data_1XGL
# 
_entry.id   1XGL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XGL         
WWPDB D_1000177259 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XGL 
_pdbx_database_status.recvd_initial_deposition_date   1996-10-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hua, Q.X.'      1 
'Gozani, S.N.'   2 
'Chance, R.E.'   3 
'Hoffmann, J.A.' 4 
'Frank, B.H.'    5 
'Weiss, M.A.'    6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of a protein in a kinetic trap.'                                   Nat.Struct.Biol. 2   129 138 1995 NSBIEW US 
1072-8368 2024 ? 7749917 10.1038/nsb0295-129 
1       'Receptor Binding Redefined by a Structural Switch in a Mutant Human Insulin' Nature           354 238 ?   1991 NATUAS UK 
0028-0836 0006 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hua, Q.X.'      1  
primary 'Gozani, S.N.'   2  
primary 'Chance, R.E.'   3  
primary 'Hoffmann, J.A.' 4  
primary 'Frank, B.H.'    5  
primary 'Weiss, M.A.'    6  
1       'Hua, Q.X.'      7  
1       'Shoelson, S.E.' 8  
1       'Kochoyan, M.'   9  
1       'Weiss, M.A.'    10 
# 
_cell.entry_id           1XGL 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XGL 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man INSULIN 2383.698 1 ? ? ? 'DISULFIDE ISOMER WITH DISULFIDE BRIDGES AT A6-B7, A7-A11 AND A20-B19' 
2 polymer man INSULIN 3433.953 1 ? ? ? 'DISULFIDE ISOMER WITH DISULFIDE BRIDGES AT A6-B7, A7-A11 AND A20-B19' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKT FVNQHLCGSHLVEALYLVCGERGFFYTPKT B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP INS_HUMAN 1 P01308 1 FVNQHLCGSHLVEALYLVCGERGFFYTPKAGIVEQCCTSICSLYQLENYCN ? 
2 UNP INS_HUMAN 2 P01308 1 FVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTGVCSLYQLENYCN ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XGL A 1 ? 21 ? P01308 31 ? 51 ? 1 21 
2 2 1XGL B 1 ? 30 ? P01308 1  ? 30 ? 1 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  1.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_details.entry_id   1XGL 
_pdbx_nmr_details.text       'DATE OF DATA-COLLECTION : 1993 IN 20% ACETIC ACID (ZINC-FREE)' 
# 
_pdbx_nmr_ensemble.entry_id                             1XGL 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1XGL 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1XGL 
_struct.title                     'HUMAN INSULIN DISULFIDE ISOMER, NMR, 10 STRUCTURES' 
_struct.pdbx_descriptor           INSULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XGL 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            'HORMONE, GLUCOSE METABOLISM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 LEU A 13 ? TYR A 19 ? LEU A 13 TYR A 19 5 ? 7  
HELX_P HELX_P2 H2 SER B 9  ? VAL B 18 ? SER B 9  VAL B 18 5 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 6  B CYS 7  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 7  A CYS 11 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.015 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1XGL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XGL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . GLY A 1 1  ? -8.718  -7.067  1.067   1.00 0.00 ? 1  GLY A N    1  
ATOM 2    C CA   . GLY A 1 1  ? -7.618  -6.129  0.700   1.00 0.00 ? 1  GLY A CA   1  
ATOM 3    C C    . GLY A 1 1  ? -7.837  -4.719  1.285   1.00 0.00 ? 1  GLY A C    1  
ATOM 4    O O    . GLY A 1 1  ? -8.799  -4.484  1.991   1.00 0.00 ? 1  GLY A O    1  
ATOM 5    H H1   . GLY A 1 1  ? -9.423  -6.561  1.639   1.00 0.00 ? 1  GLY A H1   1  
ATOM 6    H H2   . GLY A 1 1  ? -9.173  -7.435  0.207   1.00 0.00 ? 1  GLY A H2   1  
ATOM 7    H H3   . GLY A 1 1  ? -8.325  -7.857  1.618   1.00 0.00 ? 1  GLY A H3   1  
ATOM 8    H HA2  . GLY A 1 1  ? -6.691  -6.520  1.092   1.00 0.00 ? 1  GLY A HA2  1  
ATOM 9    H HA3  . GLY A 1 1  ? -7.549  -6.065  -0.373  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 10   N N    . ILE A 1 2  ? -6.928  -3.828  0.963   1.00 0.00 ? 2  ILE A N    1  
ATOM 11   C CA   . ILE A 1 2  ? -6.998  -2.410  1.457   1.00 0.00 ? 2  ILE A CA   1  
ATOM 12   C C    . ILE A 1 2  ? -7.113  -1.386  0.332   1.00 0.00 ? 2  ILE A C    1  
ATOM 13   O O    . ILE A 1 2  ? -6.979  -1.691  -0.834  1.00 0.00 ? 2  ILE A O    1  
ATOM 14   C CB   . ILE A 1 2  ? -5.709  -2.162  2.378   1.00 0.00 ? 2  ILE A CB   1  
ATOM 15   C CG1  . ILE A 1 2  ? -4.900  -0.809  2.281   1.00 0.00 ? 2  ILE A CG1  1  
ATOM 16   C CG2  . ILE A 1 2  ? -4.691  -3.340  2.332   1.00 0.00 ? 2  ILE A CG2  1  
ATOM 17   C CD1  . ILE A 1 2  ? -5.188  0.110   3.503   1.00 0.00 ? 2  ILE A CD1  1  
ATOM 18   H H    . ILE A 1 2  ? -6.183  -4.102  0.387   1.00 0.00 ? 2  ILE A H    1  
ATOM 19   H HA   . ILE A 1 2  ? -7.878  -2.305  2.072   1.00 0.00 ? 2  ILE A HA   1  
ATOM 20   H HB   . ILE A 1 2  ? -6.182  -2.091  3.340   1.00 0.00 ? 2  ILE A HB   1  
ATOM 21   H HG12 . ILE A 1 2  ? -3.838  -1.011  2.304   1.00 0.00 ? 2  ILE A HG12 1  
ATOM 22   H HG13 . ILE A 1 2  ? -5.094  -0.295  1.357   1.00 0.00 ? 2  ILE A HG13 1  
ATOM 23   H HG21 . ILE A 1 2  ? -4.346  -3.483  1.315   1.00 0.00 ? 2  ILE A HG21 1  
ATOM 24   H HG22 . ILE A 1 2  ? -3.836  -3.124  2.955   1.00 0.00 ? 2  ILE A HG22 1  
ATOM 25   H HG23 . ILE A 1 2  ? -5.150  -4.253  2.675   1.00 0.00 ? 2  ILE A HG23 1  
ATOM 26   H HD11 . ILE A 1 2  ? -4.934  -0.402  4.425   1.00 0.00 ? 2  ILE A HD11 1  
ATOM 27   H HD12 . ILE A 1 2  ? -4.621  1.028   3.427   1.00 0.00 ? 2  ILE A HD12 1  
ATOM 28   H HD13 . ILE A 1 2  ? -6.237  0.362   3.524   1.00 0.00 ? 2  ILE A HD13 1  
ATOM 29   N N    . VAL A 1 3  ? -7.375  -0.184  0.760   1.00 0.00 ? 3  VAL A N    1  
ATOM 30   C CA   . VAL A 1 3  ? -7.533  0.993   -0.177  1.00 0.00 ? 3  VAL A CA   1  
ATOM 31   C C    . VAL A 1 3  ? -6.376  2.010   -0.069  1.00 0.00 ? 3  VAL A C    1  
ATOM 32   O O    . VAL A 1 3  ? -5.510  1.881   0.771   1.00 0.00 ? 3  VAL A O    1  
ATOM 33   C CB   . VAL A 1 3  ? -8.867  1.763   0.124   1.00 0.00 ? 3  VAL A CB   1  
ATOM 34   C CG1  . VAL A 1 3  ? -10.095 0.881   -0.160  1.00 0.00 ? 3  VAL A CG1  1  
ATOM 35   C CG2  . VAL A 1 3  ? -8.922  2.210   1.607   1.00 0.00 ? 3  VAL A CG2  1  
ATOM 36   H H    . VAL A 1 3  ? -7.468  -0.099  1.733   1.00 0.00 ? 3  VAL A H    1  
ATOM 37   H HA   . VAL A 1 3  ? -7.556  0.628   -1.193  1.00 0.00 ? 3  VAL A HA   1  
ATOM 38   H HB   . VAL A 1 3  ? -8.928  2.627   -0.523  1.00 0.00 ? 3  VAL A HB   1  
ATOM 39   H HG11 . VAL A 1 3  ? -10.106 0.583   -1.199  1.00 0.00 ? 3  VAL A HG11 1  
ATOM 40   H HG12 . VAL A 1 3  ? -10.087 -0.002  0.466   1.00 0.00 ? 3  VAL A HG12 1  
ATOM 41   H HG13 . VAL A 1 3  ? -10.994 1.455   0.041   1.00 0.00 ? 3  VAL A HG13 1  
ATOM 42   H HG21 . VAL A 1 3  ? -8.871  1.353   2.256   1.00 0.00 ? 3  VAL A HG21 1  
ATOM 43   H HG22 . VAL A 1 3  ? -8.099  2.866   1.838   1.00 0.00 ? 3  VAL A HG22 1  
ATOM 44   H HG23 . VAL A 1 3  ? -9.841  2.737   1.815   1.00 0.00 ? 3  VAL A HG23 1  
ATOM 45   N N    . GLU A 1 4  ? -6.455  2.988   -0.945  1.00 0.00 ? 4  GLU A N    1  
ATOM 46   C CA   . GLU A 1 4  ? -5.487  4.141   -1.093  1.00 0.00 ? 4  GLU A CA   1  
ATOM 47   C C    . GLU A 1 4  ? -5.294  4.632   -2.541  1.00 0.00 ? 4  GLU A C    1  
ATOM 48   O O    . GLU A 1 4  ? -5.543  5.800   -2.778  1.00 0.00 ? 4  GLU A O    1  
ATOM 49   C CB   . GLU A 1 4  ? -4.037  3.778   -0.462  1.00 0.00 ? 4  GLU A CB   1  
ATOM 50   C CG   . GLU A 1 4  ? -2.901  4.742   -0.950  1.00 0.00 ? 4  GLU A CG   1  
ATOM 51   C CD   . GLU A 1 4  ? -3.166  6.162   -0.410  1.00 0.00 ? 4  GLU A CD   1  
ATOM 52   O OE1  . GLU A 1 4  ? -2.832  6.339   0.750   1.00 0.00 ? 4  GLU A OE1  1  
ATOM 53   O OE2  . GLU A 1 4  ? -3.682  6.980   -1.163  1.00 0.00 ? 4  GLU A OE2  1  
ATOM 54   H H    . GLU A 1 4  ? -7.227  2.957   -1.552  1.00 0.00 ? 4  GLU A H    1  
ATOM 55   H HA   . GLU A 1 4  ? -5.897  4.956   -0.552  1.00 0.00 ? 4  GLU A HA   1  
ATOM 56   H HB2  . GLU A 1 4  ? -4.137  3.979   0.597   1.00 0.00 ? 4  GLU A HB2  1  
ATOM 57   H HB3  . GLU A 1 4  ? -3.729  2.745   -0.517  1.00 0.00 ? 4  GLU A HB3  1  
ATOM 58   H HG2  . GLU A 1 4  ? -1.957  4.384   -0.567  1.00 0.00 ? 4  GLU A HG2  1  
ATOM 59   H HG3  . GLU A 1 4  ? -2.813  4.781   -2.023  1.00 0.00 ? 4  GLU A HG3  1  
ATOM 60   N N    . GLN A 1 5  ? -4.895  3.780   -3.451  1.00 0.00 ? 5  GLN A N    1  
ATOM 61   C CA   . GLN A 1 5  ? -4.667  4.155   -4.895  1.00 0.00 ? 5  GLN A CA   1  
ATOM 62   C C    . GLN A 1 5  ? -3.973  5.543   -5.120  1.00 0.00 ? 5  GLN A C    1  
ATOM 63   O O    . GLN A 1 5  ? -3.498  6.163   -4.189  1.00 0.00 ? 5  GLN A O    1  
ATOM 64   C CB   . GLN A 1 5  ? -6.100  4.023   -5.535  1.00 0.00 ? 5  GLN A CB   1  
ATOM 65   C CG   . GLN A 1 5  ? -6.276  4.387   -7.040  1.00 0.00 ? 5  GLN A CG   1  
ATOM 66   C CD   . GLN A 1 5  ? -5.410  3.490   -7.943  1.00 0.00 ? 5  GLN A CD   1  
ATOM 67   O OE1  . GLN A 1 5  ? -4.214  3.661   -8.064  1.00 0.00 ? 5  GLN A OE1  1  
ATOM 68   N NE2  . GLN A 1 5  ? -5.979  2.510   -8.594  1.00 0.00 ? 5  GLN A NE2  1  
ATOM 69   H H    . GLN A 1 5  ? -4.752  2.859   -3.184  1.00 0.00 ? 5  GLN A H    1  
ATOM 70   H HA   . GLN A 1 5  ? -4.030  3.395   -5.328  1.00 0.00 ? 5  GLN A HA   1  
ATOM 71   H HB2  . GLN A 1 5  ? -6.375  2.982   -5.439  1.00 0.00 ? 5  GLN A HB2  1  
ATOM 72   H HB3  . GLN A 1 5  ? -6.796  4.601   -4.940  1.00 0.00 ? 5  GLN A HB3  1  
ATOM 73   H HG2  . GLN A 1 5  ? -7.311  4.226   -7.301  1.00 0.00 ? 5  GLN A HG2  1  
ATOM 74   H HG3  . GLN A 1 5  ? -6.058  5.428   -7.226  1.00 0.00 ? 5  GLN A HG3  1  
ATOM 75   H HE21 . GLN A 1 5  ? -6.944  2.352   -8.506  1.00 0.00 ? 5  GLN A HE21 1  
ATOM 76   H HE22 . GLN A 1 5  ? -5.434  1.934   -9.170  1.00 0.00 ? 5  GLN A HE22 1  
ATOM 77   N N    . CYS A 1 6  ? -3.930  5.948   -6.367  1.00 0.00 ? 6  CYS A N    1  
ATOM 78   C CA   . CYS A 1 6  ? -3.337  7.224   -6.896  1.00 0.00 ? 6  CYS A CA   1  
ATOM 79   C C    . CYS A 1 6  ? -2.882  8.395   -6.028  1.00 0.00 ? 6  CYS A C    1  
ATOM 80   O O    . CYS A 1 6  ? -1.962  9.076   -6.437  1.00 0.00 ? 6  CYS A O    1  
ATOM 81   C CB   . CYS A 1 6  ? -4.304  7.795   -7.963  1.00 0.00 ? 6  CYS A CB   1  
ATOM 82   S SG   . CYS A 1 6  ? -4.156  7.028   -9.599  1.00 0.00 ? 6  CYS A SG   1  
ATOM 83   H H    . CYS A 1 6  ? -4.318  5.357   -7.035  1.00 0.00 ? 6  CYS A H    1  
ATOM 84   H HA   . CYS A 1 6  ? -2.477  6.905   -7.434  1.00 0.00 ? 6  CYS A HA   1  
ATOM 85   H HB2  . CYS A 1 6  ? -5.320  7.682   -7.612  1.00 0.00 ? 6  CYS A HB2  1  
ATOM 86   H HB3  . CYS A 1 6  ? -4.122  8.857   -8.086  1.00 0.00 ? 6  CYS A HB3  1  
ATOM 87   N N    . CYS A 1 7  ? -3.526  8.598   -4.913  1.00 0.00 ? 7  CYS A N    1  
ATOM 88   C CA   . CYS A 1 7  ? -3.248  9.685   -3.917  1.00 0.00 ? 7  CYS A CA   1  
ATOM 89   C C    . CYS A 1 7  ? -4.639  10.241  -3.789  1.00 0.00 ? 7  CYS A C    1  
ATOM 90   O O    . CYS A 1 7  ? -4.998  11.298  -4.266  1.00 0.00 ? 7  CYS A O    1  
ATOM 91   C CB   . CYS A 1 7  ? -2.239  10.770  -4.468  1.00 0.00 ? 7  CYS A CB   1  
ATOM 92   S SG   . CYS A 1 7  ? -1.712  12.053  -3.314  1.00 0.00 ? 7  CYS A SG   1  
ATOM 93   H H    . CYS A 1 7  ? -4.267  7.992   -4.699  1.00 0.00 ? 7  CYS A H    1  
ATOM 94   H HA   . CYS A 1 7  ? -2.985  9.241   -2.975  1.00 0.00 ? 7  CYS A HA   1  
ATOM 95   H HB2  . CYS A 1 7  ? -1.315  10.273  -4.738  1.00 0.00 ? 7  CYS A HB2  1  
ATOM 96   H HB3  . CYS A 1 7  ? -2.629  11.250  -5.355  1.00 0.00 ? 7  CYS A HB3  1  
ATOM 97   N N    . THR A 1 8  ? -5.373  9.411   -3.098  1.00 0.00 ? 8  THR A N    1  
ATOM 98   C CA   . THR A 1 8  ? -6.799  9.667   -2.806  1.00 0.00 ? 8  THR A CA   1  
ATOM 99   C C    . THR A 1 8  ? -7.006  9.838   -1.301  1.00 0.00 ? 8  THR A C    1  
ATOM 100  O O    . THR A 1 8  ? -7.884  10.581  -0.897  1.00 0.00 ? 8  THR A O    1  
ATOM 101  C CB   . THR A 1 8  ? -7.549  8.464   -3.404  1.00 0.00 ? 8  THR A CB   1  
ATOM 102  O OG1  . THR A 1 8  ? -7.153  8.471   -4.771  1.00 0.00 ? 8  THR A OG1  1  
ATOM 103  C CG2  . THR A 1 8  ? -9.029  8.737   -3.458  1.00 0.00 ? 8  THR A CG2  1  
ATOM 104  H H    . THR A 1 8  ? -4.974  8.589   -2.744  1.00 0.00 ? 8  THR A H    1  
ATOM 105  H HA   . THR A 1 8  ? -7.103  10.581  -3.293  1.00 0.00 ? 8  THR A HA   1  
ATOM 106  H HB   . THR A 1 8  ? -7.325  7.504   -2.971  1.00 0.00 ? 8  THR A HB   1  
ATOM 107  H HG1  . THR A 1 8  ? -6.219  8.250   -4.813  1.00 0.00 ? 8  THR A HG1  1  
ATOM 108  H HG21 . THR A 1 8  ? -9.224  9.607   -4.068  1.00 0.00 ? 8  THR A HG21 1  
ATOM 109  H HG22 . THR A 1 8  ? -9.536  7.885   -3.889  1.00 0.00 ? 8  THR A HG22 1  
ATOM 110  H HG23 . THR A 1 8  ? -9.423  8.915   -2.467  1.00 0.00 ? 8  THR A HG23 1  
ATOM 111  N N    . SER A 1 9  ? -6.196  9.156   -0.522  1.00 0.00 ? 9  SER A N    1  
ATOM 112  C CA   . SER A 1 9  ? -6.322  9.263   0.955   1.00 0.00 ? 9  SER A CA   1  
ATOM 113  C C    . SER A 1 9  ? -5.049  9.786   1.632   1.00 0.00 ? 9  SER A C    1  
ATOM 114  O O    . SER A 1 9  ? -5.029  10.900  2.115   1.00 0.00 ? 9  SER A O    1  
ATOM 115  C CB   . SER A 1 9  ? -6.714  7.859   1.507   1.00 0.00 ? 9  SER A CB   1  
ATOM 116  O OG   . SER A 1 9  ? -5.720  6.956   1.039   1.00 0.00 ? 9  SER A OG   1  
ATOM 117  H H    . SER A 1 9  ? -5.499  8.571   -0.893  1.00 0.00 ? 9  SER A H    1  
ATOM 118  H HA   . SER A 1 9  ? -7.110  9.942   1.213   1.00 0.00 ? 9  SER A HA   1  
ATOM 119  H HB2  . SER A 1 9  ? -6.760  7.846   2.588   1.00 0.00 ? 9  SER A HB2  1  
ATOM 120  H HB3  . SER A 1 9  ? -7.671  7.555   1.110   1.00 0.00 ? 9  SER A HB3  1  
ATOM 121  H HG   . SER A 1 9  ? -5.212  6.657   1.796   1.00 0.00 ? 9  SER A HG   1  
ATOM 122  N N    . ILE A 1 10 ? -4.026  8.974   1.646   1.00 0.00 ? 10 ILE A N    1  
ATOM 123  C CA   . ILE A 1 10 ? -2.718  9.349   2.278   1.00 0.00 ? 10 ILE A CA   1  
ATOM 124  C C    . ILE A 1 10 ? -1.518  8.914   1.411   1.00 0.00 ? 10 ILE A C    1  
ATOM 125  O O    . ILE A 1 10 ? -0.456  8.668   1.944   1.00 0.00 ? 10 ILE A O    1  
ATOM 126  C CB   . ILE A 1 10 ? -2.725  8.680   3.714   1.00 0.00 ? 10 ILE A CB   1  
ATOM 127  C CG1  . ILE A 1 10 ? -4.055  9.072   4.462   1.00 0.00 ? 10 ILE A CG1  1  
ATOM 128  C CG2  . ILE A 1 10 ? -1.534  9.194   4.569   1.00 0.00 ? 10 ILE A CG2  1  
ATOM 129  C CD1  . ILE A 1 10 ? -4.193  8.416   5.847   1.00 0.00 ? 10 ILE A CD1  1  
ATOM 130  H H    . ILE A 1 10 ? -4.149  8.108   1.220   1.00 0.00 ? 10 ILE A H    1  
ATOM 131  H HA   . ILE A 1 10 ? -2.674  10.425  2.382   1.00 0.00 ? 10 ILE A HA   1  
ATOM 132  H HB   . ILE A 1 10 ? -2.655  7.606   3.617   1.00 0.00 ? 10 ILE A HB   1  
ATOM 133  H HG12 . ILE A 1 10 ? -4.111  10.145  4.574   1.00 0.00 ? 10 ILE A HG12 1  
ATOM 134  H HG13 . ILE A 1 10 ? -4.906  8.744   3.892   1.00 0.00 ? 10 ILE A HG13 1  
ATOM 135  H HG21 . ILE A 1 10 ? -1.587  10.265  4.673   1.00 0.00 ? 10 ILE A HG21 1  
ATOM 136  H HG22 . ILE A 1 10 ? -1.579  8.746   5.550   1.00 0.00 ? 10 ILE A HG22 1  
ATOM 137  H HG23 . ILE A 1 10 ? -0.582  8.924   4.145   1.00 0.00 ? 10 ILE A HG23 1  
ATOM 138  H HD11 . ILE A 1 10 ? -4.193  7.344   5.743   1.00 0.00 ? 10 ILE A HD11 1  
ATOM 139  H HD12 . ILE A 1 10 ? -3.390  8.708   6.509   1.00 0.00 ? 10 ILE A HD12 1  
ATOM 140  H HD13 . ILE A 1 10 ? -5.126  8.728   6.286   1.00 0.00 ? 10 ILE A HD13 1  
ATOM 141  N N    . CYS A 1 11 ? -1.738  8.841   0.111   1.00 0.00 ? 11 CYS A N    1  
ATOM 142  C CA   . CYS A 1 11 ? -0.705  8.439   -0.932  1.00 0.00 ? 11 CYS A CA   1  
ATOM 143  C C    . CYS A 1 11 ? 0.619   7.977   -0.285  1.00 0.00 ? 11 CYS A C    1  
ATOM 144  O O    . CYS A 1 11 ? 1.629   8.655   -0.296  1.00 0.00 ? 11 CYS A O    1  
ATOM 145  C CB   . CYS A 1 11 ? -0.482  9.662   -1.826  1.00 0.00 ? 11 CYS A CB   1  
ATOM 146  S SG   . CYS A 1 11 ? -1.682  11.005  -1.593  1.00 0.00 ? 11 CYS A SG   1  
ATOM 147  H H    . CYS A 1 11 ? -2.640  9.062   -0.207  1.00 0.00 ? 11 CYS A H    1  
ATOM 148  H HA   . CYS A 1 11 ? -1.104  7.621   -1.517  1.00 0.00 ? 11 CYS A HA   1  
ATOM 149  H HB2  . CYS A 1 11 ? 0.519   10.035  -1.701  1.00 0.00 ? 11 CYS A HB2  1  
ATOM 150  H HB3  . CYS A 1 11 ? -0.567  9.334   -2.850  1.00 0.00 ? 11 CYS A HB3  1  
ATOM 151  N N    . SER A 1 12 ? 0.541   6.800   0.271   1.00 0.00 ? 12 SER A N    1  
ATOM 152  C CA   . SER A 1 12 ? 1.697   6.183   0.965   1.00 0.00 ? 12 SER A CA   1  
ATOM 153  C C    . SER A 1 12 ? 2.251   4.908   0.319   1.00 0.00 ? 12 SER A C    1  
ATOM 154  O O    . SER A 1 12 ? 1.555   4.152   -0.325  1.00 0.00 ? 12 SER A O    1  
ATOM 155  C CB   . SER A 1 12 ? 1.193   5.969   2.431   1.00 0.00 ? 12 SER A CB   1  
ATOM 156  O OG   . SER A 1 12 ? -0.144  5.506   2.287   1.00 0.00 ? 12 SER A OG   1  
ATOM 157  H H    . SER A 1 12 ? -0.288  6.289   0.238   1.00 0.00 ? 12 SER A H    1  
ATOM 158  H HA   . SER A 1 12 ? 2.497   6.900   1.019   1.00 0.00 ? 12 SER A HA   1  
ATOM 159  H HB2  . SER A 1 12 ? 1.732   5.224   2.994   1.00 0.00 ? 12 SER A HB2  1  
ATOM 160  H HB3  . SER A 1 12 ? 1.192   6.898   2.985   1.00 0.00 ? 12 SER A HB3  1  
ATOM 161  H HG   . SER A 1 12 ? -0.731  6.243   2.105   1.00 0.00 ? 12 SER A HG   1  
ATOM 162  N N    . LEU A 1 13 ? 3.529   4.766   0.551   1.00 0.00 ? 13 LEU A N    1  
ATOM 163  C CA   . LEU A 1 13 ? 4.364   3.622   0.059   1.00 0.00 ? 13 LEU A CA   1  
ATOM 164  C C    . LEU A 1 13 ? 4.483   2.589   1.183   1.00 0.00 ? 13 LEU A C    1  
ATOM 165  O O    . LEU A 1 13 ? 4.643   1.409   0.943   1.00 0.00 ? 13 LEU A O    1  
ATOM 166  C CB   . LEU A 1 13 ? 5.785   4.120   -0.336  1.00 0.00 ? 13 LEU A CB   1  
ATOM 167  C CG   . LEU A 1 13 ? 5.796   4.938   -1.661  1.00 0.00 ? 13 LEU A CG   1  
ATOM 168  C CD1  . LEU A 1 13 ? 4.730   6.050   -1.651  1.00 0.00 ? 13 LEU A CD1  1  
ATOM 169  C CD2  . LEU A 1 13 ? 7.187   5.596   -1.817  1.00 0.00 ? 13 LEU A CD2  1  
ATOM 170  H H    . LEU A 1 13 ? 3.949   5.472   1.076   1.00 0.00 ? 13 LEU A H    1  
ATOM 171  H HA   . LEU A 1 13 ? 3.909   3.193   -0.810  1.00 0.00 ? 13 LEU A HA   1  
ATOM 172  H HB2  . LEU A 1 13 ? 6.216   4.716   0.454   1.00 0.00 ? 13 LEU A HB2  1  
ATOM 173  H HB3  . LEU A 1 13 ? 6.431   3.262   -0.479  1.00 0.00 ? 13 LEU A HB3  1  
ATOM 174  H HG   . LEU A 1 13 ? 5.624   4.272   -2.494  1.00 0.00 ? 13 LEU A HG   1  
ATOM 175  H HD11 . LEU A 1 13 ? 4.853   6.694   -0.791  1.00 0.00 ? 13 LEU A HD11 1  
ATOM 176  H HD12 . LEU A 1 13 ? 4.809   6.640   -2.548  1.00 0.00 ? 13 LEU A HD12 1  
ATOM 177  H HD13 . LEU A 1 13 ? 3.746   5.619   -1.633  1.00 0.00 ? 13 LEU A HD13 1  
ATOM 178  H HD21 . LEU A 1 13 ? 7.956   4.834   -1.850  1.00 0.00 ? 13 LEU A HD21 1  
ATOM 179  H HD22 . LEU A 1 13 ? 7.224   6.168   -2.733  1.00 0.00 ? 13 LEU A HD22 1  
ATOM 180  H HD23 . LEU A 1 13 ? 7.380   6.264   -0.987  1.00 0.00 ? 13 LEU A HD23 1  
ATOM 181  N N    . TYR A 1 14 ? 4.384   3.086   2.391   1.00 0.00 ? 14 TYR A N    1  
ATOM 182  C CA   . TYR A 1 14 ? 4.474   2.225   3.606   1.00 0.00 ? 14 TYR A CA   1  
ATOM 183  C C    . TYR A 1 14 ? 3.153   1.434   3.645   1.00 0.00 ? 14 TYR A C    1  
ATOM 184  O O    . TYR A 1 14 ? 3.052   0.340   4.169   1.00 0.00 ? 14 TYR A O    1  
ATOM 185  C CB   . TYR A 1 14 ? 4.666   3.169   4.835   1.00 0.00 ? 14 TYR A CB   1  
ATOM 186  C CG   . TYR A 1 14 ? 4.872   2.306   6.091   1.00 0.00 ? 14 TYR A CG   1  
ATOM 187  C CD1  . TYR A 1 14 ? 3.813   1.642   6.672   1.00 0.00 ? 14 TYR A CD1  1  
ATOM 188  C CD2  . TYR A 1 14 ? 6.135   2.166   6.642   1.00 0.00 ? 14 TYR A CD2  1  
ATOM 189  C CE1  . TYR A 1 14 ? 4.003   0.848   7.776   1.00 0.00 ? 14 TYR A CE1  1  
ATOM 190  C CE2  . TYR A 1 14 ? 6.325   1.366   7.757   1.00 0.00 ? 14 TYR A CE2  1  
ATOM 191  C CZ   . TYR A 1 14 ? 5.255   0.702   8.330   1.00 0.00 ? 14 TYR A CZ   1  
ATOM 192  O OH   . TYR A 1 14 ? 5.416   -0.110  9.434   1.00 0.00 ? 14 TYR A OH   1  
ATOM 193  H H    . TYR A 1 14 ? 4.235   4.047   2.510   1.00 0.00 ? 14 TYR A H    1  
ATOM 194  H HA   . TYR A 1 14 ? 5.308   1.555   3.517   1.00 0.00 ? 14 TYR A HA   1  
ATOM 195  H HB2  . TYR A 1 14 ? 5.550   3.770   4.680   1.00 0.00 ? 14 TYR A HB2  1  
ATOM 196  H HB3  . TYR A 1 14 ? 3.830   3.838   4.996   1.00 0.00 ? 14 TYR A HB3  1  
ATOM 197  H HD1  . TYR A 1 14 ? 2.817   1.745   6.265   1.00 0.00 ? 14 TYR A HD1  1  
ATOM 198  H HD2  . TYR A 1 14 ? 6.969   2.685   6.199   1.00 0.00 ? 14 TYR A HD2  1  
ATOM 199  H HE1  . TYR A 1 14 ? 3.157   0.336   8.204   1.00 0.00 ? 14 TYR A HE1  1  
ATOM 200  H HE2  . TYR A 1 14 ? 7.312   1.256   8.184   1.00 0.00 ? 14 TYR A HE2  1  
ATOM 201  H HH   . TYR A 1 14 ? 6.338   -0.099  9.693   1.00 0.00 ? 14 TYR A HH   1  
ATOM 202  N N    . GLN A 1 15 ? 2.176   2.057   3.039   1.00 0.00 ? 15 GLN A N    1  
ATOM 203  C CA   . GLN A 1 15 ? 0.808   1.501   2.943   1.00 0.00 ? 15 GLN A CA   1  
ATOM 204  C C    . GLN A 1 15 ? 0.832   0.447   1.832   1.00 0.00 ? 15 GLN A C    1  
ATOM 205  O O    . GLN A 1 15 ? 0.063   -0.493  1.887   1.00 0.00 ? 15 GLN A O    1  
ATOM 206  C CB   . GLN A 1 15 ? -0.068  2.737   2.681   1.00 0.00 ? 15 GLN A CB   1  
ATOM 207  C CG   . GLN A 1 15 ? -1.546  2.478   2.366   1.00 0.00 ? 15 GLN A CG   1  
ATOM 208  C CD   . GLN A 1 15 ? -1.707  1.796   0.999   1.00 0.00 ? 15 GLN A CD   1  
ATOM 209  O OE1  . GLN A 1 15 ? -0.974  2.047   0.066   1.00 0.00 ? 15 GLN A OE1  1  
ATOM 210  N NE2  . GLN A 1 15 ? -2.668  0.929   0.839   1.00 0.00 ? 15 GLN A NE2  1  
ATOM 211  H H    . GLN A 1 15 ? 2.341   2.927   2.612   1.00 0.00 ? 15 GLN A H    1  
ATOM 212  H HA   . GLN A 1 15 ? 0.551   1.031   3.883   1.00 0.00 ? 15 GLN A HA   1  
ATOM 213  H HB2  . GLN A 1 15 ? -0.027  3.340   3.575   1.00 0.00 ? 15 GLN A HB2  1  
ATOM 214  H HB3  . GLN A 1 15 ? 0.364   3.310   1.878   1.00 0.00 ? 15 GLN A HB3  1  
ATOM 215  H HG2  . GLN A 1 15 ? -1.980  1.860   3.137   1.00 0.00 ? 15 GLN A HG2  1  
ATOM 216  H HG3  . GLN A 1 15 ? -2.064  3.424   2.348   1.00 0.00 ? 15 GLN A HG3  1  
ATOM 217  H HE21 . GLN A 1 15 ? -3.271  0.735   1.582   1.00 0.00 ? 15 GLN A HE21 1  
ATOM 218  H HE22 . GLN A 1 15 ? -2.783  0.479   -0.021  1.00 0.00 ? 15 GLN A HE22 1  
ATOM 219  N N    . LEU A 1 16 ? 1.712   0.605   0.867   1.00 0.00 ? 16 LEU A N    1  
ATOM 220  C CA   . LEU A 1 16 ? 1.775   -0.396  -0.238  1.00 0.00 ? 16 LEU A CA   1  
ATOM 221  C C    . LEU A 1 16 ? 2.506   -1.624  0.333   1.00 0.00 ? 16 LEU A C    1  
ATOM 222  O O    . LEU A 1 16 ? 2.342   -2.723  -0.159  1.00 0.00 ? 16 LEU A O    1  
ATOM 223  C CB   . LEU A 1 16 ? 2.582   0.118   -1.459  1.00 0.00 ? 16 LEU A CB   1  
ATOM 224  C CG   . LEU A 1 16 ? 2.031   1.452   -2.028  1.00 0.00 ? 16 LEU A CG   1  
ATOM 225  C CD1  . LEU A 1 16 ? 2.973   1.910   -3.155  1.00 0.00 ? 16 LEU A CD1  1  
ATOM 226  C CD2  . LEU A 1 16 ? 0.613   1.302   -2.630  1.00 0.00 ? 16 LEU A CD2  1  
ATOM 227  H H    . LEU A 1 16 ? 2.338   1.355   0.868   1.00 0.00 ? 16 LEU A H    1  
ATOM 228  H HA   . LEU A 1 16 ? 0.773   -0.648  -0.534  1.00 0.00 ? 16 LEU A HA   1  
ATOM 229  H HB2  . LEU A 1 16 ? 3.618   0.239   -1.182  1.00 0.00 ? 16 LEU A HB2  1  
ATOM 230  H HB3  . LEU A 1 16 ? 2.524   -0.635  -2.235  1.00 0.00 ? 16 LEU A HB3  1  
ATOM 231  H HG   . LEU A 1 16 ? 2.002   2.180   -1.238  1.00 0.00 ? 16 LEU A HG   1  
ATOM 232  H HD11 . LEU A 1 16 ? 3.977   2.051   -2.781  1.00 0.00 ? 16 LEU A HD11 1  
ATOM 233  H HD12 . LEU A 1 16 ? 2.995   1.161   -3.935  1.00 0.00 ? 16 LEU A HD12 1  
ATOM 234  H HD13 . LEU A 1 16 ? 2.633   2.835   -3.584  1.00 0.00 ? 16 LEU A HD13 1  
ATOM 235  H HD21 . LEU A 1 16 ? -0.090  0.947   -1.891  1.00 0.00 ? 16 LEU A HD21 1  
ATOM 236  H HD22 . LEU A 1 16 ? 0.270   2.254   -3.011  1.00 0.00 ? 16 LEU A HD22 1  
ATOM 237  H HD23 . LEU A 1 16 ? 0.629   0.594   -3.445  1.00 0.00 ? 16 LEU A HD23 1  
ATOM 238  N N    . GLU A 1 17 ? 3.296   -1.404  1.358   1.00 0.00 ? 17 GLU A N    1  
ATOM 239  C CA   . GLU A 1 17 ? 4.049   -2.523  1.994   1.00 0.00 ? 17 GLU A CA   1  
ATOM 240  C C    . GLU A 1 17 ? 3.054   -3.463  2.682   1.00 0.00 ? 17 GLU A C    1  
ATOM 241  O O    . GLU A 1 17 ? 3.273   -4.656  2.721   1.00 0.00 ? 17 GLU A O    1  
ATOM 242  C CB   . GLU A 1 17 ? 5.104   -1.882  2.986   1.00 0.00 ? 17 GLU A CB   1  
ATOM 243  C CG   . GLU A 1 17 ? 6.203   -1.184  2.135   1.00 0.00 ? 17 GLU A CG   1  
ATOM 244  C CD   . GLU A 1 17 ? 6.981   -0.099  2.921   1.00 0.00 ? 17 GLU A CD   1  
ATOM 245  O OE1  . GLU A 1 17 ? 7.090   -0.220  4.132   1.00 0.00 ? 17 GLU A OE1  1  
ATOM 246  O OE2  . GLU A 1 17 ? 7.435   0.811   2.245   1.00 0.00 ? 17 GLU A OE2  1  
ATOM 247  H H    . GLU A 1 17 ? 3.398   -0.498  1.713   1.00 0.00 ? 17 GLU A H    1  
ATOM 248  H HA   . GLU A 1 17 ? 4.524   -3.093  1.221   1.00 0.00 ? 17 GLU A HA   1  
ATOM 249  H HB2  . GLU A 1 17 ? 4.665   -1.121  3.605   1.00 0.00 ? 17 GLU A HB2  1  
ATOM 250  H HB3  . GLU A 1 17 ? 5.546   -2.626  3.639   1.00 0.00 ? 17 GLU A HB3  1  
ATOM 251  H HG2  . GLU A 1 17 ? 6.912   -1.936  1.824   1.00 0.00 ? 17 GLU A HG2  1  
ATOM 252  H HG3  . GLU A 1 17 ? 5.766   -0.743  1.250   1.00 0.00 ? 17 GLU A HG3  1  
ATOM 253  N N    . ASN A 1 18 ? 1.989   -2.890  3.187   1.00 0.00 ? 18 ASN A N    1  
ATOM 254  C CA   . ASN A 1 18 ? 0.911   -3.654  3.899   1.00 0.00 ? 18 ASN A CA   1  
ATOM 255  C C    . ASN A 1 18 ? 0.371   -4.836  3.063   1.00 0.00 ? 18 ASN A C    1  
ATOM 256  O O    . ASN A 1 18 ? -0.163  -5.793  3.591   1.00 0.00 ? 18 ASN A O    1  
ATOM 257  C CB   . ASN A 1 18 ? -0.216  -2.641  4.236   1.00 0.00 ? 18 ASN A CB   1  
ATOM 258  C CG   . ASN A 1 18 ? -1.399  -3.303  4.961   1.00 0.00 ? 18 ASN A CG   1  
ATOM 259  O OD1  . ASN A 1 18 ? -2.112  -4.114  4.406   1.00 0.00 ? 18 ASN A OD1  1  
ATOM 260  N ND2  . ASN A 1 18 ? -1.647  -2.992  6.204   1.00 0.00 ? 18 ASN A ND2  1  
ATOM 261  H H    . ASN A 1 18 ? 1.889   -1.925  3.082   1.00 0.00 ? 18 ASN A H    1  
ATOM 262  H HA   . ASN A 1 18 ? 1.319   -4.046  4.815   1.00 0.00 ? 18 ASN A HA   1  
ATOM 263  H HB2  . ASN A 1 18 ? 0.166   -1.842  4.858   1.00 0.00 ? 18 ASN A HB2  1  
ATOM 264  H HB3  . ASN A 1 18 ? -0.593  -2.210  3.319   1.00 0.00 ? 18 ASN A HB3  1  
ATOM 265  H HD21 . ASN A 1 18 ? -1.091  -2.338  6.675   1.00 0.00 ? 18 ASN A HD21 1  
ATOM 266  H HD22 . ASN A 1 18 ? -2.401  -3.415  6.667   1.00 0.00 ? 18 ASN A HD22 1  
ATOM 267  N N    . TYR A 1 19 ? 0.537   -4.718  1.772   1.00 0.00 ? 19 TYR A N    1  
ATOM 268  C CA   . TYR A 1 19 ? 0.069   -5.756  0.805   1.00 0.00 ? 19 TYR A CA   1  
ATOM 269  C C    . TYR A 1 19 ? 0.636   -7.166  1.024   1.00 0.00 ? 19 TYR A C    1  
ATOM 270  O O    . TYR A 1 19 ? -0.084  -8.128  0.840   1.00 0.00 ? 19 TYR A O    1  
ATOM 271  C CB   . TYR A 1 19 ? 0.398   -5.245  -0.620  1.00 0.00 ? 19 TYR A CB   1  
ATOM 272  C CG   . TYR A 1 19 ? -0.529  -4.059  -0.961  1.00 0.00 ? 19 TYR A CG   1  
ATOM 273  C CD1  . TYR A 1 19 ? -0.570  -2.887  -0.214  1.00 0.00 ? 19 TYR A CD1  1  
ATOM 274  C CD2  . TYR A 1 19 ? -1.349  -4.155  -2.060  1.00 0.00 ? 19 TYR A CD2  1  
ATOM 275  C CE1  . TYR A 1 19 ? -1.400  -1.856  -0.569  1.00 0.00 ? 19 TYR A CE1  1  
ATOM 276  C CE2  . TYR A 1 19 ? -2.180  -3.114  -2.414  1.00 0.00 ? 19 TYR A CE2  1  
ATOM 277  C CZ   . TYR A 1 19 ? -2.211  -1.956  -1.667  1.00 0.00 ? 19 TYR A CZ   1  
ATOM 278  O OH   . TYR A 1 19 ? -3.020  -0.889  -2.003  1.00 0.00 ? 19 TYR A OH   1  
ATOM 279  H H    . TYR A 1 19 ? 0.996   -3.917  1.436   1.00 0.00 ? 19 TYR A H    1  
ATOM 280  H HA   . TYR A 1 19 ? -1.005  -5.828  0.904   1.00 0.00 ? 19 TYR A HA   1  
ATOM 281  H HB2  . TYR A 1 19 ? 1.416   -4.903  -0.727  1.00 0.00 ? 19 TYR A HB2  1  
ATOM 282  H HB3  . TYR A 1 19 ? 0.239   -6.032  -1.341  1.00 0.00 ? 19 TYR A HB3  1  
ATOM 283  H HD1  . TYR A 1 19 ? 0.042   -2.751  0.661   1.00 0.00 ? 19 TYR A HD1  1  
ATOM 284  H HD2  . TYR A 1 19 ? -1.342  -5.055  -2.658  1.00 0.00 ? 19 TYR A HD2  1  
ATOM 285  H HE1  . TYR A 1 19 ? -1.412  -0.959  0.027   1.00 0.00 ? 19 TYR A HE1  1  
ATOM 286  H HE2  . TYR A 1 19 ? -2.816  -3.212  -3.279  1.00 0.00 ? 19 TYR A HE2  1  
ATOM 287  H HH   . TYR A 1 19 ? -2.467  -0.105  -1.990  1.00 0.00 ? 19 TYR A HH   1  
ATOM 288  N N    . CYS A 1 20 ? 1.888   -7.263  1.403   1.00 0.00 ? 20 CYS A N    1  
ATOM 289  C CA   . CYS A 1 20 ? 2.534   -8.592  1.644   1.00 0.00 ? 20 CYS A CA   1  
ATOM 290  C C    . CYS A 1 20 ? 3.241   -8.650  2.997   1.00 0.00 ? 20 CYS A C    1  
ATOM 291  O O    . CYS A 1 20 ? 3.371   -9.712  3.583   1.00 0.00 ? 20 CYS A O    1  
ATOM 292  C CB   . CYS A 1 20 ? 3.474   -8.846  0.502   1.00 0.00 ? 20 CYS A CB   1  
ATOM 293  S SG   . CYS A 1 20 ? 2.525   -9.472  -0.904  1.00 0.00 ? 20 CYS A SG   1  
ATOM 294  H H    . CYS A 1 20 ? 2.431   -6.461  1.547   1.00 0.00 ? 20 CYS A H    1  
ATOM 295  H HA   . CYS A 1 20 ? 1.823   -9.390  1.551   1.00 0.00 ? 20 CYS A HA   1  
ATOM 296  H HB2  . CYS A 1 20 ? 3.936   -7.912  0.212   1.00 0.00 ? 20 CYS A HB2  1  
ATOM 297  H HB3  . CYS A 1 20 ? 4.241   -9.562  0.757   1.00 0.00 ? 20 CYS A HB3  1  
ATOM 298  N N    . ASN A 1 21 ? 3.672   -7.505  3.453   1.00 0.00 ? 21 ASN A N    1  
ATOM 299  C CA   . ASN A 1 21 ? 4.382   -7.390  4.757   1.00 0.00 ? 21 ASN A CA   1  
ATOM 300  C C    . ASN A 1 21 ? 3.580   -6.467  5.686   1.00 0.00 ? 21 ASN A C    1  
ATOM 301  O O    . ASN A 1 21 ? 3.439   -6.704  6.870   1.00 0.00 ? 21 ASN A O    1  
ATOM 302  C CB   . ASN A 1 21 ? 5.766   -6.813  4.488   1.00 0.00 ? 21 ASN A CB   1  
ATOM 303  C CG   . ASN A 1 21 ? 6.553   -7.775  3.586   1.00 0.00 ? 21 ASN A CG   1  
ATOM 304  O OD1  . ASN A 1 21 ? 7.242   -8.665  4.045   1.00 0.00 ? 21 ASN A OD1  1  
ATOM 305  N ND2  . ASN A 1 21 ? 6.464   -7.625  2.292   1.00 0.00 ? 21 ASN A ND2  1  
ATOM 306  H H    . ASN A 1 21 ? 3.530   -6.680  2.944   1.00 0.00 ? 21 ASN A H    1  
ATOM 307  H HA   . ASN A 1 21 ? 4.454   -8.363  5.219   1.00 0.00 ? 21 ASN A HA   1  
ATOM 308  H HB2  . ASN A 1 21 ? 5.669   -5.865  3.978   1.00 0.00 ? 21 ASN A HB2  1  
ATOM 309  H HB3  . ASN A 1 21 ? 6.300   -6.664  5.420   1.00 0.00 ? 21 ASN A HB3  1  
ATOM 310  H HD21 . ASN A 1 21 ? 5.891   -6.923  1.921   1.00 0.00 ? 21 ASN A HD21 1  
ATOM 311  H HD22 . ASN A 1 21 ? 6.965   -8.212  1.688   1.00 0.00 ? 21 ASN A HD22 1  
ATOM 312  N N    . PHE B 2 1  ? 3.910   8.564   3.575   1.00 0.00 ? 1  PHE B N    1  
ATOM 313  C CA   . PHE B 2 1  ? 3.199   9.591   2.763   1.00 0.00 ? 1  PHE B CA   1  
ATOM 314  C C    . PHE B 2 1  ? 4.248   10.474  2.073   1.00 0.00 ? 1  PHE B C    1  
ATOM 315  O O    . PHE B 2 1  ? 5.152   10.981  2.709   1.00 0.00 ? 1  PHE B O    1  
ATOM 316  C CB   . PHE B 2 1  ? 2.313   10.469  3.674   1.00 0.00 ? 1  PHE B CB   1  
ATOM 317  C CG   . PHE B 2 1  ? 1.288   11.327  2.897   1.00 0.00 ? 1  PHE B CG   1  
ATOM 318  C CD1  . PHE B 2 1  ? 1.113   11.248  1.521   1.00 0.00 ? 1  PHE B CD1  1  
ATOM 319  C CD2  . PHE B 2 1  ? 0.493   12.208  3.607   1.00 0.00 ? 1  PHE B CD2  1  
ATOM 320  C CE1  . PHE B 2 1  ? 0.174   12.017  0.885   1.00 0.00 ? 1  PHE B CE1  1  
ATOM 321  C CE2  . PHE B 2 1  ? -0.452  12.982  2.964   1.00 0.00 ? 1  PHE B CE2  1  
ATOM 322  C CZ   . PHE B 2 1  ? -0.610  12.885  1.602   1.00 0.00 ? 1  PHE B CZ   1  
ATOM 323  H H1   . PHE B 2 1  ? 4.936   8.708   3.491   1.00 0.00 ? 1  PHE B H1   1  
ATOM 324  H H2   . PHE B 2 1  ? 3.619   8.641   4.569   1.00 0.00 ? 1  PHE B H2   1  
ATOM 325  H H3   . PHE B 2 1  ? 3.651   7.622   3.218   1.00 0.00 ? 1  PHE B H3   1  
ATOM 326  H HA   . PHE B 2 1  ? 2.602   9.087   2.022   1.00 0.00 ? 1  PHE B HA   1  
ATOM 327  H HB2  . PHE B 2 1  ? 1.767   9.826   4.349   1.00 0.00 ? 1  PHE B HB2  1  
ATOM 328  H HB3  . PHE B 2 1  ? 2.947   11.117  4.261   1.00 0.00 ? 1  PHE B HB3  1  
ATOM 329  H HD1  . PHE B 2 1  ? 1.706   10.590  0.915   1.00 0.00 ? 1  PHE B HD1  1  
ATOM 330  H HD2  . PHE B 2 1  ? 0.603   12.308  4.679   1.00 0.00 ? 1  PHE B HD2  1  
ATOM 331  H HE1  . PHE B 2 1  ? 0.049   11.943  -0.180  1.00 0.00 ? 1  PHE B HE1  1  
ATOM 332  H HE2  . PHE B 2 1  ? -1.072  13.667  3.524   1.00 0.00 ? 1  PHE B HE2  1  
ATOM 333  H HZ   . PHE B 2 1  ? -1.347  13.493  1.100   1.00 0.00 ? 1  PHE B HZ   1  
ATOM 334  N N    . VAL B 2 2  ? 4.090   10.622  0.785   1.00 0.00 ? 2  VAL B N    1  
ATOM 335  C CA   . VAL B 2 2  ? 5.023   11.451  -0.044  1.00 0.00 ? 2  VAL B CA   1  
ATOM 336  C C    . VAL B 2 2  ? 4.285   12.588  -0.781  1.00 0.00 ? 2  VAL B C    1  
ATOM 337  O O    . VAL B 2 2  ? 3.071   12.656  -0.765  1.00 0.00 ? 2  VAL B O    1  
ATOM 338  C CB   . VAL B 2 2  ? 5.718   10.511  -1.050  1.00 0.00 ? 2  VAL B CB   1  
ATOM 339  C CG1  . VAL B 2 2  ? 6.648   9.551   -0.267  1.00 0.00 ? 2  VAL B CG1  1  
ATOM 340  C CG2  . VAL B 2 2  ? 4.659   9.644   -1.772  1.00 0.00 ? 2  VAL B CG2  1  
ATOM 341  H H    . VAL B 2 2  ? 3.342   10.164  0.349   1.00 0.00 ? 2  VAL B H    1  
ATOM 342  H HA   . VAL B 2 2  ? 5.767   11.895  0.604   1.00 0.00 ? 2  VAL B HA   1  
ATOM 343  H HB   . VAL B 2 2  ? 6.285   11.089  -1.766  1.00 0.00 ? 2  VAL B HB   1  
ATOM 344  H HG11 . VAL B 2 2  ? 6.078   8.974   0.448   1.00 0.00 ? 2  VAL B HG11 1  
ATOM 345  H HG12 . VAL B 2 2  ? 7.138   8.877   -0.956  1.00 0.00 ? 2  VAL B HG12 1  
ATOM 346  H HG13 . VAL B 2 2  ? 7.405   10.102  0.271   1.00 0.00 ? 2  VAL B HG13 1  
ATOM 347  H HG21 . VAL B 2 2  ? 3.949   10.253  -2.305  1.00 0.00 ? 2  VAL B HG21 1  
ATOM 348  H HG22 . VAL B 2 2  ? 5.158   9.000   -2.475  1.00 0.00 ? 2  VAL B HG22 1  
ATOM 349  H HG23 . VAL B 2 2  ? 4.129   9.029   -1.058  1.00 0.00 ? 2  VAL B HG23 1  
ATOM 350  N N    . ASN B 2 3  ? 5.061   13.441  -1.404  1.00 0.00 ? 3  ASN B N    1  
ATOM 351  C CA   . ASN B 2 3  ? 4.512   14.613  -2.176  1.00 0.00 ? 3  ASN B CA   1  
ATOM 352  C C    . ASN B 2 3  ? 4.987   14.524  -3.639  1.00 0.00 ? 3  ASN B C    1  
ATOM 353  O O    . ASN B 2 3  ? 5.695   15.393  -4.119  1.00 0.00 ? 3  ASN B O    1  
ATOM 354  C CB   . ASN B 2 3  ? 5.016   15.905  -1.477  1.00 0.00 ? 3  ASN B CB   1  
ATOM 355  C CG   . ASN B 2 3  ? 6.555   15.878  -1.351  1.00 0.00 ? 3  ASN B CG   1  
ATOM 356  O OD1  . ASN B 2 3  ? 7.285   16.324  -2.216  1.00 0.00 ? 3  ASN B OD1  1  
ATOM 357  N ND2  . ASN B 2 3  ? 7.080   15.351  -0.278  1.00 0.00 ? 3  ASN B ND2  1  
ATOM 358  H H    . ASN B 2 3  ? 6.034   13.320  -1.371  1.00 0.00 ? 3  ASN B H    1  
ATOM 359  H HA   . ASN B 2 3  ? 3.431   14.579  -2.158  1.00 0.00 ? 3  ASN B HA   1  
ATOM 360  H HB2  . ASN B 2 3  ? 4.736   16.773  -2.058  1.00 0.00 ? 3  ASN B HB2  1  
ATOM 361  H HB3  . ASN B 2 3  ? 4.585   15.998  -0.489  1.00 0.00 ? 3  ASN B HB3  1  
ATOM 362  H HD21 . ASN B 2 3  ? 6.489   14.989  0.418   1.00 0.00 ? 3  ASN B HD21 1  
ATOM 363  H HD22 . ASN B 2 3  ? 8.054   15.319  -0.166  1.00 0.00 ? 3  ASN B HD22 1  
ATOM 364  N N    . GLN B 2 4  ? 4.582   13.472  -4.311  1.00 0.00 ? 4  GLN B N    1  
ATOM 365  C CA   . GLN B 2 4  ? 4.981   13.263  -5.732  1.00 0.00 ? 4  GLN B CA   1  
ATOM 366  C C    . GLN B 2 4  ? 3.718   13.056  -6.621  1.00 0.00 ? 4  GLN B C    1  
ATOM 367  O O    . GLN B 2 4  ? 2.617   13.317  -6.178  1.00 0.00 ? 4  GLN B O    1  
ATOM 368  C CB   . GLN B 2 4  ? 5.949   12.044  -5.674  1.00 0.00 ? 4  GLN B CB   1  
ATOM 369  C CG   . GLN B 2 4  ? 6.596   11.679  -7.031  1.00 0.00 ? 4  GLN B CG   1  
ATOM 370  C CD   . GLN B 2 4  ? 7.778   10.731  -6.794  1.00 0.00 ? 4  GLN B CD   1  
ATOM 371  O OE1  . GLN B 2 4  ? 7.756   9.866   -5.941  1.00 0.00 ? 4  GLN B OE1  1  
ATOM 372  N NE2  . GLN B 2 4  ? 8.833   10.865  -7.546  1.00 0.00 ? 4  GLN B NE2  1  
ATOM 373  H H    . GLN B 2 4  ? 4.006   12.798  -3.898  1.00 0.00 ? 4  GLN B H    1  
ATOM 374  H HA   . GLN B 2 4  ? 5.508   14.161  -6.036  1.00 0.00 ? 4  GLN B HA   1  
ATOM 375  H HB2  . GLN B 2 4  ? 6.720   12.248  -4.944  1.00 0.00 ? 4  GLN B HB2  1  
ATOM 376  H HB3  . GLN B 2 4  ? 5.389   11.190  -5.318  1.00 0.00 ? 4  GLN B HB3  1  
ATOM 377  H HG2  . GLN B 2 4  ? 5.902   11.161  -7.680  1.00 0.00 ? 4  GLN B HG2  1  
ATOM 378  H HG3  . GLN B 2 4  ? 6.946   12.581  -7.515  1.00 0.00 ? 4  GLN B HG3  1  
ATOM 379  H HE21 . GLN B 2 4  ? 8.834   11.557  -8.237  1.00 0.00 ? 4  GLN B HE21 1  
ATOM 380  H HE22 . GLN B 2 4  ? 9.615   10.288  -7.426  1.00 0.00 ? 4  GLN B HE22 1  
ATOM 381  N N    . HIS B 2 5  ? 3.905   12.595  -7.837  1.00 0.00 ? 5  HIS B N    1  
ATOM 382  C CA   . HIS B 2 5  ? 2.793   12.342  -8.806  1.00 0.00 ? 5  HIS B CA   1  
ATOM 383  C C    . HIS B 2 5  ? 2.671   10.801  -8.935  1.00 0.00 ? 5  HIS B C    1  
ATOM 384  O O    . HIS B 2 5  ? 2.864   10.249  -10.001 1.00 0.00 ? 5  HIS B O    1  
ATOM 385  C CB   . HIS B 2 5  ? 3.188   13.014  -10.144 1.00 0.00 ? 5  HIS B CB   1  
ATOM 386  C CG   . HIS B 2 5  ? 3.335   14.532  -9.950  1.00 0.00 ? 5  HIS B CG   1  
ATOM 387  N ND1  . HIS B 2 5  ? 2.358   15.376  -9.879  1.00 0.00 ? 5  HIS B ND1  1  
ATOM 388  C CD2  . HIS B 2 5  ? 4.470   15.314  -9.804  1.00 0.00 ? 5  HIS B CD2  1  
ATOM 389  C CE1  . HIS B 2 5  ? 2.824   16.571  -9.711  1.00 0.00 ? 5  HIS B CE1  1  
ATOM 390  N NE2  . HIS B 2 5  ? 4.132   16.581  -9.656  1.00 0.00 ? 5  HIS B NE2  1  
ATOM 391  H H    . HIS B 2 5  ? 4.799   12.386  -8.165  1.00 0.00 ? 5  HIS B H    1  
ATOM 392  H HA   . HIS B 2 5  ? 1.864   12.746  -8.436  1.00 0.00 ? 5  HIS B HA   1  
ATOM 393  H HB2  . HIS B 2 5  ? 4.134   12.627  -10.488 1.00 0.00 ? 5  HIS B HB2  1  
ATOM 394  H HB3  . HIS B 2 5  ? 2.442   12.834  -10.903 1.00 0.00 ? 5  HIS B HB3  1  
ATOM 395  H HD1  . HIS B 2 5  ? 1.406   15.153  -9.952  1.00 0.00 ? 5  HIS B HD1  1  
ATOM 396  H HD2  . HIS B 2 5  ? 5.487   14.948  -9.809  1.00 0.00 ? 5  HIS B HD2  1  
ATOM 397  H HE1  . HIS B 2 5  ? 2.204   17.454  -9.622  1.00 0.00 ? 5  HIS B HE1  1  
ATOM 398  N N    . LEU B 2 6  ? 2.349   10.141  -7.847  1.00 0.00 ? 6  LEU B N    1  
ATOM 399  C CA   . LEU B 2 6  ? 2.210   8.640   -7.851  1.00 0.00 ? 6  LEU B CA   1  
ATOM 400  C C    . LEU B 2 6  ? 0.795   8.131   -8.173  1.00 0.00 ? 6  LEU B C    1  
ATOM 401  O O    . LEU B 2 6  ? 0.043   7.837   -7.263  1.00 0.00 ? 6  LEU B O    1  
ATOM 402  C CB   . LEU B 2 6  ? 2.615   8.080   -6.469  1.00 0.00 ? 6  LEU B CB   1  
ATOM 403  C CG   . LEU B 2 6  ? 4.052   8.458   -6.062  1.00 0.00 ? 6  LEU B CG   1  
ATOM 404  C CD1  . LEU B 2 6  ? 4.363   7.760   -4.731  1.00 0.00 ? 6  LEU B CD1  1  
ATOM 405  C CD2  . LEU B 2 6  ? 5.087   7.996   -7.108  1.00 0.00 ? 6  LEU B CD2  1  
ATOM 406  H H    . LEU B 2 6  ? 2.195   10.632  -7.012  1.00 0.00 ? 6  LEU B H    1  
ATOM 407  H HA   . LEU B 2 6  ? 2.869   8.233   -8.600  1.00 0.00 ? 6  LEU B HA   1  
ATOM 408  H HB2  . LEU B 2 6  ? 1.931   8.471   -5.732  1.00 0.00 ? 6  LEU B HB2  1  
ATOM 409  H HB3  . LEU B 2 6  ? 2.504   7.006   -6.481  1.00 0.00 ? 6  LEU B HB3  1  
ATOM 410  H HG   . LEU B 2 6  ? 4.122   9.529   -5.931  1.00 0.00 ? 6  LEU B HG   1  
ATOM 411  H HD11 . LEU B 2 6  ? 3.665   8.086   -3.970  1.00 0.00 ? 6  LEU B HD11 1  
ATOM 412  H HD12 . LEU B 2 6  ? 4.282   6.693   -4.849  1.00 0.00 ? 6  LEU B HD12 1  
ATOM 413  H HD13 . LEU B 2 6  ? 5.371   7.982   -4.415  1.00 0.00 ? 6  LEU B HD13 1  
ATOM 414  H HD21 . LEU B 2 6  ? 5.028   6.927   -7.236  1.00 0.00 ? 6  LEU B HD21 1  
ATOM 415  H HD22 . LEU B 2 6  ? 4.911   8.472   -8.062  1.00 0.00 ? 6  LEU B HD22 1  
ATOM 416  H HD23 . LEU B 2 6  ? 6.084   8.252   -6.778  1.00 0.00 ? 6  LEU B HD23 1  
ATOM 417  N N    . CYS B 2 7  ? 0.459   8.025   -9.438  1.00 0.00 ? 7  CYS B N    1  
ATOM 418  C CA   . CYS B 2 7  ? -0.920  7.536   -9.785  1.00 0.00 ? 7  CYS B CA   1  
ATOM 419  C C    . CYS B 2 7  ? -1.016  6.263   -10.648 1.00 0.00 ? 7  CYS B C    1  
ATOM 420  O O    . CYS B 2 7  ? -1.457  6.282   -11.781 1.00 0.00 ? 7  CYS B O    1  
ATOM 421  C CB   . CYS B 2 7  ? -1.685  8.700   -10.457 1.00 0.00 ? 7  CYS B CB   1  
ATOM 422  S SG   . CYS B 2 7  ? -3.443  8.471   -10.825 1.00 0.00 ? 7  CYS B SG   1  
ATOM 423  H H    . CYS B 2 7  ? 1.105   8.253   -10.143 1.00 0.00 ? 7  CYS B H    1  
ATOM 424  H HA   . CYS B 2 7  ? -1.442  7.324   -8.883  1.00 0.00 ? 7  CYS B HA   1  
ATOM 425  H HB2  . CYS B 2 7  ? -1.627  9.551   -9.794  1.00 0.00 ? 7  CYS B HB2  1  
ATOM 426  H HB3  . CYS B 2 7  ? -1.186  8.971   -11.378 1.00 0.00 ? 7  CYS B HB3  1  
ATOM 427  N N    . GLY B 2 8  ? -0.579  5.183   -10.050 1.00 0.00 ? 8  GLY B N    1  
ATOM 428  C CA   . GLY B 2 8  ? -0.596  3.841   -10.703 1.00 0.00 ? 8  GLY B CA   1  
ATOM 429  C C    . GLY B 2 8  ? 0.803   3.323   -11.136 1.00 0.00 ? 8  GLY B C    1  
ATOM 430  O O    . GLY B 2 8  ? 1.276   2.385   -10.531 1.00 0.00 ? 8  GLY B O    1  
ATOM 431  H H    . GLY B 2 8  ? -0.225  5.260   -9.140  1.00 0.00 ? 8  GLY B H    1  
ATOM 432  H HA2  . GLY B 2 8  ? -0.948  3.155   -9.950  1.00 0.00 ? 8  GLY B HA2  1  
ATOM 433  H HA3  . GLY B 2 8  ? -1.352  3.786   -11.483 1.00 0.00 ? 8  GLY B HA3  1  
ATOM 434  N N    . SER B 2 9  ? 1.450   3.900   -12.130 1.00 0.00 ? 9  SER B N    1  
ATOM 435  C CA   . SER B 2 9  ? 2.803   3.429   -12.585 1.00 0.00 ? 9  SER B CA   1  
ATOM 436  C C    . SER B 2 9  ? 3.823   2.990   -11.526 1.00 0.00 ? 9  SER B C    1  
ATOM 437  O O    . SER B 2 9  ? 4.543   2.023   -11.679 1.00 0.00 ? 9  SER B O    1  
ATOM 438  C CB   . SER B 2 9  ? 3.435   4.533   -13.414 1.00 0.00 ? 9  SER B CB   1  
ATOM 439  O OG   . SER B 2 9  ? 3.626   5.622   -12.514 1.00 0.00 ? 9  SER B OG   1  
ATOM 440  H H    . SER B 2 9  ? 1.101   4.676   -12.625 1.00 0.00 ? 9  SER B H    1  
ATOM 441  H HA   . SER B 2 9  ? 2.629   2.586   -13.239 1.00 0.00 ? 9  SER B HA   1  
ATOM 442  H HB2  . SER B 2 9  ? 4.376   4.225   -13.848 1.00 0.00 ? 9  SER B HB2  1  
ATOM 443  H HB3  . SER B 2 9  ? 2.735   4.829   -14.168 1.00 0.00 ? 9  SER B HB3  1  
ATOM 444  H HG   . SER B 2 9  ? 4.568   5.775   -12.414 1.00 0.00 ? 9  SER B HG   1  
ATOM 445  N N    . HIS B 2 10 ? 3.807   3.750   -10.475 1.00 0.00 ? 10 HIS B N    1  
ATOM 446  C CA   . HIS B 2 10 ? 4.707   3.567   -9.312  1.00 0.00 ? 10 HIS B CA   1  
ATOM 447  C C    . HIS B 2 10 ? 4.074   2.785   -8.186  1.00 0.00 ? 10 HIS B C    1  
ATOM 448  O O    . HIS B 2 10 ? 4.788   2.123   -7.464  1.00 0.00 ? 10 HIS B O    1  
ATOM 449  C CB   . HIS B 2 10 ? 5.118   4.982   -8.874  1.00 0.00 ? 10 HIS B CB   1  
ATOM 450  C CG   . HIS B 2 10 ? 5.904   5.658   -10.010 1.00 0.00 ? 10 HIS B CG   1  
ATOM 451  N ND1  . HIS B 2 10 ? 6.234   6.905   -10.042 1.00 0.00 ? 10 HIS B ND1  1  
ATOM 452  C CD2  . HIS B 2 10 ? 6.409   5.146   -11.199 1.00 0.00 ? 10 HIS B CD2  1  
ATOM 453  C CE1  . HIS B 2 10 ? 6.884   7.156   -11.138 1.00 0.00 ? 10 HIS B CE1  1  
ATOM 454  N NE2  . HIS B 2 10 ? 7.011   6.091   -11.889 1.00 0.00 ? 10 HIS B NE2  1  
ATOM 455  H H    . HIS B 2 10 ? 3.156   4.472   -10.448 1.00 0.00 ? 10 HIS B H    1  
ATOM 456  H HA   . HIS B 2 10 ? 5.579   3.023   -9.640  1.00 0.00 ? 10 HIS B HA   1  
ATOM 457  H HB2  . HIS B 2 10 ? 4.242   5.580   -8.681  1.00 0.00 ? 10 HIS B HB2  1  
ATOM 458  H HB3  . HIS B 2 10 ? 5.719   4.975   -7.987  1.00 0.00 ? 10 HIS B HB3  1  
ATOM 459  H HD1  . HIS B 2 10 ? 6.034   7.564   -9.346  1.00 0.00 ? 10 HIS B HD1  1  
ATOM 460  H HD2  . HIS B 2 10 ? 6.325   4.116   -11.520 1.00 0.00 ? 10 HIS B HD2  1  
ATOM 461  H HE1  . HIS B 2 10 ? 7.270   8.128   -11.406 1.00 0.00 ? 10 HIS B HE1  1  
ATOM 462  N N    . LEU B 2 11 ? 2.777   2.859   -8.049  1.00 0.00 ? 11 LEU B N    1  
ATOM 463  C CA   . LEU B 2 11 ? 2.135   2.099   -6.945  1.00 0.00 ? 11 LEU B CA   1  
ATOM 464  C C    . LEU B 2 11 ? 2.173   0.633   -7.400  1.00 0.00 ? 11 LEU B C    1  
ATOM 465  O O    . LEU B 2 11 ? 2.177   -0.267  -6.588  1.00 0.00 ? 11 LEU B O    1  
ATOM 466  C CB   . LEU B 2 11 ? 0.680   2.588   -6.759  1.00 0.00 ? 11 LEU B CB   1  
ATOM 467  C CG   . LEU B 2 11 ? 0.651   4.128   -6.555  1.00 0.00 ? 11 LEU B CG   1  
ATOM 468  C CD1  . LEU B 2 11 ? -0.801  4.583   -6.628  1.00 0.00 ? 11 LEU B CD1  1  
ATOM 469  C CD2  . LEU B 2 11 ? 1.213   4.520   -5.181  1.00 0.00 ? 11 LEU B CD2  1  
ATOM 470  H H    . LEU B 2 11 ? 2.232   3.395   -8.660  1.00 0.00 ? 11 LEU B H    1  
ATOM 471  H HA   . LEU B 2 11 ? 2.720   2.207   -6.043  1.00 0.00 ? 11 LEU B HA   1  
ATOM 472  H HB2  . LEU B 2 11 ? 0.054   2.312   -7.595  1.00 0.00 ? 11 LEU B HB2  1  
ATOM 473  H HB3  . LEU B 2 11 ? 0.278   2.111   -5.879  1.00 0.00 ? 11 LEU B HB3  1  
ATOM 474  H HG   . LEU B 2 11 ? 1.215   4.630   -7.327  1.00 0.00 ? 11 LEU B HG   1  
ATOM 475  H HD11 . LEU B 2 11 ? -1.395  4.099   -5.867  1.00 0.00 ? 11 LEU B HD11 1  
ATOM 476  H HD12 . LEU B 2 11 ? -0.856  5.651   -6.495  1.00 0.00 ? 11 LEU B HD12 1  
ATOM 477  H HD13 . LEU B 2 11 ? -1.211  4.330   -7.593  1.00 0.00 ? 11 LEU B HD13 1  
ATOM 478  H HD21 . LEU B 2 11 ? 0.642   4.051   -4.398  1.00 0.00 ? 11 LEU B HD21 1  
ATOM 479  H HD22 . LEU B 2 11 ? 2.245   4.216   -5.099  1.00 0.00 ? 11 LEU B HD22 1  
ATOM 480  H HD23 . LEU B 2 11 ? 1.154   5.591   -5.048  1.00 0.00 ? 11 LEU B HD23 1  
ATOM 481  N N    . VAL B 2 12 ? 2.213   0.459   -8.701  1.00 0.00 ? 12 VAL B N    1  
ATOM 482  C CA   . VAL B 2 12 ? 2.258   -0.890  -9.315  1.00 0.00 ? 12 VAL B CA   1  
ATOM 483  C C    . VAL B 2 12 ? 3.702   -1.379  -9.231  1.00 0.00 ? 12 VAL B C    1  
ATOM 484  O O    . VAL B 2 12 ? 3.934   -2.431  -8.661  1.00 0.00 ? 12 VAL B O    1  
ATOM 485  C CB   . VAL B 2 12 ? 1.786   -0.754  -10.779 1.00 0.00 ? 12 VAL B CB   1  
ATOM 486  C CG1  . VAL B 2 12 ? 2.080   -2.052  -11.578 1.00 0.00 ? 12 VAL B CG1  1  
ATOM 487  C CG2  . VAL B 2 12 ? 0.265   -0.558  -10.775 1.00 0.00 ? 12 VAL B CG2  1  
ATOM 488  H H    . VAL B 2 12 ? 2.209   1.232   -9.305  1.00 0.00 ? 12 VAL B H    1  
ATOM 489  H HA   . VAL B 2 12 ? 1.619   -1.567  -8.766  1.00 0.00 ? 12 VAL B HA   1  
ATOM 490  H HB   . VAL B 2 12 ? 2.262   0.095   -11.251 1.00 0.00 ? 12 VAL B HB   1  
ATOM 491  H HG11 . VAL B 2 12 ? 3.141   -2.259  -11.581 1.00 0.00 ? 12 VAL B HG11 1  
ATOM 492  H HG12 . VAL B 2 12 ? 1.565   -2.892  -11.135 1.00 0.00 ? 12 VAL B HG12 1  
ATOM 493  H HG13 . VAL B 2 12 ? 1.752   -1.943  -12.602 1.00 0.00 ? 12 VAL B HG13 1  
ATOM 494  H HG21 . VAL B 2 12 ? -0.217  -1.405  -10.311 1.00 0.00 ? 12 VAL B HG21 1  
ATOM 495  H HG22 . VAL B 2 12 ? -0.001  0.333   -10.227 1.00 0.00 ? 12 VAL B HG22 1  
ATOM 496  H HG23 . VAL B 2 12 ? -0.097  -0.454  -11.786 1.00 0.00 ? 12 VAL B HG23 1  
ATOM 497  N N    . GLU B 2 13 ? 4.637   -0.627  -9.767  1.00 0.00 ? 13 GLU B N    1  
ATOM 498  C CA   . GLU B 2 13 ? 6.053   -1.124  -9.683  1.00 0.00 ? 13 GLU B CA   1  
ATOM 499  C C    . GLU B 2 13 ? 6.496   -1.301  -8.211  1.00 0.00 ? 13 GLU B C    1  
ATOM 500  O O    . GLU B 2 13 ? 7.279   -2.178  -7.901  1.00 0.00 ? 13 GLU B O    1  
ATOM 501  C CB   . GLU B 2 13 ? 6.994   -0.124  -10.407 1.00 0.00 ? 13 GLU B CB   1  
ATOM 502  C CG   . GLU B 2 13 ? 8.245   -0.885  -10.945 1.00 0.00 ? 13 GLU B CG   1  
ATOM 503  C CD   . GLU B 2 13 ? 9.132   -1.396  -9.796  1.00 0.00 ? 13 GLU B CD   1  
ATOM 504  O OE1  . GLU B 2 13 ? 9.546   -0.557  -9.011  1.00 0.00 ? 13 GLU B OE1  1  
ATOM 505  O OE2  . GLU B 2 13 ? 9.348   -2.597  -9.759  1.00 0.00 ? 13 GLU B OE2  1  
ATOM 506  H H    . GLU B 2 13 ? 4.418   0.234   -10.203 1.00 0.00 ? 13 GLU B H    1  
ATOM 507  H HA   . GLU B 2 13 ? 6.123   -2.071  -10.191 1.00 0.00 ? 13 GLU B HA   1  
ATOM 508  H HB2  . GLU B 2 13 ? 6.470   0.331   -11.232 1.00 0.00 ? 13 GLU B HB2  1  
ATOM 509  H HB3  . GLU B 2 13 ? 7.357   0.638   -9.740  1.00 0.00 ? 13 GLU B HB3  1  
ATOM 510  H HG2  . GLU B 2 13 ? 7.915   -1.724  -11.541 1.00 0.00 ? 13 GLU B HG2  1  
ATOM 511  H HG3  . GLU B 2 13 ? 8.841   -0.233  -11.568 1.00 0.00 ? 13 GLU B HG3  1  
ATOM 512  N N    . ALA B 2 14 ? 5.966   -0.483  -7.337  1.00 0.00 ? 14 ALA B N    1  
ATOM 513  C CA   . ALA B 2 14 ? 6.337   -0.568  -5.888  1.00 0.00 ? 14 ALA B CA   1  
ATOM 514  C C    . ALA B 2 14 ? 5.654   -1.729  -5.163  1.00 0.00 ? 14 ALA B C    1  
ATOM 515  O O    . ALA B 2 14 ? 6.316   -2.484  -4.486  1.00 0.00 ? 14 ALA B O    1  
ATOM 516  C CB   . ALA B 2 14 ? 5.960   0.748   -5.179  1.00 0.00 ? 14 ALA B CB   1  
ATOM 517  H H    . ALA B 2 14 ? 5.311   0.184   -7.632  1.00 0.00 ? 14 ALA B H    1  
ATOM 518  H HA   . ALA B 2 14 ? 7.410   -0.698  -5.809  1.00 0.00 ? 14 ALA B HA   1  
ATOM 519  H HB1  . ALA B 2 14 ? 4.895   0.928   -5.263  1.00 0.00 ? 14 ALA B HB1  1  
ATOM 520  H HB2  . ALA B 2 14 ? 6.223   0.698   -4.132  1.00 0.00 ? 14 ALA B HB2  1  
ATOM 521  H HB3  . ALA B 2 14 ? 6.494   1.580   -5.617  1.00 0.00 ? 14 ALA B HB3  1  
ATOM 522  N N    . LEU B 2 15 ? 4.365   -1.873  -5.317  1.00 0.00 ? 15 LEU B N    1  
ATOM 523  C CA   . LEU B 2 15 ? 3.658   -2.985  -4.623  1.00 0.00 ? 15 LEU B CA   1  
ATOM 524  C C    . LEU B 2 15 ? 4.221   -4.300  -5.110  1.00 0.00 ? 15 LEU B C    1  
ATOM 525  O O    . LEU B 2 15 ? 4.424   -5.203  -4.323  1.00 0.00 ? 15 LEU B O    1  
ATOM 526  C CB   . LEU B 2 15 ? 2.119   -2.765  -4.916  1.00 0.00 ? 15 LEU B CB   1  
ATOM 527  C CG   . LEU B 2 15 ? 1.142   -3.864  -4.410  1.00 0.00 ? 15 LEU B CG   1  
ATOM 528  C CD1  . LEU B 2 15 ? -0.274  -3.418  -4.840  1.00 0.00 ? 15 LEU B CD1  1  
ATOM 529  C CD2  . LEU B 2 15 ? 1.343   -5.253  -5.034  1.00 0.00 ? 15 LEU B CD2  1  
ATOM 530  H H    . LEU B 2 15 ? 3.852   -1.276  -5.888  1.00 0.00 ? 15 LEU B H    1  
ATOM 531  H HA   . LEU B 2 15 ? 3.885   -2.924  -3.580  1.00 0.00 ? 15 LEU B HA   1  
ATOM 532  H HB2  . LEU B 2 15 ? 1.859   -1.888  -4.340  1.00 0.00 ? 15 LEU B HB2  1  
ATOM 533  H HB3  . LEU B 2 15 ? 1.894   -2.517  -5.940  1.00 0.00 ? 15 LEU B HB3  1  
ATOM 534  H HG   . LEU B 2 15 ? 1.201   -3.922  -3.330  1.00 0.00 ? 15 LEU B HG   1  
ATOM 535  H HD11 . LEU B 2 15 ? -0.303  -3.280  -5.911  1.00 0.00 ? 15 LEU B HD11 1  
ATOM 536  H HD12 . LEU B 2 15 ? -0.998  -4.177  -4.590  1.00 0.00 ? 15 LEU B HD12 1  
ATOM 537  H HD13 . LEU B 2 15 ? -0.554  -2.491  -4.366  1.00 0.00 ? 15 LEU B HD13 1  
ATOM 538  H HD21 . LEU B 2 15 ? 1.206   -5.223  -6.105  1.00 0.00 ? 15 LEU B HD21 1  
ATOM 539  H HD22 . LEU B 2 15 ? 2.293   -5.698  -4.801  1.00 0.00 ? 15 LEU B HD22 1  
ATOM 540  H HD23 . LEU B 2 15 ? 0.591   -5.892  -4.610  1.00 0.00 ? 15 LEU B HD23 1  
ATOM 541  N N    . TYR B 2 16 ? 4.495   -4.375  -6.379  1.00 0.00 ? 16 TYR B N    1  
ATOM 542  C CA   . TYR B 2 16 ? 5.041   -5.619  -6.956  1.00 0.00 ? 16 TYR B CA   1  
ATOM 543  C C    . TYR B 2 16 ? 6.496   -5.857  -6.460  1.00 0.00 ? 16 TYR B C    1  
ATOM 544  O O    . TYR B 2 16 ? 6.864   -7.001  -6.276  1.00 0.00 ? 16 TYR B O    1  
ATOM 545  C CB   . TYR B 2 16 ? 4.954   -5.479  -8.494  1.00 0.00 ? 16 TYR B CB   1  
ATOM 546  C CG   . TYR B 2 16 ? 3.503   -5.482  -9.063  1.00 0.00 ? 16 TYR B CG   1  
ATOM 547  C CD1  . TYR B 2 16 ? 2.431   -4.808  -8.487  1.00 0.00 ? 16 TYR B CD1  1  
ATOM 548  C CD2  . TYR B 2 16 ? 3.268   -6.196  -10.225 1.00 0.00 ? 16 TYR B CD2  1  
ATOM 549  C CE1  . TYR B 2 16 ? 1.176   -4.848  -9.063  1.00 0.00 ? 16 TYR B CE1  1  
ATOM 550  C CE2  . TYR B 2 16 ? 2.009   -6.235  -10.796 1.00 0.00 ? 16 TYR B CE2  1  
ATOM 551  C CZ   . TYR B 2 16 ? 0.955   -5.565  -10.220 1.00 0.00 ? 16 TYR B CZ   1  
ATOM 552  O OH   . TYR B 2 16 ? -0.299  -5.611  -10.794 1.00 0.00 ? 16 TYR B OH   1  
ATOM 553  H H    . TYR B 2 16 ? 4.358   -3.617  -6.969  1.00 0.00 ? 16 TYR B H    1  
ATOM 554  H HA   . TYR B 2 16 ? 4.421   -6.443  -6.640  1.00 0.00 ? 16 TYR B HA   1  
ATOM 555  H HB2  . TYR B 2 16 ? 5.438   -4.583  -8.828  1.00 0.00 ? 16 TYR B HB2  1  
ATOM 556  H HB3  . TYR B 2 16 ? 5.481   -6.297  -8.927  1.00 0.00 ? 16 TYR B HB3  1  
ATOM 557  H HD1  . TYR B 2 16 ? 2.554   -4.231  -7.583  1.00 0.00 ? 16 TYR B HD1  1  
ATOM 558  H HD2  . TYR B 2 16 ? 4.085   -6.732  -10.687 1.00 0.00 ? 16 TYR B HD2  1  
ATOM 559  H HE1  . TYR B 2 16 ? 0.356   -4.317  -8.599  1.00 0.00 ? 16 TYR B HE1  1  
ATOM 560  H HE2  . TYR B 2 16 ? 1.846   -6.796  -11.705 1.00 0.00 ? 16 TYR B HE2  1  
ATOM 561  H HH   . TYR B 2 16 ? -0.963  -5.312  -10.169 1.00 0.00 ? 16 TYR B HH   1  
ATOM 562  N N    . LEU B 2 17 ? 7.268   -4.806  -6.243  1.00 0.00 ? 17 LEU B N    1  
ATOM 563  C CA   . LEU B 2 17 ? 8.691   -4.948  -5.766  1.00 0.00 ? 17 LEU B CA   1  
ATOM 564  C C    . LEU B 2 17 ? 8.692   -5.398  -4.293  1.00 0.00 ? 17 LEU B C    1  
ATOM 565  O O    . LEU B 2 17 ? 9.627   -6.035  -3.848  1.00 0.00 ? 17 LEU B O    1  
ATOM 566  C CB   . LEU B 2 17 ? 9.413   -3.543  -5.980  1.00 0.00 ? 17 LEU B CB   1  
ATOM 567  C CG   . LEU B 2 17 ? 10.901  -3.420  -5.462  1.00 0.00 ? 17 LEU B CG   1  
ATOM 568  C CD1  . LEU B 2 17 ? 10.966  -3.162  -3.940  1.00 0.00 ? 17 LEU B CD1  1  
ATOM 569  C CD2  . LEU B 2 17 ? 11.758  -4.655  -5.833  1.00 0.00 ? 17 LEU B CD2  1  
ATOM 570  H H    . LEU B 2 17 ? 6.922   -3.901  -6.383  1.00 0.00 ? 17 LEU B H    1  
ATOM 571  H HA   . LEU B 2 17 ? 9.181   -5.706  -6.358  1.00 0.00 ? 17 LEU B HA   1  
ATOM 572  H HB2  . LEU B 2 17 ? 9.431   -3.343  -7.038  1.00 0.00 ? 17 LEU B HB2  1  
ATOM 573  H HB3  . LEU B 2 17 ? 8.827   -2.763  -5.519  1.00 0.00 ? 17 LEU B HB3  1  
ATOM 574  H HG   . LEU B 2 17 ? 11.350  -2.561  -5.941  1.00 0.00 ? 17 LEU B HG   1  
ATOM 575  H HD11 . LEU B 2 17 ? 10.497  -3.942  -3.369  1.00 0.00 ? 17 LEU B HD11 1  
ATOM 576  H HD12 . LEU B 2 17 ? 11.997  -3.081  -3.622  1.00 0.00 ? 17 LEU B HD12 1  
ATOM 577  H HD13 . LEU B 2 17 ? 10.469  -2.231  -3.712  1.00 0.00 ? 17 LEU B HD13 1  
ATOM 578  H HD21 . LEU B 2 17 ? 11.335  -5.560  -5.424  1.00 0.00 ? 17 LEU B HD21 1  
ATOM 579  H HD22 . LEU B 2 17 ? 11.833  -4.753  -6.904  1.00 0.00 ? 17 LEU B HD22 1  
ATOM 580  H HD23 . LEU B 2 17 ? 12.758  -4.541  -5.449  1.00 0.00 ? 17 LEU B HD23 1  
ATOM 581  N N    . VAL B 2 18 ? 7.639   -5.065  -3.586  1.00 0.00 ? 18 VAL B N    1  
ATOM 582  C CA   . VAL B 2 18 ? 7.548   -5.452  -2.145  1.00 0.00 ? 18 VAL B CA   1  
ATOM 583  C C    . VAL B 2 18 ? 6.899   -6.837  -1.922  1.00 0.00 ? 18 VAL B C    1  
ATOM 584  O O    . VAL B 2 18 ? 7.362   -7.601  -1.095  1.00 0.00 ? 18 VAL B O    1  
ATOM 585  C CB   . VAL B 2 18 ? 6.739   -4.352  -1.426  1.00 0.00 ? 18 VAL B CB   1  
ATOM 586  C CG1  . VAL B 2 18 ? 6.694   -4.675  0.076   1.00 0.00 ? 18 VAL B CG1  1  
ATOM 587  C CG2  . VAL B 2 18 ? 7.443   -2.989  -1.597  1.00 0.00 ? 18 VAL B CG2  1  
ATOM 588  H H    . VAL B 2 18 ? 6.905   -4.550  -3.992  1.00 0.00 ? 18 VAL B H    1  
ATOM 589  H HA   . VAL B 2 18 ? 8.547   -5.465  -1.727  1.00 0.00 ? 18 VAL B HA   1  
ATOM 590  H HB   . VAL B 2 18 ? 5.734   -4.299  -1.825  1.00 0.00 ? 18 VAL B HB   1  
ATOM 591  H HG11 . VAL B 2 18 ? 7.696   -4.719  0.480   1.00 0.00 ? 18 VAL B HG11 1  
ATOM 592  H HG12 . VAL B 2 18 ? 6.149   -3.907  0.589   1.00 0.00 ? 18 VAL B HG12 1  
ATOM 593  H HG13 . VAL B 2 18 ? 6.200   -5.617  0.244   1.00 0.00 ? 18 VAL B HG13 1  
ATOM 594  H HG21 . VAL B 2 18 ? 7.558   -2.761  -2.642  1.00 0.00 ? 18 VAL B HG21 1  
ATOM 595  H HG22 . VAL B 2 18 ? 6.862   -2.207  -1.135  1.00 0.00 ? 18 VAL B HG22 1  
ATOM 596  H HG23 . VAL B 2 18 ? 8.427   -3.015  -1.153  1.00 0.00 ? 18 VAL B HG23 1  
ATOM 597  N N    . CYS B 2 19 ? 5.860   -7.122  -2.662  1.00 0.00 ? 19 CYS B N    1  
