? 160 SER B O   1 
ATOM 3839  C CB  . SER B 1 160 ? 0.140   5.550   -13.968 1.00 15.03 ? 160 SER B CB  1 
ATOM 3840  O OG  . SER B 1 160 ? 0.217   6.877   -13.473 1.00 15.03 ? 160 SER B OG  1 
ATOM 3841  N N   . ALA B 1 161 ? -0.567  3.696   -11.537 1.00 23.42 ? 161 ALA B N   1 
ATOM 3842  C CA  . ALA B 1 161 ? -0.526  3.469   -10.108 1.00 23.42 ? 161 ALA B CA  1 
ATOM 3843  C C   . ALA B 1 161 ? -0.246  4.789   -9.411  1.00 23.42 ? 161 ALA B C   1 
ATOM 3844  O O   . ALA B 1 161 ? -0.937  5.152   -8.463  1.00 23.42 ? 161 ALA B O   1 
ATOM 3845  C CB  . ALA B 1 161 ? 0.537   2.461   -9.774  1.00 4.56  ? 161 ALA B CB  1 
ATOM 3846  N N   . LEU B 1 162 ? 0.745   5.522   -9.903  1.00 18.29 ? 162 LEU B N   1 
ATOM 3847  C CA  . LEU B 1 162 ? 1.085   6.794   -9.294  1.00 18.29 ? 162 LEU B CA  1 
ATOM 3848  C C   . LEU B 1 162 ? -0.090  7.757   -9.318  1.00 18.29 ? 162 LEU B C   1 
ATOM 3849  O O   . LEU B 1 162 ? -0.498  8.273   -8.276  1.00 18.29 ? 162 LEU B O   1 
ATOM 3850  C CB  . LEU B 1 162 ? 2.275   7.421   -10.007 1.00 17.25 ? 162 LEU B CB  1 
ATOM 3851  C CG  . LEU B 1 162 ? 2.733   8.760   -9.423  1.00 17.25 ? 162 LEU B CG  1 
ATOM 3852  C CD1 . LEU B 1 162 ? 3.013   8.630   -7.928  1.00 17.25 ? 162 LEU B CD1 1 
ATOM 3853  C CD2 . LEU B 1 162 ? 3.975   9.209   -10.160 1.00 17.25 ? 162 LEU B CD2 1 
ATOM 3854  N N   . ALA B 1 163 ? -0.638  7.996   -10.504 1.00 23.43 ? 163 ALA B N   1 
ATOM 3855  C CA  . ALA B 1 163 ? -1.772  8.907   -10.650 1.00 23.43 ? 163 ALA B CA  1 
ATOM 3856  C C   . ALA B 1 163 ? -2.953  8.523   -9.757  1.00 23.43 ? 163 ALA B C   1 
ATOM 3857  O O   . ALA B 1 163 ? -3.627  9.382   -9.187  1.00 23.43 ? 163 ALA B O   1 
ATOM 3858  C CB  . ALA B 1 163 ? -2.210  8.941   -12.082 1.00 10.77 ? 163 ALA B CB  1 
ATOM 3859  N N   . ILE B 1 164 ? -3.216  7.230   -9.641  1.00 10.70 ? 164 ILE B N   1 
ATOM 3860  C CA  . ILE B 1 164 ? -4.308  6.792   -8.804  1.00 10.70 ? 164 ILE B CA  1 
ATOM 3861  C C   . ILE B 1 164 ? -3.910  6.954   -7.338  1.00 10.70 ? 164 ILE B C   1 
ATOM 3862  O O   . ILE B 1 164 ? -4.690  7.478   -6.550  1.00 10.70 ? 164 ILE B O   1 
ATOM 3863  C CB  . ILE B 1 164 ? -4.669  5.335   -9.096  1.00 6.16  ? 164 ILE B CB  1 
ATOM 3864  C CG1 . ILE B 1 164 ? -5.122  5.211   -10.547 1.00 6.16  ? 164 ILE B CG1 1 
ATOM 3865  C CG2 . ILE B 1 164 ? -5.769  4.876   -8.159  1.00 6.16  ? 164 ILE B CG2 1 
ATOM 3866  C CD1 . ILE B 1 164 ? -5.495  3.828   -10.936 1.00 6.16  ? 164 ILE B CD1 1 
ATOM 3867  N N   . LEU B 1 165 ? -2.702  6.508   -6.988  1.00 20.43 ? 165 LEU B N   1 
ATOM 3868  C CA  . LEU B 1 165 ? -2.162  6.606   -5.626  1.00 20.43 ? 165 LEU B CA  1 
ATOM 3869  C C   . LEU B 1 165 ? -2.277  8.055   -5.173  1.00 20.43 ? 165 LEU B C   1 
ATOM 3870  O O   . LEU B 1 165 ? -2.995  8.356   -4.221  1.00 20.43 ? 165 LEU B O   1 
ATOM 3871  C CB  . LEU B 1 165 ? -0.693  6.164   -5.619  1.00 54.82 ? 165 LEU B CB  1 
ATOM 3872  C CG  . LEU B 1 165 ? 0.233   6.353   -4.405  1.00 54.82 ? 165 LEU B CG  1 
ATOM 3873  C CD1 . LEU B 1 165 ? 1.514   5.578   -4.655  1.00 54.82 ? 165 LEU B CD1 1 
ATOM 3874  C CD2 . LEU B 1 165 ? 0.565   7.823   -4.172  1.00 54.82 ? 165 LEU B CD2 1 
ATOM 3875  N N   . GLU B 1 166 ? -1.547  8.948   -5.841  1.00 39.03 ? 166 GLU B N   1 
ATOM 3876  C CA  . GLU B 1 166 ? -1.616  10.374  -5.541  1.00 39.03 ? 166 GLU B CA  1 
ATOM 3877  C C   . GLU B 1 166 ? -3.022  10.647  -6.034  1.00 39.03 ? 166 GLU B C   1 
ATOM 3878  O O   . GLU B 1 166 ? -3.618  9.773   -6.660  1.00 39.03 ? 166 GLU B O   1 
ATOM 3879  C CB  . GLU B 1 166 ? -0.599  11.136  -6.389  1.00 34.23 ? 166 GLU B CB  1 
ATOM 3880  C CG  . GLU B 1 166 ? -0.641  12.645  -6.243  1.00 34.23 ? 166 GLU B CG  1 
ATOM 3881  C CD  . GLU B 1 166 ? -0.109  13.119  -4.909  1.00 34.23 ? 166 GLU B CD  1 
ATOM 3882  O OE1 . GLU B 1 166 ? 0.345   12.262  -4.124  1.00 34.23 ? 166 GLU B OE1 1 
ATOM 3883  O OE2 . GLU B 1 166 ? -0.136  14.345  -4.645  1.00 34.23 ? 166 GLU B OE2 1 
ATOM 3884  N N   . ASN B 1 167 ? -3.565  11.830  -5.794  1.00 28.01 ? 167 ASN B N   1 
ATOM 3885  C CA  . ASN B 1 167 ? -4.942  12.113  -6.235  1.00 28.01 ? 167 ASN B CA  1 
ATOM 3886  C C   . ASN B 1 167 ? -5.866  11.481  -5.204  1.00 28.01 ? 167 ASN B C   1 
ATOM 3887  O O   . ASN B 1 167 ? -6.539  12.181  -4.449  1.00 28.01 ? 167 ASN B O   1 
ATOM 3888  C CB  . ASN B 1 167 ? -5.255  11.516  -7.624  1.00 15.34 ? 167 ASN B CB  1 
ATOM 3889  C CG  . ASN B 1 167 ? -4.814  12.419  -8.785  1.00 15.34 ? 167 ASN B CG  1 
ATOM 3890  O OD1 . ASN B 1 167 ? -5.241  13.578  -8.905  1.00 15.34 ? 167 ASN B OD1 1 
ATOM 3891  N ND2 . ASN B 1 167 ? -3.973  11.880  -9.656  1.00 15.34 ? 167 ASN B ND2 1 
ATOM 3892  N N   . ALA B 1 168 ? -5.906  10.157  -5.167  1.00 14.10 ? 168 ALA B N   1 
ATOM 3893  C CA  . ALA B 1 168 ? -6.738  9.498   -4.178  1.00 14.10 ? 168 ALA B CA  1 
ATOM 3894  C C   . ALA B 1 168 ? -6.282  10.025  -2.826  1.00 14.10 ? 168 ALA B C   1 
ATOM 3895  O O   . ALA B 1 168 ? -7.097  10.322  -1.944  1.00 14.10 ? 168 ALA B O   1 
ATOM 3896  C CB  . ALA B 1 168 ? -6.555  7.991   -4.230  1.00 2.04  ? 168 ALA B CB  1 
ATOM 3897  N N   . ASN B 1 169 ? -4.968  10.159  -2.675  1.00 26.37 ? 169 ASN B N   1 
ATOM 3898  C CA  . ASN B 1 169 ? -4.411  10.636  -1.425  1.00 26.37 ? 169 ASN B CA  1 
ATOM 3899  C C   . ASN B 1 169 ? -4.707  12.112  -1.228  1.00 26.37 ? 169 ASN B C   1 
ATOM 3900  O O   . ASN B 1 169 ? -5.094  12.524  -0.138  1.00 26.37 ? 169 ASN B O   1 
ATOM 3901  C CB  . ASN B 1 169 ? -2.909  10.400  -1.394  1.00 29.61 ? 169 ASN B CB  1 
ATOM 3902  C CG  . ASN B 1 169 ? -2.341  10.478  0.011   1.00 29.61 ? 169 ASN B CG  1 
ATOM 3903  O OD1 . ASN B 1 169 ? -2.687  9.669   0.878   1.00 29.61 ? 169 ASN B OD1 1 
ATOM 3904  N ND2 . ASN B 1 169 ? -1.465  11.454  0.248   1.00 29.61 ? 169 ASN B ND2 1 
ATOM 3905  N N   . VAL B 1 170 ? -4.537  12.912  -2.278  1.00 23.60 ? 170 VAL B N   1 
ATOM 3906  C CA  . VAL B 1 170 ? -4.796  14.347  -2.164  1.00 23.60 ? 170 VAL B CA  1 
ATOM 3907  C C   . VAL B 1 170 ? -6.235  14.586  -1.776  1.00 23.60 ? 170 VAL B C   1 
ATOM 3908  O O   . VAL B 1 170 ? -6.525  15.407  -0.909  1.00 23.60 ? 170 VAL B O   1 
ATOM 3909  C CB  . VAL B 1 170 ? -4.561  15.087  -3.473  1.00 27.13 ? 170 VAL B CB  1 
ATOM 3910  C CG1 . VAL B 1 170 ? -4.334  16.550  -3.190  1.00 27.13 ? 170 VAL B CG1 1 
ATOM 3911  C CG2 . VAL B 1 170 ? -3.386  14.493  -4.196  1.00 27.13 ? 170 VAL B CG2 1 
ATOM 3912  N N   . LEU B 1 171 ? -7.141  13.879  -2.437  1.00 22.57 ? 171 LEU B N   1 
ATOM 3913  C CA  . LEU B 1 171 ? -8.548  14.023  -2.133  1.00 22.57 ? 171 LEU B CA  1 
ATOM 3914  C C   . LEU B 1 171 ? -8.748  13.778  -0.643  1.00 22.57 ? 171 LEU B C   1 
ATOM 3915  O O   . LEU B 1 171 ? -9.356  14.594  0.052   1.00 22.57 ? 171 LEU B O   1 
ATOM 3916  C CB  . LEU B 1 171 ? -9.378  13.030  -2.949  1.00 13.97 ? 171 LEU B CB  1 
ATOM 3917  C CG  . LEU B 1 171 ? -9.522  13.328  -4.443  1.00 13.97 ? 171 LEU B CG  1 
ATOM 3918  C CD1 . LEU B 1 171 ? -10.246 12.188  -5.144  1.00 13.97 ? 171 LEU B CD1 1 
ATOM 3919  C CD2 . LEU B 1 171 ? -10.278 14.618  -4.624  1.00 13.97 ? 171 LEU B CD2 1 
ATOM 3920  N N   . ALA B 1 172 ? -8.215  12.665  -0.150  1.00 16.49 ? 172 ALA B N   1 
ATOM 3921  C CA  . ALA B 1 172 ? -8.354  12.321  1.260   1.00 16.49 ? 172 ALA B CA  1 
ATOM 3922  C C   . ALA B 1 172 ? -7.840  13.434  2.161   1.00 16.49 ? 172 ALA B C   1 
ATOM 3923  O O   . ALA B 1 172 ? -8.462  13.748  3.167   1.00 16.49 ? 172 ALA B O   1 
ATOM 3924  C CB  . ALA B 1 172 ? -7.625  11.019  1.558   1.00 23.46 ? 172 ALA B CB  1 
ATOM 3925  N N   . ARG B 1 173 ? -6.704  14.026  1.807   1.00 20.64 ? 173 ARG B N   1 
ATOM 3926  C CA  . ARG B 1 173 ? -6.147  15.116  2.609   1.00 20.64 ? 173 ARG B CA  1 
ATOM 3927  C C   . ARG B 1 173 ? -7.140  16.263  2.642   1.00 20.64 ? 173 ARG B C   1 
ATOM 3928  O O   . ARG B 1 173 ? -7.555  16.703  3.714   1.00 20.64 ? 173 ARG B O   1 
ATOM 3929  C CB  . ARG B 1 173 ? -4.812  15.604  2.027   1.00 22.08 ? 173 ARG B CB  1 
ATOM 3930  C CG  . ARG B 1 173 ? -3.597  14.788  2.479   1.00 22.08 ? 173 ARG B CG  1 
ATOM 3931  C CD  . ARG B 1 173 ? -2.743  15.548  3.483   1.00 22.08 ? 173 ARG B CD  1 
ATOM 3932  N NE  . ARG B 1 173 ? -3.458  15.846  4.716   1.00 22.08 ? 173 ARG B NE  1 
ATOM 3933  C CZ  . ARG B 1 173 ? -3.224  16.930  5.449   1.00 22.08 ? 173 ARG B CZ  1 
ATOM 3934  N NH1 . ARG B 1 173 ? -2.298  17.803  5.059   1.00 22.08 ? 173 ARG B NH1 1 
ATOM 3935  N NH2 . ARG B 1 173 ? -3.916  17.153  6.564   1.00 22.08 ? 173 ARG B NH2 1 
ATOM 3936  N N   . TYR B 1 174 ? -7.510  16.737  1.456   1.00 23.08 ? 174 TYR B N   1 
ATOM 3937  C CA  . TYR B 1 174 ? -8.469  17.822  1.300   1.00 23.08 ? 174 TYR B CA  1 
ATOM 3938  C C   . TYR B 1 174 ? -9.737  17.549  2.115   1.00 23.08 ? 174 TYR B C   1 
ATOM 3939  O O   . TYR B 1 174 ? -10.178 18.396  2.897   1.00 23.08 ? 174 TYR B O   1 
ATOM 3940  C CB  . TYR B 1 174 ? -8.795  17.977  -0.185  1.00 24.34 ? 174 TYR B CB  1 
ATOM 3941  C CG  . TYR B 1 174 ? -10.237 18.292  -0.511  1.00 24.34 ? 174 TYR B CG  1 
ATOM 3942  C CD1 . TYR B 1 174 ? -10.765 19.568  -0.316  1.00 24.34 ? 174 TYR B CD1 1 
ATOM 3943  C CD2 . TYR B 1 174 ? -11.065 17.315  -1.062  1.00 24.34 ? 174 TYR B CD2 1 
ATOM 3944  C CE1 . TYR B 1 174 ? -12.089 19.863  -0.676  1.00 24.34 ? 174 TYR B CE1 1 
ATOM 3945  C CE2 . TYR B 1 174 ? -12.383 17.598  -1.419  1.00 24.34 ? 174 TYR B CE2 1 
ATOM 3946  C CZ  . TYR B 1 174 ? -12.884 18.869  -1.229  1.00 24.34 ? 174 TYR B CZ  1 
ATOM 3947  O OH  . TYR B 1 174 ? -14.167 19.143  -1.633  1.00 24.34 ? 174 TYR B OH  1 
ATOM 3948  N N   . ALA B 1 175 ? -10.310 16.360  1.937   1.00 19.01 ? 175 ALA B N   1 
ATOM 3949  C CA  . ALA B 1 175 ? -11.523 15.976  2.652   1.00 19.01 ? 175 ALA B CA  1 
ATOM 3950  C C   . ALA B 1 175 ? -11.327 16.090  4.157   1.00 19.01 ? 175 ALA B C   1 
ATOM 3951  O O   . ALA B 1 175 ? -12.132 16.711  4.851   1.00 19.01 ? 175 ALA B O   1 
ATOM 3952  C CB  . ALA B 1 175 ? -11.915 14.552  2.290   1.00 9.96  ? 175 ALA B CB  1 
ATOM 3953  N N   . SER B 1 176 ? -10.252 15.487  4.656   1.00 19.30 ? 176 SER B N   1 
ATOM 3954  C CA  . SER B 1 176 ? -9.945  15.515  6.082   1.00 19.30 ? 176 SER B CA  1 
ATOM 3955  C C   . SER B 1 176 ? -9.921  16.940  6.629   1.00 19.30 ? 176 SER B C   1 
ATOM 3956  O O   . SER B 1 176 ? -10.528 17.221  7.667   1.00 19.30 ? 176 SER B O   1 
ATOM 3957  C CB  . SER B 1 176 ? -8.596  14.849  6.342   1.00 21.53 ? 176 SER B CB  1 
ATOM 3958  O OG  . SER B 1 176 ? -8.347  14.729  7.731   1.00 21.53 ? 176 SER B OG  1 
ATOM 3959  N N   . ILE B 1 177 ? -9.230  17.833  5.922   1.00 17.76 ? 177 ILE B N   1 
ATOM 3960  C CA  . ILE B 1 177 ? -9.105  19.230  6.334   1.00 17.76 ? 177 ILE B CA  1 
ATOM 3961  C C   . ILE B 1 177 ? -10.433 19.966  6.346   1.00 17.76 ? 177 ILE B C   1 
ATOM 3962  O O   . ILE B 1 177 ? -10.702 20.749  7.257   1.00 17.76 ? 177 ILE B O   1 
ATOM 3963  C CB  . ILE B 1 177 ? -8.134  20.000  5.417   1.00 14.75 ? 177 ILE B CB  1 
ATOM 3964  C CG1 . ILE B 1 177 ? -6.764  19.325  5.442   1.00 14.75 ? 177 ILE B CG1 1 
ATOM 3965  C CG2 . ILE B 1 177 ? -8.018  21.460  5.869   1.00 14.75 ? 177 ILE B CG2 1 
ATOM 3966  C CD1 . ILE B 1 177 ? -5.815  19.858  4.413   1.00 14.75 ? 177 ILE B CD1 1 
ATOM 3967  N N   . CYS B 1 178 ? -11.257 19.734  5.330   1.00 22.39 ? 178 CYS B N   1 
ATOM 3968  C CA  . CYS B 1 178 ? -12.559 20.383  5.266   1.00 22.39 ? 178 CYS B CA  1 
ATOM 3969  C C   . CYS B 1 178 ? -13.404 20.012  6.479   1.00 22.39 ? 178 CYS B C   1 
ATOM 3970  O O   . CYS B 1 178 ? -13.959 20.875  7.158   1.00 22.39 ? 178 CYS B O   1 
ATOM 3971  C CB  . CYS B 1 178 ? -13.315 19.960  4.011   1.00 28.19 ? 178 CYS B CB  1 
ATOM 3972  S SG  . CYS B 1 178 ? -12.720 20.679  2.497   1.00 28.19 ? 178 CYS B SG  1 
ATOM 3973  N N   . GLN B 1 179 ? -13.500 18.719  6.752   1.00 18.40 ? 179 GLN B N   1 
ATOM 3974  C CA  . GLN B 1 179 ? -14.321 18.275  7.857   1.00 18.40 ? 179 GLN B CA  1 
ATOM 3975  C C   . GLN B 1 179 ? -13.910 18.824  9.213   1.00 18.40 ? 179 GLN B C   1 
ATOM 3976  O O   . GLN B 1 179 ? -14.774 19.113  10.042  1.00 18.40 ? 179 GLN B O   1 
ATOM 3977  C CB  . GLN B 1 179 ? -14.377 16.751  7.899   1.00 18.89 ? 179 GLN B CB  1 
ATOM 3978  C CG  . GLN B 1 179 ? -14.965 16.152  6.645   1.00 18.89 ? 179 GLN B CG  1 
ATOM 3979  C CD  . GLN B 1 179 ? -15.381 14.714  6.843   1.00 18.89 ? 179 GLN B CD  1 
ATOM 3980  O OE1 . GLN B 1 179 ? -14.657 13.928  7.450   1.00 18.89 ? 179 GLN B OE1 1 
ATOM 3981  N NE2 . GLN B 1 179 ? -16.553 14.358  6.325   1.00 18.89 ? 179 GLN B NE2 1 
ATOM 3982  N N   . GLN B 1 180 ? -12.615 18.979  9.468   1.00 40.28 ? 180 GLN B N   1 
ATOM 3983  C CA  . GLN B 1 180 ? -12.237 19.496  10.770  1.00 40.28 ? 180 GLN B CA  1 
ATOM 3984  C C   . GLN B 1 180 ? -12.597 20.990  10.854  1.00 40.28 ? 180 GLN B C   1 
ATOM 3985  O O   . GLN B 1 180 ? -12.461 21.615  11.901  1.00 40.28 ? 180 GLN B O   1 
ATOM 3986  C CB  . GLN B 1 180 ? -10.758 19.233  11.055  1.00 99.51 ? 180 GLN B CB  1 
ATOM 3987  C CG  . GLN B 1 180 ? -9.805  19.942  10.129  1.00 99.51 ? 180 GLN B CG  1 
ATOM 3988  C CD  . GLN B 1 180 ? -8.359  19.839  10.603  1.00 99.51 ? 180 GLN B CD  1 
ATOM 3989  O OE1 . GLN B 1 180 ? -7.453  20.490  10.057  1.00 99.51 ? 180 GLN B OE1 1 
ATOM 3990  N NE2 . GLN B 1 180 ? -8.136  19.013  11.630  1.00 99.51 ? 180 GLN B NE2 1 
ATOM 3991  N N   . ASN B 1 181 ? -13.100 21.541  9.751   1.00 22.93 ? 181 ASN B N   1 
ATOM 3992  C CA  . ASN B 1 181 ? -13.526 22.950  9.683   1.00 22.93 ? 181 ASN B CA  1 
ATOM 3993  C C   . ASN B 1 181 ? -15.039 23.082  9.435   1.00 22.93 ? 181 ASN B C   1 
ATOM 3994  O O   . ASN B 1 181 ? -15.520 24.122  8.967   1.00 22.93 ? 181 ASN B O   1 
ATOM 3995  C CB  . ASN B 1 181 ? -12.783 23.684  8.566   1.00 32.83 ? 181 ASN B CB  1 
ATOM 3996  C CG  . ASN B 1 181 ? -11.442 24.198  9.009   1.00 32.83 ? 181 ASN B CG  1 
ATOM 3997  O OD1 . ASN B 1 181 ? -11.362 25.123  9.817   1.00 32.83 ? 181 ASN B OD1 1 
ATOM 3998  N ND2 . ASN B 1 181 ? -10.373 23.597  8.492   1.00 32.83 ? 181 ASN B ND2 1 
ATOM 3999  N N   . GLY B 1 182 ? -15.777 22.019  9.742   1.00 31.22 ? 182 GLY B N   1 
ATOM 4000  C CA  . GLY B 1 182 ? -17.214 22.031  9.557   1.00 31.22 ? 182 GLY B CA  1 
ATOM 4001  C C   . GLY B 1 182 ? -17.667 22.235  8.123   1.00 31.22 ? 182 GLY B C   1 
ATOM 4002  O O   . GLY B 1 182 ? -18.710 22.842  7.881   1.00 31.22 ? 182 GLY B O   1 
ATOM 4003  N N   . ILE B 1 183 ? -16.899 21.726  7.167   1.00 26.53 ? 183 ILE B N   1 
ATOM 4004  C CA  . ILE B 1 183 ? -17.262 21.867  5.766   1.00 26.53 ? 183 ILE B CA  1 
ATOM 4005  C C   . ILE B 1 183 ? -17.327 20.533  5.046   1.00 26.53 ? 183 ILE B C   1 
ATOM 4006  O O   . ILE B 1 183 ? -16.355 19.784  5.009   1.00 26.53 ? 183 ILE B O   1 
ATOM 4007  C CB  . ILE B 1 183 ? -16.288 22.817  5.053   1.00 8.98  ? 183 ILE B CB  1 
ATOM 4008  C CG1 . ILE B 1 183 ? -16.661 24.246  5.437   1.00 8.98  ? 183 ILE B CG1 1 
ATOM 4009  C CG2 . ILE B 1 183 ? -16.323 22.619  3.541   1.00 8.98  ? 183 ILE B CG2 1 
ATOM 4010  C CD1 . ILE B 1 183 ? -15.902 25.289  4.701   1.00 8.98  ? 183 ILE B CD1 1 
ATOM 4011  N N   . VAL B 1 184 ? -18.488 20.227  4.483   1.00 27.59 ? 184 VAL B N   1 
ATOM 4012  C CA  . VAL B 1 184 ? -18.653 18.974  3.772   1.00 27.59 ? 184 VAL B CA  1 
ATOM 4013  C C   . VAL B 1 184 ? -17.843 19.024  2.485   1.00 27.59 ? 184 VAL B C   1 
ATOM 4014  O O   . VAL B 1 184 ? -17.968 19.954  1.696   1.00 27.59 ? 184 VAL B O   1 
ATOM 4015  C CB  . VAL B 1 184 ? -20.133 18.706  3.446   1.00 13.49 ? 184 VAL B CB  1 
ATOM 4016  C CG1 . VAL B 1 184 ? -20.256 17.456  2.590   1.00 13.49 ? 184 VAL B CG1 1 
ATOM 4017  C CG2 . VAL B 1 184 ? -20.918 18.523  4.736   1.00 13.49 ? 184 VAL B CG2 1 
ATOM 4018  N N   . PRO B 1 185 ? -16.984 18.022  2.267   1.00 21.06 ? 185 PRO B N   1 
ATOM 4019  C CA  . PRO B 1 185 ? -16.177 18.020  1.051   1.00 21.06 ? 185 PRO B CA  1 
ATOM 4020  C C   . PRO B 1 185 ? -16.750 17.163  -0.067  1.00 21.06 ? 185 PRO B C   1 
ATOM 4021  O O   . PRO B 1 185 ? -17.202 16.041  0.171   1.00 21.06 ? 185 PRO B O   1 
ATOM 4022  C CB  . PRO B 1 185 ? -14.849 17.474  1.546   1.00 14.10 ? 185 PRO B CB  1 
ATOM 4023  C CG  . PRO B 1 185 ? -15.309 16.397  2.485   1.00 14.10 ? 185 PRO B CG  1 
ATOM 4024  C CD  . PRO B 1 185 ? -16.444 17.065  3.253   1.00 14.10 ? 185 PRO B CD  1 
ATOM 4025  N N   . ILE B 1 186 ? -16.746 17.695  -1.283  1.00 17.13 ? 186 ILE B N   1 
ATOM 4026  C CA  . ILE B 1 186 ? -17.207 16.927  -2.428  1.00 17.13 ? 186 ILE B CA  1 
ATOM 4027  C C   . ILE B 1 186 ? -15.924 16.358  -3.010  1.00 17.13 ? 186 ILE B C   1 
ATOM 4028  O O   . ILE B 1 186 ? -15.046 17.101  -3.451  1.00 17.13 ? 186 ILE B O   1 
ATOM 4029  C CB  . ILE B 1 186 ? -17.888 17.797  -3.509  1.00 18.04 ? 186 ILE B CB  1 
ATOM 4030  C CG1 . ILE B 1 186 ? -19.225 18.333  -3.002  1.00 18.04 ? 186 ILE B CG1 1 
ATOM 4031  C CG2 . ILE B 1 186 ? -18.134 16.967  -4.760  1.00 18.04 ? 186 ILE B CG2 1 
ATOM 4032  C CD1 . ILE B 1 186 ? -19.918 19.259  -3.978  1.00 18.04 ? 186 ILE B CD1 1 
ATOM 4033  N N   . VAL B 1 187 ? -15.806 15.040  -2.985  1.00 18.62 ? 187 VAL B N   1 
ATOM 4034  C CA  . VAL B 1 187 ? -14.629 14.378  -3.508  1.00 18.62 ? 187 VAL B CA  1 
ATOM 4035  C C   . VAL B 1 187 ? -14.842 14.143  -4.996  1.00 18.62 ? 187 VAL B C   1 
ATOM 4036  O O   . VAL B 1 187 ? -15.653 13.306  -5.382  1.00 18.62 ? 187 VAL B O   1 
ATOM 4037  C CB  . VAL B 1 187 ? -14.421 13.034  -2.801  1.00 7.91  ? 187 VAL B CB  1 
ATOM 4038  C CG1 . VAL B 1 187 ? -13.183 12.353  -3.339  1.00 7.91  ? 187 VAL B CG1 1 
ATOM 4039  C CG2 . VAL B 1 187 ? -14.304 13.255  -1.308  1.00 7.91  ? 187 VAL B CG2 1 
ATOM 4040  N N   . GLU B 1 188 ? -14.107 14.871  -5.830  1.00 24.80 ? 188 GLU B N   1 
ATOM 4041  C CA  . GLU B 1 188 ? -14.271 14.735  -7.266  1.00 24.80 ? 188 GLU B CA  1 
ATOM 4042  C C   . GLU B 1 188 ? -13.108 14.121  -8.037  1.00 24.80 ? 188 GLU B C   1 
ATOM 4043  O O   . GLU B 1 188 ? -12.184 14.820  -8.467  1.00 24.80 ? 188 GLU B O   1 
ATOM 4044  C CB  . GLU B 1 188 ? -14.613 16.095  -7.877  1.00 28.03 ? 188 GLU B CB  1 
ATOM 4045  C CG  . GLU B 1 188 ? -14.670 16.107  -9.402  1.00 28.03 ? 188 GLU B CG  1 
ATOM 4046  C CD  . GLU B 1 188 ? -15.098 17.454  -9.955  1.00 28.03 ? 188 GLU B CD  1 
ATOM 4047  O OE1 . GLU B 1 188 ? -15.234 18.409  -9.155  1.00 28.03 ? 188 GLU B OE1 1 
ATOM 4048  O OE2 . GLU B 1 188 ? -15.296 17.562  -11.189 1.00 28.03 ? 188 GLU B OE2 1 
ATOM 4049  N N   . PRO B 1 189 ? -13.139 12.795  -8.219  1.00 20.05 ? 189 PRO B N   1 
ATOM 4050  C CA  . PRO B 1 189 ? -12.092 12.093  -8.956  1.00 20.05 ? 189 PRO B CA  1 
ATOM 4051  C C   . PRO B 1 189 ? -12.595 11.944  -10.385 1.00 20.05 ? 189 PRO B C   1 
ATOM 4052  O O   . PRO B 1 189 ? -13.124 10.894  -10.751 1.00 20.05 ? 189 PRO B O   1 
ATOM 4053  C CB  . PRO B 1 189 ? -12.025 10.757  -8.238  1.00 6.48  ? 189 PRO B CB  1 
ATOM 4054  C CG  . PRO B 1 189 ? -13.461 10.489  -7.955  1.00 6.48  ? 189 PRO B CG  1 
ATOM 4055  C CD  . PRO B 1 189 ? -13.971 11.842  -7.464  1.00 6.48  ? 189 PRO B CD  1 
ATOM 4056  N N   . GLU B 1 190 ? -12.448 12.987  -11.194 1.00 26.40 ? 190 GLU B N   1 
ATOM 4057  C CA  . GLU B 1 190 ? -12.941 12.917  -12.565 1.00 26.40 ? 190 GLU B CA  1 
ATOM 4058  C C   . GLU B 1 190 ? -12.082 12.172  -13.556 1.00 26.40 ? 190 GLU B C   1 
ATOM 4059  O O   . GLU B 1 190 ? -10.957 12.568  -13.827 1.00 26.40 ? 190 GLU B O   1 
ATOM 4060  C CB  . GLU B 1 190 ? -13.183 14.304  -13.150 1.00 32.39 ? 190 GLU B CB  1 
ATOM 4061  C CG  . GLU B 1 190 ? -13.728 14.211  -14.572 1.00 32.39 ? 190 GLU B CG  1 
ATOM 4062  C CD  . GLU B 1 190 ? -14.004 15.556  -15.205 1.00 32.39 ? 190 GLU B CD  1 
ATOM 4063  O OE1 . GLU B 1 190 ? -14.259 16.531  -14.459 1.00 32.39 ? 190 GLU B OE1 1 
ATOM 4064  O OE2 . GLU B 1 190 ? -13.988 15.629  -16.454 1.00 32.39 ? 190 GLU B OE2 1 
ATOM 4065  N N   . ILE B 1 191 ? -12.630 11.105  -14.117 1.00 19.98 ? 191 ILE B N   1 
ATOM 4066  C CA  . ILE B 1 191 ? -11.930 10.335  -15.130 1.00 19.98 ? 191 ILE B CA  1 
ATOM 4067  C C   . ILE B 1 191 ? -12.407 10.883  -16.478 1.00 19.98 ? 191 ILE B C   1 
ATOM 4068  O O   . ILE B 1 191 ? -13.515 10.582  -16.909 1.00 19.98 ? 191 ILE B O   1 
ATOM 4069  C CB  . ILE B 1 191 ? -12.294 8.846   -15.039 1.00 8.06  ? 191 ILE B CB  1 
ATOM 4070  C CG1 . ILE B 1 191 ? -11.785 8.268   -13.720 1.00 8.06  ? 191 ILE B CG1 1 
ATOM 4071  C CG2 . ILE B 1 191 ? -11.726 8.097   -16.232 1.00 8.06  ? 191 ILE B CG2 1 
ATOM 4072  C CD1 . ILE B 1 191 ? -12.050 6.785   -13.562 1.00 8.06  ? 191 ILE B CD1 1 
ATOM 4073  N N   . LEU B 1 192 ? -11.584 11.693  -17.136 1.00 24.06 ? 192 LEU B N   1 
ATOM 4074  C CA  . LEU B 1 192 ? -11.950 12.279  -18.430 1.00 24.06 ? 192 LEU B CA  1 
ATOM 4075  C C   . LEU B 1 192 ? -12.436 11.266  -19.460 1.00 24.06 ? 192 LEU B C   1 
ATOM 4076  O O   . LEU B 1 192 ? -12.036 10.104  -19.438 1.00 24.06 ? 192 LEU B O   1 
ATOM 4077  C CB  . LEU B 1 192 ? -10.766 13.024  -19.038 1.00 20.04 ? 192 LEU B CB  1 
ATOM 4078  C CG  . LEU B 1 192 ? -10.194 14.193  -18.246 1.00 20.04 ? 192 LEU B CG  1 
ATOM 4079  C CD1 . LEU B 1 192 ? -8.954  14.704  -18.955 1.00 20.04 ? 192 LEU B CD1 1 
ATOM 4080  C CD2 . LEU B 1 192 ? -11.235 15.286  -18.102 1.00 20.04 ? 192 LEU B CD2 1 
ATOM 4081  N N   . PRO B 1 193 ? -13.289 11.713  -20.395 1.00 29.20 ? 193 PRO B N   1 
ATOM 4082  C CA  . PRO B 1 193 ? -13.886 10.930  -21.480 1.00 29.20 ? 193 PRO B CA  1 
ATOM 4083  C C   . PRO B 1 193 ? -12.999 10.846  -22.710 1.00 29.20 ? 193 PRO B C   1 
ATOM 4084  O O   . PRO B 1 193 ? -13.226 10.013  -23.578 1.00 29.20 ? 193 PRO B O   1 
ATOM 4085  C CB  . PRO B 1 193 ? -15.165 11.693  -21.811 1.00 25.20 ? 193 PRO B CB  1 
ATOM 4086  C CG  . PRO B 1 193 ? -15.315 12.708  -20.695 1.00 25.20 ? 193 PRO B CG  1 
ATOM 4087  C CD  . PRO B 1 193 ? -13.914 13.039  -20.328 1.00 25.20 ? 193 PRO B CD  1 
ATOM 4088  N N   . ASP B 1 194 ? -12.004 11.722  -22.802 1.00 34.70 ? 194 ASP B N   1 
ATOM 4089  C CA  . ASP B 1 194 ? -11.114 11.726  -23.956 1.00 34.70 ? 194 ASP B CA  1 
ATOM 4090  C C   . ASP B 1 194 ? -10.598 10.336  -24.253 1.00 34.70 ? 194 ASP B C   1 
ATOM 4091  O O   . ASP B 1 194 ? -10.218 9.599   -23.343 1.00 34.70 ? 194 ASP B O   1 
ATOM 4092  C CB  . ASP B 1 194 ? -9.932  12.649  -23.711 1.00 54.31 ? 194 ASP B CB  1 
ATOM 4093  C CG  . ASP B 1 194 ? -10.349 13.970  -23.134 1.00 54.31 ? 194 ASP B CG  1 
ATOM 4094  O OD1 . ASP B 1 194 ? -11.306 14.578  -23.661 1.00 54.31 ? 194 ASP B OD1 1 
ATOM 4095  O OD2 . ASP B 1 194 ? -9.718  14.403  -22.154 1.00 54.31 ? 194 ASP B OD2 1 
ATOM 4096  N N   . GLY B 1 195 ? -10.584 9.981   -25.531 1.00 31.22 ? 195 GLY B N   1 
ATOM 4097  C CA  . GLY B 1 195 ? -10.103 8.671   -25.923 1.00 31.22 ? 195 GLY B CA  1 
ATOM 4098  C C   . GLY B 1 195 ? -11.129 7.928   -26.751 1.00 31.22 ? 195 GLY B C   1 
ATOM 4099  O O   . GLY B 1 195 ? -12.245 8.410   -26.936 1.00 31.22 ? 195 GLY B O   1 
ATOM 4100  N N   . ASP B 1 196 ? -10.752 6.758   -27.256 1.00 42.04 ? 196 ASP B N   1 
ATOM 4101  C CA  . ASP B 1 196 ? -11.656 5.949   -28.056 1.00 42.04 ? 196 ASP B CA  1 
ATOM 4102  C C   . ASP B 1 196 ? -12.022 4.654   -27.333 1.00 42.04 ? 196 ASP B C   1 
ATOM 4103  O O   . ASP B 1 196 ? -12.405 3.678   -27.971 1.00 42.04 ? 196 ASP B O   1 
ATOM 4104  C CB  . ASP B 1 196 ? -11.026 5.612   -29.413 1.00 69.84 ? 196 ASP B CB  1 
ATOM 4105  C CG  . ASP B 1 196 ? -9.707  4.852   -29.285 1.00 69.84 ? 196 ASP B CG  1 
ATOM 4106  O OD1 . ASP B 1 196 ? -9.287  4.230   -30.284 1.00 69.84 ? 196 ASP B OD1 1 
ATOM 4107  O OD2 . ASP B 1 196 ? -9.081  4.880   -28.203 1.00 69.84 ? 196 ASP B OD2 1 
ATOM 4108  N N   . HIS B 1 197 ? -11.905 4.647   -26.005 1.00 33.73 ? 197 HIS B N   1 
ATOM 4109  C CA  . HIS B 1 197 ? -12.226 3.458   -25.211 1.00 33.73 ? 197 HIS B CA  1 
ATOM 4110  C C   . HIS B 1 197 ? -13.735 3.221   -25.139 1.00 33.73 ? 197 HIS B C   1 
ATOM 4111  O O   . HIS B 1 197 ? -14.524 4.166   -25.190 1.00 33.73 ? 197 HIS B O   1 
ATOM 4112  C CB  . HIS B 1 197 ? -11.672 3.602   -23.793 1.00 32.36 ? 197 HIS B CB  1 
ATOM 4113  C CG  . HIS B 1 197 ? -12.086 4.867   -23.115 1.00 32.36 ? 197 HIS B CG  1 
ATOM 4114  N ND1 . HIS B 1 197 ? -11.424 6.061   -23.302 1.00 32.36 ? 197 HIS B ND1 1 
ATOM 4115  C CD2 . HIS B 1 197 ? -13.136 5.142   -22.303 1.00 32.36 ? 197 HIS B CD2 1 
ATOM 4116  C CE1 . HIS B 1 197 ? -12.051 7.017   -22.637 1.00 32.36 ? 197 HIS B CE1 1 
ATOM 4117  N NE2 . HIS B 1 197 ? -13.093 6.486   -22.024 1.00 32.36 ? 197 HIS B NE2 1 
ATOM 4118  N N   . ASP B 1 198 ? -14.131 1.958   -25.007 1.00 35.01 ? 198 ASP B N   1 
ATOM 4119  C CA  . ASP B 1 198 ? -15.546 1.609   -24.943 1.00 35.01 ? 198 ASP B CA  1 
ATOM 4120  C C   . ASP B 1 198 ? -16.074 1.674   -23.519 1.00 35.01 ? 198 ASP B C   1 
ATOM 4121  O O   . ASP B 1 198 ? -15.308 1.819   -22.574 1.00 35.01 ? 198 ASP B O   1 
ATOM 4122  C CB  . ASP B 1 198 ? -15.765 0.208   -25.499 1.00 49.85 ? 198 ASP B CB  1 
ATOM 4123  C CG  . ASP B 1 198 ? -15.281 -0.864  -24.561 1.00 49.85 ? 198 ASP B CG  1 
ATOM 4124  O OD1 . ASP B 1 198 ? -14.146 -0.751  -24.059 1.00 49.85 ? 198 ASP B OD1 1 
ATOM 4125  O OD2 . ASP B 1 198 ? -16.040 -1.824  -24.332 1.00 49.85 ? 198 ASP B OD2 1 
ATOM 4126  N N   . LEU B 1 199 ? -17.390 1.551   -23.371 1.00 28.78 ? 199 LEU B N   1 
ATOM 4127  C CA  . LEU B 1 199 ? -18.015 1.610   -22.060 1.00 28.78 ? 199 LEU B CA  1 
ATOM 4128  C C   . LEU B 1 199 ? -17.353 0.661   -21.054 1.00 28.78 ? 199 LEU B C   1 
ATOM 4129  O O   . LEU B 1 199 ? -17.044 1.068   -19.934 1.00 28.78 ? 199 LEU B O   1 
ATOM 4130  C CB  . LEU B 1 199 ? -19.508 1.298   -22.174 1.00 20.66 ? 199 LEU B CB  1 
ATOM 4131  C CG  . LEU B 1 199 ? -20.329 1.602   -20.915 1.00 20.66 ? 199 LEU B CG  1 
ATOM 4132  C CD1 . LEU B 1 199 ? -20.337 3.103   -20.651 1.00 20.66 ? 199 LEU B CD1 1 
ATOM 4133  C CD2 . LEU B 1 199 ? -21.746 1.098   -21.093 1.00 20.66 ? 199 LEU B CD2 1 
ATOM 4134  N N   . LYS B 1 200 ? -17.138 -0.593  -21.452 1.00 26.01 ? 200 LYS B N   1 
ATOM 4135  C CA  . LYS B 1 200 ? -16.499 -1.585  -20.577 1.00 26.01 ? 200 LYS B CA  1 
ATOM 4136  C C   . LYS B 1 200 ? -15.277 -0.999  -19.870 1.00 26.01 ? 200 LYS B C   1 
ATOM 4137  O O   . LYS B 1 200 ? -15.191 -1.008  -18.641 1.00 26.01 ? 200 LYS B O   1 
ATOM 4138  C CB  . LYS B 1 200 ? -16.038 -2.806  -21.378 1.00 79.37 ? 200 LYS B CB  1 
ATOM 4139  C CG  . LYS B 1 200 ? -17.115 -3.815  -21.735 1.00 79.37 ? 200 LYS B CG  1 
ATOM 4140  C CD  . LYS B 1 200 ? -16.630 -4.793  -22.830 1.00 79.37 ? 200 LYS B CD  1 
ATOM 4141  C CE  . LYS B 1 200 ? -15.476 -5.701  -22.378 1.00 79.37 ? 200 LYS B CE  1 
ATOM 4142  N NZ  . LYS B 1 200 ? -15.891 -6.773  -21.414 1.00 79.37 ? 200 LYS B NZ  1 
ATOM 4143  N N   . ARG B 1 201 ? -14.334 -0.488  -20.654 1.00 30.17 ? 201 ARG B N   1 
ATOM 4144  C CA  . ARG B 1 201 ? -13.107 0.065   -20.096 1.00 30.17 ? 201 ARG B CA  1 
ATOM 4145  C C   . ARG B 1 201 ? -13.323 1.199   -19.105 1.00 30.17 ? 201 ARG B C   1 
ATOM 4146  O O   . ARG B 1 201 ? -12.693 1.236   -18.045 1.00 30.17 ? 201 ARG B O   1 
ATOM 4147  C CB  . ARG B 1 201 ? -12.173 0.536   -21.214 1.00 43.66 ? 201 ARG B CB  1 
ATOM 4148  C CG  . ARG B 1 201 ? -10.841 1.029   -20.697 1.00 43.66 ? 201 ARG B CG  1 
ATOM 4149  C CD  . ARG B 1 201 ? -9.792  1.130   -21.793 1.00 43.66 ? 201 ARG B CD  1 
ATOM 4150  N NE  . ARG B 1 201 ? -8.514  1.583   -21.252 1.00 43.66 ? 201 ARG B NE  1 
ATOM 4151  C CZ  . ARG B 1 201 ? -7.895  1.001   -20.228 1.00 43.66 ? 201 ARG B CZ  1 
ATOM 4152  N NH1 . ARG B 1 201 ? -8.441  -0.066  -19.638 1.00 43.66 ? 201 ARG B NH1 1 
ATOM 4153  N NH2 . ARG B 1 201 ? -6.742  1.495   -19.780 1.00 43.66 ? 201 ARG B NH2 1 
ATOM 4154  N N   . CYS B 1 202 ? -14.204 2.131   -19.442 1.00 24.69 ? 202 CYS B N   1 
ATOM 4155  C CA  . CYS B 1 202 ? -14.453 3.241   -18.542 1.00 24.69 ? 202 CYS B CA  1 
ATOM 4156  C C   . CYS B 1 202 ? -14.992 2.738   -17.218 1.00 24.69 ? 202 CYS B C   1 
ATOM 4157  O O   . CYS B 1 202 ? -14.665 3.269   -16.155 1.00 24.69 ? 202 CYS B O   1 
ATOM 4158  C CB  . CYS B 1 202 ? -15.453 4.213   -19.139 1.00 24.08 ? 202 CYS B CB  1 
ATOM 4159  S SG  . CYS B 1 202 ? -15.844 5.513   -17.975 1.00 24.08 ? 202 CYS B SG  1 
ATOM 4160  N N   . GLN B 1 203 ? -15.828 1.712   -17.277 1.00 19.99 ? 203 GLN B N   1 
ATOM 4161  C CA  . GLN B 1 203 ? -16.385 1.173   -16.058 1.00 19.99 ? 203 GLN B CA  1 
ATOM 4162  C C   . GLN B 1 203 ? -15.251 0.589   -15.223 1.00 19.99 ? 203 GLN B C   1 
ATOM 4163  O O   . GLN B 1 203 ? -15.147 0.852   -14.024 1.00 19.99 ? 203 GLN B O   1 
ATOM 4164  C CB  . GLN B 1 203 ? -17.401 0.093   -16.374 1.00 22.48 ? 203 GLN B CB  1 
ATOM 4165  C CG  . GLN B 1 203 ? -18.357 -0.140  -15.238 1.00 22.48 ? 203 GLN B CG  1 
ATOM 4166  C CD  . GLN B 1 203 ? -19.087 -1.443  -15.368 1.00 22.48 ? 203 GLN B CD  1 
ATOM 4167  O OE1 . GLN B 1 203 ? -19.652 -1.746  -16.416 1.00 22.48 ? 203 GLN B OE1 1 
ATOM 4168  N NE2 . GLN B 1 203 ? -19.082 -2.228  -14.305 1.00 22.48 ? 203 GLN B NE2 1 
ATOM 4169  N N   . TYR B 1 204 ? -14.396 -0.193  -15.874 1.00 23.48 ? 204 TYR B N   1 
ATOM 4170  C CA  . TYR B 1 204 ? -13.257 -0.827  -15.215 1.00 23.48 ? 204 TYR B CA  1 
ATOM 4171  C C   . TYR B 1 204 ? -12.413 0.208   -14.487 1.00 23.48 ? 204 TYR B C   1 
ATOM 4172  O O   . TYR B 1 204 ? -12.215 0.137   -13.270 1.00 23.48 ? 204 TYR B O   1 
ATOM 4173  C CB  . TYR B 1 204 ? -12.382 -1.530  -16.247 1.00 30.69 ? 204 TYR B CB  1 
ATOM 4174  C CG  . TYR B 1 204 ? -11.273 -2.347  -15.638 1.00 30.69 ? 204 TYR B CG  1 
ATOM 4175  C CD1 . TYR B 1 204 ? -11.496 -3.659  -15.221 1.00 30.69 ? 204 TYR B CD1 1 
ATOM 4176  C CD2 . TYR B 1 204 ? -10.005 -1.804  -15.446 1.00 30.69 ? 204 TYR B CD2 1 
ATOM 4177  C CE1 . TYR B 1 204 ? -10.484 -4.417  -14.624 1.00 30.69 ? 204 TYR B CE1 1 
ATOM 4178  C CE2 . TYR B 1 204 ? -8.981  -2.550  -14.846 1.00 30.69 ? 204 TYR B CE2 1 
ATOM 4179  C CZ  . TYR B 1 204 ? -9.228  -3.856  -14.436 1.00 30.69 ? 204 TYR B CZ  1 
ATOM 4180  O OH  . TYR B 1 204 ? -8.228  -4.594  -13.830 1.00 30.69 ? 204 TYR B OH  1 
ATOM 4181  N N   . VAL B 1 205 ? -11.909 1.168   -15.250 1.00 16.35 ? 205 VAL B N   1 
ATOM 4182  C CA  . VAL B 1 205 ? -11.083 2.216   -14.688 1.00 16.35 ? 205 VAL B CA  1 
ATOM 4183  C C   . VAL B 1 205 ? -11.818 2.950   -13.575 1.00 16.35 ? 205 VAL B C   1 
ATOM 4184  O O   . VAL B 1 205 ? -11.241 3.214   -12.516 1.00 16.35 ? 205 VAL B O   1 
ATOM 4185  C CB  . VAL B 1 205 ? -10.671 3.225   -15.766 1.00 10.15 ? 205 VAL B CB  1 
ATOM 4186  C CG1 . VAL B 1 205 ? -9.770  4.289   -15.167 1.00 10.15 ? 205 VAL B CG1 1 
ATOM 4187  C CG2 . VAL B 1 205 ? -9.967  2.504   -16.904 1.00 10.15 ? 205 VAL B CG2 1 
ATOM 4188  N N   . THR B 1 206 ? -13.089 3.277   -13.798 1.00 18.27 ? 206 THR B N   1 
ATOM 4189  C CA  . THR B 1 206 ? -13.852 3.984   -12.777 1.00 18.27 ? 206 THR B CA  1 
ATOM 4190  C C   . THR B 1 206 ? -13.894 3.176   -11.492 1.00 18.27 ? 206 THR B C   1 
ATOM 4191  O O   . THR B 1 206 ? -13.721 3.717   -10.399 1.00 18.27 ? 206 THR B O   1 
ATOM 4192  C CB  . THR B 1 206 ? -15.291 4.263   -13.225 1.00 14.74 ? 206 THR B CB  1 
ATOM 4193  O OG1 . THR B 1 206 ? -15.293 5.336   -14.177 1.00 14.74 ? 206 THR B OG1 1 
ATOM 4194  C CG2 . THR B 1 206 ? -16.146 4.655   -12.030 1.00 14.74 ? 206 THR B CG2 1 
ATOM 4195  N N   . GLU B 1 207 ? -14.120 1.877   -11.622 1.00 23.76 ? 207 GLU B N   1 
ATOM 4196  C CA  . GLU B 1 207 ? -14.175 1.021   -10.456 1.00 23.76 ? 207 GLU B CA  1 
ATOM 4197  C C   . GLU B 1 207 ? -12.856 1.013   -9.697  1.00 23.76 ? 207 GLU B C   1 
ATOM 4198  O O   . GLU B 1 207 ? -12.848 1.130   -8.469  1.00 23.76 ? 207 GLU B O   1 
ATOM 4199  C CB  . GLU B 1 207 ? -14.552 -0.392  -10.867 1.00 34.23 ? 207 GLU B CB  1 
ATOM 4200  C CG  . GLU B 1 207 ? -16.012 -0.543  -11.197 1.00 34.23 ? 207 GLU B CG  1 
ATOM 4201  C CD  . GLU B 1 207 ? -16.339 -1.923  -11.718 1.00 34.23 ? 207 GLU B CD  1 
ATOM 4202  O OE1 . GLU B 1 207 ? -15.862 -2.916  -11.131 1.00 34.23 ? 207 GLU B OE1 1 
ATOM 4203  O OE2 . GLU B 1 207 ? -17.080 -2.021  -12.715 1.00 34.23 ? 207 GLU B OE2 1 
ATOM 4204  N N   . LYS B 1 208 ? -11.741 0.890   -10.414 1.00 18.12 ? 208 LYS B N   1 
ATOM 4205  C CA  . LYS B 1 208 ? -10.435 0.872   -9.759  1.00 18.12 ? 208 LYS B CA  1 
ATOM 4206  C C   . LYS B 1 208 ? -10.115 2.204   -9.087  1.00 18.12 ? 208 LYS B C   1 
ATOM 4207  O O   . LYS B 1 208 ? -9.622  2.238   -7.959  1.00 18.12 ? 208 LYS B O   1 
ATOM 4208  C CB  . LYS B 1 208 ? -9.344  0.530   -10.765 1.00 18.33 ? 208 LYS B CB  1 
ATOM 4209  C CG  . LYS B 1 208 ? -9.503  -0.845  -11.392 1.00 18.33 ? 208 LYS B CG  1 
ATOM 4210  C CD  . LYS B 1 208 ? -9.400  -1.968  -10.358 1.00 18.33 ? 208 LYS B CD  1 
ATOM 4211  C CE  . LYS B 1 208 ? -9.717  -3.332  -10.982 1.00 18.33 ? 208 LYS B CE  1 
ATOM 4212  N NZ  . LYS B 1 208 ? -9.874  -4.410  -9.959  1.00 18.33 ? 208 LYS B NZ  1 
ATOM 4213  N N   . VAL B 1 209 ? -10.395 3.301   -9.777  1.00 14.97 ? 209 VAL B N   1 
ATOM 4214  C CA  . VAL B 1 209 ? -10.123 4.613   -9.216  1.00 14.97 ? 209 VAL B CA  1 
ATOM 4215  C C   . VAL B 1 209 ? -10.932 4.817   -7.943  1.00 14.97 ? 209 VAL B C   1 
ATOM 4216  O O   . VAL B 1 209 ? -10.385 5.168   -6.901  1.00 14.97 ? 209 VAL B O   1 
ATOM 4217  C CB  . VAL B 1 209 ? -10.459 5.736   -10.222 1.00 8.37  ? 209 VAL B CB  1 
ATOM 4218  C CG1 . VAL B 1 209 ? -10.444 7.092   -9.528  1.00 8.37  ? 209 VAL B CG1 1 
ATOM 4219  C CG2 . VAL B 1 209 ? -9.457  5.721   -11.360 1.00 8.37  ? 209 VAL B CG2 1 
ATOM 4220  N N   . LEU B 1 210 ? -12.235 4.592   -8.011  1.00 22.31 ? 210 LEU B N   1 
ATOM 4221  C CA  . LEU B 1 210 ? -13.053 4.778   -6.824  1.00 22.31 ? 210 LEU B CA  1 
ATOM 4222  C C   . LEU B 1 210 ? -12.576 3.884   -5.679  1.00 22.31 ? 210 LEU B C   1 
ATOM 4223  O O   . LEU B 1 210 ? -12.419 4.346   -4.546  1.00 22.31 ? 210 LEU B O   1 
ATOM 4224  C CB  . LEU B 1 210 ? -14.525 4.515   -7.150  1.00 15.58 ? 210 LEU B CB  1 
ATOM 4225  C CG  . LEU B 1 210 ? -15.166 5.605   -8.008  1.00 15.58 ? 210 LEU B CG  1 
ATOM 4226  C CD1 . LEU B 1 210 ? -16.587 5.229   -8.328  1.00 15.58 ? 210 LEU B CD1 1 
ATOM 4227  C CD2 . LEU B 1 210 ? -15.135 6.928   -7.275  1.00 15.58 ? 210 LEU B CD2 1 
ATOM 4228  N N   . ALA B 1 211 ? -12.325 2.613   -5.974  1.00 16.85 ? 211 ALA B N   1 
ATOM 4229  C CA  . ALA B 1 211 ? -11.858 1.686   -4.948  1.00 16.85 ? 211 ALA B CA  1 
ATOM 4230  C C   . ALA B 1 211 ? -10.655 2.258   -4.195  1.00 16.85 ? 211 ALA B C   1 
ATOM 4231  O O   . ALA B 1 211 ? -10.523 2.095   -2.984  1.00 16.85 ? 211 ALA B O   1 
ATOM 4232  C CB  . ALA B 1 211 ? -11.493 0.354   -5.578  1.00 8.98  ? 211 ALA B CB  1 
ATOM 4233  N N   . ALA B 1 212 ? -9.776  2.933   -4.922  1.00 22.83 ? 212 ALA B N   1 
ATOM 4234  C CA  . ALA B 1 212 ? -8.599  3.520   -4.316  1.00 22.83 ? 212 ALA B CA  1 
ATOM 4235  C C   . ALA B 1 212 ? -8.994  4.740   -3.507  1.00 22.83 ? 212 ALA B C   1 
ATOM 4236  O O   . ALA B 1 212 ? -8.537  4.933   -2.381  1.00 22.83 ? 212 ALA B O   1 
ATOM 4237  C CB  . ALA B 1 212 ? -7.624  3.916   -5.386  1.00 2.35  ? 212 ALA B CB  1 
ATOM 4238  N N   . VAL B 1 213 ? -9.840  5.573   -4.098  1.00 20.50 ? 213 VAL B N   1 
ATOM 4239  C CA  . VAL B 1 213 ? -10.295 6.783   -3.440  1.00 20.50 ? 213 VAL B CA  1 
ATOM 4240  C C   . VAL B 1 213 ? -10.893 6.512   -2.070  1.00 20.50 ? 213 VAL B C   1 
ATOM 4241  O O   . VAL B 1 213 ? -10.590 7.218   -1.108  1.00 20.50 ? 213 VAL B O   1 
ATOM 4242  C CB  . VAL B 1 213 ? -11.361 7.506   -4.270  1.00 9.25  ? 213 VAL B CB  1 
ATOM 4243  C CG1 . VAL B 1 213 ? -11.891 8.687   -3.499  1.00 9.25  ? 213 VAL B CG1 1 
ATOM 4244  C CG2 . VAL B 1 213 ? -10.773 7.958   -5.585  1.00 9.25  ? 213 VAL B CG2 1 
ATOM 4245  N N   . TYR B 1 214 ? -11.744 5.497   -1.962  1.00 23.73 ? 214 TYR B N   1 
ATOM 4246  C CA  . TYR B 1 214 ? -12.349 5.246   -0.666  1.00 23.73 ? 214 TYR B CA  1 
ATOM 4247  C C   . TYR B 1 214 ? -11.396 4.642   0.341   1.00 23.73 ? 214 TYR B C   1 
ATOM 4248  O O   . TYR B 1 214 ? -11.486 4.946   1.534   1.00 23.73 ? 214 TYR B O   1 
ATOM 4249  C CB  . TYR B 1 214 ? -13.650 4.433   -0.802  1.00 17.25 ? 214 TYR B CB  1 
ATOM 4250  C CG  . TYR B 1 214 ? -14.832 5.344   -1.122  1.00 17.25 ? 214 TYR B CG  1 
ATOM 4251  C CD1 . TYR B 1 214 ? -15.297 5.493   -2.432  1.00 17.25 ? 214 TYR B CD1 1 
ATOM 4252  C CD2 . TYR B 1 214 ? -15.368 6.192   -0.140  1.00 17.25 ? 214 TYR B CD2 1 
ATOM 4253  C CE1 . TYR B 1 214 ? -16.243 6.466   -2.761  1.00 17.25 ? 214 TYR B CE1 1 
ATOM 4254  C CE2 . TYR B 1 214 ? -16.310 7.169   -0.463  1.00 17.25 ? 214 TYR B CE2 1 
ATOM 4255  C CZ  . TYR B 1 214 ? -16.736 7.304   -1.778  1.00 17.25 ? 214 TYR B CZ  1 
ATOM 4256  O OH  . TYR B 1 214 ? -17.617 8.310   -2.117  1.00 17.25 ? 214 TYR B OH  1 
ATOM 4257  N N   . LYS B 1 215 ? -10.463 3.818   -0.125  1.00 22.22 ? 215 LYS B N   1 
ATOM 4258  C CA  . LYS B 1 215 ? -9.489  3.231   0.790   1.00 22.22 ? 215 LYS B CA  1 
ATOM 4259  C C   . LYS B 1 215 ? -8.661  4.370   1.369   1.00 22.22 ? 215 LYS B C   1 
ATOM 4260  O O   . LYS B 1 215 ? -8.299  4.353   2.539   1.00 22.22 ? 215 LYS B O   1 
ATOM 4261  C CB  . LYS B 1 215 ? -8.574  2.250   0.058   1.00 13.12 ? 215 LYS B CB  1 
ATOM 4262  C CG  . LYS B 1 215 ? -7.381  1.758   0.886   1.00 13.12 ? 215 LYS B CG  1 
ATOM 4263  C CD  . LYS B 1 215 ? -7.797  1.091   2.192   1.00 13.12 ? 215 LYS B CD  1 
ATOM 4264  C CE  . LYS B 1 215 ? -6.657  0.283   2.816   1.00 13.12 ? 215 LYS B CE  1 
ATOM 4265  N NZ  . LYS B 1 215 ? -5.448  1.088   3.186   1.00 13.12 ? 215 LYS B NZ  1 
ATOM 4266  N N   . ALA B 1 216 ? -8.375  5.365   0.536   1.00 16.45 ? 216 ALA B N   1 
ATOM 4267  C CA  . ALA B 1 216 ? -7.602  6.528   0.954   1.00 16.45 ? 216 ALA B CA  1 
ATOM 4268  C C   . ALA B 1 216 ? -8.376  7.284   2.018   1.00 16.45 ? 216 ALA B C   1 
ATOM 4269  O O   . ALA B 1 216 ? -7.844  7.601   3.086   1.00 16.45 ? 216 ALA B O   1 
ATOM 4270  C CB  . ALA B 1 216 ? -7.332  7.440   -0.240  1.00 5.94  ? 216 ALA B CB  1 
ATOM 4271  N N   . LEU B 1 217 ? -9.634  7.580   1.722   1.00 13.94 ? 217 LEU B N   1 
ATOM 4272  C CA  . LEU B 1 217 ? -10.459 8.293   2.671   1.00 13.94 ? 217 LEU B CA  1 
ATOM 4273  C C   . LEU B 1 217 ? -10.414 7.571   4.001   1.00 13.94 ? 217 LEU B C   1 
ATOM 4274  O O   . LEU B 1 217 ? -10.290 8.208   5.043   1.00 13.94 ? 217 LEU B O   1 
ATOM 4275  C CB  . LEU B 1 217 ? -11.886 8.381   2.165   1.00 10.86 ? 217 LEU B CB  1 
ATOM 4276  C CG  . LEU B 1 217 ? -12.041 9.369   1.013   1.00 10.86 ? 217 LEU B CG  1 
ATOM 4277  C CD1 . LEU B 1 217 ? -13.445 9.285   0.459   1.00 10.86 ? 217 LEU B CD1 1 
ATOM 4278  C CD2 . LEU B 1 217 ? -11.737 10.780  1.511   1.00 10.86 ? 217 LEU B CD2 1 
ATOM 4279  N N   . SER B 1 218 ? -10.499 6.242   3.970   1.00 11.83 ? 218 SER B N   1 
ATOM 4280  C CA  . SER B 1 218 ? -10.446 5.464   5.203   1.00 11.83 ? 218 SER B CA  1 
ATOM 4281  C C   . SER B 1 218 ? -9.150  5.729   5.947   1.00 11.83 ? 218 SER B C   1 
ATOM 4282  O O   . SER B 1 218 ? -9.152  6.038   7.137   1.00 11.83 ? 218 SER B O   1 
ATOM 4283  C CB  . SER B 1 218 ? -10.526 3.971   4.916   1.00 16.54 ? 218 SER B CB  1 
ATOM 4284  O OG  . SER B 1 218 ? -10.176 3.240   6.083   1.00 16.54 ? 218 SER B OG  1 
ATOM 4285  N N   . ASP B 1 219 ? -8.044  5.593   5.227   1.00 25.77 ? 219 ASP B N   1 
ATOM 4286  C CA  . ASP B 1 219 ? -6.723  5.801   5.789   1.00 25.77 ? 219 ASP B CA  1 
ATOM 4287  C C   . ASP B 1 219 ? -6.584  7.155   6.461   1.00 25.77 ? 219 ASP B C   1 
ATOM 4288  O O   . ASP B 1 219 ? -5.926  7.273   7.503   1.00 25.77 ? 219 ASP B O   1 
ATOM 4289  C CB  . ASP B 1 219 ? -5.673  5.668   4.695   1.00 24.91 ? 219 ASP B CB  1 
ATOM 4290  C CG  . ASP B 1 219 ? -5.626  4.275   4.110   1.00 24.91 ? 219 ASP B CG  1 
ATOM 4291  O OD1 . ASP B 1 219 ? -6.423  3.418   4.562   1.00 24.91 ? 219 ASP B OD1 1 
ATOM 4292  O OD2 . ASP B 1 219 ? -4.792  4.039   3.203   1.00 24.91 ? 219 ASP B OD2 1 
ATOM 4293  N N   . HIS B 1 220 ? -7.205  8.173   5.873   1.00 22.47 ? 220 HIS B N   1 
ATOM 4294  C CA  . HIS B 1 220 ? -7.121  9.515   6.424   1.00 22.47 ? 220 HIS B CA  1 
ATOM 4295  C C   . HIS B 1 220 ? -8.199  9.848   7.433   1.00 22.47 ? 220 HIS B C   1 
ATOM 4296  O O   . HIS B 1 220 ? -8.322  11.001  7.870   1.00 22.47 ? 220 HIS B O   1 
ATOM 4297  C CB  . HIS B 1 220 ? -7.126  10.522  5.295   1.00 21.63 ? 220 HIS B CB  1 
ATOM 4298  C CG  . HIS B 1 220 ? -5.848  10.538  4.526   1.00 21.63 ? 220 HIS B CG  1 
ATOM 4299  N ND1 . HIS B 1 220 ? -4.895  11.522  4.688   1.00 21.63 ? 220 HIS B ND1 1 
ATOM 4300  C CD2 . HIS B 1 220 ? -5.339  9.662   3.629   1.00 21.63 ? 220 HIS B CD2 1 
ATOM 4301  C CE1 . HIS B 1 220 ? -3.855  11.249  3.920   1.00 21.63 ? 220 HIS B CE1 1 
ATOM 4302  N NE2 . HIS B 1 220 ? -4.099  10.125  3.269   1.00 21.63 ? 220 HIS B NE2 1 
ATOM 4303  N N   . HIS B 1 221 ? -8.967  8.831   7.808   1.00 19.85 ? 221 HIS B N   1 
ATOM 4304  C CA  . HIS B 1 221 ? -10.029 8.985   8.786   1.00 19.85 ? 221 HIS B CA  1 
ATOM 4305  C C   . HIS B 1 221 ? -11.123 9.959   8.367   1.00 19.85 ? 221 HIS B C   1 
ATOM 4306  O O   . HIS B 1 221 ? -11.670 10.667  9.212   1.00 19.85 ? 221 HIS B O   1 
ATOM 4307  C CB  . HIS B 1 221 ? -9.450  9.459   10.110  1.00 24.27 ? 221 HIS B CB  1 
ATOM 4308  C CG  . HIS B 1 221 ? -8.222  8.719   10.534  1.00 24.27 ? 221 HIS B CG  1 
ATOM 4309  N ND1 . HIS B 1 221 ? -8.163  7.341   10.587  1.00 24.27 ? 221 HIS B ND1 1 
ATOM 4310  C CD2 . HIS B 1 221 ? -7.018  9.166   10.966  1.00 24.27 ? 221 HIS B CD2 1 
ATOM 4311  C CE1 . HIS B 1 221 ? -6.976  6.972   11.035  1.00 24.27 ? 221 HIS B CE1 1 
ATOM 4312  N NE2 . HIS B 1 221 ? -6.263  8.061   11.273  1.00 24.27 ? 221 HIS B NE2 1 
ATOM 4313  N N   . VAL B 1 222 ? -11.434 10.016  7.075   1.00 22.71 ? 222 VAL B N   1 
ATOM 4314  C CA  . VAL B 1 222 ? -12.487 10.907  6.598   1.00 22.71 ? 222 VAL B CA  1 
ATOM 4315  C C   . VAL B 1 222 ? -13.848 10.315  6.966   1.00 22.71 ? 222 VAL B C   1 
ATOM 4316  O O   . VAL B 1 222 ? -14.061 9.111   6.834   1.00 22.71 ? 222 VAL B O   1 
ATOM 4317  C CB  . VAL B 1 222 ? -12.409 11.097  5.076   1.00 23.77 ? 222 VAL B CB  1 
ATOM 4318  C CG1 . VAL B 1 222 ? -13.660 11.780  4.577   1.00 23.77 ? 222 VAL B CG1 1 
ATOM 4319  C CG2 . VAL B 1 222 ? -11.199 11.940  4.727   1.00 23.77 ? 222 VAL B CG2 1 
ATOM 4320  N N   . TYR B 1 223 ? -14.753 11.170  7.440   1.00 27.30 ? 223 TYR B N   1 
ATOM 4321  C CA  . TYR B 1 223 ? -16.109 10.789  7.857   1.00 27.30 ? 223 TYR B CA  1 
ATOM 4322  C C   . TYR B 1 223 ? -16.979 10.665  6.612   1.00 27.30 ? 223 TYR B C   1 
ATOM 4323  O O   . TYR B 1 223 ? -17.469 11.665  6.090   1.00 27.30 ? 223 TYR B O   1 
ATOM 4324  C CB  . TYR B 1 223 ? -16.642 11.880  8.787   1.00 31.60 ? 223 TYR B CB  1 
ATOM 4325  C CG  . TYR B 1 223 ? -18.037 11.702  9.334   1.00 31.60 ? 223 TYR B CG  1 
ATOM 4326  C CD1 . TYR B 1 223 ? -18.358 10.631  10.162  1.00 31.60 ? 223 TYR B CD1 1 
ATOM 4327  C CD2 . TYR B 1 223 ? -19.020 12.654  9.080   1.00 31.60 ? 223 TYR B CD2 1 
ATOM 4328  C CE1 . TYR B 1 223 ? -19.616 10.515  10.728  1.00 31.60 ? 223 TYR B CE1 1 
ATOM 4329  C CE2 . TYR B 1 223 ? -20.280 12.552  9.635   1.00 31.60 ? 223 TYR B CE2 1 
ATOM 4330  C CZ  . TYR B 1 223 ? -20.575 11.484  10.459  1.00 31.60 ? 223 TYR B CZ  1 
ATOM 4331  O OH  . TYR B 1 223 ? -21.835 11.393  11.005  1.00 31.60 ? 223 TYR B OH  1 
ATOM 4332  N N   . LEU B 1 224 ? -17.176 9.437   6.138   1.00 25.36 ? 224 LEU B N   1 
ATOM 4333  C CA  . LEU B 1 224 ? -17.946 9.220   4.920   1.00 25.36 ? 224 LEU B CA  1 
ATOM 4334  C C   . LEU B 1 224 ? -19.326 9.842   4.855   1.00 25.36 ? 224 LEU B C   1 
ATOM 4335  O O   . LEU B 1 224 ? -19.664 10.482  3.857   1.00 25.36 ? 224 LEU B O   1 
ATOM 4336  C CB  . LEU B 1 224 ? -18.057 7.729   4.615   1.00 11.84 ? 224 LEU B CB  1 
ATOM 4337  C CG  . LEU B 1 224 ? -16.778 7.062   4.113   1.00 11.84 ? 224 LEU B CG  1 
ATOM 4338  C CD1 . LEU B 1 224 ? -17.126 5.684   3.571   1.00 11.84 ? 224 LEU B CD1 1 
ATOM 4339  C CD2 . LEU B 1 224 ? -16.137 7.899   3.020   1.00 11.84 ? 224 LEU B CD2 1 
ATOM 4340  N N   . GLU B 1 225 ? -20.127 9.663   5.901   1.00 29.19 ? 225 GLU B N   1 
ATOM 4341  C CA  . GLU B 1 225 ? -21.473 10.213  5.899   1.00 29.19 ? 225 GLU B CA  1 
ATOM 4342  C C   . GLU B 1 225 ? -21.508 11.738  5.917   1.00 29.19 ? 225 GLU B C   1 
ATOM 4343  O O   . GLU B 1 225 ? -22.579 12.339  5.972   1.00 29.19 ? 225 GLU B O   1 
ATOM 4344  C CB  . GLU B 1 225 ? -22.295 9.643   7.058   1.00 32.59 ? 225 GLU B CB  1 
ATOM 4345  C CG  . GLU B 1 225 ? -21.526 9.328   8.311   1.00 32.59 ? 225 GLU B CG  1 
ATOM 4346  C CD  . GLU B 1 225 ? -20.925 7.930   8.310   1.00 32.59 ? 225 GLU B CD  1 
ATOM 4347  O OE1 . GLU B 1 225 ? -20.000 7.681   7.512   1.00 32.59 ? 225 GLU B OE1 1 
ATOM 4348  O OE2 . GLU B 1 225 ? -21.371 7.072   9.107   1.00 32.59 ? 225 GLU B OE2 1 
ATOM 4349  N N   . GLY B 1 226 ? -20.334 12.355  5.853   1.00 17.70 ? 226 GLY B N   1 
ATOM 4350  C CA  . GLY B 1 226 ? -20.240 13.806  5.837   1.00 17.70 ? 226 GLY B CA  1 
ATOM 4351  C C   . GLY B 1 226 ? -19.485 14.255  4.591   1.00 17.70 ? 226 GLY B C   1 
ATOM 4352  O O   . GLY B 1 226 ? -18.787 15.273  4.587   1.00 17.70 ? 226 GLY B O   1 
ATOM 4353  N N   . THR B 1 227 ? -19.633 13.481  3.522   1.00 15.77 ? 227 THR B N   1 
ATOM 4354  C CA  . THR B 1 227 ? -18.961 13.769  2.265   1.00 15.77 ? 227 THR B CA  1 
ATOM 4355  C C   . THR B 1 227 ? -19.918 13.527  1.117   1.00 15.77 ? 227 THR B C   1 
ATOM 4356  O O   . THR B 1 227 ? -21.029 13.058  1.319   1.00 15.77 ? 227 THR B O   1 
ATOM 4357  C CB  . THR B 1 227 ? -17.778 12.822  2.039   1.00 19.64 ? 227 THR B CB  1 
ATOM 4358  O OG1 . THR B 1 227 ? -18.276 11.490  1.837   1.00 19.64 ? 227 THR B OG1 1 
ATOM 4359  C CG2 . THR B 1 227 ? -16.850 12.832  3.233   1.00 19.64 ? 227 THR B CG2 1 
ATOM 4360  N N   . LEU B 1 228 ? -19.466 13.834  -0.090  1.00 28.38 ? 228 LEU B N   1 
ATOM 4361  C CA  . LEU B 1 228 ? -20.256 13.615  -1.286  1.00 28.38 ? 228 LEU B CA  1 
ATOM 4362  C C   . LEU B 1 228 ? -19.287 13.220  -2.386  1.00 28.38 ? 228 LEU B C   1 
ATOM 4363  O O   . LEU B 1 228 ? -18.141 13.670  -2.394  1.00 28.38 ? 228 LEU B O   1 
ATOM 4364  C CB  . LEU B 1 228 ? -21.008 14.882  -1.685  1.00 21.03 ? 228 LEU B CB  1 
ATOM 4365  C CG  . LEU B 1 228 ? -22.261 15.251  -0.891  1.00 21.03 ? 228 LEU B CG  1 
ATOM 4366  C CD1 . LEU B 1 228 ? -22.861 16.520  -1.470  1.00 21.03 ? 228 LEU B CD1 1 
ATOM 4367  C CD2 . LEU B 1 228 ? -23.266 14.115  -0.960  1.00 21.03 ? 228 LEU B CD2 1 
ATOM 4368  N N   . LEU B 1 229 ? -19.738 12.380  -3.307  1.00 17.04 ? 229 LEU B N   1 
ATOM 4369  C CA  . LEU B 1 229 ? -18.886 11.937  -4.400  1.00 17.04 ? 229 LEU B CA  1 
ATOM 4370  C C   . LEU B 1 229 ? -19.350 12.543  -5.720  1.00 17.04 ? 229 LEU B C   1 
ATOM 4371  O O   . LEU B 1 229 ? -20.515 12.425  -6.097  1.00 17.04 ? 229 LEU B O   1 
ATOM 4372  C CB  . LEU B 1 229 ? -18.907 10.410  -4.495  1.00 10.07 ? 229 LEU B CB  1 
ATOM 4373  C CG  . LEU B 1 229 ? -18.125 9.773   -5.640  1.00 10.07 ? 229 LEU B CG  1 
ATOM 4374  C CD1 . LEU B 1 229 ? -16.654 10.046  -5.460  1.00 10.07 ? 229 LEU B CD1 1 
ATOM 4375  C CD2 . LEU B 1 229 ? -18.372 8.285   -5.660  1.00 10.07 ? 229 LEU B CD2 1 
ATOM 4376  N N   . LYS B 1 230 ? -18.437 13.205  -6.417  1.00 21.15 ? 230 LYS B N   1 
ATOM 4377  C CA  . LYS B 1 230 ? -18.759 13.812  -7.697  1.00 21.15 ? 230 LYS B CA  1 
ATOM 4378  C C   . LYS B 1 230 ? -17.924 13.110  -8.754  1.00 21.15 ? 230 LYS B C   1 
ATOM 4379  O O   . LYS B 1 230 ? -16.884 13.611  -9.168  1.00 21.15 ? 230 LYS B O   1 
ATOM 4380  C CB  . LYS B 1 230 ? -18.433 15.310  -7.683  1.00 16.48 ? 230 LYS B CB  1 
ATOM 4381  C CG  . LYS B 1 230 ? -18.727 16.043  -9.000  1.00 16.48 ? 230 LYS B CG  1 
ATOM 4382  C CD  . LYS B 1 230 ? -18.503 17.551  -8.856  1.00 16.48 ? 230 LYS B CD  1 
ATOM 4383  C CE  . LYS B 1 230 ? -18.818 18.309  -10.140 1.00 16.48 ? 230 LYS B CE  1 
ATOM 4384  N NZ  . LYS B 1 230 ? -18.654 19.787  -9.966  1.00 16.48 ? 230 LYS B NZ  1 
ATOM 4385  N N   . PRO B 1 231 ? -18.357 11.919  -9.184  1.00 26.93 ? 231 PRO B N   1 
ATOM 4386  C CA  . PRO B 1 231 ? -17.628 11.161  -10.197 1.00 26.93 ? 231 PRO B CA  1 
ATOM 4387  C C   . PRO B 1 231 ? -18.166 11.431  -11.575 1.00 26.93 ? 231 PRO B C   1 
ATOM 4388  O O   . PRO B 1 231 ? -19.125 12.163  -11.752 1.00 26.93 ? 231 PRO B O   1 
ATOM 4389  C CB  . PRO B 1 231 ? -17.898 9.731   -9.796  1.00 19.68 ? 231 PRO B CB  1 
ATOM 4390  C CG  . PRO B 1 231 ? -19.329 9.810   -9.426  1.00 19.68 ? 231 PRO B CG  1 
ATOM 4391  C CD  . PRO B 1 231 ? -19.383 11.067  -8.560  1.00 19.68 ? 231 PRO B CD  1 
ATOM 4392  N N   . ASN B 1 232 ? -17.539 10.812  -12.551 1.00 25.37 ? 232 ASN B N   1 
ATOM 4393  C CA  . ASN B 1 232 ? -17.949 10.931  -13.929 1.00 25.37 ? 232 ASN B CA  1 
ATOM 4394  C C   . ASN B 1 232 ? -18.926 9.775   -14.121 1.00 25.37 ? 232 ASN B C   1 
ATOM 4395  O O   . ASN B 1 232 ? -18.829 8.784   -13.415 1.00 25.37 ? 232 ASN B O   1 
ATOM 4396  C CB  . ASN B 1 232 ? -16.715 10.733  -14.807 1.00 31.63 ? 232 ASN B CB  1 
ATOM 4397  C CG  . ASN B 1 232 ? -15.945 9.455   -14.455 1.00 31.63 ? 232 ASN B CG  1 
ATOM 4398  O OD1 . ASN B 1 232 ? -16.316 8.359   -14.875 1.00 31.63 ? 232 ASN B OD1 1 
ATOM 4399  N ND2 . ASN B 1 232 ? -14.882 9.594   -13.665 1.00 31.63 ? 232 ASN B ND2 1 
ATOM 4400  N N   . MET B 1 233 ? -19.887 9.888   -15.026 1.00 23.50 ? 233 MET B N   1 
ATOM 4401  C CA  . MET B 1 233 ? -20.767 8.747   -15.244 1.00 23.50 ? 233 MET B CA  1 
ATOM 4402  C C   . MET B 1 233 ? -19.887 7.843   -16.081 1.00 23.50 ? 233 MET B C   1 
ATOM 4403  O O   . MET B 1 233 ? -19.074 8.344   -16.850 1.00 23.50 ? 233 MET B O   1 
ATOM 4404  C CB  . MET B 1 233 ? -21.983 9.127   -16.068 1.00 30.19 ? 233 MET B CB  1 
ATOM 4405  C CG  . MET B 1 233 ? -22.882 10.143  -15.429 1.00 30.19 ? 233 MET B CG  1 
ATOM 4406  S SD  . MET B 1 233 ? -24.264 10.517  -16.521 1.00 30.19 ? 233 MET B SD  1 
ATOM 4407  C CE  . MET B 1 233 ? -25.016 11.866  -15.666 1.00 30.19 ? 233 MET B CE  1 
ATOM 4408  N N   . VAL B 1 234 ? -20.008 6.530   -15.951 1.00 16.76 ? 234 VAL B N   1 
ATOM 4409  C CA  . VAL B 1 234 ? -19.158 5.694   -16.781 1.00 16.76 ? 234 VAL B CA  1 
ATOM 4410  C C   . VAL B 1 234 ? -19.783 5.700   -18.171 1.00 16.76 ? 234 VAL B C   1 
ATOM 4411  O O   . VAL B 1 234 ? -20.959 5.378   -18.332 1.00 16.76 ? 234 VAL B O   1 
ATOM 4412  C CB  . VAL B 1 234 ? -18.982 4.234   -16.208 1.00 12.03 ? 234 VAL B CB  1 
ATOM 4413  C CG1 . VAL B 1 234 ? -19.604 4.132   -14.837 1.00 12.03 ? 234 VAL B CG1 1 
ATOM 4414  C CG2 . VAL B 1 234 ? -19.536 3.188   -17.167 1.00 12.03 ? 234 VAL B CG2 1 
ATOM 4415  N N   . THR B 1 235 ? -18.988 6.113   -19.158 1.00 30.89 ? 235 THR B N   1 
ATOM 4416  C CA  . THR B 1 235 ? -19.422 6.210   -20.547 1.00 30.89 ? 235 THR B CA  1 
ATOM 4417  C C   . THR B 1 235 ? -18.236 6.007   -21.484 1.00 30.89 ? 235 THR B C   1 
ATOM 4418  O O   . THR B 1 235 ? -17.080 6.131   -21.076 1.00 30.89 ? 235 THR B O   1 
ATOM 4419  C CB  . THR B 1 235 ? -19.985 7.593   -20.852 1.00 21.98 ? 235 THR B CB  1 
ATOM 4420  O OG1 . THR B 1 235 ? -18.906 8.528   -20.944 1.00 21.98 ? 235 THR B OG1 1 
ATOM 4421  C CG2 . THR B 1 235 ? -20.924 8.039   -19.760 1.00 21.98 ? 235 THR B CG2 1 
ATOM 4422  N N   . PRO B 1 236 ? -18.512 5.734   -22.768 1.00 24.17 ? 236 PRO B N   1 
ATOM 4423  C CA  . PRO B 1 236 ? -17.468 5.512   -23.771 1.00 24.17 ? 236 PRO B CA  1 
ATOM 4424  C C   . PRO B 1 236 ? -16.677 6.785   -23.968 1.00 24.17 ? 236 PRO B C   1 
ATOM 4425  O O   . PRO B 1 236 ? -17.136 7.864   -23.585 1.00 24.17 ? 236 PRO B O   1 
ATOM 4426  C CB  . PRO B 1 236 ? -18.258 5.165   -25.033 1.00 32.79 ? 236 PRO B CB  1 
ATOM 4427  C CG  . PRO B 1 236 ? -19.613 4.781   -24.526 1.00 32.79 ? 236 PRO B CG  1 
ATOM 4428  C CD  . PRO B 1 236 ? -19.836 5.732   -23.403 1.00 32.79 ? 236 PRO B CD  1 
ATOM 4429  N N   . GLY B 1 237 ? -15.499 6.660   -24.572 1.00 34.11 ? 237 GLY B N   1 
ATOM 4430  C CA  . GLY B 1 237 ? -14.677 7.826   -24.821 1.00 34.11 ? 237 GLY B CA  1 
ATOM 4431  C C   . GLY B 1 237 ? -15.322 8.666   -25.906 1.00 34.11 ? 237 GLY B C   1 
ATOM 4432  O O   . GLY B 1 237 ? -16.037 8.117   -26.747 1.00 34.11 ? 237 GLY B O   1 
ATOM 4433  N N   . HIS B 1 238 ? -15.090 9.981   -25.893 1.00 40.19 ? 238 HIS B N   1 
ATOM 4434  C CA  . HIS B 1 238 ? -15.669 10.866  -26.900 1.00 40.19 ? 238 HIS B CA  1 
ATOM 4435  C C   . HIS B 1 238 ? -15.467 10.285  -28.286 1.00 40.19 ? 238 HIS B C   1 
ATOM 4436  O O   . HIS B 1 238 ? -16.344 10.379  -29.145 1.00 40.19 ? 238 HIS B O   1 
ATOM 4437  C CB  . HIS B 1 238 ? -15.026 12.253  -26.864 1.00 88.73 ? 238 HIS B CB  1 
ATOM 4438  C CG  . HIS B 1 238 ? -15.428 13.077  -25.684 1.00 88.73 ? 238 HIS B CG  1 
ATOM 4439  N ND1 . HIS B 1 238 ? -16.737 13.177  -25.262 1.00 88.73 ? 238 HIS B ND1 1 
ATOM 4440  C CD2 . HIS B 1 238 ? -14.700 13.857  -24.851 1.00 88.73 ? 238 HIS B CD2 1 
ATOM 4441  C CE1 . HIS B 1 238 ? -16.798 13.985  -24.216 1.00 88.73 ? 238 HIS B CE1 1 
ATOM 4442  N NE2 . HIS B 1 238 ? -15.577 14.410  -23.946 1.00 88.73 ? 238 HIS B NE2 1 
ATOM 4443  N N   . ALA B 1 239 ? -14.308 9.671   -28.488 1.00 35.04 ? 239 ALA B N   1 
ATOM 4444  C CA  . ALA B 1 239 ? -13.962 9.090   -29.774 1.00 35.04 ? 239 ALA B CA  1 
ATOM 4445  C C   . ALA B 1 239 ? -14.390 7.644   -29.982 1.00 35.04 ? 239 ALA B C   1 
ATOM 4446  O O   . ALA B 1 239 ? -14.008 7.035   -30.979 1.00 35.04 ? 239 ALA B O   1 
ATOM 4447  C CB  . ALA B 1 239 ? -12.467 9.212   -29.996 1.00 29.65 ? 239 ALA B CB  1 
ATOM 4448  N N   . CYS B 1 240 ? -15.160 7.070   -29.064 1.00 41.31 ? 240 CYS B N   1 
ATOM 4449  C CA  . CYS B 1 240 ? -15.580 5.694   -29.281 1.00 41.31 ? 240 CYS B CA  1 
ATOM 4450  C C   . CYS B 1 240 ? -16.672 5.693   -30.337 1.00 41.31 ? 240 CYS B C   1 
ATOM 4451  O O   . CYS B 1 240 ? -17.620 6.473   -30.270 1.00 41.31 ? 240 CYS B O   1 
ATOM 4452  C CB  . CYS B 1 240 ? -16.111 5.042   -28.014 1.00 36.57 ? 240 CYS B CB  1 
ATOM 4453  S SG  . CYS B 1 240 ? -16.610 3.333   -28.349 1.00 36.57 ? 240 CYS B SG  1 
ATOM 4454  N N   . PRO B 1 241 ? -16.553 4.803   -31.326 1.00 54.14 ? 241 PRO B N   1 
ATOM 4455  C CA  . PRO B 1 241 ? -17.515 4.676   -32.427 1.00 54.14 ? 241 PRO B CA  1 
ATOM 4456  C C   . PRO B 1 241 ? -18.861 4.110   -31.984 1.00 54.14 ? 241 PRO B C   1 
ATOM 4457  O O   . PRO B 1 241 ? -19.917 4.520   -32.472 1.00 54.14 ? 241 PRO B O   1 
ATOM 4458  C CB  . PRO B 1 241 ? -16.810 3.726   -33.398 1.00 49.23 ? 241 PRO B CB  1 
ATOM 4459  C CG  . PRO B 1 241 ? -15.351 3.715   -32.940 1.00 49.23 ? 241 PRO B CG  1 
ATOM 4460  C CD  . PRO B 1 241 ? -15.471 3.816   -31.458 1.00 49.23 ? 241 PRO B CD  1 
ATOM 4461  N N   . ILE B 1 242 ? -18.805 3.158   -31.060 1.00 39.31 ? 242 ILE B N   1 
ATOM 4462  C CA  . ILE B 1 242 ? -19.986 2.481   -30.546 1.00 39.31 ? 242 ILE B CA  1 
ATOM 4463  C C   . ILE B 1 242 ? -21.036 3.372   -29.901 1.00 39.31 ? 242 ILE B C   1 
ATOM 4464  O O   . ILE B 1 242 ? -20.716 4.305   -29.160 1.00 39.31 ? 242 ILE B O   1 
ATOM 4465  C CB  . ILE B 1 242 ? -19.585 1.426   -29.529 1.00 30.26 ? 242 ILE B CB  1 
ATOM 4466  C CG1 . ILE B 1 242 ? -18.519 0.511   -30.140 1.00 30.26 ? 242 ILE B CG1 1 
ATOM 4467  C CG2 . ILE B 1 242 ? -20.816 0.658   -29.089 1.00 30.26 ? 242 ILE B CG2 1 
ATOM 4468  C CD1 . ILE B 1 242 ? -17.959 -0.526  -29.177 1.00 30.26 ? 242 ILE B CD1 1 
ATOM 4469  N N   . LYS B 1 243 ? -22.297 3.054   -30.174 1.00 51.30 ? 243 LYS B N   1 
ATOM 4470  C CA  . LYS B 1 243 ? -23.425 3.809   -29.643 1.00 51.30 ? 243 LYS B CA  1 
ATOM 4471  C C   . LYS B 1 243 ? -24.022 3.045   -28.465 1.00 51.30 ? 243 LYS B C   1 
ATOM 4472  O O   . LYS B 1 243 ? -24.169 1.818   -28.524 1.00 51.30 ? 243 LYS B O   1 
ATOM 4473  C CB  . LYS B 1 243 ? -24.465 3.997   -30.749 1.00 99.18 ? 243 LYS B CB  1 
ATOM 4474  C CG  . LYS B 1 243 ? -23.876 4.637   -32.004 1.00 99.18 ? 243 LYS B CG  1 
ATOM 4475  C CD  . LYS B 1 243 ? -24.606 4.225   -33.280 1.00 99.18 ? 243 LYS B CD  1 
ATOM 4476  C CE  . LYS B 1 243 ? -23.843 4.708   -34.514 1.00 99.18 ? 243 LYS B CE  1 
ATOM 4477  N NZ  . LYS B 1 243 ? -24.449 4.236   -35.789 1.00 99.18 ? 243 LYS B NZ  1 
ATOM 4478  N N   . TYR B 1 244 ? -24.360 3.767   -27.398 1.00 36.26 ? 244 TYR B N   1 
ATOM 4479  C CA  . TYR B 1 244 ? -24.925 3.134   -26.210 1.00 36.26 ? 244 TYR B CA  1 
ATOM 4480  C C   . TYR B 1 244 ? -26.226 3.760   -25.724 1.00 36.26 ? 244 TYR B C   1 
ATOM 4481  O O   . TYR B 1 244 ? -26.430 4.972   -25.836 1.00 36.26 ? 244 TYR B O   1 
ATOM 4482  C CB  . TYR B 1 244 ? -23.925 3.167   -25.054 1.00 32.09 ? 244 TYR B CB  1 
ATOM 4483  C CG  . TYR B 1 244 ? -22.677 2.349   -25.262 1.00 32.09 ? 244 TYR B CG  1 
ATOM 4484  C CD1 . TYR B 1 244 ? -21.629 2.819   -26.050 1.00 32.09 ? 244 TYR B CD1 1 
ATOM 4485  C CD2 . TYR B 1 244 ? -22.533 1.110   -24.649 1.00 32.09 ? 244 TYR B CD2 1 
ATOM 4486  C CE1 . TYR B 1 244 ? -20.462 2.073   -26.218 1.00 32.09 ? 244 TYR B CE1 1 
ATOM 4487  C CE2 . TYR B 1 244 ? -21.378 0.359   -24.812 1.00 32.09 ? 244 TYR B CE2 1 
ATOM 4488  C CZ  . TYR B 1 244 ? -20.343 0.844   -25.595 1.00 32.09 ? 244 TYR B CZ  1 
ATOM 4489  O OH  . TYR B 1 244 ? -19.197 0.091   -25.742 1.00 32.09 ? 244 TYR B OH  1 
ATOM 4490  N N   . THR B 1 245 ? -27.091 2.921   -25.160 1.00 36.12 ? 245 THR B N   1 
ATOM 4491  C CA  . THR B 1 245 ? -28.377 3.354   -24.625 1.00 36.12 ? 245 THR B CA  1 
ATOM 4492  C C   . THR B 1 245 ? -28.132 4.062   -23.316 1.00 36.12 ? 245 THR B C   1 
ATOM 4493  O O   . THR B 1 245 ? -27.229 3.689   -22.565 1.00 36.12 ? 245 THR B O   1 
ATOM 4494  C CB  . THR B 1 245 ? -29.266 2.169   -24.239 1.00 48.29 ? 245 THR B CB  1 
ATOM 4495  O OG1 . THR B 1 245 ? -28.981 1.053   -25.085 1.00 48.29 ? 245 THR B OG1 1 
ATOM 4496  C CG2 . THR B 1 245 ? -30.721 2.542   -24.357 1.00 48.29 ? 245 THR B CG2 1 
ATOM 4497  N N   . PRO B 1 246 ? -28.920 5.101   -23.014 1.00 36.10 ? 246 PRO B N   1 
ATOM 4498  C CA  . PRO B 1 246 ? -28.687 5.761   -21.730 1.00 36.10 ? 246 PRO B CA  1 
ATOM 4499  C C   . PRO B 1 246 ? -28.990 4.702   -20.669 1.00 36.10 ? 246 PRO B C   1 
ATOM 4500  O O   . PRO B 1 246 ? -28.612 4.826   -19.509 1.00 36.10 ? 246 PRO B O   1 
ATOM 4501  C CB  . PRO B 1 246 ? -29.690 6.914   -21.739 1.00 29.30 ? 246 PRO B CB  1 
ATOM 4502  C CG  . PRO B 1 246 ? -30.726 6.476   -22.720 1.00 29.30 ? 246 PRO B CG  1 
ATOM 4503  C CD  . PRO B 1 246 ? -29.920 5.828   -23.802 1.00 29.30 ? 246 PRO B CD  1 
ATOM 4504  N N   . GLU B 1 247 ? -29.676 3.648   -21.098 1.00 28.34 ? 247 GLU B N   1 
ATOM 4505  C CA  . GLU B 1 247 ? -29.993 2.535   -20.217 1.00 28.34 ? 247 GLU B CA  1 
ATOM 4506  C C   . GLU B 1 247 ? -28.672 1.850   -19.910 1.00 28.34 ? 247 GLU B C   1 
ATOM 4507  O O   . GLU B 1 247 ? -28.331 1.621   -18.747 1.00 28.34 ? 247 GLU B O   1 
ATOM 4508  C CB  . GLU B 1 247 ? -30.920 1.542   -20.917 1.00 62.17 ? 247 GLU B CB  1 
ATOM 4509  C CG  . GLU B 1 247 ? -32.399 1.842   -20.773 1.00 62.17 ? 247 GLU B CG  1 
ATOM 4510  C CD  . GLU B 1 247 ? -32.781 3.234   -21.253 1.00 62.17 ? 247 GLU B CD  1 
ATOM 4511  O OE1 . GLU B 1 247 ? -32.514 3.566   -22.433 1.00 62.17 ? 247 GLU B OE1 1 
ATOM 4512  O OE2 . GLU B 1 247 ? -33.359 3.997   -20.443 1.00 62.17 ? 247 GLU B OE2 1 
ATOM 4513  N N   . GLU B 1 248 ? -27.933 1.534   -20.973 1.00 31.37 ? 248 GLU B N   1 
ATOM 4514  C CA  . GLU B 1 248 ? -26.640 0.867   -20.868 1.00 31.37 ? 248 GLU B CA  1 
ATOM 4515  C C   . GLU B 1 248 ? -25.655 1.675   -20.028 1.00 31.37 ? 248 GLU B C   1 
ATOM 4516  O O   . GLU B 1 248 ? -24.889 1.124   -19.237 1.00 31.37 ? 248 GLU B O   1 
ATOM 4517  C CB  . GLU B 1 248 ? -26.066 0.639   -22.265 1.00 46.06 ? 248 GLU B CB  1 
ATOM 4518  C CG  . GLU B 1 248 ? -26.968 -0.179  -23.156 1.00 46.06 ? 248 GLU B CG  1 
ATOM 4519  C CD  . GLU B 1 248 ? -26.354 -0.461  -24.511 1.00 46.06 ? 248 GLU B CD  1 
ATOM 4520  O OE1 . GLU B 1 248 ? -26.080 0.506   -25.258 1.00 46.06 ? 248 GLU B OE1 1 
ATOM 4521  O OE2 . GLU B 1 248 ? -26.147 -1.654  -24.827 1.00 46.06 ? 248 GLU B OE2 1 
ATOM 4522  N N   . ILE B 1 249 ? -25.677 2.988   -20.210 1.00 26.07 ? 249 ILE B N   1 
ATOM 4523  C CA  . ILE B 1 249 ? -24.797 3.855   -19.458 1.00 26.07 ? 249 ILE B CA  1 
ATOM 4524  C C   . ILE B 1 249 ? -25.180 3.819   -17.992 1.00 26.07 ? 249 ILE B C   1 
ATOM 4525  O O   . ILE B 1 249 ? -24.319 3.707   -17.121 1.00 26.07 ? 249 ILE B O   1 
ATOM 4526  C CB  . ILE B 1 249 ? -24.891 5.284   -19.967 1.00 25.73 ? 249 ILE B CB  1 
ATOM 4527  C CG1 . ILE B 1 249 ? -24.196 5.370   -21.321 1.00 25.73 ? 249 ILE B CG1 1 
ATOM 4528  C CG2 . ILE B 1 249 ? -24.287 6.239   -18.964 1.00 25.73 ? 249 ILE B CG2 1 
ATOM 4529  C CD1 . ILE B 1 249 ? -24.256 6.734   -21.937 1.00 25.73 ? 249 ILE B CD1 1 
ATOM 4530  N N   . ALA B 1 250 ? -26.476 3.908   -17.721 1.00 20.79 ? 250 ALA B N   1 
ATOM 4531  C CA  . ALA B 1 250 ? -26.960 3.884   -16.348 1.00 20.79 ? 250 ALA B CA  1 
ATOM 4532  C C   . ALA B 1 250 ? -26.587 2.560   -15.692 1.00 20.79 ? 250 ALA B C   1 
ATOM 4533  O O   . ALA B 1 250 ? -26.196 2.516   -14.524 1.00 20.79 ? 250 ALA B O   1 
ATOM 4534  C CB  . ALA B 1 250 ? -28.471 4.074   -16.326 1.00 18.99 ? 250 ALA B CB  1 
ATOM 4535  N N   . MET B 1 251 ? -26.702 1.482   -16.458 1.00 23.11 ? 251 MET B N   1 
ATOM 4536  C CA  . MET B 1 251 ? -26.391 0.153   -15.954 1.00 23.11 ? 251 MET B CA  1 
ATOM 4537  C C   . MET B 1 251 ? -24.937 0.062   -15.496 1.00 23.11 ? 251 MET B C   1 
ATOM 4538  O O   . MET B 1 251 ? -24.658 -0.403  -14.390 1.00 23.11 ? 251 MET B O   1 
ATOM 4539  C CB  . MET B 1 251 ? -26.676 -0.890  -17.039 1.00 54.11 ? 251 MET B CB  1 
ATOM 4540  C CG  . MET B 1 251 ? -26.681 -2.328  -16.546 1.00 54.11 ? 251 MET B CG  1 
ATOM 4541  S SD  . MET B 1 251 ? -27.762 -2.571  -15.116 1.00 54.11 ? 251 MET B SD  1 
ATOM 4542  C CE  . MET B 1 251 ? -29.415 -2.408  -15.868 1.00 54.11 ? 251 MET B CE  1 
ATOM 4543  N N   . ALA B 1 252 ? -24.012 0.520   -16.336 1.00 29.46 ? 252 ALA B N   1 
ATOM 4544  C CA  . ALA B 1 252 ? -22.591 0.472   -16.004 1.00 29.46 ? 252 ALA B CA  1 
ATOM 4545  C C   . ALA B 1 252 ? -22.243 1.411   -14.860 1.00 29.46 ? 252 ALA B C   1 
ATOM 4546  O O   . ALA B 1 252 ? -21.504 1.049   -13.942 1.00 29.46 ? 252 ALA B O   1 
ATOM 4547  C CB  . ALA B 1 252 ? -21.773 0.823   -17.214 1.00 3.76  ? 252 ALA B CB  1 
ATOM 4548  N N   . THR B 1 253 ? -22.777 2.623   -14.927 1.00 20.23 ? 253 THR B N   1 
ATOM 4549  C CA  . THR B 1 253 ? -22.535 3.619   -13.901 1.00 20.23 ? 253 THR B CA  1 
ATOM 4550  C C   . THR B 1 253 ? -22.982 3.153   -12.529 1.00 20.23 ? 253 THR B C   1 
ATOM 4551  O O   . THR B 1 253 ? -22.239 3.253   -11.558 1.00 20.23 ? 253 THR B O   1 
ATOM 4552  C CB  . THR B 1 253 ? -23.254 4.925   -14.233 1.00 17.02 ? 253 THR B CB  1 
ATOM 4553  O OG1 . THR B 1 253 ? -22.666 5.498   -15.408 1.00 17.02 ? 253 THR B OG1 1 
ATOM 4554  C CG2 . THR B 1 253 ? -23.150 5.900   -13.076 1.00 17.02 ? 253 THR B CG2 1 
ATOM 4555  N N   . VAL B 1 254 ? -24.200 2.641   -12.434 1.00 25.50 ? 254 VAL B N   1 
ATOM 4556  C CA  . VAL B 1 254 ? -24.683 2.184   -11.144 1.00 25.50 ? 254 VAL B CA  1 
ATOM 4557  C C   . VAL B 1 254 ? -23.918 0.947   -10.674 1.00 25.50 ? 254 VAL B C   1 
ATOM 4558  O O   . VAL B 1 254 ? -23.611 0.810   -9.491  1.00 25.50 ? 254 VAL B O   1 
ATOM 4559  C CB  . VAL B 1 254 ? -26.192 1.899   -11.200 1.00 9.84  ? 254 VAL B CB  1 
ATOM 4560  C CG1 . VAL B 1 254 ? -26.677 1.299   -9.876  1.00 9.84  ? 254 VAL B CG1 1 
ATOM 4561  C CG2 . VAL B 1 254 ? -26.935 3.192   -11.490 1.00 9.84  ? 254 VAL B CG2 1 
ATOM 4562  N N   . THR B 1 255 ? -23.592 0.047   -11.592 1.00 23.01 ? 255 THR B N   1 
ATOM 4563  C CA  . THR B 1 255 ? -22.854 -1.136  -11.192 1.00 23.01 ? 255 THR B CA  1 
ATOM 4564  C C   . THR B 1 255 ? -21.523 -0.721  -10.592 1.00 23.01 ? 255 THR B C   1 
ATOM 4565  O O   . THR B 1 255 ? -21.147 -1.169  -9.510  1.00 23.01 ? 255 THR B O   1 
ATOM 4566  C CB  . THR B 1 255 ? -22.562 -2.045  -12.367 1.00 20.86 ? 255 THR B CB  1 
ATOM 4567  O OG1 . THR B 1 255 ? -23.790 -2.497  -12.937 1.00 20.86 ? 255 THR B OG1 1 
ATOM 4568  C CG2 . THR B 1 255 ? -21.764 -3.237  -11.904 1.00 20.86 ? 255 THR B CG2 1 
ATOM 4569  N N   . ALA B 1 256 ? -20.810 0.142   -11.303 1.00 22.73 ? 256 ALA B N   1 
ATOM 4570  C CA  . ALA B 1 256 ? -19.518 0.611   -10.835 1.00 22.73 ? 256 ALA B CA  1 
ATOM 4571  C C   . ALA B 1 256 ? -19.636 1.196   -9.432  1.00 22.73 ? 256 ALA B C   1 
ATOM 4572  O O   . ALA B 1 256 ? -18.922 0.795   -8.511  1.00 22.73 ? 256 ALA B O   1 
ATOM 4573  C CB  . ALA B 1 256 ? -18.981 1.649   -11.792 1.00 4.99  ? 256 ALA B CB  1 
ATOM 4574  N N   . LEU B 1 257 ? -20.552 2.142   -9.273  1.00 23.64 ? 257 LEU B N   1 
ATOM 4575  C CA  . LEU B 1 257 ? -20.753 2.787   -7.988  1.00 23.64 ? 257 LEU B CA  1 
ATOM 4576  C C   . LEU B 1 257 ? -21.098 1.821   -6.870  1.00 23.64 ? 257 LEU B C   1 
ATOM 4577  O O   . LEU B 1 257 ? -20.588 1.959   -5.759  1.00 23.64 ? 257 LEU B O   1 
ATOM 4578  C CB  . LEU B 1 257 ? -21.852 3.850   -8.083  1.00 10.29 ? 257 LEU B CB  1 
ATOM 4579  C CG  . LEU B 1 257 ? -21.494 5.162   -8.778  1.00 10.29 ? 257 LEU B CG  1 
ATOM 4580  C CD1 . LEU B 1 257 ? -22.686 6.088   -8.767  1.00 10.29 ? 257 LEU B CD1 1 
ATOM 4581  C CD2 . LEU B 1 257 ? -20.336 5.816   -8.056  1.00 10.29 ? 257 LEU B CD2 1 
ATOM 4582  N N   . ARG B 1 258 ? -21.944 0.837   -7.143  1.00 24.63 ? 258 ARG B N   1 
ATOM 4583  C CA  . ARG B 1 258 ? -22.315 -0.070  -6.072  1.00 24.63 ? 258 ARG B CA  1 
ATOM 4584  C C   . ARG B 1 258 ? -21.305 -1.165  -5.786  1.00 24.63 ? 258 ARG B C   1 
ATOM 4585  O O   . ARG B 1 258 ? -21.542 -2.039  -4.949  1.00 24.63 ? 258 ARG B O   1 
ATOM 4586  C CB  . ARG B 1 258 ? -23.716 -0.650  -6.309  1.00 30.79 ? 258 ARG B CB  1 
ATOM 4587  C CG  . ARG B 1 258 ? -23.897 -1.522  -7.519  1.00 30.79 ? 258 ARG B CG  1 
ATOM 4588  C CD  . ARG B 1 258 ? -25.389 -1.631  -7.836  1.00 30.79 ? 258 ARG B CD  1 
ATOM 4589  N NE  . ARG B 1 258 ? -26.199 -1.928  -6.651  1.00 30.79 ? 258 ARG B NE  1 
ATOM 4590  C CZ  . ARG B 1 258 ? -26.334 -3.135  -6.102  1.00 30.79 ? 258 ARG B CZ  1 
ATOM 4591  N NH1 . ARG B 1 258 ? -25.711 -4.187  -6.630  1.00 30.79 ? 258 ARG B NH1 1 
ATOM 4592  N NH2 . ARG B 1 258 ? -27.090 -3.285  -5.018  1.00 30.79 ? 258 ARG B NH2 1 
ATOM 4593  N N   . ARG B 1 259 ? -20.166 -1.102  -6.463  1.00 25.44 ? 259 ARG B N   1 
ATOM 4594  C CA  . ARG B 1 259 ? -19.096 -2.066  -6.238  1.00 25.44 ? 259 ARG B CA  1 
ATOM 4595  C C   . ARG B 1 259 ? -17.980 -1.380  -5.478  1.00 25.44 ? 259 ARG B C   1 
ATOM 4596  O O   . ARG B 1 259 ? -17.020 -2.021  -5.055  1.00 25.44 ? 259 ARG B O   1 
ATOM 4597  C CB  . ARG B 1 259 ? -18.524 -2.553  -7.555  1.00 16.50 ? 259 ARG B CB  1 
ATOM 4598  C CG  . ARG B 1 259 ? -19.362 -3.571  -8.234  1.00 16.50 ? 259 ARG B CG  1 
ATOM 4599  C CD  . ARG B 1 259 ? -18.822 -3.846  -9.598  1.00 16.50 ? 259 ARG B CD  1 
ATOM 4600  N NE  . ARG B 1 259 ? -19.528 -4.949  -10.233 1.00 16.50 ? 259 ARG B NE  1 
ATOM 4601  C CZ  . ARG B 1 259 ? -19.330 -5.316  -11.497 1.00 16.50 ? 259 ARG B CZ  1 
ATOM 4602  N NH1 . ARG B 1 259 ? -18.446 -4.659  -12.246 1.00 16.50 ? 259 ARG B NH1 1 
ATOM 4603  N NH2 . ARG B 1 259 ? -20.019 -6.330  -12.015 1.00 16.50 ? 259 ARG B NH2 1 
ATOM 4604  N N   . THR B 1 260 ? -18.123 -0.072  -5.290  1.00 15.63 ? 260 THR B N   1 
ATOM 4605  C CA  . THR B 1 260 ? -17.084 0.702   -4.645  1.00 15.63 ? 260 THR B CA  1 
ATOM 4606  C C   . THR B 1 260 ? -17.498 1.712   -3.586  1.00 15.63 ? 260 THR B C   1 
ATOM 4607  O O   . THR B 1 260 ? -16.788 1.885   -2.599  1.00 15.63 ? 260 THR B O   1 
ATOM 4608  C CB  . THR B 1 260 ? -16.279 1.441   -5.713  1.00 12.51 ? 260 THR B CB  1 
ATOM 4609  O OG1 . THR B 1 260 ? -17.139 2.348   -6.414  1.00 12.51 ? 260 THR B OG1 1 
ATOM 4610  C CG2 . THR B 1 260 ? -15.712 0.458   -6.714  1.00 12.51 ? 260 THR B CG2 1 
ATOM 4611  N N   . VAL B 1 261 ? -18.623 2.391   -3.773  1.00 16.75 ? 261 VAL B N   1 
ATOM 4612  C CA  . VAL B 1 261 ? -19.035 3.393   -2.788  1.00 16.75 ? 261 VAL B CA  1 
ATOM 4613  C C   . VAL B 1 261 ? -19.744 2.815   -1.560  1.00 16.75 ? 261 VAL B C   1 
ATOM 4614  O O   . VAL B 1 261 ? -20.724 2.103   -1.679  1.00 16.75 ? 261 VAL B O   1 
ATOM 4615  C CB  . VAL B 1 261 ? -19.950 4.461   -3.420  1.00 10.92 ? 261 VAL B CB  1 
ATOM 4616  C CG1 . VAL B 1 261 ? -20.173 5.597   -2.430  1.00 10.92 ? 261 VAL B CG1 1 
ATOM 4617  C CG2 . VAL B 1 261 ? -19.329 4.985   -4.711  1.00 10.92 ? 261 VAL B CG2 1 
ATOM 4618  N N   . PRO B 1 262 ? -19.231 3.087   -0.356  1.00 23.81 ? 262 PRO B N   1 
ATOM 4619  C CA  . PRO B 1 262 ? -19.942 2.518   0.794   1.00 23.81 ? 262 PRO B CA  1 
ATOM 4620  C C   . PRO B 1 262 ? -21.311 3.169   0.990   1.00 23.81 ? 262 PRO B C   1 
ATOM 4621  O O   . PRO B 1 262 ? -21.495 4.346   0.687   1.00 23.81 ? 262 PRO B O   1 
ATOM 4622  C CB  . PRO B 1 262 ? -18.991 2.795   1.957   1.00 24.02 ? 262 PRO B CB  1 
ATOM 4623  C CG  . PRO B 1 262 ? -17.645 2.721   1.293   1.00 24.02 ? 262 PRO B CG  1 
ATOM 4624  C CD  . PRO B 1 262 ? -17.863 3.493   0.014   1.00 24.02 ? 262 PRO B CD  1 
ATOM 4625  N N   . PRO B 1 263 ? -22.290 2.403   1.494   1.00 20.27 ? 263 PRO B N   1 
ATOM 4626  C CA  . PRO B 1 263 ? -23.657 2.854   1.748   1.00 20.27 ? 263 PRO B CA  1 
ATOM 4627  C C   . PRO B 1 263 ? -23.698 4.122   2.556   1.00 20.27 ? 263 PRO B C   1 
ATOM 4628  O O   . PRO B 1 263 ? -24.639 4.897   2.441   1.00 20.27 ? 263 PRO B O   1 
ATOM 4629  C CB  . PRO B 1 263 ? -24.258 1.698   2.523   1.00 21.55 ? 263 PRO B CB  1 
ATOM 4630  C CG  . PRO B 1 263 ? -23.604 0.548   1.912   1.00 21.55 ? 263 PRO B CG  1 
ATOM 4631  C CD  . PRO B 1 263 ? -22.160 0.979   1.834   1.00 21.55 ? 263 PRO B CD  1 
ATOM 4632  N N   . ALA B 1 264 ? -22.675 4.328   3.377   1.00 14.42 ? 264 ALA B N   1 
ATOM 4633  C CA  . ALA B 1 264 ? -22.608 5.511   4.232   1.00 14.42 ? 264 ALA B CA  1 
ATOM 4634  C C   . ALA B 1 264 ? -22.525 6.841   3.484   1.00 14.42 ? 264 ALA B C   1 
ATOM 4635  O O   . ALA B 1 264 ? -22.868 7.887   4.032   1.00 14.42 ? 264 ALA B O   1 
ATOM 4636  C CB  . ALA B 1 264 ? -21.432 5.389   5.216   1.00 0.51  ? 264 ALA B CB  1 
ATOM 4637  N N   . VAL B 1 265 ? -22.060 6.821   2.244   1.00 28.58 ? 265 VAL B N   1 
ATOM 4638  C CA  . VAL B 1 265 ? -21.981 8.062   1.496   1.00 28.58 ? 265 VAL B CA  1 
ATOM 4639  C C   . VAL B 1 265 ? -23.413 8.484   1.176   1.00 28.58 ? 265 VAL B C   1 
ATOM 4640  O O   . VAL B 1 265 ? -24.159 7.746   0.519   1.00 28.58 ? 265 VAL B O   1 
ATOM 4641  C CB  . VAL B 1 265 ? -21.182 7.873   0.205   1.00 18.47 ? 265 VAL B CB  1 
ATOM 4642  C CG1 . VAL B 1 265 ? -21.162 9.166   -0.580  1.00 18.47 ? 265 VAL B CG1 1 
ATOM 4643  C CG2 . VAL B 1 265 ? -19.772 7.422   0.537   1.00 18.47 ? 265 VAL B CG2 1 
ATOM 4644  N N   . PRO B 1 266 ? -23.821 9.673   1.648   1.00 21.11 ? 266 PRO B N   1 
ATOM 4645  C CA  . PRO B 1 266 ? -25.167 10.198  1.422   1.00 21.11 ? 266 PRO B CA  1 
ATOM 4646  C C   . PRO B 1 266 ? -25.582 10.368  -0.027  1.00 21.11 ? 266 PRO B C   1 
ATOM 4647  O O   . PRO B 1 266 ? -26.714 10.050  -0.385  1.00 21.11 ? 266 PRO B O   1 
ATOM 4648  C CB  . PRO B 1 266 ? -25.161 11.518  2.188   1.00 24.86 ? 266 PRO B CB  1 
ATOM 4649  C CG  . PRO B 1 266 ? -23.741 11.928  2.154   1.00 24.86 ? 266 PRO B CG  1 
ATOM 4650  C CD  . PRO B 1 266 ? -23.024 10.631  2.431   1.00 24.86 ? 266 PRO B CD  1 
ATOM 4651  N N   . GLY B 1 267 ? -24.688 10.857  -0.872  1.00 24.06 ? 267 GLY B N   1 
ATOM 4652  C CA  . GLY B 1 267 ? -25.084 11.029  -2.254  1.00 24.06 ? 267 GLY B CA  1 
ATOM 4653  C C   . GLY B 1 267 ? -23.950 11.163  -3.238  1.00 24.06 ? 267 GLY B C   1 
ATOM 4654  O O   . GLY B 1 267 ? -22.848 11.579  -2.889  1.00 24.06 ? 267 GLY B O   1 
ATOM 4655  N N   . VAL B 1 268 ? -24.235 10.799  -4.480  1.00 17.10 ? 268 VAL B N   1 
ATOM 4656  C CA  . VAL B 1 268 ? -23.272 10.878  -5.562  1.00 17.10 ? 268 VAL B CA  1 
ATOM 4657  C C   . VAL B 1 268 ? -23.802 11.956  -6.491  1.00 17.10 ? 268 VAL B C   1 
ATOM 4658  O O   . VAL B 1 268 ? -24.889 11.812  -7.047  1.00 17.10 ? 268 VAL B O   1 
ATOM 4659  C CB  . VAL B 1 268 ? -23.216 9.562   -6.339  1.00 20.48 ? 268 VAL B CB  1 
ATOM 4660  C CG1 . VAL B 1 268 ? -22.174 9.649   -7.433  1.00 20.48 ? 268 VAL B CG1 1 
ATOM 4661  C CG2 . VAL B 1 268 ? -22.925 8.413   -5.398  1.00 20.48 ? 268 VAL B CG2 1 
ATOM 4662  N N   . THR B 1 269 ? -23.055 13.041  -6.658  1.00 17.02 ? 269 THR B N   1 
ATOM 4663  C CA  . THR B 1 269 ? -23.504 14.121  -7.529  1.00 17.02 ? 269 THR B CA  1 
ATOM 4664  C C   . THR B 1 269 ? -22.702 14.097  -8.833  1.00 17.02 ? 269 THR B C   1 
ATOM 4665  O O   . THR B 1 269 ? -21.638 14.709  -8.931  1.00 17.02 ? 269 THR B O   1 
ATOM 4666  C CB  . THR B 1 269 ? -23.322 15.485  -6.839  1.00 20.90 ? 269 THR B CB  1 
ATOM 4667  O OG1 . THR B 1 269 ? -21.937 15.834  -6.837  1.00 20.90 ? 269 THR B OG1 1 
ATOM 4668  C CG2 . THR B 1 269 ? -23.800 15.420  -5.392  1.00 20.90 ? 269 THR B CG2 1 
ATOM 4669  N N   . PHE B 1 270 ? -23.219 13.391  -9.836  1.00 25.38 ? 270 PHE B N   1 
ATOM 4670  C CA  . PHE B 1 270 ? -22.530 13.272  -11.115 1.00 25.38 ? 270 PHE B CA  1 
ATOM 4671  C C   . PHE B 1 270 ? -22.125 14.588  -11.758 1.00 25.38 ? 270 PHE B C   1 
ATOM 4672  O O   . PHE B 1 270 ? -22.754 15.627  -11.553 1.00 25.38 ? 270 PHE B O   1 
ATOM 4673  C CB  . PHE B 1 270 ? -23.377 12.493  -12.116 1.00 23.21 ? 270 PHE B CB  1 
ATOM 4674  C CG  . PHE B 1 270 ? -23.649 11.086  -11.707 1.00 23.21 ? 270 PHE B CG  1 
ATOM 4675  C CD1 . PHE B 1 270 ? -24.868 10.737  -11.139 1.00 23.21 ? 270 PHE B CD1 1 
ATOM 4676  C CD2 . PHE B 1 270 ? -22.678 10.111  -11.855 1.00 23.21 ? 270 PHE B CD2 1 
ATOM 4677  C CE1 . PHE B 1 270 ? -25.113 9.426   -10.719 1.00 23.21 ? 270 PHE B CE1 1 
ATOM 4678  C CE2 . PHE B 1 270 ? -22.912 8.807   -11.439 1.00 23.21 ? 270 PHE B CE2 1 
ATOM 4679  C CZ  . PHE B 1 270 ? -24.133 8.462   -10.869 1.00 23.21 ? 270 PHE B CZ  1 
ATOM 4680  N N   . LEU B 1 271 ? -21.060 14.525  -12.544 1.00 23.04 ? 271 LEU B N   1 
ATOM 4681  C CA  . LEU B 1 271 ? -20.561 15.688  -13.256 1.00 23.04 ? 271 LEU B CA  1 
ATOM 4682  C C   . LEU B 1 271 ? -20.992 15.531  -14.721 1.00 23.04 ? 271 LEU B C   1 
ATOM 4683  O O   . LEU B 1 271 ? -20.871 14.441  -15.310 1.00 23.04 ? 271 LEU B O   1 
ATOM 4684  C CB  . LEU B 1 271 ? -19.035 15.773  -13.117 1.00 25.05 ? 271 LEU B CB  1 
ATOM 4685  C CG  . LEU B 1 271 ? -18.162 14.568  -13.499 1.00 25.05 ? 271 LEU B CG  1 
ATOM 4686  C CD1 . LEU B 1 271 ? -17.797 14.603  -14.976 1.00 25.05 ? 271 LEU B CD1 1 
ATOM 4687  C CD2 . LEU B 1 271 ? -16.895 14.603  -12.659 1.00 25.05 ? 271 LEU B CD2 1 
ATOM 4688  N N   . SER B 1 272 ? -21.522 16.612  -15.294 1.00 49.45 ? 272 SER B N   1 
ATOM 4689  C CA  . SER B 1 272 ? -22.007 16.592  -16.672 1.00 49.45 ? 272 SER B CA  1 
ATOM 4690  C C   . SER B 1 272 ? -20.921 16.265  -17.678 1.00 49.45 ? 272 SER B C   1 
ATOM 4691  O O   . SER B 1 272 ? -21.204 15.720  -18.745 1.00 49.45 ? 272 SER B O   1 
ATOM 4692  C CB  . SER B 1 272 ? -22.663 17.931  -17.035 1.00 50.91 ? 272 SER B CB  1 
ATOM 4693  O OG  . SER B 1 272 ? -21.774 19.022  -16.874 1.00 50.91 ? 272 SER B OG  1 
ATOM 4694  N N   . GLY B 1 273 ? -19.680 16.593  -17.335 1.00 39.25 ? 273 GLY B N   1 
ATOM 4695  C CA  . GLY B 1 273 ? -18.573 16.324  -18.234 1.00 39.25 ? 273 GLY B CA  1 
ATOM 4696  C C   . GLY B 1 273 ? -18.743 16.995  -19.584 1.00 39.25 ? 273 GLY B C   1 
ATOM 4697  O O   . GLY B 1 273 ? -18.987 18.204  -19.660 1.00 39.25 ? 273 GLY B O   1 
ATOM 4698  N N   . GLY B 1 274 ? -18.614 16.214  -20.653 1.00 40.93 ? 274 GLY B N   1 
ATOM 4699  C CA  . GLY B 1 274 ? -18.764 16.777  -21.983 1.00 40.93 ? 274 GLY B CA  1 
ATOM 4700  C C   . GLY B 1 274 ? -20.149 16.566  -22.572 1.00 40.93 ? 274 GLY B C   1 
ATOM 4701  O O   . GLY B 1 274 ? -20.393 16.887  -23.736 1.00 40.93 ? 274 GLY B O   1 
ATOM 4702  N N   . GLN B 1 275 ? -21.060 16.031  -21.765 1.00 36.04 ? 275 GLN B N   1 
ATOM 4703  C CA  . GLN B 1 275 ? -22.418 15.763  -22.209 1.00 36.04 ? 275 GLN B CA  1 
ATOM 4704  C C   . GLN B 1 275 ? -23.174 17.046  -22.504 1.00 36.04 ? 275 GLN B C   1 
ATOM 4705  O O   . GLN B 1 275 ? -22.846 18.103  -21.962 1.00 36.04 ? 275 GLN B O   1 
ATOM 4706  C CB  . GLN B 1 275 ? -23.168 14.982  -21.138 1.00 32.21 ? 275 GLN B CB  1 
ATOM 4707  C CG  . GLN B 1 275 ? -22.464 13.732  -20.691 1.00 32.21 ? 275 GLN B CG  1 
ATOM 4708  C CD  . GLN B 1 275 ? -23.308 12.916  -19.733 1.00 32.21 ? 275 GLN B CD  1 
ATOM 4709  O OE1 . GLN B 1 275 ? -24.371 12.409  -20.100 1.00 32.21 ? 275 GLN B OE1 1 
ATOM 4710  N NE2 . GLN B 1 275 ? -22.844 12.789  -18.493 1.00 32.21 ? 275 GLN B NE2 1 
ATOM 4711  N N   . SER B 1 276 ? -24.184 16.936  -23.365 1.00 35.88 ? 276 SER B N   1 
ATOM 4712  C CA  . SER B 1 276 ? -25.030 18.064  -23.747 1.00 35.88 ? 276 SER B CA  1 
ATOM 4713  C C   . SER B 1 276 ? -26.079 18.238  -22.660 1.00 35.88 ? 276 SER B C   1 
ATOM 4714  O O   . SER B 1 276 ? -26.289 17.329  -21.854 1.00 35.88 ? 276 SER B O   1 
ATOM 4715  C CB  . SER B 1 276 ? -25.723 17.767  -25.068 1.00 40.95 ? 276 SER B CB  1 
ATOM 4716  O OG  . SER B 1 276 ? -26.529 16.613  -24.941 1.00 40.95 ? 276 SER B OG  1 
ATOM 4717  N N   . GLU B 1 277 ? -26.747 19.387  -22.635 1.00 28.52 ? 277 GLU B N   1 
ATOM 4718  C CA  . GLU B 1 277 ? -27.756 19.614  -21.604 1.00 28.52 ? 277 GLU B CA  1 
ATOM 4719  C C   . GLU B 1 277 ? -28.740 18.456  -21.524 1.00 28.52 ? 277 GLU B C   1 
ATOM 4720  O O   . GLU B 1 277 ? -29.118 18.033  -20.428 1.00 28.52 ? 277 GLU B O   1 
ATOM 4721  C CB  . GLU B 1 277 ? -28.504 20.930  -21.843 1.00 39.05 ? 277 GLU B CB  1 
ATOM 4722  C CG  . GLU B 1 277 ? -27.657 22.160  -21.562 1.00 39.05 ? 277 GLU B CG  1 
ATOM 4723  C CD  . GLU B 1 277 ? -28.404 23.471  -21.750 1.00 39.05 ? 277 GLU B CD  1 
ATOM 4724  O OE1 . GLU B 1 277 ? -28.990 23.669  -22.838 1.00 39.05 ? 277 GLU B OE1 1 
ATOM 4725  O OE2 . GLU B 1 277 ? -28.391 24.308  -20.810 1.00 39.05 ? 277 GLU B OE2 1 
ATOM 4726  N N   . GLU B 1 278 ? -29.138 17.935  -22.684 1.00 38.22 ? 278 GLU B N   1 
ATOM 4727  C CA  . GLU B 1 278 ? -30.081 16.829  -22.717 1.00 38.22 ? 278 GLU B CA  1 
ATOM 4728  C C   . GLU B 1 278 ? -29.440 15.512  -22.337 1.00 38.22 ? 278 GLU B C   1 
ATOM 4729  O O   . GLU B 1 278 ? -29.959 14.772  -21.501 1.00 38.22 ? 278 GLU B O   1 
ATOM 4730  C CB  . GLU B 1 278 ? -30.728 16.718  -24.096 1.00 89.82 ? 278 GLU B CB  1 
ATOM 4731  C CG  . GLU B 1 278 ? -31.897 17.666  -24.259 1.00 89.82 ? 278 GLU B CG  1 
ATOM 4732  C CD  . GLU B 1 278 ? -32.904 17.543  -23.115 1.00 89.82 ? 278 GLU B CD  1 
ATOM 4733  O OE1 . GLU B 1 278 ? -33.582 16.500  -23.019 1.00 89.82 ? 278 GLU B OE1 1 
ATOM 4734  O OE2 . GLU B 1 278 ? -33.012 18.486  -22.300 1.00 89.82 ? 278 GLU B OE2 1 
ATOM 4735  N N   . GLU B 1 279 ? -28.303 15.231  -22.956 1.00 31.46 ? 279 GLU B N   1 
ATOM 4736  C CA  . GLU B 1 279 ? -27.556 14.008  -22.702 1.00 31.46 ? 279 GLU B CA  1 
ATOM 4737  C C   . GLU B 1 279 ? -27.393 13.776  -21.194 1.00 31.46 ? 279 GLU B C   1 
ATOM 4738  O O   . GLU B 1 279 ? -27.582 12.663  -20.693 1.00 31.46 ? 279 GLU B O   1 
ATOM 4739  C CB  . GLU B 1 279 ? -26.197 14.125  -23.376 1.00 60.46 ? 279 GLU B CB  1 
ATOM 4740  C CG  . GLU B 1 279 ? -25.426 12.849  -23.450 1.00 60.46 ? 279 GLU B CG  1 
ATOM 4741  C CD  . GLU B 1 279 ? -24.178 13.000  -24.293 1.00 60.46 ? 279 GLU B CD  1 
ATOM 4742  O OE1 . GLU B 1 279 ? -23.407 12.016  -24.378 1.00 60.46 ? 279 GLU B OE1 1 
ATOM 4743  O OE2 . GLU B 1 279 ? -23.974 14.098  -24.870 1.00 60.46 ? 279 GLU B OE2 1 
ATOM 4744  N N   . ALA B 1 280 ? -27.055 14.841  -20.473 1.00 28.49 ? 280 ALA B N   1 
ATOM 4745  C CA  . ALA B 1 280 ? -26.869 14.758  -19.035 1.00 28.49 ? 280 ALA B CA  1 
ATOM 4746  C C   . ALA B 1 280 ? -28.183 14.398  -18.359 1.00 28.49 ? 280 ALA B C   1 
ATOM 4747  O O   . ALA B 1 280 ? -28.239 13.483  -17.546 1.00 28.49 ? 280 ALA B O   1 
ATOM 4748  C CB  . ALA B 1 280 ? -26.353 16.081  -18.502 1.00 31.25 ? 280 ALA B CB  1 
ATOM 4749  N N   . SER B 1 281 ? -29.241 15.121  -18.711 1.00 29.03 ? 281 SER B N   1 
ATOM 4750  C CA  . SER B 1 281 ? -30.562 14.888  -18.135 1.00 29.03 ? 281 SER B CA  1 
ATOM 4751  C C   . SER B 1 281 ? -31.070 13.470  -18.408 1.00 29.03 ? 281 SER B C   1 
ATOM 4752  O O   . SER B 1 281 ? -31.553 12.784  -17.500 1.00 29.03 ? 281 SER B O   1 
ATOM 4753  C CB  . SER B 1 281 ? -31.546 15.912  -18.695 1.00 33.57 ? 281 SER B CB  1 
ATOM 4754  O OG  . SER B 1 281 ? -31.059 17.230  -18.500 1.00 33.57 ? 281 SER B OG  1 
ATOM 4755  N N   . PHE B 1 282 ? -30.958 13.033  -19.660 1.00 35.17 ? 282 PHE B N   1 
ATOM 4756  C CA  . PHE B 1 282 ? -31.401 11.698  -20.044 1.00 35.17 ? 282 PHE B CA  1 
ATOM 4757  C C   . PHE B 1 282 ? -30.653 10.630  -19.276 1.00 35.17 ? 282 PHE B C   1 
ATOM 4758  O O   . PHE B 1 282 ? -31.265 9.753   -18.657 1.00 35.17 ? 282 PHE B O   1 
ATOM 4759  C CB  . PHE B 1 282 ? -31.199 11.478  -21.539 1.00 73.69 ? 282 PHE B CB  1 
ATOM 4760  C CG  . PHE B 1 282 ? -32.348 11.948  -22.367 1.00 73.69 ? 282 PHE B CG  1 
ATOM 4761  C CD1 . PHE B 1 282 ? -32.790 13.263  -22.283 1.00 73.69 ? 282 PHE B CD1 1 
ATOM 4762  C CD2 . PHE B 1 282 ? -33.014 11.070  -23.212 1.00 73.69 ? 282 PHE B CD2 1 
ATOM 4763  C CE1 . PHE B 1 282 ? -33.882 13.698  -23.026 1.00 73.69 ? 282 PHE B CE1 1 
ATOM 4764  C CE2 . PHE B 1 282 ? -34.108 11.494  -23.961 1.00 73.69 ? 282 PHE B CE2 1 
ATOM 4765  C CZ  . PHE B 1 282 ? -34.542 12.814  -23.865 1.00 73.69 ? 282 PHE B CZ  1 
ATOM 4766  N N   . ASN B 1 283 ? -29.327 10.713  -19.319 1.00 27.49 ? 283 ASN B N   1 
ATOM 4767  C CA  . ASN B 1 283 ? -28.476 9.759   -18.628 1.00 27.49 ? 283 ASN B CA  1 
ATOM 4768  C C   . ASN B 1 283 ? -28.773 9.755   -17.124 1.00 27.49 ? 283 ASN B C   1 
ATOM 4769  O O   . ASN B 1 283 ? -28.929 8.693   -16.517 1.00 27.49 ? 283 ASN B O   1 
ATOM 4770  C CB  . ASN B 1 283 ? -27.004 10.087  -18.909 1.00 30.08 ? 283 ASN B CB  1 
ATOM 4771  C CG  . ASN B 1 283 ? -26.571 9.676   -20.312 1.00 30.08 ? 283 ASN B CG  1 
ATOM 4772  O OD1 . ASN B 1 283 ? -25.576 10.163  -20.838 1.00 30.08 ? 283 ASN B OD1 1 
ATOM 4773  N ND2 . ASN B 1 283 ? -27.315 8.762   -20.915 1.00 30.08 ? 283 ASN B ND2 1 
ATOM 4774  N N   . LEU B 1 284 ? -28.875 10.931  -16.516 1.00 25.69 ? 284 LEU B N   1 
ATOM 4775  C CA  . LEU B 1 284 ? -29.163 10.973  -15.089 1.00 25.69 ? 284 LEU B CA  1 
ATOM 4776  C C   . LEU B 1 284 ? -30.489 10.290  -14.812 1.00 25.69 ? 284 LEU B C   1 
ATOM 4777  O O   . LEU B 1 284 ? -30.597 9.480   -13.891 1.00 25.69 ? 284 LEU B O   1 
ATOM 4778  C CB  . LEU B 1 284 ? -29.214 12.414  -14.566 1.00 10.21 ? 284 LEU B CB  1 
ATOM 4779  C CG  . LEU B 1 284 ? -29.631 12.568  -13.091 1.00 10.21 ? 284 LEU B CG  1 
ATOM 4780  C CD1 . LEU B 1 284 ? -28.823 11.632  -12.199 1.00 10.21 ? 284 LEU B CD1 1 
ATOM 4781  C CD2 . LEU B 1 284 ? -29.434 14.013  -12.658 1.00 10.21 ? 284 LEU B CD2 1 
ATOM 4782  N N   . ASN B 1 285 ? -31.498 10.619  -15.613 1.00 29.34 ? 285 ASN B N   1 
ATOM 4783  C CA  . ASN B 1 285 ? -32.813 10.025  -15.433 1.00 29.34 ? 285 ASN B CA  1 
ATOM 4784  C C   . ASN B 1 285 ? -32.695 8.506   -15.520 1.00 29.34 ? 285 ASN B C   1 
ATOM 4785  O O   . ASN B 1 285 ? -33.141 7.780   -14.629 1.00 29.34 ? 285 ASN B O   1 
ATOM 4786  C CB  . ASN B 1 285 ? -33.773 10.534  -16.503 1.00 44.21 ? 285 ASN B CB  1 
ATOM 4787  C CG  . ASN B 1 285 ? -35.225 10.307  -16.132 1.00 44.21 ? 285 ASN B CG  1 
ATOM 4788  O OD1 . ASN B 1 285 ? -35.767 10.964  -15.240 1.00 44.21 ? 285 ASN B OD1 1 
ATOM 4789  N ND2 . ASN B 1 285 ? -35.861 9.367   -16.810 1.00 44.21 ? 285 ASN B ND2 1 
ATOM 4790  N N   . ALA B 1 286 ? -32.074 8.035   -16.595 1.00 25.63 ? 286 ALA B N   1 
ATOM 4791  C CA  . ALA B 1 286 ? -31.882 6.605   -16.797 1.00 25.63 ? 286 ALA B CA  1 
ATOM 4792  C C   . ALA B 1 286 ? -31.261 5.966   -15.558 1.00 25.63 ? 286 ALA B C   1 
ATOM 4793  O O   . ALA B 1 286 ? -31.701 4.906   -15.103 1.00 25.63 ? 286 ALA B O   1 
ATOM 4794  C CB  . ALA B 1 286 ? -30.992 6.367   -18.011 1.00 13.74 ? 286 ALA B CB  1 
ATOM 4795  N N   . ILE B 1 287 ? -30.229 6.615   -15.025 1.00 26.84 ? 287 ILE B N   1 
ATOM 4796  C CA  . ILE B 1 287 ? -29.539 6.126   -13.839 1.00 26.84 ? 287 ILE B CA  1 
ATOM 4797  C C   . ILE B 1 287 ? -30.538 5.943   -12.704 1.00 26.84 ? 287 ILE B C   1 
ATOM 4798  O O   . ILE B 1 287 ? -30.588 4.884   -12.075 1.00 26.84 ? 287 ILE B O   1 
ATOM 4799  C CB  . ILE B 1 287 ? -28.432 7.119   -13.388 1.00 24.79 ? 287 ILE B CB  1 
ATOM 4800  C CG1 . ILE B 1 287 ? -27.253 7.052   -14.357 1.00 24.79 ? 287 ILE B CG1 1 
ATOM 4801  C CG2 . ILE B 1 287 ? -27.983 6.814   -11.962 1.00 24.79 ? 287 ILE B CG2 1 
ATOM 4802  C CD1 . ILE B 1 287 ? -26.162 8.069   -14.063 1.00 24.79 ? 287 ILE B CD1 1 
ATOM 4803  N N   . ASN B 1 288 ? -31.335 6.975   -12.448 1.00 38.27 ? 288 ASN B N   1 
ATOM 4804  C CA  . ASN B 1 288 ? -32.319 6.910   -11.382 1.00 38.27 ? 288 ASN B CA  1 
ATOM 4805  C C   . ASN B 1 288 ? -33.462 5.953   -11.694 1.00 38.27 ? 288 ASN B C   1 
ATOM 4806  O O   . ASN B 1 288 ? -34.367 5.768   -10.879 1.00 38.27 ? 288 ASN B O   1 
ATOM 4807  C CB  . ASN B 1 288 ? -32.876 8.297   -11.083 1.00 37.49 ? 288 ASN B CB  1 
ATOM 4808  C CG  . ASN B 1 288 ? -32.034 9.054   -10.084 1.00 37.49 ? 288 ASN B CG  1 
ATOM 4809  O OD1 . ASN B 1 288 ? -31.928 8.671   -8.918  1.00 37.49 ? 288 ASN B OD1 1 
ATOM 4810  N ND2 . ASN B 1 288 ? -31.427 10.139  -10.537 1.00 37.49 ? 288 ASN B ND2 1 
ATOM 4811  N N   . ARG B 1 289 ? -33.429 5.347   -12.875 1.00 38.53 ? 289 ARG B N   1 
ATOM 4812  C CA  . ARG B 1 289 ? -34.461 4.391   -13.245 1.00 38.53 ? 289 ARG B CA  1 
ATOM 4813  C C   . ARG B 1 289 ? -33.850 3.003   -13.407 1.00 38.53 ? 289 ARG B C   1 
ATOM 4814  O O   . ARG B 1 289 ? -34.532 2.051   -13.784 1.00 38.53 ? 289 ARG B O   1 
ATOM 4815  C CB  . ARG B 1 289 ? -35.164 4.837   -14.527 1.00 83.13 ? 289 ARG B CB  1 
ATOM 4816  C CG  . ARG B 1 289 ? -36.427 5.640   -14.262 1.00 83.13 ? 289 ARG B CG  1 
ATOM 4817  C CD  . ARG B 1 289 ? -36.671 6.671   -15.344 1.00 83.13 ? 289 ARG B CD  1 
ATOM 4818  N NE  . ARG B 1 289 ? -36.777 6.080   -16.676 1.00 83.13 ? 289 ARG B NE  1 
ATOM 4819  C CZ  . ARG B 1 289 ? -37.853 5.445   -17.135 1.00 83.13 ? 289 ARG B CZ  1 
ATOM 4820  N NH1 . ARG B 1 289 ? -38.928 5.321   -16.360 1.00 83.13 ? 289 ARG B NH1 1 
ATOM 4821  N NH2 . ARG B 1 289 ? -37.850 4.933   -18.367 1.00 83.13 ? 289 ARG B NH2 1 
ATOM 4822  N N   . CYS B 1 290 ? -32.557 2.892   -13.107 1.00 39.66 ? 290 CYS B N   1 
ATOM 4823  C CA  . CYS B 1 290 ? -31.859 1.614   -13.200 1.00 39.66 ? 290 CYS B CA  1 
ATOM 4824  C C   . CYS B 1 290 ? -32.462 0.645   -12.182 1.00 39.66 ? 290 CYS B C   1 
ATOM 4825  O O   . CYS B 1 290 ? -32.767 1.023   -11.054 1.00 39.66 ? 290 CYS B O   1 
ATOM 4826  C CB  . CYS B 1 290 ? -30.361 1.790   -12.914 1.00 39.50 ? 290 CYS B CB  1 
ATOM 4827  S SG  . CYS B 1 290 ? -29.383 0.260   -13.051 1.00 39.50 ? 290 CYS B SG  1 
ATOM 4828  N N   . PRO B 1 291 ? -32.642 -0.619  -12.579 1.00 44.08 ? 291 PRO B N   1 
ATOM 4829  C CA  . PRO B 1 291 ? -33.204 -1.695  -11.755 1.00 44.08 ? 291 PRO B CA  1 
ATOM 4830  C C   . PRO B 1 291 ? -32.433 -1.932  -10.461 1.00 44.08 ? 291 PRO B C   1 
ATOM 4831  O O   . PRO B 1 291 ? -33.018 -2.197  -9.410  1.00 44.08 ? 291 PRO B O   1 
ATOM 4832  C CB  . PRO B 1 291 ? -33.123 -2.904  -12.673 1.00 37.68 ? 291 PRO B CB  1 
ATOM 4833  C CG  . PRO B 1 291 ? -33.248 -2.298  -14.038 1.00 37.68 ? 291 PRO B CG  1 
ATOM 4834  C CD  . PRO B 1 291 ? -32.355 -1.099  -13.941 1.00 37.68 ? 291 PRO B CD  1 
ATOM 4835  N N   . LEU B 1 292 ? -31.113 -1.845  -10.549 1.00 38.17 ? 292 LEU B N   1 
ATOM 4836  C CA  . LEU B 1 292 ? -30.250 -2.058  -9.397  1.00 38.17 ? 292 LEU B CA  1 
ATOM 4837  C C   . LEU B 1 292 ? -30.557 -1.096  -8.253  1.00 38.17 ? 292 LEU B C   1 
ATOM 4838  O O   . LEU B 1 292 ? -30.879 0.066   -8.470  1.00 38.17 ? 292 LEU B O   1 
ATOM 4839  C CB  . LEU B 1 292 ? -28.795 -1.907  -9.828  1.00 25.82 ? 292 LEU B CB  1 
ATOM 4840  C CG  . LEU B 1 292 ? -28.429 -2.870  -10.953 1.00 25.82 ? 292 LEU B CG  1 
ATOM 4841  C CD1 . LEU B 1 292 ? -27.147 -2.441  -11.621 1.00 25.82 ? 292 LEU B CD1 1 
ATOM 4842  C CD2 . LEU B 1 292 ? -28.310 -4.260  -10.375 1.00 25.82 ? 292 LEU B CD2 1 
ATOM 4843  N N   . PRO B 1 293 ? -30.462 -1.583  -7.013  1.00 33.21 ? 293 PRO B N   1 
ATOM 4844  C CA  . PRO B 1 293 ? -30.715 -0.817  -5.789  1.00 33.21 ? 293 PRO B CA  1 
ATOM 4845  C C   . PRO B 1 293 ? -29.606 0.201   -5.537  1.00 33.21 ? 293 PRO B C   1 
ATOM 4846  O O   . PRO B 1 293 ? -28.441 -0.086  -5.798  1.00 33.21 ? 293 PRO B O   1 
ATOM 4847  C CB  . PRO B 1 293 ? -30.727 -1.894  -4.704  1.00 21.95 ? 293 PRO B CB  1 
ATOM 4848  C CG  . PRO B 1 293 ? -31.057 -3.149  -5.445  1.00 21.95 ? 293 PRO B CG  1 
ATOM 4849  C CD  . PRO B 1 293 ? -30.266 -3.005  -6.704  1.00 21.95 ? 293 PRO B CD  1 
ATOM 4850  N N   . ARG B 1 294 ? -29.958 1.374   -5.018  1.00 35.41 ? 294 ARG B N   1 
ATOM 4851  C CA  . ARG B 1 294 ? -28.963 2.397   -4.730  1.00 35.41 ? 294 ARG B CA  1 
ATOM 4852  C C   . ARG B 1 294 ? -29.141 2.995   -3.350  1.00 35.41 ? 294 ARG B C   1 
ATOM 4853  O O   . ARG B 1 294 ? -30.092 3.720   -3.099  1.00 35.41 ? 294 ARG B O   1 
ATOM 4854  C CB  . ARG B 1 294 ? -29.028 3.502   -5.767  1.00 55.54 ? 294 ARG B CB  1 
ATOM 4855  C CG  . ARG B 1 294 ? -28.755 3.002   -7.152  1.00 55.54 ? 294 ARG B CG  1 
ATOM 4856  C CD  . ARG B 1 294 ? -30.033 2.685   -7.848  1.00 55.54 ? 294 ARG B CD  1 
ATOM 4857  N NE  . ARG B 1 294 ? -30.795 3.908   -8.052  1.00 55.54 ? 294 ARG B NE  1 
ATOM 4858  C CZ  . ARG B 1 294 ? -31.889 3.987   -8.797  1.00 55.54 ? 294 ARG B CZ  1 
ATOM 4859  N NH1 . ARG B 1 294 ? -32.355 2.907   -9.415  1.00 55.54 ? 294 ARG B NH1 1 
ATOM 4860  N NH2 . ARG B 1 294 ? -32.517 5.150   -8.925  1.00 55.54 ? 294 ARG B NH2 1 
ATOM 4861  N N   . PRO B 1 295 ? -28.199 2.723   -2.441  1.00 34.96 ? 295 PRO B N   1 
ATOM 4862  C CA  . PRO B 1 295 ? -28.197 3.203   -1.051  1.00 34.96 ? 295 PRO B CA  1 
ATOM 4863  C C   . PRO B 1 295 ? -27.959 4.701   -0.890  1.00 34.96 ? 295 PRO B C   1 
ATOM 4864  O O   . PRO B 1 295 ? -28.019 5.238   0.229   1.00 34.96 ? 295 PRO B O   1 
ATOM 4865  C CB  . PRO B 1 295 ? -27.053 2.412   -0.407  1.00 28.52 ? 295 PRO B CB  1 
ATOM 4866  C CG  . PRO B 1 295 ? -26.741 1.311   -1.396  1.00 28.52 ? 295 PRO B CG  1 
ATOM 4867  C CD  . PRO B 1 295 ? -26.989 1.940   -2.719  1.00 28.52 ? 295 PRO B CD  1 
ATOM 4868  N N   . TRP B 1 296 ? -27.695 5.374   -2.000  1.00 22.36 ? 296 TRP B N   1 
ATOM 4869  C CA  . TRP B 1 296 ? -27.372 6.799   -1.971  1.00 22.36 ? 296 TRP B CA  1 
ATOM 4870  C C   . TRP B 1 296 ? -28.105 7.629   -3.015  1.00 22.36 ? 296 TRP B C   1 
ATOM 4871  O O   . TRP B 1 296 ? -28.586 7.113   -4.031  1.00 22.36 ? 296 TRP B O   1 
ATOM 4872  C CB  . TRP B 1 296 ? -25.874 6.955   -2.204  1.00 29.77 ? 296 TRP B CB  1 
ATOM 4873  C CG  . TRP B 1 296 ? -25.430 5.954   -3.217  1.00 29.77 ? 296 TRP B CG  1 
ATOM 4874  C CD1 . TRP B 1 296 ? -25.949 5.756   -4.483  1.00 29.77 ? 296 TRP B CD1 1 
ATOM 4875  C CD2 . TRP B 1 296 ? -24.482 4.930   -3.018  1.00 29.77 ? 296 TRP B CD2 1 
ATOM 4876  N NE1 . TRP B 1 296 ? -25.378 4.650   -5.073  1.00 29.77 ? 296 TRP B NE1 1 
ATOM 4877  C CE2 . TRP B 1 296 ? -24.472 4.123   -4.197  1.00 29.77 ? 296 TRP B CE2 1 
ATOM 4878  C CE3 . TRP B 1 296 ? -23.640 4.605   -1.963  1.00 29.77 ? 296 TRP B CE3 1 
ATOM 4879  C CZ2 . TRP B 1 296 ? -23.653 3.026   -4.339  1.00 29.77 ? 296 TRP B CZ2 1 
ATOM 4880  C CZ3 . TRP B 1 296 ? -22.830 3.526   -2.098  1.00 29.77 ? 296 TRP B CZ3 1 
ATOM 4881  C CH2 . TRP B 1 296 ? -22.836 2.735   -3.286  1.00 29.77 ? 296 TRP B CH2 1 
ATOM 4882  N N   . ALA B 1 297 ? -28.166 8.930   -2.767  1.00 17.98 ? 297 ALA B N   1 
ATOM 4883  C CA  . ALA B 1 297 ? -28.805 9.832   -3.700  1.00 17.98 ? 297 ALA B CA  1 
ATOM 4884  C C   . ALA B 1 297 ? -28.001 9.788   -4.992  1.00 17.98 ? 297 ALA B C   1 
ATOM 4885  O O   . ALA B 1 297 ? -26.775 9.682   -4.965  1.00 17.98 ? 297 ALA B O   1 
ATOM 4886  C CB  . ALA B 1 297 ? -28.799 11.237  -3.141  1.00 5.10  ? 297 ALA B CB  1 
ATOM 4887  N N   . LEU B 1 298 ? -28.676 9.847   -6.127  1.00 26.13 ? 298 LEU B N   1 
ATOM 4888  C CA  . LEU B 1 298 ? -27.953 9.861   -7.380  1.00 26.13 ? 298 LEU B CA  1 
ATOM 4889  C C   . LEU B 1 298 ? -28.421 11.082  -8.145  1.00 26.13 ? 298 LEU B C   1 
ATOM 4890  O O   . LEU B 1 298 ? -29.270 10.960  -9.019  1.00 26.13 ? 298 LEU B O   1 
ATOM 4891  C CB  . LEU B 1 298 ? -28.236 8.594   -8.186  1.00 12.85 ? 298 LEU B CB  1 
ATOM 4892  C CG  . LEU B 1 298 ? -27.696 7.269   -7.651  1.00 12.85 ? 298 LEU B CG  1 
ATOM 4893  C CD1 . LEU B 1 298 ? -28.090 6.143   -8.591  1.00 12.85 ? 298 LEU B CD1 1 
ATOM 4894  C CD2 . LEU B 1 298 ? -26.194 7.344   -7.534  1.00 12.85 ? 298 LEU B CD2 1 
ATOM 4895  N N   . THR B 1 299 ? -27.912 12.267  -7.810  1.00 24.62 ? 299 THR B N   1 
ATOM 4896  C CA  . THR B 1 299 ? -28.340 13.449  -8.550  1.00 24.62 ? 299 THR B CA  1 
ATOM 4897  C C   . THR B 1 299 ? -27.211 14.023  -9.404  1.00 24.62 ? 299 THR B C   1 
ATOM 4898  O O   . THR B 1 299 ? -26.336 13.292  -9.882  1.00 24.62 ? 299 THR B O   1 
ATOM 4899  C CB  . THR B 1 299 ? -28.917 14.577  -7.642  1.00 29.85 ? 299 THR B CB  1 
ATOM 4900  O OG1 . THR B 1 299 ? -27.872 15.470  -7.274  1.00 29.85 ? 299 THR B OG1 1 
ATOM 4901  C CG2 . THR B 1 299 ? -29.528 14.016  -6.378  1.00 29.85 ? 299 THR B CG2 1 
ATOM 4902  N N   . PHE B 1 300 ? -27.231 15.340  -9.574  1.00 24.91 ? 300 PHE B N   1 
ATOM 4903  C CA  . PHE B 1 300 ? -26.269 16.034  -10.416 1.00 24.91 ? 300 PHE B CA  1 
ATOM 4904  C C   . PHE B 1 300 ? -25.494 17.155  -9.729  1.00 24.91 ? 300 PHE B C   1 
ATOM 4905  O O   . PHE B 1 300 ? -25.922 17.706  -8.717  1.00 24.91 ? 300 PHE B O   1 
ATOM 4906  C CB  . PHE B 1 300 ? -27.029 16.642  -11.593 1.00 28.15 ? 300 PHE B CB  1 
ATOM 4907  C CG  . PHE B 1 300 ? -28.075 17.649  -11.169 1.00 28.15 ? 300 PHE B CG  1 
ATOM 4908  C CD1 . PHE B 1 300 ? -27.789 19.014  -11.155 1.00 28.15 ? 300 PHE B CD1 1 
ATOM 4909  C CD2 . PHE B 1 300 ? -29.330 17.229  -10.721 1.00 28.15 ? 300 PHE B CD2 1 
ATOM 4910  C CE1 . PHE B 1 300 ? -28.738 19.943  -10.697 1.00 28.15 ? 300 PHE B CE1 1 
ATOM 4911  C CE2 . PHE B 1 300 ? -30.276 18.150  -10.264 1.00 28.15 ? 300 PHE B CE2 1 
ATOM 4912  C CZ  . PHE B 1 300 ? -29.977 19.508  -10.252 1.00 28.15 ? 300 PHE B CZ  1 
ATOM 4913  N N   . SER B 1 301 ? -24.348 17.487  -10.312 1.00 38.83 ? 301 SER B N   1 
ATOM 4914  C CA  . SER B 1 301 ? -23.496 18.593  -9.875  1.00 38.83 ? 301 SER B CA  1 
ATOM 4915  C C   . SER B 1 301 ? -23.007 19.045  -11.232 1.00 38.83 ? 301 SER B C   1 
ATOM 4916  O O   . SER B 1 301 ? -21.858 18.829  -11.607 1.00 38.83 ? 301 SER B O   1 
ATOM 4917  C CB  . SER B 1 301 ? -22.314 18.125  -9.030  1.00 22.70 ? 301 SER B CB  1 
ATOM 4918  O OG  . SER B 1 301 ? -21.565 19.249  -8.592  1.00 22.70 ? 301 SER B OG  1 
ATOM 4919  N N   . TYR B 1 302 ? -23.927 19.641  -11.978 1.00 34.88 ? 302 TYR B N   1 
ATOM 4920  C CA  . TYR B 1 302 ? -23.665 20.093  -13.329 1.00 34.88 ? 302 TYR B CA  1 
ATOM 4921  C C   . TYR B 1 302 ? -23.146 21.513  -13.478 1.00 34.88 ? 302 TYR B C   1 
ATOM 4922  O O   . TYR B 1 302 ? -23.521 22.424  -12.731 1.00 34.88 ? 302 TYR B O   1 
ATOM 4923  C CB  . TYR B 1 302 ? -24.929 19.940  -14.163 1.00 26.93 ? 302 TYR B CB  1 
ATOM 4924  C CG  . TYR B 1 302 ? -25.354 18.514  -14.410 1.00 26.93 ? 302 TYR B CG  1 
ATOM 4925  C CD1 . TYR B 1 302 ? -26.464 18.247  -15.190 1.00 26.93 ? 302 TYR B CD1 1 
ATOM 4926  C CD2 . TYR B 1 302 ? -24.639 17.434  -13.891 1.00 26.93 ? 302 TYR B CD2 1 
ATOM 4927  C CE1 . TYR B 1 302 ? -26.861 16.961  -15.459 1.00 26.93 ? 302 TYR B CE1 1 
ATOM 4928  C CE2 . TYR B 1 302 ? -25.032 16.130  -14.155 1.00 26.93 ? 302 TYR B CE2 1 
ATOM 4929  C CZ  . TYR B 1 302 ? -26.154 15.908  -14.946 1.00 26.93 ? 302 TYR B CZ  1 
ATOM 4930  O OH  . TYR B 1 302 ? -26.604 14.642  -15.237 1.00 26.93 ? 302 TYR B OH  1 
ATOM 4931  N N   . GLY B 1 303 ? -22.282 21.684  -14.470 1.00 37.62 ? 303 GLY B N   1 
ATOM 4932  C CA  . GLY B 1 303 ? -21.712 22.984  -14.736 1.00 37.62 ? 303 GLY B CA  1 
ATOM 4933  C C   . GLY B 1 303 ? -22.285 23.503  -16.029 1.00 37.62 ? 303 GLY B C   1 
ATOM 4934  O O   . GLY B 1 303 ? -23.202 24.318  -16.011 1.00 37.62 ? 303 GLY B O   1 
ATOM 4935  N N   . ARG B 1 304 ? -21.766 23.026  -17.156 1.00 39.41 ? 304 ARG B N   1 
ATOM 4936  C CA  . ARG B 1 304 ? -22.266 23.499  -18.432 1.00 39.41 ? 304 ARG B CA  1 
ATOM 4937  C C   . ARG B 1 304 ? -23.664 22.964  -18.687 1.00 39.41 ? 304 ARG B C   1 
ATOM 4938  O O   . ARG B 1 304 ? -24.528 23.692  -19.171 1.00 39.41 ? 304 ARG B O   1 
ATOM 4939  C CB  . ARG B 1 304 ? -21.342 23.090  -19.576 1.00 92.06 ? 304 ARG B CB  1 
ATOM 4940  C CG  . ARG B 1 304 ? -21.564 23.944  -20.806 1.00 92.06 ? 304 ARG B CG  1 
ATOM 4941  C CD  . ARG B 1 304 ? -20.653 23.572  -21.954 1.00 92.06 ? 304 ARG B CD  1 
ATOM 4942  N NE  . ARG B 1 304 ? -20.088 24.763  -22.588 1.00 92.06 ? 304 ARG B NE  1 
ATOM 4943  C CZ  . ARG B 1 304 ? -18.976 25.380  -22.180 1.00 92.06 ? 304 ARG B CZ  1 
ATOM 4944  N NH1 . ARG B 1 304 ? -18.293 24.918  -21.136 1.00 92.06 ? 304 ARG B NH1 1 
ATOM 4945  N NH2 . ARG B 1 304 ? -18.547 26.471  -22.807 1.00 92.06 ? 304 ARG B NH2 1 
ATOM 4946  N N   . ALA B 1 305 ? -23.893 21.701  -18.336 1.00 38.65 ? 305 ALA B N   1 
ATOM 4947  C CA  . ALA B 1 305 ? -25.194 21.070  -18.553 1.00 38.65 ? 305 ALA B CA  1 
ATOM 4948  C C   . ALA B 1 305 ? -26.377 21.815  -17.932 1.00 38.65 ? 305 ALA B C   1 
ATOM 4949  O O   . ALA B 1 305 ? -27.539 21.460  -18.169 1.00 38.65 ? 305 ALA B O   1 
ATOM 4950  C CB  . ALA B 1 305 ? -25.164 19.642  -18.046 1.00 39.62 ? 305 ALA B CB  1 
ATOM 4951  N N   . LEU B 1 306 ? -26.085 22.839  -17.140 1.00 36.66 ? 306 LEU B N   1 
ATOM 4952  C CA  . LEU B 1 306 ? -27.128 23.630  -16.507 1.00 36.66 ? 306 LEU B CA  1 
ATOM 4953  C C   . LEU B 1 306 ? -27.154 25.042  -17.065 1.00 36.66 ? 306 LEU B C   1 
ATOM 4954  O O   . LEU B 1 306 ? -28.190 25.709  -17.048 1.00 36.66 ? 306 LEU B O   1 
ATOM 4955  C CB  . LEU B 1 306 ? -26.909 23.702  -14.996 1.00 30.61 ? 306 LEU B CB  1 
ATOM 4956  C CG  . LEU B 1 306 ? -27.558 22.621  -14.137 1.00 30.61 ? 306 LEU B CG  1 
ATOM 4957  C CD1 . LEU B 1 306 ? -27.209 22.844  -12.677 1.00 30.61 ? 306 LEU B CD1 1 
ATOM 4958  C CD2 . LEU B 1 306 ? -29.061 22.668  -14.329 1.00 30.61 ? 306 LEU B CD2 1 
ATOM 4959  N N   . GLN B 1 307 ? -26.023 25.505  -17.576 1.00 36.55 ? 307 GLN B N   1 
ATOM 4960  C CA  . GLN B 1 307 ? -25.977 26.864  -18.081 1.00 36.55 ? 307 GLN B CA  1 
ATOM 4961  C C   . GLN B 1 307 ? -25.589 27.057  -19.541 1.00 36.55 ? 307 GLN B C   1 
ATOM 4962  O O   . GLN B 1 307 ? -25.314 28.174  -19.964 1.00 36.55 ? 307 GLN B O   1 
ATOM 4963  C CB  . GLN B 1 307 ? -25.070 27.705  -17.165 1.00 33.89 ? 307 GLN B CB  1 
ATOM 4964  C CG  . GLN B 1 307 ? -23.726 27.077  -16.848 1.00 33.89 ? 307 GLN B CG  1 
ATOM 4965  C CD  . GLN B 1 307 ? -23.028 27.730  -15.663 1.00 33.89 ? 307 GLN B CD  1 
ATOM 4966  O OE1 . GLN B 1 307 ? -22.596 28.884  -15.725 1.00 33.89 ? 307 GLN B OE1 1 
ATOM 4967  N NE2 . GLN B 1 307 ? -22.918 26.986  -14.570 1.00 33.89 ? 307 GLN B NE2 1 
ATOM 4968  N N   . ALA B 1 308 ? -25.583 25.989  -20.324 1.00 37.87 ? 308 ALA B N   1 
ATOM 4969  C CA  . ALA B 1 308 ? -25.215 26.126  -21.730 1.00 37.87 ? 308 ALA B CA  1 
ATOM 4970  C C   . ALA B 1 308 ? -26.180 27.055  -22.441 1.00 37.87 ? 308 ALA B C   1 
ATOM 4971  O O   . ALA B 1 308 ? -25.808 28.146  -22.874 1.00 37.87 ? 308 ALA B O   1 
ATOM 4972  C CB  . ALA B 1 308 ? -25.216 24.778  -22.411 1.00 15.30 ? 308 ALA B CB  1 
ATOM 4973  N N   . SER B 1 309 ? -27.426 26.613  -22.557 1.00 41.00 ? 309 SER B N   1 
ATOM 4974  C CA  . SER B 1 309 ? -28.448 27.399  -23.228 1.00 41.00 ? 309 SER B CA  1 
ATOM 4975  C C   . SER B 1 309 ? -28.647 28.731  -22.519 1.00 41.00 ? 309 SER B C   1 
ATOM 4976  O O   . SER B 1 309 ? -28.888 29.753  -23.160 1.00 41.00 ? 309 SER B O   1 
ATOM 4977  C CB  . SER B 1 309 ? -29.756 26.615  -23.265 1.00 53.34 ? 309 SER B CB  1 
ATOM 4978  O OG  . SER B 1 309 ? -30.126 26.231  -21.955 1.00 53.34 ? 309 SER B OG  1 
ATOM 4979  N N   . ALA B 1 310 ? -28.540 28.722  -21.196 1.00 29.93 ? 310 ALA B N   1 
ATOM 4980  C CA  . ALA B 1 310 ? -28.712 29.951  -20.432 1.00 29.93 ? 310 ALA B CA  1 
ATOM 4981  C C   . ALA B 1 310 ? -27.705 30.996  -20.899 1.00 29.93 ? 310 ALA B C   1 
ATOM 4982  O O   . ALA B 1 310 ? -28.052 32.144  -21.184 1.00 29.93 ? 310 ALA B O   1 
ATOM 4983  C CB  . ALA B 1 310 ? -28.521 29.672  -18.948 1.00 38.79 ? 310 ALA B CB  1 
ATOM 4984  N N   . LEU B 1 311 ? -26.451 30.578  -20.978 1.00 42.93 ? 311 LEU B N   1 
ATOM 4985  C CA  . LEU B 1 311 ? -25.357 31.444  -21.395 1.00 42.93 ? 311 LEU B CA  1 
ATOM 4986  C C   . LEU B 1 311 ? -25.555 31.866  -22.844 1.00 42.93 ? 311 LEU B C   1 
ATOM 4987  O O   . LEU B 1 311 ? -25.313 33.012  -23.223 1.00 42.93 ? 311 LEU B O   1 
ATOM 4988  C CB  . LEU B 1 311 ? -24.044 30.679  -21.236 1.00 52.68 ? 311 LEU B CB  1 
ATOM 4989  C CG  . LEU B 1 311 ? -22.695 31.384  -21.294 1.00 52.68 ? 311 LEU B CG  1 
ATOM 4990  C CD1 . LEU B 1 311 ? -22.670 32.601  -20.381 1.00 52.68 ? 311 LEU B CD1 1 
ATOM 4991  C CD2 . LEU B 1 311 ? -21.636 30.380  -20.875 1.00 52.68 ? 311 LEU B CD2 1 
ATOM 4992  N N   . ASN B 1 312 ? -26.015 30.920  -23.648 1.00 41.74 ? 312 ASN B N   1 
ATOM 4993  C CA  . ASN B 1 312 ? -26.248 31.157  -25.057 1.00 41.74 ? 312 ASN B CA  1 
ATOM 4994  C C   . ASN B 1 312 ? -27.345 32.188  -25.283 1.00 41.74 ? 312 ASN B C   1 
ATOM 4995  O O   . ASN B 1 312 ? -27.299 32.952  -26.244 1.00 41.74 ? 312 ASN B O   1 
ATOM 4996  C CB  . ASN B 1 312 ? -26.623 29.849  -25.729 1.00 82.36 ? 312 ASN B CB  1 
ATOM 4997  C CG  . ASN B 1 312 ? -26.083 29.757  -27.118 1.00 82.36 ? 312 ASN B CG  1 
ATOM 4998  O OD1 . ASN B 1 312 ? -26.370 30.607  -27.959 1.00 82.36 ? 312 ASN B OD1 1 
ATOM 4999  N ND2 . ASN B 1 312 ? -25.278 28.731  -27.373 1.00 82.36 ? 312 ASN B ND2 1 
ATOM 5000  N N   . ALA B 1 313 ? -28.333 32.199  -24.394 1.00 38.36 ? 313 ALA B N   1 
ATOM 5001  C CA  . ALA B 1 313 ? -29.445 33.140  -24.479 1.00 38.36 ? 313 ALA B CA  1 
ATOM 5002  C C   . ALA B 1 313 ? -28.992 34.531  -24.053 1.00 38.36 ? 313 ALA B C   1 
ATOM 5003  O O   . ALA B 1 313 ? -29.158 35.496  -24.791 1.00 38.36 ? 313 ALA B O   1 
ATOM 5004  C CB  . ALA B 1 313 ? -30.591 32.678  -23.589 1.00 33.40 ? 313 ALA B CB  1 
ATOM 5005  N N   . TRP B 1 314 ? -28.428 34.627  -22.852 1.00 47.91 ? 314 TRP B N   1 
ATOM 5006  C CA  . TRP B 1 314 ? -27.944 35.900  -22.324 1.00 47.91 ? 314 TRP B CA  1 
ATOM 5007  C C   . TRP B 1 314 ? -27.138 36.642  -23.381 1.00 47.91 ? 314 TRP B C   1 
ATOM 5008  O O   . TRP B 1 314 ? -27.420 37.799  -23.702 1.00 47.91 ? 314 TRP B O   1 
ATOM 5009  C CB  . TRP B 1 314 ? -27.066 35.655  -21.107 1.00 41.56 ? 314 TRP B CB  1 
ATOM 5010  C CG  . TRP B 1 314 ? -26.452 36.895  -20.547 1.00 41.56 ? 314 TRP B CG  1 
ATOM 5011  C CD1 . TRP B 1 314 ? -27.105 38.023  -20.144 1.00 41.56 ? 314 TRP B CD1 1 
ATOM 5012  C CD2 . TRP B 1 314 ? -25.069 37.099  -20.243 1.00 41.56 ? 314 TRP B CD2 1 
ATOM 5013  N NE1 . TRP B 1 314 ? -26.214 38.917  -19.600 1.00 41.56 ? 314 TRP B NE1 1 
ATOM 5014  C CE2 . TRP B 1 314 ? -24.956 38.374  -19.647 1.00 41.56 ? 314 TRP B CE2 1 
ATOM 5015  C CE3 . TRP B 1 314 ? -23.912 36.327  -20.412 1.00 41.56 ? 314 TRP B CE3 1 
ATOM 5016  C CZ2 . TRP B 1 314 ? -23.731 38.895  -19.217 1.00 41.56 ? 314 TRP B CZ2 1 
ATOM 5017  C CZ3 . TRP B 1 314 ? -22.694 36.845  -19.984 1.00 41.56 ? 314 TRP B CZ3 1 
ATOM 5018  C CH2 . TRP B 1 314 ? -22.616 38.117  -19.392 1.00 41.56 ? 314 TRP B CH2 1 
ATOM 5019  N N   . ARG B 1 315 ? -26.116 35.968  -23.896 1.00 48.60 ? 315 ARG B N   1 
ATOM 5020  C CA  . ARG B 1 315 ? -25.274 36.529  -24.938 1.00 48.60 ? 315 ARG B CA  1 
ATOM 5021  C C   . ARG B 1 315 ? -24.677 37.896  -24.556 1.00 48.60 ? 315 ARG B C   1 
ATOM 5022  O O   . ARG B 1 315 ? -24.282 38.681  -25.418 1.00 48.60 ? 315 ARG B O   1 
ATOM 5023  C CB  . ARG B 1 315 ? -26.110 36.623  -26.212 1.00 80.02 ? 315 ARG B CB  1 
ATOM 5024  C CG  . ARG B 1 315 ? -25.322 36.706  -27.485 1.00 80.02 ? 315 ARG B CG  1 
ATOM 5025  C CD  . ARG B 1 315 ? -26.112 36.080  -28.616 1.00 80.02 ? 315 ARG B CD  1 
ATOM 5026  N NE  . ARG B 1 315 ? -25.958 34.628  -28.637 1.00 80.02 ? 315 ARG B NE  1 
ATOM 5027  C CZ  . ARG B 1 315 ? -24.830 34.003  -28.970 1.00 80.02 ? 315 ARG B CZ  1 
ATOM 5028  N NH1 . ARG B 1 315 ? -23.750 34.703  -29.312 1.00 80.02 ? 315 ARG B NH1 1 
ATOM 5029  N NH2 . ARG B 1 315 ? -24.780 32.676  -28.966 1.00 80.02 ? 315 ARG B NH2 1 
ATOM 5030  N N   . GLY B 1 316 ? -24.608 38.169  -23.253 1.00 50.22 ? 316 GLY B N   1 
ATOM 5031  C CA  . GLY B 1 316 ? -24.051 39.424  -22.781 1.00 50.22 ? 316 GLY B CA  1 
ATOM 5032  C C   . GLY B 1 316 ? -25.029 40.586  -22.741 1.00 50.22 ? 316 GLY B C   1 
ATOM 5033  O O   . GLY B 1 316 ? -24.725 41.629  -22.167 1.00 50.22 ? 316 GLY B O   1 
ATOM 5034  N N   . GLN B 1 317 ? -26.206 40.410  -23.335 1.00 53.44 ? 317 GLN B N   1 
ATOM 5035  C CA  . GLN B 1 317 ? -27.216 41.466  -23.373 1.00 53.44 ? 317 GLN B CA  1 
ATOM 5036  C C   . GLN B 1 317 ? -28.018 41.612  -22.089 1.00 53.44 ? 317 GLN B C   1 
ATOM 5037  O O   . GLN B 1 317 ? -28.546 40.631  -21.563 1.00 53.44 ? 317 GLN B O   1 
ATOM 5038  C CB  . GLN B 1 317 ? -28.166 41.224  -24.543 1.00 89.59 ? 317 GLN B CB  1 
ATOM 5039  C CG  . GLN B 1 317 ? -27.481 41.378  -25.874 1.00 89.59 ? 317 GLN B CG  1 
ATOM 5040  C CD  . GLN B 1 317 ? -26.743 42.694  -25.957 1.00 89.59 ? 317 GLN B CD  1 
ATOM 5041  O OE1 . GLN B 1 317 ? -27.357 43.762  -25.982 1.00 89.59 ? 317 GLN B OE1 1 
ATOM 5042  N NE2 . GLN B 1 317 ? -25.416 42.627  -25.980 1.00 89.59 ? 317 GLN B NE2 1 
ATOM 5043  N N   . ARG B 1 318 ? -28.126 42.844  -21.595 1.00 45.23 ? 318 ARG B N   1 
ATOM 5044  C CA  . ARG B 1 318 ? -28.864 43.090  -20.360 1.00 45.23 ? 318 ARG B CA  1 
ATOM 5045  C C   . ARG B 1 318 ? -30.341 42.736  -20.480 1.00 45.23 ? 318 ARG B C   1 
ATOM 5046  O O   . ARG B 1 318 ? -30.988 42.415  -19.482 1.00 45.23 ? 318 ARG B O   1 
ATOM 5047  C CB  . ARG B 1 318 ? -28.742 44.545  -19.916 1.00 96.66 ? 318 ARG B CB  1 
ATOM 5048  C CG  . ARG B 1 318 ? -29.342 44.742  -18.541 1.00 96.66 ? 318 ARG B CG  1 
ATOM 5049  C CD  . ARG B 1 318 ? -29.470 46.192  -18.137 1.00 96.66 ? 318 ARG B CD  1 
ATOM 5050  N NE  . ARG B 1 318 ? -30.023 46.293  -16.784 1.00 96.66 ? 318 ARG B NE  1 
ATOM 5051  C CZ  . ARG B 1 318 ? -30.382 47.429  -16.188 1.00 96.66 ? 318 ARG B CZ  1 
ATOM 5052  N NH1 . ARG B 1 318 ? -30.253 48.590  -16.823 1.00 96.66 ? 318 ARG B NH1 1 
ATOM 5053  N NH2 . ARG B 1 318 ? -30.869 47.405  -14.951 1.00 96.66 ? 318 ARG B NH2 1 
ATOM 5054  N N   . ASP B 1 319 ? -30.874 42.800  -21.698 1.00 74.18 ? 319 ASP B N   1 
ATOM 5055  C CA  . ASP B 1 319 ? -32.281 42.481  -21.926 1.00 74.18 ? 319 ASP B CA  1 
ATOM 5056  C C   . ASP B 1 319 ? -32.496 40.980  -21.868 1.00 74.18 ? 319 ASP B C   1 
ATOM 5057  O O   . ASP B 1 319 ? -33.454 40.500  -21.253 1.00 74.18 ? 319 ASP B O   1 
ATOM 5058  C CB  . ASP B 1 319 ? -32.748 42.997  -23.290 1.00 95.30 ? 319 ASP B CB  1 
ATOM 5059  C CG  . ASP B 1 319 ? -31.651 43.706  -24.056 1.00 95.30 ? 319 ASP B CG  1 
ATOM 5060  O OD1 . ASP B 1 319 ? -31.094 44.688  -23.517 1.00 95.30 ? 319 ASP B OD1 1 
ATOM 5061  O OD2 . ASP B 1 319 ? -31.350 43.287  -25.198 1.00 95.30 ? 319 ASP B OD2 1 
ATOM 5062  N N   . ASN B 1 320 ? -31.591 40.243  -22.505 1.00 50.01 ? 320 ASN B N   1 
ATOM 5063  C CA  . ASN B 1 320 ? -31.677 38.788  -22.546 1.00 50.01 ? 320 ASN B CA  1 
ATOM 5064  C C   . ASN B 1 320 ? -31.511 38.128  -21.177 1.00 50.01 ? 320 ASN B C   1 
ATOM 5065  O O   . ASN B 1 320 ? -31.671 36.913  -21.043 1.00 50.01 ? 320 ASN B O   1 
ATOM 5066  C CB  . ASN B 1 320 ? -30.637 38.250  -23.520 1.00 67.18 ? 320 ASN B CB  1 
ATOM 5067  C CG  . ASN B 1 320 ? -30.810 38.816  -24.909 1.00 67.18 ? 320 ASN B CG  1 
ATOM 5068  O OD1 . ASN B 1 320 ? -30.012 38.545  -25.804 1.00 67.18 ? 320 ASN B OD1 1 
ATOM 5069  N ND2 . ASN B 1 320 ? -31.861 39.612  -25.100 1.00 67.18 ? 320 ASN B ND2 1 
ATOM 5070  N N   . ALA B 1 321 ? -31.204 38.936  -20.164 1.00 49.86 ? 321 ALA B N   1 
ATOM 5071  C CA  . ALA B 1 321 ? -31.022 38.450  -18.800 1.00 49.86 ? 321 ALA B CA  1 
ATOM 5072  C C   . ALA B 1 321 ? -32.124 37.483  -18.348 1.00 49.86 ? 321 ALA B C   1 
ATOM 5073  O O   . ALA B 1 321 ? -31.848 36.334  -17.983 1.00 49.86 ? 321 ALA B O   1 
ATOM 5074  C CB  . ALA B 1 321 ? -30.957 39.630  -17.848 1.00 36.69 ? 321 ALA B CB  1 
ATOM 5075  N N   . GLY B 1 322 ? -33.368 37.960  -18.375 1.00 37.78 ? 322 GLY B N   1 
ATOM 5076  C CA  . GLY B 1 322 ? -34.499 37.146  -17.958 1.00 37.78 ? 322 GLY B CA  1 
ATOM 5077  C C   . GLY B 1 322 ? -34.667 35.862  -18.745 1.00 37.78 ? 322 GLY B C   1 
ATOM 5078  O O   . GLY B 1 322 ? -35.016 34.820  -18.187 1.00 37.78 ? 322 GLY B O   1 
ATOM 5079  N N   . ALA B 1 323 ? -34.429 35.934  -20.049 1.00 47.34 ? 323 ALA B N   1 
ATOM 5080  C CA  . ALA B 1 323 ? -34.546 34.760  -20.898 1.00 47.34 ? 323 ALA B CA  1 
ATOM 5081  C C   . ALA B 1 323 ? -33.476 33.762  -20.484 1.00 47.34 ? 323 ALA B C   1 
ATOM 5082  O O   . ALA B 1 323 ? -33.739 32.564  -20.357 1.00 47.34 ? 323 ALA B O   1 
ATOM 5083  C CB  . ALA B 1 323 ? -34.353 35.152  -22.347 1.00 37.01 ? 323 ALA B CB  1 
ATOM 5084  N N   . ALA B 1 324 ? -32.263 34.268  -20.283 1.00 48.60 ? 324 ALA B N   1 
ATOM 5085  C CA  . ALA B 1 324 ? -31.143 33.443  -19.873 1.00 48.60 ? 324 ALA B CA  1 
ATOM 5086  C C   . ALA B 1 324 ? -31.517 32.735  -18.583 1.00 48.60 ? 324 ALA B C   1 
ATOM 5087  O O   . ALA B 1 324 ? -31.385 31.518  -18.468 1.00 48.60 ? 324 ALA B O   1 
ATOM 5088  C CB  . ALA B 1 324 ? -29.923 34.306  -19.660 1.00 32.68 ? 324 ALA B CB  1 
ATOM 5089  N N   . THR B 1 325 ? -31.995 33.509  -17.615 1.00 31.08 ? 325 THR B N   1 
ATOM 5090  C CA  . THR B 1 325 ? -32.399 32.962  -16.327 1.00 31.08 ? 325 THR B CA  1 
ATOM 5091  C C   . THR B 1 325 ? -33.445 31.869  -16.492 1.00 31.08 ? 325 THR B C   1 
ATOM 5092  O O   . THR B 1 325 ? -33.472 30.900  -15.734 1.00 31.08 ? 325 THR B O   1 
ATOM 5093  C CB  . THR B 1 325 ? -32.987 34.047  -15.423 1.00 24.25 ? 325 THR B CB  1 
ATOM 5094  O OG1 . THR B 1 325 ? -32.042 35.116  -15.297 1.00 24.25 ? 325 THR B OG1 1 
ATOM 5095  C CG2 . THR B 1 325 ? -33.307 33.481  -14.037 1.00 24.25 ? 325 THR B CG2 1 
ATOM 5096  N N   . GLU B 1 326 ? -34.318 32.033  -17.479 1.00 33.77 ? 326 GLU B N   1 
ATOM 5097  C CA  . GLU B 1 326 ? -35.350 31.034  -17.729 1.00 33.77 ? 326 GLU B CA  1 
ATOM 5098  C C   . GLU B 1 326 ? -34.712 29.755  -18.238 1.00 33.77 ? 326 GLU B C   1 
ATOM 5099  O O   . GLU B 1 326 ? -35.028 28.661  -17.765 1.00 33.77 ? 326 GLU B O   1 
ATOM 5100  C CB  . GLU B 1 326 ? -36.365 31.535  -18.760 1.00 51.41 ? 326 GLU B CB  1 
ATOM 5101  C CG  . GLU B 1 326 ? -37.400 32.496  -18.204 1.00 51.41 ? 326 GLU B CG  1 
ATOM 5102  C CD  . GLU B 1 326 ? -38.160 31.920  -17.020 1.00 51.41 ? 326 GLU B CD  1 
ATOM 5103  O OE1 . GLU B 1 326 ? -38.789 30.845  -17.160 1.00 51.41 ? 326 GLU B OE1 1 
ATOM 5104  O OE2 . GLU B 1 326 ? -38.125 32.555  -15.944 1.00 51.41 ? 326 GLU B OE2 1 
ATOM 5105  N N   . GLU B 1 327 ? -33.810 29.897  -19.204 1.00 43.59 ? 327 GLU B N   1 
ATOM 5106  C CA  . GLU B 1 327 ? -33.141 28.741  -19.774 1.00 43.59 ? 327 GLU B CA  1 
ATOM 5107  C C   . GLU B 1 327 ? -32.501 27.908  -18.671 1.00 43.59 ? 327 GLU B C   1 
ATOM 5108  O O   . GLU B 1 327 ? -32.539 26.676  -18.715 1.00 43.59 ? 327 GLU B O   1 
ATOM 5109  C CB  . GLU B 1 327 ? -32.099 29.191  -20.794 1.00 62.31 ? 327 GLU B CB  1 
ATOM 5110  C CG  . GLU B 1 327 ? -32.267 28.492  -22.126 1.00 62.31 ? 327 GLU B CG  1 
ATOM 5111  C CD  . GLU B 1 327 ? -33.665 28.657  -22.695 1.00 62.31 ? 327 GLU B CD  1 
ATOM 5112  O OE1 . GLU B 1 327 ? -34.010 27.953  -23.671 1.00 62.31 ? 327 GLU B OE1 1 
ATOM 5113  O OE2 . GLU B 1 327 ? -34.419 29.497  -22.168 1.00 62.31 ? 327 GLU B OE2 1 
ATOM 5114  N N   . PHE B 1 328 ? -31.934 28.589  -17.678 1.00 32.24 ? 328 PHE B N   1 
ATOM 5115  C CA  . PHE B 1 328 ? -31.301 27.925  -16.547 1.00 32.24 ? 328 PHE B CA  1 
ATOM 5116  C C   . PHE B 1 328 ? -32.352 27.208  -15.700 1.00 32.24 ? 328 PHE B C   1 
ATOM 5117  O O   . PHE B 1 328 ? -32.301 25.983  -15.533 1.00 32.24 ? 328 PHE B O   1 
ATOM 5118  C CB  . PHE B 1 328 ? -30.529 28.951  -15.702 1.00 22.69 ? 328 PHE B CB  1 
ATOM 5119  C CG  . PHE B 1 328 ? -30.194 28.478  -14.304 1.00 22.69 ? 328 PHE B CG  1 
ATOM 5120  C CD1 . PHE B 1 328 ? -29.583 27.243  -14.091 1.00 22.69 ? 328 PHE B CD1 1 
ATOM 5121  C CD2 . PHE B 1 328 ? -30.506 29.269  -13.195 1.00 22.69 ? 328 PHE B CD2 1 
ATOM 5122  C CE1 . PHE B 1 328 ? -29.292 26.801  -12.791 1.00 22.69 ? 328 PHE B CE1 1 
ATOM 5123  C CE2 . PHE B 1 328 ? -30.219 28.837  -11.896 1.00 22.69 ? 328 PHE B CE2 1 
ATOM 5124  C CZ  . PHE B 1 328 ? -29.612 27.598  -11.696 1.00 22.69 ? 328 PHE B CZ  1 
ATOM 5125  N N   . ILE B 1 329 ? -33.307 27.970  -15.173 1.00 29.55 ? 329 ILE B N   1 
ATOM 5126  C CA  . ILE B 1 329 ? -34.367 27.396  -14.351 1.00 29.55 ? 329 ILE B CA  1 
ATOM 5127  C C   . ILE B 1 329 ? -34.983 26.179  -15.036 1.00 29.55 ? 329 ILE B C   1 
ATOM 5128  O O   . ILE B 1 329 ? -35.352 25.207  -14.375 1.00 29.55 ? 329 ILE B O   1 
ATOM 5129  C CB  . ILE B 1 329 ? -35.490 28.419  -14.070 1.00 25.56 ? 329 ILE B CB  1 
ATOM 5130  C CG1 . ILE B 1 329 ? -34.905 29.648  -13.368 1.00 25.56 ? 329 ILE B CG1 1 
ATOM 5131  C CG2 . ILE B 1 329 ? -36.572 27.776  -13.204 1.00 25.56 ? 329 ILE B CG2 1 
ATOM 5132  C CD1 . ILE B 1 329 ? -35.936 30.666  -12.918 1.00 25.56 ? 329 ILE B CD1 1 
ATOM 5133  N N   . LYS B 1 330 ? -35.086 26.232  -16.363 1.00 33.76 ? 330 LYS B N   1 
ATOM 5134  C CA  . LYS B 1 330 ? -35.661 25.122  -17.115 1.00 33.76 ? 330 LYS B CA  1 
ATOM 5135  C C   . LYS B 1 330 ? -34.832 23.863  -16.885 1.00 33.76 ? 330 LYS B C   1 
ATOM 5136  O O   . LYS B 1 330 ? -35.339 22.863  -16.379 1.00 33.76 ? 330 LYS B O   1 
ATOM 5137  C CB  . LYS B 1 330 ? -35.724 25.454  -18.613 1.00 79.06 ? 330 LYS B CB  1 
ATOM 5138  C CG  . LYS B 1 330 ? -36.625 24.510  -19.414 1.00 79.06 ? 330 LYS B CG  1 
ATOM 5139  C CD  . LYS B 1 330 ? -36.701 24.870  -20.906 1.00 79.06 ? 330 LYS B CD  1 
ATOM 5140  C CE  . LYS B 1 330 ? -37.367 26.232  -21.161 1.00 79.06 ? 330 LYS B CE  1 
ATOM 5141  N NZ  . LYS B 1 330 ? -37.487 26.550  -22.622 1.00 79.06 ? 330 LYS B NZ  1 
ATOM 5142  N N   . ARG B 1 331 ? -33.550 23.925  -17.235 1.00 35.22 ? 331 ARG B N   1 
ATOM 5143  C CA  . ARG B 1 331 ? -32.657 22.785  -17.067 1.00 35.22 ? 331 ARG B CA  1 
ATOM 5144  C C   . ARG B 1 331 ? -32.569 22.377  -15.599 1.00 35.22 ? 331 ARG B C   1 
ATOM 5145  O O   . ARG B 1 331 ? -32.538 21.189  -15.276 1.00 35.22 ? 331 ARG B O   1 
ATOM 5146  C CB  . ARG B 1 331 ? -31.270 23.133  -17.585 1.00 35.99 ? 331 ARG B CB  1 
ATOM 5147  C CG  . ARG B 1 331 ? -31.294 23.763  -18.947 1.00 35.99 ? 331 ARG B CG  1 
ATOM 5148  C CD  . ARG B 1 331 ? -31.005 22.771  -20.046 1.00 35.99 ? 331 ARG B CD  1 
ATOM 5149  N NE  . ARG B 1 331 ? -32.010 21.723  -20.207 1.00 35.99 ? 331 ARG B NE  1 
ATOM 5150  C CZ  . ARG B 1 331 ? -31.828 20.456  -19.847 1.00 35.99 ? 331 ARG B CZ  1 
ATOM 5151  N NH1 . ARG B 1 331 ? -30.676 20.075  -19.288 1.00 35.99 ? 331 ARG B NH1 1 
ATOM 5152  N NH2 . ARG B 1 331 ? -32.779 19.560  -20.080 1.00 35.99 ? 331 ARG B NH2 1 
ATOM 5153  N N   . ALA B 1 332 ? -32.528 23.359  -14.705 1.00 27.05 ? 332 ALA B N   1 
ATOM 5154  C CA  . ALA B 1 332 ? -32.452 23.053  -13.284 1.00 27.05 ? 332 ALA B CA  1 
ATOM 5155  C C   . ALA B 1 332 ? -33.650 22.194  -12.872 1.00 27.05 ? 332 ALA B C   1 
ATOM 5156  O O   . ALA B 1 332 ? -33.519 21.239  -12.103 1.00 27.05 ? 332 ALA B O   1 
ATOM 5157  C CB  . ALA B 1 332 ? -32.421 24.337  -12.473 1.00 26.97 ? 332 ALA B CB  1 
ATOM 5158  N N   . GLU B 1 333 ? -34.821 22.528  -13.399 1.00 32.34 ? 333 GLU B N   1 
ATOM 5159  C CA  . GLU B 1 333 ? -36.019 21.787  -13.062 1.00 32.34 ? 333 GLU B CA  1 
ATOM 5160  C C   . GLU B 1 333 ? -36.038 20.391  -13.653 1.00 32.34 ? 333 GLU B C   1 
ATOM 5161  O O   . GLU B 1 333 ? -36.317 19.418  -12.947 1.00 32.34 ? 333 GLU B O   1 
ATOM 5162  C CB  . GLU B 1 333 ? -37.249 22.576  -13.492 1.00 48.62 ? 333 GLU B CB  1 
ATOM 5163  C CG  . GLU B 1 333 ? -37.718 23.536  -12.414 1.00 48.62 ? 333 GLU B CG  1 
ATOM 5164  C CD  . GLU B 1 333 ? -38.730 24.544  -12.909 1.00 48.62 ? 333 GLU B CD  1 
ATOM 5165  O OE1 . GLU B 1 333 ? -39.325 25.248  -12.064 1.00 48.62 ? 333 GLU B OE1 1 
ATOM 5166  O OE2 . GLU B 1 333 ? -38.922 24.643  -14.138 1.00 48.62 ? 333 GLU B OE2 1 
ATOM 5167  N N   . VAL B 1 334 ? -35.733 20.279  -14.941 1.00 27.43 ? 334 VAL B N   1 
ATOM 5168  C CA  . VAL B 1 334 ? -35.736 18.967  -15.573 1.00 27.43 ? 334 VAL B CA  1 
ATOM 5169  C C   . VAL B 1 334 ? -34.755 18.029  -14.887 1.00 27.43 ? 334 VAL B C   1 
ATOM 5170  O O   . VAL B 1 334 ? -35.081 16.869  -14.628 1.00 27.43 ? 334 VAL B O   1 
ATOM 5171  C CB  . VAL B 1 334 ? -35.406 19.046  -17.097 1.00 17.58 ? 334 VAL B CB  1 
ATOM 5172  C CG1 . VAL B 1 334 ? -34.665 20.315  -17.403 1.00 17.58 ? 334 VAL B CG1 1 
ATOM 5173  C CG2 . VAL B 1 334 ? -34.571 17.842  -17.528 1.00 17.58 ? 334 VAL B CG2 1 
ATOM 5174  N N   . ASN B 1 335 ? -33.559 18.523  -14.584 1.00 31.54 ? 335 ASN B N   1 
ATOM 5175  C CA  . ASN B 1 335 ? -32.569 17.677  -13.935 1.00 31.54 ? 335 ASN B CA  1 
ATOM 5176  C C   . ASN B 1 335 ? -33.025 17.326  -12.540 1.00 31.54 ? 335 ASN B C   1 
ATOM 5177  O O   . ASN B 1 335 ? -32.689 16.265  -12.022 1.00 31.54 ? 335 ASN B O   1 
ATOM 5178  C CB  . ASN B 1 335 ? -31.197 18.356  -13.929 1.00 33.72 ? 335 ASN B CB  1 
ATOM 5179  C CG  . ASN B 1 335 ? -30.528 18.301  -15.298 1.00 33.72 ? 335 ASN B CG  1 
ATOM 5180  O OD1 . ASN B 1 335 ? -30.370 17.223  -15.876 1.00 33.72 ? 335 ASN B OD1 1 
ATOM 5181  N ND2 . ASN B 1 335 ? -30.141 19.459  -15.824 1.00 33.72 ? 335 ASN B ND2 1 
ATOM 5182  N N   . GLY B 1 336 ? -33.813 18.213  -11.942 1.00 30.02 ? 336 GLY B N   1 
ATOM 5183  C CA  . GLY B 1 336 ? -34.335 17.945  -10.613 1.00 30.02 ? 336 GLY B CA  1 
ATOM 5184  C C   . GLY B 1 336 ? -35.287 16.763  -10.712 1.00 30.02 ? 336 GLY B C   1 
ATOM 5185  O O   . GLY B 1 336 ? -35.496 16.025  -9.747  1.00 30.02 ? 336 GLY B O   1 
ATOM 5186  N N   . LEU B 1 337 ? -35.872 16.593  -11.896 1.00 29.38 ? 337 LEU B N   1 
ATOM 5187  C CA  . LEU B 1 337 ? -36.787 15.489  -12.151 1.00 29.38 ? 337 LEU B CA  1 
ATOM 5188  C C   . LEU B 1 337 ? -35.982 14.244  -12.470 1.00 29.38 ? 337 LEU B C   1 
ATOM 5189  O O   . LEU B 1 337 ? -36.263 13.163  -11.955 1.00 29.38 ? 337 LEU B O   1 
ATOM 5190  C CB  . LEU B 1 337 ? -37.698 15.800  -13.336 1.00 25.06 ? 337 LEU B CB  1 
ATOM 5191  C CG  . LEU B 1 337 ? -38.849 16.786  -13.143 1.00 25.06 ? 337 LEU B CG  1 
ATOM 5192  C CD1 . LEU B 1 337 ? -39.588 16.916  -14.463 1.00 25.06 ? 337 LEU B CD1 1 
ATOM 5193  C CD2 . LEU B 1 337 ? -39.791 16.303  -12.039 1.00 25.06 ? 337 LEU B CD2 1 
ATOM 5194  N N   . ALA B 1 338 ? -34.985 14.405  -13.337 1.00 35.35 ? 338 ALA B N   1 
ATOM 5195  C CA  . ALA B 1 338 ? -34.120 13.300  -13.725 1.00 35.35 ? 338 ALA B CA  1 
ATOM 5196  C C   . ALA B 1 338 ? -33.458 12.721  -12.481 1.00 35.35 ? 338 ALA B C   1 
ATOM 5197  O O   . ALA B 1 338 ? -33.100 11.546  -12.442 1.00 35.35 ? 338 ALA B O   1 
ATOM 5198  C CB  . ALA B 1 338 ? -33.066 13.782  -14.696 1.00 18.74 ? 338 ALA B CB  1 
ATOM 5199  N N   . ALA B 1 339 ? -33.299 13.562  -11.466 1.00 28.84 ? 339 ALA B N   1 
ATOM 5200  C CA  . ALA B 1 339 ? -32.686 13.150  -10.215 1.00 28.84 ? 339 ALA B CA  1 
ATOM 5201  C C   . ALA B 1 339 ? -33.617 12.238  -9.428  1.00 28.84 ? 339 ALA B C   1 
ATOM 5202  O O   . ALA B 1 339 ? -33.286 11.817  -8.317  1.00 28.84 ? 339 ALA B O   1 
ATOM 5203  C CB  . ALA B 1 339 ? -32.333 14.368  -9.381  1.00 30.10 ? 339 ALA B CB  1 
ATOM 5204  N N   . GLN B 1 340 ? -34.787 11.946  -9.991  1.00 41.60 ? 340 GLN B N   1 
ATOM 5205  C CA  . GLN B 1 340 ? -35.757 11.070  -9.337  1.00 41.60 ? 340 GLN B CA  1 
ATOM 5206  C C   . GLN B 1 340 ? -36.291 10.087  -10.362 1.00 41.60 ? 340 GLN B C   1 
ATOM 5207  O O   . GLN B 1 340 ? -37.245 9.353   -10.093 1.00 41.60 ? 340 GLN B O   1 
ATOM 5208  C CB  . GLN B 1 340 ? -36.923 11.871  -8.777  1.00 54.60 ? 340 GLN B CB  1 
ATOM 5209  C CG  . GLN B 1 340 ? -36.523 13.143  -8.088  1.00 54.60 ? 340 GLN B CG  1 
ATOM 5210  C CD  . GLN B 1 340 ? -37.720 13.888  -7.549  1.00 54.60 ? 340 GLN B CD  1 
ATOM 5211  O OE1 . GLN B 1 340 ? -38.406 13.402  -6.649  1.00 54.60 ? 340 GLN B OE1 1 
ATOM 5212  N NE2 . GLN B 1 340 ? -37.988 15.073  -8.101  1.00 54.60 ? 340 GLN B NE2 1 
ATOM 5213  N N   . GLY B 1 341 ? -35.677 10.096  -11.542 1.00 50.56 ? 341 GLY B N   1 
ATOM 5214  C CA  . GLY B 1 341 ? -36.079 9.202   -12.612 1.00 50.56 ? 341 GLY B CA  1 
ATOM 5215  C C   . GLY B 1 341 ? -37.438 9.541   -13.179 1.00 50.56 ? 341 GLY B C   1 
ATOM 5216  O O   . GLY B 1 341 ? -37.978 8.821   -14.023 1.00 50.56 ? 341 GLY B O   1 
ATOM 5217  N N   . LYS B 1 342 ? -37.999 10.648  -12.717 1.00 37.53 ? 342 LYS B N   1 
ATOM 5218  C CA  . LYS B 1 342 ? -39.306 11.057  -13.189 1.00 37.53 ? 342 LYS B CA  1 
ATOM 5219  C C   . LYS B 1 342 ? -39.239 12.225  -14.161 1.00 37.53 ? 342 LYS B C   1 
ATOM 5220  O O   . LYS B 1 342 ? -39.838 13.271  -13.937 1.00 37.53 ? 342 LYS B O   1 
ATOM 5221  C CB  . LYS B 1 342 ? -40.219 11.389  -12.001 1.00 49.78 ? 342 LYS B CB  1 
ATOM 5222  C CG  . LYS B 1 342 ? -39.639 12.372  -11.016 1.00 49.78 ? 342 LYS B CG  1 
ATOM 5223  C CD  . LYS B 1 342 ? -40.604 12.646  -9.863  1.00 49.78 ? 342 LYS B CD  1 
ATOM 5224  C CE  . LYS B 1 342 ? -40.866 11.400  -9.016  1.00 49.78 ? 342 LYS B CE  1 
ATOM 5225  N NZ  . LYS B 1 342 ? -41.721 11.720  -7.827  1.00 49.78 ? 342 LYS B NZ  1 
ATOM 5226  N N   . TYR B 1 343 ? -38.497 12.041  -15.243 1.00 41.63 ? 343 TYR B N   1 
ATOM 5227  C CA  . TYR B 1 343 ? -38.379 13.070  -16.261 1.00 41.63 ? 343 TYR B CA  1 
ATOM 5228  C C   . TYR B 1 343 ? -38.723 12.427  -17.582 1.00 41.63 ? 343 TYR B C   1 
ATOM 5229  O O   . TYR B 1 343 ? -38.103 11.437  -17.962 1.00 41.63 ? 343 TYR B O   1 
ATOM 5230  C CB  . TYR B 1 343 ? -36.956 13.610  -16.343 1.00 39.38 ? 343 TYR B CB  1 
ATOM 5231  C CG  . TYR B 1 343 ? -36.712 14.427  -17.597 1.00 39.38 ? 343 TYR B CG  1 
ATOM 5232  C CD1 . TYR B 1 343 ? -37.360 15.645  -17.801 1.00 39.38 ? 343 TYR B CD1 1 
ATOM 5233  C CD2 . TYR B 1 343 ? -35.840 13.978  -18.588 1.00 39.38 ? 343 TYR B CD2 1 
ATOM 5234  C CE1 . TYR B 1 343 ? -37.142 16.397  -18.960 1.00 39.38 ? 343 TYR B CE1 1 
ATOM 5235  C CE2 . TYR B 1 343 ? -35.615 14.724  -19.753 1.00 39.38 ? 343 TYR B CE2 1 
ATOM 5236  C CZ  . TYR B 1 343 ? -36.268 15.933  -19.928 1.00 39.38 ? 343 TYR B CZ  1 
ATOM 5237  O OH  . TYR B 1 343 ? -36.031 16.684  -21.055 1.00 39.38 ? 343 TYR B OH  1 
ATOM 5238  N N   . GLU B 1 344 ? -39.703 12.980  -18.287 1.00 65.49 ? 344 GLU B N   1 
ATOM 5239  C CA  . GLU B 1 344 ? -40.090 12.421  -19.575 1.00 68.90 ? 344 GLU B CA  1 
ATOM 5240  C C   . GLU B 1 344 ? -39.638 13.348  -20.709 1.00 70.86 ? 344 GLU B C   1 
ATOM 5241  O O   . GLU B 1 344 ? -39.405 14.549  -20.444 1.00 70.96 ? 344 GLU B O   1 
ATOM 5242  C CB  . GLU B 1 344 ? -41.608 12.234  -19.619 1.00 99.51 ? 344 GLU B CB  1 
ATOM 5243  C CG  . GLU B 1 344 ? -42.207 11.582  -18.356 1.00 88.63 ? 344 GLU B CG  1 
ATOM 5244  C CD  . GLU B 1 344 ? -42.498 10.062  -18.507 1.00 88.63 ? 344 GLU B CD  1 
ATOM 5245  O OE1 . GLU B 1 344 ? -43.190 9.674   -19.500 1.00 88.63 ? 344 GLU B OE1 1 
ATOM 5246  O OE2 . GLU B 1 344 ? -42.053 9.258   -17.626 1.00 88.63 ? 344 GLU B OE2 1 
ATOM 5247  N N   . HIS C 1 3   ? -5.631  -3.448  -18.812 1.00 96.43 ? 3   HIS C N   1 
ATOM 5248  C CA  . HIS C 1 3   ? -5.381  -4.173  -17.537 1.00 96.43 ? 3   HIS C CA  1 
ATOM 5249  C C   . HIS C 1 3   ? -6.617  -4.930  -17.072 1.00 96.43 ? 3   HIS C C   1 
ATOM 5250  O O   . HIS C 1 3   ? -6.654  -5.459  -15.957 1.00 96.43 ? 3   HIS C O   1 
ATOM 5251  C CB  . HIS C 1 3   ? -4.900  -3.198  -16.443 1.00 91.83 ? 3   HIS C CB  1 
ATOM 5252  C CG  . HIS C 1 3   ? -5.467  -1.810  -16.550 1.00 91.83 ? 3   HIS C CG  1 
ATOM 5253  N ND1 . HIS C 1 3   ? -4.941  -0.741  -15.851 1.00 91.83 ? 3   HIS C ND1 1 
ATOM 5254  C CD2 . HIS C 1 3   ? -6.501  -1.313  -17.271 1.00 91.83 ? 3   HIS C CD2 1 
ATOM 5255  C CE1 . HIS C 1 3   ? -5.624  0.352   -16.140 1.00 91.83 ? 3   HIS C CE1 1 
ATOM 5256  N NE2 . HIS C 1 3   ? -6.576  0.033   -16.999 1.00 91.83 ? 3   HIS C NE2 1 
ATOM 5257  N N   . SER C 1 4   ? -7.622  -4.988  -17.945 1.00 81.35 ? 4   SER C N   1 
ATOM 5258  C CA  . SER C 1 4   ? -8.877  -5.681  -17.656 1.00 81.35 ? 4   SER C CA  1 
ATOM 5259  C C   . SER C 1 4   ? -9.041  -6.962  -18.487 1.00 81.35 ? 4   SER C C   1 
ATOM 5260  O O   . SER C 1 4   ? -9.493  -6.922  -19.637 1.00 81.35 ? 4   SER C O   1 
ATOM 5261  C CB  . SER C 1 4   ? -10.068 -4.734  -17.892 1.00 93.97 ? 4   SER C CB  1 
ATOM 5262  O OG  . SER C 1 4   ? -9.866  -3.884  -19.017 1.00 93.97 ? 4   SER C OG  1 
ATOM 5263  N N   . TYR C 1 5   ? -8.657  -8.094  -17.900 1.00 85.47 ? 5   TYR C N   1 
ATOM 5264  C CA  . TYR C 1 5   ? -8.760  -9.392  -18.567 1.00 85.47 ? 5   TYR C CA  1 
ATOM 5265  C C   . TYR C 1 5   ? -9.774  -10.255 -17.821 1.00 85.47 ? 5   TYR C C   1 
ATOM 5266  O O   . TYR C 1 5   ? -9.407  -11.073 -16.973 1.00 85.47 ? 5   TYR C O   1 
ATOM 5267  C CB  . TYR C 1 5   ? -7.396  -10.085 -18.598 1.00 87.62 ? 5   TYR C CB  1 
ATOM 5268  C CG  . TYR C 1 5   ? -6.369  -9.332  -19.407 1.00 87.62 ? 5   TYR C CG  1 
ATOM 5269  C CD1 . TYR C 1 5   ? -5.839  -8.121  -18.953 1.00 87.62 ? 5   TYR C CD1 1 
ATOM 5270  C CD2 . TYR C 1 5   ? -5.961  -9.804  -20.649 1.00 87.62 ? 5   TYR C CD2 1 
ATOM 5271  C CE1 . TYR C 1 5   ? -4.929  -7.397  -19.724 1.00 87.62 ? 5   TYR C CE1 1 
ATOM 5272  C CE2 . TYR C 1 5   ? -5.056  -9.091  -21.427 1.00 87.62 ? 5   TYR C CE2 1 
ATOM 5273  C CZ  . TYR C 1 5   ? -4.545  -7.889  -20.962 1.00 87.62 ? 5   TYR C CZ  1 
ATOM 5274  O OH  . TYR C 1 5   ? -3.665  -7.188  -21.752 1.00 87.62 ? 5   TYR C OH  1 
ATOM 5275  N N   . PRO C 1 6   ? -11.069 -10.084 -18.147 1.00 57.19 ? 6   PRO C N   1 
ATOM 5276  C CA  . PRO C 1 6   ? -12.223 -10.778 -17.571 1.00 57.19 ? 6   PRO C CA  1 
ATOM 5277  C C   . PRO C 1 6   ? -11.945 -12.075 -16.818 1.00 57.19 ? 6   PRO C C   1 
ATOM 5278  O O   . PRO C 1 6   ? -11.714 -13.133 -17.413 1.00 57.19 ? 6   PRO C O   1 
ATOM 5279  C CB  . PRO C 1 6   ? -13.128 -10.968 -18.776 1.00 68.88 ? 6   PRO C CB  1 
ATOM 5280  C CG  . PRO C 1 6   ? -12.973 -9.648  -19.452 1.00 68.88 ? 6   PRO C CG  1 
ATOM 5281  C CD  . PRO C 1 6   ? -11.464 -9.413  -19.401 1.00 68.88 ? 6   PRO C CD  1 
ATOM 5282  N N   . ALA C 1 7   ? -11.980 -11.972 -15.494 1.00 53.78 ? 7   ALA C N   1 
ATOM 5283  C CA  . ALA C 1 7   ? -11.746 -13.115 -14.627 1.00 53.78 ? 7   ALA C CA  1 
ATOM 5284  C C   . ALA C 1 7   ? -12.875 -14.125 -14.784 1.00 53.78 ? 7   ALA C C   1 
ATOM 5285  O O   . ALA C 1 7   ? -12.644 -15.337 -14.810 1.00 53.78 ? 7   ALA C O   1 
ATOM 5286  C CB  . ALA C 1 7   ? -11.658 -12.653 -13.179 1.00 16.90 ? 7   ALA C CB  1 
ATOM 5287  N N   . LEU C 1 8   ? -14.099 -13.616 -14.895 1.00 34.82 ? 8   LEU C N   1 
ATOM 5288  C CA  . LEU C 1 8   ? -15.270 -14.464 -15.032 1.00 34.82 ? 8   LEU C CA  1 
ATOM 5289  C C   . LEU C 1 8   ? -16.127 -14.082 -16.219 1.00 34.82 ? 8   LEU C C   1 
ATOM 5290  O O   . LEU C 1 8   ? -16.225 -12.907 -16.575 1.00 34.82 ? 8   LEU C O   1 
ATOM 5291  C CB  . LEU C 1 8   ? -16.127 -14.374 -13.775 1.00 22.47 ? 8   LEU C CB  1 
ATOM 5292  C CG  . LEU C 1 8   ? -15.481 -14.810 -12.464 1.00 22.47 ? 8   LEU C CG  1 
ATOM 5293  C CD1 . LEU C 1 8   ? -16.393 -14.425 -11.314 1.00 22.47 ? 8   LEU C CD1 1 
ATOM 5294  C CD2 . LEU C 1 8   ? -15.227 -16.314 -12.481 1.00 22.47 ? 8   LEU C CD2 1 
ATOM 5295  N N   . SER C 1 9   ? -16.757 -15.089 -16.816 1.00 31.44 ? 9   SER C N   1 
ATOM 5296  C CA  . SER C 1 9   ? -17.644 -14.881 -17.946 1.00 31.44 ? 9   SER C CA  1 
ATOM 5297  C C   . SER C 1 9   ? -18.962 -14.409 -17.364 1.00 31.44 ? 9   SER C C   1 
ATOM 5298  O O   . SER C 1 9   ? -19.166 -14.454 -16.147 1.00 31.44 ? 9   SER C O   1 
ATOM 5299  C CB  . SER C 1 9   ? -17.885 -16.185 -18.689 1.00 27.92 ? 9   SER C CB  1 
ATOM 5300  O OG  . SER C 1 9   ? -18.738 -17.021 -17.935 1.00 27.92 ? 9   SER C OG  1 
ATOM 5301  N N   . ALA C 1 10  ? -19.862 -13.970 -18.232 1.00 25.48 ? 10  ALA C N   1 
ATOM 5302  C CA  . ALA C 1 10  ? -21.160 -13.490 -17.780 1.00 25.48 ? 10  ALA C CA  1 
ATOM 5303  C C   . ALA C 1 10  ? -21.926 -14.627 -17.129 1.00 25.48 ? 10  ALA C C   1 
ATOM 5304  O O   . ALA C 1 10  ? -22.576 -14.448 -16.101 1.00 25.48 ? 10  ALA C O   1 
ATOM 5305  C CB  . ALA C 1 10  ? -21.941 -12.940 -18.950 1.00 12.72 ? 10  ALA C CB  1 
ATOM 5306  N N   . GLU C 1 11  ? -21.838 -15.801 -17.739 1.00 31.95 ? 11  GLU C N   1 
ATOM 5307  C CA  . GLU C 1 11  ? -22.522 -16.975 -17.229 1.00 31.95 ? 11  GLU C CA  1 
ATOM 5308  C C   . GLU C 1 11  ? -22.043 -17.263 -15.817 1.00 31.95 ? 11  GLU C C   1 
ATOM 5309  O O   . GLU C 1 11  ? -22.843 -17.454 -14.905 1.00 31.95 ? 11  GLU C O   1 
ATOM 5310  C CB  . GLU C 1 11  ? -22.210 -18.173 -18.115 1.00 99.51 ? 11  GLU C CB  1 
ATOM 5311  C CG  . GLU C 1 11  ? -21.861 -17.795 -19.536 1.00 99.51 ? 11  GLU C CG  1 
ATOM 5312  C CD  . GLU C 1 11  ? -22.894 -18.273 -20.527 1.00 99.51 ? 11  GLU C CD  1 
ATOM 5313  O OE1 . GLU C 1 11  ? -23.119 -19.506 -20.604 1.00 99.51 ? 11  GLU C OE1 1 
ATOM 5314  O OE2 . GLU C 1 11  ? -23.477 -17.415 -21.226 1.00 99.51 ? 11  GLU C OE2 1 
ATOM 5315  N N   . GLN C 1 12  ? -20.725 -17.286 -15.648 1.00 34.90 ? 12  GLN C N   1 
ATOM 5316  C CA  . GLN C 1 12  ? -20.112 -17.575 -14.360 1.00 34.90 ? 12  GLN C CA  1 
ATOM 5317  C C   . GLN C 1 12  ? -20.507 -16.596 -13.273 1.00 34.90 ? 12  GLN C C   1 
ATOM 5318  O O   . GLN C 1 12  ? -20.827 -16.999 -12.154 1.00 34.90 ? 12  GLN C O   1 
ATOM 5319  C CB  . GLN C 1 12  ? -18.599 -17.590 -14.502 1.00 42.60 ? 12  GLN C CB  1 
ATOM 5320  C CG  . GLN C 1 12  ? -18.110 -18.577 -15.526 1.00 42.60 ? 12  GLN C CG  1 
ATOM 5321  C CD  . GLN C 1 12  ? -16.617 -18.534 -15.684 1.00 42.60 ? 12  GLN C CD  1 
ATOM 5322  O OE1 . GLN C 1 12  ? -16.044 -17.493 -16.000 1.00 42.60 ? 12  GLN C OE1 1 
ATOM 5323  N NE2 . GLN C 1 12  ? -15.971 -19.667 -15.463 1.00 42.60 ? 12  GLN C NE2 1 
ATOM 5324  N N   . LYS C 1 13  ? -20.467 -15.308 -13.596 1.00 36.32 ? 13  LYS C N   1 
ATOM 5325  C CA  . LYS C 1 13  ? -20.840 -14.299 -12.622 1.00 36.32 ? 13  LYS C CA  1 
ATOM 5326  C C   . LYS C 1 13  ? -22.263 -14.588 -12.167 1.00 36.32 ? 13  LYS C C   1 
ATOM 5327  O O   . LYS C 1 13  ? -22.579 -14.496 -10.978 1.00 36.32 ? 13  LYS C O   1 
ATOM 5328  C CB  . LYS C 1 13  ? -20.782 -12.908 -13.239 1.00 34.25 ? 13  LYS C CB  1 
ATOM 5329  C CG  . LYS C 1 13  ? -19.403 -12.411 -13.620 1.00 34.25 ? 13  LYS C CG  1 
ATOM 5330  C CD  . LYS C 1 13  ? -19.538 -10.993 -14.144 1.00 34.25 ? 13  LYS C CD  1 
ATOM 5331  C CE  . LYS C 1 13  ? -18.228 -10.399 -14.616 1.00 34.25 ? 13  LYS C CE  1 
ATOM 5332  N NZ  . LYS C 1 13  ? -18.422 -8.963  -15.040 1.00 34.25 ? 13  LYS C NZ  1 
ATOM 5333  N N   . LYS C 1 14  ? -23.120 -14.940 -13.122 1.00 27.36 ? 14  LYS C N   1 
ATOM 5334  C CA  . LYS C 1 14  ? -24.517 -15.252 -12.830 1.00 27.36 ? 14  LYS C CA  1 
ATOM 5335  C C   . LYS C 1 14  ? -24.592 -16.366 -11.797 1.00 27.36 ? 14  LYS C C   1 
ATOM 5336  O O   . LYS C 1 14  ? -25.134 -16.173 -10.711 1.00 27.36 ? 14  LYS C O   1 
ATOM 5337  C CB  . LYS C 1 14  ? -25.247 -15.680 -14.108 1.00 63.46 ? 14  LYS C CB  1 
ATOM 5338  C CG  . LYS C 1 14  ? -26.728 -15.997 -13.921 1.00 63.46 ? 14  LYS C CG  1 
ATOM 5339  C CD  . LYS C 1 14  ? -27.457 -14.857 -13.220 1.00 63.46 ? 14  LYS C CD  1 
ATOM 5340  C CE  . LYS C 1 14  ? -27.193 -13.508 -13.907 1.00 63.46 ? 14  LYS C CE  1 
ATOM 5341  N NZ  . LYS C 1 14  ? -27.629 -12.320 -13.094 1.00 63.46 ? 14  LYS C NZ  1 
ATOM 5342  N N   . GLU C 1 15  ? -24.029 -17.525 -12.132 1.00 21.49 ? 15  GLU C N   1 
ATOM 5343  C CA  . GLU C 1 15  ? -24.041 -18.671 -11.233 1.00 21.49 ? 15  GLU C CA  1 
ATOM 5344  C C   . GLU C 1 15  ? -23.614 -18.315 -9.819  1.00 21.49 ? 15  GLU C C   1 
ATOM 5345  O O   . GLU C 1 15  ? -24.238 -18.746 -8.848  1.00 21.49 ? 15  GLU C O   1 
ATOM 5346  C CB  . GLU C 1 15  ? -23.135 -19.785 -11.755 1.00 41.22 ? 15  GLU C CB  1 
ATOM 5347  C CG  . GLU C 1 15  ? -22.924 -20.882 -10.724 1.00 41.22 ? 15  GLU C CG  1 
ATOM 5348  C CD  . GLU C 1 15  ? -22.116 -22.056 -11.249 1.00 41.22 ? 15  GLU C CD  1 
ATOM 5349  O OE1 . GLU C 1 15  ? -21.111 -21.819 -11.960 1.00 41.22 ? 15  GLU C OE1 1 
ATOM 5350  O OE2 . GLU C 1 15  ? -22.481 -23.215 -10.935 1.00 41.22 ? 15  GLU C OE2 1 
ATOM 5351  N N   . LEU C 1 16  ? -22.548 -17.535 -9.698  1.00 30.94 ? 16  LEU C N   1 
ATOM 5352  C CA  . LEU C 1 16  ? -22.064 -17.157 -8.382  1.00 30.94 ? 16  LEU C CA  1 
ATOM 5353  C C   . LEU C 1 16  ? -23.095 -16.296 -7.667  1.00 30.94 ? 16  LEU C C   1 
ATOM 5354  O O   . LEU C 1 16  ? -23.491 -16.595 -6.538  1.00 30.94 ? 16  LEU C O   1 
ATOM 5355  C CB  . LEU C 1 16  ? -20.727 -16.420 -8.505  1.00 18.37 ? 16  LEU C CB  1 
ATOM 5356  C CG  . LEU C 1 16  ? -19.554 -17.293 -8.972  1.00 18.37 ? 16  LEU C CG  1 
ATOM 5357  C CD1 . LEU C 1 16  ? -18.351 -16.421 -9.287  1.00 18.37 ? 16  LEU C CD1 1 
ATOM 5358  C CD2 . LEU C 1 16  ? -19.213 -18.317 -7.891  1.00 18.37 ? 16  LEU C CD2 1 
ATOM 5359  N N   . SER C 1 17  ? -23.546 -15.238 -8.335  1.00 27.91 ? 17  SER C N   1 
ATOM 5360  C CA  . SER C 1 17  ? -24.532 -14.343 -7.747  1.00 27.91 ? 17  SER C CA  1 
ATOM 5361  C C   . SER C 1 17  ? -25.773 -15.084 -7.275  1.00 27.91 ? 17  SER C C   1 
ATOM 5362  O O   . SER C 1 17  ? -26.265 -14.838 -6.173  1.00 27.91 ? 17  SER C O   1 
ATOM 5363  C CB  . SER C 1 17  ? -24.952 -13.277 -8.741  1.00 25.50 ? 17  SER C CB  1 
ATOM 5364  O OG  . SER C 1 17  ? -25.930 -12.463 -8.132  1.00 25.50 ? 17  SER C OG  1 
ATOM 5365  N N   . ASP C 1 18  ? -26.285 -15.980 -8.114  1.00 26.62 ? 18  ASP C N   1 
ATOM 5366  C CA  . ASP C 1 18  ? -27.464 -16.751 -7.756  1.00 26.62 ? 18  ASP C CA  1 
ATOM 5367  C C   . ASP C 1 18  ? -27.177 -17.522 -6.475  1.00 26.62 ? 18  ASP C C   1 
ATOM 5368  O O   . ASP C 1 18  ? -27.845 -17.321 -5.462  1.00 26.62 ? 18  ASP C O   1 
ATOM 5369  C CB  . ASP C 1 18  ? -27.853 -17.715 -8.882  1.00 48.84 ? 18  ASP C CB  1 
ATOM 5370  C CG  . ASP C 1 18  ? -28.310 -16.990 -10.153 1.00 48.84 ? 18  ASP C CG  1 
ATOM 5371  O OD1 . ASP C 1 18  ? -28.764 -15.820 -10.058 1.00 48.84 ? 18  ASP C OD1 1 
ATOM 5372  O OD2 . ASP C 1 18  ? -28.230 -17.596 -11.250 1.00 48.84 ? 18  ASP C OD2 1 
ATOM 5373  N N   . ILE C 1 19  ? -26.172 -18.388 -6.514  1.00 19.21 ? 19  ILE C N   1 
ATOM 5374  C CA  . ILE C 1 19  ? -25.804 -19.164 -5.339  1.00 19.21 ? 19  ILE C CA  1 
ATOM 5375  C C   . ILE C 1 19  ? -25.738 -18.292 -4.093  1.00 19.21 ? 19  ILE C C   1 
ATOM 5376  O O   . ILE C 1 19  ? -26.252 -18.653 -3.041  1.00 19.21 ? 19  ILE C O   1 
ATOM 5377  C CB  . ILE C 1 19  ? -24.432 -19.816 -5.515  1.00 8.45  ? 19  ILE C CB  1 
ATOM 5378  C CG1 . ILE C 1 19  ? -24.468 -20.761 -6.706  1.00 8.45  ? 19  ILE C CG1 1 
ATOM 5379  C CG2 . ILE C 1 19  ? -24.036 -20.552 -4.248  1.00 8.45  ? 19  ILE C CG2 1 
ATOM 5380  C CD1 . ILE C 1 19  ? -23.172 -21.495 -6.936  1.00 8.45  ? 19  ILE C CD1 1 
ATOM 5381  N N   . ALA C 1 20  ? -25.096 -17.139 -4.214  1.00 29.37 ? 20  ALA C N   1 
ATOM 5382  C CA  . ALA C 1 20  ? -24.958 -16.244 -3.081  1.00 29.37 ? 20  ALA C CA  1 
ATOM 5383  C C   . ALA C 1 20  ? -26.309 -15.834 -2.525  1.00 29.37 ? 20  ALA C C   1 
ATOM 5384  O O   . ALA C 1 20  ? -26.568 -15.965 -1.327  1.00 29.37 ? 20  ALA C O   1 
ATOM 5385  C CB  . ALA C 1 20  ? -24.178 -15.016 -3.485  1.00 27.16 ? 20  ALA C CB  1 
ATOM 5386  N N   . LEU C 1 21  ? -27.167 -15.338 -3.407  1.00 34.30 ? 21  LEU C N   1 
ATOM 5387  C CA  . LEU C 1 21  ? -28.494 -14.886 -3.018  1.00 34.30 ? 21  LEU C CA  1 
ATOM 5388  C C   . LEU C 1 21  ? -29.371 -15.977 -2.420  1.00 34.30 ? 21  LEU C C   1 
ATOM 5389  O O   . LEU C 1 21  ? -30.154 -15.712 -1.509  1.00 34.30 ? 21  LEU C O   1 
ATOM 5390  C CB  . LEU C 1 21  ? -29.188 -14.263 -4.218  1.00 8.52  ? 21  LEU C CB  1 
ATOM 5391  C CG  . LEU C 1 21  ? -28.484 -12.990 -4.687  1.00 8.52  ? 21  LEU C CG  1 
ATOM 5392  C CD1 . LEU C 1 21  ? -28.980 -12.592 -6.060  1.00 8.52  ? 21  LEU C CD1 1 
ATOM 5393  C CD2 . LEU C 1 21  ? -28.712 -11.887 -3.675  1.00 8.52  ? 21  LEU C CD2 1 
ATOM 5394  N N   . ARG C 1 22  ? -29.254 -17.201 -2.925  1.00 30.02 ? 22  ARG C N   1 
ATOM 5395  C CA  . ARG C 1 22  ? -30.054 -18.287 -2.384  1.00 30.02 ? 22  ARG C CA  1 
ATOM 5396  C C   . ARG C 1 22  ? -29.705 -18.481 -0.925  1.00 30.02 ? 22  ARG C C   1 
ATOM 5397  O O   . ARG C 1 22  ? -30.583 -18.642 -0.077  1.00 30.02 ? 22  ARG C O   1 
ATOM 5398  C CB  . ARG C 1 22  ? -29.788 -19.586 -3.129  1.00 51.33 ? 22  ARG C CB  1 
ATOM 5399  C CG  . ARG C 1 22  ? -30.279 -19.589 -4.553  1.00 51.33 ? 22  ARG C CG  1 
ATOM 5400  C CD  . ARG C 1 22  ? -29.974 -20.919 -5.166  1.00 51.33 ? 22  ARG C CD  1 
ATOM 5401  N NE  . ARG C 1 22  ? -30.466 -21.986 -4.302  1.00 51.33 ? 22  ARG C NE  1 
ATOM 5402  C CZ  . ARG C 1 22  ? -30.033 -23.242 -4.354  1.00 51.33 ? 22  ARG C CZ  1 
ATOM 5403  N NH1 . ARG C 1 22  ? -29.091 -23.581 -5.231  1.00 51.33 ? 22  ARG C NH1 1 
ATOM 5404  N NH2 . ARG C 1 22  ? -30.545 -24.163 -3.537  1.00 51.33 ? 22  ARG C NH2 1 
ATOM 5405  N N   . ILE C 1 23  ? -28.413 -18.459 -0.634  1.00 30.88 ? 23  ILE C N   1 
ATOM 5406  C CA  . ILE C 1 23  ? -27.945 -18.651 0.723   1.00 30.88 ? 23  ILE C CA  1 
ATOM 5407  C C   . ILE C 1 23  ? -28.481 -17.594 1.683   1.00 30.88 ? 23  ILE C C   1 
ATOM 5408  O O   . ILE C 1 23  ? -29.003 -17.937 2.736   1.00 30.88 ? 23  ILE C O   1 
ATOM 5409  C CB  . ILE C 1 23  ? -26.403 -18.672 0.766   1.00 20.53 ? 23  ILE C CB  1 
ATOM 5410  C CG1 . ILE C 1 23  ? -25.892 -19.786 -0.151  1.00 20.53 ? 23  ILE C CG1 1 
ATOM 5411  C CG2 . ILE C 1 23  ? -25.914 -18.891 2.191   1.00 20.53 ? 23  ILE C CG2 1 
ATOM 5412  C CD1 . ILE C 1 23  ? -24.395 -19.840 -0.291  1.00 20.53 ? 23  ILE C CD1 1 
ATOM 5413  N N   . VAL C 1 24  ? -28.380 -16.319 1.328   1.00 35.21 ? 24  VAL C N   1 
ATOM 5414  C CA  . VAL C 1 24  ? -28.861 -15.285 2.234   1.00 35.21 ? 24  VAL C CA  1 
ATOM 5415  C C   . VAL C 1 24  ? -30.293 -14.834 2.017   1.00 35.21 ? 24  VAL C C   1 
ATOM 5416  O O   . VAL C 1 24  ? -30.696 -13.782 2.509   1.00 35.21 ? 24  VAL C O   1 
ATOM 5417  C CB  . VAL C 1 24  ? -27.950 -14.052 2.214   1.00 20.36 ? 24  VAL C CB  1 
ATOM 5418  C CG1 . VAL C 1 24  ? -26.627 -14.400 2.865   1.00 20.36 ? 24  VAL C CG1 1 
ATOM 5419  C CG2 . VAL C 1 24  ? -27.739 -13.573 0.794   1.00 20.36 ? 24  VAL C CG2 1 
ATOM 5420  N N   . ALA C 1 25  ? -31.064 -15.635 1.290   1.00 35.46 ? 25  ALA C N   1 
ATOM 5421  C CA  . ALA C 1 25  ? -32.466 -15.317 1.038   1.00 35.46 ? 25  ALA C CA  1 
ATOM 5422  C C   . ALA C 1 25  ? -33.140 -14.977 2.363   1.00 35.46 ? 25  ALA C C   1 
ATOM 5423  O O   . ALA C 1 25  ? -32.784 -15.525 3.409   1.00 35.46 ? 25  ALA C O   1 
ATOM 5424  C CB  . ALA C 1 25  ? -33.157 -16.491 0.402   1.00 25.78 ? 25  ALA C CB  1 
ATOM 5425  N N   . PRO C 1 26  ? -34.135 -14.076 2.328   1.00 23.85 ? 26  PRO C N   1 
ATOM 5426  C CA  . PRO C 1 26  ? -34.903 -13.605 3.485   1.00 23.85 ? 26  PRO C CA  1 
ATOM 5427  C C   . PRO C 1 26  ? -35.211 -14.651 4.543   1.00 23.85 ? 26  PRO C C   1 
ATOM 5428  O O   . PRO C 1 26  ? -35.612 -15.767 4.226   1.00 23.85 ? 26  PRO C O   1 
ATOM 5429  C CB  . PRO C 1 26  ? -36.160 -13.050 2.844   1.00 17.34 ? 26  PRO C CB  1 
ATOM 5430  C CG  . PRO C 1 26  ? -35.624 -12.452 1.585   1.00 17.34 ? 26  PRO C CG  1 
ATOM 5431  C CD  . PRO C 1 26  ? -34.719 -13.553 1.080   1.00 17.34 ? 26  PRO C CD  1 
ATOM 5432  N N   . GLY C 1 27  ? -35.010 -14.282 5.804   1.00 37.36 ? 27  GLY C N   1 
ATOM 5433  C CA  . GLY C 1 27  ? -35.288 -15.200 6.893   1.00 37.36 ? 27  GLY C CA  1 
ATOM 5434  C C   . GLY C 1 27  ? -34.450 -16.464 6.902   1.00 37.36 ? 27  GLY C C   1 
ATOM 5435  O O   . GLY C 1 27  ? -34.730 -17.387 7.673   1.00 37.36 ? 27  GLY C O   1 
ATOM 5436  N N   . LYS C 1 28  ? -33.428 -16.509 6.051   1.00 28.92 ? 28  LYS C N   1 
ATOM 5437  C CA  . LYS C 1 28  ? -32.537 -17.663 5.972   1.00 28.92 ? 28  LYS C CA  1 
ATOM 5438  C C   . LYS C 1 28  ? -31.109 -17.344 6.444   1.00 28.92 ? 28  LYS C C   1 
ATOM 5439  O O   . LYS C 1 28  ? -30.595 -16.231 6.248   1.00 28.92 ? 28  LYS C O   1 
ATOM 5440  C CB  . LYS C 1 28  ? -32.504 -18.196 4.539   1.00 28.40 ? 28  LYS C CB  1 
ATOM 5441  C CG  . LYS C 1 28  ? -33.711 -19.034 4.145   1.00 28.40 ? 28  LYS C CG  1 
ATOM 5442  C CD  . LYS C 1 28  ? -33.810 -19.144 2.622   1.00 28.40 ? 28  LYS C CD  1 
ATOM 5443  C CE  . LYS C 1 28  ? -34.822 -20.188 2.163   1.00 28.40 ? 28  LYS C CE  1 
ATOM 5444  N NZ  . LYS C 1 28  ? -34.296 -21.562 2.384   1.00 28.40 ? 28  LYS C NZ  1 
ATOM 5445  N N   . GLY C 1 29  ? -30.485 -18.334 7.077   1.00 29.81 ? 29  GLY C N   1 
ATOM 5446  C CA  . GLY C 1 29  ? -29.135 -18.185 7.577   1.00 29.81 ? 29  GLY C CA  1 
ATOM 5447  C C   . GLY C 1 29  ? -28.307 -19.416 7.256   1.00 29.81 ? 29  GLY C C   1 
ATOM 5448  O O   . GLY C 1 29  ? -28.745 -20.294 6.504   1.00 29.81 ? 29  GLY C O   1 
ATOM 5449  N N   . ILE C 1 30  ? -27.114 -19.496 7.838   1.00 25.97 ? 30  ILE C N   1 
ATOM 5450  C CA  . ILE C 1 30  ? -26.207 -20.611 7.583   1.00 25.97 ? 30  ILE C CA  1 
ATOM 5451  C C   . ILE C 1 30  ? -25.891 -21.442 8.814   1.00 25.97 ? 30  ILE C C   1 
ATOM 5452  O O   . ILE C 1 30  ? -25.613 -20.897 9.883   1.00 25.97 ? 30  ILE C O   1 
ATOM 5453  C CB  . ILE C 1 30  ? -24.851 -20.106 7.018   1.00 13.86 ? 30  ILE C CB  1 
ATOM 5454  C CG1 . ILE C 1 30  ? -25.047 -19.472 5.641   1.00 13.86 ? 30  ILE C CG1 1 
ATOM 5455  C CG2 . ILE C 1 30  ? -23.868 -21.253 6.923   1.00 13.86 ? 30  ILE C CG2 1 
ATOM 5456  C CD1 . ILE C 1 30  ? -23.820 -18.774 5.115   1.00 13.86 ? 30  ILE C CD1 1 
ATOM 5457  N N   . LEU C 1 31  ? -25.936 -22.762 8.665   1.00 32.85 ? 31  LEU C N   1 
ATOM 5458  C CA  . LEU C 1 31  ? -25.578 -23.639 9.765   1.00 32.85 ? 31  LEU C CA  1 
ATOM 5459  C C   . LEU C 1 31  ? -24.116 -23.958 9.544   1.00 32.85 ? 31  LEU C C   1 
ATOM 5460  O O   . LEU C 1 31  ? -23.752 -24.554 8.528   1.00 32.85 ? 31  LEU C O   1 
ATOM 5461  C CB  . LEU C 1 31  ? -26.357 -24.948 9.739   1.00 18.31 ? 31  LEU C CB  1 
ATOM 5462  C CG  . LEU C 1 31  ? -25.701 -25.994 10.657  1.00 18.31 ? 31  LEU C CG  1 
ATOM 5463  C CD1 . LEU C 1 31  ? -25.710 -25.494 12.092  1.00 18.31 ? 31  LEU C CD1 1 
ATOM 5464  C CD2 . LEU C 1 31  ? -26.421 -27.323 10.547  1.00 18.31 ? 31  LEU C CD2 1 
ATOM 5465  N N   . ALA C 1 32  ? -23.278 -23.560 10.489  1.00 31.25 ? 32  ALA C N   1 
ATOM 5466  C CA  . ALA C 1 32  ? -21.854 -23.811 10.372  1.00 31.25 ? 32  ALA C CA  1 
ATOM 5467  C C   . ALA C 1 32  ? -21.473 -25.065 11.146  1.00 31.25 ? 32  ALA C C   1 
ATOM 5468  O O   . ALA C 1 32  ? -21.207 -25.008 12.349  1.00 31.25 ? 32  ALA C O   1 
ATOM 5469  C CB  . ALA C 1 32  ? -21.073 -22.614 10.891  1.00 27.14 ? 32  ALA C CB  1 
ATOM 5470  N N   . ALA C 1 33  ? -21.448 -26.198 10.450  1.00 38.49 ? 33  ALA C N   1 
ATOM 5471  C CA  . ALA C 1 33  ? -21.090 -27.464 11.072  1.00 38.49 ? 33  ALA C CA  1 
ATOM 5472  C C   . ALA C 1 33  ? -19.731 -27.928 10.540  1.00 38.49 ? 33  ALA C C   1 
ATOM 5473  O O   . ALA C 1 33  ? -19.496 -29.125 10.331  1.00 38.49 ? 33  ALA C O   1 
ATOM 5474  C CB  . ALA C 1 33  ? -22.160 -28.495 10.771  1.00 29.51 ? 33  ALA C CB  1 
ATOM 5475  N N   . ASP C 1 34  ? -18.837 -26.968 10.329  1.00 40.98 ? 34  ASP C N   1 
ATOM 5476  C CA  . ASP C 1 34  ? -17.506 -27.254 9.802   1.00 40.98 ? 34  ASP C CA  1 
ATOM 5477  C C   . ASP C 1 34  ? -16.454 -27.440 10.899  1.00 40.98 ? 34  ASP C C   1 
ATOM 5478  O O   . ASP C 1 34  ? -15.272 -27.150 10.694  1.00 40.98 ? 34  ASP C O   1 
ATOM 5479  C CB  . ASP C 1 34  ? -17.077 -26.128 8.846   1.00 46.35 ? 34  ASP C CB  1 
ATOM 5480  C CG  . ASP C 1 34  ? -16.988 -24.764 9.536   1.00 46.35 ? 34  ASP C CG  1 
ATOM 5481  O OD1 . ASP C 1 34  ? -17.944 -24.386 10.250  1.00 46.35 ? 34  ASP C OD1 1 
ATOM 5482  O OD2 . ASP C 1 34  ? -15.967 -24.054 9.359   1.00 46.35 ? 34  ASP C OD2 1 
ATOM 5483  N N   . GLU C 1 35  ? -16.875 -27.940 12.057  1.00 44.79 ? 35  GLU C N   1 
ATOM 5484  C CA  . GLU C 1 35  ? -15.943 -28.144 13.165  1.00 44.79 ? 35  GLU C CA  1 
ATOM 5485  C C   . GLU C 1 35  ? -14.853 -29.167 12.855  1.00 44.79 ? 35  GLU C C   1 
ATOM 5486  O O   . GLU C 1 35  ? -15.130 -30.342 12.575  1.00 44.79 ? 35  GLU C O   1 
ATOM 5487  C CB  . GLU C 1 35  ? -16.679 -28.580 14.441  1.00 43.44 ? 35  GLU C CB  1 
ATOM 5488  C CG  . GLU C 1 35  ? -17.578 -27.530 15.073  1.00 43.44 ? 35  GLU C CG  1 
ATOM 5489  C CD  . GLU C 1 35  ? -19.000 -27.545 14.528  1.00 43.44 ? 35  GLU C CD  1 
ATOM 5490  O OE1 . GLU C 1 35  ? -19.882 -26.955 15.186  1.00 43.44 ? 35  GLU C OE1 1 
ATOM 5491  O OE2 . GLU C 1 35  ? -19.245 -28.137 13.451  1.00 43.44 ? 35  GLU C OE2 1 
ATOM 5492  N N   . SER C 1 36  ? -13.605 -28.709 12.909  1.00 53.59 ? 36  SER C N   1 
ATOM 5493  C CA  . SER C 1 36  ? -12.454 -29.574 12.666  1.00 53.59 ? 36  SER C CA  1 
ATOM 5494  C C   . SER C 1 36  ? -12.494 -30.733 13.656  1.00 53.59 ? 36  SER C C   1 
ATOM 5495  O O   . SER C 1 36  ? -13.041 -30.606 14.755  1.00 53.59 ? 36  SER C O   1 
ATOM 5496  C CB  . SER C 1 36  ? -11.150 -28.785 12.844  1.00 49.24 ? 36  SER C CB  1 
ATOM 5497  O OG  . SER C 1 36  ? -11.135 -28.077 14.076  1.00 49.24 ? 36  SER C OG  1 
ATOM 5498  N N   . VAL C 1 37  ? -11.927 -31.869 13.266  1.00 44.24 ? 37  VAL C N   1 
ATOM 5499  C CA  . VAL C 1 37  ? -11.910 -33.028 14.150  1.00 44.24 ? 37  VAL C CA  1 
ATOM 5500  C C   . VAL C 1 37  ? -11.270 -32.639 15.482  1.00 44.24 ? 37  VAL C C   1 
ATOM 5501  O O   . VAL C 1 37  ? -11.531 -33.248 16.518  1.00 44.24 ? 37  VAL C O   1 
ATOM 5502  C CB  . VAL C 1 37  ? -11.127 -34.184 13.510  1.00 34.20 ? 37  VAL C CB  1 
ATOM 5503  C CG1 . VAL C 1 37  ? -9.822  -33.654 12.936  1.00 34.20 ? 37  VAL C CG1 1 
ATOM 5504  C CG2 . VAL C 1 37  ? -10.881 -35.282 14.539  1.00 34.20 ? 37  VAL C CG2 1 
ATOM 5505  N N   . GLY C 1 38  ? -10.442 -31.602 15.442  1.00 45.78 ? 38  GLY C N   1 
ATOM 5506  C CA  . GLY C 1 38  ? -9.788  -31.136 16.647  1.00 45.78 ? 38  GLY C CA  1 
ATOM 5507  C C   . GLY C 1 38  ? -10.752 -30.406 17.559  1.00 45.78 ? 38  GLY C C   1 
ATOM 5508  O O   . GLY C 1 38  ? -10.987 -30.831 18.692  1.00 45.78 ? 38  GLY C O   1 
ATOM 5509  N N   . SER C 1 39  ? -11.314 -29.301 17.075  1.00 51.21 ? 39  SER C N   1 
ATOM 5510  C CA  . SER C 1 39  ? -12.259 -28.526 17.873  1.00 51.21 ? 39  SER C CA  1 
ATOM 5511  C C   . SER C 1 39  ? -13.464 -29.388 18.238  1.00 51.21 ? 39  SER C C   1 
ATOM 5512  O O   . SER C 1 39  ? -14.116 -29.169 19.260  1.00 51.21 ? 39  SER C O   1 
ATOM 5513  C CB  . SER C 1 39  ? -12.703 -27.271 17.112  1.00 43.89 ? 39  SER C CB  1 
ATOM 5514  O OG  . SER C 1 39  ? -13.035 -27.566 15.768  1.00 43.89 ? 39  SER C OG  1 
ATOM 5515  N N   . MET C 1 40  ? -13.742 -30.385 17.406  1.00 48.67 ? 40  MET C N   1 
ATOM 5516  C CA  . MET C 1 40  ? -14.859 -31.275 17.652  1.00 48.67 ? 40  MET C CA  1 
ATOM 5517  C C   . MET C 1 40  ? -14.583 -32.116 18.896  1.00 48.67 ? 40  MET C C   1 
ATOM 5518  O O   . MET C 1 40  ? -15.504 -32.530 19.598  1.00 48.67 ? 40  MET C O   1 
ATOM 5519  C CB  . MET C 1 40  ? -15.085 -32.187 16.450  1.00 46.14 ? 40  MET C CB  1 
ATOM 5520  C CG  . MET C 1 40  ? -16.504 -32.718 16.367  1.00 46.14 ? 40  MET C CG  1 
ATOM 5521  S SD  . MET C 1 40  ? -17.708 -31.394 16.068  1.00 46.14 ? 40  MET C SD  1 
ATOM 5522  C CE  . MET C 1 40  ? -18.251 -31.018 17.723  1.00 46.14 ? 40  MET C CE  1 
ATOM 5523  N N   . ALA C 1 41  ? -13.311 -32.369 19.170  1.00 51.47 ? 41  ALA C N   1 
ATOM 5524  C CA  . ALA C 1 41  ? -12.950 -33.154 20.340  1.00 51.47 ? 41  ALA C CA  1 
ATOM 5525  C C   . ALA C 1 41  ? -13.364 -32.399 21.591  1.00 51.47 ? 41  ALA C C   1 
ATOM 5526  O O   . ALA C 1 41  ? -13.944 -32.972 22.509  1.00 51.47 ? 41  ALA C O   1 
ATOM 5527  C CB  . ALA C 1 41  ? -11.461 -33.408 20.357  1.00 31.36 ? 41  ALA C CB  1 
ATOM 5528  N N   . LYS C 1 42  ? -13.071 -31.104 21.621  1.00 51.21 ? 42  LYS C N   1 
ATOM 5529  C CA  . LYS C 1 42  ? -13.420 -30.287 22.772  1.00 51.21 ? 42  LYS C CA  1 
ATOM 5530  C C   . LYS C 1 42  ? -14.920 -30.242 23.016  1.00 51.21 ? 42  LYS C C   1 
ATOM 5531  O O   . LYS C 1 42  ? -15.372 -30.402 24.150  1.00 51.21 ? 42  LYS C O   1 
ATOM 5532  C CB  . LYS C 1 42  ? -12.887 -28.864 22.606  1.00 92.04 ? 42  LYS C CB  1 
ATOM 5533  C CG  . LYS C 1 42  ? -11.383 -28.772 22.713  1.00 92.04 ? 42  LYS C CG  1 
ATOM 5534  C CD  . LYS C 1 42  ? -10.936 -27.358 23.036  1.00 92.04 ? 42  LYS C CD  1 
ATOM 5535  C CE  . LYS C 1 42  ? -9.458  -27.328 23.426  1.00 92.04 ? 42  LYS C CE  1 
ATOM 5536  N NZ  . LYS C 1 42  ? -9.005  -25.978 23.882  1.00 92.04 ? 42  LYS C NZ  1 
ATOM 5537  N N   . ARG C 1 43  ? -15.693 -30.029 21.958  1.00 57.50 ? 43  ARG C N   1 
ATOM 5538  C CA  . ARG C 1 43  ? -17.140 -29.957 22.105  1.00 57.50 ? 43  ARG C CA  1 
ATOM 5539  C C   . ARG C 1 43  ? -17.738 -31.270 22.571  1.00 57.50 ? 43  ARG C C   1 
ATOM 5540  O O   . ARG C 1 43  ? -18.619 -31.282 23.430  1.00 57.50 ? 43  ARG C O   1 
ATOM 5541  C CB  . ARG C 1 43  ? -17.785 -29.518 20.801  1.00 80.36 ? 43  ARG C CB  1 
ATOM 5542  C CG  . ARG C 1 43  ? -17.368 -28.132 20.419  1.00 80.36 ? 43  ARG C CG  1 
ATOM 5543  C CD  . ARG C 1 43  ? -18.283 -27.563 19.388  1.00 80.36 ? 43  ARG C CD  1 
ATOM 5544  N NE  . ARG C 1 43  ? -17.813 -26.255 18.943  1.00 80.36 ? 43  ARG C NE  1 
ATOM 5545  C CZ  . ARG C 1 43  ? -18.452 -25.499 18.052  1.00 80.36 ? 43  ARG C CZ  1 
ATOM 5546  N NH1 . ARG C 1 43  ? -19.595 -25.927 17.514  1.00 80.36 ? 43  ARG C NH1 1 
ATOM 5547  N NH2 . ARG C 1 43  ? -17.945 -24.321 17.690  1.00 80.36 ? 43  ARG C NH2 1 
ATOM 5548  N N   . LEU C 1 44  ? -17.259 -32.375 22.014  1.00 49.44 ? 44  LEU C N   1 
ATOM 5549  C CA  . LEU C 1 44  ? -17.766 -33.676 22.415  1.00 49.44 ? 44  LEU C CA  1 
ATOM 5550  C C   . LEU C 1 44  ? -17.382 -33.996 23.854  1.00 49.44 ? 44  LEU C C   1 
ATOM 5551  O O   . LEU C 1 44  ? -18.184 -34.557 24.600  1.00 49.44 ? 44  LEU C O   1 
ATOM 5552  C CB  . LEU C 1 44  ? -17.248 -34.769 21.482  1.00 29.02 ? 44  LEU C CB  1 
ATOM 5553  C CG  . LEU C 1 44  ? -17.940 -34.760 20.126  1.00 29.02 ? 44  LEU C CG  1 
ATOM 5554  C CD1 . LEU C 1 44  ? -17.442 -35.921 19.297  1.00 29.02 ? 44  LEU C CD1 1 
ATOM 5555  C CD2 . LEU C 1 44  ? -19.446 -34.848 20.326  1.00 29.02 ? 44  LEU C CD2 1 
ATOM 5556  N N   . SER C 1 45  ? -16.168 -33.630 24.251  1.00 54.79 ? 45  SER C N   1 
ATOM 5557  C CA  . SER C 1 45  ? -15.712 -33.900 25.609  1.00 54.79 ? 45  SER C CA  1 
ATOM 5558  C C   . SER C 1 45  ? -16.650 -33.288 26.649  1.00 54.79 ? 45  SER C C   1 
ATOM 5559  O O   . SER C 1 45  ? -16.919 -33.900 27.682  1.00 54.79 ? 45  SER C O   1 
ATOM 5560  C CB  . SER C 1 45  ? -14.299 -33.352 25.829  1.00 66.02 ? 45  SER C CB  1 
ATOM 5561  O OG  . SER C 1 45  ? -14.329 -31.986 26.213  1.00 66.02 ? 45  SER C OG  1 
ATOM 5562  N N   . GLN C 1 46  ? -17.152 -32.086 26.379  1.00 57.46 ? 46  GLN C N   1 
ATOM 5563  C CA  . GLN C 1 46  ? -18.042 -31.416 27.318  1.00 57.46 ? 46  GLN C CA  1 
ATOM 5564  C C   . GLN C 1 46  ? -19.316 -32.196 27.621  1.00 57.46 ? 46  GLN C C   1 
ATOM 5565  O O   . GLN C 1 46  ? -19.965 -31.945 28.639  1.00 57.46 ? 46  GLN C O   1 
ATOM 5566  C CB  . GLN C 1 46  ? -18.423 -30.043 26.794  1.00 91.65 ? 46  GLN C CB  1 
ATOM 5567  C CG  . GLN C 1 46  ? -17.248 -29.161 26.497  1.00 91.65 ? 46  GLN C CG  1 
ATOM 5568  C CD  . GLN C 1 46  ? -17.686 -27.756 26.174  1.00 91.65 ? 46  GLN C CD  1 
ATOM 5569  O OE1 . GLN C 1 46  ? -18.103 -27.004 27.060  1.00 91.65 ? 46  GLN C OE1 1 
ATOM 5570  N NE2 . GLN C 1 46  ? -17.617 -27.393 24.897  1.00 91.65 ? 46  GLN C NE2 1 
ATOM 5571  N N   . ILE C 1 47  ? -19.680 -33.132 26.747  1.00 54.21 ? 47  ILE C N   1 
ATOM 5572  C CA  . ILE C 1 47  ? -20.883 -33.938 26.948  1.00 54.21 ? 47  ILE C CA  1 
ATOM 5573  C C   . ILE C 1 47  ? -20.523 -35.420 27.039  1.00 54.21 ? 47  ILE C C   1 
ATOM 5574  O O   . ILE C 1 47  ? -21.373 -36.291 26.824  1.00 54.21 ? 47  ILE C O   1 
ATOM 5575  C CB  . ILE C 1 47  ? -21.880 -33.754 25.779  1.00 40.32 ? 47  ILE C CB  1 
ATOM 5576  C CG1 . ILE C 1 47  ? -21.291 -34.310 24.484  1.00 40.32 ? 47  ILE C CG1 1 
ATOM 5577  C CG2 . ILE C 1 47  ? -22.176 -32.291 25.585  1.00 40.32 ? 47  ILE C CG2 1 
ATOM 5578  C CD1 . ILE C 1 47  ? -22.233 -34.238 23.307  1.00 40.32 ? 47  ILE C CD1 1 
ATOM 5579  N N   . GLY C 1 48  ? -19.267 -35.698 27.384  1.00 72.56 ? 48  GLY C N   1 
ATOM 5580  C CA  . GLY C 1 48  ? -18.797 -37.074 27.446  1.00 72.56 ? 48  GLY C CA  1 
ATOM 5581  C C   . GLY C 1 48  ? -18.402 -37.385 26.012  1.00 72.56 ? 48  GLY C C   1 
ATOM 5582  O O   . GLY C 1 48  ? -17.538 -36.710 25.443  1.00 72.56 ? 48  GLY C O   1 
ATOM 5583  N N   . VAL C 1 49  ? -19.025 -38.395 25.418  1.00 57.74 ? 49  VAL C N   1 
ATOM 5584  C CA  . VAL C 1 49  ? -18.770 -38.748 24.019  1.00 57.74 ? 49  VAL C CA  1 
ATOM 5585  C C   . VAL C 1 49  ? -17.308 -38.781 23.537  1.00 57.74 ? 49  VAL C C   1 
ATOM 5586  O O   . VAL C 1 49  ? -16.648 -37.736 23.416  1.00 57.74 ? 49  VAL C O   1 
ATOM 5587  C CB  . VAL C 1 49  ? -19.541 -37.785 23.079  1.00 47.32 ? 49  VAL C CB  1 
ATOM 5588  C CG1 . VAL C 1 49  ? -19.524 -38.326 21.652  1.00 47.32 ? 49  VAL C CG1 1 
ATOM 5589  C CG2 . VAL C 1 49  ? -20.969 -37.590 23.581  1.00 47.32 ? 49  VAL C CG2 1 
ATOM 5590  N N   . GLU C 1 50  ? -16.816 -39.982 23.240  1.00 54.46 ? 50  GLU C N   1 
ATOM 5591  C CA  . GLU C 1 50  ? -15.458 -40.133 22.734  1.00 54.46 ? 50  GLU C CA  1 
ATOM 5592  C C   . GLU C 1 50  ? -15.423 -39.460 21.376  1.00 54.46 ? 50  GLU C C   1 
ATOM 5593  O O   . GLU C 1 50  ? -16.402 -39.514 20.631  1.00 54.46 ? 50  GLU C O   1 
ATOM 5594  C CB  . GLU C 1 50  ? -15.104 -41.613 22.581  1.00 99.51 ? 50  GLU C CB  1 
ATOM 5595  C CG  . GLU C 1 50  ? -14.124 -42.104 23.616  1.00 99.51 ? 50  GLU C CG  1 
ATOM 5596  C CD  . GLU C 1 50  ? -14.459 -41.592 25.007  1.00 99.51 ? 50  GLU C CD  1 
ATOM 5597  O OE1 . GLU C 1 50  ? -15.575 -41.876 25.504  1.00 99.51 ? 50  GLU C OE1 1 
ATOM 5598  O OE2 . GLU C 1 50  ? -13.604 -40.898 25.601  1.00 99.51 ? 50  GLU C OE2 1 
ATOM 5599  N N   . ASN C 1 51  ? -14.306 -38.822 21.047  1.00 50.70 ? 51  ASN C N   1 
ATOM 5600  C CA  . ASN C 1 51  ? -14.200 -38.149 19.762  1.00 50.70 ? 51  ASN C CA  1 
ATOM 5601  C C   . ASN C 1 51  ? -13.822 -39.119 18.638  1.00 50.70 ? 51  ASN C C   1 
ATOM 5602  O O   . ASN C 1 51  ? -12.685 -39.137 18.174  1.00 50.70 ? 51  ASN C O   1 
ATOM 5603  C CB  . ASN C 1 51  ? -13.189 -37.006 19.861  1.00 47.84 ? 51  ASN C CB  1 
ATOM 5604  C CG  . ASN C 1 51  ? -13.191 -36.117 18.634  1.00 47.84 ? 51  ASN C CG  1 
ATOM 5605  O OD1 . ASN C 1 51  ? -14.226 -35.910 18.003  1.00 47.84 ? 51  ASN C OD1 1 
ATOM 5606  N ND2 . ASN C 1 51  ? -12.031 -35.573 18.297  1.00 47.84 ? 51  ASN C ND2 1 
ATOM 5607  N N   . THR C 1 52  ? -14.795 -39.928 18.218  1.00 48.74 ? 52  THR C N   1 
ATOM 5608  C CA  . THR C 1 52  ? -14.627 -40.916 17.148  1.00 48.74 ? 52  THR C CA  1 
ATOM 5609  C C   . THR C 1 52  ? -15.134 -40.322 15.844  1.00 48.74 ? 52  THR C C   1 
ATOM 5610  O O   . THR C 1 52  ? -15.800 -39.291 15.850  1.00 48.74 ? 52  THR C O   1 
ATOM 5611  C CB  . THR C 1 52  ? -15.497 -42.158 17.396  1.00 52.73 ? 52  THR C CB  1 
ATOM 5612  O OG1 . THR C 1 52  ? -15.236 -42.667 18.701  1.00 52.73 ? 52  THR C OG1 1 
ATOM 5613  C CG2 . THR C 1 52  ? -15.216 -43.242 16.354  1.00 52.73 ? 52  THR C CG2 1 
ATOM 5614  N N   . GLU C 1 53  ? -14.826 -40.965 14.726  1.00 55.43 ? 53  GLU C N   1 
ATOM 5615  C CA  . GLU C 1 53  ? -15.344 -40.478 13.462  1.00 55.43 ? 53  GLU C CA  1 
ATOM 5616  C C   . GLU C 1 53  ? -16.820 -40.799 13.513  1.00 55.43 ? 53  GLU C C   1 
ATOM 5617  O O   . GLU C 1 53  ? -17.655 -40.031 13.039  1.00 55.43 ? 53  GLU C O   1 
ATOM 5618  C CB  . GLU C 1 53  ? -14.708 -41.203 12.293  1.00 98.82 ? 53  GLU C CB  1 
ATOM 5619  C CG  . GLU C 1 53  ? -13.335 -40.674 11.969  1.00 98.82 ? 53  GLU C CG  1 
ATOM 5620  C CD  . GLU C 1 53  ? -12.534 -41.629 11.102  1.00 98.82 ? 53  GLU C CD  1 
ATOM 5621  O OE1 . GLU C 1 53  ? -13.100 -42.110 10.080  1.00 98.82 ? 53  GLU C OE1 1 
ATOM 5622  O OE2 . GLU C 1 53  ? -11.344 -41.884 11.447  1.00 98.82 ? 53  GLU C OE2 1 
ATOM 5623  N N   . GLU C 1 54  ? -17.136 -41.937 14.116  1.00 48.98 ? 54  GLU C N   1 
ATOM 5624  C CA  . GLU C 1 54  ? -18.519 -42.356 14.231  1.00 48.98 ? 54  GLU C CA  1 
ATOM 5625  C C   . GLU C 1 54  ? -19.322 -41.401 15.097  1.00 48.98 ? 54  GLU C C   1 
ATOM 5626  O O   . GLU C 1 54  ? -20.370 -40.910 14.679  1.00 48.98 ? 54  GLU C O   1 
ATOM 5627  C CB  . GLU C 1 54  ? -18.599 -43.767 14.800  1.00 54.59 ? 54  GLU C CB  1 
ATOM 5628  C CG  . GLU C 1 54  ? -19.232 -44.754 13.838  1.00 54.59 ? 54  GLU C CG  1 
ATOM 5629  C CD  . GLU C 1 54  ? -20.680 -44.424 13.534  1.00 54.59 ? 54  GLU C CD  1 
ATOM 5630  O OE1 . GLU C 1 54  ? -21.275 -45.089 12.662  1.00 54.59 ? 54  GLU C OE1 1 
ATOM 5631  O OE2 . GLU C 1 54  ? -21.224 -43.501 14.173  1.00 54.59 ? 54  GLU C OE2 1 
ATOM 5632  N N   . ASN C 1 55  ? -18.839 -41.127 16.301  1.00 45.30 ? 55  ASN C N   1 
ATOM 5633  C CA  . ASN C 1 55  ? -19.565 -40.217 17.172  1.00 45.30 ? 55  ASN C CA  1 
ATOM 5634  C C   . ASN C 1 55  ? -19.810 -38.877 16.505  1.00 45.30 ? 55  ASN C C   1 
ATOM 5635  O O   . ASN C 1 55  ? -20.807 -38.208 16.787  1.00 45.30 ? 55  ASN C O   1 
ATOM 5636  C CB  . ASN C 1 55  ? -18.823 -40.011 18.485  1.00 51.98 ? 55  ASN C CB  1 
ATOM 5637  C CG  . ASN C 1 55  ? -18.891 -41.222 19.368  1.00 51.98 ? 55  ASN C CG  1 
ATOM 5638  O OD1 . ASN C 1 55  ? -19.874 -41.964 19.335  1.00 51.98 ? 55  ASN C OD1 1 
ATOM 5639  N ND2 . ASN C 1 55  ? -17.860 -41.431 20.174  1.00 51.98 ? 55  ASN C ND2 1 
ATOM 5640  N N   . ARG C 1 56  ? -18.899 -38.478 15.624  1.00 32.51 ? 56  ARG C N   1 
ATOM 5641  C CA  . ARG C 1 56  ? -19.062 -37.218 14.917  1.00 32.51 ? 56  ARG C CA  1 
ATOM 5642  C C   . ARG C 1 56  ? -20.152 -37.401 13.867  1.00 32.51 ? 56  ARG C C   1 
ATOM 5643  O O   . ARG C 1 56  ? -21.070 -36.592 13.772  1.00 32.51 ? 56  ARG C O   1 
ATOM 5644  C CB  . ARG C 1 56  ? -17.750 -36.785 14.258  1.00 38.78 ? 56  ARG C CB  1 
ATOM 5645  C CG  . ARG C 1 56  ? -16.721 -36.213 15.229  1.00 38.78 ? 56  ARG C CG  1 
ATOM 5646  C CD  . ARG C 1 56  ? -15.608 -35.488 14.475  1.00 38.78 ? 56  ARG C CD  1 
ATOM 5647  N NE  . ARG C 1 56  ? -14.771 -36.397 13.695  1.00 38.78 ? 56  ARG C NE  1 
ATOM 5648  C CZ  . ARG C 1 56  ? -13.760 -37.097 14.204  1.00 38.78 ? 56  ARG C CZ  1 
ATOM 5649  N NH1 . ARG C 1 56  ? -13.457 -36.991 15.493  1.00 38.78 ? 56  ARG C NH1 1 
ATOM 5650  N NH2 . ARG C 1 56  ? -13.053 -37.909 13.428  1.00 38.78 ? 56  ARG C NH2 1 
ATOM 5651  N N   . ARG C 1 57  ? -20.064 -38.477 13.094  1.00 45.29 ? 57  ARG C N   1 
ATOM 5652  C CA  . ARG C 1 57  ? -21.067 -38.747 12.074  1.00 45.29 ? 57  ARG C CA  1 
ATOM 5653  C C   . ARG C 1 57  ? -22.440 -38.768 12.741  1.00 45.29 ? 57  ARG C C   1 
ATOM 5654  O O   . ARG C 1 57  ? -23.403 -38.191 12.235  1.00 45.29 ? 57  ARG C O   1 
ATOM 5655  C CB  . ARG C 1 57  ? -20.809 -40.098 11.419  1.00 38.75 ? 57  ARG C CB  1 
ATOM 5656  C CG  . ARG C 1 57  ? -21.716 -40.394 10.241  1.00 38.75 ? 57  ARG C CG  1 
ATOM 5657  C CD  . ARG C 1 57  ? -21.646 -41.865 9.890   1.00 38.75 ? 57  ARG C CD  1 
ATOM 5658  N NE  . ARG C 1 57  ? -22.138 -42.677 10.995  1.00 38.75 ? 57  ARG C NE  1 
ATOM 5659  C CZ  . ARG C 1 57  ? -23.422 -42.957 11.198  1.00 38.75 ? 57  ARG C CZ  1 
ATOM 5660  N NH1 . ARG C 1 57  ? -24.349 -42.500 10.361  1.00 38.75 ? 57  ARG C NH1 1 
ATOM 5661  N NH2 . ARG C 1 57  ? -23.783 -43.675 12.253  1.00 38.75 ? 57  ARG C NH2 1 
ATOM 5662  N N   . LEU C 1 58  ? -22.516 -39.437 13.886  1.00 36.95 ? 58  LEU C N   1 
ATOM 5663  C CA  . LEU C 1 58  ? -23.763 -39.537 14.628  1.00 36.95 ? 58  LEU C CA  1 
ATOM 5664  C C   . LEU C 1 58  ? -24.301 -38.165 14.966  1.00 36.95 ? 58  LEU C C   1 
ATOM 5665  O O   . LEU C 1 58  ? -25.464 -37.862 14.694  1.00 36.95 ? 58  LEU C O   1 
ATOM 5666  C CB  . LEU C 1 58  ? -23.553 -40.327 15.916  1.00 28.18 ? 58  LEU C CB  1 
ATOM 5667  C CG  . LEU C 1 58  ? -23.252 -41.813 15.719  1.00 28.18 ? 58  LEU C CG  1 
ATOM 5668  C CD1 . LEU C 1 58  ? -22.907 -42.449 17.053  1.00 28.18 ? 58  LEU C CD1 1 
ATOM 5669  C CD2 . LEU C 1 58  ? -24.452 -42.493 15.073  1.00 28.18 ? 58  LEU C CD2 1 
ATOM 5670  N N   . TYR C 1 59  ? -23.456 -37.334 15.563  1.00 36.09 ? 59  TYR C N   1 
ATOM 5671  C CA  . TYR C 1 59  ? -23.883 -35.995 15.930  1.00 36.09 ? 59  TYR C CA  1 
ATOM 5672  C C   . TYR C 1 59  ? -24.286 -35.149 14.725  1.00 36.09 ? 59  TYR C C   1 
ATOM 5673  O O   . TYR C 1 59  ? -25.323 -34.492 14.755  1.00 36.09 ? 59  TYR C O   1 
ATOM 5674  C CB  . TYR C 1 59  ? -22.795 -35.267 16.714  1.00 39.21 ? 59  TYR C CB  1 
ATOM 5675  C CG  . TYR C 1 59  ? -23.155 -33.825 16.968  1.00 39.21 ? 59  TYR C CG  1 
ATOM 5676  C CD1 . TYR C 1 59  ? -24.328 -33.493 17.637  1.00 39.21 ? 59  TYR C CD1 1 
ATOM 5677  C CD2 . TYR C 1 59  ? -22.353 -32.791 16.497  1.00 39.21 ? 59  TYR C CD2 1 
ATOM 5678  C CE1 . TYR C 1 59  ? -24.694 -32.166 17.825  1.00 39.21 ? 59  TYR C CE1 1 
ATOM 5679  C CE2 . TYR C 1 59  ? -22.712 -31.459 16.681  1.00 39.21 ? 59  TYR C CE2 1 
ATOM 5680  C CZ  . TYR C 1 59  ? -23.882 -31.157 17.345  1.00 39.21 ? 59  TYR C CZ  1 
ATOM 5681  O OH  . TYR C 1 59  ? -24.245 -29.848 17.523  1.00 39.21 ? 59  TYR C OH  1 
ATOM 5682  N N   . ARG C 1 60  ? -23.477 -35.154 13.669  1.00 48.69 ? 60  ARG C N   1 
ATOM 5683  C CA  . ARG C 1 60  ? -23.809 -34.368 12.482  1.00 48.69 ? 60  ARG C CA  1 
ATOM 5684  C C   . ARG C 1 60  ? -25.162 -34.828 11.958  1.00 48.69 ? 60  ARG C C   1 
ATOM 5685  O O   . ARG C 1 60  ? -25.933 -34.046 11.393  1.00 48.69 ? 60  ARG C O   1 
ATOM 5686  C CB  . ARG C 1 60  ? -22.773 -34.566 11.377  1.00 46.85 ? 60  ARG C CB  1 
ATOM 5687  C CG  . ARG C 1 60  ? -21.330 -34.367 11.786  1.00 46.85 ? 60  ARG C CG  1 
ATOM 5688  C CD  . ARG C 1 60  ? -21.002 -32.945 12.193  1.00 46.85 ? 60  ARG C CD  1 
ATOM 5689  N NE  . ARG C 1 60  ? -19.552 -32.767 12.188  1.00 46.85 ? 60  ARG C NE  1 
ATOM 5690  C CZ  . ARG C 1 60  ? -18.928 -31.674 12.606  1.00 46.85 ? 60  ARG C CZ  1 
ATOM 5691  N NH1 . ARG C 1 60  ? -19.630 -30.646 13.072  1.00 46.85 ? 60  ARG C NH1 1 
ATOM 5692  N NH2 . ARG C 1 60  ? -17.604 -31.608 12.547  1.00 46.85 ? 60  ARG C NH2 1 
ATOM 5693  N N   . GLN C 1 61  ? -25.436 -36.114 12.143  1.00 48.41 ? 61  GLN C N   1 
ATOM 5694  C CA  . GLN C 1 61  ? -26.688 -36.694 11.697  1.00 48.41 ? 61  GLN C CA  1 
ATOM 5695  C C   . GLN C 1 61  ? -27.839 -36.050 12.455  1.00 48.41 ? 61  GLN C C   1 
ATOM 5696  O O   . GLN C 1 61  ? -28.874 -35.731 11.872  1.00 48.41 ? 61  GLN C O   1 
ATOM 5697  C CB  . GLN C 1 61  ? -26.668 -38.193 11.941  1.00 37.76 ? 61  GLN C CB  1 
ATOM 5698  C CG  . GLN C 1 61  ? -27.837 -38.935 11.349  1.00 37.76 ? 61  GLN C CG  1 
ATOM 5699  C CD  . GLN C 1 61  ? -27.700 -40.432 11.543  1.00 37.76 ? 61  GLN C CD  1 
ATOM 5700  O OE1 . GLN C 1 61  ? -27.505 -40.906 12.669  1.00 37.76 ? 61  GLN C OE1 1 
ATOM 5701  N NE2 . GLN C 1 61  ? -27.793 -41.188 10.448  1.00 37.76 ? 61  GLN C NE2 1 
ATOM 5702  N N   . VAL C 1 62  ? -27.653 -35.857 13.755  1.00 36.58 ? 62  VAL C N   1 
ATOM 5703  C CA  . VAL C 1 62  ? -28.674 -35.226 14.577  1.00 36.58 ? 62  VAL C CA  1 
ATOM 5704  C C   . VAL C 1 62  ? -29.090 -33.903 13.954  1.00 36.58 ? 62  VAL C C   1 
ATOM 5705  O O   . VAL C 1 62  ? -30.260 -33.544 13.974  1.00 36.58 ? 62  VAL C O   1 
ATOM 5706  C CB  . VAL C 1 62  ? -28.161 -34.920 15.993  1.00 25.14 ? 62  VAL C CB  1 
ATOM 5707  C CG1 . VAL C 1 62  ? -29.210 -34.145 16.766  1.00 25.14 ? 62  VAL C CG1 1 
ATOM 5708  C CG2 . VAL C 1 62  ? -27.814 -36.212 16.712  1.00 25.14 ? 62  VAL C CG2 1 
ATOM 5709  N N   . LEU C 1 63  ? -28.122 -33.176 13.406  1.00 31.55 ? 63  LEU C N   1 
ATOM 5710  C CA  . LEU C 1 63  ? -28.402 -31.888 12.789  1.00 31.55 ? 63  LEU C CA  1 
ATOM 5711  C C   . LEU C 1 63  ? -29.045 -32.038 11.420  1.00 31.55 ? 63  LEU C C   1 
ATOM 5712  O O   . LEU C 1 63  ? -30.112 -31.481 11.172  1.00 31.55 ? 63  LEU C O   1 
ATOM 5713  C CB  . LEU C 1 63  ? -27.116 -31.066 12.658  1.00 27.54 ? 63  LEU C CB  1 
ATOM 5714  C CG  . LEU C 1 63  ? -26.365 -30.779 13.961  1.00 27.54 ? 63  LEU C CG  1 
ATOM 5715  C CD1 . LEU C 1 63  ? -25.172 -29.896 13.674  1.00 27.54 ? 63  LEU C CD1 1 
ATOM 5716  C CD2 . LEU C 1 63  ? -27.283 -30.090 14.948  1.00 27.54 ? 63  LEU C CD2 1 
ATOM 5717  N N   . PHE C 1 64  ? -28.407 -32.809 10.544  1.00 33.03 ? 64  PHE C N   1 
ATOM 5718  C CA  . PHE C 1 64  ? -28.898 -32.996 9.184   1.00 33.03 ? 64  PHE C CA  1 
ATOM 5719  C C   . PHE C 1 64  ? -30.205 -33.745 9.035   1.00 33.03 ? 64  PHE C C   1 
ATOM 5720  O O   . PHE C 1 64  ? -30.823 -33.735 7.963   1.00 33.03 ? 64  PHE C O   1 
ATOM 5721  C CB  . PHE C 1 64  ? -27.832 -33.679 8.333   1.00 32.15 ? 64  PHE C CB  1 
ATOM 5722  C CG  . PHE C 1 64  ? -26.518 -32.972 8.353   1.00 32.15 ? 64  PHE C CG  1 
ATOM 5723  C CD1 . PHE C 1 64  ? -26.461 -31.595 8.555   1.00 32.15 ? 64  PHE C CD1 1 