ATOM 598  C CA   . CYS B 2 19 ? 5.146   -8.425  -2.535  1.00 0.00 ? 19 CYS B CA   1  
ATOM 599  C C    . CYS B 2 19 ? 5.885   -9.636  -3.120  1.00 0.00 ? 19 CYS B C    1  
ATOM 600  O O    . CYS B 2 19 ? 5.945   -10.667 -2.475  1.00 0.00 ? 19 CYS B O    1  
ATOM 601  C CB   . CYS B 2 19 ? 3.773   -8.290  -3.221  1.00 0.00 ? 19 CYS B CB   1  
ATOM 602  S SG   . CYS B 2 19 ? 2.403   -7.871  -2.121  1.00 0.00 ? 19 CYS B SG   1  
ATOM 603  H H    . CYS B 2 19 ? 5.529   -6.483  -3.320  1.00 0.00 ? 19 CYS B H    1  
ATOM 604  H HA   . CYS B 2 19 ? 4.941   -8.624  -1.483  1.00 0.00 ? 19 CYS B HA   1  
ATOM 605  H HB2  . CYS B 2 19 ? 3.787   -7.518  -3.969  1.00 0.00 ? 19 CYS B HB2  1  
ATOM 606  H HB3  . CYS B 2 19 ? 3.519   -9.220  -3.703  1.00 0.00 ? 19 CYS B HB3  1  
ATOM 607  N N    . GLY B 2 20 ? 6.422   -9.491  -4.307  1.00 0.00 ? 20 GLY B N    1  
ATOM 608  C CA   . GLY B 2 20 ? 7.141   -10.639 -4.940  1.00 0.00 ? 20 GLY B CA   1  
ATOM 609  C C    . GLY B 2 20 ? 6.067   -11.489 -5.645  1.00 0.00 ? 20 GLY B C    1  
ATOM 610  O O    . GLY B 2 20 ? 6.268   -12.662 -5.896  1.00 0.00 ? 20 GLY B O    1  
ATOM 611  H H    . GLY B 2 20 ? 6.375   -8.641  -4.791  1.00 0.00 ? 20 GLY B H    1  
ATOM 612  H HA2  . GLY B 2 20 ? 7.862   -10.284 -5.661  1.00 0.00 ? 20 GLY B HA2  1  
ATOM 613  H HA3  . GLY B 2 20 ? 7.633   -11.233 -4.186  1.00 0.00 ? 20 GLY B HA3  1  
ATOM 614  N N    . GLU B 2 21 ? 4.960   -10.840 -5.930  1.00 0.00 ? 21 GLU B N    1  
ATOM 615  C CA   . GLU B 2 21 ? 3.778   -11.458 -6.612  1.00 0.00 ? 21 GLU B CA   1  
ATOM 616  C C    . GLU B 2 21 ? 3.216   -12.629 -5.794  1.00 0.00 ? 21 GLU B C    1  
ATOM 617  O O    . GLU B 2 21 ? 3.096   -13.754 -6.247  1.00 0.00 ? 21 GLU B O    1  
ATOM 618  C CB   . GLU B 2 21 ? 4.214   -11.900 -8.058  1.00 0.00 ? 21 GLU B CB   1  
ATOM 619  C CG   . GLU B 2 21 ? 4.470   -10.642 -8.950  1.00 0.00 ? 21 GLU B CG   1  
ATOM 620  C CD   . GLU B 2 21 ? 5.525   -9.707  -8.320  1.00 0.00 ? 21 GLU B CD   1  
ATOM 621  O OE1  . GLU B 2 21 ? 6.680   -10.105 -8.305  1.00 0.00 ? 21 GLU B OE1  1  
ATOM 622  O OE2  . GLU B 2 21 ? 5.111   -8.646  -7.882  1.00 0.00 ? 21 GLU B OE2  1  
ATOM 623  H H    . GLU B 2 21 ? 4.894   -9.893  -5.685  1.00 0.00 ? 21 GLU B H    1  
ATOM 624  H HA   . GLU B 2 21 ? 3.003   -10.717 -6.686  1.00 0.00 ? 21 GLU B HA   1  
ATOM 625  H HB2  . GLU B 2 21 ? 5.106   -12.505 -8.019  1.00 0.00 ? 21 GLU B HB2  1  
ATOM 626  H HB3  . GLU B 2 21 ? 3.424   -12.484 -8.503  1.00 0.00 ? 21 GLU B HB3  1  
ATOM 627  H HG2  . GLU B 2 21 ? 4.831   -10.965 -9.913  1.00 0.00 ? 21 GLU B HG2  1  
ATOM 628  H HG3  . GLU B 2 21 ? 3.545   -10.102 -9.105  1.00 0.00 ? 21 GLU B HG3  1  
ATOM 629  N N    . ARG B 2 22 ? 2.892   -12.262 -4.582  1.00 0.00 ? 22 ARG B N    1  
ATOM 630  C CA   . ARG B 2 22 ? 2.308   -13.192 -3.566  1.00 0.00 ? 22 ARG B CA   1  
ATOM 631  C C    . ARG B 2 22 ? 0.934   -12.577 -3.254  1.00 0.00 ? 22 ARG B C    1  
ATOM 632  O O    . ARG B 2 22 ? 0.832   -11.377 -3.072  1.00 0.00 ? 22 ARG B O    1  
ATOM 633  C CB   . ARG B 2 22 ? 3.187   -13.215 -2.281  1.00 0.00 ? 22 ARG B CB   1  
ATOM 634  C CG   . ARG B 2 22 ? 2.558   -14.137 -1.190  1.00 0.00 ? 22 ARG B CG   1  
ATOM 635  C CD   . ARG B 2 22 ? 3.305   -13.967 0.162   1.00 0.00 ? 22 ARG B CD   1  
ATOM 636  N NE   . ARG B 2 22 ? 2.446   -14.534 1.249   1.00 0.00 ? 22 ARG B NE   1  
ATOM 637  C CZ   . ARG B 2 22 ? 2.898   -15.427 2.087   1.00 0.00 ? 22 ARG B CZ   1  
ATOM 638  N NH1  . ARG B 2 22 ? 3.692   -15.022 3.039   1.00 0.00 ? 22 ARG B NH1  1  
ATOM 639  N NH2  . ARG B 2 22 ? 2.545   -16.676 1.951   1.00 0.00 ? 22 ARG B NH2  1  
ATOM 640  H H    . ARG B 2 22 ? 3.039   -11.328 -4.326  1.00 0.00 ? 22 ARG B H    1  
ATOM 641  H HA   . ARG B 2 22 ? 2.179   -14.178 -3.991  1.00 0.00 ? 22 ARG B HA   1  
ATOM 642  H HB2  . ARG B 2 22 ? 4.188   -13.546 -2.521  1.00 0.00 ? 22 ARG B HB2  1  
ATOM 643  H HB3  . ARG B 2 22 ? 3.239   -12.208 -1.889  1.00 0.00 ? 22 ARG B HB3  1  
ATOM 644  H HG2  . ARG B 2 22 ? 1.520   -13.880 -1.053  1.00 0.00 ? 22 ARG B HG2  1  
ATOM 645  H HG3  . ARG B 2 22 ? 2.613   -15.166 -1.516  1.00 0.00 ? 22 ARG B HG3  1  
ATOM 646  H HD2  . ARG B 2 22 ? 4.261   -14.473 0.149   1.00 0.00 ? 22 ARG B HD2  1  
ATOM 647  H HD3  . ARG B 2 22 ? 3.459   -12.921 0.380   1.00 0.00 ? 22 ARG B HD3  1  
ATOM 648  H HE   . ARG B 2 22 ? 1.519   -14.220 1.338   1.00 0.00 ? 22 ARG B HE   1  
ATOM 649  H HH11 . ARG B 2 22 ? 3.934   -14.055 3.094   1.00 0.00 ? 22 ARG B HH11 1  
ATOM 650  H HH12 . ARG B 2 22 ? 4.055   -15.668 3.712   1.00 0.00 ? 22 ARG B HH12 1  
ATOM 651  H HH21 . ARG B 2 22 ? 1.931   -16.945 1.208   1.00 0.00 ? 22 ARG B HH21 1  
ATOM 652  H HH22 . ARG B 2 22 ? 2.888   -17.364 2.592   1.00 0.00 ? 22 ARG B HH22 1  
ATOM 653  N N    . GLY B 2 23 ? -0.054  -13.433 -3.203  1.00 0.00 ? 23 GLY B N    1  
ATOM 654  C CA   . GLY B 2 23 ? -1.486  -13.072 -2.913  1.00 0.00 ? 23 GLY B CA   1  
ATOM 655  C C    . GLY B 2 23 ? -1.859  -11.578 -2.654  1.00 0.00 ? 23 GLY B C    1  
ATOM 656  O O    . GLY B 2 23 ? -2.282  -11.309 -1.547  1.00 0.00 ? 23 GLY B O    1  
ATOM 657  H H    . GLY B 2 23 ? 0.159   -14.373 -3.365  1.00 0.00 ? 23 GLY B H    1  
ATOM 658  H HA2  . GLY B 2 23 ? -2.132  -13.512 -3.663  1.00 0.00 ? 23 GLY B HA2  1  
ATOM 659  H HA3  . GLY B 2 23 ? -1.723  -13.594 -1.999  1.00 0.00 ? 23 GLY B HA3  1  
ATOM 660  N N    . PHE B 2 24 ? -1.721  -10.648 -3.584  1.00 0.00 ? 24 PHE B N    1  
ATOM 661  C CA   . PHE B 2 24 ? -2.091  -9.228  -3.302  1.00 0.00 ? 24 PHE B CA   1  
ATOM 662  C C    . PHE B 2 24 ? -3.298  -8.911  -4.245  1.00 0.00 ? 24 PHE B C    1  
ATOM 663  O O    . PHE B 2 24 ? -3.772  -9.820  -4.898  1.00 0.00 ? 24 PHE B O    1  
ATOM 664  C CB   . PHE B 2 24 ? -0.740  -8.396  -3.541  1.00 0.00 ? 24 PHE B CB   1  
ATOM 665  C CG   . PHE B 2 24 ? -0.266  -8.190  -5.007  1.00 0.00 ? 24 PHE B CG   1  
ATOM 666  C CD1  . PHE B 2 24 ? -1.060  -7.570  -5.957  1.00 0.00 ? 24 PHE B CD1  1  
ATOM 667  C CD2  . PHE B 2 24 ? 0.999   -8.607  -5.384  1.00 0.00 ? 24 PHE B CD2  1  
ATOM 668  C CE1  . PHE B 2 24 ? -0.605  -7.371  -7.245  1.00 0.00 ? 24 PHE B CE1  1  
ATOM 669  C CE2  . PHE B 2 24 ? 1.455   -8.408  -6.670  1.00 0.00 ? 24 PHE B CE2  1  
ATOM 670  C CZ   . PHE B 2 24 ? 0.654   -7.791  -7.601  1.00 0.00 ? 24 PHE B CZ   1  
ATOM 671  H H    . PHE B 2 24 ? -1.382  -10.809 -4.485  1.00 0.00 ? 24 PHE B H    1  
ATOM 672  H HA   . PHE B 2 24 ? -2.403  -9.167  -2.264  1.00 0.00 ? 24 PHE B HA   1  
ATOM 673  H HB2  . PHE B 2 24 ? -0.697  -7.450  -3.015  1.00 0.00 ? 24 PHE B HB2  1  
ATOM 674  H HB3  . PHE B 2 24 ? 0.021   -8.996  -3.054  1.00 0.00 ? 24 PHE B HB3  1  
ATOM 675  H HD1  . PHE B 2 24 ? -2.041  -7.229  -5.694  1.00 0.00 ? 24 PHE B HD1  1  
ATOM 676  H HD2  . PHE B 2 24 ? 1.642   -9.090  -4.664  1.00 0.00 ? 24 PHE B HD2  1  
ATOM 677  H HE1  . PHE B 2 24 ? -1.240  -6.878  -7.966  1.00 0.00 ? 24 PHE B HE1  1  
ATOM 678  H HE2  . PHE B 2 24 ? 2.443   -8.735  -6.946  1.00 0.00 ? 24 PHE B HE2  1  
ATOM 679  H HZ   . PHE B 2 24 ? 1.023   -7.643  -8.605  1.00 0.00 ? 24 PHE B HZ   1  
ATOM 680  N N    . PHE B 2 25 ? -3.781  -7.691  -4.332  1.00 0.00 ? 25 PHE B N    1  
ATOM 681  C CA   . PHE B 2 25 ? -4.935  -7.333  -5.206  1.00 0.00 ? 25 PHE B CA   1  
ATOM 682  C C    . PHE B 2 25 ? -4.521  -6.150  -6.113  1.00 0.00 ? 25 PHE B C    1  
ATOM 683  O O    . PHE B 2 25 ? -3.587  -5.448  -5.776  1.00 0.00 ? 25 PHE B O    1  
ATOM 684  C CB   . PHE B 2 25 ? -6.113  -6.965  -4.245  1.00 0.00 ? 25 PHE B CB   1  
ATOM 685  C CG   . PHE B 2 25 ? -5.813  -5.587  -3.604  1.00 0.00 ? 25 PHE B CG   1  
ATOM 686  C CD1  . PHE B 2 25 ? -6.194  -4.421  -4.255  1.00 0.00 ? 25 PHE B CD1  1  
ATOM 687  C CD2  . PHE B 2 25 ? -5.146  -5.493  -2.393  1.00 0.00 ? 25 PHE B CD2  1  
ATOM 688  C CE1  . PHE B 2 25 ? -5.911  -3.192  -3.708  1.00 0.00 ? 25 PHE B CE1  1  
ATOM 689  C CE2  . PHE B 2 25 ? -4.863  -4.258  -1.853  1.00 0.00 ? 25 PHE B CE2  1  
ATOM 690  C CZ   . PHE B 2 25 ? -5.248  -3.111  -2.512  1.00 0.00 ? 25 PHE B CZ   1  
ATOM 691  H H    . PHE B 2 25 ? -3.412  -6.947  -3.840  1.00 0.00 ? 25 PHE B H    1  
ATOM 692  H HA   . PHE B 2 25 ? -5.221  -8.168  -5.828  1.00 0.00 ? 25 PHE B HA   1  
ATOM 693  H HB2  . PHE B 2 25 ? -7.093  -6.959  -4.693  1.00 0.00 ? 25 PHE B HB2  1  
ATOM 694  H HB3  . PHE B 2 25 ? -6.125  -7.700  -3.452  1.00 0.00 ? 25 PHE B HB3  1  
ATOM 695  H HD1  . PHE B 2 25 ? -6.722  -4.467  -5.196  1.00 0.00 ? 25 PHE B HD1  1  
ATOM 696  H HD2  . PHE B 2 25 ? -4.844  -6.388  -1.865  1.00 0.00 ? 25 PHE B HD2  1  
ATOM 697  H HE1  . PHE B 2 25 ? -6.204  -2.289  -4.226  1.00 0.00 ? 25 PHE B HE1  1  
ATOM 698  H HE2  . PHE B 2 25 ? -4.338  -4.189  -0.913  1.00 0.00 ? 25 PHE B HE2  1  
ATOM 699  H HZ   . PHE B 2 25 ? -5.028  -2.145  -2.090  1.00 0.00 ? 25 PHE B HZ   1  
ATOM 700  N N    . TYR B 2 26 ? -5.237  -5.990  -7.206  1.00 0.00 ? 26 TYR B N    1  
ATOM 701  C CA   . TYR B 2 26 ? -5.057  -4.919  -8.256  1.00 0.00 ? 26 TYR B CA   1  
ATOM 702  C C    . TYR B 2 26 ? -4.691  -5.647  -9.565  1.00 0.00 ? 26 TYR B C    1  
ATOM 703  O O    . TYR B 2 26 ? -3.597  -5.514  -10.086 1.00 0.00 ? 26 TYR B O    1  
ATOM 704  C CB   . TYR B 2 26 ? -3.908  -3.911  -7.895  1.00 0.00 ? 26 TYR B CB   1  
ATOM 705  C CG   . TYR B 2 26 ? -3.901  -2.736  -8.896  1.00 0.00 ? 26 TYR B CG   1  
ATOM 706  C CD1  . TYR B 2 26 ? -4.899  -1.777  -8.863  1.00 0.00 ? 26 TYR B CD1  1  
ATOM 707  C CD2  . TYR B 2 26 ? -2.893  -2.618  -9.832  1.00 0.00 ? 26 TYR B CD2  1  
ATOM 708  C CE1  . TYR B 2 26 ? -4.885  -0.724  -9.752  1.00 0.00 ? 26 TYR B CE1  1  
ATOM 709  C CE2  . TYR B 2 26 ? -2.883  -1.564  -10.718 1.00 0.00 ? 26 TYR B CE2  1  
ATOM 710  C CZ   . TYR B 2 26 ? -3.873  -0.611  -10.686 1.00 0.00 ? 26 TYR B CZ   1  
ATOM 711  O OH   . TYR B 2 26 ? -3.840  0.438   -11.581 1.00 0.00 ? 26 TYR B OH   1  
ATOM 712  H H    . TYR B 2 26 ? -5.954  -6.634  -7.361  1.00 0.00 ? 26 TYR B H    1  
ATOM 713  H HA   . TYR B 2 26 ? -6.000  -4.405  -8.391  1.00 0.00 ? 26 TYR B HA   1  
ATOM 714  H HB2  . TYR B 2 26 ? -4.047  -3.499  -6.907  1.00 0.00 ? 26 TYR B HB2  1  
ATOM 715  H HB3  . TYR B 2 26 ? -2.949  -4.405  -7.931  1.00 0.00 ? 26 TYR B HB3  1  
ATOM 716  H HD1  . TYR B 2 26 ? -5.705  -1.850  -8.146  1.00 0.00 ? 26 TYR B HD1  1  
ATOM 717  H HD2  . TYR B 2 26 ? -2.103  -3.357  -9.870  1.00 0.00 ? 26 TYR B HD2  1  
ATOM 718  H HE1  . TYR B 2 26 ? -5.669  0.014   -9.713  1.00 0.00 ? 26 TYR B HE1  1  
ATOM 719  H HE2  . TYR B 2 26 ? -2.097  -1.488  -11.450 1.00 0.00 ? 26 TYR B HE2  1  
ATOM 720  H HH   . TYR B 2 26 ? -4.740  0.633   -11.857 1.00 0.00 ? 26 TYR B HH   1  
ATOM 721  N N    . THR B 2 27 ? -5.646  -6.403  -10.047 1.00 0.00 ? 27 THR B N    1  
ATOM 722  C CA   . THR B 2 27 ? -5.460  -7.188  -11.309 1.00 0.00 ? 27 THR B CA   1  
ATOM 723  C C    . THR B 2 27 ? -6.497  -6.785  -12.402 1.00 0.00 ? 27 THR B C    1  
ATOM 724  O O    . THR B 2 27 ? -7.129  -7.672  -12.949 1.00 0.00 ? 27 THR B O    1  
ATOM 725  C CB   . THR B 2 27 ? -5.588  -8.690  -10.931 1.00 0.00 ? 27 THR B CB   1  
ATOM 726  O OG1  . THR B 2 27 ? -6.919  -8.828  -10.453 1.00 0.00 ? 27 THR B OG1  1  
ATOM 727  C CG2  . THR B 2 27 ? -4.729  -9.021  -9.699  1.00 0.00 ? 27 THR B CG2  1  
ATOM 728  H H    . THR B 2 27 ? -6.501  -6.460  -9.570  1.00 0.00 ? 27 THR B H    1  
ATOM 729  H HA   . THR B 2 27 ? -4.457  -7.090  -11.684 1.00 0.00 ? 27 THR B HA   1  
ATOM 730  H HB   . THR B 2 27 ? -5.409  -9.368  -11.757 1.00 0.00 ? 27 THR B HB   1  
ATOM 731  H HG1  . THR B 2 27 ? -7.407  -9.359  -11.088 1.00 0.00 ? 27 THR B HG1  1  
ATOM 732  H HG21 . THR B 2 27 ? -3.694  -8.780  -9.901  1.00 0.00 ? 27 THR B HG21 1  
ATOM 733  H HG22 . THR B 2 27 ? -5.058  -8.458  -8.839  1.00 0.00 ? 27 THR B HG22 1  
ATOM 734  H HG23 . THR B 2 27 ? -4.805  -10.071 -9.468  1.00 0.00 ? 27 THR B HG23 1  
ATOM 735  N N    . PRO B 2 28 ? -6.660  -5.511  -12.719 1.00 0.00 ? 28 PRO B N    1  
ATOM 736  C CA   . PRO B 2 28 ? -7.851  -4.982  -13.443 1.00 0.00 ? 28 PRO B CA   1  
ATOM 737  C C    . PRO B 2 28 ? -8.736  -5.956  -14.254 1.00 0.00 ? 28 PRO B C    1  
ATOM 738  O O    . PRO B 2 28 ? -8.386  -6.334  -15.354 1.00 0.00 ? 28 PRO B O    1  
ATOM 739  C CB   . PRO B 2 28 ? -7.239  -3.865  -14.275 1.00 0.00 ? 28 PRO B CB   1  
ATOM 740  C CG   . PRO B 2 28 ? -6.266  -3.197  -13.286 1.00 0.00 ? 28 PRO B CG   1  
ATOM 741  C CD   . PRO B 2 28 ? -5.690  -4.378  -12.462 1.00 0.00 ? 28 PRO B CD   1  
ATOM 742  H HA   . PRO B 2 28 ? -8.495  -4.504  -12.714 1.00 0.00 ? 28 PRO B HA   1  
ATOM 743  H HB2  . PRO B 2 28 ? -6.729  -4.239  -15.155 1.00 0.00 ? 28 PRO B HB2  1  
ATOM 744  H HB3  . PRO B 2 28 ? -7.997  -3.162  -14.566 1.00 0.00 ? 28 PRO B HB3  1  
ATOM 745  H HG2  . PRO B 2 28 ? -5.467  -2.703  -13.829 1.00 0.00 ? 28 PRO B HG2  1  
ATOM 746  H HG3  . PRO B 2 28 ? -6.764  -2.481  -12.651 1.00 0.00 ? 28 PRO B HG3  1  
ATOM 747  H HD2  . PRO B 2 28 ? -4.716  -4.532  -12.906 1.00 0.00 ? 28 PRO B HD2  1  
ATOM 748  H HD3  . PRO B 2 28 ? -5.634  -4.145  -11.404 1.00 0.00 ? 28 PRO B HD3  1  
ATOM 749  N N    . LYS B 2 29 ? -9.849  -6.329  -13.667 1.00 0.00 ? 29 LYS B N    1  
ATOM 750  C CA   . LYS B 2 29 ? -10.823 -7.268  -14.315 1.00 0.00 ? 29 LYS B CA   1  
ATOM 751  C C    . LYS B 2 29 ? -11.840 -6.333  -14.978 1.00 0.00 ? 29 LYS B C    1  
ATOM 752  O O    . LYS B 2 29 ? -12.561 -5.611  -14.313 1.00 0.00 ? 29 LYS B O    1  
ATOM 753  C CB   . LYS B 2 29 ? -11.483 -8.161  -13.215 1.00 0.00 ? 29 LYS B CB   1  
ATOM 754  C CG   . LYS B 2 29 ? -12.695 -8.956  -13.791 1.00 0.00 ? 29 LYS B CG   1  
ATOM 755  C CD   . LYS B 2 29 ? -13.357 -9.904  -12.726 1.00 0.00 ? 29 LYS B CD   1  
ATOM 756  C CE   . LYS B 2 29 ? -14.555 -10.635 -13.397 1.00 0.00 ? 29 LYS B CE   1  
ATOM 757  N NZ   . LYS B 2 29 ? -15.053 -11.790 -12.587 1.00 0.00 ? 29 LYS B NZ   1  
ATOM 758  H H    . LYS B 2 29 ? -10.054 -5.982  -12.776 1.00 0.00 ? 29 LYS B H    1  
ATOM 759  H HA   . LYS B 2 29 ? -10.325 -7.863  -15.073 1.00 0.00 ? 29 LYS B HA   1  
ATOM 760  H HB2  . LYS B 2 29 ? -10.743 -8.866  -12.873 1.00 0.00 ? 29 LYS B HB2  1  
ATOM 761  H HB3  . LYS B 2 29 ? -11.794 -7.542  -12.388 1.00 0.00 ? 29 LYS B HB3  1  
ATOM 762  H HG2  . LYS B 2 29 ? -13.426 -8.254  -14.168 1.00 0.00 ? 29 LYS B HG2  1  
ATOM 763  H HG3  . LYS B 2 29 ? -12.336 -9.556  -14.617 1.00 0.00 ? 29 LYS B HG3  1  
ATOM 764  H HD2  . LYS B 2 29 ? -12.645 -10.630 -12.359 1.00 0.00 ? 29 LYS B HD2  1  
ATOM 765  H HD3  . LYS B 2 29 ? -13.729 -9.327  -11.888 1.00 0.00 ? 29 LYS B HD3  1  
ATOM 766  H HE2  . LYS B 2 29 ? -15.379 -9.944  -13.518 1.00 0.00 ? 29 LYS B HE2  1  
ATOM 767  H HE3  . LYS B 2 29 ? -14.265 -11.004 -14.367 1.00 0.00 ? 29 LYS B HE3  1  
ATOM 768  H HZ1  . LYS B 2 29 ? -14.504 -11.899 -11.708 1.00 0.00 ? 29 LYS B HZ1  1  
ATOM 769  H HZ2  . LYS B 2 29 ? -16.057 -11.651 -12.351 1.00 0.00 ? 29 LYS B HZ2  1  
ATOM 770  H HZ3  . LYS B 2 29 ? -14.972 -12.660 -13.149 1.00 0.00 ? 29 LYS B HZ3  1  
ATOM 771  N N    . THR B 2 30 ? -11.849 -6.387  -16.283 1.00 0.00 ? 30 THR B N    1  
ATOM 772  C CA   . THR B 2 30 ? -12.771 -5.536  -17.094 1.00 0.00 ? 30 THR B CA   1  
ATOM 773  C C    . THR B 2 30 ? -13.731 -6.387  -17.936 1.00 0.00 ? 30 THR B C    1  
ATOM 774  O O    . THR B 2 30 ? -13.822 -7.593  -17.820 1.00 0.00 ? 30 THR B O    1  
ATOM 775  C CB   . THR B 2 30 ? -11.875 -4.631  -17.975 1.00 0.00 ? 30 THR B CB   1  
ATOM 776  O OG1  . THR B 2 30 ? -11.024 -3.968  -17.044 1.00 0.00 ? 30 THR B OG1  1  
ATOM 777  C CG2  . THR B 2 30 ? -12.648 -3.487  -18.662 1.00 0.00 ? 30 THR B CG2  1  
ATOM 778  H H    . THR B 2 30 ? -11.237 -7.002  -16.740 1.00 0.00 ? 30 THR B H    1  
ATOM 779  H HA   . THR B 2 30 ? -13.367 -4.925  -16.431 1.00 0.00 ? 30 THR B HA   1  
ATOM 780  H HB   . THR B 2 30 ? -11.282 -5.195  -18.683 1.00 0.00 ? 30 THR B HB   1  
ATOM 781  H HG1  . THR B 2 30 ? -11.197 -3.023  -17.073 1.00 0.00 ? 30 THR B HG1  1  
ATOM 782  H HG21 . THR B 2 30 ? -13.108 -2.836  -17.929 1.00 0.00 ? 30 THR B HG21 1  
ATOM 783  H HG22 . THR B 2 30 ? -11.960 -2.897  -19.248 1.00 0.00 ? 30 THR B HG22 1  
ATOM 784  H HG23 . THR B 2 30 ? -13.409 -3.880  -19.320 1.00 0.00 ? 30 THR B HG23 1  
ATOM 785  N N    . GLY A 1 1  ? -7.873  4.858   1.782   1.00 0.00 ? 1  GLY A N    2  
ATOM 786  C CA   . GLY A 1 1  ? -7.598  3.715   2.703   1.00 0.00 ? 1  GLY A CA   2  
ATOM 787  C C    . GLY A 1 1  ? -6.425  2.870   2.185   1.00 0.00 ? 1  GLY A C    2  
ATOM 788  O O    . GLY A 1 1  ? -5.376  2.824   2.797   1.00 0.00 ? 1  GLY A O    2  
ATOM 789  H H1   . GLY A 1 1  ? -7.234  4.861   0.965   1.00 0.00 ? 1  GLY A H1   2  
ATOM 790  H H2   . GLY A 1 1  ? -8.856  4.813   1.447   1.00 0.00 ? 1  GLY A H2   2  
ATOM 791  H H3   . GLY A 1 1  ? -7.715  5.748   2.291   1.00 0.00 ? 1  GLY A H3   2  
ATOM 792  H HA2  . GLY A 1 1  ? -7.361  4.103   3.682   1.00 0.00 ? 1  GLY A HA2  2  
ATOM 793  H HA3  . GLY A 1 1  ? -8.478  3.091   2.770   1.00 0.00 ? 1  GLY A HA3  2  
ATOM 794  N N    . ILE A 1 2  ? -6.657  2.227   1.069   1.00 0.00 ? 2  ILE A N    2  
ATOM 795  C CA   . ILE A 1 2  ? -5.638  1.355   0.401   1.00 0.00 ? 2  ILE A CA   2  
ATOM 796  C C    . ILE A 1 2  ? -5.236  2.186   -0.838  1.00 0.00 ? 2  ILE A C    2  
ATOM 797  O O    . ILE A 1 2  ? -5.594  3.350   -0.934  1.00 0.00 ? 2  ILE A O    2  
ATOM 798  C CB   . ILE A 1 2  ? -6.309  -0.031  0.029   1.00 0.00 ? 2  ILE A CB   2  
ATOM 799  C CG1  . ILE A 1 2  ? -7.148  -0.624  1.233   1.00 0.00 ? 2  ILE A CG1  2  
ATOM 800  C CG2  . ILE A 1 2  ? -5.242  -1.115  -0.215  1.00 0.00 ? 2  ILE A CG2  2  
ATOM 801  C CD1  . ILE A 1 2  ? -8.569  -0.031  1.380   1.00 0.00 ? 2  ILE A CD1  2  
ATOM 802  H H    . ILE A 1 2  ? -7.533  2.320   0.641   1.00 0.00 ? 2  ILE A H    2  
ATOM 803  H HA   . ILE A 1 2  ? -4.770  1.210   1.026   1.00 0.00 ? 2  ILE A HA   2  
ATOM 804  H HB   . ILE A 1 2  ? -6.876  0.077   -0.880  1.00 0.00 ? 2  ILE A HB   2  
ATOM 805  H HG12 . ILE A 1 2  ? -7.236  -1.699  1.133   1.00 0.00 ? 2  ILE A HG12 2  
ATOM 806  H HG13 . ILE A 1 2  ? -6.596  -0.436  2.143   1.00 0.00 ? 2  ILE A HG13 2  
ATOM 807  H HG21 . ILE A 1 2  ? -4.577  -0.878  -1.029  1.00 0.00 ? 2  ILE A HG21 2  
ATOM 808  H HG22 . ILE A 1 2  ? -4.659  -1.264  0.678   1.00 0.00 ? 2  ILE A HG22 2  
ATOM 809  H HG23 . ILE A 1 2  ? -5.744  -2.039  -0.453  1.00 0.00 ? 2  ILE A HG23 2  
ATOM 810  H HD11 . ILE A 1 2  ? -8.572  1.028   1.553   1.00 0.00 ? 2  ILE A HD11 2  
ATOM 811  H HD12 . ILE A 1 2  ? -9.152  -0.234  0.495   1.00 0.00 ? 2  ILE A HD12 2  
ATOM 812  H HD13 . ILE A 1 2  ? -9.049  -0.507  2.220   1.00 0.00 ? 2  ILE A HD13 2  
ATOM 813  N N    . VAL A 1 3  ? -4.523  1.579   -1.745  1.00 0.00 ? 3  VAL A N    2  
ATOM 814  C CA   . VAL A 1 3  ? -4.082  2.300   -2.986  1.00 0.00 ? 3  VAL A CA   2  
ATOM 815  C C    . VAL A 1 3  ? -4.852  1.839   -4.205  1.00 0.00 ? 3  VAL A C    2  
ATOM 816  O O    . VAL A 1 3  ? -5.798  1.090   -4.074  1.00 0.00 ? 3  VAL A O    2  
ATOM 817  C CB   . VAL A 1 3  ? -2.574  2.059   -3.250  1.00 0.00 ? 3  VAL A CB   2  
ATOM 818  C CG1  . VAL A 1 3  ? -1.789  2.820   -2.227  1.00 0.00 ? 3  VAL A CG1  2  
ATOM 819  C CG2  . VAL A 1 3  ? -2.205  0.560   -3.204  1.00 0.00 ? 3  VAL A CG2  2  
ATOM 820  H H    . VAL A 1 3  ? -4.284  0.646   -1.599  1.00 0.00 ? 3  VAL A H    2  
ATOM 821  H HA   . VAL A 1 3  ? -4.255  3.363   -2.864  1.00 0.00 ? 3  VAL A HA   2  
ATOM 822  H HB   . VAL A 1 3  ? -2.278  2.449   -4.211  1.00 0.00 ? 3  VAL A HB   2  
ATOM 823  H HG11 . VAL A 1 3  ? -2.027  2.490   -1.225  1.00 0.00 ? 3  VAL A HG11 2  
ATOM 824  H HG12 . VAL A 1 3  ? -0.734  2.672   -2.383  1.00 0.00 ? 3  VAL A HG12 2  
ATOM 825  H HG13 . VAL A 1 3  ? -1.990  3.882   -2.308  1.00 0.00 ? 3  VAL A HG13 2  
ATOM 826  H HG21 . VAL A 1 3  ? -2.449  0.126   -2.250  1.00 0.00 ? 3  VAL A HG21 2  
ATOM 827  H HG22 . VAL A 1 3  ? -2.754  0.028   -3.960  1.00 0.00 ? 3  VAL A HG22 2  
ATOM 828  H HG23 . VAL A 1 3  ? -1.149  0.443   -3.393  1.00 0.00 ? 3  VAL A HG23 2  
ATOM 829  N N    . GLU A 1 4  ? -4.365  2.357   -5.312  1.00 0.00 ? 4  GLU A N    2  
ATOM 830  C CA   . GLU A 1 4  ? -4.827  2.160   -6.716  1.00 0.00 ? 4  GLU A CA   2  
ATOM 831  C C    . GLU A 1 4  ? -5.662  3.348   -7.200  1.00 0.00 ? 4  GLU A C    2  
ATOM 832  O O    . GLU A 1 4  ? -5.534  3.753   -8.339  1.00 0.00 ? 4  GLU A O    2  
ATOM 833  C CB   . GLU A 1 4  ? -5.668  0.846   -6.892  1.00 0.00 ? 4  GLU A CB   2  
ATOM 834  C CG   . GLU A 1 4  ? -4.802  -0.287  -7.518  1.00 0.00 ? 4  GLU A CG   2  
ATOM 835  C CD   . GLU A 1 4  ? -3.677  -0.717  -6.553  1.00 0.00 ? 4  GLU A CD   2  
ATOM 836  O OE1  . GLU A 1 4  ? -4.020  -1.341  -5.563  1.00 0.00 ? 4  GLU A OE1  2  
ATOM 837  O OE2  . GLU A 1 4  ? -2.538  -0.397  -6.857  1.00 0.00 ? 4  GLU A OE2  2  
ATOM 838  H H    . GLU A 1 4  ? -3.594  2.953   -5.212  1.00 0.00 ? 4  GLU A H    2  
ATOM 839  H HA   . GLU A 1 4  ? -3.942  2.126   -7.321  1.00 0.00 ? 4  GLU A HA   2  
ATOM 840  H HB2  . GLU A 1 4  ? -6.150  0.450   -6.021  1.00 0.00 ? 4  GLU A HB2  2  
ATOM 841  H HB3  . GLU A 1 4  ? -6.445  1.120   -7.556  1.00 0.00 ? 4  GLU A HB3  2  
ATOM 842  H HG2  . GLU A 1 4  ? -5.424  -1.146  -7.719  1.00 0.00 ? 4  GLU A HG2  2  
ATOM 843  H HG3  . GLU A 1 4  ? -4.371  0.045   -8.454  1.00 0.00 ? 4  GLU A HG3  2  
ATOM 844  N N    . GLN A 1 5  ? -6.484  3.876   -6.324  1.00 0.00 ? 5  GLN A N    2  
ATOM 845  C CA   . GLN A 1 5  ? -7.348  5.048   -6.686  1.00 0.00 ? 5  GLN A CA   2  
ATOM 846  C C    . GLN A 1 5  ? -6.586  6.298   -6.219  1.00 0.00 ? 5  GLN A C    2  
ATOM 847  O O    . GLN A 1 5  ? -6.766  6.806   -5.129  1.00 0.00 ? 5  GLN A O    2  
ATOM 848  C CB   . GLN A 1 5  ? -8.712  4.948   -5.956  1.00 0.00 ? 5  GLN A CB   2  
ATOM 849  C CG   . GLN A 1 5  ? -9.601  6.164   -6.364  1.00 0.00 ? 5  GLN A CG   2  
ATOM 850  C CD   . GLN A 1 5  ? -10.811 6.291   -5.433  1.00 0.00 ? 5  GLN A CD   2  
ATOM 851  O OE1  . GLN A 1 5  ? -10.700 6.733   -4.307  1.00 0.00 ? 5  GLN A OE1  2  
ATOM 852  N NE2  . GLN A 1 5  ? -11.984 5.916   -5.862  1.00 0.00 ? 5  GLN A NE2  2  
ATOM 853  H H    . GLN A 1 5  ? -6.519  3.479   -5.433  1.00 0.00 ? 5  GLN A H    2  
ATOM 854  H HA   . GLN A 1 5  ? -7.488  5.089   -7.756  1.00 0.00 ? 5  GLN A HA   2  
ATOM 855  H HB2  . GLN A 1 5  ? -9.198  4.030   -6.256  1.00 0.00 ? 5  GLN A HB2  2  
ATOM 856  H HB3  . GLN A 1 5  ? -8.556  4.906   -4.896  1.00 0.00 ? 5  GLN A HB3  2  
ATOM 857  H HG2  . GLN A 1 5  ? -9.044  7.091   -6.328  1.00 0.00 ? 5  GLN A HG2  2  
ATOM 858  H HG3  . GLN A 1 5  ? -9.959  6.033   -7.373  1.00 0.00 ? 5  GLN A HG3  2  
ATOM 859  H HE21 . GLN A 1 5  ? -12.082 5.550   -6.766  1.00 0.00 ? 5  GLN A HE21 2  
ATOM 860  H HE22 . GLN A 1 5  ? -12.764 6.001   -5.277  1.00 0.00 ? 5  GLN A HE22 2  
ATOM 861  N N    . CYS A 1 6  ? -5.737  6.726   -7.116  1.00 0.00 ? 6  CYS A N    2  
ATOM 862  C CA   . CYS A 1 6  ? -4.858  7.920   -6.932  1.00 0.00 ? 6  CYS A CA   2  
ATOM 863  C C    . CYS A 1 6  ? -4.642  8.515   -5.515  1.00 0.00 ? 6  CYS A C    2  
ATOM 864  O O    . CYS A 1 6  ? -5.144  9.574   -5.183  1.00 0.00 ? 6  CYS A O    2  
ATOM 865  C CB   . CYS A 1 6  ? -5.380  9.031   -7.824  1.00 0.00 ? 6  CYS A CB   2  
ATOM 866  S SG   . CYS A 1 6  ? -5.384  8.867   -9.629  1.00 0.00 ? 6  CYS A SG   2  
ATOM 867  H H    . CYS A 1 6  ? -5.684  6.231   -7.958  1.00 0.00 ? 6  CYS A H    2  
ATOM 868  H HA   . CYS A 1 6  ? -3.894  7.628   -7.286  1.00 0.00 ? 6  CYS A HA   2  
ATOM 869  H HB2  . CYS A 1 6  ? -6.396  9.246   -7.525  1.00 0.00 ? 6  CYS A HB2  2  
ATOM 870  H HB3  . CYS A 1 6  ? -4.797  9.893   -7.562  1.00 0.00 ? 6  CYS A HB3  2  
ATOM 871  N N    . CYS A 1 7  ? -3.881  7.787   -4.734  1.00 0.00 ? 7  CYS A N    2  
ATOM 872  C CA   . CYS A 1 7  ? -3.532  8.170   -3.324  1.00 0.00 ? 7  CYS A CA   2  
ATOM 873  C C    . CYS A 1 7  ? -4.741  8.701   -2.574  1.00 0.00 ? 7  CYS A C    2  
ATOM 874  O O    . CYS A 1 7  ? -4.761  9.786   -2.023  1.00 0.00 ? 7  CYS A O    2  
ATOM 875  C CB   . CYS A 1 7  ? -2.432  9.240   -3.349  1.00 0.00 ? 7  CYS A CB   2  
ATOM 876  S SG   . CYS A 1 7  ? -1.664  9.622   -1.756  1.00 0.00 ? 7  CYS A SG   2  
ATOM 877  H H    . CYS A 1 7  ? -3.531  6.942   -5.074  1.00 0.00 ? 7  CYS A H    2  
ATOM 878  H HA   . CYS A 1 7  ? -3.191  7.289   -2.803  1.00 0.00 ? 7  CYS A HA   2  
ATOM 879  H HB2  . CYS A 1 7  ? -1.654  8.922   -4.025  1.00 0.00 ? 7  CYS A HB2  2  
ATOM 880  H HB3  . CYS A 1 7  ? -2.860  10.151  -3.739  1.00 0.00 ? 7  CYS A HB3  2  
ATOM 881  N N    . THR A 1 8  ? -5.709  7.831   -2.634  1.00 0.00 ? 8  THR A N    2  
ATOM 882  C CA   . THR A 1 8  ? -7.049  8.015   -1.998  1.00 0.00 ? 8  THR A CA   2  
ATOM 883  C C    . THR A 1 8  ? -7.071  9.062   -0.883  1.00 0.00 ? 8  THR A C    2  
ATOM 884  O O    . THR A 1 8  ? -7.781  10.045  -0.937  1.00 0.00 ? 8  THR A O    2  
ATOM 885  C CB   . THR A 1 8  ? -7.507  6.640   -1.451  1.00 0.00 ? 8  THR A CB   2  
ATOM 886  O OG1  . THR A 1 8  ? -6.469  6.186   -0.579  1.00 0.00 ? 8  THR A OG1  2  
ATOM 887  C CG2  . THR A 1 8  ? -7.555  5.619   -2.590  1.00 0.00 ? 8  THR A CG2  2  
ATOM 888  H H    . THR A 1 8  ? -5.523  7.013   -3.145  1.00 0.00 ? 8  THR A H    2  
ATOM 889  H HA   . THR A 1 8  ? -7.733  8.335   -2.773  1.00 0.00 ? 8  THR A HA   2  
ATOM 890  H HB   . THR A 1 8  ? -8.448  6.693   -0.921  1.00 0.00 ? 8  THR A HB   2  
ATOM 891  H HG1  . THR A 1 8  ? -6.196  5.297   -0.796  1.00 0.00 ? 8  THR A HG1  2  
ATOM 892  H HG21 . THR A 1 8  ? -8.249  5.981   -3.324  1.00 0.00 ? 8  THR A HG21 2  
ATOM 893  H HG22 . THR A 1 8  ? -6.589  5.466   -3.041  1.00 0.00 ? 8  THR A HG22 2  
ATOM 894  H HG23 . THR A 1 8  ? -7.912  4.669   -2.216  1.00 0.00 ? 8  THR A HG23 2  
ATOM 895  N N    . SER A 1 9  ? -6.255  8.769   0.093   1.00 0.00 ? 9  SER A N    2  
ATOM 896  C CA   . SER A 1 9  ? -6.115  9.641   1.280   1.00 0.00 ? 9  SER A CA   2  
ATOM 897  C C    . SER A 1 9  ? -4.679  10.157  1.481   1.00 0.00 ? 9  SER A C    2  
ATOM 898  O O    . SER A 1 9  ? -4.424  11.322  1.242   1.00 0.00 ? 9  SER A O    2  
ATOM 899  C CB   . SER A 1 9  ? -6.650  8.796   2.492   1.00 0.00 ? 9  SER A CB   2  
ATOM 900  O OG   . SER A 1 9  ? -5.920  7.573   2.478   1.00 0.00 ? 9  SER A OG   2  
ATOM 901  H H    . SER A 1 9  ? -5.721  7.952   0.026   1.00 0.00 ? 9  SER A H    2  
ATOM 902  H HA   . SER A 1 9  ? -6.743  10.495  1.174   1.00 0.00 ? 9  SER A HA   2  
ATOM 903  H HB2  . SER A 1 9  ? -6.546  9.294   3.448   1.00 0.00 ? 9  SER A HB2  2  
ATOM 904  H HB3  . SER A 1 9  ? -7.693  8.564   2.337   1.00 0.00 ? 9  SER A HB3  2  
ATOM 905  H HG   . SER A 1 9  ? -6.051  7.166   1.616   1.00 0.00 ? 9  SER A HG   2  
ATOM 906  N N    . ILE A 1 10 ? -3.783  9.301   1.898   1.00 0.00 ? 10 ILE A N    2  
ATOM 907  C CA   . ILE A 1 10 ? -2.354  9.733   2.128   1.00 0.00 ? 10 ILE A CA   2  
ATOM 908  C C    . ILE A 1 10 ? -1.272  8.755   1.594   1.00 0.00 ? 10 ILE A C    2  
ATOM 909  O O    . ILE A 1 10 ? -0.101  9.043   1.750   1.00 0.00 ? 10 ILE A O    2  
ATOM 910  C CB   . ILE A 1 10 ? -2.184  9.978   3.695   1.00 0.00 ? 10 ILE A CB   2  
ATOM 911  C CG1  . ILE A 1 10 ? -3.326  10.929  4.193   1.00 0.00 ? 10 ILE A CG1  2  
ATOM 912  C CG2  . ILE A 1 10 ? -0.813  10.644  4.044   1.00 0.00 ? 10 ILE A CG2  2  
ATOM 913  C CD1  . ILE A 1 10 ? -3.267  11.185  5.708   1.00 0.00 ? 10 ILE A CD1  2  
ATOM 914  H H    . ILE A 1 10 ? -4.089  8.389   2.047   1.00 0.00 ? 10 ILE A H    2  
ATOM 915  H HA   . ILE A 1 10 ? -2.190  10.678  1.622   1.00 0.00 ? 10 ILE A HA   2  
ATOM 916  H HB   . ILE A 1 10 ? -2.264  9.031   4.202   1.00 0.00 ? 10 ILE A HB   2  
ATOM 917  H HG12 . ILE A 1 10 ? -3.269  11.876  3.673   1.00 0.00 ? 10 ILE A HG12 2  
ATOM 918  H HG13 . ILE A 1 10 ? -4.286  10.489  3.976   1.00 0.00 ? 10 ILE A HG13 2  
ATOM 919  H HG21 . ILE A 1 10 ? -0.709  11.595  3.538   1.00 0.00 ? 10 ILE A HG21 2  
ATOM 920  H HG22 . ILE A 1 10 ? -0.752  10.824  5.103   1.00 0.00 ? 10 ILE A HG22 2  
ATOM 921  H HG23 . ILE A 1 10 ? 0.019   10.014  3.778   1.00 0.00 ? 10 ILE A HG23 2  
ATOM 922  H HD11 . ILE A 1 10 ? -3.354  10.258  6.258   1.00 0.00 ? 10 ILE A HD11 2  
ATOM 923  H HD12 . ILE A 1 10 ? -2.354  11.680  5.995   1.00 0.00 ? 10 ILE A HD12 2  
ATOM 924  H HD13 . ILE A 1 10 ? -4.088  11.830  5.972   1.00 0.00 ? 10 ILE A HD13 2  
ATOM 925  N N    . CYS A 1 11 ? -1.665  7.662   0.977   1.00 0.00 ? 11 CYS A N    2  
ATOM 926  C CA   . CYS A 1 11 ? -0.697  6.634   0.419   1.00 0.00 ? 11 CYS A CA   2  
ATOM 927  C C    . CYS A 1 11 ? 0.749   6.668   1.019   1.00 0.00 ? 11 CYS A C    2  
ATOM 928  O O    . CYS A 1 11 ? 1.665   7.198   0.414   1.00 0.00 ? 11 CYS A O    2  
ATOM 929  C CB   . CYS A 1 11 ? -0.630  6.833   -1.116  1.00 0.00 ? 11 CYS A CB   2  
ATOM 930  S SG   . CYS A 1 11 ? -0.035  8.428   -1.742  1.00 0.00 ? 11 CYS A SG   2  
ATOM 931  H H    . CYS A 1 11 ? -2.627  7.506   0.862   1.00 0.00 ? 11 CYS A H    2  
ATOM 932  H HA   . CYS A 1 11 ? -1.118  5.656   0.607   1.00 0.00 ? 11 CYS A HA   2  
ATOM 933  H HB2  . CYS A 1 11 ? 0.008   6.066   -1.538  1.00 0.00 ? 11 CYS A HB2  2  
ATOM 934  H HB3  . CYS A 1 11 ? -1.614  6.668   -1.518  1.00 0.00 ? 11 CYS A HB3  2  
ATOM 935  N N    . SER A 1 12 ? 0.905   6.093   2.191   1.00 0.00 ? 12 SER A N    2  
ATOM 936  C CA   . SER A 1 12 ? 2.222   6.038   2.901   1.00 0.00 ? 12 SER A CA   2  
ATOM 937  C C    . SER A 1 12 ? 2.916   4.687   2.662   1.00 0.00 ? 12 SER A C    2  
ATOM 938  O O    . SER A 1 12 ? 2.293   3.653   2.538   1.00 0.00 ? 12 SER A O    2  
ATOM 939  C CB   . SER A 1 12 ? 1.957   6.247   4.413   1.00 0.00 ? 12 SER A CB   2  
ATOM 940  O OG   . SER A 1 12 ? 1.226   5.093   4.821   1.00 0.00 ? 12 SER A OG   2  
ATOM 941  H H    . SER A 1 12 ? 0.151   5.682   2.646   1.00 0.00 ? 12 SER A H    2  
ATOM 942  H HA   . SER A 1 12 ? 2.854   6.832   2.530   1.00 0.00 ? 12 SER A HA   2  
ATOM 943  H HB2  . SER A 1 12 ? 2.850   6.319   5.018   1.00 0.00 ? 12 SER A HB2  2  
ATOM 944  H HB3  . SER A 1 12 ? 1.345   7.123   4.563   1.00 0.00 ? 12 SER A HB3  2  
ATOM 945  H HG   . SER A 1 12 ? 1.056   4.540   4.057   1.00 0.00 ? 12 SER A HG   2  
ATOM 946  N N    . LEU A 1 13 ? 4.209   4.787   2.603   1.00 0.00 ? 13 LEU A N    2  
ATOM 947  C CA   . LEU A 1 13 ? 5.119   3.618   2.380   1.00 0.00 ? 13 LEU A CA   2  
ATOM 948  C C    . LEU A 1 13 ? 4.825   2.334   3.154   1.00 0.00 ? 13 LEU A C    2  
ATOM 949  O O    . LEU A 1 13 ? 5.012   1.263   2.612   1.00 0.00 ? 13 LEU A O    2  
ATOM 950  C CB   . LEU A 1 13 ? 6.615   3.995   2.681   1.00 0.00 ? 13 LEU A CB   2  
ATOM 951  C CG   . LEU A 1 13 ? 6.939   5.519   2.594   1.00 0.00 ? 13 LEU A CG   2  
ATOM 952  C CD1  . LEU A 1 13 ? 6.612   6.206   3.947   1.00 0.00 ? 13 LEU A CD1  2  
ATOM 953  C CD2  . LEU A 1 13 ? 8.441   5.724   2.287   1.00 0.00 ? 13 LEU A CD2  2  
ATOM 954  H H    . LEU A 1 13 ? 4.569   5.684   2.709   1.00 0.00 ? 13 LEU A H    2  
ATOM 955  H HA   . LEU A 1 13 ? 5.022   3.355   1.346   1.00 0.00 ? 13 LEU A HA   2  
ATOM 956  H HB2  . LEU A 1 13 ? 6.921   3.600   3.634   1.00 0.00 ? 13 LEU A HB2  2  
ATOM 957  H HB3  . LEU A 1 13 ? 7.198   3.471   1.940   1.00 0.00 ? 13 LEU A HB3  2  
ATOM 958  H HG   . LEU A 1 13 ? 6.342   5.976   1.816   1.00 0.00 ? 13 LEU A HG   2  
ATOM 959  H HD11 . LEU A 1 13 ? 7.180   5.743   4.743   1.00 0.00 ? 13 LEU A HD11 2  
ATOM 960  H HD12 . LEU A 1 13 ? 6.890   7.248   3.887   1.00 0.00 ? 13 LEU A HD12 2  
ATOM 961  H HD13 . LEU A 1 13 ? 5.565   6.139   4.204   1.00 0.00 ? 13 LEU A HD13 2  
ATOM 962  H HD21 . LEU A 1 13 ? 9.036   5.270   3.064   1.00 0.00 ? 13 LEU A HD21 2  
ATOM 963  H HD22 . LEU A 1 13 ? 8.704   5.277   1.342   1.00 0.00 ? 13 LEU A HD22 2  
ATOM 964  H HD23 . LEU A 1 13 ? 8.675   6.776   2.235   1.00 0.00 ? 13 LEU A HD23 2  
ATOM 965  N N    . TYR A 1 14 ? 4.376   2.446   4.377   1.00 0.00 ? 14 TYR A N    2  
ATOM 966  C CA   . TYR A 1 14 ? 4.090   1.202   5.168   1.00 0.00 ? 14 TYR A CA   2  
ATOM 967  C C    . TYR A 1 14 ? 2.757   0.651   4.670   1.00 0.00 ? 14 TYR A C    2  
ATOM 968  O O    . TYR A 1 14 ? 2.545   -0.546  4.705   1.00 0.00 ? 14 TYR A O    2  
ATOM 969  C CB   . TYR A 1 14 ? 3.991   1.518   6.681   1.00 0.00 ? 14 TYR A CB   2  
ATOM 970  C CG   . TYR A 1 14 ? 4.145   0.213   7.487   1.00 0.00 ? 14 TYR A CG   2  
ATOM 971  C CD1  . TYR A 1 14 ? 5.400   -0.238  7.846   1.00 0.00 ? 14 TYR A CD1  2  
ATOM 972  C CD2  . TYR A 1 14 ? 3.037   -0.525  7.871   1.00 0.00 ? 14 TYR A CD2  2  
ATOM 973  C CE1  . TYR A 1 14 ? 5.546   -1.403  8.565   1.00 0.00 ? 14 TYR A CE1  2  
ATOM 974  C CE2  . TYR A 1 14 ? 3.182   -1.689  8.593   1.00 0.00 ? 14 TYR A CE2  2  
ATOM 975  C CZ   . TYR A 1 14 ? 4.443   -2.138  8.951   1.00 0.00 ? 14 TYR A CZ   2  
ATOM 976  O OH   . TYR A 1 14 ? 4.629   -3.302  9.670   1.00 0.00 ? 14 TYR A OH   2  
ATOM 977  H H    . TYR A 1 14 ? 4.222   3.335   4.751   1.00 0.00 ? 14 TYR A H    2  
ATOM 978  H HA   . TYR A 1 14 ? 4.867   0.473   4.979   1.00 0.00 ? 14 TYR A HA   2  
ATOM 979  H HB2  . TYR A 1 14 ? 4.782   2.194   6.964   1.00 0.00 ? 14 TYR A HB2  2  
ATOM 980  H HB3  . TYR A 1 14 ? 3.050   1.966   6.962   1.00 0.00 ? 14 TYR A HB3  2  
ATOM 981  H HD1  . TYR A 1 14 ? 6.278   0.317   7.553   1.00 0.00 ? 14 TYR A HD1  2  
ATOM 982  H HD2  . TYR A 1 14 ? 2.043   -0.199  7.606   1.00 0.00 ? 14 TYR A HD2  2  
ATOM 983  H HE1  . TYR A 1 14 ? 6.534   -1.744  8.839   1.00 0.00 ? 14 TYR A HE1  2  
ATOM 984  H HE2  . TYR A 1 14 ? 2.295   -2.242  8.877   1.00 0.00 ? 14 TYR A HE2  2  
ATOM 985  H HH   . TYR A 1 14 ? 3.867   -3.449  10.234  1.00 0.00 ? 14 TYR A HH   2  
ATOM 986  N N    . GLN A 1 15 ? 1.889   1.529   4.226   1.00 0.00 ? 15 GLN A N    2  
ATOM 987  C CA   . GLN A 1 15 ? 0.566   1.071   3.711   1.00 0.00 ? 15 GLN A CA   2  
ATOM 988  C C    . GLN A 1 15 ? 0.905   0.177   2.494   1.00 0.00 ? 15 GLN A C    2  
ATOM 989  O O    . GLN A 1 15 ? 0.190   -0.763  2.207   1.00 0.00 ? 15 GLN A O    2  
ATOM 990  C CB   . GLN A 1 15 ? -0.271  2.317   3.287   1.00 0.00 ? 15 GLN A CB   2  
ATOM 991  C CG   . GLN A 1 15 ? -1.746  1.972   3.032   1.00 0.00 ? 15 GLN A CG   2  
ATOM 992  C CD   . GLN A 1 15 ? -2.414  3.223   2.439   1.00 0.00 ? 15 GLN A CD   2  
ATOM 993  O OE1  . GLN A 1 15 ? -2.521  4.258   3.067   1.00 0.00 ? 15 GLN A OE1  2  
ATOM 994  N NE2  . GLN A 1 15 ? -2.867  3.161   1.217   1.00 0.00 ? 15 GLN A NE2  2  
ATOM 995  H H    . GLN A 1 15 ? 2.087   2.486   4.219   1.00 0.00 ? 15 GLN A H    2  
ATOM 996  H HA   . GLN A 1 15 ? 0.066   0.487   4.473   1.00 0.00 ? 15 GLN A HA   2  
ATOM 997  H HB2  . GLN A 1 15 ? -0.214  3.069   4.060   1.00 0.00 ? 15 GLN A HB2  2  
ATOM 998  H HB3  . GLN A 1 15 ? 0.085   2.735   2.360   1.00 0.00 ? 15 GLN A HB3  2  
ATOM 999  H HG2  . GLN A 1 15 ? -1.829  1.161   2.330   1.00 0.00 ? 15 GLN A HG2  2  
ATOM 1000 H HG3  . GLN A 1 15 ? -2.245  1.708   3.952   1.00 0.00 ? 15 GLN A HG3  2  
ATOM 1001 H HE21 . GLN A 1 15 ? -2.783  2.318   0.723   1.00 0.00 ? 15 GLN A HE21 2  
ATOM 1002 H HE22 . GLN A 1 15 ? -3.286  3.948   0.809   1.00 0.00 ? 15 GLN A HE22 2  
ATOM 1003 N N    . LEU A 1 16 ? 2.001   0.484   1.824   1.00 0.00 ? 16 LEU A N    2  
ATOM 1004 C CA   . LEU A 1 16 ? 2.397   -0.325  0.630   1.00 0.00 ? 16 LEU A CA   2  
ATOM 1005 C C    . LEU A 1 16 ? 3.000   -1.646  1.146   1.00 0.00 ? 16 LEU A C    2  
ATOM 1006 O O    . LEU A 1 16 ? 2.816   -2.690  0.550   1.00 0.00 ? 16 LEU A O    2  
ATOM 1007 C CB   . LEU A 1 16 ? 3.402   0.562   -0.215  1.00 0.00 ? 16 LEU A CB   2  
ATOM 1008 C CG   . LEU A 1 16 ? 3.590   0.031   -1.658  1.00 0.00 ? 16 LEU A CG   2  
ATOM 1009 C CD1  . LEU A 1 16 ? 2.272   0.167   -2.470  1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1010 C CD2  . LEU A 1 16 ? 4.661   0.891   -2.359  1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1011 H H    . LEU A 1 16 ? 2.581   1.240   2.096   1.00 0.00 ? 16 LEU A H    2  
ATOM 1012 H HA   . LEU A 1 16 ? 1.521   -0.557  0.050   1.00 0.00 ? 16 LEU A HA   2  
ATOM 1013 H HB2  . LEU A 1 16 ? 2.994   1.558   -0.274  1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1014 H HB3  . LEU A 1 16 ? 4.387   0.652   0.219   1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1015 H HG   . LEU A 1 16 ? 3.911   -1.000  -1.594  1.00 0.00 ? 16 LEU A HG   2  
ATOM 1016 H HD11 . LEU A 1 16 ? 1.948   1.200   -2.493  1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1017 H HD12 . LEU A 1 16 ? 2.417   -0.164  -3.488  1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1018 H HD13 . LEU A 1 16 ? 1.486   -0.428  -2.043  1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1019 H HD21 . LEU A 1 16 ? 5.592   0.873   -1.809  1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1020 H HD22 . LEU A 1 16 ? 4.846   0.515   -3.352  1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1021 H HD23 . LEU A 1 16 ? 4.323   1.915   -2.438  1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1022 N N    . GLU A 1 17 ? 3.684   -1.572  2.263   1.00 0.00 ? 17 GLU A N    2  
ATOM 1023 C CA   . GLU A 1 17 ? 4.305   -2.799  2.845   1.00 0.00 ? 17 GLU A CA   2  
ATOM 1024 C C    . GLU A 1 17 ? 3.233   -3.655  3.533   1.00 0.00 ? 17 GLU A C    2  
ATOM 1025 O O    . GLU A 1 17 ? 3.492   -4.809  3.835   1.00 0.00 ? 17 GLU A O    2  
ATOM 1026 C CB   . GLU A 1 17 ? 5.350   -2.420  3.894   1.00 0.00 ? 17 GLU A CB   2  
ATOM 1027 C CG   . GLU A 1 17 ? 6.490   -1.568  3.278   1.00 0.00 ? 17 GLU A CG   2  
ATOM 1028 C CD   . GLU A 1 17 ? 7.461   -1.046  4.367   1.00 0.00 ? 17 GLU A CD   2  
ATOM 1029 O OE1  . GLU A 1 17 ? 7.330   -1.435  5.519   1.00 0.00 ? 17 GLU A OE1  2  
ATOM 1030 O OE2  . GLU A 1 17 ? 8.305   -0.258  3.964   1.00 0.00 ? 17 GLU A OE2  2  
ATOM 1031 H H    . GLU A 1 17 ? 3.796   -0.718  2.727   1.00 0.00 ? 17 GLU A H    2  
ATOM 1032 H HA   . GLU A 1 17 ? 4.746   -3.378  2.051   1.00 0.00 ? 17 GLU A HA   2  
ATOM 1033 H HB2  . GLU A 1 17 ? 4.867   -1.865  4.689   1.00 0.00 ? 17 GLU A HB2  2  
ATOM 1034 H HB3  . GLU A 1 17 ? 5.775   -3.321  4.313   1.00 0.00 ? 17 GLU A HB3  2  
ATOM 1035 H HG2  . GLU A 1 17 ? 7.056   -2.165  2.578   1.00 0.00 ? 17 GLU A HG2  2  
ATOM 1036 H HG3  . GLU A 1 17 ? 6.077   -0.723  2.749   1.00 0.00 ? 17 GLU A HG3  2  
ATOM 1037 N N    . ASN A 1 18 ? 2.058   -3.099  3.765   1.00 0.00 ? 18 ASN A N    2  
ATOM 1038 C CA   . ASN A 1 18 ? 1.029   -3.953  4.442   1.00 0.00 ? 18 ASN A CA   2  
ATOM 1039 C C    . ASN A 1 18 ? 0.297   -4.814  3.404   1.00 0.00 ? 18 ASN A C    2  
ATOM 1040 O O    . ASN A 1 18 ? -0.736  -5.393  3.681   1.00 0.00 ? 18 ASN A O    2  
ATOM 1041 C CB   . ASN A 1 18 ? 0.013   -3.051  5.207   1.00 0.00 ? 18 ASN A CB   2  
ATOM 1042 C CG   . ASN A 1 18 ? -0.640  -3.895  6.312   1.00 0.00 ? 18 ASN A CG   2  
ATOM 1043 O OD1  . ASN A 1 18 ? 0.031   -4.385  7.201   1.00 0.00 ? 18 ASN A OD1  2  
ATOM 1044 N ND2  . ASN A 1 18 ? -1.926  -4.090  6.299   1.00 0.00 ? 18 ASN A ND2  2  
ATOM 1045 H H    . ASN A 1 18 ? 1.874   -2.176  3.499   1.00 0.00 ? 18 ASN A H    2  
ATOM 1046 H HA   . ASN A 1 18 ? 1.527   -4.595  5.145   1.00 0.00 ? 18 ASN A HA   2  
ATOM 1047 H HB2  . ASN A 1 18 ? 0.519   -2.215  5.662   1.00 0.00 ? 18 ASN A HB2  2  
ATOM 1048 H HB3  . ASN A 1 18 ? -0.753  -2.688  4.543   1.00 0.00 ? 18 ASN A HB3  2  
ATOM 1049 H HD21 . ASN A 1 18 ? -2.477  -3.703  5.588   1.00 0.00 ? 18 ASN A HD21 2  
ATOM 1050 H HD22 . ASN A 1 18 ? -2.342  -4.625  7.007   1.00 0.00 ? 18 ASN A HD22 2  
ATOM 1051 N N    . TYR A 1 19 ? 0.878   -4.871  2.230   1.00 0.00 ? 19 TYR A N    2  
ATOM 1052 C CA   . TYR A 1 19 ? 0.305   -5.675  1.108   1.00 0.00 ? 19 TYR A CA   2  
ATOM 1053 C C    . TYR A 1 19 ? 1.197   -6.916  0.914   1.00 0.00 ? 19 TYR A C    2  
ATOM 1054 O O    . TYR A 1 19 ? 0.955   -7.716  0.028   1.00 0.00 ? 19 TYR A O    2  
ATOM 1055 C CB   . TYR A 1 19 ? 0.312   -4.827  -0.173  1.00 0.00 ? 19 TYR A CB   2  
ATOM 1056 C CG   . TYR A 1 19 ? -0.457  -3.496  -0.030  1.00 0.00 ? 19 TYR A CG   2  
ATOM 1057 C CD1  . TYR A 1 19 ? -1.509  -3.324  0.857   1.00 0.00 ? 19 TYR A CD1  2  
ATOM 1058 C CD2  . TYR A 1 19 ? -0.101  -2.428  -0.832  1.00 0.00 ? 19 TYR A CD2  2  
ATOM 1059 C CE1  . TYR A 1 19 ? -2.170  -2.115  0.933   1.00 0.00 ? 19 TYR A CE1  2  
ATOM 1060 C CE2  . TYR A 1 19 ? -0.765  -1.225  -0.750  1.00 0.00 ? 19 TYR A CE2  2  
ATOM 1061 C CZ   . TYR A 1 19 ? -1.797  -1.057  0.126   1.00 0.00 ? 19 TYR A CZ   2  
ATOM 1062 O OH   . TYR A 1 19 ? -2.429  0.165   0.174   1.00 0.00 ? 19 TYR A OH   2  
ATOM 1063 H H    . TYR A 1 19 ? 1.707   -4.368  2.076   1.00 0.00 ? 19 TYR A H    2  
ATOM 1064 H HA   . TYR A 1 19 ? -0.694  -6.011  1.349   1.00 0.00 ? 19 TYR A HA   2  
ATOM 1065 H HB2  . TYR A 1 19 ? 1.335   -4.606  -0.444  1.00 0.00 ? 19 TYR A HB2  2  
ATOM 1066 H HB3  . TYR A 1 19 ? -0.145  -5.392  -0.973  1.00 0.00 ? 19 TYR A HB3  2  
ATOM 1067 H HD1  . TYR A 1 19 ? -1.824  -4.131  1.499   1.00 0.00 ? 19 TYR A HD1  2  
ATOM 1068 H HD2  . TYR A 1 19 ? 0.717   -2.532  -1.529  1.00 0.00 ? 19 TYR A HD2  2  
ATOM 1069 H HE1  . TYR A 1 19 ? -2.985  -2.007  1.634   1.00 0.00 ? 19 TYR A HE1  2  
ATOM 1070 H HE2  . TYR A 1 19 ? -0.478  -0.399  -1.385  1.00 0.00 ? 19 TYR A HE2  2  
ATOM 1071 H HH   . TYR A 1 19 ? -1.894  0.769   -0.346  1.00 0.00 ? 19 TYR A HH   2  
ATOM 1072 N N    . CYS A 1 20 ? 2.195   -7.033  1.764   1.00 0.00 ? 20 CYS A N    2  
ATOM 1073 C CA   . CYS A 1 20 ? 3.146   -8.174  1.698   1.00 0.00 ? 20 CYS A CA   2  
ATOM 1074 C C    . CYS A 1 20 ? 2.917   -9.094  2.913   1.00 0.00 ? 20 CYS A C    2  
ATOM 1075 O O    . CYS A 1 20 ? 3.100   -10.291 2.805   1.00 0.00 ? 20 CYS A O    2  
ATOM 1076 C CB   . CYS A 1 20 ? 4.552   -7.539  1.662   1.00 0.00 ? 20 CYS A CB   2  
ATOM 1077 S SG   . CYS A 1 20 ? 4.660   -6.014  0.688   1.00 0.00 ? 20 CYS A SG   2  
ATOM 1078 H H    . CYS A 1 20 ? 2.329   -6.365  2.466   1.00 0.00 ? 20 CYS A H    2  
ATOM 1079 H HA   . CYS A 1 20 ? 2.993   -8.735  0.788   1.00 0.00 ? 20 CYS A HA   2  
ATOM 1080 H HB2  . CYS A 1 20 ? 4.936   -7.305  2.640   1.00 0.00 ? 20 CYS A HB2  2  
ATOM 1081 H HB3  . CYS A 1 20 ? 5.235   -8.255  1.232   1.00 0.00 ? 20 CYS A HB3  2  
ATOM 1082 N N    . ASN A 1 21 ? 2.523   -8.513  4.027   1.00 0.00 ? 21 ASN A N    2  
ATOM 1083 C CA   . ASN A 1 21 ? 2.268   -9.304  5.267   1.00 0.00 ? 21 ASN A CA   2  
ATOM 1084 C C    . ASN A 1 21 ? 0.880   -8.948  5.814   1.00 0.00 ? 21 ASN A C    2  
ATOM 1085 O O    . ASN A 1 21 ? 0.618   -8.983  6.994   1.00 0.00 ? 21 ASN A O    2  
ATOM 1086 C CB   . ASN A 1 21 ? 3.369   -8.993  6.334   1.00 0.00 ? 21 ASN A CB   2  
ATOM 1087 C CG   . ASN A 1 21 ? 3.452   -7.513  6.763   1.00 0.00 ? 21 ASN A CG   2  
ATOM 1088 O OD1  . ASN A 1 21 ? 4.247   -7.160  7.615   1.00 0.00 ? 21 ASN A OD1  2  
ATOM 1089 N ND2  . ASN A 1 21 ? 2.677   -6.615  6.229   1.00 0.00 ? 21 ASN A ND2  2  
ATOM 1090 H H    . ASN A 1 21 ? 2.376   -7.545  4.058   1.00 0.00 ? 21 ASN A H    2  
ATOM 1091 H HA   . ASN A 1 21 ? 2.270   -10.358 5.032   1.00 0.00 ? 21 ASN A HA   2  
ATOM 1092 H HB2  . ASN A 1 21 ? 3.161   -9.587  7.213   1.00 0.00 ? 21 ASN A HB2  2  
ATOM 1093 H HB3  . ASN A 1 21 ? 4.333   -9.282  5.943   1.00 0.00 ? 21 ASN A HB3  2  
ATOM 1094 H HD21 . ASN A 1 21 ? 2.018   -6.855  5.544   1.00 0.00 ? 21 ASN A HD21 2  
ATOM 1095 H HD22 . ASN A 1 21 ? 2.763   -5.684  6.520   1.00 0.00 ? 21 ASN A HD22 2  
ATOM 1096 N N    . PHE B 2 1  ? 5.849   9.304   4.555   1.00 0.00 ? 1  PHE B N    2  
ATOM 1097 C CA   . PHE B 2 1  ? 4.854   10.404  4.481   1.00 0.00 ? 1  PHE B CA   2  
ATOM 1098 C C    . PHE B 2 1  ? 5.060   11.266  3.218   1.00 0.00 ? 1  PHE B C    2  
ATOM 1099 O O    . PHE B 2 1  ? 5.847   12.192  3.219   1.00 0.00 ? 1  PHE B O    2  
ATOM 1100 C CB   . PHE B 2 1  ? 4.980   11.285  5.762   1.00 0.00 ? 1  PHE B CB   2  
ATOM 1101 C CG   . PHE B 2 1  ? 4.095   12.538  5.631   1.00 0.00 ? 1  PHE B CG   2  
ATOM 1102 C CD1  . PHE B 2 1  ? 2.731   12.437  5.420   1.00 0.00 ? 1  PHE B CD1  2  
ATOM 1103 C CD2  . PHE B 2 1  ? 4.672   13.793  5.709   1.00 0.00 ? 1  PHE B CD2  2  
ATOM 1104 C CE1  . PHE B 2 1  ? 1.956   13.574  5.293   1.00 0.00 ? 1  PHE B CE1  2  
ATOM 1105 C CE2  . PHE B 2 1  ? 3.898   14.929  5.582   1.00 0.00 ? 1  PHE B CE2  2  
ATOM 1106 C CZ   . PHE B 2 1  ? 2.537   14.822  5.371   1.00 0.00 ? 1  PHE B CZ   2  
ATOM 1107 H H1   . PHE B 2 1  ? 6.460   9.351   3.716   1.00 0.00 ? 1  PHE B H1   2  
ATOM 1108 H H2   . PHE B 2 1  ? 6.432   9.410   5.411   1.00 0.00 ? 1  PHE B H2   2  
ATOM 1109 H H3   . PHE B 2 1  ? 5.359   8.387   4.583   1.00 0.00 ? 1  PHE B H3   2  
ATOM 1110 H HA   . PHE B 2 1  ? 3.870   9.963   4.455   1.00 0.00 ? 1  PHE B HA   2  
ATOM 1111 H HB2  . PHE B 2 1  ? 4.635   10.723  6.618   1.00 0.00 ? 1  PHE B HB2  2  
ATOM 1112 H HB3  . PHE B 2 1  ? 6.006   11.586  5.931   1.00 0.00 ? 1  PHE B HB3  2  
ATOM 1113 H HD1  . PHE B 2 1  ? 2.262   11.466  5.361   1.00 0.00 ? 1  PHE B HD1  2  
ATOM 1114 H HD2  . PHE B 2 1  ? 5.735   13.888  5.876   1.00 0.00 ? 1  PHE B HD2  2  
ATOM 1115 H HE1  . PHE B 2 1  ? 0.891   13.486  5.128   1.00 0.00 ? 1  PHE B HE1  2  
ATOM 1116 H HE2  . PHE B 2 1  ? 4.361   15.904  5.639   1.00 0.00 ? 1  PHE B HE2  2  
ATOM 1117 H HZ   . PHE B 2 1  ? 1.928   15.712  5.269   1.00 0.00 ? 1  PHE B HZ   2  
ATOM 1118 N N    . VAL B 2 2  ? 4.346   10.919  2.174   1.00 0.00 ? 2  VAL B N    2  
ATOM 1119 C CA   . VAL B 2 2  ? 4.445   11.676  0.884   1.00 0.00 ? 2  VAL B CA   2  
ATOM 1120 C C    . VAL B 2 2  ? 3.056   12.242  0.528   1.00 0.00 ? 2  VAL B C    2  
ATOM 1121 O O    . VAL B 2 2  ? 2.045   11.750  0.999   1.00 0.00 ? 2  VAL B O    2  
ATOM 1122 C CB   . VAL B 2 2  ? 4.948   10.728  -0.243  1.00 0.00 ? 2  VAL B CB   2  
ATOM 1123 C CG1  . VAL B 2 2  ? 6.385   10.264  0.101   1.00 0.00 ? 2  VAL B CG1  2  
ATOM 1124 C CG2  . VAL B 2 2  ? 4.025   9.494   -0.396  1.00 0.00 ? 2  VAL B CG2  2  
ATOM 1125 H H    . VAL B 2 2  ? 3.741   10.153  2.237   1.00 0.00 ? 2  VAL B H    2  
ATOM 1126 H HA   . VAL B 2 2  ? 5.134   12.505  0.994   1.00 0.00 ? 2  VAL B HA   2  
ATOM 1127 H HB   . VAL B 2 2  ? 4.976   11.274  -1.173  1.00 0.00 ? 2  VAL B HB   2  
ATOM 1128 H HG11 . VAL B 2 2  ? 6.408   9.738   1.046   1.00 0.00 ? 2  VAL B HG11 2  
ATOM 1129 H HG12 . VAL B 2 2  ? 6.764   9.613   -0.673  1.00 0.00 ? 2  VAL B HG12 2  
ATOM 1130 H HG13 . VAL B 2 2  ? 7.035   11.127  0.171   1.00 0.00 ? 2  VAL B HG13 2  
ATOM 1131 H HG21 . VAL B 2 2  ? 3.977   8.935   0.526   1.00 0.00 ? 2  VAL B HG21 2  
ATOM 1132 H HG22 . VAL B 2 2  ? 3.029   9.808   -0.664  1.00 0.00 ? 2  VAL B HG22 2  
ATOM 1133 H HG23 . VAL B 2 2  ? 4.388   8.843   -1.177  1.00 0.00 ? 2  VAL B HG23 2  
ATOM 1134 N N    . ASN B 2 3  ? 3.058   13.263  -0.294  1.00 0.00 ? 3  ASN B N    2  
ATOM 1135 C CA   . ASN B 2 3  ? 1.779   13.916  -0.729  1.00 0.00 ? 3  ASN B CA   2  
ATOM 1136 C C    . ASN B 2 3  ? 1.893   14.198  -2.248  1.00 0.00 ? 3  ASN B C    2  
ATOM 1137 O O    . ASN B 2 3  ? 1.512   15.245  -2.738  1.00 0.00 ? 3  ASN B O    2  
ATOM 1138 C CB   . ASN B 2 3  ? 1.657   15.184  0.148   1.00 0.00 ? 3  ASN B CB   2  
ATOM 1139 C CG   . ASN B 2 3  ? 0.285   15.881  0.092   1.00 0.00 ? 3  ASN B CG   2  
ATOM 1140 O OD1  . ASN B 2 3  ? 0.075   16.872  0.763   1.00 0.00 ? 3  ASN B OD1  2  
ATOM 1141 N ND2  . ASN B 2 3  ? -0.677  15.434  -0.666  1.00 0.00 ? 3  ASN B ND2  2  
ATOM 1142 H H    . ASN B 2 3  ? 3.917   13.605  -0.632  1.00 0.00 ? 3  ASN B H    2  
ATOM 1143 H HA   . ASN B 2 3  ? 0.943   13.243  -0.562  1.00 0.00 ? 3  ASN B HA   2  
ATOM 1144 H HB2  . ASN B 2 3  ? 1.833   14.895  1.176   1.00 0.00 ? 3  ASN B HB2  2  
ATOM 1145 H HB3  . ASN B 2 3  ? 2.416   15.893  -0.137  1.00 0.00 ? 3  ASN B HB3  2  
ATOM 1146 H HD21 . ASN B 2 3  ? -0.543  14.643  -1.225  1.00 0.00 ? 3  ASN B HD21 2  
ATOM 1147 H HD22 . ASN B 2 3  ? -1.545  15.893  -0.672  1.00 0.00 ? 3  ASN B HD22 2  
ATOM 1148 N N    . GLN B 2 4  ? 2.420   13.212  -2.934  1.00 0.00 ? 4  GLN B N    2  
ATOM 1149 C CA   . GLN B 2 4  ? 2.636   13.258  -4.422  1.00 0.00 ? 4  GLN B CA   2  
ATOM 1150 C C    . GLN B 2 4  ? 1.543   12.380  -5.116  1.00 0.00 ? 4  GLN B C    2  
ATOM 1151 O O    . GLN B 2 4  ? 1.881   11.568  -5.947  1.00 0.00 ? 4  GLN B O    2  
ATOM 1152 C CB   . GLN B 2 4  ? 4.105   12.740  -4.644  1.00 0.00 ? 4  GLN B CB   2  
ATOM 1153 C CG   . GLN B 2 4  ? 4.512   12.482  -6.129  1.00 0.00 ? 4  GLN B CG   2  
ATOM 1154 C CD   . GLN B 2 4  ? 5.984   12.039  -6.176  1.00 0.00 ? 4  GLN B CD   2  
ATOM 1155 O OE1  . GLN B 2 4  ? 6.390   11.127  -5.477  1.00 0.00 ? 4  GLN B OE1  2  
ATOM 1156 N NE2  . GLN B 2 4  ? 6.816   12.639  -6.979  1.00 0.00 ? 4  GLN B NE2  2  
ATOM 1157 H H    . GLN B 2 4  ? 2.691   12.406  -2.446  1.00 0.00 ? 4  GLN B H    2  
ATOM 1158 H HA   . GLN B 2 4  ? 2.617   14.283  -4.792  1.00 0.00 ? 4  GLN B HA   2  
ATOM 1159 H HB2  . GLN B 2 4  ? 4.773   13.504  -4.267  1.00 0.00 ? 4  GLN B HB2  2  
ATOM 1160 H HB3  . GLN B 2 4  ? 4.272   11.840  -4.066  1.00 0.00 ? 4  GLN B HB3  2  
ATOM 1161 H HG2  . GLN B 2 4  ? 3.949   11.680  -6.575  1.00 0.00 ? 4  GLN B HG2  2  
ATOM 1162 H HG3  . GLN B 2 4  ? 4.380   13.365  -6.731  1.00 0.00 ? 4  GLN B HG3  2  
ATOM 1163 H HE21 . GLN B 2 4  ? 6.516   13.368  -7.558  1.00 0.00 ? 4  GLN B HE21 2  
ATOM 1164 H HE22 . GLN B 2 4  ? 7.755   12.353  -7.005  1.00 0.00 ? 4  GLN B HE22 2  
ATOM 1165 N N    . HIS B 2 5  ? 0.276   12.562  -4.772  1.00 0.00 ? 5  HIS B N    2  
ATOM 1166 C CA   . HIS B 2 5  ? -0.896  11.811  -5.330  1.00 0.00 ? 5  HIS B CA   2  
ATOM 1167 C C    . HIS B 2 5  ? -0.625  11.061  -6.616  1.00 0.00 ? 5  HIS B C    2  
ATOM 1168 O O    . HIS B 2 5  ? -0.943  11.451  -7.722  1.00 0.00 ? 5  HIS B O    2  
ATOM 1169 C CB   . HIS B 2 5  ? -2.080  12.799  -5.570  1.00 0.00 ? 5  HIS B CB   2  
ATOM 1170 C CG   . HIS B 2 5  ? -2.633  13.350  -4.244  1.00 0.00 ? 5  HIS B CG   2  
ATOM 1171 N ND1  . HIS B 2 5  ? -3.846  13.768  -4.100  1.00 0.00 ? 5  HIS B ND1  2  
ATOM 1172 C CD2  . HIS B 2 5  ? -2.059  13.538  -2.994  1.00 0.00 ? 5  HIS B CD2  2  
ATOM 1173 C CE1  . HIS B 2 5  ? -4.024  14.179  -2.882  1.00 0.00 ? 5  HIS B CE1  2  
ATOM 1174 N NE2  . HIS B 2 5  ? -2.939  14.051  -2.160  1.00 0.00 ? 5  HIS B NE2  2  
ATOM 1175 H H    . HIS B 2 5  ? 0.039   13.200  -4.093  1.00 0.00 ? 5  HIS B H    2  
ATOM 1176 H HA   . HIS B 2 5  ? -1.199  11.089  -4.594  1.00 0.00 ? 5  HIS B HA   2  
ATOM 1177 H HB2  . HIS B 2 5  ? -1.771  13.631  -6.192  1.00 0.00 ? 5  HIS B HB2  2  
ATOM 1178 H HB3  . HIS B 2 5  ? -2.879  12.278  -6.081  1.00 0.00 ? 5  HIS B HB3  2  
ATOM 1179 H HD1  . HIS B 2 5  ? -4.523  13.767  -4.808  1.00 0.00 ? 5  HIS B HD1  2  
ATOM 1180 H HD2  . HIS B 2 5  ? -1.042  13.300  -2.727  1.00 0.00 ? 5  HIS B HD2  2  
ATOM 1181 H HE1  . HIS B 2 5  ? -4.953  14.574  -2.497  1.00 0.00 ? 5  HIS B HE1  2  
ATOM 1182 N N    . LEU B 2 6  ? -0.010  9.953   -6.325  1.00 0.00 ? 6  LEU B N    2  
ATOM 1183 C CA   . LEU B 2 6  ? 0.404   8.970   -7.381  1.00 0.00 ? 6  LEU B CA   2  
ATOM 1184 C C    . LEU B 2 6  ? -0.860  8.223   -7.823  1.00 0.00 ? 6  LEU B C    2  
ATOM 1185 O O    . LEU B 2 6  ? -1.715  7.970   -6.995  1.00 0.00 ? 6  LEU B O    2  
ATOM 1186 C CB   . LEU B 2 6  ? 1.409   7.921   -6.809  1.00 0.00 ? 6  LEU B CB   2  
ATOM 1187 C CG   . LEU B 2 6  ? 2.636   8.568   -6.122  1.00 0.00 ? 6  LEU B CG   2  
ATOM 1188 C CD1  . LEU B 2 6  ? 2.374   8.719   -4.602  1.00 0.00 ? 6  LEU B CD1  2  
ATOM 1189 C CD2  . LEU B 2 6  ? 3.874   7.662   -6.301  1.00 0.00 ? 6  LEU B CD2  2  
ATOM 1190 H H    . LEU B 2 6  ? 0.159   9.836   -5.364  1.00 0.00 ? 6  LEU B H    2  
ATOM 1191 H HA   . LEU B 2 6  ? 0.832   9.499   -8.225  1.00 0.00 ? 6  LEU B HA   2  
ATOM 1192 H HB2  . LEU B 2 6  ? 0.911   7.294   -6.082  1.00 0.00 ? 6  LEU B HB2  2  
ATOM 1193 H HB3  . LEU B 2 6  ? 1.739   7.284   -7.613  1.00 0.00 ? 6  LEU B HB3  2  
ATOM 1194 H HG   . LEU B 2 6  ? 2.829   9.524   -6.579  1.00 0.00 ? 6  LEU B HG   2  
ATOM 1195 H HD11 . LEU B 2 6  ? 1.513   9.337   -4.396  1.00 0.00 ? 6  LEU B HD11 2  
ATOM 1196 H HD12 . LEU B 2 6  ? 2.203   7.747   -4.162  1.00 0.00 ? 6  LEU B HD12 2  
ATOM 1197 H HD13 . LEU B 2 6  ? 3.234   9.166   -4.130  1.00 0.00 ? 6  LEU B HD13 2  
ATOM 1198 H HD21 . LEU B 2 6  ? 4.083   7.514   -7.353  1.00 0.00 ? 6  LEU B HD21 2  
ATOM 1199 H HD22 . LEU B 2 6  ? 4.730   8.137   -5.847  1.00 0.00 ? 6  LEU B HD22 2  
ATOM 1200 H HD23 . LEU B 2 6  ? 3.710   6.700   -5.836  1.00 0.00 ? 6  LEU B HD23 2  
ATOM 1201 N N    . CYS B 2 7  ? -0.948  7.883   -9.090  1.00 0.00 ? 7  CYS B N    2  
ATOM 1202 C CA   . CYS B 2 7  ? -2.160  7.157   -9.581  1.00 0.00 ? 7  CYS B CA   2  
ATOM 1203 C C    . CYS B 2 7  ? -1.907  5.702   -9.991  1.00 0.00 ? 7  CYS B C    2  
ATOM 1204 O O    . CYS B 2 7  ? -0.905  5.351   -10.584 1.00 0.00 ? 7  CYS B O    2  
ATOM 1205 C CB   . CYS B 2 7  ? -2.741  7.976   -10.759 1.00 0.00 ? 7  CYS B CB   2  
ATOM 1206 S SG   . CYS B 2 7  ? -3.575  9.508   -10.269 1.00 0.00 ? 7  CYS B SG   2  
ATOM 1207 H H    . CYS B 2 7  ? -0.227  8.097   -9.717  1.00 0.00 ? 7  CYS B H    2  
ATOM 1208 H HA   . CYS B 2 7  ? -2.910  7.153   -8.813  1.00 0.00 ? 7  CYS B HA   2  
ATOM 1209 H HB2  . CYS B 2 7  ? -1.940  8.238   -11.435 1.00 0.00 ? 7  CYS B HB2  2  
ATOM 1210 H HB3  . CYS B 2 7  ? -3.455  7.392   -11.325 1.00 0.00 ? 7  CYS B HB3  2  
ATOM 1211 N N    . GLY B 2 8  ? -2.894  4.922   -9.621  1.00 0.00 ? 8  GLY B N    2  
ATOM 1212 C CA   . GLY B 2 8  ? -2.982  3.441   -9.843  1.00 0.00 ? 8  GLY B CA   2  
ATOM 1213 C C    . GLY B 2 8  ? -1.838  2.694   -10.575 1.00 0.00 ? 8  GLY B C    2  
ATOM 1214 O O    . GLY B 2 8  ? -1.250  1.823   -9.968  1.00 0.00 ? 8  GLY B O    2  
ATOM 1215 H H    . GLY B 2 8  ? -3.644  5.341   -9.151  1.00 0.00 ? 8  GLY B H    2  
ATOM 1216 H HA2  . GLY B 2 8  ? -2.978  3.032   -8.848  1.00 0.00 ? 8  GLY B HA2  2  
ATOM 1217 H HA3  . GLY B 2 8  ? -3.954  3.186   -10.253 1.00 0.00 ? 8  GLY B HA3  2  
ATOM 1218 N N    . SER B 2 9  ? -1.525  3.015   -11.810 1.00 0.00 ? 9  SER B N    2  
ATOM 1219 C CA   . SER B 2 9  ? -0.423  2.297   -12.538 1.00 0.00 ? 9  SER B CA   2  
ATOM 1220 C C    . SER B 2 9  ? 0.944   2.182   -11.839 1.00 0.00 ? 9  SER B C    2  
ATOM 1221 O O    . SER B 2 9  ? 1.668   1.227   -12.042 1.00 0.00 ? 9  SER B O    2  
ATOM 1222 C CB   . SER B 2 9  ? -0.232  2.990   -13.903 1.00 0.00 ? 9  SER B CB   2  
ATOM 1223 O OG   . SER B 2 9  ? -1.451  2.714   -14.579 1.00 0.00 ? 9  SER B OG   2  
ATOM 1224 H H    . SER B 2 9  ? -1.988  3.731   -12.298 1.00 0.00 ? 9  SER B H    2  
ATOM 1225 H HA   . SER B 2 9  ? -0.758  1.289   -12.714 1.00 0.00 ? 9  SER B HA   2  
ATOM 1226 H HB2  . SER B 2 9  ? -0.121  4.063   -13.809 1.00 0.00 ? 9  SER B HB2  2  
ATOM 1227 H HB3  . SER B 2 9  ? 0.594   2.582   -14.471 1.00 0.00 ? 9  SER B HB3  2  
ATOM 1228 H HG   . SER B 2 9  ? -1.910  3.543   -14.733 1.00 0.00 ? 9  SER B HG   2  