ATOM 5724  C CD2 . PHE C 1 64  ? -25.337 -33.673 8.184   1.00 32.15 ? 64  PHE C CD2 1 
ATOM 5725  C CE1 . PHE C 1 64  ? -25.251 -30.928 8.593   1.00 32.15 ? 64  PHE C CE1 1 
ATOM 5726  C CE2 . PHE C 1 64  ? -24.120 -33.015 8.218   1.00 32.15 ? 64  PHE C CE2 1 
ATOM 5727  C CZ  . PHE C 1 64  ? -24.079 -31.638 8.425   1.00 32.15 ? 64  PHE C CZ  1 
ATOM 5728  N N   . SER C 1 65  ? -30.639 -34.401 10.099  1.00 47.92 ? 65  SER C N   1 
ATOM 5729  C CA  . SER C 1 65  ? -31.885 -35.134 10.022  1.00 47.92 ? 65  SER C CA  1 
ATOM 5730  C C   . SER C 1 65  ? -33.066 -34.231 10.359  1.00 47.92 ? 65  SER C C   1 
ATOM 5731  O O   . SER C 1 65  ? -34.196 -34.699 10.438  1.00 47.92 ? 65  SER C O   1 
ATOM 5732  C CB  . SER C 1 65  ? -31.841 -36.343 10.954  1.00 46.93 ? 65  SER C CB  1 
ATOM 5733  O OG  . SER C 1 65  ? -31.442 -35.958 12.256  1.00 46.93 ? 65  SER C OG  1 
ATOM 5734  N N   . ALA C 1 66  ? -32.808 -32.939 10.557  1.00 40.81 ? 66  ALA C N   1 
ATOM 5735  C CA  . ALA C 1 66  ? -33.883 -31.998 10.863  1.00 40.81 ? 66  ALA C CA  1 
ATOM 5736  C C   . ALA C 1 66  ? -34.897 -32.071 9.722   1.00 40.81 ? 66  ALA C C   1 
ATOM 5737  O O   . ALA C 1 66  ? -34.524 -32.314 8.569   1.00 40.81 ? 66  ALA C O   1 
ATOM 5738  C CB  . ALA C 1 66  ? -33.335 -30.581 10.990  1.00 39.17 ? 66  ALA C CB  1 
ATOM 5739  N N   . ASP C 1 67  ? -36.172 -31.868 10.044  1.00 51.08 ? 67  ASP C N   1 
ATOM 5740  C CA  . ASP C 1 67  ? -37.236 -31.932 9.042   1.00 51.08 ? 67  ASP C CA  1 
ATOM 5741  C C   . ASP C 1 67  ? -37.349 -30.667 8.189   1.00 51.08 ? 67  ASP C C   1 
ATOM 5742  O O   . ASP C 1 67  ? -36.497 -29.777 8.254   1.00 51.08 ? 67  ASP C O   1 
ATOM 5743  C CB  . ASP C 1 67  ? -38.581 -32.228 9.722   1.00 45.68 ? 67  ASP C CB  1 
ATOM 5744  C CG  . ASP C 1 67  ? -39.039 -31.100 10.632  1.00 45.68 ? 67  ASP C CG  1 
ATOM 5745  O OD1 . ASP C 1 67  ? -39.381 -31.370 11.809  1.00 45.68 ? 67  ASP C OD1 1 
ATOM 5746  O OD2 . ASP C 1 67  ? -39.059 -29.940 10.159  1.00 45.68 ? 67  ASP C OD2 1 
ATOM 5747  N N   . ASP C 1 68  ? -38.421 -30.592 7.406   1.00 45.23 ? 68  ASP C N   1 
ATOM 5748  C CA  . ASP C 1 68  ? -38.661 -29.471 6.499   1.00 45.23 ? 68  ASP C CA  1 
ATOM 5749  C C   . ASP C 1 68  ? -38.835 -28.063 7.052   1.00 45.23 ? 68  ASP C C   1 
ATOM 5750  O O   . ASP C 1 68  ? -38.751 -27.097 6.292   1.00 45.23 ? 68  ASP C O   1 
ATOM 5751  C CB  . ASP C 1 68  ? -39.856 -29.784 5.599   1.00 69.35 ? 68  ASP C CB  1 
ATOM 5752  C CG  . ASP C 1 68  ? -39.476 -30.634 4.405   1.00 69.35 ? 68  ASP C CG  1 
ATOM 5753  O OD1 . ASP C 1 68  ? -40.379 -30.967 3.607   1.00 69.35 ? 68  ASP C OD1 1 
ATOM 5754  O OD2 . ASP C 1 68  ? -38.278 -30.964 4.259   1.00 69.35 ? 68  ASP C OD2 1 
ATOM 5755  N N   . ARG C 1 69  ? -39.079 -27.905 8.346   1.00 48.85 ? 69  ARG C N   1 
ATOM 5756  C CA  . ARG C 1 69  ? -39.250 -26.543 8.833   1.00 48.85 ? 69  ARG C CA  1 
ATOM 5757  C C   . ARG C 1 69  ? -37.912 -25.844 8.902   1.00 48.85 ? 69  ARG C C   1 
ATOM 5758  O O   . ARG C 1 69  ? -37.836 -24.644 9.167   1.00 48.85 ? 69  ARG C O   1 
ATOM 5759  C CB  . ARG C 1 69  ? -39.951 -26.518 10.194  1.00 25.17 ? 69  ARG C CB  1 
ATOM 5760  C CG  . ARG C 1 69  ? -39.376 -27.438 11.221  1.00 25.17 ? 69  ARG C CG  1 
ATOM 5761  C CD  . ARG C 1 69  ? -40.362 -27.663 12.345  1.00 25.17 ? 69  ARG C CD  1 
ATOM 5762  N NE  . ARG C 1 69  ? -40.112 -28.967 12.940  1.00 25.17 ? 69  ARG C NE  1 
ATOM 5763  C CZ  . ARG C 1 69  ? -39.886 -29.172 14.231  1.00 25.17 ? 69  ARG C CZ  1 
ATOM 5764  N NH1 . ARG C 1 69  ? -39.884 -28.143 15.082  1.00 25.17 ? 69  ARG C NH1 1 
ATOM 5765  N NH2 . ARG C 1 69  ? -39.644 -30.404 14.666  1.00 25.17 ? 69  ARG C NH2 1 
ATOM 5766  N N   . VAL C 1 70  ? -36.856 -26.604 8.635   1.00 35.00 ? 70  VAL C N   1 
ATOM 5767  C CA  . VAL C 1 70  ? -35.503 -26.071 8.647   1.00 35.00 ? 70  VAL C CA  1 
ATOM 5768  C C   . VAL C 1 70  ? -35.261 -25.362 7.316   1.00 35.00 ? 70  VAL C C   1 
ATOM 5769  O O   . VAL C 1 70  ? -34.351 -24.553 7.196   1.00 35.00 ? 70  VAL C O   1 
ATOM 5770  C CB  . VAL C 1 70  ? -34.477 -27.209 8.834   1.00 17.57 ? 70  VAL C CB  1 
ATOM 5771  C CG1 . VAL C 1 70  ? -33.928 -27.656 7.484   1.00 17.57 ? 70  VAL C CG1 1 
ATOM 5772  C CG2 . VAL C 1 70  ? -33.390 -26.772 9.784   1.00 17.57 ? 70  VAL C CG2 1 
ATOM 5773  N N   . LYS C 1 71  ? -36.103 -25.673 6.331   1.00 33.29 ? 71  LYS C N   1 
ATOM 5774  C CA  . LYS C 1 71  ? -36.026 -25.093 4.987   1.00 33.29 ? 71  LYS C CA  1 
ATOM 5775  C C   . LYS C 1 71  ? -36.306 -23.599 4.928   1.00 33.29 ? 71  LYS C C   1 
ATOM 5776  O O   . LYS C 1 71  ? -35.779 -22.902 4.068   1.00 33.29 ? 71  LYS C O   1 
ATOM 5777  C CB  . LYS C 1 71  ? -37.007 -25.790 4.036   1.00 34.68 ? 71  LYS C CB  1 
ATOM 5778  C CG  . LYS C 1 71  ? -36.662 -27.233 3.719   1.00 34.68 ? 71  LYS C CG  1 
ATOM 5779  C CD  . LYS C 1 71  ? -37.756 -27.928 2.904   1.00 34.68 ? 71  LYS C CD  1 
ATOM 5780  C CE  . LYS C 1 71  ? -37.845 -27.394 1.479   1.00 34.68 ? 71  LYS C CE  1 
ATOM 5781  N NZ  . LYS C 1 71  ? -38.831 -28.158 0.641   1.00 34.68 ? 71  LYS C NZ  1 
ATOM 5782  N N   . LYS C 1 72  ? -37.144 -23.101 5.826   1.00 33.75 ? 72  LYS C N   1 
ATOM 5783  C CA  . LYS C 1 72  ? -37.474 -21.683 5.810   1.00 33.75 ? 72  LYS C CA  1 
ATOM 5784  C C   . LYS C 1 72  ? -36.401 -20.796 6.433   1.00 33.75 ? 72  LYS C C   1 
ATOM 5785  O O   . LYS C 1 72  ? -36.290 -19.615 6.089   1.00 33.75 ? 72  LYS C O   1 
ATOM 5786  C CB  . LYS C 1 72  ? -38.805 -21.442 6.530   1.00 34.86 ? 72  LYS C CB  1 
ATOM 5787  C CG  . LYS C 1 72  ? -38.824 -21.937 7.960   1.00 34.86 ? 72  LYS C CG  1 
ATOM 5788  C CD  . LYS C 1 72  ? -40.019 -21.403 8.727   1.00 34.86 ? 72  LYS C CD  1 
ATOM 5789  C CE  . LYS C 1 72  ? -40.053 -21.962 10.142  1.00 34.86 ? 72  LYS C CE  1 
ATOM 5790  N NZ  . LYS C 1 72  ? -40.151 -23.450 10.137  1.00 34.86 ? 72  LYS C NZ  1 
ATOM 5791  N N   . CYS C 1 73  ? -35.604 -21.361 7.338   1.00 34.08 ? 73  CYS C N   1 
ATOM 5792  C CA  . CYS C 1 73  ? -34.577 -20.577 8.016   1.00 34.08 ? 73  CYS C CA  1 
ATOM 5793  C C   . CYS C 1 73  ? -33.120 -20.927 7.707   1.00 34.08 ? 73  CYS C C   1 
ATOM 5794  O O   . CYS C 1 73  ? -32.209 -20.206 8.118   1.00 34.08 ? 73  CYS C O   1 
ATOM 5795  C CB  . CYS C 1 73  ? -34.815 -20.642 9.527   1.00 40.22 ? 73  CYS C CB  1 
ATOM 5796  S SG  . CYS C 1 73  ? -35.107 -22.316 10.136  1.00 40.22 ? 73  CYS C SG  1 
ATOM 5797  N N   . ILE C 1 74  ? -32.886 -22.019 6.993   1.00 28.57 ? 74  ILE C N   1 
ATOM 5798  C CA  . ILE C 1 74  ? -31.519 -22.401 6.667   1.00 28.57 ? 74  ILE C CA  1 
ATOM 5799  C C   . ILE C 1 74  ? -31.262 -22.359 5.170   1.00 28.57 ? 74  ILE C C   1 
ATOM 5800  O O   . ILE C 1 74  ? -31.751 -23.213 4.423   1.00 28.57 ? 74  ILE C O   1 
ATOM 5801  C CB  . ILE C 1 74  ? -31.201 -23.811 7.164   1.00 19.31 ? 74  ILE C CB  1 
ATOM 5802  C CG1 . ILE C 1 74  ? -31.373 -23.885 8.681   1.00 19.31 ? 74  ILE C CG1 1 
ATOM 5803  C CG2 . ILE C 1 74  ? -29.792 -24.188 6.760   1.00 19.31 ? 74  ILE C CG2 1 
ATOM 5804  C CD1 . ILE C 1 74  ? -30.447 -22.988 9.458   1.00 19.31 ? 74  ILE C CD1 1 
ATOM 5805  N N   . GLY C 1 75  ? -30.486 -21.370 4.737   1.00 30.46 ? 75  GLY C N   1 
ATOM 5806  C CA  . GLY C 1 75  ? -30.173 -21.238 3.325   1.00 30.46 ? 75  GLY C CA  1 
ATOM 5807  C C   . GLY C 1 75  ? -28.987 -22.091 2.907   1.00 30.46 ? 75  GLY C C   1 
ATOM 5808  O O   . GLY C 1 75  ? -28.876 -22.493 1.742   1.00 30.46 ? 75  GLY C O   1 
ATOM 5809  N N   . GLY C 1 76  ? -28.102 -22.373 3.861   1.00 28.63 ? 76  GLY C N   1 
ATOM 5810  C CA  . GLY C 1 76  ? -26.929 -23.178 3.563   1.00 28.63 ? 76  GLY C CA  1 
ATOM 5811  C C   . GLY C 1 76  ? -26.301 -23.845 4.776   1.00 28.63 ? 76  GLY C C   1 
ATOM 5812  O O   . GLY C 1 76  ? -26.507 -23.431 5.923   1.00 28.63 ? 76  GLY C O   1 
ATOM 5813  N N   . VAL C 1 77  ? -25.524 -24.890 4.515   1.00 31.06 ? 77  VAL C N   1 
ATOM 5814  C CA  . VAL C 1 77  ? -24.854 -25.631 5.572   1.00 31.06 ? 77  VAL C CA  1 
ATOM 5815  C C   . VAL C 1 77  ? -23.375 -25.763 5.225   1.00 31.06 ? 77  VAL C C   1 
ATOM 5816  O O   . VAL C 1 77  ? -23.027 -26.220 4.138   1.00 31.06 ? 77  VAL C O   1 
ATOM 5817  C CB  . VAL C 1 77  ? -25.460 -27.036 5.717   1.00 25.72 ? 77  VAL C CB  1 
ATOM 5818  C CG1 . VAL C 1 77  ? -24.902 -27.718 6.942   1.00 25.72 ? 77  VAL C CG1 1 
ATOM 5819  C CG2 . VAL C 1 77  ? -26.967 -26.938 5.802   1.00 25.72 ? 77  VAL C CG2 1 
ATOM 5820  N N   . ILE C 1 78  ? -22.509 -25.348 6.142   1.00 30.51 ? 78  ILE C N   1 
ATOM 5821  C CA  . ILE C 1 78  ? -21.070 -25.439 5.917   1.00 30.51 ? 78  ILE C CA  1 
ATOM 5822  C C   . ILE C 1 78  ? -20.567 -26.758 6.495   1.00 30.51 ? 78  ILE C C   1 
ATOM 5823  O O   . ILE C 1 78  ? -20.656 -26.987 7.703   1.00 30.51 ? 78  ILE C O   1 
ATOM 5824  C CB  . ILE C 1 78  ? -20.306 -24.285 6.611   1.00 24.98 ? 78  ILE C CB  1 
ATOM 5825  C CG1 . ILE C 1 78  ? -20.834 -22.928 6.143   1.00 24.98 ? 78  ILE C CG1 1 
ATOM 5826  C CG2 . ILE C 1 78  ? -18.831 -24.380 6.289   1.00 24.98 ? 78  ILE C CG2 1 
ATOM 5827  C CD1 . ILE C 1 78  ? -20.236 -21.753 6.900   1.00 24.98 ? 78  ILE C CD1 1 
ATOM 5828  N N   . PHE C 1 79  ? -20.040 -27.617 5.626   1.00 29.78 ? 79  PHE C N   1 
ATOM 5829  C CA  . PHE C 1 79  ? -19.517 -28.928 6.020   1.00 29.78 ? 79  PHE C CA  1 
ATOM 5830  C C   . PHE C 1 79  ? -18.029 -28.941 6.322   1.00 29.78 ? 79  PHE C C   1 
ATOM 5831  O O   . PHE C 1 79  ? -17.265 -28.140 5.792   1.00 29.78 ? 79  PHE C O   1 
ATOM 5832  C CB  . PHE C 1 79  ? -19.714 -29.958 4.904   1.00 41.40 ? 79  PHE C CB  1 
ATOM 5833  C CG  . PHE C 1 79  ? -21.113 -30.437 4.744   1.00 41.40 ? 79  PHE C CG  1 
ATOM 5834  C CD1 . PHE C 1 79  ? -22.092 -29.609 4.218   1.00 41.40 ? 79  PHE C CD1 1 
ATOM 5835  C CD2 . PHE C 1 79  ? -21.449 -31.736 5.100   1.00 41.40 ? 79  PHE C CD2 1 
ATOM 5836  C CE1 . PHE C 1 79  ? -23.390 -30.069 4.048   1.00 41.40 ? 79  PHE C CE1 1 
ATOM 5837  C CE2 . PHE C 1 79  ? -22.742 -32.203 4.936   1.00 41.40 ? 79  PHE C CE2 1 
ATOM 5838  C CZ  . PHE C 1 79  ? -23.716 -31.369 4.408   1.00 41.40 ? 79  PHE C CZ  1 
ATOM 5839  N N   . PHE C 1 80  ? -17.621 -29.870 7.171   1.00 38.85 ? 80  PHE C N   1 
ATOM 5840  C CA  . PHE C 1 80  ? -16.208 -30.043 7.439   1.00 38.85 ? 80  PHE C CA  1 
ATOM 5841  C C   . PHE C 1 80  ? -15.872 -31.164 6.455   1.00 38.85 ? 80  PHE C C   1 
ATOM 5842  O O   . PHE C 1 80  ? -16.656 -32.101 6.307   1.00 38.85 ? 80  PHE C O   1 
ATOM 5843  C CB  . PHE C 1 80  ? -15.969 -30.529 8.851   1.00 48.84 ? 80  PHE C CB  1 
ATOM 5844  C CG  . PHE C 1 80  ? -14.579 -31.027 9.074   1.00 48.84 ? 80  PHE C CG  1 
ATOM 5845  C CD1 . PHE C 1 80  ? -13.512 -30.143 9.125   1.00 48.84 ? 80  PHE C CD1 1 
ATOM 5846  C CD2 . PHE C 1 80  ? -14.330 -32.386 9.218   1.00 48.84 ? 80  PHE C CD2 1 
ATOM 5847  C CE1 . PHE C 1 80  ? -12.210 -30.608 9.318   1.00 48.84 ? 80  PHE C CE1 1 
ATOM 5848  C CE2 . PHE C 1 80  ? -13.036 -32.861 9.411   1.00 48.84 ? 80  PHE C CE2 1 
ATOM 5849  C CZ  . PHE C 1 80  ? -11.973 -31.970 9.462   1.00 48.84 ? 80  PHE C CZ  1 
ATOM 5850  N N   . HIS C 1 81  ? -14.729 -31.076 5.786   1.00 29.31 ? 81  HIS C N   1 
ATOM 5851  C CA  . HIS C 1 81  ? -14.345 -32.089 4.796   1.00 29.31 ? 81  HIS C CA  1 
ATOM 5852  C C   . HIS C 1 81  ? -14.870 -33.500 5.061   1.00 29.31 ? 81  HIS C C   1 
ATOM 5853  O O   . HIS C 1 81  ? -15.660 -34.042 4.287   1.00 29.31 ? 81  HIS C O   1 
ATOM 5854  C CB  . HIS C 1 81  ? -12.830 -32.172 4.665   1.00 29.23 ? 81  HIS C CB  1 
ATOM 5855  C CG  . HIS C 1 81  ? -12.380 -33.117 3.597   1.00 29.23 ? 81  HIS C CG  1 
ATOM 5856  N ND1 . HIS C 1 81  ? -12.393 -32.785 2.260   1.00 29.23 ? 81  HIS C ND1 1 
ATOM 5857  C CD2 . HIS C 1 81  ? -11.986 -34.411 3.659   1.00 29.23 ? 81  HIS C CD2 1 
ATOM 5858  C CE1 . HIS C 1 81  ? -12.028 -33.833 1.544   1.00 29.23 ? 81  HIS C CE1 1 
ATOM 5859  N NE2 . HIS C 1 81  ? -11.776 -34.833 2.368   1.00 29.23 ? 81  HIS C NE2 1 
ATOM 5860  N N   . GLU C 1 82  ? -14.382 -34.097 6.142   1.00 27.19 ? 82  GLU C N   1 
ATOM 5861  C CA  . GLU C 1 82  ? -14.776 -35.438 6.559   1.00 27.19 ? 82  GLU C CA  1 
ATOM 5862  C C   . GLU C 1 82  ? -16.274 -35.636 6.358   1.00 27.19 ? 82  GLU C C   1 
ATOM 5863  O O   . GLU C 1 82  ? -16.715 -36.502 5.596   1.00 27.19 ? 82  GLU C O   1 
ATOM 5864  C CB  . GLU C 1 82  ? -14.432 -35.612 8.038   1.00 51.28 ? 82  GLU C CB  1 
ATOM 5865  C CG  . GLU C 1 82  ? -14.945 -36.876 8.676   1.00 51.28 ? 82  GLU C CG  1 
ATOM 5866  C CD  . GLU C 1 82  ? -15.024 -36.765 10.192  1.00 51.28 ? 82  GLU C CD  1 
ATOM 5867  O OE1 . GLU C 1 82  ? -15.917 -36.042 10.696  1.00 51.28 ? 82  GLU C OE1 1 
ATOM 5868  O OE2 . GLU C 1 82  ? -14.191 -37.399 10.878  1.00 51.28 ? 82  GLU C OE2 1 
ATOM 5869  N N   . THR C 1 83  ? -17.041 -34.801 7.052   1.00 30.66 ? 83  THR C N   1 
ATOM 5870  C CA  . THR C 1 83  ? -18.494 -34.825 7.022   1.00 30.66 ? 83  THR C CA  1 
ATOM 5871  C C   . THR C 1 83  ? -19.112 -34.790 5.618   1.00 30.66 ? 83  THR C C   1 
ATOM 5872  O O   . THR C 1 83  ? -20.120 -35.449 5.361   1.00 30.66 ? 83  THR C O   1 
ATOM 5873  C CB  . THR C 1 83  ? -19.045 -33.662 7.864   1.00 32.63 ? 83  THR C CB  1 
ATOM 5874  O OG1 . THR C 1 83  ? -18.567 -33.787 9.211   1.00 32.63 ? 83  THR C OG1 1 
ATOM 5875  C CG2 . THR C 1 83  ? -20.556 -33.682 7.875   1.00 32.63 ? 83  THR C CG2 1 
ATOM 5876  N N   . LEU C 1 84  ? -18.510 -34.028 4.712   1.00 25.47 ? 84  LEU C N   1 
ATOM 5877  C CA  . LEU C 1 84  ? -19.013 -33.910 3.341   1.00 25.47 ? 84  LEU C CA  1 
ATOM 5878  C C   . LEU C 1 84  ? -19.075 -35.262 2.638   1.00 25.47 ? 84  LEU C C   1 
ATOM 5879  O O   . LEU C 1 84  ? -19.665 -35.392 1.563   1.00 25.47 ? 84  LEU C O   1 
ATOM 5880  C CB  . LEU C 1 84  ? -18.109 -32.979 2.533   1.00 28.75 ? 84  LEU C CB  1 
ATOM 5881  C CG  . LEU C 1 84  ? -18.531 -32.699 1.095   1.00 28.75 ? 84  LEU C CG  1 
ATOM 5882  C CD1 . LEU C 1 84  ? -19.718 -31.761 1.108   1.00 28.75 ? 84  LEU C CD1 1 
ATOM 5883  C CD2 . LEU C 1 84  ? -17.378 -32.080 0.326   1.00 28.75 ? 84  LEU C CD2 1 
ATOM 5884  N N   . TYR C 1 85  ? -18.455 -36.270 3.236   1.00 31.61 ? 85  TYR C N   1 
ATOM 5885  C CA  . TYR C 1 85  ? -18.457 -37.586 2.621   1.00 31.61 ? 85  TYR C CA  1 
ATOM 5886  C C   . TYR C 1 85  ? -19.055 -38.665 3.516   1.00 31.61 ? 85  TYR C C   1 
ATOM 5887  O O   . TYR C 1 85  ? -18.930 -39.862 3.230   1.00 31.61 ? 85  TYR C O   1 
ATOM 5888  C CB  . TYR C 1 85  ? -17.035 -37.971 2.199   1.00 31.26 ? 85  TYR C CB  1 
ATOM 5889  C CG  . TYR C 1 85  ? -16.440 -37.020 1.186   1.00 31.26 ? 85  TYR C CG  1 
ATOM 5890  C CD1 . TYR C 1 85  ? -15.716 -35.899 1.591   1.00 31.26 ? 85  TYR C CD1 1 
ATOM 5891  C CD2 . TYR C 1 85  ? -16.675 -37.192 -0.177  1.00 31.26 ? 85  TYR C CD2 1 
ATOM 5892  C CE1 . TYR C 1 85  ? -15.249 -34.971 0.660   1.00 31.26 ? 85  TYR C CE1 1 
ATOM 5893  C CE2 . TYR C 1 85  ? -16.211 -36.271 -1.116  1.00 31.26 ? 85  TYR C CE2 1 
ATOM 5894  C CZ  . TYR C 1 85  ? -15.505 -35.165 -0.689  1.00 31.26 ? 85  TYR C CZ  1 
ATOM 5895  O OH  . TYR C 1 85  ? -15.076 -34.241 -1.607  1.00 31.26 ? 85  TYR C OH  1 
ATOM 5896  N N   . GLN C 1 86  ? -19.709 -38.245 4.595   1.00 41.21 ? 86  GLN C N   1 
ATOM 5897  C CA  . GLN C 1 86  ? -20.333 -39.197 5.501   1.00 41.21 ? 86  GLN C CA  1 
ATOM 5898  C C   . GLN C 1 86  ? -21.785 -39.429 5.100   1.00 41.21 ? 86  GLN C C   1 
ATOM 5899  O O   . GLN C 1 86  ? -22.381 -38.634 4.364   1.00 41.21 ? 86  GLN C O   1 
ATOM 5900  C CB  . GLN C 1 86  ? -20.255 -38.697 6.943   1.00 35.65 ? 86  GLN C CB  1 
ATOM 5901  C CG  . GLN C 1 86  ? -18.838 -38.522 7.432   1.00 35.65 ? 86  GLN C CG  1 
ATOM 5902  C CD  . GLN C 1 86  ? -18.757 -38.209 8.913   1.00 35.65 ? 86  GLN C CD  1 
ATOM 5903  O OE1 . GLN C 1 86  ? -19.276 -37.186 9.387   1.00 35.65 ? 86  GLN C OE1 1 
ATOM 5904  N NE2 . GLN C 1 86  ? -18.094 -39.087 9.660   1.00 35.65 ? 86  GLN C NE2 1 
ATOM 5905  N N   . LYS C 1 87  ? -22.348 -40.529 5.584   1.00 45.22 ? 87  LYS C N   1 
ATOM 5906  C CA  . LYS C 1 87  ? -23.725 -40.879 5.282   1.00 45.22 ? 87  LYS C CA  1 
ATOM 5907  C C   . LYS C 1 87  ? -24.496 -41.164 6.561   1.00 45.22 ? 87  LYS C C   1 
ATOM 5908  O O   . LYS C 1 87  ? -23.900 -41.471 7.598   1.00 45.22 ? 87  LYS C O   1 
ATOM 5909  C CB  . LYS C 1 87  ? -23.747 -42.100 4.367   1.00 46.73 ? 87  LYS C CB  1 
ATOM 5910  C CG  . LYS C 1 87  ? -23.123 -41.826 3.019   1.00 46.73 ? 87  LYS C CG  1 
ATOM 5911  C CD  . LYS C 1 87  ? -23.079 -43.060 2.125   1.00 46.73 ? 87  LYS C CD  1 
ATOM 5912  C CE  . LYS C 1 87  ? -21.898 -43.963 2.446   1.00 46.73 ? 87  LYS C CE  1 
ATOM 5913  N NZ  . LYS C 1 87  ? -21.651 -44.940 1.340   1.00 46.73 ? 87  LYS C NZ  1 
ATOM 5914  N N   . ASP C 1 88  ? -25.819 -41.042 6.489   1.00 59.67 ? 88  ASP C N   1 
ATOM 5915  C CA  . ASP C 1 88  ? -26.669 -41.310 7.643   1.00 59.67 ? 88  ASP C CA  1 
ATOM 5916  C C   . ASP C 1 88  ? -26.820 -42.820 7.785   1.00 59.67 ? 88  ASP C C   1 
ATOM 5917  O O   . ASP C 1 88  ? -26.284 -43.585 6.979   1.00 59.67 ? 88  ASP C O   1 
ATOM 5918  C CB  . ASP C 1 88  ? -28.042 -40.644 7.476   1.00 56.32 ? 88  ASP C CB  1 
ATOM 5919  C CG  . ASP C 1 88  ? -28.826 -41.190 6.296   1.00 56.32 ? 88  ASP C CG  1 
ATOM 5920  O OD1 . ASP C 1 88  ? -29.856 -40.580 5.944   1.00 56.32 ? 88  ASP C OD1 1 
ATOM 5921  O OD2 . ASP C 1 88  ? -28.424 -42.224 5.721   1.00 56.32 ? 88  ASP C OD2 1 
ATOM 5922  N N   . ASP C 1 89  ? -27.555 -43.253 8.798   1.00 53.28 ? 89  ASP C N   1 
ATOM 5923  C CA  . ASP C 1 89  ? -27.727 -44.676 9.028   1.00 53.28 ? 89  ASP C CA  1 
ATOM 5924  C C   . ASP C 1 89  ? -28.407 -45.425 7.893   1.00 53.28 ? 89  ASP C C   1 
ATOM 5925  O O   . ASP C 1 89  ? -28.330 -46.652 7.830   1.00 53.28 ? 89  ASP C O   1 
ATOM 5926  C CB  . ASP C 1 89  ? -28.486 -44.902 10.327  1.00 50.79 ? 89  ASP C CB  1 
ATOM 5927  C CG  . ASP C 1 89  ? -27.828 -44.212 11.505  1.00 50.79 ? 89  ASP C CG  1 
ATOM 5928  O OD1 . ASP C 1 89  ? -26.578 -44.144 11.531  1.00 50.79 ? 89  ASP C OD1 1 
ATOM 5929  O OD2 . ASP C 1 89  ? -28.560 -43.747 12.405  1.00 50.79 ? 89  ASP C OD2 1 
ATOM 5930  N N   . ASN C 1 90  ? -29.064 -44.699 6.993   1.00 49.35 ? 90  ASN C N   1 
ATOM 5931  C CA  . ASN C 1 90  ? -29.742 -45.338 5.868   1.00 49.35 ? 90  ASN C CA  1 
ATOM 5932  C C   . ASN C 1 90  ? -28.819 -45.412 4.664   1.00 49.35 ? 90  ASN C C   1 
ATOM 5933  O O   . ASN C 1 90  ? -29.227 -45.854 3.585   1.00 49.35 ? 90  ASN C O   1 
ATOM 5934  C CB  . ASN C 1 90  ? -31.000 -44.564 5.489   1.00 75.74 ? 90  ASN C CB  1 
ATOM 5935  C CG  . ASN C 1 90  ? -31.931 -44.375 6.660   1.00 75.74 ? 90  ASN C CG  1 
ATOM 5936  O OD1 . ASN C 1 90  ? -32.356 -45.343 7.295   1.00 75.74 ? 90  ASN C OD1 1 
ATOM 5937  N ND2 . ASN C 1 90  ? -32.257 -43.121 6.959   1.00 75.74 ? 90  ASN C ND2 1 
ATOM 5938  N N   . GLY C 1 91  ? -27.576 -44.977 4.854   1.00 56.59 ? 91  GLY C N   1 
ATOM 5939  C CA  . GLY C 1 91  ? -26.607 -44.996 3.773   1.00 56.59 ? 91  GLY C CA  1 
ATOM 5940  C C   . GLY C 1 91  ? -26.795 -43.827 2.826   1.00 56.59 ? 91  GLY C C   1 
ATOM 5941  O O   . GLY C 1 91  ? -26.322 -43.852 1.689   1.00 56.59 ? 91  GLY C O   1 
ATOM 5942  N N   . VAL C 1 92  ? -27.491 -42.795 3.294   1.00 58.57 ? 92  VAL C N   1 
ATOM 5943  C CA  . VAL C 1 92  ? -27.733 -41.620 2.475   1.00 58.57 ? 92  VAL C CA  1 
ATOM 5944  C C   . VAL C 1 92  ? -26.774 -40.485 2.790   1.00 58.57 ? 92  VAL C C   1 
ATOM 5945  O O   . VAL C 1 92  ? -26.719 -39.982 3.915   1.00 58.57 ? 92  VAL C O   1 
ATOM 5946  C CB  . VAL C 1 92  ? -29.154 -41.095 2.650   1.00 43.01 ? 92  VAL C CB  1 
ATOM 5947  C CG1 . VAL C 1 92  ? -29.352 -39.853 1.786   1.00 43.01 ? 92  VAL C CG1 1 
ATOM 5948  C CG2 . VAL C 1 92  ? -30.145 -42.178 2.281   1.00 43.01 ? 92  VAL C CG2 1 
ATOM 5949  N N   . PRO C 1 93  ? -26.017 -40.051 1.781   1.00 39.94 ? 93  PRO C N   1 
ATOM 5950  C CA  . PRO C 1 93  ? -25.038 -38.971 1.889   1.00 39.94 ? 93  PRO C CA  1 
ATOM 5951  C C   . PRO C 1 93  ? -25.646 -37.733 2.531   1.00 39.94 ? 93  PRO C C   1 
ATOM 5952  O O   . PRO C 1 93  ? -26.665 -37.226 2.062   1.00 39.94 ? 93  PRO C O   1 
ATOM 5953  C CB  . PRO C 1 93  ? -24.657 -38.715 0.440   1.00 28.98 ? 93  PRO C CB  1 
ATOM 5954  C CG  . PRO C 1 93  ? -24.837 -40.055 -0.196  1.00 28.98 ? 93  PRO C CG  1 
ATOM 5955  C CD  . PRO C 1 93  ? -26.132 -40.517 0.391   1.00 28.98 ? 93  PRO C CD  1 
ATOM 5956  N N   . PHE C 1 94  ? -25.027 -37.255 3.605   1.00 36.83 ? 94  PHE C N   1 
ATOM 5957  C CA  . PHE C 1 94  ? -25.507 -36.057 4.280   1.00 36.83 ? 94  PHE C CA  1 
ATOM 5958  C C   . PHE C 1 94  ? -25.695 -34.949 3.242   1.00 36.83 ? 94  PHE C C   1 
ATOM 5959  O O   . PHE C 1 94  ? -26.635 -34.160 3.319   1.00 36.83 ? 94  PHE C O   1 
ATOM 5960  C CB  . PHE C 1 94  ? -24.491 -35.599 5.327   1.00 35.42 ? 94  PHE C CB  1 
ATOM 5961  C CG  . PHE C 1 94  ? -24.453 -36.450 6.561   1.00 35.42 ? 94  PHE C CG  1 
ATOM 5962  C CD1 . PHE C 1 94  ? -23.259 -36.628 7.254   1.00 35.42 ? 94  PHE C CD1 1 
ATOM 5963  C CD2 . PHE C 1 94  ? -25.610 -37.020 7.069   1.00 35.42 ? 94  PHE C CD2 1 
ATOM 5964  C CE1 . PHE C 1 94  ? -23.217 -37.360 8.439   1.00 35.42 ? 94  PHE C CE1 1 
ATOM 5965  C CE2 . PHE C 1 94  ? -25.581 -37.753 8.255   1.00 35.42 ? 94  PHE C CE2 1 
ATOM 5966  C CZ  . PHE C 1 94  ? -24.380 -37.922 8.942   1.00 35.42 ? 94  PHE C CZ  1 
ATOM 5967  N N   . VAL C 1 95  ? -24.787 -34.892 2.272   1.00 39.08 ? 95  VAL C N   1 
ATOM 5968  C CA  . VAL C 1 95  ? -24.863 -33.876 1.230   1.00 39.08 ? 95  VAL C CA  1 
ATOM 5969  C C   . VAL C 1 95  ? -26.169 -34.021 0.468   1.00 39.08 ? 95  VAL C C   1 
ATOM 5970  O O   . VAL C 1 95  ? -26.878 -33.041 0.241   1.00 39.08 ? 95  VAL C O   1 
ATOM 5971  C CB  . VAL C 1 95  ? -23.691 -33.992 0.233   1.00 36.13 ? 95  VAL C CB  1 
ATOM 5972  C CG1 . VAL C 1 95  ? -23.858 -32.975 -0.876  1.00 36.13 ? 95  VAL C CG1 1 
ATOM 5973  C CG2 . VAL C 1 95  ? -22.373 -33.767 0.950   1.00 36.13 ? 95  VAL C CG2 1 
ATOM 5974  N N   . ARG C 1 96  ? -26.480 -35.255 0.084   1.00 44.26 ? 96  ARG C N   1 
ATOM 5975  C CA  . ARG C 1 96  ? -27.702 -35.565 -0.648  1.00 44.26 ? 96  ARG C CA  1 
ATOM 5976  C C   . ARG C 1 96  ? -28.910 -34.996 0.089   1.00 44.26 ? 96  ARG C C   1 
ATOM 5977  O O   . ARG C 1 96  ? -29.703 -34.243 -0.475  1.00 44.26 ? 96  ARG C O   1 
ATOM 5978  C CB  . ARG C 1 96  ? -27.855 -37.074 -0.768  1.00 95.18 ? 96  ARG C CB  1 
ATOM 5979  C CG  . ARG C 1 96  ? -29.049 -37.497 -1.567  1.00 95.18 ? 96  ARG C CG  1 
ATOM 5980  C CD  . ARG C 1 96  ? -28.865 -37.158 -3.024  1.00 95.18 ? 96  ARG C CD  1 
ATOM 5981  N NE  . ARG C 1 96  ? -29.406 -38.223 -3.858  1.00 95.18 ? 96  ARG C NE  1 
ATOM 5982  C CZ  . ARG C 1 96  ? -29.034 -39.499 -3.771  1.00 95.18 ? 96  ARG C CZ  1 
ATOM 5983  N NH1 . ARG C 1 96  ? -28.116 -39.876 -2.886  1.00 95.18 ? 96  ARG C NH1 1 
ATOM 5984  N NH2 . ARG C 1 96  ? -29.586 -40.404 -4.568  1.00 95.18 ? 96  ARG C NH2 1 
ATOM 5985  N N   . THR C 1 97  ? -29.035 -35.367 1.359   1.00 38.00 ? 97  THR C N   1 
ATOM 5986  C CA  . THR C 1 97  ? -30.130 -34.904 2.198   1.00 38.00 ? 97  THR C CA  1 
ATOM 5987  C C   . THR C 1 97  ? -30.272 -33.384 2.171   1.00 38.00 ? 97  THR C C   1 
ATOM 5988  O O   . THR C 1 97  ? -31.307 -32.868 1.748   1.00 38.00 ? 97  THR C O   1 
ATOM 5989  C CB  . THR C 1 97  ? -29.924 -35.347 3.653   1.00 34.32 ? 97  THR C CB  1 
ATOM 5990  O OG1 . THR C 1 97  ? -29.812 -36.776 3.706   1.00 34.32 ? 97  THR C OG1 1 
ATOM 5991  C CG2 . THR C 1 97  ? -31.090 -34.881 4.520   1.00 34.32 ? 97  THR C CG2 1 
ATOM 5992  N N   . ILE C 1 98  ? -29.245 -32.666 2.628   1.00 29.65 ? 98  ILE C N   1 
ATOM 5993  C CA  . ILE C 1 98  ? -29.300 -31.209 2.635   1.00 29.65 ? 98  ILE C CA  1 
ATOM 5994  C C   . ILE C 1 98  ? -29.674 -30.690 1.247   1.00 29.65 ? 98  ILE C C   1 
ATOM 5995  O O   . ILE C 1 98  ? -30.479 -29.766 1.123   1.00 29.65 ? 98  ILE C O   1 
ATOM 5996  C CB  . ILE C 1 98  ? -27.952 -30.577 3.084   1.00 28.10 ? 98  ILE C CB  1 
ATOM 5997  C CG1 . ILE C 1 98  ? -27.869 -30.536 4.607   1.00 28.10 ? 98  ILE C CG1 1 
ATOM 5998  C CG2 . ILE C 1 98  ? -27.847 -29.142 2.590   1.00 28.10 ? 98  ILE C CG2 1 
ATOM 5999  C CD1 . ILE C 1 98  ? -27.721 -31.873 5.245   1.00 28.10 ? 98  ILE C CD1 1 
ATOM 6000  N N   . GLN C 1 99  ? -29.104 -31.291 0.206   1.00 37.84 ? 99  GLN C N   1 
ATOM 6001  C CA  . GLN C 1 99  ? -29.395 -30.868 -1.160  1.00 37.84 ? 99  GLN C CA  1 
ATOM 6002  C C   . GLN C 1 99  ? -30.855 -31.020 -1.525  1.00 37.84 ? 99  GLN C C   1 
ATOM 6003  O O   . GLN C 1 99  ? -31.445 -30.130 -2.139  1.00 37.84 ? 99  GLN C O   1 
ATOM 6004  C CB  . GLN C 1 99  ? -28.576 -31.664 -2.161  1.00 57.96 ? 99  GLN C CB  1 
ATOM 6005  C CG  . GLN C 1 99  ? -27.119 -31.329 -2.150  1.00 57.96 ? 99  GLN C CG  1 
ATOM 6006  C CD  . GLN C 1 99  ? -26.400 -31.987 -3.290  1.00 57.96 ? 99  GLN C CD  1 
ATOM 6007  O OE1 . GLN C 1 99  ? -26.443 -33.210 -3.437  1.00 57.96 ? 99  GLN C OE1 1 
ATOM 6008  N NE2 . GLN C 1 99  ? -25.734 -31.185 -4.114  1.00 57.96 ? 99  GLN C NE2 1 
ATOM 6009  N N   . ASP C 1 100 ? -31.435 -32.160 -1.161  1.00 47.35 ? 100 ASP C N   1 
ATOM 6010  C CA  . ASP C 1 100 ? -32.833 -32.418 -1.467  1.00 47.35 ? 100 ASP C CA  1 
ATOM 6011  C C   . ASP C 1 100 ? -33.772 -31.413 -0.811  1.00 47.35 ? 100 ASP C C   1 
ATOM 6012  O O   . ASP C 1 100 ? -34.832 -31.124 -1.354  1.00 47.35 ? 100 ASP C O   1 
ATOM 6013  C CB  . ASP C 1 100 ? -33.209 -33.848 -1.069  1.00 60.48 ? 100 ASP C CB  1 
ATOM 6014  C CG  . ASP C 1 100 ? -32.556 -34.899 -1.969  1.00 60.48 ? 100 ASP C CG  1 
ATOM 6015  O OD1 . ASP C 1 100 ? -32.049 -34.540 -3.063  1.00 60.48 ? 100 ASP C OD1 1 
ATOM 6016  O OD2 . ASP C 1 100 ? -32.564 -36.093 -1.585  1.00 60.48 ? 100 ASP C OD2 1 
ATOM 6017  N N   . LYS C 1 101 ? -33.395 -30.876 0.348   1.00 29.96 ? 101 LYS C N   1 
ATOM 6018  C CA  . LYS C 1 101 ? -34.236 -29.882 1.015   1.00 29.96 ? 101 LYS C CA  1 
ATOM 6019  C C   . LYS C 1 101 ? -34.026 -28.525 0.356   1.00 29.96 ? 101 LYS C C   1 
ATOM 6020  O O   . LYS C 1 101 ? -34.584 -27.517 0.796   1.00 29.96 ? 101 LYS C O   1 
ATOM 6021  C CB  . LYS C 1 101 ? -33.899 -29.766 2.504   1.00 42.27 ? 101 LYS C CB  1 
ATOM 6022  C CG  . LYS C 1 101 ? -34.267 -30.972 3.330   1.00 42.27 ? 101 LYS C CG  1 
ATOM 6023  C CD  . LYS C 1 101 ? -34.064 -30.673 4.800   1.00 42.27 ? 101 LYS C CD  1 
ATOM 6024  C CE  . LYS C 1 101 ? -34.164 -31.930 5.650   1.00 42.27 ? 101 LYS C CE  1 
ATOM 6025  N NZ  . LYS C 1 101 ? -35.560 -32.446 5.700   1.00 42.27 ? 101 LYS C NZ  1 
ATOM 6026  N N   . GLY C 1 102 ? -33.209 -28.503 -0.695  1.00 35.49 ? 102 GLY C N   1 
ATOM 6027  C CA  . GLY C 1 102 ? -32.951 -27.264 -1.401  1.00 35.49 ? 102 GLY C CA  1 
ATOM 6028  C C   . GLY C 1 102 ? -31.994 -26.324 -0.689  1.00 35.49 ? 102 GLY C C   1 
ATOM 6029  O O   . GLY C 1 102 ? -31.853 -25.160 -1.075  1.00 35.49 ? 102 GLY C O   1 
ATOM 6030  N N   . ILE C 1 103 ? -31.334 -26.820 0.353   1.00 31.59 ? 103 ILE C N   1 
ATOM 6031  C CA  . ILE C 1 103 ? -30.381 -26.012 1.100   1.00 31.59 ? 103 ILE C CA  1 
ATOM 6032  C C   . ILE C 1 103 ? -29.048 -26.089 0.361   1.00 31.59 ? 103 ILE C C   1 
ATOM 6033  O O   . ILE C 1 103 ? -28.738 -27.112 -0.244  1.00 31.59 ? 103 ILE C O   1 
ATOM 6034  C CB  . ILE C 1 103 ? -30.241 -26.548 2.530   1.00 25.82 ? 103 ILE C CB  1 
ATOM 6035  C CG1 . ILE C 1 103 ? -31.631 -26.611 3.169   1.00 25.82 ? 103 ILE C CG1 1 
ATOM 6036  C CG2 . ILE C 1 103 ? -29.326 -25.654 3.343   1.00 25.82 ? 103 ILE C CG2 1 
ATOM 6037  C CD1 . ILE C 1 103 ? -31.653 -27.126 4.581   1.00 25.82 ? 103 ILE C CD1 1 
ATOM 6038  N N   . VAL C 1 104 ? -28.267 -25.012 0.389   1.00 27.21 ? 104 VAL C N   1 
ATOM 6039  C CA  . VAL C 1 104 ? -26.985 -25.007 -0.313  1.00 27.21 ? 104 VAL C CA  1 
ATOM 6040  C C   . VAL C 1 104 ? -25.873 -25.657 0.512   1.00 27.21 ? 104 VAL C C   1 
ATOM 6041  O O   . VAL C 1 104 ? -25.832 -25.509 1.737   1.00 27.21 ? 104 VAL C O   1 
ATOM 6042  C CB  . VAL C 1 104 ? -26.556 -23.572 -0.684  1.00 22.18 ? 104 VAL C CB  1 
ATOM 6043  C CG1 . VAL C 1 104 ? -25.384 -23.622 -1.638  1.00 22.18 ? 104 VAL C CG1 1 
ATOM 6044  C CG2 . VAL C 1 104 ? -27.710 -22.826 -1.321  1.00 22.18 ? 104 VAL C CG2 1 
ATOM 6045  N N   . VAL C 1 105 ? -24.973 -26.369 -0.167  1.00 33.21 ? 105 VAL C N   1 
ATOM 6046  C CA  . VAL C 1 105 ? -23.860 -27.057 0.492   1.00 33.21 ? 105 VAL C CA  1 
ATOM 6047  C C   . VAL C 1 105 ? -22.523 -26.310 0.391   1.00 33.21 ? 105 VAL C C   1 
ATOM 6048  O O   . VAL C 1 105 ? -22.169 -25.794 -0.674  1.00 33.21 ? 105 VAL C O   1 
ATOM 6049  C CB  . VAL C 1 105 ? -23.669 -28.465 -0.106  1.00 24.70 ? 105 VAL C CB  1 
ATOM 6050  C CG1 . VAL C 1 105 ? -22.570 -29.199 0.629   1.00 24.70 ? 105 VAL C CG1 1 
ATOM 6051  C CG2 . VAL C 1 105 ? -24.962 -29.239 -0.020  1.00 24.70 ? 105 VAL C CG2 1 
ATOM 6052  N N   . GLY C 1 106 ? -21.781 -26.261 1.498   1.00 27.53 ? 106 GLY C N   1 
ATOM 6053  C CA  . GLY C 1 106 ? -20.490 -25.589 1.499   1.00 27.53 ? 106 GLY C CA  1 
ATOM 6054  C C   . GLY C 1 106 ? -19.431 -26.331 2.301   1.00 27.53 ? 106 GLY C C   1 
ATOM 6055  O O   . GLY C 1 106 ? -19.779 -27.185 3.114   1.00 27.53 ? 106 GLY C O   1 
ATOM 6056  N N   . ILE C 1 107 ? -18.148 -26.015 2.075   1.00 25.43 ? 107 ILE C N   1 
ATOM 6057  C CA  . ILE C 1 107 ? -17.025 -26.646 2.796   1.00 25.43 ? 107 ILE C CA  1 
ATOM 6058  C C   . ILE C 1 107 ? -16.023 -25.632 3.297   1.00 25.43 ? 107 ILE C C   1 
ATOM 6059  O O   . ILE C 1 107 ? -15.751 -24.633 2.626   1.00 25.43 ? 107 ILE C O   1 
ATOM 6060  C CB  . ILE C 1 107 ? -16.150 -27.583 1.915   1.00 19.43 ? 107 ILE C CB  1 
ATOM 6061  C CG1 . ILE C 1 107 ? -16.690 -27.604 0.501   1.00 19.43 ? 107 ILE C CG1 1 
ATOM 6062  C CG2 . ILE C 1 107 ? -16.026 -28.956 2.538   1.00 19.43 ? 107 ILE C CG2 1 
ATOM 6063  C CD1 . ILE C 1 107 ? -16.670 -26.236 -0.137  1.00 19.43 ? 107 ILE C CD1 1 
ATOM 6064  N N   . LYS C 1 108 ? -15.468 -25.914 4.472   1.00 31.75 ? 108 LYS C N   1 
ATOM 6065  C CA  . LYS C 1 108 ? -14.411 -25.096 5.063   1.00 31.75 ? 108 LYS C CA  1 
ATOM 6066  C C   . LYS C 1 108 ? -13.216 -25.559 4.219   1.00 31.75 ? 108 LYS C C   1 
ATOM 6067  O O   . LYS C 1 108 ? -13.030 -26.762 4.035   1.00 31.75 ? 108 LYS C O   1 
ATOM 6068  C CB  . LYS C 1 108 ? -14.209 -25.495 6.528   1.00 30.21 ? 108 LYS C CB  1 
ATOM 6069  C CG  . LYS C 1 108 ? -13.009 -24.895 7.248   1.00 30.21 ? 108 LYS C CG  1 
ATOM 6070  C CD  . LYS C 1 108 ? -12.874 -25.535 8.635   1.00 30.21 ? 108 LYS C CD  1 
ATOM 6071  C CE  . LYS C 1 108 ? -12.199 -24.614 9.665   1.00 30.21 ? 108 LYS C CE  1 
ATOM 6072  N NZ  . LYS C 1 108 ? -12.337 -25.117 11.100  1.00 30.21 ? 108 LYS C NZ  1 
ATOM 6073  N N   . VAL C 1 109 ? -12.429 -24.636 3.676   1.00 24.58 ? 109 VAL C N   1 
ATOM 6074  C CA  . VAL C 1 109 ? -11.289 -25.043 2.862   1.00 24.58 ? 109 VAL C CA  1 
ATOM 6075  C C   . VAL C 1 109 ? -9.941  -24.603 3.416   1.00 24.58 ? 109 VAL C C   1 
ATOM 6076  O O   . VAL C 1 109 ? -8.909  -25.155 3.042   1.00 24.58 ? 109 VAL C O   1 
ATOM 6077  C CB  . VAL C 1 109 ? -11.420 -24.525 1.420   1.00 13.41 ? 109 VAL C CB  1 
ATOM 6078  C CG1 . VAL C 1 109 ? -12.694 -25.057 0.805   1.00 13.41 ? 109 VAL C CG1 1 
ATOM 6079  C CG2 . VAL C 1 109 ? -11.400 -23.009 1.402   1.00 13.41 ? 109 VAL C CG2 1 
ATOM 6080  N N   . ASP C 1 110 ? -9.944  -23.613 4.307   1.00 19.03 ? 110 ASP C N   1 
ATOM 6081  C CA  . ASP C 1 110 ? -8.692  -23.144 4.888   1.00 19.03 ? 110 ASP C CA  1 
ATOM 6082  C C   . ASP C 1 110 ? -8.062  -24.312 5.633   1.00 19.03 ? 110 ASP C C   1 
ATOM 6083  O O   . ASP C 1 110 ? -8.757  -25.218 6.078   1.00 19.03 ? 110 ASP C O   1 
ATOM 6084  C CB  . ASP C 1 110 ? -8.920  -21.969 5.850   1.00 34.88 ? 110 ASP C CB  1 
ATOM 6085  C CG  . ASP C 1 110 ? -9.498  -22.399 7.182   1.00 34.88 ? 110 ASP C CG  1 
ATOM 6086  O OD1 . ASP C 1 110 ? -10.716 -22.231 7.382   1.00 34.88 ? 110 ASP C OD1 1 
ATOM 6087  O OD2 . ASP C 1 110 ? -8.735  -22.903 8.033   1.00 34.88 ? 110 ASP C OD2 1 
ATOM 6088  N N   . LYS C 1 111 ? -6.742  -24.296 5.748   1.00 26.53 ? 111 LYS C N   1 
ATOM 6089  C CA  . LYS C 1 111 ? -6.042  -25.363 6.428   1.00 26.53 ? 111 LYS C CA  1 
ATOM 6090  C C   . LYS C 1 111 ? -5.452  -24.869 7.732   1.00 26.53 ? 111 LYS C C   1 
ATOM 6091  O O   . LYS C 1 111 ? -4.301  -25.155 8.054   1.00 26.53 ? 111 LYS C O   1 
ATOM 6092  C CB  . LYS C 1 111 ? -4.936  -25.934 5.541   1.00 35.56 ? 111 LYS C CB  1 
ATOM 6093  C CG  . LYS C 1 111 ? -5.416  -26.565 4.242   1.00 35.56 ? 111 LYS C CG  1 
ATOM 6094  C CD  . LYS C 1 111 ? -4.641  -27.854 3.955   1.00 35.56 ? 111 LYS C CD  1 
ATOM 6095  C CE  . LYS C 1 111 ? -4.510  -28.173 2.461   1.00 35.56 ? 111 LYS C CE  1 
ATOM 6096  N NZ  . LYS C 1 111 ? -3.558  -27.259 1.721   1.00 35.56 ? 111 LYS C NZ  1 
ATOM 6097  N N   . GLY C 1 112 ? -6.234  -24.101 8.478   1.00 19.08 ? 112 GLY C N   1 
ATOM 6098  C CA  . GLY C 1 112 ? -5.754  -23.631 9.761   1.00 19.08 ? 112 GLY C CA  1 
ATOM 6099  C C   . GLY C 1 112 ? -4.952  -22.350 9.806   1.00 19.08 ? 112 GLY C C   1 
ATOM 6100  O O   . GLY C 1 112 ? -4.387  -21.879 8.816   1.00 19.08 ? 112 GLY C O   1 
ATOM 6101  N N   . VAL C 1 113 ? -4.896  -21.797 11.007  1.00 19.10 ? 113 VAL C N   1 
ATOM 6102  C CA  . VAL C 1 113 ? -4.202  -20.557 11.264  1.00 19.10 ? 113 VAL C CA  1 
ATOM 6103  C C   . VAL C 1 113 ? -2.742  -20.854 11.555  1.00 19.10 ? 113 VAL C C   1 
ATOM 6104  O O   . VAL C 1 113 ? -2.421  -21.921 12.069  1.00 19.10 ? 113 VAL C O   1 
ATOM 6105  C CB  . VAL C 1 113 ? -4.826  -19.876 12.483  1.00 14.43 ? 113 VAL C CB  1 
ATOM 6106  C CG1 . VAL C 1 113 ? -4.317  -20.521 13.749  1.00 14.43 ? 113 VAL C CG1 1 
ATOM 6107  C CG2 . VAL C 1 113 ? -4.525  -18.422 12.472  1.00 14.43 ? 113 VAL C CG2 1 
ATOM 6108  N N   . VAL C 1 114 ? -1.860  -19.916 11.227  1.00 27.90 ? 114 VAL C N   1 
ATOM 6109  C CA  . VAL C 1 114 ? -0.434  -20.088 11.486  1.00 27.90 ? 114 VAL C CA  1 
ATOM 6110  C C   . VAL C 1 114 ? 0.175   -18.765 11.946  1.00 27.90 ? 114 VAL C C   1 
ATOM 6111  O O   . VAL C 1 114 ? -0.357  -17.692 11.665  1.00 27.90 ? 114 VAL C O   1 
ATOM 6112  C CB  . VAL C 1 114 ? 0.318   -20.586 10.245  1.00 10.04 ? 114 VAL C CB  1 
ATOM 6113  C CG1 . VAL C 1 114 ? -0.255  -21.912 9.784   1.00 10.04 ? 114 VAL C CG1 1 
ATOM 6114  C CG2 . VAL C 1 114 ? 0.221   -19.563 9.136   1.00 10.04 ? 114 VAL C CG2 1 
ATOM 6115  N N   . PRO C 1 115 ? 1.314   -18.829 12.650  1.00 26.03 ? 115 PRO C N   1 
ATOM 6116  C CA  . PRO C 1 115 ? 2.077   -17.711 13.211  1.00 26.03 ? 115 PRO C CA  1 
ATOM 6117  C C   . PRO C 1 115 ? 2.705   -16.736 12.252  1.00 26.03 ? 115 PRO C C   1 
ATOM 6118  O O   . PRO C 1 115 ? 3.269   -17.125 11.229  1.00 26.03 ? 115 PRO C O   1 
ATOM 6119  C CB  . PRO C 1 115 ? 3.168   -18.399 14.016  1.00 4.91  ? 115 PRO C CB  1 
ATOM 6120  C CG  . PRO C 1 115 ? 2.642   -19.774 14.245  1.00 4.91  ? 115 PRO C CG  1 
ATOM 6121  C CD  . PRO C 1 115 ? 1.999   -20.094 12.945  1.00 4.91  ? 115 PRO C CD  1 
ATOM 6122  N N   . LEU C 1 116 ? 2.618   -15.462 12.604  1.00 22.10 ? 116 LEU C N   1 
ATOM 6123  C CA  . LEU C 1 116 ? 3.244   -14.422 11.814  1.00 22.10 ? 116 LEU C CA  1 
ATOM 6124  C C   . LEU C 1 116 ? 4.503   -14.049 12.587  1.00 22.10 ? 116 LEU C C   1 
ATOM 6125  O O   . LEU C 1 116 ? 4.439   -13.362 13.612  1.00 22.10 ? 116 LEU C O   1 
ATOM 6126  C CB  . LEU C 1 116 ? 2.341   -13.196 11.667  1.00 11.95 ? 116 LEU C CB  1 
ATOM 6127  C CG  . LEU C 1 116 ? 1.221   -13.283 10.636  1.00 11.95 ? 116 LEU C CG  1 
ATOM 6128  C CD1 . LEU C 1 116 ? 0.666   -11.893 10.414  1.00 11.95 ? 116 LEU C CD1 1 
ATOM 6129  C CD2 . LEU C 1 116 ? 1.742   -13.844 9.325   1.00 11.95 ? 116 LEU C CD2 1 
ATOM 6130  N N   . ALA C 1 117 ? 5.647   -14.522 12.108  1.00 24.61 ? 117 ALA C N   1 
ATOM 6131  C CA  . ALA C 1 117 ? 6.908   -14.229 12.764  1.00 24.61 ? 117 ALA C CA  1 
ATOM 6132  C C   . ALA C 1 117 ? 7.053   -12.729 12.933  1.00 24.61 ? 117 ALA C C   1 
ATOM 6133  O O   . ALA C 1 117 ? 6.738   -11.964 12.018  1.00 24.61 ? 117 ALA C O   1 
ATOM 6134  C CB  . ALA C 1 117 ? 8.052   -14.770 11.934  1.00 47.74 ? 117 ALA C CB  1 
ATOM 6135  N N   . GLY C 1 118 ? 7.510   -12.312 14.109  1.00 19.53 ? 118 GLY C N   1 
ATOM 6136  C CA  . GLY C 1 118 ? 7.727   -10.898 14.358  1.00 19.53 ? 118 GLY C CA  1 
ATOM 6137  C C   . GLY C 1 118 ? 6.561   -10.108 14.907  1.00 19.53 ? 118 GLY C C   1 
ATOM 6138  O O   . GLY C 1 118 ? 6.669   -8.888  15.095  1.00 19.53 ? 118 GLY C O   1 
ATOM 6139  N N   . THR C 1 119 ? 5.450   -10.788 15.168  1.00 26.17 ? 119 THR C N   1 
ATOM 6140  C CA  . THR C 1 119 ? 4.261   -10.124 15.690  1.00 26.17 ? 119 THR C CA  1 
ATOM 6141  C C   . THR C 1 119 ? 3.990   -10.588 17.101  1.00 26.17 ? 119 THR C C   1 
ATOM 6142  O O   . THR C 1 119 ? 4.617   -11.534 17.579  1.00 26.17 ? 119 THR C O   1 
ATOM 6143  C CB  . THR C 1 119 ? 3.012   -10.453 14.860  1.00 28.40 ? 119 THR C CB  1 
ATOM 6144  O OG1 . THR C 1 119 ? 2.709   -11.846 15.002  1.00 28.40 ? 119 THR C OG1 1 
ATOM 6145  C CG2 . THR C 1 119 ? 3.241   -10.132 13.382  1.00 28.40 ? 119 THR C CG2 1 
ATOM 6146  N N   . ASP C 1 120 ? 3.045   -9.927  17.760  1.00 25.44 ? 120 ASP C N   1 
ATOM 6147  C CA  . ASP C 1 120 ? 2.683   -10.287 19.126  1.00 25.44 ? 120 ASP C CA  1 
ATOM 6148  C C   . ASP C 1 120 ? 1.644   -11.403 19.103  1.00 25.44 ? 120 ASP C C   1 
ATOM 6149  O O   . ASP C 1 120 ? 0.460   -11.181 19.366  1.00 25.44 ? 120 ASP C O   1 
ATOM 6150  C CB  . ASP C 1 120 ? 2.126   -9.073  19.866  1.00 43.11 ? 120 ASP C CB  1 
ATOM 6151  C CG  . ASP C 1 120 ? 1.819   -9.369  21.326  1.00 43.11 ? 120 ASP C CG  1 
ATOM 6152  O OD1 . ASP C 1 120 ? 1.377   -8.436  22.031  1.00 43.11 ? 120 ASP C OD1 1 
ATOM 6153  O OD2 . ASP C 1 120 ? 2.014   -10.522 21.775  1.00 43.11 ? 120 ASP C OD2 1 
ATOM 6154  N N   . GLY C 1 121 ? 2.096   -12.606 18.771  1.00 30.42 ? 121 GLY C N   1 
ATOM 6155  C CA  . GLY C 1 121 ? 1.204   -13.747 18.722  1.00 30.42 ? 121 GLY C CA  1 
ATOM 6156  C C   . GLY C 1 121 ? 0.083   -13.614 17.714  1.00 30.42 ? 121 GLY C C   1 
ATOM 6157  O O   . GLY C 1 121 ? -1.023  -14.094 17.940  1.00 30.42 ? 121 GLY C O   1 
ATOM 6158  N N   . GLU C 1 122 ? 0.355   -12.958 16.597  1.00 21.47 ? 122 GLU C N   1 
ATOM 6159  C CA  . GLU C 1 122 ? -0.658  -12.799 15.576  1.00 21.47 ? 122 GLU C CA  1 
ATOM 6160  C C   . GLU C 1 122 ? -0.524  -13.903 14.561  1.00 21.47 ? 122 GLU C C   1 
ATOM 6161  O O   . GLU C 1 122 ? 0.491   -14.588 14.517  1.00 21.47 ? 122 GLU C O   1 
ATOM 6162  C CB  . GLU C 1 122 ? -0.506  -11.466 14.903  1.00 23.41 ? 122 GLU C CB  1 
ATOM 6163  C CG  . GLU C 1 122 ? -0.535  -10.354 15.874  1.00 23.41 ? 122 GLU C CG  1 
ATOM 6164  C CD  . GLU C 1 122 ? -0.631  -9.059  15.160  1.00 23.41 ? 122 GLU C CD  1 
ATOM 6165  O OE1 . GLU C 1 122 ? -1.702  -8.824  14.562  1.00 23.41 ? 122 GLU C OE1 1 
ATOM 6166  O OE2 . GLU C 1 122 ? 0.362   -8.294  15.177  1.00 23.41 ? 122 GLU C OE2 1 
ATOM 6167  N N   . THR C 1 123 ? -1.540  -14.066 13.727  1.00 24.81 ? 123 THR C N   1 
ATOM 6168  C CA  . THR C 1 123 ? -1.508  -15.136 12.751  1.00 24.81 ? 123 THR C CA  1 
ATOM 6169  C C   . THR C 1 123 ? -1.981  -14.743 11.377  1.00 24.81 ? 123 THR C C   1 
ATOM 6170  O O   . THR C 1 123 ? -2.253  -13.582 11.085  1.00 24.81 ? 123 THR C O   1 
ATOM 6171  C CB  . THR C 1 123 ? -2.411  -16.293 13.182  1.00 24.30 ? 123 THR C CB  1 
ATOM 6172  O OG1 . THR C 1 123 ? -3.727  -15.785 13.424  1.00 24.30 ? 123 THR C OG1 1 
ATOM 6173  C CG2 . THR C 1 123 ? -1.896  -16.956 14.432  1.00 24.30 ? 123 THR C CG2 1 
ATOM 6174  N N   . THR C 1 124 ? -2.078  -15.768 10.545  1.00 29.49 ? 124 THR C N   1 
ATOM 6175  C CA  . THR C 1 124 ? -2.564  -15.662 9.189   1.00 29.49 ? 124 THR C CA  1 
ATOM 6176  C C   . THR C 1 124 ? -3.103  -17.066 8.951   1.00 29.49 ? 124 THR C C   1 
ATOM 6177  O O   . THR C 1 124 ? -3.014  -17.921 9.834   1.00 29.49 ? 124 THR C O   1 
ATOM 6178  C CB  . THR C 1 124 ? -1.439  -15.329 8.193   1.00 20.48 ? 124 THR C CB  1 
ATOM 6179  O OG1 . THR C 1 124 ? -1.992  -15.170 6.879   1.00 20.48 ? 124 THR C OG1 1 
ATOM 6180  C CG2 . THR C 1 124 ? -0.405  -16.431 8.176   1.00 20.48 ? 124 THR C CG2 1 
ATOM 6181  N N   . THR C 1 125 ? -3.643  -17.320 7.770   1.00 16.44 ? 125 THR C N   1 
ATOM 6182  C CA  . THR C 1 125 ? -4.225  -18.624 7.509   1.00 16.44 ? 125 THR C CA  1 
ATOM 6183  C C   . THR C 1 125 ? -3.629  -19.301 6.293   1.00 16.44 ? 125 THR C C   1 
ATOM 6184  O O   . THR C 1 125 ? -3.281  -18.645 5.316   1.00 16.44 ? 125 THR C O   1 
ATOM 6185  C CB  . THR C 1 125 ? -5.746  -18.489 7.292   1.00 25.91 ? 125 THR C CB  1 
ATOM 6186  O OG1 . THR C 1 125 ? -6.328  -17.811 8.411   1.00 25.91 ? 125 THR C OG1 1 
ATOM 6187  C CG2 . THR C 1 125 ? -6.389  -19.845 7.135   1.00 25.91 ? 125 THR C CG2 1 
ATOM 6188  N N   . GLN C 1 126 ? -3.513  -20.618 6.350   1.00 19.90 ? 126 GLN C N   1 
ATOM 6189  C CA  . GLN C 1 126 ? -2.990  -21.345 5.216   1.00 19.90 ? 126 GLN C CA  1 
ATOM 6190  C C   . GLN C 1 126 ? -4.074  -22.210 4.602   1.00 19.90 ? 126 GLN C C   1 
ATOM 6191  O O   . GLN C 1 126 ? -5.104  -22.444 5.226   1.00 19.90 ? 126 GLN C O   1 
ATOM 6192  C CB  . GLN C 1 126 ? -1.826  -22.210 5.643   1.00 21.79 ? 126 GLN C CB  1 
ATOM 6193  C CG  . GLN C 1 126 ? -2.086  -23.090 6.818   1.00 21.79 ? 126 GLN C CG  1 
ATOM 6194  C CD  . GLN C 1 126 ? -0.947  -24.052 7.004   1.00 21.79 ? 126 GLN C CD  1 
ATOM 6195  O OE1 . GLN C 1 126 ? 0.197   -23.739 6.664   1.00 21.79 ? 126 GLN C OE1 1 
ATOM 6196  N NE2 . GLN C 1 126 ? -1.237  -25.224 7.542   1.00 21.79 ? 126 GLN C NE2 1 
ATOM 6197  N N   . GLY C 1 127 ? -3.839  -22.677 3.378   1.00 23.26 ? 127 GLY C N   1 
ATOM 6198  C CA  . GLY C 1 127 ? -4.809  -23.516 2.705   1.00 23.26 ? 127 GLY C CA  1 
ATOM 6199  C C   . GLY C 1 127 ? -4.809  -23.291 1.207   1.00 23.26 ? 127 GLY C C   1 
ATOM 6200  O O   . GLY C 1 127 ? -5.416  -24.063 0.454   1.00 23.26 ? 127 GLY C O   1 
ATOM 6201  N N   . LEU C 1 128 ? -4.113  -22.245 0.769   1.00 15.02 ? 128 LEU C N   1 
ATOM 6202  C CA  . LEU C 1 128 ? -4.047  -21.906 -0.650  1.00 15.02 ? 128 LEU C CA  1 
ATOM 6203  C C   . LEU C 1 128 ? -3.420  -22.968 -1.551  1.00 15.02 ? 128 LEU C C   1 
ATOM 6204  O O   . LEU C 1 128 ? -3.778  -23.072 -2.721  1.00 15.02 ? 128 LEU C O   1 
ATOM 6205  C CB  . LEU C 1 128 ? -3.290  -20.593 -0.849  1.00 8.50  ? 128 LEU C CB  1 
ATOM 6206  C CG  . LEU C 1 128 ? -3.908  -19.296 -0.335  1.00 8.50  ? 128 LEU C CG  1 
ATOM 6207  C CD1 . LEU C 1 128 ? -3.051  -18.125 -0.753  1.00 8.50  ? 128 LEU C CD1 1 
ATOM 6208  C CD2 . LEU C 1 128 ? -5.292  -19.129 -0.911  1.00 8.50  ? 128 LEU C CD2 1 
ATOM 6209  N N   . ASP C 1 129 ? -2.476  -23.748 -1.035  1.00 19.13 ? 129 ASP C N   1 
ATOM 6210  C CA  . ASP C 1 129 ? -1.844  -24.759 -1.872  1.00 19.13 ? 129 ASP C CA  1 
ATOM 6211  C C   . ASP C 1 129 ? -2.851  -25.790 -2.376  1.00 19.13 ? 129 ASP C C   1 
ATOM 6212  O O   . ASP C 1 129 ? -3.538  -26.461 -1.590  1.00 19.13 ? 129 ASP C O   1 
ATOM 6213  C CB  . ASP C 1 129 ? -0.715  -25.457 -1.116  1.00 26.31 ? 129 ASP C CB  1 
ATOM 6214  C CG  . ASP C 1 129 ? 0.436   -24.522 -0.792  1.00 26.31 ? 129 ASP C CG  1 
ATOM 6215  O OD1 . ASP C 1 129 ? 0.532   -23.449 -1.427  1.00 26.31 ? 129 ASP C OD1 1 
ATOM 6216  O OD2 . ASP C 1 129 ? 1.255   -24.870 0.093   1.00 26.31 ? 129 ASP C OD2 1 
ATOM 6217  N N   . GLY C 1 130 ? -2.944  -25.894 -3.697  1.00 21.53 ? 130 GLY C N   1 
ATOM 6218  C CA  . GLY C 1 130 ? -3.858  -26.836 -4.314  1.00 21.53 ? 130 GLY C CA  1 
ATOM 6219  C C   . GLY C 1 130 ? -5.336  -26.513 -4.167  1.00 21.53 ? 130 GLY C C   1 
ATOM 6220  O O   . GLY C 1 130 ? -6.186  -27.299 -4.595  1.00 21.53 ? 130 GLY C O   1 
ATOM 6221  N N   . LEU C 1 131 ? -5.657  -25.363 -3.582  1.00 28.28 ? 131 LEU C N   1 
ATOM 6222  C CA  . LEU C 1 131 ? -7.050  -24.985 -3.383  1.00 28.28 ? 131 LEU C CA  1 
ATOM 6223  C C   . LEU C 1 131 ? -7.890  -25.044 -4.652  1.00 28.28 ? 131 LEU C C   1 
ATOM 6224  O O   . LEU C 1 131 ? -9.053  -25.440 -4.608  1.00 28.28 ? 131 LEU C O   1 
ATOM 6225  C CB  . LEU C 1 131 ? -7.146  -23.583 -2.786  1.00 21.08 ? 131 LEU C CB  1 
ATOM 6226  C CG  . LEU C 1 131 ? -8.563  -23.108 -2.461  1.00 21.08 ? 131 LEU C CG  1 
ATOM 6227  C CD1 . LEU C 1 131 ? -9.154  -23.958 -1.352  1.00 21.08 ? 131 LEU C CD1 1 
ATOM 6228  C CD2 . LEU C 1 131 ? -8.519  -21.656 -2.038  1.00 21.08 ? 131 LEU C CD2 1 
ATOM 6229  N N   . SER C 1 132 ? -7.319  -24.661 -5.786  1.00 21.73 ? 132 SER C N   1 
ATOM 6230  C CA  . SER C 1 132 ? -8.092  -24.682 -7.018  1.00 21.73 ? 132 SER C CA  1 
ATOM 6231  C C   . SER C 1 132 ? -8.567  -26.094 -7.372  1.00 21.73 ? 132 SER C C   1 
ATOM 6232  O O   . SER C 1 132 ? -9.734  -26.293 -7.703  1.00 21.73 ? 132 SER C O   1 
ATOM 6233  C CB  . SER C 1 132 ? -7.277  -24.097 -8.165  1.00 21.83 ? 132 SER C CB  1 
ATOM 6234  O OG  . SER C 1 132 ? -8.129  -23.754 -9.240  1.00 21.83 ? 132 SER C OG  1 
ATOM 6235  N N   . GLU C 1 133 ? -7.667  -27.073 -7.299  1.00 30.13 ? 133 GLU C N   1 
ATOM 6236  C CA  . GLU C 1 133 ? -8.012  -28.462 -7.599  1.00 30.13 ? 133 GLU C CA  1 
ATOM 6237  C C   . GLU C 1 133 ? -9.075  -28.922 -6.619  1.00 30.13 ? 133 GLU C C   1 
ATOM 6238  O O   . GLU C 1 133 ? -10.048 -29.575 -6.994  1.00 30.13 ? 133 GLU C O   1 
ATOM 6239  C CB  . GLU C 1 133 ? -6.795  -29.377 -7.444  1.00 84.38 ? 133 GLU C CB  1 
ATOM 6240  C CG  . GLU C 1 133 ? -5.704  -29.177 -8.472  1.00 84.38 ? 133 GLU C CG  1 
ATOM 6241  C CD  . GLU C 1 133 ? -5.155  -27.758 -8.483  1.00 84.38 ? 133 GLU C CD  1 
ATOM 6242  O OE1 . GLU C 1 133 ? -4.610  -27.303 -7.446  1.00 84.38 ? 133 GLU C OE1 1 
ATOM 6243  O OE2 . GLU C 1 133 ? -5.269  -27.094 -9.539  1.00 84.38 ? 133 GLU C OE2 1 
ATOM 6244  N N   . ARG C 1 134 ? -8.875  -28.576 -5.354  1.00 28.09 ? 134 ARG C N   1 
ATOM 6245  C CA  . ARG C 1 134 ? -9.805  -28.962 -4.310  1.00 28.09 ? 134 ARG C CA  1 
ATOM 6246  C C   . ARG C 1 134 ? -11.187 -28.386 -4.537  1.00 28.09 ? 134 ARG C C   1 
ATOM 6247  O O   . ARG C 1 134 ? -12.186 -29.081 -4.356  1.00 28.09 ? 134 ARG C O   1 
ATOM 6248  C CB  . ARG C 1 134 ? -9.281  -28.514 -2.955  1.00 32.27 ? 134 ARG C CB  1 
ATOM 6249  C CG  . ARG C 1 134 ? -7.995  -29.179 -2.569  1.00 32.27 ? 134 ARG C CG  1 
ATOM 6250  C CD  . ARG C 1 134 ? -7.447  -28.549 -1.331  1.00 32.27 ? 134 ARG C CD  1 
ATOM 6251  N NE  . ARG C 1 134 ? -8.408  -28.612 -0.240  1.00 32.27 ? 134 ARG C NE  1 
ATOM 6252  C CZ  . ARG C 1 134 ? -8.411  -27.755 0.775   1.00 32.27 ? 134 ARG C CZ  1 
ATOM 6253  N NH1 . ARG C 1 134 ? -7.492  -26.779 0.803   1.00 32.27 ? 134 ARG C NH1 1 
ATOM 6254  N NH2 . ARG C 1 134 ? -9.322  -27.866 1.749   1.00 32.27 ? 134 ARG C NH2 1 
ATOM 6255  N N   . CYS C 1 135 ? -11.252 -27.114 -4.918  1.00 28.15 ? 135 CYS C N   1 
ATOM 6256  C CA  . CYS C 1 135 ? -12.541 -26.487 -5.155  1.00 28.15 ? 135 CYS C CA  1 
ATOM 6257  C C   . CYS C 1 135 ? -13.229 -27.216 -6.286  1.00 28.15 ? 135 CYS C C   1 
ATOM 6258  O O   . CYS C 1 135 ? -14.388 -27.610 -6.174  1.00 28.15 ? 135 CYS C O   1 
ATOM 6259  C CB  . CYS C 1 135 ? -12.371 -25.016 -5.516  1.00 24.53 ? 135 CYS C CB  1 
ATOM 6260  S SG  . CYS C 1 135 ? -11.990 -23.970 -4.097  1.00 24.53 ? 135 CYS C SG  1 
ATOM 6261  N N   . ALA C 1 136 ? -12.504 -27.403 -7.376  1.00 23.07 ? 136 ALA C N   1 
ATOM 6262  C CA  . ALA C 1 136 ? -13.053 -28.099 -8.519  1.00 23.07 ? 136 ALA C CA  1 
ATOM 6263  C C   . ALA C 1 136 ? -13.698 -29.417 -8.074  1.00 23.07 ? 136 ALA C C   1 
ATOM 6264  O O   . ALA C 1 136 ? -14.779 -29.779 -8.544  1.00 23.07 ? 136 ALA C O   1 
ATOM 6265  C CB  . ALA C 1 136 ? -11.958 -28.358 -9.510  1.00 6.77  ? 136 ALA C CB  1 
ATOM 6266  N N   . GLN C 1 137 ? -13.028 -30.119 -7.163  1.00 25.71 ? 137 GLN C N   1 
ATOM 6267  C CA  . GLN C 1 137 ? -13.513 -31.390 -6.636  1.00 25.71 ? 137 GLN C CA  1 
ATOM 6268  C C   . GLN C 1 137 ? -14.758 -31.208 -5.781  1.00 25.71 ? 137 GLN C C   1 
ATOM 6269  O O   . GLN C 1 137 ? -15.768 -31.877 -5.978  1.00 25.71 ? 137 GLN C O   1 
ATOM 6270  C CB  . GLN C 1 137 ? -12.435 -32.060 -5.782  1.00 46.54 ? 137 GLN C CB  1 
ATOM 6271  C CG  . GLN C 1 137 ? -11.877 -33.338 -6.378  1.00 46.54 ? 137 GLN C CG  1 
ATOM 6272  C CD  . GLN C 1 137 ? -12.968 -34.284 -6.834  1.00 46.54 ? 137 GLN C CD  1 
ATOM 6273  O OE1 . GLN C 1 137 ? -13.774 -34.755 -6.031  1.00 46.54 ? 137 GLN C OE1 1 
ATOM 6274  N NE2 . GLN C 1 137 ? -13.005 -34.561 -8.137  1.00 46.54 ? 137 GLN C NE2 1 
ATOM 6275  N N   . TYR C 1 138 ? -14.667 -30.311 -4.812  1.00 29.03 ? 138 TYR C N   1 
ATOM 6276  C CA  . TYR C 1 138 ? -15.779 -30.040 -3.925  1.00 29.03 ? 138 TYR C CA  1 
ATOM 6277  C C   . TYR C 1 138 ? -17.013 -29.637 -4.713  1.00 29.03 ? 138 TYR C C   1 
ATOM 6278  O O   . TYR C 1 138 ? -18.126 -30.041 -4.386  1.00 29.03 ? 138 TYR C O   1 
ATOM 6279  C CB  . TYR C 1 138 ? -15.392 -28.935 -2.955  1.00 25.68 ? 138 TYR C CB  1 
ATOM 6280  C CG  . TYR C 1 138 ? -14.407 -29.377 -1.905  1.00 25.68 ? 138 TYR C CG  1 
ATOM 6281  C CD1 . TYR C 1 138 ? -13.504 -28.477 -1.358  1.00 25.68 ? 138 TYR C CD1 1 
ATOM 6282  C CD2 . TYR C 1 138 ? -14.402 -30.688 -1.430  1.00 25.68 ? 138 TYR C CD2 1 
ATOM 6283  C CE1 . TYR C 1 138 ? -12.619 -28.861 -0.364  1.00 25.68 ? 138 TYR C CE1 1 
ATOM 6284  C CE2 . TYR C 1 138 ? -13.518 -31.083 -0.432  1.00 25.68 ? 138 TYR C CE2 1 
ATOM 6285  C CZ  . TYR C 1 138 ? -12.630 -30.161 0.095   1.00 25.68 ? 138 TYR C CZ  1 
ATOM 6286  O OH  . TYR C 1 138 ? -11.736 -30.521 1.079   1.00 25.68 ? 138 TYR C OH  1 
ATOM 6287  N N   . LYS C 1 139 ? -16.820 -28.835 -5.750  1.00 30.51 ? 139 LYS C N   1 
ATOM 6288  C CA  . LYS C 1 139 ? -17.943 -28.406 -6.569  1.00 30.51 ? 139 LYS C CA  1 
ATOM 6289  C C   . LYS C 1 139 ? -18.545 -29.661 -7.167  1.00 30.51 ? 139 LYS C C   1 
ATOM 6290  O O   . LYS C 1 139 ? -19.754 -29.879 -7.106  1.00 30.51 ? 139 LYS C O   1 
ATOM 6291  C CB  . LYS C 1 139 ? -17.470 -27.491 -7.695  1.00 17.21 ? 139 LYS C CB  1 
ATOM 6292  C CG  . LYS C 1 139 ? -18.577 -27.013 -8.620  1.00 17.21 ? 139 LYS C CG  1 
ATOM 6293  C CD  . LYS C 1 139 ? -19.477 -25.991 -7.950  1.00 17.21 ? 139 LYS C CD  1 
ATOM 6294  C CE  . LYS C 1 139 ? -20.400 -25.350 -8.988  1.00 17.21 ? 139 LYS C CE  1 
ATOM 6295  N NZ  . LYS C 1 139 ? -21.238 -24.205 -8.487  1.00 17.21 ? 139 LYS C NZ  1 
ATOM 6296  N N   . LYS C 1 140 ? -17.674 -30.490 -7.731  1.00 33.22 ? 140 LYS C N   1 
ATOM 6297  C CA  . LYS C 1 140 ? -18.072 -31.742 -8.360  1.00 33.22 ? 140 LYS C CA  1 
ATOM 6298  C C   . LYS C 1 140 ? -18.798 -32.654 -7.363  1.00 33.22 ? 140 LYS C C   1 
ATOM 6299  O O   . LYS C 1 140 ? -19.516 -33.575 -7.751  1.00 33.22 ? 140 LYS C O   1 
ATOM 6300  C CB  . LYS C 1 140 ? -16.828 -32.443 -8.917  1.00 50.52 ? 140 LYS C CB  1 
ATOM 6301  C CG  . LYS C 1 140 ? -17.086 -33.340 -10.111 1.00 50.52 ? 140 LYS C CG  1 
ATOM 6302  C CD  . LYS C 1 140 ? -15.784 -33.919 -10.664 1.00 50.52 ? 140 LYS C CD  1 
ATOM 6303  C CE  . LYS C 1 140 ? -14.834 -32.824 -11.145 1.00 50.52 ? 140 LYS C CE  1 
ATOM 6304  N NZ  . LYS C 1 140 ? -13.528 -33.370 -11.619 1.00 50.52 ? 140 LYS C NZ  1 
ATOM 6305  N N   . ASP C 1 141 ? -18.621 -32.394 -6.074  1.00 24.32 ? 141 ASP C N   1 
ATOM 6306  C CA  . ASP C 1 141 ? -19.278 -33.216 -5.073  1.00 24.32 ? 141 ASP C CA  1 
ATOM 6307  C C   . ASP C 1 141 ? -20.491 -32.550 -4.432  1.00 24.32 ? 141 ASP C C   1 
ATOM 6308  O O   . ASP C 1 141 ? -21.003 -33.030 -3.421  1.00 24.32 ? 141 ASP C O   1 
ATOM 6309  C CB  . ASP C 1 141 ? -18.278 -33.648 -3.998  1.00 40.23 ? 141 ASP C CB  1 
ATOM 6310  C CG  . ASP C 1 141 ? -17.194 -34.558 -4.549  1.00 40.23 ? 141 ASP C CG  1 
ATOM 6311  O OD1 . ASP C 1 141 ? -17.464 -35.277 -5.540  1.00 40.23 ? 141 ASP C OD1 1 
ATOM 6312  O OD2 . ASP C 1 141 ? -16.081 -34.567 -3.987  1.00 40.23 ? 141 ASP C OD2 1 
ATOM 6313  N N   . GLY C 1 142 ? -20.943 -31.439 -5.014  1.00 41.56 ? 142 GLY C N   1 
ATOM 6314  C CA  . GLY C 1 142 ? -22.125 -30.772 -4.495  1.00 41.56 ? 142 GLY C CA  1 
ATOM 6315  C C   . GLY C 1 142 ? -21.985 -29.468 -3.734  1.00 41.56 ? 142 GLY C C   1 
ATOM 6316  O O   . GLY C 1 142 ? -22.993 -28.890 -3.307  1.00 41.56 ? 142 GLY C O   1 
ATOM 6317  N N   . ALA C 1 143 ? -20.761 -28.992 -3.549  1.00 29.06 ? 143 ALA C N   1 
ATOM 6318  C CA  . ALA C 1 143 ? -20.570 -27.743 -2.825  1.00 29.06 ? 143 ALA C CA  1 
ATOM 6319  C C   . ALA C 1 143 ? -20.697 -26.565 -3.781  1.00 29.06 ? 143 ALA C C   1 
ATOM 6320  O O   . ALA C 1 143 ? -20.303 -26.654 -4.949  1.00 29.06 ? 143 ALA C O   1 
ATOM 6321  C CB  . ALA C 1 143 ? -19.216 -27.734 -2.157  1.00 10.85 ? 143 ALA C CB  1 
ATOM 6322  N N   . ASP C 1 144 ? -21.261 -25.465 -3.290  1.00 27.02 ? 144 ASP C N   1 
ATOM 6323  C CA  . ASP C 1 144 ? -21.427 -24.282 -4.119  1.00 27.02 ? 144 ASP C CA  1 
ATOM 6324  C C   . ASP C 1 144 ? -20.847 -23.053 -3.454  1.00 27.02 ? 144 ASP C C   1 
ATOM 6325  O O   . ASP C 1 144 ? -20.798 -21.977 -4.047  1.00 27.02 ? 144 ASP C O   1 
ATOM 6326  C CB  . ASP C 1 144 ? -22.900 -24.063 -4.445  1.00 44.82 ? 144 ASP C CB  1 
ATOM 6327  C CG  . ASP C 1 144 ? -23.460 -25.159 -5.325  1.00 44.82 ? 144 ASP C CG  1 
ATOM 6328  O OD1 . ASP C 1 144 ? -22.962 -25.323 -6.461  1.00 44.82 ? 144 ASP C OD1 1 
ATOM 6329  O OD2 . ASP C 1 144 ? -24.392 -25.864 -4.876  1.00 44.82 ? 144 ASP C OD2 1 
ATOM 6330  N N   . PHE C 1 145 ? -20.411 -23.212 -2.213  1.00 17.70 ? 145 PHE C N   1 
ATOM 6331  C CA  . PHE C 1 145 ? -19.798 -22.106 -1.503  1.00 17.70 ? 145 PHE C CA  1 
ATOM 6332  C C   . PHE C 1 145 ? -18.781 -22.639 -0.501  1.00 17.70 ? 145 PHE C C   1 
ATOM 6333  O O   . PHE C 1 145 ? -18.838 -23.807 -0.112  1.00 17.70 ? 145 PHE C O   1 
ATOM 6334  C CB  . PHE C 1 145 ? -20.873 -21.231 -0.835  1.00 26.82 ? 145 PHE C CB  1 
ATOM 6335  C CG  . PHE C 1 145 ? -21.472 -21.813 0.417   1.00 26.82 ? 145 PHE C CG  1 
ATOM 6336  C CD1 . PHE C 1 145 ? -21.049 -21.377 1.670   1.00 26.82 ? 145 PHE C CD1 1 
ATOM 6337  C CD2 . PHE C 1 145 ? -22.481 -22.761 0.349   1.00 26.82 ? 145 PHE C CD2 1 
ATOM 6338  C CE1 . PHE C 1 145 ? -21.624 -21.874 2.834   1.00 26.82 ? 145 PHE C CE1 1 
ATOM 6339  C CE2 . PHE C 1 145 ? -23.060 -23.264 1.506   1.00 26.82 ? 145 PHE C CE2 1 
ATOM 6340  C CZ  . PHE C 1 145 ? -22.629 -22.817 2.752   1.00 26.82 ? 145 PHE C CZ  1 
ATOM 6341  N N   . ALA C 1 146 ? -17.830 -21.799 -0.108  1.00 24.23 ? 146 ALA C N   1 
ATOM 6342  C CA  . ALA C 1 146 ? -16.796 -22.221 0.827   1.00 24.23 ? 146 ALA C CA  1 
ATOM 6343  C C   . ALA C 1 146 ? -16.578 -21.212 1.943   1.00 24.23 ? 146 ALA C C   1 
ATOM 6344  O O   . ALA C 1 146 ? -17.120 -20.106 1.912   1.00 24.23 ? 146 ALA C O   1 
ATOM 6345  C CB  . ALA C 1 146 ? -15.504 -22.446 0.079   1.00 13.42 ? 146 ALA C CB  1 
ATOM 6346  N N   . LYS C 1 147 ? -15.790 -21.607 2.935   1.00 26.25 ? 147 LYS C N   1 
ATOM 6347  C CA  . LYS C 1 147 ? -15.478 -20.732 4.055   1.00 26.25 ? 147 LYS C CA  1 
ATOM 6348  C C   . LYS C 1 147 ? -13.986 -20.815 4.354   1.00 26.25 ? 147 LYS C C   1 
ATOM 6349  O O   . LYS C 1 147 ? -13.394 -21.891 4.294   1.00 26.25 ? 147 LYS C O   1 
ATOM 6350  C CB  . LYS C 1 147 ? -16.273 -21.133 5.302   1.00 29.72 ? 147 LYS C CB  1 
ATOM 6351  C CG  . LYS C 1 147 ? -15.758 -20.486 6.581   1.00 29.72 ? 147 LYS C CG  1 
ATOM 6352  C CD  . LYS C 1 147 ? -16.437 -21.044 7.813   1.00 29.72 ? 147 LYS C CD  1 
ATOM 6353  C CE  . LYS C 1 147 ? -15.533 -20.919 9.034   1.00 29.72 ? 147 LYS C CE  1 
ATOM 6354  N NZ  . LYS C 1 147 ? -16.274 -21.060 10.336  1.00 29.72 ? 147 LYS C NZ  1 
ATOM 6355  N N   . TRP C 1 148 ? -13.389 -19.668 4.668   1.00 22.94 ? 148 TRP C N   1 
ATOM 6356  C CA  . TRP C 1 148 ? -11.970 -19.568 4.991   1.00 22.94 ? 148 TRP C CA  1 
ATOM 6357  C C   . TRP C 1 148 ? -11.904 -18.638 6.187   1.00 22.94 ? 148 TRP C C   1 
ATOM 6358  O O   . TRP C 1 148 ? -12.369 -17.501 6.110   1.00 22.94 ? 148 TRP C O   1 
ATOM 6359  C CB  . TRP C 1 148 ? -11.212 -18.953 3.810   1.00 24.09 ? 148 TRP C CB  1 
ATOM 6360  C CG  . TRP C 1 148 ? -9.752  -18.697 4.055   1.00 24.09 ? 148 TRP C CG  1 
ATOM 6361  C CD1 . TRP C 1 148 ? -9.205  -17.794 4.922   1.00 24.09 ? 148 TRP C CD1 1 
ATOM 6362  C CD2 . TRP C 1 148 ? -8.654  -19.357 3.420   1.00 24.09 ? 148 TRP C CD2 1 
ATOM 6363  N NE1 . TRP C 1 148 ? -7.835  -17.851 4.865   1.00 24.09 ? 148 TRP C NE1 1 
ATOM 6364  C CE2 . TRP C 1 148 ? -7.471  -18.803 3.949   1.00 24.09 ? 148 TRP C CE2 1 
ATOM 6365  C CE3 . TRP C 1 148 ? -8.555  -20.366 2.453   1.00 24.09 ? 148 TRP C CE3 1 
ATOM 6366  C CZ2 . TRP C 1 148 ? -6.197  -19.225 3.542   1.00 24.09 ? 148 TRP C CZ2 1 
ATOM 6367  C CZ3 . TRP C 1 148 ? -7.282  -20.788 2.046   1.00 24.09 ? 148 TRP C CZ3 1 
ATOM 6368  C CH2 . TRP C 1 148 ? -6.124  -20.215 2.592   1.00 24.09 ? 148 TRP C CH2 1 
ATOM 6369  N N   . ARG C 1 149 ? -11.333 -19.090 7.294   1.00 18.77 ? 149 ARG C N   1 
ATOM 6370  C CA  . ARG C 1 149 ? -11.292 -18.211 8.459   1.00 18.77 ? 149 ARG C CA  1 
ATOM 6371  C C   . ARG C 1 149 ? -9.951  -17.613 8.822   1.00 18.77 ? 149 ARG C C   1 
ATOM 6372  O O   . ARG C 1 149 ? -9.003  -18.338 9.104   1.00 18.77 ? 149 ARG C O   1 
ATOM 6373  C CB  . ARG C 1 149 ? -11.843 -18.926 9.694   1.00 17.39 ? 149 ARG C CB  1 
ATOM 6374  C CG  . ARG C 1 149 ? -11.769 -18.076 10.960  1.00 17.39 ? 149 ARG C CG  1 
ATOM 6375  C CD  . ARG C 1 149 ? -12.549 -18.703 12.101  1.00 17.39 ? 149 ARG C CD  1 
ATOM 6376  N NE  . ARG C 1 149 ? -11.691 -19.203 13.176  1.00 17.39 ? 149 ARG C NE  1 
ATOM 6377  C CZ  . ARG C 1 149 ? -11.555 -18.610 14.361  1.00 17.39 ? 149 ARG C CZ  1 
ATOM 6378  N NH1 . ARG C 1 149 ? -12.219 -17.493 14.626  1.00 17.39 ? 149 ARG C NH1 1 
ATOM 6379  N NH2 . ARG C 1 149 ? -10.768 -19.141 15.292  1.00 17.39 ? 149 ARG C NH2 1 
ATOM 6380  N N   . CYS C 1 150 ? -9.878  -16.287 8.812   1.00 19.13 ? 150 CYS C N   1 
ATOM 6381  C CA  . CYS C 1 150 ? -8.670  -15.585 9.213   1.00 19.13 ? 150 CYS C CA  1 
ATOM 6382  C C   . CYS C 1 150 ? -9.002  -15.107 10.614  1.00 19.13 ? 150 CYS C C   1 
ATOM 6383  O O   . CYS C 1 150 ? -10.170 -14.945 10.950  1.00 19.13 ? 150 CYS C O   1 
ATOM 6384  C CB  . CYS C 1 150 ? -8.395  -14.392 8.309   1.00 29.55 ? 150 CYS C CB  1 
ATOM 6385  S SG  . CYS C 1 150 ? -7.676  -14.833 6.733   1.00 29.55 ? 150 CYS C SG  1 
ATOM 6386  N N   . VAL C 1 151 ? -7.993  -14.883 11.441  1.00 25.06 ? 151 VAL C N   1 
ATOM 6387  C CA  . VAL C 1 151 ? -8.263  -14.444 12.793  1.00 25.06 ? 151 VAL C CA  1 
ATOM 6388  C C   . VAL C 1 151 ? -7.414  -13.265 13.201  1.00 25.06 ? 151 VAL C C   1 
ATOM 6389  O O   . VAL C 1 151 ? -6.192  -13.323 13.138  1.00 25.06 ? 151 VAL C O   1 
ATOM 6390  C CB  . VAL C 1 151 ? -8.008  -15.576 13.795  1.00 2.84  ? 151 VAL C CB  1 
ATOM 6391  C CG1 . VAL C 1 151 ? -8.321  -15.105 15.201  1.00 2.84  ? 151 VAL C CG1 1 
ATOM 6392  C CG2 . VAL C 1 151 ? -8.850  -16.766 13.442  1.00 2.84  ? 151 VAL C CG2 1 
ATOM 6393  N N   . LEU C 1 152 ? -8.065  -12.190 13.616  1.00 16.32 ? 152 LEU C N   1 
ATOM 6394  C CA  . LEU C 1 152 ? -7.354  -11.009 14.076  1.00 16.32 ? 152 LEU C CA  1 
ATOM 6395  C C   . LEU C 1 152 ? -7.630  -10.879 15.577  1.00 16.32 ? 152 LEU C C   1 
ATOM 6396  O O   . LEU C 1 152 ? -8.617  -11.415 16.078  1.00 16.32 ? 152 LEU C O   1 
ATOM 6397  C CB  . LEU C 1 152 ? -7.822  -9.776  13.311  1.00 16.79 ? 152 LEU C CB  1 
ATOM 6398  C CG  . LEU C 1 152 ? -7.551  -9.837  11.804  1.00 16.79 ? 152 LEU C CG  1 
ATOM 6399  C CD1 . LEU C 1 152 ? -7.849  -8.491  11.188  1.00 16.79 ? 152 LEU C CD1 1 
ATOM 6400  C CD2 . LEU C 1 152 ? -6.103  -10.189 11.541  1.00 16.79 ? 152 LEU C CD2 1 
ATOM 6401  N N   . LYS C 1 153 ? -6.762  -10.175 16.294  1.00 20.06 ? 153 LYS C N   1 
ATOM 6402  C CA  . LYS C 1 153 ? -6.896  -10.047 17.742  1.00 20.06 ? 153 LYS C CA  1 
ATOM 6403  C C   . LYS C 1 153 ? -6.772  -8.587  18.162  1.00 20.06 ? 153 LYS C C   1 
ATOM 6404  O O   . LYS C 1 153 ? -6.027  -7.838  17.541  1.00 20.06 ? 153 LYS C O   1 
ATOM 6405  C CB  . LYS C 1 153 ? -5.787  -10.877 18.391  1.00 45.75 ? 153 LYS C CB  1 
ATOM 6406  C CG  . LYS C 1 153 ? -5.773  -10.890 19.894  1.00 45.75 ? 153 LYS C CG  1 
ATOM 6407  C CD  . LYS C 1 153 ? -4.349  -10.672 20.432  1.00 45.75 ? 153 LYS C CD  1 
ATOM 6408  C CE  . LYS C 1 153 ? -3.340  -11.709 19.927  1.00 45.75 ? 153 LYS C CE  1 
ATOM 6409  N NZ  . LYS C 1 153 ? -2.023  -11.556 20.612  1.00 45.75 ? 153 LYS C NZ  1 
ATOM 6410  N N   . ILE C 1 154 ? -7.498  -8.170  19.199  1.00 31.12 ? 154 ILE C N   1 
ATOM 6411  C CA  . ILE C 1 154 ? -7.391  -6.782  19.645  1.00 31.12 ? 154 ILE C CA  1 
ATOM 6412  C C   . ILE C 1 154 ? -6.663  -6.677  20.981  1.00 31.12 ? 154 ILE C C   1 
ATOM 6413  O O   . ILE C 1 154 ? -7.044  -7.326  21.957  1.00 31.12 ? 154 ILE C O   1 
ATOM 6414  C CB  . ILE C 1 154 ? -8.759  -6.105  19.807  1.00 18.26 ? 154 ILE C CB  1 
ATOM 6415  C CG1 . ILE C 1 154 ? -9.517  -6.138  18.484  1.00 18.26 ? 154 ILE C CG1 1 
ATOM 6416  C CG2 . ILE C 1 154 ? -8.564  -4.657  20.246  1.00 18.26 ? 154 ILE C CG2 1 
ATOM 6417  C CD1 . ILE C 1 154 ? -10.852 -5.461  18.539  1.00 18.26 ? 154 ILE C CD1 1 
ATOM 6418  N N   . SER C 1 155 ? -5.616  -5.852  21.005  1.00 29.04 ? 155 SER C N   1 
ATOM 6419  C CA  . SER C 1 155 ? -4.793  -5.615  22.192  1.00 29.04 ? 155 SER C CA  1 
ATOM 6420  C C   . SER C 1 155 ? -4.134  -4.242  22.017  1.00 29.04 ? 155 SER C C   1 
ATOM 6421  O O   . SER C 1 155 ? -4.423  -3.540  21.038  1.00 29.04 ? 155 SER C O   1 
ATOM 6422  C CB  . SER C 1 155 ? -3.722  -6.692  22.329  1.00 29.85 ? 155 SER C CB  1 
ATOM 6423  O OG  . SER C 1 155 ? -2.540  -6.290  21.665  1.00 29.85 ? 155 SER C OG  1 
ATOM 6424  N N   . GLU C 1 156 ? -3.255  -3.857  22.947  1.00 42.49 ? 156 GLU C N   1 
ATOM 6425  C CA  . GLU C 1 156 ? -2.609  -2.547  22.871  1.00 42.49 ? 156 GLU C CA  1 
ATOM 6426  C C   . GLU C 1 156 ? -2.020  -2.303  21.495  1.00 42.49 ? 156 GLU C C   1 
ATOM 6427  O O   . GLU C 1 156 ? -1.964  -1.168  21.014  1.00 42.49 ? 156 GLU C O   1 
ATOM 6428  C CB  . GLU C 1 156 ? -1.495  -2.403  23.906  1.00 99.51 ? 156 GLU C CB  1 
ATOM 6429  C CG  . GLU C 1 156 ? -0.869  -1.009  23.886  1.00 99.51 ? 156 GLU C CG  1 
ATOM 6430  C CD  . GLU C 1 156 ? 0.538   -0.968  24.464  1.00 99.51 ? 156 GLU C CD  1 
ATOM 6431  O OE1 . GLU C 1 156 ? 0.704   -1.285  25.663  1.00 99.51 ? 156 GLU C OE1 1 
ATOM 6432  O OE2 . GLU C 1 156 ? 1.482   -0.615  23.715  1.00 99.51 ? 156 GLU C OE2 1 
ATOM 6433  N N   . ARG C 1 157 ? -1.588  -3.372  20.847  1.00 49.20 ? 157 ARG C N   1 
ATOM 6434  C CA  . ARG C 1 157 ? -1.001  -3.220  19.532  1.00 49.20 ? 157 ARG C CA  1 
ATOM 6435  C C   . ARG C 1 157 ? -1.083  -4.527  18.767  1.00 49.20 ? 157 ARG C C   1 
ATOM 6436  O O   . ARG C 1 157 ? -0.059  -5.097  18.416  1.00 49.20 ? 157 ARG C O   1 
ATOM 6437  C CB  . ARG C 1 157 ? 0.448   -2.791  19.708  1.00 81.54 ? 157 ARG C CB  1 
ATOM 6438  C CG  . ARG C 1 157 ? 1.229   -3.670  20.679  1.00 81.54 ? 157 ARG C CG  1 
ATOM 6439  C CD  . ARG C 1 157 ? 2.341   -2.872  21.345  1.00 81.54 ? 157 ARG C CD  1 
ATOM 6440  N NE  . ARG C 1 157 ? 2.891   -1.854  20.447  1.00 81.54 ? 157 ARG C NE  1 
ATOM 6441  C CZ  . ARG C 1 157 ? 3.911   -1.057  20.750  1.00 81.54 ? 157 ARG C CZ  1 
ATOM 6442  N NH1 . ARG C 1 157 ? 4.503   -1.169  21.932  1.00 81.54 ? 157 ARG C NH1 1 
ATOM 6443  N NH2 . ARG C 1 157 ? 4.324   -0.134  19.885  1.00 81.54 ? 157 ARG C NH2 1 
ATOM 6444  N N   . THR C 1 158 ? -2.291  -4.999  18.484  1.00 79.06 ? 158 THR C N   1 
ATOM 6445  C CA  . THR C 1 158 ? -2.402  -6.269  17.795  1.00 79.06 ? 158 THR C CA  1 
ATOM 6446  C C   . THR C 1 158 ? -2.811  -6.292  16.350  1.00 79.06 ? 158 THR C C   1 
ATOM 6447  O O   . THR C 1 158 ? -2.051  -6.771  15.518  1.00 79.06 ? 158 THR C O   1 
ATOM 6448  C CB  . THR C 1 158 ? -3.342  -7.189  18.490  1.00 56.82 ? 158 THR C CB  1 
ATOM 6449  O OG1 . THR C 1 158 ? -4.414  -6.410  19.023  1.00 56.82 ? 158 THR C OG1 1 
ATOM 6450  C CG2 . THR C 1 158 ? -2.620  -7.980  19.557  1.00 56.82 ? 158 THR C CG2 1 
ATOM 6451  N N   . PRO C 1 159 ? -4.022  -5.818  16.017  1.00 42.63 ? 159 PRO C N   1 
ATOM 6452  C CA  . PRO C 1 159 ? -4.269  -5.917  14.573  1.00 42.63 ? 159 PRO C CA  1 
ATOM 6453  C C   . PRO C 1 159 ? -3.229  -4.998  13.946  1.00 42.63 ? 159 PRO C C   1 
ATOM 6454  O O   . PRO C 1 159 ? -3.473  -3.810  13.752  1.00 42.63 ? 159 PRO C O   1 
ATOM 6455  C CB  . PRO C 1 159 ? -5.701  -5.409  14.416  1.00 12.08 ? 159 PRO C CB  1 
ATOM 6456  C CG  . PRO C 1 159 ? -6.247  -5.395  15.840  1.00 12.08 ? 159 PRO C CG  1 
ATOM 6457  C CD  . PRO C 1 159 ? -5.057  -5.025  16.685  1.00 12.08 ? 159 PRO C CD  1 
ATOM 6458  N N   . SER C 1 160 ? -2.053  -5.567  13.679  1.00 25.27 ? 160 SER C N   1 
ATOM 6459  C CA  . SER C 1 160 ? -0.912  -4.848  13.129  1.00 25.27 ? 160 SER C CA  1 
ATOM 6460  C C   . SER C 1 160 ? -0.964  -4.731  11.623  1.00 25.27 ? 160 SER C C   1 
ATOM 6461  O O   . SER C 1 160 ? -1.551  -5.577  10.936  1.00 25.27 ? 160 SER C O   1 
ATOM 6462  C CB  . SER C 1 160 ? 0.387   -5.544  13.531  1.00 15.03 ? 160 SER C CB  1 
ATOM 6463  O OG  . SER C 1 160 ? 0.426   -6.873  13.038  1.00 15.03 ? 160 SER C OG  1 
ATOM 6464  N N   . ALA C 1 161 ? -0.334  -3.681  11.111  1.00 23.42 ? 161 ALA C N   1 
ATOM 6465  C CA  . ALA C 1 161 ? -0.319  -3.458  9.681   1.00 23.42 ? 161 ALA C CA  1 
ATOM 6466  C C   . ALA C 1 161 ? -0.082  -4.785  8.982   1.00 23.42 ? 161 ALA C C   1 
ATOM 6467  O O   . ALA C 1 161 ? -0.801  -5.135  8.050   1.00 23.42 ? 161 ALA C O   1 
ATOM 6468  C CB  . ALA C 1 161 ? 0.757   -2.472  9.322   1.00 4.56  ? 161 ALA C CB  1 
ATOM 6469  N N   . LEU C 1 162 ? 0.905   -5.537  9.454   1.00 18.29 ? 162 LEU C N   1 
ATOM 6470  C CA  . LEU C 1 162 ? 1.205   -6.816  8.840   1.00 18.29 ? 162 LEU C CA  1 
ATOM 6471  C C   . LEU C 1 162 ? 0.011   -7.755  8.892   1.00 18.29 ? 162 LEU C C   1 
ATOM 6472  O O   . LEU C 1 162 ? -0.430  -8.264  7.860   1.00 18.29 ? 162 LEU C O   1 
ATOM 6473  C CB  . LEU C 1 162 ? 2.397   -7.466  9.529   1.00 17.25 ? 162 LEU C CB  1 
ATOM 6474  C CG  . LEU C 1 162 ? 2.815   -8.815  8.938   1.00 17.25 ? 162 LEU C CG  1 
ATOM 6475  C CD1 . LEU C 1 162 ? 3.065   -8.694  7.437   1.00 17.25 ? 162 LEU C CD1 1 
ATOM 6476  C CD2 . LEU C 1 162 ? 4.063   -9.289  9.649   1.00 17.25 ? 162 LEU C CD2 1 
ATOM 6477  N N   . ALA C 1 163 ? -0.516  -7.981  10.090  1.00 23.43 ? 163 ALA C N   1 
ATOM 6478  C CA  . ALA C 1 163 ? -1.664  -8.868  10.263  1.00 23.43 ? 163 ALA C CA  1 
ATOM 6479  C C   . ALA C 1 163 ? -2.856  -8.461  9.395   1.00 23.43 ? 163 ALA C C   1 
ATOM 6480  O O   . ALA C 1 163 ? -3.560  -9.308  8.841   1.00 23.43 ? 163 ALA C O   1 
ATOM 6481  C CB  . ALA C 1 163 ? -2.072  -8.891  11.704  1.00 10.77 ? 163 ALA C CB  1 
ATOM 6482  N N   . ILE C 1 164 ? -3.095  -7.163  9.282   1.00 10.70 ? 164 ILE C N   1 
ATOM 6483  C CA  . ILE C 1 164 ? -4.196  -6.704  8.467   1.00 10.70 ? 164 ILE C CA  1 
ATOM 6484  C C   . ILE C 1 164 ? -3.834  -6.878  6.994   1.00 10.70 ? 164 ILE C C   1 
ATOM 6485  O O   . ILE C 1 164 ? -4.641  -7.386  6.224   1.00 10.70 ? 164 ILE C O   1 
ATOM 6486  C CB  . ILE C 1 164 ? -4.521  -5.240  8.764   1.00 6.16  ? 164 ILE C CB  1 
ATOM 6487  C CG1 . ILE C 1 164 ? -4.940  -5.104  10.224  1.00 6.16  ? 164 ILE C CG1 1 
ATOM 6488  C CG2 . ILE C 1 164 ? -5.632  -4.760  7.850   1.00 6.16  ? 164 ILE C CG2 1 
ATOM 6489  C CD1 . ILE C 1 164 ? -5.275  -3.713  10.618  1.00 6.16  ? 164 ILE C CD1 1 
ATOM 6490  N N   . LEU C 1 165 ? -2.624  -6.457  6.617   1.00 20.43 ? 165 LEU C N   1 
ATOM 6491  C CA  . LEU C 1 165 ? -2.117  -6.569  5.243   1.00 20.43 ? 165 LEU C CA  1 
ATOM 6492  C C   . LEU C 1 165 ? -2.271  -8.016  4.797   1.00 20.43 ? 165 LEU C C   1 
ATOM 6493  O O   . LEU C 1 165 ? -3.016  -8.303  3.861   1.00 20.43 ? 165 LEU C O   1 
ATOM 6494  C CB  . LEU C 1 165 ? -0.639  -6.157  5.204   1.00 54.82 ? 165 LEU C CB  1 
ATOM 6495  C CG  . LEU C 1 165 ? 0.256   -6.367  3.971   1.00 54.82 ? 165 LEU C CG  1 
ATOM 6496  C CD1 . LEU C 1 165 ? 1.558   -5.618  4.191   1.00 54.82 ? 165 LEU C CD1 1 
ATOM 6497  C CD2 . LEU C 1 165 ? 0.553   -7.844  3.733   1.00 54.82 ? 165 LEU C CD2 1 
ATOM 6498  N N   . GLU C 1 166 ? -1.545  -8.922  5.451   1.00 39.03 ? 166 GLU C N   1 
ATOM 6499  C CA  . GLU C 1 166 ? -1.649  -10.347 5.156   1.00 39.03 ? 166 GLU C CA  1 
ATOM 6500  C C   . GLU C 1 166 ? -3.050  -10.590 5.679   1.00 39.03 ? 166 GLU C C   1 
ATOM 6501  O O   . GLU C 1 166 ? -3.615  -9.703  6.316   1.00 39.03 ? 166 GLU C O   1 
ATOM 6502  C CB  . GLU C 1 166 ? -0.630  -11.129 5.983   1.00 34.23 ? 166 GLU C CB  1 
ATOM 6503  C CG  . GLU C 1 166 ? -0.707  -12.636 5.842   1.00 34.23 ? 166 GLU C CG  1 
ATOM 6504  C CD  . GLU C 1 166 ? -0.213  -13.124 4.497   1.00 34.23 ? 166 GLU C CD  1 
ATOM 6505  O OE1 . GLU C 1 166 ? 0.241   -12.277 3.700   1.00 34.23 ? 166 GLU C OE1 1 
ATOM 6506  O OE2 . GLU C 1 166 ? -0.271  -14.349 4.236   1.00 34.23 ? 166 GLU C OE2 1 
ATOM 6507  N N   . ASN C 1 167 ? -3.622  -11.762 5.454   1.00 28.01 ? 167 ASN C N   1 
ATOM 6508  C CA  . ASN C 1 167 ? -4.995  -12.016 5.925   1.00 28.01 ? 167 ASN C CA  1 
ATOM 6509  C C   . ASN C 1 167 ? -5.928  -11.367 4.913   1.00 28.01 ? 167 ASN C C   1 
ATOM 6510  O O   . ASN C 1 167 ? -6.631  -12.054 4.175   1.00 28.01 ? 167 ASN C O   1 
ATOM 6511  C CB  . ASN C 1 167 ? -5.265  -11.410 7.319   1.00 15.34 ? 167 ASN C CB  1 
ATOM 6512  C CG  . ASN C 1 167 ? -4.818  -12.320 8.472   1.00 15.34 ? 167 ASN C CG  1 
ATOM 6513  O OD1 . ASN C 1 167 ? -5.265  -13.469 8.604   1.00 15.34 ? 167 ASN C OD1 1 
ATOM 6514  N ND2 . ASN C 1 167 ? -3.947  -11.797 9.324   1.00 15.34 ? 167 ASN C ND2 1 
ATOM 6515  N N   . ALA C 1 168 ? -5.941  -10.042 4.874   1.00 14.10 ? 168 ALA C N   1 
ATOM 6516  C CA  . ALA C 1 168 ? -6.781  -9.369  3.901   1.00 14.10 ? 168 ALA C CA  1 
ATOM 6517  C C   . ALA C 1 168 ? -6.365  -9.907  2.541   1.00 14.10 ? 168 ALA C C   1 
ATOM 6518  O O   . ALA C 1 168 ? -7.205  -10.189 1.678   1.00 14.10 ? 168 ALA C O   1 
ATOM 6519  C CB  . ALA C 1 168 ? -6.566  -7.866  3.946   1.00 2.04  ? 168 ALA C CB  1 
ATOM 6520  N N   . ASN C 1 169 ? -5.058  -10.069 2.362   1.00 26.37 ? 169 ASN C N   1 
ATOM 6521  C CA  . ASN C 1 169 ? -4.539  -10.559 1.102   1.00 26.37 ? 169 ASN C CA  1 
ATOM 6522  C C   . ASN C 1 169 ? -4.869  -12.029 0.914   1.00 26.37 ? 169 ASN C C   1 
ATOM 6523  O O   . ASN C 1 169 ? -5.288  -12.435 -0.166  1.00 26.37 ? 169 ASN C O   1 
ATOM 6524  C CB  . ASN C 1 169 ? -3.033  -10.354 1.037   1.00 29.61 ? 169 ASN C CB  1 
ATOM 6525  C CG  . ASN C 1 169 ? -2.497  -10.446 -0.380  1.00 29.61 ? 169 ASN C CG  1 
ATOM 6526  O OD1 . ASN C 1 169 ? -2.845  -9.632  -1.241  1.00 29.61 ? 169 ASN C OD1 1 
ATOM 6527  N ND2 . ASN C 1 169 ? -1.647  -11.440 -0.633  1.00 29.61 ? 169 ASN C ND2 1 
ATOM 6528  N N   . VAL C 1 170 ? -4.692  -12.830 1.962   1.00 23.60 ? 170 VAL C N   1 
ATOM 6529  C CA  . VAL C 1 170 ? -4.983  -14.260 1.857   1.00 23.60 ? 170 VAL C CA  1 
ATOM 6530  C C   . VAL C 1 170 ? -6.435  -14.470 1.501   1.00 23.60 ? 170 VAL C C   1 
ATOM 6531  O O   . VAL C 1 170 ? -6.761  -15.286 0.642   1.00 23.60 ? 170 VAL C O   1 
ATOM 6532  C CB  . VAL C 1 170 ? -4.735  -15.002 3.162   1.00 27.13 ? 170 VAL C CB  1 
ATOM 6533  C CG1 . VAL C 1 170 ? -4.544  -16.470 2.877   1.00 27.13 ? 170 VAL C CG1 1 
ATOM 6534  C CG2 . VAL C 1 170 ? -3.533  -14.431 3.858   1.00 27.13 ? 170 VAL C CG2 1 
ATOM 6535  N N   . LEU C 1 171 ? -7.312  -13.744 2.180   1.00 22.57 ? 171 LEU C N   1 
ATOM 6536  C CA  . LEU C 1 171 ? -8.727  -13.859 1.906   1.00 22.57 ? 171 LEU C CA  1 
ATOM 6537  C C   . LEU C 1 171 ? -8.955  -13.613 0.421   1.00 22.57 ? 171 LEU C C   1 
ATOM 6538  O O   . LEU C 1 171 ? -9.594  -14.417 -0.258  1.00 22.57 ? 171 LEU C O   1 
ATOM 6539  C CB  . LEU C 1 171 ? -9.520  -12.848 2.739   1.00 13.97 ? 171 LEU C CB  1 
ATOM 6540  C CG  . LEU C 1 171 ? -9.636  -13.140 4.236   1.00 13.97 ? 171 LEU C CG  1 
ATOM 6541  C CD1 . LEU C 1 171 ? -10.321 -11.984 4.949   1.00 13.97 ? 171 LEU C CD1 1 
ATOM 6542  C CD2 . LEU C 1 171 ? -10.414 -14.414 4.436   1.00 13.97 ? 171 LEU C CD2 1 
ATOM 6543  N N   . ALA C 1 172 ? -8.410  -12.512 -0.086  1.00 16.49 ? 172 ALA C N   1 
ATOM 6544  C CA  . ALA C 1 172 ? -8.573  -12.168 -1.493  1.00 16.49 ? 172 ALA C CA  1 
ATOM 6545  C C   . ALA C 1 172 ? -8.101  -13.292 -2.403  1.00 16.49 ? 172 ALA C C   1 
ATOM 6546  O O   . ALA C 1 172 ? -8.752  -13.595 -3.394  1.00 16.49 ? 172 ALA C O   1 
ATOM 6547  C CB  . ALA C 1 172 ? -7.824  -10.882 -1.810  1.00 23.46 ? 172 ALA C CB  1 
ATOM 6548  N N   . ARG C 1 173 ? -6.970  -13.907 -2.072  1.00 20.64 ? 173 ARG C N   1 
ATOM 6549  C CA  . ARG C 1 173 ? -6.453  -15.009 -2.883  1.00 20.64 ? 173 ARG C CA  1 
ATOM 6550  C C   . ARG C 1 173 ? -7.469  -16.136 -2.893  1.00 20.64 ? 173 ARG C C   1 
ATOM 6551  O O   . ARG C 1 173 ? -7.917  -16.570 -3.954  1.00 20.64 ? 173 ARG C O   1 
ATOM 6552  C CB  . ARG C 1 173 ? -5.116  -15.524 -2.330  1.00 22.08 ? 173 ARG C CB  1 
ATOM 6553  C CG  . ARG C 1 173 ? -3.894  -14.734 -2.810  1.00 22.08 ? 173 ARG C CG  1 
ATOM 6554  C CD  . ARG C 1 173 ? -3.078  -15.513 -3.830  1.00 22.08 ? 173 ARG C CD  1 
ATOM 6555  N NE  . ARG C 1 173 ? -3.826  -15.799 -5.047  1.00 22.08 ? 173 ARG C NE  1 
ATOM 6556  C CZ  . ARG C 1 173 ? -3.630  -16.889 -5.783  1.00 22.08 ? 173 ARG C CZ  1 
ATOM 6557  N NH1 . ARG C 1 173 ? -2.714  -17.780 -5.410  1.00 22.08 ? 173 ARG C NH1 1 
ATOM 6558  N NH2 . ARG C 1 173 ? -4.351  -17.100 -6.882  1.00 22.08 ? 173 ARG C NH2 1 
ATOM 6559  N N   . TYR C 1 174 ? -7.824  -16.600 -1.697  1.00 23.08 ? 174 TYR C N   1 
ATOM 6560  C CA  . TYR C 1 174 ? -8.801  -17.665 -1.519  1.00 23.08 ? 174 TYR C CA  1 
ATOM 6561  C C   . TYR C 1 174 ? -10.081 -17.367 -2.306  1.00 23.08 ? 174 TYR C C   1 
ATOM 6562  O O   . TYR C 1 174 ? -10.556 -18.207 -3.077  1.00 23.08 ? 174 TYR C O   1 
ATOM 6563  C CB  . TYR C 1 174 ? -9.098  -17.810 -0.026  1.00 24.34 ? 174 TYR C CB  1 
ATOM 6564  C CG  . TYR C 1 174 ? -10.538 -18.096 0.332   1.00 24.34 ? 174 TYR C CG  1 
ATOM 6565  C CD1 . TYR C 1 174 ? -11.097 -19.361 0.151   1.00 24.34 ? 174 TYR C CD1 1 
ATOM 6566  C CD2 . TYR C 1 174 ? -11.334 -17.101 0.899   1.00 24.34 ? 174 TYR C CD2 1 
ATOM 6567  C CE1 . TYR C 1 174 ? -12.418 -19.628 0.540   1.00 24.34 ? 174 TYR C CE1 1 
ATOM 6568  C CE2 . TYR C 1 174 ? -12.650 -17.356 1.284   1.00 24.34 ? 174 TYR C CE2 1 
ATOM 6569  C CZ  . TYR C 1 174 ? -13.181 -18.617 1.108   1.00 24.34 ? 174 TYR C CZ  1 
ATOM 6570  O OH  . TYR C 1 174 ? -14.460 -18.863 1.541   1.00 24.34 ? 174 TYR C OH  1 
ATOM 6571  N N   . ALA C 1 175 ? -10.626 -16.167 -2.119  1.00 19.01 ? 175 ALA C N   1 
ATOM 6572  C CA  . ALA C 1 175 ? -11.845 -15.759 -2.808  1.00 19.01 ? 175 ALA C CA  1 
ATOM 6573  C C   . ALA C 1 175 ? -11.684 -15.880 -4.317  1.00 19.01 ? 175 ALA C C   1 
ATOM 6574  O O   . ALA C 1 175 ? -12.517 -16.486 -4.992  1.00 19.01 ? 175 ALA C O   1 
ATOM 6575  C CB  . ALA C 1 175 ? -12.200 -14.327 -2.441  1.00 9.96  ? 175 ALA C CB  1 
ATOM 6576  N N   . SER C 1 176 ? -10.608 -15.300 -4.841  1.00 19.30 ? 176 SER C N   1 
ATOM 6577  C CA  . SER C 1 176 ? -10.333 -15.337 -6.273  1.00 19.30 ? 176 SER C CA  1 
ATOM 6578  C C   . SER C 1 176 ? -10.350 -16.763 -6.817  1.00 19.30 ? 176 SER C C   1 
ATOM 6579  O O   . SER C 1 176 ? -10.985 -17.033 -7.841  1.00 19.30 ? 176 SER C O   1 
ATOM 6580  C CB  . SER C 1 176 ? -8.977  -14.699 -6.564  1.00 21.53 ? 176 SER C CB  1 
ATOM 6581  O OG  . SER C 1 176 ? -8.756  -14.587 -7.957  1.00 21.53 ? 176 SER C OG  1 
ATOM 6582  N N   . ILE C 1 177 ? -9.662  -17.669 -6.123  1.00 17.76 ? 177 ILE C N   1 
ATOM 6583  C CA  . ILE C 1 177 ? -9.574  -19.069 -6.534  1.00 17.76 ? 177 ILE C CA  1 
ATOM 6584  C C   . ILE C 1 177 ? -10.917 -19.777 -6.516  1.00 17.76 ? 177 ILE C C   1 
ATOM 6585  O O   . ILE C 1 177 ? -11.223 -20.557 -7.419  1.00 17.76 ? 177 ILE C O   1 
ATOM 6586  C CB  . ILE C 1 177 ? -8.600  -19.857 -5.637  1.00 14.75 ? 177 ILE C CB  1 
ATOM 6587  C CG1 . ILE C 1 177 ? -7.217  -19.211 -5.693  1.00 14.75 ? 177 ILE C CG1 1 
ATOM 6588  C CG2 . ILE C 1 177 ? -8.524  -21.320 -6.088  1.00 14.75 ? 177 ILE C CG2 1 
ATOM 6589  C CD1 . ILE C 1 177 ? -6.257  -19.761 -4.684  1.00 14.75 ? 177 ILE C CD1 1 
ATOM 6590  N N   . CYS C 1 178 ? -11.714 -19.527 -5.483  1.00 22.39 ? 178 CYS C N   1 
ATOM 6591  C CA  . CYS C 1 178 ? -13.028 -20.149 -5.389  1.00 22.39 ? 178 CYS C CA  1 
ATOM 6592  C C   . CYS C 1 178 ? -13.891 -19.763 -6.584  1.00 22.39 ? 178 CYS C C   1 
ATOM 6593  O O   . CYS C 1 178 ? -14.479 -20.615 -7.249  1.00 22.39 ? 178 CYS C O   1 
ATOM 6594  C CB  . CYS C 1 178 ? -13.748 -19.707 -4.119  1.00 28.19 ? 178 CYS C CB  1 
ATOM 6595  S SG  . CYS C 1 178 ? -13.135 -20.436 -2.617  1.00 28.19 ? 178 CYS C SG  1 
ATOM 6596  N N   . GLN C 1 179 ? -13.967 -18.468 -6.858  1.00 18.40 ? 179 GLN C N   1 
ATOM 6597  C CA  . GLN C 1 179 ? -14.802 -18.010 -7.946  1.00 18.40 ? 179 GLN C CA  1 
ATOM 6598  C C   . GLN C 1 179 ? -14.432 -18.569 -9.309  1.00 18.40 ? 179 GLN C C   1 
ATOM 6599  O O   . GLN C 1 179 ? -15.320 -18.843 -10.119 1.00 18.40 ? 179 GLN C O   1 
ATOM 6600  C CB  . GLN C 1 179 ? -14.828 -16.485 -7.990  1.00 18.89 ? 179 GLN C CB  1 
ATOM 6601  C CG  . GLN C 1 179 ? -15.376 -15.872 -6.725  1.00 18.89 ? 179 GLN C CG  1 
ATOM 6602  C CD  . GLN C 1 179 ? -15.767 -14.426 -6.917  1.00 18.89 ? 179 GLN C CD  1 
ATOM 6603  O OE1 . GLN C 1 179 ? -15.040 -13.656 -7.541  1.00 18.89 ? 179 GLN C OE1 1 
ATOM 6604  N NE2 . GLN C 1 179 ? -16.920 -14.045 -6.375  1.00 18.89 ? 179 GLN C NE2 1 
ATOM 6605  N N   . GLN C 1 180 ? -13.146 -18.752 -9.592  1.00 40.28 ? 180 GLN C N   1 
ATOM 6606  C CA  . GLN C 1 180 ? -12.808 -19.279 -10.901 1.00 40.28 ? 180 GLN C CA  1 
ATOM 6607  C C   . GLN C 1 180 ? -13.200 -20.765 -10.974 1.00 40.28 ? 180 GLN C C   1 
ATOM 6608  O O   . GLN C 1 180 ? -13.099 -21.395 -12.021 1.00 40.28 ? 180 GLN C O   1 
ATOM 6609  C CB  . GLN C 1 180 ? -11.330 -19.046 -11.218 1.00 99.51 ? 180 GLN C CB  1 
ATOM 6610  C CG  . GLN C 1 180 ? -10.372 -19.773 -10.311 1.00 99.51 ? 180 GLN C CG  1 
ATOM 6611  C CD  . GLN C 1 180 ? -8.935  -19.700 -10.818 1.00 99.51 ? 180 GLN C CD  1 
ATOM 6612  O OE1 . GLN C 1 180 ? -8.031  -20.370 -10.290 1.00 99.51 ? 180 GLN C OE1 1 
ATOM 6613  N NE2 . GLN C 1 180 ? -8.717  -18.881 -11.850 1.00 99.51 ? 180 GLN C NE2 1 
ATOM 6614  N N   . ASN C 1 181 ? -13.690 -21.304 -9.858  1.00 22.93 ? 181 ASN C N   1 
ATOM 6615  C CA  . ASN C 1 181 ? -14.143 -22.703 -9.778  1.00 22.93 ? 181 ASN C CA  1 
ATOM 6616  C C   . ASN C 1 181 ? -15.652 -22.804 -9.497  1.00 22.93 ? 181 ASN C C   1 
ATOM 6617  O O   . ASN C 1 181 ? -16.145 -23.832 -9.017  1.00 22.93 ? 181 ASN C O   1 
ATOM 6618  C CB  . ASN C 1 181 ? -13.391 -23.450 -8.676  1.00 32.83 ? 181 ASN C CB  1 
ATOM 6619  C CG  . ASN C 1 181 ? -12.071 -23.992 -9.147  1.00 32.83 ? 181 ASN C CG  1 
ATOM 6620  O OD1 . ASN C 1 181 ? -12.027 -24.921 -9.955  1.00 32.83 ? 181 ASN C OD1 1 
ATOM 6621  N ND2 . ASN C 1 181 ? -10.979 -23.413 -8.655  1.00 32.83 ? 181 ASN C ND2 1 
ATOM 6622  N N   . GLY C 1 182 ? -16.375 -21.726 -9.790  1.00 31.22 ? 182 GLY C N   1 
ATOM 6623  C CA  . GLY C 1 182 ? -17.808 -21.709 -9.574  1.00 31.22 ? 182 GLY C CA  1 
ATOM 6624  C C   . GLY C 1 182 ? -18.233 -21.901 -8.130  1.00 31.22 ? 182 GLY C C   1 
ATOM 6625  O O   . GLY C 1 182 ? -19.283 -22.486 -7.864  1.00 31.22 ? 182 GLY C O   1 
ATOM 6626  N N   . ILE C 1 183 ? -17.434 -21.406 -7.192  1.00 26.53 ? 183 ILE C N   1 
ATOM 6627  C CA  . ILE C 1 183 ? -17.770 -21.537 -5.783  1.00 26.53 ? 183 ILE C CA  1 
ATOM 6628  C C   . ILE C 1 183 ? -17.792 -20.200 -5.065  1.00 26.53 ? 183 ILE C C   1 
ATOM 6629  O O   . ILE C 1 183 ? -16.804 -19.471 -5.051  1.00 26.53 ? 183 ILE C O   1 
ATOM 6630  C CB  . ILE C 1 183 ? -16.800 -22.505 -5.090  1.00 8.98  ? 183 ILE C CB  1 
ATOM 6631  C CG1 . ILE C 1 183 ? -17.210 -23.926 -5.462  1.00 8.98  ? 183 ILE C CG1 1 
ATOM 6632  C CG2 . ILE C 1 183 ? -16.799 -22.303 -3.578  1.00 8.98  ? 183 ILE C CG2 1 
ATOM 6633  C CD1 . ILE C 1 183 ? -16.457 -24.984 -4.740  1.00 8.98  ? 183 ILE C CD1 1 
ATOM 6634  N N   . VAL C 1 184 ? -18.934 -19.870 -4.478  1.00 27.59 ? 184 VAL C N   1 
ATOM 6635  C CA  . VAL C 1 184 ? -19.058 -18.612 -3.766  1.00 27.59 ? 184 VAL C CA  1 
ATOM 6636  C C   . VAL C 1 184 ? -18.222 -18.676 -2.497  1.00 27.59 ? 184 VAL C C   1 
ATOM 6637  O O   . VAL C 1 184 ? -18.348 -19.602 -1.703  1.00 27.59 ? 184 VAL C O   1 
ATOM 6638  C CB  . VAL C 1 184 ? -20.524 -18.313 -3.409  1.00 13.49 ? 184 VAL C CB  1 
ATOM 6639  C CG1 . VAL C 1 184 ? -20.603 -17.060 -2.553  1.00 13.49 ? 184 VAL C CG1 1 
ATOM 6640  C CG2 . VAL C 1 184 ? -21.333 -18.117 -4.682  1.00 13.49 ? 184 VAL C CG2 1 
ATOM 6641  N N   . PRO C 1 185 ? -17.337 -17.692 -2.300  1.00 21.06 ? 185 PRO C N   1 
ATOM 6642  C CA  . PRO C 1 185 ? -16.505 -17.704 -1.101  1.00 21.06 ? 185 PRO C CA  1 
ATOM 6643  C C   . PRO C 1 185 ? -17.035 -16.833 0.026   1.00 21.06 ? 185 PRO C C   1 
ATOM 6644  O O   . PRO C 1 185 ? -17.469 -15.703 -0.204  1.00 21.06 ? 185 PRO C O   1 
ATOM 6645  C CB  . PRO C 1 185 ? -15.176 -17.186 -1.627  1.00 14.10 ? 185 PRO C CB  1 
ATOM 6646  C CG  . PRO C 1 185 ? -15.635 -16.102 -2.558  1.00 14.10 ? 185 PRO C CG  1 
ATOM 6647  C CD  . PRO C 1 185 ? -16.799 -16.748 -3.300  1.00 14.10 ? 185 PRO C CD  1 
ATOM 6648  N N   . ILE C 1 186 ? -17.016 -17.364 1.243   1.00 17.13 ? 186 ILE C N   1 
ATOM 6649  C CA  . ILE C 1 186 ? -17.436 -16.584 2.396   1.00 17.13 ? 186 ILE C CA  1 
ATOM 6650  C C   . ILE C 1 186 ? -16.129 -16.040 2.949   1.00 17.13 ? 186 ILE C C   1 
ATOM 6651  O O   . ILE C 1 186 ? -15.257 -16.801 3.372   1.00 17.13 ? 186 ILE C O   1 
ATOM 6652  C CB  . ILE C 1 186 ? -18.111 -17.438 3.494   1.00 18.04 ? 186 ILE C CB  1 
ATOM 6653  C CG1 . ILE C 1 186 ? -19.469 -17.947 3.017   1.00 18.04 ? 186 ILE C CG1 1 
ATOM 6654  C CG2 . ILE C 1 186 ? -18.312 -16.600 4.748   1.00 18.04 ? 186 ILE C CG2 1 
ATOM 6655  C CD1 . ILE C 1 186 ? -20.159 -18.857 4.010   1.00 18.04 ? 186 ILE C CD1 1 
ATOM 6656  N N   . VAL C 1 187 ? -15.985 -14.725 2.918   1.00 18.62 ? 187 VAL C N   1 
ATOM 6657  C CA  . VAL C 1 187 ? -14.783 -14.087 3.414   1.00 18.62 ? 187 VAL C CA  1 
ATOM 6658  C C   . VAL C 1 187 ? -14.959 -13.845 4.906   1.00 18.62 ? 187 VAL C C   1 
ATOM 6659  O O   . VAL C 1 187 ? -15.744 -12.990 5.307   1.00 18.62 ? 187 VAL C O   1 
ATOM 6660  C CB  . VAL C 1 187 ? -14.563 -12.749 2.700   1.00 7.91  ? 187 VAL C CB  1 
ATOM 6661  C CG1 . VAL C 1 187 ? -13.300 -12.092 3.209   1.00 7.91  ? 187 VAL C CG1 1 
ATOM 6662  C CG2 . VAL C 1 187 ? -14.483 -12.975 1.205   1.00 7.91  ? 187 VAL C CG2 1 
ATOM 6663  N N   . GLU C 1 188 ? -14.221 -14.586 5.725   1.00 24.80 ? 188 GLU C N   1 
ATOM 6664  C CA  . GLU C 1 188 ? -14.351 -14.444 7.164   1.00 24.80 ? 188 GLU C CA  1 
ATOM 6665  C C   . GLU C 1 188 ? -13.159 -13.853 7.909   1.00 24.80 ? 188 GLU C C   1 
ATOM 6666  O O   . GLU C 1 188 ? -12.240 -14.570 8.320   1.00 24.80 ? 188 GLU C O   1 
ATOM 6667  C CB  . GLU C 1 188 ? -14.708 -15.795 7.785   1.00 28.03 ? 188 GLU C CB  1 
ATOM 6668  C CG  . GLU C 1 188 ? -14.731 -15.804 9.311   1.00 28.03 ? 188 GLU C CG  1 
ATOM 6669  C CD  . GLU C 1 188 ? -15.175 -17.141 9.877   1.00 28.03 ? 188 GLU C CD  1 
ATOM 6670  O OE1 . GLU C 1 188 ? -15.347 -18.094 9.082   1.00 28.03 ? 188 GLU C OE1 1 
ATOM 6671  O OE2 . GLU C 1 188 ? -15.348 -17.242 11.115  1.00 28.03 ? 188 GLU C OE2 1 
ATOM 6672  N N   . PRO C 1 189 ? -13.159 -12.526 8.088   1.00 20.05 ? 189 PRO C N   1 
ATOM 6673  C CA  . PRO C 1 189 ? -12.082 -11.844 8.800   1.00 20.05 ? 189 PRO C CA  1 
ATOM 6674  C C   . PRO C 1 189 ? -12.551 -11.682 10.240  1.00 20.05 ? 189 PRO C C   1 
ATOM 6675  O O   . PRO C 1 189 ? -13.050 -10.621 10.615  1.00 20.05 ? 189 PRO C O   1 
ATOM 6676  C CB  . PRO C 1 189 ? -12.003 -10.512 8.078   1.00 6.48  ? 189 PRO C CB  1 
ATOM 6677  C CG  . PRO C 1 189 ? -13.439 -10.214 7.826   1.00 6.48  ? 189 PRO C CG  1 
ATOM 6678  C CD  . PRO C 1 189 ? -13.987 -11.557 7.349   1.00 6.48  ? 189 PRO C CD  1 
ATOM 6679  N N   . GLU C 1 190 ? -12.408 -12.727 11.048  1.00 26.40 ? 190 GLU C N   1 
ATOM 6680  C CA  . GLU C 1 190 ? -12.869 -12.644 12.429  1.00 26.40 ? 190 GLU C CA  1 
ATOM 6681  C C   . GLU C 1 190 ? -11.974 -11.915 13.399  1.00 26.40 ? 190 GLU C C   1 
ATOM 6682  O O   . GLU C 1 190 ? -10.851 -12.333 13.647  1.00 26.40 ? 190 GLU C O   1 
ATOM 6683  C CB  . GLU C 1 190 ? -13.126 -14.025 13.022  1.00 32.39 ? 190 GLU C CB  1 
ATOM 6684  C CG  . GLU C 1 190 ? -13.638 -13.918 14.456  1.00 32.39 ? 190 GLU C CG  1 
ATOM 6685  C CD  . GLU C 1 190 ? -13.929 -15.256 15.098  1.00 32.39 ? 190 GLU C CD  1 
ATOM 6686  O OE1 . GLU C 1 190 ? -14.219 -16.227 14.359  1.00 32.39 ? 190 GLU C OE1 1 
ATOM 6687  O OE2 . GLU C 1 190 ? -13.886 -15.327 16.346  1.00 32.39 ? 190 GLU C OE2 1 
ATOM 6688  N N   . ILE C 1 191 ? -12.488 -10.836 13.970  1.00 19.98 ? 191 ILE C N   1 
ATOM 6689  C CA  . ILE C 1 191 ? -11.750 -10.079 14.965  1.00 19.98 ? 191 ILE C CA  1 
ATOM 6690  C C   . ILE C 1 191 ? -12.208 -10.614 16.325  1.00 19.98 ? 191 ILE C C   1 
ATOM 6691  O O   . ILE C 1 191 ? -13.300 -10.290 16.780  1.00 19.98 ? 191 ILE C O   1 
ATOM 6692  C CB  . ILE C 1 191 ? -12.085 -8.583  14.879  1.00 8.06  ? 191 ILE C CB  1 
ATOM 6693  C CG1 . ILE C 1 191 ? -11.594 -8.017  13.549  1.00 8.06  ? 191 ILE C CG1 1 
ATOM 6694  C CG2 . ILE C 1 191 ? -11.476 -7.843  16.058  1.00 8.06  ? 191 ILE C CG2 1 
ATOM 6695  C CD1 . ILE C 1 191 ? -11.831 -6.530  13.392  1.00 8.06  ? 191 ILE C CD1 1 
ATOM 6696  N N   . LEU C 1 192 ? -11.389 -11.440 16.967  1.00 24.06 ? 192 LEU C N   1 
ATOM 6697  C CA  . LEU C 1 192 ? -11.738 -12.016 18.270  1.00 24.06 ? 192 LEU C CA  1 
ATOM 6698  C C   . LEU C 1 192 ? -12.181 -10.992 19.307  1.00 24.06 ? 192 LEU C C   1 
ATOM 6699  O O   . LEU C 1 192 ? -11.757 -9.838  19.275  1.00 24.06 ? 192 LEU C O   1 
ATOM 6700  C CB  . LEU C 1 192 ? -10.556 -12.784 18.853  1.00 20.04 ? 192 LEU C CB  1 
ATOM 6701  C CG  . LEU C 1 192 ? -10.026 -13.966 18.052  1.00 20.04 ? 192 LEU C CG  1 
ATOM 6702  C CD1 . LEU C 1 192 ? -8.782  -14.501 18.735  1.00 20.04 ? 192 LEU C CD1 1 
ATOM 6703  C CD2 . LEU C 1 192 ? -11.092 -15.038 17.933  1.00 20.04 ? 192 LEU C CD2 1 
ATOM 6704  N N   . PRO C 1 193 ? -13.022 -11.419 20.262  1.00 29.20 ? 193 PRO C N   1 
ATOM 6705  C CA  . PRO C 1 193 ? -13.580 -10.622 21.358  1.00 29.20 ? 193 PRO C CA  1 
ATOM 6706  C C   . PRO C 1 193 ? -12.664 -10.554 22.568  1.00 29.20 ? 193 PRO C C   1 
ATOM 6707  O O   . PRO C 1 193 ? -12.855 -9.714  23.439  1.00 29.20 ? 193 PRO C O   1 
ATOM 6708  C CB  . PRO C 1 193 ? -14.866 -11.358 21.718  1.00 25.20 ? 193 PRO C CB  1 
ATOM 6709  C CG  . PRO C 1 193 ? -15.061 -12.372 20.608  1.00 25.20 ? 193 PRO C CG  1 
ATOM 6710  C CD  . PRO C 1 193 ? -13.676 -12.732 20.212  1.00 25.20 ? 193 PRO C CD  1 
ATOM 6711  N N   . ASP C 1 194 ? -11.686 -11.450 22.640  1.00 34.70 ? 194 ASP C N   1 
ATOM 6712  C CA  . ASP C 1 194 ? -10.771 -11.470 23.775  1.00 34.70 ? 194 ASP C CA  1 
ATOM 6713  C C   . ASP C 1 194 ? -10.220 -10.090 24.057  1.00 34.70 ? 194 ASP C C   1 
ATOM 6714  O O   . ASP C 1 194 ? -9.845  -9.363  23.138  1.00 34.70 ? 194 ASP C O   1 
ATOM 6715  C CB  . ASP C 1 194 ? -9.613  -12.418 23.506  1.00 54.31 ? 194 ASP C CB  1 
ATOM 6716  C CG  . ASP C 1 194 ? -10.070 -13.731 22.942  1.00 54.31 ? 194 ASP C CG  1 
ATOM 6717  O OD1 . ASP C 1 194 ? -11.028 -14.318 23.490  1.00 54.31 ? 194 ASP C OD1 1 
ATOM 6718  O OD2 . ASP C 1 194 ? -9.469  -14.178 21.949  1.00 54.31 ? 194 ASP C OD2 1 
ATOM 6719  N N   . GLY C 1 195 ? -10.171 -9.734  25.334  1.00 31.22 ? 195 GLY C N   1 
ATOM 6720  C CA  . GLY C 1 195 ? -9.655  -8.433  25.712  1.00 31.22 ? 195 GLY C CA  1 
ATOM 6721  C C   . GLY C 1 195 ? -10.647 -7.668  26.561  1.00 31.22 ? 195 GLY C C   1 
ATOM 6722  O O   . GLY C 1 195 ? -11.769 -8.126  26.772  1.00 31.22 ? 195 GLY C O   1 
ATOM 6723  N N   . ASP C 1 196 ? -10.235 -6.505  27.055  1.00 42.04 ? 196 ASP C N   1 
ATOM 6724  C CA  . ASP C 1 196 ? -11.105 -5.675  27.873  1.00 42.04 ? 196 ASP C CA  1 
ATOM 6725  C C   . ASP C 1 196 ? -11.460 -4.375  27.155  1.00 42.04 ? 196 ASP C C   1 
ATOM 6726  O O   . ASP C 1 196 ? -11.809 -3.390  27.799  1.00 42.04 ? 196 ASP C O   1 
ATOM 6727  C CB  . ASP C 1 196 ? -10.439 -5.349  29.215  1.00 69.84 ? 196 ASP C CB  1 
ATOM 6728  C CG  . ASP C 1 196 ? -9.108  -4.617  29.057  1.00 69.84 ? 196 ASP C CG  1 
ATOM 6729  O OD1 . ASP C 1 196 ? -8.654  -4.001  30.045  1.00 69.84 ? 196 ASP C OD1 1 
ATOM 6730  O OD2 . ASP C 1 196 ? -8.506  -4.660  27.962  1.00 69.84 ? 196 ASP C OD2 1 
ATOM 6731  N N   . HIS C 1 197 ? -11.372 -4.373  25.824  1.00 33.73 ? 197 HIS C N   1 
ATOM 6732  C CA  . HIS C 1 197 ? -11.685 -3.179  25.035  1.00 33.73 ? 197 HIS C CA  1 
ATOM 6733  C C   . HIS C 1 197 ? -13.190 -2.911  24.996  1.00 33.73 ? 197 HIS C C   1 
ATOM 6734  O O   . HIS C 1 197 ? -13.997 -3.839  25.065  1.00 33.73 ? 197 HIS C O   1 
ATOM 6735  C CB  . HIS C 1 197 ? -11.165 -3.337  23.606  1.00 32.36 ? 197 HIS C CB  1 
ATOM 6736  C CG  . HIS C 1 197 ? -11.621 -4.594  22.940  1.00 32.36 ? 197 HIS C CG  1 
ATOM 6737  N ND1 . HIS C 1 197 ? -10.979 -5.802  23.115  1.00 32.36 ? 197 HIS C ND1 1 
ATOM 6738  C CD2 . HIS C 1 197 ? -12.693 -4.849  22.151  1.00 32.36 ? 197 HIS C CD2 1 
ATOM 6739  C CE1 . HIS C 1 197 ? -11.639 -6.746  22.466  1.00 32.36 ? 197 HIS C CE1 1 
ATOM 6740  N NE2 . HIS C 1 197 ? -12.683 -6.194  21.874  1.00 32.36 ? 197 HIS C NE2 1 
ATOM 6741  N N   . ASP C 1 198 ? -13.564 -1.641  24.869  1.00 35.01 ? 198 ASP C N   1 
ATOM 6742  C CA  . ASP C 1 198 ? -14.973 -1.263  24.835  1.00 35.01 ? 198 ASP C CA  1 
ATOM 6743  C C   . ASP C 1 198 ? -15.532 -1.320  23.423  1.00 35.01 ? 198 ASP C C   1 
ATOM 6744  O O   . ASP C 1 198 ? -14.790 -1.482  22.462  1.00 35.01 ? 198 ASP C O   1 
ATOM 6745  C CB  . ASP C 1 198 ? -15.150 0.144   25.393  1.00 49.85 ? 198 ASP C CB  1 
ATOM 6746  C CG  . ASP C 1 198 ? -14.665 1.203   24.442  1.00 49.85 ? 198 ASP C CG  1 
ATOM 6747  O OD1 . ASP C 1 198 ? -13.543 1.066   23.916  1.00 49.85 ? 198 ASP C OD1 1 
ATOM 6748  O OD2 . ASP C 1 198 ? -15.409 2.178   24.227  1.00 49.85 ? 198 ASP C OD2 1 
ATOM 6749  N N   . LEU C 1 199 ? -16.848 -1.170  23.304  1.00 28.78 ? 199 LEU C N   1 
ATOM 6750  C CA  . LEU C 1 199 ? -17.503 -1.218  22.006  1.00 28.78 ? 199 LEU C CA  1 
ATOM 6751  C C   . LEU C 1 199 ? -16.844 -0.285  20.984  1.00 28.78 ? 199 LEU C C   1 
ATOM 6752  O O   . LEU C 1 199 ? -16.567 -0.700  19.858  1.00 28.78 ? 199 LEU C O   1 
ATOM 6753  C CB  . LEU C 1 199 ? -18.986 -0.875  22.152  1.00 20.66 ? 199 LEU C CB  1 
ATOM 6754  C CG  . LEU C 1 199 ? -19.841 -1.165  20.912  1.00 20.66 ? 199 LEU C CG  1 
ATOM 6755  C CD1 . LEU C 1 199 ? -19.885 -2.666  20.652  1.00 20.66 ? 199 LEU C CD1 1 
ATOM 6756  C CD2 . LEU C 1 199 ? -21.243 -0.632  21.119  1.00 20.66 ? 199 LEU C CD2 1 
ATOM 6757  N N   . LYS C 1 200 ? -16.595 0.966   21.374  1.00 26.01 ? 200 LYS C N   1 
ATOM 6758  C CA  . LYS C 1 200 ? -15.955 1.942   20.483  1.00 26.01 ? 200 LYS C CA  1 
ATOM 6759  C C   . LYS C 1 200 ? -14.760 1.330   19.751  1.00 26.01 ? 200 LYS C C   1 
ATOM 6760  O O   . LYS C 1 200 ? -14.700 1.335   18.521  1.00 26.01 ? 200 LYS C O   1 
ATOM 6761  C CB  . LYS C 1 200 ? -15.451 3.155   21.272  1.00 79.37 ? 200 LYS C CB  1 
ATOM 6762  C CG  . LYS C 1 200 ? -16.499 4.186   21.650  1.00 79.37 ? 200 LYS C CG  1 
ATOM 6763  C CD  . LYS C 1 200 ? -15.970 5.156   22.731  1.00 79.37 ? 200 LYS C CD  1 
ATOM 6764  C CE  . LYS C 1 200 ? -14.808 6.039   22.252  1.00 79.37 ? 200 LYS C CE  1 
ATOM 6765  N NZ  . LYS C 1 200 ? -15.222 7.118   21.295  1.00 79.37 ? 200 LYS C NZ  1 
ATOM 6766  N N   . ARG C 1 201 ? -13.811 0.801   20.516  1.00 30.17 ? 201 ARG C N   1 
ATOM 6767  C CA  . ARG C 1 201 ? -12.608 0.222   19.933  1.00 30.17 ? 201 ARG C CA  1 
ATOM 6768  C C   . ARG C 1 201 ? -12.869 -0.909  18.950  1.00 30.17 ? 201 ARG C C   1 
ATOM 6769  O O   . ARG C 1 201 ? -12.263 -0.960  17.876  1.00 30.17 ? 201 ARG C O   1 
ATOM 6770  C CB  . ARG C 1 201 ? -11.660 -0.266  21.032  1.00 43.66 ? 201 ARG C CB  1 
ATOM 6771  C CG  . ARG C 1 201 ? -10.350 -0.787  20.486  1.00 43.66 ? 201 ARG C CG  1 
ATOM 6772  C CD  . ARG C 1 201 ? -9.279  -0.907  21.560  1.00 43.66 ? 201 ARG C CD  1 
ATOM 6773  N NE  . ARG C 1 201 ? -8.023  -1.388  20.993  1.00 43.66 ? 201 ARG C NE  1 
ATOM 6774  C CZ  . ARG C 1 201 ? -7.415  -0.820  19.954  1.00 43.66 ? 201 ARG C CZ  1 
ATOM 6775  N NH1 . ARG C 1 201 ? -7.951  0.257   19.373  1.00 43.66 ? 201 ARG C NH1 1 
ATOM 6776  N NH2 . ARG C 1 201 ? -6.282  -1.339  19.482  1.00 43.66 ? 201 ARG C NH2 1 
ATOM 6777  N N   . CYS C 1 202 ? -13.761 -1.822  19.307  1.00 24.69 ? 202 CYS C N   1 
ATOM 6778  C CA  . CYS C 1 202 ? -14.052 -2.929  18.416  1.00 24.69 ? 202 CYS C CA  1 
ATOM 6779  C C   . CYS C 1 202 ? -14.609 -2.416  17.103  1.00 24.69 ? 202 CYS C C   1 
ATOM 6780  O O   . CYS C 1 202 ? -14.316 -2.956  16.034  1.00 24.69 ? 202 CYS C O   1 
ATOM 6781  C CB  . CYS C 1 202 ? -15.058 -3.878  19.036  1.00 24.08 ? 202 CYS C CB  1 
ATOM 6782  S SG  . CYS C 1 202 ? -15.501 -5.172  17.884  1.00 24.08 ? 202 CYS C SG  1 
ATOM 6783  N N   . GLN C 1 203 ? -15.423 -1.373  17.177  1.00 19.99 ? 203 GLN C N   1 
ATOM 6784  C CA  . GLN C 1 203 ? -15.995 -0.825  15.969  1.00 19.99 ? 203 GLN C CA  1 
ATOM 6785  C C   . GLN C 1 203 ? -14.868 -0.267  15.108  1.00 19.99 ? 203 GLN C C   1 
ATOM 6786  O O   . GLN C 1 203 ? -14.795 -0.534  13.908  1.00 19.99 ? 203 GLN C O   1 
ATOM 6787  C CB  . GLN C 1 203 ? -16.982 0.276   16.305  1.00 22.48 ? 203 GLN C CB  1 
ATOM 6788  C CG  . GLN C 1 203 ? -17.957 0.526   15.189  1.00 22.48 ? 203 GLN C CG  1 
ATOM 6789  C CD  . GLN C 1 203 ? -18.657 1.844   15.332  1.00 22.48 ? 203 GLN C CD  1 
ATOM 6790  O OE1 . GLN C 1 203 ? -19.193 2.161   16.391  1.00 22.48 ? 203 GLN C OE1 1 
ATOM 6791  N NE2 . GLN C 1 203 ? -18.660 2.627   14.268  1.00 22.48 ? 203 GLN C NE2 1 
ATOM 6792  N N   . TYR C 1 204 ? -13.983 0.499   15.739  1.00 23.48 ? 204 TYR C N   1 
ATOM 6793  C CA  . TYR C 1 204 ? -12.846 1.108   15.054  1.00 23.48 ? 204 TYR C CA  1 
ATOM 6794  C C   . TYR C 1 204 ? -12.039 0.055   14.311  1.00 23.48 ? 204 TYR C C   1 
ATOM 6795  O O   . TYR C 1 204 ? -11.866 0.119   13.090  1.00 23.48 ? 204 TYR C O   1 
ATOM 6796  C CB  . TYR C 1 204 ? -11.934 1.795   16.065  1.00 30.69 ? 204 TYR C CB  1 
ATOM 6797  C CG  . TYR C 1 204 ? -10.822 2.588   15.430  1.00 30.69 ? 204 TYR C CG  1 
ATOM 6798  C CD1 . TYR C 1 204 ? -11.027 3.903   15.016  1.00 30.69 ? 204 TYR C CD1 1 
ATOM 6799  C CD2 . TYR C 1 204 ? -9.570  2.019   15.213  1.00 30.69 ? 204 TYR C CD2 1 
ATOM 6800  C CE1 . TYR C 1 204 ? -10.013 4.639   14.395  1.00 30.69 ? 204 TYR C CE1 1 
ATOM 6801  C CE2 . TYR C 1 204 ? -8.545  2.743   14.589  1.00 30.69 ? 204 TYR C CE2 1 
ATOM 6802  C CZ  . TYR C 1 204 ? -8.774  4.052   14.181  1.00 30.69 ? 204 TYR C CZ  1 
ATOM 6803  O OH  . TYR C 1 204 ? -7.772  4.769   13.552  1.00 30.69 ? 204 TYR C OH  1 
ATOM 6804  N N   . VAL C 1 205 ? -11.538 -0.914  15.064  1.00 16.35 ? 205 VAL C N   1 
ATOM 6805  C CA  . VAL C 1 205 ? -10.747 -1.980  14.487  1.00 16.35 ? 205 VAL C CA  1 
ATOM 6806  C C   . VAL C 1 205 ? -11.521 -2.700  13.391  1.00 16.35 ? 205 VAL C C   1 
ATOM 6807  O O   . VAL C 1 205 ? -10.972 -2.978  12.321  1.00 16.35 ? 205 VAL C O   1 
ATOM 6808  C CB  . VAL C 1 205 ? -10.332 -2.995  15.559  1.00 10.15 ? 205 VAL C CB  1 
ATOM 6809  C CG1 . VAL C 1 205 ? -9.466  -4.078  14.942  1.00 10.15 ? 205 VAL C CG1 1 
ATOM 6810  C CG2 . VAL C 1 205 ? -9.589  -2.287  16.679  1.00 10.15 ? 205 VAL C CG2 1 
ATOM 6811  N N   . THR C 1 206 ? -12.792 -3.001  13.643  1.00 18.27 ? 206 THR C N   1 
ATOM 6812  C CA  . THR C 1 206 ? -13.592 -3.694  12.640  1.00 18.27 ? 206 THR C CA  1 
ATOM 6813  C C   . THR C 1 206 ? -13.646 -2.888  11.354  1.00 18.27 ? 206 THR C C   1 
ATOM 6814  O O   . THR C 1 206 ? -13.507 -3.434  10.260  1.00 18.27 ? 206 THR C O   1 
ATOM 6815  C CB  . THR C 1 206 ? -15.026 -3.943  13.121  1.00 14.74 ? 206 THR C CB  1 
ATOM 6816  O OG1 . THR C 1 206 ? -15.029 -5.014  14.075  1.00 14.74 ? 206 THR C OG1 1 
ATOM 6817  C CG2 . THR C 1 206 ? -15.915 -4.319  11.945  1.00 14.74 ? 206 THR C CG2 1 
ATOM 6818  N N   . GLU C 1 207 ? -13.841 -1.584  11.487  1.00 23.76 ? 207 GLU C N   1 
ATOM 6819  C CA  . GLU C 1 207 ? -13.905 -0.729  10.320  1.00 23.76 ? 207 GLU C CA  1 
ATOM 6820  C C   . GLU C 1 207 ? -12.603 -0.750  9.533   1.00 23.76 ? 207 GLU C C   1 
ATOM 6821  O O   . GLU C 1 207 ? -12.624 -0.869  8.305   1.00 23.76 ? 207 GLU C O   1 
ATOM 6822  C CB  . GLU C 1 207 ? -14.244 0.692   10.736  1.00 34.23 ? 207 GLU C CB  1 
ATOM 6823  C CG  . GLU C 1 207 ? -15.693 0.874   11.098  1.00 34.23 ? 207 GLU C CG  1 
ATOM 6824  C CD  . GLU C 1 207 ? -15.980 2.261   11.623  1.00 34.23 ? 207 GLU C CD  1 
ATOM 6825  O OE1 . GLU C 1 207 ? -15.495 3.243   11.023  1.00 34.23 ? 207 GLU C OE1 1 
ATOM 6826  O OE2 . GLU C 1 207 ? -16.697 2.376   12.635  1.00 34.23 ? 207 GLU C OE2 1 
ATOM 6827  N N   . LYS C 1 208 ? -11.470 -0.648  10.225  1.00 18.12 ? 208 LYS C N   1 
ATOM 6828  C CA  . LYS C 1 208 ? -10.179 -0.659  9.542   1.00 18.12 ? 208 LYS C CA  1 
ATOM 6829  C C   . LYS C 1 208 ? -9.900  -1.998  8.866   1.00 18.12 ? 208 LYS C C   1 
ATOM 6830  O O   . LYS C 1 208 ? -9.433  -2.044  7.728   1.00 18.12 ? 208 LYS C O   1 
ATOM 6831  C CB  . LYS C 1 208 ? -9.059  -0.337  10.524  1.00 18.33 ? 208 LYS C CB  1 
ATOM 6832  C CG  . LYS C 1 208 ? -9.177  1.042   11.150  1.00 18.33 ? 208 LYS C CG  1 
ATOM 6833  C CD  . LYS C 1 208 ? -9.072  2.161   10.112  1.00 18.33 ? 208 LYS C CD  1 
ATOM 6834  C CE  . LYS C 1 208 ? -9.348  3.532   10.740  1.00 18.33 ? 208 LYS C CE  1 
ATOM 6835  N NZ  . LYS C 1 208 ? -9.506  4.611   9.718   1.00 18.33 ? 208 LYS C NZ  1 
ATOM 6836  N N   . VAL C 1 209 ? -10.188 -3.088  9.564   1.00 14.97 ? 209 VAL C N   1 
ATOM 6837  C CA  . VAL C 1 209 ? -9.955  -4.406  9.001   1.00 14.97 ? 209 VAL C CA  1 
ATOM 6838  C C   . VAL C 1 209 ? -10.795 -4.595  7.746   1.00 14.97 ? 209 VAL C C   1 
ATOM 6839  O O   . VAL C 1 209 ? -10.279 -4.960  6.693   1.00 14.97 ? 209 VAL C O   1 
ATOM 6840  C CB  . VAL C 1 209 ? -10.292 -5.520  10.016  1.00 8.37  ? 209 VAL C CB  1 
ATOM 6841  C CG1 . VAL C 1 209 ? -10.320 -6.878  9.325   1.00 8.37  ? 209 VAL C CG1 1 
ATOM 6842  C CG2 . VAL C 1 209 ? -9.265  -5.524  11.132  1.00 8.37  ? 209 VAL C CG2 1 
ATOM 6843  N N   . LEU C 1 210 ? -12.092 -4.343  7.842   1.00 22.31 ? 210 LEU C N   1 
ATOM 6844  C CA  . LEU C 1 210 ? -12.939 -4.515  6.674   1.00 22.31 ? 210 LEU C CA  1 
ATOM 6845  C C   . LEU C 1 210 ? -12.469 -3.633  5.516   1.00 22.31 ? 210 LEU C C   1 
ATOM 6846  O O   . LEU C 1 210 ? -12.346 -4.101  4.382   1.00 22.31 ? 210 LEU C O   1 
ATOM 6847  C CB  . LEU C 1 210 ? -14.398 -4.221  7.031   1.00 15.58 ? 210 LEU C CB  1 
ATOM 6848  C CG  . LEU C 1 210 ? -15.043 -5.296  7.905   1.00 15.58 ? 210 LEU C CG  1 
ATOM 6849  C CD1 . LEU C 1 210 ? -16.448 -4.891  8.255   1.00 15.58 ? 210 LEU C CD1 1 
ATOM 6850  C CD2 . LEU C 1 210 ? -15.055 -6.621  7.174   1.00 15.58 ? 210 LEU C CD2 1 
ATOM 6851  N N   . ALA C 1 211 ? -12.185 -2.366  5.803   1.00 16.85 ? 211 ALA C N   1 
ATOM 6852  C CA  . ALA C 1 211 ? -11.722 -1.452  4.765   1.00 16.85 ? 211 ALA C CA  1 
ATOM 6853  C C   . ALA C 1 211 ? -10.548 -2.050  3.987   1.00 16.85 ? 211 ALA C C   1 
ATOM 6854  O O   . ALA C 1 211 ? -10.439 -1.891  2.773   1.00 16.85 ? 211 ALA C O   1 
ATOM 6855  C CB  . ALA C 1 211 ? -11.316 -0.126  5.384   1.00 8.98  ? 211 ALA C CB  1 
ATOM 6856  N N   . ALA C 1 212 ? -9.667  -2.741  4.696   1.00 22.83 ? 212 ALA C N   1 
ATOM 6857  C CA  . ALA C 1 212 ? -8.516  -3.354  4.066   1.00 22.83 ? 212 ALA C CA  1 
ATOM 6858  C C   . ALA C 1 212 ? -8.954  -4.567  3.269   1.00 22.83 ? 212 ALA C C   1 
ATOM 6859  O O   . ALA C 1 212 ? -8.524  -4.771  2.134   1.00 22.83 ? 212 ALA C O   1 
ATOM 6860  C CB  . ALA C 1 212 ? -7.526  -3.767  5.116   1.00 2.35  ? 212 ALA C CB  1 
ATOM 6861  N N   . VAL C 1 213 ? -9.803  -5.381  3.880   1.00 20.50 ? 213 VAL C N   1 
ATOM 6862  C CA  . VAL C 1 213 ? -10.297 -6.582  3.235   1.00 20.50 ? 213 VAL C CA  1 
ATOM 6863  C C   . VAL C 1 213 ? -10.919 -6.301  1.878   1.00 20.50 ? 213 VAL C C   1 
ATOM 6864  O O   . VAL C 1 213 ? -10.651 -7.015  0.911   1.00 20.50 ? 213 VAL C O   1 
ATOM 6865  C CB  . VAL C 1 213 ? -11.359 -7.282  4.089   1.00 9.25  ? 213 VAL C CB  1 
ATOM 6866  C CG1 . VAL C 1 213 ? -11.930 -8.453  3.333   1.00 9.25  ? 213 VAL C CG1 1 
ATOM 6867  C CG2 . VAL C 1 213 ? -10.753 -7.744  5.392   1.00 9.25  ? 213 VAL C CG2 1 
ATOM 6868  N N   . TYR C 1 214 ? -11.752 -5.270  1.786   1.00 23.73 ? 214 TYR C N   1 
ATOM 6869  C CA  . TYR C 1 214 ? -12.379 -5.008  0.503   1.00 23.73 ? 214 TYR C CA  1 
ATOM 6870  C C   . TYR C 1 214 ? -11.436 -4.426  -0.526  1.00 23.73 ? 214 TYR C C   1 
ATOM 6871  O O   . TYR C 1 214 ? -11.558 -4.730  -1.716  1.00 23.73 ? 214 TYR C O   1 
ATOM 6872  C CB  . TYR C 1 214 ? -13.660 -4.169  0.665   1.00 17.25 ? 214 TYR C CB  1 
ATOM 6873  C CG  . TYR C 1 214 ? -14.853 -5.055  1.012   1.00 17.25 ? 214 TYR C CG  1 
ATOM 6874  C CD1 . TYR C 1 214 ? -15.292 -5.192  2.333   1.00 17.25 ? 214 TYR C CD1 1 
ATOM 6875  C CD2 . TYR C 1 214 ? -15.427 -5.894  0.045   1.00 17.25 ? 214 TYR C CD2 1 
ATOM 6876  C CE1 . TYR C 1 214 ? -16.250 -6.145  2.684   1.00 17.25 ? 214 TYR C CE1 1 
ATOM 6877  C CE2 . TYR C 1 214 ? -16.381 -6.850  0.390   1.00 17.25 ? 214 TYR C CE2 1 
ATOM 6878  C CZ  . TYR C 1 214 ? -16.782 -6.974  1.714   1.00 17.25 ? 214 TYR C CZ  1 
ATOM 6879  O OH  . TYR C 1 214 ? -17.676 -7.961  2.075   1.00 17.25 ? 214 TYR C OH  1 
ATOM 6880  N N   . LYS C 1 215 ? -10.477 -3.620  -0.082  1.00 22.22 ? 215 LYS C N   1 
ATOM 6881  C CA  . LYS C 1 215 ? -9.511  -3.055  -1.020  1.00 22.22 ? 215 LYS C CA  1 
ATOM 6882  C C   . LYS C 1 215 ? -8.718  -4.213  -1.614  1.00 22.22 ? 215 LYS C C   1 
ATOM 6883  O O   . LYS C 1 215 ? -8.382  -4.204  -2.792  1.00 22.22 ? 215 LYS C O   1 
ATOM 6884  C CB  . LYS C 1 215 ? -8.560  -2.092  -0.310  1.00 13.12 ? 215 LYS C CB  1 
ATOM 6885  C CG  . LYS C 1 215 ? -7.375  -1.626  -1.165  1.00 13.12 ? 215 LYS C CG  1 
ATOM 6886  C CD  . LYS C 1 215 ? -7.806  -0.953  -2.463  1.00 13.12 ? 215 LYS C CD  1 
ATOM 6887  C CE  . LYS C 1 215 ? -6.664  -0.170  -3.113  1.00 13.12 ? 215 LYS C CE  1 
ATOM 6888  N NZ  . LYS C 1 215 ? -5.479  -1.000  -3.507  1.00 13.12 ? 215 LYS C NZ  1 
ATOM 6889  N N   . ALA C 1 216 ? -8.436  -5.212  -0.785  1.00 16.45 ? 216 ALA C N   1 
ATOM 6890  C CA  . ALA C 1 216 ? -7.696  -6.391  -1.218  1.00 16.45 ? 216 ALA C CA  1 
ATOM 6891  C C   . ALA C 1 216 ? -8.507  -7.133  -2.262  1.00 16.45 ? 216 ALA C C   1 
ATOM 6892  O O   . ALA C 1 216 ? -8.006  -7.462  -3.340  1.00 16.45 ? 216 ALA C O   1 
ATOM 6893  C CB  . ALA C 1 216 ? -7.419  -7.306  -0.028  1.00 5.94  ? 216 ALA C CB  1 
ATOM 6894  N N   . LEU C 1 217 ? -9.765  -7.402  -1.938  1.00 13.94 ? 217 LEU C N   1 
ATOM 6895  C CA  . LEU C 1 217 ? -10.624 -8.100  -2.868  1.00 13.94 ? 217 LEU C CA  1 
ATOM 6896  C C   . LEU C 1 217 ? -10.594 -7.381  -4.200  1.00 13.94 ? 217 LEU C C   1 
ATOM 6897  O O   . LEU C 1 217 ? -10.505 -8.022  -5.243  1.00 13.94 ? 217 LEU C O   1 
ATOM 6898  C CB  . LEU C 1 217 ? -12.042 -8.158  -2.330  1.00 10.86 ? 217 LEU C CB  1 
ATOM 6899  C CG  . LEU C 1 217 ? -12.192 -9.140  -1.174  1.00 10.86 ? 217 LEU C CG  1 
ATOM 6900  C CD1 . LEU C 1 217 ? -13.582 -9.026  -0.589  1.00 10.86 ? 217 LEU C CD1 1 
ATOM 6901  C CD2 . LEU C 1 217 ? -11.928 -10.558 -1.674  1.00 10.86 ? 217 LEU C CD2 1 
ATOM 6902  N N   . SER C 1 218 ? -10.651 -6.050  -4.170  1.00 11.83 ? 218 SER C N   1 
ATOM 6903  C CA  . SER C 1 218 ? -10.608 -5.277  -5.405  1.00 11.83 ? 218 SER C CA  1 
ATOM 6904  C C   . SER C 1 218 ? -9.335  -5.569  -6.177  1.00 11.83 ? 218 SER C C   1 
ATOM 6905  O O   . SER C 1 218 ? -9.369  -5.880  -7.366  1.00 11.83 ? 218 SER C O   1 
ATOM 6906  C CB  . SER C 1 218 ? -10.652 -3.781  -5.120  1.00 16.54 ? 218 SER C CB  1 
ATOM 6907  O OG  . SER C 1 218 ? -10.313 -3.060  -6.296  1.00 16.54 ? 218 SER C OG  1 
ATOM 6908  N N   . ASP C 1 219 ? -8.211  -5.455  -5.482  1.00 25.77 ? 219 ASP C N   1 
ATOM 6909  C CA  . ASP C 1 219 ? -6.907  -5.691  -6.071  1.00 25.77 ? 219 ASP C CA  1 
ATOM 6910  C C   . ASP C 1 219 ? -6.811  -7.049  -6.743  1.00 25.77 ? 219 ASP C C   1 
ATOM 6911  O O   . ASP C 1 219 ? -6.177  -7.182  -7.799  1.00 25.77 ? 219 ASP C O   1 
ATOM 6912  C CB  . ASP C 1 219 ? -5.831  -5.577  -5.001  1.00 24.91 ? 219 ASP C CB  1 
ATOM 6913  C CG  . ASP C 1 219 ? -5.743  -4.185  -4.420  1.00 24.91 ? 219 ASP C CG  1 
ATOM 6914  O OD1 . ASP C 1 219 ? -6.532  -3.312  -4.857  1.00 24.91 ? 219 ASP C OD1 1 
ATOM 6915  O OD2 . ASP C 1 219 ? -4.885  -3.964  -3.532  1.00 24.91 ? 219 ASP C OD2 1 
ATOM 6916  N N   . HIS C 1 220 ? -7.439  -8.053  -6.140  1.00 22.47 ? 220 HIS C N   1 
ATOM 6917  C CA  . HIS C 1 220 ? -7.395  -9.396  -6.690  1.00 22.47 ? 220 HIS C CA  1 
ATOM 6918  C C   . HIS C 1 220 ? -8.501  -9.709  -7.674  1.00 22.47 ? 220 HIS C C   1 
ATOM 6919  O O   . HIS C 1 220 ? -8.657  -10.861 -8.105  1.00 22.47 ? 220 HIS C O   1 
ATOM 6920  C CB  . HIS C 1 220 ? -7.396  -10.402 -5.559  1.00 21.63 ? 220 HIS C CB  1 
ATOM 6921  C CG  . HIS C 1 220 ? -6.102  -10.442 -4.817  1.00 21.63 ? 220 HIS C CG  1 
ATOM 6922  N ND1 . HIS C 1 220 ? -5.174  -11.446 -4.997  1.00 21.63 ? 220 HIS C ND1 1 
ATOM 6923  C CD2 . HIS C 1 220 ? -5.556  -9.575  -3.934  1.00 21.63 ? 220 HIS C CD2 1 
ATOM 6924  C CE1 . HIS C 1 220 ? -4.112  -11.193 -4.253  1.00 21.63 ? 220 HIS C CE1 1 
ATOM 6925  N NE2 . HIS C 1 220 ? -4.318  -10.063 -3.600  1.00 21.63 ? 220 HIS C NE2 1 
ATOM 6926  N N   . HIS C 1 221 ? -9.256  -8.678  -8.034  1.00 19.85 ? 221 HIS C N   1 
ATOM 6927  C CA  . HIS C 1 221 ? -10.342 -8.812  -8.989  1.00 19.85 ? 221 HIS C CA  1 
ATOM 6928  C C   . HIS C 1 221 ? -11.446 -9.762  -8.544  1.00 19.85 ? 221 HIS C C   1 
ATOM 6929  O O   . HIS C 1 221 ? -12.026 -10.460 -9.375  1.00 19.85 ? 221 HIS C O   1 
ATOM 6930  C CB  . HIS C 1 221 ? -9.801  -9.300  -10.324 1.00 24.27 ? 221 HIS C CB  1 
ATOM 6931  C CG  . HIS C 1 221 ? -8.568  -8.586  -10.777 1.00 24.27 ? 221 HIS C CG  1 
ATOM 6932  N ND1 . HIS C 1 221 ? -8.482  -7.210  -10.833 1.00 24.27 ? 221 HIS C ND1 1 
ATOM 6933  C CD2 . HIS C 1 221 ? -7.384  -9.058  -11.233 1.00 24.27 ? 221 HIS C CD2 1 
ATOM 6934  C CE1 . HIS C 1 221 ? -7.298  -6.866  -11.308 1.00 24.27 ? 221 HIS C CE1 1 
ATOM 6935  N NE2 . HIS C 1 221 ? -6.613  -7.969  -11.559 1.00 24.27 ? 221 HIS C NE2 1 
ATOM 6936  N N   . VAL C 1 222 ? -11.730 -9.810  -7.245  1.00 22.71 ? 222 VAL C N   1 
ATOM 6937  C CA  . VAL C 1 222 ? -12.791 -10.678 -6.744  1.00 22.71 ? 222 VAL C CA  1 
ATOM 6938  C C   . VAL C 1 222 ? -14.147 -10.059 -7.084  1.00 22.71 ? 222 VAL C C   1 
ATOM 6939  O O   . VAL C 1 222 ? -14.332 -8.851  -6.949  1.00 22.71 ? 222 VAL C O   1 
ATOM 6940  C CB  . VAL C 1 222 ? -12.684 -10.868 -5.223  1.00 23.77 ? 222 VAL C CB  1 
ATOM 6941  C CG1 . VAL C 1 222 ? -13.937 -11.523 -4.696  1.00 23.77 ? 222 VAL C CG1 1 
ATOM 6942  C CG2 . VAL C 1 222 ? -11.484 -11.734 -4.899  1.00 23.77 ? 222 VAL C CG2 1 
ATOM 6943  N N   . TYR C 1 223 ? -15.079 -10.897 -7.536  1.00 27.30 ? 223 TYR C N   1 
ATOM 6944  C CA  . TYR C 1 223 ? -16.436 -10.488 -7.925  1.00 27.30 ? 223 TYR C CA  1 
ATOM 6945  C C   . TYR C 1 223 ? -17.276 -10.344 -6.661  1.00 27.30 ? 223 TYR C C   1 
ATOM 6946  O O   . TYR C 1 223 ? -17.775 -11.334 -6.126  1.00 27.30 ? 223 TYR C O   1 
ATOM 6947  C CB  . TYR C 1 223 ? -17.011 -11.571 -8.840  1.00 31.60 ? 223 TYR C CB  1 
ATOM 6948  C CG  . TYR C 1 223 ? -18.414 -11.364 -9.357  1.00 31.60 ? 223 TYR C CG  1 
ATOM 6949  C CD1 . TYR C 1 223 ? -18.731 -10.289 -10.180 1.00 31.60 ? 223 TYR C CD1 1 
ATOM 6950  C CD2 . TYR C 1 223 ? -19.411 -12.295 -9.079  1.00 31.60 ? 223 TYR C CD2 1 
ATOM 6951  C CE1 . TYR C 1 223 ? -19.998 -10.148 -10.718 1.00 31.60 ? 223 TYR C CE1 1 
ATOM 6952  C CE2 . TYR C 1 223 ? -20.680 -12.169 -9.607  1.00 31.60 ? 223 TYR C CE2 1 
ATOM 6953  C CZ  . TYR C 1 223 ? -20.971 -11.096 -10.426 1.00 31.60 ? 223 TYR C CZ  1 
ATOM 6954  O OH  . TYR C 1 223 ? -22.241 -10.980 -10.946 1.00 31.60 ? 223 TYR C OH  1 
ATOM 6955  N N   . LEU C 1 224 ? -17.438 -9.112  -6.186  1.00 25.36 ? 224 LEU C N   1 
ATOM 6956  C CA  . LEU C 1 224 ? -18.177 -8.877  -4.952  1.00 25.36 ? 224 LEU C CA  1 
ATOM 6957  C C   . LEU C 1 224 ? -19.567 -9.471  -4.855  1.00 25.36 ? 224 LEU C C   1 
ATOM 6958  O O   . LEU C 1 224 ? -19.896 -10.101 -3.848  1.00 25.36 ? 224 LEU C O   1 
ATOM 6959  C CB  . LEU C 1 224 ? -18.250 -7.384  -4.648  1.00 11.84 ? 224 LEU C CB  1 
ATOM 6960  C CG  . LEU C 1 224 ? -16.947 -6.742  -4.175  1.00 11.84 ? 224 LEU C CG  1 
ATOM 6961  C CD1 . LEU C 1 224 ? -17.255 -5.356  -3.628  1.00 11.84 ? 224 LEU C CD1 1 
ATOM 6962  C CD2 . LEU C 1 224 ? -16.300 -7.589  -3.094  1.00 11.84 ? 224 LEU C CD2 1 
ATOM 6963  N N   . GLU C 1 225 ? -20.387 -9.276  -5.884  1.00 29.19 ? 225 GLU C N   1 
ATOM 6964  C CA  . GLU C 1 225 ? -21.743 -9.799  -5.851  1.00 29.19 ? 225 GLU C CA  1 
ATOM 6965  C C   . GLU C 1 225 ? -21.810 -11.323 -5.865  1.00 29.19 ? 225 GLU C C   1 
ATOM 6966  O O   . GLU C 1 225 ? -22.894 -11.902 -5.895  1.00 29.19 ? 225 GLU C O   1 
ATOM 6967  C CB  . GLU C 1 225 ? -22.579 -9.215  -6.993  1.00 32.59 ? 225 GLU C CB  1 
ATOM 6968  C CG  . GLU C 1 225 ? -21.831 -8.918  -8.264  1.00 32.59 ? 225 GLU C CG  1 
ATOM 6969  C CD  . GLU C 1 225 ? -21.201 -7.532  -8.279  1.00 32.59 ? 225 GLU C CD  1 
ATOM 6970  O OE1 . GLU C 1 225 ? -20.255 -7.301  -7.502  1.00 32.59 ? 225 GLU C OE1 1 
ATOM 6971  O OE2 . GLU C 1 225 ? -21.646 -6.666  -9.068  1.00 32.59 ? 225 GLU C OE2 1 
ATOM 6972  N N   . GLY C 1 226 ? -20.647 -11.964 -5.825  1.00 17.70 ? 226 GLY C N   1 
ATOM 6973  C CA  . GLY C 1 226 ? -20.583 -13.416 -5.808  1.00 17.70 ? 226 GLY C CA  1 
ATOM 6974  C C   . GLY C 1 226 ? -19.810 -13.878 -4.578  1.00 17.70 ? 226 GLY C C   1 
ATOM 6975  O O   . GLY C 1 226 ? -19.134 -14.911 -4.587  1.00 17.70 ? 226 GLY C O   1 
ATOM 6976  N N   . THR C 1 227 ? -19.919 -13.099 -3.508  1.00 15.77 ? 227 THR C N   1 
ATOM 6977  C CA  . THR C 1 227 ? -19.227 -13.400 -2.264  1.00 15.77 ? 227 THR C CA  1 
ATOM 6978  C C   . THR C 1 227 ? -20.153 -13.135 -1.097  1.00 15.77 ? 227 THR C C   1 
ATOM 6979  O O   . THR C 1 227 ? -21.258 -12.644 -1.276  1.00 15.77 ? 227 THR C O   1 
ATOM 6980  C CB  . THR C 1 227 ? -18.019 -12.476 -2.066  1.00 19.64 ? 227 THR C CB  1 
ATOM 6981  O OG1 . THR C 1 227 ? -18.485 -11.134 -1.857  1.00 19.64 ? 227 THR C OG1 1 
ATOM 6982  C CG2 . THR C 1 227 ? -17.118 -12.508 -3.280  1.00 19.64 ? 227 THR C CG2 1 
ATOM 6983  N N   . LEU C 1 228 ? -19.681 -13.449 0.101   1.00 28.38 ? 228 LEU C N   1 
ATOM 6984  C CA  . LEU C 1 228 ? -20.440 -13.212 1.313   1.00 28.38 ? 228 LEU C CA  1 
ATOM 6985  C C   . LEU C 1 228 ? -19.440 -12.835 2.391   1.00 28.38 ? 228 LEU C C   1 
ATOM 6986  O O   . LEU C 1 228 ? -18.304 -13.309 2.375   1.00 28.38 ? 228 LEU C O   1 
ATOM 6987  C CB  . LEU C 1 228 ? -21.209 -14.463 1.732   1.00 21.03 ? 228 LEU C CB  1 
ATOM 6988  C CG  . LEU C 1 228 ? -22.487 -14.807 0.965   1.00 21.03 ? 228 LEU C CG  1 
ATOM 6989  C CD1 . LEU C 1 228 ? -23.100 -16.063 1.560   1.00 21.03 ? 228 LEU C CD1 1 
ATOM 6990  C CD2 . LEU C 1 228 ? -23.466 -13.651 1.054   1.00 21.03 ? 228 LEU C CD2 1 
ATOM 6991  N N   . LEU C 1 229 ? -19.853 -11.984 3.320   1.00 17.04 ? 229 LEU C N   1 
ATOM 6992  C CA  . LEU C 1 229 ? -18.969 -11.557 4.393   1.00 17.04 ? 229 LEU C CA  1 
ATOM 6993  C C   . LEU C 1 229 ? -19.416 -12.150 5.724   1.00 17.04 ? 229 LEU C C   1 
ATOM 6994  O O   . LEU C 1 229 ? -20.571 -12.009 6.126   1.00 17.04 ? 229 LEU C O   1 
ATOM 6995  C CB  . LEU C 1 229 ? -18.957 -10.030 4.484   1.00 10.07 ? 229 LEU C CB  1 
ATOM 6996  C CG  . LEU C 1 229 ? -18.137 -9.407  5.611   1.00 10.07 ? 229 LEU C CG  1 
ATOM 6997  C CD1 . LEU C 1 229 ? -16.676 -9.710  5.400   1.00 10.07 ? 229 LEU C CD1 1 
ATOM 6998  C CD2 . LEU C 1 229 ? -18.353 -7.914  5.633   1.00 10.07 ? 229 LEU C CD2 1 
ATOM 6999  N N   . LYS C 1 230 ? -18.502 -12.830 6.402   1.00 21.15 ? 230 LYS C N   1 
ATOM 7000  C CA  . LYS C 1 230 ? -18.809 -13.429 7.691   1.00 21.15 ? 230 LYS C CA  1 
ATOM 7001  C C   . LYS C 1 230 ? -17.936 -12.741 8.727   1.00 21.15 ? 230 LYS C C   1 
ATOM 7002  O O   . LYS C 1 230 ? -16.898 -13.263 9.120   1.00 21.15 ? 230 LYS C O   1 
ATOM 7003  C CB  . LYS C 1 230 ? -18.513 -14.933 7.673   1.00 16.48 ? 230 LYS C CB  1 
ATOM 7004  C CG  . LYS C 1 230 ? -18.794 -15.657 8.998   1.00 16.48 ? 230 LYS C CG  1 
ATOM 7005  C CD  . LYS C 1 230 ? -18.604 -17.169 8.852   1.00 16.48 ? 230 LYS C CD  1 
ATOM 7006  C CE  . LYS C 1 230 ? -18.906 -17.919 10.145  1.00 16.48 ? 230 LYS C CE  1 
ATOM 7007  N NZ  . LYS C 1 230 ? -18.777 -19.400 9.970   1.00 16.48 ? 230 LYS C NZ  1 
ATOM 7008  N N   . PRO C 1 231 ? -18.336 -11.541 9.164   1.00 26.93 ? 231 PRO C N   1 
ATOM 7009  C CA  . PRO C 1 231 ? -17.569 -10.796 10.160  1.00 26.93 ? 231 PRO C CA  1 
ATOM 7010  C C   . PRO C 1 231 ? -18.083 -11.053 11.549  1.00 26.93 ? 231 PRO C C   1 
ATOM 7011  O O   . PRO C 1 231 ? -19.052 -11.765 11.749  1.00 26.93 ? 231 PRO C O   1 
ATOM 7012  C CB  . PRO C 1 231 ? -17.819 -9.362  9.761   1.00 19.68 ? 231 PRO C CB  1 
ATOM 7013  C CG  . PRO C 1 231 ? -19.259 -9.413  9.422   1.00 19.68 ? 231 PRO C CG  1 
ATOM 7014  C CD  . PRO C 1 231 ? -19.358 -10.670 8.561   1.00 19.68 ? 231 PRO C CD  1 
ATOM 7015  N N   . ASN C 1 232 ? -17.422 -10.445 12.510  1.00 25.37 ? 232 ASN C N   1 
ATOM 7016  C CA  . ASN C 1 232 ? -17.805 -10.553 13.897  1.00 25.37 ? 232 ASN C CA  1 
ATOM 7017  C C   . ASN C 1 232 ? -18.753 -9.377  14.107  1.00 25.37 ? 232 ASN C C   1 
ATOM 7018  O O   . ASN C 1 232 ? -18.651 -8.389  13.397  1.00 25.37 ? 232 ASN C O   1 
ATOM 7019  C CB  . ASN C 1 232 ? -16.548 -10.379 14.747  1.00 31.63 ? 232 ASN C CB  1 
ATOM 7020  C CG  . ASN C 1 232 ? -15.760 -9.117  14.375  1.00 31.63 ? 232 ASN C CG  1 
ATOM 7021  O OD1 . ASN C 1 232 ? -16.099 -8.014  14.801  1.00 31.63 ? 232 ASN C OD1 1 
ATOM 7022  N ND2 . ASN C 1 232 ? -14.717 -9.280  13.563  1.00 31.63 ? 232 ASN C ND2 1 
ATOM 7023  N N   . MET C 1 233 ? -19.697 -9.469  15.033  1.00 23.50 ? 233 MET C N   1 
ATOM 7024  C CA  . MET C 1 233 ? -20.548 -8.309  15.268  1.00 23.50 ? 233 MET C CA  1 
ATOM 7025  C C   . MET C 1 233 ? -19.632 -7.422  16.083  1.00 23.50 ? 233 MET C C   1 
ATOM 7026  O O   . MET C 1 233 ? -18.812 -7.939  16.835  1.00 23.50 ? 233 MET C O   1 
ATOM 7027  C CB  . MET C 1 233 ? -21.754 -8.663  16.118  1.00 30.19 ? 233 MET C CB  1 
ATOM 7028  C CG  . MET C 1 233 ? -22.686 -9.662  15.501  1.00 30.19 ? 233 MET C CG  1 
ATOM 7029  S SD  . MET C 1 233 ? -24.052 -10.005 16.624  1.00 30.19 ? 233 MET C SD  1 
ATOM 7030  C CE  . MET C 1 233 ? -24.849 -11.340 15.789  1.00 30.19 ? 233 MET C CE  1 
ATOM 7031  N N   . VAL C 1 234 ? -19.728 -6.107  15.953  1.00 16.76 ? 234 VAL C N   1 
ATOM 7032  C CA  . VAL C 1 234 ? -18.844 -5.288  16.763  1.00 16.76 ? 234 VAL C CA  1 
ATOM 7033  C C   . VAL C 1 234 ? -19.438 -5.277  18.165  1.00 16.76 ? 234 VAL C C   1 
ATOM 7034  O O   . VAL C 1 234 ? -20.604 -4.932  18.351  1.00 16.76 ? 234 VAL C O   1 
ATOM 7035  C CB  . VAL C 1 234 ? -18.650 -3.832  16.183  1.00 12.03 ? 234 VAL C CB  1 
ATOM 7036  C CG1 . VAL C 1 234 ? -19.299 -3.720  14.825  1.00 12.03 ? 234 VAL C CG1 1 
ATOM 7037  C CG2 . VAL C 1 234 ? -19.162 -2.773  17.151  1.00 12.03 ? 234 VAL C CG2 1 
ATOM 7038  N N   . THR C 1 235 ? -18.631 -5.705  19.136  1.00 30.89 ? 235 THR C N   1 
ATOM 7039  C CA  . THR C 1 235 ? -19.037 -5.791  20.535  1.00 30.89 ? 235 THR C CA  1 
ATOM 7040  C C   . THR C 1 235 ? -17.827 -5.611  21.445  1.00 30.89 ? 235 THR C C   1 
ATOM 7041  O O   . THR C 1 235 ? -16.682 -5.759  21.012  1.00 30.89 ? 235 THR C O   1 
ATOM 7042  C CB  . THR C 1 235 ? -19.621 -7.161  20.855  1.00 21.98 ? 235 THR C CB  1 
ATOM 7043  O OG1 . THR C 1 235 ? -18.559 -8.118  20.925  1.00 21.98 ? 235 THR C OG1 1 
ATOM 7044  C CG2 . THR C 1 235 ? -20.592 -7.590  19.784  1.00 21.98 ? 235 THR C CG2 1 
ATOM 7045  N N   . PRO C 1 236 ? -18.069 -5.330  22.734  1.00 24.17 ? 236 PRO C N   1 
ATOM 7046  C CA  . PRO C 1 236 ? -16.999 -5.128  23.714  1.00 24.17 ? 236 PRO C CA  1 
ATOM 7047  C C   . PRO C 1 236 ? -16.230 -6.416  23.897  1.00 24.17 ? 236 PRO C C   1 
ATOM 7048  O O   . PRO C 1 236 ? -16.719 -7.486  23.526  1.00 24.17 ? 236 PRO C O   1 
ATOM 7049  C CB  . PRO C 1 236 ? -17.754 -4.762  24.992  1.00 32.79 ? 236 PRO C CB  1 
ATOM 7050  C CG  . PRO C 1 236 ? -19.111 -4.351  24.514  1.00 32.79 ? 236 PRO C CG  1 
ATOM 7051  C CD  . PRO C 1 236 ? -19.378 -5.300  23.398  1.00 32.79 ? 236 PRO C CD  1 
ATOM 7052  N N   . GLY C 1 237 ? -15.037 -6.314  24.474  1.00 34.11 ? 237 GLY C N   1 
ATOM 7053  C CA  . GLY C 1 237 ? -14.233 -7.496  24.709  1.00 34.11 ? 237 GLY C CA  1 
ATOM 7054  C C   . GLY C 1 237 ? -14.872 -8.321  25.809  1.00 34.11 ? 237 GLY C C   1 
ATOM 7055  O O   . GLY C 1 237 ? -15.557 -7.756  26.664  1.00 34.11 ? 237 GLY C O   1 
ATOM 7056  N N   . HIS C 1 238 ? -14.667 -9.640  25.794  1.00 40.19 ? 238 HIS C N   1 
ATOM 7057  C CA  . HIS C 1 238 ? -15.242 -10.511 26.816  1.00 40.19 ? 238 HIS C CA  1 
ATOM 7058  C C   . HIS C 1 238 ? -14.999 -9.933  28.195  1.00 40.19 ? 238 HIS C C   1 
ATOM 7059  O O   . HIS C 1 238 ? -15.859 -10.007 29.073  1.00 40.19 ? 238 HIS C O   1 
ATOM 7060  C CB  . HIS C 1 238 ? -14.628 -11.912 26.769  1.00 88.73 ? 238 HIS C CB  1 
ATOM 7061  C CG  . HIS C 1 238 ? -15.073 -12.729 25.600  1.00 88.73 ? 238 HIS C CG  1 
ATOM 7062  N ND1 . HIS C 1 238 ? -16.392 -12.803 25.206  1.00 88.73 ? 238 HIS C ND1 1 
ATOM 7063  C CD2 . HIS C 1 238 ? -14.380 -13.525 24.752  1.00 88.73 ? 238 HIS C CD2 1 
ATOM 7064  C CE1 . HIS C 1 238 ? -16.493 -13.611 24.164  1.00 88.73 ? 238 HIS C CE1 1 
ATOM 7065  N NE2 . HIS C 1 238 ? -15.287 -14.062 23.868  1.00 88.73 ? 238 HIS C NE2 1 
ATOM 7066  N N   . ALA C 1 239 ? -13.823 -9.341  28.370  1.00 35.04 ? 239 ALA C N   1 
ATOM 7067  C CA  . ALA C 1 239 ? -13.437 -8.765  29.647  1.00 35.04 ? 239 ALA C CA  1 
ATOM 7068  C C   . ALA C 1 239 ? -13.831 -7.311  29.862  1.00 35.04 ? 239 ALA C C   1 
ATOM 7069  O O   . ALA C 1 239 ? -13.415 -6.708  30.848  1.00 35.04 ? 239 ALA C O   1 
ATOM 7070  C CB  . ALA C 1 239 ? -11.940 -8.918  29.838  1.00 29.65 ? 239 ALA C CB  1 
ATOM 7071  N N   . CYS C 1 240 ? -14.608 -6.723  28.959  1.00 41.31 ? 240 CYS C N   1 
ATOM 7072  C CA  . CYS C 1 240 ? -14.996 -5.338  29.182  1.00 41.31 ? 240 CYS C CA  1 
ATOM 7073  C C   . CYS C 1 240 ? -16.064 -5.312  30.261  1.00 41.31 ? 240 CYS C C   1 
ATOM 7074  O O   . CYS C 1 240 ? -17.029 -6.073  30.216  1.00 41.31 ? 240 CYS C O   1 
ATOM 7075  C CB  . CYS C 1 240 ? -15.541 -4.677  27.926  1.00 36.57 ? 240 CYS C CB  1 
ATOM 7076  S SG  . CYS C 1 240 ? -15.997 -2.959  28.267  1.00 36.57 ? 240 CYS C SG  1 
ATOM 7077  N N   . PRO C 1 241 ? -15.905 -4.423  31.246  1.00 54.14 ? 241 PRO C N   1 
ATOM 7078  C CA  . PRO C 1 241 ? -16.840 -4.275  32.367  1.00 54.14 ? 241 PRO C CA  1 
ATOM 7079  C C   . PRO C 1 241 ? -18.184 -3.682  31.952  1.00 54.14 ? 241 PRO C C   1 
ATOM 7080  O O   . PRO C 1 241 ? -19.237 -4.070  32.464  1.00 54.14 ? 241 PRO C O   1 
ATOM 7081  C CB  . PRO C 1 241 ? -16.095 -3.338  33.320  1.00 49.23 ? 241 PRO C CB  1 
ATOM 7082  C CG  . PRO C 1 241 ? -14.647 -3.357  32.831  1.00 49.23 ? 241 PRO C CG  1 
ATOM 7083  C CD  . PRO C 1 241 ? -14.801 -3.459  31.352  1.00 49.23 ? 241 PRO C CD  1 
ATOM 7084  N N   . ILE C 1 242 ? -18.128 -2.733  31.024  1.00 39.31 ? 242 ILE C N   1 
ATOM 7085  C CA  . ILE C 1 242 ? -19.306 -2.033  30.535  1.00 39.31 ? 242 ILE C CA  1 
ATOM 7086  C C   . ILE C 1 242 ? -20.388 -2.903  29.915  1.00 39.31 ? 242 ILE C C   1 
ATOM 7087  O O   . ILE C 1 242 ? -20.104 -3.844  29.169  1.00 39.31 ? 242 ILE C O   1 
ATOM 7088  C CB  . ILE C 1 242 ? -18.906 -0.988  29.507  1.00 30.26 ? 242 ILE C CB  1 
ATOM 7089  C CG1 . ILE C 1 242 ? -17.808 -0.095  30.093  1.00 30.26 ? 242 ILE C CG1 1 
ATOM 7090  C CG2 . ILE C 1 242 ? -20.130 -0.196  29.092  1.00 30.26 ? 242 ILE C CG2 1 
ATOM 7091  C CD1 . ILE C 1 242 ? -17.248 0.930   29.115  1.00 30.26 ? 242 ILE C CD1 1 
ATOM 7092  N N   . LYS C 1 243 ? -21.636 -2.559  30.214  1.00 51.30 ? 243 LYS C N   1 
ATOM 7093  C CA  . LYS C 1 243 ? -22.790 -3.292  29.710  1.00 51.30 ? 243 LYS C CA  1 
ATOM 7094  C C   . LYS C 1 243 ? -23.397 -2.518  28.544  1.00 51.30 ? 243 LYS C C   1 
ATOM 7095  O O   . LYS C 1 243 ? -23.518 -1.288  28.603  1.00 51.30 ? 243 LYS C O   1 
ATOM 7096  C CB  . LYS C 1 243 ? -23.810 -3.456  30.839  1.00 99.18 ? 243 LYS C CB  1 
ATOM 7097  C CG  . LYS C 1 243 ? -23.207 -4.106  32.082  1.00 99.18 ? 243 LYS C CG  1 
ATOM 7098  C CD  . LYS C 1 243 ? -23.901 -3.677  33.372  1.00 99.18 ? 243 LYS C CD  1 
ATOM 7099  C CE  . LYS C 1 243 ? -23.121 -4.173  34.591  1.00 99.18 ? 243 LYS C CE  1 
ATOM 7100  N NZ  . LYS C 1 243 ? -23.689 -3.687  35.877  1.00 99.18 ? 243 LYS C NZ  1 
ATOM 7101  N N   . TYR C 1 244 ? -23.773 -3.234  27.486  1.00 36.26 ? 244 TYR C N   1 
ATOM 7102  C CA  . TYR C 1 244 ? -24.351 -2.593  26.309  1.00 36.26 ? 244 TYR C CA  1 
ATOM 7103  C C   . TYR C 1 244 ? -25.675 -3.192  25.852  1.00 36.26 ? 244 TYR C C   1 
ATOM 7104  O O   . TYR C 1 244 ? -25.900 -4.399  25.971  1.00 36.26 ? 244 TYR C O   1 
ATOM 7105  C CB  . TYR C 1 244 ? -23.377 -2.648  25.131  1.00 32.09 ? 244 TYR C CB  1 
ATOM 7106  C CG  . TYR C 1 244 ? -22.108 -1.855  25.311  1.00 32.09 ? 244 TYR C CG  1 
ATOM 7107  C CD1 . TYR C 1 244 ? -21.054 -2.345  26.077  1.00 32.09 ? 244 TYR C CD1 1 
ATOM 7108  C CD2 . TYR C 1 244 ? -21.952 -0.621  24.692  1.00 32.09 ? 244 TYR C CD2 1 
ATOM 7109  C CE1 . TYR C 1 244 ? -19.868 -1.623  26.218  1.00 32.09 ? 244 TYR C CE1 1 
ATOM 7110  C CE2 . TYR C 1 244 ? -20.779 0.107   24.828  1.00 32.09 ? 244 TYR C CE2 1 
ATOM 7111  C CZ  . TYR C 1 244 ? -19.737 -0.398  25.589  1.00 32.09 ? 244 TYR C CZ  1 
ATOM 7112  O OH  . TYR C 1 244 ? -18.573 0.331   25.709  1.00 32.09 ? 244 TYR C OH  1 
ATOM 7113  N N   . THR C 1 245 ? -26.534 -2.337  25.306  1.00 36.12 ? 245 THR C N   1 
ATOM 7114  C CA  . THR C 1 245 ? -27.840 -2.744  24.799  1.00 36.12 ? 245 THR C CA  1 
ATOM 7115  C C   . THR C 1 245 ? -27.639 -3.460  23.487  1.00 36.12 ? 245 THR C C   1 
ATOM 7116  O O   . THR C 1 245 ? -26.745 -3.107  22.716  1.00 36.12 ? 245 THR C O   1 
ATOM 7117  C CB  . THR C 1 245 ? -28.713 -1.542  24.430  1.00 48.29 ? 245 THR C CB  1 
ATOM 7118  O OG1 . THR C 1 245 ? -28.387 -0.430  25.267  1.00 48.29 ? 245 THR C OG1 1 
ATOM 7119  C CG2 . THR C 1 245 ? -30.172 -1.885  24.580  1.00 48.29 ? 245 THR C CG2 1 
ATOM 7120  N N   . PRO C 1 246 ? -28.454 -4.483  23.205  1.00 36.10 ? 246 PRO C N   1 
ATOM 7121  C CA  . PRO C 1 246 ? -28.263 -5.149  21.917  1.00 36.10 ? 246 PRO C CA  1 
ATOM 7122  C C   . PRO C 1 246 ? -28.567 -4.087  20.861  1.00 36.10 ? 246 PRO C C   1 
ATOM 7123  O O   . PRO C 1 246 ? -28.217 -4.220  19.693  1.00 36.10 ? 246 PRO C O   1 
ATOM 7124  C CB  . PRO C 1 246 ? -29.289 -6.282  21.951  1.00 29.30 ? 246 PRO C CB  1 
ATOM 7125  C CG  . PRO C 1 246 ? -30.294 -5.820  22.953  1.00 29.30 ? 246 PRO C CG  1 
ATOM 7126  C CD  . PRO C 1 246 ? -29.452 -5.187  24.016  1.00 29.30 ? 246 PRO C CD  1 
ATOM 7127  N N   . GLU C 1 247 ? -29.221 -3.018  21.302  1.00 28.34 ? 247 GLU C N   1 
ATOM 7128  C CA  . GLU C 1 247 ? -29.535 -1.900  20.425  1.00 28.34 ? 247 GLU C CA  1 
ATOM 7129  C C   . GLU C 1 247 ? -28.207 -1.243  20.088  1.00 28.34 ? 247 GLU C C   1 
ATOM 7130  O O   . GLU C 1 247 ? -27.887 -1.023  18.918  1.00 28.34 ? 247 GLU C O   1 
ATOM 7131  C CB  . GLU C 1 247 ? -30.426 -0.887  21.143  1.00 62.17 ? 247 GLU C CB  1 
ATOM 7132  C CG  . GLU C 1 247 ? -31.914 -1.157  21.033  1.00 62.17 ? 247 GLU C CG  1 
ATOM 7133  C CD  . GLU C 1 247 ? -32.313 -2.540  21.523  1.00 62.17 ? 247 GLU C CD  1 
ATOM 7134  O OE1 . GLU C 1 247 ? -32.027 -2.875  22.698  1.00 62.17 ? 247 GLU C OE1 1 
ATOM 7135  O OE2 . GLU C 1 247 ? -32.924 -3.293  20.728  1.00 62.17 ? 247 GLU C OE2 1 
ATOM 7136  N N   . GLU C 1 248 ? -27.438 -0.940  21.134  1.00 31.37 ? 248 GLU C N   1 
ATOM 7137  C CA  . GLU C 1 248 ? -26.134 -0.300  21.000  1.00 31.37 ? 248 GLU C CA  1 
ATOM 7138  C C   . GLU C 1 248 ? -25.185 -1.130  20.141  1.00 31.37 ? 248 GLU C C   1 
ATOM 7139  O O   . GLU C 1 248 ? -24.425 -0.596  19.332  1.00 31.37 ? 248 GLU C O   1 
ATOM 7140  C CB  . GLU C 1 248 ? -25.526 -0.082  22.384  1.00 46.06 ? 248 GLU C CB  1 
ATOM 7141  C CG  . GLU C 1 248 ? -26.392 0.756   23.292  1.00 46.06 ? 248 GLU C CG  1 
ATOM 7142  C CD  . GLU C 1 248 ? -25.742 1.028   24.633  1.00 46.06 ? 248 GLU C CD  1 
ATOM 7143  O OE1 . GLU C 1 248 ? -25.473 0.057   25.376  1.00 46.06 ? 248 GLU C OE1 1 
ATOM 7144  O OE2 . GLU C 1 248 ? -25.504 2.217   24.942  1.00 46.06 ? 248 GLU C OE2 1 
ATOM 7145  N N   . ILE C 1 249 ? -25.230 -2.441  20.326  1.00 26.07 ? 249 ILE C N   1 
ATOM 7146  C CA  . ILE C 1 249 ? -24.385 -3.328  19.557  1.00 26.07 ? 249 ILE C CA  1 
ATOM 7147  C C   . ILE C 1 249 ? -24.798 -3.287  18.100  1.00 26.07 ? 249 ILE C C   1 
ATOM 7148  O O   . ILE C 1 249 ? -23.955 -3.194  17.210  1.00 26.07 ? 249 ILE C O   1 
ATOM 7149  C CB  . ILE C 1 249 ? -24.497 -4.754  20.071  1.00 25.73 ? 249 ILE C CB  1 
ATOM 7150  C CG1 . ILE C 1 249 ? -23.774 -4.851  21.410  1.00 25.73 ? 249 ILE C CG1 1 
ATOM 7151  C CG2 . ILE C 1 249 ? -23.934 -5.723  19.058  1.00 25.73 ? 249 ILE C CG2 1 
ATOM 7152  C CD1 . ILE C 1 249 ? -23.849 -6.213  22.030  1.00 25.73 ? 249 ILE C CD1 1 
ATOM 7153  N N   . ALA C 1 250 ? -26.102 -3.349  17.857  1.00 20.79 ? 250 ALA C N   1 
ATOM 7154  C CA  . ALA C 1 250 ? -26.614 -3.319  16.495  1.00 20.79 ? 250 ALA C CA  1 
ATOM 7155  C C   . ALA C 1 250 ? -26.229 -2.004  15.828  1.00 20.79 ? 250 ALA C C   1 
ATOM 7156  O O   . ALA C 1 250 ? -25.862 -1.969  14.652  1.00 20.79 ? 250 ALA C O   1 
ATOM 7157  C CB  . ALA C 1 250 ? -28.130 -3.477  16.506  1.00 18.99 ? 250 ALA C CB  1 
ATOM 7158  N N   . MET C 1 251 ? -26.305 -0.922  16.593  1.00 23.11 ? 251 MET C N   1 
ATOM 7159  C CA  . MET C 1 251 ? -25.978 0.399   16.081  1.00 23.11 ? 251 MET C CA  1 
ATOM 7160  C C   . MET C 1 251 ? -24.532 0.460   15.590  1.00 23.11 ? 251 MET C C   1 
ATOM 7161  O O   . MET C 1 251 ? -24.269 0.917   14.478  1.00 23.11 ? 251 MET C O   1 
ATOM 7162  C CB  . MET C 1 251 ? -26.218 1.450   17.169  1.00 54.11 ? 251 MET C CB  1 
ATOM 7163  C CG  . MET C 1 251 ? -26.204 2.887   16.672  1.00 54.11 ? 251 MET C CG  1 
ATOM 7164  S SD  . MET C 1 251 ? -27.311 3.150   15.266  1.00 54.11 ? 251 MET C SD  1 
ATOM 7165  C CE  . MET C 1 251 ? -28.950 3.022   16.054  1.00 54.11 ? 251 MET C CE  1 
ATOM 7166  N N   . ALA C 1 252 ? -23.600 -0.016  16.412  1.00 29.46 ? 252 ALA C N   1 
ATOM 7167  C CA  . ALA C 1 252 ? -22.185 0.002   16.048  1.00 29.46 ? 252 ALA C CA  1 
ATOM 7168  C C   . ALA C 1 252 ? -21.881 -0.945  14.900  1.00 29.46 ? 252 ALA C C   1 
ATOM 7169  O O   . ALA C 1 252 ? -21.156 -0.601  13.965  1.00 29.46 ? 252 ALA C O   1 
ATOM 7170  C CB  . ALA C 1 252 ? -21.348 -0.363  17.241  1.00 3.76  ? 252 ALA C CB  1 
ATOM 7171  N N   . THR C 1 253 ? -22.438 -2.146  14.980  1.00 20.23 ? 253 THR C N   1 
ATOM 7172  C CA  . THR C 1 253 ? -22.239 -3.149  13.952  1.00 20.23 ? 253 THR C CA  1 
ATOM 7173  C C   . THR C 1 253 ? -22.707 -2.676  12.589  1.00 20.23 ? 253 THR C C   1 
ATOM 7174  O O   . THR C 1 253 ? -21.987 -2.793  11.602  1.00 20.23 ? 253 THR C O   1 
ATOM 7175  C CB  . THR C 1 253 ? -22.977 -4.439  14.302  1.00 17.02 ? 253 THR C CB  1 
ATOM 7176  O OG1 . THR C 1 253 ? -22.376 -5.022  15.465  1.00 17.02 ? 253 THR C OG1 1 
ATOM 7177  C CG2 . THR C 1 253 ? -22.919 -5.418  13.146  1.00 17.02 ? 253 THR C CG2 1 
ATOM 7178  N N   . VAL C 1 254 ? -23.915 -2.140  12.519  1.00 25.50 ? 254 VAL C N   1 
ATOM 7179  C CA  . VAL C 1 254 ? -24.417 -1.675  11.239  1.00 25.50 ? 254 VAL C CA  1 
ATOM 7180  C C   . VAL C 1 254 ? -23.637 -0.454  10.750  1.00 25.50 ? 254 VAL C C   1 
ATOM 7181  O O   . VAL C 1 254 ? -23.353 -0.326  9.560   1.00 25.50 ? 254 VAL C O   1 
ATOM 7182  C CB  . VAL C 1 254 ? -25.919 -1.359  11.327  1.00 9.84  ? 254 VAL C CB  1 
ATOM 7183  C CG1 . VAL C 1 254 ? -26.419 -0.752  10.013  1.00 9.84  ? 254 VAL C CG1 1 
ATOM 7184  C CG2 . VAL C 1 254 ? -26.681 -2.636  11.636  1.00 9.84  ? 254 VAL C CG2 1 
ATOM 7185  N N   . THR C 1 255 ? -23.273 0.440   11.659  1.00 23.01 ? 255 THR C N   1 
ATOM 7186  C CA  . THR C 1 255 ? -22.520 1.607   11.240  1.00 23.01 ? 255 THR C CA  1 
ATOM 7187  C C   . THR C 1 255 ? -21.211 1.163   10.612  1.00 23.01 ? 255 THR C C   1 
ATOM 7188  O O   . THR C 1 255 ? -20.849 1.602   9.521   1.00 23.01 ? 255 THR C O   1 
ATOM 7189  C CB  . THR C 1 255 ? -22.184 2.512   12.406  1.00 20.86 ? 255 THR C CB  1 
ATOM 7190  O OG1 . THR C 1 255 ? -23.390 2.990   13.001  1.00 20.86 ? 255 THR C OG1 1 
ATOM 7191  C CG2 . THR C 1 255 ? -21.372 3.687   11.923  1.00 20.86 ? 255 THR C CG2 1 
ATOM 7192  N N   . ALA C 1 256 ? -20.500 0.287   11.309  1.00 22.73 ? 256 ALA C N   1 
ATOM 7193  C CA  . ALA C 1 256 ? -19.229 -0.209  10.815  1.00 22.73 ? 256 ALA C CA  1 
ATOM 7194  C C   . ALA C 1 256 ? -19.389 -0.794  9.416   1.00 22.73 ? 256 ALA C C   1 
ATOM 7195  O O   . ALA C 1 256 ? -18.687 -0.409  8.478   1.00 22.73 ? 256 ALA C O   1 
ATOM 7196  C CB  . ALA C 1 256 ? -18.693 -1.256  11.761  1.00 4.99  ? 256 ALA C CB  1 
ATOM 7197  N N   . LEU C 1 257 ? -20.328 -1.721  9.279   1.00 23.64 ? 257 LEU C N   1 
ATOM 7198  C CA  . LEU C 1 257 ? -20.570 -2.365  8.000   1.00 23.64 ? 257 LEU C CA  1 
ATOM 7199  C C   . LEU C 1 257 ? -20.919 -1.393  6.887   1.00 23.64 ? 257 LEU C C   1 
ATOM 7200  O O   . LEU C 1 257 ? -20.437 -1.544  5.766   1.00 23.64 ? 257 LEU C O   1 
ATOM 7201  C CB  . LEU C 1 257 ? -21.688 -3.405  8.121   1.00 10.29 ? 257 LEU C CB  1 
ATOM 7202  C CG  . LEU C 1 257 ? -21.342 -4.722  8.811   1.00 10.29 ? 257 LEU C CG  1 
ATOM 7203  C CD1 . LEU C 1 257 ? -22.552 -5.624  8.828   1.00 10.29 ? 257 LEU C CD1 1 
ATOM 7204  C CD2 . LEU C 1 257 ? -20.214 -5.401  8.065   1.00 10.29 ? 257 LEU C CD2 1 
ATOM 7205  N N   . ARG C 1 258 ? -21.739 -0.391  7.176   1.00 24.63 ? 258 ARG C N   1 
ATOM 7206  C CA  . ARG C 1 258 ? -22.115 0.521   6.112   1.00 24.63 ? 258 ARG C CA  1 
ATOM 7207  C C   . ARG C 1 258 ? -21.088 1.595   5.801   1.00 24.63 ? 258 ARG C C   1 
ATOM 7208  O O   . ARG C 1 258 ? -21.326 2.472   4.968   1.00 24.63 ? 258 ARG C O   1 
ATOM 7209  C CB  . ARG C 1 258 ? -23.498 1.130   6.378   1.00 30.79 ? 258 ARG C CB  1 
ATOM 7210  C CG  . ARG C 1 258 ? -23.634 2.008   7.589   1.00 30.79 ? 258 ARG C CG  1 
ATOM 7211  C CD  . ARG C 1 258 ? -25.116 2.148   7.938   1.00 30.79 ? 258 ARG C CD  1 
ATOM 7212  N NE  . ARG C 1 258 ? -25.946 2.459   6.771   1.00 30.79 ? 258 ARG C NE  1 
ATOM 7213  C CZ  . ARG C 1 258 ? -26.068 3.667   6.222   1.00 30.79 ? 258 ARG C CZ  1 
ATOM 7214  N NH1 . ARG C 1 258 ? -25.412 4.707   6.733   1.00 30.79 ? 258 ARG C NH1 1 
ATOM 7215  N NH2 . ARG C 1 258 ? -26.844 3.831   5.154   1.00 30.79 ? 258 ARG C NH2 1 
ATOM 7216  N N   . ARG C 1 259 ? -19.936 1.509   6.454   1.00 25.44 ? 259 ARG C N   1 
ATOM 7217  C CA  . ARG C 1 259 ? -18.852 2.451   6.203   1.00 25.44 ? 259 ARG C CA  1 
ATOM 7218  C C   . ARG C 1 259 ? -17.767 1.741   5.420   1.00 25.44 ? 259 ARG C C   1 
ATOM 7219  O O   . ARG C 1 259 ? -16.803 2.361   4.975   1.00 25.44 ? 259 ARG C O   1 
ATOM 7220  C CB  . ARG C 1 259 ? -18.242 2.928   7.506   1.00 16.50 ? 259 ARG C CB  1 
ATOM 7221  C CG  . ARG C 1 259 ? -19.044 3.964   8.201   1.00 16.50 ? 259 ARG C CG  1 
ATOM 7222  C CD  . ARG C 1 259 ? -18.469 4.231   9.553   1.00 16.50 ? 259 ARG C CD  1 
ATOM 7223  N NE  . ARG C 1 259 ? -19.138 5.349   10.201  1.00 16.50 ? 259 ARG C NE  1 
ATOM 7224  C CZ  . ARG C 1 259 ? -18.905 5.714   11.458  1.00 16.50 ? 259 ARG C CZ  1 
ATOM 7225  N NH1 . ARG C 1 259 ? -18.019 5.040   12.190  1.00 16.50 ? 259 ARG C NH1 1 
ATOM 7226  N NH2 . ARG C 1 259 ? -19.562 6.744   11.989  1.00 16.50 ? 259 ARG C NH2 1 
ATOM 7227  N N   . THR C 1 260 ? -17.941 0.435   5.239   1.00 15.63 ? 260 THR C N   1 
ATOM 7228  C CA  . THR C 1 260 ? -16.932 -0.361  4.573   1.00 15.63 ? 260 THR C CA  1 
ATOM 7229  C C   . THR C 1 260 ? -17.390 -1.365  3.526   1.00 15.63 ? 260 THR C C   1 
ATOM 7230  O O   . THR C 1 260 ? -16.705 -1.553  2.524   1.00 15.63 ? 260 THR C O   1 
ATOM 7231  C CB  . THR C 1 260 ? -16.119 -1.114  5.625   1.00 12.51 ? 260 THR C CB  1 
ATOM 7232  O OG1 . THR C 1 260 ? -16.983 -2.002  6.347   1.00 12.51 ? 260 THR C OG1 1 
ATOM 7233  C CG2 . THR C 1 260 ? -15.511 -0.141  6.611   1.00 12.51 ? 260 THR C CG2 1 
ATOM 7234  N N   . VAL C 1 261 ? -18.524 -2.020  3.738   1.00 16.75 ? 261 VAL C N   1 
ATOM 7235  C CA  . VAL C 1 261 ? -18.978 -3.015  2.765   1.00 16.75 ? 261 VAL C CA  1 
ATOM 7236  C C   . VAL C 1 261 ? -19.702 -2.424  1.552   1.00 16.75 ? 261 VAL C C   1 
ATOM 7237  O O   . VAL C 1 261 ? -20.664 -1.692  1.690   1.00 16.75 ? 261 VAL C O   1 
ATOM 7238  C CB  . VAL C 1 261 ? -19.900 -4.062  3.419   1.00 10.92 ? 261 VAL C CB  1 
ATOM 7239  C CG1 . VAL C 1 261 ? -20.168 -5.196  2.437   1.00 10.92 ? 261 VAL C CG1 1 
ATOM 7240  C CG2 . VAL C 1 261 ? -19.263 -4.597  4.697   1.00 10.92 ? 261 VAL C CG2 1 
ATOM 7241  N N   . PRO C 1 262 ? -19.221 -2.709  0.338   1.00 23.81 ? 262 PRO C N   1 
ATOM 7242  C CA  . PRO C 1 262 ? -19.945 -2.128  -0.799  1.00 23.81 ? 262 PRO C CA  1 
ATOM 7243  C C   . PRO C 1 262 ? -21.330 -2.751  -0.963  1.00 23.81 ? 262 PRO C C   1 
ATOM 7244  O O   . PRO C 1 262 ? -21.531 -3.923  -0.653  1.00 23.81 ? 262 PRO C O   1 
ATOM 7245  C CB  . PRO C 1 262 ? -19.025 -2.427  -1.981  1.00 24.02 ? 262 PRO C CB  1 
ATOM 7246  C CG  . PRO C 1 262 ? -17.663 -2.379  -1.347  1.00 24.02 ? 262 PRO C CG  1 
ATOM 7247  C CD  . PRO C 1 262 ? -17.870 -3.143  -0.061  1.00 24.02 ? 262 PRO C CD  1 
ATOM 7248  N N   . PRO C 1 263 ? -22.304 -1.966  -1.447  1.00 20.27 ? 263 PRO C N   1 
ATOM 7249  C CA  . PRO C 1 263 ? -23.686 -2.389  -1.671  1.00 20.27 ? 263 PRO C CA  1 
ATOM 7250  C C   . PRO C 1 263 ? -23.770 -3.658  -2.475  1.00 20.27 ? 263 PRO C C   1 
ATOM 7251  O O   . PRO C 1 263 ? -24.724 -4.413  -2.338  1.00 20.27 ? 263 PRO C O   1 
ATOM 7252  C CB  . PRO C 1 263 ? -24.279 -1.222  -2.435  1.00 21.55 ? 263 PRO C CB  1 
ATOM 7253  C CG  . PRO C 1 263 ? -23.589 -0.085  -1.841  1.00 21.55 ? 263 PRO C CG  1 
ATOM 7254  C CD  . PRO C 1 263 ? -22.153 -0.546  -1.793  1.00 21.55 ? 263 PRO C CD  1 
ATOM 7255  N N   . ALA C 1 264 ? -22.770 -3.886  -3.317  1.00 14.42 ? 264 ALA C N   1 
ATOM 7256  C CA  . ALA C 1 264 ? -22.746 -5.071  -4.171  1.00 14.42 ? 264 ALA C CA  1 
ATOM 7257  C C   . ALA C 1 264 ? -22.673 -6.402  -3.421  1.00 14.42 ? 264 ALA C C   1 
ATOM 7258  O O   . ALA C 1 264 ? -23.050 -7.441  -3.960  1.00 14.42 ? 264 ALA C O   1 
ATOM 7259  C CB  . ALA C 1 264 ? -21.589 -4.975  -5.180  1.00 0.51  ? 264 ALA C CB  1 
ATOM 7260  N N   . VAL C 1 265 ? -22.181 -6.390  -2.192  1.00 28.58 ? 265 VAL C N   1 
ATOM 7261  C CA  . VAL C 1 265 ? -22.111 -7.630  -1.444  1.00 28.58 ? 265 VAL C CA  1 
ATOM 7262  C C   . VAL C 1 265 ? -23.545 -8.022  -1.091  1.00 28.58 ? 265 VAL C C   1 
ATOM 7263  O O   . VAL C 1 265 ? -24.260 -7.268  -0.420  1.00 28.58 ? 265 VAL C O   1 
ATOM 7264  C CB  . VAL C 1 265 ? -21.281 -7.455  -0.171  1.00 18.47 ? 265 VAL C CB  1 
ATOM 7265  C CG1 . VAL C 1 265 ? -21.270 -8.747  0.617   1.00 18.47 ? 265 VAL C CG1 1 
ATOM 7266  C CG2 . VAL C 1 265 ? -19.869 -7.034  -0.534  1.00 18.47 ? 265 VAL C CG2 1 
ATOM 7267  N N   . PRO C 1 266 ? -23.987 -9.203  -1.552  1.00 21.11 ? 266 PRO C N   1 
ATOM 7268  C CA  . PRO C 1 266 ? -25.339 -9.700  -1.296  1.00 21.11 ? 266 PRO C CA  1 
ATOM 7269  C C   . PRO C 1 266 ? -25.725 -9.859  0.162   1.00 21.11 ? 266 PRO C C   1 
ATOM 7270  O O   . PRO C 1 266 ? -26.842 -9.517  0.544   1.00 21.11 ? 266 PRO C O   1 
ATOM 7271  C CB  . PRO C 1 266 ? -25.376 -11.021 -2.059  1.00 24.86 ? 266 PRO C CB  1 
ATOM 7272  C CG  . PRO C 1 266 ? -23.964 -11.460 -2.054  1.00 24.86 ? 266 PRO C CG  1 
ATOM 7273  C CD  . PRO C 1 266 ? -23.226 -10.179 -2.350  1.00 24.86 ? 266 PRO C CD  1 
ATOM 7274  N N   . GLY C 1 267 ? -24.823 -10.365 0.989   1.00 24.06 ? 267 GLY C N   1 
ATOM 7275  C CA  . GLY C 1 267 ? -25.193 -10.526 2.379   1.00 24.06 ? 267 GLY C CA  1 
ATOM 7276  C C   . GLY C 1 267 ? -24.040 -10.682 3.340   1.00 24.06 ? 267 GLY C C   1 
ATOM 7277  O O   . GLY C 1 267 ? -22.954 -11.120 2.968   1.00 24.06 ? 267 GLY C O   1 
ATOM 7278  N N   . VAL C 1 268 ? -24.290 -10.310 4.587   1.00 17.10 ? 268 VAL C N   1 
ATOM 7279  C CA  . VAL C 1 268 ? -23.306 -10.406 5.647   1.00 17.10 ? 268 VAL C CA  1 
ATOM 7280  C C   . VAL C 1 268 ? -23.838 -11.472 6.590   1.00 17.10 ? 268 VAL C C   1 
ATOM 7281  O O   . VAL C 1 268 ? -24.909 -11.304 7.169   1.00 17.10 ? 268 VAL C O   1 
ATOM 7282  C CB  . VAL C 1 268 ? -23.206 -9.090  6.420   1.00 20.48 ? 268 VAL C CB  1 
ATOM 7283  C CG1 . VAL C 1 268 ? -22.143 -9.197  7.491   1.00 20.48 ? 268 VAL C CG1 1 
ATOM 7284  C CG2 . VAL C 1 268 ? -22.913 -7.949  5.470   1.00 20.48 ? 268 VAL C CG2 1 
ATOM 7285  N N   . THR C 1 269 ? -23.109 -12.571 6.743   1.00 17.02 ? 269 THR C N   1 
ATOM 7286  C CA  . THR C 1 269 ? -23.561 -13.640 7.626   1.00 17.02 ? 269 THR C CA  1 
ATOM 7287  C C   . THR C 1 269 ? -22.731 -13.630 8.913   1.00 17.02 ? 269 THR C C   1 
ATOM 7288  O O   . THR C 1 269 ? -21.678 -14.264 8.989   1.00 17.02 ? 269 THR C O   1 
ATOM 7289  C CB  . THR C 1 269 ? -23.423 -15.009 6.935   1.00 20.90 ? 269 THR C CB  1 
ATOM 7290  O OG1 . THR C 1 269 ? -22.045 -15.386 6.904   1.00 20.90 ? 269 THR C OG1 1 
ATOM 7291  C CG2 . THR C 1 269 ? -23.930 -14.936 5.499   1.00 20.90 ? 269 THR C CG2 1 
ATOM 7292  N N   . PHE C 1 270 ? -23.212 -12.912 9.925   1.00 25.38 ? 270 PHE C N   1 
ATOM 7293  C CA  . PHE C 1 270 ? -22.492 -12.804 11.188  1.00 25.38 ? 270 PHE C CA  1 
ATOM 7294  C C   . PHE C 1 270 ? -22.101 -14.127 11.825  1.00 25.38 ? 270 PHE C C   1 
ATOM 7295  O O   . PHE C 1 270 ? -22.755 -15.154 11.636  1.00 25.38 ? 270 PHE C O   1 
ATOM 7296  C CB  . PHE C 1 270 ? -23.302 -12.006 12.205  1.00 23.21 ? 270 PHE C CB  1 
ATOM 7297  C CG  . PHE C 1 270 ? -23.554 -10.595 11.800  1.00 23.21 ? 270 PHE C CG  1 
ATOM 7298  C CD1 . PHE C 1 270 ? -24.777 -10.222 11.257  1.00 23.21 ? 270 PHE C CD1 1 
ATOM 7299  C CD2 . PHE C 1 270 ? -22.560 -9.640  11.924  1.00 23.21 ? 270 PHE C CD2 1 
ATOM 7300  C CE1 . PHE C 1 270 ? -25.004 -8.907  10.840  1.00 23.21 ? 270 PHE C CE1 1 
ATOM 7301  C CE2 . PHE C 1 270 ? -22.776 -8.332  11.510  1.00 23.21 ? 270 PHE C CE2 1 
ATOM 7302  C CZ  . PHE C 1 270 ? -24.001 -7.963  10.966  1.00 23.21 ? 270 PHE C CZ  1 
ATOM 7303  N N   . LEU C 1 271 ? -21.018 -14.085 12.588  1.00 23.04 ? 271 LEU C N   1 
ATOM 7304  C CA  . LEU C 1 271 ? -20.528 -15.256 13.292  1.00 23.04 ? 271 LEU C CA  1 
ATOM 7305  C C   . LEU C 1 271 ? -20.924 -15.089 14.765  1.00 23.04 ? 271 LEU C C   1 
ATOM 7306  O O   . LEU C 1 271 ? -20.767 -14.000 15.349  1.00 23.04 ? 271 LEU C O   1 
ATOM 7307  C CB  . LEU C 1 271 ? -19.007 -15.373 13.120  1.00 25.05 ? 271 LEU C CB  1 
ATOM 7308  C CG  . LEU C 1 271 ? -18.101 -14.186 13.480  1.00 25.05 ? 271 LEU C CG  1 
ATOM 7309  C CD1 . LEU C 1 271 ? -17.705 -14.226 14.949  1.00 25.05 ? 271 LEU C CD1 1 
ATOM 7310  C CD2 . LEU C 1 271 ? -16.854 -14.249 12.612  1.00 25.05 ? 271 LEU C CD2 1 
ATOM 7311  N N   . SER C 1 272 ? -21.463 -16.157 15.352  1.00 49.45 ? 272 SER C N   1 
ATOM 7312  C CA  . SER C 1 272 ? -21.917 -16.124 16.740  1.00 49.45 ? 272 SER C CA  1 
ATOM 7313  C C   . SER C 1 272 ? -20.803 -15.818 17.721  1.00 49.45 ? 272 SER C C   1 
ATOM 7314  O O   . SER C 1 272 ? -21.051 -15.266 18.793  1.00 49.45 ? 272 SER C O   1 
ATOM 7315  C CB  . SER C 1 272 ? -22.592 -17.449 17.120  1.00 50.91 ? 272 SER C CB  1 
ATOM 7316  O OG  . SER C 1 272 ? -21.730 -18.559 16.943  1.00 50.91 ? 272 SER C OG  1 
ATOM 7317  N N   . GLY C 1 273 ? -19.576 -16.173 17.352  1.00 39.25 ? 273 GLY C N   1 
ATOM 7318  C CA  . GLY C 1 273 ? -18.445 -15.924 18.227  1.00 39.25 ? 273 GLY C CA  1 
ATOM 7319  C C   . GLY C 1 273 ? -18.599 -16.590 19.582  1.00 39.25 ? 273 GLY C C   1 
ATOM 7320  O O   . GLY C 1 273 ? -18.867 -17.793 19.666  1.00 39.25 ? 273 GLY C O   1 
ATOM 7321  N N   . GLY C 1 274 ? -18.431 -15.809 20.645  1.00 40.93 ? 274 GLY C N   1 
ATOM 7322  C CA  . GLY C 1 274 ? -18.564 -16.366 21.980  1.00 40.93 ? 274 GLY C CA  1 
ATOM 7323  C C   . GLY C 1 274 ? -19.931 -16.127 22.598  1.00 40.93 ? 274 GLY C C   1 
ATOM 7324  O O   . GLY C 1 274 ? -20.156 -16.439 23.768  1.00 40.93 ? 274 GLY C O   1 
ATOM 7325  N N   . GLN C 1 275 ? -20.848 -15.574 21.810  1.00 36.04 ? 275 GLN C N   1 
ATOM 7326  C CA  . GLN C 1 275 ? -22.190 -15.277 22.283  1.00 36.04 ? 275 GLN C CA  1 
ATOM 7327  C C   . GLN C 1 275 ? -22.966 -16.544 22.597  1.00 36.04 ? 275 GLN C C   1 
ATOM 7328  O O   . GLN C 1 275 ? -22.671 -17.608 22.051  1.00 36.04 ? 275 GLN C O   1 
ATOM 7329  C CB  . GLN C 1 275 ? -22.947 -14.483 21.227  1.00 32.21 ? 275 GLN C CB  1 
ATOM 7330  C CG  . GLN C 1 275 ? -22.228 -13.248 20.762  1.00 32.21 ? 275 GLN C CG  1 
ATOM 7331  C CD  . GLN C 1 275 ? -23.076 -12.418 19.821  1.00 32.21 ? 275 GLN C CD  1 
ATOM 7332  O OE1 . GLN C 1 275 ? -24.120 -11.887 20.209  1.00 32.21 ? 275 GLN C OE1 1 
ATOM 7333  N NE2 . GLN C 1 275 ? -22.636 -12.302 18.570  1.00 32.21 ? 275 GLN C NE2 1 
ATOM 7334  N N   . SER C 1 276 ? -23.955 -16.411 23.480  1.00 35.88 ? 276 SER C N   1 
ATOM 7335  C CA  . SER C 1 276 ? -24.815 -17.521 23.883  1.00 35.88 ? 276 SER C CA  1 
ATOM 7336  C C   . SER C 1 276 ? -25.891 -17.676 22.819  1.00 35.88 ? 276 SER C C   1 
ATOM 7337  O O   . SER C 1 276 ? -26.100 -16.764 22.015  1.00 35.88 ? 276 SER C O   1 
ATOM 7338  C CB  . SER C 1 276 ? -25.473 -17.208 25.217  1.00 40.95 ? 276 SER C CB  1 
ATOM 7339  O OG  . SER C 1 276 ? -26.257 -16.037 25.105  1.00 40.95 ? 276 SER C OG  1 
ATOM 7340  N N   . GLU C 1 277 ? -26.583 -18.811 22.811  1.00 28.52 ? 277 GLU C N   1 
ATOM 7341  C CA  . GLU C 1 277 ? -27.618 -19.018 21.802  1.00 28.52 ? 277 GLU C CA  1 
ATOM 7342  C C   . GLU C 1 277 ? -28.580 -17.841 21.741  1.00 28.52 ? 277 GLU C C   1 
ATOM 7343  O O   . GLU C 1 277 ? -28.973 -17.412 20.653  1.00 28.52 ? 277 GLU C O   1 
ATOM 7344  C CB  . GLU C 1 277 ? -28.388 -20.319 22.061  1.00 39.05 ? 277 GLU C CB  1 
ATOM 7345  C CG  . GLU C 1 277 ? -27.573 -21.566 21.765  1.00 39.05 ? 277 GLU C CG  1 
ATOM 7346  C CD  . GLU C 1 277 ? -28.342 -22.861 21.971  1.00 39.05 ? 277 GLU C CD  1 
ATOM 7347  O OE1 . GLU C 1 277 ? -28.908 -23.045 23.072  1.00 39.05 ? 277 GLU C OE1 1 
ATOM 7348  O OE2 . GLU C 1 277 ? -28.367 -23.700 21.033  1.00 39.05 ? 277 GLU C OE2 1 
ATOM 7349  N N   . GLU C 1 278 ? -28.942 -17.310 22.908  1.00 38.22 ? 278 GLU C N   1 
ATOM 7350  C CA  . GLU C 1 278 ? -29.861 -16.185 22.959  1.00 38.22 ? 278 GLU C CA  1 
ATOM 7351  C C   . GLU C 1 278 ? -29.202 -14.882 22.563  1.00 38.22 ? 278 GLU C C   1 
ATOM 7352  O O   . GLU C 1 278 ? -29.723 -14.133 21.736  1.00 38.22 ? 278 GLU C O   1 
ATOM 7353  C CB  . GLU C 1 278 ? -30.475 -16.058 24.352  1.00 89.82 ? 278 GLU C CB  1 
ATOM 7354  C CG  . GLU C 1 278 ? -31.660 -16.981 24.543  1.00 89.82 ? 278 GLU C CG  1 
ATOM 7355  C CD  . GLU C 1 278 ? -32.689 -16.840 23.420  1.00 89.82 ? 278 GLU C CD  1 
ATOM 7356  O OE1 . GLU C 1 278 ? -33.348 -15.783 23.337  1.00 89.82 ? 278 GLU C OE1 1 
ATOM 7357  O OE2 . GLU C 1 278 ? -32.834 -17.782 22.610  1.00 89.82 ? 278 GLU C OE2 1 
ATOM 7358  N N   . GLU C 1 279 ? -28.046 -14.623 23.157  1.00 31.46 ? 279 GLU C N   1 
ATOM 7359  C CA  . GLU C 1 279 ? -27.279 -13.416 22.883  1.00 31.46 ? 279 GLU C CA  1 
ATOM 7360  C C   . GLU C 1 279 ? -27.145 -13.191 21.372  1.00 31.46 ? 279 GLU C C   1 
ATOM 7361  O O   . GLU C 1 279 ? -27.322 -12.074 20.873  1.00 31.46 ? 279 GLU C O   1 
ATOM 7362  C CB  . GLU C 1 279 ? -25.908 -13.560 23.528  1.00 60.46 ? 279 GLU C CB  1 
ATOM 7363  C CG  . GLU C 1 279 ? -25.110 -12.300 23.582  1.00 60.46 ? 279 GLU C CG  1 
ATOM 7364  C CD  . GLU C 1 279 ? -23.848 -12.475 24.398  1.00 60.46 ? 279 GLU C CD  1 
ATOM 7365  O OE1 . GLU C 1 279 ? -23.055 -11.507 24.464  1.00 60.46 ? 279 GLU C OE1 1 
ATOM 7366  O OE2 . GLU C 1 279 ? -23.653 -13.575 24.973  1.00 60.46 ? 279 GLU C OE2 1 
ATOM 7367  N N   . ALA C 1 280 ? -26.844 -14.263 20.646  1.00 28.49 ? 280 ALA C N   1 
ATOM 7368  C CA  . ALA C 1 280 ? -26.688 -14.187 19.204  1.00 28.49 ? 280 ALA C CA  1 
ATOM 7369  C C   . ALA C 1 280 ? -28.009 -13.801 18.556  1.00 28.49 ? 280 ALA C C   1 
ATOM 7370  O O   . ALA C 1 280 ? -28.064 -12.886 17.742  1.00 28.49 ? 280 ALA C O   1 
ATOM 7371  C CB  . ALA C 1 280 ? -26.210 -15.521 18.663  1.00 31.25 ? 280 ALA C CB  1 
ATOM 7372  N N   . SER C 1 281 ? -29.073 -14.501 18.932  1.00 29.03 ? 281 SER C N   1 
ATOM 7373  C CA  . SER C 1 281 ? -30.402 -14.242 18.384  1.00 29.03 ? 281 SER C CA  1 
ATOM 7374  C C   . SER C 1 281 ? -30.874 -12.814 18.665  1.00 29.03 ? 281 SER C C   1 
ATOM 7375  O O   . SER C 1 281 ? -31.363 -12.120 17.767  1.00 29.03 ? 281 SER C O   1 
ATOM 7376  C CB  . SER C 1 281 ? -31.394 -15.245 18.968  1.00 33.57 ? 281 SER C CB  1 
ATOM 7377  O OG  . SER C 1 281 ? -30.939 -16.573 18.766  1.00 33.57 ? 281 SER C OG  1 
ATOM 7378  N N   . PHE C 1 282 ? -30.727 -12.377 19.913  1.00 35.17 ? 282 PHE C N   1 
ATOM 7379  C CA  . PHE C 1 282 ? -31.133 -11.033 20.304  1.00 35.17 ? 282 PHE C CA  1 
ATOM 7380  C C   . PHE C 1 282 ? -30.381 -9.982  19.517  1.00 35.17 ? 282 PHE C C   1 
ATOM 7381  O O   . PHE C 1 282 ? -30.988 -9.093  18.910  1.00 35.17 ? 282 PHE C O   1 
ATOM 7382  C CB  . PHE C 1 282 ? -30.894 -10.814 21.794  1.00 73.69 ? 282 PHE C CB  1 
ATOM 7383  C CG  . PHE C 1 282 ? -32.035 -11.259 22.648  1.00 73.69 ? 282 PHE C CG  1 
ATOM 7384  C CD1 . PHE C 1 282 ? -32.505 -12.565 22.576  1.00 73.69 ? 282 PHE C CD1 1 
ATOM 7385  C CD2 . PHE C 1 282 ? -32.663 -10.366 23.505  1.00 73.69 ? 282 PHE C CD2 1 
ATOM 7386  C CE1 . PHE C 1 282 ? -33.589 -12.976 23.344  1.00 73.69 ? 282 PHE C CE1 1 
ATOM 7387  C CE2 . PHE C 1 282 ? -33.749 -10.766 24.278  1.00 73.69 ? 282 PHE C CE2 1 
ATOM 7388  C CZ  . PHE C 1 282 ? -34.212 -12.077 24.195  1.00 73.69 ? 282 PHE C CZ  1 
ATOM 7389  N N   . ASN C 1 283 ? -29.056 -10.092 19.532  1.00 27.49 ? 283 ASN C N   1 
ATOM 7390  C CA  . ASN C 1 283 ? -28.201 -9.157  18.820  1.00 27.49 ? 283 ASN C CA  1 
ATOM 7391  C C   . ASN C 1 283 ? -28.530 -9.149  17.323  1.00 27.49 ? 283 ASN C C   1 
ATOM 7392  O O   . ASN C 1 283 ? -28.677 -8.086  16.718  1.00 27.49 ? 283 ASN C O   1 
ATOM 7393  C CB  . ASN C 1 283 ? -26.730 -9.515  19.071  1.00 30.08 ? 283 ASN C CB  1 
ATOM 7394  C CG  . ASN C 1 283 ? -26.258 -9.109  20.463  1.00 30.08 ? 283 ASN C CG  1 
ATOM 7395  O OD1 . ASN C 1 283 ? -25.262 -9.616  20.968  1.00 30.08 ? 283 ASN C OD1 1 
ATOM 7396  N ND2 . ASN C 1 283 ? -26.970 -8.180  21.080  1.00 30.08 ? 283 ASN C ND2 1 
ATOM 7397  N N   . LEU C 1 284 ? -28.669 -10.324 16.720  1.00 25.69 ? 284 LEU C N   1 
ATOM 7398  C CA  . LEU C 1 284 ? -28.989 -10.362 15.300  1.00 25.69 ? 284 LEU C CA  1 
ATOM 7399  C C   . LEU C 1 284 ? -30.307 -9.653  15.051  1.00 25.69 ? 284 LEU C C   1 
ATOM 7400  O O   . LEU C 1 284 ? -30.418 -8.842  14.130  1.00 25.69 ? 284 LEU C O   1 
ATOM 7401  C CB  . LEU C 1 284 ? -29.081 -11.803 14.782  1.00 10.21 ? 284 LEU C CB  1 
ATOM 7402  C CG  . LEU C 1 284 ? -29.533 -11.951 13.317  1.00 10.21 ? 284 LEU C CG  1 
ATOM 7403  C CD1 . LEU C 1 284 ? -28.726 -11.034 12.405  1.00 10.21 ? 284 LEU C CD1 1 
ATOM 7404  C CD2 . LEU C 1 284 ? -29.375 -13.401 12.883  1.00 10.21 ? 284 LEU C CD2 1 
ATOM 7405  N N   . ASN C 1 285 ? -31.304 -9.960  15.874  1.00 29.34 ? 285 ASN C N   1 
ATOM 7406  C CA  . ASN C 1 285 ? -32.611 -9.339  15.721  1.00 29.34 ? 285 ASN C CA  1 
ATOM 7407  C C   . ASN C 1 285 ? -32.459 -7.824  15.802  1.00 29.34 ? 285 ASN C C   1 
ATOM 7408  O O   . ASN C 1 285 ? -32.910 -7.090  14.919  1.00 29.34 ? 285 ASN C O   1 
ATOM 7409  C CB  . ASN C 1 285 ? -33.558 -9.827  16.812  1.00 44.21 ? 285 ASN C CB  1 
ATOM 7410  C CG  . ASN C 1 285 ? -35.012 -9.571  16.473  1.00 44.21 ? 285 ASN C CG  1 
ATOM 7411  O OD1 . ASN C 1 285 ? -35.587 -10.218 15.595  1.00 44.21 ? 285 ASN C OD1 1 
ATOM 7412  N ND2 . ASN C 1 285 ? -35.614 -8.616  17.162  1.00 44.21 ? 285 ASN C ND2 1 
ATOM 7413  N N   . ALA C 1 286 ? -31.806 -7.363  16.862  1.00 25.63 ? 286 ALA C N   1 
ATOM 7414  C CA  . ALA C 1 286 ? -31.581 -5.937  17.056  1.00 25.63 ? 286 ALA C CA  1 
ATOM 7415  C C   . ALA C 1 286 ? -30.973 -5.313  15.804  1.00 25.63 ? 286 ALA C C   1 
ATOM 7416  O O   . ALA C 1 286 ? -31.402 -4.244  15.355  1.00 25.63 ? 286 ALA C O   1 
ATOM 7417  C CB  . ALA C 1 286 ? -30.660 -5.715  18.251  1.00 13.74 ? 286 ALA C CB  1 
ATOM 7418  N N   . ILE C 1 287 ? -29.967 -5.984  15.249  1.00 26.84 ? 287 ILE C N   1 
ATOM 7419  C CA  . ILE C 1 287 ? -29.293 -5.511  14.047  1.00 26.84 ? 287 ILE C CA  1 
ATOM 7420  C C   . ILE C 1 287 ? -30.312 -5.310  12.934  1.00 26.84 ? 287 ILE C C   1 
ATOM 7421  O O   . ILE C 1 287 ? -30.354 -4.251  12.304  1.00 26.84 ? 287 ILE C O   1 
ATOM 7422  C CB  . ILE C 1 287 ? -28.217 -6.528  13.575  1.00 24.79 ? 287 ILE C CB  1 
ATOM 7423  C CG1 . ILE C 1 287 ? -27.015 -6.483  14.518  1.00 24.79 ? 287 ILE C CG1 1 
ATOM 7424  C CG2 . ILE C 1 287 ? -27.792 -6.235  12.139  1.00 24.79 ? 287 ILE C CG2 1 
ATOM 7425  C CD1 . ILE C 1 287 ? -25.952 -7.523  14.203  1.00 24.79 ? 287 ILE C CD1 1 
ATOM 7426  N N   . ASN C 1 288 ? -31.136 -6.326  12.697  1.00 38.27 ? 288 ASN C N   1 
ATOM 7427  C CA  . ASN C 1 288 ? -32.142 -6.243  11.653  1.00 38.27 ? 288 ASN C CA  1 
ATOM 7428  C C   . ASN C 1 288 ? -33.257 -5.261  11.988  1.00 38.27 ? 288 ASN C C   1 
ATOM 7429  O O   . ASN C 1 288 ? -34.176 -5.060  11.192  1.00 38.27 ? 288 ASN C O   1 
ATOM 7430  C CB  . ASN C 1 288 ? -32.733 -7.618  11.369  1.00 37.49 ? 288 ASN C CB  1 
ATOM 7431  C CG  . ASN C 1 288 ? -31.928 -8.395  10.355  1.00 37.49 ? 288 ASN C CG  1 
ATOM 7432  O OD1 . ASN C 1 288 ? -31.840 -8.016  9.185   1.00 37.49 ? 288 ASN C OD1 1 
ATOM 7433  N ND2 . ASN C 1 288 ? -31.334 -9.491  10.796  1.00 37.49 ? 288 ASN C ND2 1 
ATOM 7434  N N   . ARG C 1 289 ? -33.187 -4.654  13.167  1.00 38.53 ? 289 ARG C N   1 
ATOM 7435  C CA  . ARG C 1 289 ? -34.190 -3.676  13.556  1.00 38.53 ? 289 ARG C CA  1 
ATOM 7436  C C   . ARG C 1 289 ? -33.547 -2.301  13.702  1.00 38.53 ? 289 ARG C C   1 
ATOM 7437  O O   . ARG C 1 289 ? -34.201 -1.335  14.092  1.00 38.53 ? 289 ARG C O   1 
ATOM 7438  C CB  . ARG C 1 289 ? -34.874 -4.106  14.854  1.00 83.13 ? 289 ARG C CB  1 
ATOM 7439  C CG  . ARG C 1 289 ? -36.159 -4.883  14.619  1.00 83.13 ? 289 ARG C CG  1 
ATOM 7440  C CD  . ARG C 1 289 ? -36.400 -5.907  15.708  1.00 83.13 ? 289 ARG C CD  1 
ATOM 7441  N NE  . ARG C 1 289 ? -36.465 -5.311  17.041  1.00 83.13 ? 289 ARG C NE  1 
ATOM 7442  C CZ  . ARG C 1 289 ? -37.517 -4.654  17.521  1.00 83.13 ? 289 ARG C CZ  1 
ATOM 7443  N NH1 . ARG C 1 289 ? -38.607 -4.509  16.770  1.00 83.13 ? 289 ARG C NH1 1 
ATOM 7444  N NH2 . ARG C 1 289 ? -37.477 -4.140  18.752  1.00 83.13 ? 289 ARG C NH2 1 
ATOM 7445  N N   . CYS C 1 290 ? -32.260 -2.217  13.374  1.00 39.66 ? 290 CYS C N   1 
ATOM 7446  C CA  . CYS C 1 290 ? -31.534 -0.953  13.449  1.00 39.66 ? 290 CYS C CA  1 
ATOM 7447  C C   . CYS C 1 290 ? -32.138 0.026   12.442  1.00 39.66 ? 290 CYS C C   1 
ATOM 7448  O O   . CYS C 1 290 ? -32.475 -0.348  11.322  1.00 39.66 ? 290 CYS C O   1 
ATOM 7449  C CB  . CYS C 1 290 ? -30.046 -1.161  13.131  1.00 39.50 ? 290 CYS C CB  1 
ATOM 7450  S SG  . CYS C 1 290 ? -29.034 0.349   13.243  1.00 39.50 ? 290 CYS C SG  1 
ATOM 7451  N N   . PRO C 1 291 ? -32.284 1.294   12.840  1.00 44.08 ? 291 PRO C N   1 
ATOM 7452  C CA  . PRO C 1 291 ? -32.841 2.379   12.026  1.00 44.08 ? 291 PRO C CA  1 
ATOM 7453  C C   . PRO C 1 291 ? -32.094 2.598   10.715  1.00 44.08 ? 291 PRO C C   1 
ATOM 7454  O O   . PRO C 1 291 ? -32.696 2.873   9.676   1.00 44.08 ? 291 PRO C O   1 
ATOM 7455  C CB  . PRO C 1 291 ? -32.716 3.588   12.939  1.00 37.68 ? 291 PRO C CB  1 
ATOM 7456  C CG  . PRO C 1 291 ? -32.824 2.987   14.308  1.00 37.68 ? 291 PRO C CG  1 
ATOM 7457  C CD  . PRO C 1 291 ? -31.958 1.770   14.194  1.00 37.68 ? 291 PRO C CD  1 
ATOM 7458  N N   . LEU C 1 292 ? -30.774 2.484   10.774  1.00 38.17 ? 292 LEU C N   1 
ATOM 7459  C CA  . LEU C 1 292 ? -29.932 2.677   9.603   1.00 38.17 ? 292 LEU C CA  1 
ATOM 7460  C C   . LEU C 1 292 ? -30.284 1.720   8.468   1.00 38.17 ? 292 LEU C C   1 
ATOM 7461  O O   . LEU C 1 292 ? -30.625 0.565   8.696   1.00 38.17 ? 292 LEU C O   1 
ATOM 7462  C CB  . LEU C 1 292 ? -28.472 2.497   10.004  1.00 25.82 ? 292 LEU C CB  1 
ATOM 7463  C CG  . LEU C 1 292 ? -28.062 3.455   11.118  1.00 25.82 ? 292 LEU C CG  1 
ATOM 7464  C CD1 . LEU C 1 292 ? -26.775 3.001   11.759  1.00 25.82 ? 292 LEU C CD1 1 
ATOM 7465  C CD2 . LEU C 1 292 ? -27.927 4.840   10.534  1.00 25.82 ? 292 LEU C CD2 1 
ATOM 7466  N N   . PRO C 1 293 ? -30.206 2.203   7.226   1.00 33.21 ? 293 PRO C N   1 
ATOM 7467  C CA  . PRO C 1 293 ? -30.501 1.440   6.010   1.00 33.21 ? 293 PRO C CA  1 
ATOM 7468  C C   . PRO C 1 293 ? -29.419 0.398   5.736   1.00 33.21 ? 293 PRO C C   1 
ATOM 7469  O O   . PRO C 1 293 ? -28.243 0.662   5.970   1.00 33.21 ? 293 PRO C O   1 
ATOM 7470  C CB  . PRO C 1 293 ? -30.514 2.515   4.922   1.00 21.95 ? 293 PRO C CB  1 
ATOM 7471  C CG  . PRO C 1 293 ? -30.802 3.777   5.667   1.00 21.95 ? 293 PRO C CG  1 
ATOM 7472  C CD  . PRO C 1 293 ? -29.988 3.619   6.909   1.00 21.95 ? 293 PRO C CD  1 
ATOM 7473  N N   . ARG C 1 294 ? -29.806 -0.768  5.227   1.00 35.41 ? 294 ARG C N   1 
ATOM 7474  C CA  . ARG C 1 294 ? -28.839 -1.811  4.920   1.00 35.41 ? 294 ARG C CA  1 
ATOM 7475  C C   . ARG C 1 294 ? -29.059 -2.409  3.545   1.00 35.41 ? 294 ARG C C   1 
ATOM 7476  O O   . ARG C 1 294 ? -30.030 -3.114  3.317   1.00 35.41 ? 294 ARG C O   1 
ATOM 7477  C CB  . ARG C 1 294 ? -28.904 -2.913  5.961   1.00 55.54 ? 294 ARG C CB  1 
ATOM 7478  C CG  . ARG C 1 294 ? -28.591 -2.416  7.338   1.00 55.54 ? 294 ARG C CG  1 
ATOM 7479  C CD  . ARG C 1 294 ? -29.847 -2.072  8.061   1.00 55.54 ? 294 ARG C CD  1 
ATOM 7480  N NE  . ARG C 1 294 ? -30.628 -3.278  8.284   1.00 55.54 ? 294 ARG C NE  1 
ATOM 7481  C CZ  . ARG C 1 294 ? -31.708 -3.334  9.053   1.00 55.54 ? 294 ARG C CZ  1 
ATOM 7482  N NH1 . ARG C 1 294 ? -32.138 -2.244  9.679   1.00 55.54 ? 294 ARG C NH1 1 
ATOM 7483  N NH2 . ARG C 1 294 ? -32.356 -4.483  9.197   1.00 55.54 ? 294 ARG C NH2 1 
ATOM 7484  N N   . PRO C 1 295 ? -28.132 -2.158  2.615   1.00 34.96 ? 295 PRO C N   1 
ATOM 7485  C CA  . PRO C 1 295 ? -28.170 -2.640  1.227   1.00 34.96 ? 295 PRO C CA  1 
ATOM 7486  C C   . PRO C 1 295 ? -27.966 -4.143  1.064   1.00 34.96 ? 295 PRO C C   1 
ATOM 7487  O O   . PRO C 1 295 ? -28.062 -4.680  -0.052  1.00 34.96 ? 295 PRO C O   1 
ATOM 7488  C CB  . PRO C 1 295 ? -27.025 -1.874  0.556   1.00 28.52 ? 295 PRO C CB  1 
ATOM 7489  C CG  . PRO C 1 295 ? -26.668 -0.777  1.536   1.00 28.52 ? 295 PRO C CG  1 
ATOM 7490  C CD  . PRO C 1 295 ? -26.900 -1.399  2.866   1.00 28.52 ? 295 PRO C CD  1 
ATOM 7491  N N   . TRP C 1 296 ? -27.691 -4.819  2.170   1.00 22.36 ? 296 TRP C N   1 
ATOM 7492  C CA  . TRP C 1 296 ? -27.399 -6.251  2.137   1.00 22.36 ? 296 TRP C CA  1 
ATOM 7493  C C   . TRP C 1 296 ? -28.126 -7.063  3.198   1.00 22.36 ? 296 TRP C C   1 
ATOM 7494  O O   . TRP C 1 296 ? -28.574 -6.535  4.224   1.00 22.36 ? 296 TRP C O   1 
ATOM 7495  C CB  . TRP C 1 296 ? -25.899 -6.437  2.338   1.00 29.77 ? 296 TRP C CB  1 
ATOM 7496  C CG  . TRP C 1 296 ? -25.413 -5.443  3.339   1.00 29.77 ? 296 TRP C CG  1 
ATOM 7497  C CD1 . TRP C 1 296 ? -25.901 -5.232  4.615   1.00 29.77 ? 296 TRP C CD1 1 
ATOM 7498  C CD2 . TRP C 1 296 ? -24.449 -4.439  3.117   1.00 29.77 ? 296 TRP C CD2 1 
ATOM 7499  N NE1 . TRP C 1 296 ? -25.294 -4.137  5.190   1.00 29.77 ? 296 TRP C NE1 1 
ATOM 7500  C CE2 . TRP C 1 296 ? -24.397 -3.630  4.293   1.00 29.77 ? 296 TRP C CE2 1 
ATOM 7501  C CE3 . TRP C 1 296 ? -23.623 -4.134  2.043   1.00 29.77 ? 296 TRP C CE3 1 
ATOM 7502  C CZ2 . TRP C 1 296 ? -23.553 -2.550  4.415   1.00 29.77 ? 296 TRP C CZ2 1 
ATOM 7503  C CZ3 . TRP C 1 296 ? -22.789 -3.071  2.158   1.00 29.77 ? 296 TRP C CZ3 1 
ATOM 7504  C CH2 . TRP C 1 296 ? -22.753 -2.278  3.344   1.00 29.77 ? 296 TRP C CH2 1 
ATOM 7505  N N   . ALA C 1 297 ? -28.218 -8.363  2.955   1.00 17.98 ? 297 ALA C N   1 
ATOM 7506  C CA  . ALA C 1 297 ? -28.856 -9.250  3.904   1.00 17.98 ? 297 ALA C CA  1 
ATOM 7507  C C   . ALA C 1 297 ? -28.023 -9.221  5.178   1.00 17.98 ? 297 ALA C C   1 
ATOM 7508  O O   . ALA C 1 297 ? -26.796 -9.139  5.124   1.00 17.98 ? 297 ALA C O   1 
ATOM 7509  C CB  . ALA C 1 297 ? -28.890 -10.656 3.347   1.00 5.10  ? 297 ALA C CB  1 
ATOM 7510  N N   . LEU C 1 298 ? -28.674 -9.263  6.327   1.00 26.13 ? 298 LEU C N   1 
ATOM 7511  C CA  . LEU C 1 298 ? -27.925 -9.290  7.564   1.00 26.13 ? 298 LEU C CA  1 
ATOM 7512  C C   . LEU C 1 298 ? -28.401 -10.500 8.342   1.00 26.13 ? 298 LEU C C   1 
ATOM 7513  O O   . LEU C 1 298 ? -29.228 -10.358 9.234   1.00 26.13 ? 298 LEU C O   1 
ATOM 7514  C CB  . LEU C 1 298 ? -28.164 -8.015  8.373   1.00 12.85 ? 298 LEU C CB  1 
ATOM 7515  C CG  . LEU C 1 298 ? -27.609 -6.703  7.824   1.00 12.85 ? 298 LEU C CG  1 
ATOM 7516  C CD1 . LEU C 1 298 ? -27.959 -5.567  8.770   1.00 12.85 ? 298 LEU C CD1 1 
ATOM 7517  C CD2 . LEU C 1 298 ? -26.111 -6.810  7.675   1.00 12.85 ? 298 LEU C CD2 1 
ATOM 7518  N N   . THR C 1 299 ? -27.924 -11.696 7.999   1.00 24.62 ? 299 THR C N   1 
ATOM 7519  C CA  . THR C 1 299 ? -28.359 -12.867 8.750   1.00 24.62 ? 299 THR C CA  1 
ATOM 7520  C C   . THR C 1 299 ? -27.224 -13.463 9.581   1.00 24.62 ? 299 THR C C   1 
ATOM 7521  O O   . THR C 1 299 ? -26.324 -12.749 10.039  1.00 24.62 ? 299 THR C O   1 
ATOM 7522  C CB  . THR C 1 299 ? -28.979 -13.985 7.857   1.00 29.85 ? 299 THR C CB  1 
ATOM 7523  O OG1 . THR C 1 299 ? -27.961 -14.899 7.469   1.00 29.85 ? 299 THR C OG1 1 
ATOM 7524  C CG2 . THR C 1 299 ? -29.606 -13.413 6.606   1.00 29.85 ? 299 THR C CG2 1 
ATOM 7525  N N   . PHE C 1 300 ? -27.268 -14.778 9.755   1.00 24.91 ? 300 PHE C N   1 
ATOM 7526  C CA  . PHE C 1 300 ? -26.301 -15.490 10.577  1.00 24.91 ? 300 PHE C CA  1 
ATOM 7527  C C   . PHE C 1 300 ? -25.565 -16.628 9.876   1.00 24.91 ? 300 PHE C C   1 
ATOM 7528  O O   . PHE C 1 300 ? -26.026 -17.172 8.874   1.00 24.91 ? 300 PHE C O   1 
ATOM 7529  C CB  . PHE C 1 300 ? -27.048 -16.080 11.771  1.00 28.15 ? 300 PHE C CB  1 
ATOM 7530  C CG  . PHE C 1 300 ? -28.124 -17.067 11.372  1.00 28.15 ? 300 PHE C CG  1 
ATOM 7531  C CD1 . PHE C 1 300 ? -27.866 -18.437 11.356  1.00 28.15 ? 300 PHE C CD1 1 
ATOM 7532  C CD2 . PHE C 1 300 ? -29.379 -16.622 10.951  1.00 28.15 ? 300 PHE C CD2 1 
ATOM 7533  C CE1 . PHE C 1 300 ? -28.843 -19.348 10.920  1.00 28.15 ? 300 PHE C CE1 1 
ATOM 7534  C CE2 . PHE C 1 300 ? -30.354 -17.525 10.516  1.00 28.15 ? 300 PHE C CE2 1 
ATOM 7535  C CZ  . PHE C 1 300 ? -30.083 -18.888 10.501  1.00 28.15 ? 300 PHE C CZ  1 
ATOM 7536  N N   . SER C 1 301 ? -24.413 -16.983 10.435  1.00 38.83 ? 301 SER C N   1 
ATOM 7537  C CA  . SER C 1 301 ? -23.594 -18.107 9.982   1.00 38.83 ? 301 SER C CA  1 
ATOM 7538  C C   . SER C 1 301 ? -23.085 -18.567 11.329  1.00 38.83 ? 301 SER C C   1 
ATOM 7539  O O   . SER C 1 301 ? -21.924 -18.374 11.678  1.00 38.83 ? 301 SER C O   1 
ATOM 7540  C CB  . SER C 1 301 ? -22.421 -17.665 9.110   1.00 22.70 ? 301 SER C CB  1 
ATOM 7541  O OG  . SER C 1 301 ? -21.706 -18.805 8.659   1.00 22.70 ? 301 SER C OG  1 
ATOM 7542  N N   . TYR C 1 302 ? -24.001 -19.142 12.096  1.00 34.88 ? 302 TYR C N   1 
ATOM 7543  C CA  . TYR C 1 302 ? -23.718 -19.597 13.442  1.00 34.88 ? 302 TYR C CA  1 
ATOM 7544  C C   . TYR C 1 302 ? -23.226 -21.027 13.582  1.00 34.88 ? 302 TYR C C   1 
ATOM 7545  O O   . TYR C 1 302 ? -23.635 -21.932 12.846  1.00 34.88 ? 302 TYR C O   1 
ATOM 7546  C CB  . TYR C 1 302 ? -24.960 -19.417 14.303  1.00 26.93 ? 302 TYR C CB  1 
ATOM 7547  C CG  . TYR C 1 302 ? -25.351 -17.981 14.555  1.00 26.93 ? 302 TYR C CG  1 
ATOM 7548  C CD1 . TYR C 1 302 ? -26.439 -17.690 15.359  1.00 26.93 ? 302 TYR C CD1 1 
ATOM 7549  C CD2 . TYR C 1 302 ? -24.626 -16.918 14.019  1.00 26.93 ? 302 TYR C CD2 1 
ATOM 7550  C CE1 . TYR C 1 302 ? -26.803 -16.396 15.633  1.00 26.93 ? 302 TYR C CE1 1 
ATOM 7551  C CE2 . TYR C 1 302 ? -24.986 -15.605 14.289  1.00 26.93 ? 302 TYR C CE2 1 
ATOM 7552  C CZ  . TYR C 1 302 ? -26.085 -15.359 15.103  1.00 26.93 ? 302 TYR C CZ  1 
ATOM 7553  O OH  . TYR C 1 302 ? -26.503 -14.083 15.401  1.00 26.93 ? 302 TYR C OH  1 
ATOM 7554  N N   . GLY C 1 303 ? -22.344 -21.214 14.556  1.00 37.62 ? 303 GLY C N   1 
ATOM 7555  C CA  . GLY C 1 303 ? -21.795 -22.525 14.812  1.00 37.62 ? 303 GLY C CA  1 
ATOM 7556  C C   . GLY C 1 303 ? -22.350 -23.030 16.119  1.00 37.62 ? 303 GLY C C   1 
ATOM 7557  O O   . GLY C 1 303 ? -23.285 -23.826 16.123  1.00 37.62 ? 303 GLY C O   1 
ATOM 7558  N N   . ARG C 1 304 ? -21.797 -22.561 17.233  1.00 39.41 ? 304 ARG C N   1 
ATOM 7559  C CA  . ARG C 1 304 ? -22.279 -23.021 18.521  1.00 39.41 ? 304 ARG C CA  1 
ATOM 7560  C C   . ARG C 1 304 ? -23.660 -22.458 18.805  1.00 39.41 ? 304 ARG C C   1 
ATOM 7561  O O   . ARG C 1 304 ? -24.528 -23.167 19.310  1.00 39.41 ? 304 ARG C O   1 
ATOM 7562  C CB  . ARG C 1 304 ? -21.322 -22.630 19.644  1.00 92.06 ? 304 ARG C CB  1 
ATOM 7563  C CG  . ARG C 1 304 ? -21.535 -23.477 20.881  1.00 92.06 ? 304 ARG C CG  1 
ATOM 7564  C CD  . ARG C 1 304 ? -20.592 -23.121 22.007  1.00 92.06 ? 304 ARG C CD  1 
ATOM 7565  N NE  . ARG C 1 304 ? -20.038 -24.323 22.632  1.00 92.06 ? 304 ARG C NE  1 
ATOM 7566  C CZ  . ARG C 1 304 ? -18.948 -24.963 22.200  1.00 92.06 ? 304 ARG C CZ  1 
ATOM 7567  N NH1 . ARG C 1 304 ? -18.278 -24.517 21.141  1.00 92.06 ? 304 ARG C NH1 1 
ATOM 7568  N NH2 . ARG C 1 304 ? -18.527 -26.061 22.821  1.00 92.06 ? 304 ARG C NH2 1 
ATOM 7569  N N   . ALA C 1 305 ? -23.871 -21.191 18.456  1.00 38.65 ? 305 ALA C N   1 
ATOM 7570  C CA  . ALA C 1 305 ? -25.153 -20.533 18.700  1.00 38.65 ? 305 ALA C CA  1 
ATOM 7571  C C   . ALA C 1 305 ? -26.364 -21.255 18.107  1.00 38.65 ? 305 ALA C C   1 
ATOM 7572  O O   . ALA C 1 305 ? -27.514 -20.876 18.368  1.00 38.65 ? 305 ALA C O   1 
ATOM 7573  C CB  . ALA C 1 305 ? -25.105 -19.107 18.189  1.00 39.62 ? 305 ALA C CB  1 
ATOM 7574  N N   . LEU C 1 306 ? -26.111 -22.286 17.311  1.00 36.66 ? 306 LEU C N   1 
ATOM 7575  C CA  . LEU C 1 306 ? -27.184 -23.056 16.702  1.00 36.66 ? 306 LEU C CA  1 
ATOM 7576  C C   . LEU C 1 306 ? -27.227 -24.466 17.264  1.00 36.66 ? 306 LEU C C   1 
ATOM 7577  O O   . LEU C 1 306 ? -28.276 -25.112 17.271  1.00 36.66 ? 306 LEU C O   1 
ATOM 7578  C CB  . LEU C 1 306 ? -26.999 -23.136 15.187  1.00 30.61 ? 306 LEU C CB  1 
ATOM 7579  C CG  . LEU C 1 306 ? -27.644 -22.043 14.340  1.00 30.61 ? 306 LEU C CG  1 
ATOM 7580  C CD1 . LEU C 1 306 ? -27.331 -22.276 12.873  1.00 30.61 ? 306 LEU C CD1 1 
ATOM 7581  C CD2 . LEU C 1 306 ? -29.143 -22.059 14.564  1.00 30.61 ? 306 LEU C CD2 1 
ATOM 7582  N N   . GLN C 1 307 ? -26.094 -24.951 17.751  1.00 36.55 ? 307 GLN C N   1 
ATOM 7583  C CA  . GLN C 1 307 ? -26.065 -26.310 18.258  1.00 36.55 ? 307 GLN C CA  1 
ATOM 7584  C C   . GLN C 1 307 ? -25.649 -26.508 19.710  1.00 36.55 ? 307 GLN C C   1 
ATOM 7585  O O   . GLN C 1 307 ? -25.389 -27.630 20.129  1.00 36.55 ? 307 GLN C O   1 
ATOM 7586  C CB  . GLN C 1 307 ? -25.196 -27.171 17.325  1.00 33.89 ? 307 GLN C CB  1 
ATOM 7587  C CG  . GLN C 1 307 ? -23.846 -26.571 16.977  1.00 33.89 ? 307 GLN C CG  1 
ATOM 7588  C CD  . GLN C 1 307 ? -23.188 -27.241 15.778  1.00 33.89 ? 307 GLN C CD  1 
ATOM 7589  O OE1 . GLN C 1 307 ? -22.778 -28.404 15.834  1.00 33.89 ? 307 GLN C OE1 1 
ATOM 7590  N NE2 . GLN C 1 307 ? -23.087 -26.502 14.682  1.00 33.89 ? 307 GLN C NE2 1 
ATOM 7591  N N   . ALA C 1 308 ? -25.605 -25.439 20.491  1.00 37.87 ? 308 ALA C N   1 
ATOM 7592  C CA  . ALA C 1 308 ? -25.209 -25.581 21.888  1.00 37.87 ? 308 ALA C CA  1 
ATOM 7593  C C   . ALA C 1 308 ? -26.177 -26.489 22.622  1.00 37.87 ? 308 ALA C C   1 
ATOM 7594  O O   . ALA C 1 308 ? -25.818 -27.587 23.049  1.00 37.87 ? 308 ALA C O   1 
ATOM 7595  C CB  . ALA C 1 308 ? -25.168 -24.233 22.566  1.00 15.30 ? 308 ALA C CB  1 
ATOM 7596  N N   . SER C 1 309 ? -27.411 -26.022 22.764  1.00 41.00 ? 309 SER C N   1 
ATOM 7597  C CA  . SER C 1 309 ? -28.434 -26.785 23.459  1.00 41.00 ? 309 SER C CA  1 
ATOM 7598  C C   . SER C 1 309 ? -28.676 -28.114 22.758  1.00 41.00 ? 309 SER C C   1 
ATOM 7599  O O   . SER C 1 309 ? -28.924 -29.129 23.406  1.00 41.00 ? 309 SER C O   1 
ATOM 7600  C CB  . SER C 1 309 ? -29.725 -25.975 23.522  1.00 53.34 ? 309 SER C CB  1 
ATOM 7601  O OG  . SER C 1 309 ? -30.115 -25.585 22.220  1.00 53.34 ? 309 SER C OG  1 
ATOM 7602  N N   . ALA C 1 310 ? -28.597 -28.109 21.432  1.00 29.93 ? 310 ALA C N   1 
ATOM 7603  C CA  . ALA C 1 310 ? -28.811 -29.336 20.675  1.00 29.93 ? 310 ALA C CA  1 
ATOM 7604  C C   . ALA C 1 310 ? -27.816 -30.401 21.123  1.00 29.93 ? 310 ALA C C   1 
ATOM 7605  O O   . ALA C 1 310 ? -28.180 -31.541 21.418  1.00 29.93 ? 310 ALA C O   1 
ATOM 7606  C CB  . ALA C 1 310 ? -28.647 -29.064 19.187  1.00 38.79 ? 310 ALA C CB  1 
ATOM 7607  N N   . LEU C 1 311 ? -26.552 -30.009 21.174  1.00 42.93 ? 311 LEU C N   1 
ATOM 7608  C CA  . LEU C 1 311 ? -25.467 -30.896 21.569  1.00 42.93 ? 311 LEU C CA  1 