ATOM 1229 N N    . HIS B 2 10 ? 1.254   3.148   -11.023 1.00 0.00 ? 10 HIS B N    2  
ATOM 1230 C CA   . HIS B 2 10 ? 2.550   3.170   -10.287 1.00 0.00 ? 10 HIS B CA   2  
ATOM 1231 C C    . HIS B 2 10 ? 2.346   2.590   -8.902  1.00 0.00 ? 10 HIS B C    2  
ATOM 1232 O O    . HIS B 2 10 ? 3.292   2.114   -8.307  1.00 0.00 ? 10 HIS B O    2  
ATOM 1233 C CB   . HIS B 2 10 ? 3.029   4.630   -10.263 1.00 0.00 ? 10 HIS B CB   2  
ATOM 1234 C CG   . HIS B 2 10 ? 3.044   5.063   -11.743 1.00 0.00 ? 10 HIS B CG   2  
ATOM 1235 N ND1  . HIS B 2 10 ? 1.968   5.268   -12.438 1.00 0.00 ? 10 HIS B ND1  2  
ATOM 1236 C CD2  . HIS B 2 10 ? 4.078   5.312   -12.637 1.00 0.00 ? 10 HIS B CD2  2  
ATOM 1237 C CE1  . HIS B 2 10 ? 2.278   5.604   -13.650 1.00 0.00 ? 10 HIS B CE1  2  
ATOM 1238 N NE2  . HIS B 2 10 ? 3.579   5.641   -13.819 1.00 0.00 ? 10 HIS B NE2  2  
ATOM 1239 H H    . HIS B 2 10 ? 0.619   3.865   -10.896 1.00 0.00 ? 10 HIS B H    2  
ATOM 1240 H HA   . HIS B 2 10 ? 3.279   2.571   -10.804 1.00 0.00 ? 10 HIS B HA   2  
ATOM 1241 H HB2  . HIS B 2 10 ? 2.353   5.257   -9.702  1.00 0.00 ? 10 HIS B HB2  2  
ATOM 1242 H HB3  . HIS B 2 10 ? 4.027   4.697   -9.851  1.00 0.00 ? 10 HIS B HB3  2  
ATOM 1243 H HD1  . HIS B 2 10 ? 1.061   5.175   -12.080 1.00 0.00 ? 10 HIS B HD1  2  
ATOM 1244 H HD2  . HIS B 2 10 ? 5.133   5.239   -12.413 1.00 0.00 ? 10 HIS B HD2  2  
ATOM 1245 H HE1  . HIS B 2 10 ? 1.563   5.824   -14.430 1.00 0.00 ? 10 HIS B HE1  2  
ATOM 1246 N N    . LEU B 2 11 ? 1.124   2.624   -8.425  1.00 0.00 ? 11 LEU B N    2  
ATOM 1247 C CA   . LEU B 2 11 ? 0.859   2.050   -7.070  1.00 0.00 ? 11 LEU B CA   2  
ATOM 1248 C C    . LEU B 2 11 ? 0.813   0.540   -7.330  1.00 0.00 ? 11 LEU B C    2  
ATOM 1249 O O    . LEU B 2 11 ? 1.089   -0.235  -6.438  1.00 0.00 ? 11 LEU B O    2  
ATOM 1250 C CB   . LEU B 2 11 ? -0.514  2.489   -6.488  1.00 0.00 ? 11 LEU B CB   2  
ATOM 1251 C CG   . LEU B 2 11 ? -0.563  3.990   -6.076  1.00 0.00 ? 11 LEU B CG   2  
ATOM 1252 C CD1  . LEU B 2 11 ? 0.472   4.331   -4.976  1.00 0.00 ? 11 LEU B CD1  2  
ATOM 1253 C CD2  . LEU B 2 11 ? -0.343  4.883   -7.285  1.00 0.00 ? 11 LEU B CD2  2  
ATOM 1254 H H    . LEU B 2 11 ? 0.389   3.017   -8.945  1.00 0.00 ? 11 LEU B H    2  
ATOM 1255 H HA   . LEU B 2 11 ? 1.671   2.273   -6.393  1.00 0.00 ? 11 LEU B HA   2  
ATOM 1256 H HB2  . LEU B 2 11 ? -1.308  2.304   -7.197  1.00 0.00 ? 11 LEU B HB2  2  
ATOM 1257 H HB3  . LEU B 2 11 ? -0.709  1.875   -5.620  1.00 0.00 ? 11 LEU B HB3  2  
ATOM 1258 H HG   . LEU B 2 11 ? -1.547  4.204   -5.683  1.00 0.00 ? 11 LEU B HG   2  
ATOM 1259 H HD11 . LEU B 2 11 ? 0.278   3.745   -4.089  1.00 0.00 ? 11 LEU B HD11 2  
ATOM 1260 H HD12 . LEU B 2 11 ? 1.487   4.145   -5.305  1.00 0.00 ? 11 LEU B HD12 2  
ATOM 1261 H HD13 . LEU B 2 11 ? 0.384   5.375   -4.717  1.00 0.00 ? 11 LEU B HD13 2  
ATOM 1262 H HD21 . LEU B 2 11 ? -1.094  4.652   -8.020  1.00 0.00 ? 11 LEU B HD21 2  
ATOM 1263 H HD22 . LEU B 2 11 ? -0.444  5.907   -6.978  1.00 0.00 ? 11 LEU B HD22 2  
ATOM 1264 H HD23 . LEU B 2 11 ? 0.630   4.756   -7.722  1.00 0.00 ? 11 LEU B HD23 2  
ATOM 1265 N N    . VAL B 2 12 ? 0.481   0.159   -8.544  1.00 0.00 ? 12 VAL B N    2  
ATOM 1266 C CA   . VAL B 2 12 ? 0.417   -1.282  -8.878  1.00 0.00 ? 12 VAL B CA   2  
ATOM 1267 C C    . VAL B 2 12 ? 1.829   -1.752  -9.195  1.00 0.00 ? 12 VAL B C    2  
ATOM 1268 O O    . VAL B 2 12 ? 2.207   -2.777  -8.659  1.00 0.00 ? 12 VAL B O    2  
ATOM 1269 C CB   . VAL B 2 12 ? -0.571  -1.486  -10.088 1.00 0.00 ? 12 VAL B CB   2  
ATOM 1270 C CG1  . VAL B 2 12 ? 0.066   -1.830  -11.466 1.00 0.00 ? 12 VAL B CG1  2  
ATOM 1271 C CG2  . VAL B 2 12 ? -1.528  -2.632  -9.718  1.00 0.00 ? 12 VAL B CG2  2  
ATOM 1272 H H    . VAL B 2 12 ? 0.272   0.817   -9.236  1.00 0.00 ? 12 VAL B H    2  
ATOM 1273 H HA   . VAL B 2 12 ? 0.034   -1.834  -8.042  1.00 0.00 ? 12 VAL B HA   2  
ATOM 1274 H HB   . VAL B 2 12 ? -1.138  -0.574  -10.205 1.00 0.00 ? 12 VAL B HB   2  
ATOM 1275 H HG11 . VAL B 2 12 ? 0.637   -2.743  -11.395 1.00 0.00 ? 12 VAL B HG11 2  
ATOM 1276 H HG12 . VAL B 2 12 ? -0.708  -1.972  -12.207 1.00 0.00 ? 12 VAL B HG12 2  
ATOM 1277 H HG13 . VAL B 2 12 ? 0.718   -1.036  -11.792 1.00 0.00 ? 12 VAL B HG13 2  
ATOM 1278 H HG21 . VAL B 2 12 ? -0.963  -3.533  -9.529  1.00 0.00 ? 12 VAL B HG21 2  
ATOM 1279 H HG22 . VAL B 2 12 ? -2.085  -2.376  -8.827  1.00 0.00 ? 12 VAL B HG22 2  
ATOM 1280 H HG23 . VAL B 2 12 ? -2.219  -2.805  -10.532 1.00 0.00 ? 12 VAL B HG23 2  
ATOM 1281 N N    . GLU B 2 13 ? 2.578   -1.030  -10.010 1.00 0.00 ? 13 GLU B N    2  
ATOM 1282 C CA   . GLU B 2 13 ? 3.969   -1.520  -10.308 1.00 0.00 ? 13 GLU B CA   2  
ATOM 1283 C C    . GLU B 2 13 ? 4.737   -1.614  -8.952  1.00 0.00 ? 13 GLU B C    2  
ATOM 1284 O O    . GLU B 2 13 ? 5.520   -2.517  -8.697  1.00 0.00 ? 13 GLU B O    2  
ATOM 1285 C CB   . GLU B 2 13 ? 4.720   -0.532  -11.291 1.00 0.00 ? 13 GLU B CB   2  
ATOM 1286 C CG   . GLU B 2 13 ? 5.748   -1.324  -12.176 1.00 0.00 ? 13 GLU B CG   2  
ATOM 1287 C CD   . GLU B 2 13 ? 6.698   -2.184  -11.320 1.00 0.00 ? 13 GLU B CD   2  
ATOM 1288 O OE1  . GLU B 2 13 ? 7.533   -1.584  -10.661 1.00 0.00 ? 13 GLU B OE1  2  
ATOM 1289 O OE2  . GLU B 2 13 ? 6.529   -3.394  -11.371 1.00 0.00 ? 13 GLU B OE2  2  
ATOM 1290 H H    . GLU B 2 13 ? 2.246   -0.187  -10.409 1.00 0.00 ? 13 GLU B H    2  
ATOM 1291 H HA   . GLU B 2 13 ? 3.906   -2.470  -10.802 1.00 0.00 ? 13 GLU B HA   2  
ATOM 1292 H HB2  . GLU B 2 13 ? 4.004   -0.068  -11.951 1.00 0.00 ? 13 GLU B HB2  2  
ATOM 1293 H HB3  . GLU B 2 13 ? 5.280   0.241   -10.787 1.00 0.00 ? 13 GLU B HB3  2  
ATOM 1294 H HG2  . GLU B 2 13 ? 5.226   -1.962  -12.874 1.00 0.00 ? 13 GLU B HG2  2  
ATOM 1295 H HG3  . GLU B 2 13 ? 6.358   -0.640  -12.751 1.00 0.00 ? 13 GLU B HG3  2  
ATOM 1296 N N    . ALA B 2 14 ? 4.439   -0.660  -8.097  1.00 0.00 ? 14 ALA B N    2  
ATOM 1297 C CA   . ALA B 2 14 ? 5.099   -0.597  -6.771  1.00 0.00 ? 14 ALA B CA   2  
ATOM 1298 C C    . ALA B 2 14 ? 4.643   -1.698  -5.827  1.00 0.00 ? 14 ALA B C    2  
ATOM 1299 O O    . ALA B 2 14 ? 5.490   -2.369  -5.293  1.00 0.00 ? 14 ALA B O    2  
ATOM 1300 C CB   . ALA B 2 14 ? 4.816   0.788   -6.193  1.00 0.00 ? 14 ALA B CB   2  
ATOM 1301 H H    . ALA B 2 14 ? 3.762   0.023   -8.290  1.00 0.00 ? 14 ALA B H    2  
ATOM 1302 H HA   . ALA B 2 14 ? 6.165   -0.697  -6.916  1.00 0.00 ? 14 ALA B HA   2  
ATOM 1303 H HB1  . ALA B 2 14 ? 5.208   1.537   -6.864  1.00 0.00 ? 14 ALA B HB1  2  
ATOM 1304 H HB2  . ALA B 2 14 ? 3.752   0.940   -6.072  1.00 0.00 ? 14 ALA B HB2  2  
ATOM 1305 H HB3  . ALA B 2 14 ? 5.305   0.908   -5.245  1.00 0.00 ? 14 ALA B HB3  2  
ATOM 1306 N N    . LEU B 2 15 ? 3.365   -1.889  -5.632  1.00 0.00 ? 15 LEU B N    2  
ATOM 1307 C CA   . LEU B 2 15 ? 2.943   -2.984  -4.691  1.00 0.00 ? 15 LEU B CA   2  
ATOM 1308 C C    . LEU B 2 15 ? 3.383   -4.357  -5.207  1.00 0.00 ? 15 LEU B C    2  
ATOM 1309 O O    . LEU B 2 15 ? 3.854   -5.174  -4.432  1.00 0.00 ? 15 LEU B O    2  
ATOM 1310 C CB   . LEU B 2 15 ? 1.357   -2.842  -4.486  1.00 0.00 ? 15 LEU B CB   2  
ATOM 1311 C CG   . LEU B 2 15 ? 0.572   -4.041  -3.850  1.00 0.00 ? 15 LEU B CG   2  
ATOM 1312 C CD1  . LEU B 2 15 ? -0.917  -3.599  -3.707  1.00 0.00 ? 15 LEU B CD1  2  
ATOM 1313 C CD2  . LEU B 2 15 ? 0.523   -5.297  -4.745  1.00 0.00 ? 15 LEU B CD2  2  
ATOM 1314 H H    . LEU B 2 15 ? 2.710   -1.325  -6.094  1.00 0.00 ? 15 LEU B H    2  
ATOM 1315 H HA   . LEU B 2 15 ? 3.468   -2.816  -3.772  1.00 0.00 ? 15 LEU B HA   2  
ATOM 1316 H HB2  . LEU B 2 15 ? 1.213   -2.023  -3.795  1.00 0.00 ? 15 LEU B HB2  2  
ATOM 1317 H HB3  . LEU B 2 15 ? 0.840   -2.526  -5.360  1.00 0.00 ? 15 LEU B HB3  2  
ATOM 1318 H HG   . LEU B 2 15 ? 0.996   -4.289  -2.888  1.00 0.00 ? 15 LEU B HG   2  
ATOM 1319 H HD11 . LEU B 2 15 ? -1.021  -2.719  -3.099  1.00 0.00 ? 15 LEU B HD11 2  
ATOM 1320 H HD12 . LEU B 2 15 ? -1.342  -3.391  -4.685  1.00 0.00 ? 15 LEU B HD12 2  
ATOM 1321 H HD13 . LEU B 2 15 ? -1.486  -4.385  -3.239  1.00 0.00 ? 15 LEU B HD13 2  
ATOM 1322 H HD21 . LEU B 2 15 ? 0.104   -5.056  -5.711  1.00 0.00 ? 15 LEU B HD21 2  
ATOM 1323 H HD22 . LEU B 2 15 ? 1.489   -5.741  -4.887  1.00 0.00 ? 15 LEU B HD22 2  
ATOM 1324 H HD23 . LEU B 2 15 ? -0.099  -6.033  -4.259  1.00 0.00 ? 15 LEU B HD23 2  
ATOM 1325 N N    . TYR B 2 16 ? 3.236   -4.548  -6.495  1.00 0.00 ? 16 TYR B N    2  
ATOM 1326 C CA   . TYR B 2 16 ? 3.610   -5.836  -7.146  1.00 0.00 ? 16 TYR B CA   2  
ATOM 1327 C C    . TYR B 2 16 ? 5.042   -6.227  -6.723  1.00 0.00 ? 16 TYR B C    2  
ATOM 1328 O O    . TYR B 2 16 ? 5.291   -7.386  -6.453  1.00 0.00 ? 16 TYR B O    2  
ATOM 1329 C CB   . TYR B 2 16 ? 3.599   -5.721  -8.707  1.00 0.00 ? 16 TYR B CB   2  
ATOM 1330 C CG   . TYR B 2 16 ? 2.374   -6.266  -9.465  1.00 0.00 ? 16 TYR B CG   2  
ATOM 1331 C CD1  . TYR B 2 16 ? 1.910   -7.558  -9.306  1.00 0.00 ? 16 TYR B CD1  2  
ATOM 1332 C CD2  . TYR B 2 16 ? 1.725   -5.430  -10.353 1.00 0.00 ? 16 TYR B CD2  2  
ATOM 1333 C CE1  . TYR B 2 16 ? 0.822   -8.006  -10.032 1.00 0.00 ? 16 TYR B CE1  2  
ATOM 1334 C CE2  . TYR B 2 16 ? 0.641   -5.874  -11.081 1.00 0.00 ? 16 TYR B CE2  2  
ATOM 1335 C CZ   . TYR B 2 16 ? 0.176   -7.165  -10.922 1.00 0.00 ? 16 TYR B CZ   2  
ATOM 1336 O OH   . TYR B 2 16 ? -0.914  -7.604  -11.650 1.00 0.00 ? 16 TYR B OH   2  
ATOM 1337 H H    . TYR B 2 16 ? 2.895   -3.828  -7.046  1.00 0.00 ? 16 TYR B H    2  
ATOM 1338 H HA   . TYR B 2 16 ? 2.880   -6.573  -6.816  1.00 0.00 ? 16 TYR B HA   2  
ATOM 1339 H HB2  . TYR B 2 16 ? 3.654   -4.682  -8.958  1.00 0.00 ? 16 TYR B HB2  2  
ATOM 1340 H HB3  . TYR B 2 16 ? 4.468   -6.206  -9.122  1.00 0.00 ? 16 TYR B HB3  2  
ATOM 1341 H HD1  . TYR B 2 16 ? 2.401   -8.227  -8.619  1.00 0.00 ? 16 TYR B HD1  2  
ATOM 1342 H HD2  . TYR B 2 16 ? 2.078   -4.421  -10.488 1.00 0.00 ? 16 TYR B HD2  2  
ATOM 1343 H HE1  . TYR B 2 16 ? 0.465   -9.017  -9.901  1.00 0.00 ? 16 TYR B HE1  2  
ATOM 1344 H HE2  . TYR B 2 16 ? 0.149   -5.205  -11.772 1.00 0.00 ? 16 TYR B HE2  2  
ATOM 1345 H HH   . TYR B 2 16 ? -1.099  -6.945  -12.325 1.00 0.00 ? 16 TYR B HH   2  
ATOM 1346 N N    . LEU B 2 17 ? 5.931   -5.249  -6.667  1.00 0.00 ? 17 LEU B N    2  
ATOM 1347 C CA   . LEU B 2 17 ? 7.350   -5.580  -6.277  1.00 0.00 ? 17 LEU B CA   2  
ATOM 1348 C C    . LEU B 2 17 ? 7.686   -5.367  -4.788  1.00 0.00 ? 17 LEU B C    2  
ATOM 1349 O O    . LEU B 2 17 ? 8.355   -6.209  -4.220  1.00 0.00 ? 17 LEU B O    2  
ATOM 1350 C CB   . LEU B 2 17 ? 8.338   -4.732  -7.187  1.00 0.00 ? 17 LEU B CB   2  
ATOM 1351 C CG   . LEU B 2 17 ? 9.873   -4.761  -6.771  1.00 0.00 ? 17 LEU B CG   2  
ATOM 1352 C CD1  . LEU B 2 17 ? 10.197  -3.835  -5.553  1.00 0.00 ? 17 LEU B CD1  2  
ATOM 1353 C CD2  . LEU B 2 17 ? 10.390  -6.210  -6.522  1.00 0.00 ? 17 LEU B CD2  2  
ATOM 1354 H H    . LEU B 2 17 ? 5.664   -4.326  -6.887  1.00 0.00 ? 17 LEU B H    2  
ATOM 1355 H HA   . LEU B 2 17 ? 7.536   -6.623  -6.519  1.00 0.00 ? 17 LEU B HA   2  
ATOM 1356 H HB2  . LEU B 2 17 ? 8.277   -5.142  -8.182  1.00 0.00 ? 17 LEU B HB2  2  
ATOM 1357 H HB3  . LEU B 2 17 ? 8.024   -3.701  -7.258  1.00 0.00 ? 17 LEU B HB3  2  
ATOM 1358 H HG   . LEU B 2 17 ? 10.424  -4.378  -7.616  1.00 0.00 ? 17 LEU B HG   2  
ATOM 1359 H HD11 . LEU B 2 17 ? 9.924   -2.815  -5.784  1.00 0.00 ? 17 LEU B HD11 2  
ATOM 1360 H HD12 . LEU B 2 17 ? 9.684   -4.120  -4.651  1.00 0.00 ? 17 LEU B HD12 2  
ATOM 1361 H HD13 . LEU B 2 17 ? 11.256  -3.845  -5.350  1.00 0.00 ? 17 LEU B HD13 2  
ATOM 1362 H HD21 . LEU B 2 17 ? 9.832   -6.729  -5.766  1.00 0.00 ? 17 LEU B HD21 2  
ATOM 1363 H HD22 . LEU B 2 17 ? 10.327  -6.787  -7.432  1.00 0.00 ? 17 LEU B HD22 2  
ATOM 1364 H HD23 . LEU B 2 17 ? 11.422  -6.175  -6.203  1.00 0.00 ? 17 LEU B HD23 2  
ATOM 1365 N N    . VAL B 2 18 ? 7.243   -4.287  -4.177  1.00 0.00 ? 18 VAL B N    2  
ATOM 1366 C CA   . VAL B 2 18 ? 7.549   -4.024  -2.734  1.00 0.00 ? 18 VAL B CA   2  
ATOM 1367 C C    . VAL B 2 18 ? 7.303   -5.272  -1.900  1.00 0.00 ? 18 VAL B C    2  
ATOM 1368 O O    . VAL B 2 18 ? 7.914   -5.469  -0.870  1.00 0.00 ? 18 VAL B O    2  
ATOM 1369 C CB   . VAL B 2 18 ? 6.670   -2.827  -2.246  1.00 0.00 ? 18 VAL B CB   2  
ATOM 1370 C CG1  . VAL B 2 18 ? 6.712   -2.691  -0.700  1.00 0.00 ? 18 VAL B CG1  2  
ATOM 1371 C CG2  . VAL B 2 18 ? 7.264   -1.533  -2.837  1.00 0.00 ? 18 VAL B CG2  2  
ATOM 1372 H H    . VAL B 2 18 ? 6.687   -3.638  -4.639  1.00 0.00 ? 18 VAL B H    2  
ATOM 1373 H HA   . VAL B 2 18 ? 8.592   -3.769  -2.670  1.00 0.00 ? 18 VAL B HA   2  
ATOM 1374 H HB   . VAL B 2 18 ? 5.648   -2.953  -2.578  1.00 0.00 ? 18 VAL B HB   2  
ATOM 1375 H HG11 . VAL B 2 18 ? 7.729   -2.552  -0.359  1.00 0.00 ? 18 VAL B HG11 2  
ATOM 1376 H HG12 . VAL B 2 18 ? 6.116   -1.847  -0.383  1.00 0.00 ? 18 VAL B HG12 2  
ATOM 1377 H HG13 . VAL B 2 18 ? 6.312   -3.579  -0.229  1.00 0.00 ? 18 VAL B HG13 2  
ATOM 1378 H HG21 . VAL B 2 18 ? 8.280   -1.403  -2.500  1.00 0.00 ? 18 VAL B HG21 2  
ATOM 1379 H HG22 . VAL B 2 18 ? 7.264   -1.552  -3.915  1.00 0.00 ? 18 VAL B HG22 2  
ATOM 1380 H HG23 . VAL B 2 18 ? 6.692   -0.687  -2.516  1.00 0.00 ? 18 VAL B HG23 2  
ATOM 1381 N N    . CYS B 2 19 ? 6.400   -6.075  -2.395  1.00 0.00 ? 19 CYS B N    2  
ATOM 1382 C CA   . CYS B 2 19 ? 6.072   -7.322  -1.677  1.00 0.00 ? 19 CYS B CA   2  
ATOM 1383 C C    . CYS B 2 19 ? 6.884   -8.554  -2.079  1.00 0.00 ? 19 CYS B C    2  
ATOM 1384 O O    . CYS B 2 19 ? 7.173   -9.367  -1.219  1.00 0.00 ? 19 CYS B O    2  
ATOM 1385 C CB   . CYS B 2 19 ? 4.587   -7.533  -1.883  1.00 0.00 ? 19 CYS B CB   2  
ATOM 1386 S SG   . CYS B 2 19 ? 3.550   -6.374  -0.961  1.00 0.00 ? 19 CYS B SG   2  
ATOM 1387 H H    . CYS B 2 19 ? 5.937   -5.848  -3.229  1.00 0.00 ? 19 CYS B H    2  
ATOM 1388 H HA   . CYS B 2 19 ? 6.229   -7.165  -0.621  1.00 0.00 ? 19 CYS B HA   2  
ATOM 1389 H HB2  . CYS B 2 19 ? 4.354   -7.356  -2.924  1.00 0.00 ? 19 CYS B HB2  2  
ATOM 1390 H HB3  . CYS B 2 19 ? 4.310   -8.548  -1.637  1.00 0.00 ? 19 CYS B HB3  2  
ATOM 1391 N N    . GLY B 2 20 ? 7.237   -8.697  -3.330  1.00 0.00 ? 20 GLY B N    2  
ATOM 1392 C CA   . GLY B 2 20 ? 8.027   -9.891  -3.735  1.00 0.00 ? 20 GLY B CA   2  
ATOM 1393 C C    . GLY B 2 20 ? 7.073   -11.073 -4.018  1.00 0.00 ? 20 GLY B C    2  
ATOM 1394 O O    . GLY B 2 20 ? 7.213   -11.701 -5.052  1.00 0.00 ? 20 GLY B O    2  
ATOM 1395 H H    . GLY B 2 20 ? 7.008   -8.037  -4.014  1.00 0.00 ? 20 GLY B H    2  
ATOM 1396 H HA2  . GLY B 2 20 ? 8.545   -9.634  -4.651  1.00 0.00 ? 20 GLY B HA2  2  
ATOM 1397 H HA3  . GLY B 2 20 ? 8.783   -10.135 -2.988  1.00 0.00 ? 20 GLY B HA3  2  
ATOM 1398 N N    . GLU B 2 21 ? 6.147   -11.351 -3.116  1.00 0.00 ? 21 GLU B N    2  
ATOM 1399 C CA   . GLU B 2 21 ? 5.180   -12.487 -3.322  1.00 0.00 ? 21 GLU B CA   2  
ATOM 1400 C C    . GLU B 2 21 ? 3.761   -12.112 -2.823  1.00 0.00 ? 21 GLU B C    2  
ATOM 1401 O O    . GLU B 2 21 ? 2.971   -12.961 -2.448  1.00 0.00 ? 21 GLU B O    2  
ATOM 1402 C CB   . GLU B 2 21 ? 5.779   -13.727 -2.555  1.00 0.00 ? 21 GLU B CB   2  
ATOM 1403 C CG   . GLU B 2 21 ? 5.496   -13.683 -1.022  1.00 0.00 ? 21 GLU B CG   2  
ATOM 1404 C CD   . GLU B 2 21 ? 5.933   -12.342 -0.394  1.00 0.00 ? 21 GLU B CD   2  
ATOM 1405 O OE1  . GLU B 2 21 ? 7.135   -12.176 -0.231  1.00 0.00 ? 21 GLU B OE1  2  
ATOM 1406 O OE2  . GLU B 2 21 ? 5.041   -11.554 -0.121  1.00 0.00 ? 21 GLU B OE2  2  
ATOM 1407 H H    . GLU B 2 21 ? 6.048   -10.823 -2.295  1.00 0.00 ? 21 GLU B H    2  
ATOM 1408 H HA   . GLU B 2 21 ? 5.092   -12.655 -4.380  1.00 0.00 ? 21 GLU B HA   2  
ATOM 1409 H HB2  . GLU B 2 21 ? 5.391   -14.648 -2.957  1.00 0.00 ? 21 GLU B HB2  2  
ATOM 1410 H HB3  . GLU B 2 21 ? 6.850   -13.743 -2.693  1.00 0.00 ? 21 GLU B HB3  2  
ATOM 1411 H HG2  . GLU B 2 21 ? 4.448   -13.844 -0.845  1.00 0.00 ? 21 GLU B HG2  2  
ATOM 1412 H HG3  . GLU B 2 21 ? 6.034   -14.486 -0.536  1.00 0.00 ? 21 GLU B HG3  2  
ATOM 1413 N N    . ARG B 2 22 ? 3.533   -10.828 -2.859  1.00 0.00 ? 22 ARG B N    2  
ATOM 1414 C CA   . ARG B 2 22 ? 2.254   -10.128 -2.444  1.00 0.00 ? 22 ARG B CA   2  
ATOM 1415 C C    . ARG B 2 22 ? 0.930   -10.946 -2.417  1.00 0.00 ? 22 ARG B C    2  
ATOM 1416 O O    . ARG B 2 22 ? 0.758   -11.898 -3.153  1.00 0.00 ? 22 ARG B O    2  
ATOM 1417 C CB   . ARG B 2 22 ? 2.109   -8.890  -3.378  1.00 0.00 ? 22 ARG B CB   2  
ATOM 1418 C CG   . ARG B 2 22 ? 1.350   -9.204  -4.674  1.00 0.00 ? 22 ARG B CG   2  
ATOM 1419 C CD   . ARG B 2 22 ? 2.189   -10.173 -5.539  1.00 0.00 ? 22 ARG B CD   2  
ATOM 1420 N NE   . ARG B 2 22 ? 1.467   -10.374 -6.827  1.00 0.00 ? 22 ARG B NE   2  
ATOM 1421 C CZ   . ARG B 2 22 ? 1.319   -11.570 -7.320  1.00 0.00 ? 22 ARG B CZ   2  
ATOM 1422 N NH1  . ARG B 2 22 ? 0.713   -12.496 -6.630  1.00 0.00 ? 22 ARG B NH1  2  
ATOM 1423 N NH2  . ARG B 2 22 ? 1.789   -11.791 -8.514  1.00 0.00 ? 22 ARG B NH2  2  
ATOM 1424 H H    . ARG B 2 22 ? 4.277   -10.284 -3.196  1.00 0.00 ? 22 ARG B H    2  
ATOM 1425 H HA   . ARG B 2 22 ? 2.417   -9.762  -1.441  1.00 0.00 ? 22 ARG B HA   2  
ATOM 1426 H HB2  . ARG B 2 22 ? 1.714   -8.018  -2.877  1.00 0.00 ? 22 ARG B HB2  2  
ATOM 1427 H HB3  . ARG B 2 22 ? 3.108   -8.631  -3.692  1.00 0.00 ? 22 ARG B HB3  2  
ATOM 1428 H HG2  . ARG B 2 22 ? 0.386   -9.643  -4.459  1.00 0.00 ? 22 ARG B HG2  2  
ATOM 1429 H HG3  . ARG B 2 22 ? 1.191   -8.279  -5.216  1.00 0.00 ? 22 ARG B HG3  2  
ATOM 1430 H HD2  . ARG B 2 22 ? 3.174   -9.776  -5.736  1.00 0.00 ? 22 ARG B HD2  2  
ATOM 1431 H HD3  . ARG B 2 22 ? 2.298   -11.129 -5.048  1.00 0.00 ? 22 ARG B HD3  2  
ATOM 1432 H HE   . ARG B 2 22 ? 1.105   -9.602  -7.304  1.00 0.00 ? 22 ARG B HE   2  
ATOM 1433 H HH11 . ARG B 2 22 ? 0.383   -12.314 -5.704  1.00 0.00 ? 22 ARG B HH11 2  
ATOM 1434 H HH12 . ARG B 2 22 ? 0.591   -13.401 -7.039  1.00 0.00 ? 22 ARG B HH12 2  
ATOM 1435 H HH21 . ARG B 2 22 ? 2.241   -11.054 -9.013  1.00 0.00 ? 22 ARG B HH21 2  
ATOM 1436 H HH22 . ARG B 2 22 ? 1.705   -12.699 -8.924  1.00 0.00 ? 22 ARG B HH22 2  
ATOM 1437 N N    . GLY B 2 23 ? 0.027   -10.514 -1.570  1.00 0.00 ? 23 GLY B N    2  
ATOM 1438 C CA   . GLY B 2 23 ? -1.305  -11.185 -1.423  1.00 0.00 ? 23 GLY B CA   2  
ATOM 1439 C C    . GLY B 2 23 ? -2.480  -10.262 -1.860  1.00 0.00 ? 23 GLY B C    2  
ATOM 1440 O O    . GLY B 2 23 ? -3.352  -10.027 -1.044  1.00 0.00 ? 23 GLY B O    2  
ATOM 1441 H H    . GLY B 2 23 ? 0.224   -9.736  -1.010  1.00 0.00 ? 23 GLY B H    2  
ATOM 1442 H HA2  . GLY B 2 23 ? -1.325  -12.141 -1.935  1.00 0.00 ? 23 GLY B HA2  2  
ATOM 1443 H HA3  . GLY B 2 23 ? -1.430  -11.397 -0.368  1.00 0.00 ? 23 GLY B HA3  2  
ATOM 1444 N N    . PHE B 2 24 ? -2.513  -9.756  -3.083  1.00 0.00 ? 24 PHE B N    2  
ATOM 1445 C CA   . PHE B 2 24 ? -3.636  -8.876  -3.514  1.00 0.00 ? 24 PHE B CA   2  
ATOM 1446 C C    . PHE B 2 24 ? -4.225  -9.548  -4.808  1.00 0.00 ? 24 PHE B C    2  
ATOM 1447 O O    . PHE B 2 24 ? -3.712  -10.577 -5.213  1.00 0.00 ? 24 PHE B O    2  
ATOM 1448 C CB   . PHE B 2 24 ? -3.028  -7.441  -3.781  1.00 0.00 ? 24 PHE B CB   2  
ATOM 1449 C CG   . PHE B 2 24 ? -2.442  -7.195  -5.195  1.00 0.00 ? 24 PHE B CG   2  
ATOM 1450 C CD1  . PHE B 2 24 ? -1.652  -8.117  -5.854  1.00 0.00 ? 24 PHE B CD1  2  
ATOM 1451 C CD2  . PHE B 2 24 ? -2.711  -5.981  -5.807  1.00 0.00 ? 24 PHE B CD2  2  
ATOM 1452 C CE1  . PHE B 2 24 ? -1.140  -7.823  -7.102  1.00 0.00 ? 24 PHE B CE1  2  
ATOM 1453 C CE2  . PHE B 2 24 ? -2.199  -5.689  -7.052  1.00 0.00 ? 24 PHE B CE2  2  
ATOM 1454 C CZ   . PHE B 2 24 ? -1.410  -6.613  -7.700  1.00 0.00 ? 24 PHE B CZ   2  
ATOM 1455 H H    . PHE B 2 24 ? -1.839  -9.919  -3.767  1.00 0.00 ? 24 PHE B H    2  
ATOM 1456 H HA   . PHE B 2 24 ? -4.350  -8.849  -2.696  1.00 0.00 ? 24 PHE B HA   2  
ATOM 1457 H HB2  . PHE B 2 24 ? -3.726  -6.655  -3.537  1.00 0.00 ? 24 PHE B HB2  2  
ATOM 1458 H HB3  . PHE B 2 24 ? -2.192  -7.318  -3.105  1.00 0.00 ? 24 PHE B HB3  2  
ATOM 1459 H HD1  . PHE B 2 24 ? -1.437  -9.073  -5.404  1.00 0.00 ? 24 PHE B HD1  2  
ATOM 1460 H HD2  . PHE B 2 24 ? -3.334  -5.249  -5.311  1.00 0.00 ? 24 PHE B HD2  2  
ATOM 1461 H HE1  . PHE B 2 24 ? -0.527  -8.543  -7.622  1.00 0.00 ? 24 PHE B HE1  2  
ATOM 1462 H HE2  . PHE B 2 24 ? -2.423  -4.739  -7.512  1.00 0.00 ? 24 PHE B HE2  2  
ATOM 1463 H HZ   . PHE B 2 24 ? -0.999  -6.387  -8.673  1.00 0.00 ? 24 PHE B HZ   2  
ATOM 1464 N N    . PHE B 2 25 ? -5.252  -9.007  -5.429  1.00 0.00 ? 25 PHE B N    2  
ATOM 1465 C CA   . PHE B 2 25 ? -5.834  -9.614  -6.669  1.00 0.00 ? 25 PHE B CA   2  
ATOM 1466 C C    . PHE B 2 25 ? -5.945  -8.440  -7.646  1.00 0.00 ? 25 PHE B C    2  
ATOM 1467 O O    . PHE B 2 25 ? -6.509  -7.425  -7.285  1.00 0.00 ? 25 PHE B O    2  
ATOM 1468 C CB   . PHE B 2 25 ? -7.276  -10.163 -6.475  1.00 0.00 ? 25 PHE B CB   2  
ATOM 1469 C CG   . PHE B 2 25 ? -7.508  -11.099 -5.271  1.00 0.00 ? 25 PHE B CG   2  
ATOM 1470 C CD1  . PHE B 2 25 ? -7.104  -12.420 -5.290  1.00 0.00 ? 25 PHE B CD1  2  
ATOM 1471 C CD2  . PHE B 2 25 ? -8.162  -10.619 -4.150  1.00 0.00 ? 25 PHE B CD2  2  
ATOM 1472 C CE1  . PHE B 2 25 ? -7.344  -13.244 -4.205  1.00 0.00 ? 25 PHE B CE1  2  
ATOM 1473 C CE2  . PHE B 2 25 ? -8.404  -11.439 -3.062  1.00 0.00 ? 25 PHE B CE2  2  
ATOM 1474 C CZ   . PHE B 2 25 ? -7.997  -12.755 -3.093  1.00 0.00 ? 25 PHE B CZ   2  
ATOM 1475 H H    . PHE B 2 25 ? -5.670  -8.187  -5.119  1.00 0.00 ? 25 PHE B H    2  
ATOM 1476 H HA   . PHE B 2 25 ? -5.169  -10.363 -7.073  1.00 0.00 ? 25 PHE B HA   2  
ATOM 1477 H HB2  . PHE B 2 25 ? -7.975  -9.342  -6.389  1.00 0.00 ? 25 PHE B HB2  2  
ATOM 1478 H HB3  . PHE B 2 25 ? -7.535  -10.711 -7.368  1.00 0.00 ? 25 PHE B HB3  2  
ATOM 1479 H HD1  . PHE B 2 25 ? -6.591  -12.802 -6.157  1.00 0.00 ? 25 PHE B HD1  2  
ATOM 1480 H HD2  . PHE B 2 25 ? -8.486  -9.589  -4.124  1.00 0.00 ? 25 PHE B HD2  2  
ATOM 1481 H HE1  . PHE B 2 25 ? -7.028  -14.276 -4.223  1.00 0.00 ? 25 PHE B HE1  2  
ATOM 1482 H HE2  . PHE B 2 25 ? -8.916  -11.049 -2.193  1.00 0.00 ? 25 PHE B HE2  2  
ATOM 1483 H HZ   . PHE B 2 25 ? -8.185  -13.405 -2.246  1.00 0.00 ? 25 PHE B HZ   2  
ATOM 1484 N N    . TYR B 2 26 ? -5.427  -8.577  -8.843  1.00 0.00 ? 26 TYR B N    2  
ATOM 1485 C CA   . TYR B 2 26 ? -5.530  -7.438  -9.801  1.00 0.00 ? 26 TYR B CA   2  
ATOM 1486 C C    . TYR B 2 26 ? -5.714  -7.942  -11.227 1.00 0.00 ? 26 TYR B C    2  
ATOM 1487 O O    . TYR B 2 26 ? -4.952  -7.677  -12.138 1.00 0.00 ? 26 TYR B O    2  
ATOM 1488 C CB   . TYR B 2 26 ? -4.268  -6.565  -9.712  1.00 0.00 ? 26 TYR B CB   2  
ATOM 1489 C CG   . TYR B 2 26 ? -4.716  -5.157  -10.165 1.00 0.00 ? 26 TYR B CG   2  
ATOM 1490 C CD1  . TYR B 2 26 ? -5.549  -4.420  -9.338  1.00 0.00 ? 26 TYR B CD1  2  
ATOM 1491 C CD2  . TYR B 2 26 ? -4.333  -4.611  -11.377 1.00 0.00 ? 26 TYR B CD2  2  
ATOM 1492 C CE1  . TYR B 2 26 ? -5.992  -3.171  -9.708  1.00 0.00 ? 26 TYR B CE1  2  
ATOM 1493 C CE2  . TYR B 2 26 ? -4.781  -3.354  -11.745 1.00 0.00 ? 26 TYR B CE2  2  
ATOM 1494 C CZ   . TYR B 2 26 ? -5.614  -2.627  -10.912 1.00 0.00 ? 26 TYR B CZ   2  
ATOM 1495 O OH   . TYR B 2 26 ? -6.068  -1.368  -11.267 1.00 0.00 ? 26 TYR B OH   2  
ATOM 1496 H H    . TYR B 2 26 ? -4.990  -9.405  -9.114  1.00 0.00 ? 26 TYR B H    2  
ATOM 1497 H HA   . TYR B 2 26 ? -6.404  -6.853  -9.554  1.00 0.00 ? 26 TYR B HA   2  
ATOM 1498 H HB2  . TYR B 2 26 ? -3.931  -6.528  -8.688  1.00 0.00 ? 26 TYR B HB2  2  
ATOM 1499 H HB3  . TYR B 2 26 ? -3.475  -6.938  -10.352 1.00 0.00 ? 26 TYR B HB3  2  
ATOM 1500 H HD1  . TYR B 2 26 ? -5.861  -4.829  -8.389  1.00 0.00 ? 26 TYR B HD1  2  
ATOM 1501 H HD2  . TYR B 2 26 ? -3.685  -5.167  -12.038 1.00 0.00 ? 26 TYR B HD2  2  
ATOM 1502 H HE1  . TYR B 2 26 ? -6.641  -2.613  -9.052  1.00 0.00 ? 26 TYR B HE1  2  
ATOM 1503 H HE2  . TYR B 2 26 ? -4.479  -2.932  -12.692 1.00 0.00 ? 26 TYR B HE2  2  
ATOM 1504 H HH   . TYR B 2 26 ? -5.749  -1.159  -12.147 1.00 0.00 ? 26 TYR B HH   2  
ATOM 1505 N N    . THR B 2 27 ? -6.779  -8.675  -11.331 1.00 0.00 ? 27 THR B N    2  
ATOM 1506 C CA   . THR B 2 27 ? -7.209  -9.296  -12.616 1.00 0.00 ? 27 THR B CA   2  
ATOM 1507 C C    . THR B 2 27 ? -8.626  -8.756  -13.015 1.00 0.00 ? 27 THR B C    2  
ATOM 1508 O O    . THR B 2 27 ? -9.544  -9.554  -13.043 1.00 0.00 ? 27 THR B O    2  
ATOM 1509 C CB   . THR B 2 27 ? -7.190  -10.831 -12.392 1.00 0.00 ? 27 THR B CB   2  
ATOM 1510 O OG1  . THR B 2 27 ? -7.949  -11.046 -11.209 1.00 0.00 ? 27 THR B OG1  2  
ATOM 1511 C CG2  . THR B 2 27 ? -5.760  -11.316 -12.018 1.00 0.00 ? 27 THR B CG2  2  
ATOM 1512 H H    . THR B 2 27 ? -7.308  -8.824  -10.518 1.00 0.00 ? 27 THR B H    2  
ATOM 1513 H HA   . THR B 2 27 ? -6.481  -9.144  -13.398 1.00 0.00 ? 27 THR B HA   2  
ATOM 1514 H HB   . THR B 2 27 ? -7.619  -11.375 -13.220 1.00 0.00 ? 27 THR B HB   2  
ATOM 1515 H HG1  . THR B 2 27 ? -8.722  -11.562 -11.442 1.00 0.00 ? 27 THR B HG1  2  
ATOM 1516 H HG21 . THR B 2 27 ? -5.416  -10.819 -11.121 1.00 0.00 ? 27 THR B HG21 2  
ATOM 1517 H HG22 . THR B 2 27 ? -5.748  -12.383 -11.848 1.00 0.00 ? 27 THR B HG22 2  
ATOM 1518 H HG23 . THR B 2 27 ? -5.067  -11.090 -12.809 1.00 0.00 ? 27 THR B HG23 2  
ATOM 1519 N N    . PRO B 2 28 ? -8.795  -7.466  -13.302 1.00 0.00 ? 28 PRO B N    2  
ATOM 1520 C CA   . PRO B 2 28 ? -10.141 -6.829  -13.542 1.00 0.00 ? 28 PRO B CA   2  
ATOM 1521 C C    . PRO B 2 28 ? -11.213 -7.689  -14.255 1.00 0.00 ? 28 PRO B C    2  
ATOM 1522 O O    . PRO B 2 28 ? -10.870 -8.535  -15.055 1.00 0.00 ? 28 PRO B O    2  
ATOM 1523 C CB   . PRO B 2 28 ? -9.791  -5.569  -14.301 1.00 0.00 ? 28 PRO B CB   2  
ATOM 1524 C CG   . PRO B 2 28 ? -8.527  -5.123  -13.525 1.00 0.00 ? 28 PRO B CG   2  
ATOM 1525 C CD   . PRO B 2 28 ? -7.726  -6.416  -13.451 1.00 0.00 ? 28 PRO B CD   2  
ATOM 1526 H HA   . PRO B 2 28 ? -10.506 -6.504  -12.570 1.00 0.00 ? 28 PRO B HA   2  
ATOM 1527 H HB2  . PRO B 2 28 ? -9.574  -5.787  -15.341 1.00 0.00 ? 28 PRO B HB2  2  
ATOM 1528 H HB3  . PRO B 2 28 ? -10.564 -4.823  -14.225 1.00 0.00 ? 28 PRO B HB3  2  
ATOM 1529 H HG2  . PRO B 2 28 ? -7.973  -4.364  -14.054 1.00 0.00 ? 28 PRO B HG2  2  
ATOM 1530 H HG3  . PRO B 2 28 ? -8.759  -4.774  -12.528 1.00 0.00 ? 28 PRO B HG3  2  
ATOM 1531 H HD2  . PRO B 2 28 ? -7.194  -6.507  -14.386 1.00 0.00 ? 28 PRO B HD2  2  
ATOM 1532 H HD3  . PRO B 2 28 ? -7.078  -6.382  -12.587 1.00 0.00 ? 28 PRO B HD3  2  
ATOM 1533 N N    . LYS B 2 29 ? -12.472 -7.435  -13.965 1.00 0.00 ? 29 LYS B N    2  
ATOM 1534 C CA   . LYS B 2 29 ? -13.591 -8.220  -14.600 1.00 0.00 ? 29 LYS B CA   2  
ATOM 1535 C C    . LYS B 2 29 ? -14.574 -7.420  -15.483 1.00 0.00 ? 29 LYS B C    2  
ATOM 1536 O O    . LYS B 2 29 ? -15.762 -7.378  -15.214 1.00 0.00 ? 29 LYS B O    2  
ATOM 1537 C CB   . LYS B 2 29 ? -14.413 -8.927  -13.490 1.00 0.00 ? 29 LYS B CB   2  
ATOM 1538 C CG   . LYS B 2 29 ? -13.609 -9.937  -12.664 1.00 0.00 ? 29 LYS B CG   2  
ATOM 1539 C CD   . LYS B 2 29 ? -13.006 -11.031 -13.565 1.00 0.00 ? 29 LYS B CD   2  
ATOM 1540 C CE   . LYS B 2 29 ? -12.341 -12.071 -12.669 1.00 0.00 ? 29 LYS B CE   2  
ATOM 1541 N NZ   . LYS B 2 29 ? -11.637 -13.083 -13.498 1.00 0.00 ? 29 LYS B NZ   2  
ATOM 1542 H H    . LYS B 2 29 ? -12.688 -6.724  -13.329 1.00 0.00 ? 29 LYS B H    2  
ATOM 1543 H HA   . LYS B 2 29 ? -13.159 -8.980  -15.234 1.00 0.00 ? 29 LYS B HA   2  
ATOM 1544 H HB2  . LYS B 2 29 ? -14.810 -8.162  -12.838 1.00 0.00 ? 29 LYS B HB2  2  
ATOM 1545 H HB3  . LYS B 2 29 ? -15.246 -9.447  -13.937 1.00 0.00 ? 29 LYS B HB3  2  
ATOM 1546 H HG2  . LYS B 2 29 ? -12.846 -9.435  -12.085 1.00 0.00 ? 29 LYS B HG2  2  
ATOM 1547 H HG3  . LYS B 2 29 ? -14.307 -10.398 -11.978 1.00 0.00 ? 29 LYS B HG3  2  
ATOM 1548 H HD2  . LYS B 2 29 ? -13.787 -11.492 -14.152 1.00 0.00 ? 29 LYS B HD2  2  
ATOM 1549 H HD3  . LYS B 2 29 ? -12.264 -10.613 -14.229 1.00 0.00 ? 29 LYS B HD3  2  
ATOM 1550 H HE2  . LYS B 2 29 ? -11.622 -11.606 -12.014 1.00 0.00 ? 29 LYS B HE2  2  
ATOM 1551 H HE3  . LYS B 2 29 ? -13.090 -12.571 -12.077 1.00 0.00 ? 29 LYS B HE3  2  
ATOM 1552 H HZ1  . LYS B 2 29 ? -11.760 -12.856 -14.505 1.00 0.00 ? 29 LYS B HZ1  2  
ATOM 1553 H HZ2  . LYS B 2 29 ? -10.626 -13.076 -13.264 1.00 0.00 ? 29 LYS B HZ2  2  
ATOM 1554 H HZ3  . LYS B 2 29 ? -12.027 -14.026 -13.304 1.00 0.00 ? 29 LYS B HZ3  2  
ATOM 1555 N N    . THR B 2 30 ? -14.064 -6.815  -16.515 1.00 0.00 ? 30 THR B N    2  
ATOM 1556 C CA   . THR B 2 30 ? -14.921 -6.017  -17.449 1.00 0.00 ? 30 THR B CA   2  
ATOM 1557 C C    . THR B 2 30 ? -14.952 -6.743  -18.798 1.00 0.00 ? 30 THR B C    2  
ATOM 1558 O O    . THR B 2 30 ? -15.283 -7.908  -18.893 1.00 0.00 ? 30 THR B O    2  
ATOM 1559 C CB   . THR B 2 30 ? -14.322 -4.604  -17.599 1.00 0.00 ? 30 THR B CB   2  
ATOM 1560 O OG1  . THR B 2 30 ? -14.818 -3.909  -16.464 1.00 0.00 ? 30 THR B OG1  2  
ATOM 1561 C CG2  . THR B 2 30 ? -14.905 -3.854  -18.819 1.00 0.00 ? 30 THR B CG2  2  
ATOM 1562 H H    . THR B 2 30 ? -13.097 -6.880  -16.678 1.00 0.00 ? 30 THR B H    2  
ATOM 1563 H HA   . THR B 2 30 ? -15.929 -5.947  -17.064 1.00 0.00 ? 30 THR B HA   2  
ATOM 1564 H HB   . THR B 2 30 ? -13.242 -4.608  -17.582 1.00 0.00 ? 30 THR B HB   2  
ATOM 1565 H HG1  . THR B 2 30 ? -14.080 -3.662  -15.905 1.00 0.00 ? 30 THR B HG1  2  
ATOM 1566 H HG21 . THR B 2 30 ? -15.981 -3.771  -18.728 1.00 0.00 ? 30 THR B HG21 2  
ATOM 1567 H HG22 . THR B 2 30 ? -14.482 -2.862  -18.897 1.00 0.00 ? 30 THR B HG22 2  
ATOM 1568 H HG23 . THR B 2 30 ? -14.667 -4.387  -19.728 1.00 0.00 ? 30 THR B HG23 2  
ATOM 1569 N N    . GLY A 1 1  ? -9.670  -3.687  4.119   1.00 0.00 ? 1  GLY A N    3  
ATOM 1570 C CA   . GLY A 1 1  ? -8.533  -3.313  3.219   1.00 0.00 ? 1  GLY A CA   3  
ATOM 1571 C C    . GLY A 1 1  ? -8.676  -1.870  2.727   1.00 0.00 ? 1  GLY A C    3  
ATOM 1572 O O    . GLY A 1 1  ? -9.672  -1.221  2.983   1.00 0.00 ? 1  GLY A O    3  
ATOM 1573 H H1   . GLY A 1 1  ? -10.308 -2.873  4.246   1.00 0.00 ? 1  GLY A H1   3  
ATOM 1574 H H2   . GLY A 1 1  ? -10.187 -4.472  3.678   1.00 0.00 ? 1  GLY A H2   3  
ATOM 1575 H H3   . GLY A 1 1  ? -9.301  -3.983  5.044   1.00 0.00 ? 1  GLY A H3   3  
ATOM 1576 H HA2  . GLY A 1 1  ? -7.593  -3.415  3.743   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 1577 H HA3  . GLY A 1 1  ? -8.542  -3.962  2.357   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 1578 N N    . ILE A 1 2  ? -7.665  -1.404  2.028   1.00 0.00 ? 2  ILE A N    3  
ATOM 1579 C CA   . ILE A 1 2  ? -7.684  -0.001  1.485   1.00 0.00 ? 2  ILE A CA   3  
ATOM 1580 C C    . ILE A 1 2  ? -7.468  -0.103  -0.040  1.00 0.00 ? 2  ILE A C    3  
ATOM 1581 O O    . ILE A 1 2  ? -7.346  -1.196  -0.559  1.00 0.00 ? 2  ILE A O    3  
ATOM 1582 C CB   . ILE A 1 2  ? -6.534  0.864   2.097   1.00 0.00 ? 2  ILE A CB   3  
ATOM 1583 C CG1  . ILE A 1 2  ? -6.020  0.391   3.499   1.00 0.00 ? 2  ILE A CG1  3  
ATOM 1584 C CG2  . ILE A 1 2  ? -7.075  2.320   2.237   1.00 0.00 ? 2  ILE A CG2  3  
ATOM 1585 C CD1  . ILE A 1 2  ? -7.020  0.591   4.657   1.00 0.00 ? 2  ILE A CD1  3  
ATOM 1586 H H    . ILE A 1 2  ? -6.879  -1.959  1.847   1.00 0.00 ? 2  ILE A H    3  
ATOM 1587 H HA   . ILE A 1 2  ? -8.654  0.434   1.666   1.00 0.00 ? 2  ILE A HA   3  
ATOM 1588 H HB   . ILE A 1 2  ? -5.687  0.877   1.427   1.00 0.00 ? 2  ILE A HB   3  
ATOM 1589 H HG12 . ILE A 1 2  ? -5.735  -0.648  3.454   1.00 0.00 ? 2  ILE A HG12 3  
ATOM 1590 H HG13 . ILE A 1 2  ? -5.134  0.963   3.732   1.00 0.00 ? 2  ILE A HG13 3  
ATOM 1591 H HG21 . ILE A 1 2  ? -7.948  2.310   2.873   1.00 0.00 ? 2  ILE A HG21 3  
ATOM 1592 H HG22 . ILE A 1 2  ? -6.320  2.954   2.677   1.00 0.00 ? 2  ILE A HG22 3  
ATOM 1593 H HG23 . ILE A 1 2  ? -7.358  2.749   1.288   1.00 0.00 ? 2  ILE A HG23 3  
ATOM 1594 H HD11 . ILE A 1 2  ? -7.938  0.056   4.492   1.00 0.00 ? 2  ILE A HD11 3  
ATOM 1595 H HD12 . ILE A 1 2  ? -6.549  0.207   5.549   1.00 0.00 ? 2  ILE A HD12 3  
ATOM 1596 H HD13 . ILE A 1 2  ? -7.246  1.640   4.804   1.00 0.00 ? 2  ILE A HD13 3  
ATOM 1597 N N    . VAL A 1 3  ? -7.416  1.027   -0.712  1.00 0.00 ? 3  VAL A N    3  
ATOM 1598 C CA   . VAL A 1 3  ? -7.208  1.014   -2.199  1.00 0.00 ? 3  VAL A CA   3  
ATOM 1599 C C    . VAL A 1 3  ? -5.920  1.700   -2.648  1.00 0.00 ? 3  VAL A C    3  
ATOM 1600 O O    . VAL A 1 3  ? -5.184  2.278   -1.871  1.00 0.00 ? 3  VAL A O    3  
ATOM 1601 C CB   . VAL A 1 3  ? -8.388  1.714   -2.914  1.00 0.00 ? 3  VAL A CB   3  
ATOM 1602 C CG1  . VAL A 1 3  ? -9.675  0.942   -2.651  1.00 0.00 ? 3  VAL A CG1  3  
ATOM 1603 C CG2  . VAL A 1 3  ? -8.531  3.170   -2.428  1.00 0.00 ? 3  VAL A CG2  3  
ATOM 1604 H H    . VAL A 1 3  ? -7.518  1.882   -0.248  1.00 0.00 ? 3  VAL A H    3  
ATOM 1605 H HA   . VAL A 1 3  ? -7.170  -0.004  -2.548  1.00 0.00 ? 3  VAL A HA   3  
ATOM 1606 H HB   . VAL A 1 3  ? -8.215  1.706   -3.982  1.00 0.00 ? 3  VAL A HB   3  
ATOM 1607 H HG11 . VAL A 1 3  ? -9.573  -0.068  -3.013  1.00 0.00 ? 3  VAL A HG11 3  
ATOM 1608 H HG12 . VAL A 1 3  ? -9.897  0.911   -1.594  1.00 0.00 ? 3  VAL A HG12 3  
ATOM 1609 H HG13 . VAL A 1 3  ? -10.493 1.415   -3.176  1.00 0.00 ? 3  VAL A HG13 3  
ATOM 1610 H HG21 . VAL A 1 3  ? -7.609  3.706   -2.608  1.00 0.00 ? 3  VAL A HG21 3  
ATOM 1611 H HG22 . VAL A 1 3  ? -9.332  3.661   -2.961  1.00 0.00 ? 3  VAL A HG22 3  
ATOM 1612 H HG23 . VAL A 1 3  ? -8.732  3.199   -1.367  1.00 0.00 ? 3  VAL A HG23 3  
ATOM 1613 N N    . GLU A 1 4  ? -5.736  1.578   -3.937  1.00 0.00 ? 4  GLU A N    3  
ATOM 1614 C CA   . GLU A 1 4  ? -4.570  2.134   -4.658  1.00 0.00 ? 4  GLU A CA   3  
ATOM 1615 C C    . GLU A 1 4  ? -5.046  3.108   -5.750  1.00 0.00 ? 4  GLU A C    3  
ATOM 1616 O O    . GLU A 1 4  ? -4.936  2.837   -6.930  1.00 0.00 ? 4  GLU A O    3  
ATOM 1617 C CB   . GLU A 1 4  ? -3.808  0.909   -5.207  1.00 0.00 ? 4  GLU A CB   3  
ATOM 1618 C CG   . GLU A 1 4  ? -2.589  0.536   -4.315  1.00 0.00 ? 4  GLU A CG   3  
ATOM 1619 C CD   . GLU A 1 4  ? -2.935  0.557   -2.812  1.00 0.00 ? 4  GLU A CD   3  
ATOM 1620 O OE1  . GLU A 1 4  ? -3.723  -0.266  -2.384  1.00 0.00 ? 4  GLU A OE1  3  
ATOM 1621 O OE2  . GLU A 1 4  ? -2.387  1.417   -2.146  1.00 0.00 ? 4  GLU A OE2  3  
ATOM 1622 H H    . GLU A 1 4  ? -6.402  1.090   -4.461  1.00 0.00 ? 4  GLU A H    3  
ATOM 1623 H HA   . GLU A 1 4  ? -3.963  2.703   -3.968  1.00 0.00 ? 4  GLU A HA   3  
ATOM 1624 H HB2  . GLU A 1 4  ? -4.467  0.060   -5.262  1.00 0.00 ? 4  GLU A HB2  3  
ATOM 1625 H HB3  . GLU A 1 4  ? -3.473  1.145   -6.195  1.00 0.00 ? 4  GLU A HB3  3  
ATOM 1626 H HG2  . GLU A 1 4  ? -2.256  -0.457  -4.584  1.00 0.00 ? 4  GLU A HG2  3  
ATOM 1627 H HG3  . GLU A 1 4  ? -1.771  1.206   -4.492  1.00 0.00 ? 4  GLU A HG3  3  
ATOM 1628 N N    . GLN A 1 5  ? -5.574  4.222   -5.297  1.00 0.00 ? 5  GLN A N    3  
ATOM 1629 C CA   . GLN A 1 5  ? -6.078  5.276   -6.233  1.00 0.00 ? 5  GLN A CA   3  
ATOM 1630 C C    . GLN A 1 5  ? -5.597  6.672   -5.778  1.00 0.00 ? 5  GLN A C    3  
ATOM 1631 O O    . GLN A 1 5  ? -5.448  6.917   -4.599  1.00 0.00 ? 5  GLN A O    3  
ATOM 1632 C CB   . GLN A 1 5  ? -7.617  5.173   -6.251  1.00 0.00 ? 5  GLN A CB   3  
ATOM 1633 C CG   . GLN A 1 5  ? -8.265  6.205   -7.204  1.00 0.00 ? 5  GLN A CG   3  
ATOM 1634 C CD   . GLN A 1 5  ? -7.583  6.232   -8.584  1.00 0.00 ? 5  GLN A CD   3  
ATOM 1635 O OE1  . GLN A 1 5  ? -7.410  5.222   -9.238  1.00 0.00 ? 5  GLN A OE1  3  
ATOM 1636 N NE2  . GLN A 1 5  ? -7.186  7.380   -9.062  1.00 0.00 ? 5  GLN A NE2  3  
ATOM 1637 H H    . GLN A 1 5  ? -5.638  4.369   -4.330  1.00 0.00 ? 5  GLN A H    3  
ATOM 1638 H HA   . GLN A 1 5  ? -5.683  5.091   -7.220  1.00 0.00 ? 5  GLN A HA   3  
ATOM 1639 H HB2  . GLN A 1 5  ? -7.906  4.179   -6.561  1.00 0.00 ? 5  GLN A HB2  3  
ATOM 1640 H HB3  . GLN A 1 5  ? -7.999  5.337   -5.256  1.00 0.00 ? 5  GLN A HB3  3  
ATOM 1641 H HG2  . GLN A 1 5  ? -9.301  5.936   -7.363  1.00 0.00 ? 5  GLN A HG2  3  
ATOM 1642 H HG3  . GLN A 1 5  ? -8.234  7.192   -6.766  1.00 0.00 ? 5  GLN A HG3  3  
ATOM 1643 H HE21 . GLN A 1 5  ? -7.325  8.202   -8.545  1.00 0.00 ? 5  GLN A HE21 3  
ATOM 1644 H HE22 . GLN A 1 5  ? -6.745  7.424   -9.938  1.00 0.00 ? 5  GLN A HE22 3  
ATOM 1645 N N    . CYS A 1 6  ? -5.380  7.533   -6.742  1.00 0.00 ? 6  CYS A N    3  
ATOM 1646 C CA   . CYS A 1 6  ? -4.905  8.950   -6.547  1.00 0.00 ? 6  CYS A CA   3  
ATOM 1647 C C    . CYS A 1 6  ? -4.557  9.472   -5.133  1.00 0.00 ? 6  CYS A C    3  
ATOM 1648 O O    . CYS A 1 6  ? -5.123  10.438  -4.651  1.00 0.00 ? 6  CYS A O    3  
ATOM 1649 C CB   . CYS A 1 6  ? -5.972  9.846   -7.213  1.00 0.00 ? 6  CYS A CB   3  
ATOM 1650 S SG   . CYS A 1 6  ? -5.871  10.000  -9.020  1.00 0.00 ? 6  CYS A SG   3  
ATOM 1651 H H    . CYS A 1 6  ? -5.536  7.232   -7.658  1.00 0.00 ? 6  CYS A H    3  
ATOM 1652 H HA   . CYS A 1 6  ? -4.020  9.090   -7.147  1.00 0.00 ? 6  CYS A HA   3  
ATOM 1653 H HB2  . CYS A 1 6  ? -6.942  9.413   -6.994  1.00 0.00 ? 6  CYS A HB2  3  
ATOM 1654 H HB3  . CYS A 1 6  ? -5.972  10.823  -6.757  1.00 0.00 ? 6  CYS A HB3  3  
ATOM 1655 N N    . CYS A 1 7  ? -3.613  8.788   -4.537  1.00 0.00 ? 7  CYS A N    3  
ATOM 1656 C CA   . CYS A 1 7  ? -3.050  9.046   -3.172  1.00 0.00 ? 7  CYS A CA   3  
ATOM 1657 C C    . CYS A 1 7  ? -4.066  9.721   -2.278  1.00 0.00 ? 7  CYS A C    3  
ATOM 1658 O O    . CYS A 1 7  ? -3.778  10.683  -1.590  1.00 0.00 ? 7  CYS A O    3  
ATOM 1659 C CB   . CYS A 1 7  ? -1.790  9.931   -3.309  1.00 0.00 ? 7  CYS A CB   3  
ATOM 1660 S SG   . CYS A 1 7  ? -0.965  10.430  -1.772  1.00 0.00 ? 7  CYS A SG   3  
ATOM 1661 H H    . CYS A 1 7  ? -3.262  8.031   -5.021  1.00 0.00 ? 7  CYS A H    3  
ATOM 1662 H HA   . CYS A 1 7  ? -2.787  8.099   -2.726  1.00 0.00 ? 7  CYS A HA   3  
ATOM 1663 H HB2  . CYS A 1 7  ? -1.068  9.414   -3.921  1.00 0.00 ? 7  CYS A HB2  3  
ATOM 1664 H HB3  . CYS A 1 7  ? -2.075  10.838  -3.826  1.00 0.00 ? 7  CYS A HB3  3  
ATOM 1665 N N    . THR A 1 8  ? -5.231  9.133   -2.382  1.00 0.00 ? 8  THR A N    3  
ATOM 1666 C CA   . THR A 1 8  ? -6.444  9.573   -1.619  1.00 0.00 ? 8  THR A CA   3  
ATOM 1667 C C    . THR A 1 8  ? -6.117  10.565  -0.491  1.00 0.00 ? 8  THR A C    3  
ATOM 1668 O O    . THR A 1 8  ? -6.599  11.679  -0.543  1.00 0.00 ? 8  THR A O    3  
ATOM 1669 C CB   . THR A 1 8  ? -7.170  8.276   -1.077  1.00 0.00 ? 8  THR A CB   3  
ATOM 1670 O OG1  . THR A 1 8  ? -7.878  8.597   0.119   1.00 0.00 ? 8  THR A OG1  3  
ATOM 1671 C CG2  . THR A 1 8  ? -6.205  7.139   -0.731  1.00 0.00 ? 8  THR A CG2  3  
ATOM 1672 H H    . THR A 1 8  ? -5.255  8.375   -3.016  1.00 0.00 ? 8  THR A H    3  
ATOM 1673 H HA   . THR A 1 8  ? -7.106  10.055  -2.317  1.00 0.00 ? 8  THR A HA   3  
ATOM 1674 H HB   . THR A 1 8  ? -7.892  7.914   -1.801  1.00 0.00 ? 8  THR A HB   3  
ATOM 1675 H HG1  . THR A 1 8  ? -7.632  9.450   0.481   1.00 0.00 ? 8  THR A HG1  3  
ATOM 1676 H HG21 . THR A 1 8  ? -5.503  7.464   0.021   1.00 0.00 ? 8  THR A HG21 3  
ATOM 1677 H HG22 . THR A 1 8  ? -6.762  6.287   -0.361  1.00 0.00 ? 8  THR A HG22 3  
ATOM 1678 H HG23 . THR A 1 8  ? -5.662  6.824   -1.611  1.00 0.00 ? 8  THR A HG23 3  
ATOM 1679 N N    . SER A 1 9  ? -5.328  10.155  0.481   1.00 0.00 ? 9  SER A N    3  
ATOM 1680 C CA   . SER A 1 9  ? -4.986  11.094  1.595   1.00 0.00 ? 9  SER A CA   3  
ATOM 1681 C C    . SER A 1 9  ? -3.606  11.009  2.266   1.00 0.00 ? 9  SER A C    3  
ATOM 1682 O O    . SER A 1 9  ? -3.047  12.032  2.615   1.00 0.00 ? 9  SER A O    3  
ATOM 1683 C CB   . SER A 1 9  ? -6.063  10.962  2.695   1.00 0.00 ? 9  SER A CB   3  
ATOM 1684 O OG   . SER A 1 9  ? -7.238  11.349  2.009   1.00 0.00 ? 9  SER A OG   3  
ATOM 1685 H H    . SER A 1 9  ? -4.966  9.244   0.478   1.00 0.00 ? 9  SER A H    3  
ATOM 1686 H HA   . SER A 1 9  ? -5.035  12.087  1.196   1.00 0.00 ? 9  SER A HA   3  
ATOM 1687 H HB2  . SER A 1 9  ? -6.215  9.959   3.062   1.00 0.00 ? 9  SER A HB2  3  
ATOM 1688 H HB3  . SER A 1 9  ? -5.871  11.640  3.519   1.00 0.00 ? 9  SER A HB3  3  
ATOM 1689 H HG   . SER A 1 9  ? -7.512  10.580  1.511   1.00 0.00 ? 9  SER A HG   3  
ATOM 1690 N N    . ILE A 1 10 ? -3.087  9.817   2.430   1.00 0.00 ? 10 ILE A N    3  
ATOM 1691 C CA   . ILE A 1 10 ? -1.746  9.620   3.095   1.00 0.00 ? 10 ILE A CA   3  
ATOM 1692 C C    . ILE A 1 10 ? -0.995  8.406   2.512   1.00 0.00 ? 10 ILE A C    3  
ATOM 1693 O O    . ILE A 1 10 ? -0.663  7.459   3.202   1.00 0.00 ? 10 ILE A O    3  
ATOM 1694 C CB   . ILE A 1 10 ? -1.957  9.418   4.644   1.00 0.00 ? 10 ILE A CB   3  
ATOM 1695 C CG1  . ILE A 1 10 ? -2.896  10.533  5.199   1.00 0.00 ? 10 ILE A CG1  3  
ATOM 1696 C CG2  . ILE A 1 10 ? -0.577  9.535   5.348   1.00 0.00 ? 10 ILE A CG2  3  
ATOM 1697 C CD1  . ILE A 1 10 ? -3.143  10.386  6.714   1.00 0.00 ? 10 ILE A CD1  3  
ATOM 1698 H H    . ILE A 1 10 ? -3.569  9.049   2.087   1.00 0.00 ? 10 ILE A H    3  
ATOM 1699 H HA   . ILE A 1 10 ? -1.149  10.503  2.928   1.00 0.00 ? 10 ILE A HA   3  
ATOM 1700 H HB   . ILE A 1 10 ? -2.405  8.448   4.807   1.00 0.00 ? 10 ILE A HB   3  
ATOM 1701 H HG12 . ILE A 1 10 ? -2.464  11.501  5.003   1.00 0.00 ? 10 ILE A HG12 3  
ATOM 1702 H HG13 . ILE A 1 10 ? -3.858  10.481  4.709   1.00 0.00 ? 10 ILE A HG13 3  
ATOM 1703 H HG21 . ILE A 1 10 ? -0.149  10.511  5.158   1.00 0.00 ? 10 ILE A HG21 3  
ATOM 1704 H HG22 . ILE A 1 10 ? -0.683  9.410   6.411   1.00 0.00 ? 10 ILE A HG22 3  
ATOM 1705 H HG23 . ILE A 1 10 ? 0.107   8.784   4.992   1.00 0.00 ? 10 ILE A HG23 3  
ATOM 1706 H HD11 . ILE A 1 10 ? -3.590  9.429   6.934   1.00 0.00 ? 10 ILE A HD11 3  
ATOM 1707 H HD12 . ILE A 1 10 ? -2.218  10.488  7.262   1.00 0.00 ? 10 ILE A HD12 3  
ATOM 1708 H HD13 . ILE A 1 10 ? -3.822  11.168  7.030   1.00 0.00 ? 10 ILE A HD13 3  
ATOM 1709 N N    . CYS A 1 11 ? -0.756  8.473   1.240   1.00 0.00 ? 11 CYS A N    3  
ATOM 1710 C CA   . CYS A 1 11 ? -0.029  7.375   0.528   1.00 0.00 ? 11 CYS A CA   3  
ATOM 1711 C C    . CYS A 1 11 ? 1.440   7.148   0.955   1.00 0.00 ? 11 CYS A C    3  
ATOM 1712 O O    . CYS A 1 11 ? 2.334   7.888   0.583   1.00 0.00 ? 11 CYS A O    3  
ATOM 1713 C CB   . CYS A 1 11 ? -0.056  7.654   -0.976  1.00 0.00 ? 11 CYS A CB   3  
ATOM 1714 S SG   . CYS A 1 11 ? 0.632   9.210   -1.596  1.00 0.00 ? 11 CYS A SG   3  
ATOM 1715 H H    . CYS A 1 11 ? -1.090  9.262   0.773   1.00 0.00 ? 11 CYS A H    3  
ATOM 1716 H HA   . CYS A 1 11 ? -0.572  6.455   0.697   1.00 0.00 ? 11 CYS A HA   3  
ATOM 1717 H HB2  . CYS A 1 11 ? 0.487   6.859   -1.468  1.00 0.00 ? 11 CYS A HB2  3  
ATOM 1718 H HB3  . CYS A 1 11 ? -1.080  7.600   -1.304  1.00 0.00 ? 11 CYS A HB3  3  
ATOM 1719 N N    . SER A 1 12 ? 1.623   6.111   1.734   1.00 0.00 ? 12 SER A N    3  
ATOM 1720 C CA   . SER A 1 12 ? 2.962   5.698   2.254   1.00 0.00 ? 12 SER A CA   3  
ATOM 1721 C C    . SER A 1 12 ? 3.084   4.232   1.746   1.00 0.00 ? 12 SER A C    3  
ATOM 1722 O O    . SER A 1 12 ? 2.160   3.717   1.146   1.00 0.00 ? 12 SER A O    3  
ATOM 1723 C CB   . SER A 1 12 ? 2.962   5.796   3.830   1.00 0.00 ? 12 SER A CB   3  
ATOM 1724 O OG   . SER A 1 12 ? 2.687   4.496   4.338   1.00 0.00 ? 12 SER A OG   3  
ATOM 1725 H H    . SER A 1 12 ? 0.851   5.574   1.991   1.00 0.00 ? 12 SER A H    3  
ATOM 1726 H HA   . SER A 1 12 ? 3.744   6.298   1.816   1.00 0.00 ? 12 SER A HA   3  
ATOM 1727 H HB2  . SER A 1 12 ? 3.897   6.164   4.235   1.00 0.00 ? 12 SER A HB2  3  
ATOM 1728 H HB3  . SER A 1 12 ? 2.174   6.462   4.154   1.00 0.00 ? 12 SER A HB3  3  
ATOM 1729 H HG   . SER A 1 12 ? 3.422   4.249   4.905   1.00 0.00 ? 12 SER A HG   3  
ATOM 1730 N N    . LEU A 1 13 ? 4.194   3.587   1.991   1.00 0.00 ? 13 LEU A N    3  
ATOM 1731 C CA   . LEU A 1 13 ? 4.364   2.169   1.523   1.00 0.00 ? 13 LEU A CA   3  
ATOM 1732 C C    . LEU A 1 13 ? 4.184   1.190   2.708   1.00 0.00 ? 13 LEU A C    3  
ATOM 1733 O O    . LEU A 1 13 ? 3.908   0.019   2.510   1.00 0.00 ? 13 LEU A O    3  
ATOM 1734 C CB   . LEU A 1 13 ? 5.781   1.984   0.894   1.00 0.00 ? 13 LEU A CB   3  
ATOM 1735 C CG   . LEU A 1 13 ? 6.036   2.949   -0.339  1.00 0.00 ? 13 LEU A CG   3  
ATOM 1736 C CD1  . LEU A 1 13 ? 7.526   2.871   -0.760  1.00 0.00 ? 13 LEU A CD1  3  
ATOM 1737 C CD2  . LEU A 1 13 ? 5.208   2.563   -1.594  1.00 0.00 ? 13 LEU A CD2  3  
ATOM 1738 H H    . LEU A 1 13 ? 4.913   4.031   2.476   1.00 0.00 ? 13 LEU A H    3  
ATOM 1739 H HA   . LEU A 1 13 ? 3.630   1.955   0.773   1.00 0.00 ? 13 LEU A HA   3  
ATOM 1740 H HB2  . LEU A 1 13 ? 6.503   2.147   1.678   1.00 0.00 ? 13 LEU A HB2  3  
ATOM 1741 H HB3  . LEU A 1 13 ? 5.877   0.956   0.565   1.00 0.00 ? 13 LEU A HB3  3  
ATOM 1742 H HG   . LEU A 1 13 ? 5.802   3.963   -0.057  1.00 0.00 ? 13 LEU A HG   3  
ATOM 1743 H HD11 . LEU A 1 13 ? 8.171   3.174   0.051   1.00 0.00 ? 13 LEU A HD11 3  
ATOM 1744 H HD12 . LEU A 1 13 ? 7.790   1.865   -1.060  1.00 0.00 ? 13 LEU A HD12 3  
ATOM 1745 H HD13 . LEU A 1 13 ? 7.695   3.533   -1.603  1.00 0.00 ? 13 LEU A HD13 3  
ATOM 1746 H HD21 . LEU A 1 13 ? 5.439   1.552   -1.895  1.00 0.00 ? 13 LEU A HD21 3  
ATOM 1747 H HD22 . LEU A 1 13 ? 4.154   2.632   -1.383  1.00 0.00 ? 13 LEU A HD22 3  
ATOM 1748 H HD23 . LEU A 1 13 ? 5.427   3.218   -2.425  1.00 0.00 ? 13 LEU A HD23 3  
ATOM 1749 N N    . TYR A 1 14 ? 4.331   1.697   3.915   1.00 0.00 ? 14 TYR A N    3  
ATOM 1750 C CA   . TYR A 1 14 ? 4.170   0.805   5.115   1.00 0.00 ? 14 TYR A CA   3  
ATOM 1751 C C    . TYR A 1 14 ? 2.700   0.353   5.177   1.00 0.00 ? 14 TYR A C    3  
ATOM 1752 O O    . TYR A 1 14 ? 2.400   -0.747  5.600   1.00 0.00 ? 14 TYR A O    3  
ATOM 1753 C CB   . TYR A 1 14 ? 4.562   1.554   6.438   1.00 0.00 ? 14 TYR A CB   3  
ATOM 1754 C CG   . TYR A 1 14 ? 4.354   0.582   7.621   1.00 0.00 ? 14 TYR A CG   3  
ATOM 1755 C CD1  . TYR A 1 14 ? 5.353   -0.305  7.958   1.00 0.00 ? 14 TYR A CD1  3  
ATOM 1756 C CD2  . TYR A 1 14 ? 3.179   0.571   8.353   1.00 0.00 ? 14 TYR A CD2  3  
ATOM 1757 C CE1  . TYR A 1 14 ? 5.186   -1.187  9.005   1.00 0.00 ? 14 TYR A CE1  3  
ATOM 1758 C CE2  . TYR A 1 14 ? 3.010   -0.310  9.401   1.00 0.00 ? 14 TYR A CE2  3  
ATOM 1759 C CZ   . TYR A 1 14 ? 4.010   -1.200  9.737   1.00 0.00 ? 14 TYR A CZ   3  
ATOM 1760 O OH   . TYR A 1 14 ? 3.833   -2.076  10.789  1.00 0.00 ? 14 TYR A OH   3  
ATOM 1761 H H    . TYR A 1 14 ? 4.531   2.650   4.016   1.00 0.00 ? 14 TYR A H    3  
ATOM 1762 H HA   . TYR A 1 14 ? 4.818   -0.047  4.993   1.00 0.00 ? 14 TYR A HA   3  
ATOM 1763 H HB2  . TYR A 1 14 ? 5.608   1.812   6.388   1.00 0.00 ? 14 TYR A HB2  3  
ATOM 1764 H HB3  . TYR A 1 14 ? 4.002   2.454   6.630   1.00 0.00 ? 14 TYR A HB3  3  
ATOM 1765 H HD1  . TYR A 1 14 ? 6.277   -0.309  7.397   1.00 0.00 ? 14 TYR A HD1  3  
ATOM 1766 H HD2  . TYR A 1 14 ? 2.381   1.258   8.108   1.00 0.00 ? 14 TYR A HD2  3  
ATOM 1767 H HE1  . TYR A 1 14 ? 5.988   -1.870  9.240   1.00 0.00 ? 14 TYR A HE1  3  
ATOM 1768 H HE2  . TYR A 1 14 ? 2.082   -0.302  9.963   1.00 0.00 ? 14 TYR A HE2  3  
ATOM 1769 H HH   . TYR A 1 14 ? 4.557   -2.703  10.782  1.00 0.00 ? 14 TYR A HH   3  
ATOM 1770 N N    . GLN A 1 15 ? 1.827   1.232   4.745   1.00 0.00 ? 15 GLN A N    3  
ATOM 1771 C CA   . GLN A 1 15 ? 0.370   0.925   4.744   1.00 0.00 ? 15 GLN A CA   3  
ATOM 1772 C C    . GLN A 1 15 ? 0.143   -0.210  3.723   1.00 0.00 ? 15 GLN A C    3  
ATOM 1773 O O    . GLN A 1 15 ? -0.783  -0.985  3.870   1.00 0.00 ? 15 GLN A O    3  
ATOM 1774 C CB   . GLN A 1 15 ? -0.372  2.242   4.367   1.00 0.00 ? 15 GLN A CB   3  
ATOM 1775 C CG   . GLN A 1 15 ? -1.902  2.076   4.373   1.00 0.00 ? 15 GLN A CG   3  
ATOM 1776 C CD   . GLN A 1 15 ? -2.405  1.479   3.046   1.00 0.00 ? 15 GLN A CD   3  
ATOM 1777 O OE1  . GLN A 1 15 ? -2.304  2.092   2.003   1.00 0.00 ? 15 GLN A OE1  3  
ATOM 1778 N NE2  . GLN A 1 15 ? -2.950  0.291   3.038   1.00 0.00 ? 15 GLN A NE2  3  
ATOM 1779 H H    . GLN A 1 15 ? 2.118   2.109   4.419   1.00 0.00 ? 15 GLN A H    3  
ATOM 1780 H HA   . GLN A 1 15 ? 0.078   0.577   5.724   1.00 0.00 ? 15 GLN A HA   3  
ATOM 1781 H HB2  . GLN A 1 15 ? -0.100  3.001   5.087   1.00 0.00 ? 15 GLN A HB2  3  
ATOM 1782 H HB3  . GLN A 1 15 ? -0.051  2.592   3.398   1.00 0.00 ? 15 GLN A HB3  3  
ATOM 1783 H HG2  . GLN A 1 15 ? -2.205  1.439   5.191   1.00 0.00 ? 15 GLN A HG2  3  
ATOM 1784 H HG3  . GLN A 1 15 ? -2.368  3.038   4.506   1.00 0.00 ? 15 GLN A HG3  3  
ATOM 1785 H HE21 . GLN A 1 15 ? -3.012  -0.225  3.872   1.00 0.00 ? 15 GLN A HE21 3  
ATOM 1786 H HE22 . GLN A 1 15 ? -3.302  -0.083  2.201   1.00 0.00 ? 15 GLN A HE22 3  
ATOM 1787 N N    . LEU A 1 16 ? 1.003   -0.286  2.729   1.00 0.00 ? 16 LEU A N    3  
ATOM 1788 C CA   . LEU A 1 16 ? 0.859   -1.354  1.688   1.00 0.00 ? 16 LEU A CA   3  
ATOM 1789 C C    . LEU A 1 16 ? 1.290   -2.708  2.280   1.00 0.00 ? 16 LEU A C    3  
ATOM 1790 O O    . LEU A 1 16 ? 0.919   -3.767  1.811   1.00 0.00 ? 16 LEU A O    3  
ATOM 1791 C CB   . LEU A 1 16 ? 1.742   -0.996  0.487   1.00 0.00 ? 16 LEU A CB   3  
ATOM 1792 C CG   . LEU A 1 16 ? 1.510   0.478   0.045   1.00 0.00 ? 16 LEU A CG   3  
ATOM 1793 C CD1  . LEU A 1 16 ? 2.339   0.739   -1.222  1.00 0.00 ? 16 LEU A CD1  3  
ATOM 1794 C CD2  . LEU A 1 16 ? 0.031   0.773   -0.260  1.00 0.00 ? 16 LEU A CD2  3  
ATOM 1795 H H    . LEU A 1 16 ? 1.755   0.346   2.646   1.00 0.00 ? 16 LEU A H    3  
ATOM 1796 H HA   . LEU A 1 16 ? -0.173  -1.408  1.380   1.00 0.00 ? 16 LEU A HA   3  
ATOM 1797 H HB2  . LEU A 1 16 ? 2.775   -1.159  0.745   1.00 0.00 ? 16 LEU A HB2  3  
ATOM 1798 H HB3  . LEU A 1 16 ? 1.506   -1.655  -0.330  1.00 0.00 ? 16 LEU A HB3  3  
ATOM 1799 H HG   . LEU A 1 16 ? 1.822   1.139   0.837   1.00 0.00 ? 16 LEU A HG   3  
ATOM 1800 H HD11 . LEU A 1 16 ? 3.385   0.571   -1.027  1.00 0.00 ? 16 LEU A HD11 3  
ATOM 1801 H HD12 . LEU A 1 16 ? 2.023   0.072   -2.007  1.00 0.00 ? 16 LEU A HD12 3  
ATOM 1802 H HD13 . LEU A 1 16 ? 2.188   1.748   -1.570  1.00 0.00 ? 16 LEU A HD13 3  
ATOM 1803 H HD21 . LEU A 1 16 ? -0.327  0.119   -1.037  1.00 0.00 ? 16 LEU A HD21 3  
ATOM 1804 H HD22 . LEU A 1 16 ? -0.577  0.629   0.621   1.00 0.00 ? 16 LEU A HD22 3  
ATOM 1805 H HD23 . LEU A 1 16 ? -0.076  1.801   -0.576  1.00 0.00 ? 16 LEU A HD23 3  
ATOM 1806 N N    . GLU A 1 17 ? 2.079   -2.658  3.321   1.00 0.00 ? 17 GLU A N    3  
ATOM 1807 C CA   . GLU A 1 17 ? 2.530   -3.949  3.950   1.00 0.00 ? 17 GLU A CA   3  
ATOM 1808 C C    . GLU A 1 17 ? 1.347   -4.638  4.651   1.00 0.00 ? 17 GLU A C    3  
ATOM 1809 O O    . GLU A 1 17 ? 1.428   -5.791  5.023   1.00 0.00 ? 17 GLU A O    3  
ATOM 1810 C CB   . GLU A 1 17 ? 3.641   -3.669  4.972   1.00 0.00 ? 17 GLU A CB   3  
ATOM 1811 C CG   . GLU A 1 17 ? 4.748   -2.796  4.334   1.00 0.00 ? 17 GLU A CG   3  
ATOM 1812 C CD   . GLU A 1 17 ? 5.272   -3.443  3.040   1.00 0.00 ? 17 GLU A CD   3  
ATOM 1813 O OE1  . GLU A 1 17 ? 4.598   -3.296  2.029   1.00 0.00 ? 17 GLU A OE1  3  
ATOM 1814 O OE2  . GLU A 1 17 ? 6.322   -4.054  3.140   1.00 0.00 ? 17 GLU A OE2  3  
ATOM 1815 H H    . GLU A 1 17 ? 2.362   -1.787  3.666   1.00 0.00 ? 17 GLU A H    3  
ATOM 1816 H HA   . GLU A 1 17 ? 2.895   -4.609  3.180   1.00 0.00 ? 17 GLU A HA   3  
ATOM 1817 H HB2  . GLU A 1 17 ? 3.240   -3.187  5.851   1.00 0.00 ? 17 GLU A HB2  3  
ATOM 1818 H HB3  . GLU A 1 17 ? 4.072   -4.614  5.269   1.00 0.00 ? 17 GLU A HB3  3  
ATOM 1819 H HG2  . GLU A 1 17 ? 4.351   -1.822  4.096   1.00 0.00 ? 17 GLU A HG2  3  
ATOM 1820 H HG3  . GLU A 1 17 ? 5.561   -2.670  5.035   1.00 0.00 ? 17 GLU A HG3  3  
ATOM 1821 N N    . ASN A 1 18 ? 0.276   -3.896  4.792   1.00 0.00 ? 18 ASN A N    3  
ATOM 1822 C CA   . ASN A 1 18 ? -0.950  -4.424  5.450   1.00 0.00 ? 18 ASN A CA   3  
ATOM 1823 C C    . ASN A 1 18 ? -1.566  -5.564  4.615   1.00 0.00 ? 18 ASN A C    3  
ATOM 1824 O O    . ASN A 1 18 ? -2.288  -6.387  5.139   1.00 0.00 ? 18 ASN A O    3  
ATOM 1825 C CB   . ASN A 1 18 ? -1.950  -3.265  5.602   1.00 0.00 ? 18 ASN A CB   3  
ATOM 1826 C CG   . ASN A 1 18 ? -1.358  -2.112  6.440   1.00 0.00 ? 18 ASN A CG   3  
ATOM 1827 O OD1  . ASN A 1 18 ? -1.931  -1.042  6.534   1.00 0.00 ? 18 ASN A OD1  3  
ATOM 1828 N ND2  . ASN A 1 18 ? -0.227  -2.269  7.069   1.00 0.00 ? 18 ASN A ND2  3  
ATOM 1829 H H    . ASN A 1 18 ? 0.271   -2.975  4.458   1.00 0.00 ? 18 ASN A H    3  
ATOM 1830 H HA   . ASN A 1 18 ? -0.686  -4.834  6.409   1.00 0.00 ? 18 ASN A HA   3  
ATOM 1831 H HB2  . ASN A 1 18 ? -2.246  -2.884  4.633   1.00 0.00 ? 18 ASN A HB2  3  
ATOM 1832 H HB3  . ASN A 1 18 ? -2.820  -3.621  6.128   1.00 0.00 ? 18 ASN A HB3  3  
ATOM 1833 H HD21 . ASN A 1 18 ? 0.261   -3.118  7.015   1.00 0.00 ? 18 ASN A HD21 3  
ATOM 1834 H HD22 . ASN A 1 18 ? 0.131   -1.531  7.599   1.00 0.00 ? 18 ASN A HD22 3  
ATOM 1835 N N    . TYR A 1 19 ? -1.251  -5.574  3.340   1.00 0.00 ? 19 TYR A N    3  
ATOM 1836 C CA   . TYR A 1 19 ? -1.778  -6.626  2.418   1.00 0.00 ? 19 TYR A CA   3  
ATOM 1837 C C    . TYR A 1 19 ? -0.688  -7.717  2.358   1.00 0.00 ? 19 TYR A C    3  
ATOM 1838 O O    . TYR A 1 19 ? -0.998  -8.881  2.184   1.00 0.00 ? 19 TYR A O    3  
ATOM 1839 C CB   . TYR A 1 19 ? -1.991  -6.105  0.952   1.00 0.00 ? 19 TYR A CB   3  
ATOM 1840 C CG   . TYR A 1 19 ? -2.758  -4.771  0.816   1.00 0.00 ? 19 TYR A CG   3  
ATOM 1841 C CD1  . TYR A 1 19 ? -4.141  -4.692  0.808   1.00 0.00 ? 19 TYR A CD1  3  
ATOM 1842 C CD2  . TYR A 1 19 ? -2.035  -3.597  0.685   1.00 0.00 ? 19 TYR A CD2  3  
ATOM 1843 C CE1  . TYR A 1 19 ? -4.770  -3.463  0.667   1.00 0.00 ? 19 TYR A CE1  3  
ATOM 1844 C CE2  . TYR A 1 19 ? -2.657  -2.385  0.545   1.00 0.00 ? 19 TYR A CE2  3  
ATOM 1845 C CZ   . TYR A 1 19 ? -4.024  -2.306  0.535   1.00 0.00 ? 19 TYR A CZ   3  
ATOM 1846 O OH   . TYR A 1 19 ? -4.635  -1.079  0.395   1.00 0.00 ? 19 TYR A OH   3  
ATOM 1847 H H    . TYR A 1 19 ? -0.663  -4.879  2.986   1.00 0.00 ? 19 TYR A H    3  
ATOM 1848 H HA   . TYR A 1 19 ? -2.685  -7.046  2.820   1.00 0.00 ? 19 TYR A HA   3  
ATOM 1849 H HB2  . TYR A 1 19 ? -1.069  -6.004  0.401   1.00 0.00 ? 19 TYR A HB2  3  
ATOM 1850 H HB3  . TYR A 1 19 ? -2.568  -6.859  0.437   1.00 0.00 ? 19 TYR A HB3  3  
ATOM 1851 H HD1  . TYR A 1 19 ? -4.736  -5.589  0.908   1.00 0.00 ? 19 TYR A HD1  3  
ATOM 1852 H HD2  . TYR A 1 19 ? -0.962  -3.629  0.679   1.00 0.00 ? 19 TYR A HD2  3  
ATOM 1853 H HE1  . TYR A 1 19 ? -5.850  -3.406  0.659   1.00 0.00 ? 19 TYR A HE1  3  
ATOM 1854 H HE2  . TYR A 1 19 ? -2.069  -1.483  0.446   1.00 0.00 ? 19 TYR A HE2  3  
ATOM 1855 H HH   . TYR A 1 19 ? -4.465  -0.779  -0.499  1.00 0.00 ? 19 TYR A HH   3  
ATOM 1856 N N    . CYS A 1 20 ? 0.558   -7.322  2.509   1.00 0.00 ? 20 CYS A N    3  
ATOM 1857 C CA   . CYS A 1 20 ? 1.667   -8.324  2.464   1.00 0.00 ? 20 CYS A CA   3  
ATOM 1858 C C    . CYS A 1 20 ? 1.770   -9.223  3.725   1.00 0.00 ? 20 CYS A C    3  
ATOM 1859 O O    . CYS A 1 20 ? 2.082   -10.389 3.577   1.00 0.00 ? 20 CYS A O    3  
ATOM 1860 C CB   . CYS A 1 20 ? 2.999   -7.551  2.238   1.00 0.00 ? 20 CYS A CB   3  