ATOM 7609  C C   . LEU C 1 311 ? -25.642 -31.312 23.022  1.00 42.93 ? 311 LEU C C   1 
ATOM 7610  O O   . LEU C 1 311 ? -25.416 -32.461 23.398  1.00 42.93 ? 311 LEU C O   1 
ATOM 7611  C CB  . LEU C 1 311 ? -24.142 -30.158 21.380  1.00 52.68 ? 311 LEU C CB  1 
ATOM 7612  C CG  . LEU C 1 311 ? -22.807 -30.891 21.409  1.00 52.68 ? 311 LEU C CG  1 
ATOM 7613  C CD1 . LEU C 1 311 ? -22.827 -32.109 20.499  1.00 52.68 ? 311 LEU C CD1 1 
ATOM 7614  C CD2 . LEU C 1 311 ? -21.737 -29.910 20.966  1.00 52.68 ? 311 LEU C CD2 1 
ATOM 7615  N N   . ASN C 1 312 ? -26.065 -30.355 23.834  1.00 41.74 ? 312 ASN C N   1 
ATOM 7616  C CA  . ASN C 1 312 ? -26.272 -30.584 25.248  1.00 41.74 ? 312 ASN C CA  1 
ATOM 7617  C C   . ASN C 1 312 ? -27.385 -31.591 25.500  1.00 41.74 ? 312 ASN C C   1 
ATOM 7618  O O   . ASN C 1 312 ? -27.334 -32.355 26.462  1.00 41.74 ? 312 ASN C O   1 
ATOM 7619  C CB  . ASN C 1 312 ? -26.605 -29.267 25.925  1.00 82.36 ? 312 ASN C CB  1 
ATOM 7620  C CG  . ASN C 1 312 ? -26.033 -29.184 27.302  1.00 82.36 ? 312 ASN C CG  1 
ATOM 7621  O OD1 . ASN C 1 312 ? -26.320 -30.026 28.151  1.00 82.36 ? 312 ASN C OD1 1 
ATOM 7622  N ND2 . ASN C 1 312 ? -25.203 -28.175 27.537  1.00 82.36 ? 312 ASN C ND2 1 
ATOM 7623  N N   . ALA C 1 313 ? -28.392 -31.584 24.633  1.00 38.36 ? 313 ALA C N   1 
ATOM 7624  C CA  . ALA C 1 313 ? -29.521 -32.502 24.744  1.00 38.36 ? 313 ALA C CA  1 
ATOM 7625  C C   . ALA C 1 313 ? -29.106 -33.903 24.312  1.00 38.36 ? 313 ALA C C   1 
ATOM 7626  O O   . ALA C 1 313 ? -29.276 -34.863 25.056  1.00 38.36 ? 313 ALA C O   1 
ATOM 7627  C CB  . ALA C 1 313 ? -30.677 -32.018 23.878  1.00 33.40 ? 313 ALA C CB  1 
ATOM 7628  N N   . TRP C 1 314 ? -28.570 -34.012 23.099  1.00 47.91 ? 314 TRP C N   1 
ATOM 7629  C CA  . TRP C 1 314 ? -28.124 -35.296 22.564  1.00 47.91 ? 314 TRP C CA  1 
ATOM 7630  C C   . TRP C 1 314 ? -27.310 -36.053 23.604  1.00 47.91 ? 314 TRP C C   1 
ATOM 7631  O O   . TRP C 1 314 ? -27.609 -37.203 23.934  1.00 47.91 ? 314 TRP C O   1 
ATOM 7632  C CB  . TRP C 1 314 ? -27.268 -35.072 21.327  1.00 41.56 ? 314 TRP C CB  1 
ATOM 7633  C CG  . TRP C 1 314 ? -26.692 -36.325 20.757  1.00 41.56 ? 314 TRP C CG  1 
ATOM 7634  C CD1 . TRP C 1 314 ? -27.376 -37.440 20.371  1.00 41.56 ? 314 TRP C CD1 1 
ATOM 7635  C CD2 . TRP C 1 314 ? -25.320 -36.558 20.423  1.00 41.56 ? 314 TRP C CD2 1 
ATOM 7636  N NE1 . TRP C 1 314 ? -26.516 -38.353 19.809  1.00 41.56 ? 314 TRP C NE1 1 
ATOM 7637  C CE2 . TRP C 1 314 ? -25.247 -37.836 19.828  1.00 41.56 ? 314 TRP C CE2 1 
ATOM 7638  C CE3 . TRP C 1 314 ? -24.144 -35.809 20.565  1.00 41.56 ? 314 TRP C CE3 1 
ATOM 7639  C CZ2 . TRP C 1 314 ? -24.042 -38.382 19.372  1.00 41.56 ? 314 TRP C CZ2 1 
ATOM 7640  C CZ3 . TRP C 1 314 ? -22.947 -36.353 20.112  1.00 41.56 ? 314 TRP C CZ3 1 
ATOM 7641  C CH2 . TRP C 1 314 ? -22.907 -37.628 19.522  1.00 41.56 ? 314 TRP C CH2 1 
ATOM 7642  N N   . ARG C 1 315 ? -26.264 -35.398 24.095  1.00 48.60 ? 315 ARG C N   1 
ATOM 7643  C CA  . ARG C 1 315 ? -25.411 -35.975 25.121  1.00 48.60 ? 315 ARG C CA  1 
ATOM 7644  C C   . ARG C 1 315 ? -24.851 -37.355 24.728  1.00 48.60 ? 315 ARG C C   1 
ATOM 7645  O O   . ARG C 1 315 ? -24.453 -38.146 25.584  1.00 48.60 ? 315 ARG C O   1 
ATOM 7646  C CB  . ARG C 1 315 ? -26.221 -36.050 26.412  1.00 80.02 ? 315 ARG C CB  1 
ATOM 7647  C CG  . ARG C 1 315 ? -25.407 -36.146 27.668  1.00 80.02 ? 315 ARG C CG  1 
ATOM 7648  C CD  . ARG C 1 315 ? -26.159 -35.502 28.815  1.00 80.02 ? 315 ARG C CD  1 
ATOM 7649  N NE  . ARG C 1 315 ? -25.976 -34.054 28.829  1.00 80.02 ? 315 ARG C NE  1 
ATOM 7650  C CZ  . ARG C 1 315 ? -24.828 -33.452 29.135  1.00 80.02 ? 315 ARG C CZ  1 
ATOM 7651  N NH1 . ARG C 1 315 ? -23.755 -34.173 29.456  1.00 80.02 ? 315 ARG C NH1 1 
ATOM 7652  N NH2 . ARG C 1 315 ? -24.751 -32.126 29.128  1.00 80.02 ? 315 ARG C NH2 1 
ATOM 7653  N N   . GLY C 1 316 ? -24.816 -37.631 23.425  1.00 50.22 ? 316 GLY C N   1 
ATOM 7654  C CA  . GLY C 1 316 ? -24.295 -38.899 22.944  1.00 50.22 ? 316 GLY C CA  1 
ATOM 7655  C C   . GLY C 1 316 ? -25.297 -40.040 22.927  1.00 50.22 ? 316 GLY C C   1 
ATOM 7656  O O   . GLY C 1 316 ? -25.027 -41.090 22.349  1.00 50.22 ? 316 GLY C O   1 
ATOM 7657  N N   . GLN C 1 317 ? -26.457 -39.839 23.547  1.00 53.44 ? 317 GLN C N   1 
ATOM 7658  C CA  . GLN C 1 317 ? -27.488 -40.874 23.609  1.00 53.44 ? 317 GLN C CA  1 
ATOM 7659  C C   . GLN C 1 317 ? -28.320 -41.006 22.343  1.00 53.44 ? 317 GLN C C   1 
ATOM 7660  O O   . GLN C 1 317 ? -28.839 -40.015 21.826  1.00 53.44 ? 317 GLN C O   1 
ATOM 7661  C CB  . GLN C 1 317 ? -28.407 -40.610 24.799  1.00 89.59 ? 317 GLN C CB  1 
ATOM 7662  C CG  . GLN C 1 317 ? -27.697 -40.776 26.115  1.00 89.59 ? 317 GLN C CG  1 
ATOM 7663  C CD  . GLN C 1 317 ? -26.984 -42.106 26.185  1.00 89.59 ? 317 GLN C CD  1 
ATOM 7664  O OE1 . GLN C 1 317 ? -27.619 -43.162 26.226  1.00 89.59 ? 317 GLN C OE1 1 
ATOM 7665  N NE2 . GLN C 1 317 ? -25.655 -42.067 26.179  1.00 89.59 ? 317 GLN C NE2 1 
ATOM 7666  N N   . ARG C 1 318 ? -28.464 -42.237 21.854  1.00 45.23 ? 318 ARG C N   1 
ATOM 7667  C CA  . ARG C 1 318 ? -29.234 -42.469 20.637  1.00 45.23 ? 318 ARG C CA  1 
ATOM 7668  C C   . ARG C 1 318 ? -30.700 -42.085 20.787  1.00 45.23 ? 318 ARG C C   1 
ATOM 7669  O O   . ARG C 1 318 ? -31.362 -41.753 19.803  1.00 45.23 ? 318 ARG C O   1 
ATOM 7670  C CB  . ARG C 1 318 ? -29.152 -43.927 20.193  1.00 96.66 ? 318 ARG C CB  1 
ATOM 7671  C CG  . ARG C 1 318 ? -29.784 -44.115 18.832  1.00 96.66 ? 318 ARG C CG  1 
ATOM 7672  C CD  . ARG C 1 318 ? -29.951 -45.562 18.434  1.00 96.66 ? 318 ARG C CD  1 
ATOM 7673  N NE  . ARG C 1 318 ? -30.535 -45.654 17.094  1.00 96.66 ? 318 ARG C NE  1 
ATOM 7674  C CZ  . ARG C 1 318 ? -30.930 -46.784 16.508  1.00 96.66 ? 318 ARG C CZ  1 
ATOM 7675  N NH1 . ARG C 1 318 ? -30.812 -47.946 17.142  1.00 96.66 ? 318 ARG C NH1 1 
ATOM 7676  N NH2 . ARG C 1 318 ? -31.444 -46.752 15.282  1.00 96.66 ? 318 ARG C NH2 1 
ATOM 7677  N N   . ASP C 1 319 ? -31.208 -42.135 22.017  1.00 74.18 ? 319 ASP C N   1 
ATOM 7678  C CA  . ASP C 1 319 ? -32.603 -41.788 22.274  1.00 74.18 ? 319 ASP C CA  1 
ATOM 7679  C C   . ASP C 1 319 ? -32.788 -40.283 22.217  1.00 74.18 ? 319 ASP C C   1 
ATOM 7680  O O   . ASP C 1 319 ? -33.749 -39.784 21.623  1.00 74.18 ? 319 ASP C O   1 
ATOM 7681  C CB  . ASP C 1 319 ? -33.051 -42.292 23.650  1.00 95.30 ? 319 ASP C CB  1 
ATOM 7682  C CG  . ASP C 1 319 ? -31.951 -43.021 24.393  1.00 95.30 ? 319 ASP C CG  1 
ATOM 7683  O OD1 . ASP C 1 319 ? -31.427 -44.015 23.845  1.00 95.30 ? 319 ASP C OD1 1 
ATOM 7684  O OD2 . ASP C 1 319 ? -31.618 -42.606 25.527  1.00 95.30 ? 319 ASP C OD2 1 
ATOM 7685  N N   . ASN C 1 320 ? -31.854 -39.563 22.834  1.00 50.01 ? 320 ASN C N   1 
ATOM 7686  C CA  . ASN C 1 320 ? -31.909 -38.107 22.873  1.00 50.01 ? 320 ASN C CA  1 
ATOM 7687  C C   . ASN C 1 320 ? -31.760 -37.452 21.499  1.00 50.01 ? 320 ASN C C   1 
ATOM 7688  O O   . ASN C 1 320 ? -31.898 -36.234 21.366  1.00 50.01 ? 320 ASN C O   1 
ATOM 7689  C CB  . ASN C 1 320 ? -30.838 -37.588 23.823  1.00 67.18 ? 320 ASN C CB  1 
ATOM 7690  C CG  . ASN C 1 320 ? -30.992 -38.148 25.217  1.00 67.18 ? 320 ASN C CG  1 
ATOM 7691  O OD1 . ASN C 1 320 ? -30.170 -37.892 26.094  1.00 67.18 ? 320 ASN C OD1 1 
ATOM 7692  N ND2 . ASN C 1 320 ? -32.055 -38.922 25.432  1.00 67.18 ? 320 ASN C ND2 1 
ATOM 7693  N N   . ALA C 1 321 ? -31.492 -38.269 20.481  1.00 49.86 ? 321 ALA C N   1 
ATOM 7694  C CA  . ALA C 1 321 ? -31.330 -37.789 19.113  1.00 49.86 ? 321 ALA C CA  1 
ATOM 7695  C C   . ALA C 1 321 ? -32.421 -36.801 18.683  1.00 49.86 ? 321 ALA C C   1 
ATOM 7696  O O   . ALA C 1 321 ? -32.130 -35.657 18.309  1.00 49.86 ? 321 ALA C O   1 
ATOM 7697  C CB  . ALA C 1 321 ? -31.310 -38.971 18.162  1.00 36.69 ? 321 ALA C CB  1 
ATOM 7698  N N   . GLY C 1 322 ? -33.674 -37.251 18.738  1.00 37.78 ? 322 GLY C N   1 
ATOM 7699  C CA  . GLY C 1 322 ? -34.797 -36.416 18.343  1.00 37.78 ? 322 GLY C CA  1 
ATOM 7700  C C   . GLY C 1 322 ? -34.921 -35.126 19.131  1.00 37.78 ? 322 GLY C C   1 
ATOM 7701  O O   . GLY C 1 322 ? -35.261 -34.079 18.579  1.00 37.78 ? 322 GLY C O   1 
ATOM 7702  N N   . ALA C 1 323 ? -34.656 -35.202 20.429  1.00 47.34 ? 323 ALA C N   1 
ATOM 7703  C CA  . ALA C 1 323 ? -34.730 -34.024 21.278  1.00 47.34 ? 323 ALA C CA  1 
ATOM 7704  C C   . ALA C 1 323 ? -33.650 -33.048 20.839  1.00 47.34 ? 323 ALA C C   1 
ATOM 7705  O O   . ALA C 1 323 ? -33.891 -31.845 20.715  1.00 47.34 ? 323 ALA C O   1 
ATOM 7706  C CB  . ALA C 1 323 ? -34.515 -34.417 22.724  1.00 37.01 ? 323 ALA C CB  1 
ATOM 7707  N N   . ALA C 1 324 ? -32.452 -33.580 20.612  1.00 48.60 ? 324 ALA C N   1 
ATOM 7708  C CA  . ALA C 1 324 ? -31.325 -32.778 20.177  1.00 48.60 ? 324 ALA C CA  1 
ATOM 7709  C C   . ALA C 1 324 ? -31.712 -32.066 18.893  1.00 48.60 ? 324 ALA C C   1 
ATOM 7710  O O   . ALA C 1 324 ? -31.557 -30.851 18.773  1.00 48.60 ? 324 ALA C O   1 
ATOM 7711  C CB  . ALA C 1 324 ? -30.127 -33.667 19.939  1.00 32.68 ? 324 ALA C CB  1 
ATOM 7712  N N   . THR C 1 325 ? -32.227 -32.831 17.938  1.00 31.08 ? 325 THR C N   1 
ATOM 7713  C CA  . THR C 1 325 ? -32.648 -32.278 16.657  1.00 31.08 ? 325 THR C CA  1 
ATOM 7714  C C   . THR C 1 325 ? -33.667 -31.164 16.843  1.00 31.08 ? 325 THR C C   1 
ATOM 7715  O O   . THR C 1 325 ? -33.691 -30.196 16.083  1.00 31.08 ? 325 THR C O   1 
ATOM 7716  C CB  . THR C 1 325 ? -33.277 -33.352 15.769  1.00 24.25 ? 325 THR C CB  1 
ATOM 7717  O OG1 . THR C 1 325 ? -32.357 -34.441 15.626  1.00 24.25 ? 325 THR C OG1 1 
ATOM 7718  C CG2 . THR C 1 325 ? -33.615 -32.782 14.389  1.00 24.25 ? 325 THR C CG2 1 
ATOM 7719  N N   . GLU C 1 326 ? -34.522 -31.308 17.849  1.00 33.77 ? 326 GLU C N   1 
ATOM 7720  C CA  . GLU C 1 326 ? -35.527 -30.288 18.119  1.00 33.77 ? 326 GLU C CA  1 
ATOM 7721  C C   . GLU C 1 326 ? -34.852 -29.020 18.611  1.00 33.77 ? 326 GLU C C   1 
ATOM 7722  O O   . GLU C 1 326 ? -35.156 -27.922 18.143  1.00 33.77 ? 326 GLU C O   1 
ATOM 7723  C CB  . GLU C 1 326 ? -36.530 -30.766 19.173  1.00 51.41 ? 326 GLU C CB  1 
ATOM 7724  C CG  . GLU C 1 326 ? -37.596 -31.707 18.642  1.00 51.41 ? 326 GLU C CG  1 
ATOM 7725  C CD  . GLU C 1 326 ? -38.370 -31.116 17.473  1.00 51.41 ? 326 GLU C CD  1 
ATOM 7726  O OE1 . GLU C 1 326 ? -38.973 -30.029 17.625  1.00 51.41 ? 326 GLU C OE1 1 
ATOM 7727  O OE2 . GLU C 1 326 ? -38.371 -31.754 16.399  1.00 51.41 ? 326 GLU C OE2 1 
ATOM 7728  N N   . GLU C 1 327 ? -33.932 -29.180 19.557  1.00 43.59 ? 327 GLU C N   1 
ATOM 7729  C CA  . GLU C 1 327 ? -33.228 -28.037 20.110  1.00 43.59 ? 327 GLU C CA  1 
ATOM 7730  C C   . GLU C 1 327 ? -32.595 -27.219 18.992  1.00 43.59 ? 327 GLU C C   1 
ATOM 7731  O O   . GLU C 1 327 ? -32.606 -25.986 19.034  1.00 43.59 ? 327 GLU C O   1 
ATOM 7732  C CB  . GLU C 1 327 ? -32.173 -28.506 21.109  1.00 62.31 ? 327 GLU C CB  1 
ATOM 7733  C CG  . GLU C 1 327 ? -32.297 -27.801 22.442  1.00 62.31 ? 327 GLU C CG  1 
ATOM 7734  C CD  . GLU C 1 327 ? -33.686 -27.936 23.042  1.00 62.31 ? 327 GLU C CD  1 
ATOM 7735  O OE1 . GLU C 1 327 ? -33.995 -27.224 24.023  1.00 62.31 ? 327 GLU C OE1 1 
ATOM 7736  O OE2 . GLU C 1 327 ? -34.468 -28.762 22.533  1.00 62.31 ? 327 GLU C OE2 1 
ATOM 7737  N N   . PHE C 1 328 ? -32.063 -27.913 17.989  1.00 32.24 ? 328 PHE C N   1 
ATOM 7738  C CA  . PHE C 1 328 ? -31.441 -27.264 16.843  1.00 32.24 ? 328 PHE C CA  1 
ATOM 7739  C C   . PHE C 1 328 ? -32.496 -26.527 16.017  1.00 32.24 ? 328 PHE C C   1 
ATOM 7740  O O   . PHE C 1 328 ? -32.423 -25.304 15.847  1.00 32.24 ? 328 PHE C O   1 
ATOM 7741  C CB  . PHE C 1 328 ? -30.710 -28.308 15.983  1.00 22.69 ? 328 PHE C CB  1 
ATOM 7742  C CG  . PHE C 1 328 ? -30.395 -27.844 14.577  1.00 22.69 ? 328 PHE C CG  1 
ATOM 7743  C CD1 . PHE C 1 328 ? -29.764 -26.622 14.348  1.00 22.69 ? 328 PHE C CD1 1 
ATOM 7744  C CD2 . PHE C 1 328 ? -30.748 -28.631 13.477  1.00 22.69 ? 328 PHE C CD2 1 
ATOM 7745  C CE1 . PHE C 1 328 ? -29.492 -26.188 13.041  1.00 22.69 ? 328 PHE C CE1 1 
ATOM 7746  C CE2 . PHE C 1 328 ? -30.480 -28.207 12.171  1.00 22.69 ? 328 PHE C CE2 1 
ATOM 7747  C CZ  . PHE C 1 328 ? -29.852 -26.981 11.955  1.00 22.69 ? 328 PHE C CZ  1 
ATOM 7748  N N   . ILE C 1 329 ? -33.478 -27.271 15.512  1.00 29.55 ? 329 ILE C N   1 
ATOM 7749  C CA  . ILE C 1 329 ? -34.544 -26.676 14.712  1.00 29.55 ? 329 ILE C CA  1 
ATOM 7750  C C   . ILE C 1 329 ? -35.119 -25.446 15.408  1.00 29.55 ? 329 ILE C C   1 
ATOM 7751  O O   . ILE C 1 329 ? -35.483 -24.468 14.753  1.00 29.55 ? 329 ILE C O   1 
ATOM 7752  C CB  . ILE C 1 329 ? -35.693 -27.677 14.458  1.00 25.56 ? 329 ILE C CB  1 
ATOM 7753  C CG1 . ILE C 1 329 ? -35.149 -28.919 13.746  1.00 25.56 ? 329 ILE C CG1 1 
ATOM 7754  C CG2 . ILE C 1 329 ? -36.780 -27.013 13.614  1.00 25.56 ? 329 ILE C CG2 1 
ATOM 7755  C CD1 . ILE C 1 329 ? -36.210 -29.916 13.321  1.00 25.56 ? 329 ILE C CD1 1 
ATOM 7756  N N   . LYS C 1 330 ? -35.195 -25.494 16.736  1.00 33.76 ? 330 LYS C N   1 
ATOM 7757  C CA  . LYS C 1 330 ? -35.731 -24.372 17.499  1.00 33.76 ? 330 LYS C CA  1 
ATOM 7758  C C   . LYS C 1 330 ? -34.881 -23.130 17.248  1.00 33.76 ? 330 LYS C C   1 
ATOM 7759  O O   . LYS C 1 330 ? -35.378 -22.121 16.751  1.00 33.76 ? 330 LYS C O   1 
ATOM 7760  C CB  . LYS C 1 330 ? -35.767 -24.699 18.998  1.00 79.06 ? 330 LYS C CB  1 
ATOM 7761  C CG  . LYS C 1 330 ? -36.631 -23.735 19.816  1.00 79.06 ? 330 LYS C CG  1 
ATOM 7762  C CD  . LYS C 1 330 ? -36.682 -24.092 21.310  1.00 79.06 ? 330 LYS C CD  1 
ATOM 7763  C CE  . LYS C 1 330 ? -37.371 -25.439 21.583  1.00 79.06 ? 330 LYS C CE  1 
ATOM 7764  N NZ  . LYS C 1 330 ? -37.465 -25.752 23.048  1.00 79.06 ? 330 LYS C NZ  1 
ATOM 7765  N N   . ARG C 1 331 ? -33.592 -23.218 17.570  1.00 35.22 ? 331 ARG C N   1 
ATOM 7766  C CA  . ARG C 1 331 ? -32.680 -22.097 17.380  1.00 35.22 ? 331 ARG C CA  1 
ATOM 7767  C C   . ARG C 1 331 ? -32.617 -21.694 15.909  1.00 35.22 ? 331 ARG C C   1 
ATOM 7768  O O   . ARG C 1 331 ? -32.568 -20.507 15.583  1.00 35.22 ? 331 ARG C O   1 
ATOM 7769  C CB  . ARG C 1 331 ? -31.290 -22.472 17.869  1.00 35.99 ? 331 ARG C CB  1 
ATOM 7770  C CG  . ARG C 1 331 ? -31.297 -23.099 19.232  1.00 35.99 ? 331 ARG C CG  1 
ATOM 7771  C CD  . ARG C 1 331 ? -30.965 -22.112 20.322  1.00 35.99 ? 331 ARG C CD  1 
ATOM 7772  N NE  . ARG C 1 331 ? -31.944 -21.043 20.503  1.00 35.99 ? 331 ARG C NE  1 
ATOM 7773  C CZ  . ARG C 1 331 ? -31.744 -19.781 20.136  1.00 35.99 ? 331 ARG C CZ  1 
ATOM 7774  N NH1 . ARG C 1 331 ? -30.597 -19.424 19.551  1.00 35.99 ? 331 ARG C NH1 1 
ATOM 7775  N NH2 . ARG C 1 331 ? -32.671 -18.864 20.388  1.00 35.99 ? 331 ARG C NH2 1 
ATOM 7776  N N   . ALA C 1 332 ? -32.615 -22.678 15.017  1.00 27.05 ? 332 ALA C N   1 
ATOM 7777  C CA  . ALA C 1 332 ? -32.563 -22.376 13.594  1.00 27.05 ? 332 ALA C CA  1 
ATOM 7778  C C   . ALA C 1 332 ? -33.752 -21.493 13.207  1.00 27.05 ? 332 ALA C C   1 
ATOM 7779  O O   . ALA C 1 332 ? -33.618 -20.543 12.432  1.00 27.05 ? 332 ALA C O   1 
ATOM 7780  C CB  . ALA C 1 332 ? -32.576 -23.662 12.786  1.00 26.97 ? 332 ALA C CB  1 
ATOM 7781  N N   . GLU C 1 333 ? -34.918 -21.803 13.760  1.00 32.34 ? 333 GLU C N   1 
ATOM 7782  C CA  . GLU C 1 333 ? -36.108 -21.037 13.447  1.00 32.34 ? 333 GLU C CA  1 
ATOM 7783  C C   . GLU C 1 333 ? -36.086 -19.640 14.035  1.00 32.34 ? 333 GLU C C   1 
ATOM 7784  O O   . GLU C 1 333 ? -36.360 -18.663 13.333  1.00 32.34 ? 333 GLU C O   1 
ATOM 7785  C CB  . GLU C 1 333 ? -37.344 -21.800 13.905  1.00 48.62 ? 333 GLU C CB  1 
ATOM 7786  C CG  . GLU C 1 333 ? -37.856 -22.752 12.840  1.00 48.62 ? 333 GLU C CG  1 
ATOM 7787  C CD  . GLU C 1 333 ? -38.877 -23.739 13.359  1.00 48.62 ? 333 GLU C CD  1 
ATOM 7788  O OE1 . GLU C 1 333 ? -39.504 -24.432 12.529  1.00 48.62 ? 333 GLU C OE1 1 
ATOM 7789  O OE2 . GLU C 1 333 ? -39.045 -23.831 14.592  1.00 48.62 ? 333 GLU C OE2 1 
ATOM 7790  N N   . VAL C 1 334 ? -35.750 -19.532 15.316  1.00 27.43 ? 334 VAL C N   1 
ATOM 7791  C CA  . VAL C 1 334 ? -35.713 -18.219 15.945  1.00 27.43 ? 334 VAL C CA  1 
ATOM 7792  C C   . VAL C 1 334 ? -34.727 -17.303 15.236  1.00 27.43 ? 334 VAL C C   1 
ATOM 7793  O O   . VAL C 1 334 ? -35.035 -16.137 14.980  1.00 27.43 ? 334 VAL C O   1 
ATOM 7794  C CB  . VAL C 1 334 ? -35.352 -18.302 17.462  1.00 17.58 ? 334 VAL C CB  1 
ATOM 7795  C CG1 . VAL C 1 334 ? -34.630 -19.586 17.754  1.00 17.58 ? 334 VAL C CG1 1 
ATOM 7796  C CG2 . VAL C 1 334 ? -34.483 -17.115 17.871  1.00 17.58 ? 334 VAL C CG2 1 
ATOM 7797  N N   . ASN C 1 335 ? -33.549 -17.822 14.907  1.00 31.54 ? 335 ASN C N   1 
ATOM 7798  C CA  . ASN C 1 335 ? -32.556 -16.998 14.236  1.00 31.54 ? 335 ASN C CA  1 
ATOM 7799  C C   . ASN C 1 335 ? -33.035 -16.640 12.850  1.00 31.54 ? 335 ASN C C   1 
ATOM 7800  O O   . ASN C 1 335 ? -32.689 -15.587 12.323  1.00 31.54 ? 335 ASN C O   1 
ATOM 7801  C CB  . ASN C 1 335 ? -31.198 -17.704 14.202  1.00 33.72 ? 335 ASN C CB  1 
ATOM 7802  C CG  . ASN C 1 335 ? -30.499 -17.661 15.555  1.00 33.72 ? 335 ASN C CG  1 
ATOM 7803  O OD1 . ASN C 1 335 ? -30.306 -16.585 16.128  1.00 33.72 ? 335 ASN C OD1 1 
ATOM 7804  N ND2 . ASN C 1 335 ? -30.125 -18.826 16.076  1.00 33.72 ? 335 ASN C ND2 1 
ATOM 7805  N N   . GLY C 1 336 ? -33.854 -17.511 12.271  1.00 30.02 ? 336 GLY C N   1 
ATOM 7806  C CA  . GLY C 1 336 ? -34.399 -17.235 10.953  1.00 30.02 ? 336 GLY C CA  1 
ATOM 7807  C C   . GLY C 1 336 ? -35.324 -16.034 11.071  1.00 30.02 ? 336 GLY C C   1 
ATOM 7808  O O   . GLY C 1 336 ? -35.539 -15.294 10.108  1.00 30.02 ? 336 GLY C O   1 
ATOM 7809  N N   . LEU C 1 337 ? -35.879 -15.850 12.267  1.00 29.38 ? 337 LEU C N   1 
ATOM 7810  C CA  . LEU C 1 337 ? -36.766 -14.726 12.539  1.00 29.38 ? 337 LEU C CA  1 
ATOM 7811  C C   . LEU C 1 337 ? -35.929 -13.498 12.837  1.00 29.38 ? 337 LEU C C   1 
ATOM 7812  O O   . LEU C 1 337 ? -36.199 -12.413 12.326  1.00 29.38 ? 337 LEU C O   1 
ATOM 7813  C CB  . LEU C 1 337 ? -37.658 -15.016 13.744  1.00 25.06 ? 337 LEU C CB  1 
ATOM 7814  C CG  . LEU C 1 337 ? -38.832 -15.979 13.577  1.00 25.06 ? 337 LEU C CG  1 
ATOM 7815  C CD1 . LEU C 1 337 ? -39.545 -16.092 14.914  1.00 25.06 ? 337 LEU C CD1 1 
ATOM 7816  C CD2 . LEU C 1 337 ? -39.788 -15.479 12.494  1.00 25.06 ? 337 LEU C CD2 1 
ATOM 7817  N N   . ALA C 1 338 ? -34.917 -13.677 13.682  1.00 35.35 ? 338 ALA C N   1 
ATOM 7818  C CA  . ALA C 1 338 ? -34.022 -12.590 14.049  1.00 35.35 ? 338 ALA C CA  1 
ATOM 7819  C C   . ALA C 1 338 ? -33.374 -12.027 12.790  1.00 35.35 ? 338 ALA C C   1 
ATOM 7820  O O   . ALA C 1 338 ? -32.994 -10.859 12.741  1.00 35.35 ? 338 ALA C O   1 
ATOM 7821  C CB  . ALA C 1 338 ? -32.957 -13.092 14.998  1.00 18.74 ? 338 ALA C CB  1 
ATOM 7822  N N   . ALA C 1 339 ? -33.255 -12.873 11.773  1.00 28.84 ? 339 ALA C N   1 
ATOM 7823  C CA  . ALA C 1 339 ? -32.662 -12.475 10.508  1.00 28.84 ? 339 ALA C CA  1 
ATOM 7824  C C   . ALA C 1 339 ? -33.590 -11.546 9.740   1.00 28.84 ? 339 ALA C C   1 
ATOM 7825  O O   . ALA C 1 339 ? -33.275 -11.135 8.621   1.00 28.84 ? 339 ALA C O   1 
ATOM 7826  C CB  . ALA C 1 339 ? -32.352 -13.702 9.670   1.00 30.10 ? 339 ALA C CB  1 
ATOM 7827  N N   . GLN C 1 340 ? -34.742 -11.229 10.328  1.00 41.60 ? 340 GLN C N   1 
ATOM 7828  C CA  . GLN C 1 340 ? -35.708 -10.335 9.693   1.00 41.60 ? 340 GLN C CA  1 
ATOM 7829  C C   . GLN C 1 340 ? -36.199 -9.339  10.726  1.00 41.60 ? 340 GLN C C   1 
ATOM 7830  O O   . GLN C 1 340 ? -37.143 -8.586  10.477  1.00 41.60 ? 340 GLN C O   1 
ATOM 7831  C CB  . GLN C 1 340 ? -36.901 -11.112 9.160   1.00 54.60 ? 340 GLN C CB  1 
ATOM 7832  C CG  . GLN C 1 340 ? -36.543 -12.394 8.465   1.00 54.60 ? 340 GLN C CG  1 
ATOM 7833  C CD  . GLN C 1 340 ? -37.766 -13.115 7.955   1.00 54.60 ? 340 GLN C CD  1 
ATOM 7834  O OE1 . GLN C 1 340 ? -38.461 -12.617 7.068   1.00 54.60 ? 340 GLN C OE1 1 
ATOM 7835  N NE2 . GLN C 1 340 ? -38.046 -14.293 8.515   1.00 54.60 ? 340 GLN C NE2 1 
ATOM 7836  N N   . GLY C 1 341 ? -35.559 -9.358  11.894  1.00 50.56 ? 341 GLY C N   1 
ATOM 7837  C CA  . GLY C 1 341 ? -35.920 -8.455  12.970  1.00 50.56 ? 341 GLY C CA  1 
ATOM 7838  C C   . GLY C 1 341 ? -37.273 -8.765  13.567  1.00 50.56 ? 341 GLY C C   1 
ATOM 7839  O O   . GLY C 1 341 ? -37.779 -8.032  14.420  1.00 50.56 ? 341 GLY C O   1 
ATOM 7840  N N   . LYS C 1 342 ? -37.867 -9.861  13.119  1.00 37.53 ? 342 LYS C N   1 
ATOM 7841  C CA  . LYS C 1 342 ? -39.171 -10.242 13.620  1.00 37.53 ? 342 LYS C CA  1 
ATOM 7842  C C   . LYS C 1 342 ? -39.107 -11.409 14.594  1.00 37.53 ? 342 LYS C C   1 
ATOM 7843  O O   . LYS C 1 342 ? -39.732 -12.443 14.385  1.00 37.53 ? 342 LYS C O   1 
ATOM 7844  C CB  . LYS C 1 342 ? -40.116 -10.557 12.453  1.00 49.78 ? 342 LYS C CB  1 
ATOM 7845  C CG  . LYS C 1 342 ? -39.578 -11.554 11.458  1.00 49.78 ? 342 LYS C CG  1 
ATOM 7846  C CD  . LYS C 1 342 ? -40.573 -11.810 10.328  1.00 49.78 ? 342 LYS C CD  1 
ATOM 7847  C CE  . LYS C 1 342 ? -40.828 -10.560 9.484   1.00 49.78 ? 342 LYS C CE  1 
ATOM 7848  N NZ  . LYS C 1 342 ? -41.715 -10.865 8.315   1.00 49.78 ? 342 LYS C NZ  1 
ATOM 7849  N N   . TYR C 1 343 ? -38.338 -11.238 15.659  1.00 41.63 ? 343 TYR C N   1 
ATOM 7850  C CA  . TYR C 1 343 ? -38.219 -12.268 16.676  1.00 41.63 ? 343 TYR C CA  1 
ATOM 7851  C C   . TYR C 1 343 ? -38.521 -11.616 18.003  1.00 41.63 ? 343 TYR C C   1 
ATOM 7852  O O   . TYR C 1 343 ? -37.872 -10.638 18.368  1.00 41.63 ? 343 TYR C O   1 
ATOM 7853  C CB  . TYR C 1 343 ? -36.805 -12.837 16.729  1.00 39.38 ? 343 TYR C CB  1 
ATOM 7854  C CG  . TYR C 1 343 ? -36.551 -13.656 17.979  1.00 39.38 ? 343 TYR C CG  1 
ATOM 7855  C CD1 . TYR C 1 343 ? -37.219 -14.861 18.200  1.00 39.38 ? 343 TYR C CD1 1 
ATOM 7856  C CD2 . TYR C 1 343 ? -35.649 -13.223 18.950  1.00 39.38 ? 343 TYR C CD2 1 
ATOM 7857  C CE1 . TYR C 1 343 ? -36.992 -15.615 19.356  1.00 39.38 ? 343 TYR C CE1 1 
ATOM 7858  C CE2 . TYR C 1 343 ? -35.414 -13.972 20.111  1.00 39.38 ? 343 TYR C CE2 1 
ATOM 7859  C CZ  . TYR C 1 343 ? -36.088 -15.167 20.303  1.00 39.38 ? 343 TYR C CZ  1 
ATOM 7860  O OH  . TYR C 1 343 ? -35.841 -15.921 21.426  1.00 39.38 ? 343 TYR C OH  1 
ATOM 7861  N N   . GLU C 1 344 ? -39.496 -12.147 18.730  1.00 65.49 ? 344 GLU C N   1 
ATOM 7862  C CA  . GLU C 1 344 ? -39.844 -11.578 20.026  1.00 68.90 ? 344 GLU C CA  1 
ATOM 7863  C C   . GLU C 1 344 ? -39.386 -12.512 21.151  1.00 70.86 ? 344 GLU C C   1 
ATOM 7864  O O   . GLU C 1 344 ? -39.183 -13.718 20.884  1.00 70.96 ? 344 GLU C O   1 
ATOM 7865  C CB  . GLU C 1 344 ? -41.356 -11.360 20.102  1.00 99.51 ? 344 GLU C CB  1 
ATOM 7866  C CG  . GLU C 1 344 ? -41.969 -10.698 18.851  1.00 88.63 ? 344 GLU C CG  1 
ATOM 7867  C CD  . GLU C 1 344 ? -42.226 -9.172  19.004  1.00 88.63 ? 344 GLU C CD  1 
ATOM 7868  O OE1 . GLU C 1 344 ? -42.888 -8.768  20.012  1.00 88.63 ? 344 GLU C OE1 1 
ATOM 7869  O OE2 . GLU C 1 344 ? -41.783 -8.379  18.113  1.00 88.63 ? 344 GLU C OE2 1 
ATOM 7870  N N   . HIS D 1 3   ? 5.332   -2.560  18.769  1.00 96.43 ? 3   HIS D N   1 
ATOM 7871  C CA  . HIS D 1 3   ? 5.068   -3.355  17.540  1.00 96.43 ? 3   HIS D CA  1 
ATOM 7872  C C   . HIS D 1 3   ? 6.286   -4.169  17.125  1.00 96.43 ? 3   HIS D C   1 
ATOM 7873  O O   . HIS D 1 3   ? 6.312   -4.765  16.045  1.00 96.43 ? 3   HIS D O   1 
ATOM 7874  C CB  . HIS D 1 3   ? 4.613   -2.437  16.387  1.00 91.83 ? 3   HIS D CB  1 
ATOM 7875  C CG  . HIS D 1 3   ? 5.213   -1.059  16.412  1.00 91.83 ? 3   HIS D CG  1 
ATOM 7876  N ND1 . HIS D 1 3   ? 4.715   -0.022  15.648  1.00 91.83 ? 3   HIS D ND1 1 
ATOM 7877  C CD2 . HIS D 1 3   ? 6.258   -0.545  17.106  1.00 91.83 ? 3   HIS D CD2 1 
ATOM 7878  C CE1 . HIS D 1 3   ? 5.424   1.070   15.872  1.00 91.83 ? 3   HIS D CE1 1 
ATOM 7879  N NE2 . HIS D 1 3   ? 6.367   0.780   16.753  1.00 91.83 ? 3   HIS D NE2 1 
ATOM 7880  N N   . SER D 1 4   ? 7.287   -4.198  18.004  1.00 81.35 ? 4   SER D N   1 
ATOM 7881  C CA  . SER D 1 4   ? 8.526   -4.938  17.762  1.00 81.35 ? 4   SER D CA  1 
ATOM 7882  C C   . SER D 1 4   ? 8.656   -6.170  18.670  1.00 81.35 ? 4   SER D C   1 
ATOM 7883  O O   . SER D 1 4   ? 9.106   -6.071  19.817  1.00 81.35 ? 4   SER D O   1 
ATOM 7884  C CB  . SER D 1 4   ? 9.739   -4.007  17.945  1.00 93.97 ? 4   SER D CB  1 
ATOM 7885  O OG  . SER D 1 4   ? 9.555   -3.087  19.016  1.00 93.97 ? 4   SER D OG  1 
ATOM 7886  N N   . TYR D 1 5   ? 8.245   -7.326  18.151  1.00 85.47 ? 5   TYR D N   1 
ATOM 7887  C CA  . TYR D 1 5   ? 8.315   -8.584  18.896  1.00 85.47 ? 5   TYR D CA  1 
ATOM 7888  C C   . TYR D 1 5   ? 9.310   -9.514  18.206  1.00 85.47 ? 5   TYR D C   1 
ATOM 7889  O O   . TYR D 1 5   ? 8.924   -10.373 17.408  1.00 85.47 ? 5   TYR D O   1 
ATOM 7890  C CB  . TYR D 1 5   ? 6.935   -9.239  18.963  1.00 87.62 ? 5   TYR D CB  1 
ATOM 7891  C CG  . TYR D 1 5   ? 5.924   -8.414  19.721  1.00 87.62 ? 5   TYR D CG  1 
ATOM 7892  C CD1 . TYR D 1 5   ? 5.425   -7.221  19.193  1.00 87.62 ? 5   TYR D CD1 1 
ATOM 7893  C CD2 . TYR D 1 5   ? 5.502   -8.800  20.988  1.00 87.62 ? 5   TYR D CD2 1 
ATOM 7894  C CE1 . TYR D 1 5   ? 4.532   -6.429  19.916  1.00 87.62 ? 5   TYR D CE1 1 
ATOM 7895  C CE2 . TYR D 1 5   ? 4.614   -8.019  21.718  1.00 87.62 ? 5   TYR D CE2 1 
ATOM 7896  C CZ  . TYR D 1 5   ? 4.133   -6.836  21.180  1.00 87.62 ? 5   TYR D CZ  1 
ATOM 7897  O OH  . TYR D 1 5   ? 3.269   -6.067  21.922  1.00 87.62 ? 5   TYR D OH  1 
ATOM 7898  N N   . PRO D 1 6   ? 10.608  -9.355  18.526  1.00 57.19 ? 6   PRO D N   1 
ATOM 7899  C CA  . PRO D 1 6   ? 11.745  -10.111 17.997  1.00 57.19 ? 6   PRO D CA  1 
ATOM 7900  C C   . PRO D 1 6   ? 11.437  -11.444 17.323  1.00 57.19 ? 6   PRO D C   1 
ATOM 7901  O O   . PRO D 1 6   ? 11.179  -12.458 17.980  1.00 57.19 ? 6   PRO D O   1 
ATOM 7902  C CB  . PRO D 1 6   ? 12.643  -10.249 19.215  1.00 68.88 ? 6   PRO D CB  1 
ATOM 7903  C CG  . PRO D 1 6   ? 12.519  -8.887  19.810  1.00 68.88 ? 6   PRO D CG  1 
ATOM 7904  C CD  . PRO D 1 6   ? 11.016  -8.619  19.739  1.00 68.88 ? 6   PRO D CD  1 
ATOM 7905  N N   . ALA D 1 7   ? 11.478  -11.422 15.995  1.00 53.78 ? 7   ALA D N   1 
ATOM 7906  C CA  . ALA D 1 7   ? 11.217  -12.610 15.198  1.00 53.78 ? 7   ALA D CA  1 
ATOM 7907  C C   . ALA D 1 7   ? 12.322  -13.635 15.420  1.00 53.78 ? 7   ALA D C   1 
ATOM 7908  O O   . ALA D 1 7   ? 12.060  -14.838 15.518  1.00 53.78 ? 7   ALA D O   1 
ATOM 7909  C CB  . ALA D 1 7   ? 11.144  -12.234 13.725  1.00 16.90 ? 7   ALA D CB  1 
ATOM 7910  N N   . LEU D 1 8   ? 13.557  -13.150 15.505  1.00 34.82 ? 8   LEU D N   1 
ATOM 7911  C CA  . LEU D 1 8   ? 14.706  -14.017 15.697  1.00 34.82 ? 8   LEU D CA  1 
ATOM 7912  C C   . LEU D 1 8   ? 15.571  -13.585 16.862  1.00 34.82 ? 8   LEU D C   1 
ATOM 7913  O O   . LEU D 1 8   ? 15.696  -12.392 17.146  1.00 34.82 ? 8   LEU D O   1 
ATOM 7914  C CB  . LEU D 1 8   ? 15.568  -14.024 14.440  1.00 22.47 ? 8   LEU D CB  1 
ATOM 7915  C CG  . LEU D 1 8   ? 14.915  -14.522 13.155  1.00 22.47 ? 8   LEU D CG  1 
ATOM 7916  C CD1 . LEU D 1 8   ? 15.838  -14.230 11.987  1.00 22.47 ? 8   LEU D CD1 1 
ATOM 7917  C CD2 . LEU D 1 8   ? 14.624  -16.015 13.263  1.00 22.47 ? 8   LEU D CD2 1 
ATOM 7918  N N   . SER D 1 9   ? 16.174  -14.569 17.521  1.00 31.44 ? 9   SER D N   1 
ATOM 7919  C CA  . SER D 1 9   ? 17.064  -14.314 18.640  1.00 31.44 ? 9   SER D CA  1 
ATOM 7920  C C   . SER D 1 9   ? 18.394  -13.911 18.034  1.00 31.44 ? 9   SER D C   1 
ATOM 7921  O O   . SER D 1 9   ? 18.599  -14.034 16.824  1.00 31.44 ? 9   SER D O   1 
ATOM 7922  C CB  . SER D 1 9   ? 17.271  -15.576 19.460  1.00 27.92 ? 9   SER D CB  1 
ATOM 7923  O OG  . SER D 1 9   ? 18.105  -16.477 18.762  1.00 27.92 ? 9   SER D OG  1 
ATOM 7924  N N   . ALA D 1 10  ? 19.302  -13.442 18.878  1.00 25.48 ? 10  ALA D N   1 
ATOM 7925  C CA  . ALA D 1 10  ? 20.613  -13.021 18.402  1.00 25.48 ? 10  ALA D CA  1 
ATOM 7926  C C   . ALA D 1 10  ? 21.352  -14.214 17.824  1.00 25.48 ? 10  ALA D C   1 
ATOM 7927  O O   . ALA D 1 10  ? 22.009  -14.113 16.790  1.00 25.48 ? 10  ALA D O   1 
ATOM 7928  C CB  . ALA D 1 10  ? 21.405  -12.421 19.540  1.00 12.72 ? 10  ALA D CB  1 
ATOM 7929  N N   . GLU D 1 11  ? 21.234  -15.346 18.504  1.00 31.95 ? 11  GLU D N   1 
ATOM 7930  C CA  . GLU D 1 11  ? 21.890  -16.566 18.069  1.00 31.95 ? 11  GLU D CA  1 
ATOM 7931  C C   . GLU D 1 11  ? 21.407  -16.926 16.675  1.00 31.95 ? 11  GLU D C   1 
ATOM 7932  O O   . GLU D 1 11  ? 22.205  -17.192 15.778  1.00 31.95 ? 11  GLU D O   1 
ATOM 7933  C CB  . GLU D 1 11  ? 21.547  -17.700 19.023  1.00 99.51 ? 11  GLU D CB  1 
ATOM 7934  C CG  . GLU D 1 11  ? 21.204  -17.228 20.418  1.00 99.51 ? 11  GLU D CG  1 
ATOM 7935  C CD  . GLU D 1 11  ? 22.223  -17.671 21.439  1.00 99.51 ? 11  GLU D CD  1 
ATOM 7936  O OE1 . GLU D 1 11  ? 22.417  -18.902 21.592  1.00 99.51 ? 11  GLU D OE1 1 
ATOM 7937  O OE2 . GLU D 1 11  ? 22.825  -16.787 22.087  1.00 99.51 ? 11  GLU D OE2 1 
ATOM 7938  N N   . GLN D 1 12  ? 20.090  -16.928 16.502  1.00 34.90 ? 12  GLN D N   1 
ATOM 7939  C CA  . GLN D 1 12  ? 19.473  -17.280 15.231  1.00 34.90 ? 12  GLN D CA  1 
ATOM 7940  C C   . GLN D 1 12  ? 19.894  -16.378 14.090  1.00 34.90 ? 12  GLN D C   1 
ATOM 7941  O O   . GLN D 1 12  ? 20.206  -16.856 12.998  1.00 34.90 ? 12  GLN D O   1 
ATOM 7942  C CB  . GLN D 1 12  ? 17.959  -17.249 15.369  1.00 42.60 ? 12  GLN D CB  1 
ATOM 7943  C CG  . GLN D 1 12  ? 17.444  -18.160 16.449  1.00 42.60 ? 12  GLN D CG  1 
ATOM 7944  C CD  . GLN D 1 12  ? 15.952  -18.071 16.599  1.00 42.60 ? 12  GLN D CD  1 
ATOM 7945  O OE1 . GLN D 1 12  ? 15.404  -16.999 16.849  1.00 42.60 ? 12  GLN D OE1 1 
ATOM 7946  N NE2 . GLN D 1 12  ? 15.279  -19.199 16.444  1.00 42.60 ? 12  GLN D NE2 1 
ATOM 7947  N N   . LYS D 1 13  ? 19.885  -15.072 14.333  1.00 36.32 ? 13  LYS D N   1 
ATOM 7948  C CA  . LYS D 1 13  ? 20.284  -14.133 13.302  1.00 36.32 ? 13  LYS D CA  1 
ATOM 7949  C C   . LYS D 1 13  ? 21.701  -14.484 12.870  1.00 36.32 ? 13  LYS D C   1 
ATOM 7950  O O   . LYS D 1 13  ? 22.021  -14.471 11.679  1.00 36.32 ? 13  LYS D O   1 
ATOM 7951  C CB  . LYS D 1 13  ? 20.259  -12.706 13.834  1.00 34.25 ? 13  LYS D CB  1 
ATOM 7952  C CG  . LYS D 1 13  ? 18.892  -12.153 14.179  1.00 34.25 ? 13  LYS D CG  1 
ATOM 7953  C CD  . LYS D 1 13  ? 19.061  -10.710 14.616  1.00 34.25 ? 13  LYS D CD  1 
ATOM 7954  C CE  . LYS D 1 13  ? 17.764  -10.057 15.047  1.00 34.25 ? 13  LYS D CE  1 
ATOM 7955  N NZ  . LYS D 1 13  ? 17.992  -8.604  15.384  1.00 34.25 ? 13  LYS D NZ  1 
ATOM 7956  N N   . LYS D 1 14  ? 22.547  -14.798 13.848  1.00 27.36 ? 14  LYS D N   1 
ATOM 7957  C CA  . LYS D 1 14  ? 23.936  -15.161 13.580  1.00 27.36 ? 14  LYS D CA  1 
ATOM 7958  C C   . LYS D 1 14  ? 23.986  -16.337 12.617  1.00 27.36 ? 14  LYS D C   1 
ATOM 7959  O O   . LYS D 1 14  ? 24.535  -16.223 11.523  1.00 27.36 ? 14  LYS D O   1 
ATOM 7960  C CB  . LYS D 1 14  ? 24.653  -15.529 14.884  1.00 63.46 ? 14  LYS D CB  1 
ATOM 7961  C CG  . LYS D 1 14  ? 26.126  -15.892 14.722  1.00 63.46 ? 14  LYS D CG  1 
ATOM 7962  C CD  . LYS D 1 14  ? 26.884  -14.814 13.956  1.00 63.46 ? 14  LYS D CD  1 
ATOM 7963  C CE  . LYS D 1 14  ? 26.652  -13.420 14.560  1.00 63.46 ? 14  LYS D CE  1 
ATOM 7964  N NZ  . LYS D 1 14  ? 27.118  -12.295 13.678  1.00 63.46 ? 14  LYS D NZ  1 
ATOM 7965  N N   . GLU D 1 15  ? 23.394  -17.460 13.020  1.00 21.49 ? 15  GLU D N   1 
ATOM 7966  C CA  . GLU D 1 15  ? 23.380  -18.658 12.191  1.00 21.49 ? 15  GLU D CA  1 
ATOM 7967  C C   . GLU D 1 15  ? 22.965  -18.378 10.757  1.00 21.49 ? 15  GLU D C   1 
ATOM 7968  O O   . GLU D 1 15  ? 23.580  -18.882 9.815   1.00 21.49 ? 15  GLU D O   1 
ATOM 7969  C CB  . GLU D 1 15  ? 22.446  -19.716 12.776  1.00 41.22 ? 15  GLU D CB  1 
ATOM 7970  C CG  . GLU D 1 15  ? 22.210  -20.868 11.812  1.00 41.22 ? 15  GLU D CG  1 
ATOM 7971  C CD  . GLU D 1 15  ? 21.373  -21.987 12.404  1.00 41.22 ? 15  GLU D CD  1 
ATOM 7972  O OE1 . GLU D 1 15  ? 20.372  -21.684 13.096  1.00 41.22 ? 15  GLU D OE1 1 
ATOM 7973  O OE2 . GLU D 1 15  ? 21.710  -23.172 12.163  1.00 41.22 ? 15  GLU D OE2 1 
ATOM 7974  N N   . LEU D 1 16  ? 21.918  -17.580 10.585  1.00 30.94 ? 16  LEU D N   1 
ATOM 7975  C CA  . LEU D 1 16  ? 21.447  -17.271 9.247   1.00 30.94 ? 16  LEU D CA  1 
ATOM 7976  C C   . LEU D 1 16  ? 22.501  -16.480 8.485   1.00 30.94 ? 16  LEU D C   1 
ATOM 7977  O O   . LEU D 1 16  ? 22.892  -16.857 7.378   1.00 30.94 ? 16  LEU D O   1 
ATOM 7978  C CB  . LEU D 1 16  ? 20.129  -16.496 9.320   1.00 18.37 ? 16  LEU D CB  1 
ATOM 7979  C CG  . LEU D 1 16  ? 18.933  -17.311 9.834   1.00 18.37 ? 16  LEU D CG  1 
ATOM 7980  C CD1 . LEU D 1 16  ? 17.751  -16.392 10.092  1.00 18.37 ? 16  LEU D CD1 1 
ATOM 7981  C CD2 . LEU D 1 16  ? 18.569  -18.389 8.816   1.00 18.37 ? 16  LEU D CD2 1 
ATOM 7982  N N   . SER D 1 17  ? 22.976  -15.396 9.090   1.00 27.91 ? 17  SER D N   1 
ATOM 7983  C CA  . SER D 1 17  ? 23.984  -14.562 8.452   1.00 27.91 ? 17  SER D CA  1 
ATOM 7984  C C   . SER D 1 17  ? 25.208  -15.360 8.030   1.00 27.91 ? 17  SER D C   1 
ATOM 7985  O O   . SER D 1 17  ? 25.708  -15.194 6.917   1.00 27.91 ? 17  SER D O   1 
ATOM 7986  C CB  . SER D 1 17  ? 24.428  -13.448 9.381   1.00 25.50 ? 17  SER D CB  1 
ATOM 7987  O OG  . SER D 1 17  ? 25.427  -12.696 8.727   1.00 25.50 ? 17  SER D OG  1 
ATOM 7988  N N   . ASP D 1 18  ? 25.696  -16.216 8.924   1.00 26.62 ? 18  ASP D N   1 
ATOM 7989  C CA  . ASP D 1 18  ? 26.857  -17.036 8.617   1.00 26.62 ? 18  ASP D CA  1 
ATOM 7990  C C   . ASP D 1 18  ? 26.554  -17.875 7.384   1.00 26.62 ? 18  ASP D C   1 
ATOM 7991  O O   . ASP D 1 18  ? 27.229  -17.753 6.363   1.00 26.62 ? 18  ASP D O   1 
ATOM 7992  C CB  . ASP D 1 18  ? 27.219  -17.939 9.800   1.00 48.84 ? 18  ASP D CB  1 
ATOM 7993  C CG  . ASP D 1 18  ? 27.691  -17.149 11.027  1.00 48.84 ? 18  ASP D CG  1 
ATOM 7994  O OD1 . ASP D 1 18  ? 28.174  -15.999 10.863  1.00 48.84 ? 18  ASP D OD1 1 
ATOM 7995  O OD2 . ASP D 1 18  ? 27.595  -17.686 12.159  1.00 48.84 ? 18  ASP D OD2 1 
ATOM 7996  N N   . ILE D 1 19  ? 25.528  -18.712 7.471   1.00 19.21 ? 19  ILE D N   1 
ATOM 7997  C CA  . ILE D 1 19  ? 25.143  -19.549 6.344   1.00 19.21 ? 19  ILE D CA  1 
ATOM 7998  C C   . ILE D 1 19  ? 25.102  -18.752 5.047   1.00 19.21 ? 19  ILE D C   1 
ATOM 7999  O O   . ILE D 1 19  ? 25.609  -19.189 4.021   1.00 19.21 ? 19  ILE D O   1 
ATOM 8000  C CB  . ILE D 1 19  ? 23.755  -20.156 6.555   1.00 8.45  ? 19  ILE D CB  1 
ATOM 8001  C CG1 . ILE D 1 19  ? 23.765  -21.028 7.800   1.00 8.45  ? 19  ILE D CG1 1 
ATOM 8002  C CG2 . ILE D 1 19  ? 23.344  -20.957 5.332   1.00 8.45  ? 19  ILE D CG2 1 
ATOM 8003  C CD1 . ILE D 1 19  ? 22.451  -21.715 8.070   1.00 8.45  ? 19  ILE D CD1 1 
ATOM 8004  N N   . ALA D 1 20  ? 24.487  -17.580 5.096   1.00 29.37 ? 20  ALA D N   1 
ATOM 8005  C CA  . ALA D 1 20  ? 24.373  -16.751 3.910   1.00 29.37 ? 20  ALA D CA  1 
ATOM 8006  C C   . ALA D 1 20  ? 25.735  -16.409 3.336   1.00 29.37 ? 20  ALA D C   1 
ATOM 8007  O O   . ALA D 1 20  ? 25.994  -16.619 2.149   1.00 29.37 ? 20  ALA D O   1 
ATOM 8008  C CB  . ALA D 1 20  ? 23.624  -15.482 4.237   1.00 27.16 ? 20  ALA D CB  1 
ATOM 8009  N N   . LEU D 1 21  ? 26.604  -15.881 4.190   1.00 34.30 ? 21  LEU D N   1 
ATOM 8010  C CA  . LEU D 1 21  ? 27.942  -15.486 3.779   1.00 34.30 ? 21  LEU D CA  1 
ATOM 8011  C C   . LEU D 1 21  ? 28.794  -16.632 3.251   1.00 34.30 ? 21  LEU D C   1 
ATOM 8012  O O   . LEU D 1 21  ? 29.585  -16.442 2.329   1.00 34.30 ? 21  LEU D O   1 
ATOM 8013  C CB  . LEU D 1 21  ? 28.649  -14.809 4.942   1.00 8.52  ? 21  LEU D CB  1 
ATOM 8014  C CG  . LEU D 1 21  ? 27.975  -13.493 5.330   1.00 8.52  ? 21  LEU D CG  1 
ATOM 8015  C CD1 . LEU D 1 21  ? 28.478  -13.025 6.678   1.00 8.52  ? 21  LEU D CD1 1 
ATOM 8016  C CD2 . LEU D 1 21  ? 28.232  -12.459 4.254   1.00 8.52  ? 21  LEU D CD2 1 
ATOM 8017  N N   . ARG D 1 22  ? 28.646  -17.820 3.828   1.00 30.02 ? 22  ARG D N   1 
ATOM 8018  C CA  . ARG D 1 22  ? 29.420  -18.957 3.357   1.00 30.02 ? 22  ARG D CA  1 
ATOM 8019  C C   . ARG D 1 22  ? 29.070  -19.229 1.911   1.00 30.02 ? 22  ARG D C   1 
ATOM 8020  O O   . ARG D 1 22  ? 29.945  -19.463 1.078   1.00 30.02 ? 22  ARG D O   1 
ATOM 8021  C CB  . ARG D 1 22  ? 29.120  -20.201 4.178   1.00 51.33 ? 22  ARG D CB  1 
ATOM 8022  C CG  . ARG D 1 22  ? 29.608  -20.129 5.602   1.00 51.33 ? 22  ARG D CG  1 
ATOM 8023  C CD  . ARG D 1 22  ? 29.269  -21.413 6.293   1.00 51.33 ? 22  ARG D CD  1 
ATOM 8024  N NE  . ARG D 1 22  ? 29.737  -22.541 5.497   1.00 51.33 ? 22  ARG D NE  1 
ATOM 8025  C CZ  . ARG D 1 22  ? 29.273  -23.781 5.622   1.00 51.33 ? 22  ARG D CZ  1 
ATOM 8026  N NH1 . ARG D 1 22  ? 28.321  -24.044 6.515   1.00 51.33 ? 22  ARG D NH1 1 
ATOM 8027  N NH2 . ARG D 1 22  ? 29.764  -24.761 4.865   1.00 51.33 ? 22  ARG D NH2 1 
ATOM 8028  N N   . ILE D 1 23  ? 27.779  -19.194 1.615   1.00 30.88 ? 23  ILE D N   1 
ATOM 8029  C CA  . ILE D 1 23  ? 27.309  -19.457 0.270   1.00 30.88 ? 23  ILE D CA  1 
ATOM 8030  C C   . ILE D 1 23  ? 27.873  -18.473 -0.750  1.00 30.88 ? 23  ILE D C   1 
ATOM 8031  O O   . ILE D 1 23  ? 28.389  -18.891 -1.779  1.00 30.88 ? 23  ILE D O   1 
ATOM 8032  C CB  . ILE D 1 23  ? 25.768  -19.442 0.223   1.00 20.53 ? 23  ILE D CB  1 
ATOM 8033  C CG1 . ILE D 1 23  ? 25.227  -20.486 1.204   1.00 20.53 ? 23  ILE D CG1 1 
ATOM 8034  C CG2 . ILE D 1 23  ? 25.276  -19.735 -1.188  1.00 20.53 ? 23  ILE D CG2 1 
ATOM 8035  C CD1 . ILE D 1 23  ? 23.729  -20.495 1.341   1.00 20.53 ? 23  ILE D CD1 1 
ATOM 8036  N N   . VAL D 1 24  ? 27.802  -17.176 -0.473  1.00 35.21 ? 24  VAL D N   1 
ATOM 8037  C CA  . VAL D 1 24  ? 28.311  -16.211 -1.438  1.00 35.21 ? 24  VAL D CA  1 
ATOM 8038  C C   . VAL D 1 24  ? 29.753  -15.783 -1.244  1.00 35.21 ? 24  VAL D C   1 
ATOM 8039  O O   . VAL D 1 24  ? 30.182  -14.773 -1.797  1.00 35.21 ? 24  VAL D O   1 
ATOM 8040  C CB  . VAL D 1 24  ? 27.430  -14.957 -1.496  1.00 20.36 ? 24  VAL D CB  1 
ATOM 8041  C CG1 . VAL D 1 24  ? 26.100  -15.311 -2.130  1.00 20.36 ? 24  VAL D CG1 1 
ATOM 8042  C CG2 . VAL D 1 24  ? 27.228  -14.388 -0.108  1.00 20.36 ? 24  VAL D CG2 1 
ATOM 8043  N N   . ALA D 1 25  ? 30.503  -16.557 -0.467  1.00 35.46 ? 25  ALA D N   1 
ATOM 8044  C CA  . ALA D 1 25  ? 31.911  -16.258 -0.230  1.00 35.46 ? 25  ALA D CA  1 
ATOM 8045  C C   . ALA D 1 25  ? 32.596  -16.015 -1.570  1.00 35.46 ? 25  ALA D C   1 
ATOM 8046  O O   . ALA D 1 25  ? 32.229  -16.616 -2.582  1.00 35.46 ? 25  ALA D O   1 
ATOM 8047  C CB  . ALA D 1 25  ? 32.572  -17.408 0.479   1.00 25.78 ? 25  ALA D CB  1 
ATOM 8048  N N   . PRO D 1 26  ? 33.613  -15.139 -1.586  1.00 23.85 ? 26  PRO D N   1 
ATOM 8049  C CA  . PRO D 1 26  ? 34.395  -14.757 -2.767  1.00 23.85 ? 26  PRO D CA  1 
ATOM 8050  C C   . PRO D 1 26  ? 34.679  -15.872 -3.758  1.00 23.85 ? 26  PRO D C   1 
ATOM 8051  O O   . PRO D 1 26  ? 35.052  -16.976 -3.373  1.00 23.85 ? 26  PRO D O   1 
ATOM 8052  C CB  . PRO D 1 26  ? 35.664  -14.195 -2.156  1.00 17.34 ? 26  PRO D CB  1 
ATOM 8053  C CG  . PRO D 1 26  ? 35.140  -13.509 -0.937  1.00 17.34 ? 26  PRO D CG  1 
ATOM 8054  C CD  . PRO D 1 26  ? 34.207  -14.555 -0.369  1.00 17.34 ? 26  PRO D CD  1 
ATOM 8055  N N   . GLY D 1 27  ? 34.490  -15.576 -5.040  1.00 37.36 ? 27  GLY D N   1 
ATOM 8056  C CA  . GLY D 1 27  ? 34.748  -16.564 -6.070  1.00 37.36 ? 27  GLY D CA  1 
ATOM 8057  C C   . GLY D 1 27  ? 33.879  -17.806 -6.006  1.00 37.36 ? 27  GLY D C   1 
ATOM 8058  O O   . GLY D 1 27  ? 34.138  -18.780 -6.719  1.00 37.36 ? 27  GLY D O   1 
ATOM 8059  N N   . LYS D 1 28  ? 32.854  -17.774 -5.157  1.00 28.92 ? 28  LYS D N   1 
ATOM 8060  C CA  . LYS D 1 28  ? 31.936  -18.899 -5.012  1.00 28.92 ? 28  LYS D CA  1 
ATOM 8061  C C   . LYS D 1 28  ? 30.516  -18.575 -5.508  1.00 28.92 ? 28  LYS D C   1 
ATOM 8062  O O   . LYS D 1 28  ? 30.029  -17.440 -5.381  1.00 28.92 ? 28  LYS D O   1 
ATOM 8063  C CB  . LYS D 1 28  ? 31.886  -19.344 -3.550  1.00 28.40 ? 28  LYS D CB  1 
ATOM 8064  C CG  . LYS D 1 28  ? 33.072  -20.186 -3.101  1.00 28.40 ? 28  LYS D CG  1 
ATOM 8065  C CD  . LYS D 1 28  ? 33.164  -20.206 -1.575  1.00 28.40 ? 28  LYS D CD  1 
ATOM 8066  C CE  . LYS D 1 28  ? 34.149  -21.244 -1.050  1.00 28.40 ? 28  LYS D CE  1 
ATOM 8067  N NZ  . LYS D 1 28  ? 33.591  -22.616 -1.188  1.00 28.40 ? 28  LYS D NZ  1 
ATOM 8068  N N   . GLY D 1 29  ? 29.870  -19.585 -6.082  1.00 29.81 ? 29  GLY D N   1 
ATOM 8069  C CA  . GLY D 1 29  ? 28.525  -19.435 -6.595  1.00 29.81 ? 29  GLY D CA  1 
ATOM 8070  C C   . GLY D 1 29  ? 27.667  -20.624 -6.203  1.00 29.81 ? 29  GLY D C   1 
ATOM 8071  O O   . GLY D 1 29  ? 28.081  -21.465 -5.398  1.00 29.81 ? 29  GLY D O   1 
ATOM 8072  N N   . ILE D 1 30  ? 26.474  -20.709 -6.784  1.00 25.97 ? 30  ILE D N   1 
ATOM 8073  C CA  . ILE D 1 30  ? 25.539  -21.785 -6.465  1.00 25.97 ? 30  ILE D CA  1 
ATOM 8074  C C   . ILE D 1 30  ? 25.205  -22.681 -7.645  1.00 25.97 ? 30  ILE D C   1 
ATOM 8075  O O   . ILE D 1 30  ? 24.943  -22.195 -8.746  1.00 25.97 ? 30  ILE D O   1 
ATOM 8076  C CB  . ILE D 1 30  ? 24.194  -21.214 -5.937  1.00 13.86 ? 30  ILE D CB  1 
ATOM 8077  C CG1 . ILE D 1 30  ? 24.402  -20.502 -4.600  1.00 13.86 ? 30  ILE D CG1 1 
ATOM 8078  C CG2 . ILE D 1 30  ? 23.184  -22.329 -5.776  1.00 13.86 ? 30  ILE D CG2 1 
ATOM 8079  C CD1 . ILE D 1 30  ? 23.192  -19.744 -4.122  1.00 13.86 ? 30  ILE D CD1 1 
ATOM 8080  N N   . LEU D 1 31  ? 25.217  -23.990 -7.416  1.00 32.85 ? 31  LEU D N   1 
ATOM 8081  C CA  . LEU D 1 31  ? 24.840  -24.923 -8.463  1.00 32.85 ? 31  LEU D CA  1 
ATOM 8082  C C   . LEU D 1 31  ? 23.371  -25.192 -8.228  1.00 32.85 ? 31  LEU D C   1 
ATOM 8083  O O   . LEU D 1 31  ? 22.990  -25.717 -7.179  1.00 32.85 ? 31  LEU D O   1 
ATOM 8084  C CB  . LEU D 1 31  ? 25.586  -26.247 -8.355  1.00 18.31 ? 31  LEU D CB  1 
ATOM 8085  C CG  . LEU D 1 31  ? 24.908  -27.330 -9.211  1.00 18.31 ? 31  LEU D CG  1 
ATOM 8086  C CD1 . LEU D 1 31  ? 24.932  -26.918 -10.672 1.00 18.31 ? 31  LEU D CD1 1 
ATOM 8087  C CD2 . LEU D 1 31  ? 25.595  -28.667 -9.018  1.00 18.31 ? 31  LEU D CD2 1 
ATOM 8088  N N   . ALA D 1 32  ? 22.545  -24.832 -9.198  1.00 31.25 ? 32  ALA D N   1 
ATOM 8089  C CA  . ALA D 1 32  ? 21.115  -25.040 -9.072  1.00 31.25 ? 32  ALA D CA  1 
ATOM 8090  C C   . ALA D 1 32  ? 20.704  -26.330 -9.770  1.00 31.25 ? 32  ALA D C   1 
ATOM 8091  O O   . ALA D 1 32  ? 20.443  -26.339 -10.975 1.00 31.25 ? 32  ALA D O   1 
ATOM 8092  C CB  . ALA D 1 32  ? 20.365  -23.859 -9.665  1.00 27.14 ? 32  ALA D CB  1 
ATOM 8093  N N   . ALA D 1 33  ? 20.651  -27.418 -9.007  1.00 38.49 ? 33  ALA D N   1 
ATOM 8094  C CA  . ALA D 1 33  ? 20.263  -28.710 -9.552  1.00 38.49 ? 33  ALA D CA  1 
ATOM 8095  C C   . ALA D 1 33  ? 18.892  -29.107 -8.998  1.00 38.49 ? 33  ALA D C   1 
ATOM 8096  O O   . ALA D 1 33  ? 18.627  -30.283 -8.718  1.00 38.49 ? 33  ALA D O   1 
ATOM 8097  C CB  . ALA D 1 33  ? 21.307  -29.746 -9.186  1.00 29.51 ? 33  ALA D CB  1 
ATOM 8098  N N   . ASP D 1 34  ? 18.021  -28.115 -8.849  1.00 40.98 ? 34  ASP D N   1 
ATOM 8099  C CA  . ASP D 1 34  ? 16.682  -28.336 -8.310  1.00 40.98 ? 34  ASP D CA  1 
ATOM 8100  C C   . ASP D 1 34  ? 15.628  -28.563 -9.398  1.00 40.98 ? 34  ASP D C   1 
ATOM 8101  O O   . ASP D 1 34  ? 14.453  -28.232 -9.215  1.00 40.98 ? 34  ASP D O   1 
ATOM 8102  C CB  . ASP D 1 34  ? 16.279  -27.145 -7.426  1.00 46.35 ? 34  ASP D CB  1 
ATOM 8103  C CG  . ASP D 1 34  ? 16.225  -25.823 -8.198  1.00 46.35 ? 34  ASP D CG  1 
ATOM 8104  O OD1 . ASP D 1 34  ? 17.191  -25.512 -8.930  1.00 46.35 ? 34  ASP D OD1 1 
ATOM 8105  O OD2 . ASP D 1 34  ? 15.222  -25.079 -8.067  1.00 46.35 ? 34  ASP D OD2 1 
ATOM 8106  N N   . GLU D 1 35  ? 16.040  -29.142 -10.523 1.00 44.79 ? 35  GLU D N   1 
ATOM 8107  C CA  . GLU D 1 35  ? 15.105  -29.389 -11.620 1.00 44.79 ? 35  GLU D CA  1 
ATOM 8108  C C   . GLU D 1 35  ? 13.990  -30.365 -11.252 1.00 44.79 ? 35  GLU D C   1 
ATOM 8109  O O   . GLU D 1 35  ? 14.238  -31.528 -10.901 1.00 44.79 ? 35  GLU D O   1 
ATOM 8110  C CB  . GLU D 1 35  ? 15.833  -29.919 -12.864 1.00 43.44 ? 35  GLU D CB  1 
ATOM 8111  C CG  . GLU D 1 35  ? 16.759  -28.932 -13.555 1.00 43.44 ? 35  GLU D CG  1 
ATOM 8112  C CD  . GLU D 1 35  ? 18.179  -28.949 -13.005 1.00 43.44 ? 35  GLU D CD  1 
ATOM 8113  O OE1 . GLU D 1 35  ? 19.077  -28.421 -13.695 1.00 43.44 ? 35  GLU D OE1 1 
ATOM 8114  O OE2 . GLU D 1 35  ? 18.407  -29.481 -11.893 1.00 43.44 ? 35  GLU D OE2 1 
ATOM 8115  N N   . SER D 1 36  ? 12.754  -29.881 -11.338 1.00 53.59 ? 36  SER D N   1 
ATOM 8116  C CA  . SER D 1 36  ? 11.582  -30.701 -11.047 1.00 53.59 ? 36  SER D CA  1 
ATOM 8117  C C   . SER D 1 36  ? 11.595  -31.919 -11.965 1.00 53.59 ? 36  SER D C   1 
ATOM 8118  O O   . SER D 1 36  ? 12.147  -31.872 -13.068 1.00 53.59 ? 36  SER D O   1 
ATOM 8119  C CB  . SER D 1 36  ? 10.298  -29.893 -11.278 1.00 49.24 ? 36  SER D CB  1 
ATOM 8120  O OG  . SER D 1 36  ? 10.303  -29.261 -12.550 1.00 49.24 ? 36  SER D OG  1 
ATOM 8121  N N   . VAL D 1 37  ? 10.999  -33.015 -11.510 1.00 44.24 ? 37  VAL D N   1 
ATOM 8122  C CA  . VAL D 1 37  ? 10.956  -34.225 -12.322 1.00 44.24 ? 37  VAL D CA  1 
ATOM 8123  C C   . VAL D 1 37  ? 10.329  -33.901 -13.678 1.00 44.24 ? 37  VAL D C   1 
ATOM 8124  O O   . VAL D 1 37  ? 10.577  -34.579 -14.674 1.00 44.24 ? 37  VAL D O   1 
ATOM 8125  C CB  . VAL D 1 37  ? 10.143  -35.321 -11.616 1.00 34.20 ? 37  VAL D CB  1 
ATOM 8126  C CG1 . VAL D 1 37  ? 8.850   -34.725 -11.080 1.00 34.20 ? 37  VAL D CG1 1 
ATOM 8127  C CG2 . VAL D 1 37  ? 9.873   -36.472 -12.578 1.00 34.20 ? 37  VAL D CG2 1 
ATOM 8128  N N   . GLY D 1 38  ? 9.526   -32.844 -13.703 1.00 45.78 ? 38  GLY D N   1 
ATOM 8129  C CA  . GLY D 1 38  ? 8.887   -32.436 -14.936 1.00 45.78 ? 38  GLY D CA  1 
ATOM 8130  C C   . GLY D 1 38  ? 9.870   -31.786 -15.888 1.00 45.78 ? 38  GLY D C   1 
ATOM 8131  O O   . GLY D 1 38  ? 10.097  -32.285 -16.992 1.00 45.78 ? 38  GLY D O   1 
ATOM 8132  N N   . SER D 1 39  ? 10.457  -30.668 -15.469 1.00 51.21 ? 39  SER D N   1 
ATOM 8133  C CA  . SER D 1 39  ? 11.423  -29.966 -16.309 1.00 51.21 ? 39  SER D CA  1 
ATOM 8134  C C   . SER D 1 39  ? 12.607  -30.877 -16.617 1.00 51.21 ? 39  SER D C   1 
ATOM 8135  O O   . SER D 1 39  ? 13.267  -30.737 -17.648 1.00 51.21 ? 39  SER D O   1 
ATOM 8136  C CB  . SER D 1 39  ? 11.896  -28.678 -15.623 1.00 43.89 ? 39  SER D CB  1 
ATOM 8137  O OG  . SER D 1 39  ? 12.218  -28.899 -14.263 1.00 43.89 ? 39  SER D OG  1 
ATOM 8138  N N   . MET D 1 40  ? 12.859  -31.829 -15.725 1.00 48.67 ? 40  MET D N   1 
ATOM 8139  C CA  . MET D 1 40  ? 13.955  -32.759 -15.913 1.00 48.67 ? 40  MET D CA  1 
ATOM 8140  C C   . MET D 1 40  ? 13.661  -33.666 -17.105 1.00 48.67 ? 40  MET D C   1 
ATOM 8141  O O   . MET D 1 40  ? 14.573  -34.144 -17.778 1.00 48.67 ? 40  MET D O   1 
ATOM 8142  C CB  . MET D 1 40  ? 14.156  -33.601 -14.657 1.00 46.14 ? 40  MET D CB  1 
ATOM 8143  C CG  . MET D 1 40  ? 15.561  -34.161 -14.537 1.00 46.14 ? 40  MET D CG  1 
ATOM 8144  S SD  . MET D 1 40  ? 16.797  -32.851 -14.314 1.00 46.14 ? 40  MET D SD  1 
ATOM 8145  C CE  . MET D 1 40  ? 17.352  -32.589 -15.987 1.00 46.14 ? 40  MET D CE  1 
ATOM 8146  N N   . ALA D 1 41  ? 12.384  -33.905 -17.367 1.00 51.47 ? 41  ALA D N   1 
ATOM 8147  C CA  . ALA D 1 41  ? 12.006  -34.750 -18.489 1.00 51.47 ? 41  ALA D CA  1 
ATOM 8148  C C   . ALA D 1 41  ? 12.441  -34.082 -19.782 1.00 51.47 ? 41  ALA D C   1 
ATOM 8149  O O   . ALA D 1 41  ? 13.008  -34.724 -20.662 1.00 51.47 ? 41  ALA D O   1 
ATOM 8150  C CB  . ALA D 1 41  ? 10.511  -34.968 -18.497 1.00 31.36 ? 41  ALA D CB  1 
ATOM 8151  N N   . LYS D 1 42  ? 12.180  -32.785 -19.891 1.00 51.21 ? 42  LYS D N   1 
ATOM 8152  C CA  . LYS D 1 42  ? 12.551  -32.048 -21.089 1.00 51.21 ? 42  LYS D CA  1 
ATOM 8153  C C   . LYS D 1 42  ? 14.052  -32.054 -21.330 1.00 51.21 ? 42  LYS D C   1 
ATOM 8154  O O   . LYS D 1 42  ? 14.503  -32.294 -22.450 1.00 51.21 ? 42  LYS D O   1 
ATOM 8155  C CB  . LYS D 1 42  ? 12.053  -30.605 -21.010 1.00 92.04 ? 42  LYS D CB  1 
ATOM 8156  C CG  . LYS D 1 42  ? 10.552  -30.483 -21.129 1.00 92.04 ? 42  LYS D CG  1 
ATOM 8157  C CD  . LYS D 1 42  ? 10.140  -29.081 -21.538 1.00 92.04 ? 42  LYS D CD  1 
ATOM 8158  C CE  . LYS D 1 42  ? 8.664   -29.039 -21.934 1.00 92.04 ? 42  LYS D CE  1 
ATOM 8159  N NZ  . LYS D 1 42  ? 8.246   -27.708 -22.473 1.00 92.04 ? 42  LYS D NZ  1 
ATOM 8160  N N   . ARG D 1 43  ? 14.829  -31.796 -20.283 1.00 57.50 ? 43  ARG D N   1 
ATOM 8161  C CA  . ARG D 1 43  ? 16.277  -31.769 -20.429 1.00 57.50 ? 43  ARG D CA  1 
ATOM 8162  C C   . ARG D 1 43  ? 16.843  -33.122 -20.812 1.00 57.50 ? 43  ARG D C   1 
ATOM 8163  O O   . ARG D 1 43  ? 17.726  -33.207 -21.666 1.00 57.50 ? 43  ARG D O   1 
ATOM 8164  C CB  . ARG D 1 43  ? 16.929  -31.267 -19.151 1.00 80.36 ? 43  ARG D CB  1 
ATOM 8165  C CG  . ARG D 1 43  ? 16.546  -29.851 -18.856 1.00 80.36 ? 43  ARG D CG  1 
ATOM 8166  C CD  . ARG D 1 43  ? 17.472  -29.243 -17.857 1.00 80.36 ? 43  ARG D CD  1 
ATOM 8167  N NE  . ARG D 1 43  ? 17.034  -27.899 -17.494 1.00 80.36 ? 43  ARG D NE  1 
ATOM 8168  C CZ  . ARG D 1 43  ? 17.689  -27.107 -16.648 1.00 80.36 ? 43  ARG D CZ  1 
ATOM 8169  N NH1 . ARG D 1 43  ? 18.820  -27.530 -16.081 1.00 80.36 ? 43  ARG D NH1 1 
ATOM 8170  N NH2 . ARG D 1 43  ? 17.210  -25.898 -16.360 1.00 80.36 ? 43  ARG D NH2 1 
ATOM 8171  N N   . LEU D 1 44  ? 16.336  -34.179 -20.191 1.00 49.44 ? 44  LEU D N   1 
ATOM 8172  C CA  . LEU D 1 44  ? 16.812  -35.514 -20.511 1.00 49.44 ? 44  LEU D CA  1 
ATOM 8173  C C   . LEU D 1 44  ? 16.424  -35.911 -21.930 1.00 49.44 ? 44  LEU D C   1 
ATOM 8174  O O   . LEU D 1 44  ? 17.213  -36.535 -22.637 1.00 49.44 ? 44  LEU D O   1 
ATOM 8175  C CB  . LEU D 1 44  ? 16.266  -36.536 -19.516 1.00 29.02 ? 44  LEU D CB  1 
ATOM 8176  C CG  . LEU D 1 44  ? 16.954  -36.461 -18.160 1.00 29.02 ? 44  LEU D CG  1 
ATOM 8177  C CD1 . LEU D 1 44  ? 16.427  -37.558 -17.265 1.00 29.02 ? 44  LEU D CD1 1 
ATOM 8178  C CD2 . LEU D 1 44  ? 18.459  -36.598 -18.349 1.00 29.02 ? 44  LEU D CD2 1 
ATOM 8179  N N   . SER D 1 45  ? 15.219  -35.540 -22.352 1.00 54.79 ? 45  SER D N   1 
ATOM 8180  C CA  . SER D 1 45  ? 14.760  -35.881 -23.693 1.00 54.79 ? 45  SER D CA  1 
ATOM 8181  C C   . SER D 1 45  ? 15.716  -35.356 -24.765 1.00 54.79 ? 45  SER D C   1 
ATOM 8182  O O   . SER D 1 45  ? 15.971  -36.036 -25.758 1.00 54.79 ? 45  SER D O   1 
ATOM 8183  C CB  . SER D 1 45  ? 13.362  -35.312 -23.951 1.00 66.02 ? 45  SER D CB  1 
ATOM 8184  O OG  . SER D 1 45  ? 13.425  -33.974 -24.417 1.00 66.02 ? 45  SER D OG  1 
ATOM 8185  N N   . GLN D 1 46  ? 16.245  -34.152 -24.567 1.00 57.46 ? 46  GLN D N   1 
ATOM 8186  C CA  . GLN D 1 46  ? 17.154  -33.561 -25.541 1.00 57.46 ? 46  GLN D CA  1 
ATOM 8187  C C   . GLN D 1 46  ? 18.409  -34.390 -25.792 1.00 57.46 ? 46  GLN D C   1 
ATOM 8188  O O   . GLN D 1 46  ? 19.066  -34.216 -26.821 1.00 57.46 ? 46  GLN D O   1 
ATOM 8189  C CB  . GLN D 1 46  ? 17.567  -32.170 -25.099 1.00 91.65 ? 46  GLN D CB  1 
ATOM 8190  C CG  . GLN D 1 46  ? 16.414  -31.243 -24.861 1.00 91.65 ? 46  GLN D CG  1 
ATOM 8191  C CD  . GLN D 1 46  ? 16.886  -29.832 -24.622 1.00 91.65 ? 46  GLN D CD  1 
ATOM 8192  O OE1 . GLN D 1 46  ? 17.322  -29.145 -25.550 1.00 91.65 ? 46  GLN D OE1 1 
ATOM 8193  N NE2 . GLN D 1 46  ? 16.823  -29.391 -23.369 1.00 91.65 ? 46  GLN D NE2 1 
ATOM 8194  N N   . ILE D 1 47  ? 18.748  -35.280 -24.861 1.00 54.21 ? 47  ILE D N   1 
ATOM 8195  C CA  . ILE D 1 47  ? 19.932  -36.126 -25.008 1.00 54.21 ? 47  ILE D CA  1 
ATOM 8196  C C   . ILE D 1 47  ? 19.536  -37.600 -25.012 1.00 54.21 ? 47  ILE D C   1 
ATOM 8197  O O   . ILE D 1 47  ? 20.363  -38.477 -24.741 1.00 54.21 ? 47  ILE D O   1 
ATOM 8198  C CB  . ILE D 1 47  ? 20.930  -35.895 -23.850 1.00 40.32 ? 47  ILE D CB  1 
ATOM 8199  C CG1 . ILE D 1 47  ? 20.325  -36.357 -22.526 1.00 40.32 ? 47  ILE D CG1 1 
ATOM 8200  C CG2 . ILE D 1 47  ? 21.261  -34.430 -23.743 1.00 40.32 ? 47  ILE D CG2 1 
ATOM 8201  C CD1 . ILE D 1 47  ? 21.266  -36.237 -21.351 1.00 40.32 ? 47  ILE D CD1 1 
ATOM 8202  N N   . GLY D 1 48  ? 18.274  -37.869 -25.344 1.00 72.56 ? 48  GLY D N   1 
ATOM 8203  C CA  . GLY D 1 48  ? 17.771  -39.234 -25.325 1.00 72.56 ? 48  GLY D CA  1 
ATOM 8204  C C   . GLY D 1 48  ? 17.365  -39.448 -23.875 1.00 72.56 ? 48  GLY D C   1 
ATOM 8205  O O   . GLY D 1 48  ? 16.517  -38.719 -23.352 1.00 72.56 ? 48  GLY D O   1 
ATOM 8206  N N   . VAL D 1 49  ? 17.961  -40.435 -23.220 1.00 57.74 ? 49  VAL D N   1 
ATOM 8207  C CA  . VAL D 1 49  ? 17.695  -40.696 -21.802 1.00 57.74 ? 49  VAL D CA  1 
ATOM 8208  C C   . VAL D 1 49  ? 16.231  -40.664 -21.325 1.00 57.74 ? 49  VAL D C   1 
ATOM 8209  O O   . VAL D 1 49  ? 15.597  -39.598 -21.270 1.00 57.74 ? 49  VAL D O   1 
ATOM 8210  C CB  . VAL D 1 49  ? 18.488  -39.698 -20.920 1.00 47.32 ? 49  VAL D CB  1 
ATOM 8211  C CG1 . VAL D 1 49  ? 18.454  -40.150 -19.462 1.00 47.32 ? 49  VAL D CG1 1 
ATOM 8212  C CG2 . VAL D 1 49  ? 19.921  -39.568 -21.427 1.00 47.32 ? 49  VAL D CG2 1 
ATOM 8213  N N   . GLU D 1 50  ? 15.709  -41.833 -20.957 1.00 54.46 ? 50  GLU D N   1 
ATOM 8214  C CA  . GLU D 1 50  ? 14.347  -41.920 -20.448 1.00 54.46 ? 50  GLU D CA  1 
ATOM 8215  C C   . GLU D 1 50  ? 14.326  -41.165 -19.133 1.00 54.46 ? 50  GLU D C   1 
ATOM 8216  O O   . GLU D 1 50  ? 15.301  -41.198 -18.383 1.00 54.46 ? 50  GLU D O   1 
ATOM 8217  C CB  . GLU D 1 50  ? 13.956  -43.379 -20.207 1.00 99.51 ? 50  GLU D CB  1 
ATOM 8218  C CG  . GLU D 1 50  ? 12.967  -43.908 -21.214 1.00 99.51 ? 50  GLU D CG  1 
ATOM 8219  C CD  . GLU D 1 50  ? 13.318  -43.490 -22.633 1.00 99.51 ? 50  GLU D CD  1 
ATOM 8220  O OE1 . GLU D 1 50  ? 14.428  -43.830 -23.107 1.00 99.51 ? 50  GLU D OE1 1 
ATOM 8221  O OE2 . GLU D 1 50  ? 12.482  -42.811 -23.271 1.00 99.51 ? 50  GLU D OE2 1 
ATOM 8222  N N   . ASN D 1 51  ? 13.224  -40.482 -18.847 1.00 50.70 ? 51  ASN D N   1 
ATOM 8223  C CA  . ASN D 1 51  ? 13.132  -39.730 -17.606 1.00 50.70 ? 51  ASN D CA  1 
ATOM 8224  C C   . ASN D 1 51  ? 12.728  -40.621 -16.427 1.00 50.70 ? 51  ASN D C   1 
ATOM 8225  O O   . ASN D 1 51  ? 11.590  -40.583 -15.967 1.00 50.70 ? 51  ASN D O   1 
ATOM 8226  C CB  . ASN D 1 51  ? 12.149  -38.571 -17.778 1.00 47.84 ? 51  ASN D CB  1 
ATOM 8227  C CG  . ASN D 1 51  ? 12.170  -37.609 -16.606 1.00 47.84 ? 51  ASN D CG  1 
ATOM 8228  O OD1 . ASN D 1 51  ? 13.209  -37.390 -15.985 1.00 47.84 ? 51  ASN D OD1 1 
ATOM 8229  N ND2 . ASN D 1 51  ? 11.023  -37.018 -16.307 1.00 47.84 ? 51  ASN D ND2 1 
ATOM 8230  N N   . THR D 1 52  ? 13.680  -41.426 -15.955 1.00 48.74 ? 52  THR D N   1 
ATOM 8231  C CA  . THR D 1 52  ? 13.486  -42.344 -14.828 1.00 48.74 ? 52  THR D CA  1 
ATOM 8232  C C   . THR D 1 52  ? 14.004  -41.684 -13.561 1.00 48.74 ? 52  THR D C   1 
ATOM 8233  O O   . THR D 1 52  ? 14.695  -40.671 -13.626 1.00 48.74 ? 52  THR D O   1 
ATOM 8234  C CB  . THR D 1 52  ? 14.326  -43.619 -14.997 1.00 52.73 ? 52  THR D CB  1 
ATOM 8235  O OG1 . THR D 1 52  ? 14.055  -44.199 -16.271 1.00 52.73 ? 52  THR D OG1 1 
ATOM 8236  C CG2 . THR D 1 52  ? 14.016  -44.631 -13.892 1.00 52.73 ? 52  THR D CG2 1 
ATOM 8237  N N   . GLU D 1 53  ? 13.678  -42.251 -12.406 1.00 55.43 ? 53  GLU D N   1 
ATOM 8238  C CA  . GLU D 1 53  ? 14.205  -41.701 -11.173 1.00 55.43 ? 53  GLU D CA  1 
ATOM 8239  C C   . GLU D 1 53  ? 15.673  -42.060 -11.199 1.00 55.43 ? 53  GLU D C   1 
ATOM 8240  O O   . GLU D 1 53  ? 16.525  -41.285 -10.769 1.00 55.43 ? 53  GLU D O   1 
ATOM 8241  C CB  . GLU D 1 53  ? 13.549  -42.338 -9.964  1.00 98.82 ? 53  GLU D CB  1 
ATOM 8242  C CG  . GLU D 1 53  ? 12.189  -41.758 -9.678  1.00 98.82 ? 53  GLU D CG  1 
ATOM 8243  C CD  . GLU D 1 53  ? 11.362  -42.638 -8.757  1.00 98.82 ? 53  GLU D CD  1 
ATOM 8244  O OE1 . GLU D 1 53  ? 11.914  -43.070 -7.707  1.00 98.82 ? 53  GLU D OE1 1 
ATOM 8245  O OE2 . GLU D 1 53  ? 10.168  -42.885 -9.091  1.00 98.82 ? 53  GLU D OE2 1 
ATOM 8246  N N   . GLU D 1 54  ? 15.962  -43.240 -11.731 1.00 48.98 ? 54  GLU D N   1 
ATOM 8247  C CA  . GLU D 1 54  ? 17.335  -43.698 -11.815 1.00 48.98 ? 54  GLU D CA  1 
ATOM 8248  C C   . GLU D 1 54  ? 18.162  -42.817 -12.734 1.00 48.98 ? 54  GLU D C   1 
ATOM 8249  O O   . GLU D 1 54  ? 19.221  -42.328 -12.343 1.00 48.98 ? 54  GLU D O   1 
ATOM 8250  C CB  . GLU D 1 54  ? 17.381  -45.143 -12.298 1.00 54.59 ? 54  GLU D CB  1 
ATOM 8251  C CG  . GLU D 1 54  ? 17.988  -46.085 -11.276 1.00 54.59 ? 54  GLU D CG  1 
ATOM 8252  C CD  . GLU D 1 54  ? 19.442  -45.772 -10.987 1.00 54.59 ? 54  GLU D CD  1 
ATOM 8253  O OE1 . GLU D 1 54  ? 20.020  -46.398 -10.073 1.00 54.59 ? 54  GLU D OE1 1 
ATOM 8254  O OE2 . GLU D 1 54  ? 20.011  -44.904 -11.678 1.00 54.59 ? 54  GLU D OE2 1 
ATOM 8255  N N   . ASN D 1 55  ? 17.689  -42.606 -13.955 1.00 45.30 ? 55  ASN D N   1 
ATOM 8256  C CA  . ASN D 1 55  ? 18.439  -41.767 -14.876 1.00 45.30 ? 55  ASN D CA  1 
ATOM 8257  C C   . ASN D 1 55  ? 18.715  -40.395 -14.291 1.00 45.30 ? 55  ASN D C   1 
ATOM 8258  O O   . ASN D 1 55  ? 19.729  -39.769 -14.609 1.00 45.30 ? 55  ASN D O   1 
ATOM 8259  C CB  . ASN D 1 55  ? 17.705  -41.623 -16.202 1.00 51.98 ? 55  ASN D CB  1 
ATOM 8260  C CG  . ASN D 1 55  ? 17.745  -42.887 -17.009 1.00 51.98 ? 55  ASN D CG  1 
ATOM 8261  O OD1 . ASN D 1 55  ? 18.710  -43.649 -16.928 1.00 51.98 ? 55  ASN D OD1 1 
ATOM 8262  N ND2 . ASN D 1 55  ? 16.711  -43.119 -17.806 1.00 51.98 ? 55  ASN D ND2 1 
ATOM 8263  N N   . ARG D 1 56  ? 17.812  -39.922 -13.438 1.00 32.51 ? 56  ARG D N   1 
ATOM 8264  C CA  . ARG D 1 56  ? 18.005  -38.626 -12.808 1.00 32.51 ? 56  ARG D CA  1 
ATOM 8265  C C   . ARG D 1 56  ? 19.088  -38.772 -11.746 1.00 32.51 ? 56  ARG D C   1 
ATOM 8266  O O   . ARG D 1 56  ? 20.025  -37.981 -11.696 1.00 32.51 ? 56  ARG D O   1 
ATOM 8267  C CB  . ARG D 1 56  ? 16.703  -38.123 -12.182 1.00 38.78 ? 56  ARG D CB  1 
ATOM 8268  C CG  . ARG D 1 56  ? 15.690  -37.585 -13.190 1.00 38.78 ? 56  ARG D CG  1 
ATOM 8269  C CD  . ARG D 1 56  ? 14.594  -36.789 -12.484 1.00 38.78 ? 56  ARG D CD  1 
ATOM 8270  N NE  . ARG D 1 56  ? 13.732  -37.628 -11.654 1.00 38.78 ? 56  ARG D NE  1 
ATOM 8271  C CZ  . ARG D 1 56  ? 12.706  -38.334 -12.123 1.00 38.78 ? 56  ARG D CZ  1 
ATOM 8272  N NH1 . ARG D 1 56  ? 12.408  -38.298 -13.418 1.00 38.78 ? 56  ARG D NH1 1 
ATOM 8273  N NH2 . ARG D 1 56  ? 11.977  -39.079 -11.302 1.00 38.78 ? 56  ARG D NH2 1 
ATOM 8274  N N   . ARG D 1 57  ? 18.972  -39.797 -10.909 1.00 45.29 ? 57  ARG D N   1 
ATOM 8275  C CA  . ARG D 1 57  ? 19.966  -40.028 -9.871  1.00 45.29 ? 57  ARG D CA  1 
ATOM 8276  C C   . ARG D 1 57  ? 21.339  -40.123 -10.530 1.00 45.29 ? 57  ARG D C   1 
ATOM 8277  O O   . ARG D 1 57  ? 22.315  -39.540 -10.057 1.00 45.29 ? 57  ARG D O   1 
ATOM 8278  C CB  . ARG D 1 57  ? 19.674  -41.331 -9.136  1.00 38.75 ? 57  ARG D CB  1 
ATOM 8279  C CG  . ARG D 1 57  ? 20.570  -41.577 -7.939  1.00 38.75 ? 57  ARG D CG  1 
ATOM 8280  C CD  . ARG D 1 57  ? 20.463  -43.022 -7.500  1.00 38.75 ? 57  ARG D CD  1 
ATOM 8281  N NE  . ARG D 1 57  ? 20.937  -43.911 -8.553  1.00 38.75 ? 57  ARG D NE  1 
ATOM 8282  C CZ  . ARG D 1 57  ? 22.214  -44.234 -8.734  1.00 38.75 ? 57  ARG D CZ  1 
ATOM 8283  N NH1 . ARG D 1 57  ? 23.151  -43.749 -7.923  1.00 38.75 ? 57  ARG D NH1 1 
ATOM 8284  N NH2 . ARG D 1 57  ? 22.560  -45.023 -9.742  1.00 38.75 ? 57  ARG D NH2 1 
ATOM 8285  N N   . LEU D 1 58  ? 21.401  -40.862 -11.633 1.00 36.95 ? 58  LEU D N   1 
ATOM 8286  C CA  . LEU D 1 58  ? 22.647  -41.037 -12.362 1.00 36.95 ? 58  LEU D CA  1 
ATOM 8287  C C   . LEU D 1 58  ? 23.219  -39.701 -12.781 1.00 36.95 ? 58  LEU D C   1 
ATOM 8288  O O   . LEU D 1 58  ? 24.389  -39.411 -12.523 1.00 36.95 ? 58  LEU D O   1 
ATOM 8289  C CB  . LEU D 1 58  ? 22.421  -41.898 -13.602 1.00 28.18 ? 58  LEU D CB  1 
ATOM 8290  C CG  . LEU D 1 58  ? 22.083  -43.362 -13.316 1.00 28.18 ? 58  LEU D CG  1 
ATOM 8291  C CD1 . LEU D 1 58  ? 21.725  -44.069 -14.610 1.00 28.18 ? 58  LEU D CD1 1 
ATOM 8292  C CD2 . LEU D 1 58  ? 23.265  -44.030 -12.625 1.00 28.18 ? 58  LEU D CD2 1 
ATOM 8293  N N   . TYR D 1 59  ? 22.396  -38.888 -13.430 1.00 36.09 ? 59  TYR D N   1 
ATOM 8294  C CA  . TYR D 1 59  ? 22.856  -37.584 -13.876 1.00 36.09 ? 59  TYR D CA  1 
ATOM 8295  C C   . TYR D 1 59  ? 23.278  -36.677 -12.722 1.00 36.09 ? 59  TYR D C   1 
ATOM 8296  O O   . TYR D 1 59  ? 24.330  -36.048 -12.789 1.00 36.09 ? 59  TYR D O   1 
ATOM 8297  C CB  . TYR D 1 59  ? 21.789  -36.879 -14.706 1.00 39.21 ? 59  TYR D CB  1 
ATOM 8298  C CG  . TYR D 1 59  ? 22.184  -35.464 -15.046 1.00 39.21 ? 59  TYR D CG  1 
ATOM 8299  C CD1 . TYR D 1 59  ? 23.366  -35.201 -15.729 1.00 39.21 ? 59  TYR D CD1 1 
ATOM 8300  C CD2 . TYR D 1 59  ? 21.407  -34.384 -14.641 1.00 39.21 ? 59  TYR D CD2 1 
ATOM 8301  C CE1 . TYR D 1 59  ? 23.765  -33.898 -15.996 1.00 39.21 ? 59  TYR D CE1 1 
ATOM 8302  C CE2 . TYR D 1 59  ? 21.798  -33.074 -14.904 1.00 39.21 ? 59  TYR D CE2 1 
ATOM 8303  C CZ  . TYR D 1 59  ? 22.977  -32.842 -15.580 1.00 39.21 ? 59  TYR D CZ  1 
ATOM 8304  O OH  . TYR D 1 59  ? 23.373  -31.555 -15.836 1.00 39.21 ? 59  TYR D OH  1 
ATOM 8305  N N   . ARG D 1 60  ? 22.466  -36.598 -11.672 1.00 48.69 ? 60  ARG D N   1 
ATOM 8306  C CA  . ARG D 1 60  ? 22.815  -35.750 -10.533 1.00 48.69 ? 60  ARG D CA  1 
ATOM 8307  C C   . ARG D 1 60  ? 24.155  -36.211 -9.977  1.00 48.69 ? 60  ARG D C   1 
ATOM 8308  O O   . ARG D 1 60  ? 24.944  -35.415 -9.457  1.00 48.69 ? 60  ARG D O   1 
ATOM 8309  C CB  . ARG D 1 60  ? 21.772  -35.856 -9.422  1.00 46.85 ? 60  ARG D CB  1 
ATOM 8310  C CG  . ARG D 1 60  ? 20.336  -35.647 -9.847  1.00 46.85 ? 60  ARG D CG  1 
ATOM 8311  C CD  . ARG D 1 60  ? 20.043  -34.245 -10.341 1.00 46.85 ? 60  ARG D CD  1 
ATOM 8312  N NE  . ARG D 1 60  ? 18.597  -34.032 -10.351 1.00 46.85 ? 60  ARG D NE  1 
ATOM 8313  C CZ  . ARG D 1 60  ? 18.001  -32.951 -10.837 1.00 46.85 ? 60  ARG D CZ  1 
ATOM 8314  N NH1 . ARG D 1 60  ? 18.730  -31.971 -11.362 1.00 46.85 ? 60  ARG D NH1 1 
ATOM 8315  N NH2 . ARG D 1 60  ? 16.679  -32.849 -10.787 1.00 46.85 ? 60  ARG D NH2 1 
ATOM 8316  N N   . GLN D 1 61  ? 24.398  -37.511 -10.083 1.00 48.41 ? 61  GLN D N   1 
ATOM 8317  C CA  . GLN D 1 61  ? 25.635  -38.094 -9.598  1.00 48.41 ? 61  GLN D CA  1 
ATOM 8318  C C   . GLN D 1 61  ? 26.803  -37.525 -10.389 1.00 48.41 ? 61  GLN D C   1 
ATOM 8319  O O   . GLN D 1 61  ? 27.844  -37.197 -9.824  1.00 48.41 ? 61  GLN D O   1 
ATOM 8320  C CB  . GLN D 1 61  ? 25.578  -39.604 -9.752  1.00 37.76 ? 61  GLN D CB  1 
ATOM 8321  C CG  . GLN D 1 61  ? 26.727  -40.337 -9.111  1.00 37.76 ? 61  GLN D CG  1 
ATOM 8322  C CD  . GLN D 1 61  ? 26.554  -41.839 -9.214  1.00 37.76 ? 61  GLN D CD  1 
ATOM 8323  O OE1 . GLN D 1 61  ? 26.350  -42.376 -10.311 1.00 37.76 ? 61  GLN D OE1 1 
ATOM 8324  N NE2 . GLN D 1 61  ? 26.626  -42.530 -8.076  1.00 37.76 ? 61  GLN D NE2 1 
ATOM 8325  N N   . VAL D 1 62  ? 26.624  -37.407 -11.699 1.00 36.58 ? 62  VAL D N   1 
ATOM 8326  C CA  . VAL D 1 62  ? 27.662  -36.852 -12.554 1.00 36.58 ? 62  VAL D CA  1 
ATOM 8327  C C   . VAL D 1 62  ? 28.109  -35.504 -12.011 1.00 36.58 ? 62  VAL D C   1 
ATOM 8328  O O   . VAL D 1 62  ? 29.288  -35.175 -12.048 1.00 36.58 ? 62  VAL D O   1 
ATOM 8329  C CB  . VAL D 1 62  ? 27.160  -36.620 -13.989 1.00 25.14 ? 62  VAL D CB  1 
ATOM 8330  C CG1 . VAL D 1 62  ? 28.229  -35.918 -14.803 1.00 25.14 ? 62  VAL D CG1 1 
ATOM 8331  C CG2 . VAL D 1 62  ? 26.783  -37.944 -14.629 1.00 25.14 ? 62  VAL D CG2 1 
ATOM 8332  N N   . LEU D 1 63  ? 27.158  -34.722 -11.512 1.00 31.55 ? 63  LEU D N   1 
ATOM 8333  C CA  . LEU D 1 63  ? 27.468  -33.406 -10.972 1.00 31.55 ? 63  LEU D CA  1 
ATOM 8334  C C   . LEU D 1 63  ? 28.104  -33.488 -9.594  1.00 31.55 ? 63  LEU D C   1 
ATOM 8335  O O   . LEU D 1 63  ? 29.184  -32.943 -9.377  1.00 31.55 ? 63  LEU D O   1 
ATOM 8336  C CB  . LEU D 1 63  ? 26.202  -32.547 -10.896 1.00 27.54 ? 63  LEU D CB  1 
ATOM 8337  C CG  . LEU D 1 63  ? 25.462  -32.321 -12.217 1.00 27.54 ? 63  LEU D CG  1 
ATOM 8338  C CD1 . LEU D 1 63  ? 24.289  -31.394 -11.988 1.00 27.54 ? 63  LEU D CD1 1 
ATOM 8339  C CD2 . LEU D 1 63  ? 26.398  -31.715 -13.240 1.00 27.54 ? 63  LEU D CD2 1 
ATOM 8340  N N   . PHE D 1 64  ? 27.445  -34.189 -8.676  1.00 33.03 ? 64  PHE D N   1 
ATOM 8341  C CA  . PHE D 1 64  ? 27.929  -34.305 -7.305  1.00 33.03 ? 64  PHE D CA  1 
ATOM 8342  C C   . PHE D 1 64  ? 29.217  -35.076 -7.107  1.00 33.03 ? 64  PHE D C   1 
ATOM 8343  O O   . PHE D 1 64  ? 29.832  -35.016 -6.035  1.00 33.03 ? 64  PHE D O   1 
ATOM 8344  C CB  . PHE D 1 64  ? 26.844  -34.909 -6.418  1.00 32.15 ? 64  PHE D CB  1 
ATOM 8345  C CG  . PHE D 1 64  ? 25.548  -34.173 -6.486  1.00 32.15 ? 64  PHE D CG  1 
ATOM 8346  C CD1 . PHE D 1 64  ? 25.526  -32.811 -6.771  1.00 32.15 ? 64  PHE D CD1 1 
ATOM 8347  C CD2 . PHE D 1 64  ? 24.350  -34.834 -6.279  1.00 32.15 ? 64  PHE D CD2 1 
ATOM 8348  C CE1 . PHE D 1 64  ? 24.332  -32.118 -6.853  1.00 32.15 ? 64  PHE D CE1 1 
ATOM 8349  C CE2 . PHE D 1 64  ? 23.149  -34.150 -6.357  1.00 32.15 ? 64  PHE D CE2 1 
ATOM 8350  C CZ  . PHE D 1 64  ? 23.142  -32.787 -6.647  1.00 32.15 ? 64  PHE D CZ  1 
ATOM 8351  N N   . SER D 1 65  ? 29.636  -35.806 -8.127  1.00 47.92 ? 65  SER D N   1 
ATOM 8352  C CA  . SER D 1 65  ? 30.864  -36.562 -8.002  1.00 47.92 ? 65  SER D CA  1 
ATOM 8353  C C   . SER D 1 65  ? 32.067  -35.710 -8.388  1.00 47.92 ? 65  SER D C   1 
ATOM 8354  O O   . SER D 1 65  ? 33.186  -36.209 -8.434  1.00 47.92 ? 65  SER D O   1 
ATOM 8355  C CB  . SER D 1 65  ? 30.792  -37.824 -8.859  1.00 46.93 ? 65  SER D CB  1 
ATOM 8356  O OG  . SER D 1 65  ? 30.406  -37.509 -10.183 1.00 46.93 ? 65  SER D OG  1 
ATOM 8357  N N   . ALA D 1 66  ? 31.842  -34.427 -8.665  1.00 40.81 ? 66  ALA D N   1 
ATOM 8358  C CA  . ALA D 1 66  ? 32.941  -33.533 -9.023  1.00 40.81 ? 66  ALA D CA  1 
ATOM 8359  C C   . ALA D 1 66  ? 33.949  -33.561 -7.876  1.00 40.81 ? 66  ALA D C   1 
ATOM 8360  O O   . ALA D 1 66  ? 33.569  -33.724 -6.712  1.00 40.81 ? 66  ALA D O   1 
ATOM 8361  C CB  . ALA D 1 66  ? 32.428  -32.112 -9.238  1.00 39.17 ? 66  ALA D CB  1 
ATOM 8362  N N   . ASP D 1 67  ? 35.230  -33.408 -8.205  1.00 51.08 ? 67  ASP D N   1 
ATOM 8363  C CA  . ASP D 1 67  ? 36.290  -33.438 -7.198  1.00 51.08 ? 67  ASP D CA  1 
ATOM 8364  C C   . ASP D 1 67  ? 36.432  -32.127 -6.422  1.00 51.08 ? 67  ASP D C   1 
ATOM 8365  O O   . ASP D 1 67  ? 35.602  -31.222 -6.543  1.00 51.08 ? 67  ASP D O   1 
ATOM 8366  C CB  . ASP D 1 67  ? 37.629  -33.807 -7.853  1.00 45.68 ? 67  ASP D CB  1 
ATOM 8367  C CG  . ASP D 1 67  ? 38.117  -32.748 -8.828  1.00 45.68 ? 67  ASP D CG  1 
ATOM 8368  O OD1 . ASP D 1 67  ? 38.454  -33.097 -9.985  1.00 45.68 ? 67  ASP D OD1 1 
ATOM 8369  O OD2 . ASP D 1 67  ? 38.164  -31.562 -8.426  1.00 45.68 ? 67  ASP D OD2 1 
ATOM 8370  N N   . ASP D 1 68  ? 37.504  -32.031 -5.641  1.00 45.23 ? 68  ASP D N   1 
ATOM 8371  C CA  . ASP D 1 68  ? 37.769  -30.863 -4.803  1.00 45.23 ? 68  ASP D CA  1 
ATOM 8372  C C   . ASP D 1 68  ? 37.979  -29.495 -5.439  1.00 45.23 ? 68  ASP D C   1 
ATOM 8373  O O   . ASP D 1 68  ? 37.917  -28.484 -4.739  1.00 45.23 ? 68  ASP D O   1 
ATOM 8374  C CB  . ASP D 1 68  ? 38.954  -31.150 -3.881  1.00 69.35 ? 68  ASP D CB  1 
ATOM 8375  C CG  . ASP D 1 68  ? 38.551  -31.917 -2.639  1.00 69.35 ? 68  ASP D CG  1 
ATOM 8376  O OD1 . ASP D 1 68  ? 39.443  -32.223 -1.819  1.00 69.35 ? 68  ASP D OD1 1 
ATOM 8377  O OD2 . ASP D 1 68  ? 37.345  -32.208 -2.478  1.00 69.35 ? 68  ASP D OD2 1 
ATOM 8378  N N   . ARG D 1 69  ? 38.229  -29.422 -6.739  1.00 48.85 ? 69  ARG D N   1 
ATOM 8379  C CA  . ARG D 1 69  ? 38.435  -28.097 -7.307  1.00 48.85 ? 69  ARG D CA  1 
ATOM 8380  C C   . ARG D 1 69  ? 37.114  -27.371 -7.423  1.00 48.85 ? 69  ARG D C   1 
ATOM 8381  O O   . ARG D 1 69  ? 37.068  -26.188 -7.761  1.00 48.85 ? 69  ARG D O   1 
ATOM 8382  C CB  . ARG D 1 69  ? 39.139  -28.172 -8.665  1.00 25.17 ? 69  ARG D CB  1 
ATOM 8383  C CG  . ARG D 1 69  ? 38.544  -29.137 -9.636  1.00 25.17 ? 69  ARG D CG  1 
ATOM 8384  C CD  . ARG D 1 69  ? 39.527  -29.454 -10.740 1.00 25.17 ? 69  ARG D CD  1 
ATOM 8385  N NE  . ARG D 1 69  ? 39.246  -30.785 -11.257 1.00 25.17 ? 69  ARG D NE  1 
ATOM 8386  C CZ  . ARG D 1 69  ? 39.018  -31.062 -12.534 1.00 25.17 ? 69  ARG D CZ  1 
ATOM 8387  N NH1 . ARG D 1 69  ? 39.043  -30.087 -13.446 1.00 25.17 ? 69  ARG D NH1 1 
ATOM 8388  N NH2 . ARG D 1 69  ? 38.747  -32.312 -12.895 1.00 25.17 ? 69  ARG D NH2 1 
ATOM 8389  N N   . VAL D 1 70  ? 36.040  -28.088 -7.114  1.00 35.00 ? 70  VAL D N   1 
ATOM 8390  C CA  . VAL D 1 70  ? 34.700  -27.523 -7.163  1.00 35.00 ? 70  VAL D CA  1 
ATOM 8391  C C   . VAL D 1 70  ? 34.473  -26.729 -5.879  1.00 35.00 ? 70  VAL D C   1 
ATOM 8392  O O   . VAL D 1 70  ? 33.582  -25.893 -5.811  1.00 35.00 ? 70  VAL D O   1 
ATOM 8393  C CB  . VAL D 1 70  ? 33.647  -28.646 -7.285  1.00 17.57 ? 70  VAL D CB  1 
ATOM 8394  C CG1 . VAL D 1 70  ? 33.084  -28.996 -5.913  1.00 17.57 ? 70  VAL D CG1 1 
ATOM 8395  C CG2 . VAL D 1 70  ? 32.573  -28.240 -8.264  1.00 17.57 ? 70  VAL D CG2 1 
ATOM 8396  N N   . LYS D 1 71  ? 35.305  -27.001 -4.874  1.00 33.29 ? 71  LYS D N   1 
ATOM 8397  C CA  . LYS D 1 71  ? 35.239  -26.339 -3.568  1.00 33.29 ? 71  LYS D CA  1 
ATOM 8398  C C   . LYS D 1 71  ? 35.556  -24.851 -3.598  1.00 33.29 ? 71  LYS D C   1 
ATOM 8399  O O   . LYS D 1 71  ? 35.044  -24.091 -2.784  1.00 33.29 ? 71  LYS D O   1 
ATOM 8400  C CB  . LYS D 1 71  ? 36.200  -27.001 -2.573  1.00 34.68 ? 71  LYS D CB  1 
ATOM 8401  C CG  . LYS D 1 71  ? 35.820  -28.413 -2.170  1.00 34.68 ? 71  LYS D CG  1 
ATOM 8402  C CD  . LYS D 1 71  ? 36.894  -29.084 -1.310  1.00 34.68 ? 71  LYS D CD  1 
ATOM 8403  C CE  . LYS D 1 71  ? 36.993  -28.467 0.079   1.00 34.68 ? 71  LYS D CE  1 
ATOM 8404  N NZ  . LYS D 1 71  ? 37.958  -29.203 0.966   1.00 34.68 ? 71  LYS D NZ  1 
ATOM 8405  N N   . LYS D 1 72  ? 36.407  -24.429 -4.521  1.00 33.75 ? 72  LYS D N   1 
ATOM 8406  C CA  . LYS D 1 72  ? 36.772  -23.022 -4.590  1.00 33.75 ? 72  LYS D CA  1 
ATOM 8407  C C   . LYS D 1 72  ? 35.722  -22.148 -5.269  1.00 33.75 ? 72  LYS D C   1 
ATOM 8408  O O   . LYS D 1 72  ? 35.640  -20.945 -4.997  1.00 33.75 ? 72  LYS D O   1 
ATOM 8409  C CB  . LYS D 1 72  ? 38.110  -22.857 -5.318  1.00 34.86 ? 72  LYS D CB  1 
ATOM 8410  C CG  . LYS D 1 72  ? 38.120  -23.437 -6.716  1.00 34.86 ? 72  LYS D CG  1 
ATOM 8411  C CD  . LYS D 1 72  ? 39.330  -22.980 -7.509  1.00 34.86 ? 72  LYS D CD  1 
ATOM 8412  C CE  . LYS D 1 72  ? 39.353  -23.624 -8.888  1.00 34.86 ? 72  LYS D CE  1 
ATOM 8413  N NZ  . LYS D 1 72  ? 39.414  -25.111 -8.793  1.00 34.86 ? 72  LYS D NZ  1 
ATOM 8414  N N   . CYS D 1 73  ? 34.914  -22.747 -6.142  1.00 34.08 ? 73  CYS D N   1 
ATOM 8415  C CA  . CYS D 1 73  ? 33.908  -21.981 -6.869  1.00 34.08 ? 73  CYS D CA  1 
ATOM 8416  C C   . CYS D 1 73  ? 32.442  -22.276 -6.545  1.00 34.08 ? 73  CYS D C   1 
ATOM 8417  O O   . CYS D 1 73  ? 31.550  -21.559 -7.002  1.00 34.08 ? 73  CYS D O   1 
ATOM 8418  C CB  . CYS D 1 73  ? 34.147  -22.143 -8.372  1.00 40.22 ? 73  CYS D CB  1 
ATOM 8419  S SG  . CYS D 1 73  ? 34.399  -23.857 -8.878  1.00 40.22 ? 73  CYS D SG  1 
ATOM 8420  N N   . ILE D 1 74  ? 32.179  -23.317 -5.767  1.00 28.57 ? 74  ILE D N   1 
ATOM 8421  C CA  . ILE D 1 74  ? 30.803  -23.644 -5.424  1.00 28.57 ? 74  ILE D CA  1 
ATOM 8422  C C   . ILE D 1 74  ? 30.544  -23.506 -3.933  1.00 28.57 ? 74  ILE D C   1 
ATOM 8423  O O   . ILE D 1 74  ? 31.010  -24.324 -3.133  1.00 28.57 ? 74  ILE D O   1 
ATOM 8424  C CB  . ILE D 1 74  ? 30.452  -25.074 -5.835  1.00 19.31 ? 74  ILE D CB  1 
ATOM 8425  C CG1 . ILE D 1 74  ? 30.626  -25.244 -7.345  1.00 19.31 ? 74  ILE D CG1 1 
ATOM 8426  C CG2 . ILE D 1 74  ? 29.033  -25.392 -5.414  1.00 19.31 ? 74  ILE D CG2 1 
ATOM 8427  C CD1 . ILE D 1 74  ? 29.723  -24.373 -8.178  1.00 19.31 ? 74  ILE D CD1 1 
ATOM 8428  N N   . GLY D 1 75  ? 29.792  -22.474 -3.563  1.00 30.46 ? 75  GLY D N   1 
ATOM 8429  C CA  . GLY D 1 75  ? 29.479  -22.249 -2.163  1.00 30.46 ? 75  GLY D CA  1 
ATOM 8430  C C   . GLY D 1 75  ? 28.272  -23.046 -1.698  1.00 30.46 ? 75  GLY D C   1 
ATOM 8431  O O   . GLY D 1 75  ? 28.148  -23.374 -0.511  1.00 30.46 ? 75  GLY D O   1 
ATOM 8432  N N   . GLY D 1 76  ? 27.382  -23.364 -2.637  1.00 28.63 ? 76  GLY D N   1 
ATOM 8433  C CA  . GLY D 1 76  ? 26.189  -24.121 -2.295  1.00 28.63 ? 76  GLY D CA  1 
ATOM 8434  C C   . GLY D 1 76  ? 25.548  -24.845 -3.468  1.00 28.63 ? 76  GLY D C   1 
ATOM 8435  O O   . GLY D 1 76  ? 25.766  -24.505 -4.637  1.00 28.63 ? 76  GLY D O   1 
ATOM 8436  N N   . VAL D 1 77  ? 24.744  -25.852 -3.147  1.00 31.06 ? 77  VAL D N   1 
ATOM 8437  C CA  . VAL D 1 77  ? 24.059  -26.639 -4.159  1.00 31.06 ? 77  VAL D CA  1 
ATOM 8438  C C   . VAL D 1 77  ? 22.576  -26.714 -3.811  1.00 31.06 ? 77  VAL D C   1 
ATOM 8439  O O   . VAL D 1 77  ? 22.215  -27.096 -2.700  1.00 31.06 ? 77  VAL D O   1 
ATOM 8440  C CB  . VAL D 1 77  ? 24.630  -28.065 -4.217  1.00 25.72 ? 77  VAL D CB  1 
ATOM 8441  C CG1 . VAL D 1 77  ? 24.058  -28.806 -5.401  1.00 25.72 ? 77  VAL D CG1 1 
ATOM 8442  C CG2 . VAL D 1 77  ? 26.139  -28.009 -4.303  1.00 25.72 ? 77  VAL D CG2 1 
ATOM 8443  N N   . ILE D 1 78  ? 21.723  -26.334 -4.754  1.00 30.51 ? 78  ILE D N   1 
ATOM 8444  C CA  . ILE D 1 78  ? 20.281  -26.376 -4.530  1.00 30.51 ? 78  ILE D CA  1 
ATOM 8445  C C   . ILE D 1 78  ? 19.747  -27.716 -5.028  1.00 30.51 ? 78  ILE D C   1 
ATOM 8446  O O   . ILE D 1 78  ? 19.833  -28.019 -6.220  1.00 30.51 ? 78  ILE D O   1 
ATOM 8447  C CB  . ILE D 1 78  ? 19.548  -25.249 -5.295  1.00 24.98 ? 78  ILE D CB  1 
ATOM 8448  C CG1 . ILE D 1 78  ? 20.107  -23.879 -4.907  1.00 24.98 ? 78  ILE D CG1 1 
ATOM 8449  C CG2 . ILE D 1 78  ? 18.070  -25.288 -4.973  1.00 24.98 ? 78  ILE D CG2 1 
ATOM 8450  C CD1 . ILE D 1 78  ? 19.540  -22.737 -5.736  1.00 24.98 ? 78  ILE D CD1 1 
ATOM 8451  N N   . PHE D 1 79  ? 19.198  -28.508 -4.111  1.00 29.78 ? 79  PHE D N   1 
ATOM 8452  C CA  . PHE D 1 79  ? 18.644  -29.827 -4.427  1.00 29.78 ? 79  PHE D CA  1 
ATOM 8453  C C   . PHE D 1 79  ? 17.157  -29.822 -4.733  1.00 29.78 ? 79  PHE D C   1 
ATOM 8454  O O   . PHE D 1 79  ? 16.411  -28.972 -4.255  1.00 29.78 ? 79  PHE D O   1 
ATOM 8455  C CB  . PHE D 1 79  ? 18.813  -30.791 -3.250  1.00 41.40 ? 79  PHE D CB  1 
ATOM 8456  C CG  . PHE D 1 79  ? 20.199  -31.294 -3.056  1.00 41.40 ? 79  PHE D CG  1 
ATOM 8457  C CD1 . PHE D 1 79  ? 21.197  -30.460 -2.577  1.00 41.40 ? 79  PHE D CD1 1 
ATOM 8458  C CD2 . PHE D 1 79  ? 20.504  -32.620 -3.332  1.00 41.40 ? 79  PHE D CD2 1 
ATOM 8459  C CE1 . PHE D 1 79  ? 22.483  -30.940 -2.375  1.00 41.40 ? 79  PHE D CE1 1 
ATOM 8460  C CE2 . PHE D 1 79  ? 21.785  -33.108 -3.135  1.00 41.40 ? 79  PHE D CE2 1 
ATOM 8461  C CZ  . PHE D 1 79  ? 22.778  -32.267 -2.655  1.00 41.40 ? 79  PHE D CZ  1 
ATOM 8462  N N   . PHE D 1 80  ? 16.727  -30.791 -5.526  1.00 38.85 ? 80  PHE D N   1 
ATOM 8463  C CA  . PHE D 1 80  ? 15.311  -30.945 -5.788  1.00 38.85 ? 80  PHE D CA  1 
ATOM 8464  C C   . PHE D 1 80  ? 14.945  -31.995 -4.740  1.00 38.85 ? 80  PHE D C   1 
ATOM 8465  O O   . PHE D 1 80  ? 15.706  -32.940 -4.532  1.00 38.85 ? 80  PHE D O   1 
ATOM 8466  C CB  . PHE D 1 80  ? 15.064  -31.509 -7.169  1.00 48.84 ? 80  PHE D CB  1 
ATOM 8467  C CG  . PHE D 1 80  ? 13.662  -31.986 -7.367  1.00 48.84 ? 80  PHE D CG  1 
ATOM 8468  C CD1 . PHE D 1 80  ? 12.617  -31.081 -7.475  1.00 48.84 ? 80  PHE D CD1 1 
ATOM 8469  C CD2 . PHE D 1 80  ? 13.381  -33.345 -7.429  1.00 48.84 ? 80  PHE D CD2 1 
ATOM 8470  C CE1 . PHE D 1 80  ? 11.304  -31.525 -7.644  1.00 48.84 ? 80  PHE D CE1 1 
ATOM 8471  C CE2 . PHE D 1 80  ? 12.075  -33.799 -7.597  1.00 48.84 ? 80  PHE D CE2 1 
ATOM 8472  C CZ  . PHE D 1 80  ? 11.035  -32.887 -7.707  1.00 48.84 ? 80  PHE D CZ  1 
ATOM 8473  N N   . HIS D 1 81  ? 13.803  -31.839 -4.081  1.00 29.31 ? 81  HIS D N   1 
ATOM 8474  C CA  . HIS D 1 81  ? 13.393  -32.781 -3.033  1.00 29.31 ? 81  HIS D CA  1 
ATOM 8475  C C   . HIS D 1 81  ? 13.884  -34.218 -3.210  1.00 29.31 ? 81  HIS D C   1 
ATOM 8476  O O   . HIS D 1 81  ? 14.658  -34.731 -2.402  1.00 29.31 ? 81  HIS D O   1 
ATOM 8477  C CB  . HIS D 1 81  ? 11.876  -32.819 -2.903  1.00 29.23 ? 81  HIS D CB  1 
ATOM 8478  C CG  . HIS D 1 81  ? 11.401  -33.686 -1.781  1.00 29.23 ? 81  HIS D CG  1 
ATOM 8479  N ND1 . HIS D 1 81  ? 11.419  -33.274 -0.467  1.00 29.23 ? 81  HIS D ND1 1 
ATOM 8480  C CD2 . HIS D 1 81  ? 10.975  -34.972 -1.767  1.00 29.23 ? 81  HIS D CD2 1 
ATOM 8481  C CE1 . HIS D 1 81  ? 11.027  -34.268 0.310   1.00 29.23 ? 81  HIS D CE1 1 
ATOM 8482  N NE2 . HIS D 1 81  ? 10.752  -35.310 -0.453  1.00 29.23 ? 81  HIS D NE2 1 
ATOM 8483  N N   . GLU D 1 82  ? 13.384  -34.867 -4.255  1.00 27.19 ? 82  GLU D N   1 
ATOM 8484  C CA  . GLU D 1 82  ? 13.746  -36.240 -4.589  1.00 27.19 ? 82  GLU D CA  1 
ATOM 8485  C C   . GLU D 1 82  ? 15.237  -36.462 -4.371  1.00 27.19 ? 82  GLU D C   1 
ATOM 8486  O O   . GLU D 1 82  ? 15.655  -37.291 -3.556  1.00 27.19 ? 82  GLU D O   1 
ATOM 8487  C CB  . GLU D 1 82  ? 13.401  -36.494 -6.056  1.00 51.28 ? 82  GLU D CB  1 
ATOM 8488  C CG  . GLU D 1 82  ? 13.884  -37.807 -6.615  1.00 51.28 ? 82  GLU D CG  1 
ATOM 8489  C CD  . GLU D 1 82  ? 13.969  -37.791 -8.134  1.00 51.28 ? 82  GLU D CD  1 
ATOM 8490  O OE1 . GLU D 1 82  ? 14.880  -37.121 -8.678  1.00 51.28 ? 82  GLU D OE1 1 
ATOM 8491  O OE2 . GLU D 1 82  ? 13.122  -38.444 -8.784  1.00 51.28 ? 82  GLU D OE2 1 
ATOM 8492  N N   . THR D 1 83  ? 16.026  -35.689 -5.111  1.00 30.66 ? 83  THR D N   1 
ATOM 8493  C CA  . THR D 1 83  ? 17.478  -35.747 -5.075  1.00 30.66 ? 83  THR D CA  1 
ATOM 8494  C C   . THR D 1 83  ? 18.094  -35.642 -3.673  1.00 30.66 ? 83  THR D C   1 
ATOM 8495  O O   . THR D 1 83  ? 19.085  -36.308 -3.373  1.00 30.66 ? 83  THR D O   1 
ATOM 8496  C CB  . THR D 1 83  ? 18.059  -34.651 -5.983  1.00 32.63 ? 83  THR D CB  1 
ATOM 8497  O OG1 . THR D 1 83  ? 17.581  -34.845 -7.322  1.00 32.63 ? 83  THR D OG1 1 
ATOM 8498  C CG2 . THR D 1 83  ? 19.570  -34.708 -5.987  1.00 32.63 ? 83  THR D CG2 1 
ATOM 8499  N N   . LEU D 1 84  ? 17.509  -34.812 -2.816  1.00 25.47 ? 84  LEU D N   1 
ATOM 8500  C CA  . LEU D 1 84  ? 18.012  -34.624 -1.454  1.00 25.47 ? 84  LEU D CA  1 
ATOM 8501  C C   . LEU D 1 84  ? 18.039  -35.932 -0.670  1.00 25.47 ? 84  LEU D C   1 
ATOM 8502  O O   . LEU D 1 84  ? 18.623  -36.011 0.413   1.00 25.47 ? 84  LEU D O   1 
ATOM 8503  C CB  . LEU D 1 84  ? 17.129  -33.624 -0.707  1.00 28.75 ? 84  LEU D CB  1 
ATOM 8504  C CG  . LEU D 1 84  ? 17.555  -33.268 0.713   1.00 28.75 ? 84  LEU D CG  1 
ATOM 8505  C CD1 . LEU D 1 84  ? 18.764  -32.362 0.648   1.00 28.75 ? 84  LEU D CD1 1 
ATOM 8506  C CD2 . LEU D 1 84  ? 16.416  -32.575 1.439   1.00 28.75 ? 84  LEU D CD2 1 
ATOM 8507  N N   . TYR D 1 85  ? 17.395  -36.958 -1.209  1.00 31.61 ? 85  TYR D N   1 
ATOM 8508  C CA  . TYR D 1 85  ? 17.364  -38.235 -0.514  1.00 31.61 ? 85  TYR D CA  1 
ATOM 8509  C C   . TYR D 1 85  ? 17.938  -39.380 -1.341  1.00 31.61 ? 85  TYR D C   1 
ATOM 8510  O O   . TYR D 1 85  ? 17.783  -40.554 -0.983  1.00 31.61 ? 85  TYR D O   1 
ATOM 8511  C CB  . TYR D 1 85  ? 15.932  -38.559 -0.075  1.00 31.26 ? 85  TYR D CB  1 
ATOM 8512  C CG  . TYR D 1 85  ? 15.359  -37.534 0.876   1.00 31.26 ? 85  TYR D CG  1 
ATOM 8513  C CD1 . TYR D 1 85  ? 14.664  -36.423 0.402   1.00 31.26 ? 85  TYR D CD1 1 
ATOM 8514  C CD2 . TYR D 1 85  ? 15.586  -37.629 2.248   1.00 31.26 ? 85  TYR D CD2 1 
ATOM 8515  C CE1 . TYR D 1 85  ? 14.217  -35.428 1.273   1.00 31.26 ? 85  TYR D CE1 1 
ATOM 8516  C CE2 . TYR D 1 85  ? 15.144  -36.642 3.127   1.00 31.26 ? 85  TYR D CE2 1 
ATOM 8517  C CZ  . TYR D 1 85  ? 14.466  -35.546 2.632   1.00 31.26 ? 85  TYR D CZ  1 
ATOM 8518  O OH  . TYR D 1 85  ? 14.057  -34.559 3.491   1.00 31.26 ? 85  TYR D OH  1 
ATOM 8519  N N   . GLN D 1 86  ? 18.605  -39.043 -2.441  1.00 41.21 ? 86  GLN D N   1 
ATOM 8520  C CA  . GLN D 1 86  ? 19.206  -40.062 -3.285  1.00 41.21 ? 86  GLN D CA  1 
ATOM 8521  C C   . GLN D 1 86  ? 20.652  -40.305 -2.866  1.00 41.21 ? 86  GLN D C   1 
ATOM 8522  O O   . GLN D 1 86  ? 21.265  -39.482 -2.177  1.00 41.21 ? 86  GLN D O   1 
ATOM 8523  C CB  . GLN D 1 86  ? 19.144  -39.648 -4.755  1.00 35.65 ? 86  GLN D CB  1 
ATOM 8524  C CG  . GLN D 1 86  ? 17.733  -39.469 -5.259  1.00 35.65 ? 86  GLN D CG  1 
ATOM 8525  C CD  . GLN D 1 86  ? 17.663  -39.244 -6.757  1.00 35.65 ? 86  GLN D CD  1 
ATOM 8526  O OE1 . GLN D 1 86  ? 18.207  -38.265 -7.289  1.00 35.65 ? 86  GLN D OE1 1 
ATOM 8527  N NE2 . GLN D 1 86  ? 16.980  -40.150 -7.452  1.00 35.65 ? 86  GLN D NE2 1 
ATOM 8528  N N   . LYS D 1 87  ? 21.189  -41.446 -3.281  1.00 45.22 ? 87  LYS D N   1 
ATOM 8529  C CA  . LYS D 1 87  ? 22.555  -41.810 -2.953  1.00 45.22 ? 87  LYS D CA  1 
ATOM 8530  C C   . LYS D 1 87  ? 23.322  -42.191 -4.209  1.00 45.22 ? 87  LYS D C   1 
ATOM 8531  O O   . LYS D 1 87  ? 22.721  -42.545 -5.229  1.00 45.22 ? 87  LYS D O   1 
ATOM 8532  C CB  . LYS D 1 87  ? 22.546  -42.974 -1.966  1.00 46.73 ? 87  LYS D CB  1 
ATOM 8533  C CG  . LYS D 1 87  ? 21.926  -42.604 -0.639  1.00 46.73 ? 87  LYS D CG  1 
ATOM 8534  C CD  . LYS D 1 87  ? 21.850  -43.780 0.328   1.00 46.73 ? 87  LYS D CD  1 
ATOM 8535  C CE  . LYS D 1 87  ? 20.648  -44.671 0.057   1.00 46.73 ? 87  LYS D CE  1 
ATOM 8536  N NZ  . LYS D 1 87  ? 20.375  -45.574 1.220   1.00 46.73 ? 87  LYS D NZ  1 
ATOM 8537  N N   . ASP D 1 88  ? 24.648  -42.097 -4.140  1.00 59.67 ? 88  ASP D N   1 
ATOM 8538  C CA  . ASP D 1 88  ? 25.494  -42.454 -5.273  1.00 59.67 ? 88  ASP D CA  1 
ATOM 8539  C C   . ASP D 1 88  ? 25.608  -43.974 -5.322  1.00 59.67 ? 88  ASP D C   1 
ATOM 8540  O O   . ASP D 1 88  ? 25.051  -44.675 -4.474  1.00 59.67 ? 88  ASP D O   1 
ATOM 8541  C CB  . ASP D 1 88  ? 26.882  -41.813 -5.142  1.00 56.32 ? 88  ASP D CB  1 
ATOM 8542  C CG  . ASP D 1 88  ? 27.650  -42.305 -3.928  1.00 56.32 ? 88  ASP D CG  1 
ATOM 8543  O OD1 . ASP D 1 88  ? 28.694  -41.701 -3.609  1.00 56.32 ? 88  ASP D OD1 1 
ATOM 8544  O OD2 . ASP D 1 88  ? 27.222  -43.293 -3.293  1.00 56.32 ? 88  ASP D OD2 1 
ATOM 8545  N N   . ASP D 1 89  ? 26.334  -44.484 -6.305  1.00 53.28 ? 89  ASP D N   1 
ATOM 8546  C CA  . ASP D 1 89  ? 26.471  -45.923 -6.448  1.00 53.28 ? 89  ASP D CA  1 
ATOM 8547  C C   . ASP D 1 89  ? 27.130  -46.618 -5.267  1.00 53.28 ? 89  ASP D C   1 
ATOM 8548  O O   . ASP D 1 89  ? 27.023  -47.837 -5.130  1.00 53.28 ? 89  ASP D O   1 
ATOM 8549  C CB  . ASP D 1 89  ? 27.228  -46.245 -7.729  1.00 50.79 ? 89  ASP D CB  1 
ATOM 8550  C CG  . ASP D 1 89  ? 26.590  -45.612 -8.948  1.00 50.79 ? 89  ASP D CG  1 
ATOM 8551  O OD1 . ASP D 1 89  ? 25.342  -45.516 -8.982  1.00 50.79 ? 89  ASP D OD1 1 