ATOM 1861 S SG   . CYS A 1 20 ? 2.977   -6.191  1.040   1.00 0.00 ? 20 CYS A SG   3  
ATOM 1862 H H    . CYS A 1 20 ? 0.790   -6.378  2.650   1.00 0.00 ? 20 CYS A H    3  
ATOM 1863 H HA   . CYS A 1 20 ? 1.525   -8.957  1.595   1.00 0.00 ? 20 CYS A HA   3  
ATOM 1864 H HB2  . CYS A 1 20 ? 3.435   -7.159  3.141   1.00 0.00 ? 20 CYS A HB2  3  
ATOM 1865 H HB3  . CYS A 1 20 ? 3.701   -8.275  1.854   1.00 0.00 ? 20 CYS A HB3  3  
ATOM 1866 N N    . ASN A 1 21 ? 1.512   -8.685  4.901   1.00 0.00 ? 21 ASN A N    3  
ATOM 1867 C CA   . ASN A 1 21 ? 1.583   -9.445  6.199   1.00 0.00 ? 21 ASN A CA   3  
ATOM 1868 C C    . ASN A 1 21 ? 1.246   -10.950 6.096   1.00 0.00 ? 21 ASN A C    3  
ATOM 1869 O O    . ASN A 1 21 ? 0.122   -11.363 5.871   1.00 0.00 ? 21 ASN A O    3  
ATOM 1870 C CB   . ASN A 1 21 ? 0.629   -8.742  7.212   1.00 0.00 ? 21 ASN A CB   3  
ATOM 1871 C CG   . ASN A 1 21 ? 1.104   -8.969  8.654   1.00 0.00 ? 21 ASN A CG   3  
ATOM 1872 O OD1  . ASN A 1 21 ? 1.333   -8.040  9.403   1.00 0.00 ? 21 ASN A OD1  3  
ATOM 1873 N ND2  . ASN A 1 21 ? 1.269   -10.186 9.088   1.00 0.00 ? 21 ASN A ND2  3  
ATOM 1874 H H    . ASN A 1 21 ? 1.253   -7.744  4.963   1.00 0.00 ? 21 ASN A H    3  
ATOM 1875 H HA   . ASN A 1 21 ? 2.601   -9.368  6.558   1.00 0.00 ? 21 ASN A HA   3  
ATOM 1876 H HB2  . ASN A 1 21 ? 0.599   -7.679  7.027   1.00 0.00 ? 21 ASN A HB2  3  
ATOM 1877 H HB3  . ASN A 1 21 ? -0.373  -9.136  7.136   1.00 0.00 ? 21 ASN A HB3  3  
ATOM 1878 H HD21 . ASN A 1 21 ? 1.092   -10.947 8.499   1.00 0.00 ? 21 ASN A HD21 3  
ATOM 1879 H HD22 . ASN A 1 21 ? 1.574   -10.336 10.006  1.00 0.00 ? 21 ASN A HD22 3  
ATOM 1880 N N    . PHE B 2 1  ? 9.331   7.722   -4.056  1.00 0.00 ? 1  PHE B N    3  
ATOM 1881 C CA   . PHE B 2 1  ? 8.494   8.729   -4.760  1.00 0.00 ? 1  PHE B CA   3  
ATOM 1882 C C    . PHE B 2 1  ? 9.245   9.239   -6.003  1.00 0.00 ? 1  PHE B C    3  
ATOM 1883 O O    . PHE B 2 1  ? 10.451  9.385   -5.963  1.00 0.00 ? 1  PHE B O    3  
ATOM 1884 C CB   . PHE B 2 1  ? 8.212   9.901   -3.784  1.00 0.00 ? 1  PHE B CB   3  
ATOM 1885 C CG   . PHE B 2 1  ? 7.674   11.193  -4.462  1.00 0.00 ? 1  PHE B CG   3  
ATOM 1886 C CD1  . PHE B 2 1  ? 6.350   11.319  -4.850  1.00 0.00 ? 1  PHE B CD1  3  
ATOM 1887 C CD2  . PHE B 2 1  ? 8.532   12.260  -4.686  1.00 0.00 ? 1  PHE B CD2  3  
ATOM 1888 C CE1  . PHE B 2 1  ? 5.893   12.479  -5.445  1.00 0.00 ? 1  PHE B CE1  3  
ATOM 1889 C CE2  . PHE B 2 1  ? 8.077   13.421  -5.282  1.00 0.00 ? 1  PHE B CE2  3  
ATOM 1890 C CZ   . PHE B 2 1  ? 6.760   13.531  -5.660  1.00 0.00 ? 1  PHE B CZ   3  
ATOM 1891 H H1   . PHE B 2 1  ? 10.232  7.610   -4.559  1.00 0.00 ? 1  PHE B H1   3  
ATOM 1892 H H2   . PHE B 2 1  ? 9.522   8.056   -3.088  1.00 0.00 ? 1  PHE B H2   3  
ATOM 1893 H H3   . PHE B 2 1  ? 8.824   6.814   -4.023  1.00 0.00 ? 1  PHE B H3   3  
ATOM 1894 H HA   . PHE B 2 1  ? 7.574   8.232   -5.050  1.00 0.00 ? 1  PHE B HA   3  
ATOM 1895 H HB2  . PHE B 2 1  ? 7.480   9.573   -3.064  1.00 0.00 ? 1  PHE B HB2  3  
ATOM 1896 H HB3  . PHE B 2 1  ? 9.118   10.137  -3.242  1.00 0.00 ? 1  PHE B HB3  3  
ATOM 1897 H HD1  . PHE B 2 1  ? 5.660   10.508  -4.683  1.00 0.00 ? 1  PHE B HD1  3  
ATOM 1898 H HD2  . PHE B 2 1  ? 9.568   12.183  -4.391  1.00 0.00 ? 1  PHE B HD2  3  
ATOM 1899 H HE1  . PHE B 2 1  ? 4.860   12.569  -5.746  1.00 0.00 ? 1  PHE B HE1  3  
ATOM 1900 H HE2  . PHE B 2 1  ? 8.752   14.249  -5.461  1.00 0.00 ? 1  PHE B HE2  3  
ATOM 1901 H HZ   . PHE B 2 1  ? 6.403   14.441  -6.121  1.00 0.00 ? 1  PHE B HZ   3  
ATOM 1902 N N    . VAL B 2 2  ? 8.511   9.495   -7.058  1.00 0.00 ? 2  VAL B N    3  
ATOM 1903 C CA   . VAL B 2 2  ? 9.120   10.007  -8.334  1.00 0.00 ? 2  VAL B CA   3  
ATOM 1904 C C    . VAL B 2 2  ? 8.547   11.413  -8.498  1.00 0.00 ? 2  VAL B C    3  
ATOM 1905 O O    . VAL B 2 2  ? 7.842   11.877  -7.624  1.00 0.00 ? 2  VAL B O    3  
ATOM 1906 C CB   . VAL B 2 2  ? 8.719   9.117   -9.557  1.00 0.00 ? 2  VAL B CB   3  
ATOM 1907 C CG1  . VAL B 2 2  ? 9.373   7.725   -9.412  1.00 0.00 ? 2  VAL B CG1  3  
ATOM 1908 C CG2  . VAL B 2 2  ? 7.197   8.982   -9.682  1.00 0.00 ? 2  VAL B CG2  3  
ATOM 1909 H H    . VAL B 2 2  ? 7.543   9.353   -7.012  1.00 0.00 ? 2  VAL B H    3  
ATOM 1910 H HA   . VAL B 2 2  ? 10.195  10.088  -8.240  1.00 0.00 ? 2  VAL B HA   3  
ATOM 1911 H HB   . VAL B 2 2  ? 9.076   9.575   -10.466 1.00 0.00 ? 2  VAL B HB   3  
ATOM 1912 H HG11 . VAL B 2 2  ? 9.054   7.238   -8.506  1.00 0.00 ? 2  VAL B HG11 3  
ATOM 1913 H HG12 . VAL B 2 2  ? 9.120   7.099   -10.255 1.00 0.00 ? 2  VAL B HG12 3  
ATOM 1914 H HG13 . VAL B 2 2  ? 10.447  7.838   -9.386  1.00 0.00 ? 2  VAL B HG13 3  
ATOM 1915 H HG21 . VAL B 2 2  ? 6.763   9.963   -9.786  1.00 0.00 ? 2  VAL B HG21 3  
ATOM 1916 H HG22 . VAL B 2 2  ? 6.955   8.404   -10.560 1.00 0.00 ? 2  VAL B HG22 3  
ATOM 1917 H HG23 . VAL B 2 2  ? 6.768   8.503   -8.814  1.00 0.00 ? 2  VAL B HG23 3  
ATOM 1918 N N    . ASN B 2 3  ? 8.826   12.073  -9.588  1.00 0.00 ? 3  ASN B N    3  
ATOM 1919 C CA   . ASN B 2 3  ? 8.288   13.458  -9.767  1.00 0.00 ? 3  ASN B CA   3  
ATOM 1920 C C    . ASN B 2 3  ? 7.104   13.443  -10.741 1.00 0.00 ? 3  ASN B C    3  
ATOM 1921 O O    . ASN B 2 3  ? 7.056   14.156  -11.727 1.00 0.00 ? 3  ASN B O    3  
ATOM 1922 C CB   . ASN B 2 3  ? 9.475   14.301  -10.265 1.00 0.00 ? 3  ASN B CB   3  
ATOM 1923 C CG   . ASN B 2 3  ? 10.633  14.050  -9.280  1.00 0.00 ? 3  ASN B CG   3  
ATOM 1924 O OD1  . ASN B 2 3  ? 10.673  14.578  -8.186  1.00 0.00 ? 3  ASN B OD1  3  
ATOM 1925 N ND2  . ASN B 2 3  ? 11.588  13.236  -9.627  1.00 0.00 ? 3  ASN B ND2  3  
ATOM 1926 H H    . ASN B 2 3  ? 9.381   11.669  -10.282 1.00 0.00 ? 3  ASN B H    3  
ATOM 1927 H HA   . ASN B 2 3  ? 7.965   13.856  -8.817  1.00 0.00 ? 3  ASN B HA   3  
ATOM 1928 H HB2  . ASN B 2 3  ? 9.767   14.029  -11.266 1.00 0.00 ? 3  ASN B HB2  3  
ATOM 1929 H HB3  . ASN B 2 3  ? 9.215   15.346  -10.238 1.00 0.00 ? 3  ASN B HB3  3  
ATOM 1930 H HD21 . ASN B 2 3  ? 11.569  12.800  -10.505 1.00 0.00 ? 3  ASN B HD21 3  
ATOM 1931 H HD22 . ASN B 2 3  ? 12.330  13.059  -9.011  1.00 0.00 ? 3  ASN B HD22 3  
ATOM 1932 N N    . GLN B 2 4  ? 6.188   12.582  -10.376 1.00 0.00 ? 4  GLN B N    3  
ATOM 1933 C CA   . GLN B 2 4  ? 4.929   12.365  -11.139 1.00 0.00 ? 4  GLN B CA   3  
ATOM 1934 C C    . GLN B 2 4  ? 3.775   12.446  -10.106 1.00 0.00 ? 4  GLN B C    3  
ATOM 1935 O O    . GLN B 2 4  ? 3.975   12.915  -9.002  1.00 0.00 ? 4  GLN B O    3  
ATOM 1936 C CB   . GLN B 2 4  ? 5.088   10.978  -11.828 1.00 0.00 ? 4  GLN B CB   3  
ATOM 1937 C CG   . GLN B 2 4  ? 3.938   10.581  -12.784 1.00 0.00 ? 4  GLN B CG   3  
ATOM 1938 C CD   . GLN B 2 4  ? 3.681   11.672  -13.837 1.00 0.00 ? 4  GLN B CD   3  
ATOM 1939 O OE1  . GLN B 2 4  ? 3.031   12.666  -13.581 1.00 0.00 ? 4  GLN B OE1  3  
ATOM 1940 N NE2  . GLN B 2 4  ? 4.176   11.534  -15.037 1.00 0.00 ? 4  GLN B NE2  3  
ATOM 1941 H H    . GLN B 2 4  ? 6.336   12.055  -9.563  1.00 0.00 ? 4  GLN B H    3  
ATOM 1942 H HA   . GLN B 2 4  ? 4.814   13.174  -11.852 1.00 0.00 ? 4  GLN B HA   3  
ATOM 1943 H HB2  . GLN B 2 4  ? 6.011   10.989  -12.392 1.00 0.00 ? 4  GLN B HB2  3  
ATOM 1944 H HB3  . GLN B 2 4  ? 5.170   10.219  -11.066 1.00 0.00 ? 4  GLN B HB3  3  
ATOM 1945 H HG2  . GLN B 2 4  ? 4.229   9.674   -13.297 1.00 0.00 ? 4  GLN B HG2  3  
ATOM 1946 H HG3  . GLN B 2 4  ? 3.020   10.375  -12.253 1.00 0.00 ? 4  GLN B HG3  3  
ATOM 1947 H HE21 . GLN B 2 4  ? 4.715   10.751  -15.268 1.00 0.00 ? 4  GLN B HE21 3  
ATOM 1948 H HE22 . GLN B 2 4  ? 4.002   12.226  -15.709 1.00 0.00 ? 4  GLN B HE22 3  
ATOM 1949 N N    . HIS B 2 5  ? 2.603   11.994  -10.469 1.00 0.00 ? 5  HIS B N    3  
ATOM 1950 C CA   . HIS B 2 5  ? 1.403   11.989  -9.659  1.00 0.00 ? 5  HIS B CA   3  
ATOM 1951 C C    . HIS B 2 5  ? 1.237   10.479  -9.439  1.00 0.00 ? 5  HIS B C    3  
ATOM 1952 O O    . HIS B 2 5  ? 1.521   9.615   -10.245 1.00 0.00 ? 5  HIS B O    3  
ATOM 1953 C CB   . HIS B 2 5  ? 0.300   12.668  -10.525 1.00 0.00 ? 5  HIS B CB   3  
ATOM 1954 C CG   . HIS B 2 5  ? 0.868   14.004  -11.043 1.00 0.00 ? 5  HIS B CG   3  
ATOM 1955 N ND1  . HIS B 2 5  ? 0.513   14.578  -12.145 1.00 0.00 ? 5  HIS B ND1  3  
ATOM 1956 C CD2  . HIS B 2 5  ? 1.829   14.859  -10.519 1.00 0.00 ? 5  HIS B CD2  3  
ATOM 1957 C CE1  . HIS B 2 5  ? 1.178   15.677  -12.304 1.00 0.00 ? 5  HIS B CE1  3  
ATOM 1958 N NE2  . HIS B 2 5  ? 2.009   15.892  -11.315 1.00 0.00 ? 5  HIS B NE2  3  
ATOM 1959 H H    . HIS B 2 5  ? 2.389   11.585  -11.297 1.00 0.00 ? 5  HIS B H    3  
ATOM 1960 H HA   . HIS B 2 5  ? 1.576   12.515  -8.731  1.00 0.00 ? 5  HIS B HA   3  
ATOM 1961 H HB2  . HIS B 2 5  ? 0.036   12.049  -11.368 1.00 0.00 ? 5  HIS B HB2  3  
ATOM 1962 H HB3  . HIS B 2 5  ? -0.596  12.878  -9.960  1.00 0.00 ? 5  HIS B HB3  3  
ATOM 1963 H HD1  . HIS B 2 5  ? -0.157  14.240  -12.773 1.00 0.00 ? 5  HIS B HD1  3  
ATOM 1964 H HD2  . HIS B 2 5  ? 2.353   14.702  -9.587  1.00 0.00 ? 5  HIS B HD2  3  
ATOM 1965 H HE1  . HIS B 2 5  ? 1.052   16.328  -13.154 1.00 0.00 ? 5  HIS B HE1  3  
ATOM 1966 N N    . LEU B 2 6  ? 0.754   10.307  -8.272  1.00 0.00 ? 6  LEU B N    3  
ATOM 1967 C CA   . LEU B 2 6  ? 0.423   9.011   -7.603  1.00 0.00 ? 6  LEU B CA   3  
ATOM 1968 C C    . LEU B 2 6  ? -1.036  8.532   -7.671  1.00 0.00 ? 6  LEU B C    3  
ATOM 1969 O O    . LEU B 2 6  ? -1.769  8.641   -6.708  1.00 0.00 ? 6  LEU B O    3  
ATOM 1970 C CB   . LEU B 2 6  ? 0.843   9.151   -6.136  1.00 0.00 ? 6  LEU B CB   3  
ATOM 1971 C CG   . LEU B 2 6  ? 2.377   9.262   -5.987  1.00 0.00 ? 6  LEU B CG   3  
ATOM 1972 C CD1  . LEU B 2 6  ? 2.643   9.501   -4.492  1.00 0.00 ? 6  LEU B CD1  3  
ATOM 1973 C CD2  . LEU B 2 6  ? 3.079   7.946   -6.415  1.00 0.00 ? 6  LEU B CD2  3  
ATOM 1974 H H    . LEU B 2 6  ? 0.653   11.183  -7.888  1.00 0.00 ? 6  LEU B H    3  
ATOM 1975 H HA   . LEU B 2 6  ? 1.028   8.240   -8.062  1.00 0.00 ? 6  LEU B HA   3  
ATOM 1976 H HB2  . LEU B 2 6  ? 0.404   10.070  -5.767  1.00 0.00 ? 6  LEU B HB2  3  
ATOM 1977 H HB3  . LEU B 2 6  ? 0.453   8.337   -5.546  1.00 0.00 ? 6  LEU B HB3  3  
ATOM 1978 H HG   . LEU B 2 6  ? 2.758   10.085  -6.574  1.00 0.00 ? 6  LEU B HG   3  
ATOM 1979 H HD11 . LEU B 2 6  ? 2.152   10.408  -4.167  1.00 0.00 ? 6  LEU B HD11 3  
ATOM 1980 H HD12 . LEU B 2 6  ? 2.257   8.673   -3.917  1.00 0.00 ? 6  LEU B HD12 3  
ATOM 1981 H HD13 . LEU B 2 6  ? 3.703   9.596   -4.315  1.00 0.00 ? 6  LEU B HD13 3  
ATOM 1982 H HD21 . LEU B 2 6  ? 2.866   7.700   -7.445  1.00 0.00 ? 6  LEU B HD21 3  
ATOM 1983 H HD22 . LEU B 2 6  ? 4.148   8.060   -6.307  1.00 0.00 ? 6  LEU B HD22 3  
ATOM 1984 H HD23 . LEU B 2 6  ? 2.738   7.127   -5.797  1.00 0.00 ? 6  LEU B HD23 3  
ATOM 1985 N N    . CYS B 2 7  ? -1.391  8.021   -8.821  1.00 0.00 ? 7  CYS B N    3  
ATOM 1986 C CA   . CYS B 2 7  ? -2.774  7.492   -9.069  1.00 0.00 ? 7  CYS B CA   3  
ATOM 1987 C C    . CYS B 2 7  ? -2.618  6.032   -9.577  1.00 0.00 ? 7  CYS B C    3  
ATOM 1988 O O    . CYS B 2 7  ? -1.586  5.706   -10.128 1.00 0.00 ? 7  CYS B O    3  
ATOM 1989 C CB   . CYS B 2 7  ? -3.455  8.455   -10.102 1.00 0.00 ? 7  CYS B CB   3  
ATOM 1990 S SG   . CYS B 2 7  ? -3.906  10.108  -9.506  1.00 0.00 ? 7  CYS B SG   3  
ATOM 1991 H H    . CYS B 2 7  ? -0.721  7.986   -9.535  1.00 0.00 ? 7  CYS B H    3  
ATOM 1992 H HA   . CYS B 2 7  ? -3.332  7.477   -8.150  1.00 0.00 ? 7  CYS B HA   3  
ATOM 1993 H HB2  . CYS B 2 7  ? -2.774  8.588   -10.927 1.00 0.00 ? 7  CYS B HB2  3  
ATOM 1994 H HB3  . CYS B 2 7  ? -4.362  8.033   -10.507 1.00 0.00 ? 7  CYS B HB3  3  
ATOM 1995 N N    . GLY B 2 8  ? -3.630  5.214   -9.375  1.00 0.00 ? 8  GLY B N    3  
ATOM 1996 C CA   . GLY B 2 8  ? -3.661  3.756   -9.788  1.00 0.00 ? 8  GLY B CA   3  
ATOM 1997 C C    . GLY B 2 8  ? -2.378  3.099   -10.404 1.00 0.00 ? 8  GLY B C    3  
ATOM 1998 O O    . GLY B 2 8  ? -1.731  2.385   -9.665  1.00 0.00 ? 8  GLY B O    3  
ATOM 1999 H H    . GLY B 2 8  ? -4.420  5.564   -8.913  1.00 0.00 ? 8  GLY B H    3  
ATOM 2000 H HA2  . GLY B 2 8  ? -3.823  3.219   -8.869  1.00 0.00 ? 8  GLY B HA2  3  
ATOM 2001 H HA3  . GLY B 2 8  ? -4.565  3.548   -10.357 1.00 0.00 ? 8  GLY B HA3  3  
ATOM 2002 N N    . SER B 2 9  ? -2.007  3.304   -11.656 1.00 0.00 ? 9  SER B N    3  
ATOM 2003 C CA   . SER B 2 9  ? -0.772  2.661   -12.230 1.00 0.00 ? 9  SER B CA   3  
ATOM 2004 C C    . SER B 2 9  ? 0.498   2.499   -11.383 1.00 0.00 ? 9  SER B C    3  
ATOM 2005 O O    . SER B 2 9  ? 1.186   1.504   -11.485 1.00 0.00 ? 9  SER B O    3  
ATOM 2006 C CB   . SER B 2 9  ? -0.363  3.423   -13.523 1.00 0.00 ? 9  SER B CB   3  
ATOM 2007 O OG   . SER B 2 9  ? -1.399  3.128   -14.457 1.00 0.00 ? 9  SER B OG   3  
ATOM 2008 H H    . SER B 2 9  ? -2.499  3.881   -12.277 1.00 0.00 ? 9  SER B H    3  
ATOM 2009 H HA   . SER B 2 9  ? -1.057  1.667   -12.518 1.00 0.00 ? 9  SER B HA   3  
ATOM 2010 H HB2  . SER B 2 9  ? -0.327  4.496   -13.399 1.00 0.00 ? 9  SER B HB2  3  
ATOM 2011 H HB3  . SER B 2 9  ? 0.583   3.072   -13.905 1.00 0.00 ? 9  SER B HB3  3  
ATOM 2012 H HG   . SER B 2 9  ? -2.155  2.775   -13.982 1.00 0.00 ? 9  SER B HG   3  
ATOM 2013 N N    . HIS B 2 10 ? 0.754   3.470   -10.555 1.00 0.00 ? 10 HIS B N    3  
ATOM 2014 C CA   . HIS B 2 10 ? 1.978   3.440   -9.697  1.00 0.00 ? 10 HIS B CA   3  
ATOM 2015 C C    . HIS B 2 10 ? 1.746   2.932   -8.293  1.00 0.00 ? 10 HIS B C    3  
ATOM 2016 O O    . HIS B 2 10 ? 2.646   2.333   -7.736  1.00 0.00 ? 10 HIS B O    3  
ATOM 2017 C CB   . HIS B 2 10 ? 2.576   4.855   -9.620  1.00 0.00 ? 10 HIS B CB   3  
ATOM 2018 C CG   . HIS B 2 10 ? 2.614   5.437   -11.036 1.00 0.00 ? 10 HIS B CG   3  
ATOM 2019 N ND1  . HIS B 2 10 ? 1.579   5.919   -11.640 1.00 0.00 ? 10 HIS B ND1  3  
ATOM 2020 C CD2  . HIS B 2 10 ? 3.642   5.576   -11.954 1.00 0.00 ? 10 HIS B CD2  3  
ATOM 2021 C CE1  . HIS B 2 10 ? 1.913   6.328   -12.822 1.00 0.00 ? 10 HIS B CE1  3  
ATOM 2022 N NE2  . HIS B 2 10 ? 3.188   6.134   -13.059 1.00 0.00 ? 10 HIS B NE2  3  
ATOM 2023 H H    . HIS B 2 10 ? 0.122   4.205   -10.488 1.00 0.00 ? 10 HIS B H    3  
ATOM 2024 H HA   . HIS B 2 10 ? 2.718   2.811   -10.173 1.00 0.00 ? 10 HIS B HA   3  
ATOM 2025 H HB2  . HIS B 2 10 ? 2.009   5.513   -8.979  1.00 0.00 ? 10 HIS B HB2  3  
ATOM 2026 H HB3  . HIS B 2 10 ? 3.587   4.792   -9.252  1.00 0.00 ? 10 HIS B HB3  3  
ATOM 2027 H HD1  . HIS B 2 10 ? 0.679   5.968   -11.252 1.00 0.00 ? 10 HIS B HD1  3  
ATOM 2028 H HD2  . HIS B 2 10 ? 4.670   5.275   -11.799 1.00 0.00 ? 10 HIS B HD2  3  
ATOM 2029 H HE1  . HIS B 2 10 ? 1.232   6.776   -13.527 1.00 0.00 ? 10 HIS B HE1  3  
ATOM 2030 N N    . LEU B 2 11 ? 0.575   3.152   -7.742  1.00 0.00 ? 11 LEU B N    3  
ATOM 2031 C CA   . LEU B 2 11 ? 0.356   2.647   -6.356  1.00 0.00 ? 11 LEU B CA   3  
ATOM 2032 C C    . LEU B 2 11 ? 0.154   1.146   -6.496  1.00 0.00 ? 11 LEU B C    3  
ATOM 2033 O O    . LEU B 2 11 ? 0.548   0.411   -5.613  1.00 0.00 ? 11 LEU B O    3  
ATOM 2034 C CB   . LEU B 2 11 ? -0.907  3.260   -5.692  1.00 0.00 ? 11 LEU B CB   3  
ATOM 2035 C CG   . LEU B 2 11 ? -0.946  4.797   -5.764  1.00 0.00 ? 11 LEU B CG   3  
ATOM 2036 C CD1  . LEU B 2 11 ? -2.283  5.243   -5.141  1.00 0.00 ? 11 LEU B CD1  3  
ATOM 2037 C CD2  . LEU B 2 11 ? 0.211   5.411   -4.948  1.00 0.00 ? 11 LEU B CD2  3  
ATOM 2038 H H    . LEU B 2 11 ? -0.138  3.620   -8.221  1.00 0.00 ? 11 LEU B H    3  
ATOM 2039 H HA   . LEU B 2 11 ? 1.238   2.835   -5.760  1.00 0.00 ? 11 LEU B HA   3  
ATOM 2040 H HB2  . LEU B 2 11 ? -1.833  2.843   -6.056  1.00 0.00 ? 11 LEU B HB2  3  
ATOM 2041 H HB3  . LEU B 2 11 ? -0.834  3.014   -4.642  1.00 0.00 ? 11 LEU B HB3  3  
ATOM 2042 H HG   . LEU B 2 11 ? -0.899  5.124   -6.792  1.00 0.00 ? 11 LEU B HG   3  
ATOM 2043 H HD11 . LEU B 2 11 ? -2.368  4.920   -4.113  1.00 0.00 ? 11 LEU B HD11 3  
ATOM 2044 H HD12 . LEU B 2 11 ? -2.358  6.321   -5.171  1.00 0.00 ? 11 LEU B HD12 3  
ATOM 2045 H HD13 . LEU B 2 11 ? -3.104  4.827   -5.706  1.00 0.00 ? 11 LEU B HD13 3  
ATOM 2046 H HD21 . LEU B 2 11 ? 0.161   5.086   -3.919  1.00 0.00 ? 11 LEU B HD21 3  
ATOM 2047 H HD22 . LEU B 2 11 ? 1.162   5.126   -5.374  1.00 0.00 ? 11 LEU B HD22 3  
ATOM 2048 H HD23 . LEU B 2 11 ? 0.138   6.484   -4.966  1.00 0.00 ? 11 LEU B HD23 3  
ATOM 2049 N N    . VAL B 2 12 ? -0.437  0.718   -7.594  1.00 0.00 ? 12 VAL B N    3  
ATOM 2050 C CA   . VAL B 2 12 ? -0.644  -0.738  -7.760  1.00 0.00 ? 12 VAL B CA   3  
ATOM 2051 C C    . VAL B 2 12 ? 0.705   -1.347  -8.130  1.00 0.00 ? 12 VAL B C    3  
ATOM 2052 O O    . VAL B 2 12 ? 1.074   -2.334  -7.533  1.00 0.00 ? 12 VAL B O    3  
ATOM 2053 C CB   . VAL B 2 12 ? -1.708  -1.024  -8.885  1.00 0.00 ? 12 VAL B CB   3  
ATOM 2054 C CG1  . VAL B 2 12 ? -1.481  -2.418  -9.514  1.00 0.00 ? 12 VAL B CG1  3  
ATOM 2055 C CG2  . VAL B 2 12 ? -3.088  -1.106  -8.212  1.00 0.00 ? 12 VAL B CG2  3  
ATOM 2056 H H    . VAL B 2 12 ? -0.739  1.318   -8.306  1.00 0.00 ? 12 VAL B H    3  
ATOM 2057 H HA   . VAL B 2 12 ? -1.002  -1.155  -6.832  1.00 0.00 ? 12 VAL B HA   3  
ATOM 2058 H HB   . VAL B 2 12 ? -1.698  -0.256  -9.646  1.00 0.00 ? 12 VAL B HB   3  
ATOM 2059 H HG11 . VAL B 2 12 ? -1.519  -3.174  -8.745  1.00 0.00 ? 12 VAL B HG11 3  
ATOM 2060 H HG12 . VAL B 2 12 ? -2.240  -2.636  -10.249 1.00 0.00 ? 12 VAL B HG12 3  
ATOM 2061 H HG13 . VAL B 2 12 ? -0.516  -2.455  -10.002 1.00 0.00 ? 12 VAL B HG13 3  
ATOM 2062 H HG21 . VAL B 2 12 ? -3.084  -1.885  -7.457  1.00 0.00 ? 12 VAL B HG21 3  
ATOM 2063 H HG22 . VAL B 2 12 ? -3.327  -0.168  -7.750  1.00 0.00 ? 12 VAL B HG22 3  
ATOM 2064 H HG23 . VAL B 2 12 ? -3.852  -1.335  -8.937  1.00 0.00 ? 12 VAL B HG23 3  
ATOM 2065 N N    . GLU B 2 13 ? 1.430   -0.777  -9.065  1.00 0.00 ? 13 GLU B N    3  
ATOM 2066 C CA   . GLU B 2 13 ? 2.738   -1.435  -9.376  1.00 0.00 ? 13 GLU B CA   3  
ATOM 2067 C C    . GLU B 2 13 ? 3.658   -1.442  -8.133  1.00 0.00 ? 13 GLU B C    3  
ATOM 2068 O O    . GLU B 2 13 ? 4.435   -2.360  -7.959  1.00 0.00 ? 13 GLU B O    3  
ATOM 2069 C CB   . GLU B 2 13 ? 3.403   -0.689  -10.569 1.00 0.00 ? 13 GLU B CB   3  
ATOM 2070 C CG   . GLU B 2 13 ? 4.268   -1.712  -11.355 1.00 0.00 ? 13 GLU B CG   3  
ATOM 2071 C CD   . GLU B 2 13 ? 4.817   -1.071  -12.643 1.00 0.00 ? 13 GLU B CD   3  
ATOM 2072 O OE1  . GLU B 2 13 ? 5.636   -0.174  -12.512 1.00 0.00 ? 13 GLU B OE1  3  
ATOM 2073 O OE2  . GLU B 2 13 ? 4.386   -1.522  -13.692 1.00 0.00 ? 13 GLU B OE2  3  
ATOM 2074 H H    . GLU B 2 13 ? 1.135   0.043   -9.527  1.00 0.00 ? 13 GLU B H    3  
ATOM 2075 H HA   . GLU B 2 13 ? 2.522   -2.462  -9.643  1.00 0.00 ? 13 GLU B HA   3  
ATOM 2076 H HB2  . GLU B 2 13 ? 2.646   -0.306  -11.236 1.00 0.00 ? 13 GLU B HB2  3  
ATOM 2077 H HB3  . GLU B 2 13 ? 4.020   0.126   -10.225 1.00 0.00 ? 13 GLU B HB3  3  
ATOM 2078 H HG2  . GLU B 2 13 ? 5.094   -2.064  -10.761 1.00 0.00 ? 13 GLU B HG2  3  
ATOM 2079 H HG3  . GLU B 2 13 ? 3.663   -2.567  -11.626 1.00 0.00 ? 13 GLU B HG3  3  
ATOM 2080 N N    . ALA B 2 14 ? 3.531   -0.442  -7.295  1.00 0.00 ? 14 ALA B N    3  
ATOM 2081 C CA   . ALA B 2 14 ? 4.389   -0.373  -6.068  1.00 0.00 ? 14 ALA B CA   3  
ATOM 2082 C C    . ALA B 2 14 ? 3.943   -1.329  -4.946  1.00 0.00 ? 14 ALA B C    3  
ATOM 2083 O O    . ALA B 2 14 ? 4.772   -2.011  -4.391  1.00 0.00 ? 14 ALA B O    3  
ATOM 2084 C CB   . ALA B 2 14 ? 4.376   1.071   -5.546  1.00 0.00 ? 14 ALA B CB   3  
ATOM 2085 H H    . ALA B 2 14 ? 2.872   0.261   -7.463  1.00 0.00 ? 14 ALA B H    3  
ATOM 2086 H HA   . ALA B 2 14 ? 5.406   -0.617  -6.343  1.00 0.00 ? 14 ALA B HA   3  
ATOM 2087 H HB1  . ALA B 2 14 ? 4.754   1.737   -6.306  1.00 0.00 ? 14 ALA B HB1  3  
ATOM 2088 H HB2  . ALA B 2 14 ? 3.373   1.370   -5.288  1.00 0.00 ? 14 ALA B HB2  3  
ATOM 2089 H HB3  . ALA B 2 14 ? 5.001   1.161   -4.671  1.00 0.00 ? 14 ALA B HB3  3  
ATOM 2090 N N    . LEU B 2 15 ? 2.668   -1.389  -4.633  1.00 0.00 ? 15 LEU B N    3  
ATOM 2091 C CA   . LEU B 2 15 ? 2.219   -2.315  -3.534  1.00 0.00 ? 15 LEU B CA   3  
ATOM 2092 C C    . LEU B 2 15 ? 2.612   -3.758  -3.894  1.00 0.00 ? 15 LEU B C    3  
ATOM 2093 O O    . LEU B 2 15 ? 3.118   -4.509  -3.079  1.00 0.00 ? 15 LEU B O    3  
ATOM 2094 C CB   . LEU B 2 15 ? 0.644   -2.101  -3.350  1.00 0.00 ? 15 LEU B CB   3  
ATOM 2095 C CG   . LEU B 2 15 ? -0.098  -2.885  -2.257  1.00 0.00 ? 15 LEU B CG   3  
ATOM 2096 C CD1  . LEU B 2 15 ? -1.579  -2.829  -2.638  1.00 0.00 ? 15 LEU B CD1  3  
ATOM 2097 C CD2  . LEU B 2 15 ? 0.411   -4.304  -2.031  1.00 0.00 ? 15 LEU B CD2  3  
ATOM 2098 H H    . LEU B 2 15 ? 2.013   -0.843  -5.112  1.00 0.00 ? 15 LEU B H    3  
ATOM 2099 H HA   . LEU B 2 15 ? 2.737   -2.044  -2.639  1.00 0.00 ? 15 LEU B HA   3  
ATOM 2100 H HB2  . LEU B 2 15 ? 0.529   -1.112  -2.985  1.00 0.00 ? 15 LEU B HB2  3  
ATOM 2101 H HB3  . LEU B 2 15 ? 0.032   -2.121  -4.233  1.00 0.00 ? 15 LEU B HB3  3  
ATOM 2102 H HG   . LEU B 2 15 ? -0.009  -2.360  -1.320  1.00 0.00 ? 15 LEU B HG   3  
ATOM 2103 H HD11 . LEU B 2 15 ? -1.726  -3.233  -3.625  1.00 0.00 ? 15 LEU B HD11 3  
ATOM 2104 H HD12 . LEU B 2 15 ? -2.186  -3.369  -1.930  1.00 0.00 ? 15 LEU B HD12 3  
ATOM 2105 H HD13 . LEU B 2 15 ? -1.890  -1.799  -2.655  1.00 0.00 ? 15 LEU B HD13 3  
ATOM 2106 H HD21 . LEU B 2 15 ? 0.433   -4.856  -2.957  1.00 0.00 ? 15 LEU B HD21 3  
ATOM 2107 H HD22 . LEU B 2 15 ? 1.401   -4.264  -1.606  1.00 0.00 ? 15 LEU B HD22 3  
ATOM 2108 H HD23 . LEU B 2 15 ? -0.226  -4.803  -1.318  1.00 0.00 ? 15 LEU B HD23 3  
ATOM 2109 N N    . TYR B 2 16 ? 2.394   -4.085  -5.131  1.00 0.00 ? 16 TYR B N    3  
ATOM 2110 C CA   . TYR B 2 16 ? 2.707   -5.440  -5.630  1.00 0.00 ? 16 TYR B CA   3  
ATOM 2111 C C    . TYR B 2 16 ? 4.238   -5.619  -5.756  1.00 0.00 ? 16 TYR B C    3  
ATOM 2112 O O    . TYR B 2 16 ? 4.703   -6.737  -5.876  1.00 0.00 ? 16 TYR B O    3  
ATOM 2113 C CB   . TYR B 2 16 ? 1.956   -5.565  -6.964  1.00 0.00 ? 16 TYR B CB   3  
ATOM 2114 C CG   . TYR B 2 16 ? 0.424   -5.675  -6.697  1.00 0.00 ? 16 TYR B CG   3  
ATOM 2115 C CD1  . TYR B 2 16 ? -0.339  -4.603  -6.259  1.00 0.00 ? 16 TYR B CD1  3  
ATOM 2116 C CD2  . TYR B 2 16 ? -0.218  -6.878  -6.894  1.00 0.00 ? 16 TYR B CD2  3  
ATOM 2117 C CE1  . TYR B 2 16 ? -1.693  -4.737  -6.036  1.00 0.00 ? 16 TYR B CE1  3  
ATOM 2118 C CE2  . TYR B 2 16 ? -1.578  -7.022  -6.668  1.00 0.00 ? 16 TYR B CE2  3  
ATOM 2119 C CZ   . TYR B 2 16 ? -2.326  -5.947  -6.237  1.00 0.00 ? 16 TYR B CZ   3  
ATOM 2120 O OH   . TYR B 2 16 ? -3.681  -6.090  -6.009  1.00 0.00 ? 16 TYR B OH   3  
ATOM 2121 H H    . TYR B 2 16 ? 2.040   -3.440  -5.771  1.00 0.00 ? 16 TYR B H    3  
ATOM 2122 H HA   . TYR B 2 16 ? 2.318   -6.168  -4.924  1.00 0.00 ? 16 TYR B HA   3  
ATOM 2123 H HB2  . TYR B 2 16 ? 2.133   -4.688  -7.576  1.00 0.00 ? 16 TYR B HB2  3  
ATOM 2124 H HB3  . TYR B 2 16 ? 2.293   -6.422  -7.509  1.00 0.00 ? 16 TYR B HB3  3  
ATOM 2125 H HD1  . TYR B 2 16 ? 0.115   -3.646  -6.075  1.00 0.00 ? 16 TYR B HD1  3  
ATOM 2126 H HD2  . TYR B 2 16 ? 0.358   -7.723  -7.231  1.00 0.00 ? 16 TYR B HD2  3  
ATOM 2127 H HE1  . TYR B 2 16 ? -2.258  -3.881  -5.698  1.00 0.00 ? 16 TYR B HE1  3  
ATOM 2128 H HE2  . TYR B 2 16 ? -2.056  -7.977  -6.829  1.00 0.00 ? 16 TYR B HE2  3  
ATOM 2129 H HH   . TYR B 2 16 ? -4.037  -5.240  -5.740  1.00 0.00 ? 16 TYR B HH   3  
ATOM 2130 N N    . LEU B 2 17 ? 4.953   -4.513  -5.716  1.00 0.00 ? 17 LEU B N    3  
ATOM 2131 C CA   . LEU B 2 17 ? 6.450   -4.522  -5.816  1.00 0.00 ? 17 LEU B CA   3  
ATOM 2132 C C    . LEU B 2 17 ? 7.109   -4.573  -4.410  1.00 0.00 ? 17 LEU B C    3  
ATOM 2133 O O    . LEU B 2 17 ? 8.195   -5.108  -4.286  1.00 0.00 ? 17 LEU B O    3  
ATOM 2134 C CB   . LEU B 2 17 ? 6.908   -3.228  -6.584  1.00 0.00 ? 17 LEU B CB   3  
ATOM 2135 C CG   . LEU B 2 17 ? 8.449   -3.123  -6.748  1.00 0.00 ? 17 LEU B CG   3  
ATOM 2136 C CD1  . LEU B 2 17 ? 9.007   -4.349  -7.500  1.00 0.00 ? 17 LEU B CD1  3  
ATOM 2137 C CD2  . LEU B 2 17 ? 8.788   -1.843  -7.541  1.00 0.00 ? 17 LEU B CD2  3  
ATOM 2138 H H    . LEU B 2 17 ? 4.495   -3.650  -5.637  1.00 0.00 ? 17 LEU B H    3  
ATOM 2139 H HA   . LEU B 2 17 ? 6.742   -5.399  -6.379  1.00 0.00 ? 17 LEU B HA   3  
ATOM 2140 H HB2  . LEU B 2 17 ? 6.465   -3.222  -7.566  1.00 0.00 ? 17 LEU B HB2  3  
ATOM 2141 H HB3  . LEU B 2 17 ? 6.585   -2.343  -6.055  1.00 0.00 ? 17 LEU B HB3  3  
ATOM 2142 H HG   . LEU B 2 17 ? 8.925   -3.055  -5.783  1.00 0.00 ? 17 LEU B HG   3  
ATOM 2143 H HD11 . LEU B 2 17 ? 8.561   -4.422  -8.479  1.00 0.00 ? 17 LEU B HD11 3  
ATOM 2144 H HD12 . LEU B 2 17 ? 10.078  -4.245  -7.616  1.00 0.00 ? 17 LEU B HD12 3  
ATOM 2145 H HD13 . LEU B 2 17 ? 8.801   -5.256  -6.954  1.00 0.00 ? 17 LEU B HD13 3  
ATOM 2146 H HD21 . LEU B 2 17 ? 8.334   -1.860  -8.519  1.00 0.00 ? 17 LEU B HD21 3  
ATOM 2147 H HD22 . LEU B 2 17 ? 8.433   -0.972  -7.014  1.00 0.00 ? 17 LEU B HD22 3  
ATOM 2148 H HD23 . LEU B 2 17 ? 9.854   -1.759  -7.661  1.00 0.00 ? 17 LEU B HD23 3  
ATOM 2149 N N    . VAL B 2 18 ? 6.461   -4.034  -3.403  1.00 0.00 ? 18 VAL B N    3  
ATOM 2150 C CA   . VAL B 2 18 ? 7.035   -4.041  -2.019  1.00 0.00 ? 18 VAL B CA   3  
ATOM 2151 C C    . VAL B 2 18 ? 6.807   -5.381  -1.304  1.00 0.00 ? 18 VAL B C    3  
ATOM 2152 O O    . VAL B 2 18 ? 7.725   -5.850  -0.664  1.00 0.00 ? 18 VAL B O    3  
ATOM 2153 C CB   . VAL B 2 18 ? 6.389   -2.898  -1.179  1.00 0.00 ? 18 VAL B CB   3  
ATOM 2154 C CG1  . VAL B 2 18 ? 7.005   -2.908  0.239   1.00 0.00 ? 18 VAL B CG1  3  
ATOM 2155 C CG2  . VAL B 2 18 ? 6.688   -1.525  -1.809  1.00 0.00 ? 18 VAL B CG2  3  
ATOM 2156 H H    . VAL B 2 18 ? 5.590   -3.617  -3.556  1.00 0.00 ? 18 VAL B H    3  
ATOM 2157 H HA   . VAL B 2 18 ? 8.104   -3.867  -2.093  1.00 0.00 ? 18 VAL B HA   3  
ATOM 2158 H HB   . VAL B 2 18 ? 5.319   -3.043  -1.113  1.00 0.00 ? 18 VAL B HB   3  
ATOM 2159 H HG11 . VAL B 2 18 ? 8.078   -2.780  0.183   1.00 0.00 ? 18 VAL B HG11 3  
ATOM 2160 H HG12 . VAL B 2 18 ? 6.579   -2.123  0.843   1.00 0.00 ? 18 VAL B HG12 3  
ATOM 2161 H HG13 . VAL B 2 18 ? 6.807   -3.856  0.713   1.00 0.00 ? 18 VAL B HG13 3  
ATOM 2162 H HG21 . VAL B 2 18 ? 7.755   -1.355  -1.857  1.00 0.00 ? 18 VAL B HG21 3  
ATOM 2163 H HG22 . VAL B 2 18 ? 6.286   -1.471  -2.806  1.00 0.00 ? 18 VAL B HG22 3  
ATOM 2164 H HG23 . VAL B 2 18 ? 6.237   -0.742  -1.215  1.00 0.00 ? 18 VAL B HG23 3  
ATOM 2165 N N    . CYS B 2 19 ? 5.626   -5.951  -1.422  1.00 0.00 ? 19 CYS B N    3  
ATOM 2166 C CA   . CYS B 2 19 ? 5.315   -7.261  -0.756  1.00 0.00 ? 19 CYS B CA   3  
ATOM 2167 C C    . CYS B 2 19 ? 6.425   -8.301  -0.939  1.00 0.00 ? 19 CYS B C    3  
ATOM 2168 O O    . CYS B 2 19 ? 6.514   -9.255  -0.189  1.00 0.00 ? 19 CYS B O    3  
ATOM 2169 C CB   . CYS B 2 19 ? 3.974   -7.813  -1.314  1.00 0.00 ? 19 CYS B CB   3  
ATOM 2170 S SG   . CYS B 2 19 ? 2.449   -7.046  -0.711  1.00 0.00 ? 19 CYS B SG   3  
ATOM 2171 H H    . CYS B 2 19 ? 4.939   -5.529  -1.960  1.00 0.00 ? 19 CYS B H    3  
ATOM 2172 H HA   . CYS B 2 19 ? 5.193   -7.097  0.297   1.00 0.00 ? 19 CYS B HA   3  
ATOM 2173 H HB2  . CYS B 2 19 ? 3.956   -7.656  -2.375  1.00 0.00 ? 19 CYS B HB2  3  
ATOM 2174 H HB3  . CYS B 2 19 ? 3.902   -8.877  -1.131  1.00 0.00 ? 19 CYS B HB3  3  
ATOM 2175 N N    . GLY B 2 20 ? 7.231   -8.066  -1.944  1.00 0.00 ? 20 GLY B N    3  
ATOM 2176 C CA   . GLY B 2 20 ? 8.373   -8.983  -2.259  1.00 0.00 ? 20 GLY B CA   3  
ATOM 2177 C C    . GLY B 2 20 ? 8.095   -9.608  -3.621  1.00 0.00 ? 20 GLY B C    3  
ATOM 2178 O O    . GLY B 2 20 ? 8.279   -10.800 -3.781  1.00 0.00 ? 20 GLY B O    3  
ATOM 2179 H H    . GLY B 2 20 ? 7.053   -7.261  -2.490  1.00 0.00 ? 20 GLY B H    3  
ATOM 2180 H HA2  . GLY B 2 20 ? 9.325   -8.459  -2.239  1.00 0.00 ? 20 GLY B HA2  3  
ATOM 2181 H HA3  . GLY B 2 20 ? 8.402   -9.767  -1.517  1.00 0.00 ? 20 GLY B HA3  3  
ATOM 2182 N N    . GLU B 2 21 ? 7.667   -8.800  -4.573  1.00 0.00 ? 21 GLU B N    3  
ATOM 2183 C CA   . GLU B 2 21 ? 7.358   -9.314  -5.942  1.00 0.00 ? 21 GLU B CA   3  
ATOM 2184 C C    . GLU B 2 21 ? 6.265   -10.396 -5.800  1.00 0.00 ? 21 GLU B C    3  
ATOM 2185 O O    . GLU B 2 21 ? 6.409   -11.522 -6.234  1.00 0.00 ? 21 GLU B O    3  
ATOM 2186 C CB   . GLU B 2 21 ? 8.657   -9.904  -6.588  1.00 0.00 ? 21 GLU B CB   3  
ATOM 2187 C CG   . GLU B 2 21 ? 9.745   -8.801  -6.818  1.00 0.00 ? 21 GLU B CG   3  
ATOM 2188 C CD   . GLU B 2 21 ? 10.258  -8.198  -5.495  1.00 0.00 ? 21 GLU B CD   3  
ATOM 2189 O OE1  . GLU B 2 21 ? 10.842  -8.952  -4.734  1.00 0.00 ? 21 GLU B OE1  3  
ATOM 2190 O OE2  . GLU B 2 21 ? 10.037  -7.012  -5.313  1.00 0.00 ? 21 GLU B OE2  3  
ATOM 2191 H H    . GLU B 2 21 ? 7.528   -7.840  -4.425  1.00 0.00 ? 21 GLU B H    3  
ATOM 2192 H HA   . GLU B 2 21 ? 6.970   -8.502  -6.535  1.00 0.00 ? 21 GLU B HA   3  
ATOM 2193 H HB2  . GLU B 2 21 ? 9.053   -10.695 -5.971  1.00 0.00 ? 21 GLU B HB2  3  
ATOM 2194 H HB3  . GLU B 2 21 ? 8.390   -10.338 -7.536  1.00 0.00 ? 21 GLU B HB3  3  
ATOM 2195 H HG2  . GLU B 2 21 ? 10.589  -9.228  -7.336  1.00 0.00 ? 21 GLU B HG2  3  
ATOM 2196 H HG3  . GLU B 2 21 ? 9.340   -8.000  -7.423  1.00 0.00 ? 21 GLU B HG3  3  
ATOM 2197 N N    . ARG B 2 22 ? 5.189   -9.974  -5.182  1.00 0.00 ? 22 ARG B N    3  
ATOM 2198 C CA   . ARG B 2 22 ? 4.001   -10.856 -4.935  1.00 0.00 ? 22 ARG B CA   3  
ATOM 2199 C C    . ARG B 2 22 ? 2.814   -10.246 -5.700  1.00 0.00 ? 22 ARG B C    3  
ATOM 2200 O O    . ARG B 2 22 ? 2.817   -9.068  -6.002  1.00 0.00 ? 22 ARG B O    3  
ATOM 2201 C CB   . ARG B 2 22 ? 3.705   -10.890 -3.411  1.00 0.00 ? 22 ARG B CB   3  
ATOM 2202 C CG   . ARG B 2 22 ? 2.509   -11.824 -3.010  1.00 0.00 ? 22 ARG B CG   3  
ATOM 2203 C CD   . ARG B 2 22 ? 2.710   -13.336 -3.322  1.00 0.00 ? 22 ARG B CD   3  
ATOM 2204 N NE   . ARG B 2 22 ? 2.616   -13.596 -4.803  1.00 0.00 ? 22 ARG B NE   3  
ATOM 2205 C CZ   . ARG B 2 22 ? 1.585   -14.180 -5.371  1.00 0.00 ? 22 ARG B CZ   3  
ATOM 2206 N NH1  . ARG B 2 22 ? 0.618   -14.716 -4.671  1.00 0.00 ? 22 ARG B NH1  3  
ATOM 2207 N NH2  . ARG B 2 22 ? 1.558   -14.205 -6.677  1.00 0.00 ? 22 ARG B NH2  3  
ATOM 2208 H H    . ARG B 2 22 ? 5.162   -9.047  -4.873  1.00 0.00 ? 22 ARG B H    3  
ATOM 2209 H HA   . ARG B 2 22 ? 4.211   -11.844 -5.316  1.00 0.00 ? 22 ARG B HA   3  
ATOM 2210 H HB2  . ARG B 2 22 ? 4.600   -11.122 -2.842  1.00 0.00 ? 22 ARG B HB2  3  
ATOM 2211 H HB3  . ARG B 2 22 ? 3.409   -9.887  -3.140  1.00 0.00 ? 22 ARG B HB3  3  
ATOM 2212 H HG2  . ARG B 2 22 ? 2.354   -11.719 -1.943  1.00 0.00 ? 22 ARG B HG2  3  
ATOM 2213 H HG3  . ARG B 2 22 ? 1.610   -11.478 -3.494  1.00 0.00 ? 22 ARG B HG3  3  
ATOM 2214 H HD2  . ARG B 2 22 ? 3.685   -13.652 -2.983  1.00 0.00 ? 22 ARG B HD2  3  
ATOM 2215 H HD3  . ARG B 2 22 ? 1.970   -13.913 -2.788  1.00 0.00 ? 22 ARG B HD3  3  
ATOM 2216 H HE   . ARG B 2 22 ? 3.358   -13.327 -5.382  1.00 0.00 ? 22 ARG B HE   3  
ATOM 2217 H HH11 . ARG B 2 22 ? 0.630   -14.700 -3.673  1.00 0.00 ? 22 ARG B HH11 3  
ATOM 2218 H HH12 . ARG B 2 22 ? -0.143  -15.153 -5.150  1.00 0.00 ? 22 ARG B HH12 3  
ATOM 2219 H HH21 . ARG B 2 22 ? 2.300   -13.778 -7.193  1.00 0.00 ? 22 ARG B HH21 3  
ATOM 2220 H HH22 . ARG B 2 22 ? 0.798   -14.649 -7.158  1.00 0.00 ? 22 ARG B HH22 3  
ATOM 2221 N N    . GLY B 2 23 ? 1.831   -11.067 -5.980  1.00 0.00 ? 23 GLY B N    3  
ATOM 2222 C CA   . GLY B 2 23 ? 0.620   -10.607 -6.723  1.00 0.00 ? 23 GLY B CA   3  
ATOM 2223 C C    . GLY B 2 23 ? -0.752  -11.019 -6.153  1.00 0.00 ? 23 GLY B C    3  
ATOM 2224 O O    . GLY B 2 23 ? -1.609  -11.330 -6.958  1.00 0.00 ? 23 GLY B O    3  
ATOM 2225 H H    . GLY B 2 23 ? 1.898   -11.996 -5.694  1.00 0.00 ? 23 GLY B H    3  
ATOM 2226 H HA2  . GLY B 2 23 ? 0.638   -9.540  -6.828  1.00 0.00 ? 23 GLY B HA2  3  
ATOM 2227 H HA3  . GLY B 2 23 ? 0.696   -11.019 -7.715  1.00 0.00 ? 23 GLY B HA3  3  
ATOM 2228 N N    . PHE B 2 24 ? -0.915  -11.016 -4.847  1.00 0.00 ? 24 PHE B N    3  
ATOM 2229 C CA   . PHE B 2 24 ? -2.211  -11.391 -4.175  1.00 0.00 ? 24 PHE B CA   3  
ATOM 2230 C C    . PHE B 2 24 ? -3.488  -11.367 -5.074  1.00 0.00 ? 24 PHE B C    3  
ATOM 2231 O O    . PHE B 2 24 ? -4.193  -12.358 -5.113  1.00 0.00 ? 24 PHE B O    3  
ATOM 2232 C CB   . PHE B 2 24 ? -2.353  -10.449 -2.881  1.00 0.00 ? 24 PHE B CB   3  
ATOM 2233 C CG   . PHE B 2 24 ? -2.113  -8.914  -3.032  1.00 0.00 ? 24 PHE B CG   3  
ATOM 2234 C CD1  . PHE B 2 24 ? -0.957  -8.381  -3.570  1.00 0.00 ? 24 PHE B CD1  3  
ATOM 2235 C CD2  . PHE B 2 24 ? -3.112  -8.066  -2.589  1.00 0.00 ? 24 PHE B CD2  3  
ATOM 2236 C CE1  . PHE B 2 24 ? -0.810  -7.023  -3.662  1.00 0.00 ? 24 PHE B CE1  3  
ATOM 2237 C CE2  . PHE B 2 24 ? -2.963  -6.709  -2.680  1.00 0.00 ? 24 PHE B CE2  3  
ATOM 2238 C CZ   . PHE B 2 24 ? -1.810  -6.195  -3.220  1.00 0.00 ? 24 PHE B CZ   3  
ATOM 2239 H H    . PHE B 2 24 ? -0.165  -10.767 -4.269  1.00 0.00 ? 24 PHE B H    3  
ATOM 2240 H HA   . PHE B 2 24 ? -2.099  -12.403 -3.809  1.00 0.00 ? 24 PHE B HA   3  
ATOM 2241 H HB2  . PHE B 2 24 ? -3.339  -10.606 -2.461  1.00 0.00 ? 24 PHE B HB2  3  
ATOM 2242 H HB3  . PHE B 2 24 ? -1.645  -10.799 -2.145  1.00 0.00 ? 24 PHE B HB3  3  
ATOM 2243 H HD1  . PHE B 2 24 ? -0.159  -9.012  -3.921  1.00 0.00 ? 24 PHE B HD1  3  
ATOM 2244 H HD2  . PHE B 2 24 ? -4.020  -8.471  -2.167  1.00 0.00 ? 24 PHE B HD2  3  
ATOM 2245 H HE1  . PHE B 2 24 ? 0.097   -6.612  -4.084  1.00 0.00 ? 24 PHE B HE1  3  
ATOM 2246 H HE2  . PHE B 2 24 ? -3.740  -6.049  -2.325  1.00 0.00 ? 24 PHE B HE2  3  
ATOM 2247 H HZ   . PHE B 2 24 ? -1.696  -5.133  -3.297  1.00 0.00 ? 24 PHE B HZ   3  
ATOM 2248 N N    . PHE B 2 25 ? -3.752  -10.273 -5.756  1.00 0.00 ? 25 PHE B N    3  
ATOM 2249 C CA   . PHE B 2 25 ? -4.953  -10.173 -6.648  1.00 0.00 ? 25 PHE B CA   3  
ATOM 2250 C C    . PHE B 2 25 ? -4.593  -9.155  -7.759  1.00 0.00 ? 25 PHE B C    3  
ATOM 2251 O O    . PHE B 2 25 ? -5.054  -8.033  -7.788  1.00 0.00 ? 25 PHE B O    3  
ATOM 2252 C CB   . PHE B 2 25 ? -6.186  -9.692  -5.829  1.00 0.00 ? 25 PHE B CB   3  
ATOM 2253 C CG   . PHE B 2 25 ? -7.533  -9.907  -6.587  1.00 0.00 ? 25 PHE B CG   3  
ATOM 2254 C CD1  . PHE B 2 25 ? -7.658  -10.667 -7.747  1.00 0.00 ? 25 PHE B CD1  3  
ATOM 2255 C CD2  . PHE B 2 25 ? -8.681  -9.324  -6.072  1.00 0.00 ? 25 PHE B CD2  3  
ATOM 2256 C CE1  . PHE B 2 25 ? -8.888  -10.834 -8.359  1.00 0.00 ? 25 PHE B CE1  3  
ATOM 2257 C CE2  . PHE B 2 25 ? -9.909  -9.486  -6.684  1.00 0.00 ? 25 PHE B CE2  3  
ATOM 2258 C CZ   . PHE B 2 25 ? -10.017 -10.240 -7.828  1.00 0.00 ? 25 PHE B CZ   3  
ATOM 2259 H H    . PHE B 2 25 ? -3.158  -9.501  -5.694  1.00 0.00 ? 25 PHE B H    3  
ATOM 2260 H HA   . PHE B 2 25 ? -5.119  -11.140 -7.095  1.00 0.00 ? 25 PHE B HA   3  
ATOM 2261 H HB2  . PHE B 2 25 ? -6.237  -10.251 -4.906  1.00 0.00 ? 25 PHE B HB2  3  
ATOM 2262 H HB3  . PHE B 2 25 ? -6.083  -8.642  -5.592  1.00 0.00 ? 25 PHE B HB3  3  
ATOM 2263 H HD1  . PHE B 2 25 ? -6.798  -11.142 -8.190  1.00 0.00 ? 25 PHE B HD1  3  
ATOM 2264 H HD2  . PHE B 2 25 ? -8.613  -8.729  -5.175  1.00 0.00 ? 25 PHE B HD2  3  
ATOM 2265 H HE1  . PHE B 2 25 ? -8.962  -11.431 -9.255  1.00 0.00 ? 25 PHE B HE1  3  
ATOM 2266 H HE2  . PHE B 2 25 ? -10.789 -9.017  -6.265  1.00 0.00 ? 25 PHE B HE2  3  
ATOM 2267 H HZ   . PHE B 2 25 ? -10.986 -10.363 -8.297  1.00 0.00 ? 25 PHE B HZ   3  
ATOM 2268 N N    . TYR B 2 26 ? -3.757  -9.666  -8.627  1.00 0.00 ? 26 TYR B N    3  
ATOM 2269 C CA   . TYR B 2 26 ? -3.144  -9.025  -9.844  1.00 0.00 ? 26 TYR B CA   3  
ATOM 2270 C C    . TYR B 2 26 ? -1.787  -9.705  -9.673  1.00 0.00 ? 26 TYR B C    3  
ATOM 2271 O O    . TYR B 2 26 ? -0.847  -9.203  -9.083  1.00 0.00 ? 26 TYR B O    3  
ATOM 2272 C CB   . TYR B 2 26 ? -3.094  -7.438  -9.711  1.00 0.00 ? 26 TYR B CB   3  
ATOM 2273 C CG   . TYR B 2 26 ? -1.815  -6.778  -10.277 1.00 0.00 ? 26 TYR B CG   3  
ATOM 2274 C CD1  . TYR B 2 26 ? -1.217  -7.131  -11.474 1.00 0.00 ? 26 TYR B CD1  3  
ATOM 2275 C CD2  . TYR B 2 26 ? -1.223  -5.782  -9.533  1.00 0.00 ? 26 TYR B CD2  3  
ATOM 2276 C CE1  . TYR B 2 26 ? -0.058  -6.496  -11.890 1.00 0.00 ? 26 TYR B CE1  3  
ATOM 2277 C CE2  . TYR B 2 26 ? -0.068  -5.150  -9.943  1.00 0.00 ? 26 TYR B CE2  3  
ATOM 2278 C CZ   . TYR B 2 26 ? 0.520   -5.502  -11.121 1.00 0.00 ? 26 TYR B CZ   3  
ATOM 2279 O OH   . TYR B 2 26 ? 1.677   -4.876  -11.539 1.00 0.00 ? 26 TYR B OH   3  
ATOM 2280 H H    . TYR B 2 26 ? -3.495  -10.594 -8.453  1.00 0.00 ? 26 TYR B H    3  
ATOM 2281 H HA   . TYR B 2 26 ? -3.643  -9.375  -10.731 1.00 0.00 ? 26 TYR B HA   3  
ATOM 2282 H HB2  . TYR B 2 26 ? -3.948  -7.020  -10.225 1.00 0.00 ? 26 TYR B HB2  3  
ATOM 2283 H HB3  . TYR B 2 26 ? -3.166  -7.150  -8.677  1.00 0.00 ? 26 TYR B HB3  3  
ATOM 2284 H HD1  . TYR B 2 26 ? -1.656  -7.900  -12.090 1.00 0.00 ? 26 TYR B HD1  3  
ATOM 2285 H HD2  . TYR B 2 26 ? -1.685  -5.482  -8.612  1.00 0.00 ? 26 TYR B HD2  3  
ATOM 2286 H HE1  . TYR B 2 26 ? 0.398   -6.779  -12.828 1.00 0.00 ? 26 TYR B HE1  3  
ATOM 2287 H HE2  . TYR B 2 26 ? 0.377   -4.377  -9.333  1.00 0.00 ? 26 TYR B HE2  3  
ATOM 2288 H HH   . TYR B 2 26 ? 1.457   -3.973  -11.787 1.00 0.00 ? 26 TYR B HH   3  
ATOM 2289 N N    . THR B 2 27 ? -1.828  -10.886 -10.234 1.00 0.00 ? 27 THR B N    3  
ATOM 2290 C CA   . THR B 2 27 ? -0.725  -11.885 -10.285 1.00 0.00 ? 27 THR B CA   3  
ATOM 2291 C C    . THR B 2 27 ? -0.014  -11.910 -11.656 1.00 0.00 ? 27 THR B C    3  
ATOM 2292 O O    . THR B 2 27 ? -0.166  -12.898 -12.352 1.00 0.00 ? 27 THR B O    3  
ATOM 2293 C CB   . THR B 2 27 ? -1.417  -13.250 -9.906  1.00 0.00 ? 27 THR B CB   3  
ATOM 2294 O OG1  . THR B 2 27 ? -0.510  -14.326 -10.119 1.00 0.00 ? 27 THR B OG1  3  
ATOM 2295 C CG2  . THR B 2 27 ? -2.633  -13.551 -10.820 1.00 0.00 ? 27 THR B CG2  3  
ATOM 2296 H H    . THR B 2 27 ? -2.674  -11.127 -10.665 1.00 0.00 ? 27 THR B H    3  
ATOM 2297 H HA   . THR B 2 27 ? -0.043  -11.712 -9.481  1.00 0.00 ? 27 THR B HA   3  
ATOM 2298 H HB   . THR B 2 27 ? -1.734  -13.256 -8.873  1.00 0.00 ? 27 THR B HB   3  
ATOM 2299 H HG1  . THR B 2 27 ? 0.269   -14.002 -10.571 1.00 0.00 ? 27 THR B HG1  3  
ATOM 2300 H HG21 . THR B 2 27 ? -2.332  -13.607 -11.855 1.00 0.00 ? 27 THR B HG21 3  
ATOM 2301 H HG22 . THR B 2 27 ? -3.079  -14.496 -10.553 1.00 0.00 ? 27 THR B HG22 3  
ATOM 2302 H HG23 . THR B 2 27 ? -3.384  -12.780 -10.717 1.00 0.00 ? 27 THR B HG23 3  
ATOM 2303 N N    . PRO B 2 28 ? 0.738   -10.894 -12.072 1.00 0.00 ? 28 PRO B N    3  
ATOM 2304 C CA   . PRO B 2 28 ? 1.212   -10.893 -13.475 1.00 0.00 ? 28 PRO B CA   3  
ATOM 2305 C C    . PRO B 2 28 ? 2.370   -11.891 -13.550 1.00 0.00 ? 28 PRO B C    3  
ATOM 2306 O O    . PRO B 2 28 ? 3.151   -11.986 -12.624 1.00 0.00 ? 28 PRO B O    3  
ATOM 2307 C CB   . PRO B 2 28 ? 1.597   -9.456  -13.727 1.00 0.00 ? 28 PRO B CB   3  
ATOM 2308 C CG   . PRO B 2 28 ? 2.161   -9.000  -12.372 1.00 0.00 ? 28 PRO B CG   3  
ATOM 2309 C CD   . PRO B 2 28 ? 1.236   -9.672  -11.334 1.00 0.00 ? 28 PRO B CD   3  
ATOM 2310 H HA   . PRO B 2 28 ? 0.406   -11.189 -14.126 1.00 0.00 ? 28 PRO B HA   3  
ATOM 2311 H HB2  . PRO B 2 28 ? 2.347   -9.392  -14.501 1.00 0.00 ? 28 PRO B HB2  3  
ATOM 2312 H HB3  . PRO B 2 28 ? 0.728   -8.874  -13.990 1.00 0.00 ? 28 PRO B HB3  3  
ATOM 2313 H HG2  . PRO B 2 28 ? 3.190   -9.307  -12.253 1.00 0.00 ? 28 PRO B HG2  3  
ATOM 2314 H HG3  . PRO B 2 28 ? 2.110   -7.928  -12.273 1.00 0.00 ? 28 PRO B HG3  3  
ATOM 2315 H HD2  . PRO B 2 28 ? 1.907   -9.899  -10.518 1.00 0.00 ? 28 PRO B HD2  3  
ATOM 2316 H HD3  . PRO B 2 28 ? 0.415   -9.038  -11.041 1.00 0.00 ? 28 PRO B HD3  3  
ATOM 2317 N N    . LYS B 2 29 ? 2.442   -12.599 -14.646 1.00 0.00 ? 29 LYS B N    3  
ATOM 2318 C CA   . LYS B 2 29 ? 3.531   -13.600 -14.811 1.00 0.00 ? 29 LYS B CA   3  
ATOM 2319 C C    . LYS B 2 29 ? 4.719   -12.855 -15.427 1.00 0.00 ? 29 LYS B C    3  
ATOM 2320 O O    . LYS B 2 29 ? 4.540   -11.977 -16.258 1.00 0.00 ? 29 LYS B O    3  
ATOM 2321 C CB   . LYS B 2 29 ? 2.995   -14.726 -15.727 1.00 0.00 ? 29 LYS B CB   3  
ATOM 2322 C CG   . LYS B 2 29 ? 2.212   -15.807 -14.926 1.00 0.00 ? 29 LYS B CG   3  
ATOM 2323 C CD   . LYS B 2 29 ? 1.025   -15.190 -14.130 1.00 0.00 ? 29 LYS B CD   3  
ATOM 2324 C CE   . LYS B 2 29 ? 0.459   -16.186 -13.108 1.00 0.00 ? 29 LYS B CE   3  
ATOM 2325 N NZ   . LYS B 2 29 ? 1.518   -16.553 -12.125 1.00 0.00 ? 29 LYS B NZ   3  
ATOM 2326 H H    . LYS B 2 29 ? 1.783   -12.483 -15.364 1.00 0.00 ? 29 LYS B H    3  
ATOM 2327 H HA   . LYS B 2 29 ? 3.812   -14.001 -13.847 1.00 0.00 ? 29 LYS B HA   3  
ATOM 2328 H HB2  . LYS B 2 29 ? 2.317   -14.303 -16.455 1.00 0.00 ? 29 LYS B HB2  3  
ATOM 2329 H HB3  . LYS B 2 29 ? 3.809   -15.196 -16.257 1.00 0.00 ? 29 LYS B HB3  3  
ATOM 2330 H HG2  . LYS B 2 29 ? 1.802   -16.498 -15.652 1.00 0.00 ? 29 LYS B HG2  3  
ATOM 2331 H HG3  . LYS B 2 29 ? 2.884   -16.359 -14.283 1.00 0.00 ? 29 LYS B HG3  3  
ATOM 2332 H HD2  . LYS B 2 29 ? 1.338   -14.330 -13.568 1.00 0.00 ? 29 LYS B HD2  3  
ATOM 2333 H HD3  . LYS B 2 29 ? 0.237   -14.896 -14.805 1.00 0.00 ? 29 LYS B HD3  3  
ATOM 2334 H HE2  . LYS B 2 29 ? -0.354  -15.727 -12.567 1.00 0.00 ? 29 LYS B HE2  3  
ATOM 2335 H HE3  . LYS B 2 29 ? 0.106   -17.079 -13.603 1.00 0.00 ? 29 LYS B HE3  3  
ATOM 2336 H HZ1  . LYS B 2 29 ? 2.401   -16.070 -12.377 1.00 0.00 ? 29 LYS B HZ1  3  
ATOM 2337 H HZ2  . LYS B 2 29 ? 1.212   -16.248 -11.183 1.00 0.00 ? 29 LYS B HZ2  3  
ATOM 2338 H HZ3  . LYS B 2 29 ? 1.662   -17.582 -12.138 1.00 0.00 ? 29 LYS B HZ3  3  
ATOM 2339 N N    . THR B 2 30 ? 5.897   -13.235 -14.995 1.00 0.00 ? 30 THR B N    3  
ATOM 2340 C CA   . THR B 2 30 ? 7.140   -12.580 -15.513 1.00 0.00 ? 30 THR B CA   3  
ATOM 2341 C C    . THR B 2 30 ? 7.878   -13.569 -16.433 1.00 0.00 ? 30 THR B C    3  
ATOM 2342 O O    . THR B 2 30 ? 7.524   -13.805 -17.570 1.00 0.00 ? 30 THR B O    3  
ATOM 2343 C CB   . THR B 2 30 ? 8.088   -12.197 -14.344 1.00 0.00 ? 30 THR B CB   3  
ATOM 2344 O OG1  . THR B 2 30 ? 7.318   -11.707 -13.250 1.00 0.00 ? 30 THR B OG1  3  
ATOM 2345 C CG2  . THR B 2 30 ? 8.898   -10.947 -14.731 1.00 0.00 ? 30 THR B CG2  3  
ATOM 2346 H H    . THR B 2 30 ? 5.963   -13.951 -14.326 1.00 0.00 ? 30 THR B H    3  
ATOM 2347 H HA   . THR B 2 30 ? 6.888   -11.699 -16.084 1.00 0.00 ? 30 THR B HA   3  
ATOM 2348 H HB   . THR B 2 30 ? 8.701   -13.018 -14.012 1.00 0.00 ? 30 THR B HB   3  
ATOM 2349 H HG1  . THR B 2 30 ? 6.386   -11.732 -13.465 1.00 0.00 ? 30 THR B HG1  3  
ATOM 2350 H HG21 . THR B 2 30 ? 9.457   -11.125 -15.639 1.00 0.00 ? 30 THR B HG21 3  
ATOM 2351 H HG22 . THR B 2 30 ? 8.241   -10.098 -14.883 1.00 0.00 ? 30 THR B HG22 3  
ATOM 2352 H HG23 . THR B 2 30 ? 9.585   -10.704 -13.936 1.00 0.00 ? 30 THR B HG23 3  
ATOM 2353 N N    . GLY A 1 1  ? -10.398 -3.388  5.541   1.00 0.00 ? 1  GLY A N    4  
ATOM 2354 C CA   . GLY A 1 1  ? -8.954  -3.545  5.223   1.00 0.00 ? 1  GLY A CA   4  
ATOM 2355 C C    . GLY A 1 1  ? -8.405  -2.249  4.627   1.00 0.00 ? 1  GLY A C    4  
ATOM 2356 O O    . GLY A 1 1  ? -7.747  -1.496  5.317   1.00 0.00 ? 1  GLY A O    4  
ATOM 2357 H H1   . GLY A 1 1  ? -10.703 -2.423  5.288   1.00 0.00 ? 1  GLY A H1   4  
ATOM 2358 H H2   . GLY A 1 1  ? -10.949 -4.086  5.002   1.00 0.00 ? 1  GLY A H2   4  
ATOM 2359 H H3   . GLY A 1 1  ? -10.535 -3.544  6.558   1.00 0.00 ? 1  GLY A H3   4  
ATOM 2360 H HA2  . GLY A 1 1  ? -8.419  -3.777  6.133   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 2361 H HA3  . GLY A 1 1  ? -8.819  -4.348  4.510   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 2362 N N    . ILE A 1 2  ? -8.684  -2.009  3.365   1.00 0.00 ? 2  ILE A N    4  
ATOM 2363 C CA   . ILE A 1 2  ? -8.181  -0.756  2.710   1.00 0.00 ? 2  ILE A CA   4  
ATOM 2364 C C    . ILE A 1 2  ? -9.294  0.033   2.026   1.00 0.00 ? 2  ILE A C    4  
ATOM 2365 O O    . ILE A 1 2  ? -10.423 -0.410  1.940   1.00 0.00 ? 2  ILE A O    4  
ATOM 2366 C CB   . ILE A 1 2  ? -7.061  -1.133  1.672   1.00 0.00 ? 2  ILE A CB   4  
ATOM 2367 C CG1  . ILE A 1 2  ? -7.504  -2.179  0.586   1.00 0.00 ? 2  ILE A CG1  4  
ATOM 2368 C CG2  . ILE A 1 2  ? -5.848  -1.692  2.439   1.00 0.00 ? 2  ILE A CG2  4  
ATOM 2369 C CD1  . ILE A 1 2  ? -8.392  -1.582  -0.522  1.00 0.00 ? 2  ILE A CD1  4  
ATOM 2370 H H    . ILE A 1 2  ? -9.219  -2.644  2.845   1.00 0.00 ? 2  ILE A H    4  
ATOM 2371 H HA   . ILE A 1 2  ? -7.748  -0.111  3.463   1.00 0.00 ? 2  ILE A HA   4  
ATOM 2372 H HB   . ILE A 1 2  ? -6.729  -0.234  1.176   1.00 0.00 ? 2  ILE A HB   4  
ATOM 2373 H HG12 . ILE A 1 2  ? -6.639  -2.627  0.118   1.00 0.00 ? 2  ILE A HG12 4  
ATOM 2374 H HG13 . ILE A 1 2  ? -8.062  -2.973  1.049   1.00 0.00 ? 2  ILE A HG13 4  
ATOM 2375 H HG21 . ILE A 1 2  ? -5.482  -0.936  3.119   1.00 0.00 ? 2  ILE A HG21 4  
ATOM 2376 H HG22 . ILE A 1 2  ? -6.119  -2.577  3.000   1.00 0.00 ? 2  ILE A HG22 4  
ATOM 2377 H HG23 . ILE A 1 2  ? -5.060  -1.957  1.750   1.00 0.00 ? 2  ILE A HG23 4  
ATOM 2378 H HD11 . ILE A 1 2  ? -7.873  -0.782  -1.025  1.00 0.00 ? 2  ILE A HD11 4  
ATOM 2379 H HD12 . ILE A 1 2  ? -8.610  -2.358  -1.246  1.00 0.00 ? 2  ILE A HD12 4  
ATOM 2380 H HD13 . ILE A 1 2  ? -9.325  -1.203  -0.140  1.00 0.00 ? 2  ILE A HD13 4  
ATOM 2381 N N    . VAL A 1 3  ? -8.903  1.191   1.567   1.00 0.00 ? 3  VAL A N    4  
ATOM 2382 C CA   . VAL A 1 3  ? -9.830  2.124   0.862   1.00 0.00 ? 3  VAL A CA   4  
ATOM 2383 C C    . VAL A 1 3  ? -9.144  2.546   -0.452  1.00 0.00 ? 3  VAL A C    4  
ATOM 2384 O O    . VAL A 1 3  ? -8.117  2.001   -0.807  1.00 0.00 ? 3  VAL A O    4  
ATOM 2385 C CB   . VAL A 1 3  ? -10.090 3.358   1.768   1.00 0.00 ? 3  VAL A CB   4  
ATOM 2386 C CG1  . VAL A 1 3  ? -10.654 2.920   3.136   1.00 0.00 ? 3  VAL A CG1  4  
ATOM 2387 C CG2  . VAL A 1 3  ? -8.794  4.178   1.956   1.00 0.00 ? 3  VAL A CG2  4  
ATOM 2388 H H    . VAL A 1 3  ? -7.966  1.458   1.686   1.00 0.00 ? 3  VAL A H    4  
ATOM 2389 H HA   . VAL A 1 3  ? -10.758 1.608   0.630   1.00 0.00 ? 3  VAL A HA   4  
ATOM 2390 H HB   . VAL A 1 3  ? -10.832 3.976   1.296   1.00 0.00 ? 3  VAL A HB   4  
ATOM 2391 H HG11 . VAL A 1 3  ? -9.964  2.260   3.641   1.00 0.00 ? 3  VAL A HG11 4  
ATOM 2392 H HG12 . VAL A 1 3  ? -10.823 3.786   3.760   1.00 0.00 ? 3  VAL A HG12 4  
ATOM 2393 H HG13 . VAL A 1 3  ? -11.594 2.402   2.991   1.00 0.00 ? 3  VAL A HG13 4  
ATOM 2394 H HG21 . VAL A 1 3  ? -8.026  3.569   2.406   1.00 0.00 ? 3  VAL A HG21 4  
ATOM 2395 H HG22 . VAL A 1 3  ? -8.444  4.537   1.001   1.00 0.00 ? 3  VAL A HG22 4  
ATOM 2396 H HG23 . VAL A 1 3  ? -8.976  5.025   2.601   1.00 0.00 ? 3  VAL A HG23 4  
ATOM 2397 N N    . GLU A 1 4  ? -9.763  3.504   -1.100  1.00 0.00 ? 4  GLU A N    4  
ATOM 2398 C CA   . GLU A 1 4  ? -9.306  4.106   -2.403  1.00 0.00 ? 4  GLU A CA   4  
ATOM 2399 C C    . GLU A 1 4  ? -7.926  3.641   -2.966  1.00 0.00 ? 4  GLU A C    4  
ATOM 2400 O O    . GLU A 1 4  ? -6.992  4.411   -3.006  1.00 0.00 ? 4  GLU A O    4  
ATOM 2401 C CB   . GLU A 1 4  ? -9.328  5.663   -2.205  1.00 0.00 ? 4  GLU A CB   4  
ATOM 2402 C CG   . GLU A 1 4  ? -10.760 6.258   -2.357  1.00 0.00 ? 4  GLU A CG   4  
ATOM 2403 C CD   . GLU A 1 4  ? -11.759 5.544   -1.425  1.00 0.00 ? 4  GLU A CD   4  
ATOM 2404 O OE1  . GLU A 1 4  ? -11.650 5.770   -0.233  1.00 0.00 ? 4  GLU A OE1  4  
ATOM 2405 O OE2  . GLU A 1 4  ? -12.578 4.809   -1.952  1.00 0.00 ? 4  GLU A OE2  4  
ATOM 2406 H H    . GLU A 1 4  ? -10.582 3.845   -0.688  1.00 0.00 ? 4  GLU A H    4  
ATOM 2407 H HA   . GLU A 1 4  ? -10.043 3.841   -3.146  1.00 0.00 ? 4  GLU A HA   4  
ATOM 2408 H HB2  . GLU A 1 4  ? -8.969  5.896   -1.215  1.00 0.00 ? 4  GLU A HB2  4  
ATOM 2409 H HB3  . GLU A 1 4  ? -8.673  6.149   -2.908  1.00 0.00 ? 4  GLU A HB3  4  
ATOM 2410 H HG2  . GLU A 1 4  ? -10.732 7.304   -2.083  1.00 0.00 ? 4  GLU A HG2  4  
ATOM 2411 H HG3  . GLU A 1 4  ? -11.089 6.186   -3.383  1.00 0.00 ? 4  GLU A HG3  4  
ATOM 2412 N N    . GLN A 1 5  ? -7.869  2.389   -3.360  1.00 0.00 ? 5  GLN A N    4  
ATOM 2413 C CA   . GLN A 1 5  ? -6.653  1.701   -3.941  1.00 0.00 ? 5  GLN A CA   4  
ATOM 2414 C C    . GLN A 1 5  ? -5.602  2.563   -4.696  1.00 0.00 ? 5  GLN A C    4  
ATOM 2415 O O    . GLN A 1 5  ? -4.446  2.191   -4.776  1.00 0.00 ? 5  GLN A O    4  
ATOM 2416 C CB   . GLN A 1 5  ? -7.191  0.560   -4.867  1.00 0.00 ? 5  GLN A CB   4  
ATOM 2417 C CG   . GLN A 1 5  ? -6.050  -0.380  -5.361  1.00 0.00 ? 5  GLN A CG   4  
ATOM 2418 C CD   . GLN A 1 5  ? -6.656  -1.495  -6.235  1.00 0.00 ? 5  GLN A CD   4  
ATOM 2419 O OE1  . GLN A 1 5  ? -7.399  -2.334  -5.762  1.00 0.00 ? 5  GLN A OE1  4  
ATOM 2420 N NE2  . GLN A 1 5  ? -6.369  -1.545  -7.509  1.00 0.00 ? 5  GLN A NE2  4  
ATOM 2421 H H    . GLN A 1 5  ? -8.689  1.861   -3.266  1.00 0.00 ? 5  GLN A H    4  
ATOM 2422 H HA   . GLN A 1 5  ? -6.135  1.250   -3.110  1.00 0.00 ? 5  GLN A HA   4  
ATOM 2423 H HB2  . GLN A 1 5  ? -7.911  -0.034  -4.317  1.00 0.00 ? 5  GLN A HB2  4  
ATOM 2424 H HB3  . GLN A 1 5  ? -7.698  0.982   -5.723  1.00 0.00 ? 5  GLN A HB3  4  
ATOM 2425 H HG2  . GLN A 1 5  ? -5.312  0.155   -5.941  1.00 0.00 ? 5  GLN A HG2  4  
ATOM 2426 H HG3  . GLN A 1 5  ? -5.550  -0.843  -4.521  1.00 0.00 ? 5  GLN A HG3  4  
ATOM 2427 H HE21 . GLN A 1 5  ? -5.769  -0.879  -7.902  1.00 0.00 ? 5  GLN A HE21 4  
ATOM 2428 H HE22 . GLN A 1 5  ? -6.755  -2.245  -8.076  1.00 0.00 ? 5  GLN A HE22 4  
ATOM 2429 N N    . CYS A 1 6  ? -6.041  3.679   -5.221  1.00 0.00 ? 6  CYS A N    4  
ATOM 2430 C CA   . CYS A 1 6  ? -5.158  4.626   -5.989  1.00 0.00 ? 6  CYS A CA   4  
ATOM 2431 C C    . CYS A 1 6  ? -4.399  5.692   -5.161  1.00 0.00 ? 6  CYS A C    4  
ATOM 2432 O O    . CYS A 1 6  ? -3.240  5.963   -5.402  1.00 0.00 ? 6  CYS A O    4  
ATOM 2433 C CB   . CYS A 1 6  ? -6.039  5.320   -7.032  1.00 0.00 ? 6  CYS A CB   4  
ATOM 2434 S SG   . CYS A 1 6  ? -5.891  4.771   -8.752  1.00 0.00 ? 6  CYS A SG   4  
ATOM 2435 H H    . CYS A 1 6  ? -6.988  3.902   -5.103  1.00 0.00 ? 6  CYS A H    4  
ATOM 2436 H HA   . CYS A 1 6  ? -4.424  4.041   -6.522  1.00 0.00 ? 6  CYS A HA   4  
ATOM 2437 H HB2  . CYS A 1 6  ? -7.073  5.173   -6.751  1.00 0.00 ? 6  CYS A HB2  4  
ATOM 2438 H HB3  . CYS A 1 6  ? -5.850  6.380   -6.993  1.00 0.00 ? 6  CYS A HB3  4  
ATOM 2439 N N    . CYS A 1 7  ? -5.083  6.273   -4.217  1.00 0.00 ? 7  CYS A N    4  
ATOM 2440 C CA   . CYS A 1 7  ? -4.481  7.325   -3.337  1.00 0.00 ? 7  CYS A CA   4  
ATOM 2441 C C    . CYS A 1 7  ? -5.346  7.334   -2.059  1.00 0.00 ? 7  CYS A C    4  
ATOM 2442 O O    . CYS A 1 7  ? -5.862  8.342   -1.614  1.00 0.00 ? 7  CYS A O    4  
ATOM 2443 C CB   . CYS A 1 7  ? -4.522  8.699   -4.066  1.00 0.00 ? 7  CYS A CB   4  
ATOM 2444 S SG   . CYS A 1 7  ? -3.549  10.027  -3.313  1.00 0.00 ? 7  CYS A SG   4  
ATOM 2445 H H    . CYS A 1 7  ? -6.008  5.998   -4.071  1.00 0.00 ? 7  CYS A H    4  
ATOM 2446 H HA   . CYS A 1 7  ? -3.465  7.057   -3.085  1.00 0.00 ? 7  CYS A HA   4  
ATOM 2447 H HB2  . CYS A 1 7  ? -4.137  8.564   -5.070  1.00 0.00 ? 7  CYS A HB2  4  
ATOM 2448 H HB3  . CYS A 1 7  ? -5.545  9.038   -4.155  1.00 0.00 ? 7  CYS A HB3  4  
ATOM 2449 N N    . THR A 1 8  ? -5.442  6.141   -1.541  1.00 0.00 ? 8  THR A N    4  
ATOM 2450 C CA   . THR A 1 8  ? -6.206  5.765   -0.307  1.00 0.00 ? 8  THR A CA   4  
ATOM 2451 C C    . THR A 1 8  ? -6.670  6.896   0.647   1.00 0.00 ? 8  THR A C    4  
ATOM 2452 O O    . THR A 1 8  ? -7.818  7.285   0.601   1.00 0.00 ? 8  THR A O    4  
ATOM 2453 C CB   . THR A 1 8  ? -5.318  4.692   0.460   1.00 0.00 ? 8  THR A CB   4  
ATOM 2454 O OG1  . THR A 1 8  ? -4.176  5.347   1.004   1.00 0.00 ? 8  THR A OG1  4  
ATOM 2455 C CG2  . THR A 1 8  ? -4.674  3.700   -0.559  1.00 0.00 ? 8  THR A CG2  4  
ATOM 2456 H H    . THR A 1 8  ? -4.969  5.429   -2.018  1.00 0.00 ? 8  THR A H    4  
ATOM 2457 H HA   . THR A 1 8  ? -7.094  5.245   -0.631  1.00 0.00 ? 8  THR A HA   4  
ATOM 2458 H HB   . THR A 1 8  ? -5.860  4.180   1.240   1.00 0.00 ? 8  THR A HB   4  
ATOM 2459 H HG1  . THR A 1 8  ? -4.403  5.684   1.874   1.00 0.00 ? 8  THR A HG1  4  
ATOM 2460 H HG21 . THR A 1 8  ? -5.442  3.208   -1.137  1.00 0.00 ? 8  THR A HG21 4  
ATOM 2461 H HG22 . THR A 1 8  ? -4.014  4.229   -1.231  1.00 0.00 ? 8  THR A HG22 4  
ATOM 2462 H HG23 . THR A 1 8  ? -4.090  2.951   -0.042  1.00 0.00 ? 8  THR A HG23 4  
ATOM 2463 N N    . SER A 1 9  ? -5.776  7.382   1.467   1.00 0.00 ? 9  SER A N    4  
ATOM 2464 C CA   . SER A 1 9  ? -6.083  8.469   2.439   1.00 0.00 ? 9  SER A CA   4  
ATOM 2465 C C    . SER A 1 9  ? -4.994  9.540   2.357   1.00 0.00 ? 9  SER A C    4  
ATOM 2466 O O    . SER A 1 9  ? -5.237  10.645  1.905   1.00 0.00 ? 9  SER A O    4  
ATOM 2467 C CB   . SER A 1 9  ? -6.184  7.792   3.838   1.00 0.00 ? 9  SER A CB   4  
ATOM 2468 O OG   . SER A 1 9  ? -5.026  6.970   3.972   1.00 0.00 ? 9  SER A OG   4  
ATOM 2469 H H    . SER A 1 9  ? -4.871  7.023   1.448   1.00 0.00 ? 9  SER A H    4  
ATOM 2470 H HA   . SER A 1 9  ? -7.011  8.932   2.184   1.00 0.00 ? 9  SER A HA   4  
ATOM 2471 H HB2  . SER A 1 9  ? -6.250  8.498   4.657   1.00 0.00 ? 9  SER A HB2  4  
ATOM 2472 H HB3  . SER A 1 9  ? -7.058  7.161   3.852   1.00 0.00 ? 9  SER A HB3  4  
ATOM 2473 H HG   . SER A 1 9  ? -4.772  6.626   3.114   1.00 0.00 ? 9  SER A HG   4  
ATOM 2474 N N    . ILE A 1 10 ? -3.823  9.173   2.805   1.00 0.00 ? 10 ILE A N    4  
ATOM 2475 C CA   . ILE A 1 10 ? -2.655  10.107  2.785   1.00 0.00 ? 10 ILE A CA   4  
ATOM 2476 C C    . ILE A 1 10 ? -1.539  9.368   2.036   1.00 0.00 ? 10 ILE A C    4  
ATOM 2477 O O    . ILE A 1 10 ? -0.389  9.349   2.420   1.00 0.00 ? 10 ILE A O    4  
ATOM 2478 C CB   . ILE A 1 10 ? -2.264  10.457  4.262   1.00 0.00 ? 10 ILE A CB   4  
ATOM 2479 C CG1  . ILE A 1 10 ? -3.553  10.947  4.987   1.00 0.00 ? 10 ILE A CG1  4  
ATOM 2480 C CG2  . ILE A 1 10 ? -1.217  11.598  4.253   1.00 0.00 ? 10 ILE A CG2  4  
ATOM 2481 C CD1  . ILE A 1 10 ? -3.272  11.488  6.410   1.00 0.00 ? 10 ILE A CD1  4  
ATOM 2482 H H    . ILE A 1 10 ? -3.737  8.268   3.154   1.00 0.00 ? 10 ILE A H    4  
ATOM 2483 H HA   . ILE A 1 10 ? -2.905  11.000  2.230   1.00 0.00 ? 10 ILE A HA   4  
ATOM 2484 H HB   . ILE A 1 10 ? -1.873  9.579   4.762   1.00 0.00 ? 10 ILE A HB   4  
ATOM 2485 H HG12 . ILE A 1 10 ? -4.029  11.719  4.399   1.00 0.00 ? 10 ILE A HG12 4  
ATOM 2486 H HG13 . ILE A 1 10 ? -4.232  10.106  5.076   1.00 0.00 ? 10 ILE A HG13 4  
ATOM 2487 H HG21 . ILE A 1 10 ? -1.620  12.475  3.767   1.00 0.00 ? 10 ILE A HG21 4  
ATOM 2488 H HG22 . ILE A 1 10 ? -0.946  11.856  5.265   1.00 0.00 ? 10 ILE A HG22 4  
ATOM 2489 H HG23 . ILE A 1 10 ? -0.322  11.296  3.733   1.00 0.00 ? 10 ILE A HG23 4  
ATOM 2490 H HD11 . ILE A 1 10 ? -2.810  10.726  7.020   1.00 0.00 ? 10 ILE A HD11 4  
ATOM 2491 H HD12 . ILE A 1 10 ? -2.652  12.376  6.389   1.00 0.00 ? 10 ILE A HD12 4  
ATOM 2492 H HD13 . ILE A 1 10 ? -4.210  11.760  6.863   1.00 0.00 ? 10 ILE A HD13 4  
ATOM 2493 N N    . CYS A 1 11 ? -2.001  8.776   0.962   1.00 0.00 ? 11 CYS A N    4  