ATOM 8552  O OD2 . ASP D 1 89  ? 27.334  -45.220 -9.872  1.00 50.79 ? 89  ASP D OD2 1 
ATOM 8553  N N   . ASN D 1 90  ? 27.803  -45.855 -4.410  1.00 49.35 ? 90  ASN D N   1 
ATOM 8554  C CA  . ASN D 1 90  ? 28.462  -46.442 -3.246  1.00 49.35 ? 90  ASN D CA  1 
ATOM 8555  C C   . ASN D 1 90  ? 27.536  -46.420 -2.043  1.00 49.35 ? 90  ASN D C   1 
ATOM 8556  O O   . ASN D 1 90  ? 27.931  -46.805 -0.938  1.00 49.35 ? 90  ASN D O   1 
ATOM 8557  C CB  . ASN D 1 90  ? 29.739  -45.676 -2.911  1.00 75.74 ? 90  ASN D CB  1 
ATOM 8558  C CG  . ASN D 1 90  ? 30.677  -45.582 -4.087  1.00 75.74 ? 90  ASN D CG  1 
ATOM 8559  O OD1 . ASN D 1 90  ? 31.079  -46.597 -4.660  1.00 75.74 ? 90  ASN D OD1 1 
ATOM 8560  N ND2 . ASN D 1 90  ? 31.034  -44.356 -4.460  1.00 75.74 ? 90  ASN D ND2 1 
ATOM 8561  N N   . GLY D 1 91  ? 26.304  -45.967 -2.264  1.00 56.59 ? 91  GLY D N   1 
ATOM 8562  C CA  . GLY D 1 91  ? 25.333  -45.897 -1.187  1.00 56.59 ? 91  GLY D CA  1 
ATOM 8563  C C   . GLY D 1 91  ? 25.547  -44.678 -0.312  1.00 56.59 ? 91  GLY D C   1 
ATOM 8564  O O   . GLY D 1 91  ? 25.071  -44.622 0.823   1.00 56.59 ? 91  GLY D O   1 
ATOM 8565  N N   . VAL D 1 92  ? 26.270  -43.694 -0.839  1.00 58.57 ? 92  VAL D N   1 
ATOM 8566  C CA  . VAL D 1 92  ? 26.538  -42.477 -0.091  1.00 58.57 ? 92  VAL D CA  1 
ATOM 8567  C C   . VAL D 1 92  ? 25.608  -41.340 -0.478  1.00 58.57 ? 92  VAL D C   1 
ATOM 8568  O O   . VAL D 1 92  ? 25.568  -40.905 -1.632  1.00 58.57 ? 92  VAL D O   1 
ATOM 8569  C CB  . VAL D 1 92  ? 27.972  -41.998 -0.293  1.00 43.01 ? 92  VAL D CB  1 
ATOM 8570  C CG1 . VAL D 1 92  ? 28.199  -40.711 0.495   1.00 43.01 ? 92  VAL D CG1 1 
ATOM 8571  C CG2 . VAL D 1 92  ? 28.935  -43.081 0.144   1.00 43.01 ? 92  VAL D CG2 1 
ATOM 8572  N N   . PRO D 1 93  ? 24.860  -40.828 0.500   1.00 39.94 ? 93  PRO D N   1 
ATOM 8573  C CA  . PRO D 1 93  ? 23.908  -39.732 0.323   1.00 39.94 ? 93  PRO D CA  1 
ATOM 8574  C C   . PRO D 1 93  ? 24.547  -38.551 -0.390  1.00 39.94 ? 93  PRO D C   1 
ATOM 8575  O O   . PRO D 1 93  ? 25.578  -38.041 0.051   1.00 39.94 ? 93  PRO D O   1 
ATOM 8576  C CB  . PRO D 1 93  ? 23.530  -39.380 1.753   1.00 28.98 ? 93  PRO D CB  1 
ATOM 8577  C CG  . PRO D 1 93  ? 23.676  -40.683 2.469   1.00 28.98 ? 93  PRO D CG  1 
ATOM 8578  C CD  . PRO D 1 93  ? 24.960  -41.211 1.916   1.00 28.98 ? 93  PRO D CD  1 
ATOM 8579  N N   . PHE D 1 94  ? 23.943  -38.123 -1.493  1.00 36.83 ? 94  PHE D N   1 
ATOM 8580  C CA  . PHE D 1 94  ? 24.453  -36.981 -2.237  1.00 36.83 ? 94  PHE D CA  1 
ATOM 8581  C C   . PHE D 1 94  ? 24.666  -35.817 -1.268  1.00 36.83 ? 94  PHE D C   1 
ATOM 8582  O O   . PHE D 1 94  ? 25.625  -35.057 -1.388  1.00 36.83 ? 94  PHE D O   1 
ATOM 8583  C CB  . PHE D 1 94  ? 23.451  -36.562 -3.314  1.00 35.42 ? 94  PHE D CB  1 
ATOM 8584  C CG  . PHE D 1 94  ? 23.395  -37.485 -4.494  1.00 35.42 ? 94  PHE D CG  1 
ATOM 8585  C CD1 . PHE D 1 94  ? 22.199  -37.676 -5.179  1.00 35.42 ? 94  PHE D CD1 1 
ATOM 8586  C CD2 . PHE D 1 94  ? 24.539  -38.113 -4.963  1.00 35.42 ? 94  PHE D CD2 1 
ATOM 8587  C CE1 . PHE D 1 94  ? 22.141  -38.477 -6.319  1.00 35.42 ? 94  PHE D CE1 1 
ATOM 8588  C CE2 . PHE D 1 94  ? 24.494  -38.915 -6.102  1.00 35.42 ? 94  PHE D CE2 1 
ATOM 8589  C CZ  . PHE D 1 94  ? 23.291  -39.096 -6.782  1.00 35.42 ? 94  PHE D CZ  1 
ATOM 8590  N N   . VAL D 1 95  ? 23.758  -35.680 -0.306  1.00 39.08 ? 95  VAL D N   1 
ATOM 8591  C CA  . VAL D 1 95  ? 23.856  -34.604 0.673   1.00 39.08 ? 95  VAL D CA  1 
ATOM 8592  C C   . VAL D 1 95  ? 25.157  -34.734 1.447   1.00 39.08 ? 95  VAL D C   1 
ATOM 8593  O O   . VAL D 1 95  ? 25.889  -33.761 1.617   1.00 39.08 ? 95  VAL D O   1 
ATOM 8594  C CB  . VAL D 1 95  ? 22.680  -34.632 1.670   1.00 36.13 ? 95  VAL D CB  1 
ATOM 8595  C CG1 . VAL D 1 95  ? 22.869  -33.554 2.716   1.00 36.13 ? 95  VAL D CG1 1 
ATOM 8596  C CG2 . VAL D 1 95  ? 21.369  -34.418 0.937   1.00 36.13 ? 95  VAL D CG2 1 
ATOM 8597  N N   . ARG D 1 96  ? 25.436  -35.950 1.906   1.00 44.26 ? 96  ARG D N   1 
ATOM 8598  C CA  . ARG D 1 96  ? 26.649  -36.245 2.660   1.00 44.26 ? 96  ARG D CA  1 
ATOM 8599  C C   . ARG D 1 96  ? 27.872  -35.751 1.894   1.00 44.26 ? 96  ARG D C   1 
ATOM 8600  O O   . ARG D 1 96  ? 28.682  -34.985 2.415   1.00 44.26 ? 96  ARG D O   1 
ATOM 8601  C CB  . ARG D 1 96  ? 26.764  -37.747 2.871   1.00 95.18 ? 96  ARG D CB  1 
ATOM 8602  C CG  . ARG D 1 96  ? 27.946  -38.150 3.698   1.00 95.18 ? 96  ARG D CG  1 
ATOM 8603  C CD  . ARG D 1 96  ? 27.768  -37.719 5.132   1.00 95.18 ? 96  ARG D CD  1 
ATOM 8604  N NE  . ARG D 1 96  ? 28.281  -38.745 6.031   1.00 95.18 ? 96  ARG D NE  1 
ATOM 8605  C CZ  . ARG D 1 96  ? 27.877  -40.014 6.020   1.00 95.18 ? 96  ARG D CZ  1 
ATOM 8606  N NH1 . ARG D 1 96  ? 26.952  -40.422 5.156   1.00 95.18 ? 96  ARG D NH1 1 
ATOM 8607  N NH2 . ARG D 1 96  ? 28.405  -40.883 6.872   1.00 95.18 ? 96  ARG D NH2 1 
ATOM 8608  N N   . THR D 1 97  ? 27.991  -36.201 0.650   1.00 38.00 ? 97  THR D N   1 
ATOM 8609  C CA  . THR D 1 97  ? 29.098  -35.817 -0.213  1.00 38.00 ? 97  THR D CA  1 
ATOM 8610  C C   . THR D 1 97  ? 29.278  -34.302 -0.276  1.00 38.00 ? 97  THR D C   1 
ATOM 8611  O O   . THR D 1 97  ? 30.324  -33.787 0.118   1.00 38.00 ? 97  THR D O   1 
ATOM 8612  C CB  . THR D 1 97  ? 28.885  -36.342 -1.639  1.00 34.32 ? 97  THR D CB  1 
ATOM 8613  O OG1 . THR D 1 97  ? 28.738  -37.769 -1.606  1.00 34.32 ? 97  THR D OG1 1 
ATOM 8614  C CG2 . THR D 1 97  ? 30.064  -35.957 -2.527  1.00 34.32 ? 97  THR D CG2 1 
ATOM 8615  N N   . ILE D 1 98  ? 28.269  -33.588 -0.780  1.00 29.65 ? 98  ILE D N   1 
ATOM 8616  C CA  . ILE D 1 98  ? 28.361  -32.136 -0.875  1.00 29.65 ? 98  ILE D CA  1 
ATOM 8617  C C   . ILE D 1 98  ? 28.744  -31.543 0.481   1.00 29.65 ? 98  ILE D C   1 
ATOM 8618  O O   . ILE D 1 98  ? 29.571  -30.633 0.552   1.00 29.65 ? 98  ILE D O   1 
ATOM 8619  C CB  . ILE D 1 98  ? 27.029  -31.499 -1.366  1.00 28.10 ? 98  ILE D CB  1 
ATOM 8620  C CG1 . ILE D 1 98  ? 26.950  -31.549 -2.889  1.00 28.10 ? 98  ILE D CG1 1 
ATOM 8621  C CG2 . ILE D 1 98  ? 26.958  -30.036 -0.960  1.00 28.10 ? 98  ILE D CG2 1 
ATOM 8622  C CD1 . ILE D 1 98  ? 26.771  -32.918 -3.446  1.00 28.10 ? 98  ILE D CD1 1 
ATOM 8623  N N   . GLN D 1 99  ? 28.157  -32.066 1.554   1.00 37.84 ? 99  GLN D N   1 
ATOM 8624  C CA  . GLN D 1 99  ? 28.455  -31.568 2.893   1.00 37.84 ? 99  GLN D CA  1 
ATOM 8625  C C   . GLN D 1 99  ? 29.911  -31.734 3.272   1.00 37.84 ? 99  GLN D C   1 
ATOM 8626  O O   . GLN D 1 99  ? 30.521  -30.823 3.833   1.00 37.84 ? 99  GLN D O   1 
ATOM 8627  C CB  . GLN D 1 99  ? 27.615  -32.282 3.937   1.00 57.96 ? 99  GLN D CB  1 
ATOM 8628  C CG  . GLN D 1 99  ? 26.167  -31.913 3.901   1.00 57.96 ? 99  GLN D CG  1 
ATOM 8629  C CD  . GLN D 1 99  ? 25.429  -32.484 5.075   1.00 57.96 ? 99  GLN D CD  1 
ATOM 8630  O OE1 . GLN D 1 99  ? 25.442  -33.696 5.297   1.00 57.96 ? 99  GLN D OE1 1 
ATOM 8631  N NE2 . GLN D 1 99  ? 24.782  -31.617 5.847   1.00 57.96 ? 99  GLN D NE2 1 
ATOM 8632  N N   . ASP D 1 100 ? 30.463  -32.907 2.980   1.00 47.35 ? 100 ASP D N   1 
ATOM 8633  C CA  . ASP D 1 100 ? 31.853  -33.181 3.305   1.00 47.35 ? 100 ASP D CA  1 
ATOM 8634  C C   . ASP D 1 100 ? 32.819  -32.239 2.593   1.00 47.35 ? 100 ASP D C   1 
ATOM 8635  O O   . ASP D 1 100 ? 33.884  -31.944 3.122   1.00 47.35 ? 100 ASP D O   1 
ATOM 8636  C CB  . ASP D 1 100 ? 32.195  -34.640 2.996   1.00 60.48 ? 100 ASP D CB  1 
ATOM 8637  C CG  . ASP D 1 100 ? 31.515  -35.619 3.956   1.00 60.48 ? 100 ASP D CG  1 
ATOM 8638  O OD1 . ASP D 1 100 ? 31.015  -35.182 5.024   1.00 60.48 ? 100 ASP D OD1 1 
ATOM 8639  O OD2 . ASP D 1 100 ? 31.494  -36.833 3.645   1.00 60.48 ? 100 ASP D OD2 1 
ATOM 8640  N N   . LYS D 1 101 ? 32.457  -31.765 1.403   1.00 29.96 ? 101 LYS D N   1 
ATOM 8641  C CA  . LYS D 1 101 ? 33.323  -30.834 0.680   1.00 29.96 ? 101 LYS D CA  1 
ATOM 8642  C C   . LYS D 1 101 ? 33.145  -29.435 1.255   1.00 29.96 ? 101 LYS D C   1 
ATOM 8643  O O   . LYS D 1 101 ? 33.729  -28.469 0.757   1.00 29.96 ? 101 LYS D O   1 
ATOM 8644  C CB  . LYS D 1 101 ? 32.993  -30.800 -0.814  1.00 42.27 ? 101 LYS D CB  1 
ATOM 8645  C CG  . LYS D 1 101 ? 33.334  -32.063 -1.565  1.00 42.27 ? 101 LYS D CG  1 
ATOM 8646  C CD  . LYS D 1 101 ? 33.141  -31.848 -3.051  1.00 42.27 ? 101 LYS D CD  1 
ATOM 8647  C CE  . LYS D 1 101 ? 33.212  -33.157 -3.823  1.00 42.27 ? 101 LYS D CE  1 
ATOM 8648  N NZ  . LYS D 1 101 ? 34.595  -33.708 -3.837  1.00 42.27 ? 101 LYS D NZ  1 
ATOM 8649  N N   . GLY D 1 102 ? 32.327  -29.329 2.300   1.00 35.49 ? 102 GLY D N   1 
ATOM 8650  C CA  . GLY D 1 102 ? 32.098  -28.044 2.929   1.00 35.49 ? 102 GLY D CA  1 
ATOM 8651  C C   . GLY D 1 102 ? 31.165  -27.126 2.158   1.00 35.49 ? 102 GLY D C   1 
ATOM 8652  O O   . GLY D 1 102 ? 31.053  -25.937 2.472   1.00 35.49 ? 102 GLY D O   1 
ATOM 8653  N N   . ILE D 1 103 ? 30.497  -27.667 1.145   1.00 31.59 ? 103 ILE D N   1 
ATOM 8654  C CA  . ILE D 1 103 ? 29.565  -26.883 0.347   1.00 31.59 ? 103 ILE D CA  1 
ATOM 8655  C C   . ILE D 1 103 ? 28.228  -26.883 1.085   1.00 31.59 ? 103 ILE D C   1 
ATOM 8656  O O   . ILE D 1 103 ? 27.892  -27.860 1.750   1.00 31.59 ? 103 ILE D O   1 
ATOM 8657  C CB  . ILE D 1 103 ? 29.415  -27.501 -1.048  1.00 25.82 ? 103 ILE D CB  1 
ATOM 8658  C CG1 . ILE D 1 103 ? 30.805  -27.637 -1.677  1.00 25.82 ? 103 ILE D CG1 1 
ATOM 8659  C CG2 . ILE D 1 103 ? 28.524  -26.637 -1.917  1.00 25.82 ? 103 ILE D CG2 1 
ATOM 8660  C CD1 . ILE D 1 103 ? 30.816  -28.236 -3.055  1.00 25.82 ? 103 ILE D CD1 1 
ATOM 8661  N N   . VAL D 1 104 ? 27.475  -25.791 0.989   1.00 27.21 ? 104 VAL D N   1 
ATOM 8662  C CA  . VAL D 1 104 ? 26.192  -25.712 1.685   1.00 27.21 ? 104 VAL D CA  1 
ATOM 8663  C C   . VAL D 1 104 ? 25.066  -26.384 0.896   1.00 27.21 ? 104 VAL D C   1 
ATOM 8664  O O   . VAL D 1 104 ? 25.031  -26.309 -0.335  1.00 27.21 ? 104 VAL D O   1 
ATOM 8665  C CB  . VAL D 1 104 ? 25.797  -24.248 1.967   1.00 22.18 ? 104 VAL D CB  1 
ATOM 8666  C CG1 . VAL D 1 104 ? 24.622  -24.212 2.918   1.00 22.18 ? 104 VAL D CG1 1 
ATOM 8667  C CG2 . VAL D 1 104 ? 26.967  -23.493 2.561   1.00 22.18 ? 104 VAL D CG2 1 
ATOM 8668  N N   . VAL D 1 105 ? 24.147  -27.032 1.614   1.00 33.21 ? 105 VAL D N   1 
ATOM 8669  C CA  . VAL D 1 105 ? 23.019  -27.730 0.994   1.00 33.21 ? 105 VAL D CA  1 
ATOM 8670  C C   . VAL D 1 105 ? 21.701  -26.946 1.044   1.00 33.21 ? 105 VAL D C   1 
ATOM 8671  O O   . VAL D 1 105 ? 21.357  -26.359 2.075   1.00 33.21 ? 105 VAL D O   1 
ATOM 8672  C CB  . VAL D 1 105 ? 22.792  -29.095 1.675   1.00 24.70 ? 105 VAL D CB  1 
ATOM 8673  C CG1 . VAL D 1 105 ? 21.677  -29.845 0.981   1.00 24.70 ? 105 VAL D CG1 1 
ATOM 8674  C CG2 . VAL D 1 105 ? 24.066  -29.904 1.641   1.00 24.70 ? 105 VAL D CG2 1 
ATOM 8675  N N   . GLY D 1 106 ? 20.962  -26.947 -0.066  1.00 27.53 ? 106 GLY D N   1 
ATOM 8676  C CA  . GLY D 1 106 ? 19.689  -26.245 -0.113  1.00 27.53 ? 106 GLY D CA  1 
ATOM 8677  C C   . GLY D 1 106 ? 18.613  -27.008 -0.872  1.00 27.53 ? 106 GLY D C   1 
ATOM 8678  O O   . GLY D 1 106 ? 18.942  -27.918 -1.631  1.00 27.53 ? 106 GLY D O   1 
ATOM 8679  N N   . ILE D 1 107 ? 17.338  -26.648 -0.670  1.00 25.43 ? 107 ILE D N   1 
ATOM 8680  C CA  . ILE D 1 107 ? 16.201  -27.294 -1.356  1.00 25.43 ? 107 ILE D CA  1 
ATOM 8681  C C   . ILE D 1 107 ? 15.226  -26.288 -1.921  1.00 25.43 ? 107 ILE D C   1 
ATOM 8682  O O   . ILE D 1 107 ? 14.977  -25.244 -1.312  1.00 25.43 ? 107 ILE D O   1 
ATOM 8683  C CB  . ILE D 1 107 ? 15.301  -28.154 -0.423  1.00 19.43 ? 107 ILE D CB  1 
ATOM 8684  C CG1 . ILE D 1 107 ? 15.837  -28.103 0.991   1.00 19.43 ? 107 ILE D CG1 1 
ATOM 8685  C CG2 . ILE D 1 107 ? 15.146  -29.559 -0.962  1.00 19.43 ? 107 ILE D CG2 1 
ATOM 8686  C CD1 . ILE D 1 107 ? 15.850  -26.699 1.546   1.00 19.43 ? 107 ILE D CD1 1 
ATOM 8687  N N   . LYS D 1 108 ? 14.666  -26.627 -3.079  1.00 31.75 ? 108 LYS D N   1 
ATOM 8688  C CA  . LYS D 1 108 ? 13.631  -25.821 -3.722  1.00 31.75 ? 108 LYS D CA  1 
ATOM 8689  C C   . LYS D 1 108 ? 12.423  -26.203 -2.855  1.00 31.75 ? 108 LYS D C   1 
ATOM 8690  O O   . LYS D 1 108 ? 12.207  -27.388 -2.600  1.00 31.75 ? 108 LYS D O   1 
ATOM 8691  C CB  . LYS D 1 108 ? 13.423  -26.303 -5.161  1.00 30.21 ? 108 LYS D CB  1 
ATOM 8692  C CG  . LYS D 1 108 ? 12.239  -25.719 -5.920  1.00 30.21 ? 108 LYS D CG  1 
ATOM 8693  C CD  . LYS D 1 108 ? 12.092  -26.438 -7.267  1.00 30.21 ? 108 LYS D CD  1 
ATOM 8694  C CE  . LYS D 1 108 ? 11.441  -25.564 -8.352  1.00 30.21 ? 108 LYS D CE  1 
ATOM 8695  N NZ  . LYS D 1 108 ? 11.570  -26.156 -9.754  1.00 30.21 ? 108 LYS D NZ  1 
ATOM 8696  N N   . VAL D 1 109 ? 11.658  -25.230 -2.373  1.00 24.58 ? 109 VAL D N   1 
ATOM 8697  C CA  . VAL D 1 109 ? 10.507  -25.559 -1.539  1.00 24.58 ? 109 VAL D CA  1 
ATOM 8698  C C   . VAL D 1 109 ? 9.171   -25.121 -2.124  1.00 24.58 ? 109 VAL D C   1 
ATOM 8699  O O   . VAL D 1 109 ? 8.124   -25.624 -1.721  1.00 24.58 ? 109 VAL D O   1 
ATOM 8700  C CB  . VAL D 1 109 ? 10.647  -24.958 -0.131  1.00 13.41 ? 109 VAL D CB  1 
ATOM 8701  C CG1 . VAL D 1 109 ? 11.906  -25.483 0.520   1.00 13.41 ? 109 VAL D CG1 1 
ATOM 8702  C CG2 . VAL D 1 109 ? 10.664  -23.443 -0.204  1.00 13.41 ? 109 VAL D CG2 1 
ATOM 8703  N N   . ASP D 1 110 ? 9.200   -24.187 -3.073  1.00 19.03 ? 110 ASP D N   1 
ATOM 8704  C CA  . ASP D 1 110 ? 7.961   -23.723 -3.686  1.00 19.03 ? 110 ASP D CA  1 
ATOM 8705  C C   . ASP D 1 110 ? 7.304   -24.918 -4.361  1.00 19.03 ? 110 ASP D C   1 
ATOM 8706  O O   . ASP D 1 110 ? 7.978   -25.867 -4.748  1.00 19.03 ? 110 ASP D O   1 
ATOM 8707  C CB  . ASP D 1 110 ? 8.220   -22.615 -4.716  1.00 34.88 ? 110 ASP D CB  1 
ATOM 8708  C CG  . ASP D 1 110 ? 8.790   -23.138 -6.018  1.00 34.88 ? 110 ASP D CG  1 
ATOM 8709  O OD1 . ASP D 1 110 ? 10.012  -23.012 -6.223  1.00 34.88 ? 110 ASP D OD1 1 
ATOM 8710  O OD2 . ASP D 1 110 ? 8.017   -23.673 -6.840  1.00 34.88 ? 110 ASP D OD2 1 
ATOM 8711  N N   . LYS D 1 111 ? 5.986   -24.878 -4.482  1.00 26.53 ? 111 LYS D N   1 
ATOM 8712  C CA  . LYS D 1 111 ? 5.261   -25.967 -5.098  1.00 26.53 ? 111 LYS D CA  1 
ATOM 8713  C C   . LYS D 1 111 ? 4.686   -25.538 -6.433  1.00 26.53 ? 111 LYS D C   1 
ATOM 8714  O O   . LYS D 1 111 ? 3.529   -25.814 -6.740  1.00 26.53 ? 111 LYS D O   1 
ATOM 8715  C CB  . LYS D 1 111 ? 4.140   -26.455 -4.183  1.00 35.56 ? 111 LYS D CB  1 
ATOM 8716  C CG  . LYS D 1 111 ? 4.601   -27.018 -2.847  1.00 35.56 ? 111 LYS D CG  1 
ATOM 8717  C CD  . LYS D 1 111 ? 3.794   -28.268 -2.485  1.00 35.56 ? 111 LYS D CD  1 
ATOM 8718  C CE  . LYS D 1 111 ? 3.652   -28.493 -0.975  1.00 35.56 ? 111 LYS D CE  1 
ATOM 8719  N NZ  . LYS D 1 111 ? 2.721   -27.513 -0.295  1.00 35.56 ? 111 LYS D NZ  1 
ATOM 8720  N N   . GLY D 1 112 ? 5.488   -24.836 -7.220  1.00 19.08 ? 112 GLY D N   1 
ATOM 8721  C CA  . GLY D 1 112 ? 5.022   -24.432 -8.532  1.00 19.08 ? 112 GLY D CA  1 
ATOM 8722  C C   . GLY D 1 112 ? 4.252   -23.138 -8.657  1.00 19.08 ? 112 GLY D C   1 
ATOM 8723  O O   . GLY D 1 112 ? 3.697   -22.594 -7.699  1.00 19.08 ? 112 GLY D O   1 
ATOM 8724  N N   . VAL D 1 113 ? 4.213   -22.656 -9.889  1.00 19.10 ? 113 VAL D N   1 
ATOM 8725  C CA  . VAL D 1 113 ? 3.550   -21.418 -10.223 1.00 19.10 ? 113 VAL D CA  1 
ATOM 8726  C C   . VAL D 1 113 ? 2.084   -21.697 -10.501 1.00 19.10 ? 113 VAL D C   1 
ATOM 8727  O O   . VAL D 1 113 ? 1.737   -22.785 -10.951 1.00 19.10 ? 113 VAL D O   1 
ATOM 8728  C CB  . VAL D 1 113 ? 4.192   -20.828 -11.479 1.00 14.43 ? 113 VAL D CB  1 
ATOM 8729  C CG1 . VAL D 1 113 ? 3.671   -21.535 -12.705 1.00 14.43 ? 113 VAL D CG1 1 
ATOM 8730  C CG2 . VAL D 1 113 ? 3.927   -19.369 -11.557 1.00 14.43 ? 113 VAL D CG2 1 
ATOM 8731  N N   . VAL D 1 114 ? 1.224   -20.720 -10.234 1.00 27.90 ? 114 VAL D N   1 
ATOM 8732  C CA  . VAL D 1 114 ? -0.205  -20.872 -10.487 1.00 27.90 ? 114 VAL D CA  1 
ATOM 8733  C C   . VAL D 1 114 ? -0.781  -19.565 -11.028 1.00 27.90 ? 114 VAL D C   1 
ATOM 8734  O O   . VAL D 1 114 ? -0.223  -18.490 -10.810 1.00 27.90 ? 114 VAL D O   1 
ATOM 8735  C CB  . VAL D 1 114 ? -0.972  -21.276 -9.221  1.00 10.04 ? 114 VAL D CB  1 
ATOM 8736  C CG1 . VAL D 1 114 ? -0.432  -22.585 -8.678  1.00 10.04 ? 114 VAL D CG1 1 
ATOM 8737  C CG2 . VAL D 1 114 ? -0.853  -20.190 -8.175  1.00 10.04 ? 114 VAL D CG2 1 
ATOM 8738  N N   . PRO D 1 115 ? -1.919  -19.644 -11.731 1.00 26.03 ? 115 PRO D N   1 
ATOM 8739  C CA  . PRO D 1 115 ? -2.654  -18.543 -12.362 1.00 26.03 ? 115 PRO D CA  1 
ATOM 8740  C C   . PRO D 1 115 ? -3.259  -17.497 -11.465 1.00 26.03 ? 115 PRO D C   1 
ATOM 8741  O O   . PRO D 1 115 ? -3.835  -17.809 -10.422 1.00 26.03 ? 115 PRO D O   1 
ATOM 8742  C CB  . PRO D 1 115 ? -3.759  -19.252 -13.127 1.00 4.91  ? 115 PRO D CB  1 
ATOM 8743  C CG  . PRO D 1 115 ? -3.267  -20.651 -13.271 1.00 4.91  ? 115 PRO D CG  1 
ATOM 8744  C CD  . PRO D 1 115 ? -2.635  -20.907 -11.951 1.00 4.91  ? 115 PRO D CD  1 
ATOM 8745  N N   . LEU D 1 116 ? -3.140  -16.249 -11.893 1.00 22.10 ? 116 LEU D N   1 
ATOM 8746  C CA  . LEU D 1 116 ? -3.743  -15.149 -11.170 1.00 22.10 ? 116 LEU D CA  1 
ATOM 8747  C C   . LEU D 1 116 ? -4.990  -14.792 -11.969 1.00 22.10 ? 116 LEU D C   1 
ATOM 8748  O O   . LEU D 1 116 ? -4.907  -14.170 -13.033 1.00 22.10 ? 116 LEU D O   1 
ATOM 8749  C CB  . LEU D 1 116 ? -2.810  -13.938 -11.094 1.00 11.95 ? 116 LEU D CB  1 
ATOM 8750  C CG  . LEU D 1 116 ? -1.695  -13.989 -10.056 1.00 11.95 ? 116 LEU D CG  1 
ATOM 8751  C CD1 . LEU D 1 116 ? -1.106  -12.603 -9.915  1.00 11.95 ? 116 LEU D CD1 1 
ATOM 8752  C CD2 . LEU D 1 116 ? -2.232  -14.458 -8.715  1.00 11.95 ? 116 LEU D CD2 1 
ATOM 8753  N N   . ALA D 1 117 ? -6.147  -15.207 -11.466 1.00 24.61 ? 117 ALA D N   1 
ATOM 8754  C CA  . ALA D 1 117 ? -7.399  -14.924 -12.143 1.00 24.61 ? 117 ALA D CA  1 
ATOM 8755  C C   . ALA D 1 117 ? -7.507  -13.434 -12.403 1.00 24.61 ? 117 ALA D C   1 
ATOM 8756  O O   . ALA D 1 117 ? -7.175  -12.623 -11.535 1.00 24.61 ? 117 ALA D O   1 
ATOM 8757  C CB  . ALA D 1 117 ? -8.557  -15.386 -11.286 1.00 47.74 ? 117 ALA D CB  1 
ATOM 8758  N N   . GLY D 1 118 ? -7.950  -13.077 -13.604 1.00 19.53 ? 118 GLY D N   1 
ATOM 8759  C CA  . GLY D 1 118 ? -8.132  -11.677 -13.938 1.00 19.53 ? 118 GLY D CA  1 
ATOM 8760  C C   . GLY D 1 118 ? -6.946  -10.950 -14.530 1.00 19.53 ? 118 GLY D C   1 
ATOM 8761  O O   . GLY D 1 118 ? -7.023  -9.741  -14.792 1.00 19.53 ? 118 GLY D O   1 
ATOM 8762  N N   . THR D 1 119 ? -5.852  -11.672 -14.745 1.00 26.17 ? 119 THR D N   1 
ATOM 8763  C CA  . THR D 1 119 ? -4.645  -11.069 -15.302 1.00 26.17 ? 119 THR D CA  1 
ATOM 8764  C C   . THR D 1 119 ? -4.383  -11.624 -16.682 1.00 26.17 ? 119 THR D C   1 
ATOM 8765  O O   . THR D 1 119 ? -5.032  -12.582 -17.103 1.00 26.17 ? 119 THR D O   1 
ATOM 8766  C CB  . THR D 1 119 ? -3.407  -11.378 -14.449 1.00 28.40 ? 119 THR D CB  1 
ATOM 8767  O OG1 . THR D 1 119 ? -3.138  -12.784 -14.505 1.00 28.40 ? 119 THR D OG1 1 
ATOM 8768  C CG2 . THR D 1 119 ? -3.631  -10.963 -12.995 1.00 28.40 ? 119 THR D CG2 1 
ATOM 8769  N N   . ASP D 1 120 ? -3.421  -11.028 -17.376 1.00 25.44 ? 120 ASP D N   1 
ATOM 8770  C CA  . ASP D 1 120 ? -3.065  -11.478 -18.716 1.00 25.44 ? 120 ASP D CA  1 
ATOM 8771  C C   . ASP D 1 120 ? -2.053  -12.615 -18.622 1.00 25.44 ? 120 ASP D C   1 
ATOM 8772  O O   . ASP D 1 120 ? -0.864  -12.439 -18.894 1.00 25.44 ? 120 ASP D O   1 
ATOM 8773  C CB  . ASP D 1 120 ? -2.476  -10.325 -19.527 1.00 43.11 ? 120 ASP D CB  1 
ATOM 8774  C CG  . ASP D 1 120 ? -2.174  -10.716 -20.964 1.00 43.11 ? 120 ASP D CG  1 
ATOM 8775  O OD1 . ASP D 1 120 ? -1.708  -9.839  -21.723 1.00 43.11 ? 120 ASP D OD1 1 
ATOM 8776  O OD2 . ASP D 1 120 ? -2.396  -11.889 -21.343 1.00 43.11 ? 120 ASP D OD2 1 
ATOM 8777  N N   . GLY D 1 121 ? -2.535  -13.785 -18.220 1.00 30.42 ? 121 GLY D N   1 
ATOM 8778  C CA  . GLY D 1 121 ? -1.671  -14.943 -18.098 1.00 30.42 ? 121 GLY D CA  1 
ATOM 8779  C C   . GLY D 1 121 ? -0.550  -14.776 -17.096 1.00 30.42 ? 121 GLY D C   1 
ATOM 8780  O O   . GLY D 1 121 ? 0.544   -15.296 -17.289 1.00 30.42 ? 121 GLY D O   1 
ATOM 8781  N N   . GLU D 1 122 ? -0.808  -14.047 -16.022 1.00 21.47 ? 122 GLU D N   1 
ATOM 8782  C CA  . GLU D 1 122 ? 0.207   -13.851 -15.009 1.00 21.47 ? 122 GLU D CA  1 
ATOM 8783  C C   . GLU D 1 122 ? 0.043   -14.889 -13.929 1.00 21.47 ? 122 GLU D C   1 
ATOM 8784  O O   . GLU D 1 122 ? -0.989  -15.544 -13.848 1.00 21.47 ? 122 GLU D O   1 
ATOM 8785  C CB  . GLU D 1 122 ? 0.085   -12.477 -14.418 1.00 23.41 ? 122 GLU D CB  1 
ATOM 8786  C CG  . GLU D 1 122 ? 0.143   -11.427 -15.455 1.00 23.41 ? 122 GLU D CG  1 
ATOM 8787  C CD  . GLU D 1 122 ? 0.270   -10.093 -14.820 1.00 23.41 ? 122 GLU D CD  1 
ATOM 8788  O OE1 . GLU D 1 122 ? 1.345   -9.849  -14.233 1.00 23.41 ? 122 GLU D OE1 1 
ATOM 8789  O OE2 . GLU D 1 122 ? -0.704  -9.307  -14.887 1.00 23.41 ? 122 GLU D OE2 1 
ATOM 8790  N N   . THR D 1 123 ? 1.053   -15.025 -13.083 1.00 24.81 ? 123 THR D N   1 
ATOM 8791  C CA  . THR D 1 123 ? 0.993   -16.033 -12.044 1.00 24.81 ? 123 THR D CA  1 
ATOM 8792  C C   . THR D 1 123 ? 1.472   -15.570 -10.695 1.00 24.81 ? 123 THR D C   1 
ATOM 8793  O O   . THR D 1 123 ? 1.772   -14.399 -10.473 1.00 24.81 ? 123 THR D O   1 
ATOM 8794  C CB  . THR D 1 123 ? 1.867   -17.236 -12.401 1.00 24.30 ? 123 THR D CB  1 
ATOM 8795  O OG1 . THR D 1 123 ? 3.197   -16.776 -12.669 1.00 24.30 ? 123 THR D OG1 1 
ATOM 8796  C CG2 . THR D 1 123 ? 1.339   -17.961 -13.611 1.00 24.30 ? 123 THR D CG2 1 
ATOM 8797  N N   . THR D 1 124 ? 1.542   -16.545 -9.803  1.00 29.49 ? 124 THR D N   1 
ATOM 8798  C CA  . THR D 1 124 ? 2.027   -16.368 -8.453  1.00 29.49 ? 124 THR D CA  1 
ATOM 8799  C C   . THR D 1 124 ? 2.531   -17.768 -8.129  1.00 29.49 ? 124 THR D C   1 
ATOM 8800  O O   . THR D 1 124 ? 2.424   -18.672 -8.959  1.00 29.49 ? 124 THR D O   1 
ATOM 8801  C CB  . THR D 1 124 ? 0.909   -15.949 -7.484  1.00 20.48 ? 124 THR D CB  1 
ATOM 8802  O OG1 . THR D 1 124 ? 1.463   -15.724 -6.179  1.00 20.48 ? 124 THR D OG1 1 
ATOM 8803  C CG2 . THR D 1 124 ? -0.152  -17.022 -7.404  1.00 20.48 ? 124 THR D CG2 1 
ATOM 8804  N N   . THR D 1 125 ? 3.063   -17.963 -6.933  1.00 16.44 ? 125 THR D N   1 
ATOM 8805  C CA  . THR D 1 125 ? 3.612   -19.263 -6.592  1.00 16.44 ? 125 THR D CA  1 
ATOM 8806  C C   . THR D 1 125 ? 2.997   -19.850 -5.339  1.00 16.44 ? 125 THR D C   1 
ATOM 8807  O O   . THR D 1 125 ? 2.663   -19.128 -4.405  1.00 16.44 ? 125 THR D O   1 
ATOM 8808  C CB  . THR D 1 125 ? 5.135   -19.152 -6.378  1.00 25.91 ? 125 THR D CB  1 
ATOM 8809  O OG1 . THR D 1 125 ? 5.736   -18.557 -7.533  1.00 25.91 ? 125 THR D OG1 1 
ATOM 8810  C CG2 . THR D 1 125 ? 5.744   -20.511 -6.137  1.00 25.91 ? 125 THR D CG2 1 
ATOM 8811  N N   . GLN D 1 126 ? 2.849   -21.165 -5.316  1.00 19.90 ? 126 GLN D N   1 
ATOM 8812  C CA  . GLN D 1 126 ? 2.306   -21.809 -4.143  1.00 19.90 ? 126 GLN D CA  1 
ATOM 8813  C C   . GLN D 1 126 ? 3.366   -22.661 -3.474  1.00 19.90 ? 126 GLN D C   1 
ATOM 8814  O O   . GLN D 1 126 ? 4.392   -22.958 -4.078  1.00 19.90 ? 126 GLN D O   1 
ATOM 8815  C CB  . GLN D 1 126 ? 1.122   -22.670 -4.521  1.00 21.79 ? 126 GLN D CB  1 
ATOM 8816  C CG  . GLN D 1 126 ? 1.363   -23.626 -5.640  1.00 21.79 ? 126 GLN D CG  1 
ATOM 8817  C CD  . GLN D 1 126 ? 0.200   -24.568 -5.771  1.00 21.79 ? 126 GLN D CD  1 
ATOM 8818  O OE1 . GLN D 1 126 ? -0.936  -24.208 -5.455  1.00 21.79 ? 126 GLN D OE1 1 
ATOM 8819  N NE2 . GLN D 1 126 ? 0.463   -25.778 -6.237  1.00 21.79 ? 126 GLN D NE2 1 
ATOM 8820  N N   . GLY D 1 127 ? 3.118   -23.048 -2.225  1.00 23.26 ? 127 GLY D N   1 
ATOM 8821  C CA  . GLY D 1 127 ? 4.066   -23.868 -1.499  1.00 23.26 ? 127 GLY D CA  1 
ATOM 8822  C C   . GLY D 1 127 ? 4.067   -23.552 -0.017  1.00 23.26 ? 127 GLY D C   1 
ATOM 8823  O O   . GLY D 1 127 ? 4.654   -24.292 0.783   1.00 23.26 ? 127 GLY D O   1 
ATOM 8824  N N   . LEU D 1 128 ? 3.396   -22.465 0.355   1.00 15.02 ? 128 LEU D N   1 
ATOM 8825  C CA  . LEU D 1 128 ? 3.336   -22.040 1.750   1.00 15.02 ? 128 LEU D CA  1 
ATOM 8826  C C   . LEU D 1 128 ? 2.681   -23.030 2.712   1.00 15.02 ? 128 LEU D C   1 
ATOM 8827  O O   . LEU D 1 128 ? 3.034   -23.071 3.887   1.00 15.02 ? 128 LEU D O   1 
ATOM 8828  C CB  . LEU D 1 128 ? 2.610   -20.699 1.866   1.00 8.50  ? 128 LEU D CB  1 
ATOM 8829  C CG  . LEU D 1 128 ? 3.262   -19.451 1.278   1.00 8.50  ? 128 LEU D CG  1 
ATOM 8830  C CD1 . LEU D 1 128 ? 2.432   -18.236 1.621   1.00 8.50  ? 128 LEU D CD1 1 
ATOM 8831  C CD2 . LEU D 1 128 ? 4.648   -19.283 1.848   1.00 8.50  ? 128 LEU D CD2 1 
ATOM 8832  N N   . ASP D 1 129 ? 1.720   -23.816 2.240   1.00 19.13 ? 129 ASP D N   1 
ATOM 8833  C CA  . ASP D 1 129 ? 1.061   -24.760 3.134   1.00 19.13 ? 129 ASP D CA  1 
ATOM 8834  C C   . ASP D 1 129 ? 2.042   -25.782 3.703   1.00 19.13 ? 129 ASP D C   1 
ATOM 8835  O O   . ASP D 1 129 ? 2.714   -26.516 2.962   1.00 19.13 ? 129 ASP D O   1 
ATOM 8836  C CB  . ASP D 1 129 ? -0.083  -25.474 2.418   1.00 26.31 ? 129 ASP D CB  1 
ATOM 8837  C CG  . ASP D 1 129 ? -1.210  -24.533 2.034   1.00 26.31 ? 129 ASP D CG  1 
ATOM 8838  O OD1 . ASP D 1 129 ? -1.282  -23.421 2.603   1.00 26.31 ? 129 ASP D OD1 1 
ATOM 8839  O OD2 . ASP D 1 129 ? -2.035  -24.914 1.169   1.00 26.31 ? 129 ASP D OD2 1 
ATOM 8840  N N   . GLY D 1 130 ? 2.129   -25.808 5.029   1.00 21.53 ? 130 GLY D N   1 
ATOM 8841  C CA  . GLY D 1 130 ? 3.018   -26.733 5.705   1.00 21.53 ? 130 GLY D CA  1 
ATOM 8842  C C   . GLY D 1 130 ? 4.504   -26.455 5.544   1.00 21.53 ? 130 GLY D C   1 
ATOM 8843  O O   . GLY D 1 130 ? 5.333   -27.235 6.022   1.00 21.53 ? 130 GLY D O   1 
ATOM 8844  N N   . LEU D 1 131 ? 4.854   -25.351 4.891   1.00 28.28 ? 131 LEU D N   1 
ATOM 8845  C CA  . LEU D 1 131 ? 6.257   -25.020 4.675   1.00 28.28 ? 131 LEU D CA  1 
ATOM 8846  C C   . LEU D 1 131 ? 7.093   -25.023 5.949   1.00 28.28 ? 131 LEU D C   1 
ATOM 8847  O O   . LEU D 1 131 ? 8.245   -25.449 5.933   1.00 28.28 ? 131 LEU D O   1 
ATOM 8848  C CB  . LEU D 1 131 ? 6.389   -23.659 3.995   1.00 21.08 ? 131 LEU D CB  1 
ATOM 8849  C CG  . LEU D 1 131 ? 7.817   -23.240 3.647   1.00 21.08 ? 131 LEU D CG  1 
ATOM 8850  C CD1 . LEU D 1 131 ? 8.390   -24.169 2.593   1.00 21.08 ? 131 LEU D CD1 1 
ATOM 8851  C CD2 . LEU D 1 131 ? 7.809   -21.815 3.137   1.00 21.08 ? 131 LEU D CD2 1 
ATOM 8852  N N   . SER D 1 132 ? 6.529   -24.558 7.055   1.00 21.73 ? 132 SER D N   1 
ATOM 8853  C CA  . SER D 1 132 ? 7.298   -24.523 8.289   1.00 21.73 ? 132 SER D CA  1 
ATOM 8854  C C   . SER D 1 132 ? 7.737   -25.922 8.730   1.00 21.73 ? 132 SER D C   1 
ATOM 8855  O O   . SER D 1 132 ? 8.899   -26.129 9.076   1.00 21.73 ? 132 SER D O   1 
ATOM 8856  C CB  . SER D 1 132 ? 6.495   -23.850 9.396   1.00 21.83 ? 132 SER D CB  1 
ATOM 8857  O OG  . SER D 1 132 ? 7.353   -23.463 10.451  1.00 21.83 ? 132 SER D OG  1 
ATOM 8858  N N   . GLU D 1 133 ? 6.814   -26.881 8.712   1.00 30.13 ? 133 GLU D N   1 
ATOM 8859  C CA  . GLU D 1 133 ? 7.124   -28.258 9.097   1.00 30.13 ? 133 GLU D CA  1 
ATOM 8860  C C   . GLU D 1 133 ? 8.177   -28.802 8.151   1.00 30.13 ? 133 GLU D C   1 
ATOM 8861  O O   . GLU D 1 133 ? 9.133   -29.454 8.568   1.00 30.13 ? 133 GLU D O   1 
ATOM 8862  C CB  . GLU D 1 133 ? 5.885   -29.151 8.993   1.00 84.38 ? 133 GLU D CB  1 
ATOM 8863  C CG  . GLU D 1 133 ? 4.798   -28.863 10.003  1.00 84.38 ? 133 GLU D CG  1 
ATOM 8864  C CD  . GLU D 1 133 ? 4.284   -27.433 9.926   1.00 84.38 ? 133 GLU D CD  1 
ATOM 8865  O OE1 . GLU D 1 133 ? 3.752   -27.028 8.862   1.00 84.38 ? 133 GLU D OE1 1 
ATOM 8866  O OE2 . GLU D 1 133 ? 4.411   -26.709 10.941  1.00 84.38 ? 133 GLU D OE2 1 
ATOM 8867  N N   . ARG D 1 134 ? 7.989   -28.529 6.866   1.00 28.09 ? 134 ARG D N   1 
ATOM 8868  C CA  . ARG D 1 134 ? 8.912   -29.000 5.851   1.00 28.09 ? 134 ARG D CA  1 
ATOM 8869  C C   . ARG D 1 134 ? 10.307  -28.444 6.047   1.00 28.09 ? 134 ARG D C   1 
ATOM 8870  O O   . ARG D 1 134 ? 11.289  -29.173 5.913   1.00 28.09 ? 134 ARG D O   1 
ATOM 8871  C CB  . ARG D 1 134 ? 8.402   -28.621 4.469   1.00 32.27 ? 134 ARG D CB  1 
ATOM 8872  C CG  . ARG D 1 134 ? 7.101   -29.277 4.119   1.00 32.27 ? 134 ARG D CG  1 
ATOM 8873  C CD  . ARG D 1 134 ? 6.571   -28.710 2.844   1.00 32.27 ? 134 ARG D CD  1 
ATOM 8874  N NE  . ARG D 1 134 ? 7.532   -28.862 1.762   1.00 32.27 ? 134 ARG D NE  1 
ATOM 8875  C CZ  . ARG D 1 134 ? 7.558   -28.068 0.697   1.00 32.27 ? 134 ARG D CZ  1 
ATOM 8876  N NH1 . ARG D 1 134 ? 6.664   -27.075 0.607   1.00 32.27 ? 134 ARG D NH1 1 
ATOM 8877  N NH2 . ARG D 1 134 ? 8.469   -28.261 -0.265  1.00 32.27 ? 134 ARG D NH2 1 
ATOM 8878  N N   . CYS D 1 135 ? 10.402  -27.154 6.352   1.00 28.15 ? 135 CYS D N   1 
ATOM 8879  C CA  . CYS D 1 135 ? 11.706  -26.545 6.555   1.00 28.15 ? 135 CYS D CA  1 
ATOM 8880  C C   . CYS D 1 135 ? 12.373  -27.221 7.730   1.00 28.15 ? 135 CYS D C   1 
ATOM 8881  O O   . CYS D 1 135 ? 13.522  -27.649 7.647   1.00 28.15 ? 135 CYS D O   1 
ATOM 8882  C CB  . CYS D 1 135 ? 11.571  -25.051 6.825   1.00 24.53 ? 135 CYS D CB  1 
ATOM 8883  S SG  . CYS D 1 135 ? 11.218  -24.084 5.345   1.00 24.53 ? 135 CYS D SG  1 
ATOM 8884  N N   . ALA D 1 136 ? 11.641  -27.324 8.827   1.00 23.07 ? 136 ALA D N   1 
ATOM 8885  C CA  . ALA D 1 136 ? 12.170  -27.963 10.012  1.00 23.07 ? 136 ALA D CA  1 
ATOM 8886  C C   . ALA D 1 136 ? 12.784  -29.321 9.650   1.00 23.07 ? 136 ALA D C   1 
ATOM 8887  O O   . ALA D 1 136 ? 13.854  -29.679 10.144  1.00 23.07 ? 136 ALA D O   1 
ATOM 8888  C CB  . ALA D 1 136 ? 11.068  -28.134 11.012  1.00 6.77  ? 136 ALA D CB  1 
ATOM 8889  N N   . GLN D 1 137 ? 12.099  -30.060 8.780   1.00 25.71 ? 137 GLN D N   1 
ATOM 8890  C CA  . GLN D 1 137 ? 12.553  -31.372 8.333   1.00 25.71 ? 137 GLN D CA  1 
ATOM 8891  C C   . GLN D 1 137 ? 13.805  -31.272 7.473   1.00 25.71 ? 137 GLN D C   1 
ATOM 8892  O O   . GLN D 1 137 ? 14.798  -31.952 7.714   1.00 25.71 ? 137 GLN D O   1 
ATOM 8893  C CB  . GLN D 1 137 ? 11.461  -32.065 7.517   1.00 46.54 ? 137 GLN D CB  1 
ATOM 8894  C CG  . GLN D 1 137 ? 10.871  -33.291 8.187   1.00 46.54 ? 137 GLN D CG  1 
ATOM 8895  C CD  . GLN D 1 137 ? 11.937  -34.234 8.703   1.00 46.54 ? 137 GLN D CD  1 
ATOM 8896  O OE1 . GLN D 1 137 ? 12.733  -34.773 7.934   1.00 46.54 ? 137 GLN D OE1 1 
ATOM 8897  N NE2 . GLN D 1 137 ? 11.965  -34.433 10.021  1.00 46.54 ? 137 GLN D NE2 1 
ATOM 8898  N N   . TYR D 1 138 ? 13.738  -30.434 6.451   1.00 29.03 ? 138 TYR D N   1 
ATOM 8899  C CA  . TYR D 1 138 ? 14.858  -30.243 5.553   1.00 29.03 ? 138 TYR D CA  1 
ATOM 8900  C C   . TYR D 1 138 ? 16.100  -29.824 6.320   1.00 29.03 ? 138 TYR D C   1 
ATOM 8901  O O   . TYR D 1 138 ? 17.203  -30.274 6.022   1.00 29.03 ? 138 TYR D O   1 
ATOM 8902  C CB  . TYR D 1 138 ? 14.500  -29.190 4.517   1.00 25.68 ? 138 TYR D CB  1 
ATOM 8903  C CG  . TYR D 1 138 ? 13.507  -29.671 3.493   1.00 25.68 ? 138 TYR D CG  1 
ATOM 8904  C CD1 . TYR D 1 138 ? 12.628  -28.784 2.888   1.00 25.68 ? 138 TYR D CD1 1 
ATOM 8905  C CD2 . TYR D 1 138 ? 13.470  -31.007 3.097   1.00 25.68 ? 138 TYR D CD2 1 
ATOM 8906  C CE1 . TYR D 1 138 ? 11.736  -29.205 1.916   1.00 25.68 ? 138 TYR D CE1 1 
ATOM 8907  C CE2 . TYR D 1 138 ? 12.580  -31.441 2.122   1.00 25.68 ? 138 TYR D CE2 1 
ATOM 8908  C CZ  . TYR D 1 138 ? 11.716  -30.531 1.537   1.00 25.68 ? 138 TYR D CZ  1 
ATOM 8909  O OH  . TYR D 1 138 ? 10.815  -30.928 0.573   1.00 25.68 ? 138 TYR D OH  1 
ATOM 8910  N N   . LYS D 1 139 ? 15.925  -28.956 7.306   1.00 30.51 ? 139 LYS D N   1 
ATOM 8911  C CA  . LYS D 1 139 ? 17.056  -28.506 8.102   1.00 30.51 ? 139 LYS D CA  1 
ATOM 8912  C C   . LYS D 1 139 ? 17.625  -29.737 8.777   1.00 30.51 ? 139 LYS D C   1 
ATOM 8913  O O   . LYS D 1 139 ? 18.829  -29.987 8.734   1.00 30.51 ? 139 LYS D O   1 
ATOM 8914  C CB  . LYS D 1 139 ? 16.603  -27.513 9.169   1.00 17.21 ? 139 LYS D CB  1 
ATOM 8915  C CG  . LYS D 1 139 ? 17.719  -27.007 10.067  1.00 17.21 ? 139 LYS D CG  1 
ATOM 8916  C CD  . LYS D 1 139 ? 18.645  -26.050 9.340   1.00 17.21 ? 139 LYS D CD  1 
ATOM 8917  C CE  . LYS D 1 139 ? 19.581  -25.369 10.341  1.00 17.21 ? 139 LYS D CE  1 
ATOM 8918  N NZ  . LYS D 1 139 ? 20.449  -24.278 9.775   1.00 17.21 ? 139 LYS D NZ  1 
ATOM 8919  N N   . LYS D 1 140 ? 16.733  -30.508 9.387   1.00 33.22 ? 140 LYS D N   1 
ATOM 8920  C CA  . LYS D 1 140 ? 17.099  -31.730 10.091  1.00 33.22 ? 140 LYS D CA  1 
ATOM 8921  C C   . LYS D 1 140 ? 17.805  -32.717 9.154   1.00 33.22 ? 140 LYS D C   1 
ATOM 8922  O O   . LYS D 1 140 ? 18.499  -33.631 9.600   1.00 33.22 ? 140 LYS D O   1 
ATOM 8923  C CB  . LYS D 1 140 ? 15.837  -32.365 10.685  1.00 50.52 ? 140 LYS D CB  1 
ATOM 8924  C CG  . LYS D 1 140 ? 16.070  -33.194 11.932  1.00 50.52 ? 140 LYS D CG  1 
ATOM 8925  C CD  . LYS D 1 140 ? 14.753  -33.707 12.515  1.00 50.52 ? 140 LYS D CD  1 
ATOM 8926  C CE  . LYS D 1 140 ? 13.829  -32.562 12.925  1.00 50.52 ? 140 LYS D CE  1 
ATOM 8927  N NZ  . LYS D 1 140 ? 12.509  -33.047 13.426  1.00 50.52 ? 140 LYS D NZ  1 
ATOM 8928  N N   . ASP D 1 141 ? 17.637  -32.532 7.851   1.00 24.32 ? 141 ASP D N   1 
ATOM 8929  C CA  . ASP D 1 141 ? 18.275  -33.429 6.904   1.00 24.32 ? 141 ASP D CA  1 
ATOM 8930  C C   . ASP D 1 141 ? 19.505  -32.832 6.229   1.00 24.32 ? 141 ASP D C   1 
ATOM 8931  O O   . ASP D 1 141 ? 20.008  -33.385 5.250   1.00 24.32 ? 141 ASP D O   1 
ATOM 8932  C CB  . ASP D 1 141 ? 17.267  -33.901 5.853   1.00 40.23 ? 141 ASP D CB  1 
ATOM 8933  C CG  . ASP D 1 141 ? 16.161  -34.749 6.455   1.00 40.23 ? 141 ASP D CG  1 
ATOM 8934  O OD1 . ASP D 1 141 ? 16.410  -35.412 7.488   1.00 40.23 ? 141 ASP D OD1 1 
ATOM 8935  O OD2 . ASP D 1 141 ? 15.049  -34.765 5.890   1.00 40.23 ? 141 ASP D OD2 1 
ATOM 8936  N N   . GLY D 1 142 ? 19.984  -31.700 6.744   1.00 41.56 ? 142 GLY D N   1 
ATOM 8937  C CA  . GLY D 1 142 ? 21.183  -31.094 6.190   1.00 41.56 ? 142 GLY D CA  1 
ATOM 8938  C C   . GLY D 1 142 ? 21.076  -29.835 5.351   1.00 41.56 ? 142 GLY D C   1 
ATOM 8939  O O   . GLY D 1 142 ? 22.099  -29.309 4.894   1.00 41.56 ? 142 GLY D O   1 
ATOM 8940  N N   . ALA D 1 143 ? 19.865  -29.342 5.133   1.00 29.06 ? 143 ALA D N   1 
ATOM 8941  C CA  . ALA D 1 143 ? 19.706  -28.135 4.334   1.00 29.06 ? 143 ALA D CA  1 
ATOM 8942  C C   . ALA D 1 143 ? 19.860  -26.904 5.217   1.00 29.06 ? 143 ALA D C   1 
ATOM 8943  O O   . ALA D 1 143 ? 19.461  -26.913 6.388   1.00 29.06 ? 143 ALA D O   1 
ATOM 8944  C CB  . ALA D 1 143 ? 18.354  -28.134 3.662   1.00 10.85 ? 143 ALA D CB  1 
ATOM 8945  N N   . ASP D 1 144 ? 20.451  -25.850 4.663   1.00 27.02 ? 144 ASP D N   1 
ATOM 8946  C CA  . ASP D 1 144 ? 20.645  -24.623 5.420   1.00 27.02 ? 144 ASP D CA  1 
ATOM 8947  C C   . ASP D 1 144 ? 20.097  -23.424 4.680   1.00 27.02 ? 144 ASP D C   1 
ATOM 8948  O O   . ASP D 1 144 ? 20.073  -22.313 5.206   1.00 27.02 ? 144 ASP D O   1 
ATOM 8949  C CB  . ASP D 1 144 ? 22.122  -24.421 5.737   1.00 44.82 ? 144 ASP D CB  1 
ATOM 8950  C CG  . ASP D 1 144 ? 22.653  -25.475 6.683   1.00 44.82 ? 144 ASP D CG  1 
ATOM 8951  O OD1 . ASP D 1 144 ? 22.148  -25.558 7.826   1.00 44.82 ? 144 ASP D OD1 1 
ATOM 8952  O OD2 . ASP D 1 144 ? 23.569  -26.229 6.282   1.00 44.82 ? 144 ASP D OD2 1 
ATOM 8953  N N   . PHE D 1 145 ? 19.659  -23.647 3.449   1.00 17.70 ? 145 PHE D N   1 
ATOM 8954  C CA  . PHE D 1 145 ? 19.075  -22.571 2.671   1.00 17.70 ? 145 PHE D CA  1 
ATOM 8955  C C   . PHE D 1 145 ? 18.047  -23.139 1.699   1.00 17.70 ? 145 PHE D C   1 
ATOM 8956  O O   . PHE D 1 145 ? 18.077  -24.329 1.382   1.00 17.70 ? 145 PHE D O   1 
ATOM 8957  C CB  . PHE D 1 145 ? 20.173  -21.765 1.955   1.00 26.82 ? 145 PHE D CB  1 
ATOM 8958  C CG  . PHE D 1 145 ? 20.760  -22.435 0.743   1.00 26.82 ? 145 PHE D CG  1 
ATOM 8959  C CD1 . PHE D 1 145 ? 20.351  -22.065 -0.535  1.00 26.82 ? 145 PHE D CD1 1 
ATOM 8960  C CD2 . PHE D 1 145 ? 21.746  -23.402 0.872   1.00 26.82 ? 145 PHE D CD2 1 
ATOM 8961  C CE1 . PHE D 1 145 ? 20.916  -22.646 -1.665  1.00 26.82 ? 145 PHE D CE1 1 
ATOM 8962  C CE2 . PHE D 1 145 ? 22.314  -23.988 -0.250  1.00 26.82 ? 145 PHE D CE2 1 
ATOM 8963  C CZ  . PHE D 1 145 ? 21.898  -23.607 -1.523  1.00 26.82 ? 145 PHE D CZ  1 
ATOM 8964  N N   . ALA D 1 146 ? 17.118  -22.301 1.253   1.00 24.23 ? 146 ALA D N   1 
ATOM 8965  C CA  . ALA D 1 146 ? 16.076  -22.754 0.341   1.00 24.23 ? 146 ALA D CA  1 
ATOM 8966  C C   . ALA D 1 146 ? 15.886  -21.809 -0.834  1.00 24.23 ? 146 ALA D C   1 
ATOM 8967  O O   . ALA D 1 146 ? 16.455  -20.717 -0.868  1.00 24.23 ? 146 ALA D O   1 
ATOM 8968  C CB  . ALA D 1 146 ? 14.778  -22.901 1.097   1.00 13.42 ? 146 ALA D CB  1 
ATOM 8969  N N   . LYS D 1 147 ? 15.090  -22.244 -1.804  1.00 26.25 ? 147 LYS D N   1 
ATOM 8970  C CA  . LYS D 1 147 ? 14.803  -21.431 -2.975  1.00 26.25 ? 147 LYS D CA  1 
ATOM 8971  C C   . LYS D 1 147 ? 13.309  -21.495 -3.275  1.00 26.25 ? 147 LYS D C   1 
ATOM 8972  O O   . LYS D 1 147 ? 12.691  -22.551 -3.152  1.00 26.25 ? 147 LYS D O   1 
ATOM 8973  C CB  . LYS D 1 147 ? 15.590  -21.926 -4.193  1.00 29.72 ? 147 LYS D CB  1 
ATOM 8974  C CG  . LYS D 1 147 ? 15.094  -21.345 -5.511  1.00 29.72 ? 147 LYS D CG  1 
ATOM 8975  C CD  . LYS D 1 147 ? 15.762  -21.993 -6.704  1.00 29.72 ? 147 LYS D CD  1 
ATOM 8976  C CE  . LYS D 1 147 ? 14.863  -21.920 -7.934  1.00 29.72 ? 147 LYS D CE  1 
ATOM 8977  N NZ  . LYS D 1 147 ? 15.604  -22.158 -9.222  1.00 29.72 ? 147 LYS D NZ  1 
ATOM 8978  N N   . TRP D 1 148 ? 12.742  -20.356 -3.660  1.00 22.94 ? 148 TRP D N   1 
ATOM 8979  C CA  . TRP D 1 148 ? 11.326  -20.240 -3.993  1.00 22.94 ? 148 TRP D CA  1 
ATOM 8980  C C   . TRP D 1 148 ? 11.285  -19.383 -5.243  1.00 22.94 ? 148 TRP D C   1 
ATOM 8981  O O   . TRP D 1 148 ? 11.778  -18.255 -5.233  1.00 22.94 ? 148 TRP D O   1 
ATOM 8982  C CB  . TRP D 1 148 ? 10.580  -19.537 -2.854  1.00 24.09 ? 148 TRP D CB  1 
ATOM 8983  C CG  . TRP D 1 148 ? 9.128   -19.261 -3.119  1.00 24.09 ? 148 TRP D CG  1 
ATOM 8984  C CD1 . TRP D 1 148 ? 8.605   -18.399 -4.042  1.00 24.09 ? 148 TRP D CD1 1 
ATOM 8985  C CD2 . TRP D 1 148 ? 8.013   -19.855 -2.450  1.00 24.09 ? 148 TRP D CD2 1 
ATOM 8986  N NE1 . TRP D 1 148 ? 7.234   -18.419 -3.986  1.00 24.09 ? 148 TRP D NE1 1 
ATOM 8987  C CE2 . TRP D 1 148 ? 6.845   -19.305 -3.016  1.00 24.09 ? 148 TRP D CE2 1 
ATOM 8988  C CE3 . TRP D 1 148 ? 7.887   -20.801 -1.424  1.00 24.09 ? 148 TRP D CE3 1 
ATOM 8989  C CZ2 . TRP D 1 148 ? 5.560   -19.671 -2.589  1.00 24.09 ? 148 TRP D CZ2 1 
ATOM 8990  C CZ3 . TRP D 1 148 ? 6.603   -21.165 -0.997  1.00 24.09 ? 148 TRP D CZ3 1 
ATOM 8991  C CH2 . TRP D 1 148 ? 5.460   -20.599 -1.581  1.00 24.09 ? 148 TRP D CH2 1 
ATOM 8992  N N   . ARG D 1 149 ? 10.706  -19.888 -6.323  1.00 18.77 ? 149 ARG D N   1 
ATOM 8993  C CA  . ARG D 1 149 ? 10.689  -19.080 -7.539  1.00 18.77 ? 149 ARG D CA  1 
ATOM 8994  C C   . ARG D 1 149 ? 9.363   -18.473 -7.942  1.00 18.77 ? 149 ARG D C   1 
ATOM 8995  O O   . ARG D 1 149 ? 8.399   -19.190 -8.183  1.00 18.77 ? 149 ARG D O   1 
ATOM 8996  C CB  . ARG D 1 149 ? 11.225  -19.882 -8.726  1.00 17.39 ? 149 ARG D CB  1 
ATOM 8997  C CG  . ARG D 1 149 ? 11.175  -19.108 -10.042 1.00 17.39 ? 149 ARG D CG  1 
ATOM 8998  C CD  . ARG D 1 149 ? 11.941  -19.822 -11.140 1.00 17.39 ? 149 ARG D CD  1 
ATOM 8999  N NE  . ARG D 1 149 ? 11.073  -20.365 -12.186 1.00 17.39 ? 149 ARG D NE  1 
ATOM 9000  C CZ  . ARG D 1 149 ? 10.955  -19.842 -13.405 1.00 17.39 ? 149 ARG D CZ  1 
ATOM 9001  N NH1 . ARG D 1 149 ? 11.646  -18.759 -13.735 1.00 17.39 ? 149 ARG D NH1 1 
ATOM 9002  N NH2 . ARG D 1 149 ? 10.157  -20.409 -14.305 1.00 17.39 ? 149 ARG D NH2 1 
ATOM 9003  N N   . CYS D 1 150 ? 9.323   -17.147 -8.013  1.00 19.13 ? 150 CYS D N   1 
ATOM 9004  C CA  . CYS D 1 150 ? 8.133   -16.442 -8.460  1.00 19.13 ? 150 CYS D CA  1 
ATOM 9005  C C   . CYS D 1 150 ? 8.480   -16.057 -9.886  1.00 19.13 ? 150 CYS D C   1 
ATOM 9006  O O   . CYS D 1 150 ? 9.652   -15.944 -10.227 1.00 19.13 ? 150 CYS D O   1 
ATOM 9007  C CB  . CYS D 1 150 ? 7.886   -15.189 -7.630  1.00 29.55 ? 150 CYS D CB  1 
ATOM 9008  S SG  . CYS D 1 150 ? 7.153   -15.516 -6.033  1.00 29.55 ? 150 CYS D SG  1 
ATOM 9009  N N   . VAL D 1 151 ? 7.479   -15.859 -10.729 1.00 25.06 ? 151 VAL D N   1 
ATOM 9010  C CA  . VAL D 1 151 ? 7.763   -15.510 -12.104 1.00 25.06 ? 151 VAL D CA  1 
ATOM 9011  C C   . VAL D 1 151 ? 6.944   -14.337 -12.585 1.00 25.06 ? 151 VAL D C   1 
ATOM 9012  O O   . VAL D 1 151 ? 5.720   -14.361 -12.523 1.00 25.06 ? 151 VAL D O   1 
ATOM 9013  C CB  . VAL D 1 151 ? 7.482   -16.693 -13.037 1.00 2.84  ? 151 VAL D CB  1 
ATOM 9014  C CG1 . VAL D 1 151 ? 7.810   -16.317 -14.467 1.00 2.84  ? 151 VAL D CG1 1 
ATOM 9015  C CG2 . VAL D 1 151 ? 8.294   -17.880 -12.610 1.00 2.84  ? 151 VAL D CG2 1 
ATOM 9016  N N   . LEU D 1 152 ? 7.621   -13.305 -13.062 1.00 16.32 ? 152 LEU D N   1 
ATOM 9017  C CA  . LEU D 1 152 ? 6.940   -12.137 -13.595 1.00 16.32 ? 152 LEU D CA  1 
ATOM 9018  C C   . LEU D 1 152 ? 7.223   -12.105 -15.100 1.00 16.32 ? 152 LEU D C   1 
ATOM 9019  O O   . LEU D 1 152 ? 8.197   -12.694 -15.564 1.00 16.32 ? 152 LEU D O   1 
ATOM 9020  C CB  . LEU D 1 152 ? 7.437   -10.872 -12.905 1.00 16.79 ? 152 LEU D CB  1 
ATOM 9021  C CG  . LEU D 1 152 ? 7.161   -10.835 -11.397 1.00 16.79 ? 152 LEU D CG  1 
ATOM 9022  C CD1 . LEU D 1 152 ? 7.491   -9.462  -10.863 1.00 16.79 ? 152 LEU D CD1 1 
ATOM 9023  C CD2 . LEU D 1 152 ? 5.705   -11.135 -11.119 1.00 16.79 ? 152 LEU D CD2 1 
ATOM 9024  N N   . LYS D 1 153 ? 6.374   -11.425 -15.862 1.00 20.06 ? 153 LYS D N   1 
ATOM 9025  C CA  . LYS D 1 153 ? 6.515   -11.388 -17.314 1.00 20.06 ? 153 LYS D CA  1 
ATOM 9026  C C   . LYS D 1 153 ? 6.427   -9.954  -17.823 1.00 20.06 ? 153 LYS D C   1 
ATOM 9027  O O   . LYS D 1 153 ? 5.699   -9.150  -17.251 1.00 20.06 ? 153 LYS D O   1 
ATOM 9028  C CB  . LYS D 1 153 ? 5.387   -12.228 -17.916 1.00 45.75 ? 153 LYS D CB  1 
ATOM 9029  C CG  . LYS D 1 153 ? 5.375   -12.332 -19.415 1.00 45.75 ? 153 LYS D CG  1 
ATOM 9030  C CD  . LYS D 1 153 ? 3.958   -12.113 -19.971 1.00 45.75 ? 153 LYS D CD  1 
ATOM 9031  C CE  . LYS D 1 153 ? 2.924   -13.092 -19.408 1.00 45.75 ? 153 LYS D CE  1 
ATOM 9032  N NZ  . LYS D 1 153 ? 1.612   -12.949 -20.106 1.00 45.75 ? 153 LYS D NZ  1 
ATOM 9033  N N   . ILE D 1 154 ? 7.165   -9.618  -18.880 1.00 31.12 ? 154 ILE D N   1 
ATOM 9034  C CA  . ILE D 1 154 ? 7.094   -8.257  -19.410 1.00 31.12 ? 154 ILE D CA  1 
ATOM 9035  C C   . ILE D 1 154 ? 6.371   -8.215  -20.752 1.00 31.12 ? 154 ILE D C   1 
ATOM 9036  O O   . ILE D 1 154 ? 6.738   -8.931  -21.686 1.00 31.12 ? 154 ILE D O   1 
ATOM 9037  C CB  . ILE D 1 154 ? 8.478   -7.624  -19.607 1.00 18.26 ? 154 ILE D CB  1 
ATOM 9038  C CG1 . ILE D 1 154 ? 9.232   -7.596  -18.282 1.00 18.26 ? 154 ILE D CG1 1 
ATOM 9039  C CG2 . ILE D 1 154 ? 8.319   -6.201  -20.134 1.00 18.26 ? 154 ILE D CG2 1 
ATOM 9040  C CD1 . ILE D 1 154 ? 10.584  -6.956  -18.373 1.00 18.26 ? 154 ILE D CD1 1 
ATOM 9041  N N   . SER D 1 155 ? 5.345   -7.368  -20.830 1.00 29.04 ? 155 SER D N   1 
ATOM 9042  C CA  . SER D 1 155 ? 4.531   -7.184  -22.032 1.00 29.04 ? 155 SER D CA  1 
ATOM 9043  C C   . SER D 1 155 ? 3.904   -5.786  -21.942 1.00 29.04 ? 155 SER D C   1 
ATOM 9044  O O   . SER D 1 155 ? 4.208   -5.034  -21.006 1.00 29.04 ? 155 SER D O   1 
ATOM 9045  C CB  . SER D 1 155 ? 3.434   -8.240  -22.107 1.00 29.85 ? 155 SER D CB  1 
ATOM 9046  O OG  . SER D 1 155 ? 2.260   -7.770  -21.473 1.00 29.85 ? 155 SER D OG  1 
ATOM 9047  N N   . GLU D 1 156 ? 3.037   -5.438  -22.897 1.00 42.49 ? 156 GLU D N   1 
ATOM 9048  C CA  . GLU D 1 156 ? 2.423   -4.110  -22.903 1.00 42.49 ? 156 GLU D CA  1 
ATOM 9049  C C   . GLU D 1 156 ? 1.838   -3.769  -21.546 1.00 42.49 ? 156 GLU D C   1 
ATOM 9050  O O   . GLU D 1 156 ? 1.809   -2.605  -21.135 1.00 42.49 ? 156 GLU D O   1 
ATOM 9051  C CB  . GLU D 1 156 ? 1.315   -4.002  -23.949 1.00 99.51 ? 156 GLU D CB  1 
ATOM 9052  C CG  . GLU D 1 156 ? 0.724   -2.594  -24.015 1.00 99.51 ? 156 GLU D CG  1 
ATOM 9053  C CD  . GLU D 1 156 ? -0.681  -2.554  -24.600 1.00 99.51 ? 156 GLU D CD  1 
ATOM 9054  O OE1 . GLU D 1 156 ? -0.852  -2.939  -25.778 1.00 99.51 ? 156 GLU D OE1 1 
ATOM 9055  O OE2 . GLU D 1 156 ? -1.617  -2.134  -23.877 1.00 99.51 ? 156 GLU D OE2 1 
ATOM 9056  N N   . ARG D 1 157 ? 1.378   -4.785  -20.836 1.00 49.20 ? 157 ARG D N   1 
ATOM 9057  C CA  . ARG D 1 157 ? 0.792   -4.540  -19.535 1.00 49.20 ? 157 ARG D CA  1 
ATOM 9058  C C   . ARG D 1 157 ? 0.840   -5.800  -18.692 1.00 49.20 ? 157 ARG D C   1 
ATOM 9059  O O   . ARG D 1 157 ? -0.198  -6.323  -18.311 1.00 49.20 ? 157 ARG D O   1 
ATOM 9060  C CB  . ARG D 1 157 ? -0.646  -4.088  -19.742 1.00 81.54 ? 157 ARG D CB  1 
ATOM 9061  C CG  . ARG D 1 157 ? -1.446  -5.004  -20.661 1.00 81.54 ? 157 ARG D CG  1 
ATOM 9062  C CD  . ARG D 1 157 ? -2.536  -4.221  -21.378 1.00 81.54 ? 157 ARG D CD  1 
ATOM 9063  N NE  . ARG D 1 157 ? -3.063  -3.138  -20.546 1.00 81.54 ? 157 ARG D NE  1 
ATOM 9064  C CZ  . ARG D 1 157 ? -4.063  -2.337  -20.899 1.00 81.54 ? 157 ARG D CZ  1 
ATOM 9065  N NH1 . ARG D 1 157 ? -4.655  -2.505  -22.075 1.00 81.54 ? 157 ARG D NH1 1 
ATOM 9066  N NH2 . ARG D 1 157 ? -4.454  -1.353  -20.093 1.00 81.54 ? 157 ARG D NH2 1 
ATOM 9067  N N   . THR D 1 158 ? 2.036   -6.284  -18.377 1.00 79.06 ? 158 THR D N   1 
ATOM 9068  C CA  . THR D 1 158 ? 2.115   -7.512  -17.612 1.00 79.06 ? 158 THR D CA  1 
ATOM 9069  C C   . THR D 1 158 ? 2.519   -7.457  -16.167 1.00 79.06 ? 158 THR D C   1 
ATOM 9070  O O   . THR D 1 158 ? 1.746   -7.867  -15.310 1.00 79.06 ? 158 THR D O   1 
ATOM 9071  C CB  . THR D 1 158 ? 3.033   -8.494  -18.247 1.00 56.82 ? 158 THR D CB  1 
ATOM 9072  O OG1 . THR D 1 158 ? 4.125   -7.776  -18.822 1.00 56.82 ? 158 THR D OG1 1 
ATOM 9073  C CG2 . THR D 1 158 ? 2.294   -9.331  -19.266 1.00 56.82 ? 158 THR D CG2 1 
ATOM 9074  N N   . PRO D 1 159 ? 3.741   -6.994  -15.859 1.00 42.63 ? 159 PRO D N   1 
ATOM 9075  C CA  . PRO D 1 159 ? 3.983   -7.011  -14.410 1.00 42.63 ? 159 PRO D CA  1 
ATOM 9076  C C   . PRO D 1 159 ? 2.964   -6.031  -13.844 1.00 42.63 ? 159 PRO D C   1 
ATOM 9077  O O   . PRO D 1 159 ? 3.237   -4.839  -13.721 1.00 42.63 ? 159 PRO D O   1 
ATOM 9078  C CB  . PRO D 1 159 ? 5.426   -6.529  -14.280 1.00 12.08 ? 159 PRO D CB  1 
ATOM 9079  C CG  . PRO D 1 159 ? 5.976   -6.615  -15.699 1.00 12.08 ? 159 PRO D CG  1 
ATOM 9080  C CD  . PRO D 1 159 ? 4.797   -6.268  -16.569 1.00 12.08 ? 159 PRO D CD  1 
ATOM 9081  N N   . SER D 1 160 ? 1.774   -6.554  -13.548 1.00 25.27 ? 160 SER D N   1 
ATOM 9082  C CA  . SER D 1 160 ? 0.650   -5.775  -13.046 1.00 25.27 ? 160 SER D CA  1 
ATOM 9083  C C   . SER D 1 160 ? 0.701   -5.568  -11.550 1.00 25.27 ? 160 SER D C   1 
ATOM 9084  O O   . SER D 1 160 ? 1.266   -6.386  -10.810 1.00 25.27 ? 160 SER D O   1 
ATOM 9085  C CB  . SER D 1 160 ? -0.665  -6.463  -13.410 1.00 15.03 ? 160 SER D CB  1 
ATOM 9086  O OG  . SER D 1 160 ? -0.738  -7.758  -12.837 1.00 15.03 ? 160 SER D OG  1 
ATOM 9087  N N   . ALA D 1 161 ? 0.096   -4.474  -11.104 1.00 23.42 ? 161 ALA D N   1 
ATOM 9088  C CA  . ALA D 1 161 ? 0.084   -4.165  -9.691  1.00 23.42 ? 161 ALA D CA  1 
ATOM 9089  C C   . ALA D 1 161 ? -0.187  -5.441  -8.913  1.00 23.42 ? 161 ALA D C   1 
ATOM 9090  O O   . ALA D 1 161 ? 0.520   -5.752  -7.959  1.00 23.42 ? 161 ALA D O   1 
ATOM 9091  C CB  . ALA D 1 161 ? -0.969  -3.134  -9.396  1.00 4.56  ? 161 ALA D CB  1 
ATOM 9092  N N   . LEU D 1 162 ? -1.191  -6.196  -9.342  1.00 18.29 ? 162 LEU D N   1 
ATOM 9093  C CA  . LEU D 1 162 ? -1.524  -7.429  -8.654  1.00 18.29 ? 162 LEU D CA  1 
ATOM 9094  C C   . LEU D 1 162 ? -0.354  -8.398  -8.644  1.00 18.29 ? 162 LEU D C   1 
ATOM 9095  O O   . LEU D 1 162 ? 0.072   -8.854  -7.582  1.00 18.29 ? 162 LEU D O   1 
ATOM 9096  C CB  . LEU D 1 162 ? -2.730  -8.090  -9.307  1.00 17.25 ? 162 LEU D CB  1 
ATOM 9097  C CG  . LEU D 1 162 ? -3.182  -9.390  -8.636  1.00 17.25 ? 162 LEU D CG  1 
ATOM 9098  C CD1 . LEU D 1 162 ? -3.433  -9.172  -7.147  1.00 17.25 ? 162 LEU D CD1 1 
ATOM 9099  C CD2 . LEU D 1 162 ? -4.440  -9.875  -9.322  1.00 17.25 ? 162 LEU D CD2 1 
ATOM 9100  N N   . ALA D 1 163 ? 0.170   -8.708  -9.825  1.00 23.43 ? 163 ALA D N   1 
ATOM 9101  C CA  . ALA D 1 163 ? 1.297   -9.632  -9.939  1.00 23.43 ? 163 ALA D CA  1 
ATOM 9102  C C   . ALA D 1 163 ? 2.497   -9.202  -9.093  1.00 23.43 ? 163 ALA D C   1 
ATOM 9103  O O   . ALA D 1 163 ? 3.178   -10.031 -8.487  1.00 23.43 ? 163 ALA D O   1 
ATOM 9104  C CB  . ALA D 1 163 ? 1.707   -9.751  -11.375 1.00 10.77 ? 163 ALA D CB  1 
ATOM 9105  N N   . ILE D 1 164 ? 2.767   -7.906  -9.058  1.00 10.70 ? 164 ILE D N   1 
ATOM 9106  C CA  . ILE D 1 164 ? 3.877   -7.425  -8.269  1.00 10.70 ? 164 ILE D CA  1 
ATOM 9107  C C   . ILE D 1 164 ? 3.508   -7.501  -6.789  1.00 10.70 ? 164 ILE D C   1 
ATOM 9108  O O   . ILE D 1 164 ? 4.300   -7.981  -5.987  1.00 10.70 ? 164 ILE D O   1 
ATOM 9109  C CB  . ILE D 1 164 ? 4.238   -5.990  -8.652  1.00 6.16  ? 164 ILE D CB  1 
ATOM 9110  C CG1 . ILE D 1 164 ? 4.664   -5.953  -10.116 1.00 6.16  ? 164 ILE D CG1 1 
ATOM 9111  C CG2 . ILE D 1 164 ? 5.359   -5.483  -7.765  1.00 6.16  ? 164 ILE D CG2 1 
ATOM 9112  C CD1 . ILE D 1 164 ? 5.034   -4.597  -10.592 1.00 6.16  ? 164 ILE D CD1 1 
ATOM 9113  N N   . LEU D 1 165 ? 2.308   -7.028  -6.442  1.00 20.43 ? 165 LEU D N   1 
ATOM 9114  C CA  . LEU D 1 165 ? 1.795   -7.045  -5.066  1.00 20.43 ? 165 LEU D CA  1 
ATOM 9115  C C   . LEU D 1 165 ? 1.913   -8.465  -4.532  1.00 20.43 ? 165 LEU D C   1 
ATOM 9116  O O   . LEU D 1 165 ? 2.648   -8.714  -3.578  1.00 20.43 ? 165 LEU D O   1 
ATOM 9117  C CB  . LEU D 1 165 ? 0.327   -6.595  -5.057  1.00 54.82 ? 165 LEU D CB  1 
ATOM 9118  C CG  . LEU D 1 165 ? -0.575  -6.708  -3.817  1.00 54.82 ? 165 LEU D CG  1 
ATOM 9119  C CD1 . LEU D 1 165 ? -1.858  -5.943  -4.087  1.00 54.82 ? 165 LEU D CD1 1 
ATOM 9120  C CD2 . LEU D 1 165 ? -0.909  -8.161  -3.492  1.00 54.82 ? 165 LEU D CD2 1 
ATOM 9121  N N   . GLU D 1 166 ? 1.166   -9.392  -5.133  1.00 39.03 ? 166 GLU D N   1 
ATOM 9122  C CA  . GLU D 1 166 ? 1.235   -10.798 -4.752  1.00 39.03 ? 166 GLU D CA  1 
ATOM 9123  C C   . GLU D 1 166 ? 2.630   -11.107 -5.255  1.00 39.03 ? 166 GLU D C   1 
ATOM 9124  O O   . GLU D 1 166 ? 3.218   -10.274 -5.942  1.00 39.03 ? 166 GLU D O   1 
ATOM 9125  C CB  . GLU D 1 166 ? 0.198   -11.603 -5.534  1.00 34.23 ? 166 GLU D CB  1 
ATOM 9126  C CG  . GLU D 1 166 ? 0.238   -13.101 -5.302  1.00 34.23 ? 166 GLU D CG  1 
ATOM 9127  C CD  . GLU D 1 166 ? -0.271  -13.494 -3.932  1.00 34.23 ? 166 GLU D CD  1 
ATOM 9128  O OE1 . GLU D 1 166 ? -0.705  -12.590 -3.189  1.00 34.23 ? 166 GLU D OE1 1 
ATOM 9129  O OE2 . GLU D 1 166 ? -0.243  -14.703 -3.597  1.00 34.23 ? 166 GLU D OE2 1 
ATOM 9130  N N   . ASN D 1 167 ? 3.172   -12.276 -4.957  1.00 28.01 ? 167 ASN D N   1 
ATOM 9131  C CA  . ASN D 1 167 ? 4.540   -12.592 -5.407  1.00 28.01 ? 167 ASN D CA  1 
ATOM 9132  C C   . ASN D 1 167 ? 5.487   -11.905 -4.432  1.00 28.01 ? 167 ASN D C   1 
ATOM 9133  O O   . ASN D 1 167 ? 6.171   -12.564 -3.652  1.00 28.01 ? 167 ASN D O   1 
ATOM 9134  C CB  . ASN D 1 167 ? 4.828   -12.078 -6.834  1.00 15.34 ? 167 ASN D CB  1 
ATOM 9135  C CG  . ASN D 1 167 ? 4.361   -13.045 -7.932  1.00 15.34 ? 167 ASN D CG  1 
ATOM 9136  O OD1 . ASN D 1 167 ? 4.781   -14.211 -7.992  1.00 15.34 ? 167 ASN D OD1 1 
ATOM 9137  N ND2 . ASN D 1 167 ? 3.505   -12.553 -8.817  1.00 15.34 ? 167 ASN D ND2 1 
ATOM 9138  N N   . ALA D 1 168 ? 5.532   -10.582 -4.473  1.00 14.10 ? 168 ALA D N   1 
ATOM 9139  C CA  . ALA D 1 168 ? 6.386   -9.871  -3.540  1.00 14.10 ? 168 ALA D CA  1 
ATOM 9140  C C   . ALA D 1 168 ? 5.954   -10.316 -2.152  1.00 14.10 ? 168 ALA D C   1 
ATOM 9141  O O   . ALA D 1 168 ? 6.785   -10.565 -1.270  1.00 14.10 ? 168 ALA D O   1 
ATOM 9142  C CB  . ALA D 1 168 ? 6.208   -8.369  -3.677  1.00 2.04  ? 168 ALA D CB  1 
ATOM 9143  N N   . ASN D 1 169 ? 4.644   -10.435 -1.968  1.00 26.37 ? 169 ASN D N   1 
ATOM 9144  C CA  . ASN D 1 169 ? 4.109   -10.835 -0.682  1.00 26.37 ? 169 ASN D CA  1 
ATOM 9145  C C   . ASN D 1 169 ? 4.403   -12.298 -0.405  1.00 26.37 ? 169 ASN D C   1 
ATOM 9146  O O   . ASN D 1 169 ? 4.809   -12.649 0.699   1.00 26.37 ? 169 ASN D O   1 
ATOM 9147  C CB  . ASN D 1 169 ? 2.609   -10.589 -0.635  1.00 29.61 ? 169 ASN D CB  1 
ATOM 9148  C CG  . ASN D 1 169 ? 2.068   -10.583 0.782   1.00 29.61 ? 169 ASN D CG  1 
ATOM 9149  O OD1 . ASN D 1 169 ? 2.434   -9.727  1.594   1.00 29.61 ? 169 ASN D OD1 1 
ATOM 9150  N ND2 . ASN D 1 169 ? 1.193   -11.539 1.092   1.00 29.61 ? 169 ASN D ND2 1 
ATOM 9151  N N   . VAL D 1 170 ? 4.209   -13.157 -1.403  1.00 23.60 ? 170 VAL D N   1 
ATOM 9152  C CA  . VAL D 1 170 ? 4.464   -14.584 -1.211  1.00 23.60 ? 170 VAL D CA  1 
ATOM 9153  C C   . VAL D 1 170 ? 5.910   -14.808 -0.838  1.00 23.60 ? 170 VAL D C   1 
ATOM 9154  O O   . VAL D 1 170 ? 6.214   -15.578 0.070   1.00 23.60 ? 170 VAL D O   1 
ATOM 9155  C CB  . VAL D 1 170 ? 4.201   -15.398 -2.470  1.00 27.13 ? 170 VAL D CB  1 
ATOM 9156  C CG1 . VAL D 1 170 ? 3.973   -16.841 -2.097  1.00 27.13 ? 170 VAL D CG1 1 
ATOM 9157  C CG2 . VAL D 1 170 ? 3.015   -14.841 -3.203  1.00 27.13 ? 170 VAL D CG2 1 
ATOM 9158  N N   . LEU D 1 171 ? 6.806   -14.145 -1.556  1.00 22.57 ? 171 LEU D N   1 
ATOM 9159  C CA  . LEU D 1 171 ? 8.217   -14.279 -1.271  1.00 22.57 ? 171 LEU D CA  1 
ATOM 9160  C C   . LEU D 1 171 ? 8.448   -13.949 0.198   1.00 22.57 ? 171 LEU D C   1 
ATOM 9161  O O   . LEU D 1 171 ? 9.066   -14.725 0.927   1.00 22.57 ? 171 LEU D O   1 
ATOM 9162  C CB  . LEU D 1 171 ? 9.036   -13.339 -2.160  1.00 13.97 ? 171 LEU D CB  1 
ATOM 9163  C CG  . LEU D 1 171 ? 9.149   -13.724 -3.636  1.00 13.97 ? 171 LEU D CG  1 
ATOM 9164  C CD1 . LEU D 1 171 ? 9.864   -12.631 -4.416  1.00 13.97 ? 171 LEU D CD1 1 
ATOM 9165  C CD2 . LEU D 1 171 ? 9.896   -15.026 -3.756  1.00 13.97 ? 171 LEU D CD2 1 
ATOM 9166  N N   . ALA D 1 172 ? 7.929   -12.806 0.635   1.00 16.49 ? 172 ALA D N   1 
ATOM 9167  C CA  . ALA D 1 172 ? 8.097   -12.381 2.020   1.00 16.49 ? 172 ALA D CA  1 
ATOM 9168  C C   . ALA D 1 172 ? 7.596   -13.437 2.994   1.00 16.49 ? 172 ALA D C   1 
ATOM 9169  O O   . ALA D 1 172 ? 8.237   -13.695 4.004   1.00 16.49 ? 172 ALA D O   1 
ATOM 9170  C CB  . ALA D 1 172 ? 7.379   -11.061 2.255   1.00 23.46 ? 172 ALA D CB  1 
ATOM 9171  N N   . ARG D 1 173 ? 6.451   -14.043 2.697   1.00 20.64 ? 173 ARG D N   1 
ATOM 9172  C CA  . ARG D 1 173 ? 5.906   -15.081 3.571   1.00 20.64 ? 173 ARG D CA  1 
ATOM 9173  C C   . ARG D 1 173 ? 6.894   -16.229 3.653   1.00 20.64 ? 173 ARG D C   1 
ATOM 9174  O O   . ARG D 1 173 ? 7.329   -16.609 4.740   1.00 20.64 ? 173 ARG D O   1 
ATOM 9175  C CB  . ARG D 1 173 ? 4.557   -15.596 3.045   1.00 22.08 ? 173 ARG D CB  1 
ATOM 9176  C CG  . ARG D 1 173 ? 3.354   -14.749 3.472   1.00 22.08 ? 173 ARG D CG  1 
ATOM 9177  C CD  . ARG D 1 173 ? 2.517   -15.445 4.535   1.00 22.08 ? 173 ARG D CD  1 
ATOM 9178  N NE  . ARG D 1 173 ? 3.255   -15.674 5.769   1.00 22.08 ? 173 ARG D NE  1 
ATOM 9179  C CZ  . ARG D 1 173 ? 3.031   -16.713 6.569   1.00 22.08 ? 173 ARG D CZ  1 
ATOM 9180  N NH1 . ARG D 1 173 ? 2.094   -17.602 6.247   1.00 22.08 ? 173 ARG D NH1 1 
ATOM 9181  N NH2 . ARG D 1 173 ? 3.744   -16.874 7.681   1.00 22.08 ? 173 ARG D NH2 1 
ATOM 9182  N N   . TYR D 1 174 ? 7.239   -16.774 2.489   1.00 23.08 ? 174 TYR D N   1 
ATOM 9183  C CA  . TYR D 1 174 ? 8.191   -17.871 2.379   1.00 23.08 ? 174 TYR D CA  1 
ATOM 9184  C C   . TYR D 1 174 ? 9.475   -17.557 3.151   1.00 23.08 ? 174 TYR D C   1 
ATOM 9185  O O   . TYR D 1 174 ? 9.928   -18.360 3.973   1.00 23.08 ? 174 TYR D O   1 
ATOM 9186  C CB  . TYR D 1 174 ? 8.487   -18.113 0.898   1.00 24.34 ? 174 TYR D CB  1 
ATOM 9187  C CG  . TYR D 1 174 ? 9.921   -18.455 0.563   1.00 24.34 ? 174 TYR D CG  1 
ATOM 9188  C CD1 . TYR D 1 174 ? 10.447  -19.720 0.822   1.00 24.34 ? 174 TYR D CD1 1 
ATOM 9189  C CD2 . TYR D 1 174 ? 10.742  -17.516 -0.059  1.00 24.34 ? 174 TYR D CD2 1 
ATOM 9190  C CE1 . TYR D 1 174 ? 11.763  -20.042 0.455   1.00 24.34 ? 174 TYR D CE1 1 
ATOM 9191  C CE2 . TYR D 1 174 ? 12.051  -17.826 -0.424  1.00 24.34 ? 174 TYR D CE2 1 
ATOM 9192  C CZ  . TYR D 1 174 ? 12.551  -19.086 -0.171  1.00 24.34 ? 174 TYR D CZ  1 
ATOM 9193  O OH  . TYR D 1 174 ? 13.825  -19.389 -0.582  1.00 24.34 ? 174 TYR D OH  1 
ATOM 9194  N N   . ALA D 1 175 ? 10.050  -16.384 2.894   1.00 19.01 ? 175 ALA D N   1 
ATOM 9195  C CA  . ALA D 1 175 ? 11.278  -15.965 3.561   1.00 19.01 ? 175 ALA D CA  1 
ATOM 9196  C C   . ALA D 1 175 ? 11.111  -15.990 5.074   1.00 19.01 ? 175 ALA D C   1 
ATOM 9197  O O   . ALA D 1 175 ? 11.927  -16.574 5.787   1.00 19.01 ? 175 ALA D O   1 
ATOM 9198  C CB  . ALA D 1 175 ? 11.668  -14.567 3.110   1.00 9.96  ? 175 ALA D CB  1 
ATOM 9199  N N   . SER D 1 176 ? 10.048  -15.354 5.558   1.00 19.30 ? 176 SER D N   1 
ATOM 9200  C CA  . SER D 1 176 ? 9.769   -15.297 6.989   1.00 19.30 ? 176 SER D CA  1 
ATOM 9201  C C   . SER D 1 176 ? 9.750   -16.688 7.618   1.00 19.30 ? 176 SER D C   1 
ATOM 9202  O O   . SER D 1 176 ? 10.376  -16.911 8.659   1.00 19.30 ? 176 SER D O   1 
ATOM 9203  C CB  . SER D 1 176 ? 8.428   -14.610 7.235   1.00 21.53 ? 176 SER D CB  1 
ATOM 9204  O OG  . SER D 1 176 ? 8.207   -14.409 8.619   1.00 21.53 ? 176 SER D OG  1 
ATOM 9205  N N   . ILE D 1 177 ? 9.042   -17.617 6.977   1.00 17.76 ? 177 ILE D N   1 
ATOM 9206  C CA  . ILE D 1 177 ? 8.918   -18.987 7.472   1.00 17.76 ? 177 ILE D CA  1 
ATOM 9207  C C   . ILE D 1 177 ? 10.244  -19.728 7.501   1.00 17.76 ? 177 ILE D C   1 
ATOM 9208  O O   . ILE D 1 177 ? 10.528  -20.458 8.452   1.00 17.76 ? 177 ILE D O   1 
ATOM 9209  C CB  . ILE D 1 177 ? 7.927   -19.804 6.620   1.00 14.75 ? 177 ILE D CB  1 
ATOM 9210  C CG1 . ILE D 1 177 ? 6.560   -19.122 6.633   1.00 14.75 ? 177 ILE D CG1 1 
ATOM 9211  C CG2 . ILE D 1 177 ? 7.815   -21.235 7.159   1.00 14.75 ? 177 ILE D CG2 1 
ATOM 9212  C CD1 . ILE D 1 177 ? 5.589   -19.709 5.655   1.00 14.75 ? 177 ILE D CD1 1 
ATOM 9213  N N   . CYS D 1 178 ? 11.048  -19.560 6.458   1.00 22.39 ? 178 CYS D N   1 
ATOM 9214  C CA  . CYS D 1 178 ? 12.347  -20.218 6.407   1.00 22.39 ? 178 CYS D CA  1 
ATOM 9215  C C   . CYS D 1 178 ? 13.217  -19.782 7.580   1.00 22.39 ? 178 CYS D C   1 
ATOM 9216  O O   . CYS D 1 178 ? 13.782  -20.606 8.297   1.00 22.39 ? 178 CYS D O   1 
ATOM 9217  C CB  . CYS D 1 178 ? 13.080  -19.872 5.115   1.00 28.19 ? 178 CYS D CB  1 
ATOM 9218  S SG  . CYS D 1 178 ? 12.452  -20.675 3.657   1.00 28.19 ? 178 CYS D SG  1 
ATOM 9219  N N   . GLN D 1 179 ? 13.324  -18.475 7.775   1.00 18.40 ? 179 GLN D N   1 
ATOM 9220  C CA  . GLN D 1 179 ? 14.167  -17.972 8.837   1.00 18.40 ? 179 GLN D CA  1 
ATOM 9221  C C   . GLN D 1 179 ? 13.781  -18.439 10.230  1.00 18.40 ? 179 GLN D C   1 
ATOM 9222  O O   . GLN D 1 179 ? 14.660  -18.684 11.058  1.00 18.40 ? 179 GLN D O   1 
ATOM 9223  C CB  . GLN D 1 179 ? 14.231  -16.448 8.789   1.00 18.89 ? 179 GLN D CB  1 
ATOM 9224  C CG  . GLN D 1 179 ? 14.796  -15.927 7.490   1.00 18.89 ? 179 GLN D CG  1 
ATOM 9225  C CD  . GLN D 1 179 ? 15.222  -14.482 7.596   1.00 18.89 ? 179 GLN D CD  1 
ATOM 9226  O OE1 . GLN D 1 179 ? 14.513  -13.657 8.170   1.00 18.89 ? 179 GLN D OE1 1 
ATOM 9227  N NE2 . GLN D 1 179 ? 16.385  -14.162 7.037   1.00 18.89 ? 179 GLN D NE2 1 
ATOM 9228  N N   . GLN D 1 180 ? 12.490  -18.572 10.518  1.00 40.28 ? 180 GLN D N   1 
ATOM 9229  C CA  . GLN D 1 180 ? 12.136  -19.011 11.855  1.00 40.28 ? 180 GLN D CA  1 
ATOM 9230  C C   . GLN D 1 180 ? 12.491  -20.500 12.019  1.00 40.28 ? 180 GLN D C   1 
ATOM 9231  O O   . GLN D 1 180 ? 12.373  -21.062 13.103  1.00 40.28 ? 180 GLN D O   1 
ATOM 9232  C CB  . GLN D 1 180 ? 10.664  -18.724 12.153  1.00 99.51 ? 180 GLN D CB  1 
ATOM 9233  C CG  . GLN D 1 180 ? 9.691   -19.480 11.288  1.00 99.51 ? 180 GLN D CG  1 
ATOM 9234  C CD  . GLN D 1 180 ? 8.255   -19.343 11.784  1.00 99.51 ? 180 GLN D CD  1 
ATOM 9235  O OE1 . GLN D 1 180 ? 7.335   -20.020 11.294  1.00 99.51 ? 180 GLN D OE1 1 
ATOM 9236  N NE2 . GLN D 1 180 ? 8.054   -18.458 12.764  1.00 99.51 ? 180 GLN D NE2 1 
ATOM 9237  N N   . ASN D 1 181 ? 12.971  -21.116 10.940  1.00 22.93 ? 181 ASN D N   1 
ATOM 9238  C CA  . ASN D 1 181 ? 13.390  -22.528 10.946  1.00 22.93 ? 181 ASN D CA  1 
ATOM 9239  C C   . ASN D 1 181 ? 14.896  -22.683 10.678  1.00 22.93 ? 181 ASN D C   1 
ATOM 9240  O O   . ASN D 1 181 ? 15.365  -23.750 10.262  1.00 22.93 ? 181 ASN D O   1 
ATOM 9241  C CB  . ASN D 1 181 ? 12.622  -23.323 9.888   1.00 32.83 ? 181 ASN D CB  1 
ATOM 9242  C CG  . ASN D 1 181 ? 11.288  -23.803 10.387  1.00 32.83 ? 181 ASN D CG  1 
ATOM 9243  O OD1 . ASN D 1 181 ? 11.220  -24.679 11.249  1.00 32.83 ? 181 ASN D OD1 1 
ATOM 9244  N ND2 . ASN D 1 181 ? 10.212  -23.228 9.856   1.00 32.83 ? 181 ASN D ND2 1 
ATOM 9245  N N   . GLY D 1 182 ? 15.645  -21.607 10.908  1.00 31.22 ? 182 GLY D N   1 
ATOM 9246  C CA  . GLY D 1 182 ? 17.078  -21.638 10.696  1.00 31.22 ? 182 GLY D CA  1 
ATOM 9247  C C   . GLY D 1 182 ? 17.502  -21.927 9.268   1.00 31.22 ? 182 GLY D C   1 
ATOM 9248  O O   . GLY D 1 182 ? 18.537  -22.552 9.042   1.00 31.22 ? 182 GLY D O   1 
ATOM 9249  N N   . ILE D 1 183 ? 16.717  -21.470 8.299   1.00 26.53 ? 183 ILE D N   1 
ATOM 9250  C CA  . ILE D 1 183 ? 17.053  -21.695 6.901   1.00 26.53 ? 183 ILE D CA  1 
ATOM 9251  C C   . ILE D 1 183 ? 17.109  -20.405 6.104   1.00 26.53 ? 183 ILE D C   1 
ATOM 9252  O O   . ILE D 1 183 ? 16.139  -19.654 6.043   1.00 26.53 ? 183 ILE D O   1 
ATOM 9253  C CB  . ILE D 1 183 ? 16.061  -22.679 6.264   1.00 8.98  ? 183 ILE D CB  1 
ATOM 9254  C CG1 . ILE D 1 183 ? 16.435  -24.085 6.723   1.00 8.98  ? 183 ILE D CG1 1 
ATOM 9255  C CG2 . ILE D 1 183 ? 16.068  -22.569 4.743   1.00 8.98  ? 183 ILE D CG2 1 
ATOM 9256  C CD1 . ILE D 1 183 ? 15.658  -25.166 6.064   1.00 8.98  ? 183 ILE D CD1 1 
ATOM 9257  N N   . VAL D 1 184 ? 18.260  -20.138 5.502   1.00 27.59 ? 184 VAL D N   1 
ATOM 9258  C CA  . VAL D 1 184 ? 18.416  -18.929 4.716   1.00 27.59 ? 184 VAL D CA  1 
ATOM 9259  C C   . VAL D 1 184 ? 17.581  -19.050 3.451   1.00 27.59 ? 184 VAL D C   1 
ATOM 9260  O O   . VAL D 1 184 ? 17.686  -20.025 2.714   1.00 27.59 ? 184 VAL D O   1 
ATOM 9261  C CB  . VAL D 1 184 ? 19.890  -18.689 4.347   1.00 13.49 ? 184 VAL D CB  1 
ATOM 9262  C CG1 . VAL D 1 184 ? 20.002  -17.491 3.417   1.00 13.49 ? 184 VAL D CG1 1 
ATOM 9263  C CG2 . VAL D 1 184 ? 20.701  -18.435 5.609   1.00 13.49 ? 184 VAL D CG2 1 
ATOM 9264  N N   . PRO D 1 185 ? 16.722  -18.058 3.191   1.00 21.06 ? 185 PRO D N   1 
ATOM 9265  C CA  . PRO D 1 185 ? 15.892  -18.122 1.992   1.00 21.06 ? 185 PRO D CA  1 
ATOM 9266  C C   . PRO D 1 185 ? 16.446  -17.335 0.816   1.00 21.06 ? 185 PRO D C   1 
ATOM 9267  O O   . PRO D 1 185 ? 16.907  -16.203 0.979   1.00 21.06 ? 185 PRO D O   1 
ATOM 9268  C CB  . PRO D 1 185 ? 14.575  -17.542 2.480   1.00 14.10 ? 185 PRO D CB  1 
ATOM 9269  C CG  . PRO D 1 185 ? 15.058  -16.414 3.346   1.00 14.10 ? 185 PRO D CG  1 
ATOM 9270  C CD  . PRO D 1 185 ? 16.205  -17.042 4.130   1.00 14.10 ? 185 PRO D CD  1 
ATOM 9271  N N   . ILE D 1 186 ? 16.416  -17.937 -0.366  1.00 17.13 ? 186 ILE D N   1 
ATOM 9272  C CA  . ILE D 1 186 ? 16.857  -17.239 -1.563  1.00 17.13 ? 186 ILE D CA  1 
ATOM 9273  C C   . ILE D 1 186 ? 15.566  -16.698 -2.153  1.00 17.13 ? 186 ILE D C   1 
ATOM 9274  O O   . ILE D 1 186 ? 14.677  -17.461 -2.532  1.00 17.13 ? 186 ILE D O   1 
ATOM 9275  C CB  . ILE D 1 186 ? 17.514  -18.174 -2.605  1.00 18.04 ? 186 ILE D CB  1 
ATOM 9276  C CG1 . ILE D 1 186 ? 18.858  -18.686 -2.093  1.00 18.04 ? 186 ILE D CG1 1 
ATOM 9277  C CG2 . ILE D 1 186 ? 17.739  -17.419 -3.906  1.00 18.04 ? 186 ILE D CG2 1 
ATOM 9278  C CD1 . ILE D 1 186 ? 19.528  -19.671 -3.027  1.00 18.04 ? 186 ILE D CD1 1 
ATOM 9279  N N   . VAL D 1 187 ? 15.454  -15.381 -2.202  1.00 18.62 ? 187 VAL D N   1 
ATOM 9280  C CA  . VAL D 1 187 ? 14.269  -14.744 -2.740  1.00 18.62 ? 187 VAL D CA  1 
ATOM 9281  C C   . VAL D 1 187 ? 14.454  -14.597 -4.243  1.00 18.62 ? 187 VAL D C   1 
ATOM 9282  O O   . VAL D 1 187 ? 15.260  -13.788 -4.693  1.00 18.62 ? 187 VAL D O   1 
ATOM 9283  C CB  . VAL D 1 187 ? 14.080  -13.360 -2.109  1.00 7.91  ? 187 VAL D CB  1 
ATOM 9284  C CG1 . VAL D 1 187 ? 12.835  -12.705 -2.661  1.00 7.91  ? 187 VAL D CG1 1 
ATOM 9285  C CG2 . VAL D 1 187 ? 13.991  -13.493 -0.603  1.00 7.91  ? 187 VAL D CG2 1 
ATOM 9286  N N   . GLU D 1 188 ? 13.700  -15.368 -5.019  1.00 24.80 ? 188 GLU D N   1 
ATOM 9287  C CA  . GLU D 1 188 ? 13.836  -15.317 -6.463  1.00 24.80 ? 188 GLU D CA  1 
ATOM 9288  C C   . GLU D 1 188 ? 12.661  -14.743 -7.246  1.00 24.80 ? 188 GLU D C   1 
ATOM 9289  O O   . GLU D 1 188 ? 11.726  -15.461 -7.617  1.00 24.80 ? 188 GLU D O   1 
ATOM 9290  C CB  . GLU D 1 188 ? 14.161  -16.712 -7.000  1.00 28.03 ? 188 GLU D CB  1 
ATOM 9291  C CG  . GLU D 1 188 ? 14.188  -16.813 -8.523  1.00 28.03 ? 188 GLU D CG  1 
ATOM 9292  C CD  . GLU D 1 188 ? 14.600  -18.192 -9.005  1.00 28.03 ? 188 GLU D CD  1 
ATOM 9293  O OE1 . GLU D 1 188 ? 14.747  -19.099 -8.153  1.00 28.03 ? 188 GLU D OE1 1 
ATOM 9294  O OE2 . GLU D 1 188 ? 14.774  -18.373 -10.234 1.00 28.03 ? 188 GLU D OE2 1 
ATOM 9295  N N   . PRO D 1 189 ? 12.694  -13.430 -7.506  1.00 20.05 ? 189 PRO D N   1 
ATOM 9296  C CA  . PRO D 1 189 ? 11.636  -12.766 -8.261  1.00 20.05 ? 189 PRO D CA  1 
ATOM 9297  C C   . PRO D 1 189 ? 12.111  -12.703 -9.706  1.00 20.05 ? 189 PRO D C   1 
ATOM 9298  O O   . PRO D 1 189 ? 12.637  -11.679 -10.143 1.00 20.05 ? 189 PRO D O   1 
ATOM 9299  C CB  . PRO D 1 189 ? 11.588  -11.391 -7.621  1.00 6.48  ? 189 PRO D CB  1 
ATOM 9300  C CG  . PRO D 1 189 ? 13.030  -11.114 -7.382  1.00 6.48  ? 189 PRO D CG  1 
ATOM 9301  C CD  . PRO D 1 189 ? 13.544  -12.439 -6.823  1.00 6.48  ? 189 PRO D CD  1 
ATOM 9302  N N   . GLU D 1 190 ? 11.944  -13.791 -10.451 1.00 26.40 ? 190 GLU D N   1 
ATOM 9303  C CA  . GLU D 1 190 ? 12.410  -13.803 -11.832 1.00 26.40 ? 190 GLU D CA  1 
ATOM 9304  C C   . GLU D 1 190 ? 11.536  -13.113 -12.848 1.00 26.40 ? 190 GLU D C   1 
ATOM 9305  O O   . GLU D 1 190 ? 10.403  -13.518 -13.075 1.00 26.40 ? 190 GLU D O   1 
ATOM 9306  C CB  . GLU D 1 190 ? 12.635  -15.224 -12.340 1.00 32.39 ? 190 GLU D CB  1 
ATOM 9307  C CG  . GLU D 1 190 ? 13.153  -15.216 -13.776 1.00 32.39 ? 190 GLU D CG  1 
ATOM 9308  C CD  . GLU D 1 190 ? 13.412  -16.597 -14.335 1.00 32.39 ? 190 GLU D CD  1 
ATOM 9309  O OE1 . GLU D 1 190 ? 13.677  -17.528 -13.538 1.00 32.39 ? 190 GLU D OE1 1 
ATOM 9310  O OE2 . GLU D 1 190 ? 13.370  -16.742 -15.577 1.00 32.39 ? 190 GLU D OE2 1 
ATOM 9311  N N   . ILE D 1 191 ? 12.077  -12.083 -13.481 1.00 19.98 ? 191 ILE D N   1 
ATOM 9312  C CA  . ILE D 1 191 ? 11.360  -11.370 -14.523 1.00 19.98 ? 191 ILE D CA  1 
ATOM 9313  C C   . ILE D 1 191 ? 11.808  -11.997 -15.846 1.00 19.98 ? 191 ILE D C   1 
ATOM 9314  O O   . ILE D 1 191 ? 12.909  -11.728 -16.316 1.00 19.98 ? 191 ILE D O   1 
ATOM 9315  C CB  . ILE D 1 191 ? 11.731  -9.880  -14.526 1.00 8.06  ? 191 ILE D CB  1 
ATOM 9316  C CG1 . ILE D 1 191 ? 11.251  -9.223  -13.234 1.00 8.06  ? 191 ILE D CG1 1 
ATOM 9317  C CG2 . ILE D 1 191 ? 11.143  -9.198  -15.750 1.00 8.06  ? 191 ILE D CG2 1 
ATOM 9318  C CD1 . ILE D 1 191 ? 11.525  -7.736  -13.167 1.00 8.06  ? 191 ILE D CD1 1 
ATOM 9319  N N   . LEU D 1 192 ? 10.970  -12.841 -16.440 1.00 24.06 ? 192 LEU D N   1 
ATOM 9320  C CA  . LEU D 1 192 ? 11.307  -13.503 -17.705 1.00 24.06 ? 192 LEU D CA  1 
ATOM 9321  C C   . LEU D 1 192 ? 11.778  -12.554 -18.800 1.00 24.06 ? 192 LEU D C   1 
ATOM 9322  O O   . LEU D 1 192 ? 11.382  -11.390 -18.839 1.00 24.06 ? 192 LEU D O   1 
ATOM 9323  C CB  . LEU D 1 192 ? 10.109  -14.275 -18.245 1.00 20.04 ? 192 LEU D CB  1 
ATOM 9324  C CG  . LEU D 1 192 ? 9.548   -15.393 -17.375 1.00 20.04 ? 192 LEU D CG  1 
ATOM 9325  C CD1 . LEU D 1 192 ? 8.293   -15.938 -18.029 1.00 20.04 ? 192 LEU D CD1 1 
ATOM 9326  C CD2 . LEU D 1 192 ? 10.587  -16.482 -17.188 1.00 20.04 ? 192 LEU D CD2 1 
ATOM 9327  N N   . PRO D 1 193 ? 12.611  -13.058 -19.724 1.00 29.20 ? 193 PRO D N   1 
ATOM 9328  C CA  . PRO D 1 193 ? 13.190  -12.343 -20.864 1.00 29.20 ? 193 PRO D CA  1 
ATOM 9329  C C   . PRO D 1 193 ? 12.278  -12.326 -22.080 1.00 29.20 ? 193 PRO D C   1 
ATOM 9330  O O   . PRO D 1 193 ? 12.492  -11.546 -22.999 1.00 29.20 ? 193 PRO D O   1 
ATOM 9331  C CB  . PRO D 1 193 ? 14.459  -13.130 -21.175 1.00 25.20 ? 193 PRO D CB  1 
ATOM 9332  C CG  . PRO D 1 193 ? 14.626  -14.080 -20.005 1.00 25.20 ? 193 PRO D CG  1 
ATOM 9333  C CD  . PRO D 1 193 ? 13.232  -14.381 -19.593 1.00 25.20 ? 193 PRO D CD  1 
ATOM 9334  N N   . ASP D 1 194 ? 11.279  -13.201 -22.101 1.00 34.70 ? 194 ASP D N   1 
ATOM 9335  C CA  . ASP D 1 194 ? 10.366  -13.267 -23.236 1.00 34.70 ? 194 ASP D CA  1 
ATOM 9336  C C   . ASP D 1 194 ? 9.850   -11.894 -23.604 1.00 34.70 ? 194 ASP D C   1 
ATOM 9337  O O   . ASP D 1 194 ? 9.491   -11.104 -22.731 1.00 34.70 ? 194 ASP D O   1 
ATOM 9338  C CB  . ASP D 1 194 ? 9.185   -14.169 -22.915 1.00 54.31 ? 194 ASP D CB  1 
ATOM 9339  C CG  . ASP D 1 194 ? 9.609   -15.456 -22.270 1.00 54.31 ? 194 ASP D CG  1 
ATOM 9340  O OD1 . ASP D 1 194 ? 10.553  -16.098 -22.779 1.00 54.31 ? 194 ASP D OD1 1 
ATOM 9341  O OD2 . ASP D 1 194 ? 8.994   -15.827 -21.255 1.00 54.31 ? 194 ASP D OD2 1 
ATOM 9342  N N   . GLY D 1 195 ? 9.812   -11.614 -24.899 1.00 31.22 ? 195 GLY D N   1 
ATOM 9343  C CA  . GLY D 1 195 ? 9.329   -10.326 -25.358 1.00 31.22 ? 195 GLY D CA  1 
ATOM 9344  C C   . GLY D 1 195 ? 10.342  -9.639  -26.247 1.00 31.22 ? 195 GLY D C   1 
ATOM 9345  O O   . GLY D 1 195 ? 11.452  -10.136 -26.426 1.00 31.22 ? 195 GLY D O   1 
ATOM 9346  N N   . ASP D 1 196 ? 9.960   -8.498  -26.812 1.00 42.04 ? 196 ASP D N   1 
ATOM 9347  C CA  . ASP D 1 196 ? 10.851  -7.741  -27.675 1.00 42.04 ? 196 ASP D CA  1 
ATOM 9348  C C   . ASP D 1 196 ? 11.236  -6.409  -27.036 1.00 42.04 ? 196 ASP D C   1 
ATOM 9349  O O   . ASP D 1 196 ? 11.611  -5.473  -27.737 1.00 42.04 ? 196 ASP D O   1 
ATOM 9350  C CB  . ASP D 1 196 ? 10.196  -7.480  -29.037 1.00 69.84 ? 196 ASP D CB  1 
ATOM 9351  C CG  . ASP D 1 196 ? 8.883   -6.708  -28.929 1.00 69.84 ? 196 ASP D CG  1 
ATOM 9352  O OD1 . ASP D 1 196 ? 8.447   -6.142  -29.954 1.00 69.84 ? 196 ASP D OD1 1 
ATOM 9353  O OD2 . ASP D 1 196 ? 8.278   -6.670  -27.835 1.00 69.84 ? 196 ASP D OD2 1 
ATOM 9354  N N   . HIS D 1 197 ? 11.145  -6.324  -25.709 1.00 33.73 ? 197 HIS D N   1 
ATOM 9355  C CA  . HIS D 1 197 ? 11.486  -5.092  -24.992 1.00 33.73 ? 197 HIS D CA  1 
ATOM 9356  C C   . HIS D 1 197 ? 12.997  -4.859  -24.963 1.00 33.73 ? 197 HIS D C   1 
ATOM 9357  O O   . HIS D 1 197 ? 13.781  -5.809  -24.973 1.00 33.73 ? 197 HIS D O   1 
ATOM 9358  C CB  . HIS D 1 197 ? 10.960  -5.151  -23.557 1.00 32.36 ? 197 HIS D CB  1 
ATOM 9359  C CG  . HIS D 1 197 ? 11.382  -6.376  -22.815 1.00 32.36 ? 197 HIS D CG  1 
ATOM 9360  N ND1 . HIS D 1 197 ? 10.712  -7.576  -22.920 1.00 32.36 ? 197 HIS D ND1 1 
ATOM 9361  C CD2 . HIS D 1 197 ? 12.446  -6.608  -22.009 1.00 32.36 ? 197 HIS D CD2 1 
ATOM 9362  C CE1 . HIS D 1 197 ? 11.347  -8.495  -22.212 1.00 32.36 ? 197 HIS D CE1 1 
ATOM 9363  N NE2 . HIS D 1 197 ? 12.403  -7.934  -21.651 1.00 32.36 ? 197 HIS D NE2 1 
ATOM 9364  N N   . ASP D 1 198 ? 13.402  -3.593  -24.912 1.00 35.01 ? 198 ASP D N   1 
ATOM 9365  C CA  . ASP D 1 198 ? 14.819  -3.248  -24.896 1.00 35.01 ? 198 ASP D CA  1 
ATOM 9366  C C   . ASP D 1 198 ? 15.374  -3.233  -23.481 1.00 35.01 ? 198 ASP D C   1 
ATOM 9367  O O   . ASP D 1 198 ? 14.626  -3.319  -22.514 1.00 35.01 ? 198 ASP D O   1 
ATOM 9368  C CB  . ASP D 1 198 ? 15.032  -1.882  -25.537 1.00 49.85 ? 198 ASP D CB  1 
ATOM 9369  C CG  . ASP D 1 198 ? 14.571  -0.756  -24.654 1.00 49.85 ? 198 ASP D CG  1 
ATOM 9370  O OD1 . ASP D 1 198 ? 13.445  -0.834  -24.124 1.00 49.85 ? 198 ASP D OD1 1 
ATOM 9371  O OD2 . ASP D 1 198 ? 15.338  0.212   -24.495 1.00 49.85 ? 198 ASP D OD2 1 
ATOM 9372  N N   . LEU D 1 199 ? 16.693  -3.108  -23.366 1.00 28.78 ? 199 LEU D N   1 
ATOM 9373  C CA  . LEU D 1 199 ? 17.343  -3.094  -22.065 1.00 28.78 ? 199 LEU D CA  1 
ATOM 9374  C C   . LEU D 1 199 ? 16.705  -2.085  -21.104 1.00 28.78 ? 199 LEU D C   1 
ATOM 9375  O O   . LEU D 1 199 ? 16.416  -2.424  -19.956 1.00 28.78 ? 199 LEU D O   1 
ATOM 9376  C CB  . LEU D 1 199 ? 18.835  -2.796  -22.226 1.00 20.66 ? 199 LEU D CB  1 
ATOM 9377  C CG  . LEU D 1 199 ? 19.680  -3.031  -20.968 1.00 20.66 ? 199 LEU D CG  1 
ATOM 9378  C CD1 . LEU D 1 199 ? 19.687  -4.515  -20.617 1.00 20.66 ? 199 LEU D CD1 1 
ATOM 9379  C CD2 . LEU D 1 199 ? 21.094  -2.546  -21.202 1.00 20.66 ? 199 LEU D CD2 1 
ATOM 9380  N N   . LYS D 1 200 ? 16.488  -0.854  -21.570 1.00 26.01 ? 200 LYS D N   1 
ATOM 9381  C CA  . LYS D 1 200 ? 15.870  0.189   -20.742 1.00 26.01 ? 200 LYS D CA  1 
ATOM 9382  C C   . LYS D 1 200 ? 14.659  -0.348  -19.979 1.00 26.01 ? 200 LYS D C   1 
ATOM 9383  O O   . LYS D 1 200 ? 14.597  -0.267  -18.751 1.00 26.01 ? 200 LYS D O   1 
ATOM 9384  C CB  . LYS D 1 200 ? 15.397  1.365   -21.604 1.00 79.37 ? 200 LYS D CB  1 
ATOM 9385  C CG  . LYS D 1 200 ? 16.472  2.345   -22.040 1.00 79.37 ? 200 LYS D CG  1 
ATOM 9386  C CD  . LYS D 1 200 ? 15.969  3.260   -23.180 1.00 79.37 ? 200 LYS D CD  1 
ATOM 9387  C CE  . LYS D 1 200 ? 14.828  4.199   -22.759 1.00 79.37 ? 200 LYS D CE  1 
ATOM 9388  N NZ  . LYS D 1 200 ? 15.266  5.323   -21.868 1.00 79.37 ? 200 LYS D NZ  1 
ATOM 9389  N N   . ARG D 1 201 ? 13.699  -0.899  -20.713 1.00 30.17 ? 201 ARG D N   1 
ATOM 9390  C CA  . ARG D 1 201 ? 12.481  -1.412  -20.101 1.00 30.17 ? 201 ARG D CA  1 
ATOM 9391  C C   . ARG D 1 201 ? 12.712  -2.488  -19.050 1.00 30.17 ? 201 ARG D C   1 
ATOM 9392  O O   . ARG D 1 201 ? 12.102  -2.459  -17.978 1.00 30.17 ? 201 ARG D O   1 
ATOM 9393  C CB  . ARG D 1 201 ? 11.524  -1.942  -21.172 1.00 43.66 ? 201 ARG D CB  1 
ATOM 9394  C CG  . ARG D 1 201 ? 10.200  -2.397  -20.601 1.00 43.66 ? 201 ARG D CG  1 
ATOM 9395  C CD  . ARG D 1 201 ? 9.129   -2.556  -21.669 1.00 43.66 ? 201 ARG D CD  1 
ATOM 9396  N NE  . ARG D 1 201 ? 7.860   -2.971  -21.078 1.00 43.66 ? 201 ARG D NE  1 
ATOM 9397  C CZ  . ARG D 1 201 ? 7.264   -2.327  -20.078 1.00 43.66 ? 201 ARG D CZ  1 
ATOM 9398  N NH1 . ARG D 1 201 ? 7.825   -1.231  -19.562 1.00 43.66 ? 201 ARG D NH1 1 
ATOM 9399  N NH2 . ARG D 1 201 ? 6.118   -2.789  -19.580 1.00 43.66 ? 201 ARG D NH2 1 
ATOM 9400  N N   . CYS D 1 202 ? 13.582  -3.442  -19.348 1.00 24.69 ? 202 CYS D N   1 
ATOM 9401  C CA  . CYS D 1 202 ? 13.844  -4.500  -18.391 1.00 24.69 ? 202 CYS D CA  1 
ATOM 9402  C C   . CYS D 1 202 ? 14.411  -3.923  -17.109 1.00 24.69 ? 202 CYS D C   1 
ATOM 9403  O O   . CYS D 1 202 ? 14.102  -4.389  -16.011 1.00 24.69 ? 202 CYS D O   1 
ATOM 9404  C CB  . CYS D 1 202 ? 14.828  -5.509  -18.949 1.00 24.08 ? 202 CYS D CB  1 
ATOM 9405  S SG  . CYS D 1 202 ? 15.237  -6.741  -17.720 1.00 24.08 ? 202 CYS D SG  1 
ATOM 9406  N N   . GLN D 1 203 ? 15.250  -2.906  -17.243 1.00 19.99 ? 203 GLN D N   1 
ATOM 9407  C CA  . GLN D 1 203 ? 15.833  -2.300  -16.069 1.00 19.99 ? 203 GLN D CA  1 
ATOM 9408  C C   . GLN D 1 203 ? 14.718  -1.663  -15.248 1.00 19.99 ? 203 GLN D C   1 
ATOM 9409  O O   . GLN D 1 203 ? 14.636  -1.856  -14.034 1.00 19.99 ? 203 GLN D O   1 
ATOM 9410  C CB  . GLN D 1 203 ? 16.847  -1.246  -16.467 1.00 22.48 ? 203 GLN D CB  1 
ATOM 9411  C CG  . GLN D 1 203 ? 17.826  -0.952  -15.365 1.00 22.48 ? 203 GLN D CG  1 
ATOM 9412  C CD  . GLN D 1 203 ? 18.558  0.337   -15.585 1.00 22.48 ? 203 GLN D CD  1 
ATOM 9413  O OE1 . GLN D 1 203 ? 19.103  0.577   -16.659 1.00 22.48 ? 203 GLN D OE1 1 
ATOM 9414  N NE2 . GLN D 1 203 ? 18.578  1.183   -14.570 1.00 22.48 ? 203 GLN D NE2 1 
ATOM 9415  N N   . TYR D 1 204 ? 13.854  -0.916  -15.927 1.00 23.48 ? 204 TYR D N   1 
ATOM 9416  C CA  . TYR D 1 204 ? 12.730  -0.239  -15.284 1.00 23.48 ? 204 TYR D CA  1 
ATOM 9417  C C   . TYR D 1 204 ? 11.896  -1.225  -14.481 1.00 23.48 ? 204 TYR D C   1 
ATOM 9418  O O   . TYR D 1 204 ? 11.722  -1.083  -13.267 1.00 23.48 ? 204 TYR D O   1 
ATOM 9419  C CB  . TYR D 1 204 ? 11.837  0.408   -16.338 1.00 30.69 ? 204 TYR D CB  1 
ATOM 9420  C CG  . TYR D 1 204 ? 10.744  1.265   -15.756 1.00 30.69 ? 204 TYR D CG  1 
ATOM 9421  C CD1 . TYR D 1 204 ? 10.980  2.597   -15.421 1.00 30.69 ? 204 TYR D CD1 1 
ATOM 9422  C CD2 . TYR D 1 204 ? 9.478   0.740   -15.509 1.00 30.69 ? 204 TYR D CD2 1 
ATOM 9423  C CE1 . TYR D 1 204 ? 9.983   3.394   -14.849 1.00 30.69 ? 204 TYR D CE1 1 
ATOM 9424  C CE2 . TYR D 1 204 ? 8.469   1.525   -14.934 1.00 30.69 ? 204 TYR D CE2 1 
ATOM 9425  C CZ  . TYR D 1 204 ? 8.729   2.851   -14.605 1.00 30.69 ? 204 TYR D CZ  1 
ATOM 9426  O OH  . TYR D 1 204 ? 7.744   3.628   -14.024 1.00 30.69 ? 204 TYR D OH  1 
ATOM 9427  N N   . VAL D 1 205 ? 11.373  -2.226  -15.176 1.00 16.35 ? 205 VAL D N   1 
ATOM 9428  C CA  . VAL D 1 205 ? 10.554  -3.235  -14.539 1.00 16.35 ? 205 VAL D CA  1 
ATOM 9429  C C   . VAL D 1 205 ? 11.308  -3.906  -13.399 1.00 16.35 ? 205 VAL D C   1 
ATOM 9430  O O   . VAL D 1 205 ? 10.751  -4.105  -12.316 1.00 16.35 ? 205 VAL D O   1 
ATOM 9431  C CB  . VAL D 1 205 ? 10.117  -4.302  -15.549 1.00 10.15 ? 205 VAL D CB  1 
ATOM 9432  C CG1 . VAL D 1 205 ? 9.224   -5.325  -14.871 1.00 10.15 ? 205 VAL D CG1 1 
ATOM 9433  C CG2 . VAL D 1 205 ? 9.394   -3.646  -16.713 1.00 10.15 ? 205 VAL D CG2 1 
ATOM 9434  N N   . THR D 1 206 ? 12.573  -4.253  -13.627 1.00 18.27 ? 206 THR D N   1 
ATOM 9435  C CA  . THR D 1 206 ? 13.353  -4.902  -12.581 1.00 18.27 ? 206 THR D CA  1 
ATOM 9436  C C   . THR D 1 206 ? 13.423  -4.022  -11.347 1.00 18.27 ? 206 THR D C   1 
ATOM 9437  O O   . THR D 1 206 ? 13.269  -4.497  -10.222 1.00 18.27 ? 206 THR D O   1 
ATOM 9438  C CB  . THR D 1 206 ? 14.782  -5.215  -13.041 1.00 14.74 ? 206 THR D CB  1 
ATOM 9439  O OG1 . THR D 1 206 ? 14.761  -6.341  -13.928 1.00 14.74 ? 206 THR D OG1 1 
ATOM 9440  C CG2 . THR D 1 206 ? 15.658  -5.541  -11.841 1.00 14.74 ? 206 THR D CG2 1 
ATOM 9441  N N   . GLU D 1 207 ? 13.652  -2.733  -11.557 1.00 23.76 ? 207 GLU D N   1 
ATOM 9442  C CA  . GLU D 1 207 ? 13.733  -1.811  -10.444 1.00 23.76 ? 207 GLU D CA  1 
ATOM 9443  C C   . GLU D 1 207 ? 12.429  -1.753  -9.662  1.00 23.76 ? 207 GLU D C   1 
ATOM 9444  O O   . GLU D 1 207 ? 12.445  -1.797  -8.428  1.00 23.76 ? 207 GLU D O   1 
ATOM 9445  C CB  . GLU D 1 207 ? 14.108  -0.427  -10.943 1.00 34.23 ? 207 GLU D CB  1 
ATOM 9446  C CG  . GLU D 1 207 ? 15.562  -0.303  -11.310 1.00 34.23 ? 207 GLU D CG  1 
ATOM 9447  C CD  . GLU D 1 207 ? 15.884  1.043   -11.917 1.00 34.23 ? 207 GLU D CD  1 
ATOM 9448  O OE1 . GLU D 1 207 ? 15.422  2.071   -11.379 1.00 34.23 ? 207 GLU D OE1 1 
ATOM 9449  O OE2 . GLU D 1 207 ? 16.605  1.079   -12.931 1.00 34.23 ? 207 GLU D OE2 1 
ATOM 9450  N N   . LYS D 1 208 ? 11.301  -1.665  -10.363 1.00 18.12 ? 208 LYS D N   1 
ATOM 9451  C CA  . LYS D 1 208 ? 10.008  -1.603  -9.685  1.00 18.12 ? 208 LYS D CA  1 
ATOM 9452  C C   . LYS D 1 208 ? 9.696   -2.892  -8.930  1.00 18.12 ? 208 LYS D C   1 
ATOM 9453  O O   . LYS D 1 208 ? 9.225   -2.858  -7.793  1.00 18.12 ? 208 LYS D O   1 
ATOM 9454  C CB  . LYS D 1 208 ? 8.899   -1.314  -10.688 1.00 18.33 ? 208 LYS D CB  1 
ATOM 9455  C CG  . LYS D 1 208 ? 9.052   0.021   -11.397 1.00 18.33 ? 208 LYS D CG  1 
ATOM 9456  C CD  . LYS D 1 208 ? 8.973   1.202   -10.428 1.00 18.33 ? 208 LYS D CD  1 
ATOM 9457  C CE  . LYS D 1 208 ? 9.283   2.526   -11.137 1.00 18.33 ? 208 LYS D CE  1 
ATOM 9458  N NZ  . LYS D 1 208 ? 9.465   3.661   -10.182 1.00 18.33 ? 208 LYS D NZ  1 
ATOM 9459  N N   . VAL D 1 209 ? 9.958   -4.029  -9.560  1.00 14.97 ? 209 VAL D N   1 
ATOM 9460  C CA  . VAL D 1 209 ? 9.692   -5.304  -8.919  1.00 14.97 ? 209 VAL D CA  1 
ATOM 9461  C C   . VAL D 1 209 ? 10.525  -5.438  -7.652  1.00 14.97 ? 209 VAL D C   1 
ATOM 9462  O O   . VAL D 1 209 ? 9.997   -5.725  -6.581  1.00 14.97 ? 209 VAL D O   1 
ATOM 9463  C CB  . VAL D 1 209 ? 10.004  -6.486  -9.864  1.00 8.37  ? 209 VAL D CB  1 
ATOM 9464  C CG1 . VAL D 1 209 ? 9.997   -7.799  -9.092  1.00 8.37  ? 209 VAL D CG1 1 
ATOM 9465  C CG2 . VAL D 1 209 ? 8.980   -6.532  -10.981 1.00 8.37  ? 209 VAL D CG2 1 
ATOM 9466  N N   . LEU D 1 210 ? 11.827  -5.224  -7.758  1.00 22.31 ? 210 LEU D N   1 
ATOM 9467  C CA  . LEU D 1 210 ? 12.667  -5.345  -6.579  1.00 22.31 ? 210 LEU D CA  1 
ATOM 9468  C C   . LEU D 1 210 ? 12.217  -4.383  -5.478  1.00 22.31 ? 210 LEU D C   1 
ATOM 9469  O O   . LEU D 1 210 ? 12.079  -4.778  -4.318  1.00 22.31 ? 210 LEU D O   1 
ATOM 9470  C CB  . LEU D 1 210 ? 14.133  -5.109  -6.947  1.00 15.58 ? 210 LEU D CB  1 
ATOM 9471  C CG  . LEU D 1 210 ? 14.754  -6.250  -7.753  1.00 15.58 ? 210 LEU D CG  1 
ATOM 9472  C CD1 . LEU D 1 210 ? 16.169  -5.901  -8.121  1.00 15.58 ? 210 LEU D CD1 1 
ATOM 9473  C CD2 . LEU D 1 210 ? 14.732  -7.528  -6.943  1.00 15.58 ? 210 LEU D CD2 1 
ATOM 9474  N N   . ALA D 1 211 ? 11.964  -3.130  -5.842  1.00 16.85 ? 211 ALA D N   1 
ATOM 9475  C CA  . ALA D 1 211 ? 11.522  -2.143  -4.863  1.00 16.85 ? 211 ALA D CA  1 
ATOM 9476  C C   . ALA D 1 211 ? 10.331  -2.665  -4.055  1.00 16.85 ? 211 ALA D C   1 
ATOM 9477  O O   . ALA D 1 211 ? 10.224  -2.430  -2.853  1.00 16.85 ? 211 ALA D O   1 
ATOM 9478  C CB  . ALA D 1 211 ? 11.149  -0.848  -5.562  1.00 8.98  ? 211 ALA D CB  1 
ATOM 9479  N N   . ALA D 1 212 ? 9.435   -3.376  -4.724  1.00 22.83 ? 212 ALA D N   1 
ATOM 9480  C CA  . ALA D 1 212 ? 8.268   -3.921  -4.062  1.00 22.83 ? 212 ALA D CA  1 
ATOM 9481  C C   . ALA D 1 212 ? 8.674   -5.094  -3.191  1.00 22.83 ? 212 ALA D C   1 
ATOM 9482  O O   . ALA D 1 212 ? 8.238   -5.218  -2.048  1.00 22.83 ? 212 ALA D O   1 
ATOM 9483  C CB  . ALA D 1 212 ? 7.270   -4.373  -5.088  1.00 2.35  ? 212 ALA D CB  1 
ATOM 9484  N N   . VAL D 1 213 ? 9.505   -5.964  -3.749  1.00 20.50 ? 213 VAL D N   1 
ATOM 9485  C CA  . VAL D 1 213 ? 9.967   -7.136  -3.030  1.00 20.50 ? 213 VAL D CA  1 
ATOM 9486  C C   . VAL D 1 213 ? 10.593  -6.788  -1.691  1.00 20.50 ? 213 VAL D C   1 
ATOM 9487  O O   . VAL D 1 213 ? 10.306  -7.436  -0.684  1.00 20.50 ? 213 VAL D O   1 
ATOM 9488  C CB  . VAL D 1 213 ? 11.014  -7.911  -3.838  1.00 9.25  ? 213 VAL D CB  1 
ATOM 9489  C CG1 . VAL D 1 213 ? 11.555  -9.048  -3.010  1.00 9.25  ? 213 VAL D CG1 1 
ATOM 9490  C CG2 . VAL D 1 213 ? 10.400  -8.436  -5.112  1.00 9.25  ? 213 VAL D CG2 1 
ATOM 9491  N N   . TYR D 1 214 ? 11.451  -5.774  -1.658  1.00 23.73 ? 214 TYR D N   1 
ATOM 9492  C CA  . TYR D 1 214 ? 12.082  -5.450  -0.391  1.00 23.73 ? 214 TYR D CA  1 
ATOM 9493  C C   . TYR D 1 214 ? 11.151  -4.784  0.597   1.00 23.73 ? 214 TYR D C   1 
ATOM 9494  O O   . TYR D 1 214 ? 11.263  -5.019  1.804   1.00 23.73 ? 214 TYR D O   1 