ATOM 2494 C CA   . CYS A 1 11 ? -1.217  7.966   -0.028  1.00 0.00 ? 11 CYS A CA   4  
ATOM 2495 C C    . CYS A 1 11 ? 0.313   7.962   0.194   1.00 0.00 ? 11 CYS A C    4  
ATOM 2496 O O    . CYS A 1 11 ? 1.061   8.597   -0.524  1.00 0.00 ? 11 CYS A O    4  
ATOM 2497 C CB   . CYS A 1 11 ? -1.617  8.528   -1.402  1.00 0.00 ? 11 CYS A CB   4  
ATOM 2498 S SG   . CYS A 1 11 ? -3.219  9.377   -1.427  1.00 0.00 ? 11 CYS A SG   4  
ATOM 2499 H H    . CYS A 1 11 ? -2.959  8.880   0.794   1.00 0.00 ? 11 CYS A H    4  
ATOM 2500 H HA   . CYS A 1 11 ? -1.557  6.942   0.052   1.00 0.00 ? 11 CYS A HA   4  
ATOM 2501 H HB2  . CYS A 1 11 ? -0.871  9.231   -1.737  1.00 0.00 ? 11 CYS A HB2  4  
ATOM 2502 H HB3  . CYS A 1 11 ? -1.659  7.709   -2.105  1.00 0.00 ? 11 CYS A HB3  4  
ATOM 2503 N N    . SER A 1 12 ? 0.704   7.227   1.204   1.00 0.00 ? 12 SER A N    4  
ATOM 2504 C CA   . SER A 1 12 ? 2.125   7.074   1.614   1.00 0.00 ? 12 SER A CA   4  
ATOM 2505 C C    . SER A 1 12 ? 2.548   5.651   1.229   1.00 0.00 ? 12 SER A C    4  
ATOM 2506 O O    . SER A 1 12 ? 1.731   4.752   1.147   1.00 0.00 ? 12 SER A O    4  
ATOM 2507 C CB   . SER A 1 12 ? 2.198   7.279   3.145   1.00 0.00 ? 12 SER A CB   4  
ATOM 2508 O OG   . SER A 1 12 ? 1.297   6.294   3.629   1.00 0.00 ? 12 SER A OG   4  
ATOM 2509 H H    . SER A 1 12 ? 0.055   6.738   1.738   1.00 0.00 ? 12 SER A H    4  
ATOM 2510 H HA   . SER A 1 12 ? 2.748   7.795   1.105   1.00 0.00 ? 12 SER A HA   4  
ATOM 2511 H HB2  . SER A 1 12 ? 3.165   7.116   3.602   1.00 0.00 ? 12 SER A HB2  4  
ATOM 2512 H HB3  . SER A 1 12 ? 1.836   8.253   3.440   1.00 0.00 ? 12 SER A HB3  4  
ATOM 2513 H HG   . SER A 1 12 ? 1.802   5.588   4.039   1.00 0.00 ? 12 SER A HG   4  
ATOM 2514 N N    . LEU A 1 13 ? 3.825   5.505   1.004   1.00 0.00 ? 13 LEU A N    4  
ATOM 2515 C CA   . LEU A 1 13 ? 4.391   4.175   0.625   1.00 0.00 ? 13 LEU A CA   4  
ATOM 2516 C C    . LEU A 1 13 ? 4.123   3.220   1.806   1.00 0.00 ? 13 LEU A C    4  
ATOM 2517 O O    . LEU A 1 13 ? 4.140   2.014   1.666   1.00 0.00 ? 13 LEU A O    4  
ATOM 2518 C CB   . LEU A 1 13 ? 5.900   4.305   0.369   1.00 0.00 ? 13 LEU A CB   4  
ATOM 2519 C CG   . LEU A 1 13 ? 6.258   5.295   -0.810  1.00 0.00 ? 13 LEU A CG   4  
ATOM 2520 C CD1  . LEU A 1 13 ? 5.364   5.038   -2.037  1.00 0.00 ? 13 LEU A CD1  4  
ATOM 2521 C CD2  . LEU A 1 13 ? 6.174   6.786   -0.408  1.00 0.00 ? 13 LEU A CD2  4  
ATOM 2522 H H    . LEU A 1 13 ? 4.395   6.286   1.085   1.00 0.00 ? 13 LEU A H    4  
ATOM 2523 H HA   . LEU A 1 13 ? 3.909   3.816   -0.265  1.00 0.00 ? 13 LEU A HA   4  
ATOM 2524 H HB2  . LEU A 1 13 ? 6.332   4.608   1.305   1.00 0.00 ? 13 LEU A HB2  4  
ATOM 2525 H HB3  . LEU A 1 13 ? 6.289   3.328   0.126   1.00 0.00 ? 13 LEU A HB3  4  
ATOM 2526 H HG   . LEU A 1 13 ? 7.270   5.104   -1.131  1.00 0.00 ? 13 LEU A HG   4  
ATOM 2527 H HD11 . LEU A 1 13 ? 4.326   5.184   -1.791  1.00 0.00 ? 13 LEU A HD11 4  
ATOM 2528 H HD12 . LEU A 1 13 ? 5.614   5.737   -2.813  1.00 0.00 ? 13 LEU A HD12 4  
ATOM 2529 H HD13 . LEU A 1 13 ? 5.500   4.033   -2.409  1.00 0.00 ? 13 LEU A HD13 4  
ATOM 2530 H HD21 . LEU A 1 13 ? 6.822   6.980   0.433   1.00 0.00 ? 13 LEU A HD21 4  
ATOM 2531 H HD22 . LEU A 1 13 ? 6.492   7.406   -1.233  1.00 0.00 ? 13 LEU A HD22 4  
ATOM 2532 H HD23 . LEU A 1 13 ? 5.172   7.076   -0.157  1.00 0.00 ? 13 LEU A HD23 4  
ATOM 2533 N N    . TYR A 1 14 ? 3.874   3.821   2.946   1.00 0.00 ? 14 TYR A N    4  
ATOM 2534 C CA   . TYR A 1 14 ? 3.595   3.055   4.183   1.00 0.00 ? 14 TYR A CA   4  
ATOM 2535 C C    . TYR A 1 14 ? 2.242   2.340   4.045   1.00 0.00 ? 14 TYR A C    4  
ATOM 2536 O O    . TYR A 1 14 ? 2.089   1.250   4.557   1.00 0.00 ? 14 TYR A O    4  
ATOM 2537 C CB   . TYR A 1 14 ? 3.604   4.038   5.386   1.00 0.00 ? 14 TYR A CB   4  
ATOM 2538 C CG   . TYR A 1 14 ? 3.458   3.199   6.655   1.00 0.00 ? 14 TYR A CG   4  
ATOM 2539 C CD1  . TYR A 1 14 ? 4.549   2.523   7.158   1.00 0.00 ? 14 TYR A CD1  4  
ATOM 2540 C CD2  . TYR A 1 14 ? 2.240   3.102   7.299   1.00 0.00 ? 14 TYR A CD2  4  
ATOM 2541 C CE1  . TYR A 1 14 ? 4.422   1.756   8.293   1.00 0.00 ? 14 TYR A CE1  4  
ATOM 2542 C CE2  . TYR A 1 14 ? 2.117   2.335   8.435   1.00 0.00 ? 14 TYR A CE2  4  
ATOM 2543 C CZ   . TYR A 1 14 ? 3.205   1.656   8.940   1.00 0.00 ? 14 TYR A CZ   4  
ATOM 2544 O OH   . TYR A 1 14 ? 3.084   0.892   10.082  1.00 0.00 ? 14 TYR A OH   4  
ATOM 2545 H H    . TYR A 1 14 ? 3.863   4.796   2.991   1.00 0.00 ? 14 TYR A H    4  
ATOM 2546 H HA   . TYR A 1 14 ? 4.348   2.299   4.305   1.00 0.00 ? 14 TYR A HA   4  
ATOM 2547 H HB2  . TYR A 1 14 ? 4.561   4.538   5.413   1.00 0.00 ? 14 TYR A HB2  4  
ATOM 2548 H HB3  . TYR A 1 14 ? 2.830   4.792   5.365   1.00 0.00 ? 14 TYR A HB3  4  
ATOM 2549 H HD1  . TYR A 1 14 ? 5.506   2.600   6.661   1.00 0.00 ? 14 TYR A HD1  4  
ATOM 2550 H HD2  . TYR A 1 14 ? 1.379   3.627   6.916   1.00 0.00 ? 14 TYR A HD2  4  
ATOM 2551 H HE1  . TYR A 1 14 ? 5.281   1.231   8.676   1.00 0.00 ? 14 TYR A HE1  4  
ATOM 2552 H HE2  . TYR A 1 14 ? 1.164   2.267   8.938   1.00 0.00 ? 14 TYR A HE2  4  
ATOM 2553 H HH   . TYR A 1 14 ? 2.243   1.107   10.495  1.00 0.00 ? 14 TYR A HH   4  
ATOM 2554 N N    . GLN A 1 15 ? 1.295   2.945   3.368   1.00 0.00 ? 15 GLN A N    4  
ATOM 2555 C CA   . GLN A 1 15 ? -0.033  2.283   3.200   1.00 0.00 ? 15 GLN A CA   4  
ATOM 2556 C C    . GLN A 1 15 ? 0.130   1.215   2.091   1.00 0.00 ? 15 GLN A C    4  
ATOM 2557 O O    . GLN A 1 15 ? -0.719  0.361   1.931   1.00 0.00 ? 15 GLN A O    4  
ATOM 2558 C CB   . GLN A 1 15 ? -1.062  3.332   2.786   1.00 0.00 ? 15 GLN A CB   4  
ATOM 2559 C CG   . GLN A 1 15 ? -2.510  2.757   2.838   1.00 0.00 ? 15 GLN A CG   4  
ATOM 2560 C CD   . GLN A 1 15 ? -3.192  3.079   4.172   1.00 0.00 ? 15 GLN A CD   4  
ATOM 2561 O OE1  . GLN A 1 15 ? -2.922  2.501   5.208   1.00 0.00 ? 15 GLN A OE1  4  
ATOM 2562 N NE2  . GLN A 1 15 ? -4.097  4.018   4.151   1.00 0.00 ? 15 GLN A NE2  4  
ATOM 2563 H H    . GLN A 1 15 ? 1.430   3.828   2.968   1.00 0.00 ? 15 GLN A H    4  
ATOM 2564 H HA   . GLN A 1 15 ? -0.318  1.804   4.124   1.00 0.00 ? 15 GLN A HA   4  
ATOM 2565 H HB2  . GLN A 1 15 ? -0.971  4.168   3.465   1.00 0.00 ? 15 GLN A HB2  4  
ATOM 2566 H HB3  . GLN A 1 15 ? -0.831  3.674   1.790   1.00 0.00 ? 15 GLN A HB3  4  
ATOM 2567 H HG2  . GLN A 1 15 ? -3.093  3.188   2.042   1.00 0.00 ? 15 GLN A HG2  4  
ATOM 2568 H HG3  . GLN A 1 15 ? -2.521  1.682   2.710   1.00 0.00 ? 15 GLN A HG3  4  
ATOM 2569 H HE21 . GLN A 1 15 ? -4.270  4.469   3.298   1.00 0.00 ? 15 GLN A HE21 4  
ATOM 2570 H HE22 . GLN A 1 15 ? -4.586  4.265   4.964   1.00 0.00 ? 15 GLN A HE22 4  
ATOM 2571 N N    . LEU A 1 16 ? 1.220   1.277   1.352   1.00 0.00 ? 16 LEU A N    4  
ATOM 2572 C CA   . LEU A 1 16 ? 1.426   0.264   0.270   1.00 0.00 ? 16 LEU A CA   4  
ATOM 2573 C C    . LEU A 1 16 ? 1.971   -0.997  0.937   1.00 0.00 ? 16 LEU A C    4  
ATOM 2574 O O    . LEU A 1 16 ? 1.812   -2.091  0.436   1.00 0.00 ? 16 LEU A O    4  
ATOM 2575 C CB   . LEU A 1 16 ? 2.435   0.763   -0.772  1.00 0.00 ? 16 LEU A CB   4  
ATOM 2576 C CG   . LEU A 1 16 ? 2.102   2.195   -1.226  1.00 0.00 ? 16 LEU A CG   4  
ATOM 2577 C CD1  . LEU A 1 16 ? 3.014   2.524   -2.432  1.00 0.00 ? 16 LEU A CD1  4  
ATOM 2578 C CD2  . LEU A 1 16 ? 0.624   2.414   -1.573  1.00 0.00 ? 16 LEU A CD2  4  
ATOM 2579 H H    . LEU A 1 16 ? 1.896   1.976   1.497   1.00 0.00 ? 16 LEU A H    4  
ATOM 2580 H HA   . LEU A 1 16 ? 0.479   0.050   -0.202  1.00 0.00 ? 16 LEU A HA   4  
ATOM 2581 H HB2  . LEU A 1 16 ? 3.449   0.727   -0.395  1.00 0.00 ? 16 LEU A HB2  4  
ATOM 2582 H HB3  . LEU A 1 16 ? 2.389   0.100   -1.622  1.00 0.00 ? 16 LEU A HB3  4  
ATOM 2583 H HG   . LEU A 1 16 ? 2.311   2.850   -0.401  1.00 0.00 ? 16 LEU A HG   4  
ATOM 2584 H HD11 . LEU A 1 16 ? 4.055   2.426   -2.148  1.00 0.00 ? 16 LEU A HD11 4  
ATOM 2585 H HD12 . LEU A 1 16 ? 2.807   1.846   -3.248  1.00 0.00 ? 16 LEU A HD12 4  
ATOM 2586 H HD13 . LEU A 1 16 ? 2.845   3.533   -2.777  1.00 0.00 ? 16 LEU A HD13 4  
ATOM 2587 H HD21 . LEU A 1 16 ? 0.307   1.733   -2.348  1.00 0.00 ? 16 LEU A HD21 4  
ATOM 2588 H HD22 . LEU A 1 16 ? 0.018   2.269   -0.695  1.00 0.00 ? 16 LEU A HD22 4  
ATOM 2589 H HD23 . LEU A 1 16 ? 0.477   3.434   -1.889  1.00 0.00 ? 16 LEU A HD23 4  
ATOM 2590 N N    . GLU A 1 17 ? 2.603   -0.811  2.067   1.00 0.00 ? 17 GLU A N    4  
ATOM 2591 C CA   . GLU A 1 17 ? 3.165   -1.974  2.814   1.00 0.00 ? 17 GLU A CA   4  
ATOM 2592 C C    . GLU A 1 17 ? 1.972   -2.881  3.198   1.00 0.00 ? 17 GLU A C    4  
ATOM 2593 O O    . GLU A 1 17 ? 2.136   -4.062  3.405   1.00 0.00 ? 17 GLU A O    4  
ATOM 2594 C CB   . GLU A 1 17 ? 3.893   -1.450  4.084   1.00 0.00 ? 17 GLU A CB   4  
ATOM 2595 C CG   . GLU A 1 17 ? 5.150   -0.628  3.664   1.00 0.00 ? 17 GLU A CG   4  
ATOM 2596 C CD   . GLU A 1 17 ? 5.811   0.140   4.838   1.00 0.00 ? 17 GLU A CD   4  
ATOM 2597 O OE1  . GLU A 1 17 ? 5.696   -0.311  5.968   1.00 0.00 ? 17 GLU A OE1  4  
ATOM 2598 O OE2  . GLU A 1 17 ? 6.418   1.154   4.524   1.00 0.00 ? 17 GLU A OE2  4  
ATOM 2599 H H    . GLU A 1 17 ? 2.711   0.093   2.424   1.00 0.00 ? 17 GLU A H    4  
ATOM 2600 H HA   . GLU A 1 17 ? 3.834   -2.520  2.172   1.00 0.00 ? 17 GLU A HA   4  
ATOM 2601 H HB2  . GLU A 1 17 ? 3.225   -0.837  4.665   1.00 0.00 ? 17 GLU A HB2  4  
ATOM 2602 H HB3  . GLU A 1 17 ? 4.202   -2.289  4.689   1.00 0.00 ? 17 GLU A HB3  4  
ATOM 2603 H HG2  . GLU A 1 17 ? 5.888   -1.289  3.235   1.00 0.00 ? 17 GLU A HG2  4  
ATOM 2604 H HG3  . GLU A 1 17 ? 4.864   0.087   2.907   1.00 0.00 ? 17 GLU A HG3  4  
ATOM 2605 N N    . ASN A 1 18 ? 0.802   -2.285  3.248   1.00 0.00 ? 18 ASN A N    4  
ATOM 2606 C CA   . ASN A 1 18 ? -0.471  -2.994  3.608   1.00 0.00 ? 18 ASN A CA   4  
ATOM 2607 C C    . ASN A 1 18 ? -0.888  -4.078  2.585   1.00 0.00 ? 18 ASN A C    4  
ATOM 2608 O O    . ASN A 1 18 ? -1.688  -4.936  2.899   1.00 0.00 ? 18 ASN A O    4  
ATOM 2609 C CB   . ASN A 1 18 ? -1.554  -1.879  3.760   1.00 0.00 ? 18 ASN A CB   4  
ATOM 2610 C CG   . ASN A 1 18 ? -2.896  -2.293  4.402   1.00 0.00 ? 18 ASN A CG   4  
ATOM 2611 O OD1  . ASN A 1 18 ? -3.701  -1.440  4.721   1.00 0.00 ? 18 ASN A OD1  4  
ATOM 2612 N ND2  . ASN A 1 18 ? -3.217  -3.540  4.618   1.00 0.00 ? 18 ASN A ND2  4  
ATOM 2613 H H    . ASN A 1 18 ? 0.760   -1.333  3.028   1.00 0.00 ? 18 ASN A H    4  
ATOM 2614 H HA   . ASN A 1 18 ? -0.316  -3.473  4.559   1.00 0.00 ? 18 ASN A HA   4  
ATOM 2615 H HB2  . ASN A 1 18 ? -1.145  -1.066  4.345   1.00 0.00 ? 18 ASN A HB2  4  
ATOM 2616 H HB3  . ASN A 1 18 ? -1.777  -1.500  2.776   1.00 0.00 ? 18 ASN A HB3  4  
ATOM 2617 H HD21 . ASN A 1 18 ? -2.596  -4.261  4.409   1.00 0.00 ? 18 ASN A HD21 4  
ATOM 2618 H HD22 . ASN A 1 18 ? -4.094  -3.751  5.000   1.00 0.00 ? 18 ASN A HD22 4  
ATOM 2619 N N    . TYR A 1 19 ? -0.344  -4.039  1.394   1.00 0.00 ? 19 TYR A N    4  
ATOM 2620 C CA   . TYR A 1 19 ? -0.739  -5.086  0.380   1.00 0.00 ? 19 TYR A CA   4  
ATOM 2621 C C    . TYR A 1 19 ? 0.042   -6.399  0.619   1.00 0.00 ? 19 TYR A C    4  
ATOM 2622 O O    . TYR A 1 19 ? -0.377  -7.431  0.132   1.00 0.00 ? 19 TYR A O    4  
ATOM 2623 C CB   . TYR A 1 19 ? -0.453  -4.574  -1.085  1.00 0.00 ? 19 TYR A CB   4  
ATOM 2624 C CG   . TYR A 1 19 ? -1.286  -3.316  -1.459  1.00 0.00 ? 19 TYR A CG   4  
ATOM 2625 C CD1  . TYR A 1 19 ? -1.083  -2.103  -0.822  1.00 0.00 ? 19 TYR A CD1  4  
ATOM 2626 C CD2  . TYR A 1 19 ? -2.248  -3.377  -2.453  1.00 0.00 ? 19 TYR A CD2  4  
ATOM 2627 C CE1  . TYR A 1 19 ? -1.807  -0.984  -1.171  1.00 0.00 ? 19 TYR A CE1  4  
ATOM 2628 C CE2  . TYR A 1 19 ? -2.974  -2.256  -2.798  1.00 0.00 ? 19 TYR A CE2  4  
ATOM 2629 C CZ   . TYR A 1 19 ? -2.763  -1.052  -2.161  1.00 0.00 ? 19 TYR A CZ   4  
ATOM 2630 O OH   . TYR A 1 19 ? -3.493  0.068   -2.510  1.00 0.00 ? 19 TYR A OH   4  
ATOM 2631 H H    . TYR A 1 19 ? 0.303   -3.331  1.191   1.00 0.00 ? 19 TYR A H    4  
ATOM 2632 H HA   . TYR A 1 19 ? -1.793  -5.294  0.471   1.00 0.00 ? 19 TYR A HA   4  
ATOM 2633 H HB2  . TYR A 1 19 ? 0.596   -4.352  -1.215  1.00 0.00 ? 19 TYR A HB2  4  
ATOM 2634 H HB3  . TYR A 1 19 ? -0.715  -5.370  -1.772  1.00 0.00 ? 19 TYR A HB3  4  
ATOM 2635 H HD1  . TYR A 1 19 ? -0.351  -2.024  -0.043  1.00 0.00 ? 19 TYR A HD1  4  
ATOM 2636 H HD2  . TYR A 1 19 ? -2.433  -4.303  -2.976  1.00 0.00 ? 19 TYR A HD2  4  
ATOM 2637 H HE1  . TYR A 1 19 ? -1.635  -0.045  -0.668  1.00 0.00 ? 19 TYR A HE1  4  
ATOM 2638 H HE2  . TYR A 1 19 ? -3.726  -2.320  -3.573  1.00 0.00 ? 19 TYR A HE2  4  
ATOM 2639 H HH   . TYR A 1 19 ? -4.279  0.086   -1.961  1.00 0.00 ? 19 TYR A HH   4  
ATOM 2640 N N    . CYS A 1 20 ? 1.126   -6.330  1.357   1.00 0.00 ? 20 CYS A N    4  
ATOM 2641 C CA   . CYS A 1 20 ? 1.959   -7.550  1.656   1.00 0.00 ? 20 CYS A CA   4  
ATOM 2642 C C    . CYS A 1 20 ? 1.894   -7.848  3.169   1.00 0.00 ? 20 CYS A C    4  
ATOM 2643 O O    . CYS A 1 20 ? 1.893   -8.990  3.587   1.00 0.00 ? 20 CYS A O    4  
ATOM 2644 C CB   . CYS A 1 20 ? 3.433   -7.304  1.224   1.00 0.00 ? 20 CYS A CB   4  
ATOM 2645 S SG   . CYS A 1 20 ? 3.677   -6.132  -0.132  1.00 0.00 ? 20 CYS A SG   4  
ATOM 2646 H H    . CYS A 1 20 ? 1.404   -5.466  1.722   1.00 0.00 ? 20 CYS A H    4  
ATOM 2647 H HA   . CYS A 1 20 ? 1.581   -8.395  1.099   1.00 0.00 ? 20 CYS A HA   4  
ATOM 2648 H HB2  . CYS A 1 20 ? 4.072   -6.997  2.042   1.00 0.00 ? 20 CYS A HB2  4  
ATOM 2649 H HB3  . CYS A 1 20 ? 3.834   -8.248  0.892   1.00 0.00 ? 20 CYS A HB3  4  
ATOM 2650 N N    . ASN A 1 21 ? 1.842   -6.791  3.942   1.00 0.00 ? 21 ASN A N    4  
ATOM 2651 C CA   . ASN A 1 21 ? 1.780   -6.851  5.428   1.00 0.00 ? 21 ASN A CA   4  
ATOM 2652 C C    . ASN A 1 21 ? 0.391   -6.374  5.886   1.00 0.00 ? 21 ASN A C    4  
ATOM 2653 O O    . ASN A 1 21 ? -0.406  -5.831  5.144   1.00 0.00 ? 21 ASN A O    4  
ATOM 2654 C CB   . ASN A 1 21 ? 2.865   -5.925  6.017   1.00 0.00 ? 21 ASN A CB   4  
ATOM 2655 C CG   . ASN A 1 21 ? 4.297   -6.437  5.775   1.00 0.00 ? 21 ASN A CG   4  
ATOM 2656 O OD1  . ASN A 1 21 ? 5.258   -5.731  6.005   1.00 0.00 ? 21 ASN A OD1  4  
ATOM 2657 N ND2  . ASN A 1 21 ? 4.505   -7.644  5.318   1.00 0.00 ? 21 ASN A ND2  4  
ATOM 2658 H H    . ASN A 1 21 ? 1.834   -5.898  3.560   1.00 0.00 ? 21 ASN A H    4  
ATOM 2659 H HA   . ASN A 1 21 ? 1.932   -7.864  5.763   1.00 0.00 ? 21 ASN A HA   4  
ATOM 2660 H HB2  . ASN A 1 21 ? 2.786   -4.947  5.569   1.00 0.00 ? 21 ASN A HB2  4  
ATOM 2661 H HB3  . ASN A 1 21 ? 2.733   -5.822  7.086   1.00 0.00 ? 21 ASN A HB3  4  
ATOM 2662 H HD21 . ASN A 1 21 ? 3.749   -8.237  5.126   1.00 0.00 ? 21 ASN A HD21 4  
ATOM 2663 H HD22 . ASN A 1 21 ? 5.425   -7.953  5.173   1.00 0.00 ? 21 ASN A HD22 4  
ATOM 2664 N N    . PHE B 2 1  ? 12.801  5.497   -4.569  1.00 0.00 ? 1  PHE B N    4  
ATOM 2665 C CA   . PHE B 2 1  ? 11.704  6.407   -4.128  1.00 0.00 ? 1  PHE B CA   4  
ATOM 2666 C C    . PHE B 2 1  ? 10.863  6.786   -5.354  1.00 0.00 ? 1  PHE B C    4  
ATOM 2667 O O    . PHE B 2 1  ? 11.366  6.786   -6.461  1.00 0.00 ? 1  PHE B O    4  
ATOM 2668 C CB   . PHE B 2 1  ? 12.319  7.674   -3.501  1.00 0.00 ? 1  PHE B CB   4  
ATOM 2669 C CG   . PHE B 2 1  ? 11.268  8.606   -2.859  1.00 0.00 ? 1  PHE B CG   4  
ATOM 2670 C CD1  . PHE B 2 1  ? 10.249  8.112   -2.062  1.00 0.00 ? 1  PHE B CD1  4  
ATOM 2671 C CD2  . PHE B 2 1  ? 11.344  9.973   -3.064  1.00 0.00 ? 1  PHE B CD2  4  
ATOM 2672 C CE1  . PHE B 2 1  ? 9.330   8.968   -1.483  1.00 0.00 ? 1  PHE B CE1  4  
ATOM 2673 C CE2  . PHE B 2 1  ? 10.428  10.826  -2.487  1.00 0.00 ? 1  PHE B CE2  4  
ATOM 2674 C CZ   . PHE B 2 1  ? 9.423   10.320  -1.698  1.00 0.00 ? 1  PHE B CZ   4  
ATOM 2675 H H1   . PHE B 2 1  ? 12.744  5.343   -5.596  1.00 0.00 ? 1  PHE B H1   4  
ATOM 2676 H H2   . PHE B 2 1  ? 13.721  5.925   -4.337  1.00 0.00 ? 1  PHE B H2   4  
ATOM 2677 H H3   . PHE B 2 1  ? 12.703  4.590   -4.071  1.00 0.00 ? 1  PHE B H3   4  
ATOM 2678 H HA   . PHE B 2 1  ? 11.087  5.877   -3.413  1.00 0.00 ? 1  PHE B HA   4  
ATOM 2679 H HB2  . PHE B 2 1  ? 13.015  7.378   -2.737  1.00 0.00 ? 1  PHE B HB2  4  
ATOM 2680 H HB3  . PHE B 2 1  ? 12.860  8.232   -4.253  1.00 0.00 ? 1  PHE B HB3  4  
ATOM 2681 H HD1  . PHE B 2 1  ? 10.169  7.052   -1.885  1.00 0.00 ? 1  PHE B HD1  4  
ATOM 2682 H HD2  . PHE B 2 1  ? 12.126  10.383  -3.686  1.00 0.00 ? 1  PHE B HD2  4  
ATOM 2683 H HE1  . PHE B 2 1  ? 8.538   8.581   -0.860  1.00 0.00 ? 1  PHE B HE1  4  
ATOM 2684 H HE2  . PHE B 2 1  ? 10.496  11.894  -2.648  1.00 0.00 ? 1  PHE B HE2  4  
ATOM 2685 H HZ   . PHE B 2 1  ? 8.707   10.989  -1.246  1.00 0.00 ? 1  PHE B HZ   4  
ATOM 2686 N N    . VAL B 2 2  ? 9.618   7.104   -5.112  1.00 0.00 ? 2  VAL B N    4  
ATOM 2687 C CA   . VAL B 2 2  ? 8.693   7.488   -6.219  1.00 0.00 ? 2  VAL B CA   4  
ATOM 2688 C C    . VAL B 2 2  ? 8.246   8.946   -6.068  1.00 0.00 ? 2  VAL B C    4  
ATOM 2689 O O    . VAL B 2 2  ? 8.614   9.628   -5.132  1.00 0.00 ? 2  VAL B O    4  
ATOM 2690 C CB   . VAL B 2 2  ? 7.462   6.517   -6.206  1.00 0.00 ? 2  VAL B CB   4  
ATOM 2691 C CG1  . VAL B 2 2  ? 7.842   5.152   -6.842  1.00 0.00 ? 2  VAL B CG1  4  
ATOM 2692 C CG2  . VAL B 2 2  ? 7.013   6.241   -4.756  1.00 0.00 ? 2  VAL B CG2  4  
ATOM 2693 H H    . VAL B 2 2  ? 9.283   7.090   -4.190  1.00 0.00 ? 2  VAL B H    4  
ATOM 2694 H HA   . VAL B 2 2  ? 9.201   7.380   -7.166  1.00 0.00 ? 2  VAL B HA   4  
ATOM 2695 H HB   . VAL B 2 2  ? 6.631   6.941   -6.747  1.00 0.00 ? 2  VAL B HB   4  
ATOM 2696 H HG11 . VAL B 2 2  ? 8.655   4.680   -6.312  1.00 0.00 ? 2  VAL B HG11 4  
ATOM 2697 H HG12 . VAL B 2 2  ? 6.993   4.486   -6.828  1.00 0.00 ? 2  VAL B HG12 4  
ATOM 2698 H HG13 . VAL B 2 2  ? 8.138   5.290   -7.867  1.00 0.00 ? 2  VAL B HG13 4  
ATOM 2699 H HG21 . VAL B 2 2  ? 6.757   7.169   -4.260  1.00 0.00 ? 2  VAL B HG21 4  
ATOM 2700 H HG22 . VAL B 2 2  ? 6.153   5.592   -4.780  1.00 0.00 ? 2  VAL B HG22 4  
ATOM 2701 H HG23 . VAL B 2 2  ? 7.793   5.744   -4.194  1.00 0.00 ? 2  VAL B HG23 4  
ATOM 2702 N N    . ASN B 2 3  ? 7.452   9.367   -7.015  1.00 0.00 ? 3  ASN B N    4  
ATOM 2703 C CA   . ASN B 2 3  ? 6.909   10.763  -7.040  1.00 0.00 ? 3  ASN B CA   4  
ATOM 2704 C C    . ASN B 2 3  ? 5.495   10.620  -6.404  1.00 0.00 ? 3  ASN B C    4  
ATOM 2705 O O    . ASN B 2 3  ? 5.071   9.502   -6.167  1.00 0.00 ? 3  ASN B O    4  
ATOM 2706 C CB   . ASN B 2 3  ? 6.910   11.197  -8.555  1.00 0.00 ? 3  ASN B CB   4  
ATOM 2707 C CG   . ASN B 2 3  ? 8.311   10.937  -9.154  1.00 0.00 ? 3  ASN B CG   4  
ATOM 2708 O OD1  . ASN B 2 3  ? 9.286   11.557  -8.777  1.00 0.00 ? 3  ASN B OD1  4  
ATOM 2709 N ND2  . ASN B 2 3  ? 8.461   10.029  -10.084 1.00 0.00 ? 3  ASN B ND2  4  
ATOM 2710 H H    . ASN B 2 3  ? 7.205   8.753   -7.735  1.00 0.00 ? 3  ASN B H    4  
ATOM 2711 H HA   . ASN B 2 3  ? 7.521   11.422  -6.440  1.00 0.00 ? 3  ASN B HA   4  
ATOM 2712 H HB2  . ASN B 2 3  ? 6.185   10.619  -9.112  1.00 0.00 ? 3  ASN B HB2  4  
ATOM 2713 H HB3  . ASN B 2 3  ? 6.708   12.247  -8.713  1.00 0.00 ? 3  ASN B HB3  4  
ATOM 2714 H HD21 . ASN B 2 3  ? 7.700   9.499   -10.398 1.00 0.00 ? 3  ASN B HD21 4  
ATOM 2715 H HD22 . ASN B 2 3  ? 9.349   9.874   -10.472 1.00 0.00 ? 3  ASN B HD22 4  
ATOM 2716 N N    . GLN B 2 4  ? 4.783   11.692  -6.129  1.00 0.00 ? 4  GLN B N    4  
ATOM 2717 C CA   . GLN B 2 4  ? 3.417   11.543  -5.520  1.00 0.00 ? 4  GLN B CA   4  
ATOM 2718 C C    . GLN B 2 4  ? 2.444   11.287  -6.693  1.00 0.00 ? 4  GLN B C    4  
ATOM 2719 O O    . GLN B 2 4  ? 1.345   11.807  -6.729  1.00 0.00 ? 4  GLN B O    4  
ATOM 2720 C CB   . GLN B 2 4  ? 3.095   12.864  -4.760  1.00 0.00 ? 4  GLN B CB   4  
ATOM 2721 C CG   . GLN B 2 4  ? 1.803   12.765  -3.909  1.00 0.00 ? 4  GLN B CG   4  
ATOM 2722 C CD   . GLN B 2 4  ? 1.951   11.668  -2.847  1.00 0.00 ? 4  GLN B CD   4  
ATOM 2723 O OE1  . GLN B 2 4  ? 2.883   11.669  -2.067  1.00 0.00 ? 4  GLN B OE1  4  
ATOM 2724 N NE2  . GLN B 2 4  ? 1.056   10.721  -2.784  1.00 0.00 ? 4  GLN B NE2  4  
ATOM 2725 H H    . GLN B 2 4  ? 5.114   12.596  -6.298  1.00 0.00 ? 4  GLN B H    4  
ATOM 2726 H HA   . GLN B 2 4  ? 3.393   10.727  -4.811  1.00 0.00 ? 4  GLN B HA   4  
ATOM 2727 H HB2  . GLN B 2 4  ? 3.923   13.093  -4.101  1.00 0.00 ? 4  GLN B HB2  4  
ATOM 2728 H HB3  . GLN B 2 4  ? 2.997   13.671  -5.475  1.00 0.00 ? 4  GLN B HB3  4  
ATOM 2729 H HG2  . GLN B 2 4  ? 1.638   13.702  -3.403  1.00 0.00 ? 4  GLN B HG2  4  
ATOM 2730 H HG3  . GLN B 2 4  ? 0.940   12.551  -4.523  1.00 0.00 ? 4  GLN B HG3  4  
ATOM 2731 H HE21 . GLN B 2 4  ? 0.302   10.724  -3.410  1.00 0.00 ? 4  GLN B HE21 4  
ATOM 2732 H HE22 . GLN B 2 4  ? 1.141   10.013  -2.111  1.00 0.00 ? 4  GLN B HE22 4  
ATOM 2733 N N    . HIS B 2 5  ? 2.886   10.478  -7.634  1.00 0.00 ? 5  HIS B N    4  
ATOM 2734 C CA   . HIS B 2 5  ? 2.076   10.127  -8.830  1.00 0.00 ? 5  HIS B CA   4  
ATOM 2735 C C    . HIS B 2 5  ? 1.619   8.685   -8.567  1.00 0.00 ? 5  HIS B C    4  
ATOM 2736 O O    . HIS B 2 5  ? 1.953   7.772   -9.299  1.00 0.00 ? 5  HIS B O    4  
ATOM 2737 C CB   . HIS B 2 5  ? 2.994   10.233  -10.075 1.00 0.00 ? 5  HIS B CB   4  
ATOM 2738 C CG   . HIS B 2 5  ? 3.528   11.660  -10.264 1.00 0.00 ? 5  HIS B CG   4  
ATOM 2739 N ND1  . HIS B 2 5  ? 4.253   12.047  -11.260 1.00 0.00 ? 5  HIS B ND1  4  
ATOM 2740 C CD2  . HIS B 2 5  ? 3.384   12.803  -9.491  1.00 0.00 ? 5  HIS B CD2  4  
ATOM 2741 C CE1  . HIS B 2 5  ? 4.540   13.304  -11.135 1.00 0.00 ? 5  HIS B CE1  4  
ATOM 2742 N NE2  . HIS B 2 5  ? 4.019   13.817  -10.047 1.00 0.00 ? 5  HIS B NE2  4  
ATOM 2743 H H    . HIS B 2 5  ? 3.775   10.071  -7.600  1.00 0.00 ? 5  HIS B H    4  
ATOM 2744 H HA   . HIS B 2 5  ? 1.218   10.777  -8.913  1.00 0.00 ? 5  HIS B HA   4  
ATOM 2745 H HB2  . HIS B 2 5  ? 3.849   9.596   -9.935  1.00 0.00 ? 5  HIS B HB2  4  
ATOM 2746 H HB3  . HIS B 2 5  ? 2.470   9.934   -10.968 1.00 0.00 ? 5  HIS B HB3  4  
ATOM 2747 H HD1  . HIS B 2 5  ? 4.542   11.472  -12.000 1.00 0.00 ? 5  HIS B HD1  4  
ATOM 2748 H HD2  . HIS B 2 5  ? 2.833   12.854  -8.560  1.00 0.00 ? 5  HIS B HD2  4  
ATOM 2749 H HE1  . HIS B 2 5  ? 5.137   13.864  -11.839 1.00 0.00 ? 5  HIS B HE1  4  
ATOM 2750 N N    . LEU B 2 6  ? 0.853   8.551   -7.508  1.00 0.00 ? 6  LEU B N    4  
ATOM 2751 C CA   . LEU B 2 6  ? 0.319   7.219   -7.095  1.00 0.00 ? 6  LEU B CA   4  
ATOM 2752 C C    . LEU B 2 6  ? -1.159  7.139   -7.491  1.00 0.00 ? 6  LEU B C    4  
ATOM 2753 O O    . LEU B 2 6  ? -2.003  7.850   -6.982  1.00 0.00 ? 6  LEU B O    4  
ATOM 2754 C CB   . LEU B 2 6  ? 0.546   7.097   -5.567  1.00 0.00 ? 6  LEU B CB   4  
ATOM 2755 C CG   . LEU B 2 6  ? 2.077   7.255   -5.249  1.00 0.00 ? 6  LEU B CG   4  
ATOM 2756 C CD1  . LEU B 2 6  ? 2.271   7.488   -3.733  1.00 0.00 ? 6  LEU B CD1  4  
ATOM 2757 C CD2  . LEU B 2 6  ? 2.850   5.970   -5.622  1.00 0.00 ? 6  LEU B CD2  4  
ATOM 2758 H H    . LEU B 2 6  ? 0.632   9.348   -6.983  1.00 0.00 ? 6  LEU B H    4  
ATOM 2759 H HA   . LEU B 2 6  ? 0.840   6.428   -7.602  1.00 0.00 ? 6  LEU B HA   4  
ATOM 2760 H HB2  . LEU B 2 6  ? -0.023  7.860   -5.059  1.00 0.00 ? 6  LEU B HB2  4  
ATOM 2761 H HB3  . LEU B 2 6  ? 0.191   6.129   -5.236  1.00 0.00 ? 6  LEU B HB3  4  
ATOM 2762 H HG   . LEU B 2 6  ? 2.500   8.103   -5.773  1.00 0.00 ? 6  LEU B HG   4  
ATOM 2763 H HD11 . LEU B 2 6  ? 1.750   8.385   -3.437  1.00 0.00 ? 6  LEU B HD11 4  
ATOM 2764 H HD12 . LEU B 2 6  ? 1.895   6.656   -3.156  1.00 0.00 ? 6  LEU B HD12 4  
ATOM 2765 H HD13 . LEU B 2 6  ? 3.322   7.625   -3.515  1.00 0.00 ? 6  LEU B HD13 4  
ATOM 2766 H HD21 . LEU B 2 6  ? 2.736   5.754   -6.673  1.00 0.00 ? 6  LEU B HD21 4  
ATOM 2767 H HD22 . LEU B 2 6  ? 3.903   6.111   -5.429  1.00 0.00 ? 6  LEU B HD22 4  
ATOM 2768 H HD23 . LEU B 2 6  ? 2.500   5.120   -5.052  1.00 0.00 ? 6  LEU B HD23 4  
ATOM 2769 N N    . CYS B 2 7  ? -1.349  6.219   -8.410  1.00 0.00 ? 7  CYS B N    4  
ATOM 2770 C CA   . CYS B 2 7  ? -2.626  5.815   -9.093  1.00 0.00 ? 7  CYS B CA   4  
ATOM 2771 C C    . CYS B 2 7  ? -2.043  5.791   -10.503 1.00 0.00 ? 7  CYS B C    4  
ATOM 2772 O O    . CYS B 2 7  ? -2.033  6.789   -11.200 1.00 0.00 ? 7  CYS B O    4  
ATOM 2773 C CB   . CYS B 2 7  ? -3.742  6.892   -8.995  1.00 0.00 ? 7  CYS B CB   4  
ATOM 2774 S SG   . CYS B 2 7  ? -5.348  6.462   -9.710  1.00 0.00 ? 7  CYS B SG   4  
ATOM 2775 H H    . CYS B 2 7  ? -0.550  5.726   -8.692  1.00 0.00 ? 7  CYS B H    4  
ATOM 2776 H HA   . CYS B 2 7  ? -2.929  4.825   -8.778  1.00 0.00 ? 7  CYS B HA   4  
ATOM 2777 H HB2  . CYS B 2 7  ? -3.924  7.122   -7.959  1.00 0.00 ? 7  CYS B HB2  4  
ATOM 2778 H HB3  . CYS B 2 7  ? -3.416  7.799   -9.476  1.00 0.00 ? 7  CYS B HB3  4  
ATOM 2779 N N    . GLY B 2 8  ? -1.555  4.621   -10.851 1.00 0.00 ? 8  GLY B N    4  
ATOM 2780 C CA   . GLY B 2 8  ? -0.930  4.413   -12.189 1.00 0.00 ? 8  GLY B CA   4  
ATOM 2781 C C    . GLY B 2 8  ? 0.516   3.786   -11.976 1.00 0.00 ? 8  GLY B C    4  
ATOM 2782 O O    . GLY B 2 8  ? 0.833   3.392   -10.866 1.00 0.00 ? 8  GLY B O    4  
ATOM 2783 H H    . GLY B 2 8  ? -1.616  3.869   -10.227 1.00 0.00 ? 8  GLY B H    4  
ATOM 2784 H HA2  . GLY B 2 8  ? -1.564  3.751   -12.764 1.00 0.00 ? 8  GLY B HA2  4  
ATOM 2785 H HA3  . GLY B 2 8  ? -0.901  5.396   -12.652 1.00 0.00 ? 8  GLY B HA3  4  
ATOM 2786 N N    . SER B 2 9  ? 1.359   3.671   -12.998 1.00 0.00 ? 9  SER B N    4  
ATOM 2787 C CA   . SER B 2 9  ? 2.749   3.098   -12.907 1.00 0.00 ? 9  SER B CA   4  
ATOM 2788 C C    . SER B 2 9  ? 3.571   3.051   -11.614 1.00 0.00 ? 9  SER B C    4  
ATOM 2789 O O    . SER B 2 9  ? 4.295   2.103   -11.422 1.00 0.00 ? 9  SER B O    4  
ATOM 2790 C CB   . SER B 2 9  ? 3.592   3.809   -13.977 1.00 0.00 ? 9  SER B CB   4  
ATOM 2791 O OG   . SER B 2 9  ? 3.059   3.317   -15.195 1.00 0.00 ? 9  SER B OG   4  
ATOM 2792 H H    . SER B 2 9  ? 1.156   3.944   -13.918 1.00 0.00 ? 9  SER B H    4  
ATOM 2793 H HA   . SER B 2 9  ? 2.639   2.068   -13.180 1.00 0.00 ? 9  SER B HA   4  
ATOM 2794 H HB2  . SER B 2 9  ? 3.461   4.882   -13.939 1.00 0.00 ? 9  SER B HB2  4  
ATOM 2795 H HB3  . SER B 2 9  ? 4.643   3.567   -13.917 1.00 0.00 ? 9  SER B HB3  4  
ATOM 2796 H HG   . SER B 2 9  ? 2.775   4.058   -15.733 1.00 0.00 ? 9  SER B HG   4  
ATOM 2797 N N    . HIS B 2 10 ? 3.470   4.019   -10.750 1.00 0.00 ? 10 HIS B N    4  
ATOM 2798 C CA   . HIS B 2 10 ? 4.277   3.990   -9.483  1.00 0.00 ? 10 HIS B CA   4  
ATOM 2799 C C    . HIS B 2 10 ? 3.686   3.046   -8.442  1.00 0.00 ? 10 HIS B C    4  
ATOM 2800 O O    . HIS B 2 10 ? 4.412   2.541   -7.611  1.00 0.00 ? 10 HIS B O    4  
ATOM 2801 C CB   . HIS B 2 10 ? 4.379   5.409   -8.915  1.00 0.00 ? 10 HIS B CB   4  
ATOM 2802 C CG   . HIS B 2 10 ? 5.327   6.206   -9.809  1.00 0.00 ? 10 HIS B CG   4  
ATOM 2803 N ND1  . HIS B 2 10 ? 6.595   5.991   -9.918  1.00 0.00 ? 10 HIS B ND1  4  
ATOM 2804 C CD2  . HIS B 2 10 ? 5.101   7.275   -10.665 1.00 0.00 ? 10 HIS B CD2  4  
ATOM 2805 C CE1  . HIS B 2 10 ? 7.119   6.828   -10.748 1.00 0.00 ? 10 HIS B CE1  4  
ATOM 2806 N NE2  . HIS B 2 10 ? 6.224   7.653   -11.244 1.00 0.00 ? 10 HIS B NE2  4  
ATOM 2807 H H    . HIS B 2 10 ? 2.856   4.732   -10.955 1.00 0.00 ? 10 HIS B H    4  
ATOM 2808 H HA   . HIS B 2 10 ? 5.272   3.673   -9.729  1.00 0.00 ? 10 HIS B HA   4  
ATOM 2809 H HB2  . HIS B 2 10 ? 3.421   5.892   -8.898  1.00 0.00 ? 10 HIS B HB2  4  
ATOM 2810 H HB3  . HIS B 2 10 ? 4.792   5.381   -7.916  1.00 0.00 ? 10 HIS B HB3  4  
ATOM 2811 H HD1  . HIS B 2 10 ? 7.092   5.295   -9.440  1.00 0.00 ? 10 HIS B HD1  4  
ATOM 2812 H HD2  . HIS B 2 10 ? 4.136   7.727   -10.836 1.00 0.00 ? 10 HIS B HD2  4  
ATOM 2813 H HE1  . HIS B 2 10 ? 8.168   6.841   -11.001 1.00 0.00 ? 10 HIS B HE1  4  
ATOM 2814 N N    . LEU B 2 11 ? 2.399   2.809   -8.497  1.00 0.00 ? 11 LEU B N    4  
ATOM 2815 C CA   . LEU B 2 11 ? 1.770   1.878   -7.514  1.00 0.00 ? 11 LEU B CA   4  
ATOM 2816 C C    . LEU B 2 11 ? 2.010   0.528   -8.210  1.00 0.00 ? 11 LEU B C    4  
ATOM 2817 O O    . LEU B 2 11 ? 2.131   -0.477  -7.543  1.00 0.00 ? 11 LEU B O    4  
ATOM 2818 C CB   . LEU B 2 11 ? 0.251   2.148   -7.349  1.00 0.00 ? 11 LEU B CB   4  
ATOM 2819 C CG   . LEU B 2 11 ? 0.008   3.325   -6.356  1.00 0.00 ? 11 LEU B CG   4  
ATOM 2820 C CD1  . LEU B 2 11 ? -1.469  3.671   -6.381  1.00 0.00 ? 11 LEU B CD1  4  
ATOM 2821 C CD2  . LEU B 2 11 ? 0.318   2.927   -4.884  1.00 0.00 ? 11 LEU B CD2  4  
ATOM 2822 H H    . LEU B 2 11 ? 1.849   3.227   -9.179  1.00 0.00 ? 11 LEU B H    4  
ATOM 2823 H HA   . LEU B 2 11 ? 2.295   1.895   -6.575  1.00 0.00 ? 11 LEU B HA   4  
ATOM 2824 H HB2  . LEU B 2 11 ? -0.184  2.406   -8.301  1.00 0.00 ? 11 LEU B HB2  4  
ATOM 2825 H HB3  . LEU B 2 11 ? -0.237  1.252   -6.982  1.00 0.00 ? 11 LEU B HB3  4  
ATOM 2826 H HG   . LEU B 2 11 ? 0.573   4.197   -6.649  1.00 0.00 ? 11 LEU B HG   4  
ATOM 2827 H HD11 . LEU B 2 11 ? -1.761  3.953   -7.379  1.00 0.00 ? 11 LEU B HD11 4  
ATOM 2828 H HD12 . LEU B 2 11 ? -2.064  2.831   -6.062  1.00 0.00 ? 11 LEU B HD12 4  
ATOM 2829 H HD13 . LEU B 2 11 ? -1.636  4.493   -5.710  1.00 0.00 ? 11 LEU B HD13 4  
ATOM 2830 H HD21 . LEU B 2 11 ? 1.351   2.624   -4.778  1.00 0.00 ? 11 LEU B HD21 4  
ATOM 2831 H HD22 . LEU B 2 11 ? 0.149   3.764   -4.219  1.00 0.00 ? 11 LEU B HD22 4  
ATOM 2832 H HD23 . LEU B 2 11 ? -0.314  2.111   -4.563  1.00 0.00 ? 11 LEU B HD23 4  
ATOM 2833 N N    . VAL B 2 12 ? 2.085   0.528   -9.526  1.00 0.00 ? 12 VAL B N    4  
ATOM 2834 C CA   . VAL B 2 12 ? 2.334   -0.779  -10.211 1.00 0.00 ? 12 VAL B CA   4  
ATOM 2835 C C    . VAL B 2 12 ? 3.769   -1.192  -9.877  1.00 0.00 ? 12 VAL B C    4  
ATOM 2836 O O    . VAL B 2 12 ? 3.994   -2.329  -9.517  1.00 0.00 ? 12 VAL B O    4  
ATOM 2837 C CB   . VAL B 2 12 ? 2.217   -0.677  -11.755 1.00 0.00 ? 12 VAL B CB   4  
ATOM 2838 C CG1  . VAL B 2 12 ? 2.505   -2.060  -12.384 1.00 0.00 ? 12 VAL B CG1  4  
ATOM 2839 C CG2  . VAL B 2 12 ? 0.803   -0.275  -12.149 1.00 0.00 ? 12 VAL B CG2  4  
ATOM 2840 H H    . VAL B 2 12 ? 1.985   1.353   -10.040 1.00 0.00 ? 12 VAL B H    4  
ATOM 2841 H HA   . VAL B 2 12 ? 1.652   -1.530  -9.833  1.00 0.00 ? 12 VAL B HA   4  
ATOM 2842 H HB   . VAL B 2 12 ? 2.931   0.046   -12.124 1.00 0.00 ? 12 VAL B HB   4  
ATOM 2843 H HG11 . VAL B 2 12 ? 1.817   -2.806  -12.008 1.00 0.00 ? 12 VAL B HG11 4  
ATOM 2844 H HG12 . VAL B 2 12 ? 2.420   -1.998  -13.457 1.00 0.00 ? 12 VAL B HG12 4  
ATOM 2845 H HG13 . VAL B 2 12 ? 3.507   -2.376  -12.148 1.00 0.00 ? 12 VAL B HG13 4  
ATOM 2846 H HG21 . VAL B 2 12 ? 0.085   -0.981  -11.761 1.00 0.00 ? 12 VAL B HG21 4  
ATOM 2847 H HG22 . VAL B 2 12 ? 0.579   0.709   -11.760 1.00 0.00 ? 12 VAL B HG22 4  
ATOM 2848 H HG23 . VAL B 2 12 ? 0.705   -0.254  -13.229 1.00 0.00 ? 12 VAL B HG23 4  
ATOM 2849 N N    . GLU B 2 13 ? 4.704   -0.281  -9.986  1.00 0.00 ? 13 GLU B N    4  
ATOM 2850 C CA   . GLU B 2 13 ? 6.131   -0.651  -9.678  1.00 0.00 ? 13 GLU B CA   4  
ATOM 2851 C C    . GLU B 2 13 ? 6.385   -0.814  -8.167  1.00 0.00 ? 13 GLU B C    4  
ATOM 2852 O O    . GLU B 2 13 ? 7.285   -1.533  -7.785  1.00 0.00 ? 13 GLU B O    4  
ATOM 2853 C CB   . GLU B 2 13 ? 7.086   0.428   -10.249 1.00 0.00 ? 13 GLU B CB   4  
ATOM 2854 C CG   . GLU B 2 13 ? 6.812   0.596   -11.781 1.00 0.00 ? 13 GLU B CG   4  
ATOM 2855 C CD   . GLU B 2 13 ? 7.104   2.018   -12.311 1.00 0.00 ? 13 GLU B CD   4  
ATOM 2856 O OE1  . GLU B 2 13 ? 7.499   2.882   -11.541 1.00 0.00 ? 13 GLU B OE1  4  
ATOM 2857 O OE2  . GLU B 2 13 ? 6.898   2.168   -13.503 1.00 0.00 ? 13 GLU B OE2  4  
ATOM 2858 H H    . GLU B 2 13 ? 4.472   0.636   -10.266 1.00 0.00 ? 13 GLU B H    4  
ATOM 2859 H HA   . GLU B 2 13 ? 6.366   -1.571  -10.183 1.00 0.00 ? 13 GLU B HA   4  
ATOM 2860 H HB2  . GLU B 2 13 ? 7.022   1.338   -9.683  1.00 0.00 ? 13 GLU B HB2  4  
ATOM 2861 H HB3  . GLU B 2 13 ? 8.099   0.060   -10.150 1.00 0.00 ? 13 GLU B HB3  4  
ATOM 2862 H HG2  . GLU B 2 13 ? 7.433   -0.103  -12.326 1.00 0.00 ? 13 GLU B HG2  4  
ATOM 2863 H HG3  . GLU B 2 13 ? 5.792   0.349   -12.017 1.00 0.00 ? 13 GLU B HG3  4  
ATOM 2864 N N    . ALA B 2 14 ? 5.599   -0.162  -7.346  1.00 0.00 ? 14 ALA B N    4  
ATOM 2865 C CA   . ALA B 2 14 ? 5.801   -0.281  -5.864  1.00 0.00 ? 14 ALA B CA   4  
ATOM 2866 C C    . ALA B 2 14 ? 5.130   -1.516  -5.238  1.00 0.00 ? 14 ALA B C    4  
ATOM 2867 O O    . ALA B 2 14 ? 5.711   -2.104  -4.349  1.00 0.00 ? 14 ALA B O    4  
ATOM 2868 C CB   . ALA B 2 14 ? 5.267   1.001   -5.195  1.00 0.00 ? 14 ALA B CB   4  
ATOM 2869 H H    . ALA B 2 14 ? 4.881   0.399   -7.702  1.00 0.00 ? 14 ALA B H    4  
ATOM 2870 H HA   . ALA B 2 14 ? 6.859   -0.338  -5.662  1.00 0.00 ? 14 ALA B HA   4  
ATOM 2871 H HB1  . ALA B 2 14 ? 4.221   1.139   -5.413  1.00 0.00 ? 14 ALA B HB1  4  
ATOM 2872 H HB2  . ALA B 2 14 ? 5.408   0.938   -4.123  1.00 0.00 ? 14 ALA B HB2  4  
ATOM 2873 H HB3  . ALA B 2 14 ? 5.808   1.864   -5.555  1.00 0.00 ? 14 ALA B HB3  4  
ATOM 2874 N N    . LEU B 2 15 ? 3.958   -1.901  -5.683  1.00 0.00 ? 15 LEU B N    4  
ATOM 2875 C CA   . LEU B 2 15 ? 3.308   -3.105  -5.073  1.00 0.00 ? 15 LEU B CA   4  
ATOM 2876 C C    . LEU B 2 15 ? 3.929   -4.365  -5.687  1.00 0.00 ? 15 LEU B C    4  
ATOM 2877 O O    . LEU B 2 15 ? 4.060   -5.380  -5.031  1.00 0.00 ? 15 LEU B O    4  
ATOM 2878 C CB   . LEU B 2 15 ? 1.759   -3.047  -5.329  1.00 0.00 ? 15 LEU B CB   4  
ATOM 2879 C CG   . LEU B 2 15 ? 1.051   -2.046  -4.355  1.00 0.00 ? 15 LEU B CG   4  
ATOM 2880 C CD1  . LEU B 2 15 ? 1.714   -0.643  -4.327  1.00 0.00 ? 15 LEU B CD1  4  
ATOM 2881 C CD2  . LEU B 2 15 ? -0.405  -1.866  -4.821  1.00 0.00 ? 15 LEU B CD2  4  
ATOM 2882 H H    . LEU B 2 15 ? 3.499   -1.418  -6.402  1.00 0.00 ? 15 LEU B H    4  
ATOM 2883 H HA   . LEU B 2 15 ? 3.518   -3.112  -4.022  1.00 0.00 ? 15 LEU B HA   4  
ATOM 2884 H HB2  . LEU B 2 15 ? 1.528   -2.743  -6.337  1.00 0.00 ? 15 LEU B HB2  4  
ATOM 2885 H HB3  . LEU B 2 15 ? 1.348   -4.036  -5.172  1.00 0.00 ? 15 LEU B HB3  4  
ATOM 2886 H HG   . LEU B 2 15 ? 1.050   -2.461  -3.357  1.00 0.00 ? 15 LEU B HG   4  
ATOM 2887 H HD11 . LEU B 2 15 ? 1.715   -0.193  -5.303  1.00 0.00 ? 15 LEU B HD11 4  
ATOM 2888 H HD12 . LEU B 2 15 ? 1.168   0.009   -3.665  1.00 0.00 ? 15 LEU B HD12 4  
ATOM 2889 H HD13 . LEU B 2 15 ? 2.731   -0.705  -3.971  1.00 0.00 ? 15 LEU B HD13 4  
ATOM 2890 H HD21 . LEU B 2 15 ? -0.430  -1.495  -5.837  1.00 0.00 ? 15 LEU B HD21 4  
ATOM 2891 H HD22 . LEU B 2 15 ? -0.921  -2.814  -4.780  1.00 0.00 ? 15 LEU B HD22 4  
ATOM 2892 H HD23 . LEU B 2 15 ? -0.916  -1.155  -4.187  1.00 0.00 ? 15 LEU B HD23 4  
ATOM 2893 N N    . TYR B 2 16 ? 4.322   -4.257  -6.926  1.00 0.00 ? 16 TYR B N    4  
ATOM 2894 C CA   . TYR B 2 16 ? 4.942   -5.420  -7.622  1.00 0.00 ? 16 TYR B CA   4  
ATOM 2895 C C    . TYR B 2 16 ? 6.373   -5.584  -7.099  1.00 0.00 ? 16 TYR B C    4  
ATOM 2896 O O    . TYR B 2 16 ? 6.934   -6.660  -7.186  1.00 0.00 ? 16 TYR B O    4  
ATOM 2897 C CB   . TYR B 2 16 ? 4.993   -5.185  -9.140  1.00 0.00 ? 16 TYR B CB   4  
ATOM 2898 C CG   . TYR B 2 16 ? 3.610   -5.269  -9.837  1.00 0.00 ? 16 TYR B CG   4  
ATOM 2899 C CD1  . TYR B 2 16 ? 2.446   -4.746  -9.306  1.00 0.00 ? 16 TYR B CD1  4  
ATOM 2900 C CD2  . TYR B 2 16 ? 3.546   -5.920  -11.055 1.00 0.00 ? 16 TYR B CD2  4  
ATOM 2901 C CE1  . TYR B 2 16 ? 1.254   -4.876  -9.976  1.00 0.00 ? 16 TYR B CE1  4  
ATOM 2902 C CE2  . TYR B 2 16 ? 2.351   -6.052  -11.726 1.00 0.00 ? 16 TYR B CE2  4  
ATOM 2903 C CZ   . TYR B 2 16 ? 1.193   -5.529  -11.190 1.00 0.00 ? 16 TYR B CZ   4  
ATOM 2904 O OH   . TYR B 2 16 ? -0.008  -5.656  -11.858 1.00 0.00 ? 16 TYR B OH   4  
ATOM 2905 H H    . TYR B 2 16 ? 4.213   -3.411  -7.405  1.00 0.00 ? 16 TYR B H    4  
ATOM 2906 H HA   . TYR B 2 16 ? 4.383   -6.320  -7.406  1.00 0.00 ? 16 TYR B HA   4  
ATOM 2907 H HB2  . TYR B 2 16 ? 5.424   -4.222  -9.330  1.00 0.00 ? 16 TYR B HB2  4  
ATOM 2908 H HB3  . TYR B 2 16 ? 5.659   -5.918  -9.566  1.00 0.00 ? 16 TYR B HB3  4  
ATOM 2909 H HD1  . TYR B 2 16 ? 2.451   -4.224  -8.361  1.00 0.00 ? 16 TYR B HD1  4  
ATOM 2910 H HD2  . TYR B 2 16 ? 4.445   -6.335  -11.492 1.00 0.00 ? 16 TYR B HD2  4  
ATOM 2911 H HE1  . TYR B 2 16 ? 0.360   -4.461  -9.535  1.00 0.00 ? 16 TYR B HE1  4  
ATOM 2912 H HE2  . TYR B 2 16 ? 2.317   -6.565  -12.675 1.00 0.00 ? 16 TYR B HE2  4  
ATOM 2913 H HH   . TYR B 2 16 ? -0.670  -5.167  -11.366 1.00 0.00 ? 16 TYR B HH   4  
ATOM 2914 N N    . LEU B 2 17 ? 6.932   -4.523  -6.563  1.00 0.00 ? 17 LEU B N    4  
ATOM 2915 C CA   . LEU B 2 17 ? 8.328   -4.592  -6.020  1.00 0.00 ? 17 LEU B CA   4  
ATOM 2916 C C    . LEU B 2 17 ? 8.332   -4.820  -4.496  1.00 0.00 ? 17 LEU B C    4  
ATOM 2917 O O    . LEU B 2 17 ? 9.330   -5.274  -3.977  1.00 0.00 ? 17 LEU B O    4  
ATOM 2918 C CB   . LEU B 2 17 ? 9.042   -3.270  -6.382  1.00 0.00 ? 17 LEU B CB   4  
ATOM 2919 C CG   . LEU B 2 17 ? 10.524  -3.235  -5.885  1.00 0.00 ? 17 LEU B CG   4  
ATOM 2920 C CD1  . LEU B 2 17 ? 11.303  -4.510  -6.337  1.00 0.00 ? 17 LEU B CD1  4  
ATOM 2921 C CD2  . LEU B 2 17 ? 11.233  -2.006  -6.519  1.00 0.00 ? 17 LEU B CD2  4  
ATOM 2922 H H    . LEU B 2 17 ? 6.441   -3.676  -6.517  1.00 0.00 ? 17 LEU B H    4  
ATOM 2923 H HA   . LEU B 2 17 ? 8.835   -5.421  -6.488  1.00 0.00 ? 17 LEU B HA   4  
ATOM 2924 H HB2  . LEU B 2 17 ? 9.023   -3.167  -7.455  1.00 0.00 ? 17 LEU B HB2  4  
ATOM 2925 H HB3  . LEU B 2 17 ? 8.497   -2.444  -5.946  1.00 0.00 ? 17 LEU B HB3  4  
ATOM 2926 H HG   . LEU B 2 17 ? 10.549  -3.124  -4.810  1.00 0.00 ? 17 LEU B HG   4  
ATOM 2927 H HD11 . LEU B 2 17 ? 11.306  -4.601  -7.415  1.00 0.00 ? 17 LEU B HD11 4  
ATOM 2928 H HD12 . LEU B 2 17 ? 12.327  -4.462  -5.996  1.00 0.00 ? 17 LEU B HD12 4  
ATOM 2929 H HD13 . LEU B 2 17 ? 10.871  -5.403  -5.918  1.00 0.00 ? 17 LEU B HD13 4  
ATOM 2930 H HD21 . LEU B 2 17 ? 10.730  -1.092  -6.243  1.00 0.00 ? 17 LEU B HD21 4  
ATOM 2931 H HD22 . LEU B 2 17 ? 12.255  -1.948  -6.170  1.00 0.00 ? 17 LEU B HD22 4  
ATOM 2932 H HD23 . LEU B 2 17 ? 11.231  -2.086  -7.600  1.00 0.00 ? 17 LEU B HD23 4  
ATOM 2933 N N    . VAL B 2 18 ? 7.246   -4.521  -3.812  1.00 0.00 ? 18 VAL B N    4  
ATOM 2934 C CA   . VAL B 2 18 ? 7.211   -4.736  -2.326  1.00 0.00 ? 18 VAL B CA   4  
ATOM 2935 C C    . VAL B 2 18 ? 6.573   -6.102  -1.999  1.00 0.00 ? 18 VAL B C    4  
ATOM 2936 O O    . VAL B 2 18 ? 7.044   -6.757  -1.084  1.00 0.00 ? 18 VAL B O    4  
ATOM 2937 C CB   . VAL B 2 18 ? 6.415   -3.566  -1.673  1.00 0.00 ? 18 VAL B CB   4  
ATOM 2938 C CG1  . VAL B 2 18 ? 6.210   -3.842  -0.157  1.00 0.00 ? 18 VAL B CG1  4  
ATOM 2939 C CG2  . VAL B 2 18 ? 7.281   -2.284  -1.796  1.00 0.00 ? 18 VAL B CG2  4  
ATOM 2940 H H    . VAL B 2 18 ? 6.463   -4.154  -4.271  1.00 0.00 ? 18 VAL B H    4  
ATOM 2941 H HA   . VAL B 2 18 ? 8.221   -4.741  -1.945  1.00 0.00 ? 18 VAL B HA   4  
ATOM 2942 H HB   . VAL B 2 18 ? 5.462   -3.416  -2.163  1.00 0.00 ? 18 VAL B HB   4  
ATOM 2943 H HG11 . VAL B 2 18 ? 5.663   -4.759  -0.015  1.00 0.00 ? 18 VAL B HG11 4  
ATOM 2944 H HG12 . VAL B 2 18 ? 7.163   -3.931  0.342   1.00 0.00 ? 18 VAL B HG12 4  
ATOM 2945 H HG13 . VAL B 2 18 ? 5.646   -3.045  0.304   1.00 0.00 ? 18 VAL B HG13 4  
ATOM 2946 H HG21 . VAL B 2 18 ? 7.491   -2.052  -2.830  1.00 0.00 ? 18 VAL B HG21 4  
ATOM 2947 H HG22 . VAL B 2 18 ? 6.772   -1.444  -1.344  1.00 0.00 ? 18 VAL B HG22 4  
ATOM 2948 H HG23 . VAL B 2 18 ? 8.225   -2.426  -1.284  1.00 0.00 ? 18 VAL B HG23 4  
ATOM 2949 N N    . CYS B 2 19 ? 5.547   -6.513  -2.710  1.00 0.00 ? 19 CYS B N    4  
ATOM 2950 C CA   . CYS B 2 19 ? 4.934   -7.842  -2.404  1.00 0.00 ? 19 CYS B CA   4  
ATOM 2951 C C    . CYS B 2 19 ? 5.642   -8.834  -3.348  1.00 0.00 ? 19 CYS B C    4  
ATOM 2952 O O    . CYS B 2 19 ? 6.071   -9.859  -2.859  1.00 0.00 ? 19 CYS B O    4  
ATOM 2953 C CB   . CYS B 2 19 ? 3.348   -7.803  -2.649  1.00 0.00 ? 19 CYS B CB   4  
ATOM 2954 S SG   . CYS B 2 19 ? 2.390   -6.709  -1.575  1.00 0.00 ? 19 CYS B SG   4  
ATOM 2955 H H    . CYS B 2 19 ? 5.170   -5.972  -3.432  1.00 0.00 ? 19 CYS B H    4  
ATOM 2956 H HA   . CYS B 2 19 ? 5.126   -8.127  -1.379  1.00 0.00 ? 19 CYS B HA   4  
ATOM 2957 H HB2  . CYS B 2 19 ? 2.992   -7.544  -3.631  1.00 0.00 ? 19 CYS B HB2  4  
ATOM 2958 H HB3  . CYS B 2 19 ? 2.985   -8.801  -2.469  1.00 0.00 ? 19 CYS B HB3  4  
ATOM 2959 N N    . GLY B 2 20 ? 5.775   -8.515  -4.625  1.00 0.00 ? 20 GLY B N    4  
ATOM 2960 C CA   . GLY B 2 20 ? 6.440   -9.399  -5.634  1.00 0.00 ? 20 GLY B CA   4  
ATOM 2961 C C    . GLY B 2 20 ? 5.640   -10.676 -5.963  1.00 0.00 ? 20 GLY B C    4  
ATOM 2962 O O    . GLY B 2 20 ? 5.469   -11.009 -7.120  1.00 0.00 ? 20 GLY B O    4  
ATOM 2963 H H    . GLY B 2 20 ? 5.451   -7.670  -4.965  1.00 0.00 ? 20 GLY B H    4  
ATOM 2964 H HA2  . GLY B 2 20 ? 6.492   -8.831  -6.549  1.00 0.00 ? 20 GLY B HA2  4  
ATOM 2965 H HA3  . GLY B 2 20 ? 7.463   -9.626  -5.358  1.00 0.00 ? 20 GLY B HA3  4  
ATOM 2966 N N    . GLU B 2 21 ? 5.165   -11.347 -4.944  1.00 0.00 ? 21 GLU B N    4  
ATOM 2967 C CA   . GLU B 2 21 ? 4.383   -12.599 -5.112  1.00 0.00 ? 21 GLU B CA   4  
ATOM 2968 C C    . GLU B 2 21 ? 3.544   -12.855 -3.850  1.00 0.00 ? 21 GLU B C    4  
ATOM 2969 O O    . GLU B 2 21 ? 3.433   -13.976 -3.393  1.00 0.00 ? 21 GLU B O    4  
ATOM 2970 C CB   . GLU B 2 21 ? 5.414   -13.759 -5.396  1.00 0.00 ? 21 GLU B CB   4  
ATOM 2971 C CG   . GLU B 2 21 ? 6.768   -13.619 -4.601  1.00 0.00 ? 21 GLU B CG   4  
ATOM 2972 C CD   . GLU B 2 21 ? 6.571   -13.655 -3.066  1.00 0.00 ? 21 GLU B CD   4  
ATOM 2973 O OE1  . GLU B 2 21 ? 6.045   -12.694 -2.533  1.00 0.00 ? 21 GLU B OE1  4  
ATOM 2974 O OE2  . GLU B 2 21 ? 6.961   -14.663 -2.498  1.00 0.00 ? 21 GLU B OE2  4  
ATOM 2975 H H    . GLU B 2 21 ? 5.297   -11.035 -4.030  1.00 0.00 ? 21 GLU B H    4  
ATOM 2976 H HA   . GLU B 2 21 ? 3.697   -12.455 -5.929  1.00 0.00 ? 21 GLU B HA   4  
ATOM 2977 H HB2  . GLU B 2 21 ? 4.976   -14.718 -5.154  1.00 0.00 ? 21 GLU B HB2  4  
ATOM 2978 H HB3  . GLU B 2 21 ? 5.656   -13.776 -6.448  1.00 0.00 ? 21 GLU B HB3  4  
ATOM 2979 H HG2  . GLU B 2 21 ? 7.416   -14.438 -4.879  1.00 0.00 ? 21 GLU B HG2  4  
ATOM 2980 H HG3  . GLU B 2 21 ? 7.272   -12.702 -4.869  1.00 0.00 ? 21 GLU B HG3  4  
ATOM 2981 N N    . ARG B 2 22 ? 2.967   -11.801 -3.322  1.00 0.00 ? 22 ARG B N    4  
ATOM 2982 C CA   . ARG B 2 22 ? 2.125   -11.931 -2.084  1.00 0.00 ? 22 ARG B CA   4  
ATOM 2983 C C    . ARG B 2 22 ? 0.688   -11.449 -2.361  1.00 0.00 ? 22 ARG B C    4  
ATOM 2984 O O    . ARG B 2 22 ? 0.351   -10.314 -2.076  1.00 0.00 ? 22 ARG B O    4  
ATOM 2985 C CB   . ARG B 2 22 ? 2.809   -11.101 -0.950  1.00 0.00 ? 22 ARG B CB   4  
ATOM 2986 C CG   . ARG B 2 22 ? 2.415   -11.623 0.451   1.00 0.00 ? 22 ARG B CG   4  
ATOM 2987 C CD   . ARG B 2 22 ? 0.922   -11.350 0.781   1.00 0.00 ? 22 ARG B CD   4  
ATOM 2988 N NE   . ARG B 2 22 ? 0.522   -11.950 2.100   1.00 0.00 ? 22 ARG B NE   4  
ATOM 2989 C CZ   . ARG B 2 22 ? 1.325   -12.710 2.789   1.00 0.00 ? 22 ARG B CZ   4  
ATOM 2990 N NH1  . ARG B 2 22 ? 1.469   -13.963 2.433   1.00 0.00 ? 22 ARG B NH1  4  
ATOM 2991 N NH2  . ARG B 2 22 ? 1.954   -12.181 3.805   1.00 0.00 ? 22 ARG B NH2  4  
ATOM 2992 H H    . ARG B 2 22 ? 3.097   -10.927 -3.743  1.00 0.00 ? 22 ARG B H    4  
ATOM 2993 H HA   . ARG B 2 22 ? 2.083   -12.968 -1.789  1.00 0.00 ? 22 ARG B HA   4  
ATOM 2994 H HB2  . ARG B 2 22 ? 3.883   -11.149 -1.050  1.00 0.00 ? 22 ARG B HB2  4  
ATOM 2995 H HB3  . ARG B 2 22 ? 2.495   -10.075 -1.045  1.00 0.00 ? 22 ARG B HB3  4  
ATOM 2996 H HG2  . ARG B 2 22 ? 2.626   -12.680 0.506   1.00 0.00 ? 22 ARG B HG2  4  
ATOM 2997 H HG3  . ARG B 2 22 ? 3.031   -11.130 1.188   1.00 0.00 ? 22 ARG B HG3  4  
ATOM 2998 H HD2  . ARG B 2 22 ? 0.749   -10.286 0.839   1.00 0.00 ? 22 ARG B HD2  4  
ATOM 2999 H HD3  . ARG B 2 22 ? 0.284   -11.774 0.023   1.00 0.00 ? 22 ARG B HD3  4  
ATOM 3000 H HE   . ARG B 2 22 ? -0.373  -11.773 2.461   1.00 0.00 ? 22 ARG B HE   4  
ATOM 3001 H HH11 . ARG B 2 22 ? 0.957   -14.302 1.640   1.00 0.00 ? 22 ARG B HH11 4  
ATOM 3002 H HH12 . ARG B 2 22 ? 2.077   -14.577 2.937   1.00 0.00 ? 22 ARG B HH12 4  
ATOM 3003 H HH21 . ARG B 2 22 ? 1.820   -11.205 3.989   1.00 0.00 ? 22 ARG B HH21 4  
ATOM 3004 H HH22 . ARG B 2 22 ? 2.555   -12.737 4.379   1.00 0.00 ? 22 ARG B HH22 4  
ATOM 3005 N N    . GLY B 2 23 ? -0.095  -12.355 -2.908  1.00 0.00 ? 23 GLY B N    4  
ATOM 3006 C CA   . GLY B 2 23 ? -1.539  -12.129 -3.275  1.00 0.00 ? 23 GLY B CA   4  
ATOM 3007 C C    . GLY B 2 23 ? -2.048  -10.664 -3.099  1.00 0.00 ? 23 GLY B C    4  
ATOM 3008 O O    . GLY B 2 23 ? -2.742  -10.446 -2.126  1.00 0.00 ? 23 GLY B O    4  
ATOM 3009 H H    . GLY B 2 23 ? 0.294   -13.235 -3.082  1.00 0.00 ? 23 GLY B H    4  
ATOM 3010 H HA2  . GLY B 2 23 ? -1.741  -12.557 -4.251  1.00 0.00 ? 23 GLY B HA2  4  
ATOM 3011 H HA3  . GLY B 2 23 ? -2.109  -12.730 -2.579  1.00 0.00 ? 23 GLY B HA3  4  
ATOM 3012 N N    . PHE B 2 24 ? -1.741  -9.706  -3.963  1.00 0.00 ? 24 PHE B N    4  
ATOM 3013 C CA   . PHE B 2 24 ? -2.222  -8.312  -3.782  1.00 0.00 ? 24 PHE B CA   4  
ATOM 3014 C C    . PHE B 2 24 ? -3.217  -8.054  -4.958  1.00 0.00 ? 24 PHE B C    4  
ATOM 3015 O O    . PHE B 2 24 ? -3.308  -8.889  -5.838  1.00 0.00 ? 24 PHE B O    4  
ATOM 3016 C CB   . PHE B 2 24 ? -0.984  -7.374  -3.863  1.00 0.00 ? 24 PHE B CB   4  
ATOM 3017 C CG   . PHE B 2 24 ? -0.378  -7.353  -5.279  1.00 0.00 ? 24 PHE B CG   4  
ATOM 3018 C CD1  . PHE B 2 24 ? -0.960  -6.568  -6.262  1.00 0.00 ? 24 PHE B CD1  4  
ATOM 3019 C CD2  . PHE B 2 24 ? 0.741   -8.103  -5.602  1.00 0.00 ? 24 PHE B CD2  4  
ATOM 3020 C CE1  . PHE B 2 24 ? -0.438  -6.529  -7.538  1.00 0.00 ? 24 PHE B CE1  4  
ATOM 3021 C CE2  . PHE B 2 24 ? 1.264   -8.060  -6.884  1.00 0.00 ? 24 PHE B CE2  4  
ATOM 3022 C CZ   . PHE B 2 24 ? 0.675   -7.276  -7.852  1.00 0.00 ? 24 PHE B CZ   4  
ATOM 3023 H H    . PHE B 2 24 ? -1.206  -9.795  -4.772  1.00 0.00 ? 24 PHE B H    4  
ATOM 3024 H HA   . PHE B 2 24 ? -2.694  -8.278  -2.800  1.00 0.00 ? 24 PHE B HA   4  
ATOM 3025 H HB2  . PHE B 2 24 ? -1.259  -6.363  -3.633  1.00 0.00 ? 24 PHE B HB2  4  
ATOM 3026 H HB3  . PHE B 2 24 ? -0.224  -7.691  -3.165  1.00 0.00 ? 24 PHE B HB3  4  
ATOM 3027 H HD1  . PHE B 2 24 ? -1.829  -5.977  -6.022  1.00 0.00 ? 24 PHE B HD1  4  
ATOM 3028 H HD2  . PHE B 2 24 ? 1.208   -8.726  -4.854  1.00 0.00 ? 24 PHE B HD2  4  
ATOM 3029 H HE1  . PHE B 2 24 ? -0.910  -5.915  -8.290  1.00 0.00 ? 24 PHE B HE1  4  
ATOM 3030 H HE2  . PHE B 2 24 ? 2.138   -8.641  -7.136  1.00 0.00 ? 24 PHE B HE2  4  
ATOM 3031 H HZ   . PHE B 2 24 ? 1.087   -7.253  -8.851  1.00 0.00 ? 24 PHE B HZ   4  
ATOM 3032 N N    . PHE B 2 25 ? -3.935  -6.950  -4.983  1.00 0.00 ? 25 PHE B N    4  
ATOM 3033 C CA   . PHE B 2 25 ? -4.884  -6.647  -6.068  1.00 0.00 ? 25 PHE B CA   4  
ATOM 3034 C C    . PHE B 2 25 ? -4.596  -5.271  -6.703  1.00 0.00 ? 25 PHE B C    4  
ATOM 3035 O O    . PHE B 2 25 ? -5.191  -4.281  -6.320  1.00 0.00 ? 25 PHE B O    4  
ATOM 3036 C CB   . PHE B 2 25 ? -6.264  -6.702  -5.443  1.00 0.00 ? 25 PHE B CB   4  
ATOM 3037 C CG   . PHE B 2 25 ? -7.353  -6.443  -6.476  1.00 0.00 ? 25 PHE B CG   4  
ATOM 3038 C CD1  . PHE B 2 25 ? -7.107  -6.275  -7.835  1.00 0.00 ? 25 PHE B CD1  4  
ATOM 3039 C CD2  . PHE B 2 25 ? -8.672  -6.379  -6.051  1.00 0.00 ? 25 PHE B CD2  4  
ATOM 3040 C CE1  . PHE B 2 25 ? -8.131  -6.058  -8.730  1.00 0.00 ? 25 PHE B CE1  4  
ATOM 3041 C CE2  . PHE B 2 25 ? -9.700  -6.161  -6.950  1.00 0.00 ? 25 PHE B CE2  4  
ATOM 3042 C CZ   . PHE B 2 25 ? -9.425  -6.000  -8.290  1.00 0.00 ? 25 PHE B CZ   4  
ATOM 3043 H H    . PHE B 2 25 ? -3.920  -6.257  -4.309  1.00 0.00 ? 25 PHE B H    4  
ATOM 3044 H HA   . PHE B 2 25 ? -4.813  -7.404  -6.833  1.00 0.00 ? 25 PHE B HA   4  
ATOM 3045 H HB2  . PHE B 2 25 ? -6.420  -7.691  -5.030  1.00 0.00 ? 25 PHE B HB2  4  
ATOM 3046 H HB3  . PHE B 2 25 ? -6.355  -5.978  -4.646  1.00 0.00 ? 25 PHE B HB3  4  
ATOM 3047 H HD1  . PHE B 2 25 ? -6.099  -6.314  -8.208  1.00 0.00 ? 25 PHE B HD1  4  
ATOM 3048 H HD2  . PHE B 2 25 ? -8.905  -6.496  -5.001  1.00 0.00 ? 25 PHE B HD2  4  
ATOM 3049 H HE1  . PHE B 2 25 ? -7.913  -5.926  -9.777  1.00 0.00 ? 25 PHE B HE1  4  
ATOM 3050 H HE2  . PHE B 2 25 ? -10.723 -6.109  -6.606  1.00 0.00 ? 25 PHE B HE2  4  
ATOM 3051 H HZ   . PHE B 2 25 ? -10.218 -5.837  -9.006  1.00 0.00 ? 25 PHE B HZ   4  
ATOM 3052 N N    . TYR B 2 26 ? -3.691  -5.236  -7.647  1.00 0.00 ? 26 TYR B N    4  
ATOM 3053 C CA   . TYR B 2 26 ? -3.360  -3.952  -8.316  1.00 0.00 ? 26 TYR B CA   4  
ATOM 3054 C C    . TYR B 2 26 ? -3.064  -4.335  -9.767  1.00 0.00 ? 26 TYR B C    4  
ATOM 3055 O O    . TYR B 2 26 ? -1.981  -4.188  -10.298 1.00 0.00 ? 26 TYR B O    4  
ATOM 3056 C CB   . TYR B 2 26 ? -2.118  -3.276  -7.660  1.00 0.00 ? 26 TYR B CB   4  
ATOM 3057 C CG   . TYR B 2 26 ? -2.152  -1.796  -8.106  1.00 0.00 ? 26 TYR B CG   4  
ATOM 3058 C CD1  . TYR B 2 26 ? -3.022  -0.910  -7.491  1.00 0.00 ? 26 TYR B CD1  4  
ATOM 3059 C CD2  . TYR B 2 26 ? -1.349  -1.331  -9.132  1.00 0.00 ? 26 TYR B CD2  4  
ATOM 3060 C CE1  . TYR B 2 26 ? -3.087  0.410   -7.890  1.00 0.00 ? 26 TYR B CE1  4  
ATOM 3061 C CE2  . TYR B 2 26 ? -1.419  -0.011  -9.523  1.00 0.00 ? 26 TYR B CE2  4  
ATOM 3062 C CZ   . TYR B 2 26 ? -2.288  0.868   -8.912  1.00 0.00 ? 26 TYR B CZ   4  
ATOM 3063 O OH   . TYR B 2 26 ? -2.364  2.192   -9.303  1.00 0.00 ? 26 TYR B OH   4  
ATOM 3064 H H    . TYR B 2 26 ? -3.234  -6.049  -7.946  1.00 0.00 ? 26 TYR B H    4  
ATOM 3065 H HA   . TYR B 2 26 ? -4.223  -3.294  -8.311  1.00 0.00 ? 26 TYR B HA   4  
ATOM 3066 H HB2  . TYR B 2 26 ? -2.205  -3.323  -6.589  1.00 0.00 ? 26 TYR B HB2  4  
ATOM 3067 H HB3  . TYR B 2 26 ? -1.185  -3.722  -7.964  1.00 0.00 ? 26 TYR B HB3  4  
ATOM 3068 H HD1  . TYR B 2 26 ? -3.653  -1.257  -6.689  1.00 0.00 ? 26 TYR B HD1  4  
ATOM 3069 H HD2  . TYR B 2 26 ? -0.663  -2.002  -9.631  1.00 0.00 ? 26 TYR B HD2  4  
ATOM 3070 H HE1  . TYR B 2 26 ? -3.775  1.083   -7.401  1.00 0.00 ? 26 TYR B HE1  4  
ATOM 3071 H HE2  . TYR B 2 26 ? -0.791  0.341   -10.322 1.00 0.00 ? 26 TYR B HE2  4  
ATOM 3072 H HH   . TYR B 2 26 ? -1.560  2.415   -9.777  1.00 0.00 ? 26 TYR B HH   4  
ATOM 3073 N N    . THR B 2 27 ? -4.101  -4.854  -10.362 1.00 0.00 ? 27 THR B N    4  
ATOM 3074 C CA   . THR B 2 27 ? -4.069  -5.302  -11.790 1.00 0.00 ? 27 THR B CA   4  
ATOM 3075 C C    . THR B 2 27 ? -5.011  -4.349  -12.578 1.00 0.00 ? 27 THR B C    4  
ATOM 3076 O O    . THR B 2 27 ? -6.075  -4.795  -12.961 1.00 0.00 ? 27 THR B O    4  
ATOM 3077 C CB   . THR B 2 27 ? -4.532  -6.791  -11.826 1.00 0.00 ? 27 THR B CB   4  
ATOM 3078 O OG1  . THR B 2 27 ? -4.725  -7.129  -13.189 1.00 0.00 ? 27 THR B OG1  4  
ATOM 3079 C CG2  . THR B 2 27 ? -5.862  -7.121  -11.153 1.00 0.00 ? 27 THR B CG2  4  
ATOM 3080 H H    . THR B 2 27 ? -4.921  -4.957  -9.838  1.00 0.00 ? 27 THR B H    4  
ATOM 3081 H HA   . THR B 2 27 ? -3.071  -5.339  -12.204 1.00 0.00 ? 27 THR B HA   4  
ATOM 3082 H HB   . THR B 2 27 ? -3.748  -7.410  -11.420 1.00 0.00 ? 27 THR B HB   4  
ATOM 3083 H HG1  . THR B 2 27 ? -4.522  -8.061  -13.280 1.00 0.00 ? 27 THR B HG1  4  
ATOM 3084 H HG21 . THR B 2 27 ? -6.701  -6.590  -11.576 1.00 0.00 ? 27 THR B HG21 4  
ATOM 3085 H HG22 . THR B 2 27 ? -6.030  -8.181  -11.271 1.00 0.00 ? 27 THR B HG22 4  
ATOM 3086 H HG23 . THR B 2 27 ? -5.781  -6.910  -10.102 1.00 0.00 ? 27 THR B HG23 4  
ATOM 3087 N N    . PRO B 2 28 ? -4.659  -3.084  -12.805 1.00 0.00 ? 28 PRO B N    4  
ATOM 3088 C CA   . PRO B 2 28 ? -5.592  -2.136  -13.481 1.00 0.00 ? 28 PRO B CA   4  
ATOM 3089 C C    . PRO B 2 28 ? -6.048  -2.608  -14.875 1.00 0.00 ? 28 PRO B C    4  
ATOM 3090 O O    . PRO B 2 28 ? -5.448  -2.288  -15.887 1.00 0.00 ? 28 PRO B O    4  
ATOM 3091 C CB   . PRO B 2 28 ? -4.845  -0.796  -13.541 1.00 0.00 ? 28 PRO B CB   4  
ATOM 3092 C CG   . PRO B 2 28 ? -3.769  -0.895  -12.454 1.00 0.00 ? 28 PRO B CG   4  
ATOM 3093 C CD   . PRO B 2 28 ? -3.371  -2.381  -12.454 1.00 0.00 ? 28 PRO B CD   4  
ATOM 3094 H HA   . PRO B 2 28 ? -6.457  -2.039  -12.841 1.00 0.00 ? 28 PRO B HA   4  
ATOM 3095 H HB2  . PRO B 2 28 ? -4.403  -0.598  -14.507 1.00 0.00 ? 28 PRO B HB2  4  
ATOM 3096 H HB3  . PRO B 2 28 ? -5.534  -0.001  -13.294 1.00 0.00 ? 28 PRO B HB3  4  
ATOM 3097 H HG2  . PRO B 2 28 ? -2.934  -0.272  -12.736 1.00 0.00 ? 28 PRO B HG2  4  
ATOM 3098 H HG3  . PRO B 2 28 ? -4.148  -0.578  -11.491 1.00 0.00 ? 28 PRO B HG3  4  
ATOM 3099 H HD2  . PRO B 2 28 ? -2.588  -2.596  -13.176 1.00 0.00 ? 28 PRO B HD2  4  
ATOM 3100 H HD3  . PRO B 2 28 ? -3.055  -2.558  -11.440 1.00 0.00 ? 28 PRO B HD3  4  
ATOM 3101 N N    . LYS B 2 29 ? -7.113  -3.360  -14.855 1.00 0.00 ? 29 LYS B N    4  
ATOM 3102 C CA   . LYS B 2 29 ? -7.720  -3.921  -16.103 1.00 0.00 ? 29 LYS B CA   4  
ATOM 3103 C C    . LYS B 2 29 ? -9.115  -3.307  -16.173 1.00 0.00 ? 29 LYS B C    4  
ATOM 3104 O O    . LYS B 2 29 ? -10.114 -3.981  -16.347 1.00 0.00 ? 29 LYS B O    4  
ATOM 3105 C CB   . LYS B 2 29 ? -7.789  -5.461  -15.983 1.00 0.00 ? 29 LYS B CB   4  
ATOM 3106 C CG   . LYS B 2 29 ? -6.356  -6.020  -15.911 1.00 0.00 ? 29 LYS B CG   4  
ATOM 3107 C CD   . LYS B 2 29 ? -6.351  -7.558  -15.773 1.00 0.00 ? 29 LYS B CD   4  
ATOM 3108 C CE   . LYS B 2 29 ? -6.601  -8.250  -17.128 1.00 0.00 ? 29 LYS B CE   4  
ATOM 3109 N NZ   . LYS B 2 29 ? -6.333  -9.713  -17.012 1.00 0.00 ? 29 LYS B NZ   4  
ATOM 3110 H H    . LYS B 2 29 ? -7.528  -3.562  -13.990 1.00 0.00 ? 29 LYS B H    4  
ATOM 3111 H HA   . LYS B 2 29 ? -7.159  -3.608  -16.973 1.00 0.00 ? 29 LYS B HA   4  
ATOM 3112 H HB2  . LYS B 2 29 ? -8.341  -5.725  -15.092 1.00 0.00 ? 29 LYS B HB2  4  
ATOM 3113 H HB3  . LYS B 2 29 ? -8.312  -5.864  -16.831 1.00 0.00 ? 29 LYS B HB3  4  
ATOM 3114 H HG2  . LYS B 2 29 ? -5.839  -5.749  -16.822 1.00 0.00 ? 29 LYS B HG2  4  
ATOM 3115 H HG3  . LYS B 2 29 ? -5.814  -5.590  -15.084 1.00 0.00 ? 29 LYS B HG3  4  
ATOM 3116 H HD2  . LYS B 2 29 ? -5.404  -7.890  -15.381 1.00 0.00 ? 29 LYS B HD2  4  
ATOM 3117 H HD3  . LYS B 2 29 ? -7.130  -7.851  -15.085 1.00 0.00 ? 29 LYS B HD3  4  
ATOM 3118 H HE2  . LYS B 2 29 ? -7.629  -8.125  -17.433 1.00 0.00 ? 29 LYS B HE2  4  
ATOM 3119 H HE3  . LYS B 2 29 ? -5.945  -7.850  -17.883 1.00 0.00 ? 29 LYS B HE3  4  
ATOM 3120 H HZ1  . LYS B 2 29 ? -6.043  -9.933  -16.035 1.00 0.00 ? 29 LYS B HZ1  4  
ATOM 3121 H HZ2  . LYS B 2 29 ? -7.187  -10.256 -17.254 1.00 0.00 ? 29 LYS B HZ2  4  
ATOM 3122 H HZ3  . LYS B 2 29 ? -5.567  -9.975  -17.668 1.00 0.00 ? 29 LYS B HZ3  4  
ATOM 3123 N N    . THR B 2 30 ? -9.103  -2.011  -16.028 1.00 0.00 ? 30 THR B N    4  
ATOM 3124 C CA   . THR B 2 30 ? -10.343 -1.196  -16.060 1.00 0.00 ? 30 THR B CA   4  
ATOM 3125 C C    . THR B 2 30 ? -10.144 0.056   -16.927 1.00 0.00 ? 30 THR B C    4  
ATOM 3126 O O    . THR B 2 30 ? -11.032 0.508   -17.622 1.00 0.00 ? 30 THR B O    4  