ATOM 9495  C CB  . TYR D 1 214 ? 13.383  -4.653  -0.599  1.00 17.25 ? 214 TYR D CB  1 
ATOM 9496  C CG  . TYR D 1 214 ? 14.555  -5.588  -0.888  1.00 17.25 ? 214 TYR D CG  1 
ATOM 9497  C CD1 . TYR D 1 214 ? 14.994  -5.815  -2.197  1.00 17.25 ? 214 TYR D CD1 1 
ATOM 9498  C CD2 . TYR D 1 214 ? 15.107  -6.380  0.130   1.00 17.25 ? 214 TYR D CD2 1 
ATOM 9499  C CE1 . TYR D 1 214 ? 15.929  -6.810  -2.486  1.00 17.25 ? 214 TYR D CE1 1 
ATOM 9500  C CE2 . TYR D 1 214 ? 16.038  -7.379  -0.153  1.00 17.25 ? 214 TYR D CE2 1 
ATOM 9501  C CZ  . TYR D 1 214 ? 16.438  -7.592  -1.466  1.00 17.25 ? 214 TYR D CZ  1 
ATOM 9502  O OH  . TYR D 1 214 ? 17.309  -8.621  -1.763  1.00 17.25 ? 214 TYR D OH  1 
ATOM 9503  N N   . LYS D 1 215 ? 10.213  -3.984  0.102   1.00 22.22 ? 215 LYS D N   1 
ATOM 9504  C CA  . LYS D 1 215 ? 9.259   -3.340  1.000   1.00 22.22 ? 215 LYS D CA  1 
ATOM 9505  C C   . LYS D 1 215 ? 8.437   -4.439  1.660   1.00 22.22 ? 215 LYS D C   1 
ATOM 9506  O O   . LYS D 1 215 ? 8.099   -4.352  2.834   1.00 22.22 ? 215 LYS D O   1 
ATOM 9507  C CB  . LYS D 1 215 ? 8.334   -2.398  0.230   1.00 13.12 ? 215 LYS D CB  1 
ATOM 9508  C CG  . LYS D 1 215 ? 7.159   -1.853  1.050   1.00 13.12 ? 215 LYS D CG  1 
ATOM 9509  C CD  . LYS D 1 215 ? 7.604   -1.113  2.308   1.00 13.12 ? 215 LYS D CD  1 
ATOM 9510  C CE  . LYS D 1 215 ? 6.479   -0.265  2.905   1.00 13.12 ? 215 LYS D CE  1 
ATOM 9511  N NZ  . LYS D 1 215 ? 5.274   -1.040  3.344   1.00 13.12 ? 215 LYS D NZ  1 
ATOM 9512  N N   . ALA D 1 216 ? 8.132   -5.479  0.892   1.00 16.45 ? 216 ALA D N   1 
ATOM 9513  C CA  . ALA D 1 216 ? 7.362   -6.612  1.392   1.00 16.45 ? 216 ALA D CA  1 
ATOM 9514  C C   . ALA D 1 216 ? 8.153   -7.309  2.483   1.00 16.45 ? 216 ALA D C   1 
ATOM 9515  O O   . ALA D 1 216 ? 7.642   -7.560  3.577   1.00 16.45 ? 216 ALA D O   1 
ATOM 9516  C CB  . ALA D 1 216 ? 7.066   -7.590  0.259   1.00 5.94  ? 216 ALA D CB  1 
ATOM 9517  N N   . LEU D 1 217 ? 9.405   -7.627  2.180   1.00 13.94 ? 217 LEU D N   1 
ATOM 9518  C CA  . LEU D 1 217 ? 10.245  -8.289  3.154   1.00 13.94 ? 217 LEU D CA  1 
ATOM 9519  C C   . LEU D 1 217 ? 10.229  -7.491  4.440   1.00 13.94 ? 217 LEU D C   1 
ATOM 9520  O O   . LEU D 1 217 ? 10.122  -8.065  5.519   1.00 13.94 ? 217 LEU D O   1 
ATOM 9521  C CB  . LEU D 1 217 ? 11.661  -8.414  2.626   1.00 10.86 ? 217 LEU D CB  1 
ATOM 9522  C CG  . LEU D 1 217 ? 11.790  -9.467  1.531   1.00 10.86 ? 217 LEU D CG  1 
ATOM 9523  C CD1 . LEU D 1 217 ? 13.183  -9.423  0.945   1.00 10.86 ? 217 LEU D CD1 1 
ATOM 9524  C CD2 . LEU D 1 217 ? 11.490  -10.846 2.115   1.00 10.86 ? 217 LEU D CD2 1 
ATOM 9525  N N   . SER D 1 218 ? 10.319  -6.166  4.330   1.00 11.83 ? 218 SER D N   1 
ATOM 9526  C CA  . SER D 1 218 ? 10.292  -5.318  5.516   1.00 11.83 ? 218 SER D CA  1 
ATOM 9527  C C   . SER D 1 218 ? 9.011   -5.532  6.299   1.00 11.83 ? 218 SER D C   1 
ATOM 9528  O O   . SER D 1 218 ? 9.034   -5.771  7.505   1.00 11.83 ? 218 SER D O   1 
ATOM 9529  C CB  . SER D 1 218 ? 10.374  -3.844  5.141   1.00 16.54 ? 218 SER D CB  1 
ATOM 9530  O OG  . SER D 1 218 ? 10.049  -3.045  6.270   1.00 16.54 ? 218 SER D OG  1 
ATOM 9531  N N   . ASP D 1 219 ? 7.891   -5.433  5.594   1.00 25.77 ? 219 ASP D N   1 
ATOM 9532  C CA  . ASP D 1 219 ? 6.581   -5.600  6.192   1.00 25.77 ? 219 ASP D CA  1 
ATOM 9533  C C   . ASP D 1 219 ? 6.449   -6.912  6.945   1.00 25.77 ? 219 ASP D C   1 
ATOM 9534  O O   . ASP D 1 219 ? 5.811   -6.966  8.004   1.00 25.77 ? 219 ASP D O   1 
ATOM 9535  C CB  . ASP D 1 219 ? 5.511   -5.526  5.113   1.00 24.91 ? 219 ASP D CB  1 
ATOM 9536  C CG  . ASP D 1 219 ? 5.458   -4.169  4.448   1.00 24.91 ? 219 ASP D CG  1 
ATOM 9537  O OD1 . ASP D 1 219 ? 6.267   -3.292  4.835   1.00 24.91 ? 219 ASP D OD1 1 
ATOM 9538  O OD2 . ASP D 1 219 ? 4.607   -3.982  3.546   1.00 24.91 ? 219 ASP D OD2 1 
ATOM 9539  N N   . HIS D 1 220 ? 7.055   -7.966  6.405   1.00 22.47 ? 220 HIS D N   1 
ATOM 9540  C CA  . HIS D 1 220 ? 6.976   -9.273  7.035   1.00 22.47 ? 220 HIS D CA  1 
ATOM 9541  C C   . HIS D 1 220 ? 8.072   -9.552  8.041   1.00 22.47 ? 220 HIS D C   1 
ATOM 9542  O O   . HIS D 1 220 ? 8.199   -10.679 8.541   1.00 22.47 ? 220 HIS D O   1 
ATOM 9543  C CB  . HIS D 1 220 ? 6.955   -10.344 5.967   1.00 21.63 ? 220 HIS D CB  1 
ATOM 9544  C CG  . HIS D 1 220 ? 5.662   -10.398 5.225   1.00 21.63 ? 220 HIS D CG  1 
ATOM 9545  N ND1 . HIS D 1 220 ? 4.709   -11.366 5.461   1.00 21.63 ? 220 HIS D ND1 1 
ATOM 9546  C CD2 . HIS D 1 220 ? 5.139   -9.573  4.288   1.00 21.63 ? 220 HIS D CD2 1 
ATOM 9547  C CE1 . HIS D 1 220 ? 3.655   -11.133 4.700   1.00 21.63 ? 220 HIS D CE1 1 
ATOM 9548  N NE2 . HIS D 1 220 ? 3.891   -10.050 3.980   1.00 21.63 ? 220 HIS D NE2 1 
ATOM 9549  N N   . HIS D 1 221 ? 8.852   -8.520  8.340   1.00 19.85 ? 221 HIS D N   1 
ATOM 9550  C CA  . HIS D 1 221 ? 9.932   -8.622  9.305   1.00 19.85 ? 221 HIS D CA  1 
ATOM 9551  C C   . HIS D 1 221 ? 11.013  -9.624  8.923   1.00 19.85 ? 221 HIS D C   1 
ATOM 9552  O O   . HIS D 1 221 ? 11.574  -10.284 9.797   1.00 19.85 ? 221 HIS D O   1 
ATOM 9553  C CB  . HIS D 1 221 ? 9.376   -9.015  10.666  1.00 24.27 ? 221 HIS D CB  1 
ATOM 9554  C CG  . HIS D 1 221 ? 8.160   -8.245  11.070  1.00 24.27 ? 221 HIS D CG  1 
ATOM 9555  N ND1 . HIS D 1 221 ? 8.108   -6.867  11.043  1.00 24.27 ? 221 HIS D ND1 1 
ATOM 9556  C CD2 . HIS D 1 221 ? 6.963   -8.660  11.550  1.00 24.27 ? 221 HIS D CD2 1 
ATOM 9557  C CE1 . HIS D 1 221 ? 6.932   -6.466  11.492  1.00 24.27 ? 221 HIS D CE1 1 
ATOM 9558  N NE2 . HIS D 1 221 ? 6.219   -7.535  11.807  1.00 24.27 ? 221 HIS D NE2 1 
ATOM 9559  N N   . VAL D 1 222 ? 11.299  -9.758  7.630   1.00 22.71 ? 222 VAL D N   1 
ATOM 9560  C CA  . VAL D 1 222 ? 12.339  -10.680 7.186   1.00 22.71 ? 222 VAL D CA  1 
ATOM 9561  C C   . VAL D 1 222 ? 13.710  -10.075 7.493   1.00 22.71 ? 222 VAL D C   1 
ATOM 9562  O O   . VAL D 1 222 ? 13.924  -8.882  7.286   1.00 22.71 ? 222 VAL D O   1 
ATOM 9563  C CB  . VAL D 1 222 ? 12.230  -10.958 5.679   1.00 23.77 ? 222 VAL D CB  1 
ATOM 9564  C CG1 . VAL D 1 222 ? 13.468  -11.675 5.197   1.00 23.77 ? 222 VAL D CG1 1 
ATOM 9565  C CG2 . VAL D 1 222 ? 11.010  -11.814 5.404   1.00 23.77 ? 222 VAL D CG2 1 
ATOM 9566  N N   . TYR D 1 223 ? 14.619  -10.906 7.998   1.00 27.30 ? 223 TYR D N   1 
ATOM 9567  C CA  . TYR D 1 223 ? 15.985  -10.507 8.366   1.00 27.30 ? 223 TYR D CA  1 
ATOM 9568  C C   . TYR D 1 223 ? 16.832  -10.461 7.100   1.00 27.30 ? 223 TYR D C   1 
ATOM 9569  O O   . TYR D 1 223 ? 17.307  -11.493 6.628   1.00 27.30 ? 223 TYR D O   1 
ATOM 9570  C CB  . TYR D 1 223 ? 16.532  -11.546 9.347   1.00 31.60 ? 223 TYR D CB  1 
ATOM 9571  C CG  . TYR D 1 223 ? 17.938  -11.343 9.857   1.00 31.60 ? 223 TYR D CG  1 
ATOM 9572  C CD1 . TYR D 1 223 ? 18.279  -10.228 10.614  1.00 31.60 ? 223 TYR D CD1 1 
ATOM 9573  C CD2 . TYR D 1 223 ? 18.912  -12.313 9.639   1.00 31.60 ? 223 TYR D CD2 1 
ATOM 9574  C CE1 . TYR D 1 223 ? 19.549  -10.086 11.148  1.00 31.60 ? 223 TYR D CE1 1 
ATOM 9575  C CE2 . TYR D 1 223 ? 20.183  -12.186 10.163  1.00 31.60 ? 223 TYR D CE2 1 
ATOM 9576  C CZ  . TYR D 1 223 ? 20.498  -11.073 10.917  1.00 31.60 ? 223 TYR D CZ  1 
ATOM 9577  O OH  . TYR D 1 223 ? 21.769  -10.957 11.433  1.00 31.60 ? 223 TYR D OH  1 
ATOM 9578  N N   . LEU D 1 224 ? 17.024  -9.264  6.552   1.00 25.36 ? 224 LEU D N   1 
ATOM 9579  C CA  . LEU D 1 224 ? 17.771  -9.122  5.308   1.00 25.36 ? 224 LEU D CA  1 
ATOM 9580  C C   . LEU D 1 224 ? 19.146  -9.754  5.253   1.00 25.36 ? 224 LEU D C   1 
ATOM 9581  O O   . LEU D 1 224 ? 19.462  -10.452 4.287   1.00 25.36 ? 224 LEU D O   1 
ATOM 9582  C CB  . LEU D 1 224 ? 17.882  -7.652  4.915   1.00 11.84 ? 224 LEU D CB  1 
ATOM 9583  C CG  . LEU D 1 224 ? 16.596  -7.008  4.399   1.00 11.84 ? 224 LEU D CG  1 
ATOM 9584  C CD1 . LEU D 1 224 ? 16.939  -5.666  3.771   1.00 11.84 ? 224 LEU D CD1 1 
ATOM 9585  C CD2 . LEU D 1 224 ? 15.930  -7.904  3.369   1.00 11.84 ? 224 LEU D CD2 1 
ATOM 9586  N N   . GLU D 1 225 ? 19.969  -9.518  6.271   1.00 29.19 ? 225 GLU D N   1 
ATOM 9587  C CA  . GLU D 1 225 ? 21.312  -10.075 6.275   1.00 29.19 ? 225 GLU D CA  1 
ATOM 9588  C C   . GLU D 1 225 ? 21.341  -11.595 6.381   1.00 29.19 ? 225 GLU D C   1 
ATOM 9589  O O   . GLU D 1 225 ? 22.410  -12.198 6.450   1.00 29.19 ? 225 GLU D O   1 
ATOM 9590  C CB  . GLU D 1 225 ? 22.159  -9.443  7.382   1.00 32.59 ? 225 GLU D CB  1 
ATOM 9591  C CG  . GLU D 1 225 ? 21.416  -9.051  8.630   1.00 32.59 ? 225 GLU D CG  1 
ATOM 9592  C CD  . GLU D 1 225 ? 20.821  -7.652  8.559   1.00 32.59 ? 225 GLU D CD  1 
ATOM 9593  O OE1 . GLU D 1 225 ? 19.881  -7.445  7.766   1.00 32.59 ? 225 GLU D OE1 1 
ATOM 9594  O OE2 . GLU D 1 225 ? 21.285  -6.751  9.296   1.00 32.59 ? 225 GLU D OE2 1 
ATOM 9595  N N   . GLY D 1 226 ? 20.163  -12.209 6.375   1.00 17.70 ? 226 GLY D N   1 
ATOM 9596  C CA  . GLY D 1 226 ? 20.064  -13.658 6.446   1.00 17.70 ? 226 GLY D CA  1 
ATOM 9597  C C   . GLY D 1 226 ? 19.282  -14.175 5.243   1.00 17.70 ? 226 GLY D C   1 
ATOM 9598  O O   . GLY D 1 226 ? 18.581  -15.188 5.312   1.00 17.70 ? 226 GLY D O   1 
ATOM 9599  N N   . THR D 1 227 ? 19.413  -13.465 4.128   1.00 15.77 ? 227 THR D N   1 
ATOM 9600  C CA  . THR D 1 227 ? 18.716  -13.823 2.903   1.00 15.77 ? 227 THR D CA  1 
ATOM 9601  C C   . THR D 1 227 ? 19.651  -13.652 1.725   1.00 15.77 ? 227 THR D C   1 
ATOM 9602  O O   . THR D 1 227 ? 20.767  -13.178 1.878   1.00 15.77 ? 227 THR D O   1 
ATOM 9603  C CB  . THR D 1 227 ? 17.532  -12.884 2.645   1.00 19.64 ? 227 THR D CB  1 
ATOM 9604  O OG1 . THR D 1 227 ? 18.031  -11.569 2.356   1.00 19.64 ? 227 THR D OG1 1 
ATOM 9605  C CG2 . THR D 1 227 ? 16.627  -12.820 3.855   1.00 19.64 ? 227 THR D CG2 1 
ATOM 9606  N N   . LEU D 1 228 ? 19.174  -14.027 0.547   1.00 28.38 ? 228 LEU D N   1 
ATOM 9607  C CA  . LEU D 1 228 ? 19.941  -13.882 -0.675  1.00 28.38 ? 228 LEU D CA  1 
ATOM 9608  C C   . LEU D 1 228 ? 18.953  -13.547 -1.777  1.00 28.38 ? 228 LEU D C   1 
ATOM 9609  O O   . LEU D 1 228 ? 17.805  -13.990 -1.737  1.00 28.38 ? 228 LEU D O   1 
ATOM 9610  C CB  . LEU D 1 228 ? 20.680  -15.174 -1.014  1.00 21.03 ? 228 LEU D CB  1 
ATOM 9611  C CG  . LEU D 1 228 ? 21.947  -15.502 -0.224  1.00 21.03 ? 228 LEU D CG  1 
ATOM 9612  C CD1 . LEU D 1 228 ? 22.531  -16.806 -0.740  1.00 21.03 ? 228 LEU D CD1 1 
ATOM 9613  C CD2 . LEU D 1 228 ? 22.955  -14.377 -0.378  1.00 21.03 ? 228 LEU D CD2 1 
ATOM 9614  N N   . LEU D 1 229 ? 19.389  -12.764 -2.755  1.00 17.04 ? 229 LEU D N   1 
ATOM 9615  C CA  . LEU D 1 229 ? 18.518  -12.381 -3.855  1.00 17.04 ? 229 LEU D CA  1 
ATOM 9616  C C   . LEU D 1 229 ? 18.953  -13.064 -5.146  1.00 17.04 ? 229 LEU D C   1 
ATOM 9617  O O   . LEU D 1 229 ? 20.112  -12.975 -5.551  1.00 17.04 ? 229 LEU D O   1 
ATOM 9618  C CB  . LEU D 1 229 ? 18.543  -10.862 -4.038  1.00 10.07 ? 229 LEU D CB  1 
ATOM 9619  C CG  . LEU D 1 229 ? 17.741  -10.289 -5.204  1.00 10.07 ? 229 LEU D CG  1 
ATOM 9620  C CD1 . LEU D 1 229 ? 16.273  -10.543 -4.979  1.00 10.07 ? 229 LEU D CD1 1 
ATOM 9621  C CD2 . LEU D 1 229 ? 17.994  -8.806  -5.314  1.00 10.07 ? 229 LEU D CD2 1 
ATOM 9622  N N   . LYS D 1 230 ? 18.025  -13.762 -5.785  1.00 21.15 ? 230 LYS D N   1 
ATOM 9623  C CA  . LYS D 1 230 ? 18.319  -14.444 -7.034  1.00 21.15 ? 230 LYS D CA  1 
ATOM 9624  C C   . LYS D 1 230 ? 17.466  -13.800 -8.113  1.00 21.15 ? 230 LYS D C   1 
ATOM 9625  O O   . LYS D 1 230 ? 16.416  -14.319 -8.478  1.00 21.15 ? 230 LYS D O   1 
ATOM 9626  C CB  . LYS D 1 230 ? 17.987  -15.937 -6.926  1.00 16.48 ? 230 LYS D CB  1 
ATOM 9627  C CG  . LYS D 1 230 ? 18.252  -16.747 -8.204  1.00 16.48 ? 230 LYS D CG  1 
ATOM 9628  C CD  . LYS D 1 230 ? 18.025  -18.242 -7.968  1.00 16.48 ? 230 LYS D CD  1 
ATOM 9629  C CE  . LYS D 1 230 ? 18.312  -19.075 -9.212  1.00 16.48 ? 230 LYS D CE  1 
ATOM 9630  N NZ  . LYS D 1 230 ? 18.145  -20.540 -8.948  1.00 16.48 ? 230 LYS D NZ  1 
ATOM 9631  N N   . PRO D 1 231 ? 17.896  -12.639 -8.620  1.00 26.93 ? 231 PRO D N   1 
ATOM 9632  C CA  . PRO D 1 231 ? 17.150  -11.937 -9.662  1.00 26.93 ? 231 PRO D CA  1 
ATOM 9633  C C   . PRO D 1 231 ? 17.660  -12.289 -11.032 1.00 26.93 ? 231 PRO D C   1 
ATOM 9634  O O   . PRO D 1 231 ? 18.612  -13.035 -11.184 1.00 26.93 ? 231 PRO D O   1 
ATOM 9635  C CB  . PRO D 1 231 ? 17.434  -10.487 -9.350  1.00 19.68 ? 231 PRO D CB  1 
ATOM 9636  C CG  . PRO D 1 231 ? 18.871  -10.552 -9.003  1.00 19.68 ? 231 PRO D CG  1 
ATOM 9637  C CD  . PRO D 1 231 ? 18.937  -11.757 -8.067  1.00 19.68 ? 231 PRO D CD  1 
ATOM 9638  N N   . ASN D 1 232 ? 17.016  -11.724 -12.029 1.00 25.37 ? 232 ASN D N   1 
ATOM 9639  C CA  . ASN D 1 232 ? 17.399  -11.926 -13.406 1.00 25.37 ? 232 ASN D CA  1 
ATOM 9640  C C   . ASN D 1 232 ? 18.376  -10.788 -13.684 1.00 25.37 ? 232 ASN D C   1 
ATOM 9641  O O   . ASN D 1 232 ? 18.297  -9.757  -13.034 1.00 25.37 ? 232 ASN D O   1 
ATOM 9642  C CB  . ASN D 1 232 ? 16.149  -11.772 -14.270 1.00 31.63 ? 232 ASN D CB  1 
ATOM 9643  C CG  . ASN D 1 232 ? 15.391  -10.472 -13.978 1.00 31.63 ? 232 ASN D CG  1 
ATOM 9644  O OD1 . ASN D 1 232 ? 15.758  -9.405  -14.469 1.00 31.63 ? 232 ASN D OD1 1 
ATOM 9645  N ND2 . ASN D 1 232 ? 14.343  -10.560 -13.161 1.00 31.63 ? 232 ASN D ND2 1 
ATOM 9646  N N   . MET D 1 233 ? 19.319  -10.958 -14.599 1.00 23.50 ? 233 MET D N   1 
ATOM 9647  C CA  . MET D 1 233 ? 20.199  -9.836  -14.900 1.00 23.50 ? 233 MET D CA  1 
ATOM 9648  C C   . MET D 1 233 ? 19.307  -8.978  -15.771 1.00 23.50 ? 233 MET D C   1 
ATOM 9649  O O   . MET D 1 233 ? 18.477  -9.519  -16.493 1.00 23.50 ? 233 MET D O   1 
ATOM 9650  C CB  . MET D 1 233 ? 21.398  -10.270 -15.723 1.00 30.19 ? 233 MET D CB  1 
ATOM 9651  C CG  . MET D 1 233 ? 22.305  -11.252 -15.044 1.00 30.19 ? 233 MET D CG  1 
ATOM 9652  S SD  . MET D 1 233 ? 23.664  -11.696 -16.139 1.00 30.19 ? 233 MET D SD  1 
ATOM 9653  C CE  . MET D 1 233 ? 24.426  -12.997 -15.221 1.00 30.19 ? 233 MET D CE  1 
ATOM 9654  N N   . VAL D 1 234 ? 19.435  -7.660  -15.720 1.00 16.76 ? 234 VAL D N   1 
ATOM 9655  C CA  . VAL D 1 234 ? 18.573  -6.870  -16.581 1.00 16.76 ? 234 VAL D CA  1 
ATOM 9656  C C   . VAL D 1 234 ? 19.170  -6.959  -17.980 1.00 16.76 ? 234 VAL D C   1 
ATOM 9657  O O   . VAL D 1 234 ? 20.345  -6.654  -18.182 1.00 16.76 ? 234 VAL D O   1 
ATOM 9658  C CB  . VAL D 1 234 ? 18.414  -5.378  -16.091 1.00 12.03 ? 234 VAL D CB  1 
ATOM 9659  C CG1 . VAL D 1 234 ? 19.063  -5.200  -14.740 1.00 12.03 ? 234 VAL D CG1 1 
ATOM 9660  C CG2 . VAL D 1 234 ? 18.954  -4.392  -17.119 1.00 12.03 ? 234 VAL D CG2 1 
ATOM 9661  N N   . THR D 1 235 ? 18.355  -7.425  -18.926 1.00 30.89 ? 235 THR D N   1 
ATOM 9662  C CA  . THR D 1 235 ? 18.761  -7.605  -20.315 1.00 30.89 ? 235 THR D CA  1 
ATOM 9663  C C   . THR D 1 235 ? 17.558  -7.451  -21.239 1.00 30.89 ? 235 THR D C   1 
ATOM 9664  O O   . THR D 1 235 ? 16.410  -7.545  -20.802 1.00 30.89 ? 235 THR D O   1 
ATOM 9665  C CB  . THR D 1 235 ? 19.313  -9.006  -20.550 1.00 21.98 ? 235 THR D CB  1 
ATOM 9666  O OG1 . THR D 1 235 ? 18.228  -9.940  -20.566 1.00 21.98 ? 235 THR D OG1 1 
ATOM 9667  C CG2 . THR D 1 235 ? 20.271  -9.392  -19.451 1.00 21.98 ? 235 THR D CG2 1 
ATOM 9668  N N   . PRO D 1 236 ? 17.810  -7.254  -22.542 1.00 24.17 ? 236 PRO D N   1 
ATOM 9669  C CA  . PRO D 1 236 ? 16.748  -7.086  -23.536 1.00 24.17 ? 236 PRO D CA  1 
ATOM 9670  C C   . PRO D 1 236 ? 15.948  -8.364  -23.643 1.00 24.17 ? 236 PRO D C   1 
ATOM 9671  O O   . PRO D 1 236 ? 16.410  -9.421  -23.207 1.00 24.17 ? 236 PRO D O   1 
ATOM 9672  C CB  . PRO D 1 236 ? 17.514  -6.816  -24.831 1.00 32.79 ? 236 PRO D CB  1 
ATOM 9673  C CG  . PRO D 1 236 ? 18.880  -6.411  -24.373 1.00 32.79 ? 236 PRO D CG  1 
ATOM 9674  C CD  . PRO D 1 236 ? 19.121  -7.296  -23.202 1.00 32.79 ? 236 PRO D CD  1 
ATOM 9675  N N   . GLY D 1 237 ? 14.759  -8.268  -24.230 1.00 34.11 ? 237 GLY D N   1 
ATOM 9676  C CA  . GLY D 1 237 ? 13.927  -9.442  -24.396 1.00 34.11 ? 237 GLY D CA  1 
ATOM 9677  C C   . GLY D 1 237 ? 14.547  -10.347 -25.442 1.00 34.11 ? 237 GLY D C   1 
ATOM 9678  O O   . GLY D 1 237 ? 15.248  -9.852  -26.327 1.00 34.11 ? 237 GLY D O   1 
ATOM 9679  N N   . HIS D 1 238 ? 14.310  -11.658 -25.348 1.00 40.19 ? 238 HIS D N   1 
ATOM 9680  C CA  . HIS D 1 238 ? 14.866  -12.603 -26.313 1.00 40.19 ? 238 HIS D CA  1 
ATOM 9681  C C   . HIS D 1 238 ? 14.640  -12.103 -27.726 1.00 40.19 ? 238 HIS D C   1 
ATOM 9682  O O   . HIS D 1 238 ? 15.500  -12.252 -28.595 1.00 40.19 ? 238 HIS D O   1 
ATOM 9683  C CB  . HIS D 1 238 ? 14.218  -13.983 -26.184 1.00 88.73 ? 238 HIS D CB  1 
ATOM 9684  C CG  . HIS D 1 238 ? 14.640  -14.738 -24.966 1.00 88.73 ? 238 HIS D CG  1 
ATOM 9685  N ND1 . HIS D 1 238 ? 15.956  -14.821 -24.563 1.00 88.73 ? 238 HIS D ND1 1 
ATOM 9686  C CD2 . HIS D 1 238 ? 13.926  -15.465 -24.074 1.00 88.73 ? 238 HIS D CD2 1 
ATOM 9687  C CE1 . HIS D 1 238 ? 16.035  -15.566 -23.474 1.00 88.73 ? 238 HIS D CE1 1 
ATOM 9688  N NE2 . HIS D 1 238 ? 14.817  -15.969 -23.156 1.00 88.73 ? 238 HIS D NE2 1 
ATOM 9689  N N   . ALA D 1 239 ? 13.480  -11.495 -27.940 1.00 35.04 ? 239 ALA D N   1 
ATOM 9690  C CA  . ALA D 1 239 ? 13.111  -10.988 -29.251 1.00 35.04 ? 239 ALA D CA  1 
ATOM 9691  C C   . ALA D 1 239 ? 13.540  -9.559  -29.552 1.00 35.04 ? 239 ALA D C   1 
ATOM 9692  O O   . ALA D 1 239 ? 13.141  -9.008  -30.575 1.00 35.04 ? 239 ALA D O   1 
ATOM 9693  C CB  . ALA D 1 239 ? 11.611  -11.116 -29.438 1.00 29.65 ? 239 ALA D CB  1 
ATOM 9694  N N   . CYS D 1 240 ? 14.330  -8.937  -28.684 1.00 41.31 ? 240 CYS D N   1 
ATOM 9695  C CA  . CYS D 1 240 ? 14.752  -7.578  -28.989 1.00 41.31 ? 240 CYS D CA  1 
ATOM 9696  C C   . CYS D 1 240 ? 15.822  -7.644  -30.063 1.00 41.31 ? 240 CYS D C   1 
ATOM 9697  O O   . CYS D 1 240 ? 16.769  -8.424  -29.969 1.00 41.31 ? 240 CYS D O   1 
ATOM 9698  C CB  . CYS D 1 240 ? 15.310  -6.856  -27.772 1.00 36.57 ? 240 CYS D CB  1 
ATOM 9699  S SG  . CYS D 1 240 ? 15.809  -5.173  -28.216 1.00 36.57 ? 240 CYS D SG  1 
ATOM 9700  N N   . PRO D 1 241 ? 15.688  -6.812  -31.100 1.00 54.14 ? 241 PRO D N   1 
ATOM 9701  C CA  . PRO D 1 241 ? 16.628  -6.755  -32.225 1.00 54.14 ? 241 PRO D CA  1 
ATOM 9702  C C   . PRO D 1 241 ? 17.985  -6.170  -31.842 1.00 54.14 ? 241 PRO D C   1 
ATOM 9703  O O   . PRO D 1 241 ? 19.030  -6.614  -32.326 1.00 54.14 ? 241 PRO D O   1 
ATOM 9704  C CB  . PRO D 1 241 ? 15.909  -5.859  -33.236 1.00 49.23 ? 241 PRO D CB  1 
ATOM 9705  C CG  . PRO D 1 241 ? 14.459  -5.814  -32.752 1.00 49.23 ? 241 PRO D CG  1 
ATOM 9706  C CD  . PRO D 1 241 ? 14.608  -5.829  -31.268 1.00 49.23 ? 241 PRO D CD  1 
ATOM 9707  N N   . ILE D 1 242 ? 17.951  -5.166  -30.973 1.00 39.31 ? 242 ILE D N   1 
ATOM 9708  C CA  . ILE D 1 242 ? 19.145  -4.466  -30.523 1.00 39.31 ? 242 ILE D CA  1 
ATOM 9709  C C   . ILE D 1 242 ? 20.204  -5.324  -29.847 1.00 39.31 ? 242 ILE D C   1 
ATOM 9710  O O   . ILE D 1 242 ? 19.895  -6.210  -29.048 1.00 39.31 ? 242 ILE D O   1 
ATOM 9711  C CB  . ILE D 1 242 ? 18.768  -3.353  -29.562 1.00 30.26 ? 242 ILE D CB  1 
ATOM 9712  C CG1 . ILE D 1 242 ? 17.694  -2.469  -30.204 1.00 30.26 ? 242 ILE D CG1 1 
ATOM 9713  C CG2 . ILE D 1 242 ? 20.011  -2.566  -29.191 1.00 30.26 ? 242 ILE D CG2 1 
ATOM 9714  C CD1 . ILE D 1 242 ? 17.157  -1.374  -29.292 1.00 30.26 ? 242 ILE D CD1 1 
ATOM 9715  N N   . LYS D 1 243 ? 21.460  -5.029  -30.162 1.00 51.30 ? 243 LYS D N   1 
ATOM 9716  C CA  . LYS D 1 243 ? 22.595  -5.758  -29.611 1.00 51.30 ? 243 LYS D CA  1 
ATOM 9717  C C   . LYS D 1 243 ? 23.218  -4.929  -28.491 1.00 51.30 ? 243 LYS D C   1 
ATOM 9718  O O   . LYS D 1 243 ? 23.369  -3.709  -28.624 1.00 51.30 ? 243 LYS D O   1 
ATOM 9719  C CB  . LYS D 1 243 ? 23.613  -6.015  -30.724 1.00 99.18 ? 243 LYS D CB  1 
ATOM 9720  C CG  . LYS D 1 243 ? 22.997  -6.723  -31.928 1.00 99.18 ? 243 LYS D CG  1 
ATOM 9721  C CD  . LYS D 1 243 ? 23.704  -6.391  -33.239 1.00 99.18 ? 243 LYS D CD  1 
ATOM 9722  C CE  . LYS D 1 243 ? 22.915  -6.940  -34.428 1.00 99.18 ? 243 LYS D CE  1 
ATOM 9723  N NZ  . LYS D 1 243 ? 23.498  -6.547  -35.740 1.00 99.18 ? 243 LYS D NZ  1 
ATOM 9724  N N   . TYR D 1 244 ? 23.574  -5.590  -27.391 1.00 36.26 ? 244 TYR D N   1 
ATOM 9725  C CA  . TYR D 1 244 ? 24.165  -4.892  -26.253 1.00 36.26 ? 244 TYR D CA  1 
ATOM 9726  C C   . TYR D 1 244 ? 25.473  -5.495  -25.755 1.00 36.26 ? 244 TYR D C   1 
ATOM 9727  O O   . TYR D 1 244 ? 25.669  -6.712  -25.801 1.00 36.26 ? 244 TYR D O   1 
ATOM 9728  C CB  . TYR D 1 244 ? 23.187  -4.853  -25.077 1.00 32.09 ? 244 TYR D CB  1 
ATOM 9729  C CG  . TYR D 1 244 ? 21.939  -4.041  -25.309 1.00 32.09 ? 244 TYR D CG  1 
ATOM 9730  C CD1 . TYR D 1 244 ? 20.874  -4.551  -26.048 1.00 32.09 ? 244 TYR D CD1 1 
ATOM 9731  C CD2 . TYR D 1 244 ? 21.812  -2.768  -24.766 1.00 32.09 ? 244 TYR D CD2 1 
ATOM 9732  C CE1 . TYR D 1 244 ? 19.707  -3.810  -26.236 1.00 32.09 ? 244 TYR D CE1 1 
ATOM 9733  C CE2 . TYR D 1 244 ? 20.657  -2.022  -24.950 1.00 32.09 ? 244 TYR D CE2 1 
ATOM 9734  C CZ  . TYR D 1 244 ? 19.605  -2.546  -25.684 1.00 32.09 ? 244 TYR D CZ  1 
ATOM 9735  O OH  . TYR D 1 244 ? 18.459  -1.798  -25.852 1.00 32.09 ? 244 TYR D OH  1 
ATOM 9736  N N   . THR D 1 245 ? 26.352  -4.629  -25.259 1.00 36.12 ? 245 THR D N   1 
ATOM 9737  C CA  . THR D 1 245 ? 27.647  -5.037  -24.724 1.00 36.12 ? 245 THR D CA  1 
ATOM 9738  C C   . THR D 1 245 ? 27.424  -5.667  -23.371 1.00 36.12 ? 245 THR D C   1 
ATOM 9739  O O   . THR D 1 245 ? 26.538  -5.246  -22.626 1.00 36.12 ? 245 THR D O   1 
ATOM 9740  C CB  . THR D 1 245 ? 28.547  -3.837  -24.425 1.00 48.29 ? 245 THR D CB  1 
ATOM 9741  O OG1 . THR D 1 245 ? 28.250  -2.770  -25.328 1.00 48.29 ? 245 THR D OG1 1 
ATOM 9742  C CG2 . THR D 1 245 ? 29.998  -4.223  -24.548 1.00 48.29 ? 245 THR D CG2 1 
ATOM 9743  N N   . PRO D 1 246 ? 28.214  -6.691  -23.025 1.00 36.10 ? 246 PRO D N   1 
ATOM 9744  C CA  . PRO D 1 246 ? 28.003  -7.273  -21.700 1.00 36.10 ? 246 PRO D CA  1 
ATOM 9745  C C   . PRO D 1 246 ? 28.331  -6.156  -20.709 1.00 36.10 ? 246 PRO D C   1 
ATOM 9746  O O   . PRO D 1 246 ? 27.975  -6.210  -19.537 1.00 36.10 ? 246 PRO D O   1 
ATOM 9747  C CB  . PRO D 1 246 ? 29.001  -8.430  -21.661 1.00 29.30 ? 246 PRO D CB  1 
ATOM 9748  C CG  . PRO D 1 246 ? 30.020  -8.055  -22.686 1.00 29.30 ? 246 PRO D CG  1 
ATOM 9749  C CD  . PRO D 1 246 ? 29.196  -7.467  -23.789 1.00 29.30 ? 246 PRO D CD  1 
ATOM 9750  N N   . GLU D 1 247 ? 29.012  -5.132  -21.211 1.00 28.34 ? 247 GLU D N   1 
ATOM 9751  C CA  . GLU D 1 247 ? 29.352  -3.971  -20.403 1.00 28.34 ? 247 GLU D CA  1 
ATOM 9752  C C   . GLU D 1 247 ? 28.039  -3.262  -20.111 1.00 28.34 ? 247 GLU D C   1 
ATOM 9753  O O   . GLU D 1 247 ? 27.723  -2.965  -18.957 1.00 28.34 ? 247 GLU D O   1 
ATOM 9754  C CB  . GLU D 1 247 ? 30.269  -3.025  -21.177 1.00 62.17 ? 247 GLU D CB  1 
ATOM 9755  C CG  . GLU D 1 247 ? 31.749  -3.324  -21.045 1.00 62.17 ? 247 GLU D CG  1 
ATOM 9756  C CD  . GLU D 1 247 ? 32.115  -4.744  -21.450 1.00 62.17 ? 247 GLU D CD  1 
ATOM 9757  O OE1 . GLU D 1 247 ? 31.824  -5.143  -22.603 1.00 62.17 ? 247 GLU D OE1 1 
ATOM 9758  O OE2 . GLU D 1 247 ? 32.707  -5.462  -20.608 1.00 62.17 ? 247 GLU D OE2 1 
ATOM 9759  N N   . GLU D 1 248 ? 27.281  -3.005  -21.176 1.00 31.37 ? 248 GLU D N   1 
ATOM 9760  C CA  . GLU D 1 248 ? 25.993  -2.327  -21.086 1.00 31.37 ? 248 GLU D CA  1 
ATOM 9761  C C   . GLU D 1 248 ? 25.022  -3.080  -20.181 1.00 31.37 ? 248 GLU D C   1 
ATOM 9762  O O   . GLU D 1 248 ? 24.273  -2.480  -19.408 1.00 31.37 ? 248 GLU D O   1 
ATOM 9763  C CB  . GLU D 1 248 ? 25.393  -2.178  -22.482 1.00 46.06 ? 248 GLU D CB  1 
ATOM 9764  C CG  . GLU D 1 248 ? 26.281  -1.418  -23.436 1.00 46.06 ? 248 GLU D CG  1 
ATOM 9765  C CD  . GLU D 1 248 ? 25.641  -1.212  -24.793 1.00 46.06 ? 248 GLU D CD  1 
ATOM 9766  O OE1 . GLU D 1 248 ? 25.349  -2.219  -25.477 1.00 46.06 ? 248 GLU D OE1 1 
ATOM 9767  O OE2 . GLU D 1 248 ? 25.433  -0.038  -25.175 1.00 46.06 ? 248 GLU D OE2 1 
ATOM 9768  N N   . ILE D 1 249 ? 25.034  -4.401  -20.286 1.00 26.07 ? 249 ILE D N   1 
ATOM 9769  C CA  . ILE D 1 249 ? 24.166  -5.219  -19.469 1.00 26.07 ? 249 ILE D CA  1 
ATOM 9770  C C   . ILE D 1 249 ? 24.578  -5.100  -18.015 1.00 26.07 ? 249 ILE D C   1 
ATOM 9771  O O   . ILE D 1 249 ? 23.735  -4.932  -17.135 1.00 26.07 ? 249 ILE D O   1 
ATOM 9772  C CB  . ILE D 1 249 ? 24.245  -6.675  -19.895 1.00 25.73 ? 249 ILE D CB  1 
ATOM 9773  C CG1 . ILE D 1 249 ? 23.523  -6.836  -21.228 1.00 25.73 ? 249 ILE D CG1 1 
ATOM 9774  C CG2 . ILE D 1 249 ? 23.656  -7.567  -18.827 1.00 25.73 ? 249 ILE D CG2 1 
ATOM 9775  C CD1 . ILE D 1 249 ? 23.565  -8.234  -21.764 1.00 25.73 ? 249 ILE D CD1 1 
ATOM 9776  N N   . ALA D 1 250 ? 25.879  -5.179  -17.764 1.00 20.79 ? 250 ALA D N   1 
ATOM 9777  C CA  . ALA D 1 250 ? 26.389  -5.078  -16.404 1.00 20.79 ? 250 ALA D CA  1 
ATOM 9778  C C   . ALA D 1 250 ? 26.034  -3.716  -15.819 1.00 20.79 ? 250 ALA D C   1 
ATOM 9779  O O   . ALA D 1 250 ? 25.666  -3.602  -14.649 1.00 20.79 ? 250 ALA D O   1 
ATOM 9780  C CB  . ALA D 1 250 ? 27.900  -5.274  -16.401 1.00 18.99 ? 250 ALA D CB  1 
ATOM 9781  N N   . MET D 1 251 ? 26.139  -2.685  -16.649 1.00 23.11 ? 251 MET D N   1 
ATOM 9782  C CA  . MET D 1 251 ? 25.843  -1.328  -16.218 1.00 23.11 ? 251 MET D CA  1 
ATOM 9783  C C   . MET D 1 251 ? 24.398  -1.202  -15.737 1.00 23.11 ? 251 MET D C   1 
ATOM 9784  O O   . MET D 1 251 ? 24.143  -0.672  -14.656 1.00 23.11 ? 251 MET D O   1 
ATOM 9785  C CB  . MET D 1 251 ? 26.111  -0.350  -17.367 1.00 54.11 ? 251 MET D CB  1 
ATOM 9786  C CG  . MET D 1 251 ? 26.131  1.114   -16.958 1.00 54.11 ? 251 MET D CG  1 
ATOM 9787  S SD  . MET D 1 251 ? 27.241  1.434   -15.566 1.00 54.11 ? 251 MET D SD  1 
ATOM 9788  C CE  . MET D 1 251 ? 28.878  1.219   -16.339 1.00 54.11 ? 251 MET D CE  1 
ATOM 9789  N N   . ALA D 1 252 ? 23.456  -1.704  -16.532 1.00 29.46 ? 252 ALA D N   1 
ATOM 9790  C CA  . ALA D 1 252 ? 22.041  -1.629  -16.175 1.00 29.46 ? 252 ALA D CA  1 
ATOM 9791  C C   . ALA D 1 252 ? 21.712  -2.498  -14.973 1.00 29.46 ? 252 ALA D C   1 
ATOM 9792  O O   . ALA D 1 252 ? 20.993  -2.080  -14.063 1.00 29.46 ? 252 ALA D O   1 
ATOM 9793  C CB  . ALA D 1 252 ? 21.198  -2.046  -17.347 1.00 3.76  ? 252 ALA D CB  1 
ATOM 9794  N N   . THR D 1 253 ? 22.240  -3.715  -14.979 1.00 20.23 ? 253 THR D N   1 
ATOM 9795  C CA  . THR D 1 253 ? 22.013  -4.648  -13.893 1.00 20.23 ? 253 THR D CA  1 
ATOM 9796  C C   . THR D 1 253 ? 22.490  -4.105  -12.558 1.00 20.23 ? 253 THR D C   1 
ATOM 9797  O O   . THR D 1 253 ? 21.765  -4.145  -11.569 1.00 20.23 ? 253 THR D O   1 
ATOM 9798  C CB  . THR D 1 253 ? 22.721  -5.975  -14.161 1.00 17.02 ? 253 THR D CB  1 
ATOM 9799  O OG1 . THR D 1 253 ? 22.107  -6.612  -15.289 1.00 17.02 ? 253 THR D OG1 1 
ATOM 9800  C CG2 . THR D 1 253 ? 22.636  -6.881  -12.948 1.00 17.02 ? 253 THR D CG2 1 
ATOM 9801  N N   . VAL D 1 254 ? 23.711  -3.595  -12.517 1.00 25.50 ? 254 VAL D N   1 
ATOM 9802  C CA  . VAL D 1 254 ? 24.221  -3.066  -11.266 1.00 25.50 ? 254 VAL D CA  1 
ATOM 9803  C C   . VAL D 1 254 ? 23.470  -1.800  -10.854 1.00 25.50 ? 254 VAL D C   1 
ATOM 9804  O O   . VAL D 1 254 ? 23.187  -1.593  -9.675  1.00 25.50 ? 254 VAL D O   1 
ATOM 9805  C CB  . VAL D 1 254 ? 25.730  -2.793  -11.367 1.00 9.84  ? 254 VAL D CB  1 
ATOM 9806  C CG1 . VAL D 1 254 ? 26.243  -2.120  -10.090 1.00 9.84  ? 254 VAL D CG1 1 
ATOM 9807  C CG2 . VAL D 1 254 ? 26.462  -4.104  -11.596 1.00 9.84  ? 254 VAL D CG2 1 
ATOM 9808  N N   . THR D 1 255 ? 23.130  -0.954  -11.816 1.00 23.01 ? 255 THR D N   1 
ATOM 9809  C CA  . THR D 1 255 ? 22.405  0.254   -11.471 1.00 23.01 ? 255 THR D CA  1 
ATOM 9810  C C   . THR D 1 255 ? 21.084  -0.118  -10.822 1.00 23.01 ? 255 THR D C   1 
ATOM 9811  O O   . THR D 1 255 ? 20.731  0.394   -9.761  1.00 23.01 ? 255 THR D O   1 
ATOM 9812  C CB  . THR D 1 255 ? 22.093  1.095   -12.691 1.00 20.86 ? 255 THR D CB  1 
ATOM 9813  O OG1 . THR D 1 255 ? 23.312  1.507   -13.310 1.00 20.86 ? 255 THR D OG1 1 
ATOM 9814  C CG2 . THR D 1 255 ? 21.309  2.317   -12.283 1.00 20.86 ? 255 THR D CG2 1 
ATOM 9815  N N   . ALA D 1 256 ? 20.354  -1.018  -11.468 1.00 22.73 ? 256 ALA D N   1 
ATOM 9816  C CA  . ALA D 1 256 ? 19.069  -1.451  -10.949 1.00 22.73 ? 256 ALA D CA  1 
ATOM 9817  C C   . ALA D 1 256 ? 19.212  -1.955  -9.517  1.00 22.73 ? 256 ALA D C   1 
ATOM 9818  O O   . ALA D 1 256 ? 18.518  -1.497  -8.607  1.00 22.73 ? 256 ALA D O   1 
ATOM 9819  C CB  . ALA D 1 256 ? 18.510  -2.541  -11.833 1.00 4.99  ? 256 ALA D CB  1 
ATOM 9820  N N   . LEU D 1 257 ? 20.128  -2.894  -9.321  1.00 23.64 ? 257 LEU D N   1 
ATOM 9821  C CA  . LEU D 1 257 ? 20.351  -3.465  -8.004  1.00 23.64 ? 257 LEU D CA  1 
ATOM 9822  C C   . LEU D 1 257 ? 20.722  -2.437  -6.951  1.00 23.64 ? 257 LEU D C   1 
ATOM 9823  O O   . LEU D 1 257 ? 20.233  -2.507  -5.824  1.00 23.64 ? 257 LEU D O   1 
ATOM 9824  C CB  . LEU D 1 257 ? 21.444  -4.537  -8.059  1.00 10.29 ? 257 LEU D CB  1 
ATOM 9825  C CG  . LEU D 1 257 ? 21.067  -5.885  -8.669  1.00 10.29 ? 257 LEU D CG  1 
ATOM 9826  C CD1 . LEU D 1 257 ? 22.255  -6.815  -8.627  1.00 10.29 ? 257 LEU D CD1 1 
ATOM 9827  C CD2 . LEU D 1 257 ? 19.921  -6.491  -7.888  1.00 10.29 ? 257 LEU D CD2 1 
ATOM 9828  N N   . ARG D 1 258 ? 21.566  -1.475  -7.297  1.00 24.63 ? 258 ARG D N   1 
ATOM 9829  C CA  . ARG D 1 258 ? 21.962  -0.509  -6.289  1.00 24.63 ? 258 ARG D CA  1 
ATOM 9830  C C   . ARG D 1 258 ? 20.962  0.606   -6.047  1.00 24.63 ? 258 ARG D C   1 
ATOM 9831  O O   . ARG D 1 258 ? 21.219  1.526   -5.268  1.00 24.63 ? 258 ARG D O   1 
ATOM 9832  C CB  . ARG D 1 258 ? 23.360  0.049   -6.586  1.00 30.79 ? 258 ARG D CB  1 
ATOM 9833  C CG  . ARG D 1 258 ? 23.520  0.848   -7.848  1.00 30.79 ? 258 ARG D CG  1 
ATOM 9834  C CD  . ARG D 1 258 ? 25.007  0.931   -8.199  1.00 30.79 ? 258 ARG D CD  1 
ATOM 9835  N NE  . ARG D 1 258 ? 25.841  1.292   -7.050  1.00 30.79 ? 258 ARG D NE  1 
ATOM 9836  C CZ  . ARG D 1 258 ? 25.991  2.528   -6.575  1.00 30.79 ? 258 ARG D CZ  1 
ATOM 9837  N NH1 . ARG D 1 258 ? 25.363  3.551   -7.150  1.00 30.79 ? 258 ARG D NH1 1 
ATOM 9838  N NH2 . ARG D 1 258 ? 26.769  2.737   -5.515  1.00 30.79 ? 258 ARG D NH2 1 
ATOM 9839  N N   . ARG D 1 259 ? 19.809  0.509   -6.697  1.00 25.44 ? 259 ARG D N   1 
ATOM 9840  C CA  . ARG D 1 259 ? 18.748  1.491   -6.509  1.00 25.44 ? 259 ARG D CA  1 
ATOM 9841  C C   . ARG D 1 259 ? 17.645  0.856   -5.688  1.00 25.44 ? 259 ARG D C   1 
ATOM 9842  O O   . ARG D 1 259 ? 16.695  1.525   -5.285  1.00 25.44 ? 259 ARG D O   1 
ATOM 9843  C CB  . ARG D 1 259 ? 18.152  1.903   -7.840  1.00 16.50 ? 259 ARG D CB  1 
ATOM 9844  C CG  . ARG D 1 259 ? 18.981  2.875   -8.593  1.00 16.50 ? 259 ARG D CG  1 
ATOM 9845  C CD  . ARG D 1 259 ? 18.416  3.074   -9.961  1.00 16.50 ? 259 ARG D CD  1 
ATOM 9846  N NE  . ARG D 1 259 ? 19.113  4.134   -10.673 1.00 16.50 ? 259 ARG D NE  1 
ATOM 9847  C CZ  . ARG D 1 259 ? 18.893  4.427   -11.951 1.00 16.50 ? 259 ARG D CZ  1 
ATOM 9848  N NH1 . ARG D 1 259 ? 17.992  3.733   -12.644 1.00 16.50 ? 259 ARG D NH1 1 
ATOM 9849  N NH2 . ARG D 1 259 ? 19.575  5.407   -12.540 1.00 16.50 ? 259 ARG D NH2 1 
ATOM 9850  N N   . THR D 1 260 ? 17.786  -0.440  -5.427  1.00 15.63 ? 260 THR D N   1 
ATOM 9851  C CA  . THR D 1 260 ? 16.756  -1.170  -4.718  1.00 15.63 ? 260 THR D CA  1 
ATOM 9852  C C   . THR D 1 260 ? 17.187  -2.119  -3.611  1.00 15.63 ? 260 THR D C   1 
ATOM 9853  O O   . THR D 1 260 ? 16.495  -2.230  -2.602  1.00 15.63 ? 260 THR D O   1 
ATOM 9854  C CB  . THR D 1 260 ? 15.927  -1.965  -5.726  1.00 12.51 ? 260 THR D CB  1 
ATOM 9855  O OG1 . THR D 1 260 ? 16.771  -2.916  -6.389  1.00 12.51 ? 260 THR D OG1 1 
ATOM 9856  C CG2 . THR D 1 260 ? 15.346  -1.039  -6.771  1.00 12.51 ? 260 THR D CG2 1 
ATOM 9857  N N   . VAL D 1 261 ? 18.305  -2.814  -3.779  1.00 16.75 ? 261 VAL D N   1 
ATOM 9858  C CA  . VAL D 1 261 ? 18.732  -3.759  -2.746  1.00 16.75 ? 261 VAL D CA  1 
ATOM 9859  C C   . VAL D 1 261 ? 19.468  -3.113  -1.568  1.00 16.75 ? 261 VAL D C   1 
ATOM 9860  O O   . VAL D 1 261 ? 20.448  -2.414  -1.747  1.00 16.75 ? 261 VAL D O   1 
ATOM 9861  C CB  . VAL D 1 261 ? 19.630  -4.866  -3.332  1.00 10.92 ? 261 VAL D CB  1 
ATOM 9862  C CG1 . VAL D 1 261 ? 19.868  -5.944  -2.282  1.00 10.92 ? 261 VAL D CG1 1 
ATOM 9863  C CG2 . VAL D 1 261 ? 18.983  -5.461  -4.578  1.00 10.92 ? 261 VAL D CG2 1 
ATOM 9864  N N   . PRO D 1 262 ? 18.977  -3.312  -0.341  1.00 23.81 ? 262 PRO D N   1 
ATOM 9865  C CA  . PRO D 1 262 ? 19.713  -2.681  0.761   1.00 23.81 ? 262 PRO D CA  1 
ATOM 9866  C C   . PRO D 1 262 ? 21.082  -3.327  0.968   1.00 23.81 ? 262 PRO D C   1 
ATOM 9867  O O   . PRO D 1 262 ? 21.256  -4.520  0.730   1.00 23.81 ? 262 PRO D O   1 
ATOM 9868  C CB  . PRO D 1 262 ? 18.784  -2.886  1.956   1.00 24.02 ? 262 PRO D CB  1 
ATOM 9869  C CG  . PRO D 1 262 ? 17.425  -2.843  1.315   1.00 24.02 ? 262 PRO D CG  1 
ATOM 9870  C CD  . PRO D 1 262 ? 17.615  -3.689  0.079   1.00 24.02 ? 262 PRO D CD  1 
ATOM 9871  N N   . PRO D 1 263 ? 22.074  -2.538  1.408   1.00 20.27 ? 263 PRO D N   1 
ATOM 9872  C CA  . PRO D 1 263 ? 23.445  -2.980  1.661   1.00 20.27 ? 263 PRO D CA  1 
ATOM 9873  C C   . PRO D 1 263 ? 23.496  -4.199  2.541   1.00 20.27 ? 263 PRO D C   1 
ATOM 9874  O O   . PRO D 1 263 ? 24.432  -4.985  2.453   1.00 20.27 ? 263 PRO D O   1 
ATOM 9875  C CB  . PRO D 1 263 ? 24.065  -1.784  2.356   1.00 21.55 ? 263 PRO D CB  1 
ATOM 9876  C CG  . PRO D 1 263 ? 23.404  -0.668  1.692   1.00 21.55 ? 263 PRO D CG  1 
ATOM 9877  C CD  . PRO D 1 263 ? 21.957  -1.096  1.667   1.00 21.55 ? 263 PRO D CD  1 
ATOM 9878  N N   . ALA D 1 264 ? 22.489  -4.352  3.391   1.00 14.42 ? 264 ALA D N   1 
ATOM 9879  C CA  . ALA D 1 264 ? 22.434  -5.483  4.316   1.00 14.42 ? 264 ALA D CA  1 
ATOM 9880  C C   . ALA D 1 264 ? 22.330  -6.854  3.647   1.00 14.42 ? 264 ALA D C   1 
ATOM 9881  O O   . ALA D 1 264 ? 22.680  -7.868  4.249   1.00 14.42 ? 264 ALA D O   1 
ATOM 9882  C CB  . ALA D 1 264 ? 21.277  -5.298  5.313   1.00 0.51  ? 264 ALA D CB  1 
ATOM 9883  N N   . VAL D 1 265 ? 21.841  -6.904  2.418   1.00 28.58 ? 265 VAL D N   1 
ATOM 9884  C CA  . VAL D 1 265 ? 21.743  -8.186  1.746   1.00 28.58 ? 265 VAL D CA  1 
ATOM 9885  C C   . VAL D 1 265 ? 23.167  -8.633  1.422   1.00 28.58 ? 265 VAL D C   1 
ATOM 9886  O O   . VAL D 1 265 ? 23.902  -7.938  0.710   1.00 28.58 ? 265 VAL D O   1 
ATOM 9887  C CB  . VAL D 1 265 ? 20.919  -8.068  0.461   1.00 18.47 ? 265 VAL D CB  1 
ATOM 9888  C CG1 . VAL D 1 265 ? 20.879  -9.404  -0.247  1.00 18.47 ? 265 VAL D CG1 1 
ATOM 9889  C CG2 . VAL D 1 265 ? 19.518  -7.591  0.794   1.00 18.47 ? 265 VAL D CG2 1 
ATOM 9890  N N   . PRO D 1 266 ? 23.579  -9.795  1.955   1.00 21.11 ? 266 PRO D N   1 
ATOM 9891  C CA  . PRO D 1 266 ? 24.919  -10.338 1.735   1.00 21.11 ? 266 PRO D CA  1 
ATOM 9892  C C   . PRO D 1 266 ? 25.304  -10.594 0.290   1.00 21.11 ? 266 PRO D C   1 
ATOM 9893  O O   . PRO D 1 266 ? 26.430  -10.303 -0.107  1.00 21.11 ? 266 PRO D O   1 
ATOM 9894  C CB  . PRO D 1 266 ? 24.922  -11.612 2.576   1.00 24.86 ? 266 PRO D CB  1 
ATOM 9895  C CG  . PRO D 1 266 ? 23.500  -12.016 2.593   1.00 24.86 ? 266 PRO D CG  1 
ATOM 9896  C CD  . PRO D 1 266 ? 22.793  -10.701 2.808   1.00 24.86 ? 266 PRO D CD  1 
ATOM 9897  N N   . GLY D 1 267 ? 24.392  -11.127 -0.508  1.00 24.06 ? 267 GLY D N   1 
ATOM 9898  C CA  . GLY D 1 267 ? 24.760  -11.381 -1.884  1.00 24.06 ? 267 GLY D CA  1 
ATOM 9899  C C   . GLY D 1 267 ? 23.606  -11.567 -2.838  1.00 24.06 ? 267 GLY D C   1 
ATOM 9900  O O   . GLY D 1 267 ? 22.510  -11.956 -2.444  1.00 24.06 ? 267 GLY D O   1 
ATOM 9901  N N   . VAL D 1 268 ? 23.868  -11.277 -4.104  1.00 17.10 ? 268 VAL D N   1 
ATOM 9902  C CA  . VAL D 1 268 ? 22.884  -11.414 -5.160  1.00 17.10 ? 268 VAL D CA  1 
ATOM 9903  C C   . VAL D 1 268 ? 23.392  -12.547 -6.035  1.00 17.10 ? 268 VAL D C   1 
ATOM 9904  O O   . VAL D 1 268 ? 24.469  -12.441 -6.619  1.00 17.10 ? 268 VAL D O   1 
ATOM 9905  C CB  . VAL D 1 268 ? 22.818  -10.145 -6.012  1.00 20.48 ? 268 VAL D CB  1 
ATOM 9906  C CG1 . VAL D 1 268 ? 21.755  -10.290 -7.078  1.00 20.48 ? 268 VAL D CG1 1 
ATOM 9907  C CG2 . VAL D 1 268 ? 22.551  -8.942  -5.133  1.00 20.48 ? 268 VAL D CG2 1 
ATOM 9908  N N   . THR D 1 269 ? 22.637  -13.636 -6.124  1.00 17.02 ? 269 THR D N   1 
ATOM 9909  C CA  . THR D 1 269 ? 23.065  -14.767 -6.939  1.00 17.02 ? 269 THR D CA  1 
ATOM 9910  C C   . THR D 1 269 ? 22.238  -14.814 -8.227  1.00 17.02 ? 269 THR D C   1 
ATOM 9911  O O   . THR D 1 269 ? 21.170  -15.426 -8.268  1.00 17.02 ? 269 THR D O   1 
ATOM 9912  C CB  . THR D 1 269 ? 22.891  -16.087 -6.167  1.00 20.90 ? 269 THR D CB  1 
ATOM 9913  O OG1 . THR D 1 269 ? 21.504  -16.428 -6.119  1.00 20.90 ? 269 THR D OG1 1 
ATOM 9914  C CG2 . THR D 1 269 ? 23.397  -15.940 -4.737  1.00 20.90 ? 269 THR D CG2 1 
ATOM 9915  N N   . PHE D 1 270 ? 22.738  -14.171 -9.279  1.00 25.38 ? 270 PHE D N   1 
ATOM 9916  C CA  . PHE D 1 270 ? 22.024  -14.122 -10.549 1.00 25.38 ? 270 PHE D CA  1 
ATOM 9917  C C   . PHE D 1 270 ? 21.602  -15.471 -11.106 1.00 25.38 ? 270 PHE D C   1 
ATOM 9918  O O   . PHE D 1 270 ? 22.230  -16.500 -10.853 1.00 25.38 ? 270 PHE D O   1 
ATOM 9919  C CB  . PHE D 1 270 ? 22.855  -13.407 -11.610 1.00 23.21 ? 270 PHE D CB  1 
ATOM 9920  C CG  . PHE D 1 270 ? 23.141  -11.981 -11.289 1.00 23.21 ? 270 PHE D CG  1 
ATOM 9921  C CD1 . PHE D 1 270 ? 24.371  -11.606 -10.766 1.00 23.21 ? 270 PHE D CD1 1 
ATOM 9922  C CD2 . PHE D 1 270 ? 22.171  -11.011 -11.475 1.00 23.21 ? 270 PHE D CD2 1 
ATOM 9923  C CE1 . PHE D 1 270 ? 24.630  -10.274 -10.428 1.00 23.21 ? 270 PHE D CE1 1 
ATOM 9924  C CE2 . PHE D 1 270 ? 22.418  -9.686  -11.140 1.00 23.21 ? 270 PHE D CE2 1 
ATOM 9925  C CZ  . PHE D 1 270 ? 23.651  -9.315  -10.614 1.00 23.21 ? 270 PHE D CZ  1 
ATOM 9926  N N   . LEU D 1 271 ? 20.522  -15.449 -11.874 1.00 23.04 ? 271 LEU D N   1 
ATOM 9927  C CA  . LEU D 1 271 ? 20.005  -16.649 -12.508 1.00 23.04 ? 271 LEU D CA  1 
ATOM 9928  C C   . LEU D 1 271 ? 20.408  -16.580 -13.987 1.00 23.04 ? 271 LEU D C   1 
ATOM 9929  O O   . LEU D 1 271 ? 20.279  -15.525 -14.636 1.00 23.04 ? 271 LEU D O   1 
ATOM 9930  C CB  . LEU D 1 271 ? 18.481  -16.718 -12.335 1.00 25.05 ? 271 LEU D CB  1 
ATOM 9931  C CG  . LEU D 1 271 ? 17.605  -15.533 -12.769 1.00 25.05 ? 271 LEU D CG  1 
ATOM 9932  C CD1 . LEU D 1 271 ? 17.212  -15.652 -14.235 1.00 25.05 ? 271 LEU D CD1 1 
ATOM 9933  C CD2 . LEU D 1 271 ? 16.355  -15.513 -11.904 1.00 25.05 ? 271 LEU D CD2 1 
ATOM 9934  N N   . SER D 1 272 ? 20.922  -17.695 -14.506 1.00 49.45 ? 272 SER D N   1 
ATOM 9935  C CA  . SER D 1 272 ? 21.380  -17.757 -15.892 1.00 49.45 ? 272 SER D CA  1 
ATOM 9936  C C   . SER D 1 272 ? 20.276  -17.483 -16.894 1.00 49.45 ? 272 SER D C   1 
ATOM 9937  O O   . SER D 1 272 ? 20.540  -17.003 -17.996 1.00 49.45 ? 272 SER D O   1 
ATOM 9938  C CB  . SER D 1 272 ? 22.023  -19.118 -16.189 1.00 50.91 ? 272 SER D CB  1 
ATOM 9939  O OG  . SER D 1 272 ? 21.133  -20.194 -15.948 1.00 50.91 ? 272 SER D OG  1 
ATOM 9940  N N   . GLY D 1 273 ? 19.040  -17.785 -16.509 1.00 39.25 ? 273 GLY D N   1 
ATOM 9941  C CA  . GLY D 1 273 ? 17.917  -17.563 -17.401 1.00 39.25 ? 273 GLY D CA  1 
ATOM 9942  C C   . GLY D 1 273 ? 18.058  -18.313 -18.713 1.00 39.25 ? 273 GLY D C   1 
ATOM 9943  O O   . GLY D 1 273 ? 18.296  -19.525 -18.723 1.00 39.25 ? 273 GLY D O   1 
ATOM 9944  N N   . GLY D 1 274 ? 17.911  -17.594 -19.822 1.00 40.93 ? 274 GLY D N   1 
ATOM 9945  C CA  . GLY D 1 274 ? 18.033  -18.234 -21.121 1.00 40.93 ? 274 GLY D CA  1 
ATOM 9946  C C   . GLY D 1 274 ? 19.407  -18.065 -21.747 1.00 40.93 ? 274 GLY D C   1 
ATOM 9947  O O   . GLY D 1 274 ? 19.627  -18.454 -22.895 1.00 40.93 ? 274 GLY D O   1 
ATOM 9948  N N   . GLN D 1 275 ? 20.335  -17.489 -20.991 1.00 36.04 ? 275 GLN D N   1 
ATOM 9949  C CA  . GLN D 1 275 ? 21.686  -17.253 -21.475 1.00 36.04 ? 275 GLN D CA  1 
ATOM 9950  C C   . GLN D 1 275 ? 22.430  -18.555 -21.710 1.00 36.04 ? 275 GLN D C   1 
ATOM 9951  O O   . GLN D 1 275 ? 22.109  -19.577 -21.101 1.00 36.04 ? 275 GLN D O   1 
ATOM 9952  C CB  . GLN D 1 275 ? 22.459  -16.415 -20.466 1.00 32.21 ? 275 GLN D CB  1 
ATOM 9953  C CG  . GLN D 1 275 ? 21.769  -15.138 -20.079 1.00 32.21 ? 275 GLN D CG  1 
ATOM 9954  C CD  . GLN D 1 275 ? 22.636  -14.273 -19.187 1.00 32.21 ? 275 GLN D CD  1 
ATOM 9955  O OE1 . GLN D 1 275 ? 23.693  -13.793 -19.603 1.00 32.21 ? 275 GLN D OE1 1 
ATOM 9956  N NE2 . GLN D 1 275 ? 22.196  -14.071 -17.947 1.00 32.21 ? 275 GLN D NE2 1 
ATOM 9957  N N   . SER D 1 276 ? 23.425  -18.501 -22.595 1.00 35.88 ? 276 SER D N   1 
ATOM 9958  C CA  . SER D 1 276 ? 24.258  -19.654 -22.927 1.00 35.88 ? 276 SER D CA  1 
ATOM 9959  C C   . SER D 1 276 ? 25.327  -19.770 -21.852 1.00 35.88 ? 276 SER D C   1 
ATOM 9960  O O   . SER D 1 276 ? 25.557  -18.817 -21.104 1.00 35.88 ? 276 SER D O   1 
ATOM 9961  C CB  . SER D 1 276 ? 24.927  -19.438 -24.275 1.00 40.95 ? 276 SER D CB  1 
ATOM 9962  O OG  . SER D 1 276 ? 25.739  -18.282 -24.232 1.00 40.95 ? 276 SER D OG  1 
ATOM 9963  N N   . GLU D 1 277 ? 25.991  -20.919 -21.773 1.00 28.52 ? 277 GLU D N   1 
ATOM 9964  C CA  . GLU D 1 277 ? 27.019  -21.090 -20.749 1.00 28.52 ? 277 GLU D CA  1 
ATOM 9965  C C   . GLU D 1 277 ? 28.009  -19.935 -20.757 1.00 28.52 ? 277 GLU D C   1 
ATOM 9966  O O   . GLU D 1 277 ? 28.411  -19.451 -19.694 1.00 28.52 ? 277 GLU D O   1 
ATOM 9967  C CB  . GLU D 1 277 ? 27.757  -22.422 -20.927 1.00 39.05 ? 277 GLU D CB  1 
ATOM 9968  C CG  . GLU D 1 277 ? 26.911  -23.629 -20.558 1.00 39.05 ? 277 GLU D CG  1 
ATOM 9969  C CD  . GLU D 1 277 ? 27.649  -24.952 -20.683 1.00 39.05 ? 277 GLU D CD  1 
ATOM 9970  O OE1 . GLU D 1 277 ? 28.213  -25.216 -21.769 1.00 39.05 ? 277 GLU D OE1 1 
ATOM 9971  O OE2 . GLU D 1 277 ? 27.651  -25.733 -19.696 1.00 39.05 ? 277 GLU D OE2 1 
ATOM 9972  N N   . GLU D 1 278 ? 28.387  -19.485 -21.952 1.00 38.22 ? 278 GLU D N   1 
ATOM 9973  C CA  . GLU D 1 278 ? 29.334  -18.387 -22.067 1.00 38.22 ? 278 GLU D CA  1 
ATOM 9974  C C   . GLU D 1 278 ? 28.705  -17.047 -21.753 1.00 38.22 ? 278 GLU D C   1 
ATOM 9975  O O   . GLU D 1 278 ? 29.243  -16.262 -20.971 1.00 38.22 ? 278 GLU D O   1 
ATOM 9976  C CB  . GLU D 1 278 ? 29.953  -18.360 -23.463 1.00 89.82 ? 278 GLU D CB  1 
ATOM 9977  C CG  . GLU D 1 278 ? 31.116  -19.321 -23.593 1.00 89.82 ? 278 GLU D CG  1 
ATOM 9978  C CD  . GLU D 1 278 ? 32.145  -19.137 -22.478 1.00 89.82 ? 278 GLU D CD  1 
ATOM 9979  O OE1 . GLU D 1 278 ? 32.829  -18.094 -22.456 1.00 89.82 ? 278 GLU D OE1 1 
ATOM 9980  O OE2 . GLU D 1 278 ? 32.265  -20.032 -21.612 1.00 89.82 ? 278 GLU D OE2 1 
ATOM 9981  N N   . GLU D 1 279 ? 27.557  -16.796 -22.366 1.00 31.46 ? 279 GLU D N   1 
ATOM 9982  C CA  . GLU D 1 279 ? 26.820  -15.557 -22.169 1.00 31.46 ? 279 GLU D CA  1 
ATOM 9983  C C   . GLU D 1 279 ? 26.688  -15.237 -20.674 1.00 31.46 ? 279 GLU D C   1 
ATOM 9984  O O   . GLU D 1 279 ? 26.891  -14.097 -20.242 1.00 31.46 ? 279 GLU D O   1 
ATOM 9985  C CB  . GLU D 1 279 ? 25.447  -15.706 -22.808 1.00 60.46 ? 279 GLU D CB  1 
ATOM 9986  C CG  . GLU D 1 279 ? 24.680  -14.432 -22.941 1.00 60.46 ? 279 GLU D CG  1 
ATOM 9987  C CD  . GLU D 1 279 ? 23.416  -14.626 -23.750 1.00 60.46 ? 279 GLU D CD  1 
ATOM 9988  O OE1 . GLU D 1 279 ? 22.647  -13.644 -23.877 1.00 60.46 ? 279 GLU D OE1 1 
ATOM 9989  O OE2 . GLU D 1 279 ? 23.196  -15.754 -24.258 1.00 60.46 ? 279 GLU D OE2 1 
ATOM 9990  N N   . ALA D 1 280 ? 26.359  -16.256 -19.886 1.00 28.49 ? 280 ALA D N   1 
ATOM 9991  C CA  . ALA D 1 280 ? 26.202  -16.088 -18.451 1.00 28.49 ? 280 ALA D CA  1 
ATOM 9992  C C   . ALA D 1 280 ? 27.531  -15.697 -17.823 1.00 28.49 ? 280 ALA D C   1 
ATOM 9993  O O   . ALA D 1 280 ? 27.606  -14.736 -17.066 1.00 28.49 ? 280 ALA D O   1 
ATOM 9994  C CB  . ALA D 1 280 ? 25.691  -17.376 -17.833 1.00 31.25 ? 280 ALA D CB  1 
ATOM 9995  N N   . SER D 1 281 ? 28.578  -16.444 -18.152 1.00 29.03 ? 281 SER D N   1 
ATOM 9996  C CA  . SER D 1 281 ? 29.911  -16.185 -17.616 1.00 29.03 ? 281 SER D CA  1 
ATOM 9997  C C   . SER D 1 281 ? 30.419  -14.788 -17.982 1.00 29.03 ? 281 SER D C   1 
ATOM 9998  O O   . SER D 1 281 ? 30.923  -14.053 -17.125 1.00 29.03 ? 281 SER D O   1 
ATOM 9999  C CB  . SER D 1 281 ? 30.880  -17.245 -18.135 1.00 33.57 ? 281 SER D CB  1 
ATOM 10000 O OG  . SER D 1 281 ? 30.392  -18.547 -17.855 1.00 33.57 ? 281 SER D OG  1 
ATOM 10001 N N   . PHE D 1 282 ? 30.285  -14.424 -19.254 1.00 35.17 ? 282 PHE D N   1 
ATOM 10002 C CA  . PHE D 1 282 ? 30.726  -13.116 -19.724 1.00 35.17 ? 282 PHE D CA  1 
ATOM 10003 C C   . PHE D 1 282 ? 29.997  -12.001 -19.005 1.00 35.17 ? 282 PHE D C   1 
ATOM 10004 O O   . PHE D 1 282 ? 30.625  -11.093 -18.450 1.00 35.17 ? 282 PHE D O   1 
ATOM 10005 C CB  . PHE D 1 282 ? 30.495  -12.982 -21.225 1.00 73.69 ? 282 PHE D CB  1 
ATOM 10006 C CG  . PHE D 1 282 ? 31.626  -13.506 -22.046 1.00 73.69 ? 282 PHE D CG  1 
ATOM 10007 C CD1 . PHE D 1 282 ? 32.065  -14.816 -21.894 1.00 73.69 ? 282 PHE D CD1 1 
ATOM 10008 C CD2 . PHE D 1 282 ? 32.279  -12.681 -22.953 1.00 73.69 ? 282 PHE D CD2 1 
ATOM 10009 C CE1 . PHE D 1 282 ? 33.140  -15.298 -22.632 1.00 73.69 ? 282 PHE D CE1 1 
ATOM 10010 C CE2 . PHE D 1 282 ? 33.356  -13.154 -23.697 1.00 73.69 ? 282 PHE D CE2 1 
ATOM 10011 C CZ  . PHE D 1 282 ? 33.787  -14.468 -23.533 1.00 73.69 ? 282 PHE D CZ  1 
ATOM 10012 N N   . ASN D 1 283 ? 28.671  -12.080 -19.018 1.00 27.49 ? 283 ASN D N   1 
ATOM 10013 C CA  . ASN D 1 283 ? 27.837  -11.083 -18.367 1.00 27.49 ? 283 ASN D CA  1 
ATOM 10014 C C   . ASN D 1 283 ? 28.163  -10.993 -16.872 1.00 27.49 ? 283 ASN D C   1 
ATOM 10015 O O   . ASN D 1 283 ? 28.335  -9.899  -16.331 1.00 27.49 ? 283 ASN D O   1 
ATOM 10016 C CB  . ASN D 1 283 ? 26.358  -11.419 -18.600 1.00 30.08 ? 283 ASN D CB  1 
ATOM 10017 C CG  . ASN D 1 283 ? 25.899  -11.088 -20.016 1.00 30.08 ? 283 ASN D CG  1 
ATOM 10018 O OD1 . ASN D 1 283 ? 24.893  -11.600 -20.494 1.00 30.08 ? 283 ASN D OD1 1 
ATOM 10019 N ND2 . ASN D 1 283 ? 26.635  -10.215 -20.686 1.00 30.08 ? 283 ASN D ND2 1 
ATOM 10020 N N   . LEU D 1 284 ? 28.272  -12.132 -16.198 1.00 25.69 ? 284 LEU D N   1 
ATOM 10021 C CA  . LEU D 1 284 ? 28.588  -12.092 -14.777 1.00 25.69 ? 284 LEU D CA  1 
ATOM 10022 C C   . LEU D 1 284 ? 29.922  -11.402 -14.567 1.00 25.69 ? 284 LEU D C   1 
ATOM 10023 O O   . LEU D 1 284 ? 30.051  -10.540 -13.697 1.00 25.69 ? 284 LEU D O   1 
ATOM 10024 C CB  . LEU D 1 284 ? 28.643  -13.501 -14.173 1.00 10.21 ? 284 LEU D CB  1 
ATOM 10025 C CG  . LEU D 1 284 ? 29.088  -13.571 -12.700 1.00 10.21 ? 284 LEU D CG  1 
ATOM 10026 C CD1 . LEU D 1 284 ? 28.302  -12.581 -11.848 1.00 10.21 ? 284 LEU D CD1 1 
ATOM 10027 C CD2 . LEU D 1 284 ? 28.894  -14.988 -12.179 1.00 10.21 ? 284 LEU D CD2 1 
ATOM 10028 N N   . ASN D 1 285 ? 30.913  -11.782 -15.366 1.00 29.34 ? 285 ASN D N   1 
ATOM 10029 C CA  . ASN D 1 285 ? 32.234  -11.185 -15.246 1.00 29.34 ? 285 ASN D CA  1 
ATOM 10030 C C   . ASN D 1 285 ? 32.120  -9.674  -15.419 1.00 29.34 ? 285 ASN D C   1 
ATOM 10031 O O   . ASN D 1 285 ? 32.587  -8.899  -14.581 1.00 29.34 ? 285 ASN D O   1 
ATOM 10032 C CB  . ASN D 1 285 ? 33.171  -11.760 -16.303 1.00 44.21 ? 285 ASN D CB  1 
ATOM 10033 C CG  . ASN D 1 285 ? 34.631  -11.520 -15.974 1.00 44.21 ? 285 ASN D CG  1 
ATOM 10034 O OD1 . ASN D 1 285 ? 35.188  -12.126 -15.056 1.00 44.21 ? 285 ASN D OD1 1 
ATOM 10035 N ND2 . ASN D 1 285 ? 35.257  -10.623 -16.718 1.00 44.21 ? 285 ASN D ND2 1 
ATOM 10036 N N   . ALA D 1 286 ? 31.480  -9.262  -16.507 1.00 25.63 ? 286 ALA D N   1 
ATOM 10037 C CA  . ALA D 1 286 ? 31.291  -7.846  -16.789 1.00 25.63 ? 286 ALA D CA  1 
ATOM 10038 C C   . ALA D 1 286 ? 30.696  -7.132  -15.578 1.00 25.63 ? 286 ALA D C   1 
ATOM 10039 O O   . ALA D 1 286 ? 31.150  -6.049  -15.194 1.00 25.63 ? 286 ALA D O   1 
ATOM 10040 C CB  . ALA D 1 286 ? 30.378  -7.673  -17.998 1.00 13.74 ? 286 ALA D CB  1 
ATOM 10041 N N   . ILE D 1 287 ? 29.672  -7.744  -14.988 1.00 26.84 ? 287 ILE D N   1 
ATOM 10042 C CA  . ILE D 1 287 ? 29.008  -7.183  -13.819 1.00 26.84 ? 287 ILE D CA  1 
ATOM 10043 C C   . ILE D 1 287 ? 30.029  -6.940  -12.717 1.00 26.84 ? 287 ILE D C   1 
ATOM 10044 O O   . ILE D 1 287 ? 30.096  -5.846  -12.151 1.00 26.84 ? 287 ILE D O   1 
ATOM 10045 C CB  . ILE D 1 287 ? 27.906  -8.143  -13.290 1.00 24.79 ? 287 ILE D CB  1 
ATOM 10046 C CG1 . ILE D 1 287 ? 26.708  -8.126  -14.238 1.00 24.79 ? 287 ILE D CG1 1 
ATOM 10047 C CG2 . ILE D 1 287 ? 27.486  -7.753  -11.876 1.00 24.79 ? 287 ILE D CG2 1 
ATOM 10048 C CD1 . ILE D 1 287 ? 25.619  -9.119  -13.864 1.00 24.79 ? 287 ILE D CD1 1 
ATOM 10049 N N   . ASN D 1 288 ? 30.827  -7.960  -12.416 1.00 38.27 ? 288 ASN D N   1 
ATOM 10050 C CA  . ASN D 1 288 ? 31.832  -7.837  -11.375 1.00 38.27 ? 288 ASN D CA  1 
ATOM 10051 C C   . ASN D 1 288 ? 32.972  -6.906  -11.764 1.00 38.27 ? 288 ASN D C   1 
ATOM 10052 O O   . ASN D 1 288 ? 33.894  -6.679  -10.979 1.00 38.27 ? 288 ASN D O   1 
ATOM 10053 C CB  . ASN D 1 288 ? 32.389  -9.207  -11.006 1.00 37.49 ? 288 ASN D CB  1 
ATOM 10054 C CG  . ASN D 1 288 ? 31.564  -9.901  -9.949  1.00 37.49 ? 288 ASN D CG  1 
ATOM 10055 O OD1 . ASN D 1 288 ? 31.482  -9.450  -8.805  1.00 37.49 ? 288 ASN D OD1 1 
ATOM 10056 N ND2 . ASN D 1 288 ? 30.943  -11.007 -10.326 1.00 37.49 ? 288 ASN D ND2 1 
ATOM 10057 N N   . ARG D 1 289 ? 32.919  -6.369  -12.978 1.00 38.53 ? 289 ARG D N   1 
ATOM 10058 C CA  . ARG D 1 289 ? 33.947  -5.441  -13.422 1.00 38.53 ? 289 ARG D CA  1 
ATOM 10059 C C   . ARG D 1 289 ? 33.338  -4.063  -13.653 1.00 38.53 ? 289 ARG D C   1 
ATOM 10060 O O   . ARG D 1 289 ? 34.017  -3.138  -14.098 1.00 38.53 ? 289 ARG D O   1 
ATOM 10061 C CB  . ARG D 1 289 ? 34.623  -5.966  -14.689 1.00 83.13 ? 289 ARG D CB  1 
ATOM 10062 C CG  . ARG D 1 289 ? 35.888  -6.758  -14.403 1.00 83.13 ? 289 ARG D CG  1 
ATOM 10063 C CD  . ARG D 1 289 ? 36.106  -7.851  -15.427 1.00 83.13 ? 289 ARG D CD  1 
ATOM 10064 N NE  . ARG D 1 289 ? 36.188  -7.339  -16.793 1.00 83.13 ? 289 ARG D NE  1 
ATOM 10065 C CZ  . ARG D 1 289 ? 37.258  -6.738  -17.308 1.00 83.13 ? 289 ARG D CZ  1 
ATOM 10066 N NH1 . ARG D 1 289 ? 38.349  -6.574  -16.563 1.00 83.13 ? 289 ARG D NH1 1 
ATOM 10067 N NH2 . ARG D 1 289 ? 37.233  -6.298  -18.568 1.00 83.13 ? 289 ARG D NH2 1 
ATOM 10068 N N   . CYS D 1 290 ? 32.053  -3.928  -13.335 1.00 39.66 ? 290 CYS D N   1 
ATOM 10069 C CA  . CYS D 1 290 ? 31.358  -2.653  -13.489 1.00 39.66 ? 290 CYS D CA  1 
ATOM 10070 C C   . CYS D 1 290 ? 31.984  -1.630  -12.541 1.00 39.66 ? 290 CYS D C   1 
ATOM 10071 O O   . CYS D 1 290 ? 32.310  -1.943  -11.399 1.00 39.66 ? 290 CYS D O   1 
ATOM 10072 C CB  . CYS D 1 290 ? 29.864  -2.805  -13.164 1.00 39.50 ? 290 CYS D CB  1 
ATOM 10073 S SG  . CYS D 1 290 ? 28.891  -1.281  -13.371 1.00 39.50 ? 290 CYS D SG  1 
ATOM 10074 N N   . PRO D 1 291 ? 32.162  -0.392  -13.014 1.00 44.08 ? 291 PRO D N   1 
ATOM 10075 C CA  . PRO D 1 291 ? 32.744  0.726   -12.265 1.00 44.08 ? 291 PRO D CA  1 
ATOM 10076 C C   . PRO D 1 291 ? 31.999  1.043   -10.972 1.00 44.08 ? 291 PRO D C   1 
ATOM 10077 O O   . PRO D 1 291 ? 32.606  1.365   -9.950  1.00 44.08 ? 291 PRO D O   1 
ATOM 10078 C CB  . PRO D 1 291 ? 32.650  1.881   -13.250 1.00 37.68 ? 291 PRO D CB  1 
ATOM 10079 C CG  . PRO D 1 291 ? 32.746  1.195   -14.580 1.00 37.68 ? 291 PRO D CG  1 
ATOM 10080 C CD  . PRO D 1 291 ? 31.850  0.009   -14.396 1.00 37.68 ? 291 PRO D CD  1 
ATOM 10081 N N   . LEU D 1 292 ? 30.677  0.958   -11.029 1.00 38.17 ? 292 LEU D N   1 
ATOM 10082 C CA  . LEU D 1 292 ? 29.838  1.241   -9.875  1.00 38.17 ? 292 LEU D CA  1 
ATOM 10083 C C   . LEU D 1 292 ? 30.163  0.346   -8.684  1.00 38.17 ? 292 LEU D C   1 
ATOM 10084 O O   . LEU D 1 292 ? 30.476  -0.829  -8.839  1.00 38.17 ? 292 LEU D O   1 
ATOM 10085 C CB  . LEU D 1 292 ? 28.375  1.073   -10.270 1.00 25.82 ? 292 LEU D CB  1 
ATOM 10086 C CG  . LEU D 1 292 ? 27.990  1.971   -11.441 1.00 25.82 ? 292 LEU D CG  1 
ATOM 10087 C CD1 . LEU D 1 292 ? 26.694  1.510   -12.058 1.00 25.82 ? 292 LEU D CD1 1 
ATOM 10088 C CD2 . LEU D 1 292 ? 27.888  3.392   -10.943 1.00 25.82 ? 292 LEU D CD2 1 
ATOM 10089 N N   . PRO D 1 293 ? 30.095  0.905   -7.473  1.00 33.21 ? 293 PRO D N   1 
ATOM 10090 C CA  . PRO D 1 293 ? 30.368  0.210   -6.212  1.00 33.21 ? 293 PRO D CA  1 
ATOM 10091 C C   . PRO D 1 293 ? 29.261  -0.786  -5.879  1.00 33.21 ? 293 PRO D C   1 
ATOM 10092 O O   . PRO D 1 293 ? 28.091  -0.509  -6.134  1.00 33.21 ? 293 PRO D O   1 
ATOM 10093 C CB  . PRO D 1 293 ? 30.406  1.348   -5.191  1.00 21.95 ? 293 PRO D CB  1 
ATOM 10094 C CG  . PRO D 1 293 ? 30.726  2.556   -6.010  1.00 21.95 ? 293 PRO D CG  1 
ATOM 10095 C CD  . PRO D 1 293 ? 29.911  2.343   -7.243  1.00 21.95 ? 293 PRO D CD  1 
ATOM 10096 N N   . ARG D 1 294 ? 29.618  -1.929  -5.299  1.00 35.41 ? 294 ARG D N   1 
ATOM 10097 C CA  . ARG D 1 294 ? 28.625  -2.928  -4.933  1.00 35.41 ? 294 ARG D CA  1 
ATOM 10098 C C   . ARG D 1 294 ? 28.827  -3.446  -3.524  1.00 35.41 ? 294 ARG D C   1 
ATOM 10099 O O   . ARG D 1 294 ? 29.780  -4.160  -3.251  1.00 35.41 ? 294 ARG D O   1 
ATOM 10100 C CB  . ARG D 1 294 ? 28.665  -4.092  -5.906  1.00 55.54 ? 294 ARG D CB  1 
ATOM 10101 C CG  . ARG D 1 294 ? 28.367  -3.671  -7.312  1.00 55.54 ? 294 ARG D CG  1 
ATOM 10102 C CD  . ARG D 1 294 ? 29.633  -3.402  -8.050  1.00 55.54 ? 294 ARG D CD  1 
ATOM 10103 N NE  . ARG D 1 294 ? 30.385  -4.639  -8.196  1.00 55.54 ? 294 ARG D NE  1 
ATOM 10104 C CZ  . ARG D 1 294 ? 31.464  -4.767  -8.956  1.00 55.54 ? 294 ARG D CZ  1 
ATOM 10105 N NH1 . ARG D 1 294 ? 31.923  -3.727  -9.645  1.00 55.54 ? 294 ARG D NH1 1 
ATOM 10106 N NH2 . ARG D 1 294 ? 32.085  -5.938  -9.028  1.00 55.54 ? 294 ARG D NH2 1 
ATOM 10107 N N   . PRO D 1 295 ? 27.904  -3.117  -2.615  1.00 34.96 ? 295 PRO D N   1 
ATOM 10108 C CA  . PRO D 1 295 ? 27.927  -3.515  -1.200  1.00 34.96 ? 295 PRO D CA  1 
ATOM 10109 C C   . PRO D 1 295 ? 27.686  -5.000  -0.947  1.00 34.96 ? 295 PRO D C   1 
ATOM 10110 O O   . PRO D 1 295 ? 27.767  -5.471  0.199   1.00 34.96 ? 295 PRO D O   1 
ATOM 10111 C CB  . PRO D 1 295 ? 26.800  -2.682  -0.581  1.00 28.52 ? 295 PRO D CB  1 
ATOM 10112 C CG  . PRO D 1 295 ? 26.472  -1.638  -1.626  1.00 28.52 ? 295 PRO D CG  1 
ATOM 10113 C CD  . PRO D 1 295 ? 26.692  -2.345  -2.915  1.00 28.52 ? 295 PRO D CD  1 
ATOM 10114 N N   . TRP D 1 296 ? 27.398  -5.735  -2.011  1.00 22.36 ? 296 TRP D N   1 
ATOM 10115 C CA  . TRP D 1 296 ? 27.071  -7.154  -1.892  1.00 22.36 ? 296 TRP D CA  1 
ATOM 10116 C C   . TRP D 1 296 ? 27.779  -8.047  -2.900  1.00 22.36 ? 296 TRP D C   1 
ATOM 10117 O O   . TRP D 1 296 ? 28.242  -7.593  -3.954  1.00 22.36 ? 296 TRP D O   1 
ATOM 10118 C CB  . TRP D 1 296 ? 25.567  -7.316  -2.087  1.00 29.77 ? 296 TRP D CB  1 
ATOM 10119 C CG  . TRP D 1 296 ? 25.107  -6.372  -3.148  1.00 29.77 ? 296 TRP D CG  1 
ATOM 10120 C CD1 . TRP D 1 296 ? 25.603  -6.251  -4.433  1.00 29.77 ? 296 TRP D CD1 1 
ATOM 10121 C CD2 . TRP D 1 296 ? 24.167  -5.334  -2.991  1.00 29.77 ? 296 TRP D CD2 1 
ATOM 10122 N NE1 . TRP D 1 296 ? 25.024  -5.178  -5.076  1.00 29.77 ? 296 TRP D NE1 1 
ATOM 10123 C CE2 . TRP D 1 296 ? 24.138  -4.597  -4.214  1.00 29.77 ? 296 TRP D CE2 1 
ATOM 10124 C CE3 . TRP D 1 296 ? 23.347  -4.945  -1.941  1.00 29.77 ? 296 TRP D CE3 1 
ATOM 10125 C CZ2 . TRP D 1 296 ? 23.321  -3.506  -4.404  1.00 29.77 ? 296 TRP D CZ2 1 
ATOM 10126 C CZ3 . TRP D 1 296 ? 22.539  -3.871  -2.122  1.00 29.77 ? 296 TRP D CZ3 1 
ATOM 10127 C CH2 . TRP D 1 296 ? 22.525  -3.150  -3.354  1.00 29.77 ? 296 TRP D CH2 1 
ATOM 10128 N N   . ALA D 1 297 ? 27.840  -9.331  -2.578  1.00 17.98 ? 297 ALA D N   1 
ATOM 10129 C CA  . ALA D 1 297 ? 28.457  -10.290 -3.470  1.00 17.98 ? 297 ALA D CA  1 
ATOM 10130 C C   . ALA D 1 297 ? 27.628  -10.317 -4.746  1.00 17.98 ? 297 ALA D C   1 
ATOM 10131 O O   . ALA D 1 297 ? 26.403  -10.203 -4.702  1.00 17.98 ? 297 ALA D O   1 
ATOM 10132 C CB  . ALA D 1 297 ? 28.456  -11.660 -2.829  1.00 5.10  ? 297 ALA D CB  1 
ATOM 10133 N N   . LEU D 1 298 ? 28.280  -10.445 -5.889  1.00 26.13 ? 298 LEU D N   1 
ATOM 10134 C CA  . LEU D 1 298 ? 27.533  -10.529 -7.124  1.00 26.13 ? 298 LEU D CA  1 
ATOM 10135 C C   . LEU D 1 298 ? 27.981  -11.794 -7.826  1.00 26.13 ? 298 LEU D C   1 
ATOM 10136 O O   . LEU D 1 298 ? 28.813  -11.727 -8.722  1.00 26.13 ? 298 LEU D O   1 
ATOM 10137 C CB  . LEU D 1 298 ? 27.806  -9.311  -8.008  1.00 12.85 ? 298 LEU D CB  1 
ATOM 10138 C CG  . LEU D 1 298 ? 27.281  -7.955  -7.541  1.00 12.85 ? 298 LEU D CG  1 
ATOM 10139 C CD1 . LEU D 1 298 ? 27.661  -6.887  -8.552  1.00 12.85 ? 298 LEU D CD1 1 
ATOM 10140 C CD2 . LEU D 1 298 ? 25.781  -8.016  -7.391  1.00 12.85 ? 298 LEU D CD2 1 
ATOM 10141 N N   . THR D 1 299 ? 27.474  -12.955 -7.413  1.00 24.62 ? 299 THR D N   1 
ATOM 10142 C CA  . THR D 1 299 ? 27.882  -14.180 -8.091  1.00 24.62 ? 299 THR D CA  1 
ATOM 10143 C C   . THR D 1 299 ? 26.735  -14.797 -8.888  1.00 24.62 ? 299 THR D C   1 
ATOM 10144 O O   . THR D 1 299 ? 25.853  -14.091 -9.391  1.00 24.62 ? 299 THR D O   1 
ATOM 10145 C CB  . THR D 1 299 ? 28.472  -15.256 -7.129  1.00 29.85 ? 299 THR D CB  1 
ATOM 10146 O OG1 . THR D 1 299 ? 27.432  -16.121 -6.691  1.00 29.85 ? 299 THR D OG1 1 
ATOM 10147 C CG2 . THR D 1 299 ? 29.111  -14.626 -5.913  1.00 29.85 ? 299 THR D CG2 1 
ATOM 10148 N N   . PHE D 1 300 ? 26.747  -16.121 -8.982  1.00 24.91 ? 300 PHE D N   1 
ATOM 10149 C CA  . PHE D 1 300 ? 25.765  -16.858 -9.763  1.00 24.91 ? 300 PHE D CA  1 
ATOM 10150 C C   . PHE D 1 300 ? 24.999  -17.934 -8.997  1.00 24.91 ? 300 PHE D C   1 
ATOM 10151 O O   . PHE D 1 300 ? 25.445  -18.427 -7.963  1.00 24.91 ? 300 PHE D O   1 
ATOM 10152 C CB  . PHE D 1 300 ? 26.500  -17.537 -10.916 1.00 28.15 ? 300 PHE D CB  1 
ATOM 10153 C CG  . PHE D 1 300 ? 27.550  -18.524 -10.455 1.00 28.15 ? 300 PHE D CG  1 
ATOM 10154 C CD1 . PHE D 1 300 ? 27.259  -19.884 -10.356 1.00 28.15 ? 300 PHE D CD1 1 
ATOM 10155 C CD2 . PHE D 1 300 ? 28.814  -18.085 -10.056 1.00 28.15 ? 300 PHE D CD2 1 
ATOM 10156 C CE1 . PHE D 1 300 ? 28.212  -20.790 -9.863  1.00 28.15 ? 300 PHE D CE1 1 
ATOM 10157 C CE2 . PHE D 1 300 ? 29.766  -18.983 -9.565  1.00 28.15 ? 300 PHE D CE2 1 
ATOM 10158 C CZ  . PHE D 1 300 ? 29.462  -20.336 -9.468  1.00 28.15 ? 300 PHE D CZ  1 
ATOM 10159 N N   . SER D 1 301 ? 23.841  -18.293 -9.538  1.00 38.83 ? 301 SER D N   1 
ATOM 10160 C CA  . SER D 1 301 ? 22.993  -19.367 -9.020  1.00 38.83 ? 301 SER D CA  1 
ATOM 10161 C C   . SER D 1 301 ? 22.476  -19.895 -10.339 1.00 38.83 ? 301 SER D C   1 
ATOM 10162 O O   . SER D 1 301 ? 21.321  -19.696 -10.704 1.00 38.83 ? 301 SER D O   1 
ATOM 10163 C CB  . SER D 1 301 ? 21.830  -18.845 -8.182  1.00 22.70 ? 301 SER D CB  1 
ATOM 10164 O OG  . SER D 1 301 ? 21.085  -19.938 -7.665  1.00 22.70 ? 301 SER D OG  1 
ATOM 10165 N N   . TYR D 1 302 ? 23.379  -20.538 -11.067 1.00 34.88 ? 302 TYR D N   1 
ATOM 10166 C CA  . TYR D 1 302 ? 23.088  -21.066 -12.384 1.00 34.88 ? 302 TYR D CA  1 
ATOM 10167 C C   . TYR D 1 302 ? 22.561  -22.490 -12.439 1.00 34.88 ? 302 TYR D C   1 
ATOM 10168 O O   . TYR D 1 302 ? 22.947  -23.358 -11.648 1.00 34.88 ? 302 TYR D O   1 
ATOM 10169 C CB  . TYR D 1 302 ? 24.336  -20.969 -13.250 1.00 26.93 ? 302 TYR D CB  1 
ATOM 10170 C CG  . TYR D 1 302 ? 24.763  -19.562 -13.587 1.00 26.93 ? 302 TYR D CG  1 
ATOM 10171 C CD1 . TYR D 1 302 ? 25.858  -19.346 -14.403 1.00 26.93 ? 302 TYR D CD1 1 
ATOM 10172 C CD2 . TYR D 1 302 ? 24.062  -18.450 -13.118 1.00 26.93 ? 302 TYR D CD2 1 
ATOM 10173 C CE1 . TYR D 1 302 ? 26.255  -18.080 -14.753 1.00 26.93 ? 302 TYR D CE1 1 
ATOM 10174 C CE2 . TYR D 1 302 ? 24.455  -17.165 -13.466 1.00 26.93 ? 302 TYR D CE2 1 
ATOM 10175 C CZ  . TYR D 1 302 ? 25.562  -16.996 -14.290 1.00 26.93 ? 302 TYR D CZ  1 
ATOM 10176 O OH  . TYR D 1 302 ? 26.012  -15.751 -14.662 1.00 26.93 ? 302 TYR D OH  1 
ATOM 10177 N N   . GLY D 1 303 ? 21.677  -22.714 -13.403 1.00 37.62 ? 303 GLY D N   1 
ATOM 10178 C CA  . GLY D 1 303 ? 21.097  -24.024 -13.582 1.00 37.62 ? 303 GLY D CA  1 
ATOM 10179 C C   . GLY D 1 303 ? 21.642  -24.621 -14.854 1.00 37.62 ? 303 GLY D C   1 
ATOM 10180 O O   . GLY D 1 303 ? 22.557  -25.438 -14.806 1.00 37.62 ? 303 GLY D O   1 
ATOM 10181 N N   . ARG D 1 304 ? 21.103  -24.207 -15.996 1.00 39.41 ? 304 ARG D N   1 
ATOM 10182 C CA  . ARG D 1 304 ? 21.577  -24.756 -17.252 1.00 39.41 ? 304 ARG D CA  1 
ATOM 10183 C C   . ARG D 1 304 ? 22.972  -24.244 -17.565 1.00 39.41 ? 304 ARG D C   1 
ATOM 10184 O O   . ARG D 1 304 ? 23.823  -25.004 -18.022 1.00 39.41 ? 304 ARG D O   1 
ATOM 10185 C CB  . ARG D 1 304 ? 20.632  -24.410 -18.400 1.00 92.06 ? 304 ARG D CB  1 
ATOM 10186 C CG  . ARG D 1 304 ? 20.827  -25.335 -19.582 1.00 92.06 ? 304 ARG D CG  1 
ATOM 10187 C CD  . ARG D 1 304 ? 19.895  -25.026 -20.732 1.00 92.06 ? 304 ARG D CD  1 
ATOM 10188 N NE  . ARG D 1 304 ? 19.313  -26.249 -21.285 1.00 92.06 ? 304 ARG D NE  1 
ATOM 10189 C CZ  . ARG D 1 304 ? 18.207  -26.835 -20.819 1.00 92.06 ? 304 ARG D CZ  1 
ATOM 10190 N NH1 . ARG D 1 304 ? 17.546  -26.310 -19.792 1.00 92.06 ? 304 ARG D NH1 1 
ATOM 10191 N NH2 . ARG D 1 304 ? 17.761  -27.958 -21.374 1.00 92.06 ? 304 ARG D NH2 1 
ATOM 10192 N N   . ALA D 1 305 ? 23.213  -22.965 -17.292 1.00 38.65 ? 305 ALA D N   1 
ATOM 10193 C CA  . ALA D 1 305 ? 24.511  -22.353 -17.570 1.00 38.65 ? 305 ALA D CA  1 
ATOM 10194 C C   . ALA D 1 305 ? 25.703  -23.067 -16.930 1.00 38.65 ? 305 ALA D C   1 
ATOM 10195 O O   . ALA D 1 305 ? 26.862  -22.733 -17.210 1.00 38.65 ? 305 ALA D O   1 
ATOM 10196 C CB  . ALA D 1 305 ? 24.497  -20.898 -17.147 1.00 39.62 ? 305 ALA D CB  1 
ATOM 10197 N N   . LEU D 1 306 ? 25.423  -24.042 -16.074 1.00 36.66 ? 306 LEU D N   1 
ATOM 10198 C CA  . LEU D 1 306 ? 26.475  -24.800 -15.416 1.00 36.66 ? 306 LEU D CA  1 
ATOM 10199 C C   . LEU D 1 306 ? 26.485  -26.242 -15.892 1.00 36.66 ? 306 LEU D C   1 
ATOM 10200 O O   . LEU D 1 306 ? 27.518  -26.912 -15.856 1.00 36.66 ? 306 LEU D O   1 
ATOM 10201 C CB  . LEU D 1 306 ? 26.285  -24.783 -13.899 1.00 30.61 ? 306 LEU D CB  1 
ATOM 10202 C CG  . LEU D 1 306 ? 26.955  -23.658 -13.118 1.00 30.61 ? 306 LEU D CG  1 
ATOM 10203 C CD1 . LEU D 1 306 ? 26.633  -23.793 -11.641 1.00 30.61 ? 306 LEU D CD1 1 
ATOM 10204 C CD2 . LEU D 1 306 ? 28.453  -23.723 -13.335 1.00 30.61 ? 306 LEU D CD2 1 
ATOM 10205 N N   . GLN D 1 307 ? 25.342  -26.728 -16.353 1.00 36.55 ? 307 GLN D N   1 
ATOM 10206 C CA  . GLN D 1 307 ? 25.280  -28.114 -16.777 1.00 36.55 ? 307 GLN D CA  1 
ATOM 10207 C C   . GLN D 1 307 ? 24.863  -28.389 -18.216 1.00 36.55 ? 307 GLN D C   1 
ATOM 10208 O O   . GLN D 1 307 ? 24.576  -29.528 -18.568 1.00 36.55 ? 307 GLN D O   1 
ATOM 10209 C CB  . GLN D 1 307 ? 24.388  -28.896 -15.796 1.00 33.89 ? 307 GLN D CB  1 
ATOM 10210 C CG  . GLN D 1 307 ? 23.052  -28.243 -15.490 1.00 33.89 ? 307 GLN D CG  1 
ATOM 10211 C CD  . GLN D 1 307 ? 22.376  -28.823 -14.256 1.00 33.89 ? 307 GLN D CD  1 
ATOM 10212 O OE1 . GLN D 1 307 ? 21.938  -29.977 -14.243 1.00 33.89 ? 307 GLN D OE1 1 
ATOM 10213 N NE2 . GLN D 1 307 ? 22.290  -28.016 -13.207 1.00 33.89 ? 307 GLN D NE2 1 
ATOM 10214 N N   . ALA D 1 308 ? 24.846  -27.369 -19.060 1.00 37.87 ? 308 ALA D N   1 
ATOM 10215 C CA  . ALA D 1 308 ? 24.450  -27.585 -20.447 1.00 37.87 ? 308 ALA D CA  1 
ATOM 10216 C C   . ALA D 1 308 ? 25.397  -28.560 -21.122 1.00 37.87 ? 308 ALA D C   1 
ATOM 10217 O O   . ALA D 1 308 ? 25.012  -29.672 -21.483 1.00 37.87 ? 308 ALA D O   1 
ATOM 10218 C CB  . ALA D 1 308 ? 24.444  -26.280 -21.206 1.00 15.30 ? 308 ALA D CB  1 
ATOM 10219 N N   . SER D 1 309 ? 26.643  -28.132 -21.287 1.00 41.00 ? 309 SER D N   1 
ATOM 10220 C CA  . SER D 1 309 ? 27.648  -28.960 -21.931 1.00 41.00 ? 309 SER D CA  1 
ATOM 10221 C C   . SER D 1 309 ? 27.856  -30.250 -21.150 1.00 41.00 ? 309 SER D C   1 
ATOM 10222 O O   . SER D 1 309 ? 28.080  -31.308 -21.734 1.00 41.00 ? 309 SER D O   1 
ATOM 10223 C CB  . SER D 1 309 ? 28.958  -28.187 -22.038 1.00 53.34 ? 309 SER D CB  1 
ATOM 10224 O OG  . SER D 1 309 ? 29.355  -27.728 -20.760 1.00 53.34 ? 309 SER D OG  1 
ATOM 10225 N N   . ALA D 1 310 ? 27.775  -30.163 -19.827 1.00 29.93 ? 310 ALA D N   1 
ATOM 10226 C CA  . ALA D 1 310 ? 27.956  -31.346 -18.996 1.00 29.93 ? 310 ALA D CA  1 
ATOM 10227 C C   . ALA D 1 310 ? 26.937  -32.412 -19.383 1.00 29.93 ? 310 ALA D C   1 
ATOM 10228 O O   . ALA D 1 310 ? 27.273  -33.576 -19.607 1.00 29.93 ? 310 ALA D O   1 
ATOM 10229 C CB  . ALA D 1 310 ? 27.796  -30.981 -17.528 1.00 38.79 ? 310 ALA D CB  1 
ATOM 10230 N N   . LEU D 1 311 ? 25.682  -31.993 -19.462 1.00 42.93 ? 311 LEU D N   1 
ATOM 10231 C CA  . LEU D 1 311 ? 24.577  -32.876 -19.806 1.00 42.93 ? 311 LEU D CA  1 
ATOM 10232 C C   . LEU D 1 311 ? 24.745  -33.383 -21.232 1.00 42.93 ? 311 LEU D C   1 
ATOM 10233 O O   . LEU D 1 311 ? 24.491  -34.547 -21.538 1.00 42.93 ? 311 LEU D O   1 
ATOM 10234 C CB  . LEU D 1 311 ? 23.270  -32.096 -19.667 1.00 52.68 ? 311 LEU D CB  1 
ATOM 10235 C CG  . LEU D 1 311 ? 21.918  -32.797 -19.658 1.00 52.68 ? 311 LEU D CG  1 
ATOM 10236 C CD1 . LEU D 1 311 ? 21.906  -33.958 -18.675 1.00 52.68 ? 311 LEU D CD1 1 
ATOM 10237 C CD2 . LEU D 1 311 ? 20.871  -31.765 -19.278 1.00 52.68 ? 311 LEU D CD2 1 
ATOM 10238 N N   . ASN D 1 312 ? 25.193  -32.487 -22.098 1.00 41.74 ? 312 ASN D N   1 
ATOM 10239 C CA  . ASN D 1 312 ? 25.397  -32.807 -23.495 1.00 41.74 ? 312 ASN D CA  1 
ATOM 10240 C C   . ASN D 1 312 ? 26.486  -33.854 -23.682 1.00 41.74 ? 312 ASN D C   1 
ATOM 10241 O O   . ASN D 1 312 ? 26.418  -34.673 -24.596 1.00 41.74 ? 312 ASN D O   1 
ATOM 10242 C CB  . ASN D 1 312 ? 25.765  -31.542 -24.250 1.00 82.36 ? 312 ASN D CB  1 
ATOM 10243 C CG  . ASN D 1 312 ? 25.198  -31.528 -25.630 1.00 82.36 ? 312 ASN D CG  1 
ATOM 10244 O OD1 . ASN D 1 312 ? 25.465  -32.427 -26.426 1.00 82.36 ? 312 ASN D OD1 1 
ATOM 10245 N ND2 . ASN D 1 312 ? 24.393  -30.515 -25.929 1.00 82.36 ? 312 ASN D ND2 1 
ATOM 10246 N N   . ALA D 1 313 ? 27.491  -33.819 -22.813 1.00 38.36 ? 313 ALA D N   1 
ATOM 10247 C CA  . ALA D 1 313 ? 28.597  -34.769 -22.864 1.00 38.36 ? 313 ALA D CA  1 
ATOM 10248 C C   . ALA D 1 313 ? 28.148  -36.131 -22.350 1.00 38.36 ? 313 ALA D C   1 
ATOM 10249 O O   . ALA D 1 313 ? 28.295  -37.138 -23.033 1.00 38.36 ? 313 ALA D O   1 
ATOM 10250 C CB  . ALA D 1 313 ? 29.763  -34.262 -22.025 1.00 33.40 ? 313 ALA D CB  1 
ATOM 10251 N N   . TRP D 1 314 ? 27.606  -36.153 -21.134 1.00 47.91 ? 314 TRP D N   1 
ATOM 10252 C CA  . TRP D 1 314 ? 27.127  -37.392 -20.524 1.00 47.91 ? 314 TRP D CA  1 
ATOM 10253 C C   . TRP D 1 314 ? 26.298  -38.189 -21.520 1.00 47.91 ? 314 TRP D C   1 
ATOM 10254 O O   . TRP D 1 314 ? 26.569  -39.364 -21.779 1.00 47.91 ? 314 TRP D O   1 
ATOM 10255 C CB  . TRP D 1 314 ? 26.274  -37.072 -19.306 1.00 41.56 ? 314 TRP D CB  1 
ATOM 10256 C CG  . TRP D 1 314 ? 25.667  -38.274 -18.664 1.00 41.56 ? 314 TRP D CG  1 
ATOM 10257 C CD1 . TRP D 1 314 ? 26.323  -39.380 -18.209 1.00 41.56 ? 314 TRP D CD1 1 
ATOM 10258 C CD2 . TRP D 1 314 ? 24.289  -38.453 -18.321 1.00 41.56 ? 314 TRP D CD2 1 
ATOM 10259 N NE1 . TRP D 1 314 ? 25.439  -40.236 -17.596 1.00 41.56 ? 314 TRP D NE1 1 
ATOM 10260 C CE2 . TRP D 1 314 ? 24.183  -39.690 -17.651 1.00 41.56 ? 314 TRP D CE2 1 
ATOM 10261 C CE3 . TRP D 1 314 ? 23.132  -37.686 -18.513 1.00 41.56 ? 314 TRP D CE3 1 
ATOM 10262 C CZ2 . TRP D 1 314 ? 22.965  -40.179 -17.167 1.00 41.56 ? 314 TRP D CZ2 1 
ATOM 10263 C CZ3 . TRP D 1 314 ? 21.921  -38.172 -18.032 1.00 41.56 ? 314 TRP D CZ3 1 
ATOM 10264 C CH2 . TRP D 1 314 ? 21.849  -39.407 -17.366 1.00 41.56 ? 314 TRP D CH2 1 
ATOM 10265 N N   . ARG D 1 315 ? 25.269  -37.541 -22.054 1.00 48.60 ? 315 ARG D N   1 
ATOM 10266 C CA  . ARG D 1 315 ? 24.405  -38.158 -23.045 1.00 48.60 ? 315 ARG D CA  1 
ATOM 10267 C C   . ARG D 1 315 ? 23.810  -39.497 -22.572 1.00 48.60 ? 315 ARG D C   1 
ATOM 10268 O O   . ARG D 1 315 ? 23.394  -40.329 -23.380 1.00 48.60 ? 315 ARG D O   1 
ATOM 10269 C CB  . ARG D 1 315 ? 25.215  -38.330 -24.327 1.00 80.02 ? 315 ARG D CB  1 
ATOM 10270 C CG  . ARG D 1 315 ? 24.402  -38.482 -25.578 1.00 80.02 ? 315 ARG D CG  1 
ATOM 10271 C CD  . ARG D 1 315 ? 25.172  -37.927 -26.758 1.00 80.02 ? 315 ARG D CD  1 
ATOM 10272 N NE  . ARG D 1 315 ? 25.024  -36.478 -26.861 1.00 80.02 ? 315 ARG D NE  1 
ATOM 10273 C CZ  . ARG D 1 315 ? 23.892  -35.868 -27.207 1.00 80.02 ? 315 ARG D CZ  1 
ATOM 10274 N NH1 . ARG D 1 315 ? 22.803  -36.582 -27.487 1.00 80.02 ? 315 ARG D NH1 1 
ATOM 10275 N NH2 . ARG D 1 315 ? 23.847  -34.543 -27.281 1.00 80.02 ? 315 ARG D NH2 1 
ATOM 10276 N N   . GLY D 1 316 ? 23.765  -39.693 -21.255 1.00 50.22 ? 316 GLY D N   1 
ATOM 10277 C CA  . GLY D 1 316 ? 23.212  -40.916 -20.700 1.00 50.22 ? 316 GLY D CA  1 
ATOM 10278 C C   . GLY D 1 316 ? 24.186  -42.078 -20.611 1.00 50.22 ? 316 GLY D C   1 
ATOM 10279 O O   . GLY D 1 316 ? 23.890  -43.084 -19.971 1.00 50.22 ? 316 GLY D O   1 
ATOM 10280 N N   . GLN D 1 317 ? 25.352  -41.943 -21.237 1.00 53.44 ? 317 GLN D N   1 
ATOM 10281 C CA  . GLN D 1 317 ? 26.357  -43.005 -21.233 1.00 53.44 ? 317 GLN D CA  1 
ATOM 10282 C C   . GLN D 1 317 ? 27.184  -43.081 -19.958 1.00 53.44 ? 317 GLN D C   1 
ATOM 10283 O O   . GLN D 1 317 ? 27.725  -42.073 -19.500 1.00 53.44 ? 317 GLN D O   1 
ATOM 10284 C CB  . GLN D 1 317 ? 27.285  -42.836 -22.433 1.00 89.59 ? 317 GLN D CB  1 
ATOM 10285 C CG  . GLN D 1 317 ? 26.574  -43.064 -23.739 1.00 89.59 ? 317 GLN D CG  1 
ATOM 10286 C CD  . GLN D 1 317 ? 25.829  -44.379 -23.732 1.00 89.59 ? 317 GLN D CD  1 
ATOM 10287 O OE1 . GLN D 1 317 ? 26.438  -45.450 -23.706 1.00 89.59 ? 317 GLN D OE1 1 
ATOM 10288 N NE2 . GLN D 1 317 ? 24.502  -44.307 -23.733 1.00 89.59 ? 317 GLN D NE2 1 
ATOM 10289 N N   . ARG D 1 318 ? 27.296  -44.282 -19.395 1.00 45.23 ? 318 ARG D N   1 
ATOM 10290 C CA  . ARG D 1 318 ? 28.057  -44.459 -18.163 1.00 45.23 ? 318 ARG D CA  1 
ATOM 10291 C C   . ARG D 1 318 ? 29.532  -44.121 -18.332 1.00 45.23 ? 318 ARG D C   1 
ATOM 10292 O O   . ARG D 1 318 ? 30.200  -43.746 -17.366 1.00 45.23 ? 318 ARG D O   1 
ATOM 10293 C CB  . ARG D 1 318 ? 27.938  -45.886 -17.633 1.00 96.66 ? 318 ARG D CB  1 
ATOM 10294 C CG  . ARG D 1 318 ? 28.563  -46.006 -16.260 1.00 96.66 ? 318 ARG D CG  1 
ATOM 10295 C CD  . ARG D 1 318 ? 28.694  -47.430 -15.775 1.00 96.66 ? 318 ARG D CD  1 
ATOM 10296 N NE  . ARG D 1 318 ? 29.273  -47.455 -14.430 1.00 96.66 ? 318 ARG D NE  1 
ATOM 10297 C CZ  . ARG D 1 318 ? 29.639  -48.556 -13.775 1.00 96.66 ? 318 ARG D CZ  1 
ATOM 10298 N NH1 . ARG D 1 318 ? 29.493  -49.752 -14.339 1.00 96.66 ? 318 ARG D NH1 1 
ATOM 10299 N NH2 . ARG D 1 318 ? 30.150  -48.463 -12.551 1.00 96.66 ? 318 ARG D NH2 1 
ATOM 10300 N N   . ASP D 1 319 ? 30.042  -44.258 -19.554 1.00 74.18 ? 319 ASP D N   1 
ATOM 10301 C CA  . ASP D 1 319 ? 31.445  -43.961 -19.827 1.00 74.18 ? 319 ASP D CA  1 
ATOM 10302 C C   . ASP D 1 319 ? 31.667  -42.460 -19.860 1.00 74.18 ? 319 ASP D C   1 
ATOM 10303 O O   . ASP D 1 319 ? 32.639  -41.950 -19.293 1.00 74.18 ? 319 ASP D O   1 
ATOM 10304 C CB  . ASP D 1 319 ? 31.884  -44.557 -21.168 1.00 95.30 ? 319 ASP D CB  1 
ATOM 10305 C CG  . ASP D 1 319 ? 30.768  -45.304 -21.869 1.00 95.30 ? 319 ASP D CG  1 
ATOM 10306 O OD1 . ASP D 1 319 ? 30.219  -46.250 -21.264 1.00 95.30 ? 319 ASP D OD1 1 
ATOM 10307 O OD2 . ASP D 1 319 ? 30.448  -44.950 -23.028 1.00 95.30 ? 319 ASP D OD2 1 
ATOM 10308 N N   . ASN D 1 320 ? 30.753  -41.756 -20.522 1.00 50.01 ? 320 ASN D N   1 
ATOM 10309 C CA  . ASN D 1 320 ? 30.844  -40.307 -20.650 1.00 50.01 ? 320 ASN D CA  1 
ATOM 10310 C C   . ASN D 1 320 ? 30.707  -39.567 -19.317 1.00 50.01 ? 320 ASN D C   1 
ATOM 10311 O O   . ASN D 1 320 ? 30.875  -38.347 -19.258 1.00 50.01 ? 320 ASN D O   1 
ATOM 10312 C CB  . ASN D 1 320 ? 29.787  -39.821 -21.633 1.00 67.18 ? 320 ASN D CB  1 
ATOM 10313 C CG  . ASN D 1 320 ? 29.930  -40.468 -22.990 1.00 67.18 ? 320 ASN D CG  1 
ATOM 10314 O OD1 . ASN D 1 320 ? 29.117  -40.245 -23.883 1.00 67.18 ? 320 ASN D OD1 1 
ATOM 10315 N ND2 . ASN D 1 320 ? 30.975  -41.278 -23.154 1.00 67.18 ? 320 ASN D ND2 1 
ATOM 10316 N N   . ALA D 1 321 ? 30.417  -40.314 -18.254 1.00 49.86 ? 321 ALA D N   1 
ATOM 10317 C CA  . ALA D 1 321 ? 30.264  -39.748 -16.917 1.00 49.86 ? 321 ALA D CA  1 
ATOM 10318 C C   . ALA D 1 321 ? 31.378  -38.762 -16.544 1.00 49.86 ? 321 ALA D C   1 
ATOM 10319 O O   . ALA D 1 321 ? 31.114  -37.592 -16.241 1.00 49.86 ? 321 ALA D O   1 
ATOM 10320 C CB  . ALA D 1 321 ? 30.213  -40.870 -15.897 1.00 36.69 ? 321 ALA D CB  1 
ATOM 10321 N N   . GLY D 1 322 ? 32.620  -39.246 -16.567 1.00 37.78 ? 322 GLY D N   1 
ATOM 10322 C CA  . GLY D 1 322 ? 33.762  -38.416 -16.219 1.00 37.78 ? 322 GLY D CA  1 
ATOM 10323 C C   . GLY D 1 322 ? 33.919  -37.180 -17.083 1.00 37.78 ? 322 GLY D C   1 
ATOM 10324 O O   . GLY D 1 322 ? 34.283  -36.109 -16.594 1.00 37.78 ? 322 GLY D O   1 
ATOM 10325 N N   . ALA D 1 323 ? 33.655  -37.327 -18.376 1.00 47.34 ? 323 ALA D N   1 
ATOM 10326 C CA  . ALA D 1 323 ? 33.760  -36.205 -19.294 1.00 47.34 ? 323 ALA D CA  1 
ATOM 10327 C C   . ALA D 1 323 ? 32.703  -35.178 -18.918 1.00 47.34 ? 323 ALA D C   1 
ATOM 10328 O O   . ALA D 1 323 ? 32.973  -33.976 -18.867 1.00 47.34 ? 323 ALA D O   1 
ATOM 10329 C CB  . ALA D 1 323 ? 33.538  -36.679 -20.714 1.00 37.01 ? 323 ALA D CB  1 
ATOM 10330 N N   . ALA D 1 324 ? 31.493  -35.666 -18.664 1.00 48.60 ? 324 ALA D N   1 
ATOM 10331 C CA  . ALA D 1 324 ? 30.384  -34.812 -18.282 1.00 48.60 ? 324 ALA D CA  1 
ATOM 10332 C C   . ALA D 1 324 ? 30.786  -34.033 -17.043 1.00 48.60 ? 324 ALA D C   1 
ATOM 10333 O O   . ALA D 1 324 ? 30.661  -32.810 -16.996 1.00 48.60 ? 324 ALA D O   1 
ATOM 10334 C CB  . ALA D 1 324 ? 29.165  -35.656 -17.996 1.00 32.68 ? 324 ALA D CB  1 
ATOM 10335 N N   . THR D 1 325 ? 31.280  -34.752 -16.041 1.00 31.08 ? 325 THR D N   1 
ATOM 10336 C CA  . THR D 1 325 ? 31.711  -34.133 -14.795 1.00 31.08 ? 325 THR D CA  1 
ATOM 10337 C C   . THR D 1 325 ? 32.757  -33.056 -15.044 1.00 31.08 ? 325 THR D C   1 
ATOM 10338 O O   . THR D 1 325 ? 32.804  -32.045 -14.344 1.00 31.08 ? 325 THR D O   1 
ATOM 10339 C CB  . THR D 1 325 ? 32.312  -35.166 -13.841 1.00 24.25 ? 325 THR D CB  1 
ATOM 10340 O OG1 . THR D 1 325 ? 31.365  -36.222 -13.635 1.00 24.25 ? 325 THR D OG1 1 
ATOM 10341 C CG2 . THR D 1 325 ? 32.661  -34.522 -12.497 1.00 24.25 ? 325 THR D CG2 1 
ATOM 10342 N N   . GLU D 1 326 ? 33.611  -33.282 -16.036 1.00 33.77 ? 326 GLU D N   1 
ATOM 10343 C CA  . GLU D 1 326 ? 34.641  -32.305 -16.364 1.00 33.77 ? 326 GLU D CA  1 
ATOM 10344 C C   . GLU D 1 326 ? 33.998  -31.054 -16.934 1.00 33.77 ? 326 GLU D C   1 
ATOM 10345 O O   . GLU D 1 326 ? 34.328  -29.936 -16.531 1.00 33.77 ? 326 GLU D O   1 
ATOM 10346 C CB  . GLU D 1 326 ? 35.635  -32.870 -17.383 1.00 51.41 ? 326 GLU D CB  1 
ATOM 10347 C CG  . GLU D 1 326 ? 36.676  -33.803 -16.792 1.00 51.41 ? 326 GLU D CG  1 
ATOM 10348 C CD  . GLU D 1 326 ? 37.461  -33.162 -15.658 1.00 51.41 ? 326 GLU D CD  1 
ATOM 10349 O OE1 . GLU D 1 326 ? 38.091  -32.100 -15.873 1.00 51.41 ? 326 GLU D OE1 1 
ATOM 10350 O OE2 . GLU D 1 326 ? 37.445  -33.733 -14.547 1.00 51.41 ? 326 GLU D OE2 1 
ATOM 10351 N N   . GLU D 1 327 ? 33.078  -31.247 -17.872 1.00 43.59 ? 327 GLU D N   1 
ATOM 10352 C CA  . GLU D 1 327 ? 32.403  -30.123 -18.495 1.00 43.59 ? 327 GLU D CA  1 
ATOM 10353 C C   . GLU D 1 327 ? 31.788  -29.224 -17.431 1.00 43.59 ? 327 GLU D C   1 
ATOM 10354 O O   . GLU D 1 327 ? 31.829  -27.997 -17.547 1.00 43.59 ? 327 GLU D O   1 
ATOM 10355 C CB  . GLU D 1 327 ? 31.339  -30.627 -19.467 1.00 62.31 ? 327 GLU D CB  1 
ATOM 10356 C CG  . GLU D 1 327 ? 31.483  -30.007 -20.841 1.00 62.31 ? 327 GLU D CG  1 
ATOM 10357 C CD  . GLU D 1 327 ? 32.870  -30.211 -21.426 1.00 62.31 ? 327 GLU D CD  1 
ATOM 10358 O OE1 . GLU D 1 327 ? 33.198  -29.568 -22.448 1.00 62.31 ? 327 GLU D OE1 1 
ATOM 10359 O OE2 . GLU D 1 327 ? 33.630  -31.024 -20.865 1.00 62.31 ? 327 GLU D OE2 1 
ATOM 10360 N N   . PHE D 1 328 ? 31.237  -29.843 -16.389 1.00 32.24 ? 328 PHE D N   1 
ATOM 10361 C CA  . PHE D 1 328 ? 30.628  -29.111 -15.287 1.00 32.24 ? 328 PHE D CA  1 
ATOM 10362 C C   . PHE D 1 328 ? 31.699  -28.351 -14.503 1.00 32.24 ? 328 PHE D C   1 
ATOM 10363 O O   . PHE D 1 328 ? 31.656  -27.119 -14.407 1.00 32.24 ? 328 PHE D O   1 
ATOM 10364 C CB  . PHE D 1 328 ? 29.870  -30.083 -14.369 1.00 22.69 ? 328 PHE D CB  1 
ATOM 10365 C CG  . PHE D 1 328 ? 29.564  -29.527 -12.994 1.00 22.69 ? 328 PHE D CG  1 
ATOM 10366 C CD1 . PHE D 1 328 ? 28.962  -28.279 -12.842 1.00 22.69 ? 328 PHE D CD1 1 
ATOM 10367 C CD2 . PHE D 1 328 ? 29.894  -30.254 -11.847 1.00 22.69 ? 328 PHE D CD2 1 
ATOM 10368 C CE1 . PHE D 1 328 ? 28.698  -27.760 -11.564 1.00 22.69 ? 328 PHE D CE1 1 
ATOM 10369 C CE2 . PHE D 1 328 ? 29.634  -29.745 -10.571 1.00 22.69 ? 328 PHE D CE2 1 
ATOM 10370 C CZ  . PHE D 1 328 ? 29.036  -28.494 -10.431 1.00 22.69 ? 328 PHE D CZ  1 
ATOM 10371 N N   . ILE D 1 329 ? 32.661  -29.087 -13.951 1.00 29.55 ? 329 ILE D N   1 
ATOM 10372 C CA  . ILE D 1 329 ? 33.740  -28.471 -13.185 1.00 29.55 ? 329 ILE D CA  1 
ATOM 10373 C C   . ILE D 1 329 ? 34.346  -27.300 -13.951 1.00 29.55 ? 329 ILE D C   1 
ATOM 10374 O O   . ILE D 1 329 ? 34.733  -26.293 -13.355 1.00 29.55 ? 329 ILE D O   1 
ATOM 10375 C CB  . ILE D 1 329 ? 34.863  -29.482 -12.866 1.00 25.56 ? 329 ILE D CB  1 
ATOM 10376 C CG1 . ILE D 1 329 ? 34.287  -30.665 -12.083 1.00 25.56 ? 329 ILE D CG1 1 
ATOM 10377 C CG2 . ILE D 1 329 ? 35.964  -28.795 -12.060 1.00 25.56 ? 329 ILE D CG2 1 
ATOM 10378 C CD1 . ILE D 1 329 ? 35.323  -31.660 -11.594 1.00 25.56 ? 329 ILE D CD1 1 
ATOM 10379 N N   . LYS D 1 330 ? 34.424  -27.430 -15.274 1.00 33.76 ? 330 LYS D N   1 
ATOM 10380 C CA  . LYS D 1 330 ? 34.988  -26.369 -16.101 1.00 33.76 ? 330 LYS D CA  1 
ATOM 10381 C C   . LYS D 1 330 ? 34.169  -25.094 -15.929 1.00 33.76 ? 330 LYS D C   1 
ATOM 10382 O O   . LYS D 1 330 ? 34.690  -24.069 -15.492 1.00 33.76 ? 330 LYS D O   1 
ATOM 10383 C CB  . LYS D 1 330 ? 35.020  -26.787 -17.578 1.00 79.06 ? 330 LYS D CB  1 
ATOM 10384 C CG  . LYS D 1 330 ? 35.909  -25.896 -18.449 1.00 79.06 ? 330 LYS D CG  1 
ATOM 10385 C CD  . LYS D 1 330 ? 35.955  -26.343 -19.919 1.00 79.06 ? 330 LYS D CD  1 
ATOM 10386 C CE  . LYS D 1 330 ? 36.611  -27.721 -20.107 1.00 79.06 ? 330 LYS D CE  1 
ATOM 10387 N NZ  . LYS D 1 330 ? 36.701  -28.124 -21.550 1.00 79.06 ? 330 LYS D NZ  1 
ATOM 10388 N N   . ARG D 1 331 ? 32.880  -25.170 -16.249 1.00 35.22 ? 331 ARG D N   1 
ATOM 10389 C CA  . ARG D 1 331 ? 31.995  -24.018 -16.131 1.00 35.22 ? 331 ARG D CA  1 
ATOM 10390 C C   . ARG D 1 331 ? 31.938  -23.525 -14.687 1.00 35.22 ? 331 ARG D C   1 
ATOM 10391 O O   . ARG D 1 331 ? 31.917  -22.319 -14.434 1.00 35.22 ? 331 ARG D O   1 
ATOM 10392 C CB  . ARG D 1 331 ? 30.597  -24.388 -16.602 1.00 35.99 ? 331 ARG D CB  1 
ATOM 10393 C CG  . ARG D 1 331 ? 30.591  -25.096 -17.924 1.00 35.99 ? 331 ARG D CG  1 
ATOM 10394 C CD  . ARG D 1 331 ? 30.286  -24.169 -19.073 1.00 35.99 ? 331 ARG D CD  1 
ATOM 10395 N NE  . ARG D 1 331 ? 31.291  -23.137 -19.315 1.00 35.99 ? 331 ARG D NE  1 
ATOM 10396 C CZ  . ARG D 1 331 ? 31.122  -21.850 -19.025 1.00 35.99 ? 331 ARG D CZ  1 
ATOM 10397 N NH1 . ARG D 1 331 ? 29.982  -21.431 -18.467 1.00 35.99 ? 331 ARG D NH1 1 
ATOM 10398 N NH2 . ARG D 1 331 ? 32.071  -20.974 -19.329 1.00 35.99 ? 331 ARG D NH2 1 
ATOM 10399 N N   . ALA D 1 332 ? 31.910  -24.452 -13.737 1.00 27.05 ? 332 ALA D N   1 
ATOM 10400 C CA  . ALA D 1 332 ? 31.863  -24.064 -12.336 1.00 27.05 ? 332 ALA D CA  1 
ATOM 10401 C C   . ALA D 1 332 ? 33.072  -23.189 -11.998 1.00 27.05 ? 332 ALA D C   1 
ATOM 10402 O O   . ALA D 1 332 ? 32.960  -22.190 -11.283 1.00 27.05 ? 332 ALA D O   1 
ATOM 10403 C CB  . ALA D 1 332 ? 31.842  -25.299 -11.451 1.00 26.97 ? 332 ALA D CB  1 
ATOM 10404 N N   . GLU D 1 333 ? 34.231  -23.559 -12.527 1.00 32.34 ? 333 GLU D N   1 
ATOM 10405 C CA  . GLU D 1 333 ? 35.439  -22.806 -12.256 1.00 32.34 ? 333 GLU D CA  1 
ATOM 10406 C C   . GLU D 1 333 ? 35.452  -21.447 -12.928 1.00 32.34 ? 333 GLU D C   1 
ATOM 10407 O O   . GLU D 1 333 ? 35.748  -20.435 -12.285 1.00 32.34 ? 333 GLU D O   1 
ATOM 10408 C CB  . GLU D 1 333 ? 36.657  -23.624 -12.664 1.00 48.62 ? 333 GLU D CB  1 
ATOM 10409 C CG  . GLU D 1 333 ? 37.143  -24.523 -11.540 1.00 48.62 ? 333 GLU D CG  1 
ATOM 10410 C CD  . GLU D 1 333 ? 38.141  -25.563 -11.995 1.00 48.62 ? 333 GLU D CD  1 
ATOM 10411 O OE1 . GLU D 1 333 ? 38.749  -26.220 -11.123 1.00 48.62 ? 333 GLU D OE1 1 
ATOM 10412 O OE2 . GLU D 1 333 ? 38.309  -25.734 -13.220 1.00 48.62 ? 333 GLU D OE2 1 
ATOM 10413 N N   . VAL D 1 334 ? 35.122  -21.408 -14.214 1.00 27.43 ? 334 VAL D N   1 
ATOM 10414 C CA  . VAL D 1 334 ? 35.118  -20.135 -14.922 1.00 27.43 ? 334 VAL D CA  1 
ATOM 10415 C C   . VAL D 1 334 ? 34.154  -19.153 -14.273 1.00 27.43 ? 334 VAL D C   1 
ATOM 10416 O O   . VAL D 1 334 ? 34.490  -17.982 -14.087 1.00 27.43 ? 334 VAL D O   1 
ATOM 10417 C CB  . VAL D 1 334 ? 34.758  -20.301 -16.432 1.00 17.58 ? 334 VAL D CB  1 
ATOM 10418 C CG1 . VAL D 1 334 ? 34.006  -21.582 -16.649 1.00 17.58 ? 334 VAL D CG1 1 
ATOM 10419 C CG2 . VAL D 1 334 ? 33.920  -19.119 -16.916 1.00 17.58 ? 334 VAL D CG2 1 
ATOM 10420 N N   . ASN D 1 335 ? 32.962  -19.623 -13.918 1.00 31.54 ? 335 ASN D N   1 
ATOM 10421 C CA  . ASN D 1 335 ? 31.988  -18.736 -13.301 1.00 31.54 ? 335 ASN D CA  1 
ATOM 10422 C C   . ASN D 1 335 ? 32.474  -18.307 -11.938 1.00 31.54 ? 335 ASN D C   1 
ATOM 10423 O O   . ASN D 1 335 ? 32.152  -17.215 -11.476 1.00 31.54 ? 335 ASN D O   1 
ATOM 10424 C CB  . ASN D 1 335 ? 30.614  -19.406 -13.229 1.00 33.72 ? 335 ASN D CB  1 
ATOM 10425 C CG  . ASN D 1 335 ? 29.919  -19.428 -14.585 1.00 33.72 ? 335 ASN D CG  1 
ATOM 10426 O OD1 . ASN D 1 335 ? 29.754  -18.384 -15.223 1.00 33.72 ? 335 ASN D OD1 1 
ATOM 10427 N ND2 . ASN D 1 335 ? 29.517  -20.612 -15.036 1.00 33.72 ? 335 ASN D ND2 1 
ATOM 10428 N N   . GLY D 1 336 ? 33.269  -19.161 -11.304 1.00 30.02 ? 336 GLY D N   1 
ATOM 10429 C CA  . GLY D 1 336 ? 33.818  -18.819 -10.004 1.00 30.02 ? 336 GLY D CA  1 
ATOM 10430 C C   . GLY D 1 336 ? 34.772  -17.650 -10.190 1.00 30.02 ? 336 GLY D C   1 
ATOM 10431 O O   . GLY D 1 336 ? 35.004  -16.858 -9.273  1.00 30.02 ? 336 GLY D O   1 
ATOM 10432 N N   . LEU D 1 337 ? 35.335  -17.552 -11.393 1.00 29.38 ? 337 LEU D N   1 
ATOM 10433 C CA  . LEU D 1 337 ? 36.250  -16.469 -11.729 1.00 29.38 ? 337 LEU D CA  1 
ATOM 10434 C C   . LEU D 1 337 ? 35.443  -15.241 -12.104 1.00 29.38 ? 337 LEU D C   1 
ATOM 10435 O O   . LEU D 1 337 ? 35.739  -14.134 -11.658 1.00 29.38 ? 337 LEU D O   1 
ATOM 10436 C CB  . LEU D 1 337 ? 37.136  -16.853 -12.911 1.00 25.06 ? 337 LEU D CB  1 