ATOM 3127 C CB   . THR B 2 30 ? -10.676 -0.856  -14.584 1.00 0.00 ? 30 THR B CB   4  
ATOM 3128 O OG1  . THR B 2 30 ? -11.806 0.000   -14.645 1.00 0.00 ? 30 THR B OG1  4  
ATOM 3129 C CG2  . THR B 2 30 ? -9.566  -0.014  -13.899 1.00 0.00 ? 30 THR B CG2  4  
ATOM 3130 H H    . THR B 2 30 ? -8.247  -1.552  -15.893 1.00 0.00 ? 30 THR B H    4  
ATOM 3131 H HA   . THR B 2 30 ? -11.136 -1.784  -16.494 1.00 0.00 ? 30 THR B HA   4  
ATOM 3132 H HB   . THR B 2 30 ? -10.938 -1.745  -14.023 1.00 0.00 ? 30 THR B HB   4  
ATOM 3133 H HG1  . THR B 2 30 ? -11.583 0.838   -14.232 1.00 0.00 ? 30 THR B HG1  4  
ATOM 3134 H HG21 . THR B 2 30 ? -8.625  -0.545  -13.911 1.00 0.00 ? 30 THR B HG21 4  
ATOM 3135 H HG22 . THR B 2 30 ? -9.443  0.938   -14.393 1.00 0.00 ? 30 THR B HG22 4  
ATOM 3136 H HG23 . THR B 2 30 ? -9.842  0.162   -12.869 1.00 0.00 ? 30 THR B HG23 4  
ATOM 3137 N N    . GLY A 1 1  ? -8.795  -7.550  1.554   1.00 0.00 ? 1  GLY A N    5  
ATOM 3138 C CA   . GLY A 1 1  ? -7.752  -6.562  1.154   1.00 0.00 ? 1  GLY A CA   5  
ATOM 3139 C C    . GLY A 1 1  ? -8.025  -5.161  1.739   1.00 0.00 ? 1  GLY A C    5  
ATOM 3140 O O    . GLY A 1 1  ? -8.978  -4.970  2.470   1.00 0.00 ? 1  GLY A O    5  
ATOM 3141 H H1   . GLY A 1 1  ? -9.508  -7.077  2.142   1.00 0.00 ? 1  GLY A H1   5  
ATOM 3142 H H2   . GLY A 1 1  ? -9.253  -7.945  0.707   1.00 0.00 ? 1  GLY A H2   5  
ATOM 3143 H H3   . GLY A 1 1  ? -8.348  -8.317  2.097   1.00 0.00 ? 1  GLY A H3   5  
ATOM 3144 H HA2  . GLY A 1 1  ? -6.797  -6.905  1.522   1.00 0.00 ? 1  GLY A HA2  5  
ATOM 3145 H HA3  . GLY A 1 1  ? -7.714  -6.499  0.079   1.00 0.00 ? 1  GLY A HA3  5  
ATOM 3146 N N    . ILE A 1 2  ? -7.169  -4.229  1.389   1.00 0.00 ? 2  ILE A N    5  
ATOM 3147 C CA   . ILE A 1 2  ? -7.296  -2.813  1.880   1.00 0.00 ? 2  ILE A CA   5  
ATOM 3148 C C    . ILE A 1 2  ? -7.491  -1.802  0.755   1.00 0.00 ? 2  ILE A C    5  
ATOM 3149 O O    . ILE A 1 2  ? -7.373  -2.105  -0.414  1.00 0.00 ? 2  ILE A O    5  
ATOM 3150 C CB   . ILE A 1 2  ? -5.997  -2.497  2.765   1.00 0.00 ? 2  ILE A CB   5  
ATOM 3151 C CG1  . ILE A 1 2  ? -5.258  -1.106  2.642   1.00 0.00 ? 2  ILE A CG1  5  
ATOM 3152 C CG2  . ILE A 1 2  ? -4.923  -3.624  2.697   1.00 0.00 ? 2  ILE A CG2  5  
ATOM 3153 C CD1  . ILE A 1 2  ? -5.559  -0.197  3.868   1.00 0.00 ? 2  ILE A CD1  5  
ATOM 3154 H H    . ILE A 1 2  ? -6.428  -4.468  0.796   1.00 0.00 ? 2  ILE A H    5  
ATOM 3155 H HA   . ILE A 1 2  ? -8.163  -2.749  2.518   1.00 0.00 ? 2  ILE A HA   5  
ATOM 3156 H HB   . ILE A 1 2  ? -6.448  -2.444  3.740   1.00 0.00 ? 2  ILE A HB   5  
ATOM 3157 H HG12 . ILE A 1 2  ? -4.188  -1.256  2.637   1.00 0.00 ? 2  ILE A HG12 5  
ATOM 3158 H HG13 . ILE A 1 2  ? -5.501  -0.608  1.722   1.00 0.00 ? 2  ILE A HG13 5  
ATOM 3159 H HG21 . ILE A 1 2  ? -4.600  -3.755  1.672   1.00 0.00 ? 2  ILE A HG21 5  
ATOM 3160 H HG22 . ILE A 1 2  ? -4.065  -3.363  3.297   1.00 0.00 ? 2  ILE A HG22 5  
ATOM 3161 H HG23 . ILE A 1 2  ? -5.328  -4.557  3.056   1.00 0.00 ? 2  ILE A HG23 5  
ATOM 3162 H HD11 . ILE A 1 2  ? -5.256  -0.690  4.784   1.00 0.00 ? 2  ILE A HD11 5  
ATOM 3163 H HD12 . ILE A 1 2  ? -5.040  0.748   3.774   1.00 0.00 ? 2  ILE A HD12 5  
ATOM 3164 H HD13 . ILE A 1 2  ? -6.618  0.003   3.916   1.00 0.00 ? 2  ILE A HD13 5  
ATOM 3165 N N    . VAL A 1 3  ? -7.800  -0.611  1.185   1.00 0.00 ? 3  VAL A N    5  
ATOM 3166 C CA   . VAL A 1 3  ? -8.041  0.551   0.248   1.00 0.00 ? 3  VAL A CA   5  
ATOM 3167 C C    . VAL A 1 3  ? -6.933  1.624   0.322   1.00 0.00 ? 3  VAL A C    5  
ATOM 3168 O O    . VAL A 1 3  ? -6.040  1.542   1.139   1.00 0.00 ? 3  VAL A O    5  
ATOM 3169 C CB   . VAL A 1 3  ? -9.403  1.256   0.582   1.00 0.00 ? 3  VAL A CB   5  
ATOM 3170 C CG1  . VAL A 1 3  ? -10.593 0.314   0.334   1.00 0.00 ? 3  VAL A CG1  5  
ATOM 3171 C CG2  . VAL A 1 3  ? -9.441  1.708   2.064   1.00 0.00 ? 3  VAL A CG2  5  
ATOM 3172 H H    . VAL A 1 3  ? -7.872  -0.527  2.160   1.00 0.00 ? 3  VAL A H    5  
ATOM 3173 H HA   . VAL A 1 3  ? -8.072  0.180   -0.766  1.00 0.00 ? 3  VAL A HA   5  
ATOM 3174 H HB   . VAL A 1 3  ? -9.523  2.113   -0.067  1.00 0.00 ? 3  VAL A HB   5  
ATOM 3175 H HG11 . VAL A 1 3  ? -10.617 0.010   -0.703  1.00 0.00 ? 3  VAL A HG11 5  
ATOM 3176 H HG12 . VAL A 1 3  ? -10.525 -0.564  0.963   1.00 0.00 ? 3  VAL A HG12 5  
ATOM 3177 H HG13 . VAL A 1 3  ? -11.514 0.844   0.557   1.00 0.00 ? 3  VAL A HG13 5  
ATOM 3178 H HG21 . VAL A 1 3  ? -9.331  0.857   2.715   1.00 0.00 ? 3  VAL A HG21 5  
ATOM 3179 H HG22 . VAL A 1 3  ? -8.646  2.404   2.271   1.00 0.00 ? 3  VAL A HG22 5  
ATOM 3180 H HG23 . VAL A 1 3  ? -10.379 2.190   2.294   1.00 0.00 ? 3  VAL A HG23 5  
ATOM 3181 N N    . GLU A 1 4  ? -7.083  2.593   -0.555  1.00 0.00 ? 4  GLU A N    5  
ATOM 3182 C CA   . GLU A 1 4  ? -6.178  3.792   -0.733  1.00 0.00 ? 4  GLU A CA   5  
ATOM 3183 C C    . GLU A 1 4  ? -6.047  4.284   -2.188  1.00 0.00 ? 4  GLU A C    5  
ATOM 3184 O O    . GLU A 1 4  ? -6.359  5.438   -2.423  1.00 0.00 ? 4  GLU A O    5  
ATOM 3185 C CB   . GLU A 1 4  ? -4.695  3.503   -0.140  1.00 0.00 ? 4  GLU A CB   5  
ATOM 3186 C CG   . GLU A 1 4  ? -3.621  4.519   -0.662  1.00 0.00 ? 4  GLU A CG   5  
ATOM 3187 C CD   . GLU A 1 4  ? -3.941  5.927   -0.120  1.00 0.00 ? 4  GLU A CD   5  
ATOM 3188 O OE1  . GLU A 1 4  ? -3.586  6.126   1.030   1.00 0.00 ? 4  GLU A OE1  5  
ATOM 3189 O OE2  . GLU A 1 4  ? -4.516  6.715   -0.862  1.00 0.00 ? 4  GLU A OE2  5  
ATOM 3190 H H    . GLU A 1 4  ? -7.868  2.521   -1.142  1.00 0.00 ? 4  GLU A H    5  
ATOM 3191 H HA   . GLU A 1 4  ? -6.613  4.589   -0.185  1.00 0.00 ? 4  GLU A HA   5  
ATOM 3192 H HB2  . GLU A 1 4  ? -4.777  3.704   0.921   1.00 0.00 ? 4  GLU A HB2  5  
ATOM 3193 H HB3  . GLU A 1 4  ? -4.338  2.486   -0.199  1.00 0.00 ? 4  GLU A HB3  5  
ATOM 3194 H HG2  . GLU A 1 4  ? -2.651  4.210   -0.303  1.00 0.00 ? 4  GLU A HG2  5  
ATOM 3195 H HG3  . GLU A 1 4  ? -3.564  4.557   -1.737  1.00 0.00 ? 4  GLU A HG3  5  
ATOM 3196 N N    . GLN A 1 5  ? -5.630  3.449   -3.105  1.00 0.00 ? 5  GLN A N    5  
ATOM 3197 C CA   . GLN A 1 5  ? -5.460  3.827   -4.555  1.00 0.00 ? 5  GLN A CA   5  
ATOM 3198 C C    . GLN A 1 5  ? -4.841  5.246   -4.805  1.00 0.00 ? 5  GLN A C    5  
ATOM 3199 O O    . GLN A 1 5  ? -4.373  5.894   -3.888  1.00 0.00 ? 5  GLN A O    5  
ATOM 3200 C CB   . GLN A 1 5  ? -6.901  3.621   -5.156  1.00 0.00 ? 5  GLN A CB   5  
ATOM 3201 C CG   . GLN A 1 5  ? -7.135  3.968   -6.659  1.00 0.00 ? 5  GLN A CG   5  
ATOM 3202 C CD   . GLN A 1 5  ? -6.250  3.111   -7.580  1.00 0.00 ? 5  GLN A CD   5  
ATOM 3203 O OE1  . GLN A 1 5  ? -5.067  3.339   -7.734  1.00 0.00 ? 5  GLN A OE1  5  
ATOM 3204 N NE2  . GLN A 1 5  ? -6.786  2.101   -8.213  1.00 0.00 ? 5  GLN A NE2  5  
ATOM 3205 H H    . GLN A 1 5  ? -5.436  2.536   -2.839  1.00 0.00 ? 5  GLN A H    5  
ATOM 3206 H HA   . GLN A 1 5  ? -4.797  3.097   -5.003  1.00 0.00 ? 5  GLN A HA   5  
ATOM 3207 H HB2  . GLN A 1 5  ? -7.122  2.568   -5.050  1.00 0.00 ? 5  GLN A HB2  5  
ATOM 3208 H HB3  . GLN A 1 5  ? -7.608  4.166   -4.546  1.00 0.00 ? 5  GLN A HB3  5  
ATOM 3209 H HG2  . GLN A 1 5  ? -8.166  3.756   -6.891  1.00 0.00 ? 5  GLN A HG2  5  
ATOM 3210 H HG3  . GLN A 1 5  ? -6.973  5.018   -6.854  1.00 0.00 ? 5  GLN A HG3  5  
ATOM 3211 H HE21 . GLN A 1 5  ? -7.740  1.896   -8.098  1.00 0.00 ? 5  GLN A HE21 5  
ATOM 3212 H HE22 . GLN A 1 5  ? -6.229  1.549   -8.801  1.00 0.00 ? 5  GLN A HE22 5  
ATOM 3213 N N    . CYS A 1 6  ? -4.851  5.646   -6.054  1.00 0.00 ? 6  CYS A N    5  
ATOM 3214 C CA   . CYS A 1 6  ? -4.336  6.947   -6.603  1.00 0.00 ? 6  CYS A CA   5  
ATOM 3215 C C    . CYS A 1 6  ? -3.917  8.144   -5.752  1.00 0.00 ? 6  CYS A C    5  
ATOM 3216 O O    . CYS A 1 6  ? -3.042  8.866   -6.187  1.00 0.00 ? 6  CYS A O    5  
ATOM 3217 C CB   . CYS A 1 6  ? -5.357  7.465   -7.646  1.00 0.00 ? 6  CYS A CB   5  
ATOM 3218 S SG   . CYS A 1 6  ? -5.215  6.698   -9.282  1.00 0.00 ? 6  CYS A SG   5  
ATOM 3219 H H    . CYS A 1 6  ? -5.227  5.033   -6.708  1.00 0.00 ? 6  CYS A H    5  
ATOM 3220 H HA   . CYS A 1 6  ? -3.476  6.668   -7.163  1.00 0.00 ? 6  CYS A HA   5  
ATOM 3221 H HB2  . CYS A 1 6  ? -6.356  7.304   -7.268  1.00 0.00 ? 6  CYS A HB2  5  
ATOM 3222 H HB3  . CYS A 1 6  ? -5.232  8.533   -7.777  1.00 0.00 ? 6  CYS A HB3  5  
ATOM 3223 N N    . CYS A 1 7  ? -4.539  8.321   -4.620  1.00 0.00 ? 7  CYS A N    5  
ATOM 3224 C CA   . CYS A 1 7  ? -4.290  9.424   -3.637  1.00 0.00 ? 7  CYS A CA   5  
ATOM 3225 C C    . CYS A 1 7  ? -5.703  9.912   -3.474  1.00 0.00 ? 7  CYS A C    5  
ATOM 3226 O O    . CYS A 1 7  ? -6.125  10.948  -3.945  1.00 0.00 ? 7  CYS A O    5  
ATOM 3227 C CB   . CYS A 1 7  ? -3.350  10.555  -4.219  1.00 0.00 ? 7  CYS A CB   5  
ATOM 3228 S SG   . CYS A 1 7  ? -2.856  11.868  -3.084  1.00 0.00 ? 7  CYS A SG   5  
ATOM 3229 H H    . CYS A 1 7  ? -5.244  7.680   -4.385  1.00 0.00 ? 7  CYS A H    5  
ATOM 3230 H HA   . CYS A 1 7  ? -3.979  8.998   -2.699  1.00 0.00 ? 7  CYS A HA   5  
ATOM 3231 H HB2  . CYS A 1 7  ? -2.410  10.103  -4.511  1.00 0.00 ? 7  CYS A HB2  5  
ATOM 3232 H HB3  . CYS A 1 7  ? -3.786  11.010  -5.096  1.00 0.00 ? 7  CYS A HB3  5  
ATOM 3233 N N    . THR A 1 8  ? -6.376  9.050   -2.760  1.00 0.00 ? 8  THR A N    5  
ATOM 3234 C CA   . THR A 1 8  ? -7.805  9.237   -2.431  1.00 0.00 ? 8  THR A CA   5  
ATOM 3235 C C    . THR A 1 8  ? -7.980  9.406   -0.922  1.00 0.00 ? 8  THR A C    5  
ATOM 3236 O O    . THR A 1 8  ? -8.882  10.106  -0.497  1.00 0.00 ? 8  THR A O    5  
ATOM 3237 C CB   . THR A 1 8  ? -8.511  7.997   -3.005  1.00 0.00 ? 8  THR A CB   5  
ATOM 3238 O OG1  . THR A 1 8  ? -8.151  8.016   -4.382  1.00 0.00 ? 8  THR A OG1  5  
ATOM 3239 C CG2  . THR A 1 8  ? -10.002 8.196   -3.021  1.00 0.00 ? 8  THR A CG2  5  
ATOM 3240 H H    . THR A 1 8  ? -5.928  8.251   -2.414  1.00 0.00 ? 8  THR A H    5  
ATOM 3241 H HA   . THR A 1 8  ? -8.166  10.133  -2.913  1.00 0.00 ? 8  THR A HA   5  
ATOM 3242 H HB   . THR A 1 8  ? -8.227  7.051   -2.575  1.00 0.00 ? 8  THR A HB   5  
ATOM 3243 H HG1  . THR A 1 8  ? -7.208  7.841   -4.447  1.00 0.00 ? 8  THR A HG1  5  
ATOM 3244 H HG21 . THR A 1 8  ? -10.256 9.052   -3.628  1.00 0.00 ? 8  THR A HG21 5  
ATOM 3245 H HG22 . THR A 1 8  ? -10.478 7.318   -3.435  1.00 0.00 ? 8  THR A HG22 5  
ATOM 3246 H HG23 . THR A 1 8  ? -10.379 8.359   -2.020  1.00 0.00 ? 8  THR A HG23 5  
ATOM 3247 N N    . SER A 1 9  ? -7.118  8.768   -0.163  1.00 0.00 ? 9  SER A N    5  
ATOM 3248 C CA   . SER A 1 9  ? -7.209  8.876   1.318   1.00 0.00 ? 9  SER A CA   5  
ATOM 3249 C C    . SER A 1 9  ? -5.946  9.464   1.958   1.00 0.00 ? 9  SER A C    5  
ATOM 3250 O O    . SER A 1 9  ? -5.968  10.580  2.436   1.00 0.00 ? 9  SER A O    5  
ATOM 3251 C CB   . SER A 1 9  ? -7.517  7.458   1.884   1.00 0.00 ? 9  SER A CB   5  
ATOM 3252 O OG   . SER A 1 9  ? -6.493  6.602   1.394   1.00 0.00 ? 9  SER A OG   5  
ATOM 3253 H H    . SER A 1 9  ? -6.403  8.217   -0.550  1.00 0.00 ? 9  SER A H    5  
ATOM 3254 H HA   . SER A 1 9  ? -8.023  9.517   1.593   1.00 0.00 ? 9  SER A HA   5  
ATOM 3255 H HB2  . SER A 1 9  ? -7.533  7.448   2.967   1.00 0.00 ? 9  SER A HB2  5  
ATOM 3256 H HB3  . SER A 1 9  ? -8.469  7.104   1.515   1.00 0.00 ? 9  SER A HB3  5  
ATOM 3257 H HG   . SER A 1 9  ? -5.951  6.332   2.138   1.00 0.00 ? 9  SER A HG   5  
ATOM 3258 N N    . ILE A 1 10 ? -4.884  8.704   1.948   1.00 0.00 ? 10 ILE A N    5  
ATOM 3259 C CA   . ILE A 1 10 ? -3.581  9.146   2.543   1.00 0.00 ? 10 ILE A CA   5  
ATOM 3260 C C    . ILE A 1 10 ? -2.384  8.767   1.646   1.00 0.00 ? 10 ILE A C    5  
ATOM 3261 O O    . ILE A 1 10 ? -1.297  8.575   2.151   1.00 0.00 ? 10 ILE A O    5  
ATOM 3262 C CB   . ILE A 1 10 ? -3.516  8.485   3.982   1.00 0.00 ? 10 ILE A CB   5  
ATOM 3263 C CG1  . ILE A 1 10 ? -4.844  8.815   4.763   1.00 0.00 ? 10 ILE A CG1  5  
ATOM 3264 C CG2  . ILE A 1 10 ? -2.330  9.061   4.802   1.00 0.00 ? 10 ILE A CG2  5  
ATOM 3265 C CD1  . ILE A 1 10 ? -4.913  8.160   6.154   1.00 0.00 ? 10 ILE A CD1  5  
ATOM 3266 H H    . ILE A 1 10 ? -4.976  7.831   1.528   1.00 0.00 ? 10 ILE A H    5  
ATOM 3267 H HA   . ILE A 1 10 ? -3.586  10.224  2.642   1.00 0.00 ? 10 ILE A HA   5  
ATOM 3268 H HB   . ILE A 1 10 ? -3.396  7.415   3.887   1.00 0.00 ? 10 ILE A HB   5  
ATOM 3269 H HG12 . ILE A 1 10 ? -4.950  9.885   4.872   1.00 0.00 ? 10 ILE A HG12 5  
ATOM 3270 H HG13 . ILE A 1 10 ? -5.693  8.442   4.217   1.00 0.00 ? 10 ILE A HG13 5  
ATOM 3271 H HG21 . ILE A 1 10 ? -2.433  10.128  4.904   1.00 0.00 ? 10 ILE A HG21 5  
ATOM 3272 H HG22 . ILE A 1 10 ? -2.327  8.616   5.786   1.00 0.00 ? 10 ILE A HG22 5  
ATOM 3273 H HG23 . ILE A 1 10 ? -1.378  8.835   4.355   1.00 0.00 ? 10 ILE A HG23 5  
ATOM 3274 H HD11 . ILE A 1 10 ? -4.863  7.089   6.054   1.00 0.00 ? 10 ILE A HD11 5  
ATOM 3275 H HD12 . ILE A 1 10 ? -4.108  8.494   6.793   1.00 0.00 ? 10 ILE A HD12 5  
ATOM 3276 H HD13 . ILE A 1 10 ? -5.849  8.428   6.616   1.00 0.00 ? 10 ILE A HD13 5  
ATOM 3277 N N    . CYS A 1 11 ? -2.635  8.675   0.353   1.00 0.00 ? 11 CYS A N    5  
ATOM 3278 C CA   . CYS A 1 11 ? -1.610  8.320   -0.716  1.00 0.00 ? 11 CYS A CA   5  
ATOM 3279 C C    . CYS A 1 11 ? -0.249  7.927   -0.102  1.00 0.00 ? 11 CYS A C    5  
ATOM 3280 O O    . CYS A 1 11 ? 0.726   8.653   -0.143  1.00 0.00 ? 11 CYS A O    5  
ATOM 3281 C CB   . CYS A 1 11 ? -1.472  9.548   -1.620  1.00 0.00 ? 11 CYS A CB   5  
ATOM 3282 S SG   . CYS A 1 11 ? -2.730  10.831  -1.359  1.00 0.00 ? 11 CYS A SG   5  
ATOM 3283 H H    . CYS A 1 11 ? -3.554  8.851   0.059   1.00 0.00 ? 11 CYS A H    5  
ATOM 3284 H HA   . CYS A 1 11 ? -1.985  7.480   -1.287  1.00 0.00 ? 11 CYS A HA   5  
ATOM 3285 H HB2  . CYS A 1 11 ? -0.487  9.970   -1.523  1.00 0.00 ? 11 CYS A HB2  5  
ATOM 3286 H HB3  . CYS A 1 11 ? -1.567  9.211   -2.640  1.00 0.00 ? 11 CYS A HB3  5  
ATOM 3287 N N    . SER A 1 12 ? -0.253  6.750   0.460   1.00 0.00 ? 12 SER A N    5  
ATOM 3288 C CA   . SER A 1 12 ? 0.949   6.195   1.125   1.00 0.00 ? 12 SER A CA   5  
ATOM 3289 C C    . SER A 1 12 ? 1.548   4.945   0.469   1.00 0.00 ? 12 SER A C    5  
ATOM 3290 O O    . SER A 1 12 ? 0.873   4.152   -0.153  1.00 0.00 ? 12 SER A O    5  
ATOM 3291 C CB   . SER A 1 12 ? 0.495   5.963   2.604   1.00 0.00 ? 12 SER A CB   5  
ATOM 3292 O OG   . SER A 1 12 ? -0.821  5.434   2.499   1.00 0.00 ? 12 SER A OG   5  
ATOM 3293 H H    . SER A 1 12 ? -1.057  6.200   0.451   1.00 0.00 ? 12 SER A H    5  
ATOM 3294 H HA   . SER A 1 12 ? 1.714   6.950   1.155   1.00 0.00 ? 12 SER A HA   5  
ATOM 3295 H HB2  . SER A 1 12 ? 1.085   5.248   3.156   1.00 0.00 ? 12 SER A HB2  5  
ATOM 3296 H HB3  . SER A 1 12 ? 0.463   6.893   3.155   1.00 0.00 ? 12 SER A HB3  5  
ATOM 3297 H HG   . SER A 1 12 ? -1.449  6.140   2.330   1.00 0.00 ? 12 SER A HG   5  
ATOM 3298 N N    . LEU A 1 13 ? 2.837   4.866   0.668   1.00 0.00 ? 13 LEU A N    5  
ATOM 3299 C CA   . LEU A 1 13 ? 3.714   3.763   0.157   1.00 0.00 ? 13 LEU A CA   5  
ATOM 3300 C C    . LEU A 1 13 ? 3.914   2.742   1.283   1.00 0.00 ? 13 LEU A C    5  
ATOM 3301 O O    . LEU A 1 13 ? 4.125   1.570   1.043   1.00 0.00 ? 13 LEU A O    5  
ATOM 3302 C CB   . LEU A 1 13 ? 5.099   4.327   -0.276  1.00 0.00 ? 13 LEU A CB   5  
ATOM 3303 C CG   . LEU A 1 13 ? 5.034   5.140   -1.604  1.00 0.00 ? 13 LEU A CG   5  
ATOM 3304 C CD1  . LEU A 1 13 ? 3.915   6.198   -1.570  1.00 0.00 ? 13 LEU A CD1  5  
ATOM 3305 C CD2  . LEU A 1 13 ? 6.387   5.863   -1.800  1.00 0.00 ? 13 LEU A CD2  5  
ATOM 3306 H H    . LEU A 1 13 ? 3.236   5.595   1.178   1.00 0.00 ? 13 LEU A H    5  
ATOM 3307 H HA   . LEU A 1 13 ? 3.257   3.307   -0.697  1.00 0.00 ? 13 LEU A HA   5  
ATOM 3308 H HB2  . LEU A 1 13 ? 5.520   4.948   0.499   1.00 0.00 ? 13 LEU A HB2  5  
ATOM 3309 H HB3  . LEU A 1 13 ? 5.782   3.502   -0.433  1.00 0.00 ? 13 LEU A HB3  5  
ATOM 3310 H HG   . LEU A 1 13 ? 4.872   4.461   -2.430  1.00 0.00 ? 13 LEU A HG   5  
ATOM 3311 H HD11 . LEU A 1 13 ? 4.028   6.851   -0.715  1.00 0.00 ? 13 LEU A HD11 5  
ATOM 3312 H HD12 . LEU A 1 13 ? 3.941   6.787   -2.471  1.00 0.00 ? 13 LEU A HD12 5  
ATOM 3313 H HD13 . LEU A 1 13 ? 2.954   5.718   -1.524  1.00 0.00 ? 13 LEU A HD13 5  
ATOM 3314 H HD21 . LEU A 1 13 ? 7.191   5.140   -1.850  1.00 0.00 ? 13 LEU A HD21 5  
ATOM 3315 H HD22 . LEU A 1 13 ? 6.371   6.432   -2.719  1.00 0.00 ? 13 LEU A HD22 5  
ATOM 3316 H HD23 . LEU A 1 13 ? 6.568   6.545   -0.978  1.00 0.00 ? 13 LEU A HD23 5  
ATOM 3317 N N    . TYR A 1 14 ? 3.822   3.240   2.491   1.00 0.00 ? 14 TYR A N    5  
ATOM 3318 C CA   . TYR A 1 14 ? 3.987   2.391   3.706   1.00 0.00 ? 14 TYR A CA   5  
ATOM 3319 C C    . TYR A 1 14 ? 2.707   1.536   3.784   1.00 0.00 ? 14 TYR A C    5  
ATOM 3320 O O    . TYR A 1 14 ? 2.674   0.441   4.313   1.00 0.00 ? 14 TYR A O    5  
ATOM 3321 C CB   . TYR A 1 14 ? 4.164   3.349   4.926   1.00 0.00 ? 14 TYR A CB   5  
ATOM 3322 C CG   . TYR A 1 14 ? 4.445   2.504   6.180   1.00 0.00 ? 14 TYR A CG   5  
ATOM 3323 C CD1  . TYR A 1 14 ? 3.435   1.792   6.791   1.00 0.00 ? 14 TYR A CD1  5  
ATOM 3324 C CD2  . TYR A 1 14 ? 5.727   2.428   6.697   1.00 0.00 ? 14 TYR A CD2  5  
ATOM 3325 C CE1  . TYR A 1 14 ? 3.694   1.013   7.892   1.00 0.00 ? 14 TYR A CE1  5  
ATOM 3326 C CE2  . TYR A 1 14 ? 5.987   1.644   7.810   1.00 0.00 ? 14 TYR A CE2  5  
ATOM 3327 C CZ   . TYR A 1 14 ? 4.966   0.931   8.414   1.00 0.00 ? 14 TYR A CZ   5  
ATOM 3328 O OH   . TYR A 1 14 ? 5.196   0.134   9.516   1.00 0.00 ? 14 TYR A OH   5  
ATOM 3329 H H    . TYR A 1 14 ? 3.629   4.193   2.610   1.00 0.00 ? 14 TYR A H    5  
ATOM 3330 H HA   . TYR A 1 14 ? 4.850   1.763   3.597   1.00 0.00 ? 14 TYR A HA   5  
ATOM 3331 H HB2  . TYR A 1 14 ? 5.013   3.992   4.745   1.00 0.00 ? 14 TYR A HB2  5  
ATOM 3332 H HB3  . TYR A 1 14 ? 3.301   3.977   5.107   1.00 0.00 ? 14 TYR A HB3  5  
ATOM 3333 H HD1  . TYR A 1 14 ? 2.426   1.844   6.410   1.00 0.00 ? 14 TYR A HD1  5  
ATOM 3334 H HD2  . TYR A 1 14 ? 6.524   2.985   6.229   1.00 0.00 ? 14 TYR A HD2  5  
ATOM 3335 H HE1  . TYR A 1 14 ? 2.886   0.463   8.344   1.00 0.00 ? 14 TYR A HE1  5  
ATOM 3336 H HE2  . TYR A 1 14 ? 6.989   1.586   8.210   1.00 0.00 ? 14 TYR A HE2  5  
ATOM 3337 H HH   . TYR A 1 14 ? 6.123   0.192   9.749   1.00 0.00 ? 14 TYR A HH   5  
ATOM 3338 N N    . GLN A 1 15 ? 1.686   2.107   3.201   1.00 0.00 ? 15 GLN A N    5  
ATOM 3339 C CA   . GLN A 1 15 ? 0.344   1.484   3.144   1.00 0.00 ? 15 GLN A CA   5  
ATOM 3340 C C    . GLN A 1 15 ? 0.391   0.427   2.036   1.00 0.00 ? 15 GLN A C    5  
ATOM 3341 O O    . GLN A 1 15 ? -0.330  -0.549  2.115   1.00 0.00 ? 15 GLN A O    5  
ATOM 3342 C CB   . GLN A 1 15 ? -0.598  2.675   2.900   1.00 0.00 ? 15 GLN A CB   5  
ATOM 3343 C CG   . GLN A 1 15 ? -2.070  2.341   2.626   1.00 0.00 ? 15 GLN A CG   5  
ATOM 3344 C CD   . GLN A 1 15 ? -2.233  1.645   1.266   1.00 0.00 ? 15 GLN A CD   5  
ATOM 3345 O OE1  . GLN A 1 15 ? -1.538  1.927   0.312   1.00 0.00 ? 15 GLN A OE1  5  
ATOM 3346 N NE2  . GLN A 1 15 ? -3.153  0.731   1.134   1.00 0.00 ? 15 GLN A NE2  5  
ATOM 3347 H H    . GLN A 1 15 ? 1.796   2.982   2.767   1.00 0.00 ? 15 GLN A H    5  
ATOM 3348 H HA   . GLN A 1 15 ? 0.135   1.008   4.092   1.00 0.00 ? 15 GLN A HA   5  
ATOM 3349 H HB2  . GLN A 1 15 ? -0.564  3.284   3.790   1.00 0.00 ? 15 GLN A HB2  5  
ATOM 3350 H HB3  . GLN A 1 15 ? -0.216  3.264   2.084   1.00 0.00 ? 15 GLN A HB3  5  
ATOM 3351 H HG2  . GLN A 1 15 ? -2.452  1.707   3.410   1.00 0.00 ? 15 GLN A HG2  5  
ATOM 3352 H HG3  . GLN A 1 15 ? -2.634  3.261   2.617   1.00 0.00 ? 15 GLN A HG3  5  
ATOM 3353 H HE21 . GLN A 1 15 ? -3.727  0.512   1.895   1.00 0.00 ? 15 GLN A HE21 5  
ATOM 3354 H HE22 . GLN A 1 15 ? -3.269  0.272   0.280   1.00 0.00 ? 15 GLN A HE22 5  
ATOM 3355 N N    . LEU A 1 16 ? 1.237   0.624   1.048   1.00 0.00 ? 16 LEU A N    5  
ATOM 3356 C CA   . LEU A 1 16 ? 1.319   -0.379  -0.055  1.00 0.00 ? 16 LEU A CA   5  
ATOM 3357 C C    . LEU A 1 16 ? 2.125   -1.567  0.500   1.00 0.00 ? 16 LEU A C    5  
ATOM 3358 O O    . LEU A 1 16 ? 2.002   -2.675  0.017   1.00 0.00 ? 16 LEU A O    5  
ATOM 3359 C CB   . LEU A 1 16 ? 2.068   0.168   -1.299  1.00 0.00 ? 16 LEU A CB   5  
ATOM 3360 C CG   . LEU A 1 16 ? 1.437   1.470   -1.857  1.00 0.00 ? 16 LEU A CG   5  
ATOM 3361 C CD1  . LEU A 1 16 ? 2.325   1.968   -3.011  1.00 0.00 ? 16 LEU A CD1  5  
ATOM 3362 C CD2  . LEU A 1 16 ? 0.012   1.248   -2.421  1.00 0.00 ? 16 LEU A CD2  5  
ATOM 3363 H H    . LEU A 1 16 ? 1.824   1.403   1.029   1.00 0.00 ? 16 LEU A H    5  
ATOM 3364 H HA   . LEU A 1 16 ? 0.323   -0.682  -0.323  1.00 0.00 ? 16 LEU A HA   5  
ATOM 3365 H HB2  . LEU A 1 16 ? 3.103   0.341   -1.050  1.00 0.00 ? 16 LEU A HB2  5  
ATOM 3366 H HB3  . LEU A 1 16 ? 2.026   -0.592  -2.070  1.00 0.00 ? 16 LEU A HB3  5  
ATOM 3367 H HG   . LEU A 1 16 ? 1.393   2.200   -1.071  1.00 0.00 ? 16 LEU A HG   5  
ATOM 3368 H HD11 . LEU A 1 16 ? 3.330   2.160   -2.665  1.00 0.00 ? 16 LEU A HD11 5  
ATOM 3369 H HD12 . LEU A 1 16 ? 2.364   1.218   -3.789  1.00 0.00 ? 16 LEU A HD12 5  
ATOM 3370 H HD13 . LEU A 1 16 ? 1.929   2.873   -3.434  1.00 0.00 ? 16 LEU A HD13 5  
ATOM 3371 H HD21 . LEU A 1 16 ? -0.652  0.862   -1.662  1.00 0.00 ? 16 LEU A HD21 5  
ATOM 3372 H HD22 . LEU A 1 16 ? -0.387  2.180   -2.798  1.00 0.00 ? 16 LEU A HD22 5  
ATOM 3373 H HD23 . LEU A 1 16 ? 0.042   0.537   -3.233  1.00 0.00 ? 16 LEU A HD23 5  
ATOM 3374 N N    . GLU A 1 17 ? 2.930   -1.303  1.503   1.00 0.00 ? 17 GLU A N    5  
ATOM 3375 C CA   . GLU A 1 17 ? 3.753   -2.380  2.123   1.00 0.00 ? 17 GLU A CA   5  
ATOM 3376 C C    . GLU A 1 17 ? 2.824   -3.364  2.841   1.00 0.00 ? 17 GLU A C    5  
ATOM 3377 O O    . GLU A 1 17 ? 3.102   -4.545  2.879   1.00 0.00 ? 17 GLU A O    5  
ATOM 3378 C CB   . GLU A 1 17 ? 4.801   -1.684  3.084   1.00 0.00 ? 17 GLU A CB   5  
ATOM 3379 C CG   . GLU A 1 17 ? 5.842   -0.936  2.203   1.00 0.00 ? 17 GLU A CG   5  
ATOM 3380 C CD   . GLU A 1 17 ? 6.586   0.189   2.964   1.00 0.00 ? 17 GLU A CD   5  
ATOM 3381 O OE1  . GLU A 1 17 ? 6.732   0.080   4.171   1.00 0.00 ? 17 GLU A OE1  5  
ATOM 3382 O OE2  . GLU A 1 17 ? 6.977   1.117   2.272   1.00 0.00 ? 17 GLU A OE2  5  
ATOM 3383 H H    . GLU A 1 17 ? 2.996   -0.391  1.853   1.00 0.00 ? 17 GLU A H    5  
ATOM 3384 H HA   . GLU A 1 17 ? 4.236   -2.930  1.341   1.00 0.00 ? 17 GLU A HA   5  
ATOM 3385 H HB2  . GLU A 1 17 ? 4.342   -0.942  3.713   1.00 0.00 ? 17 GLU A HB2  5  
ATOM 3386 H HB3  . GLU A 1 17 ? 5.297   -2.402  3.729   1.00 0.00 ? 17 GLU A HB3  5  
ATOM 3387 H HG2  . GLU A 1 17 ? 6.578   -1.654  1.875   1.00 0.00 ? 17 GLU A HG2  5  
ATOM 3388 H HG3  . GLU A 1 17 ? 5.360   -0.522  1.328   1.00 0.00 ? 17 GLU A HG3  5  
ATOM 3389 N N    . ASN A 1 18 ? 1.747   -2.843  3.373   1.00 0.00 ? 18 ASN A N    5  
ATOM 3390 C CA   . ASN A 1 18 ? 0.726   -3.655  4.116   1.00 0.00 ? 18 ASN A CA   5  
ATOM 3391 C C    . ASN A 1 18 ? 0.223   -4.866  3.298   1.00 0.00 ? 18 ASN A C    5  
ATOM 3392 O O    . ASN A 1 18 ? -0.249  -5.845  3.844   1.00 0.00 ? 18 ASN A O    5  
ATOM 3393 C CB   . ASN A 1 18 ? -0.440  -2.697  4.478   1.00 0.00 ? 18 ASN A CB   5  
ATOM 3394 C CG   . ASN A 1 18 ? -1.569  -3.412  5.237   1.00 0.00 ? 18 ASN A CG   5  
ATOM 3395 O OD1  . ASN A 1 18 ? -2.257  -4.260  4.704   1.00 0.00 ? 18 ASN A OD1  5  
ATOM 3396 N ND2  . ASN A 1 18 ? -1.799  -3.107  6.485   1.00 0.00 ? 18 ASN A ND2  5  
ATOM 3397 H H    . ASN A 1 18 ? 1.596   -1.883  3.267   1.00 0.00 ? 18 ASN A H    5  
ATOM 3398 H HA   . ASN A 1 18 ? 1.176   -4.021  5.022   1.00 0.00 ? 18 ASN A HA   5  
ATOM 3399 H HB2  . ASN A 1 18 ? -0.082  -1.877  5.087   1.00 0.00 ? 18 ASN A HB2  5  
ATOM 3400 H HB3  . ASN A 1 18 ? -0.862  -2.289  3.571   1.00 0.00 ? 18 ASN A HB3  5  
ATOM 3401 H HD21 . ASN A 1 18 ? -1.264  -2.424  6.939   1.00 0.00 ? 18 ASN A HD21 5  
ATOM 3402 H HD22 . ASN A 1 18 ? -2.519  -3.565  6.970   1.00 0.00 ? 18 ASN A HD22 5  
ATOM 3403 N N    . TYR A 1 19 ? 0.349   -4.746  2.003   1.00 0.00 ? 19 TYR A N    5  
ATOM 3404 C CA   . TYR A 1 19 ? -0.092  -5.811  1.053   1.00 0.00 ? 19 TYR A CA   5  
ATOM 3405 C C    . TYR A 1 19 ? 0.549   -7.191  1.262   1.00 0.00 ? 19 TYR A C    5  
ATOM 3406 O O    . TYR A 1 19 ? -0.128  -8.188  1.101   1.00 0.00 ? 19 TYR A O    5  
ATOM 3407 C CB   . TYR A 1 19 ? 0.172   -5.292  -0.383  1.00 0.00 ? 19 TYR A CB   5  
ATOM 3408 C CG   . TYR A 1 19 ? -0.821  -4.154  -0.703  1.00 0.00 ? 19 TYR A CG   5  
ATOM 3409 C CD1  . TYR A 1 19 ? -0.899  -2.982  0.041   1.00 0.00 ? 19 TYR A CD1  5  
ATOM 3410 C CD2  . TYR A 1 19 ? -1.663  -4.296  -1.779  1.00 0.00 ? 19 TYR A CD2  5  
ATOM 3411 C CE1  . TYR A 1 19 ? -1.789  -1.995  -0.296  1.00 0.00 ? 19 TYR A CE1  5  
ATOM 3412 C CE2  . TYR A 1 19 ? -2.553  -3.298  -2.115  1.00 0.00 ? 19 TYR A CE2  5  
ATOM 3413 C CZ   . TYR A 1 19 ? -2.622  -2.141  -1.372  1.00 0.00 ? 19 TYR A CZ   5  
ATOM 3414 O OH   . TYR A 1 19 ? -3.490  -1.116  -1.690  1.00 0.00 ? 19 TYR A OH   5  
ATOM 3415 H H    . TYR A 1 19 ? 0.760   -3.926  1.652   1.00 0.00 ? 19 TYR A H    5  
ATOM 3416 H HA   . TYR A 1 19 ? -1.158  -5.936  1.180   1.00 0.00 ? 19 TYR A HA   5  
ATOM 3417 H HB2  . TYR A 1 19 ? 1.170   -4.900  -0.518  1.00 0.00 ? 19 TYR A HB2  5  
ATOM 3418 H HB3  . TYR A 1 19 ? 0.035   -6.090  -1.096  1.00 0.00 ? 19 TYR A HB3  5  
ATOM 3419 H HD1  . TYR A 1 19 ? -0.271  -2.811  0.898   1.00 0.00 ? 19 TYR A HD1  5  
ATOM 3420 H HD2  . TYR A 1 19 ? -1.627  -5.198  -2.374  1.00 0.00 ? 19 TYR A HD2  5  
ATOM 3421 H HE1  . TYR A 1 19 ? -1.829  -1.097  0.297   1.00 0.00 ? 19 TYR A HE1  5  
ATOM 3422 H HE2  . TYR A 1 19 ? -3.205  -3.432  -2.963  1.00 0.00 ? 19 TYR A HE2  5  
ATOM 3423 H HH   . TYR A 1 19 ? -2.977  -0.305  -1.695  1.00 0.00 ? 19 TYR A HH   5  
ATOM 3424 N N    . CYS A 1 20 ? 1.814   -7.224  1.608   1.00 0.00 ? 20 CYS A N    5  
ATOM 3425 C CA   . CYS A 1 20 ? 2.530   -8.518  1.837   1.00 0.00 ? 20 CYS A CA   5  
ATOM 3426 C C    . CYS A 1 20 ? 3.275   -8.535  3.171   1.00 0.00 ? 20 CYS A C    5  
ATOM 3427 O O    . CYS A 1 20 ? 3.473   -9.586  3.756   1.00 0.00 ? 20 CYS A O    5  
ATOM 3428 C CB   . CYS A 1 20 ? 3.451   -8.732  0.671   1.00 0.00 ? 20 CYS A CB   5  
ATOM 3429 S SG   . CYS A 1 20 ? 2.497   -9.410  -0.706  1.00 0.00 ? 20 CYS A SG   5  
ATOM 3430 H H    . CYS A 1 20 ? 2.320   -6.396  1.735   1.00 0.00 ? 20 CYS A H    5  
ATOM 3431 H HA   . CYS A 1 20 ? 1.858   -9.351  1.767   1.00 0.00 ? 20 CYS A HA   5  
ATOM 3432 H HB2  . CYS A 1 20 ? 3.859   -7.777  0.366   1.00 0.00 ? 20 CYS A HB2  5  
ATOM 3433 H HB3  . CYS A 1 20 ? 4.259   -9.408  0.908   1.00 0.00 ? 20 CYS A HB3  5  
ATOM 3434 N N    . ASN A 1 21 ? 3.662   -7.367  3.611   1.00 0.00 ? 21 ASN A N    5  
ATOM 3435 C CA   . ASN A 1 21 ? 4.399   -7.212  4.895   1.00 0.00 ? 21 ASN A CA   5  
ATOM 3436 C C    . ASN A 1 21 ? 3.576   -6.323  5.841   1.00 0.00 ? 21 ASN A C    5  
ATOM 3437 O O    . ASN A 1 21 ? 3.479   -6.562  7.030   1.00 0.00 ? 21 ASN A O    5  
ATOM 3438 C CB   . ASN A 1 21 ? 5.745   -6.568  4.587   1.00 0.00 ? 21 ASN A CB   5  
ATOM 3439 C CG   . ASN A 1 21 ? 6.554   -7.495  3.668   1.00 0.00 ? 21 ASN A CG   5  
ATOM 3440 O OD1  . ASN A 1 21 ? 7.298   -8.347  4.112   1.00 0.00 ? 21 ASN A OD1  5  
ATOM 3441 N ND2  . ASN A 1 21 ? 6.424   -7.357  2.376   1.00 0.00 ? 21 ASN A ND2  5  
ATOM 3442 H H    . ASN A 1 21 ? 3.465   -6.553  3.102   1.00 0.00 ? 21 ASN A H    5  
ATOM 3443 H HA   . ASN A 1 21 ? 4.530   -8.178  5.358   1.00 0.00 ? 21 ASN A HA   5  
ATOM 3444 H HB2  . ASN A 1 21 ? 5.589   -5.629  4.076   1.00 0.00 ? 21 ASN A HB2  5  
ATOM 3445 H HB3  . ASN A 1 21 ? 6.295   -6.388  5.503   1.00 0.00 ? 21 ASN A HB3  5  
ATOM 3446 H HD21 . ASN A 1 21 ? 5.807   -6.686  2.018   1.00 0.00 ? 21 ASN A HD21 5  
ATOM 3447 H HD22 . ASN A 1 21 ? 6.937   -7.921  1.761   1.00 0.00 ? 21 ASN A HD22 5  
ATOM 3448 N N    . PHE B 2 1  ? 3.110   8.694   3.667   1.00 0.00 ? 1  PHE B N    5  
ATOM 3449 C CA   . PHE B 2 1  ? 2.328   9.681   2.870   1.00 0.00 ? 1  PHE B CA   5  
ATOM 3450 C C    . PHE B 2 1  ? 3.314   10.610  2.149   1.00 0.00 ? 1  PHE B C    5  
ATOM 3451 O O    . PHE B 2 1  ? 4.208   11.165  2.759   1.00 0.00 ? 1  PHE B O    5  
ATOM 3452 C CB   . PHE B 2 1  ? 1.425   10.519  3.801   1.00 0.00 ? 1  PHE B CB   5  
ATOM 3453 C CG   . PHE B 2 1  ? 0.338   11.321  3.048   1.00 0.00 ? 1  PHE B CG   5  
ATOM 3454 C CD1  . PHE B 2 1  ? 0.131   11.227  1.678   1.00 0.00 ? 1  PHE B CD1  5  
ATOM 3455 C CD2  . PHE B 2 1  ? -0.480  12.167  3.775   1.00 0.00 ? 1  PHE B CD2  5  
ATOM 3456 C CE1  . PHE B 2 1  ? -0.862  11.945  1.065   1.00 0.00 ? 1  PHE B CE1  5  
ATOM 3457 C CE2  . PHE B 2 1  ? -1.478  12.889  3.156   1.00 0.00 ? 1  PHE B CE2  5  
ATOM 3458 C CZ   . PHE B 2 1  ? -1.668  12.778  1.798   1.00 0.00 ? 1  PHE B CZ   5  
ATOM 3459 H H1   . PHE B 2 1  ? 4.125   8.888   3.554   1.00 0.00 ? 1  PHE B H1   5  
ATOM 3460 H H2   . PHE B 2 1  ? 2.842   8.761   4.667   1.00 0.00 ? 1  PHE B H2   5  
ATOM 3461 H H3   . PHE B 2 1  ? 2.888   7.739   3.320   1.00 0.00 ? 1  PHE B H3   5  
ATOM 3462 H HA   . PHE B 2 1  ? 1.738   9.145   2.147   1.00 0.00 ? 1  PHE B HA   5  
ATOM 3463 H HB2  . PHE B 2 1  ? 0.929   9.853   4.493   1.00 0.00 ? 1  PHE B HB2  5  
ATOM 3464 H HB3  . PHE B 2 1  ? 2.041   11.200  4.368   1.00 0.00 ? 1  PHE B HB3  5  
ATOM 3465 H HD1  . PHE B 2 1  ? 0.741   10.596  1.059   1.00 0.00 ? 1  PHE B HD1  5  
ATOM 3466 H HD2  . PHE B 2 1  ? -0.347  12.276  4.844   1.00 0.00 ? 1  PHE B HD2  5  
ATOM 3467 H HE1  . PHE B 2 1  ? -1.010  11.860  0.002   1.00 0.00 ? 1  PHE B HE1  5  
ATOM 3468 H HE2  . PHE B 2 1  ? -2.116  13.547  3.729   1.00 0.00 ? 1  PHE B HE2  5  
ATOM 3469 H HZ   . PHE B 2 1  ? -2.447  13.347  1.313   1.00 0.00 ? 1  PHE B HZ   5  
ATOM 3470 N N    . VAL B 2 2  ? 3.116   10.744  0.865   1.00 0.00 ? 2  VAL B N    5  
ATOM 3471 C CA   . VAL B 2 2  ? 3.984   11.614  0.009   1.00 0.00 ? 2  VAL B CA   5  
ATOM 3472 C C    . VAL B 2 2  ? 3.172   12.710  -0.712  1.00 0.00 ? 2  VAL B C    5  
ATOM 3473 O O    . VAL B 2 2  ? 1.957   12.718  -0.665  1.00 0.00 ? 2  VAL B O    5  
ATOM 3474 C CB   . VAL B 2 2  ? 4.698   10.705  -1.012  1.00 0.00 ? 2  VAL B CB   5  
ATOM 3475 C CG1  . VAL B 2 2  ? 5.694   9.795   -0.250  1.00 0.00 ? 2  VAL B CG1  5  
ATOM 3476 C CG2  . VAL B 2 2  ? 3.665   9.783   -1.703  1.00 0.00 ? 2  VAL B CG2  5  
ATOM 3477 H H    . VAL B 2 2  ? 2.379   10.248  0.450   1.00 0.00 ? 2  VAL B H    5  
ATOM 3478 H HA   . VAL B 2 2  ? 4.722   12.097  0.635   1.00 0.00 ? 2  VAL B HA   5  
ATOM 3479 H HB   . VAL B 2 2  ? 5.216   11.307  -1.745  1.00 0.00 ? 2  VAL B HB   5  
ATOM 3480 H HG11 . VAL B 2 2  ? 5.172   9.195   0.481   1.00 0.00 ? 2  VAL B HG11 5  
ATOM 3481 H HG12 . VAL B 2 2  ? 6.199   9.143   -0.951  1.00 0.00 ? 2  VAL B HG12 5  
ATOM 3482 H HG13 . VAL B 2 2  ? 6.437   10.386  0.266   1.00 0.00 ? 2  VAL B HG13 5  
ATOM 3483 H HG21 . VAL B 2 2  ? 2.910   10.353  -2.219  1.00 0.00 ? 2  VAL B HG21 5  
ATOM 3484 H HG22 . VAL B 2 2  ? 4.175   9.160   -2.416  1.00 0.00 ? 2  VAL B HG22 5  
ATOM 3485 H HG23 . VAL B 2 2  ? 3.183   9.146   -0.972  1.00 0.00 ? 2  VAL B HG23 5  
ATOM 3486 N N    . ASN B 2 3  ? 3.888   13.597  -1.360  1.00 0.00 ? 3  ASN B N    5  
ATOM 3487 C CA   . ASN B 2 3  ? 3.263   14.736  -2.121  1.00 0.00 ? 3  ASN B CA   5  
ATOM 3488 C C    . ASN B 2 3  ? 3.701   14.664  -3.596  1.00 0.00 ? 3  ASN B C    5  
ATOM 3489 O O    . ASN B 2 3  ? 4.353   15.564  -4.097  1.00 0.00 ? 3  ASN B O    5  
ATOM 3490 C CB   . ASN B 2 3  ? 3.720   16.055  -1.440  1.00 0.00 ? 3  ASN B CB   5  
ATOM 3491 C CG   . ASN B 2 3  ? 5.262   16.105  -1.355  1.00 0.00 ? 3  ASN B CG   5  
ATOM 3492 O OD1  . ASN B 2 3  ? 5.945   16.580  -2.242  1.00 0.00 ? 3  ASN B OD1  5  
ATOM 3493 N ND2  . ASN B 2 3  ? 5.839   15.609  -0.294  1.00 0.00 ? 3  ASN B ND2  5  
ATOM 3494 H H    . ASN B 2 3  ? 4.866   13.524  -1.352  1.00 0.00 ? 3  ASN B H    5  
ATOM 3495 H HA   . ASN B 2 3  ? 2.184   14.649  -2.074  1.00 0.00 ? 3  ASN B HA   5  
ATOM 3496 H HB2  . ASN B 2 3  ? 3.381   16.905  -2.016  1.00 0.00 ? 3  ASN B HB2  5  
ATOM 3497 H HB3  . ASN B 2 3  ? 3.311   16.131  -0.441  1.00 0.00 ? 3  ASN B HB3  5  
ATOM 3498 H HD21 . ASN B 2 3  ? 5.286   15.222  0.418   1.00 0.00 ? 3  ASN B HD21 5  
ATOM 3499 H HD22 . ASN B 2 3  ? 6.816   15.625  -0.208  1.00 0.00 ? 3  ASN B HD22 5  
ATOM 3500 N N    . GLN B 2 4  ? 3.331   13.589  -4.253  1.00 0.00 ? 4  GLN B N    5  
ATOM 3501 C CA   . GLN B 2 4  ? 3.703   13.393  -5.683  1.00 0.00 ? 4  GLN B CA   5  
ATOM 3502 C C    . GLN B 2 4  ? 2.428   13.120  -6.538  1.00 0.00 ? 4  GLN B C    5  
ATOM 3503 O O    . GLN B 2 4  ? 1.327   13.328  -6.066  1.00 0.00 ? 4  GLN B O    5  
ATOM 3504 C CB   . GLN B 2 4  ? 4.731   12.223  -5.646  1.00 0.00 ? 4  GLN B CB   5  
ATOM 3505 C CG   . GLN B 2 4  ? 5.359   11.884  -7.018  1.00 0.00 ? 4  GLN B CG   5  
ATOM 3506 C CD   . GLN B 2 4  ? 6.593   10.997  -6.809  1.00 0.00 ? 4  GLN B CD   5  
ATOM 3507 O OE1  . GLN B 2 4  ? 6.635   10.135  -5.953  1.00 0.00 ? 4  GLN B OE1  5  
ATOM 3508 N NE2  . GLN B 2 4  ? 7.618   11.179  -7.591  1.00 0.00 ? 4  GLN B NE2  5  
ATOM 3509 H H    . GLN B 2 4  ? 2.800   12.890  -3.822  1.00 0.00 ? 4  GLN B H    5  
ATOM 3510 H HA   . GLN B 2 4  ? 4.177   14.315  -6.004  1.00 0.00 ? 4  GLN B HA   5  
ATOM 3511 H HB2  . GLN B 2 4  ? 5.509   12.469  -4.939  1.00 0.00 ? 4  GLN B HB2  5  
ATOM 3512 H HB3  . GLN B 2 4  ? 4.223   11.345  -5.273  1.00 0.00 ? 4  GLN B HB3  5  
ATOM 3513 H HG2  . GLN B 2 4  ? 4.675   11.329  -7.647  1.00 0.00 ? 4  GLN B HG2  5  
ATOM 3514 H HG3  . GLN B 2 4  ? 5.651   12.799  -7.515  1.00 0.00 ? 4  GLN B HG3  5  
ATOM 3515 H HE21 . GLN B 2 4  ? 7.568   11.867  -8.283  1.00 0.00 ? 4  GLN B HE21 5  
ATOM 3516 H HE22 . GLN B 2 4  ? 8.431   10.641  -7.488  1.00 0.00 ? 4  GLN B HE22 5  
ATOM 3517 N N    . HIS B 2 5  ? 2.606   12.663  -7.756  1.00 0.00 ? 5  HIS B N    5  
ATOM 3518 C CA   . HIS B 2 5  ? 1.482   12.350  -8.695  1.00 0.00 ? 5  HIS B CA   5  
ATOM 3519 C C    . HIS B 2 5  ? 1.433   10.805  -8.815  1.00 0.00 ? 5  HIS B C    5  
ATOM 3520 O O    . HIS B 2 5  ? 1.625   10.258  -9.883  1.00 0.00 ? 5  HIS B O    5  
ATOM 3521 C CB   . HIS B 2 5  ? 1.808   13.035  -10.045 1.00 0.00 ? 5  HIS B CB   5  
ATOM 3522 C CG   . HIS B 2 5  ? 1.886   14.558  -9.861  1.00 0.00 ? 5  HIS B CG   5  
ATOM 3523 N ND1  . HIS B 2 5  ? 0.870   15.354  -9.767  1.00 0.00 ? 5  HIS B ND1  5  
ATOM 3524 C CD2  . HIS B 2 5  ? 2.983   15.396  -9.747  1.00 0.00 ? 5  HIS B CD2  5  
ATOM 3525 C CE1  . HIS B 2 5  ? 1.281   16.571  -9.615  1.00 0.00 ? 5  HIS B CE1  5  
ATOM 3526 N NE2  . HIS B 2 5  ? 2.588   16.646  -9.596  1.00 0.00 ? 5  HIS B NE2  5  
ATOM 3527 H H    . HIS B 2 5  ? 3.499   12.496  -8.107  1.00 0.00 ? 5  HIS B H    5  
ATOM 3528 H HA   . HIS B 2 5  ? 0.545   12.710  -8.301  1.00 0.00 ? 5  HIS B HA   5  
ATOM 3529 H HB2  . HIS B 2 5  ? 2.764   12.693  -10.413 1.00 0.00 ? 5  HIS B HB2  5  
ATOM 3530 H HB3  . HIS B 2 5  ? 1.052   12.814  -10.783 1.00 0.00 ? 5  HIS B HB3  5  
ATOM 3531 H HD1  . HIS B 2 5  ? -0.071  15.085  -9.813  1.00 0.00 ? 5  HIS B HD1  5  
ATOM 3532 H HD2  . HIS B 2 5  ? 4.017   15.081  -9.778  1.00 0.00 ? 5  HIS B HD2  5  
ATOM 3533 H HE1  . HIS B 2 5  ? 0.620   17.423  -9.513  1.00 0.00 ? 5  HIS B HE1  5  
ATOM 3534 N N    . LEU B 2 6  ? 1.172   10.136  -7.716  1.00 0.00 ? 6  LEU B N    5  
ATOM 3535 C CA   . LEU B 2 6  ? 1.108   8.630   -7.711  1.00 0.00 ? 6  LEU B CA   5  
ATOM 3536 C C    . LEU B 2 6  ? -0.288  8.050   -7.993  1.00 0.00 ? 6  LEU B C    5  
ATOM 3537 O O    . LEU B 2 6  ? -1.001  7.723   -7.062  1.00 0.00 ? 6  LEU B O    5  
ATOM 3538 C CB   . LEU B 2 6  ? 1.576   8.097   -6.338  1.00 0.00 ? 6  LEU B CB   5  
ATOM 3539 C CG   . LEU B 2 6  ? 3.004   8.546   -5.970  1.00 0.00 ? 6  LEU B CG   5  
ATOM 3540 C CD1  . LEU B 2 6  ? 3.383   7.872   -4.646  1.00 0.00 ? 6  LEU B CD1  5  
ATOM 3541 C CD2  . LEU B 2 6  ? 4.033   8.131   -7.041  1.00 0.00 ? 6  LEU B CD2  5  
ATOM 3542 H H    . LEU B 2 6  ? 1.017   10.622  -6.878  1.00 0.00 ? 6  LEU B H    5  
ATOM 3543 H HA   . LEU B 2 6  ? 1.766   8.251   -8.474  1.00 0.00 ? 6  LEU B HA   5  
ATOM 3544 H HB2  . LEU B 2 6  ? 0.893   8.458   -5.584  1.00 0.00 ? 6  LEU B HB2  5  
ATOM 3545 H HB3  . LEU B 2 6  ? 1.517   7.019   -6.343  1.00 0.00 ? 6  LEU B HB3  5  
ATOM 3546 H HG   . LEU B 2 6  ? 3.024   9.621   -5.845  1.00 0.00 ? 6  LEU B HG   5  
ATOM 3547 H HD11 . LEU B 2 6  ? 2.690   8.167   -3.868  1.00 0.00 ? 6  LEU B HD11 5  
ATOM 3548 H HD12 . LEU B 2 6  ? 3.351   6.801   -4.757  1.00 0.00 ? 6  LEU B HD12 5  
ATOM 3549 H HD13 . LEU B 2 6  ? 4.388   8.144   -4.358  1.00 0.00 ? 6  LEU B HD13 5  
ATOM 3550 H HD21 . LEU B 2 6  ? 4.022   7.059   -7.165  1.00 0.00 ? 6  LEU B HD21 5  
ATOM 3551 H HD22 . LEU B 2 6  ? 3.807   8.592   -7.992  1.00 0.00 ? 6  LEU B HD22 5  
ATOM 3552 H HD23 . LEU B 2 6  ? 5.023   8.437   -6.739  1.00 0.00 ? 6  LEU B HD23 5  
ATOM 3553 N N    . CYS B 2 7  ? -0.652  7.920   -9.248  1.00 0.00 ? 7  CYS B N    5  
ATOM 3554 C CA   . CYS B 2 7  ? -2.014  7.363   -9.557  1.00 0.00 ? 7  CYS B CA   5  
ATOM 3555 C C    . CYS B 2 7  ? -2.069  6.082   -10.412 1.00 0.00 ? 7  CYS B C    5  
ATOM 3556 O O    . CYS B 2 7  ? -2.541  6.074   -11.533 1.00 0.00 ? 7  CYS B O    5  
ATOM 3557 C CB   . CYS B 2 7  ? -2.852  8.484   -10.213 1.00 0.00 ? 7  CYS B CB   5  
ATOM 3558 S SG   . CYS B 2 7  ? -4.606  8.168   -10.532 1.00 0.00 ? 7  CYS B SG   5  
ATOM 3559 H H    . CYS B 2 7  ? -0.037  8.177   -9.971  1.00 0.00 ? 7  CYS B H    5  
ATOM 3560 H HA   . CYS B 2 7  ? -2.501  7.130   -8.640  1.00 0.00 ? 7  CYS B HA   5  
ATOM 3561 H HB2  . CYS B 2 7  ? -2.820  9.340   -9.554  1.00 0.00 ? 7  CYS B HB2  5  
ATOM 3562 H HB3  . CYS B 2 7  ? -2.392  8.774   -11.147 1.00 0.00 ? 7  CYS B HB3  5  
ATOM 3563 N N    . GLY B 2 8  ? -1.565  5.029   -9.821  1.00 0.00 ? 8  GLY B N    5  
ATOM 3564 C CA   . GLY B 2 8  ? -1.533  3.684   -10.469 1.00 0.00 ? 8  GLY B CA   5  
ATOM 3565 C C    . GLY B 2 8  ? -0.122  3.233   -10.937 1.00 0.00 ? 8  GLY B C    5  
ATOM 3566 O O    . GLY B 2 8  ? 0.413   2.322   -10.340 1.00 0.00 ? 8  GLY B O    5  
ATOM 3567 H H    . GLY B 2 8  ? -1.191  5.128   -8.921  1.00 0.00 ? 8  GLY B H    5  
ATOM 3568 H HA2  . GLY B 2 8  ? -1.830  2.985   -9.704  1.00 0.00 ? 8  GLY B HA2  5  
ATOM 3569 H HA3  . GLY B 2 8  ? -2.305  3.588   -11.229 1.00 0.00 ? 8  GLY B HA3  5  
ATOM 3570 N N    . SER B 2 9  ? 0.469   3.837   -11.950 1.00 0.00 ? 9  SER B N    5  
ATOM 3571 C CA   . SER B 2 9  ? 1.832   3.430   -12.439 1.00 0.00 ? 9  SER B CA   5  
ATOM 3572 C C    . SER B 2 9  ? 2.899   3.046   -11.406 1.00 0.00 ? 9  SER B C    5  
ATOM 3573 O O    . SER B 2 9  ? 3.662   2.116   -11.575 1.00 0.00 ? 9  SER B O    5  
ATOM 3574 C CB   . SER B 2 9  ? 2.387   4.560   -13.289 1.00 0.00 ? 9  SER B CB   5  
ATOM 3575 O OG   . SER B 2 9  ? 2.547   5.661   -12.398 1.00 0.00 ? 9  SER B OG   5  
ATOM 3576 H H    . SER B 2 9  ? 0.070   4.591   -12.439 1.00 0.00 ? 9  SER B H    5  
ATOM 3577 H HA   . SER B 2 9  ? 1.682   2.576   -13.085 1.00 0.00 ? 9  SER B HA   5  
ATOM 3578 H HB2  . SER B 2 9  ? 3.330   4.296   -13.746 1.00 0.00 ? 9  SER B HB2  5  
ATOM 3579 H HB3  . SER B 2 9  ? 1.654   4.817   -14.024 1.00 0.00 ? 9  SER B HB3  5  
ATOM 3580 H HG   . SER B 2 9  ? 3.482   5.861   -12.324 1.00 0.00 ? 9  SER B HG   5  
ATOM 3581 N N    . HIS B 2 10 ? 2.874   3.810   -10.358 1.00 0.00 ? 10 HIS B N    5  
ATOM 3582 C CA   . HIS B 2 10 ? 3.812   3.678   -9.218  1.00 0.00 ? 10 HIS B CA   5  
ATOM 3583 C C    . HIS B 2 10 ? 3.248   2.871   -8.073  1.00 0.00 ? 10 HIS B C    5  
ATOM 3584 O O    . HIS B 2 10 ? 4.013   2.250   -7.367  1.00 0.00 ? 10 HIS B O    5  
ATOM 3585 C CB   . HIS B 2 10 ? 4.164   5.113   -8.797  1.00 0.00 ? 10 HIS B CB   5  
ATOM 3586 C CG   . HIS B 2 10 ? 4.886   5.821   -9.957  1.00 0.00 ? 10 HIS B CG   5  
ATOM 3587 N ND1  . HIS B 2 10 ? 5.154   7.083   -10.002 1.00 0.00 ? 10 HIS B ND1  5  
ATOM 3588 C CD2  . HIS B 2 10 ? 5.383   5.329   -11.156 1.00 0.00 ? 10 HIS B CD2  5  
ATOM 3589 C CE1  . HIS B 2 10 ? 5.760   7.359   -11.115 1.00 0.00 ? 10 HIS B CE1  5  
ATOM 3590 N NE2  . HIS B 2 10 ? 5.920   6.299   -11.865 1.00 0.00 ? 10 HIS B NE2  5  
ATOM 3591 H H    . HIS B 2 10 ? 2.189   4.499   -10.316 1.00 0.00 ? 10 HIS B H    5  
ATOM 3592 H HA   . HIS B 2 10 ? 4.701   3.175   -9.567  1.00 0.00 ? 10 HIS B HA   5  
ATOM 3593 H HB2  . HIS B 2 10 ? 3.265   5.668   -8.583  1.00 0.00 ? 10 HIS B HB2  5  
ATOM 3594 H HB3  . HIS B 2 10 ? 4.788   5.140   -7.926  1.00 0.00 ? 10 HIS B HB3  5  
ATOM 3595 H HD1  . HIS B 2 10 ? 4.939   7.735   -9.302  1.00 0.00 ? 10 HIS B HD1  5  
ATOM 3596 H HD2  . HIS B 2 10 ? 5.343   4.294   -11.471 1.00 0.00 ? 10 HIS B HD2  5  
ATOM 3597 H HE1  . HIS B 2 10 ? 6.091   8.349   -11.397 1.00 0.00 ? 10 HIS B HE1  5  
ATOM 3598 N N    . LEU B 2 11 ? 1.953   2.882   -7.901  1.00 0.00 ? 11 LEU B N    5  
ATOM 3599 C CA   . LEU B 2 11 ? 1.379   2.097   -6.779  1.00 0.00 ? 11 LEU B CA   5  
ATOM 3600 C C    . LEU B 2 11 ? 1.477   0.632   -7.229  1.00 0.00 ? 11 LEU B C    5  
ATOM 3601 O O    . LEU B 2 11 ? 1.546   -0.262  -6.414  1.00 0.00 ? 11 LEU B O    5  
ATOM 3602 C CB   . LEU B 2 11 ? -0.092  2.514   -6.556  1.00 0.00 ? 11 LEU B CB   5  
ATOM 3603 C CG   . LEU B 2 11 ? -0.193  4.053   -6.357  1.00 0.00 ? 11 LEU B CG   5  
ATOM 3604 C CD1  . LEU B 2 11 ? -1.666  4.435   -6.393  1.00 0.00 ? 11 LEU B CD1  5  
ATOM 3605 C CD2  . LEU B 2 11 ? 0.386   4.479   -5.000  1.00 0.00 ? 11 LEU B CD2  5  
ATOM 3606 H H    . LEU B 2 11 ? 1.367   3.388   -8.500  1.00 0.00 ? 11 LEU B H    5  
ATOM 3607 H HA   . LEU B 2 11 ? 1.982   2.237   -5.892  1.00 0.00 ? 11 LEU B HA   5  
ATOM 3608 H HB2  . LEU B 2 11 ? -0.727  2.204   -7.373  1.00 0.00 ? 11 LEU B HB2  5  
ATOM 3609 H HB3  . LEU B 2 11 ? -0.448  2.023   -5.664  1.00 0.00 ? 11 LEU B HB3  5  
ATOM 3610 H HG   . LEU B 2 11 ? 0.326   4.578   -7.146  1.00 0.00 ? 11 LEU B HG   5  
ATOM 3611 H HD11 . LEU B 2 11 ? -2.216  3.926   -5.614  1.00 0.00 ? 11 LEU B HD11 5  
ATOM 3612 H HD12 . LEU B 2 11 ? -1.770  5.500   -6.262  1.00 0.00 ? 11 LEU B HD12 5  
ATOM 3613 H HD13 . LEU B 2 11 ? -2.089  4.158   -7.346  1.00 0.00 ? 11 LEU B HD13 5  
ATOM 3614 H HD21 . LEU B 2 11 ? -0.141  3.986   -4.200  1.00 0.00 ? 11 LEU B HD21 5  
ATOM 3615 H HD22 . LEU B 2 11 ? 1.433   4.226   -4.943  1.00 0.00 ? 11 LEU B HD22 5  
ATOM 3616 H HD23 . LEU B 2 11 ? 0.278   5.546   -4.869  1.00 0.00 ? 11 LEU B HD23 5  
ATOM 3617 N N    . VAL B 2 12 ? 1.491   0.453   -8.530  1.00 0.00 ? 12 VAL B N    5  
ATOM 3618 C CA   . VAL B 2 12 ? 1.586   -0.894  -9.140  1.00 0.00 ? 12 VAL B CA   5  
ATOM 3619 C C    . VAL B 2 12 ? 3.055   -1.311  -9.092  1.00 0.00 ? 12 VAL B C    5  
ATOM 3620 O O    . VAL B 2 12 ? 3.353   -2.348  -8.525  1.00 0.00 ? 12 VAL B O    5  
ATOM 3621 C CB   . VAL B 2 12 ? 1.070   -0.790  -10.591 1.00 0.00 ? 12 VAL B CB   5  
ATOM 3622 C CG1  . VAL B 2 12 ? 1.406   -2.075  -11.393 1.00 0.00 ? 12 VAL B CG1  5  
ATOM 3623 C CG2  . VAL B 2 12 ? -0.459  -0.668  -10.548 1.00 0.00 ? 12 VAL B CG2  5  
ATOM 3624 H H    . VAL B 2 12 ? 1.434   1.222   -9.136  1.00 0.00 ? 12 VAL B H    5  
ATOM 3625 H HA   . VAL B 2 12 ? 0.996   -1.599  -8.571  1.00 0.00 ? 12 VAL B HA   5  
ATOM 3626 H HB   . VAL B 2 12 ? 1.491   0.079   -11.078 1.00 0.00 ? 12 VAL B HB   5  
ATOM 3627 H HG11 . VAL B 2 12 ? 2.476   -2.229  -11.423 1.00 0.00 ? 12 VAL B HG11 5  
ATOM 3628 H HG12 . VAL B 2 12 ? 0.945   -2.938  -10.933 1.00 0.00 ? 12 VAL B HG12 5  
ATOM 3629 H HG13 . VAL B 2 12 ? 1.046   -1.987  -12.409 1.00 0.00 ? 12 VAL B HG13 5  
ATOM 3630 H HG21 . VAL B 2 12 ? -0.886  -1.536  -10.068 1.00 0.00 ? 12 VAL B HG21 5  
ATOM 3631 H HG22 . VAL B 2 12 ? -0.754  0.212   -9.996  1.00 0.00 ? 12 VAL B HG22 5  
ATOM 3632 H HG23 . VAL B 2 12 ? -0.851  -0.587  -11.550 1.00 0.00 ? 12 VAL B HG23 5  
ATOM 3633 N N    . GLU B 2 13 ? 3.937   -0.517  -9.656  1.00 0.00 ? 13 GLU B N    5  
ATOM 3634 C CA   . GLU B 2 13 ? 5.377   -0.944  -9.609  1.00 0.00 ? 13 GLU B CA   5  
ATOM 3635 C C    . GLU B 2 13 ? 5.867   -1.090  -8.147  1.00 0.00 ? 13 GLU B C    5  
ATOM 3636 O O    . GLU B 2 13 ? 6.701   -1.927  -7.855  1.00 0.00 ? 13 GLU B O    5  
ATOM 3637 C CB   . GLU B 2 13 ? 6.248   0.097   -10.361 1.00 0.00 ? 13 GLU B CB   5  
ATOM 3638 C CG   . GLU B 2 13 ? 7.521   -0.603  -10.929 1.00 0.00 ? 13 GLU B CG   5  
ATOM 3639 C CD   . GLU B 2 13 ? 8.462   -1.064  -9.802  1.00 0.00 ? 13 GLU B CD   5  
ATOM 3640 O OE1  . GLU B 2 13 ? 8.854   -0.202  -9.031  1.00 0.00 ? 13 GLU B OE1  5  
ATOM 3641 O OE2  . GLU B 2 13 ? 8.738   -2.252  -9.766  1.00 0.00 ? 13 GLU B OE2  5  
ATOM 3642 H H    . GLU B 2 13 ? 3.664   0.331   -10.089 1.00 0.00 ? 13 GLU B H    5  
ATOM 3643 H HA   . GLU B 2 13 ? 5.480   -1.888  -10.114 1.00 0.00 ? 13 GLU B HA   5  
ATOM 3644 H HB2  . GLU B 2 13 ? 5.681   0.523   -11.173 1.00 0.00 ? 13 GLU B HB2  5  
ATOM 3645 H HB3  . GLU B 2 13 ? 6.591   0.880   -9.706  1.00 0.00 ? 13 GLU B HB3  5  
ATOM 3646 H HG2  . GLU B 2 13 ? 7.217   -1.460  -11.512 1.00 0.00 ? 13 GLU B HG2  5  
ATOM 3647 H HG3  . GLU B 2 13 ? 8.067   0.074   -11.570 1.00 0.00 ? 13 GLU B HG3  5  
ATOM 3648 N N    . ALA B 2 14 ? 5.320   -0.296  -7.262  1.00 0.00 ? 14 ALA B N    5  
ATOM 3649 C CA   . ALA B 2 14 ? 5.733   -0.355  -5.823  1.00 0.00 ? 14 ALA B CA   5  
ATOM 3650 C C    . ALA B 2 14 ? 5.128   -1.545  -5.076  1.00 0.00 ? 14 ALA B C    5  
ATOM 3651 O O    . ALA B 2 14 ? 5.844   -2.263  -4.414  1.00 0.00 ? 14 ALA B O    5  
ATOM 3652 C CB   . ALA B 2 14 ? 5.311   0.944   -5.110  1.00 0.00 ? 14 ALA B CB   5  
ATOM 3653 H H    . ALA B 2 14 ? 4.626   0.337   -7.542  1.00 0.00 ? 14 ALA B H    5  
ATOM 3654 H HA   . ALA B 2 14 ? 6.813   -0.432  -5.773  1.00 0.00 ? 14 ALA B HA   5  
ATOM 3655 H HB1  . ALA B 2 14 ? 4.237   1.072   -5.166  1.00 0.00 ? 14 ALA B HB1  5  
ATOM 3656 H HB2  . ALA B 2 14 ? 5.603   0.913   -4.070  1.00 0.00 ? 14 ALA B HB2  5  
ATOM 3657 H HB3  . ALA B 2 14 ? 5.791   1.799   -5.564  1.00 0.00 ? 14 ALA B HB3  5  
ATOM 3658 N N    . LEU B 2 15 ? 3.844   -1.753  -5.195  1.00 0.00 ? 15 LEU B N    5  
ATOM 3659 C CA   . LEU B 2 15 ? 3.212   -2.894  -4.479  1.00 0.00 ? 15 LEU B CA   5  
ATOM 3660 C C    . LEU B 2 15 ? 3.825   -4.182  -4.976  1.00 0.00 ? 15 LEU B C    5  
ATOM 3661 O O    . LEU B 2 15 ? 4.093   -5.070  -4.191  1.00 0.00 ? 15 LEU B O    5  
ATOM 3662 C CB   . LEU B 2 15 ? 1.656   -2.752  -4.731  1.00 0.00 ? 15 LEU B CB   5  
ATOM 3663 C CG   . LEU B 2 15 ? 0.748   -3.894  -4.196  1.00 0.00 ? 15 LEU B CG   5  
ATOM 3664 C CD1  . LEU B 2 15 ? -0.699  -3.522  -4.590  1.00 0.00 ? 15 LEU B CD1  5  
ATOM 3665 C CD2  . LEU B 2 15 ? 1.001   -5.275  -4.820  1.00 0.00 ? 15 LEU B CD2  5  
ATOM 3666 H H    . LEU B 2 15 ? 3.288   -1.185  -5.754  1.00 0.00 ? 15 LEU B H    5  
ATOM 3667 H HA   . LEU B 2 15 ? 3.462   -2.817  -3.442  1.00 0.00 ? 15 LEU B HA   5  
ATOM 3668 H HB2  . LEU B 2 15 ? 1.368   -1.886  -4.153  1.00 0.00 ? 15 LEU B HB2  5  
ATOM 3669 H HB3  . LEU B 2 15 ? 1.391   -2.521  -5.750  1.00 0.00 ? 15 LEU B HB3  5  
ATOM 3670 H HG   . LEU B 2 15 ? 0.838   -3.944  -3.117  1.00 0.00 ? 15 LEU B HG   5  
ATOM 3671 H HD11 . LEU B 2 15 ? -0.764  -3.390  -5.660  1.00 0.00 ? 15 LEU B HD11 5  
ATOM 3672 H HD12 . LEU B 2 15 ? -1.378  -4.314  -4.317  1.00 0.00 ? 15 LEU B HD12 5  
ATOM 3673 H HD13 . LEU B 2 15 ? -1.012  -2.607  -4.112  1.00 0.00 ? 15 LEU B HD13 5  
ATOM 3674 H HD21 . LEU B 2 15 ? 0.834   -5.257  -5.886  1.00 0.00 ? 15 LEU B HD21 5  
ATOM 3675 H HD22 . LEU B 2 15 ? 1.977   -5.672  -4.610  1.00 0.00 ? 15 LEU B HD22 5  
ATOM 3676 H HD23 . LEU B 2 15 ? 0.292   -5.948  -4.373  1.00 0.00 ? 15 LEU B HD23 5  
ATOM 3677 N N    . TYR B 2 16 ? 4.069   -4.250  -6.251  1.00 0.00 ? 16 TYR B N    5  
ATOM 3678 C CA   . TYR B 2 16 ? 4.661   -5.469  -6.838  1.00 0.00 ? 16 TYR B CA   5  
ATOM 3679 C C    . TYR B 2 16 ? 6.138   -5.633  -6.380  1.00 0.00 ? 16 TYR B C    5  
ATOM 3680 O O    . TYR B 2 16 ? 6.566   -6.757  -6.201  1.00 0.00 ? 16 TYR B O    5  
ATOM 3681 C CB   . TYR B 2 16 ? 4.525   -5.340  -8.373  1.00 0.00 ? 16 TYR B CB   5  
ATOM 3682 C CG   . TYR B 2 16 ? 3.062   -5.418  -8.903  1.00 0.00 ? 16 TYR B CG   5  
ATOM 3683 C CD1  . TYR B 2 16 ? 1.974   -4.795  -8.302  1.00 0.00 ? 16 TYR B CD1  5  
ATOM 3684 C CD2  . TYR B 2 16 ? 2.833   -6.148  -10.057 1.00 0.00 ? 16 TYR B CD2  5  
ATOM 3685 C CE1  . TYR B 2 16 ? 0.707   -4.899  -8.845  1.00 0.00 ? 16 TYR B CE1  5  
ATOM 3686 C CE2  . TYR B 2 16 ? 1.562   -6.253  -10.594 1.00 0.00 ? 16 TYR B CE2  5  
ATOM 3687 C CZ   . TYR B 2 16 ? 0.491   -5.632  -9.992  1.00 0.00 ? 16 TYR B CZ   5  
ATOM 3688 O OH   . TYR B 2 16 ? -0.773  -5.742  -10.533 1.00 0.00 ? 16 TYR B OH   5  
ATOM 3689 H H    . TYR B 2 16 ? 3.879   -3.504  -6.841  1.00 0.00 ? 16 TYR B H    5  
ATOM 3690 H HA   . TYR B 2 16 ? 4.090   -6.321  -6.503  1.00 0.00 ? 16 TYR B HA   5  
ATOM 3691 H HB2  . TYR B 2 16 ? 4.956   -4.425  -8.724  1.00 0.00 ? 16 TYR B HB2  5  
ATOM 3692 H HB3  . TYR B 2 16 ? 5.081   -6.134  -8.817  1.00 0.00 ? 16 TYR B HB3  5  
ATOM 3693 H HD1  . TYR B 2 16 ? 2.092   -4.208  -7.404  1.00 0.00 ? 16 TYR B HD1  5  
ATOM 3694 H HD2  . TYR B 2 16 ? 3.662   -6.647  -10.538 1.00 0.00 ? 16 TYR B HD2  5  
ATOM 3695 H HE1  . TYR B 2 16 ? -0.125  -4.407  -8.361  1.00 0.00 ? 16 TYR B HE1  5  
ATOM 3696 H HE2  . TYR B 2 16 ? 1.403   -6.826  -11.495 1.00 0.00 ? 16 TYR B HE2  5  
ATOM 3697 H HH   . TYR B 2 16 ? -1.434  -5.473  -9.891  1.00 0.00 ? 16 TYR B HH   5  
ATOM 3698 N N    . LEU B 2 17 ? 6.863   -4.544  -6.188  1.00 0.00 ? 17 LEU B N    5  
ATOM 3699 C CA   . LEU B 2 17 ? 8.303   -4.614  -5.748  1.00 0.00 ? 17 LEU B CA   5  
ATOM 3700 C C    . LEU B 2 17 ? 8.364   -5.056  -4.274  1.00 0.00 ? 17 LEU B C    5  
ATOM 3701 O O    . LEU B 2 17 ? 9.342   -5.644  -3.852  1.00 0.00 ? 17 LEU B O    5  
ATOM 3702 C CB   . LEU B 2 17 ? 8.949   -3.175  -5.987  1.00 0.00 ? 17 LEU B CB   5  
ATOM 3703 C CG   . LEU B 2 17 ? 10.442  -2.977  -5.509  1.00 0.00 ? 17 LEU B CG   5  
ATOM 3704 C CD1  . LEU B 2 17 ? 10.534  -2.708  -3.990  1.00 0.00 ? 17 LEU B CD1  5  
ATOM 3705 C CD2  . LEU B 2 17 ? 11.349  -4.171  -5.898  1.00 0.00 ? 17 LEU B CD2  5  
ATOM 3706 H H    . LEU B 2 17 ? 6.469   -3.658  -6.321  1.00 0.00 ? 17 LEU B H    5  
ATOM 3707 H HA   . LEU B 2 17 ? 8.813   -5.349  -6.350  1.00 0.00 ? 17 LEU B HA   5  
ATOM 3708 H HB2  . LEU B 2 17 ? 8.929   -2.980  -7.045  1.00 0.00 ? 17 LEU B HB2  5  
ATOM 3709 H HB3  . LEU B 2 17 ? 8.338   -2.423  -5.512  1.00 0.00 ? 17 LEU B HB3  5  
ATOM 3710 H HG   . LEU B 2 17 ? 10.835  -2.099  -6.002  1.00 0.00 ? 17 LEU B HG   5  
ATOM 3711 H HD11 . LEU B 2 17 ? 10.119  -3.507  -3.403  1.00 0.00 ? 17 LEU B HD11 5  
ATOM 3712 H HD12 . LEU B 2 17 ? 11.569  -2.576  -3.700  1.00 0.00 ? 17 LEU B HD12 5  
ATOM 3713 H HD13 . LEU B 2 17 ? 9.999   -1.802  -3.752  1.00 0.00 ? 17 LEU B HD13 5  
ATOM 3714 H HD21 . LEU B 2 17 ? 10.982  -5.092  -5.474  1.00 0.00 ? 17 LEU B HD21 5  
ATOM 3715 H HD22 . LEU B 2 17 ? 11.401  -4.270  -6.969  1.00 0.00 ? 17 LEU B HD22 5  
ATOM 3716 H HD23 . LEU B 2 17 ? 12.352  -4.005  -5.540  1.00 0.00 ? 17 LEU B HD23 5  
ATOM 3717 N N    . VAL B 2 18 ? 7.315   -4.770  -3.540  1.00 0.00 ? 18 VAL B N    5  
ATOM 3718 C CA   . VAL B 2 18 ? 7.282   -5.154  -2.097  1.00 0.00 ? 18 VAL B CA   5  
ATOM 3719 C C    . VAL B 2 18 ? 6.708   -6.569  -1.851  1.00 0.00 ? 18 VAL B C    5  
ATOM 3720 O O    . VAL B 2 18 ? 7.229   -7.305  -1.034  1.00 0.00 ? 18 VAL B O    5  
ATOM 3721 C CB   . VAL B 2 18 ? 6.439   -4.093  -1.359  1.00 0.00 ? 18 VAL B CB   5  
ATOM 3722 C CG1  . VAL B 2 18 ? 6.450   -4.409  0.144   1.00 0.00 ? 18 VAL B CG1  5  
ATOM 3723 C CG2  . VAL B 2 18 ? 7.071   -2.697  -1.555  1.00 0.00 ? 18 VAL B CG2  5  
ATOM 3724 H H    . VAL B 2 18 ? 6.547   -4.295  -3.929  1.00 0.00 ? 18 VAL B H    5  
ATOM 3725 H HA   . VAL B 2 18 ? 8.291   -5.116  -1.704  1.00 0.00 ? 18 VAL B HA   5  
ATOM 3726 H HB   . VAL B 2 18 ? 5.422   -4.091  -1.732  1.00 0.00 ? 18 VAL B HB   5  
ATOM 3727 H HG11 . VAL B 2 18 ? 7.463   -4.402  0.522   1.00 0.00 ? 18 VAL B HG11 5  
ATOM 3728 H HG12 . VAL B 2 18 ? 5.881   -3.666  0.669   1.00 0.00 ? 18 VAL B HG12 5  
ATOM 3729 H HG13 . VAL B 2 18 ? 6.008   -5.373  0.329   1.00 0.00 ? 18 VAL B HG13 5  
ATOM 3730 H HG21 . VAL B 2 18 ? 7.146   -2.469  -2.603  1.00 0.00 ? 18 VAL B HG21 5  
ATOM 3731 H HG22 . VAL B 2 18 ? 6.463   -1.943  -1.080  1.00 0.00 ? 18 VAL B HG22 5  
ATOM 3732 H HG23 . VAL B 2 18 ? 8.066   -2.672  -1.137  1.00 0.00 ? 18 VAL B HG23 5  
ATOM 3733 N N    . CYS B 2 19 ? 5.666   -6.908  -2.562  1.00 0.00 ? 19 CYS B N    5  
ATOM 3734 C CA   . CYS B 2 19 ? 5.019   -8.244  -2.411  1.00 0.00 ? 19 CYS B CA   5  
ATOM 3735 C C    . CYS B 2 19 ? 5.801   -9.420  -3.011  1.00 0.00 ? 19 CYS B C    5  
ATOM 3736 O O    . CYS B 2 19 ? 5.929   -10.444 -2.364  1.00 0.00 ? 19 CYS B O    5  
ATOM 3737 C CB   . CYS B 2 19 ? 3.624   -8.180  -3.060  1.00 0.00 ? 19 CYS B CB   5  
ATOM 3738 S SG   . CYS B 2 19 ? 2.265   -7.824  -1.926  1.00 0.00 ? 19 CYS B SG   5  
ATOM 3739 H H    . CYS B 2 19 ? 5.286   -6.289  -3.213  1.00 0.00 ? 19 CYS B H    5  
ATOM 3740 H HA   . CYS B 2 19 ? 4.853   -8.448  -1.353  1.00 0.00 ? 19 CYS B HA   5  
ATOM 3741 H HB2  . CYS B 2 19 ? 3.580   -7.412  -3.811  1.00 0.00 ? 19 CYS B HB2  5  
ATOM 3742 H HB3  . CYS B 2 19 ? 3.403   -9.125  -3.531  1.00 0.00 ? 19 CYS B HB3  5  
ATOM 3743 N N    . GLY B 2 20 ? 6.300   -9.255  -4.212  1.00 0.00 ? 20 GLY B N    5  
ATOM 3744 C CA   . GLY B 2 20 ? 7.057   -10.370 -4.860  1.00 0.00 ? 20 GLY B CA   5  
ATOM 3745 C C    . GLY B 2 20 ? 6.008   -11.275 -5.533  1.00 0.00 ? 20 GLY B C    5  
ATOM 3746 O O    . GLY B 2 20 ? 6.260   -12.438 -5.785  1.00 0.00 ? 20 GLY B O    5  
ATOM 3747 H H    . GLY B 2 20 ? 6.198   -8.411  -4.697  1.00 0.00 ? 20 GLY B H    5  
ATOM 3748 H HA2  . GLY B 2 20 ? 7.741   -9.983  -5.602  1.00 0.00 ? 20 GLY B HA2  5  
ATOM 3749 H HA3  . GLY B 2 20 ? 7.598   -10.935 -4.117  1.00 0.00 ? 20 GLY B HA3  5  
ATOM 3750 N N    . GLU B 2 21 ? 4.863   -10.682 -5.791  1.00 0.00 ? 21 GLU B N    5  
ATOM 3751 C CA   . GLU B 2 21 ? 3.697   -11.362 -6.439  1.00 0.00 ? 21 GLU B CA   5  
ATOM 3752 C C    . GLU B 2 21 ? 3.213   -12.555 -5.602  1.00 0.00 ? 21 GLU B C    5  
ATOM 3753 O O    . GLU B 2 21 ? 3.137   -13.685 -6.047  1.00 0.00 ? 21 GLU B O    5  
ATOM 3754 C CB   . GLU B 2 21 ? 4.114   -11.788 -7.894  1.00 0.00 ? 21 GLU B CB   5  
ATOM 3755 C CG   . GLU B 2 21 ? 4.285   -10.524 -8.797  1.00 0.00 ? 21 GLU B CG   5  
ATOM 3756 C CD   . GLU B 2 21 ? 5.309   -9.534  -8.199  1.00 0.00 ? 21 GLU B CD   5  
ATOM 3757 O OE1  . GLU B 2 21 ? 6.482   -9.875  -8.213  1.00 0.00 ? 21 GLU B OE1  5  
ATOM 3758 O OE2  . GLU B 2 21 ? 4.854   -8.494  -7.753  1.00 0.00 ? 21 GLU B OE2  5  
ATOM 3759 H H    . GLU B 2 21 ? 4.757   -9.739  -5.548  1.00 0.00 ? 21 GLU B H    5  