ATOM 10437 C CG  . LEU D 1 337 ? 38.287  -17.832 -12.683 1.00 25.06 ? 337 LEU D CG  1 
ATOM 10438 C CD1 . LEU D 1 337 ? 38.999  -18.043 -14.007 1.00 25.06 ? 337 LEU D CD1 1 
ATOM 10439 C CD2 . LEU D 1 337 ? 39.251  -17.291 -11.628 1.00 25.06 ? 337 LEU D CD2 1 
ATOM 10440 N N   . ALA D 1 338 ? 34.429  -15.447 -12.941 1.00 35.35 ? 338 ALA D N   1 
ATOM 10441 C CA  . ALA D 1 338 ? 33.561  -14.362 -13.376 1.00 35.35 ? 338 ALA D CA  1 
ATOM 10442 C C   . ALA D 1 338 ? 32.925  -13.709 -12.156 1.00 35.35 ? 338 ALA D C   1 
ATOM 10443 O O   . ALA D 1 338 ? 32.573  -12.531 -12.178 1.00 35.35 ? 338 ALA D O   1 
ATOM 10444 C CB  . ALA D 1 338 ? 32.487  -14.894 -14.296 1.00 18.74 ? 338 ALA D CB  1 
ATOM 10445 N N   . ALA D 1 339 ? 32.784  -14.488 -11.090 1.00 28.84 ? 339 ALA D N   1 
ATOM 10446 C CA  . ALA D 1 339 ? 32.197  -14.000 -9.853  1.00 28.84 ? 339 ALA D CA  1 
ATOM 10447 C C   . ALA D 1 339 ? 33.147  -13.049 -9.139  1.00 28.84 ? 339 ALA D C   1 
ATOM 10448 O O   . ALA D 1 339 ? 32.839  -12.563 -8.048  1.00 28.84 ? 339 ALA D O   1 
ATOM 10449 C CB  . ALA D 1 339 ? 31.855  -15.166 -8.943  1.00 30.10 ? 339 ALA D CB  1 
ATOM 10450 N N   . GLN D 1 340 ? 34.307  -12.796 -9.741  1.00 41.60 ? 340 GLN D N   1 
ATOM 10451 C CA  . GLN D 1 340 ? 35.293  -11.889 -9.157  1.00 41.60 ? 340 GLN D CA  1 
ATOM 10452 C C   . GLN D 1 340 ? 35.810  -10.970 -10.248 1.00 41.60 ? 340 GLN D C   1 
ATOM 10453 O O   . GLN D 1 340 ? 36.772  -10.227 -10.041 1.00 41.60 ? 340 GLN D O   1 
ATOM 10454 C CB  . GLN D 1 340 ? 36.466  -12.662 -8.574  1.00 54.60 ? 340 GLN D CB  1 
ATOM 10455 C CG  . GLN D 1 340 ? 36.074  -13.889 -7.805  1.00 54.60 ? 340 GLN D CG  1 
ATOM 10456 C CD  . GLN D 1 340 ? 37.278  -14.608 -7.247  1.00 54.60 ? 340 GLN D CD  1 
ATOM 10457 O OE1 . GLN D 1 340 ? 37.984  -14.074 -6.390  1.00 54.60 ? 340 GLN D OE1 1 
ATOM 10458 N NE2 . GLN D 1 340 ? 37.531  -15.824 -7.734  1.00 54.60 ? 340 GLN D NE2 1 
ATOM 10459 N N   . GLY D 1 341 ? 35.173  -11.044 -11.414 1.00 50.56 ? 341 GLY D N   1 
ATOM 10460 C CA  . GLY D 1 341 ? 35.558  -10.216 -12.542 1.00 50.56 ? 341 GLY D CA  1 
ATOM 10461 C C   . GLY D 1 341 ? 36.904  -10.595 -13.114 1.00 50.56 ? 341 GLY D C   1 
ATOM 10462 O O   . GLY D 1 341 ? 37.430  -9.928  -14.008 1.00 50.56 ? 341 GLY D O   1 
ATOM 10463 N N   . LYS D 1 342 ? 37.470  -11.675 -12.598 1.00 37.53 ? 342 LYS D N   1 
ATOM 10464 C CA  . LYS D 1 342 ? 38.766  -12.119 -13.071 1.00 37.53 ? 342 LYS D CA  1 
ATOM 10465 C C   . LYS D 1 342 ? 38.675  -13.340 -13.972 1.00 37.53 ? 342 LYS D C   1 
ATOM 10466 O O   . LYS D 1 342 ? 39.274  -14.375 -13.699 1.00 37.53 ? 342 LYS D O   1 
ATOM 10467 C CB  . LYS D 1 342 ? 39.700  -12.385 -11.883 1.00 49.78 ? 342 LYS D CB  1 
ATOM 10468 C CG  . LYS D 1 342 ? 39.136  -13.307 -10.832 1.00 49.78 ? 342 LYS D CG  1 
ATOM 10469 C CD  . LYS D 1 342 ? 40.121  -13.517 -9.685  1.00 49.78 ? 342 LYS D CD  1 
ATOM 10470 C CE  . LYS D 1 342 ? 40.405  -12.226 -8.917  1.00 49.78 ? 342 LYS D CE  1 
ATOM 10471 N NZ  . LYS D 1 342 ? 41.282  -12.481 -7.728  1.00 49.78 ? 342 LYS D NZ  1 
ATOM 10472 N N   . TYR D 1 343 ? 37.913  -13.215 -15.048 1.00 41.63 ? 343 TYR D N   1 
ATOM 10473 C CA  . TYR D 1 343 ? 37.771  -14.302 -16.002 1.00 41.63 ? 343 TYR D CA  1 
ATOM 10474 C C   . TYR D 1 343 ? 38.092  -13.738 -17.365 1.00 41.63 ? 343 TYR D C   1 
ATOM 10475 O O   . TYR D 1 343 ? 37.468  -12.769 -17.790 1.00 41.63 ? 343 TYR D O   1 
ATOM 10476 C CB  . TYR D 1 343 ? 36.344  -14.838 -16.025 1.00 39.38 ? 343 TYR D CB  1 
ATOM 10477 C CG  . TYR D 1 343 ? 36.072  -15.725 -17.225 1.00 39.38 ? 343 TYR D CG  1 
ATOM 10478 C CD1 . TYR D 1 343 ? 36.711  -16.957 -17.370 1.00 39.38 ? 343 TYR D CD1 1 
ATOM 10479 C CD2 . TYR D 1 343 ? 35.183  -15.330 -18.224 1.00 39.38 ? 343 TYR D CD2 1 
ATOM 10480 C CE1 . TYR D 1 343 ? 36.468  -17.774 -18.479 1.00 39.38 ? 343 TYR D CE1 1 
ATOM 10481 C CE2 . TYR D 1 343 ? 34.932  -16.142 -19.338 1.00 39.38 ? 343 TYR D CE2 1 
ATOM 10482 C CZ  . TYR D 1 343 ? 35.577  -17.362 -19.455 1.00 39.38 ? 343 TYR D CZ  1 
ATOM 10483 O OH  . TYR D 1 343 ? 35.315  -18.176 -20.532 1.00 39.38 ? 343 TYR D OH  1 
ATOM 10484 N N   . GLU D 1 344 ? 39.055  -14.336 -18.055 1.00 65.49 ? 344 GLU D N   1 
ATOM 10485 C CA  . GLU D 1 344 ? 39.419  -13.855 -19.381 1.00 68.90 ? 344 GLU D CA  1 
ATOM 10486 C C   . GLU D 1 344 ? 38.942  -14.844 -20.450 1.00 70.86 ? 344 GLU D C   1 
ATOM 10487 O O   . GLU D 1 344 ? 38.709  -16.026 -20.111 1.00 70.96 ? 344 GLU D O   1 
ATOM 10488 C CB  . GLU D 1 344 ? 40.937  -13.679 -19.465 1.00 99.51 ? 344 GLU D CB  1 
ATOM 10489 C CG  . GLU D 1 344 ? 41.563  -12.957 -18.254 1.00 88.63 ? 344 GLU D CG  1 
ATOM 10490 C CD  . GLU D 1 344 ? 41.858  -11.451 -18.498 1.00 88.63 ? 344 GLU D CD  1 
ATOM 10491 O OE1 . GLU D 1 344 ? 42.531  -11.125 -19.526 1.00 88.63 ? 344 GLU D OE1 1 
ATOM 10492 O OE2 . GLU D 1 344 ? 41.433  -10.594 -17.658 1.00 88.63 ? 344 GLU D OE2 1 
ATOM 10493 N N   . HIS E 1 3   ? 17.268  48.208  50.587  1.00 96.43 ? 3   HIS E N   1 
ATOM 10494 C CA  . HIS E 1 3   ? 16.665  49.454  50.043  1.00 96.43 ? 3   HIS E CA  1 
ATOM 10495 C C   . HIS E 1 3   ? 16.271  49.295  48.581  1.00 96.43 ? 3   HIS E C   1 
ATOM 10496 O O   . HIS E 1 3   ? 15.903  50.266  47.915  1.00 96.43 ? 3   HIS E O   1 
ATOM 10497 C CB  . HIS E 1 3   ? 17.628  50.645  50.218  1.00 91.83 ? 3   HIS E CB  1 
ATOM 10498 C CG  . HIS E 1 3   ? 19.086  50.286  50.138  1.00 91.83 ? 3   HIS E CG  1 
ATOM 10499 N ND1 . HIS E 1 3   ? 20.083  51.147  50.552  1.00 91.83 ? 3   HIS E ND1 1 
ATOM 10500 C CD2 . HIS E 1 3   ? 19.715  49.167  49.703  1.00 91.83 ? 3   HIS E CD2 1 
ATOM 10501 C CE1 . HIS E 1 3   ? 21.261  50.574  50.378  1.00 91.83 ? 3   HIS E CE1 1 
ATOM 10502 N NE2 . HIS E 1 3   ? 21.065  49.371  49.864  1.00 91.83 ? 3   HIS E NE2 1 
ATOM 10503 N N   . SER E 1 4   ? 16.339  48.056  48.097  1.00 81.35 ? 4   SER E N   1 
ATOM 10504 C CA  . SER E 1 4   ? 15.991  47.731  46.714  1.00 81.35 ? 4   SER E CA  1 
ATOM 10505 C C   . SER E 1 4   ? 14.690  46.920  46.615  1.00 81.35 ? 4   SER E C   1 
ATOM 10506 O O   . SER E 1 4   ? 14.693  45.692  46.753  1.00 81.35 ? 4   SER E O   1 
ATOM 10507 C CB  . SER E 1 4   ? 17.149  46.968  46.044  1.00 93.97 ? 4   SER E CB  1 
ATOM 10508 O OG  . SER E 1 4   ? 17.787  46.064  46.939  1.00 93.97 ? 4   SER E OG  1 
ATOM 10509 N N   . TYR E 1 5   ? 13.579  47.619  46.389  1.00 85.47 ? 5   TYR E N   1 
ATOM 10510 C CA  . TYR E 1 5   ? 12.268  46.982  46.264  1.00 85.47 ? 5   TYR E CA  1 
ATOM 10511 C C   . TYR E 1 5   ? 11.756  47.175  44.839  1.00 85.47 ? 5   TYR E C   1 
ATOM 10512 O O   . TYR E 1 5   ? 10.984  48.098  44.564  1.00 85.47 ? 5   TYR E O   1 
ATOM 10513 C CB  . TYR E 1 5   ? 11.285  47.588  47.267  1.00 87.62 ? 5   TYR E CB  1 
ATOM 10514 C CG  . TYR E 1 5   ? 11.680  47.346  48.703  1.00 87.62 ? 5   TYR E CG  1 
ATOM 10515 C CD1 . TYR E 1 5   ? 12.783  47.992  49.266  1.00 87.62 ? 5   TYR E CD1 1 
ATOM 10516 C CD2 . TYR E 1 5   ? 10.981  46.435  49.487  1.00 87.62 ? 5   TYR E CD2 1 
ATOM 10517 C CE1 . TYR E 1 5   ? 13.183  47.730  50.577  1.00 87.62 ? 5   TYR E CE1 1 
ATOM 10518 C CE2 . TYR E 1 5   ? 11.370  46.164  50.793  1.00 87.62 ? 5   TYR E CE2 1 
ATOM 10519 C CZ  . TYR E 1 5   ? 12.470  46.811  51.333  1.00 87.62 ? 5   TYR E CZ  1 
ATOM 10520 O OH  . TYR E 1 5   ? 12.851  46.518  52.620  1.00 87.62 ? 5   TYR E OH  1 
ATOM 10521 N N   . PRO E 1 6   ? 12.177  46.285  43.921  1.00 57.19 ? 6   PRO E N   1 
ATOM 10522 C CA  . PRO E 1 6   ? 11.839  46.263  42.496  1.00 57.19 ? 6   PRO E CA  1 
ATOM 10523 C C   . PRO E 1 6   ? 10.613  47.060  42.062  1.00 57.19 ? 6   PRO E C   1 
ATOM 10524 O O   . PRO E 1 6   ? 9.467   46.642  42.253  1.00 57.19 ? 6   PRO E O   1 
ATOM 10525 C CB  . PRO E 1 6   ? 11.717  44.775  42.211  1.00 68.88 ? 6   PRO E CB  1 
ATOM 10526 C CG  . PRO E 1 6   ? 12.875  44.246  42.987  1.00 68.88 ? 6   PRO E CG  1 
ATOM 10527 C CD  . PRO E 1 6   ? 12.764  44.990  44.317  1.00 68.88 ? 6   PRO E CD  1 
ATOM 10528 N N   . ALA E 1 7   ? 10.881  48.217  41.466  1.00 53.78 ? 7   ALA E N   1 
ATOM 10529 C CA  . ALA E 1 7   ? 9.827   49.095  40.984  1.00 53.78 ? 7   ALA E CA  1 
ATOM 10530 C C   . ALA E 1 7   ? 9.090   48.434  39.826  1.00 53.78 ? 7   ALA E C   1 
ATOM 10531 O O   . ALA E 1 7   ? 7.863   48.520  39.724  1.00 53.78 ? 7   ALA E O   1 
ATOM 10532 C CB  . ALA E 1 7   ? 10.428  50.419  40.531  1.00 16.90 ? 7   ALA E CB  1 
ATOM 10533 N N   . LEU E 1 8   ? 9.848   47.768  38.960  1.00 34.82 ? 8   LEU E N   1 
ATOM 10534 C CA  . LEU E 1 8   ? 9.279   47.105  37.800  1.00 34.82 ? 8   LEU E CA  1 
ATOM 10535 C C   . LEU E 1 8   ? 9.700   45.656  37.695  1.00 34.82 ? 8   LEU E C   1 
ATOM 10536 O O   . LEU E 1 8   ? 10.815  45.294  38.074  1.00 34.82 ? 8   LEU E O   1 
ATOM 10537 C CB  . LEU E 1 8   ? 9.713   47.822  36.527  1.00 22.47 ? 8   LEU E CB  1 
ATOM 10538 C CG  . LEU E 1 8   ? 9.303   49.283  36.380  1.00 22.47 ? 8   LEU E CG  1 
ATOM 10539 C CD1 . LEU E 1 8   ? 10.022  49.880  35.185  1.00 22.47 ? 8   LEU E CD1 1 
ATOM 10540 C CD2 . LEU E 1 8   ? 7.790   49.388  36.218  1.00 22.47 ? 8   LEU E CD2 1 
ATOM 10541 N N   . SER E 1 9   ? 8.799   44.836  37.163  1.00 31.44 ? 9   SER E N   1 
ATOM 10542 C CA  . SER E 1 9   ? 9.066   43.423  36.963  1.00 31.44 ? 9   SER E CA  1 
ATOM 10543 C C   . SER E 1 9   ? 9.892   43.328  35.696  1.00 31.44 ? 9   SER E C   1 
ATOM 10544 O O   . SER E 1 9   ? 10.042  44.311  34.965  1.00 31.44 ? 9   SER E O   1 
ATOM 10545 C CB  . SER E 1 9   ? 7.772   42.655  36.752  1.00 27.92 ? 9   SER E CB  1 
ATOM 10546 O OG  . SER E 1 9   ? 7.249   42.929  35.469  1.00 27.92 ? 9   SER E OG  1 
ATOM 10547 N N   . ALA E 1 10  ? 10.417  42.141  35.427  1.00 25.48 ? 10  ALA E N   1 
ATOM 10548 C CA  . ALA E 1 10  ? 11.232  41.939  34.236  1.00 25.48 ? 10  ALA E CA  1 
ATOM 10549 C C   . ALA E 1 10  ? 10.387  42.163  32.996  1.00 25.48 ? 10  ALA E C   1 
ATOM 10550 O O   . ALA E 1 10  ? 10.832  42.772  32.026  1.00 25.48 ? 10  ALA E O   1 
ATOM 10551 C CB  . ALA E 1 10  ? 11.800  40.539  34.233  1.00 12.72 ? 10  ALA E CB  1 
ATOM 10552 N N   . GLU E 1 11  ? 9.159   41.665  33.042  1.00 31.95 ? 11  GLU E N   1 
ATOM 10553 C CA  . GLU E 1 11  ? 8.242   41.801  31.925  1.00 31.95 ? 11  GLU E CA  1 
ATOM 10554 C C   . GLU E 1 11  ? 8.025   43.274  31.629  1.00 31.95 ? 11  GLU E C   1 
ATOM 10555 O O   . GLU E 1 11  ? 8.133   43.713  30.486  1.00 31.95 ? 11  GLU E O   1 
ATOM 10556 C CB  . GLU E 1 11  ? 6.906   41.162  32.280  1.00 99.51 ? 11  GLU E CB  1 
ATOM 10557 C CG  . GLU E 1 11  ? 7.021   40.064  33.312  1.00 99.51 ? 11  GLU E CG  1 
ATOM 10558 C CD  . GLU E 1 11  ? 6.674   38.708  32.747  1.00 99.51 ? 11  GLU E CD  1 
ATOM 10559 O OE1 . GLU E 1 11  ? 5.525   38.537  32.271  1.00 99.51 ? 11  GLU E OE1 1 
ATOM 10560 O OE2 . GLU E 1 11  ? 7.552   37.817  32.781  1.00 99.51 ? 11  GLU E OE2 1 
ATOM 10561 N N   . GLN E 1 12  ? 7.722   44.035  32.676  1.00 34.90 ? 12  GLN E N   1 
ATOM 10562 C CA  . GLN E 1 12  ? 7.458   45.461  32.550  1.00 34.90 ? 12  GLN E CA  1 
ATOM 10563 C C   . GLN E 1 12  ? 8.626   46.239  31.978  1.00 34.90 ? 12  GLN E C   1 
ATOM 10564 O O   . GLN E 1 12  ? 8.444   47.084  31.100  1.00 34.90 ? 12  GLN E O   1 
ATOM 10565 C CB  . GLN E 1 12  ? 7.082   46.036  33.905  1.00 42.60 ? 12  GLN E CB  1 
ATOM 10566 C CG  . GLN E 1 12  ? 5.893   45.356  34.528  1.00 42.60 ? 12  GLN E CG  1 
ATOM 10567 C CD  . GLN E 1 12  ? 5.576   45.908  35.888  1.00 42.60 ? 12  GLN E CD  1 
ATOM 10568 O OE1 . GLN E 1 12  ? 6.412   45.892  36.789  1.00 42.60 ? 12  GLN E OE1 1 
ATOM 10569 N NE2 . GLN E 1 12  ? 4.360   46.405  36.050  1.00 42.60 ? 12  GLN E NE2 1 
ATOM 10570 N N   . LYS E 1 13  ? 9.822   45.971  32.489  1.00 36.32 ? 13  LYS E N   1 
ATOM 10571 C CA  . LYS E 1 13  ? 11.000  46.659  31.994  1.00 36.32 ? 13  LYS E CA  1 
ATOM 10572 C C   . LYS E 1 13  ? 11.100  46.404  30.498  1.00 36.32 ? 13  LYS E C   1 
ATOM 10573 O O   . LYS E 1 13  ? 11.404  47.311  29.719  1.00 36.32 ? 13  LYS E O   1 
ATOM 10574 C CB  . LYS E 1 13  ? 12.256  46.137  32.679  1.00 34.25 ? 13  LYS E CB  1 
ATOM 10575 C CG  . LYS E 1 13  ? 12.376  46.438  34.158  1.00 34.25 ? 13  LYS E CG  1 
ATOM 10576 C CD  . LYS E 1 13  ? 13.713  45.910  34.643  1.00 34.25 ? 13  LYS E CD  1 
ATOM 10577 C CE  . LYS E 1 13  ? 13.931  46.098  36.130  1.00 34.25 ? 13  LYS E CE  1 
ATOM 10578 N NZ  . LYS E 1 13  ? 15.312  45.631  36.523  1.00 34.25 ? 13  LYS E NZ  1 
ATOM 10579 N N   . LYS E 1 14  ? 10.839  45.161  30.100  1.00 27.36 ? 14  LYS E N   1 
ATOM 10580 C CA  . LYS E 1 14  ? 10.892  44.773  28.693  1.00 27.36 ? 14  LYS E CA  1 
ATOM 10581 C C   . LYS E 1 14  ? 9.958   45.655  27.879  1.00 27.36 ? 14  LYS E C   1 
ATOM 10582 O O   . LYS E 1 14  ? 10.399  46.365  26.979  1.00 27.36 ? 14  LYS E O   1 
ATOM 10583 C CB  . LYS E 1 14  ? 10.491  43.303  28.529  1.00 63.46 ? 14  LYS E CB  1 
ATOM 10584 C CG  . LYS E 1 14  ? 10.545  42.783  27.095  1.00 63.46 ? 14  LYS E CG  1 
ATOM 10585 C CD  . LYS E 1 14  ? 11.897  43.064  26.452  1.00 63.46 ? 14  LYS E CD  1 
ATOM 10586 C CE  . LYS E 1 14  ? 13.058  42.576  27.333  1.00 63.46 ? 14  LYS E CE  1 
ATOM 10587 N NZ  . LYS E 1 14  ? 14.403  43.093  26.903  1.00 63.46 ? 14  LYS E NZ  1 
ATOM 10588 N N   . GLU E 1 15  ? 8.669   45.620  28.212  1.00 21.49 ? 15  GLU E N   1 
ATOM 10589 C CA  . GLU E 1 15  ? 7.673   46.412  27.504  1.00 21.49 ? 15  GLU E CA  1 
ATOM 10590 C C   . GLU E 1 15  ? 8.090   47.863  27.329  1.00 21.49 ? 15  GLU E C   1 
ATOM 10591 O O   . GLU E 1 15  ? 7.933   48.435  26.249  1.00 21.49 ? 15  GLU E O   1 
ATOM 10592 C CB  . GLU E 1 15  ? 6.327   46.372  28.225  1.00 41.22 ? 15  GLU E CB  1 
ATOM 10593 C CG  . GLU E 1 15  ? 5.344   47.385  27.663  1.00 41.22 ? 15  GLU E CG  1 
ATOM 10594 C CD  . GLU E 1 15  ? 3.962   47.295  28.286  1.00 41.22 ? 15  GLU E CD  1 
ATOM 10595 O OE1 . GLU E 1 15  ? 3.876   47.131  29.526  1.00 41.22 ? 15  GLU E OE1 1 
ATOM 10596 O OE2 . GLU E 1 15  ? 2.963   47.405  27.534  1.00 41.22 ? 15  GLU E OE2 1 
ATOM 10597 N N   . LEU E 1 16  ? 8.615   48.464  28.389  1.00 30.94 ? 16  LEU E N   1 
ATOM 10598 C CA  . LEU E 1 16  ? 9.029   49.853  28.312  1.00 30.94 ? 16  LEU E CA  1 
ATOM 10599 C C   . LEU E 1 16  ? 10.183  50.008  27.331  1.00 30.94 ? 16  LEU E C   1 
ATOM 10600 O O   . LEU E 1 16  ? 10.120  50.825  26.410  1.00 30.94 ? 16  LEU E O   1 
ATOM 10601 C CB  . LEU E 1 16  ? 9.422   50.363  29.702  1.00 18.37 ? 16  LEU E CB  1 
ATOM 10602 C CG  . LEU E 1 16  ? 8.254   50.494  30.690  1.00 18.37 ? 16  LEU E CG  1 
ATOM 10603 C CD1 . LEU E 1 16  ? 8.784   50.771  32.087  1.00 18.37 ? 16  LEU E CD1 1 
ATOM 10604 C CD2 . LEU E 1 16  ? 7.318   51.612  30.235  1.00 18.37 ? 16  LEU E CD2 1 
ATOM 10605 N N   . SER E 1 17  ? 11.226  49.205  27.517  1.00 27.91 ? 17  SER E N   1 
ATOM 10606 C CA  . SER E 1 17  ? 12.387  49.269  26.640  1.00 27.91 ? 17  SER E CA  1 
ATOM 10607 C C   . SER E 1 17  ? 12.011  49.113  25.176  1.00 27.91 ? 17  SER E C   1 
ATOM 10608 O O   . SER E 1 17  ? 12.493  49.862  24.325  1.00 27.91 ? 17  SER E O   1 
ATOM 10609 C CB  . SER E 1 17  ? 13.393  48.192  27.001  1.00 25.50 ? 17  SER E CB  1 
ATOM 10610 O OG  . SER E 1 17  ? 14.476  48.278  26.101  1.00 25.50 ? 17  SER E OG  1 
ATOM 10611 N N   . ASP E 1 18  ? 11.161  48.133  24.882  1.00 26.62 ? 18  ASP E N   1 
ATOM 10612 C CA  . ASP E 1 18  ? 10.728  47.905  23.512  1.00 26.62 ? 18  ASP E CA  1 
ATOM 10613 C C   . ASP E 1 18  ? 10.072  49.174  22.986  1.00 26.62 ? 18  ASP E C   1 
ATOM 10614 O O   . ASP E 1 18  ? 10.541  49.762  22.013  1.00 26.62 ? 18  ASP E O   1 
ATOM 10615 C CB  . ASP E 1 18  ? 9.749   46.729  23.435  1.00 48.84 ? 18  ASP E CB  1 
ATOM 10616 C CG  . ASP E 1 18  ? 10.401  45.389  23.799  1.00 48.84 ? 18  ASP E CG  1 
ATOM 10617 O OD1 . ASP E 1 18  ? 11.646  45.262  23.669  1.00 48.84 ? 18  ASP E OD1 1 
ATOM 10618 O OD2 . ASP E 1 18  ? 9.665   44.455  24.201  1.00 48.84 ? 18  ASP E OD2 1 
ATOM 10619 N N   . ILE E 1 19  ? 9.002   49.607  23.641  1.00 19.21 ? 19  ILE E N   1 
ATOM 10620 C CA  . ILE E 1 19  ? 8.310   50.820  23.230  1.00 19.21 ? 19  ILE E CA  1 
ATOM 10621 C C   . ILE E 1 19  ? 9.288   51.953  22.954  1.00 19.21 ? 19  ILE E C   1 
ATOM 10622 O O   . ILE E 1 19  ? 9.184   52.647  21.950  1.00 19.21 ? 19  ILE E O   1 
ATOM 10623 C CB  . ILE E 1 19  ? 7.346   51.300  24.316  1.00 8.45  ? 19  ILE E CB  1 
ATOM 10624 C CG1 . ILE E 1 19  ? 6.297   50.229  24.574  1.00 8.45  ? 19  ILE E CG1 1 
ATOM 10625 C CG2 . ILE E 1 19  ? 6.697   52.608  23.898  1.00 8.45  ? 19  ILE E CG2 1 
ATOM 10626 C CD1 . ILE E 1 19  ? 5.265   50.627  25.597  1.00 8.45  ? 19  ILE E CD1 1 
ATOM 10627 N N   . ALA E 1 20  ? 10.240  52.142  23.856  1.00 29.37 ? 20  ALA E N   1 
ATOM 10628 C CA  . ALA E 1 20  ? 11.211  53.209  23.698  1.00 29.37 ? 20  ALA E CA  1 
ATOM 10629 C C   . ALA E 1 20  ? 11.981  53.075  22.398  1.00 29.37 ? 20  ALA E C   1 
ATOM 10630 O O   . ALA E 1 20  ? 12.059  54.017  21.606  1.00 29.37 ? 20  ALA E O   1 
ATOM 10631 C CB  . ALA E 1 20  ? 12.171  53.210  24.863  1.00 27.16 ? 20  ALA E CB  1 
ATOM 10632 N N   . LEU E 1 21  ? 12.550  51.895  22.186  1.00 34.30 ? 21  LEU E N   1 
ATOM 10633 C CA  . LEU E 1 21  ? 13.336  51.624  20.992  1.00 34.30 ? 21  LEU E CA  1 
ATOM 10634 C C   . LEU E 1 21  ? 12.555  51.749  19.692  1.00 34.30 ? 21  LEU E C   1 
ATOM 10635 O O   . LEU E 1 21  ? 13.099  52.193  18.683  1.00 34.30 ? 21  LEU E O   1 
ATOM 10636 C CB  . LEU E 1 21  ? 13.952  50.238  21.095  1.00 8.52  ? 21  LEU E CB  1 
ATOM 10637 C CG  . LEU E 1 21  ? 14.965  50.147  22.236  1.00 8.52  ? 21  LEU E CG  1 
ATOM 10638 C CD1 . LEU E 1 21  ? 15.297  48.700  22.528  1.00 8.52  ? 21  LEU E CD1 1 
ATOM 10639 C CD2 . LEU E 1 21  ? 16.204  50.938  21.873  1.00 8.52  ? 21  LEU E CD2 1 
ATOM 10640 N N   . ARG E 1 22  ? 11.285  51.357  19.702  1.00 30.02 ? 22  ARG E N   1 
ATOM 10641 C CA  . ARG E 1 22  ? 10.483  51.468  18.495  1.00 30.02 ? 22  ARG E CA  1 
ATOM 10642 C C   . ARG E 1 22  ? 10.392  52.922  18.091  1.00 30.02 ? 22  ARG E C   1 
ATOM 10643 O O   . ARG E 1 22  ? 10.539  53.267  16.918  1.00 30.02 ? 22  ARG E O   1 
ATOM 10644 C CB  . ARG E 1 22  ? 9.077   50.932  18.721  1.00 51.33 ? 22  ARG E CB  1 
ATOM 10645 C CG  . ARG E 1 22  ? 9.015   49.443  18.937  1.00 51.33 ? 22  ARG E CG  1 
ATOM 10646 C CD  . ARG E 1 22  ? 7.586   49.043  19.129  1.00 51.33 ? 22  ARG E CD  1 
ATOM 10647 N NE  . ARG E 1 22  ? 6.772   49.582  18.046  1.00 51.33 ? 22  ARG E NE  1 
ATOM 10648 C CZ  . ARG E 1 22  ? 5.453   49.738  18.115  1.00 51.33 ? 22  ARG E CZ  1 
ATOM 10649 N NH1 . ARG E 1 22  ? 4.805   49.398  19.228  1.00 51.33 ? 22  ARG E NH1 1 
ATOM 10650 N NH2 . ARG E 1 22  ? 4.779   50.226  17.075  1.00 51.33 ? 22  ARG E NH2 1 
ATOM 10651 N N   . ILE E 1 23  ? 10.154  53.779  19.073  1.00 30.88 ? 23  ILE E N   1 
ATOM 10652 C CA  . ILE E 1 23  ? 10.025  55.199  18.817  1.00 30.88 ? 23  ILE E CA  1 
ATOM 10653 C C   . ILE E 1 23  ? 11.284  55.799  18.201  1.00 30.88 ? 23  ILE E C   1 
ATOM 10654 O O   . ILE E 1 23  ? 11.199  56.492  17.195  1.00 30.88 ? 23  ILE E O   1 
ATOM 10655 C CB  . ILE E 1 23  ? 9.658   55.951  20.113  1.00 20.53 ? 23  ILE E CB  1 
ATOM 10656 C CG1 . ILE E 1 23  ? 8.355   55.377  20.673  1.00 20.53 ? 23  ILE E CG1 1 
ATOM 10657 C CG2 . ILE E 1 23  ? 9.507   57.442  19.838  1.00 20.53 ? 23  ILE E CG2 1 
ATOM 10658 C CD1 . ILE E 1 23  ? 7.945   55.947  22.004  1.00 20.53 ? 23  ILE E CD1 1 
ATOM 10659 N N   . VAL E 1 24  ? 12.450  55.530  18.776  1.00 35.21 ? 24  VAL E N   1 
ATOM 10660 C CA  . VAL E 1 24  ? 13.668  56.109  18.225  1.00 35.21 ? 24  VAL E CA  1 
ATOM 10661 C C   . VAL E 1 24  ? 14.404  55.252  17.212  1.00 35.21 ? 24  VAL E C   1 
ATOM 10662 O O   . VAL E 1 24  ? 15.572  55.500  16.918  1.00 35.21 ? 24  VAL E O   1 
ATOM 10663 C CB  . VAL E 1 24  ? 14.649  56.512  19.333  1.00 20.36 ? 24  VAL E CB  1 
ATOM 10664 C CG1 . VAL E 1 24  ? 14.090  57.703  20.084  1.00 20.36 ? 24  VAL E CG1 1 
ATOM 10665 C CG2 . VAL E 1 24  ? 14.893  55.351  20.272  1.00 20.36 ? 24  VAL E CG2 1 
ATOM 10666 N N   . ALA E 1 25  ? 13.719  54.252  16.670  1.00 35.46 ? 25  ALA E N   1 
ATOM 10667 C CA  . ALA E 1 25  ? 14.315  53.379  15.665  1.00 35.46 ? 25  ALA E CA  1 
ATOM 10668 C C   . ALA E 1 25  ? 14.957  54.240  14.583  1.00 35.46 ? 25  ALA E C   1 
ATOM 10669 O O   . ALA E 1 25  ? 14.473  55.333  14.278  1.00 35.46 ? 25  ALA E O   1 
ATOM 10670 C CB  . ALA E 1 25  ? 13.262  52.496  15.055  1.00 25.78 ? 25  ALA E CB  1 
ATOM 10671 N N   . PRO E 1 26  ? 16.050  53.747  13.979  1.00 23.85 ? 26  PRO E N   1 
ATOM 10672 C CA  . PRO E 1 26  ? 16.820  54.416  12.925  1.00 23.85 ? 26  PRO E CA  1 
ATOM 10673 C C   . PRO E 1 26  ? 16.008  55.212  11.918  1.00 23.85 ? 26  PRO E C   1 
ATOM 10674 O O   . PRO E 1 26  ? 14.983  54.747  11.428  1.00 23.85 ? 26  PRO E O   1 
ATOM 10675 C CB  . PRO E 1 26  ? 17.566  53.264  12.278  1.00 17.34 ? 26  PRO E CB  1 
ATOM 10676 C CG  . PRO E 1 26  ? 17.870  52.396  13.455  1.00 17.34 ? 26  PRO E CG  1 
ATOM 10677 C CD  . PRO E 1 26  ? 16.539  52.369  14.172  1.00 17.34 ? 26  PRO E CD  1 
ATOM 10678 N N   . GLY E 1 27  ? 16.470  56.422  11.621  1.00 37.36 ? 27  GLY E N   1 
ATOM 10679 C CA  . GLY E 1 27  ? 15.778  57.259  10.659  1.00 37.36 ? 27  GLY E CA  1 
ATOM 10680 C C   . GLY E 1 27  ? 14.367  57.657  11.046  1.00 37.36 ? 27  GLY E C   1 
ATOM 10681 O O   . GLY E 1 27  ? 13.632  58.212  10.224  1.00 37.36 ? 27  GLY E O   1 
ATOM 10682 N N   . LYS E 1 28  ? 13.988  57.376  12.291  1.00 28.92 ? 28  LYS E N   1 
ATOM 10683 C CA  . LYS E 1 28  ? 12.661  57.721  12.791  1.00 28.92 ? 28  LYS E CA  1 
ATOM 10684 C C   . LYS E 1 28  ? 12.700  58.801  13.886  1.00 28.92 ? 28  LYS E C   1 
ATOM 10685 O O   . LYS E 1 28  ? 13.634  58.864  14.700  1.00 28.92 ? 28  LYS E O   1 
ATOM 10686 C CB  . LYS E 1 28  ? 11.965  56.468  13.323  1.00 28.40 ? 28  LYS E CB  1 
ATOM 10687 C CG  . LYS E 1 28  ? 11.383  55.559  12.250  1.00 28.40 ? 28  LYS E CG  1 
ATOM 10688 C CD  . LYS E 1 28  ? 11.115  54.165  12.818  1.00 28.40 ? 28  LYS E CD  1 
ATOM 10689 C CE  . LYS E 1 28  ? 10.282  53.291  11.887  1.00 28.40 ? 28  LYS E CE  1 
ATOM 10690 N NZ  . LYS E 1 28  ? 8.861   53.731  11.884  1.00 28.40 ? 28  LYS E NZ  1 
ATOM 10691 N N   . GLY E 1 29  ? 11.678  59.651  13.881  1.00 29.81 ? 29  GLY E N   1 
ATOM 10692 C CA  . GLY E 1 29  ? 11.574  60.721  14.852  1.00 29.81 ? 29  GLY E CA  1 
ATOM 10693 C C   . GLY E 1 29  ? 10.157  60.821  15.387  1.00 29.81 ? 29  GLY E C   1 
ATOM 10694 O O   . GLY E 1 29  ? 9.317   59.953  15.122  1.00 29.81 ? 29  GLY E O   1 
ATOM 10695 N N   . ILE E 1 30  ? 9.878   61.890  16.127  1.00 25.97 ? 30  ILE E N   1 
ATOM 10696 C CA  . ILE E 1 30  ? 8.563   62.086  16.730  1.00 25.97 ? 30  ILE E CA  1 
ATOM 10697 C C   . ILE E 1 30  ? 7.836   63.324  16.236  1.00 25.97 ? 30  ILE E C   1 
ATOM 10698 O O   . ILE E 1 30  ? 8.428   64.399  16.136  1.00 25.97 ? 30  ILE E O   1 
ATOM 10699 C CB  . ILE E 1 30  ? 8.673   62.213  18.275  1.00 13.86 ? 30  ILE E CB  1 
ATOM 10700 C CG1 . ILE E 1 30  ? 9.165   60.901  18.887  1.00 13.86 ? 30  ILE E CG1 1 
ATOM 10701 C CG2 . ILE E 1 30  ? 7.329   62.585  18.863  1.00 13.86 ? 30  ILE E CG2 1 
ATOM 10702 C CD1 . ILE E 1 30  ? 9.496   61.002  20.352  1.00 13.86 ? 30  ILE E CD1 1 
ATOM 10703 N N   . LEU E 1 31  ? 6.553   63.173  15.924  1.00 32.85 ? 31  LEU E N   1 
ATOM 10704 C CA  . LEU E 1 31  ? 5.757   64.315  15.512  1.00 32.85 ? 31  LEU E CA  1 
ATOM 10705 C C   . LEU E 1 31  ? 5.089   64.796  16.780  1.00 32.85 ? 31  LEU E C   1 
ATOM 10706 O O   . LEU E 1 31  ? 4.307   64.066  17.393  1.00 32.85 ? 31  LEU E O   1 
ATOM 10707 C CB  . LEU E 1 31  ? 4.667   63.932  14.519  1.00 18.31 ? 31  LEU E CB  1 
ATOM 10708 C CG  . LEU E 1 31  ? 3.618   65.051  14.399  1.00 18.31 ? 31  LEU E CG  1 
ATOM 10709 C CD1 . LEU E 1 31  ? 4.276   66.318  13.879  1.00 18.31 ? 31  LEU E CD1 1 
ATOM 10710 C CD2 . LEU E 1 31  ? 2.485   64.622  13.489  1.00 18.31 ? 31  LEU E CD2 1 
ATOM 10711 N N   . ALA E 1 32  ? 5.396   66.022  17.177  1.00 31.25 ? 32  ALA E N   1 
ATOM 10712 C CA  . ALA E 1 32  ? 4.815   66.579  18.385  1.00 31.25 ? 32  ALA E CA  1 
ATOM 10713 C C   . ALA E 1 32  ? 3.610   67.443  18.041  1.00 31.25 ? 32  ALA E C   1 
ATOM 10714 O O   . ALA E 1 32  ? 3.750   68.632  17.745  1.00 31.25 ? 32  ALA E O   1 
ATOM 10715 C CB  . ALA E 1 32  ? 5.856   67.399  19.129  1.00 27.14 ? 32  ALA E CB  1 
ATOM 10716 N N   . ALA E 1 33  ? 2.426   66.839  18.081  1.00 38.49 ? 33  ALA E N   1 
ATOM 10717 C CA  . ALA E 1 33  ? 1.196   67.557  17.783  1.00 38.49 ? 33  ALA E CA  1 
ATOM 10718 C C   . ALA E 1 33  ? 0.374   67.716  19.065  1.00 38.49 ? 33  ALA E C   1 
ATOM 10719 O O   . ALA E 1 33  ? -0.861  67.641  19.051  1.00 38.49 ? 33  ALA E O   1 
ATOM 10720 C CB  . ALA E 1 33  ? 0.408   66.796  16.736  1.00 29.51 ? 33  ALA E CB  1 
ATOM 10721 N N   . ASP E 1 34  ? 1.072   67.943  20.173  1.00 40.98 ? 34  ASP E N   1 
ATOM 10722 C CA  . ASP E 1 34  ? 0.428   68.093  21.475  1.00 40.98 ? 34  ASP E CA  1 
ATOM 10723 C C   . ASP E 1 34  ? 0.141   69.552  21.837  1.00 40.98 ? 34  ASP E C   1 
ATOM 10724 O O   . ASP E 1 34  ? 0.127   69.918  23.016  1.00 40.98 ? 34  ASP E O   1 
ATOM 10725 C CB  . ASP E 1 34  ? 1.303   67.443  22.560  1.00 46.35 ? 34  ASP E CB  1 
ATOM 10726 C CG  . ASP E 1 34  ? 2.684   68.094  22.679  1.00 46.35 ? 34  ASP E CG  1 
ATOM 10727 O OD1 . ASP E 1 34  ? 3.353   68.283  21.639  1.00 46.35 ? 34  ASP E OD1 1 
ATOM 10728 O OD2 . ASP E 1 34  ? 3.115   68.409  23.816  1.00 46.35 ? 34  ASP E OD2 1 
ATOM 10729 N N   . GLU E 1 35  ? -0.106  70.384  20.829  1.00 44.79 ? 35  GLU E N   1 
ATOM 10730 C CA  . GLU E 1 35  ? -0.382  71.798  21.079  1.00 44.79 ? 35  GLU E CA  1 
ATOM 10731 C C   . GLU E 1 35  ? -1.657  72.030  21.887  1.00 44.79 ? 35  GLU E C   1 
ATOM 10732 O O   . GLU E 1 35  ? -2.763  71.655  21.471  1.00 44.79 ? 35  GLU E O   1 
ATOM 10733 C CB  . GLU E 1 35  ? -0.481  72.589  19.766  1.00 43.44 ? 35  GLU E CB  1 
ATOM 10734 C CG  . GLU E 1 35  ? 0.814   72.730  18.984  1.00 43.44 ? 35  GLU E CG  1 
ATOM 10735 C CD  . GLU E 1 35  ? 1.058   71.589  18.006  1.00 43.44 ? 35  GLU E CD  1 
ATOM 10736 O OE1 . GLU E 1 35  ? 1.909   71.763  17.108  1.00 43.44 ? 35  GLU E OE1 1 
ATOM 10737 O OE2 . GLU E 1 35  ? 0.412   70.521  18.125  1.00 43.44 ? 35  GLU E OE2 1 
ATOM 10738 N N   . SER E 1 36  ? -1.492  72.655  23.050  1.00 53.59 ? 36  SER E N   1 
ATOM 10739 C CA  . SER E 1 36  ? -2.619  72.974  23.921  1.00 53.59 ? 36  SER E CA  1 
ATOM 10740 C C   . SER E 1 36  ? -3.611  73.835  23.145  1.00 53.59 ? 36  SER E C   1 
ATOM 10741 O O   . SER E 1 36  ? -3.230  74.555  22.218  1.00 53.59 ? 36  SER E O   1 
ATOM 10742 C CB  . SER E 1 36  ? -2.133  73.736  25.161  1.00 49.24 ? 36  SER E CB  1 
ATOM 10743 O OG  . SER E 1 36  ? -1.304  74.833  24.805  1.00 49.24 ? 36  SER E OG  1 
ATOM 10744 N N   . VAL E 1 37  ? -4.885  73.753  23.512  1.00 44.24 ? 37  VAL E N   1 
ATOM 10745 C CA  . VAL E 1 37  ? -5.902  74.547  22.832  1.00 44.24 ? 37  VAL E CA  1 
ATOM 10746 C C   . VAL E 1 37  ? -5.511  76.023  22.884  1.00 44.24 ? 37  VAL E C   1 
ATOM 10747 O O   . VAL E 1 37  ? -5.915  76.820  22.040  1.00 44.24 ? 37  VAL E O   1 
ATOM 10748 C CB  . VAL E 1 37  ? -7.275  74.343  23.490  1.00 34.20 ? 37  VAL E CB  1 
ATOM 10749 C CG1 . VAL E 1 37  ? -7.129  74.439  25.001  1.00 34.20 ? 37  VAL E CG1 1 
ATOM 10750 C CG2 . VAL E 1 37  ? -8.267  75.371  22.957  1.00 34.20 ? 37  VAL E CG2 1 
ATOM 10751 N N   . GLY E 1 38  ? -4.703  76.369  23.879  1.00 45.78 ? 38  GLY E N   1 
ATOM 10752 C CA  . GLY E 1 38  ? -4.256  77.739  24.020  1.00 45.78 ? 38  GLY E CA  1 
ATOM 10753 C C   . GLY E 1 38  ? -3.221  78.101  22.974  1.00 45.78 ? 38  GLY E C   1 
ATOM 10754 O O   . GLY E 1 38  ? -3.441  78.996  22.156  1.00 45.78 ? 38  GLY E O   1 
ATOM 10755 N N   . SER E 1 39  ? -2.084  77.409  22.995  1.00 51.21 ? 39  SER E N   1 
ATOM 10756 C CA  . SER E 1 39  ? -1.024  77.678  22.028  1.00 51.21 ? 39  SER E CA  1 
ATOM 10757 C C   . SER E 1 39  ? -1.537  77.444  20.611  1.00 51.21 ? 39  SER E C   1 
ATOM 10758 O O   . SER E 1 39  ? -1.054  78.048  19.652  1.00 51.21 ? 39  SER E O   1 
ATOM 10759 C CB  . SER E 1 39  ? 0.199   76.796  22.313  1.00 43.89 ? 39  SER E CB  1 
ATOM 10760 O OG  . SER E 1 39  ? -0.173  75.452  22.554  1.00 43.89 ? 39  SER E OG  1 
ATOM 10761 N N   . MET E 1 40  ? -2.538  76.579  20.488  1.00 48.67 ? 40  MET E N   1 
ATOM 10762 C CA  . MET E 1 40  ? -3.113  76.281  19.191  1.00 48.67 ? 40  MET E CA  1 
ATOM 10763 C C   . MET E 1 40  ? -3.838  77.512  18.655  1.00 48.67 ? 40  MET E C   1 
ATOM 10764 O O   . MET E 1 40  ? -3.943  77.709  17.445  1.00 48.67 ? 40  MET E O   1 
ATOM 10765 C CB  . MET E 1 40  ? -4.087  75.112  19.301  1.00 46.14 ? 40  MET E CB  1 
ATOM 10766 C CG  . MET E 1 40  ? -4.287  74.381  17.986  1.00 46.14 ? 40  MET E CG  1 
ATOM 10767 S SD  . MET E 1 40  ? -2.769  73.557  17.430  1.00 46.14 ? 40  MET E SD  1 
ATOM 10768 C CE  . MET E 1 40  ? -2.082  74.772  16.321  1.00 46.14 ? 40  MET E CE  1 
ATOM 10769 N N   . ALA E 1 41  ? -4.340  78.344  19.556  1.00 51.47 ? 41  ALA E N   1 
ATOM 10770 C CA  . ALA E 1 41  ? -5.040  79.550  19.139  1.00 51.47 ? 41  ALA E CA  1 
ATOM 10771 C C   . ALA E 1 41  ? -4.065  80.465  18.420  1.00 51.47 ? 41  ALA E C   1 
ATOM 10772 O O   . ALA E 1 41  ? -4.376  81.012  17.364  1.00 51.47 ? 41  ALA E O   1 
ATOM 10773 C CB  . ALA E 1 41  ? -5.622  80.255  20.341  1.00 31.36 ? 41  ALA E CB  1 
ATOM 10774 N N   . LYS E 1 42  ? -2.876  80.626  18.991  1.00 51.21 ? 42  LYS E N   1 
ATOM 10775 C CA  . LYS E 1 42  ? -1.869  81.484  18.388  1.00 51.21 ? 42  LYS E CA  1 
ATOM 10776 C C   . LYS E 1 42  ? -1.454  81.005  17.006  1.00 51.21 ? 42  LYS E C   1 
ATOM 10777 O O   . LYS E 1 42  ? -1.369  81.800  16.070  1.00 51.21 ? 42  LYS E O   1 
ATOM 10778 C CB  . LYS E 1 42  ? -0.636  81.581  19.286  1.00 92.04 ? 42  LYS E CB  1 
ATOM 10779 C CG  . LYS E 1 42  ? -0.877  82.374  20.550  1.00 92.04 ? 42  LYS E CG  1 
ATOM 10780 C CD  . LYS E 1 42  ? 0.426   82.865  21.153  1.00 92.04 ? 42  LYS E CD  1 
ATOM 10781 C CE  . LYS E 1 42  ? 0.165   83.895  22.252  1.00 92.04 ? 42  LYS E CE  1 
ATOM 10782 N NZ  . LYS E 1 42  ? 1.422   84.507  22.783  1.00 92.04 ? 42  LYS E NZ  1 
ATOM 10783 N N   . ARG E 1 43  ? -1.199  79.708  16.872  1.00 57.50 ? 43  ARG E N   1 
ATOM 10784 C CA  . ARG E 1 43  ? -0.783  79.168  15.586  1.00 57.50 ? 43  ARG E CA  1 
ATOM 10785 C C   . ARG E 1 43  ? -1.858  79.305  14.527  1.00 57.50 ? 43  ARG E C   1 
ATOM 10786 O O   . ARG E 1 43  ? -1.565  79.659  13.385  1.00 57.50 ? 43  ARG E O   1 
ATOM 10787 C CB  . ARG E 1 43  ? -0.368  77.713  15.731  1.00 80.36 ? 43  ARG E CB  1 
ATOM 10788 C CG  . ARG E 1 43  ? 0.829   77.566  16.616  1.00 80.36 ? 43  ARG E CG  1 
ATOM 10789 C CD  . ARG E 1 43  ? 1.464   76.228  16.441  1.00 80.36 ? 43  ARG E CD  1 
ATOM 10790 N NE  . ARG E 1 43  ? 2.567   76.049  17.379  1.00 80.36 ? 43  ARG E NE  1 
ATOM 10791 C CZ  . ARG E 1 43  ? 3.335   74.963  17.426  1.00 80.36 ? 43  ARG E CZ  1 
ATOM 10792 N NH1 . ARG E 1 43  ? 3.117   73.957  16.577  1.00 80.36 ? 43  ARG E NH1 1 
ATOM 10793 N NH2 . ARG E 1 43  ? 4.314   74.876  18.326  1.00 80.36 ? 43  ARG E NH2 1 
ATOM 10794 N N   . LEU E 1 44  ? -3.102  79.035  14.901  1.00 49.44 ? 44  LEU E N   1 
ATOM 10795 C CA  . LEU E 1 44  ? -4.195  79.157  13.952  1.00 49.44 ? 44  LEU E CA  1 
ATOM 10796 C C   . LEU E 1 44  ? -4.418  80.611  13.554  1.00 49.44 ? 44  LEU E C   1 
ATOM 10797 O O   . LEU E 1 44  ? -4.688  80.901  12.389  1.00 49.44 ? 44  LEU E O   1 
ATOM 10798 C CB  . LEU E 1 44  ? -5.482  78.572  14.531  1.00 29.02 ? 44  LEU E CB  1 
ATOM 10799 C CG  . LEU E 1 44  ? -5.479  77.050  14.548  1.00 29.02 ? 44  LEU E CG  1 
ATOM 10800 C CD1 . LEU E 1 44  ? -6.814  76.548  15.045  1.00 29.02 ? 44  LEU E CD1 1 
ATOM 10801 C CD2 . LEU E 1 44  ? -5.196  76.529  13.145  1.00 29.02 ? 44  LEU E CD2 1 
ATOM 10802 N N   . SER E 1 45  ? -4.293  81.525  14.512  1.00 54.79 ? 45  SER E N   1 
ATOM 10803 C CA  . SER E 1 45  ? -4.495  82.940  14.225  1.00 54.79 ? 45  SER E CA  1 
ATOM 10804 C C   . SER E 1 45  ? -3.564  83.426  13.113  1.00 54.79 ? 45  SER E C   1 
ATOM 10805 O O   . SER E 1 45  ? -3.970  84.218  12.263  1.00 54.79 ? 45  SER E O   1 
ATOM 10806 C CB  . SER E 1 45  ? -4.260  83.789  15.477  1.00 66.02 ? 45  SER E CB  1 
ATOM 10807 O OG  . SER E 1 45  ? -2.888  84.114  15.632  1.00 66.02 ? 45  SER E OG  1 
ATOM 10808 N N   . GLN E 1 46  ? -2.320  82.953  13.115  1.00 57.46 ? 46  GLN E N   1 
ATOM 10809 C CA  . GLN E 1 46  ? -1.357  83.371  12.106  1.00 57.46 ? 46  GLN E CA  1 
ATOM 10810 C C   . GLN E 1 46  ? -1.784  83.051  10.677  1.00 57.46 ? 46  GLN E C   1 
ATOM 10811 O O   . GLN E 1 46  ? -1.270  83.652  9.731   1.00 57.46 ? 46  GLN E O   1 
ATOM 10812 C CB  . GLN E 1 46  ? -0.007  82.729  12.368  1.00 91.65 ? 46  GLN E CB  1 
ATOM 10813 C CG  . GLN E 1 46  ? 0.542   83.009  13.734  1.00 91.65 ? 46  GLN E CG  1 
ATOM 10814 C CD  . GLN E 1 46  ? 1.960   82.518  13.866  1.00 91.65 ? 46  GLN E CD  1 
ATOM 10815 O OE1 . GLN E 1 46  ? 2.888   83.109  13.307  1.00 91.65 ? 46  GLN E OE1 1 
ATOM 10816 N NE2 . GLN E 1 46  ? 2.141   81.418  14.590  1.00 91.65 ? 46  GLN E NE2 1 
ATOM 10817 N N   . ILE E 1 47  ? -2.711  82.109  10.515  1.00 54.21 ? 47  ILE E N   1 
ATOM 10818 C CA  . ILE E 1 47  ? -3.191  81.730  9.187   1.00 54.21 ? 47  ILE E CA  1 
ATOM 10819 C C   . ILE E 1 47  ? -4.693  81.980  9.072   1.00 54.21 ? 47  ILE E C   1 
ATOM 10820 O O   . ILE E 1 47  ? -5.367  81.397  8.216   1.00 54.21 ? 47  ILE E O   1 
ATOM 10821 C CB  . ILE E 1 47  ? -2.926  80.233  8.904   1.00 40.32 ? 47  ILE E CB  1 
ATOM 10822 C CG1 . ILE E 1 47  ? -3.754  79.358  9.844   1.00 40.32 ? 47  ILE E CG1 1 
ATOM 10823 C CG2 . ILE E 1 47  ? -1.469  79.921  9.115   1.00 40.32 ? 47  ILE E CG2 1 
ATOM 10824 C CD1 . ILE E 1 47  ? -3.612  77.879  9.583   1.00 40.32 ? 47  ILE E CD1 1 
ATOM 10825 N N   . GLY E 1 48  ? -5.207  82.869  9.922   1.00 72.56 ? 48  GLY E N   1 
ATOM 10826 C CA  . GLY E 1 48  ? -6.636  83.143  9.942   1.00 72.56 ? 48  GLY E CA  1 
ATOM 10827 C C   . GLY E 1 48  ? -7.199  82.055  10.841  1.00 72.56 ? 48  GLY E C   1 
ATOM 10828 O O   . GLY E 1 48  ? -6.813  81.951  12.010  1.00 72.56 ? 48  GLY E O   1 
ATOM 10829 N N   . VAL E 1 49  ? -8.105  81.242  10.313  1.00 57.74 ? 49  VAL E N   1 
ATOM 10830 C CA  . VAL E 1 49  ? -8.673  80.120  11.066  1.00 57.74 ? 49  VAL E CA  1 
ATOM 10831 C C   . VAL E 1 49  ? -9.096  80.371  12.526  1.00 57.74 ? 49  VAL E C   1 
ATOM 10832 O O   . VAL E 1 49  ? -8.251  80.568  13.414  1.00 57.74 ? 49  VAL E O   1 
ATOM 10833 C CB  . VAL E 1 49  ? -7.680  78.929  11.075  1.00 47.32 ? 49  VAL E CB  1 
ATOM 10834 C CG1 . VAL E 1 49  ? -8.378  77.673  11.589  1.00 47.32 ? 49  VAL E CG1 1 
ATOM 10835 C CG2 . VAL E 1 49  ? -7.106  78.712  9.678   1.00 47.32 ? 49  VAL E CG2 1 
ATOM 10836 N N   . GLU E 1 50  ? -10.405 80.337  12.770  1.00 54.46 ? 50  GLU E N   1 
ATOM 10837 C CA  . GLU E 1 50  ? -10.922 80.518  14.120  1.00 54.46 ? 50  GLU E CA  1 
ATOM 10838 C C   . GLU E 1 50  ? -10.443 79.330  14.931  1.00 54.46 ? 50  GLU E C   1 
ATOM 10839 O O   . GLU E 1 50  ? -10.362 78.217  14.412  1.00 54.46 ? 50  GLU E O   1 
ATOM 10840 C CB  . GLU E 1 50  ? -12.450 80.548  14.110  1.00 99.51 ? 50  GLU E CB  1 
ATOM 10841 C CG  . GLU E 1 50  ? -13.024 81.921  14.359  1.00 99.51 ? 50  GLU E CG  1 
ATOM 10842 C CD  . GLU E 1 50  ? -12.285 82.997  13.582  1.00 99.51 ? 50  GLU E CD  1 
ATOM 10843 O OE1 . GLU E 1 50  ? -12.244 82.920  12.330  1.00 99.51 ? 50  GLU E OE1 1 
ATOM 10844 O OE2 . GLU E 1 50  ? -11.737 83.919  14.227  1.00 99.51 ? 50  GLU E OE2 1 
ATOM 10845 N N   . ASN E 1 51  ? -10.121 79.555  16.200  1.00 50.70 ? 51  ASN E N   1 
ATOM 10846 C CA  . ASN E 1 51  ? -9.649  78.465  17.038  1.00 50.70 ? 51  ASN E CA  1 
ATOM 10847 C C   . ASN E 1 51  ? -10.809 77.645  17.615  1.00 50.70 ? 51  ASN E C   1 
ATOM 10848 O O   . ASN E 1 51  ? -11.141 77.761  18.791  1.00 50.70 ? 51  ASN E O   1 
ATOM 10849 C CB  . ASN E 1 51  ? -8.764  79.020  18.155  1.00 47.84 ? 51  ASN E CB  1 
ATOM 10850 C CG  . ASN E 1 51  ? -8.053  77.930  18.932  1.00 47.84 ? 51  ASN E CG  1 
ATOM 10851 O OD1 . ASN E 1 51  ? -7.693  76.891  18.381  1.00 47.84 ? 51  ASN E OD1 1 
ATOM 10852 N ND2 . ASN E 1 51  ? -7.833  78.168  20.216  1.00 47.84 ? 51  ASN E ND2 1 
ATOM 10853 N N   . THR E 1 52  ? -11.419 76.823  16.761  1.00 48.74 ? 52  THR E N   1 
ATOM 10854 C CA  . THR E 1 52  ? -12.542 75.954  17.128  1.00 48.74 ? 52  THR E CA  1 
ATOM 10855 C C   . THR E 1 52  ? -12.009 74.563  17.431  1.00 48.74 ? 52  THR E C   1 
ATOM 10856 O O   . THR E 1 52  ? -10.860 74.258  17.124  1.00 48.74 ? 52  THR E O   1 
ATOM 10857 C CB  . THR E 1 52  ? -13.513 75.772  15.952  1.00 52.73 ? 52  THR E CB  1 
ATOM 10858 O OG1 . THR E 1 52  ? -13.907 77.051  15.460  1.00 52.73 ? 52  THR E OG1 1 
ATOM 10859 C CG2 . THR E 1 52  ? -14.750 74.980  16.379  1.00 52.73 ? 52  THR E CG2 1 
ATOM 10860 N N   . GLU E 1 53  ? -12.836 73.715  18.029  1.00 55.43 ? 53  GLU E N   1 
ATOM 10861 C CA  . GLU E 1 53  ? -12.399 72.355  18.276  1.00 55.43 ? 53  GLU E CA  1 
ATOM 10862 C C   . GLU E 1 53  ? -12.366 71.717  16.907  1.00 55.43 ? 53  GLU E C   1 
ATOM 10863 O O   . GLU E 1 53  ? -11.491 70.908  16.603  1.00 55.43 ? 53  GLU E O   1 
ATOM 10864 C CB  . GLU E 1 53  ? -13.386 71.615  19.157  1.00 98.82 ? 53  GLU E CB  1 
ATOM 10865 C CG  . GLU E 1 53  ? -13.227 71.963  20.614  1.00 98.82 ? 53  GLU E CG  1 
ATOM 10866 C CD  . GLU E 1 53  ? -14.437 71.567  21.442  1.00 98.82 ? 53  GLU E CD  1 
ATOM 10867 O OE1 . GLU E 1 53  ? -14.896 70.400  21.291  1.00 98.82 ? 53  GLU E OE1 1 
ATOM 10868 O OE2 . GLU E 1 53  ? -14.913 72.424  22.240  1.00 98.82 ? 53  GLU E OE2 1 
ATOM 10869 N N   . GLU E 1 54  ? -13.322 72.106  16.073  1.00 48.98 ? 54  GLU E N   1 
ATOM 10870 C CA  . GLU E 1 54  ? -13.397 71.567  14.729  1.00 48.98 ? 54  GLU E CA  1 
ATOM 10871 C C   . GLU E 1 54  ? -12.187 71.962  13.901  1.00 48.98 ? 54  GLU E C   1 
ATOM 10872 O O   . GLU E 1 54  ? -11.524 71.105  13.317  1.00 48.98 ? 54  GLU E O   1 
ATOM 10873 C CB  . GLU E 1 54  ? -14.673 72.036  14.042  1.00 54.59 ? 54  GLU E CB  1 
ATOM 10874 C CG  . GLU E 1 54  ? -15.598 70.892  13.676  1.00 54.59 ? 54  GLU E CG  1 
ATOM 10875 C CD  . GLU E 1 54  ? -14.986 69.952  12.657  1.00 54.59 ? 54  GLU E CD  1 
ATOM 10876 O OE1 . GLU E 1 54  ? -15.598 68.903  12.366  1.00 54.59 ? 54  GLU E OE1 1 
ATOM 10877 O OE2 . GLU E 1 54  ? -13.894 70.264  12.143  1.00 54.59 ? 54  GLU E OE2 1 
ATOM 10878 N N   . ASN E 1 55  ? -11.887 73.252  13.846  1.00 45.30 ? 55  ASN E N   1 
ATOM 10879 C CA  . ASN E 1 55  ? -10.737 73.686  13.069  1.00 45.30 ? 55  ASN E CA  1 
ATOM 10880 C C   . ASN E 1 55  ? -9.467  72.980  13.504  1.00 45.30 ? 55  ASN E C   1 
ATOM 10881 O O   . ASN E 1 55  ? -8.559  72.767  12.697  1.00 45.30 ? 55  ASN E O   1 
ATOM 10882 C CB  . ASN E 1 55  ? -10.549 75.193  13.171  1.00 51.98 ? 55  ASN E CB  1 
ATOM 10883 C CG  . ASN E 1 55  ? -11.597 75.946  12.405  1.00 51.98 ? 55  ASN E CG  1 
ATOM 10884 O OD1 . ASN E 1 55  ? -12.094 75.462  11.387  1.00 51.98 ? 55  ASN E OD1 1 
ATOM 10885 N ND2 . ASN E 1 55  ? -11.936 77.139  12.873  1.00 51.98 ? 55  ASN E ND2 1 
ATOM 10886 N N   . ARG E 1 56  ? -9.396  72.621  14.782  1.00 32.51 ? 56  ARG E N   1 
ATOM 10887 C CA  . ARG E 1 56  ? -8.227  71.917  15.283  1.00 32.51 ? 56  ARG E CA  1 
ATOM 10888 C C   . ARG E 1 56  ? -8.281  70.482  14.772  1.00 32.51 ? 56  ARG E C   1 
ATOM 10889 O O   . ARG E 1 56  ? -7.301  69.971  14.238  1.00 32.51 ? 56  ARG E O   1 
ATOM 10890 C CB  . ARG E 1 56  ? -8.187  71.941  16.813  1.00 38.78 ? 56  ARG E CB  1 
ATOM 10891 C CG  . ARG E 1 56  ? -7.751  73.277  17.407  1.00 38.78 ? 56  ARG E CG  1 
ATOM 10892 C CD  . ARG E 1 56  ? -7.396  73.123  18.885  1.00 38.78 ? 56  ARG E CD  1 
ATOM 10893 N NE  . ARG E 1 56  ? -8.559  72.822  19.716  1.00 38.78 ? 56  ARG E NE  1 
ATOM 10894 C CZ  . ARG E 1 56  ? -9.405  73.742  20.174  1.00 38.78 ? 56  ARG E CZ  1 
ATOM 10895 N NH1 . ARG E 1 56  ? -9.215  75.025  19.883  1.00 38.78 ? 56  ARG E NH1 1 
ATOM 10896 N NH2 . ARG E 1 56  ? -10.444 73.383  20.917  1.00 38.78 ? 56  ARG E NH2 1 
ATOM 10897 N N   . ARG E 1 57  ? -9.434  69.839  14.916  1.00 45.29 ? 57  ARG E N   1 
ATOM 10898 C CA  . ARG E 1 57  ? -9.589  68.471  14.443  1.00 45.29 ? 57  ARG E CA  1 
ATOM 10899 C C   . ARG E 1 57  ? -9.216  68.426  12.965  1.00 45.29 ? 57  ARG E C   1 
ATOM 10900 O O   . ARG E 1 57  ? -8.500  67.530  12.514  1.00 45.29 ? 57  ARG E O   1 
ATOM 10901 C CB  . ARG E 1 57  ? -11.033 68.011  14.609  1.00 38.75 ? 57  ARG E CB  1 
ATOM 10902 C CG  . ARG E 1 57  ? -11.254 66.548  14.283  1.00 38.75 ? 57  ARG E CG  1 
ATOM 10903 C CD  . ARG E 1 57  ? -12.733 66.271  14.121  1.00 38.75 ? 57  ARG E CD  1 
ATOM 10904 N NE  . ARG E 1 57  ? -13.272 67.023  12.996  1.00 38.75 ? 57  ARG E NE  1 
ATOM 10905 C CZ  . ARG E 1 57  ? -13.225 66.609  11.733  1.00 38.75 ? 57  ARG E CZ  1 
ATOM 10906 N NH1 . ARG E 1 57  ? -12.673 65.437  11.432  1.00 38.75 ? 57  ARG E NH1 1 
ATOM 10907 N NH2 . ARG E 1 57  ? -13.710 67.377  10.766  1.00 38.75 ? 57  ARG E NH2 1 
ATOM 10908 N N   . LEU E 1 58  ? -9.707  69.406  12.215  1.00 36.95 ? 58  LEU E N   1 
ATOM 10909 C CA  . LEU E 1 58  ? -9.429  69.486  10.789  1.00 36.95 ? 58  LEU E CA  1 
ATOM 10910 C C   . LEU E 1 58  ? -7.940  69.534  10.531  1.00 36.95 ? 58  LEU E C   1 
ATOM 10911 O O   . LEU E 1 58  ? -7.415  68.753  9.734   1.00 36.95 ? 58  LEU E O   1 
ATOM 10912 C CB  . LEU E 1 58  ? -10.085 70.726  10.188  1.00 28.18 ? 58  LEU E CB  1 
ATOM 10913 C CG  . LEU E 1 58  ? -11.614 70.692  10.151  1.00 28.18 ? 58  LEU E CG  1 
ATOM 10914 C CD1 . LEU E 1 58  ? -12.146 72.035  9.685   1.00 28.18 ? 58  LEU E CD1 1 
ATOM 10915 C CD2 . LEU E 1 58  ? -12.074 69.564  9.237   1.00 28.18 ? 58  LEU E CD2 1 
ATOM 10916 N N   . TYR E 1 59  ? -7.259  70.454  11.202  1.00 36.09 ? 59  TYR E N   1 
ATOM 10917 C CA  . TYR E 1 59  ? -5.823  70.579  11.017  1.00 36.09 ? 59  TYR E CA  1 
ATOM 10918 C C   . TYR E 1 59  ? -5.059  69.323  11.429  1.00 36.09 ? 59  TYR E C   1 
ATOM 10919 O O   . TYR E 1 59  ? -4.184  68.869  10.697  1.00 36.09 ? 59  TYR E O   1 
ATOM 10920 C CB  . TYR E 1 59  ? -5.273  71.777  11.785  1.00 39.21 ? 59  TYR E CB  1 
ATOM 10921 C CG  . TYR E 1 59  ? -3.768  71.834  11.736  1.00 39.21 ? 59  TYR E CG  1 
ATOM 10922 C CD1 . TYR E 1 59  ? -3.098  71.883  10.518  1.00 39.21 ? 59  TYR E CD1 1 
ATOM 10923 C CD2 . TYR E 1 59  ? -3.008  71.786  12.900  1.00 39.21 ? 59  TYR E CD2 1 
ATOM 10924 C CE1 . TYR E 1 59  ? -1.710  71.878  10.462  1.00 39.21 ? 59  TYR E CE1 1 
ATOM 10925 C CE2 . TYR E 1 59  ? -1.617  71.782  12.854  1.00 39.21 ? 59  TYR E CE2 1 
ATOM 10926 C CZ  . TYR E 1 59  ? -0.978  71.827  11.633  1.00 39.21 ? 59  TYR E CZ  1 
ATOM 10927 O OH  . TYR E 1 59  ? 0.391   71.815  11.580  1.00 39.21 ? 59  TYR E OH  1 
ATOM 10928 N N   . ARG E 1 60  ? -5.376  68.763  12.593  1.00 48.69 ? 60  ARG E N   1 
ATOM 10929 C CA  . ARG E 1 60  ? -4.684  67.556  13.043  1.00 48.69 ? 60  ARG E CA  1 
ATOM 10930 C C   . ARG E 1 60  ? -4.884  66.466  12.000  1.00 48.69 ? 60  ARG E C   1 
ATOM 10931 O O   . ARG E 1 60  ? -4.020  65.606  11.795  1.00 48.69 ? 60  ARG E O   1 
ATOM 10932 C CB  . ARG E 1 60  ? -5.245  67.057  14.373  1.00 46.85 ? 60  ARG E CB  1 
ATOM 10933 C CG  . ARG E 1 60  ? -5.332  68.088  15.477  1.00 46.85 ? 60  ARG E CG  1 
ATOM 10934 C CD  . ARG E 1 60  ? -3.984  68.599  15.943  1.00 46.85 ? 60  ARG E CD  1 
ATOM 10935 N NE  . ARG E 1 60  ? -4.144  69.266  17.233  1.00 46.85 ? 60  ARG E NE  1 
ATOM 10936 C CZ  . ARG E 1 60  ? -3.179  69.924  17.862  1.00 46.85 ? 60  ARG E CZ  1 
ATOM 10937 N NH1 . ARG E 1 60  ? -1.970  70.011  17.317  1.00 46.85 ? 60  ARG E NH1 1 
ATOM 10938 N NH2 . ARG E 1 60  ? -3.424  70.485  19.040  1.00 46.85 ? 60  ARG E NH2 1 
ATOM 10939 N N   . GLN E 1 61  ? -6.041  66.504  11.351  1.00 48.41 ? 61  GLN E N   1 
ATOM 10940 C CA  . GLN E 1 61  ? -6.370  65.529  10.328  1.00 48.41 ? 61  GLN E CA  1 
ATOM 10941 C C   . GLN E 1 61  ? -5.394  65.666  9.170   1.00 48.41 ? 61  GLN E C   1 
ATOM 10942 O O   . GLN E 1 61  ? -4.919  64.670  8.626   1.00 48.41 ? 61  GLN E O   1 
ATOM 10943 C CB  . GLN E 1 61  ? -7.793  65.757  9.850   1.00 37.76 ? 61  GLN E CB  1 
ATOM 10944 C CG  . GLN E 1 61  ? -8.315  64.692  8.923   1.00 37.76 ? 61  GLN E CG  1 
ATOM 10945 C CD  . GLN E 1 61  ? -9.769  64.928  8.567   1.00 37.76 ? 61  GLN E CD  1 
ATOM 10946 O OE1 . GLN E 1 61  ? -10.135 66.018  8.108   1.00 37.76 ? 61  GLN E OE1 1 
ATOM 10947 N NE2 . GLN E 1 61  ? -10.610 63.916  8.782   1.00 37.76 ? 61  GLN E NE2 1 
ATOM 10948 N N   . VAL E 1 62  ? -5.093  66.905  8.797   1.00 36.58 ? 62  VAL E N   1 
ATOM 10949 C CA  . VAL E 1 62  ? -4.151  67.159  7.718   1.00 36.58 ? 62  VAL E CA  1 
ATOM 10950 C C   . VAL E 1 62  ? -2.853  66.413  7.982   1.00 36.58 ? 62  VAL E C   1 
ATOM 10951 O O   . VAL E 1 62  ? -2.237  65.888  7.064   1.00 36.58 ? 62  VAL E O   1 
ATOM 10952 C CB  . VAL E 1 62  ? -3.801  68.652  7.603   1.00 25.14 ? 62  VAL E CB  1 
ATOM 10953 C CG1 . VAL E 1 62  ? -2.720  68.849  6.558   1.00 25.14 ? 62  VAL E CG1 1 
ATOM 10954 C CG2 . VAL E 1 62  ? -5.042  69.451  7.245   1.00 25.14 ? 62  VAL E CG2 1 
ATOM 10955 N N   . LEU E 1 63  ? -2.438  66.375  9.243   1.00 31.55 ? 63  LEU E N   1 
ATOM 10956 C CA  . LEU E 1 63  ? -1.204  65.696  9.612   1.00 31.55 ? 63  LEU E CA  1 
ATOM 10957 C C   . LEU E 1 63  ? -1.367  64.185  9.635   1.00 31.55 ? 63  LEU E C   1 
ATOM 10958 O O   . LEU E 1 63  ? -0.615  63.471  8.976   1.00 31.55 ? 63  LEU E O   1 
ATOM 10959 C CB  . LEU E 1 63  ? -0.719  66.175  10.984  1.00 27.54 ? 63  LEU E CB  1 
ATOM 10960 C CG  . LEU E 1 63  ? -0.456  67.677  11.118  1.00 27.54 ? 63  LEU E CG  1 
ATOM 10961 C CD1 . LEU E 1 63  ? 0.091   67.975  12.496  1.00 27.54 ? 63  LEU E CD1 1 
ATOM 10962 C CD2 . LEU E 1 63  ? 0.538   68.126  10.069  1.00 27.54 ? 63  LEU E CD2 1 
ATOM 10963 N N   . PHE E 1 64  ? -2.363  63.707  10.375  1.00 33.03 ? 64  PHE E N   1 
ATOM 10964 C CA  . PHE E 1 64  ? -2.596  62.273  10.514  1.00 33.03 ? 64  PHE E CA  1 
ATOM 10965 C C   . PHE E 1 64  ? -3.040  61.537  9.268   1.00 33.03 ? 64  PHE E C   1 
ATOM 10966 O O   . PHE E 1 64  ? -3.018  60.301  9.222   1.00 33.03 ? 64  PHE E O   1 
ATOM 10967 C CB  . PHE E 1 64  ? -3.601  62.014  11.632  1.00 32.15 ? 64  PHE E CB  1 
ATOM 10968 C CG  . PHE E 1 64  ? -3.216  62.640  12.930  1.00 32.15 ? 64  PHE E CG  1 
ATOM 10969 C CD1 . PHE E 1 64  ? -1.874  62.844  13.244  1.00 32.15 ? 64  PHE E CD1 1 
ATOM 10970 C CD2 . PHE E 1 64  ? -4.183  63.038  13.837  1.00 32.15 ? 64  PHE E CD2 1 
ATOM 10971 C CE1 . PHE E 1 64  ? -1.501  63.437  14.436  1.00 32.15 ? 64  PHE E CE1 1 
ATOM 10972 C CE2 . PHE E 1 64  ? -3.820  63.631  15.034  1.00 32.15 ? 64  PHE E CE2 1 
ATOM 10973 C CZ  . PHE E 1 64  ? -2.475  63.832  15.331  1.00 32.15 ? 64  PHE E CZ  1 
ATOM 10974 N N   . SER E 1 65  ? -3.447  62.279  8.252   1.00 47.92 ? 65  SER E N   1 
ATOM 10975 C CA  . SER E 1 65  ? -3.879  61.635  7.030   1.00 47.92 ? 65  SER E CA  1 
ATOM 10976 C C   . SER E 1 65  ? -2.697  61.385  6.101   1.00 47.92 ? 65  SER E C   1 
ATOM 10977 O O   . SER E 1 65  ? -2.882  60.932  4.978   1.00 47.92 ? 65  SER E O   1 
ATOM 10978 C CB  . SER E 1 65  ? -4.945  62.483  6.339   1.00 46.93 ? 65  SER E CB  1 
ATOM 10979 O OG  . SER E 1 65  ? -4.507  63.820  6.197   1.00 46.93 ? 65  SER E OG  1 
ATOM 10980 N N   . ALA E 1 66  ? -1.484  61.679  6.567   1.00 40.81 ? 66  ALA E N   1 
ATOM 10981 C CA  . ALA E 1 66  ? -0.292  61.450  5.752   1.00 40.81 ? 66  ALA E CA  1 
ATOM 10982 C C   . ALA E 1 66  ? -0.269  59.969  5.376   1.00 40.81 ? 66  ALA E C   1 
ATOM 10983 O O   . ALA E 1 66  ? -0.728  59.121  6.148   1.00 40.81 ? 66  ALA E O   1 
ATOM 10984 C CB  . ALA E 1 66  ? 0.967   61.815  6.530   1.00 39.17 ? 66  ALA E CB  1 
ATOM 10985 N N   . ASP E 1 67  ? 0.257   59.663  4.192   1.00 51.08 ? 67  ASP E N   1 
ATOM 10986 C CA  . ASP E 1 67  ? 0.316   58.283  3.713   1.00 51.08 ? 67  ASP E CA  1 
ATOM 10987 C C   . ASP E 1 67  ? 1.461   57.472  4.324   1.00 51.08 ? 67  ASP E C   1 
ATOM 10988 O O   . ASP E 1 67  ? 2.135   57.924  5.254   1.00 51.08 ? 67  ASP E O   1 
ATOM 10989 C CB  . ASP E 1 67  ? 0.419   58.262  2.180   1.00 45.68 ? 67  ASP E CB  1 
ATOM 10990 C CG  . ASP E 1 67  ? 1.723   58.855  1.672   1.00 45.68 ? 67  ASP E CG  1 
ATOM 10991 O OD1 . ASP E 1 67  ? 1.682   59.740  0.783   1.00 45.68 ? 67  ASP E OD1 1 
ATOM 10992 O OD2 . ASP E 1 67  ? 2.791   58.425  2.166   1.00 45.68 ? 67  ASP E OD2 1 
ATOM 10993 N N   . ASP E 1 68  ? 1.684   56.282  3.775   1.00 45.23 ? 68  ASP E N   1 
ATOM 10994 C CA  . ASP E 1 68  ? 2.712   55.366  4.265   1.00 45.23 ? 68  ASP E CA  1 
ATOM 10995 C C   . ASP E 1 68  ? 4.179   55.774  4.232   1.00 45.23 ? 68  ASP E C   1 
ATOM 10996 O O   . ASP E 1 68  ? 5.001   55.138  4.893   1.00 45.23 ? 68  ASP E O   1 
ATOM 10997 C CB  . ASP E 1 68  ? 2.574   54.015  3.564   1.00 69.35 ? 68  ASP E CB  1 
ATOM 10998 C CG  . ASP E 1 68  ? 1.522   53.134  4.204   1.00 69.35 ? 68  ASP E CG  1 
ATOM 10999 O OD1 . ASP E 1 68  ? 1.309   52.009  3.702   1.00 69.35 ? 68  ASP E OD1 1 
ATOM 11000 O OD2 . ASP E 1 68  ? 0.912   53.560  5.210   1.00 69.35 ? 68  ASP E OD2 1 
ATOM 11001 N N   . ARG E 1 69  ? 4.544   56.807  3.485   1.00 48.85 ? 69  ARG E N   1 
ATOM 11002 C CA  . ARG E 1 69  ? 5.957   57.157  3.472   1.00 48.85 ? 69  ARG E CA  1 
ATOM 11003 C C   . ARG E 1 69  ? 6.335   57.838  4.767   1.00 48.85 ? 69  ARG E C   1 
ATOM 11004 O O   . ARG E 1 69  ? 7.509   58.106  5.023   1.00 48.85 ? 69  ARG E O   1 
ATOM 11005 C CB  . ARG E 1 69  ? 6.305   58.039  2.269   1.00 25.17 ? 69  ARG E CB  1 
ATOM 11006 C CG  . ARG E 1 69  ? 5.409   59.216  2.065   1.00 25.17 ? 69  ARG E CG  1 
ATOM 11007 C CD  . ARG E 1 69  ? 5.552   59.755  0.660   1.00 25.17 ? 69  ARG E CD  1 
ATOM 11008 N NE  . ARG E 1 69  ? 4.308   60.400  0.271   1.00 25.17 ? 69  ARG E NE  1 
ATOM 11009 C CZ  . ARG E 1 69  ? 4.213   61.650  -0.166  1.00 25.17 ? 69  ARG E CZ  1 
ATOM 11010 N NH1 . ARG E 1 69  ? 5.310   62.403  -0.280  1.00 25.17 ? 69  ARG E NH1 1 
ATOM 11011 N NH2 . ARG E 1 69  ? 3.020   62.149  -0.471  1.00 25.17 ? 69  ARG E NH2 1 
ATOM 11012 N N   . VAL E 1 70  ? 5.328   58.091  5.595   1.00 35.00 ? 70  VAL E N   1 
ATOM 11013 C CA  . VAL E 1 70  ? 5.536   58.728  6.886   1.00 35.00 ? 70  VAL E CA  1 
ATOM 11014 C C   . VAL E 1 70  ? 6.006   57.660  7.871   1.00 35.00 ? 70  VAL E C   1 
ATOM 11015 O O   . VAL E 1 70  ? 6.565   57.974  8.913   1.00 35.00 ? 70  VAL E O   1 
ATOM 11016 C CB  . VAL E 1 70  ? 4.225   59.370  7.386   1.00 17.57 ? 70  VAL E CB  1 
ATOM 11017 C CG1 . VAL E 1 70  ? 3.505   58.430  8.346   1.00 17.57 ? 70  VAL E CG1 1 
ATOM 11018 C CG2 . VAL E 1 70  ? 4.514   60.715  8.005   1.00 17.57 ? 70  VAL E CG2 1 
ATOM 11019 N N   . LYS E 1 71  ? 5.778   56.397  7.511   1.00 33.29 ? 71  LYS E N   1 
ATOM 11020 C CA  . LYS E 1 71  ? 6.159   55.241  8.327   1.00 33.29 ? 71  LYS E CA  1 
ATOM 11021 C C   . LYS E 1 71  ? 7.659   55.057  8.499   1.00 33.29 ? 71  LYS E C   1 
ATOM 11022 O O   . LYS E 1 71  ? 8.108   54.539  9.515   1.00 33.29 ? 71  LYS E O   1 
ATOM 11023 C CB  . LYS E 1 71  ? 5.594   53.945  7.733   1.00 34.68 ? 71  LYS E CB  1 
ATOM 11024 C CG  . LYS E 1 71  ? 4.083   53.825  7.798   1.00 34.68 ? 71  LYS E CG  1 
ATOM 11025 C CD  . LYS E 1 71  ? 3.562   52.597  7.047   1.00 34.68 ? 71  LYS E CD  1 
ATOM 11026 C CE  . LYS E 1 71  ? 3.927   51.293  7.746   1.00 34.68 ? 71  LYS E CE  1 
ATOM 11027 N NZ  . LYS E 1 71  ? 3.313   50.095  7.079   1.00 34.68 ? 71  LYS E NZ  1 
ATOM 11028 N N   . LYS E 1 72  ? 8.440   55.464  7.509   1.00 33.75 ? 72  LYS E N   1 
ATOM 11029 C CA  . LYS E 1 72  ? 9.882   55.295  7.599   1.00 33.75 ? 72  LYS E CA  1 
ATOM 11030 C C   . LYS E 1 72  ? 10.570  56.343  8.468   1.00 33.75 ? 72  LYS E C   1 
ATOM 11031 O O   . LYS E 1 72  ? 11.645  56.088  9.022   1.00 33.75 ? 72  LYS E O   1 
ATOM 11032 C CB  . LYS E 1 72  ? 10.506  55.316  6.200   1.00 34.86 ? 72  LYS E CB  1 
ATOM 11033 C CG  . LYS E 1 72  ? 10.204  56.575  5.416   1.00 34.86 ? 72  LYS E CG  1 
ATOM 11034 C CD  . LYS E 1 72  ? 11.086  56.700  4.187   1.00 34.86 ? 72  LYS E CD  1 
ATOM 11035 C CE  . LYS E 1 72  ? 10.724  57.939  3.380   1.00 34.86 ? 72  LYS E CE  1 
ATOM 11036 N NZ  . LYS E 1 72  ? 9.308   57.892  2.915   1.00 34.86 ? 72  LYS E NZ  1 
ATOM 11037 N N   . CYS E 1 73  ? 9.951   57.516  8.600   1.00 34.08 ? 73  CYS E N   1 
ATOM 11038 C CA  . CYS E 1 73  ? 10.556  58.591  9.378   1.00 34.08 ? 73  CYS E CA  1 
ATOM 11039 C C   . CYS E 1 73  ? 9.849   58.993  10.674  1.00 34.08 ? 73  CYS E C   1 
ATOM 11040 O O   . CYS E 1 73  ? 10.387  59.778  11.456  1.00 34.08 ? 73  CYS E O   1 
ATOM 11041 C CB  . CYS E 1 73  ? 10.730  59.820  8.481   1.00 40.22 ? 73  CYS E CB  1 
ATOM 11042 S SG  . CYS E 1 73  ? 9.253   60.226  7.527   1.00 40.22 ? 73  CYS E SG  1 
ATOM 11043 N N   . ILE E 1 74  ? 8.654   58.470  10.912  1.00 28.57 ? 74  ILE E N   1 
ATOM 11044 C CA  . ILE E 1 74  ? 7.935   58.815  12.130  1.00 28.57 ? 74  ILE E CA  1 
ATOM 11045 C C   . ILE E 1 74  ? 7.736   57.607  13.030  1.00 28.57 ? 74  ILE E C   1 
ATOM 11046 O O   . ILE E 1 74  ? 6.932   56.720  12.726  1.00 28.57 ? 74  ILE E O   1 
ATOM 11047 C CB  . ILE E 1 74  ? 6.559   59.404  11.816  1.00 19.31 ? 74  ILE E CB  1 
ATOM 11048 C CG1 . ILE E 1 74  ? 6.711   60.669  10.970  1.00 19.31 ? 74  ILE E CG1 1 
ATOM 11049 C CG2 . ILE E 1 74  ? 5.825   59.699  13.106  1.00 19.31 ? 74  ILE E CG2 1 
ATOM 11050 C CD1 . ILE E 1 74  ? 7.459   61.785  11.648  1.00 19.31 ? 74  ILE E CD1 1 
ATOM 11051 N N   . GLY E 1 75  ? 8.462   57.582  14.144  1.00 30.46 ? 75  GLY E N   1 
ATOM 11052 C CA  . GLY E 1 75  ? 8.348   56.475  15.077  1.00 30.46 ? 75  GLY E CA  1 
ATOM 11053 C C   . GLY E 1 75  ? 7.203   56.655  16.060  1.00 30.46 ? 75  GLY E C   1 
ATOM 11054 O O   . GLY E 1 75  ? 6.648   55.675  16.573  1.00 30.46 ? 75  GLY E O   1 
ATOM 11055 N N   . GLY E 1 76  ? 6.844   57.911  16.318  1.00 28.63 ? 76  GLY E N   1 
ATOM 11056 C CA  . GLY E 1 76  ? 5.762   58.192  17.248  1.00 28.63 ? 76  GLY E CA  1 
ATOM 11057 C C   . GLY E 1 76  ? 5.121   59.559  17.071  1.00 28.63 ? 76  GLY E C   1 
ATOM 11058 O O   . GLY E 1 76  ? 5.707   60.480  16.489  1.00 28.63 ? 76  GLY E O   1 
ATOM 11059 N N   . VAL E 1 77  ? 3.903   59.689  17.584  1.00 31.06 ? 77  VAL E N   1 
ATOM 11060 C CA  . VAL E 1 77  ? 3.162   60.937  17.494  1.00 31.06 ? 77  VAL E CA  1 
ATOM 11061 C C   . VAL E 1 77  ? 2.655   61.315  18.881  1.00 31.06 ? 77  VAL E C   1 
ATOM 11062 O O   . VAL E 1 77  ? 2.003   60.514  19.547  1.00 31.06 ? 77  VAL E O   1 
ATOM 11063 C CB  . VAL E 1 77  ? 1.960   60.787  16.548  1.00 25.72 ? 77  VAL E CB  1 
ATOM 11064 C CG1 . VAL E 1 77  ? 1.321   62.132  16.301  1.00 25.72 ? 77  VAL E CG1 1 
ATOM 11065 C CG2 . VAL E 1 77  ? 2.409   60.164  15.244  1.00 25.72 ? 77  VAL E CG2 1 
ATOM 11066 N N   . ILE E 1 78  ? 2.969   62.529  19.320  1.00 30.51 ? 78  ILE E N   1 
ATOM 11067 C CA  . ILE E 1 78  ? 2.526   62.996  20.629  1.00 30.51 ? 78  ILE E CA  1 
ATOM 11068 C C   . ILE E 1 78  ? 1.206   63.743  20.461  1.00 30.51 ? 78  ILE E C   1 
ATOM 11069 O O   . ILE E 1 78  ? 1.152   64.773  19.785  1.00 30.51 ? 78  ILE E O   1 
ATOM 11070 C CB  . ILE E 1 78  ? 3.550   63.964  21.270  1.00 24.98 ? 78  ILE E CB  1 
ATOM 11071 C CG1 . ILE E 1 78  ? 4.925   63.302  21.378  1.00 24.98 ? 78  ILE E CG1 1 
ATOM 11072 C CG2 . ILE E 1 78  ? 3.083   64.362  22.653  1.00 24.98 ? 78  ILE E CG2 1 
ATOM 11073 C CD1 . ILE E 1 78  ? 6.016   64.249  21.855  1.00 24.98 ? 78  ILE E CD1 1 
ATOM 11074 N N   . PHE E 1 79  ? 0.151   63.218  21.079  1.00 29.78 ? 79  PHE E N   1 
ATOM 11075 C CA  . PHE E 1 79  ? -1.187  63.811  21.012  1.00 29.78 ? 79  PHE E CA  1 
ATOM 11076 C C   . PHE E 1 79  ? -1.503  64.768  22.148  1.00 29.78 ? 79  PHE E C   1 
ATOM 11077 O O   . PHE E 1 79  ? -0.966  64.652  23.246  1.00 29.78 ? 79  PHE E O   1 
ATOM 11078 C CB  . PHE E 1 79  ? -2.271  62.732  21.078  1.00 41.40 ? 79  PHE E CB  1 
ATOM 11079 C CG  . PHE E 1 79  ? -2.435  61.943  19.827  1.00 41.40 ? 79  PHE E CG  1 
ATOM 11080 C CD1 . PHE E 1 79  ? -1.475  61.022  19.438  1.00 41.40 ? 79  PHE E CD1 1 
ATOM 11081 C CD2 . PHE E 1 79  ? -3.570  62.105  19.045  1.00 41.40 ? 79  PHE E CD2 1 
ATOM 11082 C CE1 . PHE E 1 79  ? -1.644  60.270  18.284  1.00 41.40 ? 79  PHE E CE1 1 
ATOM 11083 C CE2 . PHE E 1 79  ? -3.747  61.360  17.891  1.00 41.40 ? 79  PHE E CE2 1 
ATOM 11084 C CZ  . PHE E 1 79  ? -2.782  60.440  17.508  1.00 41.40 ? 79  PHE E CZ  1 
ATOM 11085 N N   . PHE E 1 80  ? -2.391  65.712  21.878  1.00 38.85 ? 80  PHE E N   1 
ATOM 11086 C CA  . PHE E 1 80  ? -2.847  66.604  22.924  1.00 38.85 ? 80  PHE E CA  1 
ATOM 11087 C C   . PHE E 1 80  ? -4.125  65.889  23.363  1.00 38.85 ? 80  PHE E C   1 
ATOM 11088 O O   . PHE E 1 80  ? -4.870  65.396  22.516  1.00 38.85 ? 80  PHE E O   1 
ATOM 11089 C CB  . PHE E 1 80  ? -3.201  67.967  22.371  1.00 48.84 ? 80  PHE E CB  1 
ATOM 11090 C CG  . PHE E 1 80  ? -3.972  68.809  23.333  1.00 48.84 ? 80  PHE E CG  1 
ATOM 11091 C CD1 . PHE E 1 80  ? -3.355  69.347  24.452  1.00 48.84 ? 80  PHE E CD1 1 
ATOM 11092 C CD2 . PHE E 1 80  ? -5.325  69.053  23.131  1.00 48.84 ? 80  PHE E CD2 1 
ATOM 11093 C CE1 . PHE E 1 80  ? -4.078  70.123  25.361  1.00 48.84 ? 80  PHE E CE1 1 
ATOM 11094 C CE2 . PHE E 1 80  ? -6.056  69.824  24.031  1.00 48.84 ? 80  PHE E CE2 1 
ATOM 11095 C CZ  . PHE E 1 80  ? -5.431  70.362  25.148  1.00 48.84 ? 80  PHE E CZ  1 
ATOM 11096 N N   . HIS E 1 81  ? -4.382  65.825  24.664  1.00 29.31 ? 81  HIS E N   1 
ATOM 11097 C CA  . HIS E 1 81  ? -5.567  65.127  25.174  1.00 29.31 ? 81  HIS E CA  1 
ATOM 11098 C C   . HIS E 1 81  ? -6.779  65.121  24.242  1.00 29.31 ? 81  HIS E C   1 
ATOM 11099 O O   . HIS E 1 81  ? -7.216  64.070  23.772  1.00 29.31 ? 81  HIS E O   1 
ATOM 11100 C CB  . HIS E 1 81  ? -6.009  65.714  26.508  1.00 29.23 ? 81  HIS E CB  1 
ATOM 11101 C CG  . HIS E 1 81  ? -7.153  64.977  27.127  1.00 29.23 ? 81  HIS E CG  1 
ATOM 11102 N ND1 . HIS E 1 81  ? -6.991  63.786  27.801  1.00 29.23 ? 81  HIS E ND1 1 
ATOM 11103 C CD2 . HIS E 1 81  ? -8.486  65.216  27.104  1.00 29.23 ? 81  HIS E CD2 1 
ATOM 11104 C CE1 . HIS E 1 81  ? -8.174  63.322  28.163  1.00 29.23 ? 81  HIS E CE1 1 
ATOM 11105 N NE2 . HIS E 1 81  ? -9.098  64.170  27.752  1.00 29.23 ? 81  HIS E NE2 1 
ATOM 11106 N N   . GLU E 1 82  ? -7.337  66.306  24.022  1.00 27.19 ? 82  GLU E N   1 
ATOM 11107 C CA  . GLU E 1 82  ? -8.493  66.494  23.152  1.00 27.19 ? 82  GLU E CA  1 
ATOM 11108 C C   . GLU E 1 82  ? -8.367  65.623  21.908  1.00 27.19 ? 82  GLU E C   1 
ATOM 11109 O O   . GLU E 1 82  ? -9.195  64.744  21.648  1.00 27.19 ? 82  GLU E O   1 
ATOM 11110 C CB  . GLU E 1 82  ? -8.560  67.965  22.740  1.00 51.28 ? 82  GLU E CB  1 
ATOM 11111 C CG  . GLU E 1 82  ? -9.587  68.294  21.689  1.00 51.28 ? 82  GLU E CG  1 
ATOM 11112 C CD  . GLU E 1 82  ? -9.280  69.600  20.972  1.00 51.28 ? 82  GLU E CD  1 
ATOM 11113 O OE1 . GLU E 1 82  ? -8.317  69.633  20.168  1.00 51.28 ? 82  GLU E OE1 1 
ATOM 11114 O OE2 . GLU E 1 82  ? -9.999  70.595  21.215  1.00 51.28 ? 82  GLU E OE2 1 
ATOM 11115 N N   . THR E 1 83  ? -7.301  65.881  21.157  1.00 30.66 ? 83  THR E N   1 
ATOM 11116 C CA  . THR E 1 83  ? -6.996  65.181  19.919  1.00 30.66 ? 83  THR E CA  1 
ATOM 11117 C C   . THR E 1 83  ? -6.991  63.651  20.027  1.00 30.66 ? 83  THR E C   1 
ATOM 11118 O O   . THR E 1 83  ? -7.429  62.957  19.109  1.00 30.66 ? 83  THR E O   1 
ATOM 11119 C CB  . THR E 1 83  ? -5.646  65.671  19.371  1.00 32.63 ? 83  THR E CB  1 
ATOM 11120 O OG1 . THR E 1 83  ? -5.713  67.086  19.145  1.00 32.63 ? 83  THR E OG1 1 
ATOM 11121 C CG2 . THR E 1 83  ? -5.319  64.980  18.067  1.00 32.63 ? 83  THR E CG2 1 
ATOM 11122 N N   . LEU E 1 84  ? -6.501  63.125  21.145  1.00 25.47 ? 84  LEU E N   1 
ATOM 11123 C CA  . LEU E 1 84  ? -6.439  61.678  21.358  1.00 25.47 ? 84  LEU E CA  1 
ATOM 11124 C C   . LEU E 1 84  ? -7.815  61.028  21.270  1.00 25.47 ? 84  LEU E C   1 
ATOM 11125 O O   . LEU E 1 84  ? -7.936  59.801  21.213  1.00 25.47 ? 84  LEU E O   1 
ATOM 11126 C CB  . LEU E 1 84  ? -5.843  61.379  22.733  1.00 28.75 ? 84  LEU E CB  1 
ATOM 11127 C CG  . LEU E 1 84  ? -5.649  59.909  23.088  1.00 28.75 ? 84  LEU E CG  1 
ATOM 11128 C CD1 . LEU E 1 84  ? -4.471  59.369  22.307  1.00 28.75 ? 84  LEU E CD1 1 
ATOM 11129 C CD2 . LEU E 1 84  ? -5.406  59.761  24.578  1.00 28.75 ? 84  LEU E CD2 1 
ATOM 11130 N N   . TYR E 1 85  ? -8.858  61.846  21.274  1.00 31.61 ? 85  TYR E N   1 
ATOM 11131 C CA  . TYR E 1 85  ? -10.204 61.302  21.208  1.00 31.61 ? 85  TYR E CA  1 
ATOM 11132 C C   . TYR E 1 85  ? -11.002 61.819  20.016  1.00 31.61 ? 85  TYR E C   1 
ATOM 11133 O O   . TYR E 1 85  ? -12.221 61.625  19.943  1.00 31.61 ? 85  TYR E O   1 
ATOM 11134 C CB  . TYR E 1 85  ? -10.951 61.587  22.515  1.00 31.26 ? 85  TYR E CB  1 
ATOM 11135 C CG  . TYR E 1 85  ? -10.290 60.964  23.722  1.00 31.26 ? 85  TYR E CG  1 
ATOM 11136 C CD1 . TYR E 1 85  ? -9.323  61.656  24.450  1.00 31.26 ? 85  TYR E CD1 1 
ATOM 11137 C CD2 . TYR E 1 85  ? -10.567 59.648  24.087  1.00 31.26 ? 85  TYR E CD2 1 
ATOM 11138 C CE1 . TYR E 1 85  ? -8.645  61.047  25.507  1.00 31.26 ? 85  TYR E CE1 1 
ATOM 11139 C CE2 . TYR E 1 85  ? -9.896  59.029  25.141  1.00 31.26 ? 85  TYR E CE2 1 
ATOM 11140 C CZ  . TYR E 1 85  ? -8.937  59.733  25.841  1.00 31.26 ? 85  TYR E CZ  1 
ATOM 11141 O OH  . TYR E 1 85  ? -8.253  59.117  26.857  1.00 31.26 ? 85  TYR E OH  1 
ATOM 11142 N N   . GLN E 1 86  ? -10.317 62.471  19.082  1.00 41.21 ? 86  GLN E N   1 
ATOM 11143 C CA  . GLN E 1 86  ? -10.985 62.987  17.897  1.00 41.21 ? 86  GLN E CA  1 
ATOM 11144 C C   . GLN E 1 86  ? -10.926 61.959  16.773  1.00 41.21 ? 86  GLN E C   1 
ATOM 11145 O O   . GLN E 1 86  ? -10.111 61.029  16.798  1.00 41.21 ? 86  GLN E O   1 
ATOM 11146 C CB  . GLN E 1 86  ? -10.345 64.300  17.448  1.00 35.65 ? 86  GLN E CB  1 
ATOM 11147 C CG  . GLN E 1 86  ? -10.440 65.389  18.487  1.00 35.65 ? 86  GLN E CG  1 
ATOM 11148 C CD  . GLN E 1 86  ? -9.978  66.740  17.974  1.00 35.65 ? 86  GLN E CD  1 
ATOM 11149 O OE1 . GLN E 1 86  ? -8.814  66.917  17.583  1.00 35.65 ? 86  GLN E OE1 1 
ATOM 11150 N NE2 . GLN E 1 86  ? -10.887 67.710  17.981  1.00 35.65 ? 86  GLN E NE2 1 
ATOM 11151 N N   . LYS E 1 87  ? -11.802 62.128  15.790  1.00 45.22 ? 87  LYS E N   1 
ATOM 11152 C CA  . LYS E 1 87  ? -11.863 61.223  14.657  1.00 45.22 ? 87  LYS E CA  1 
ATOM 11153 C C   . LYS E 1 87  ? -11.808 61.999  13.350  1.00 45.22 ? 87  LYS E C   1 
ATOM 11154 O O   . LYS E 1 87  ? -12.115 63.195  13.317  1.00 45.22 ? 87  LYS E O   1 
ATOM 11155 C CB  . LYS E 1 87  ? -13.148 60.404  14.732  1.00 46.73 ? 87  LYS E CB  1 
ATOM 11156 C CG  . LYS E 1 87  ? -13.188 59.497  15.940  1.00 46.73 ? 87  LYS E CG  1 
ATOM 11157 C CD  . LYS E 1 87  ? -14.498 58.727  16.059  1.00 46.73 ? 87  LYS E CD  1 
ATOM 11158 C CE  . LYS E 1 87  ? -15.601 59.561  16.694  1.00 46.73 ? 87  LYS E CE  1 
ATOM 11159 N NZ  . LYS E 1 87  ? -16.735 58.696  17.148  1.00 46.73 ? 87  LYS E NZ  1 
ATOM 11160 N N   . ASP E 1 88  ? -11.397 61.323  12.281  1.00 59.67 ? 88  ASP E N   1 
ATOM 11161 C CA  . ASP E 1 88  ? -11.322 61.952  10.967  1.00 59.67 ? 88  ASP E CA  1 
ATOM 11162 C C   . ASP E 1 88  ? -12.730 62.009  10.385  1.00 59.67 ? 88  ASP E C   1 
ATOM 11163 O O   . ASP E 1 88  ? -13.689 61.544  11.008  1.00 59.67 ? 88  ASP E O   1 
ATOM 11164 C CB  . ASP E 1 88  ? -10.386 61.167  10.038  1.00 56.32 ? 88  ASP E CB  1 
ATOM 11165 C CG  . ASP E 1 88  ? -10.877 59.759  9.755   1.00 56.32 ? 88  ASP E CG  1 
ATOM 11166 O OD1 . ASP E 1 88  ? -10.096 58.968  9.187   1.00 56.32 ? 88  ASP E OD1 1 
ATOM 11167 O OD2 . ASP E 1 88  ? -12.038 59.437  10.089  1.00 56.32 ? 88  ASP E OD2 1 
ATOM 11168 N N   . ASP E 1 89  ? -12.858 62.567  9.191   1.00 53.28 ? 89  ASP E N   1 
ATOM 11169 C CA  . ASP E 1 89  ? -14.166 62.694  8.574   1.00 53.28 ? 89  ASP E CA  1 
ATOM 11170 C C   . ASP E 1 89  ? -14.872 61.373  8.306   1.00 53.28 ? 89  ASP E C   1 
ATOM 11171 O O   . ASP E 1 89  ? -16.083 61.354  8.084   1.00 53.28 ? 89  ASP E O   1 
ATOM 11172 C CB  . ASP E 1 89  ? -14.055 63.493  7.284   1.00 50.79 ? 89  ASP E CB  1 
ATOM 11173 C CG  . ASP E 1 89  ? -13.396 64.840  7.498   1.00 50.79 ? 89  ASP E CG  1 
ATOM 11174 O OD1 . ASP E 1 89  ? -13.613 65.443  8.575   1.00 50.79 ? 89  ASP E OD1 1 
ATOM 11175 O OD2 . ASP E 1 89  ? -12.671 65.298  6.589   1.00 50.79 ? 89  ASP E OD2 1 
ATOM 11176 N N   . ASN E 1 90  ? -14.130 60.270  8.334   1.00 49.35 ? 90  ASN E N   1 
ATOM 11177 C CA  . ASN E 1 90  ? -14.728 58.960  8.092   1.00 49.35 ? 90  ASN E CA  1 
ATOM 11178 C C   . ASN E 1 90  ? -15.155 58.321  9.401   1.00 49.35 ? 90  ASN E C   1 
ATOM 11179 O O   . ASN E 1 90  ? -15.619 57.176  9.421   1.00 49.35 ? 90  ASN E O   1 
ATOM 11180 C CB  . ASN E 1 90  ? -13.739 58.040  7.383   1.00 75.74 ? 90  ASN E CB  1 
ATOM 11181 C CG  . ASN E 1 90  ? -13.203 58.646  6.110   1.00 75.74 ? 90  ASN E CG  1 
ATOM 11182 O OD1 . ASN E 1 90  ? -13.965 59.013  5.213   1.00 75.74 ? 90  ASN E OD1 1 
ATOM 11183 N ND2 . ASN E 1 90  ? -11.880 58.758  6.021   1.00 75.74 ? 90  ASN E ND2 1 
ATOM 11184 N N   . GLY E 1 91  ? -14.996 59.065  10.493  1.00 56.59 ? 91  GLY E N   1 
ATOM 11185 C CA  . GLY E 1 91  ? -15.365 58.555  11.801  1.00 56.59 ? 91  GLY E CA  1 
ATOM 11186 C C   . GLY E 1 91  ? -14.307 57.628  12.366  1.00 56.59 ? 91  GLY E C   1 
ATOM 11187 O O   . GLY E 1 91  ? -14.576 56.840  13.273  1.00 56.59 ? 91  GLY E O   1 
ATOM 11188 N N   . VAL E 1 92  ? -13.095 57.718  11.826  1.00 58.57 ? 92  VAL E N   1 
ATOM 11189 C CA  . VAL E 1 92  ? -12.003 56.879  12.289  1.00 58.57 ? 92  VAL E CA  1 
ATOM 11190 C C   . VAL E 1 92  ? -11.087 57.601  13.262  1.00 58.57 ? 92  VAL E C   1 
ATOM 11191 O O   . VAL E 1 92  ? -10.478 58.623  12.935  1.00 58.57 ? 92  VAL E O   1 
ATOM 11192 C CB  . VAL E 1 92  ? -11.151 56.375  11.129  1.00 43.01 ? 92  VAL E CB  1 
ATOM 11193 C CG1 . VAL E 1 92  ? -10.010 55.516  11.666  1.00 43.01 ? 92  VAL E CG1 1 
ATOM 11194 C CG2 . VAL E 1 92  ? -12.016 55.591  10.166  1.00 43.01 ? 92  VAL E CG2 1 
ATOM 11195 N N   . PRO E 1 93  ? -10.962 57.057  14.474  1.00 39.94 ? 93  PRO E N   1 
ATOM 11196 C CA  . PRO E 1 93  ? -10.129 57.605  15.542  1.00 39.94 ? 93  PRO E CA  1 
ATOM 11197 C C   . PRO E 1 93  ? -8.717  57.891  15.054  1.00 39.94 ? 93  PRO E C   1 
ATOM 11198 O O   . PRO E 1 93  ? -8.051  57.003  14.522  1.00 39.94 ? 93  PRO E O   1 
ATOM 11199 C CB  . PRO E 1 93  ? -10.143 56.497  16.583  1.00 28.98 ? 93  PRO E CB  1 
ATOM 11200 C CG  . PRO E 1 93  ? -11.474 55.852  16.368  1.00 28.98 ? 93  PRO E CG  1 
ATOM 11201 C CD  . PRO E 1 93  ? -11.554 55.773  14.877  1.00 28.98 ? 93  PRO E CD  1 
ATOM 11202 N N   . PHE E 1 94  ? -8.266  59.129  15.227  1.00 36.83 ? 94  PHE E N   1 
ATOM 11203 C CA  . PHE E 1 94  ? -6.919  59.503  14.823  1.00 36.83 ? 94  PHE E CA  1 
ATOM 11204 C C   . PHE E 1 94  ? -5.930  58.495  15.412  1.00 36.83 ? 94  PHE E C   1 
ATOM 11205 O O   . PHE E 1 94  ? -4.944  58.126  14.776  1.00 36.83 ? 94  PHE E O   1 
ATOM 11206 C CB  . PHE E 1 94  ? -6.581  60.901  15.342  1.00 35.42 ? 94  PHE E CB  1 
ATOM 11207 C CG  . PHE E 1 94  ? -7.263  62.013  14.603  1.00 35.42 ? 94  PHE E CG  1 
ATOM 11208 C CD1 . PHE E 1 94  ? -7.624  63.180  15.270  1.00 35.42 ? 94  PHE E CD1 1 
ATOM 11209 C CD2 . PHE E 1 94  ? -7.489  61.928  13.238  1.00 35.42 ? 94  PHE E CD2 1 
ATOM 11210 C CE1 . PHE E 1 94  ? -8.197  64.252  14.587  1.00 35.42 ? 94  PHE E CE1 1 
ATOM 11211 C CE2 . PHE E 1 94  ? -8.060  62.993  12.544  1.00 35.42 ? 94  PHE E CE2 1 
ATOM 11212 C CZ  . PHE E 1 94  ? -8.415  64.159  13.221  1.00 35.42 ? 94  PHE E CZ  1 
ATOM 11213 N N   . VAL E 1 95  ? -6.199  58.055  16.638  1.00 39.08 ? 95  VAL E N   1 
ATOM 11214 C CA  . VAL E 1 95  ? -5.326  57.096  17.301  1.00 39.08 ? 95  VAL E CA  1 
ATOM 11215 C C   . VAL E 1 95  ? -5.260  55.816  16.486  1.00 39.08 ? 95  VAL E C   1 
ATOM 11216 O O   . VAL E 1 95  ? -4.180  55.285  16.234  1.00 39.08 ? 95  VAL E O   1 
ATOM 11217 C CB  . VAL E 1 95  ? -5.826  56.756  18.721  1.00 36.13 ? 95  VAL E CB  1 
ATOM 11218 C CG1 . VAL E 1 95  ? -4.939  55.694  19.336  1.00 36.13 ? 95  VAL E CG1 1 
ATOM 11219 C CG2 . VAL E 1 95  ? -5.822  58.001  19.587  1.00 36.13 ? 95  VAL E CG2 1 
ATOM 11220 N N   . ARG E 1 96  ? -6.428  55.333  16.074  1.00 44.26 ? 96  ARG E N   1 
ATOM 11221 C CA  . ARG E 1 96  ? -6.537  54.118  15.275  1.00 44.26 ? 96  ARG E CA  1 
ATOM 11222 C C   . ARG E 1 96  ? -5.623  54.211  14.057  1.00 44.26 ? 96  ARG E C   1 
ATOM 11223 O O   . ARG E 1 96  ? -4.783  53.342  13.825  1.00 44.26 ? 96  ARG E O   1 
ATOM 11224 C CB  . ARG E 1 96  ? -7.974  53.944  14.808  1.00 95.18 ? 96  ARG E CB  1 
ATOM 11225 C CG  . ARG E 1 96  ? -8.207  52.683  14.034  1.00 95.18 ? 96  ARG E CG  1 
ATOM 11226 C CD  . ARG E 1 96  ? -8.097  51.476  14.931  1.00 95.18 ? 96  ARG E CD  1 
ATOM 11227 N NE  . ARG E 1 96  ? -9.104  50.487  14.566  1.00 95.18 ? 96  ARG E NE  1 
ATOM 11228 C CZ  . ARG E 1 96  ? -10.411 50.739  14.517  1.00 95.18 ? 96  ARG E CZ  1 
ATOM 11229 N NH1 . ARG E 1 96  ? -10.878 51.949  14.810  1.00 95.18 ? 96  ARG E NH1 1 
ATOM 11230 N NH2 . ARG E 1 96  ? -11.256 49.778  14.167  1.00 95.18 ? 96  ARG E NH2 1 
ATOM 11231 N N   . THR E 1 97  ? -5.799  55.278  13.286  1.00 38.00 ? 97  THR E N   1 
ATOM 11232 C CA  . THR E 1 97  ? -5.002  55.515  12.093  1.00 38.00 ? 97  THR E CA  1 
ATOM 11233 C C   . THR E 1 97  ? -3.503  55.422  12.376  1.00 38.00 ? 97  THR E C   1 
ATOM 11234 O O   . THR E 1 97  ? -2.820  54.568  11.812  1.00 38.00 ? 97  THR E O   1 
ATOM 11235 C CB  . THR E 1 97  ? -5.301  56.900  11.503  1.00 34.32 ? 97  THR E CB  1 
ATOM 11236 O OG1 . THR E 1 97  ? -6.701  57.001  11.207  1.00 34.32 ? 97  THR E OG1 1 
ATOM 11237 C CG2 . THR E 1 97  ? -4.480  57.127  10.238  1.00 34.32 ? 97  THR E CG2 1 
ATOM 11238 N N   . ILE E 1 98  ? -2.989  56.303  13.236  1.00 29.65 ? 98  ILE E N   1 
ATOM 11239 C CA  . ILE E 1 98  ? -1.568  56.282  13.561  1.00 29.65 ? 98  ILE E CA  1 
ATOM 11240 C C   . ILE E 1 98  ? -1.149  54.877  13.996  1.00 29.65 ? 98  ILE E C   1 
ATOM 11241 O O   . ILE E 1 98  ? -0.087  54.393  13.601  1.00 29.65 ? 98  ILE E O   1 
ATOM 11242 C CB  . ILE E 1 98  ? -1.210  57.303  14.678  1.00 28.10 ? 98  ILE E CB  1 
ATOM 11243 C CG1 . ILE E 1 98  ? -1.006  58.691  14.078  1.00 28.10 ? 98  ILE E CG1 1 
ATOM 11244 C CG2 . ILE E 1 98  ? 0.092   56.913  15.359  1.00 28.10 ? 98  ILE E CG2 1 
ATOM 11245 C CD1 . ILE E 1 98  ? -2.255  59.327  13.575  1.00 28.10 ? 98  ILE E CD1 1 
ATOM 11246 N N   . GLN E 1 99  ? -1.985  54.220  14.795  1.00 37.84 ? 99  GLN E N   1 
ATOM 11247 C CA  . GLN E 1 99  ? -1.675  52.874  15.266  1.00 37.84 ? 99  GLN E CA  1 
ATOM 11248 C C   . GLN E 1 99  ? -1.533  51.874  14.140  1.00 37.84 ? 99  GLN E C   1 
ATOM 11249 O O   . GLN E 1 99  ? -0.612  51.056  14.138  1.00 37.84 ? 99  GLN E O   1 
ATOM 11250 C CB  . GLN E 1 99  ? -2.751  52.368  16.210  1.00 57.96 ? 99  GLN E CB  1 
ATOM 11251 C CG  . GLN E 1 99  ? -2.758  53.052  17.539  1.00 57.96 ? 99  GLN E CG  1 
ATOM 11252 C CD  . GLN E 1 99  ? -3.696  52.376  18.495  1.00 57.96 ? 99  GLN E CD  1 
ATOM 11253 O OE1 . GLN E 1 99  ? -4.885  52.227  18.208  1.00 57.96 ? 99  GLN E OE1 1 
ATOM 11254 N NE2 . GLN E 1 99  ? -3.172  51.953  19.640  1.00 57.96 ? 99  GLN E NE2 1 
ATOM 11255 N N   . ASP E 1 100 ? -2.457  51.929  13.186  1.00 47.35 ? 100 ASP E N   1 
ATOM 11256 C CA  . ASP E 1 100 ? -2.426  51.011  12.059  1.00 47.35 ? 100 ASP E CA  1 
ATOM 11257 C C   . ASP E 1 100 ? -1.161  51.156  11.221  1.00 47.35 ? 100 ASP E C   1 
ATOM 11258 O O   . ASP E 1 100 ? -0.706  50.184  10.631  1.00 47.35 ? 100 ASP E O   1 
ATOM 11259 C CB  . ASP E 1 100 ? -3.673  51.191  11.191  1.00 60.48 ? 100 ASP E CB  1 
ATOM 11260 C CG  . ASP E 1 100 ? -4.946  50.698  11.881  1.00 60.48 ? 100 ASP E CG  1 
ATOM 11261 O OD1 . ASP E 1 100 ? -4.846  49.962  12.897  1.00 60.48 ? 100 ASP E OD1 1 
ATOM 11262 O OD2 . ASP E 1 100 ? -6.051  51.036  11.395  1.00 60.48 ? 100 ASP E OD2 1 
ATOM 11263 N N   . LYS E 1 101 ? -0.588  52.357  11.164  1.00 29.96 ? 101 LYS E N   1 
ATOM 11264 C CA  . LYS E 1 101 ? 0.644   52.557  10.402  1.00 29.96 ? 101 LYS E CA  1 
ATOM 11265 C C   . LYS E 1 101 ? 1.828   52.068  11.227  1.00 29.96 ? 101 LYS E C   1 
ATOM 11266 O O   . LYS E 1 101 ? 2.983   52.199  10.812  1.00 29.96 ? 101 LYS E O   1 
ATOM 11267 C CB  . LYS E 1 101 ? 0.859   54.032  10.054  1.00 42.27 ? 101 LYS E CB  1 
ATOM 11268 C CG  . LYS E 1 101 ? -0.123  54.595  9.058   1.00 42.27 ? 101 LYS E CG  1 
ATOM 11269 C CD  . LYS E 1 101 ? 0.297   55.992  8.652   1.00 42.27 ? 101 LYS E CD  1 
ATOM 11270 C CE  . LYS E 1 101 ? -0.792  56.701  7.861   1.00 42.27 ? 101 LYS E CE  1 
ATOM 11271 N NZ  . LYS E 1 101 ? -0.966  56.099  6.511   1.00 42.27 ? 101 LYS E NZ  1 
ATOM 11272 N N   . GLY E 1 102 ? 1.536   51.516  12.402  1.00 35.49 ? 102 GLY E N   1 
ATOM 11273 C CA  . GLY E 1 102 ? 2.589   51.008  13.259  1.00 35.49 ? 102 GLY E CA  1 
ATOM 11274 C C   . GLY E 1 102 ? 3.365   52.081  14.002  1.00 35.49 ? 102 GLY E C   1 
ATOM 11275 O O   . GLY E 1 102 ? 4.411   51.803  14.595  1.00 35.49 ? 102 GLY E O   1 
ATOM 11276 N N   . ILE E 1 103 ? 2.861   53.311  13.972  1.00 31.59 ? 103 ILE E N   1 
ATOM 11277 C CA  . ILE E 1 103 ? 3.515   54.414  14.663  1.00 31.59 ? 103 ILE E CA  1 
ATOM 11278 C C   . ILE E 1 103 ? 3.047   54.377  16.116  1.00 31.59 ? 103 ILE E C   1 
ATOM 11279 O O   . ILE E 1 103 ? 1.914   53.985  16.388  1.00 31.59 ? 103 ILE E O   1 
ATOM 11280 C CB  . ILE E 1 103 ? 3.137   55.746  14.005  1.00 25.82 ? 103 ILE E CB  1 
ATOM 11281 C CG1 . ILE E 1 103 ? 3.470   55.668  12.512  1.00 25.82 ? 103 ILE E CG1 1 
ATOM 11282 C CG2 . ILE E 1 103 ? 3.890   56.890  14.655  1.00 25.82 ? 103 ILE E CG2 1 
ATOM 11283 C CD1 . ILE E 1 103 ? 3.148   56.911  11.730  1.00 25.82 ? 103 ILE E CD1 1 
ATOM 11284 N N   . VAL E 1 104 ? 3.913   54.762  17.049  1.00 27.21 ? 104 VAL E N   1 
ATOM 11285 C CA  . VAL E 1 104 ? 3.541   54.734  18.463  1.00 27.21 ? 104 VAL E CA  1 
ATOM 11286 C C   . VAL E 1 104 ? 2.758   55.981  18.878  1.00 27.21 ? 104 VAL E C   1 
ATOM 11287 O O   . VAL E 1 104 ? 3.040   57.085  18.403  1.00 27.21 ? 104 VAL E O   1 
ATOM 11288 C CB  . VAL E 1 104 ? 4.784   54.602  19.366  1.00 22.18 ? 104 VAL E CB  1 
ATOM 11289 C CG1 . VAL E 1 104 ? 4.353   54.299  20.784  1.00 22.18 ? 104 VAL E CG1 1 
ATOM 11290 C CG2 . VAL E 1 104 ? 5.691   53.502  18.856  1.00 22.18 ? 104 VAL E CG2 1 
ATOM 11291 N N   . VAL E 1 105 ? 1.783   55.798  19.769  1.00 33.21 ? 105 VAL E N   1 
ATOM 11292 C CA  . VAL E 1 105 ? 0.945   56.898  20.250  1.00 33.21 ? 105 VAL E CA  1 
ATOM 11293 C C   . VAL E 1 105 ? 1.349   57.427  21.632  1.00 33.21 ? 105 VAL E C   1 
ATOM 11294 O O   . VAL E 1 105 ? 1.638   56.647  22.545  1.00 33.21 ? 105 VAL E O   1 
ATOM 11295 C CB  . VAL E 1 105 ? -0.531  56.458  20.318  1.00 24.70 ? 105 VAL E CB  1 
ATOM 11296 C CG1 . VAL E 1 105 ? -1.403  57.620  20.741  1.00 24.70 ? 105 VAL E CG1 1 
ATOM 11297 C CG2 . VAL E 1 105 ? -0.974  55.936  18.972  1.00 24.70 ? 105 VAL E CG2 1 
ATOM 11298 N N   . GLY E 1 106 ? 1.361   58.752  21.785  1.00 27.53 ? 106 GLY E N   1 
ATOM 11299 C CA  . GLY E 1 106 ? 1.716   59.350  23.063  1.00 27.53 ? 106 GLY E CA  1 
ATOM 11300 C C   . GLY E 1 106 ? 0.854   60.553  23.421  1.00 27.53 ? 106 GLY E C   1 
ATOM 11301 O O   . GLY E 1 106 ? 0.207   61.113  22.538  1.00 27.53 ? 106 GLY E O   1 
ATOM 11302 N N   . ILE E 1 107 ? 0.839   60.946  24.701  1.00 25.43 ? 107 ILE E N   1 
ATOM 11303 C CA  . ILE E 1 107 ? 0.060   62.106  25.177  1.00 25.43 ? 107 ILE E CA  1 
ATOM 11304 C C   . ILE E 1 107 ? 0.872   63.013  26.073  1.00 25.43 ? 107 ILE E C   1 
ATOM 11305 O O   . ILE E 1 107 ? 1.695   62.543  26.864  1.00 25.43 ? 107 ILE E O   1 
ATOM 11306 C CB  . ILE E 1 107 ? -1.150  61.732  26.080  1.00 19.43 ? 107 ILE E CB  1 
ATOM 11307 C CG1 . ILE E 1 107 ? -1.219  60.229  26.244  1.00 19.43 ? 107 ILE E CG1 1 
ATOM 11308 C CG2 . ILE E 1 107 ? -2.430  62.343  25.552  1.00 19.43 ? 107 ILE E CG2 1 
ATOM 11309 C CD1 . ILE E 1 107 ? 0.022   59.671  26.899  1.00 19.43 ? 107 ILE E CD1 1 
ATOM 11310 N N   . LYS E 1 108 ? 0.615   64.312  25.950  1.00 31.75 ? 108 LYS E N   1 
ATOM 11311 C CA  . LYS E 1 108 ? 1.236   65.324  26.802  1.00 31.75 ? 108 LYS E CA  1 
ATOM 11312 C C   . LYS E 1 108 ? 0.414   65.131  28.084  1.00 31.75 ? 108 LYS E C   1 
ATOM 11313 O O   . LYS E 1 108 ? -0.813  65.056  28.014  1.00 31.75 ? 108 LYS E O   1 
ATOM 11314 C CB  . LYS E 1 108 ? 0.981   66.717  26.216  1.00 30.21 ? 108 LYS E CB  1 
ATOM 11315 C CG  . LYS E 1 108 ? 1.373   67.910  27.076  1.00 30.21 ? 108 LYS E CG  1 
ATOM 11316 C CD  . LYS E 1 108 ? 0.892   69.203  26.406  1.00 30.21 ? 108 LYS E CD  1 
ATOM 11317 C CE  . LYS E 1 108 ? 1.752   70.427  26.762  1.00 30.21 ? 108 LYS E CE  1 
ATOM 11318 N NZ  . LYS E 1 108 ? 1.471   71.635  25.871  1.00 30.21 ? 108 LYS E NZ  1 
ATOM 11319 N N   . VAL E 1 109 ? 1.061   65.013  29.238  1.00 24.58 ? 109 VAL E N   1 
ATOM 11320 C CA  . VAL E 1 109 ? 0.309   64.820  30.473  1.00 24.58 ? 109 VAL E CA  1 
ATOM 11321 C C   . VAL E 1 109 ? 0.494   65.936  31.493  1.00 24.58 ? 109 VAL E C   1 
ATOM 11322 O O   . VAL E 1 109 ? -0.320  66.084  32.402  1.00 24.58 ? 109 VAL E O   1 
ATOM 11323 C CB  . VAL E 1 109 ? 0.666   63.481  31.140  1.00 13.41 ? 109 VAL E CB  1 
ATOM 11324 C CG1 . VAL E 1 109 ? 0.368   62.346  30.187  1.00 13.41 ? 109 VAL E CG1 1 
ATOM 11325 C CG2 . VAL E 1 109 ? 2.124   63.472  31.557  1.00 13.41 ? 109 VAL E CG2 1 
ATOM 11326 N N   . ASP E 1 110 ? 1.558   66.723  31.348  1.00 19.03 ? 110 ASP E N   1 
ATOM 11327 C CA  . ASP E 1 110 ? 1.796   67.817  32.280  1.00 19.03 ? 110 ASP E CA  1 
ATOM 11328 C C   . ASP E 1 110 ? 0.614   68.770  32.186  1.00 19.03 ? 110 ASP E C   1 
ATOM 11329 O O   . ASP E 1 110 ? -0.049  68.844  31.158  1.00 19.03 ? 110 ASP E O   1 
ATOM 11330 C CB  . ASP E 1 110 ? 3.099   68.562  31.958  1.00 34.88 ? 110 ASP E CB  1 
ATOM 11331 C CG  . ASP E 1 110 ? 2.976   69.475  30.756  1.00 34.88 ? 110 ASP E CG  1 
ATOM 11332 O OD1 . ASP E 1 110 ? 3.441   69.088  29.668  1.00 34.88 ? 110 ASP E OD1 1 
ATOM 11333 O OD2 . ASP E 1 110 ? 2.419   70.584  30.899  1.00 34.88 ? 110 ASP E OD2 1 
ATOM 11334 N N   . LYS E 1 111 ? 0.342   69.484  33.268  1.00 26.53 ? 111 LYS E N   1 
ATOM 11335 C CA  . LYS E 1 111 ? -0.767  70.412  33.289  1.00 26.53 ? 111 LYS E CA  1 
ATOM 11336 C C   . LYS E 1 111 ? -0.266  71.841  33.338  1.00 26.53 ? 111 LYS E C   1 
ATOM 11337 O O   . LYS E 1 111 ? -0.766  72.659  34.105  1.00 26.53 ? 111 LYS E O   1 
ATOM 11338 C CB  . LYS E 1 111 ? -1.677  70.140  34.485  1.00 35.56 ? 111 LYS E CB  1 
ATOM 11339 C CG  . LYS E 1 111 ? -2.334  68.767  34.492  1.00 35.56 ? 111 LYS E CG  1 
ATOM 11340 C CD  . LYS E 1 111 ? -3.790  68.874  34.952  1.00 35.56 ? 111 LYS E CD  1 
ATOM 11341 C CE  . LYS E 1 111 ? -4.309  67.610  35.651  1.00 35.56 ? 111 LYS E CE  1 
ATOM 11342 N NZ  . LYS E 1 111 ? -3.732  67.395  37.032  1.00 35.56 ? 111 LYS E NZ  1 
ATOM 11343 N N   . GLY E 1 112 ? 0.744   72.138  32.532  1.00 19.08 ? 112 GLY E N   1 
ATOM 11344 C CA  . GLY E 1 112 ? 1.244   73.497  32.491  1.00 19.08 ? 112 GLY E CA  1 
ATOM 11345 C C   . GLY E 1 112 ? 2.304   73.907  33.488  1.00 19.08 ? 112 GLY E C   1 
ATOM 11346 O O   . GLY E 1 112 ? 2.511   73.291  34.536  1.00 19.08 ? 112 GLY E O   1 
ATOM 11347 N N   . VAL E 1 113 ? 2.971   74.996  33.141  1.00 19.10 ? 113 VAL E N   1 
ATOM 11348 C CA  . VAL E 1 113 ? 4.041   75.544  33.941  1.00 19.10 ? 113 VAL E CA  1 
ATOM 11349 C C   . VAL E 1 113 ? 3.457   76.479  34.984  1.00 19.10 ? 113 VAL E C   1 
ATOM 11350 O O   . VAL E 1 113 ? 2.414   77.085  34.754  1.00 19.10 ? 113 VAL E O   1 
ATOM 11351 C CB  . VAL E 1 113 ? 4.988   76.335  33.037  1.00 14.43 ? 113 VAL E CB  1 
ATOM 11352 C CG1 . VAL E 1 113 ? 4.402   77.693  32.739  1.00 14.43 ? 113 VAL E CG1 1 
ATOM 11353 C CG2 . VAL E 1 113 ? 6.323   76.463  33.675  1.00 14.43 ? 113 VAL E CG2 1 
ATOM 11354 N N   . VAL E 1 114 ? 4.122   76.596  36.127  1.00 27.90 ? 114 VAL E N   1 
ATOM 11355 C CA  . VAL E 1 114 ? 3.662   77.487  37.189  1.00 27.90 ? 114 VAL E CA  1 
ATOM 11356 C C   . VAL E 1 114 ? 4.857   78.175  37.846  1.00 27.90 ? 114 VAL E C   1 
ATOM 11357 O O   . VAL E 1 114 ? 5.981   77.677  37.793  1.00 27.90 ? 114 VAL E O   1 
ATOM 11358 C CB  . VAL E 1 114 ? 2.859   76.736  38.260  1.00 10.04 ? 114 VAL E CB  1 
ATOM 11359 C CG1 . VAL E 1 114 ? 1.653   76.063  37.633  1.00 10.04 ? 114 VAL E CG1 1 
ATOM 11360 C CG2 . VAL E 1 114 ? 3.736   75.707  38.937  1.00 10.04 ? 114 VAL E CG2 1 
ATOM 11361 N N   . PRO E 1 115 ? 4.620   79.326  38.489  1.00 26.03 ? 115 PRO E N   1 
ATOM 11362 C CA  . PRO E 1 115 ? 5.594   80.176  39.181  1.00 26.03 ? 115 PRO E CA  1 
ATOM 11363 C C   . PRO E 1 115 ? 6.277   79.615  40.398  1.00 26.03 ? 115 PRO E C   1 
ATOM 11364 O O   . PRO E 1 115 ? 5.649   78.970  41.240  1.00 26.03 ? 115 PRO E O   1 
ATOM 11365 C CB  . PRO E 1 115 ? 4.777   81.395  39.576  1.00 4.91  ? 115 PRO E CB  1 
ATOM 11366 C CG  . PRO E 1 115 ? 3.596   81.357  38.669  1.00 4.91  ? 115 PRO E CG  1 
ATOM 11367 C CD  . PRO E 1 115 ? 3.277   79.907  38.619  1.00 4.91  ? 115 PRO E CD  1 
ATOM 11368 N N   . LEU E 1 116 ? 7.570   79.885  40.496  1.00 22.10 ? 116 LEU E N   1 
ATOM 11369 C CA  . LEU E 1 116 ? 8.337   79.474  41.654  1.00 22.10 ? 116 LEU E CA  1 
ATOM 11370 C C   . LEU E 1 116 ? 8.504   80.742  42.482  1.00 22.10 ? 116 LEU E C   1 
ATOM 11371 O O   . LEU E 1 116 ? 9.305   81.620  42.146  1.00 22.10 ? 116 LEU E O   1 
ATOM 11372 C CB  . LEU E 1 116 ? 9.710   78.924  41.262  1.00 11.95 ? 116 LEU E CB  1 
ATOM 11373 C CG  . LEU E 1 116 ? 9.757   77.492  40.742  1.00 11.95 ? 116 LEU E CG  1 
ATOM 11374 C CD1 . LEU E 1 116 ? 11.199  77.035  40.725  1.00 11.95 ? 116 LEU E CD1 1 
ATOM 11375 C CD2 . LEU E 1 116 ? 8.937   76.571  41.630  1.00 11.95 ? 116 LEU E CD2 1 
ATOM 11376 N N   . ALA E 1 117 ? 7.728   80.848  43.554  1.00 24.61 ? 117 ALA E N   1 
ATOM 11377 C CA  . ALA E 1 117 ? 7.802   82.013  44.416  1.00 24.61 ? 117 ALA E CA  1 
ATOM 11378 C C   . ALA E 1 117 ? 9.239   82.229  44.851  1.00 24.61 ? 117 ALA E C   1 
ATOM 11379 O O   . ALA E 1 117 ? 9.940   81.271  45.188  1.00 24.61 ? 117 ALA E O