ATOM 3760 H HA   . GLU B 2 21 ? 2.884   -10.659 -6.495  1.00 0.00 ? 21 GLU B HA   5  
ATOM 3761 H HB2  . GLU B 2 21 ? 5.036   -12.349 -7.877  1.00 0.00 ? 21 GLU B HB2  5  
ATOM 3762 H HB3  . GLU B 2 21 ? 3.343   -12.413 -8.316  1.00 0.00 ? 21 GLU B HB3  5  
ATOM 3763 H HG2  . GLU B 2 21 ? 4.636   -10.834 -9.768  1.00 0.00 ? 21 GLU B HG2  5  
ATOM 3764 H HG3  . GLU B 2 21 ? 3.331   -10.031 -8.930  1.00 0.00 ? 21 GLU B HG3  5  
ATOM 3765 N N    . ARG B 2 22 ? 2.904   -12.197 -4.382  1.00 0.00 ? 22 ARG B N    5  
ATOM 3766 C CA   . ARG B 2 22 ? 2.394   -13.151 -3.348  1.00 0.00 ? 22 ARG B CA   5  
ATOM 3767 C C    . ARG B 2 22 ? 1.000   -12.602 -3.002  1.00 0.00 ? 22 ARG B C    5  
ATOM 3768 O O    . ARG B 2 22 ? 0.844   -11.408 -2.821  1.00 0.00 ? 22 ARG B O    5  
ATOM 3769 C CB   . ARG B 2 22 ? 3.306   -13.123 -2.086  1.00 0.00 ? 22 ARG B CB   5  
ATOM 3770 C CG   . ARG B 2 22 ? 2.753   -14.069 -0.976  1.00 0.00 ? 22 ARG B CG   5  
ATOM 3771 C CD   . ARG B 2 22 ? 3.526   -13.857 0.355   1.00 0.00 ? 22 ARG B CD   5  
ATOM 3772 N NE   . ARG B 2 22 ? 2.724   -14.460 1.467   1.00 0.00 ? 22 ARG B NE   5  
ATOM 3773 C CZ   . ARG B 2 22 ? 3.242   -15.325 2.296   1.00 0.00 ? 22 ARG B CZ   5  
ATOM 3774 N NH1  . ARG B 2 22 ? 4.040   -14.877 3.225   1.00 0.00 ? 22 ARG B NH1  5  
ATOM 3775 N NH2  . ARG B 2 22 ? 2.947   -16.590 2.173   1.00 0.00 ? 22 ARG B NH2  5  
ATOM 3776 H H    . ARG B 2 22 ? 3.012   -11.256 -4.135  1.00 0.00 ? 22 ARG B H    5  
ATOM 3777 H HA   . ARG B 2 22 ? 2.303   -14.144 -3.766  1.00 0.00 ? 22 ARG B HA   5  
ATOM 3778 H HB2  . ARG B 2 22 ? 4.315   -13.406 -2.352  1.00 0.00 ? 22 ARG B HB2  5  
ATOM 3779 H HB3  . ARG B 2 22 ? 3.320   -12.114 -1.701  1.00 0.00 ? 22 ARG B HB3  5  
ATOM 3780 H HG2  . ARG B 2 22 ? 1.707   -13.863 -0.812  1.00 0.00 ? 22 ARG B HG2  5  
ATOM 3781 H HG3  . ARG B 2 22 ? 2.850   -15.097 -1.300  1.00 0.00 ? 22 ARG B HG3  5  
ATOM 3782 H HD2  . ARG B 2 22 ? 4.504   -14.314 0.318   1.00 0.00 ? 22 ARG B HD2  5  
ATOM 3783 H HD3  . ARG B 2 22 ? 3.634   -12.803 0.565   1.00 0.00 ? 22 ARG B HD3  5  
ATOM 3784 H HE   . ARG B 2 22 ? 1.786   -14.191 1.579   1.00 0.00 ? 22 ARG B HE   5  
ATOM 3785 H HH11 . ARG B 2 22 ? 4.235   -13.898 3.270   1.00 0.00 ? 22 ARG B HH11 5  
ATOM 3786 H HH12 . ARG B 2 22 ? 4.453   -15.501 3.889   1.00 0.00 ? 22 ARG B HH12 5  
ATOM 3787 H HH21 . ARG B 2 22 ? 2.328   -16.893 1.448   1.00 0.00 ? 22 ARG B HH21 5  
ATOM 3788 H HH22 . ARG B 2 22 ? 3.341   -17.258 2.807   1.00 0.00 ? 22 ARG B HH22 5  
ATOM 3789 N N    . GLY B 2 23 ? 0.058   -13.505 -2.922  1.00 0.00 ? 23 GLY B N    5  
ATOM 3790 C CA   . GLY B 2 23 ? -1.383  -13.213 -2.595  1.00 0.00 ? 23 GLY B CA   5  
ATOM 3791 C C    . GLY B 2 23 ? -1.822  -11.738 -2.331  1.00 0.00 ? 23 GLY B C    5  
ATOM 3792 O O    . GLY B 2 23 ? -2.228  -11.484 -1.215  1.00 0.00 ? 23 GLY B O    5  
ATOM 3793 H H    . GLY B 2 23 ? 0.311   -14.435 -3.086  1.00 0.00 ? 23 GLY B H    5  
ATOM 3794 H HA2  . GLY B 2 23 ? -2.026  -13.688 -3.327  1.00 0.00 ? 23 GLY B HA2  5  
ATOM 3795 H HA3  . GLY B 2 23 ? -1.570  -13.742 -1.673  1.00 0.00 ? 23 GLY B HA3  5  
ATOM 3796 N N    . PHE B 2 24 ? -1.755  -10.807 -3.268  1.00 0.00 ? 24 PHE B N    5  
ATOM 3797 C CA   . PHE B 2 24 ? -2.187  -9.405  -2.982  1.00 0.00 ? 24 PHE B CA   5  
ATOM 3798 C C    . PHE B 2 24 ? -3.432  -9.153  -3.894  1.00 0.00 ? 24 PHE B C    5  
ATOM 3799 O O    . PHE B 2 24 ? -3.878  -10.088 -4.530  1.00 0.00 ? 24 PHE B O    5  
ATOM 3800 C CB   . PHE B 2 24 ? -0.885  -8.509  -3.261  1.00 0.00 ? 24 PHE B CB   5  
ATOM 3801 C CG   . PHE B 2 24 ? -0.460  -8.288  -4.739  1.00 0.00 ? 24 PHE B CG   5  
ATOM 3802 C CD1  . PHE B 2 24 ? -1.309  -7.713  -5.670  1.00 0.00 ? 24 PHE B CD1  5  
ATOM 3803 C CD2  . PHE B 2 24 ? 0.813   -8.644  -5.148  1.00 0.00 ? 24 PHE B CD2  5  
ATOM 3804 C CE1  . PHE B 2 24 ? -0.898  -7.497  -6.970  1.00 0.00 ? 24 PHE B CE1  5  
ATOM 3805 C CE2  . PHE B 2 24 ? 1.224   -8.429  -6.446  1.00 0.00 ? 24 PHE B CE2  5  
ATOM 3806 C CZ   . PHE B 2 24 ? 0.370   -7.857  -7.358  1.00 0.00 ? 24 PHE B CZ   5  
ATOM 3807 H H    . PHE B 2 24 ? -1.432  -10.956 -4.177  1.00 0.00 ? 24 PHE B H    5  
ATOM 3808 H HA   . PHE B 2 24 ? -2.473  -9.355  -1.937  1.00 0.00 ? 24 PHE B HA   5  
ATOM 3809 H HB2  . PHE B 2 24 ? -0.874  -7.560  -2.739  1.00 0.00 ? 24 PHE B HB2  5  
ATOM 3810 H HB3  . PHE B 2 24 ? -0.083  -9.069  -2.791  1.00 0.00 ? 24 PHE B HB3  5  
ATOM 3811 H HD1  . PHE B 2 24 ? -2.298  -7.418  -5.382  1.00 0.00 ? 24 PHE B HD1  5  
ATOM 3812 H HD2  . PHE B 2 24 ? 1.498   -9.091  -4.443  1.00 0.00 ? 24 PHE B HD2  5  
ATOM 3813 H HE1  . PHE B 2 24 ? -1.575  -7.040  -7.676  1.00 0.00 ? 24 PHE B HE1  5  
ATOM 3814 H HE2  . PHE B 2 24 ? 2.220   -8.709  -6.747  1.00 0.00 ? 24 PHE B HE2  5  
ATOM 3815 H HZ   . PHE B 2 24 ? 0.705   -7.696  -8.372  1.00 0.00 ? 24 PHE B HZ   5  
ATOM 3816 N N    . PHE B 2 25 ? -3.977  -7.959  -3.973  1.00 0.00 ? 25 PHE B N    5  
ATOM 3817 C CA   . PHE B 2 25 ? -5.170  -7.662  -4.817  1.00 0.00 ? 25 PHE B CA   5  
ATOM 3818 C C    . PHE B 2 25 ? -4.839  -6.464  -5.738  1.00 0.00 ? 25 PHE B C    5  
ATOM 3819 O O    . PHE B 2 25 ? -3.932  -5.716  -5.430  1.00 0.00 ? 25 PHE B O    5  
ATOM 3820 C CB   . PHE B 2 25 ? -6.338  -7.348  -3.826  1.00 0.00 ? 25 PHE B CB   5  
ATOM 3821 C CG   . PHE B 2 25 ? -6.090  -5.953  -3.199  1.00 0.00 ? 25 PHE B CG   5  
ATOM 3822 C CD1  . PHE B 2 25 ? -6.545  -4.811  -3.844  1.00 0.00 ? 25 PHE B CD1  5  
ATOM 3823 C CD2  . PHE B 2 25 ? -5.397  -5.820  -2.006  1.00 0.00 ? 25 PHE B CD2  5  
ATOM 3824 C CE1  . PHE B 2 25 ? -6.309  -3.567  -3.309  1.00 0.00 ? 25 PHE B CE1  5  
ATOM 3825 C CE2  . PHE B 2 25 ? -5.161  -4.571  -1.479  1.00 0.00 ? 25 PHE B CE2  5  
ATOM 3826 C CZ   . PHE B 2 25 ? -5.619  -3.447  -2.132  1.00 0.00 ? 25 PHE B CZ   5  
ATOM 3827 H H    . PHE B 2 25 ? -3.632  -7.195  -3.494  1.00 0.00 ? 25 PHE B H    5  
ATOM 3828 H HA   . PHE B 2 25 ? -5.430  -8.514  -5.428  1.00 0.00 ? 25 PHE B HA   5  
ATOM 3829 H HB2  . PHE B 2 25 ? -7.330  -7.391  -4.247  1.00 0.00 ? 25 PHE B HB2  5  
ATOM 3830 H HB3  . PHE B 2 25 ? -6.294  -8.078  -3.031  1.00 0.00 ? 25 PHE B HB3  5  
ATOM 3831 H HD1  . PHE B 2 25 ? -7.095  -4.887  -4.770  1.00 0.00 ? 25 PHE B HD1  5  
ATOM 3832 H HD2  . PHE B 2 25 ? -5.037  -6.697  -1.483  1.00 0.00 ? 25 PHE B HD2  5  
ATOM 3833 H HE1  . PHE B 2 25 ? -6.659  -2.682  -3.822  1.00 0.00 ? 25 PHE B HE1  5  
ATOM 3834 H HE2  . PHE B 2 25 ? -4.616  -4.472  -0.552  1.00 0.00 ? 25 PHE B HE2  5  
ATOM 3835 H HZ   . PHE B 2 25 ? -5.436  -2.469  -1.718  1.00 0.00 ? 25 PHE B HZ   5  
ATOM 3836 N N    . TYR B 2 26 ? -5.590  -6.346  -6.814  1.00 0.00 ? 26 TYR B N    5  
ATOM 3837 C CA   . TYR B 2 26 ? -5.491  -5.273  -7.871  1.00 0.00 ? 26 TYR B CA   5  
ATOM 3838 C C    . TYR B 2 26 ? -5.123  -5.988  -9.188  1.00 0.00 ? 26 TYR B C    5  
ATOM 3839 O O    . TYR B 2 26 ? -4.052  -5.803  -9.737  1.00 0.00 ? 26 TYR B O    5  
ATOM 3840 C CB   . TYR B 2 26 ? -4.383  -4.207  -7.545  1.00 0.00 ? 26 TYR B CB   5  
ATOM 3841 C CG   . TYR B 2 26 ? -4.461  -3.038  -8.550  1.00 0.00 ? 26 TYR B CG   5  
ATOM 3842 C CD1  . TYR B 2 26 ? -5.504  -2.130  -8.495  1.00 0.00 ? 26 TYR B CD1  5  
ATOM 3843 C CD2  . TYR B 2 26 ? -3.486  -2.876  -9.513  1.00 0.00 ? 26 TYR B CD2  5  
ATOM 3844 C CE1  . TYR B 2 26 ? -5.565  -1.081  -9.388  1.00 0.00 ? 26 TYR B CE1  5  
ATOM 3845 C CE2  . TYR B 2 26 ? -3.551  -1.827  -10.403 1.00 0.00 ? 26 TYR B CE2  5  
ATOM 3846 C CZ   . TYR B 2 26 ? -4.585  -0.924  -10.349 1.00 0.00 ? 26 TYR B CZ   5  
ATOM 3847 O OH   . TYR B 2 26 ? -4.628  0.121   -11.247 1.00 0.00 ? 26 TYR B OH   5  
ATOM 3848 H H    . TYR B 2 26 ? -6.278  -7.025  -6.947  1.00 0.00 ? 26 TYR B H    5  
ATOM 3849 H HA   . TYR B 2 26 ? -6.461  -4.805  -7.984  1.00 0.00 ? 26 TYR B HA   5  
ATOM 3850 H HB2  . TYR B 2 26 ? -4.517  -3.798  -6.554  1.00 0.00 ? 26 TYR B HB2  5  
ATOM 3851 H HB3  . TYR B 2 26 ? -3.403  -4.654  -7.605  1.00 0.00 ? 26 TYR B HB3  5  
ATOM 3852 H HD1  . TYR B 2 26 ? -6.287  -2.238  -7.756  1.00 0.00 ? 26 TYR B HD1  5  
ATOM 3853 H HD2  . TYR B 2 26 ? -2.661  -3.576  -9.570  1.00 0.00 ? 26 TYR B HD2  5  
ATOM 3854 H HE1  . TYR B 2 26 ? -6.383  -0.383  -9.331  1.00 0.00 ? 26 TYR B HE1  5  
ATOM 3855 H HE2  . TYR B 2 26 ? -2.789  -1.717  -11.156 1.00 0.00 ? 26 TYR B HE2  5  
ATOM 3856 H HH   . TYR B 2 26 ? -5.542  0.270   -11.500 1.00 0.00 ? 26 TYR B HH   5  
ATOM 3857 N N    . THR B 2 27 ? -6.053  -6.792  -9.641  1.00 0.00 ? 27 THR B N    5  
ATOM 3858 C CA   . THR B 2 27 ? -5.862  -7.574  -10.904 1.00 0.00 ? 27 THR B CA   5  
ATOM 3859 C C    . THR B 2 27 ? -6.947  -7.228  -11.971 1.00 0.00 ? 27 THR B C    5  
ATOM 3860 O O    . THR B 2 27 ? -7.548  -8.147  -12.498 1.00 0.00 ? 27 THR B O    5  
ATOM 3861 C CB   . THR B 2 27 ? -5.905  -9.079  -10.517 1.00 0.00 ? 27 THR B CB   5  
ATOM 3862 O OG1  . THR B 2 27 ? -7.215  -9.279  -10.005 1.00 0.00 ? 27 THR B OG1  5  
ATOM 3863 C CG2  . THR B 2 27 ? -4.999  -9.360  -9.308  1.00 0.00 ? 27 THR B CG2  5  
ATOM 3864 H H    . THR B 2 27 ? -6.891  -6.889  -9.141  1.00 0.00 ? 27 THR B H    5  
ATOM 3865 H HA   . THR B 2 27 ? -4.875  -7.429  -11.306 1.00 0.00 ? 27 THR B HA   5  
ATOM 3866 H HB   . THR B 2 27 ? -5.715  -9.750  -11.346 1.00 0.00 ? 27 THR B HB   5  
ATOM 3867 H HG1  . THR B 2 27 ? -7.693  -9.836  -10.623 1.00 0.00 ? 27 THR B HG1  5  
ATOM 3868 H HG21 . THR B 2 27 ? -3.984  -9.071  -9.538  1.00 0.00 ? 27 THR B HG21 5  
ATOM 3869 H HG22 . THR B 2 27 ? -5.334  -8.810  -8.441  1.00 0.00 ? 27 THR B HG22 5  
ATOM 3870 H HG23 . THR B 2 27 ? -5.018  -10.412 -9.071  1.00 0.00 ? 27 THR B HG23 5  
ATOM 3871 N N    . PRO B 2 28 ? -7.180  -5.965  -12.289 1.00 0.00 ? 28 PRO B N    5  
ATOM 3872 C CA   . PRO B 2 28 ? -8.414  -5.499  -12.983 1.00 0.00 ? 28 PRO B CA   5  
ATOM 3873 C C    . PRO B 2 28 ? -9.271  -6.519  -13.765 1.00 0.00 ? 28 PRO B C    5  
ATOM 3874 O O    . PRO B 2 28 ? -8.932  -6.884  -14.873 1.00 0.00 ? 28 PRO B O    5  
ATOM 3875 C CB   . PRO B 2 28 ? -7.881  -4.357  -13.834 1.00 0.00 ? 28 PRO B CB   5  
ATOM 3876 C CG   . PRO B 2 28 ? -6.916  -3.637  -12.874 1.00 0.00 ? 28 PRO B CG   5  
ATOM 3877 C CD   . PRO B 2 28 ? -6.260  -4.785  -12.061 1.00 0.00 ? 28 PRO B CD   5  
ATOM 3878 H HA   . PRO B 2 28 ? -9.062  -5.050  -12.238 1.00 0.00 ? 28 PRO B HA   5  
ATOM 3879 H HB2  . PRO B 2 28 ? -7.375  -4.709  -14.726 1.00 0.00 ? 28 PRO B HB2  5  
ATOM 3880 H HB3  . PRO B 2 28 ? -8.680  -3.693  -14.108 1.00 0.00 ? 28 PRO B HB3  5  
ATOM 3881 H HG2  . PRO B 2 28 ? -6.157  -3.107  -13.440 1.00 0.00 ? 28 PRO B HG2  5  
ATOM 3882 H HG3  . PRO B 2 28 ? -7.431  -2.944  -12.229 1.00 0.00 ? 28 PRO B HG3  5  
ATOM 3883 H HD2  . PRO B 2 28 ? -5.292  -4.893  -12.530 1.00 0.00 ? 28 PRO B HD2  5  
ATOM 3884 H HD3  . PRO B 2 28 ? -6.188  -4.544  -11.005 1.00 0.00 ? 28 PRO B HD3  5  
ATOM 3885 N N    . LYS B 2 29 ? -10.349 -6.943  -13.148 1.00 0.00 ? 29 LYS B N    5  
ATOM 3886 C CA   . LYS B 2 29 ? -11.292 -7.933  -13.766 1.00 0.00 ? 29 LYS B CA   5  
ATOM 3887 C C    . LYS B 2 29 ? -12.372 -7.052  -14.405 1.00 0.00 ? 29 LYS B C    5  
ATOM 3888 O O    . LYS B 2 29 ? -13.109 -6.363  -13.724 1.00 0.00 ? 29 LYS B O    5  
ATOM 3889 C CB   . LYS B 2 29 ? -11.878 -8.851  -12.646 1.00 0.00 ? 29 LYS B CB   5  
ATOM 3890 C CG   . LYS B 2 29 ? -13.064 -9.708  -13.187 1.00 0.00 ? 29 LYS B CG   5  
ATOM 3891 C CD   . LYS B 2 29 ? -13.650 -10.682 -12.100 1.00 0.00 ? 29 LYS B CD   5  
ATOM 3892 C CE   . LYS B 2 29 ? -14.828 -11.474 -12.737 1.00 0.00 ? 29 LYS B CE   5  
ATOM 3893 N NZ   . LYS B 2 29 ? -15.247 -12.648 -11.910 1.00 0.00 ? 29 LYS B NZ   5  
ATOM 3894 H H    . LYS B 2 29 ? -10.547 -6.602  -12.254 1.00 0.00 ? 29 LYS B H    5  
ATOM 3895 H HA   . LYS B 2 29 ? -10.786 -8.506  -14.535 1.00 0.00 ? 29 LYS B HA   5  
ATOM 3896 H HB2  . LYS B 2 29 ? -11.096 -9.518  -12.321 1.00 0.00 ? 29 LYS B HB2  5  
ATOM 3897 H HB3  . LYS B 2 29 ? -12.197 -8.244  -11.813 1.00 0.00 ? 29 LYS B HB3  5  
ATOM 3898 H HG2  . LYS B 2 29 ? -13.839 -9.045  -13.547 1.00 0.00 ? 29 LYS B HG2  5  
ATOM 3899 H HG3  . LYS B 2 29 ? -12.698 -10.294 -14.019 1.00 0.00 ? 29 LYS B HG3  5  
ATOM 3900 H HD2  . LYS B 2 29 ? -12.894 -11.371 -11.750 1.00 0.00 ? 29 LYS B HD2  5  
ATOM 3901 H HD3  . LYS B 2 29 ? -14.028 -10.119 -11.255 1.00 0.00 ? 29 LYS B HD3  5  
ATOM 3902 H HE2  . LYS B 2 29 ? -15.688 -10.824 -12.838 1.00 0.00 ? 29 LYS B HE2  5  
ATOM 3903 H HE3  . LYS B 2 29 ? -14.546 -11.833 -13.712 1.00 0.00 ? 29 LYS B HE3  5  
ATOM 3904 H HZ1  . LYS B 2 29 ? -14.670 -12.725 -11.045 1.00 0.00 ? 29 LYS B HZ1  5  
ATOM 3905 H HZ2  . LYS B 2 29 ? -16.250 -12.558 -11.647 1.00 0.00 ? 29 LYS B HZ2  5  
ATOM 3906 H HZ3  . LYS B 2 29 ? -15.138 -13.516 -12.471 1.00 0.00 ? 29 LYS B HZ3  5  
ATOM 3907 N N    . THR B 2 30 ? -12.412 -7.112  -15.709 1.00 0.00 ? 30 THR B N    5  
ATOM 3908 C CA   . THR B 2 30 ? -13.396 -6.313  -16.499 1.00 0.00 ? 30 THR B CA   5  
ATOM 3909 C C    . THR B 2 30 ? -14.334 -7.213  -17.312 1.00 0.00 ? 30 THR B C    5  
ATOM 3910 O O    . THR B 2 30 ? -14.363 -8.422  -17.189 1.00 0.00 ? 30 THR B O    5  
ATOM 3911 C CB   . THR B 2 30 ? -12.569 -5.368  -17.407 1.00 0.00 ? 30 THR B CB   5  
ATOM 3912 O OG1  . THR B 2 30 ? -11.728 -4.660  -16.501 1.00 0.00 ? 30 THR B OG1  5  
ATOM 3913 C CG2  . THR B 2 30 ? -13.416 -4.268  -18.077 1.00 0.00 ? 30 THR B CG2  5  
ATOM 3914 H H    . THR B 2 30 ? -11.782 -7.699  -16.180 1.00 0.00 ? 30 THR B H    5  
ATOM 3915 H HA   . THR B 2 30 ? -14.003 -5.728  -15.823 1.00 0.00 ? 30 THR B HA   5  
ATOM 3916 H HB   . THR B 2 30 ? -11.967 -5.907  -18.128 1.00 0.00 ? 30 THR B HB   5  
ATOM 3917 H HG1  . THR B 2 30 ? -11.947 -3.724  -16.529 1.00 0.00 ? 30 THR B HG1  5  
ATOM 3918 H HG21 . THR B 2 30 ? -13.887 -3.636  -17.334 1.00 0.00 ? 30 THR B HG21 5  
ATOM 3919 H HG22 . THR B 2 30 ? -12.773 -3.647  -18.683 1.00 0.00 ? 30 THR B HG22 5  
ATOM 3920 H HG23 . THR B 2 30 ? -14.173 -4.701  -18.714 1.00 0.00 ? 30 THR B HG23 5  
ATOM 3921 N N    . GLY A 1 1  ? -7.662  4.707   1.474   1.00 0.00 ? 1  GLY A N    6  
ATOM 3922 C CA   . GLY A 1 1  ? -7.438  3.528   2.363   1.00 0.00 ? 1  GLY A CA   6  
ATOM 3923 C C    . GLY A 1 1  ? -6.256  2.685   1.862   1.00 0.00 ? 1  GLY A C    6  
ATOM 3924 O O    . GLY A 1 1  ? -5.233  2.603   2.512   1.00 0.00 ? 1  GLY A O    6  
ATOM 3925 H H1   . GLY A 1 1  ? -6.990  4.730   0.684   1.00 0.00 ? 1  GLY A H1   6  
ATOM 3926 H H2   . GLY A 1 1  ? -8.631  4.688   1.100   1.00 0.00 ? 1  GLY A H2   6  
ATOM 3927 H H3   . GLY A 1 1  ? -7.512  5.575   2.021   1.00 0.00 ? 1  GLY A H3   6  
ATOM 3928 H HA2  . GLY A 1 1  ? -7.235  3.877   3.364   1.00 0.00 ? 1  GLY A HA2  6  
ATOM 3929 H HA3  . GLY A 1 1  ? -8.327  2.914   2.372   1.00 0.00 ? 1  GLY A HA3  6  
ATOM 3930 N N    . ILE A 1 2  ? -6.450  2.086   0.714   1.00 0.00 ? 2  ILE A N    6  
ATOM 3931 C CA   . ILE A 1 2  ? -5.418  1.224   0.056   1.00 0.00 ? 2  ILE A CA   6  
ATOM 3932 C C    . ILE A 1 2  ? -4.956  2.094   -1.136  1.00 0.00 ? 2  ILE A C    6  
ATOM 3933 O O    . ILE A 1 2  ? -5.295  3.266   -1.204  1.00 0.00 ? 2  ILE A O    6  
ATOM 3934 C CB   . ILE A 1 2  ? -6.090  -0.138  -0.392  1.00 0.00 ? 2  ILE A CB   6  
ATOM 3935 C CG1  . ILE A 1 2  ? -6.984  -0.761  0.755   1.00 0.00 ? 2  ILE A CG1  6  
ATOM 3936 C CG2  . ILE A 1 2  ? -5.028  -1.228  -0.634  1.00 0.00 ? 2  ILE A CG2  6  
ATOM 3937 C CD1  . ILE A 1 2  ? -8.402  -0.154  0.867   1.00 0.00 ? 2  ILE A CD1  6  
ATOM 3938 H H    . ILE A 1 2  ? -7.308  2.207   0.256   1.00 0.00 ? 2  ILE A H    6  
ATOM 3939 H HA   . ILE A 1 2  ? -4.577  1.045   0.709   1.00 0.00 ? 2  ILE A HA   6  
ATOM 3940 H HB   . ILE A 1 2  ? -6.620  0.010   -1.319  1.00 0.00 ? 2  ILE A HB   6  
ATOM 3941 H HG12 . ILE A 1 2  ? -7.081  -1.831  0.612   1.00 0.00 ? 2  ILE A HG12 6  
ATOM 3942 H HG13 . ILE A 1 2  ? -6.466  -0.614  1.692   1.00 0.00 ? 2  ILE A HG13 6  
ATOM 3943 H HG21 . ILE A 1 2  ? -4.329  -0.970  -1.412  1.00 0.00 ? 2  ILE A HG21 6  
ATOM 3944 H HG22 . ILE A 1 2  ? -4.483  -1.416  0.276   1.00 0.00 ? 2  ILE A HG22 6  
ATOM 3945 H HG23 . ILE A 1 2  ? -5.533  -2.135  -0.925  1.00 0.00 ? 2  ILE A HG23 6  
ATOM 3946 H HD11 . ILE A 1 2  ? -8.399  0.898   1.079   1.00 0.00 ? 2  ILE A HD11 6  
ATOM 3947 H HD12 . ILE A 1 2  ? -8.952  -0.318  -0.047  1.00 0.00 ? 2  ILE A HD12 6  
ATOM 3948 H HD13 . ILE A 1 2  ? -8.921  -0.654  1.670   1.00 0.00 ? 2  ILE A HD13 6  
ATOM 3949 N N    . VAL A 1 3  ? -4.215  1.510   -2.035  1.00 0.00 ? 3  VAL A N    6  
ATOM 3950 C CA   . VAL A 1 3  ? -3.715  2.268   -3.231  1.00 0.00 ? 3  VAL A CA   6  
ATOM 3951 C C    . VAL A 1 3  ? -4.443  1.863   -4.495  1.00 0.00 ? 3  VAL A C    6  
ATOM 3952 O O    . VAL A 1 3  ? -5.402  1.123   -4.428  1.00 0.00 ? 3  VAL A O    6  
ATOM 3953 C CB   . VAL A 1 3  ? -2.201  2.016   -3.443  1.00 0.00 ? 3  VAL A CB   6  
ATOM 3954 C CG1  . VAL A 1 3  ? -1.449  2.729   -2.363  1.00 0.00 ? 3  VAL A CG1  6  
ATOM 3955 C CG2  . VAL A 1 3  ? -1.853  0.512   -3.438  1.00 0.00 ? 3  VAL A CG2  6  
ATOM 3956 H H    . VAL A 1 3  ? -3.993  0.568   -1.913  1.00 0.00 ? 3  VAL A H    6  
ATOM 3957 H HA   . VAL A 1 3  ? -3.880  3.328   -3.078  1.00 0.00 ? 3  VAL A HA   6  
ATOM 3958 H HB   . VAL A 1 3  ? -1.862  2.436   -4.377  1.00 0.00 ? 3  VAL A HB   6  
ATOM 3959 H HG11 . VAL A 1 3  ? -1.731  2.367   -1.384  1.00 0.00 ? 3  VAL A HG11 6  
ATOM 3960 H HG12 . VAL A 1 3  ? -0.390  2.572   -2.483  1.00 0.00 ? 3  VAL A HG12 6  
ATOM 3961 H HG13 . VAL A 1 3  ? -1.633  3.795   -2.414  1.00 0.00 ? 3  VAL A HG13 6  
ATOM 3962 H HG21 . VAL A 1 3  ? -2.141  0.047   -2.510  1.00 0.00 ? 3  VAL A HG21 6  
ATOM 3963 H HG22 . VAL A 1 3  ? -2.379  0.014   -4.234  1.00 0.00 ? 3  VAL A HG22 6  
ATOM 3964 H HG23 . VAL A 1 3  ? -0.792  0.386   -3.589  1.00 0.00 ? 3  VAL A HG23 6  
ATOM 3965 N N    . GLU A 1 4  ? -3.906  2.412   -5.563  1.00 0.00 ? 4  GLU A N    6  
ATOM 3966 C CA   . GLU A 1 4  ? -4.313  2.272   -6.990  1.00 0.00 ? 4  GLU A CA   6  
ATOM 3967 C C    . GLU A 1 4  ? -5.113  3.489   -7.463  1.00 0.00 ? 4  GLU A C    6  
ATOM 3968 O O    . GLU A 1 4  ? -4.935  3.932   -8.580  1.00 0.00 ? 4  GLU A O    6  
ATOM 3969 C CB   . GLU A 1 4  ? -5.163  0.977   -7.246  1.00 0.00 ? 4  GLU A CB   6  
ATOM 3970 C CG   . GLU A 1 4  ? -4.287  -0.144  -7.879  1.00 0.00 ? 4  GLU A CG   6  
ATOM 3971 C CD   . GLU A 1 4  ? -3.207  -0.624  -6.886  1.00 0.00 ? 4  GLU A CD   6  
ATOM 3972 O OE1  . GLU A 1 4  ? -3.597  -1.279  -5.934  1.00 0.00 ? 4  GLU A OE1  6  
ATOM 3973 O OE2  . GLU A 1 4  ? -2.053  -0.310  -7.133  1.00 0.00 ? 4  GLU A OE2  6  
ATOM 3974 H H    . GLU A 1 4  ? -3.131  2.994   -5.410  1.00 0.00 ? 4  GLU A H    6  
ATOM 3975 H HA   . GLU A 1 4  ? -3.405  2.248   -7.561  1.00 0.00 ? 4  GLU A HA   6  
ATOM 3976 H HB2  . GLU A 1 4  ? -5.684  0.557   -6.410  1.00 0.00 ? 4  GLU A HB2  6  
ATOM 3977 H HB3  . GLU A 1 4  ? -5.909  1.285   -7.931  1.00 0.00 ? 4  GLU A HB3  6  
ATOM 3978 H HG2  . GLU A 1 4  ? -4.911  -0.987  -8.136  1.00 0.00 ? 4  GLU A HG2  6  
ATOM 3979 H HG3  . GLU A 1 4  ? -3.814  0.215   -8.784  1.00 0.00 ? 4  GLU A HG3  6  
ATOM 3980 N N    . GLN A 1 5  ? -5.963  3.997   -6.601  1.00 0.00 ? 5  GLN A N    6  
ATOM 3981 C CA   . GLN A 1 5  ? -6.797  5.192   -6.954  1.00 0.00 ? 5  GLN A CA   6  
ATOM 3982 C C    . GLN A 1 5  ? -6.038  6.415   -6.412  1.00 0.00 ? 5  GLN A C    6  
ATOM 3983 O O    . GLN A 1 5  ? -6.255  6.886   -5.312  1.00 0.00 ? 5  GLN A O    6  
ATOM 3984 C CB   . GLN A 1 5  ? -8.191  5.086   -6.282  1.00 0.00 ? 5  GLN A CB   6  
ATOM 3985 C CG   . GLN A 1 5  ? -9.046  6.328   -6.681  1.00 0.00 ? 5  GLN A CG   6  
ATOM 3986 C CD   . GLN A 1 5  ? -10.291 6.439   -5.794  1.00 0.00 ? 5  GLN A CD   6  
ATOM 3987 O OE1  . GLN A 1 5  ? -10.220 6.838   -4.649  1.00 0.00 ? 5  GLN A OE1  6  
ATOM 3988 N NE2  . GLN A 1 5  ? -11.450 6.095   -6.282  1.00 0.00 ? 5  GLN A NE2  6  
ATOM 3989 H H    . GLN A 1 5  ? -6.039  3.569   -5.727  1.00 0.00 ? 5  GLN A H    6  
ATOM 3990 H HA   . GLN A 1 5  ? -6.893  5.274   -8.027  1.00 0.00 ? 5  GLN A HA   6  
ATOM 3991 H HB2  . GLN A 1 5  ? -8.675  4.186   -6.635  1.00 0.00 ? 5  GLN A HB2  6  
ATOM 3992 H HB3  . GLN A 1 5  ? -8.077  5.003   -5.219  1.00 0.00 ? 5  GLN A HB3  6  
ATOM 3993 H HG2  . GLN A 1 5  ? -8.480  7.245   -6.590  1.00 0.00 ? 5  GLN A HG2  6  
ATOM 3994 H HG3  . GLN A 1 5  ? -9.366  6.239   -7.708  1.00 0.00 ? 5  GLN A HG3  6  
ATOM 3995 H HE21 . GLN A 1 5  ? -11.517 5.763   -7.203  1.00 0.00 ? 5  GLN A HE21 6  
ATOM 3996 H HE22 . GLN A 1 5  ? -12.252 6.170   -5.726  1.00 0.00 ? 5  GLN A HE22 6  
ATOM 3997 N N    . CYS A 1 6  ? -5.149  6.862   -7.259  1.00 0.00 ? 6  CYS A N    6  
ATOM 3998 C CA   . CYS A 1 6  ? -4.263  8.036   -6.998  1.00 0.00 ? 6  CYS A CA   6  
ATOM 3999 C C    . CYS A 1 6  ? -4.096  8.577   -5.552  1.00 0.00 ? 6  CYS A C    6  
ATOM 4000 O O    . CYS A 1 6  ? -4.598  9.630   -5.202  1.00 0.00 ? 6  CYS A O    6  
ATOM 4001 C CB   . CYS A 1 6  ? -4.735  9.186   -7.868  1.00 0.00 ? 6  CYS A CB   6  
ATOM 4002 S SG   . CYS A 1 6  ? -4.668  9.087   -9.677  1.00 0.00 ? 6  CYS A SG   6  
ATOM 4003 H H    . CYS A 1 6  ? -5.069  6.396   -8.115  1.00 0.00 ? 6  CYS A H    6  
ATOM 4004 H HA   . CYS A 1 6  ? -3.289  7.744   -7.323  1.00 0.00 ? 6  CYS A HA   6  
ATOM 4005 H HB2  . CYS A 1 6  ? -5.759  9.404   -7.602  1.00 0.00 ? 6  CYS A HB2  6  
ATOM 4006 H HB3  . CYS A 1 6  ? -4.152  10.030  -7.553  1.00 0.00 ? 6  CYS A HB3  6  
ATOM 4007 N N    . CYS A 1 7  ? -3.376  7.811   -4.769  1.00 0.00 ? 7  CYS A N    6  
ATOM 4008 C CA   . CYS A 1 7  ? -3.078  8.138   -3.334  1.00 0.00 ? 7  CYS A CA   6  
ATOM 4009 C C    . CYS A 1 7  ? -4.310  8.658   -2.613  1.00 0.00 ? 7  CYS A C    6  
ATOM 4010 O O    . CYS A 1 7  ? -4.338  9.724   -2.024  1.00 0.00 ? 7  CYS A O    6  
ATOM 4011 C CB   . CYS A 1 7  ? -1.965  9.193   -3.276  1.00 0.00 ? 7  CYS A CB   6  
ATOM 4012 S SG   . CYS A 1 7  ? -1.258  9.507   -1.641  1.00 0.00 ? 7  CYS A SG   6  
ATOM 4013 H H    . CYS A 1 7  ? -3.024  6.974   -5.125  1.00 0.00 ? 7  CYS A H    6  
ATOM 4014 H HA   . CYS A 1 7  ? -2.770  7.235   -2.831  1.00 0.00 ? 7  CYS A HA   6  
ATOM 4015 H HB2  . CYS A 1 7  ? -1.165  8.888   -3.932  1.00 0.00 ? 7  CYS A HB2  6  
ATOM 4016 H HB3  . CYS A 1 7  ? -2.366  10.123  -3.650  1.00 0.00 ? 7  CYS A HB3  6  
ATOM 4017 N N    . THR A 1 8  ? -5.286  7.805   -2.743  1.00 0.00 ? 8  THR A N    6  
ATOM 4018 C CA   . THR A 1 8  ? -6.648  7.985   -2.154  1.00 0.00 ? 8  THR A CA   6  
ATOM 4019 C C    . THR A 1 8  ? -6.701  8.992   -1.003  1.00 0.00 ? 8  THR A C    6  
ATOM 4020 O O    . THR A 1 8  ? -7.396  9.986   -1.048  1.00 0.00 ? 8  THR A O    6  
ATOM 4021 C CB   . THR A 1 8  ? -7.144  6.598   -1.676  1.00 0.00 ? 8  THR A CB   6  
ATOM 4022 O OG1  . THR A 1 8  ? -6.148  6.098   -0.780  1.00 0.00 ? 8  THR A OG1  6  
ATOM 4023 C CG2  . THR A 1 8  ? -7.159  5.619   -2.852  1.00 0.00 ? 8  THR A CG2  6  
ATOM 4024 H H    . THR A 1 8  ? -5.090  7.003   -3.275  1.00 0.00 ? 8  THR A H    6  
ATOM 4025 H HA   . THR A 1 8  ? -7.296  8.342   -2.942  1.00 0.00 ? 8  THR A HA   6  
ATOM 4026 H HB   . THR A 1 8  ? -8.105  6.646   -1.182  1.00 0.00 ? 8  THR A HB   6  
ATOM 4027 H HG1  . THR A 1 8  ? -5.877  5.214   -1.019  1.00 0.00 ? 8  THR A HG1  6  
ATOM 4028 H HG21 . THR A 1 8  ? -7.819  6.017   -3.599  1.00 0.00 ? 8  THR A HG21 6  
ATOM 4029 H HG22 . THR A 1 8  ? -6.179  5.469   -3.269  1.00 0.00 ? 8  THR A HG22 6  
ATOM 4030 H HG23 . THR A 1 8  ? -7.543  4.661   -2.527  1.00 0.00 ? 8  THR A HG23 6  
ATOM 4031 N N    . SER A 1 9  ? -5.928  8.652   -0.007  1.00 0.00 ? 9  SER A N    6  
ATOM 4032 C CA   . SER A 1 9  ? -5.825  9.480   1.216   1.00 0.00 ? 9  SER A CA   6  
ATOM 4033 C C    . SER A 1 9  ? -4.391  9.968   1.492   1.00 0.00 ? 9  SER A C    6  
ATOM 4034 O O    . SER A 1 9  ? -4.113  11.137  1.306   1.00 0.00 ? 9  SER A O    6  
ATOM 4035 C CB   . SER A 1 9  ? -6.418  8.599   2.374   1.00 0.00 ? 9  SER A CB   6  
ATOM 4036 O OG   . SER A 1 9  ? -5.704  7.367   2.344   1.00 0.00 ? 9  SER A OG   6  
ATOM 4037 H H    . SER A 1 9  ? -5.403  7.832   -0.082  1.00 0.00 ? 9  SER A H    6  
ATOM 4038 H HA   . SER A 1 9  ? -6.437  10.345  1.116   1.00 0.00 ? 9  SER A HA   6  
ATOM 4039 H HB2  . SER A 1 9  ? -6.346  9.061   3.351   1.00 0.00 ? 9  SER A HB2  6  
ATOM 4040 H HB3  . SER A 1 9  ? -7.458  8.388   2.170   1.00 0.00 ? 9  SER A HB3  6  
ATOM 4041 H HG   . SER A 1 9  ? -5.805  6.994   1.464   1.00 0.00 ? 9  SER A HG   6  
ATOM 4042 N N    . ILE A 1 10 ? -3.525  9.085   1.913   1.00 0.00 ? 10 ILE A N    6  
ATOM 4043 C CA   . ILE A 1 10 ? -2.100  9.488   2.214   1.00 0.00 ? 10 ILE A CA   6  
ATOM 4044 C C    . ILE A 1 10 ? -1.009  8.515   1.688   1.00 0.00 ? 10 ILE A C    6  
ATOM 4045 O O    . ILE A 1 10 ? 0.157   8.780   1.901   1.00 0.00 ? 10 ILE A O    6  
ATOM 4046 C CB   . ILE A 1 10 ? -1.990  9.674   3.794   1.00 0.00 ? 10 ILE A CB   6  
ATOM 4047 C CG1  . ILE A 1 10 ? -3.137  10.624  4.281   1.00 0.00 ? 10 ILE A CG1  6  
ATOM 4048 C CG2  . ILE A 1 10 ? -0.625  10.309  4.220   1.00 0.00 ? 10 ILE A CG2  6  
ATOM 4049 C CD1  . ILE A 1 10 ? -3.136  10.824  5.807   1.00 0.00 ? 10 ILE A CD1  6  
ATOM 4050 H H    . ILE A 1 10 ? -3.848  8.172   2.016   1.00 0.00 ? 10 ILE A H    6  
ATOM 4051 H HA   . ILE A 1 10 ? -1.904  10.448  1.750   1.00 0.00 ? 10 ILE A HA   6  
ATOM 4052 H HB   . ILE A 1 10 ? -2.102  8.711   4.263   1.00 0.00 ? 10 ILE A HB   6  
ATOM 4053 H HG12 . ILE A 1 10 ? -3.048  11.587  3.799   1.00 0.00 ? 10 ILE A HG12 6  
ATOM 4054 H HG13 . ILE A 1 10 ? -4.094  10.204  4.012   1.00 0.00 ? 10 ILE A HG13 6  
ATOM 4055 H HG21 . ILE A 1 10 ? -0.489  11.276  3.755   1.00 0.00 ? 10 ILE A HG21 6  
ATOM 4056 H HG22 . ILE A 1 10 ? -0.604  10.450  5.288   1.00 0.00 ? 10 ILE A HG22 6  
ATOM 4057 H HG23 . ILE A 1 10 ? 0.210   9.677   3.965   1.00 0.00 ? 10 ILE A HG23 6  
ATOM 4058 H HD11 . ILE A 1 10 ? -3.257  9.880   6.318   1.00 0.00 ? 10 ILE A HD11 6  
ATOM 4059 H HD12 . ILE A 1 10 ? -2.230  11.295  6.146   1.00 0.00 ? 10 ILE A HD12 6  
ATOM 4060 H HD13 . ILE A 1 10 ? -3.959  11.471  6.060   1.00 0.00 ? 10 ILE A HD13 6  
ATOM 4061 N N    . CYS A 1 11 ? -1.392  7.450   1.016   1.00 0.00 ? 11 CYS A N    6  
ATOM 4062 C CA   . CYS A 1 11 ? -0.415  6.429   0.460   1.00 0.00 ? 11 CYS A CA   6  
ATOM 4063 C C    . CYS A 1 11 ? 1.006   6.422   1.118   1.00 0.00 ? 11 CYS A C    6  
ATOM 4064 O O    . CYS A 1 11 ? 1.952   6.961   0.569   1.00 0.00 ? 11 CYS A O    6  
ATOM 4065 C CB   . CYS A 1 11 ? -0.284  6.682   -1.063  1.00 0.00 ? 11 CYS A CB   6  
ATOM 4066 S SG   . CYS A 1 11 ? 0.356   8.290   -1.607  1.00 0.00 ? 11 CYS A SG   6  
ATOM 4067 H H    . CYS A 1 11 ? -2.350  7.312   0.858   1.00 0.00 ? 11 CYS A H    6  
ATOM 4068 H HA   . CYS A 1 11 ? -0.855  5.452   0.596   1.00 0.00 ? 11 CYS A HA   6  
ATOM 4069 H HB2  . CYS A 1 11 ? 0.360   5.923   -1.487  1.00 0.00 ? 11 CYS A HB2  6  
ATOM 4070 H HB3  . CYS A 1 11 ? -1.254  6.546   -1.509  1.00 0.00 ? 11 CYS A HB3  6  
ATOM 4071 N N    . SER A 1 12 ? 1.108   5.804   2.273   1.00 0.00 ? 12 SER A N    6  
ATOM 4072 C CA   . SER A 1 12 ? 2.395   5.704   3.032   1.00 0.00 ? 12 SER A CA   6  
ATOM 4073 C C    . SER A 1 12 ? 3.080   4.353   2.772   1.00 0.00 ? 12 SER A C    6  
ATOM 4074 O O    . SER A 1 12 ? 2.451   3.333   2.586   1.00 0.00 ? 12 SER A O    6  
ATOM 4075 C CB   . SER A 1 12 ? 2.073   5.862   4.539   1.00 0.00 ? 12 SER A CB   6  
ATOM 4076 O OG   . SER A 1 12 ? 1.311   4.706   4.876   1.00 0.00 ? 12 SER A OG   6  
ATOM 4077 H H    . SER A 1 12 ? 0.332   5.387   2.683   1.00 0.00 ? 12 SER A H    6  
ATOM 4078 H HA   . SER A 1 12 ? 3.051   6.503   2.716   1.00 0.00 ? 12 SER A HA   6  
ATOM 4079 H HB2  . SER A 1 12 ? 2.941   5.901   5.181   1.00 0.00 ? 12 SER A HB2  6  
ATOM 4080 H HB3  . SER A 1 12 ? 1.466   6.742   4.696   1.00 0.00 ? 12 SER A HB3  6  
ATOM 4081 H HG   . SER A 1 12 ? 1.164   4.183   4.086   1.00 0.00 ? 12 SER A HG   6  
ATOM 4082 N N    . LEU A 1 13 ? 4.376   4.437   2.767   1.00 0.00 ? 13 LEU A N    6  
ATOM 4083 C CA   . LEU A 1 13 ? 5.280   3.265   2.538   1.00 0.00 ? 13 LEU A CA   6  
ATOM 4084 C C    . LEU A 1 13 ? 4.940   1.957   3.253   1.00 0.00 ? 13 LEU A C    6  
ATOM 4085 O O    . LEU A 1 13 ? 5.135   0.904   2.679   1.00 0.00 ? 13 LEU A O    6  
ATOM 4086 C CB   . LEU A 1 13 ? 6.767   3.609   2.911   1.00 0.00 ? 13 LEU A CB   6  
ATOM 4087 C CG   . LEU A 1 13 ? 7.113   5.131   2.893   1.00 0.00 ? 13 LEU A CG   6  
ATOM 4088 C CD1  . LEU A 1 13 ? 6.742   5.774   4.256   1.00 0.00 ? 13 LEU A CD1  6  
ATOM 4089 C CD2  . LEU A 1 13 ? 8.628   5.325   2.653   1.00 0.00 ? 13 LEU A CD2  6  
ATOM 4090 H H    . LEU A 1 13 ? 4.743   5.326   2.920   1.00 0.00 ? 13 LEU A H    6  
ATOM 4091 H HA   . LEU A 1 13 ? 5.221   3.041   1.492   1.00 0.00 ? 13 LEU A HA   6  
ATOM 4092 H HB2  . LEU A 1 13 ? 7.030   3.176   3.861   1.00 0.00 ? 13 LEU A HB2  6  
ATOM 4093 H HB3  . LEU A 1 13 ? 7.373   3.105   2.175   1.00 0.00 ? 13 LEU A HB3  6  
ATOM 4094 H HG   . LEU A 1 13 ? 6.554   5.624   2.109   1.00 0.00 ? 13 LEU A HG   6  
ATOM 4095 H HD11 . LEU A 1 13 ? 7.272   5.274   5.055   1.00 0.00 ? 13 LEU A HD11 6  
ATOM 4096 H HD12 . LEU A 1 13 ? 7.035   6.813   4.244   1.00 0.00 ? 13 LEU A HD12 6  
ATOM 4097 H HD13 . LEU A 1 13 ? 5.685   5.712   4.469   1.00 0.00 ? 13 LEU A HD13 6  
ATOM 4098 H HD21 . LEU A 1 13 ? 9.187   4.836   3.436   1.00 0.00 ? 13 LEU A HD21 6  
ATOM 4099 H HD22 . LEU A 1 13 ? 8.924   4.909   1.704   1.00 0.00 ? 13 LEU A HD22 6  
ATOM 4100 H HD23 . LEU A 1 13 ? 8.878   6.376   2.648   1.00 0.00 ? 13 LEU A HD23 6  
ATOM 4101 N N    . TYR A 1 14 ? 4.443   2.032   4.460   1.00 0.00 ? 14 TYR A N    6  
ATOM 4102 C CA   . TYR A 1 14 ? 4.110   0.765   5.194   1.00 0.00 ? 14 TYR A CA   6  
ATOM 4103 C C    . TYR A 1 14 ? 2.792   0.250   4.624   1.00 0.00 ? 14 TYR A C    6  
ATOM 4104 O O    . TYR A 1 14 ? 2.564   -0.943  4.606   1.00 0.00 ? 14 TYR A O    6  
ATOM 4105 C CB   . TYR A 1 14 ? 3.955   1.028   6.712   1.00 0.00 ? 14 TYR A CB   6  
ATOM 4106 C CG   . TYR A 1 14 ? 4.061   -0.307  7.476   1.00 0.00 ? 14 TYR A CG   6  
ATOM 4107 C CD1  . TYR A 1 14 ? 5.295   -0.789  7.867   1.00 0.00 ? 14 TYR A CD1  6  
ATOM 4108 C CD2  . TYR A 1 14 ? 2.928   -1.042  7.789   1.00 0.00 ? 14 TYR A CD2  6  
ATOM 4109 C CE1  . TYR A 1 14 ? 5.396   -1.980  8.548   1.00 0.00 ? 14 TYR A CE1  6  
ATOM 4110 C CE2  . TYR A 1 14 ? 3.030   -2.234  8.473   1.00 0.00 ? 14 TYR A CE2  6  
ATOM 4111 C CZ   . TYR A 1 14 ? 4.271   -2.713  8.863   1.00 0.00 ? 14 TYR A CZ   6  
ATOM 4112 O OH   . TYR A 1 14 ? 4.412   -3.905  9.547   1.00 0.00 ? 14 TYR A OH   6  
ATOM 4113 H H    . TYR A 1 14 ? 4.285   2.909   4.860   1.00 0.00 ? 14 TYR A H    6  
ATOM 4114 H HA   . TYR A 1 14 ? 4.885   0.032   5.009   1.00 0.00 ? 14 TYR A HA   6  
ATOM 4115 H HB2  . TYR A 1 14 ? 4.743   1.682   7.050   1.00 0.00 ? 14 TYR A HB2  6  
ATOM 4116 H HB3  . TYR A 1 14 ? 3.010   1.478   6.972   1.00 0.00 ? 14 TYR A HB3  6  
ATOM 4117 H HD1  . TYR A 1 14 ? 6.190   -0.236  7.629   1.00 0.00 ? 14 TYR A HD1  6  
ATOM 4118 H HD2  . TYR A 1 14 ? 1.950   -0.694  7.496   1.00 0.00 ? 14 TYR A HD2  6  
ATOM 4119 H HE1  . TYR A 1 14 ? 6.369   -2.345  8.849   1.00 0.00 ? 14 TYR A HE1  6  
ATOM 4120 H HE2  . TYR A 1 14 ? 2.125   -2.784  8.702   1.00 0.00 ? 14 TYR A HE2  6  
ATOM 4121 H HH   . TYR A 1 14 ? 3.627   -4.061  10.074  1.00 0.00 ? 14 TYR A HH   6  
ATOM 4122 N N    . GLN A 1 15 ? 1.953   1.156   4.178   1.00 0.00 ? 15 GLN A N    6  
ATOM 4123 C CA   . GLN A 1 15 ? 0.646   0.736   3.595   1.00 0.00 ? 15 GLN A CA   6  
ATOM 4124 C C    . GLN A 1 15 ? 1.022   -0.119  2.360   1.00 0.00 ? 15 GLN A C    6  
ATOM 4125 O O    . GLN A 1 15 ? 0.308   -1.039  2.012   1.00 0.00 ? 15 GLN A O    6  
ATOM 4126 C CB   . GLN A 1 15 ? -0.159  2.007   3.184   1.00 0.00 ? 15 GLN A CB   6  
ATOM 4127 C CG   . GLN A 1 15 ? -1.626  1.692   2.858   1.00 0.00 ? 15 GLN A CG   6  
ATOM 4128 C CD   . GLN A 1 15 ? -2.254  2.973   2.285   1.00 0.00 ? 15 GLN A CD   6  
ATOM 4129 O OE1  . GLN A 1 15 ? -2.374  3.986   2.945   1.00 0.00 ? 15 GLN A OE1  6  
ATOM 4130 N NE2  . GLN A 1 15 ? -2.659  2.961   1.045   1.00 0.00 ? 15 GLN A NE2  6  
ATOM 4131 H H    . GLN A 1 15 ? 2.163   2.110   4.214   1.00 0.00 ? 15 GLN A H    6  
ATOM 4132 H HA   . GLN A 1 15 ? 0.109   0.131   4.316   1.00 0.00 ? 15 GLN A HA   6  
ATOM 4133 H HB2  . GLN A 1 15 ? -0.123  2.730   3.985   1.00 0.00 ? 15 GLN A HB2  6  
ATOM 4134 H HB3  . GLN A 1 15 ? 0.240   2.453   2.287   1.00 0.00 ? 15 GLN A HB3  6  
ATOM 4135 H HG2  . GLN A 1 15 ? -1.691  0.909   2.124   1.00 0.00 ? 15 GLN A HG2  6  
ATOM 4136 H HG3  . GLN A 1 15 ? -2.165  1.403   3.748   1.00 0.00 ? 15 GLN A HG3  6  
ATOM 4137 H HE21 . GLN A 1 15 ? -2.566  2.135   0.525   1.00 0.00 ? 15 GLN A HE21 6  
ATOM 4138 H HE22 . GLN A 1 15 ? -3.051  3.769   0.650   1.00 0.00 ? 15 GLN A HE22 6  
ATOM 4139 N N    . LEU A 1 16 ? 2.148   0.196   1.746   1.00 0.00 ? 16 LEU A N    6  
ATOM 4140 C CA   . LEU A 1 16 ? 2.580   -0.576  0.539   1.00 0.00 ? 16 LEU A CA   6  
ATOM 4141 C C    . LEU A 1 16 ? 3.145   -1.921  1.031   1.00 0.00 ? 16 LEU A C    6  
ATOM 4142 O O    . LEU A 1 16 ? 2.972   -2.941  0.391   1.00 0.00 ? 16 LEU A O    6  
ATOM 4143 C CB   . LEU A 1 16 ? 3.629   0.328   -0.232  1.00 0.00 ? 16 LEU A CB   6  
ATOM 4144 C CG   . LEU A 1 16 ? 3.868   -0.154  -1.685  1.00 0.00 ? 16 LEU A CG   6  
ATOM 4145 C CD1  . LEU A 1 16 ? 2.585   0.030   -2.543  1.00 0.00 ? 16 LEU A CD1  6  
ATOM 4146 C CD2  . LEU A 1 16 ? 4.978   0.716   -2.312  1.00 0.00 ? 16 LEU A CD2  6  
ATOM 4147 H H    . LEU A 1 16 ? 2.725   0.934   2.068   1.00 0.00 ? 16 LEU A H    6  
ATOM 4148 H HA   . LEU A 1 16 ? 1.726   -0.774  -0.082  1.00 0.00 ? 16 LEU A HA   6  
ATOM 4149 H HB2  . LEU A 1 16 ? 3.236   1.331   -0.271  1.00 0.00 ? 16 LEU A HB2  6  
ATOM 4150 H HB3  . LEU A 1 16 ? 4.598   0.388   0.244   1.00 0.00 ? 16 LEU A HB3  6  
ATOM 4151 H HG   . LEU A 1 16 ? 4.174   -1.191  -1.646  1.00 0.00 ? 16 LEU A HG   6  
ATOM 4152 H HD11 . LEU A 1 16 ? 2.276   1.067   -2.541  1.00 0.00 ? 16 LEU A HD11 6  
ATOM 4153 H HD12 . LEU A 1 16 ? 2.767   -0.266  -3.566  1.00 0.00 ? 16 LEU A HD12 6  
ATOM 4154 H HD13 . LEU A 1 16 ? 1.776   -0.569  -2.169  1.00 0.00 ? 16 LEU A HD13 6  
ATOM 4155 H HD21 . LEU A 1 16 ? 5.885   0.665   -1.726  1.00 0.00 ? 16 LEU A HD21 6  
ATOM 4156 H HD22 . LEU A 1 16 ? 5.197   0.373   -3.309  1.00 0.00 ? 16 LEU A HD22 6  
ATOM 4157 H HD23 . LEU A 1 16 ? 4.655   1.747   -2.366  1.00 0.00 ? 16 LEU A HD23 6  
ATOM 4158 N N    . GLU A 1 17 ? 3.786   -1.897  2.175   1.00 0.00 ? 17 GLU A N    6  
ATOM 4159 C CA   . GLU A 1 17 ? 4.367   -3.154  2.737   1.00 0.00 ? 17 GLU A CA   6  
ATOM 4160 C C    . GLU A 1 17 ? 3.258   -4.018  3.350   1.00 0.00 ? 17 GLU A C    6  
ATOM 4161 O O    . GLU A 1 17 ? 3.490   -5.186  3.620   1.00 0.00 ? 17 GLU A O    6  
ATOM 4162 C CB   . GLU A 1 17 ? 5.375   -2.827  3.838   1.00 0.00 ? 17 GLU A CB   6  
ATOM 4163 C CG   . GLU A 1 17 ? 6.549   -1.969  3.300   1.00 0.00 ? 17 GLU A CG   6  
ATOM 4164 C CD   . GLU A 1 17 ? 7.481   -1.500  4.445   1.00 0.00 ? 17 GLU A CD   6  
ATOM 4165 O OE1  . GLU A 1 17 ? 7.301   -1.928  5.577   1.00 0.00 ? 17 GLU A OE1  6  
ATOM 4166 O OE2  . GLU A 1 17 ? 8.351   -0.711  4.104   1.00 0.00 ? 17 GLU A OE2  6  
ATOM 4167 H H    . GLU A 1 17 ? 3.890   -1.063  2.675   1.00 0.00 ? 17 GLU A H    6  
ATOM 4168 H HA   . GLU A 1 17 ? 4.832   -3.709  1.940   1.00 0.00 ? 17 GLU A HA   6  
ATOM 4169 H HB2  . GLU A 1 17 ? 4.868   -2.294  4.635   1.00 0.00 ? 17 GLU A HB2  6  
ATOM 4170 H HB3  . GLU A 1 17 ? 5.771   -3.747  4.242   1.00 0.00 ? 17 GLU A HB3  6  
ATOM 4171 H HG2  . GLU A 1 17 ? 7.134   -2.549  2.602   1.00 0.00 ? 17 GLU A HG2  6  
ATOM 4172 H HG3  . GLU A 1 17 ? 6.169   -1.100  2.787   1.00 0.00 ? 17 GLU A HG3  6  
ATOM 4173 N N    . ASN A 1 18 ? 2.082   -3.455  3.556   1.00 0.00 ? 18 ASN A N    6  
ATOM 4174 C CA   . ASN A 1 18 ? 1.016   -4.318  4.160   1.00 0.00 ? 18 ASN A CA   6  
ATOM 4175 C C    . ASN A 1 18 ? 0.315   -5.130  3.064   1.00 0.00 ? 18 ASN A C    6  
ATOM 4176 O O    . ASN A 1 18 ? -0.735  -5.705  3.280   1.00 0.00 ? 18 ASN A O    6  
ATOM 4177 C CB   . ASN A 1 18 ? -0.018  -3.430  4.918   1.00 0.00 ? 18 ASN A CB   6  
ATOM 4178 C CG   . ASN A 1 18 ? -0.725  -4.303  5.964   1.00 0.00 ? 18 ASN A CG   6  
ATOM 4179 O OD1  . ASN A 1 18 ? -0.097  -4.835  6.860   1.00 0.00 ? 18 ASN A OD1  6  
ATOM 4180 N ND2  . ASN A 1 18 ? -2.013  -4.480  5.893   1.00 0.00 ? 18 ASN A ND2  6  
ATOM 4181 H H    . ASN A 1 18 ? 1.920   -2.520  3.317   1.00 0.00 ? 18 ASN A H    6  
ATOM 4182 H HA   . ASN A 1 18 ? 1.478   -4.991  4.860   1.00 0.00 ? 18 ASN A HA   6  
ATOM 4183 H HB2  . ASN A 1 18 ? 0.479   -2.617  5.421   1.00 0.00 ? 18 ASN A HB2  6  
ATOM 4184 H HB3  . ASN A 1 18 ? -0.753  -3.033  4.237   1.00 0.00 ? 18 ASN A HB3  6  
ATOM 4185 H HD21 . ASN A 1 18 ? -2.530  -4.060  5.176   1.00 0.00 ? 18 ASN A HD21 6  
ATOM 4186 H HD22 . ASN A 1 18 ? -2.463  -5.034  6.565   1.00 0.00 ? 18 ASN A HD22 6  
ATOM 4187 N N    . TYR A 1 19 ? 0.942   -5.153  1.913   1.00 0.00 ? 19 TYR A N    6  
ATOM 4188 C CA   . TYR A 1 19 ? 0.403   -5.908  0.740   1.00 0.00 ? 19 TYR A CA   6  
ATOM 4189 C C    . TYR A 1 19 ? 1.287   -7.155  0.537   1.00 0.00 ? 19 TYR A C    6  
ATOM 4190 O O    . TYR A 1 19 ? 1.071   -7.919  -0.387  1.00 0.00 ? 19 TYR A O    6  
ATOM 4191 C CB   . TYR A 1 19 ? 0.473   -5.016  -0.508  1.00 0.00 ? 19 TYR A CB   6  
ATOM 4192 C CG   . TYR A 1 19 ? -0.284  -3.680  -0.347  1.00 0.00 ? 19 TYR A CG   6  
ATOM 4193 C CD1  . TYR A 1 19 ? -1.369  -3.525  0.504   1.00 0.00 ? 19 TYR A CD1  6  
ATOM 4194 C CD2  . TYR A 1 19 ? 0.117   -2.590  -1.094  1.00 0.00 ? 19 TYR A CD2  6  
ATOM 4195 C CE1  . TYR A 1 19 ? -2.017  -2.311  0.598   1.00 0.00 ? 19 TYR A CE1  6  
ATOM 4196 C CE2  . TYR A 1 19 ? -0.535  -1.380  -0.995  1.00 0.00 ? 19 TYR A CE2  6  
ATOM 4197 C CZ   . TYR A 1 19 ? -1.599  -1.230  -0.155  1.00 0.00 ? 19 TYR A CZ   6  
ATOM 4198 O OH   . TYR A 1 19 ? -2.218  -0.001  -0.088  1.00 0.00 ? 19 TYR A OH   6  
ATOM 4199 H H    . TYR A 1 19 ? 1.782   -4.657  1.810   1.00 0.00 ? 19 TYR A H    6  
ATOM 4200 H HA   . TYR A 1 19 ? -0.608  -6.239  0.930   1.00 0.00 ? 19 TYR A HA   6  
ATOM 4201 H HB2  . TYR A 1 19 ? 1.508   -4.799  -0.730  1.00 0.00 ? 19 TYR A HB2  6  
ATOM 4202 H HB3  . TYR A 1 19 ? 0.042   -5.545  -1.345  1.00 0.00 ? 19 TYR A HB3  6  
ATOM 4203 H HD1  . TYR A 1 19 ? -1.719  -4.350  1.103   1.00 0.00 ? 19 TYR A HD1  6  
ATOM 4204 H HD2  . TYR A 1 19 ? 0.960   -2.679  -1.763  1.00 0.00 ? 19 TYR A HD2  6  
ATOM 4205 H HE1  . TYR A 1 19 ? -2.858  -2.216  1.269   1.00 0.00 ? 19 TYR A HE1  6  
ATOM 4206 H HE2  . TYR A 1 19 ? -0.213  -0.537  -1.588  1.00 0.00 ? 19 TYR A HE2  6  
ATOM 4207 H HH   . TYR A 1 19 ? -1.655  0.614   -0.565  1.00 0.00 ? 19 TYR A HH   6  
ATOM 4208 N N    . CYS A 1 20 ? 2.249   -7.316  1.421   1.00 0.00 ? 20 CYS A N    6  
ATOM 4209 C CA   . CYS A 1 20 ? 3.188   -8.467  1.351   1.00 0.00 ? 20 CYS A CA   6  
ATOM 4210 C C    . CYS A 1 20 ? 2.899   -9.427  2.522   1.00 0.00 ? 20 CYS A C    6  
ATOM 4211 O O    . CYS A 1 20 ? 3.071   -10.621 2.377   1.00 0.00 ? 20 CYS A O    6  
ATOM 4212 C CB   . CYS A 1 20 ? 4.602   -7.851  1.393   1.00 0.00 ? 20 CYS A CB   6  
ATOM 4213 S SG   . CYS A 1 20 ? 4.768   -6.294  0.481   1.00 0.00 ? 20 CYS A SG   6  
ATOM 4214 H H    . CYS A 1 20 ? 2.364   -6.675  2.151   1.00 0.00 ? 20 CYS A H    6  
ATOM 4215 H HA   . CYS A 1 20 ? 3.064   -8.993  0.415   1.00 0.00 ? 20 CYS A HA   6  
ATOM 4216 H HB2  . CYS A 1 20 ? 4.949   -7.657  2.394   1.00 0.00 ? 20 CYS A HB2  6  
ATOM 4217 H HB3  . CYS A 1 20 ? 5.293   -8.560  0.965   1.00 0.00 ? 20 CYS A HB3  6  
ATOM 4218 N N    . ASN A 1 21 ? 2.467   -8.881  3.639   1.00 0.00 ? 21 ASN A N    6  
ATOM 4219 C CA   . ASN A 1 21 ? 2.154   -9.711  4.839   1.00 0.00 ? 21 ASN A CA   6  
ATOM 4220 C C    . ASN A 1 21 ? 0.750   -9.356  5.343   1.00 0.00 ? 21 ASN A C    6  
ATOM 4221 O O    . ASN A 1 21 ? 0.440   -9.430  6.510   1.00 0.00 ? 21 ASN A O    6  
ATOM 4222 C CB   . ASN A 1 21 ? 3.215   -9.455  5.959   1.00 0.00 ? 21 ASN A CB   6  
ATOM 4223 C CG   . ASN A 1 21 ? 3.300   -7.993  6.444   1.00 0.00 ? 21 ASN A CG   6  
ATOM 4224 O OD1  . ASN A 1 21 ? 4.064   -7.681  7.340   1.00 0.00 ? 21 ASN A OD1  6  
ATOM 4225 N ND2  . ASN A 1 21 ? 2.558   -7.065  5.913   1.00 0.00 ? 21 ASN A ND2  6  
ATOM 4226 H H    . ASN A 1 21 ? 2.332   -7.912  3.700   1.00 0.00 ? 21 ASN A H    6  
ATOM 4227 H HA   . ASN A 1 21 ? 2.152   -10.756 4.566   1.00 0.00 ? 21 ASN A HA   6  
ATOM 4228 H HB2  . ASN A 1 21 ? 2.964   -10.076 6.807   1.00 0.00 ? 21 ASN A HB2  6  
ATOM 4229 H HB3  . ASN A 1 21 ? 4.190   -9.743  5.597   1.00 0.00 ? 21 ASN A HB3  6  
ATOM 4230 H HD21 . ASN A 1 21 ? 1.924   -7.271  5.195   1.00 0.00 ? 21 ASN A HD21 6  
ATOM 4231 H HD22 . ASN A 1 21 ? 2.644   -6.147  6.241   1.00 0.00 ? 21 ASN A HD22 6  
ATOM 4232 N N    . PHE B 2 1  ? 5.993   8.859   4.945   1.00 0.00 ? 1  PHE B N    6  
ATOM 4233 C CA   . PHE B 2 1  ? 5.016   9.974   4.873   1.00 0.00 ? 1  PHE B CA   6  
ATOM 4234 C C    . PHE B 2 1  ? 5.284   10.877  3.650   1.00 0.00 ? 1  PHE B C    6  
ATOM 4235 O O    . PHE B 2 1  ? 6.081   11.792  3.716   1.00 0.00 ? 1  PHE B O    6  
ATOM 4236 C CB   . PHE B 2 1  ? 5.102   10.807  6.188   1.00 0.00 ? 1  PHE B CB   6  
ATOM 4237 C CG   . PHE B 2 1  ? 4.239   12.076  6.068   1.00 0.00 ? 1  PHE B CG   6  
ATOM 4238 C CD1  . PHE B 2 1  ? 2.884   12.001  5.800   1.00 0.00 ? 1  PHE B CD1  6  
ATOM 4239 C CD2  . PHE B 2 1  ? 4.828   13.319  6.214   1.00 0.00 ? 1  PHE B CD2  6  
ATOM 4240 C CE1  . PHE B 2 1  ? 2.128   13.153  5.684   1.00 0.00 ? 1  PHE B CE1  6  
ATOM 4241 C CE2  . PHE B 2 1  ? 4.074   14.470  6.099   1.00 0.00 ? 1  PHE B CE2  6  
ATOM 4242 C CZ   . PHE B 2 1  ? 2.721   14.389  5.830   1.00 0.00 ? 1  PHE B CZ   6  
ATOM 4243 H H1   . PHE B 2 1  ? 6.638   8.927   4.133   1.00 0.00 ? 1  PHE B H1   6  
ATOM 4244 H H2   . PHE B 2 1  ? 6.543   8.925   5.826   1.00 0.00 ? 1  PHE B H2   6  
ATOM 4245 H H3   . PHE B 2 1  ? 5.492   7.947   4.920   1.00 0.00 ? 1  PHE B H3   6  
ATOM 4246 H HA   . PHE B 2 1  ? 4.028   9.548   4.791   1.00 0.00 ? 1  PHE B HA   6  
ATOM 4247 H HB2  . PHE B 2 1  ? 4.716   10.219  7.009   1.00 0.00 ? 1  PHE B HB2  6  
ATOM 4248 H HB3  . PHE B 2 1  ? 6.125   11.087  6.409   1.00 0.00 ? 1  PHE B HB3  6  
ATOM 4249 H HD1  . PHE B 2 1  ? 2.405   11.040  5.687   1.00 0.00 ? 1  PHE B HD1  6  
ATOM 4250 H HD2  . PHE B 2 1  ? 5.885   13.393  6.426   1.00 0.00 ? 1  PHE B HD2  6  
ATOM 4251 H HE1  . PHE B 2 1  ? 1.070   13.086  5.475   1.00 0.00 ? 1  PHE B HE1  6  
ATOM 4252 H HE2  . PHE B 2 1  ? 4.547   15.435  6.209   1.00 0.00 ? 1  PHE B HE2  6  
ATOM 4253 H HZ   . PHE B 2 1  ? 2.128   15.291  5.736   1.00 0.00 ? 1  PHE B HZ   6  
ATOM 4254 N N    . VAL B 2 2  ? 4.608   10.578  2.568   1.00 0.00 ? 2  VAL B N    6  
ATOM 4255 C CA   . VAL B 2 2  ? 4.767   11.380  1.311   1.00 0.00 ? 2  VAL B CA   6  
ATOM 4256 C C    . VAL B 2 2  ? 3.400   11.977  0.921   1.00 0.00 ? 2  VAL B C    6  
ATOM 4257 O O    . VAL B 2 2  ? 2.366   11.483  1.333   1.00 0.00 ? 2  VAL B O    6  
ATOM 4258 C CB   . VAL B 2 2  ? 5.302   10.466  0.171   1.00 0.00 ? 2  VAL B CB   6  
ATOM 4259 C CG1  . VAL B 2 2  ? 6.718   9.969   0.554   1.00 0.00 ? 2  VAL B CG1  6  
ATOM 4260 C CG2  . VAL B 2 2  ? 4.371   9.251   -0.064  1.00 0.00 ? 2  VAL B CG2  6  
ATOM 4261 H H    . VAL B 2 2  ? 3.991   9.818   2.578   1.00 0.00 ? 2  VAL B H    6  
ATOM 4262 H HA   . VAL B 2 2  ? 5.462   12.195  1.477   1.00 0.00 ? 2  VAL B HA   6  
ATOM 4263 H HB   . VAL B 2 2  ? 5.375   11.044  -0.738  1.00 0.00 ? 2  VAL B HB   6  
ATOM 4264 H HG11 . VAL B 2 2  ? 6.698   9.410   1.479   1.00 0.00 ? 2  VAL B HG11 6  
ATOM 4265 H HG12 . VAL B 2 2  ? 7.121   9.341   -0.228  1.00 0.00 ? 2  VAL B HG12 6  
ATOM 4266 H HG13 . VAL B 2 2  ? 7.376   10.820  0.680   1.00 0.00 ? 2  VAL B HG13 6  
ATOM 4267 H HG21 . VAL B 2 2  ? 4.280   8.660   0.835   1.00 0.00 ? 2  VAL B HG21 6  
ATOM 4268 H HG22 . VAL B 2 2  ? 3.391   9.588   -0.359  1.00 0.00 ? 2  VAL B HG22 6  
ATOM 4269 H HG23 . VAL B 2 2  ? 4.757   8.624   -0.853  1.00 0.00 ? 2  VAL B HG23 6  
ATOM 4270 N N    . ASN B 2 3  ? 3.448   13.027  0.137   1.00 0.00 ? 3  ASN B N    6  
ATOM 4271 C CA   . ASN B 2 3  ? 2.195   13.713  -0.324  1.00 0.00 ? 3  ASN B CA   6  
ATOM 4272 C C    . ASN B 2 3  ? 2.374   14.048  -1.826  1.00 0.00 ? 3  ASN B C    6  
ATOM 4273 O O    . ASN B 2 3  ? 2.027   15.117  -2.292  1.00 0.00 ? 3  ASN B O    6  
ATOM 4274 C CB   . ASN B 2 3  ? 2.056   14.951  0.593   1.00 0.00 ? 3  ASN B CB   6  
ATOM 4275 C CG   . ASN B 2 3  ? 0.695   15.668  0.509   1.00 0.00 ? 3  ASN B CG   6  
ATOM 4276 O OD1  . ASN B 2 3  ? 0.472   16.637  1.207   1.00 0.00 ? 3  ASN B OD1  6  
ATOM 4277 N ND2  . ASN B 2 3  ? -0.241  15.261  -0.302  1.00 0.00 ? 3  ASN B ND2  6  
ATOM 4278 H H    . ASN B 2 3  ? 4.324   13.369  -0.154  1.00 0.00 ? 3  ASN B H    6  
ATOM 4279 H HA   . ASN B 2 3  ? 1.346   13.047  -0.214  1.00 0.00 ? 3  ASN B HA   6  
ATOM 4280 H HB2  . ASN B 2 3  ? 2.187   14.623  1.616   1.00 0.00 ? 3  ASN B HB2  6  
ATOM 4281 H HB3  . ASN B 2 3  ? 2.834   15.658  0.365   1.00 0.00 ? 3  ASN B HB3  6  
ATOM 4282 H HD21 . ASN B 2 3  ? -0.095  14.489  -0.884  1.00 0.00 ? 3  ASN B HD21 6  
ATOM 4283 H HD22 . ASN B 2 3  ? -1.103  15.734  -0.327  1.00 0.00 ? 3  ASN B HD22 6  
ATOM 4284 N N    . GLN B 2 4  ? 2.915   13.079  -2.526  1.00 0.00 ? 4  GLN B N    6  
ATOM 4285 C CA   . GLN B 2 4  ? 3.191   13.175  -4.001  1.00 0.00 ? 4  GLN B CA   6  
ATOM 4286 C C    . GLN B 2 4  ? 2.115   12.339  -4.770  1.00 0.00 ? 4  GLN B C    6  
ATOM 4287 O O    . GLN B 2 4  ? 2.477   11.553  -5.616  1.00 0.00 ? 4  GLN B O    6  
ATOM 4288 C CB   . GLN B 2 4  ? 4.662   12.645  -4.185  1.00 0.00 ? 4  GLN B CB   6  
ATOM 4289 C CG   . GLN B 2 4  ? 5.124   12.435  -5.660  1.00 0.00 ? 4  GLN B CG   6  
ATOM 4290 C CD   . GLN B 2 4  ? 6.591   11.974  -5.665  1.00 0.00 ? 4  GLN B CD   6  
ATOM 4291 O OE1  . GLN B 2 4  ? 6.957   11.031  -4.985  1.00 0.00 ? 4  GLN B OE1  6  
ATOM 4292 N NE2  . GLN B 2 4  ? 7.462   12.590  -6.414  1.00 0.00 ? 4  GLN B NE2  6  
ATOM 4293 H H    . GLN B 2 4  ? 3.156   12.252  -2.057  1.00 0.00 ? 4  GLN B H    6  
ATOM 4294 H HA   . GLN B 2 4  ? 3.200   14.214  -4.335  1.00 0.00 ? 4  GLN B HA   6  
ATOM 4295 H HB2  . GLN B 2 4  ? 5.323   13.386  -3.754  1.00 0.00 ? 4  GLN B HB2  6  
ATOM 4296 H HB3  . GLN B 2 4  ? 4.793   11.723  -3.633  1.00 0.00 ? 4  GLN B HB3  6  
ATOM 4297 H HG2  . GLN B 2 4  ? 4.570   11.658  -6.157  1.00 0.00 ? 4  GLN B HG2  6  
ATOM 4298 H HG3  . GLN B 2 4  ? 5.027   13.341  -6.236  1.00 0.00 ? 4  GLN B HG3  6  
ATOM 4299 H HE21 . GLN B 2 4  ? 7.194   13.344  -6.976  1.00 0.00 ? 4  GLN B HE21 6  
ATOM 4300 H HE22 . GLN B 2 4  ? 8.397   12.292  -6.411  1.00 0.00 ? 4  GLN B HE22 6  
ATOM 4301 N N    . HIS B 2 5  ? 0.839   12.526  -4.470  1.00 0.00 ? 5  HIS B N    6  
ATOM 4302 C CA   . HIS B 2 5  ? -0.320  11.812  -5.099  1.00 0.00 ? 5  HIS B CA   6  
ATOM 4303 C C    . HIS B 2 5  ? -0.007  11.104  -6.401  1.00 0.00 ? 5  HIS B C    6  
ATOM 4304 O O    . HIS B 2 5  ? -0.276  11.539  -7.503  1.00 0.00 ? 5  HIS B O    6  
ATOM 4305 C CB   . HIS B 2 5  ? -1.480  12.824  -5.351  1.00 0.00 ? 5  HIS B CB   6  
ATOM 4306 C CG   . HIS B 2 5  ? -2.079  13.335  -4.029  1.00 0.00 ? 5  HIS B CG   6  
ATOM 4307 N ND1  . HIS B 2 5  ? -3.291  13.764  -3.917  1.00 0.00 ? 5  HIS B ND1  6  
ATOM 4308 C CD2  . HIS B 2 5  ? -1.554  13.470  -2.751  1.00 0.00 ? 5  HIS B CD2  6  
ATOM 4309 C CE1  . HIS B 2 5  ? -3.513  14.134  -2.693  1.00 0.00 ? 5  HIS B CE1  6  
ATOM 4310 N NE2  . HIS B 2 5  ? -2.459  13.965  -1.934  1.00 0.00 ? 5  HIS B NE2  6  
ATOM 4311 H H    . HIS B 2 5  ? 0.583   13.143  -3.777  1.00 0.00 ? 5  HIS B H    6  
ATOM 4312 H HA   . HIS B 2 5  ? -0.661  11.068  -4.403  1.00 0.00 ? 5  HIS B HA   6  
ATOM 4313 H HB2  . HIS B 2 5  ? -1.137  13.673  -5.929  1.00 0.00 ? 5  HIS B HB2  6  
ATOM 4314 H HB3  . HIS B 2 5  ? -2.264  12.333  -5.911  1.00 0.00 ? 5  HIS B HB3  6  
ATOM 4315 H HD1  . HIS B 2 5  ? -3.939  13.798  -4.651  1.00 0.00 ? 5  HIS B HD1  6  
ATOM 4316 H HD2  . HIS B 2 5  ? -0.550  13.209  -2.452  1.00 0.00 ? 5  HIS B HD2  6  
ATOM 4317 H HE1  . HIS B 2 5  ? -4.452  14.528  -2.331  1.00 0.00 ? 5  HIS B HE1  6  
ATOM 4318 N N    . LEU B 2 6  ? 0.582   9.978   -6.126  1.00 0.00 ? 6  LEU B N    6  
ATOM 4319 C CA   . LEU B 2 6  ? 1.026   9.028   -7.200  1.00 0.00 ? 6  LEU B CA   6  
ATOM 4320 C C    . LEU B 2 6  ? -0.229  8.316   -7.719  1.00 0.00 ? 6  LEU B C    6  
ATOM 4321 O O    . LEU B 2 6  ? -1.120  8.045   -6.935  1.00 0.00 ? 6  LEU B O    6  
ATOM 4322 C CB   . LEU B 2 6  ? 1.993   7.945   -6.627  1.00 0.00 ? 6  LEU B CB   6  
ATOM 4323 C CG   . LEU B 2 6  ? 3.200   8.550   -5.870  1.00 0.00 ? 6  LEU B CG   6  
ATOM 4324 C CD1  . LEU B 2 6  ? 2.879   8.651   -4.357  1.00 0.00 ? 6  LEU B CD1  6  
ATOM 4325 C CD2  . LEU B 2 6  ? 4.433   7.634   -6.033  1.00 0.00 ? 6  LEU B CD2  6  
ATOM 4326 H H    . LEU B 2 6  ? 0.711   9.825   -5.165  1.00 0.00 ? 6  LEU B H    6  
ATOM 4327 H HA   . LEU B 2 6  ? 1.493   9.580   -8.007  1.00 0.00 ? 6  LEU B HA   6  
ATOM 4328 H HB2  . LEU B 2 6  ? 1.460   7.300   -5.944  1.00 0.00 ? 6  LEU B HB2  6  
ATOM 4329 H HB3  . LEU B 2 6  ? 2.348   7.333   -7.441  1.00 0.00 ? 6  LEU B HB3  6  
ATOM 4330 H HG   . LEU B 2 6  ? 3.423   9.520   -6.283  1.00 0.00 ? 6  LEU B HG   6  
ATOM 4331 H HD11 . LEU B 2 6  ? 2.019   9.272   -4.163  1.00 0.00 ? 6  LEU B HD11 6  
ATOM 4332 H HD12 . LEU B 2 6  ? 2.680   7.666   -3.960  1.00 0.00 ? 6  LEU B HD12 6  
ATOM 4333 H HD13 . LEU B 2 6  ? 3.726   9.068   -3.835  1.00 0.00 ? 6  LEU B HD13 6  
ATOM 4334 H HD21 . LEU B 2 6  ? 4.682   7.520   -7.081  1.00 0.00 ? 6  LEU B HD21 6  
ATOM 4335 H HD22 . LEU B 2 6  ? 5.276   8.080   -5.528  1.00 0.00 ? 6  LEU B HD22 6  
ATOM 4336 H HD23 . LEU B 2 6  ? 4.238   6.658   -5.610  1.00 0.00 ? 6  LEU B HD23 6  
ATOM 4337 N N    . CYS B 2 7  ? -0.271  8.022   -8.999  1.00 0.00 ? 7  CYS B N    6  
ATOM 4338 C CA   . CYS B 2 7  ? -1.471  7.331   -9.564  1.00 0.00 ? 7  CYS B CA   6  
ATOM 4339 C C    . CYS B 2 7  ? -1.221  5.889   -10.017 1.00 0.00 ? 7  CYS B C    6  
ATOM 4340 O O    . CYS B 2 7  ? -0.200  5.545   -10.581 1.00 0.00 ? 7  CYS B O    6  
ATOM 4341 C CB   . CYS B 2 7  ? -1.994  8.200   -10.733 1.00 0.00 ? 7  CYS B CB   6  
ATOM 4342 S SG   . CYS B 2 7  ? -2.828  9.724   -10.222 1.00 0.00 ? 7  CYS B SG   6  
ATOM 4343 H H    . CYS B 2 7  ? 0.477   8.249   -9.589  1.00 0.00 ? 7  CYS B H    6  
ATOM 4344 H HA   . CYS B 2 7  ? -2.251  7.310   -8.827  1.00 0.00 ? 7  CYS B HA   6  
ATOM 4345 H HB2  . CYS B 2 7  ? -1.164  8.474   -11.368 1.00 0.00 ? 7  CYS B HB2  6  
ATOM 4346 H HB3  . CYS B 2 7  ? -2.692  7.647   -11.348 1.00 0.00 ? 7  CYS B HB3  6  
ATOM 4347 N N    . GLY B 2 8  ? -2.231  5.109   -9.714  1.00 0.00 ? 8  GLY B N    6  
ATOM 4348 C CA   . GLY B 2 8  ? -2.329  3.639   -9.993  1.00 0.00 ? 8  GLY B CA   6  
ATOM 4349 C C    . GLY B 2 8  ? -1.166  2.903   -10.706 1.00 0.00 ? 8  GLY B C    6  
ATOM 4350 O O    . GLY B 2 8  ? -0.613  2.002   -10.109 1.00 0.00 ? 8  GLY B O    6  
ATOM 4351 H H    . GLY B 2 8  ? -2.994  5.521   -9.259  1.00 0.00 ? 8  GLY B H    6  
ATOM 4352 H HA2  . GLY B 2 8  ? -2.370  3.194   -9.013  1.00 0.00 ? 8  GLY B HA2  6  
ATOM 4353 H HA3  . GLY B 2 8  ? -3.288  3.412   -10.450 1.00 0.00 ? 8  GLY B HA3  6  
ATOM 4354 N N    . SER B 2 9  ? -0.799  3.263   -11.915 1.00 0.00 ? 9  SER B N    6  
ATOM 4355 C CA   . SER B 2 9  ? 0.321   2.557   -12.625 1.00 0.00 ? 9  SER B CA   6  
ATOM 4356 C C    . SER B 2 9  ? 1.658   2.397   -11.878 1.00 0.00 ? 9  SER B C    6  
ATOM 4357 O O    . SER B 2 9  ? 2.376   1.439   -12.086 1.00 0.00 ? 9  SER B O    6  
ATOM 4358 C CB   . SER B 2 9  ? 0.575   3.295   -13.956 1.00 0.00 ? 9  SER B CB   6  
ATOM 4359 O OG   . SER B 2 9  ? -0.620  3.061   -14.689 1.00 0.00 ? 9  SER B OG   6  
ATOM 4360 H H    . SER B 2 9  ? -1.235  4.003   -12.395 1.00 0.00 ? 9  SER B H    6  
ATOM 4361 H HA   . SER B 2 9  ? -0.020  1.559   -12.851 1.00 0.00 ? 9  SER B HA   6  
ATOM 4362 H HB2  . SER B 2 9  ? 0.696   4.362   -13.817 1.00 0.00 ? 9  SER B HB2  6  
ATOM 4363 H HB3  . SER B 2 9  ? 1.418   2.896   -14.505 1.00 0.00 ? 9  SER B HB3  6  
ATOM 4364 H HG   . SER B 2 9  ? -1.062  3.900   -14.830 1.00 0.00 ? 9  SER B HG   6  
ATOM 4365 N N    . HIS B 2 10 ? 1.946   3.328   -11.015 1.00 0.00 ? 10 HIS B N    6  
ATOM 4366 C CA   . HIS B 2 10 ? 3.213   3.307   -10.229 1.00 0.00 ? 10 HIS B CA   6  
ATOM 4367 C C    . HIS B 2 10 ? 2.946   2.680   -8.875  1.00 0.00 ? 10 HIS B C    6  
ATOM 4368 O O    . HIS B 2 10 ? 3.862   2.171   -8.261  1.00 0.00 ? 10 HIS B O    6  
ATOM 4369 C CB   . HIS B 2 10 ? 3.708   4.758   -10.133 1.00 0.00 ? 10 HIS B CB   6  
ATOM 4370 C CG   . HIS B 2 10 ? 3.788   5.243   -11.594 1.00 0.00 ? 10 HIS B CG   6  
ATOM 4371 N ND1  . HIS B 2 10 ? 2.744   5.488   -12.323 1.00 0.00 ? 10 HIS B ND1  6  
ATOM 4372 C CD2  . HIS B 2 10 ? 4.860   5.509   -12.438 1.00 0.00 ? 10 HIS B CD2  6  
ATOM 4373 C CE1  . HIS B 2 10 ? 3.105   5.862   -13.508 1.00 0.00 ? 10 HIS B CE1  6  
ATOM 4374 N NE2  . HIS B 2 10 ? 4.413   5.887   -13.624 1.00 0.00 ? 10 HIS B NE2  6  
ATOM 4375 H H    . HIS B 2 10 ? 1.316   4.050   -10.887 1.00 0.00 ? 10 HIS B H    6  
ATOM 4376 H HA   . HIS B 2 10 ? 3.954   2.717   -10.738 1.00 0.00 ? 10 HIS B HA   6  
ATOM 4377 H HB2  . HIS B 2 10 ? 3.019   5.374   -9.577  1.00 0.00 ? 10 HIS B HB2  6  
ATOM 4378 H HB3  . HIS B 2 10 ? 4.689   4.796   -9.680  1.00 0.00 ? 10 HIS B HB3  6  
ATOM 4379 H HD1  . HIS B 2 10 ? 1.822   5.396   -12.005 1.00 0.00 ? 10 HIS B HD1  6  
ATOM 4380 H HD2  . HIS B 2 10 ? 5.904   5.414   -12.174 1.00 0.00 ? 10 HIS B HD2  6  
ATOM 4381 H HE1  . HIS B 2 10 ? 2.425   6.120   -14.308 1.00 0.00 ? 10 HIS B HE1  6  
ATOM 4382 N N    . LEU B 2 11 ? 1.707   2.714   -8.445  1.00 0.00 ? 11 LEU B N    6  
ATOM 4383 C CA   . LEU B 2 11 ? 1.381   2.095   -7.124  1.00 0.00 ? 11 LEU B CA   6  
ATOM 4384 C C    . LEU B 2 11 ? 1.327   0.597   -7.440  1.00 0.00 ? 11 LEU B C    6  
ATOM 4385 O O    . LEU B 2 11 ? 1.557   -0.214  -6.567  1.00 0.00 ? 11 LEU B O    6  
ATOM 4386 C CB   . LEU B 2 11 ? -0.008  2.533   -6.580  1.00 0.00 ? 11 LEU B CB   6  
ATOM 4387 C CG   . LEU B 2 11 ? -0.056  4.018   -6.117  1.00 0.00 ? 11 LEU B CG   6  
ATOM 4388 C CD1  . LEU B 2 11 ? 0.940   4.306   -4.965  1.00 0.00 ? 11 LEU B CD1  6  
ATOM 4389 C CD2  . LEU B 2 11 ? 0.223   4.950   -7.283  1.00 0.00 ? 11 LEU B CD2  6  
ATOM 4390 H H    . LEU B 2 11 ? 0.998   3.136   -8.979  1.00 0.00 ? 11 LEU B H    6  
ATOM 4391 H HA   . LEU B 2 11 ? 2.168   2.283   -6.407  1.00 0.00 ? 11 LEU B HA   6  
ATOM 4392 H HB2  . LEU B 2 11 ? -0.776  2.384   -7.326  1.00 0.00 ? 11 LEU B HB2  6  
ATOM 4393 H HB3  . LEU B 2 11 ? -0.246  1.891   -5.743  1.00 0.00 ? 11 LEU B HB3  6  
ATOM 4394 H HG   . LEU B 2 11 ? -1.051  4.232   -5.755  1.00 0.00 ? 11 LEU B HG   6  
ATOM 4395 H HD11 . LEU B 2 11 ? 0.703   3.690   -4.109  1.00 0.00 ? 11 LEU B HD11 6  
ATOM 4396 H HD12 . LEU B 2 11 ? 1.965   4.117   -5.260  1.00 0.00 ? 11 LEU B HD12 6  
ATOM 4397 H HD13 . LEU B 2 11 ? 0.854   5.341   -4.671  1.00 0.00 ? 11 LEU B HD13 6  
ATOM 4398 H HD21 . LEU B 2 11 ? -0.499  4.757   -8.053  1.00 0.00 ? 11 LEU B HD21 6  
ATOM 4399 H HD22 . LEU B 2 11 ? 0.124   5.964   -6.943  1.00 0.00 ? 11 LEU B HD22 6  
ATOM 4400 H HD23 . LEU B 2 11 ? 1.212   4.826   -7.685  1.00 0.00 ? 11 LEU B HD23 6  
ATOM 4401 N N    . VAL B 2 12 ? 1.038   0.265   -8.679  1.00 0.00 ? 12 VAL B N    6  
ATOM 4402 C CA   . VAL B 2 12 ? 0.969   -1.163  -9.067  1.00 0.00 ? 12 VAL B CA   6  
ATOM 4403 C C    . VAL B 2 12 ? 2.387   -1.642  -9.346  1.00 0.00 ? 12 VAL B C    6  
ATOM 4404 O O    . VAL B 2 12 ? 2.730   -2.689  -8.833  1.00 0.00 ? 12 VAL B O    6  
ATOM 4405 C CB   . VAL B 2 12 ? 0.028   -1.309  -10.322 1.00 0.00 ? 12 VAL B CB   6  
ATOM 4406 C CG1  . VAL B 2 12 ? 0.715   -1.613  -11.685 1.00 0.00 ? 12 VAL B CG1  6  
ATOM 4407 C CG2  . VAL B 2 12 ? -0.957  -2.455  -10.033 1.00 0.00 ? 12 VAL B CG2  6  
ATOM 4408 H H    . VAL B 2 12 ? 0.865   0.950   -9.354  1.00 0.00 ? 12 VAL B H    6  
ATOM 4409 H HA   . VAL B 2 12 ? 0.546   -1.740  -8.268  1.00 0.00 ? 12 VAL B HA   6  
ATOM 4410 H HB   . VAL B 2 12 ? -0.523  -0.387  -10.427 1.00 0.00 ? 12 VAL B HB   6  
ATOM 4411 H HG11 . VAL B 2 12 ? 1.272   -2.536  -11.626 1.00 0.00 ? 12 VAL B HG11 6  
ATOM 4412 H HG12 . VAL B 2 12 ? -0.030  -1.718  -12.461 1.00 0.00 ? 12 VAL B HG12 6  
ATOM 4413 H HG13 . VAL B 2 12 ? 1.389   -0.816  -11.956 1.00 0.00 ? 12 VAL B HG13 6  
ATOM 4414 H HG21 . VAL B 2 12 ? -0.412  -3.370  -9.854  1.00 0.00 ? 12 VAL B HG21 6  
ATOM 4415 H HG22 . VAL B 2 12 ? -1.547  -2.223  -9.155  1.00 0.00 ? 12 VAL B HG22 6  
ATOM 4416 H HG23 . VAL B 2 12 ? -1.618  -2.588  -10.879 1.00 0.00 ? 12 VAL B HG23 6  
ATOM 4417 N N    . GLU B 2 13 ? 3.177   -0.901  -10.103 1.00 0.00 ? 13 GLU B N    6  
ATOM 4418 C CA   . GLU B 2 13 ? 4.573   -1.399  -10.364 1.00 0.00 ? 13 GLU B CA   6  
ATOM 4419 C C    . GLU B 2 13 ? 5.285   -1.552  -8.983  1.00 0.00 ? 13 GLU B C    6  
ATOM 4420 O O    . GLU B 2 13 ? 6.046   -2.475  -8.731  1.00 0.00 ? 13 GLU B O    6  
ATOM 4421 C CB   . GLU B 2 13 ? 5.375   -0.387  -11.279 1.00 0.00 ? 13 GLU B CB   6  
ATOM 4422 C CG   . GLU B 2 13 ? 6.427   -1.162  -12.152 1.00 0.00 ? 13 GLU B CG   6  
ATOM 4423 C CD   . GLU B 2 13 ? 7.332   -2.065  -11.292 1.00 0.00 ? 13 GLU B CD   6  
ATOM 4424 O OE1  . GLU B 2 13 ? 8.147   -1.501  -10.578 1.00 0.00 ? 13 GLU B OE1  6  
ATOM 4425 O OE2  . GLU B 2 13 ? 7.149   -3.269  -11.393 1.00 0.00 ? 13 GLU B OE2  6  
ATOM 4426 H H    . GLU B 2 13 ? 2.872   -0.040  -10.484 1.00 0.00 ? 13 GLU B H    6  
ATOM 4427 H HA   . GLU B 2 13 ? 4.517   -2.330  -10.894 1.00 0.00 ? 13 GLU B HA   6  
ATOM 4428 H HB2  . GLU B 2 13 ? 4.691   0.109   -11.950 1.00 0.00 ? 13 GLU B HB2  6  
ATOM 4429 H HB3  . GLU B 2 13 ? 5.924   0.359   -10.726 1.00 0.00 ? 13 GLU B HB3  6  
ATOM 4430 H HG2  . GLU B 2 13 ? 5.925   -1.766  -12.893 1.00 0.00 ? 13 GLU B HG2  6  
ATOM 4431 H HG3  . GLU B 2 13 ? 7.068   -0.466  -12.677 1.00 0.00 ? 13 GLU B HG3  6  
ATOM 4432 N N    . ALA B 2 14 ? 4.965   -0.625  -8.106  1.00 0.00 ? 14 ALA B N    6  
ATOM 4433 C CA   . ALA B 2 14 ? 5.572   -0.619  -6.753  1.00 0.00 ? 14 ALA B CA   6  
ATOM 4434 C C    . ALA B 2 14 ? 5.064   -1.747  -5.870  1.00 0.00 ? 14 ALA B C    6  
ATOM 4435 O O    . ALA B 2 14 ? 5.881   -2.448  -5.326  1.00 0.00 ? 14 ALA B O    6  
ATOM 4436 C CB   . ALA B 2 14 ? 5.284   0.747   -6.138  1.00 0.00 ? 14 ALA B CB   6  
ATOM 4437 H H    . ALA B 2 14 ? 4.304   0.073   -8.300  1.00 0.00 ? 14 ALA B H    6  
ATOM 4438 H HA   . ALA B 2 14 ? 6.641   -0.729  -6.860  1.00 0.00 ? 14 ALA B HA   6  
ATOM 4439 H HB1  . ALA B 2 14 ? 5.711   1.514   -6.765  1.00 0.00 ? 14 ALA B HB1  6  
ATOM 4440 H HB2  . ALA B 2 14 ? 4.218   0.911   -6.054  1.00 0.00 ? 14 ALA B HB2  6  
ATOM 4441 H HB3  . ALA B 2 14 ? 5.736   0.827   -5.167  1.00 0.00 ? 14 ALA B HB3  6  
ATOM 4442 N N    . LEU B 2 15 ? 3.777   -1.927  -5.732  1.00 0.00 ? 15 LEU B N    6  
ATOM 4443 C CA   . LEU B 2 15 ? 3.305   -3.048  -4.848  1.00 0.00 ? 15 LEU B CA   6  
ATOM 4444 C C    . LEU B 2 15 ? 3.748   -4.408  -5.397  1.00 0.00 ? 15 LEU B C    6  
ATOM 4445 O O    . LEU B 2 15 ? 4.177   -5.259  -4.634  1.00 0.00 ? 15 LEU B O    6  
ATOM 4446 C CB   . LEU B 2 15 ? 1.714   -2.892  -4.701  1.00 0.00 ? 15 LEU B CB   6  
ATOM 4447 C CG   . LEU B 2 15 ? 0.889   -4.101  -4.141  1.00 0.00 ? 15 LEU B CG   6  
ATOM 4448 C CD1  . LEU B 2 15 ? -0.599  -3.645  -4.041  1.00 0.00 ? 15 LEU B CD1  6  
ATOM 4449 C CD2  . LEU B 2 15 ? 0.860   -5.325  -5.082  1.00 0.00 ? 15 LEU B CD2  6  
ATOM 4450 H H    . LEU B 2 15 ? 3.149   -1.338  -6.198  1.00 0.00 ? 15 LEU B H    6  
ATOM 4451 H HA   . LEU B 2 15 ? 3.795   -2.922  -3.903  1.00 0.00 ? 15 LEU B HA   6  
ATOM 4452 H HB2  . LEU B 2 15 ? 1.553   -2.097  -3.988  1.00 0.00 ? 15 LEU B HB2  6  
ATOM 4453 H HB3  . LEU B 2 15 ? 1.237   -2.537  -5.583  1.00 0.00 ? 15 LEU B HB3  6  
ATOM 4454 H HG   . LEU B 2 15 ? 1.271   -4.391  -3.172  1.00 0.00 ? 15 LEU B HG   6  
ATOM 4455 H HD11 . LEU B 2 15 ? -0.716  -2.786  -3.405  1.00 0.00 ? 15 LEU B HD11 6  
ATOM 4456 H HD12 . LEU B 2 15 ? -0.982  -3.396  -5.027  1.00 0.00 ? 15 LEU B HD12 6  
ATOM 4457 H HD13 . LEU B 2 15 ? -1.195  -4.439  -3.625  1.00 0.00 ? 15 LEU B HD13 6  
ATOM 4458 H HD21 . LEU B 2 15 ? 0.482   -5.044  -6.054  1.00 0.00 ? 15 LEU B HD21 6  
ATOM 4459 H HD22 . LEU B 2 15 ? 1.825   -5.776  -5.202  1.00 0.00 ? 15 LEU B HD22 6  
ATOM 4460 H HD23 . LEU B 2 15 ? 0.210   -6.069  -4.648  1.00 0.00 ? 15 LEU B HD23 6  
ATOM 4461 N N    . TYR B 2 16 ? 3.650   -4.551  -6.695  1.00 0.00 ? 16 TYR B N    6  
ATOM 4462 C CA   . TYR B 2 16 ? 4.033   -5.820  -7.377  1.00 0.00 ? 16 TYR B CA   6  
ATOM 4463 C C    . TYR B 2 16 ? 5.442   -6.246  -6.912  1.00 0.00 ? 16 TYR B C    6  
ATOM 4464 O O    . TYR B 2 16 ? 5.665   -7.418  -6.675  1.00 0.00 ? 16 TYR B O    6  
ATOM 4465 C CB   . TYR B 2 16 ? 4.086   -5.649  -8.932  1.00 0.00 ? 16 TYR B CB   6  
ATOM 4466 C CG   . TYR B 2 16 ? 2.886   -6.150  -9.758  1.00 0.00 ? 16 TYR B CG   6  
ATOM 4467 C CD1  . TYR B 2 16 ? 2.399   -7.439  -9.664  1.00 0.00 ? 16 TYR B CD1  6  
ATOM 4468 C CD2  . TYR B 2 16 ? 2.283   -5.274  -10.640 1.00 0.00 ? 16 TYR B CD2  6  
ATOM 4469 C CE1  . TYR B 2 16 ? 1.335   -7.846  -10.448 1.00 0.00 ? 16 TYR B CE1  6  
ATOM 4470 C CE2  . TYR B 2 16 ? 1.224   -5.676  -11.424 1.00 0.00 ? 16 TYR B CE2  6  
ATOM 4471 C CZ   . TYR B 2 16 ? 0.736   -6.966  -11.332 1.00 0.00 ? 16 TYR B CZ   6  
ATOM 4472 O OH   . TYR B 2 16 ? -0.329  -7.362  -12.117 1.00 0.00 ? 16 TYR B OH   6  
ATOM 4473 H H    . TYR B 2 16 ? 3.341   -3.808  -7.233  1.00 0.00 ? 16 TYR B H    6  
ATOM 4474 H HA   . TYR B 2 16 ? 3.282   -6.559  -7.104  1.00 0.00 ? 16 TYR B HA   6  
ATOM 4475 H HB2  . TYR B 2 16 ? 4.164   -4.603  -9.143  1.00 0.00 ? 16 TYR B HB2  6  
ATOM 4476 H HB3  . TYR B 2 16 ? 4.965   -6.131  -9.331  1.00 0.00 ? 16 TYR B HB3  6  
ATOM 4477 H HD1  . TYR B 2 16 ? 2.854   -8.140  -8.982  1.00 0.00 ? 16 TYR B HD1  6  
ATOM 4478 H HD2  . TYR B 2 16 ? 2.654   -4.265  -10.723 1.00 0.00 ? 16 TYR B HD2  6  
ATOM 4479 H HE1  . TYR B 2 16 ? 0.961   -8.856  -10.368 1.00 0.00 ? 16 TYR B HE1  6  
ATOM 4480 H HE2  . TYR B 2 16 ? 0.767   -4.976  -12.111 1.00 0.00 ? 16 TYR B HE2  6  
ATOM 4481 H HH   . TYR B 2 16 ? -0.480  -6.677  -12.775 1.00 0.00 ? 16 TYR B HH   6  
ATOM 4482 N N    . LEU B 2 17 ? 6.340   -5.283  -6.787  1.00 0.00 ? 17 LEU B N    6  
ATOM 4483 C CA   . LEU B 2 17 ? 7.739   -5.648  -6.352  1.00 0.00 ? 17 LEU B CA   6  
ATOM 4484 C C    . LEU B 2 17 ? 8.017   -5.493  -4.845  1.00 0.00 ? 17 LEU B C    6  
ATOM 4485 O O    . LEU B 2 17 ? 8.653   -6.363  -4.282  1.00 0.00 ? 17 LEU B O    6  
ATOM 4486 C CB   . LEU B 2 17 ? 8.773   -4.782  -7.192  1.00 0.00 ? 17 LEU B CB   6  
ATOM 4487 C CG   . LEU B 2 17 ? 10.290  -4.848  -6.717  1.00 0.00 ? 17 LEU B CG   6  
ATOM 4488 C CD1  . LEU B 2 17 ? 10.577  -3.969  -5.455  1.00 0.00 ? 17 LEU B CD1  6  
ATOM 4489 C CD2  . LEU B 2 17 ? 10.777  -6.311  -6.500  1.00 0.00 ? 17 LEU B CD2  6  
ATOM 4490 H H    . LEU B 2 17 ? 6.095   -4.349  -6.983  1.00 0.00 ? 17 LEU B H    6  
ATOM 4491 H HA   . LEU B 2 17 ? 7.921   -6.684  -6.625  1.00 0.00 ? 17 LEU B HA   6  
ATOM 4492 H HB2  . LEU B 2 17 ? 8.746   -5.155  -8.203  1.00 0.00 ? 17 LEU B HB2  6  
ATOM 4493 H HB3  . LEU B 2 17 ? 8.475   -3.745  -7.238  1.00 0.00 ? 17 LEU B HB3  6  
ATOM 4494 H HG   . LEU B 2 17 ? 10.879  -4.442  -7.525  1.00 0.00 ? 17 LEU B HG   6  
ATOM 4495 H HD11 . LEU B 2 17 ? 10.326  -2.939  -5.659  1.00 0.00 ? 17 LEU B HD11 6  
ATOM 4496 H HD12 . LEU B 2 17 ? 10.024  -4.280  -4.585  1.00 0.00 ? 17 LEU B HD12 6  
ATOM 4497 H HD13 . LEU B 2 17 ? 11.626  -4.002  -5.210  1.00 0.00 ? 17 LEU B HD13 6  
ATOM 4498 H HD21 . LEU B 2 17 ? 10.184  -6.849  -5.786  1.00 0.00 ? 17 LEU B HD21 6  
ATOM 4499 H HD22 . LEU B 2 17 ? 10.744  -6.854  -7.432  1.00 0.00 ? 17 LEU B HD22 6  
ATOM 4500 H HD23 . LEU B 2 17 ? 11.797  -6.302  -6.141  1.00 0.00 ? 17 LEU B HD23 6  
ATOM 4501 N N    . VAL B 2 18 ? 7.564   -4.430  -4.213  1.00 0.00 ? 18 VAL B N    6  
ATOM 4502 C CA   . VAL B 2 18 ? 7.815   -4.223  -2.751  1.00 0.00 ? 18 VAL B CA   6  
ATOM 4503 C C    . VAL B 2 18 ? 7.521   -5.497  -1.973  1.00 0.00 ? 18 VAL B C    6  
ATOM 4504 O O    . VAL B 2 18 ? 8.088   -5.738  -0.927  1.00 0.00 ? 18 VAL B O    6  
ATOM 4505 C CB   . VAL B 2 18 ? 6.933   -3.031  -2.255  1.00 0.00 ? 18 VAL B CB   6  
ATOM 4506 C CG1  . VAL B 2 18 ? 6.915   -2.952  -0.704  1.00 0.00 ? 18 VAL B CG1  6  
ATOM 4507 C CG2  . VAL B 2 18 ? 7.566   -1.726  -2.775  1.00 0.00 ? 18 VAL B CG2  6  
ATOM 4508 H H    . VAL B 2 18 ? 7.036   -3.757  -4.672  1.00 0.00 ? 18 VAL B H    6  
ATOM 4509 H HA   . VAL B 2 18 ? 8.858   -3.985  -2.636  1.00 0.00 ? 18 VAL B HA   6  
ATOM 4510 H HB   . VAL B 2 18 ? 5.924   -3.131  -2.630  1.00 0.00 ? 18 VAL B HB   6  
ATOM 4511 H HG11 . VAL B 2 18 ? 7.920   -2.839  -0.319  1.00 0.00 ? 18 VAL B HG11 6  
ATOM 4512 H HG12 . VAL B 2 18 ? 6.318   -2.112  -0.380  1.00 0.00 ? 18 VAL B HG12 6  
ATOM 4513 H HG13 . VAL B 2 18 ? 6.485   -3.851  -0.282  1.00 0.00 ? 18 VAL B HG13 6  
ATOM 4514 H HG21 . VAL B 2 18 ? 8.570   -1.622  -2.393  1.00 0.00 ? 18 VAL B HG21 6  
ATOM 4515 H HG22 . VAL B 2 18 ? 7.609   -1.706  -3.851  1.00 0.00 ? 18 VAL B HG22 6  
ATOM 4516 H HG23 . VAL B 2 18 ? 6.993   -0.884  -2.445  1.00 0.00 ? 18 VAL B HG23 6  
ATOM 4517 N N    . CYS B 2 19 ? 6.629   -6.268  -2.531  1.00 0.00 ? 19 CYS B N    6  
ATOM 4518 C CA   . CYS B 2 19 ? 6.256   -7.536  -1.874  1.00 0.00 ? 19 CYS B CA   6  
ATOM 4519 C C    . CYS B 2 19 ? 7.068   -8.764  -2.288  1.00 0.00 ? 19 CYS B C    6  
ATOM 4520 O O    . CYS B 2 19 ? 7.312   -9.611  -1.447  1.00 0.00 ? 19 CYS B O    6  
ATOM 4521 C CB   . CYS B 2 19 ? 4.778   -7.718  -2.146  1.00 0.00 ? 19 CYS B CB   6  
ATOM 4522 S SG   . CYS B 2 19 ? 3.720   -6.579  -1.224  1.00 0.00 ? 19 CYS B SG   6  
ATOM 4523 H H    . CYS B 2 19 ? 6.202   -6.006  -3.375  1.00 0.00 ? 19 CYS B H    6  
ATOM 4524 H HA   . CYS B 2 19 ? 6.373   -7.419  -0.807  1.00 0.00 ? 19 CYS B HA   6  
ATOM 4525 H HB2  . CYS B 2 19 ? 4.590   -7.501  -3.187  1.00 0.00 ? 19 CYS B HB2  6  
ATOM 4526 H HB3  . CYS B 2 19 ? 4.479   -8.737  -1.947  1.00 0.00 ? 19 CYS B HB3  6  
ATOM 4527 N N    . GLY B 2 20 ? 7.468   -8.867  -3.528  1.00 0.00 ? 20 GLY B N    6  
ATOM 4528 C CA   . GLY B 2 20 ? 8.259   -10.057 -3.945  1.00 0.00 ? 20 GLY B CA   6  
ATOM 4529 C C    . GLY B 2 20 ? 7.303   -11.214 -4.307  1.00 0.00 ? 20 GLY B C    6  
ATOM 4530 O O    . GLY B 2 20 ? 7.476   -11.806 -5.357  1.00 0.00 ? 20 GLY B O    6  
ATOM 4531 H H    . GLY B 2 20 ? 7.275   -8.179  -4.196  1.00 0.00 ? 20 GLY B H    6  
ATOM 4532 H HA2  . GLY B 2 20 ? 8.816   -9.774  -4.830  1.00 0.00 ? 20 GLY B HA2  6  
ATOM 4533 H HA3  . GLY B 2 20 ? 8.982   -10.337 -3.178  1.00 0.00 ? 20 GLY B HA3  6  
ATOM 4534 N N    . GLU B 2 21 ? 6.338   -11.511 -3.453  1.00 0.00 ? 21 GLU B N    6  
ATOM 4535 C CA   . GLU B 2 21 ? 5.366   -12.625 -3.738  1.00 0.00 ? 21 GLU B CA   6  
ATOM 4536 C C    . GLU B 2 21 ? 3.934   -12.248 -3.283  1.00 0.00 ? 21 GLU B C    6  
ATOM 4537 O O    . GLU B 2 21 ? 3.118   -13.099 -2.970  1.00 0.00 ? 21 GLU B O    6  
ATOM 4538 C CB   . GLU B 2 21 ? 5.918   -13.899 -2.995  1.00 0.00 ? 21 GLU B CB   6  
ATOM 4539 C CG   . GLU B 2 21 ? 5.574   -13.908 -1.474  1.00 0.00 ? 21 GLU B CG   6  
ATOM 4540 C CD   . GLU B 2 21 ? 6.004   -12.596 -0.780  1.00 0.00 ? 21 GLU B CD   6  
ATOM 4541 O OE1  . GLU B 2 21 ? 7.200   -12.453 -0.565  1.00 0.00 ? 21 GLU B OE1  6  
ATOM 4542 O OE2  . GLU B 2 21 ? 5.111   -11.806 -0.514  1.00 0.00 ? 21 GLU B OE2  6  
ATOM 4543 H H    . GLU B 2 21 ? 6.212   -11.011 -2.619  1.00 0.00 ? 21 GLU B H    6  
ATOM 4544 H HA   . GLU B 2 21 ? 5.318   -12.755 -4.805  1.00 0.00 ? 21 GLU B HA   6  
ATOM 4545 H HB2  . GLU B 2 21 ? 5.535   -14.801 -3.444  1.00 0.00 ? 21 GLU B HB2  6  
ATOM 4546 H HB3  . GLU B 2 21 ? 6.994   -13.926 -3.091  1.00 0.00 ? 21 GLU B HB3  6  
ATOM 4547 H HG2  . GLU B 2 21 ? 4.518   -14.060 -1.343  1.00 0.00 ? 21 GLU B HG2  6  
ATOM 4548 H HG3  . GLU B 2 21 ? 6.084   -14.734 -0.995  1.00 0.00 ? 21 GLU B HG3  6  
ATOM 4549 N N    . ARG B 2 22 ? 3.723   -10.961 -3.281  1.00 0.00 ? 22 ARG B N    6  
ATOM 4550 C CA   . ARG B 2 22 ? 2.437   -10.259 -2.892  1.00 0.00 ? 22 ARG B CA   6  
ATOM 4551 C C    . ARG B 2 22 ? 1.104   -11.059 -2.946  1.00 0.00 ? 22 ARG B C    6  
ATOM 4552 O O    . ARG B 2 22 ? 0.949   -11.981 -3.723  1.00 0.00 ? 22 ARG B O    6  
ATOM 4553 C CB   . ARG B 2 22 ? 2.345   -8.987  -3.785  1.00 0.00 ? 22 ARG B CB   6  
ATOM 4554 C CG   . ARG B 2 22 ? 1.634   -9.242  -5.121  1.00 0.00 ? 22 ARG B CG   6  
ATOM 4555 C CD   . ARG B 2 22 ? 2.495   -10.193 -5.986  1.00 0.00 ? 22 ARG B CD   6  
ATOM 4556 N NE   . ARG B 2 22 ? 1.823   -10.336 -7.308  1.00 0.00 ? 22 ARG B NE   6  
ATOM 4557 C CZ   . ARG B 2 22 ? 1.680   -11.512 -7.850  1.00 0.00 ? 22 ARG B CZ   6  
ATOM 4558 N NH1  . ARG B 2 22 ? 1.034   -12.453 -7.219  1.00 0.00 ? 22 ARG B NH1  6  
ATOM 4559 N NH2  . ARG B 2 22 ? 2.194   -11.697 -9.031  1.00 0.00 ? 22 ARG B NH2  6  
ATOM 4560 H H    . ARG B 2 22 ? 4.486   -10.416 -3.568  1.00 0.00 ? 22 ARG B H    6  
ATOM 4561 H HA   . ARG B 2 22 ? 2.564   -9.931  -1.871  1.00 0.00 ? 22 ARG B HA   6  
ATOM 4562 H HB2  . ARG B 2 22 ? 1.941   -8.127  -3.268  1.00 0.00 ? 22 ARG B HB2  6  
ATOM 4563 H HB3  . ARG B 2 22 ? 3.358   -8.730  -4.049  1.00 0.00 ? 22 ARG B HB3  6  
ATOM 4564 H HG2  . ARG B 2 22 ? 0.657   -9.675  -4.960  1.00 0.00 ? 22 ARG B HG2  6  
ATOM 4565 H HG3  . ARG B 2 22 ? 1.509   -8.297  -5.634  1.00 0.00 ? 22 ARG B HG3  6  
ATOM 4566 H HD2  . ARG B 2 22 ? 3.492   -9.801  -6.130  1.00 0.00 ? 22 ARG B HD2  6  
ATOM 4567 H HD3  . ARG B 2 22 ? 2.573   -11.166 -5.526  1.00 0.00 ? 22 ARG B HD3  6  
ATOM 4568 H HE   . ARG B 2 22 ? 1.489   -9.542  -7.771  1.00 0.00 ? 22 ARG B HE   6  
ATOM 4569 H HH11 . ARG B 2 22 ? 0.670   -12.300 -6.300  1.00 0.00 ? 22 ARG B HH11 6  
ATOM 4570 H HH12 . ARG B 2 22 ? 0.918   -13.341 -7.664  1.00 0.00 ? 22 ARG B HH12 6  
ATOM 4571 H HH21 . ARG B 2 22 ? 2.674   -10.948 -9.485  1.00 0.00 ? 22 ARG B HH21 6  
ATOM 4572 H HH22 . ARG B 2 22 ? 2.115   -12.588 -9.477  1.00 0.00 ? 22 ARG B HH22 6  
ATOM 4573 N N    . GLY B 2 23 ? 0.173   -10.644 -2.121  1.00 0.00 ? 23 GLY B N    6  
ATOM 4574 C CA   . GLY B 2 23 ? -1.173  -11.302 -2.051  1.00 0.00 ? 23 GLY B CA   6  
ATOM 4575 C C    . GLY B 2 23 ? -2.318  -10.348 -2.500  1.00 0.00 ? 23 GLY B C    6  
ATOM 4576 O O    . GLY B 2 23 ? -3.219  -10.130 -1.711  1.00 0.00 ? 23 GLY B O    6  
ATOM 4577 H H    . GLY B 2 23 ? 0.357   -9.890  -1.526  1.00 0.00 ? 23 GLY B H    6  
ATOM 4578 H HA2  . GLY B 2 23 ? -1.184  -12.238 -2.597  1.00 0.00 ? 23 GLY B HA2  6  
ATOM 4579 H HA3  . GLY B 2 23 ? -1.343  -11.549 -1.010  1.00 0.00 ? 23 GLY B HA3  6  
ATOM 4580 N N    . PHE B 2 24 ? -2.296  -9.797  -3.703  1.00 0.00 ? 24 PHE B N    6  
ATOM 4581 C CA   . PHE B 2 24 ? -3.389  -8.887  -4.147  1.00 0.00 ? 24 PHE B CA   6  
ATOM 4582 C C    . PHE B 2 24 ? -3.934  -9.504  -5.487  1.00 0.00 ? 24 PHE B C    6  
ATOM 4583 O O    . PHE B 2 24 ? -3.419  -10.525 -5.908  1.00 0.00 ? 24 PHE B O    6  
ATOM 4584 C CB   . PHE B 2 24 ? -2.753  -7.452  -4.337  1.00 0.00 ? 24 PHE B CB   6  
ATOM 4585 C CG   . PHE B 2 24 ? -2.109  -7.163  -5.717  1.00 0.00 ? 24 PHE B CG   6  
ATOM 4586 C CD1  . PHE B 2 24 ? -1.304  -8.072  -6.378  1.00 0.00 ? 24 PHE B CD1  6  
ATOM 4587 C CD2  . PHE B 2 24 ? -2.338  -5.924  -6.295  1.00 0.00 ? 24 PHE B CD2  6  
ATOM 4588 C CE1  . PHE B 2 24 ? -0.739  -7.741  -7.592  1.00 0.00 ? 24 PHE B CE1  6  
ATOM 4589 C CE2  . PHE B 2 24 ? -1.773  -5.595  -7.507  1.00 0.00 ? 24 PHE B CE2  6  
ATOM 4590 C CZ   . PHE B 2 24 ? -0.970  -6.507  -8.157  1.00 0.00 ? 24 PHE B CZ   6  
ATOM 4591 H H    . PHE B 2 24 ? -1.597  -9.945  -4.367  1.00 0.00 ? 24 PHE B H    6  
ATOM 4592 H HA   . PHE B 2 24 ? -4.135  -8.879  -3.357  1.00 0.00 ? 24 PHE B HA   6  
ATOM 4593 H HB2  . PHE B 2 24 ? -3.450  -6.664  -4.093  1.00 0.00 ? 24 PHE B HB2  6  
ATOM 4594 H HB3  . PHE B 2 24 ? -1.943  -7.365  -3.625  1.00 0.00 ? 24 PHE B HB3  6  
ATOM 4595 H HD1  . PHE B 2 24 ? -1.120  -9.047  -5.954  1.00 0.00 ? 24 PHE B HD1  6  
ATOM 4596 H HD2  . PHE B 2 24 ? -2.970  -5.202  -5.797  1.00 0.00 ? 24 PHE B HD2  6  
ATOM 4597 H HE1  . PHE B 2 24 ? -0.114  -8.451  -8.114  1.00 0.00 ? 24 PHE B HE1  6  
ATOM 4598 H HE2  . PHE B 2 24 ? -1.966  -4.627  -7.941  1.00 0.00 ? 24 PHE B HE2  6  
ATOM 4599 H HZ   . PHE B 2 24 ? -0.518  -6.252  -9.104  1.00 0.00 ? 24 PHE B HZ   6  
ATOM 4600 N N    . PHE B 2 25 ? -4.928  -8.927  -6.128  1.00 0.00 ? 25 PHE B N    6  
ATOM 4601 C CA   . PHE B 2 25 ? -5.469  -9.481  -7.410  1.00 0.00 ? 25 PHE B CA   6  
ATOM 4602 C C    . PHE B 2 25 ? -5.526  -8.271  -8.347  1.00 0.00 ? 25 PHE B C    6  
ATOM 4603 O O    . PHE B 2 25 ? -6.091  -7.261  -7.972  1.00 0.00 ? 25 PHE B O    6  
ATOM 4604 C CB   . PHE B 2 25 ? -6.924  -10.016 -7.294  1.00 0.00 ? 25 PHE B CB   6  
ATOM 4605 C CG   . PHE B 2 25 ? -7.217  -10.991 -6.135  1.00 0.00 ? 25 PHE B CG   6  
ATOM 4606 C CD1  . PHE B 2 25 ? -6.827  -12.315 -6.186  1.00 0.00 ? 25 PHE B CD1  6  
ATOM 4607 C CD2  . PHE B 2 25 ? -7.907  -10.542 -5.023  1.00 0.00 ? 25 PHE B CD2  6  
ATOM 4608 C CE1  . PHE B 2 25 ? -7.121  -13.175 -5.141  1.00 0.00 ? 25 PHE B CE1  6  
ATOM 4609 C CE2  . PHE B 2 25 ? -8.204  -11.397 -3.976  1.00 0.00 ? 25 PHE B CE2  6  
ATOM 4610 C CZ   . PHE B 2 25 ? -7.813  -12.717 -4.039  1.00 0.00 ? 25 PHE B CZ   6  
ATOM 4611 H H    . PHE B 2 25 ? -5.350  -8.112  -5.804  1.00 0.00 ? 25 PHE B H    6  
ATOM 4612 H HA   . PHE B 2 25 ? -4.798  -10.224 -7.815  1.00 0.00 ? 25 PHE B HA   6  
ATOM 4613 H HB2  . PHE B 2 25 ? -7.615  -9.189  -7.205  1.00 0.00 ? 25 PHE B HB2  6  
ATOM 4614 H HB3  . PHE B 2 25 ? -7.154  -10.528 -8.216  1.00 0.00 ? 25 PHE B HB3  6  
ATOM 4615 H HD1  . PHE B 2 25 ? -6.285  -12.675 -7.045  1.00 0.00 ? 25 PHE B HD1  6  
ATOM 4616 H HD2  . PHE B 2 25 ? -8.219  -9.510  -4.973  1.00 0.00 ? 25 PHE B HD2  6  
ATOM 4617 H HE1  . PHE B 2 25 ? -6.818  -14.210 -5.185  1.00 0.00 ? 25 PHE B HE1  6  
ATOM 4618 H HE2  . PHE B 2 25 ? -8.745  -11.031 -3.114  1.00 0.00 ? 25 PHE B HE2  6  
ATOM 4619 H HZ   . PHE B 2 25 ? -8.041  -13.394 -3.224  1.00 0.00 ? 25 PHE B HZ   6  
ATOM 4620 N N    . TYR B 2 26 ? -4.963  -8.372  -9.527  1.00 0.00 ? 26 TYR B N    6  
ATOM 4621 C CA   . TYR B 2 26 ? -5.013  -7.198  -10.447 1.00 0.00 ? 26 TYR B CA   6  
ATOM 4622 C C    . TYR B 2 26 ? -5.146  -7.647  -11.896 1.00 0.00 ? 26 TYR B C    6  
ATOM 4623 O O    . TYR B 2 26 ? -4.346  -7.362  -12.766 1.00 0.00 ? 26 TYR B O    6  
ATOM 4624 C CB   . TYR B 2 26 ? -3.745  -6.347  -10.277 1.00 0.00 ? 26 TYR B CB   6  
ATOM 4625 C CG   . TYR B 2 26 ? -4.156  -4.917  -10.696 1.00 0.00 ? 26 TYR B CG   6  
ATOM 4626 C CD1  . TYR B 2 26 ? -5.013  -4.199  -9.875  1.00 0.00 ? 26 TYR B CD1  6  
ATOM 4627 C CD2  . TYR B 2 26 ? -3.718  -4.334  -11.871 1.00 0.00 ? 26 TYR B CD2  6  
ATOM 4628 C CE1  . TYR B 2 26 ? -5.425  -2.931  -10.217 1.00 0.00 ? 26 TYR B CE1  6  
ATOM 4629 C CE2  . TYR B 2 26 ? -4.136  -3.058  -12.211 1.00 0.00 ? 26 TYR B CE2  6  
ATOM 4630 C CZ   . TYR B 2 26 ? -4.992  -2.350  -11.385 1.00 0.00 ? 26 TYR B CZ   6  
ATOM 4631 O OH   . TYR B 2 26 ? -5.416  -1.073  -11.712 1.00 0.00 ? 26 TYR B OH   6  
ATOM 4632 H H    . TYR B 2 26 ? -4.525  -9.196  -9.812  1.00 0.00 ? 26 TYR B H    6  
ATOM 4633 H HA   . TYR B 2 26 ? -5.888  -6.610  -10.214 1.00 0.00 ? 26 TYR B HA   6  
ATOM 4634 H HB2  . TYR B 2 26 ? -3.449  -6.350  -9.240  1.00 0.00 ? 26 TYR B HB2  6  
ATOM 4635 H HB3  . TYR B 2 26 ? -2.932  -6.708  -10.898 1.00 0.00 ? 26 TYR B HB3  6  
ATOM 4636 H HD1  . TYR B 2 26 ? -5.367  -4.637  -8.955  1.00 0.00 ? 26 TYR B HD1  6  
ATOM 4637 H HD2  . TYR B 2 26 ? -3.052  -4.875  -12.525 1.00 0.00 ? 26 TYR B HD2  6  
ATOM 4638 H HE1  . TYR B 2 26 ? -6.092  -2.387  -9.567  1.00 0.00 ? 26 TYR B HE1  6  
ATOM 4639 H HE2  . TYR B 2 26 ? -3.791  -2.607  -13.128 1.00 0.00 ? 26 TYR B HE2  6  
ATOM 4640 H HH   . TYR B 2 26 ? -5.059  -0.836  -12.570 1.00 0.00 ? 26 TYR B HH   6  
ATOM 4641 N N    . THR B 2 27 ? -6.215  -8.362  -12.069 1.00 0.00 ? 27 THR B N    6  
ATOM 4642 C CA   . THR B 2 27 ? -6.601  -8.931  -13.391 1.00 0.00 ? 27 THR B CA   6  
ATOM 4643 C C    . THR B 2 27 ? -7.995  -8.356  -13.827 1.00 0.00 ? 27 THR B C    6  
ATOM 4644 O O    . THR B 2 27 ? -8.920  -9.140  -13.919 1.00 0.00 ? 27 THR B O    6  
ATOM 4645 C CB   . THR B 2 27 ? -6.611  -10.473 -13.222 1.00 0.00 ? 27 THR B CB   6  
ATOM 4646 O OG1  . THR B 2 27 ? -7.419  -10.720 -12.079 1.00 0.00 ? 27 THR B OG1  6  
ATOM 4647 C CG2  . THR B 2 27 ? -5.203  -10.991 -12.810 1.00 0.00 ? 27 THR B CG2  6  
ATOM 4648 H H    . THR B 2 27 ? -6.778  -8.533  -11.284 1.00 0.00 ? 27 THR B H    6  
ATOM 4649 H HA   . THR B 2 27 ? -5.841  -8.761  -14.139 1.00 0.00 ? 27 THR B HA   6  
ATOM 4650 H HB   . THR B 2 27 ? -7.014  -10.981 -14.087 1.00 0.00 ? 27 THR B HB   6  
ATOM 4651 H HG1  . THR B 2 27 ? -8.188  -11.215 -12.362 1.00 0.00 ? 27 THR B HG1  6  
ATOM 4652 H HG21 . THR B 2 27 ? -4.888  -10.531 -11.883 1.00 0.00 ? 27 THR B HG21 6  
ATOM 4653 H HG22 . THR B 2 27 ? -5.211  -12.063 -12.679 1.00 0.00 ? 27 THR B HG22 6  
ATOM 4654 H HG23 . THR B 2 27 ? -4.476  -10.746 -13.565 1.00 0.00 ? 27 THR B HG23 6  
ATOM 4655 N N    . PRO B 2 28 ? -8.136  -7.055  -14.073 1.00 0.00 ? 28 PRO B N    6  
ATOM 4656 C CA   . PRO B 2 28 ? -9.463  -6.391  -14.342 1.00 0.00 ? 28 PRO B CA   6  
ATOM 4657 C C    . PRO B 2 28 ? -10.516 -7.210  -15.128 1.00 0.00 ? 28 PRO B C    6  
ATOM 4658 O O    . PRO B 2 28 ? -10.152 -8.031  -15.944 1.00 0.00 ? 28 PRO B O    6  
ATOM 4659 C CB   . PRO B 2 28 ? -9.067  -5.110  -15.041 1.00 0.00 ? 28 PRO B CB   6  
ATOM 4660 C CG   . PRO B 2 28 ? -7.830  -4.709  -14.200 1.00 0.00 ? 28 PRO B CG   6  
ATOM 4661 C CD   . PRO B 2 28 ? -7.048  -6.015  -14.141 1.00 0.00 ? 28 PRO B CD   6  
ATOM 4662 H HA   . PRO B 2 28 ? -9.862  -6.095  -13.375 1.00 0.00 ? 28 PRO B HA   6  
ATOM 4663 H HB2  . PRO B 2 28 ? -8.811  -5.293  -16.079 1.00 0.00 ? 28 PRO B HB2  6  
ATOM 4664 H HB3  . PRO B 2 28 ? -9.833  -4.356  -14.968 1.00 0.00 ? 28 PRO B HB3  6  
ATOM 4665 H HG2  . PRO B 2 28 ? -7.246  -3.941  -14.678 1.00 0.00 ? 28 PRO B HG2  6  
ATOM 4666 H HG3  . PRO B 2 28 ? -8.097  -4.393  -13.200 1.00 0.00 ? 28 PRO B HG3  6  
ATOM 4667 H HD2  . PRO B 2 28 ? -6.481  -6.081  -15.057 1.00 0.00 ? 28 PRO B HD2  6  
ATOM 4668 H HD3  . PRO B 2 28 ? -6.436  -6.022  -13.252 1.00 0.00 ? 28 PRO B HD3  6  
ATOM 4669 N N    . LYS B 2 29 ? -11.783 -6.950  -14.879 1.00 0.00 ? 29 LYS B N    6  
ATOM 4670 C CA   . LYS B 2 29 ? -12.886 -7.695  -15.585 1.00 0.00 ? 29 LYS B CA   6  
ATOM 4671 C C    . LYS B 2 29 ? -13.822 -6.850  -16.477 1.00 0.00 ? 29 LYS B C    6  
ATOM 4672 O O    . LYS B 2 29 ? -15.019 -6.801  -16.253 1.00 0.00 ? 29 LYS B O    6  
ATOM 4673 C CB   . LYS B 2 29 ? -13.759 -8.430  -14.534 1.00 0.00 ? 29 LYS B CB   6  
ATOM 4674 C CG   . LYS B 2 29 ? -13.001 -9.480  -13.715 1.00 0.00 ? 29 LYS B CG   6  
ATOM 4675 C CD   . LYS B 2 29 ? -12.378 -10.549 -14.631 1.00 0.00 ? 29 LYS B CD   6  
ATOM 4676 C CE   . LYS B 2 29 ? -11.761 -11.630 -13.747 1.00 0.00 ? 29 LYS B CE   6  
ATOM 4677 N NZ   . LYS B 2 29 ? -11.038 -12.621 -14.585 1.00 0.00 ? 29 LYS B NZ   6  
ATOM 4678 H H    . LYS B 2 29 ? -12.016 -6.258  -14.227 1.00 0.00 ? 29 LYS B H    6  
ATOM 4679 H HA   . LYS B 2 29 ? -12.437 -8.437  -16.229 1.00 0.00 ? 29 LYS B HA   6  
ATOM 4680 H HB2  . LYS B 2 29 ? -14.172 -7.683  -13.871 1.00 0.00 ? 29 LYS B HB2  6  
ATOM 4681 H HB3  . LYS B 2 29 ? -14.581 -8.922  -15.032 1.00 0.00 ? 29 LYS B HB3  6  
ATOM 4682 H HG2  . LYS B 2 29 ? -12.256 -9.010  -13.088 1.00 0.00 ? 29 LYS B HG2  6  
ATOM 4683 H HG3  . LYS B 2 29 ? -13.732 -9.955  -13.075 1.00 0.00 ? 29 LYS B HG3  6  
ATOM 4684 H HD2  . LYS B 2 29 ? -13.140 -10.978 -15.264 1.00 0.00 ? 29 LYS B HD2  6  
ATOM 4685 H HD3  . LYS B 2 29 ? -11.604 -10.118 -15.249 1.00 0.00 ? 29 LYS B HD3  6  
ATOM 4686 H HE2  . LYS B 2 29 ? -11.064 -11.198 -13.048 1.00 0.00 ? 29 LYS B HE2  6  
ATOM 4687 H HE3  . LYS B 2 29 ? -12.541 -12.140 -13.204 1.00 0.00 ? 29 LYS B HE3  6  
ATOM 4688 H HZ1  . LYS B 2 29 ? -11.118 -12.357 -15.587 1.00 0.00 ? 29 LYS B HZ1  6  
ATOM 4689 H HZ2  . LYS B 2 29 ? -10.037 -12.637 -14.311 1.00 0.00 ? 29 LYS B HZ2  6  
ATOM 4690 H HZ3  . LYS B 2 29 ? -11.447 -13.564 -14.440 1.00 0.00 ? 29 LYS B HZ3  6  
ATOM 4691 N N    . THR B 2 30 ? -13.264 -6.215  -17.465 1.00 0.00 ? 30 THR B N    6  
ATOM 4692 C CA   . THR B 2 30 ? -14.073 -5.373  -18.402 1.00 0.00 ? 30 THR B CA   6  
ATOM 4693 C C    . THR B 2 30 ? -14.059 -6.049  -19.777 1.00 0.00 ? 30 THR B C    6  
ATOM 4694 O O    . THR B 2 30 ? -14.400 -7.205  -19.928 1.00 0.00 ? 30 THR B O    6  
ATOM 4695 C CB   . THR B 2 30 ? -13.451 -3.964  -18.477 1.00 0.00 ? 30 THR B CB   6  
ATOM 4696 O OG1  . THR B 2 30 ? -13.982 -3.303  -17.339 1.00 0.00 ? 30 THR B OG1  6  
ATOM 4697 C CG2  . THR B 2 30 ? -13.975 -3.162  -19.691 1.00 0.00 ? 30 THR B CG2  6  
ATOM 4698 H H    . THR B 2 30 ? -12.293 -6.289  -17.592 1.00 0.00 ? 30 THR B H    6  
ATOM 4699 H HA   . THR B 2 30 ? -15.094 -5.303  -18.055 1.00 0.00 ? 30 THR B HA   6  
ATOM 4700 H HB   . THR B 2 30 ? -12.372 -3.984  -18.417 1.00 0.00 ? 30 THR B HB   6  
ATOM 4701 H HG1  . THR B 2 30 ? -13.264 -3.086  -16.741 1.00 0.00 ? 30 THR B HG1  6  
ATOM 4702 H HG21 . THR B 2 30 ? -15.052 -3.067  -19.639 1.00 0.00 ? 30 THR B HG21 6  
ATOM 4703 H HG22 . THR B 2 30 ? -13.536 -2.174  -19.717 1.00 0.00 ? 30 THR B HG22 6  
ATOM 4704 H HG23 . THR B 2 30 ? -13.708 -3.666  -20.608 1.00 0.00 ? 30 THR B HG23 6  
ATOM 4705 N N    . GLY A 1 1  ? -3.204  -4.961  -1.454  1.00 0.00 ? 1  GLY A N    7  
ATOM 4706 C CA   . GLY A 1 1  ? -3.601  -5.846  -2.576  1.00 0.00 ? 1  GLY A CA   7  
ATOM 4707 C C    . GLY A 1 1  ? -4.697  -5.150  -3.366  1.00 0.00 ? 1  GLY A C    7  
ATOM 4708 O O    . GLY A 1 1  ? -5.736  -5.727  -3.626  1.00 0.00 ? 1  GLY A O    7  
ATOM 4709 H H1   . GLY A 1 1  ? -3.799  -4.108  -1.455  1.00 0.00 ? 1  GLY A H1   7  
ATOM 4710 H H2   . GLY A 1 1  ? -3.336  -5.491  -0.572  1.00 0.00 ? 1  GLY A H2   7  
ATOM 4711 H H3   . GLY A 1 1  ? -2.206  -4.687  -1.559  1.00 0.00 ? 1  GLY A H3   7  
ATOM 4712 H HA2  . GLY A 1 1  ? -2.749  -6.045  -3.210  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 4713 H HA3  . GLY A 1 1  ? -3.988  -6.771  -2.176  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 4714 N N    . ILE A 1 2  ? -4.425  -3.916  -3.712  1.00 0.00 ? 2  ILE A N    7  
ATOM 4715 C CA   . ILE A 1 2  ? -5.407  -3.111  -4.497  1.00 0.00 ? 2  ILE A CA   7  
ATOM 4716 C C    . ILE A 1 2  ? -4.714  -2.506  -5.702  1.00 0.00 ? 2  ILE A C    7  
ATOM 4717 O O    . ILE A 1 2  ? -3.509  -2.581  -5.849  1.00 0.00 ? 2  ILE A O    7  
ATOM 4718 C CB   . ILE A 1 2  ? -6.017  -1.962  -3.615  1.00 0.00 ? 2  ILE A CB   7  
ATOM 4719 C CG1  . ILE A 1 2  ? -4.952  -0.947  -3.075  1.00 0.00 ? 2  ILE A CG1  7  
ATOM 4720 C CG2  . ILE A 1 2  ? -6.836  -2.551  -2.452  1.00 0.00 ? 2  ILE A CG2  7  
ATOM 4721 C CD1  . ILE A 1 2  ? -4.782  0.262   -4.034  1.00 0.00 ? 2  ILE A CD1  7  
ATOM 4722 H H    . ILE A 1 2  ? -3.567  -3.519  -3.457  1.00 0.00 ? 2  ILE A H    7  
ATOM 4723 H HA   . ILE A 1 2  ? -6.195  -3.751  -4.858  1.00 0.00 ? 2  ILE A HA   7  
ATOM 4724 H HB   . ILE A 1 2  ? -6.709  -1.420  -4.246  1.00 0.00 ? 2  ILE A HB   7  
ATOM 4725 H HG12 . ILE A 1 2  ? -5.265  -0.580  -2.108  1.00 0.00 ? 2  ILE A HG12 7  
ATOM 4726 H HG13 . ILE A 1 2  ? -3.995  -1.441  -2.963  1.00 0.00 ? 2  ILE A HG13 7  
ATOM 4727 H HG21 . ILE A 1 2  ? -7.632  -3.167  -2.838  1.00 0.00 ? 2  ILE A HG21 7  
ATOM 4728 H HG22 . ILE A 1 2  ? -6.225  -3.151  -1.800  1.00 0.00 ? 2  ILE A HG22 7  
ATOM 4729 H HG23 . ILE A 1 2  ? -7.268  -1.743  -1.881  1.00 0.00 ? 2  ILE A HG23 7  
ATOM 4730 H HD11 . ILE A 1 2  ? -5.725  0.774   -4.156  1.00 0.00 ? 2  ILE A HD11 7  
ATOM 4731 H HD12 . ILE A 1 2  ? -4.080  0.963   -3.611  1.00 0.00 ? 2  ILE A HD12 7  
ATOM 4732 H HD13 . ILE A 1 2  ? -4.430  -0.038  -5.009  1.00 0.00 ? 2  ILE A HD13 7  
ATOM 4733 N N    . VAL A 1 3  ? -5.531  -1.919  -6.529  1.00 0.00 ? 3  VAL A N    7  
ATOM 4734 C CA   . VAL A 1 3  ? -5.046  -1.265  -7.772  1.00 0.00 ? 3  VAL A CA   7  
ATOM 4735 C C    . VAL A 1 3  ? -5.681  0.129   -7.866  1.00 0.00 ? 3  VAL A C    7  
ATOM 4736 O O    . VAL A 1 3  ? -6.478  0.469   -7.014  1.00 0.00 ? 3  VAL A O    7  
ATOM 4737 C CB   . VAL A 1 3  ? -5.443  -2.173  -8.953  1.00 0.00 ? 3  VAL A CB   7  
ATOM 4738 C CG1  . VAL A 1 3  ? -4.714  -3.519  -8.782  1.00 0.00 ? 3  VAL A CG1  7  
ATOM 4739 C CG2  . VAL A 1 3  ? -6.968  -2.468  -8.918  1.00 0.00 ? 3  VAL A CG2  7  
ATOM 4740 H H    . VAL A 1 3  ? -6.490  -1.905  -6.332  1.00 0.00 ? 3  VAL A H    7  
ATOM 4741 H HA   . VAL A 1 3  ? -3.974  -1.149  -7.724  1.00 0.00 ? 3  VAL A HA   7  
ATOM 4742 H HB   . VAL A 1 3  ? -5.162  -1.720  -9.894  1.00 0.00 ? 3  VAL A HB   7  
ATOM 4743 H HG11 . VAL A 1 3  ? -3.647  -3.382  -8.751  1.00 0.00 ? 3  VAL A HG11 7  
ATOM 4744 H HG12 . VAL A 1 3  ? -5.035  -4.035  -7.886  1.00 0.00 ? 3  VAL A HG12 7  
ATOM 4745 H HG13 . VAL A 1 3  ? -4.951  -4.128  -9.628  1.00 0.00 ? 3  VAL A HG13 7  
ATOM 4746 H HG21 . VAL A 1 3  ? -7.536  -1.552  -8.970  1.00 0.00 ? 3  VAL A HG21 7  
ATOM 4747 H HG22 . VAL A 1 3  ? -7.241  -3.099  -9.754  1.00 0.00 ? 3  VAL A HG22 7  
ATOM 4748 H HG23 . VAL A 1 3  ? -7.232  -2.983  -8.005  1.00 0.00 ? 3  VAL A HG23 7  
ATOM 4749 N N    . GLU A 1 4  ? -5.305  0.865   -8.889  1.00 0.00 ? 4  GLU A N    7  
ATOM 4750 C CA   . GLU A 1 4  ? -5.801  2.264   -9.170  1.00 0.00 ? 4  GLU A CA   7  
ATOM 4751 C C    . GLU A 1 4  ? -6.831  2.804   -8.170  1.00 0.00 ? 4  GLU A C    7  
ATOM 4752 O O    . GLU A 1 4  ? -8.019  2.574   -8.304  1.00 0.00 ? 4  GLU A O    7  
ATOM 4753 C CB   . GLU A 1 4  ? -6.421  2.292   -10.571 1.00 0.00 ? 4  GLU A CB   7  
ATOM 4754 C CG   . GLU A 1 4  ? -6.303  3.689   -11.239 1.00 0.00 ? 4  GLU A CG   7  
ATOM 4755 C CD   . GLU A 1 4  ? -6.886  4.869   -10.414 1.00 0.00 ? 4  GLU A CD   7  
ATOM 4756 O OE1  . GLU A 1 4  ? -6.271  5.267   -9.437  1.00 0.00 ? 4  GLU A OE1  7  
ATOM 4757 O OE2  . GLU A 1 4  ? -7.943  5.327   -10.814 1.00 0.00 ? 4  GLU A OE2  7  
ATOM 4758 H H    . GLU A 1 4  ? -4.657  0.479   -9.515  1.00 0.00 ? 4  GLU A H    7  
ATOM 4759 H HA   . GLU A 1 4  ? -4.947  2.925   -9.137  1.00 0.00 ? 4  GLU A HA   7  
ATOM 4760 H HB2  . GLU A 1 4  ? -5.920  1.562   -11.189 1.00 0.00 ? 4  GLU A HB2  7  
ATOM 4761 H HB3  . GLU A 1 4  ? -7.465  2.021   -10.516 1.00 0.00 ? 4  GLU A HB3  7  
ATOM 4762 H HG2  . GLU A 1 4  ? -5.265  3.893   -11.462 1.00 0.00 ? 4  GLU A HG2  7  
ATOM 4763 H HG3  . GLU A 1 4  ? -6.843  3.632   -12.170 1.00 0.00 ? 4  GLU A HG3  7  
ATOM 4764 N N    . GLN A 1 5  ? -6.333  3.501   -7.186  1.00 0.00 ? 5  GLN A N    7  
ATOM 4765 C CA   . GLN A 1 5  ? -7.259  4.066   -6.161  1.00 0.00 ? 5  GLN A CA   7  
ATOM 4766 C C    . GLN A 1 5  ? -6.662  5.348   -5.550  1.00 0.00 ? 5  GLN A C    7  
ATOM 4767 O O    . GLN A 1 5  ? -6.613  5.531   -4.350  1.00 0.00 ? 5  GLN A O    7  
ATOM 4768 C CB   . GLN A 1 5  ? -7.476  2.928   -5.146  1.00 0.00 ? 5  GLN A CB   7  
ATOM 4769 C CG   . GLN A 1 5  ? -8.709  3.137   -4.258  1.00 0.00 ? 5  GLN A CG   7  
ATOM 4770 C CD   . GLN A 1 5  ? -8.899  1.801   -3.534  1.00 0.00 ? 5  GLN A CD   7  
ATOM 4771 O OE1  . GLN A 1 5  ? -9.517  0.892   -4.053  1.00 0.00 ? 5  GLN A OE1  7  
ATOM 4772 N NE2  . GLN A 1 5  ? -8.380  1.623   -2.351  1.00 0.00 ? 5  GLN A NE2  7  
ATOM 4773 H H    . GLN A 1 5  ? -5.365  3.649   -7.127  1.00 0.00 ? 5  GLN A H    7  
ATOM 4774 H HA   . GLN A 1 5  ? -8.189  4.334   -6.647  1.00 0.00 ? 5  GLN A HA   7  
ATOM 4775 H HB2  . GLN A 1 5  ? -7.583  1.996   -5.678  1.00 0.00 ? 5  GLN A HB2  7  
ATOM 4776 H HB3  . GLN A 1 5  ? -6.604  2.840   -4.516  1.00 0.00 ? 5  GLN A HB3  7  
ATOM 4777 H HG2  . GLN A 1 5  ? -8.561  3.936   -3.551  1.00 0.00 ? 5  GLN A HG2  7  
ATOM 4778 H HG3  . GLN A 1 5  ? -9.590  3.333   -4.851  1.00 0.00 ? 5  GLN A HG3  7  
ATOM 4779 H HE21 . GLN A 1 5  ? -7.886  2.349   -1.920  1.00 0.00 ? 5  GLN A HE21 7  
ATOM 4780 H HE22 . GLN A 1 5  ? -8.485  0.761   -1.893  1.00 0.00 ? 5  GLN A HE22 7  
ATOM 4781 N N    . CYS A 1 6  ? -6.227  6.191   -6.450  1.00 0.00 ? 6  CYS A N    7  
ATOM 4782 C CA   . CYS A 1 6  ? -5.597  7.522   -6.158  1.00 0.00 ? 6  CYS A CA   7  
ATOM 4783 C C    . CYS A 1 6  ? -5.321  8.066   -4.729  1.00 0.00 ? 6  CYS A C    7  
ATOM 4784 O O    . CYS A 1 6  ? -6.165  8.661   -4.084  1.00 0.00 ? 6  CYS A O    7  
ATOM 4785 C CB   . CYS A 1 6  ? -6.415  8.585   -6.914  1.00 0.00 ? 6  CYS A CB   7  
ATOM 4786 S SG   . CYS A 1 6  ? -6.129  8.802   -8.690  1.00 0.00 ? 6  CYS A SG   7  
ATOM 4787 H H    . CYS A 1 6  ? -6.305  5.937   -7.390  1.00 0.00 ? 6  CYS A H    7  
ATOM 4788 H HA   . CYS A 1 6  ? -4.646  7.492   -6.650  1.00 0.00 ? 6  CYS A HA   7  
ATOM 4789 H HB2  . CYS A 1 6  ? -7.462  8.349   -6.792  1.00 0.00 ? 6  CYS A HB2  7  
ATOM 4790 H HB3  . CYS A 1 6  ? -6.243  9.549   -6.458  1.00 0.00 ? 6  CYS A HB3  7  
ATOM 4791 N N    . CYS A 1 7  ? -4.100  7.799   -4.344  1.00 0.00 ? 7  CYS A N    7  
ATOM 4792 C CA   . CYS A 1 7  ? -3.432  8.162   -3.053  1.00 0.00 ? 7  CYS A CA   7  
ATOM 4793 C C    . CYS A 1 7  ? -4.339  8.188   -1.839  1.00 0.00 ? 7  CYS A C    7  
ATOM 4794 O O    . CYS A 1 7  ? -4.245  9.033   -0.971  1.00 0.00 ? 7  CYS A O    7  
ATOM 4795 C CB   . CYS A 1 7  ? -2.753  9.553   -3.244  1.00 0.00 ? 7  CYS A CB   7  
ATOM 4796 S SG   . CYS A 1 7  ? -1.968  10.287  -1.784  1.00 0.00 ? 7  CYS A SG   7  
ATOM 4797 H H    . CYS A 1 7  ? -3.577  7.285   -4.972  1.00 0.00 ? 7  CYS A H    7  
ATOM 4798 H HA   . CYS A 1 7  ? -2.684  7.403   -2.880  1.00 0.00 ? 7  CYS A HA   7  
ATOM 4799 H HB2  . CYS A 1 7  ? -2.000  9.473   -4.006  1.00 0.00 ? 7  CYS A HB2  7  
ATOM 4800 H HB3  . CYS A 1 7  ? -3.499  10.242  -3.607  1.00 0.00 ? 7  CYS A HB3  7  
ATOM 4801 N N    . THR A 1 8  ? -5.189  7.208   -1.871  1.00 0.00 ? 8  THR A N    7  
ATOM 4802 C CA   . THR A 1 8  ? -6.214  6.976   -0.797  1.00 0.00 ? 8  THR A CA   7  
ATOM 4803 C C    . THR A 1 8  ? -6.122  7.856   0.470   1.00 0.00 ? 8  THR A C    7  
ATOM 4804 O O    . THR A 1 8  ? -6.987  8.674   0.715   1.00 0.00 ? 8  THR A O    7  
ATOM 4805 C CB   . THR A 1 8  ? -6.152  5.491   -0.341  1.00 0.00 ? 8  THR A CB   7  
ATOM 4806 O OG1  . THR A 1 8  ? -4.827  5.252   0.123   1.00 0.00 ? 8  THR A OG1  7  
ATOM 4807 C CG2  . THR A 1 8  ? -6.317  4.539   -1.535  1.00 0.00 ? 8  THR A CG2  7  
ATOM 4808 H H    . THR A 1 8  ? -5.126  6.624   -2.662  1.00 0.00 ? 8  THR A H    7  
ATOM 4809 H HA   . THR A 1 8  ? -7.185  7.146   -1.235  1.00 0.00 ? 8  THR A HA   7  
ATOM 4810 H HB   . THR A 1 8  ? -6.864  5.279   0.446   1.00 0.00 ? 8  THR A HB   7  
ATOM 4811 H HG1  . THR A 1 8  ? -4.771  5.507   1.048   1.00 0.00 ? 8  THR A HG1  7  
ATOM 4812 H HG21 . THR A 1 8  ? -5.531  4.716   -2.255  1.00 0.00 ? 8  THR A HG21 7  
ATOM 4813 H HG22 . THR A 1 8  ? -6.264  3.513   -1.205  1.00 0.00 ? 8  THR A HG22 7  
ATOM 4814 H HG23 . THR A 1 8  ? -7.275  4.713   -2.010  1.00 0.00 ? 8  THR A HG23 7  
ATOM 4815 N N    . SER A 1 9  ? -5.071  7.657   1.231   1.00 0.00 ? 9  SER A N    7  
ATOM 4816 C CA   . SER A 1 9  ? -4.858  8.435   2.497   1.00 0.00 ? 9  SER A CA   7  
ATOM 4817 C C    . SER A 1 9  ? -3.522  9.183   2.677   1.00 0.00 ? 9  SER A C    7  
ATOM 4818 O O    . SER A 1 9  ? -3.501  10.398  2.712   1.00 0.00 ? 9  SER A O    7  
ATOM 4819 C CB   . SER A 1 9  ? -5.081  7.434   3.659   1.00 0.00 ? 9  SER A CB   7  
ATOM 4820 O OG   . SER A 1 9  ? -4.212  6.347   3.348   1.00 0.00 ? 9  SER A OG   7  
ATOM 4821 H H    . SER A 1 9  ? -4.419  6.980   0.961   1.00 0.00 ? 9  SER A H    7  
ATOM 4822 H HA   . SER A 1 9  ? -5.637  9.165   2.570   1.00 0.00 ? 9  SER A HA   7  
ATOM 4823 H HB2  . SER A 1 9  ? -4.848  7.847   4.631   1.00 0.00 ? 9  SER A HB2  7  
ATOM 4824 H HB3  . SER A 1 9  ? -6.102  7.076   3.659   1.00 0.00 ? 9  SER A HB3  7  
ATOM 4825 H HG   . SER A 1 9  ? -4.344  6.111   2.427   1.00 0.00 ? 9  SER A HG   7  
ATOM 4826 N N    . ILE A 1 10 ? -2.460  8.428   2.786   1.00 0.00 ? 10 ILE A N    7  
ATOM 4827 C CA   . ILE A 1 10 ? -1.076  8.986   2.979   1.00 0.00 ? 10 ILE A CA   7  
ATOM 4828 C C    . ILE A 1 10 ? -0.081  8.563   1.882   1.00 0.00 ? 10 ILE A C    7  
ATOM 4829 O O    . ILE A 1 10 ? 1.057   8.976   1.941   1.00 0.00 ? 10 ILE A O    7  
ATOM 4830 C CB   . ILE A 1 10 ? -0.593  8.523   4.421   1.00 0.00 ? 10 ILE A CB   7  
ATOM 4831 C CG1  . ILE A 1 10 ? -1.552  9.047   5.523   1.00 0.00 ? 10 ILE A CG1  7  
ATOM 4832 C CG2  . ILE A 1 10 ? 0.866   8.944   4.777   1.00 0.00 ? 10 ILE A CG2  7  
ATOM 4833 C CD1  . ILE A 1 10 ? -1.636  10.587  5.563   1.00 0.00 ? 10 ILE A CD1  7  
ATOM 4834 H H    . ILE A 1 10 ? -2.608  7.466   2.734   1.00 0.00 ? 10 ILE A H    7  
ATOM 4835 H HA   . ILE A 1 10 ? -1.126  10.065  2.962   1.00 0.00 ? 10 ILE A HA   7  
ATOM 4836 H HB   . ILE A 1 10 ? -0.631  7.445   4.456   1.00 0.00 ? 10 ILE A HB   7  
ATOM 4837 H HG12 . ILE A 1 10 ? -2.540  8.655   5.337   1.00 0.00 ? 10 ILE A HG12 7  
ATOM 4838 H HG13 . ILE A 1 10 ? -1.219  8.692   6.487   1.00 0.00 ? 10 ILE A HG13 7  
ATOM 4839 H HG21 . ILE A 1 10 ? 0.989   10.011  4.699   1.00 0.00 ? 10 ILE A HG21 7  
ATOM 4840 H HG22 . ILE A 1 10 ? 1.096   8.644   5.790   1.00 0.00 ? 10 ILE A HG22 7  
ATOM 4841 H HG23 . ILE A 1 10 ? 1.579   8.460   4.128   1.00 0.00 ? 10 ILE A HG23 7  
ATOM 4842 H HD11 . ILE A 1 10 ? -0.668  11.025  5.759   1.00 0.00 ? 10 ILE A HD11 7  
ATOM 4843 H HD12 . ILE A 1 10 ? -2.011  10.983  4.633   1.00 0.00 ? 10 ILE A HD12 7  
ATOM 4844 H HD13 . ILE A 1 10 ? -2.315  10.870  6.351   1.00 0.00 ? 10 ILE A HD13 7  
ATOM 4845 N N    . CYS A 1 11 ? -0.524  7.781   0.923   1.00 0.00 ? 11 CYS A N    7  
ATOM 4846 C CA   . CYS A 1 11 ? 0.333   7.284   -0.214  1.00 0.00 ? 11 CYS A CA   7  
ATOM 4847 C C    . CYS A 1 11 ? 1.859   7.549   -0.131  1.00 0.00 ? 11 CYS A C    7  
ATOM 4848 O O    . CYS A 1 11 ? 2.445   8.283   -0.904  1.00 0.00 ? 11 CYS A O    7  
ATOM 4849 C CB   . CYS A 1 11 ? -0.193  7.886   -1.528  1.00 0.00 ? 11 CYS A CB   7  
ATOM 4850 S SG   . CYS A 1 11 ? -0.056  9.657   -1.874  1.00 0.00 ? 11 CYS A SG   7  
ATOM 4851 H H    . CYS A 1 11 ? -1.464  7.497   0.946   1.00 0.00 ? 11 CYS A H    7  
ATOM 4852 H HA   . CYS A 1 11 ? 0.189   6.211   -0.272  1.00 0.00 ? 11 CYS A HA   7  
ATOM 4853 H HB2  . CYS A 1 11 ? 0.301   7.385   -2.346  1.00 0.00 ? 11 CYS A HB2  7  
ATOM 4854 H HB3  . CYS A 1 11 ? -1.241  7.643   -1.568  1.00 0.00 ? 11 CYS A HB3  7  
ATOM 4855 N N    . SER A 1 12 ? 2.423   6.903   0.852   1.00 0.00 ? 12 SER A N    7  
ATOM 4856 C CA   . SER A 1 12 ? 3.867   6.955   1.179   1.00 0.00 ? 12 SER A CA   7  
ATOM 4857 C C    . SER A 1 12 ? 4.295   5.526   0.787   1.00 0.00 ? 12 SER A C    7  
ATOM 4858 O O    . SER A 1 12 ? 3.448   4.663   0.650   1.00 0.00 ? 12 SER A O    7  
ATOM 4859 C CB   . SER A 1 12 ? 3.994   7.239   2.699   1.00 0.00 ? 12 SER A CB   7  
ATOM 4860 O OG   . SER A 1 12 ? 3.425   6.112   3.357   1.00 0.00 ? 12 SER A OG   7  
ATOM 4861 H H    . SER A 1 12 ? 1.880   6.336   1.424   1.00 0.00 ? 12 SER A H    7  
ATOM 4862 H HA   . SER A 1 12 ? 4.371   7.683   0.557   1.00 0.00 ? 12 SER A HA   7  
ATOM 4863 H HB2  . SER A 1 12 ? 5.001   7.380   3.055   1.00 0.00 ? 12 SER A HB2  7  
ATOM 4864 H HB3  . SER A 1 12 ? 3.409   8.111   2.953   1.00 0.00 ? 12 SER A HB3  7  
ATOM 4865 H HG   . SER A 1 12 ? 3.037   5.509   2.720   1.00 0.00 ? 12 SER A HG   7  
ATOM 4866 N N    . LEU A 1 13 ? 5.563   5.281   0.624   1.00 0.00 ? 13 LEU A N    7  
ATOM 4867 C CA   . LEU A 1 13 ? 5.967   3.899   0.237   1.00 0.00 ? 13 LEU A CA   7  
ATOM 4868 C C    . LEU A 1 13 ? 6.012   2.906   1.391   1.00 0.00 ? 13 LEU A C    7  
ATOM 4869 O O    . LEU A 1 13 ? 5.772   1.733   1.165   1.00 0.00 ? 13 LEU A O    7  
ATOM 4870 C CB   . LEU A 1 13 ? 7.342   3.934   -0.448  1.00 0.00 ? 13 LEU A CB   7  
ATOM 4871 C CG   . LEU A 1 13 ? 7.388   4.937   -1.648  1.00 0.00 ? 13 LEU A CG   7  
ATOM 4872 C CD1  . LEU A 1 13 ? 8.712   4.751   -2.420  1.00 0.00 ? 13 LEU A CD1  7  
ATOM 4873 C CD2  . LEU A 1 13 ? 6.207   4.746   -2.634  1.00 0.00 ? 13 LEU A CD2  7  
ATOM 4874 H H    . LEU A 1 13 ? 6.210   5.996   0.748   1.00 0.00 ? 13 LEU A H    7  
ATOM 4875 H HA   . LEU A 1 13 ? 5.233   3.530   -0.443  1.00 0.00 ? 13 LEU A HA   7  
ATOM 4876 H HB2  . LEU A 1 13 ? 8.088   4.163   0.288   1.00 0.00 ? 13 LEU A HB2  7  
ATOM 4877 H HB3  . LEU A 1 13 ? 7.549   2.947   -0.829  1.00 0.00 ? 13 LEU A HB3  7  
ATOM 4878 H HG   . LEU A 1 13 ? 7.371   5.946   -1.268  1.00 0.00 ? 13 LEU A HG   7  
ATOM 4879 H HD11 . LEU A 1 13 ? 8.785   3.736   -2.781  1.00 0.00 ? 13 LEU A HD11 7  
ATOM 4880 H HD12 . LEU A 1 13 ? 8.745   5.414   -3.278  1.00 0.00 ? 13 LEU A HD12 7  
ATOM 4881 H HD13 . LEU A 1 13 ? 9.554   4.955   -1.773  1.00 0.00 ? 13 LEU A HD13 7  
ATOM 4882 H HD21 . LEU A 1 13 ? 6.174   3.732   -3.011  1.00 0.00 ? 13 LEU A HD21 7  
ATOM 4883 H HD22 . LEU A 1 13 ? 5.273   4.955   -2.143  1.00 0.00 ? 13 LEU A HD22 7  
ATOM 4884 H HD23 . LEU A 1 13 ? 6.311   5.428   -3.469  1.00 0.00 ? 13 LEU A HD23 7  
ATOM 4885 N N    . TYR A 1 14 ? 6.287   3.347   2.592   1.00 0.00 ? 14 TYR A N    7  
ATOM 4886 C CA   . TYR A 1 14 ? 6.328   2.361   3.716   1.00 0.00 ? 14 TYR A CA   7  
ATOM 4887 C C    . TYR A 1 14 ? 4.880   1.856   3.909   1.00 0.00 ? 14 TYR A C    7  
ATOM 4888 O O    . TYR A 1 14 ? 4.688   0.712   4.277   1.00 0.00 ? 14 TYR A O    7  
ATOM 4889 C CB   . TYR A 1 14 ? 6.884   3.058   5.001   1.00 0.00 ? 14 TYR A CB   7  
ATOM 4890 C CG   . TYR A 1 14 ? 7.247   1.994   6.068   1.00 0.00 ? 14 TYR A CG   7  
ATOM 4891 C CD1  . TYR A 1 14 ? 6.273   1.390   6.839   1.00 0.00 ? 14 TYR A CD1  7  
ATOM 4892 C CD2  . TYR A 1 14 ? 8.569   1.633   6.268   1.00 0.00 ? 14 TYR A CD2  7  
ATOM 4893 C CE1  . TYR A 1 14 ? 6.609   0.446   7.792   1.00 0.00 ? 14 TYR A CE1  7  
ATOM 4894 C CE2  . TYR A 1 14 ? 8.904   0.692   7.218   1.00 0.00 ? 14 TYR A CE2  7  
ATOM 4895 C CZ   . TYR A 1 14 ? 7.926   0.092   7.987   1.00 0.00 ? 14 TYR A CZ   7  
ATOM 4896 O OH   . TYR A 1 14 ? 8.271   -0.848  8.938   1.00 0.00 ? 14 TYR A OH   7  
ATOM 4897 H H    . TYR A 1 14 ? 6.444   4.299   2.734   1.00 0.00 ? 14 TYR A H    7  
ATOM 4898 H HA   . TYR A 1 14 ? 6.964   1.540   3.430   1.00 0.00 ? 14 TYR A HA   7  
ATOM 4899 H HB2  . TYR A 1 14 ? 7.779   3.616   4.759   1.00 0.00 ? 14 TYR A HB2  7  
ATOM 4900 H HB3  . TYR A 1 14 ? 6.166   3.737   5.435   1.00 0.00 ? 14 TYR A HB3  7  
ATOM 4901 H HD1  . TYR A 1 14 ? 5.241   1.662   6.699   1.00 0.00 ? 14 TYR A HD1  7  
ATOM 4902 H HD2  . TYR A 1 14 ? 9.350   2.084   5.677   1.00 0.00 ? 14 TYR A HD2  7  
ATOM 4903 H HE1  . TYR A 1 14 ? 5.839   -0.025  8.387   1.00 0.00 ? 14 TYR A HE1  7  
ATOM 4904 H HE2  . TYR A 1 14 ? 9.943   0.427   7.367   1.00 0.00 ? 14 TYR A HE2  7  
ATOM 4905 H HH   . TYR A 1 14 ? 9.210   -1.023  8.836   1.00 0.00 ? 14 TYR A HH   7  
ATOM 4906 N N    . GLN A 1 15 ? 3.896   2.701   3.652   1.00 0.00 ? 15 GLN A N    7  
ATOM 4907 C CA   . GLN A 1 15 ? 2.471   2.269   3.814   1.00 0.00 ? 15 GLN A CA   7  
ATOM 4908 C C    . GLN A 1 15 ? 2.180   1.205   2.754   1.00 0.00 ? 15 GLN A C    7  
ATOM 4909 O O    . GLN A 1 15 ? 1.325   0.377   2.980   1.00 0.00 ? 15 GLN A O    7  
ATOM 4910 C CB   . GLN A 1 15 ? 1.453   3.426   3.578   1.00 0.00 ? 15 GLN A CB   7  
ATOM 4911 C CG   . GLN A 1 15 ? 0.067   2.975   4.110   1.00 0.00 ? 15 GLN A CG   7  
ATOM 4912 C CD   . GLN A 1 15 ? -1.062  3.983   3.826   1.00 0.00 ? 15 GLN A CD   7  
ATOM 4913 O OE1  . GLN A 1 15 ? -2.187  3.748   4.218   1.00 0.00 ? 15 GLN A OE1  7  
ATOM 4914 N NE2  . GLN A 1 15 ? -0.860  5.093   3.171   1.00 0.00 ? 15 GLN A NE2  7  
ATOM 4915 H H    . GLN A 1 15 ? 4.070   3.615   3.356   1.00 0.00 ? 15 GLN A H    7  
ATOM 4916 H HA   . GLN A 1 15 ? 2.338   1.847   4.796   1.00 0.00 ? 15 GLN A HA   7  
ATOM 4917 H HB2  . GLN A 1 15 ? 1.742   4.315   4.104   1.00 0.00 ? 15 GLN A HB2  7  
ATOM 4918 H HB3  . GLN A 1 15 ? 1.378   3.641   2.525   1.00 0.00 ? 15 GLN A HB3  7  
ATOM 4919 H HG2  . GLN A 1 15 ? -0.223  2.024   3.696   1.00 0.00 ? 15 GLN A HG2  7  
ATOM 4920 H HG3  . GLN A 1 15 ? 0.147   2.872   5.184   1.00 0.00 ? 15 GLN A HG3  7  
ATOM 4921 H HE21 . GLN A 1 15 ? 0.027   5.321   2.825   1.00 0.00 ? 15 GLN A HE21 7  
ATOM 4922 H HE22 . GLN A 1 15 ? -1.625  5.693   3.034   1.00 0.00 ? 15 GLN A HE22 7  
ATOM 4923 N N    . LEU A 1 16 ? 2.876   1.228   1.638   1.00 0.00 ? 16 LEU A N    7  
ATOM 4924 C CA   . LEU A 1 16 ? 2.586   0.186   0.598   1.00 0.00 ? 16 LEU A CA   7  
ATOM 4925 C C    . LEU A 1 16 ? 3.174   -1.156  1.025   1.00 0.00 ? 16 LEU A C    7  
ATOM 4926 O O    . LEU A 1 16 ? 2.686   -2.198  0.631   1.00 0.00 ? 16 LEU A O    7  
ATOM 4927 C CB   . LEU A 1 16 ? 3.179   0.640   -0.748  1.00 0.00 ? 16 LEU A CB   7  
ATOM 4928 C CG   . LEU A 1 16 ? 2.544   2.006   -1.144  1.00 0.00 ? 16 LEU A CG   7  
ATOM 4929 C CD1  . LEU A 1 16 ? 3.234   2.501   -2.424  1.00 0.00 ? 16 LEU A CD1  7  
ATOM 4930 C CD2  . LEU A 1 16 ? 1.016   1.848   -1.427  1.00 0.00 ? 16 LEU A CD2  7  
ATOM 4931 H H    . LEU A 1 16 ? 3.580   1.905   1.481   1.00 0.00 ? 16 LEU A H    7  
ATOM 4932 H HA   . LEU A 1 16 ? 1.521   0.055   0.513   1.00 0.00 ? 16 LEU A HA   7  
ATOM 4933 H HB2  . LEU A 1 16 ? 4.256   0.720   -0.676  1.00 0.00 ? 16 LEU A HB2  7  
ATOM 4934 H HB3  . LEU A 1 16 ? 2.945   -0.094  -1.505  1.00 0.00 ? 16 LEU A HB3  7  
ATOM 4935 H HG   . LEU A 1 16 ? 2.696   2.730   -0.360  1.00 0.00 ? 16 LEU A HG   7  
ATOM 4936 H HD11 . LEU A 1 16 ? 4.293   2.610   -2.247  1.00 0.00 ? 16 LEU A HD11 7  
ATOM 4937 H HD12 . LEU A 1 16 ? 3.092   1.786   -3.220  1.00 0.00 ? 16 LEU A HD12 7  
ATOM 4938 H HD13 . LEU A 1 16 ? 2.827   3.456   -2.724  1.00 0.00 ? 16 LEU A HD13 7  
ATOM 4939 H HD21 . LEU A 1 16 ? 0.497   1.487   -0.555  1.00 0.00 ? 16 LEU A HD21 7  
ATOM 4940 H HD22 . LEU A 1 16 ? 0.574   2.800   -1.681  1.00 0.00 ? 16 LEU A HD22 7  
ATOM 4941 H HD23 . LEU A 1 16 ? 0.854   1.162   -2.246  1.00 0.00 ? 16 LEU A HD23 7  
ATOM 4942 N N    . GLU A 1 17 ? 4.202   -1.111  1.834   1.00 0.00 ? 17 GLU A N    7  
ATOM 4943 C CA   . GLU A 1 17 ? 4.824   -2.389  2.297   1.00 0.00 ? 17 GLU A CA   7  
ATOM 4944 C C    . GLU A 1 17 ? 3.788   -3.129  3.175   1.00 0.00 ? 17 GLU A C    7  
ATOM 4945 O O    . GLU A 1 17 ? 3.968   -4.294  3.470   1.00 0.00 ? 17 GLU A O    7  
ATOM 4946 C CB   . GLU A 1 17 ? 6.080   -2.090  3.125   1.00 0.00 ? 17 GLU A CB   7  
ATOM 4947 C CG   . GLU A 1 17 ? 7.060   -1.239  2.287   1.00 0.00 ? 17 GLU A CG   7  
ATOM 4948 C CD   . GLU A 1 17 ? 8.369   -1.020  3.069   1.00 0.00 ? 17 GLU A CD   7  
ATOM 4949 O OE1  . GLU A 1 17 ? 8.276   -0.511  4.173   1.00 0.00 ? 17 GLU A OE1  7  
ATOM 4950 O OE2  . GLU A 1 17 ? 9.394   -1.378  2.511   1.00 0.00 ? 17 GLU A OE2  7  
ATOM 4951 H H    . GLU A 1 17 ? 4.555   -0.250  2.139   1.00 0.00 ? 17 GLU A H    7  
ATOM 4952 H HA   . GLU A 1 17 ? 5.068   -3.003  1.439   1.00 0.00 ? 17 GLU A HA   7  
ATOM 4953 H HB2  . GLU A 1 17 ? 5.799   -1.560  4.023   1.00 0.00 ? 17 GLU A HB2  7  
ATOM 4954 H HB3  . GLU A 1 17 ? 6.549   -3.020  3.417   1.00 0.00 ? 17 GLU A HB3  7  
ATOM 4955 H HG2  . GLU A 1 17 ? 7.263   -1.743  1.352   1.00 0.00 ? 17 GLU A HG2  7  
ATOM 4956 H HG3  . GLU A 1 17 ? 6.632   -0.274  2.072   1.00 0.00 ? 17 GLU A HG3  7  
ATOM 4957 N N    . ASN A 1 18 ? 2.741   -2.428  3.567   1.00 0.00 ? 18 ASN A N    7  
ATOM 4958 C CA   . ASN A 1 18 ? 1.668   -3.032  4.420   1.00 0.00 ? 18 ASN A CA   7  
ATOM 4959 C C    . ASN A 1 18 ? 1.023   -4.245  3.744   1.00 0.00 ? 18 ASN A C    7  
ATOM 4960 O O    . ASN A 1 18 ? 0.389   -5.044  4.405   1.00 0.00 ? 18 ASN A O    7  
ATOM 4961 C CB   . ASN A 1 18 ? 0.573   -1.966  4.728   1.00 0.00 ? 18 ASN A CB   7  
ATOM 4962 C CG   . ASN A 1 18 ? -0.336  -1.620  3.537   1.00 0.00 ? 18 ASN A CG   7  
ATOM 4963 O OD1  . ASN A 1 18 ? -1.425  -1.104  3.696   1.00 0.00 ? 18 ASN A OD1  7  
ATOM 4964 N ND2  . ASN A 1 18 ? 0.064   -1.869  2.329   1.00 0.00 ? 18 ASN A ND2  7  
ATOM 4965 H H    . ASN A 1 18 ? 2.658   -1.491  3.294   1.00 0.00 ? 18 ASN A H    7  
ATOM 4966 H HA   . ASN A 1 18 ? 2.116   -3.370  5.342   1.00 0.00 ? 18 ASN A HA   7  
ATOM 4967 H HB2  . ASN A 1 18 ? -0.032  -2.302  5.545   1.00 0.00 ? 18 ASN A HB2  7  
ATOM 4968 H HB3  . ASN A 1 18 ? 1.066   -1.058  5.036   1.00 0.00 ? 18 ASN A HB3  7  
ATOM 4969 H HD21 . ASN A 1 18 ? 0.938   -2.279  2.163   1.00 0.00 ? 18 ASN A HD21 7  
ATOM 4970 H HD22 . ASN A 1 18 ? -0.523  -1.641  1.583   1.00 0.00 ? 18 ASN A HD22 7  
ATOM 4971 N N    . TYR A 1 19 ? 1.205   -4.350  2.450   1.00 0.00 ? 19 TYR A N    7  
ATOM 4972 C CA   . TYR A 1 19 ? 0.614   -5.498  1.707   1.00 0.00 ? 19 TYR A CA   7  
ATOM 4973 C C    . TYR A 1 19 ? 1.619   -6.661  1.667   1.00 0.00 ? 19 TYR A C    7  
ATOM 4974 O O    . TYR A 1 19 ? 1.619   -7.434  0.729   1.00 0.00 ? 19 TYR A O    7  
ATOM 4975 C CB   . TYR A 1 19 ? 0.288   -5.071  0.259   1.00 0.00 ? 19 TYR A CB   7  
ATOM 4976 C CG   . TYR A 1 19 ? -0.597  -3.816  0.191   1.00 0.00 ? 19 TYR A CG   7  
ATOM 4977 C CD1  . TYR A 1 19 ? -1.861  -3.803  0.749   1.00 0.00 ? 19 TYR A CD1  7  
ATOM 4978 C CD2  . TYR A 1 19 ? -0.145  -2.677  -0.448  1.00 0.00 ? 19 TYR A CD2  7  
ATOM 4979 C CE1  . TYR A 1 19 ? -2.654  -2.672  0.663   1.00 0.00 ? 19 TYR A CE1  7  
ATOM 4980 C CE2  . TYR A 1 19 ? -0.932  -1.550  -0.534  1.00 0.00 ? 19 TYR A CE2  7  
ATOM 4981 C CZ   . TYR A 1 19 ? -2.193  -1.537  0.021   1.00 0.00 ? 19 TYR A CZ   7  
ATOM 4982 O OH   . TYR A 1 19 ? -2.987  -0.414  -0.072  1.00 0.00 ? 19 TYR A OH   7  
ATOM 4983 H H    . TYR A 1 19 ? 1.731   -3.678  1.967   1.00 0.00 ? 19 TYR A H    7  
ATOM 4984 H HA   . TYR A 1 19 ? -0.294  -5.827  2.192   1.00 0.00 ? 19 TYR A HA   7  
ATOM 4985 H HB2  . TYR A 1 19 ? 1.202   -4.909  -0.296  1.00 0.00 ? 19 TYR A HB2  7  
ATOM 4986 H HB3  . TYR A 1 19 ? -0.257  -5.876  -0.212  1.00 0.00 ? 19 TYR A HB3  7  
ATOM 4987 H HD1  . TYR A 1 19 ? -2.239  -4.683  1.254   1.00 0.00 ? 19 TYR A HD1  7  
ATOM 4988 H HD2  . TYR A 1 19 ? 0.836   -2.662  -0.877  1.00 0.00 ? 19 TYR A HD2  7  
ATOM 4989 H HE1  . TYR A 1 19 ? -3.644  -2.675  1.101   1.00 0.00 ? 19 TYR A HE1  7  
ATOM 4990 H HE2  . TYR A 1 19 ? -0.563  -0.669  -1.036  1.00 0.00 ? 19 TYR A HE2  7  
ATOM 4991 H HH   . TYR A 1 19 ? -3.762  -0.546  0.482   1.00 0.00 ? 19 TYR A HH   7  
ATOM 4992 N N    . CYS A 1 20 ? 2.450   -6.771  2.676   1.00 0.00 ? 20 CYS A N    7  
ATOM 4993 C CA   . CYS A 1 20 ? 3.440   -7.892  2.690   1.00 0.00 ? 20 CYS A CA   7  
ATOM 4994 C C    . CYS A 1 20 ? 3.077   -8.841  3.841   1.00 0.00 ? 20 CYS A C    7  
ATOM 4995 O O    . CYS A 1 20 ? 3.903   -9.603  4.304   1.00 0.00 ? 20 CYS A O    7  
ATOM 4996 C CB   . CYS A 1 20 ? 4.861   -7.340  2.902   1.00 0.00 ? 20 CYS A CB   7  
ATOM 4997 S SG   . CYS A 1 20 ? 6.141   -8.593  2.627   1.00 0.00 ? 20 CYS A SG   7  
ATOM 4998 H H    . CYS A 1 20 ? 2.431   -6.126  3.415   1.00 0.00 ? 20 CYS A H    7  
ATOM 4999 H HA   . CYS A 1 20 ? 3.403   -8.447  1.765   1.00 0.00 ? 20 CYS A HA   7  
ATOM 5000 H HB2  . CYS A 1 20 ? 5.052   -6.488  2.264   1.00 0.00 ? 20 CYS A HB2  7  
ATOM 5001 H HB3  . CYS A 1 20 ? 4.936   -7.017  3.927   1.00 0.00 ? 20 CYS A HB3  7  
ATOM 5002 N N    . ASN A 1 21 ? 1.830   -8.737  4.241   1.00 0.00 ? 21 ASN A N    7  
ATOM 5003 C CA   . ASN A 1 21 ? 1.178   -9.529  5.337   1.00 0.00 ? 21 ASN A CA   7  
ATOM 5004 C C    . ASN A 1 21 ? 2.118   -10.480 6.110   1.00 0.00 ? 21 ASN A C    7  
ATOM 5005 O O    . ASN A 1 21 ? 2.077   -11.691 6.002   1.00 0.00 ? 21 ASN A O    7  
ATOM 5006 C CB   . ASN A 1 21 ? 0.037   -10.300 4.662   1.00 0.00 ? 21 ASN A CB   7  
ATOM 5007 C CG   . ASN A 1 21 ? -1.047  -10.679 5.671   1.00 0.00 ? 21 ASN A CG   7  
ATOM 5008 O OD1  . ASN A 1 21 ? -0.815  -11.274 6.705   1.00 0.00 ? 21 ASN A OD1  7  
ATOM 5009 N ND2  . ASN A 1 21 ? -2.271  -10.338 5.378   1.00 0.00 ? 21 ASN A ND2  7  
ATOM 5010 H H    . ASN A 1 21 ? 1.260   -8.079  3.792   1.00 0.00 ? 21 ASN A H    7  
ATOM 5011 H HA   . ASN A 1 21 ? 0.775   -8.829  6.054   1.00 0.00 ? 21 ASN A HA   7  
ATOM 5012 H HB2  . ASN A 1 21 ? -0.415  -9.678  3.904   1.00 0.00 ? 21 ASN A HB2  7  
ATOM 5013 H HB3  . ASN A 1 21 ? 0.405   -11.199 4.196   1.00 0.00 ? 21 ASN A HB3  7  
ATOM 5014 H HD21 . ASN A 1 21 ? -2.447  -9.854  4.542   1.00 0.00 ? 21 ASN A HD21 7  
ATOM 5015 H HD22 . ASN A 1 21 ? -3.013  -10.561 5.980   1.00 0.00 ? 21 ASN A HD22 7  
ATOM 5016 N N    . PHE B 2 1  ? 8.254   9.324   -1.804  1.00 0.00 ? 1  PHE B N    7  
ATOM 5017 C CA   . PHE B 2 1  ? 7.951   10.461  -0.887  1.00 0.00 ? 1  PHE B CA   7  
ATOM 5018 C C    . PHE B 2 1  ? 6.504   10.946  -1.113  1.00 0.00 ? 1  PHE B C    7  
ATOM 5019 O O    . PHE B 2 1  ? 5.942   10.774  -2.178  1.00 0.00 ? 1  PHE B O    7  
ATOM 5020 C CB   . PHE B 2 1  ? 8.980   11.613  -1.157  1.00 0.00 ? 1  PHE B CB   7  
ATOM 5021 C CG   . PHE B 2 1  ? 8.637   12.874  -0.333  1.00 0.00 ? 1  PHE B CG   7  
ATOM 5022 C CD1  . PHE B 2 1  ? 8.345   12.788  1.021   1.00 0.00 ? 1  PHE B CD1  7  
ATOM 5023 C CD2  . PHE B 2 1  ? 8.601   14.121  -0.940  1.00 0.00 ? 1  PHE B CD2  7  
ATOM 5024 C CE1  . PHE B 2 1  ? 8.024   13.915  1.746   1.00 0.00 ? 1  PHE B CE1  7  
ATOM 5025 C CE2  . PHE B 2 1  ? 8.277   15.253  -0.210  1.00 0.00 ? 1  PHE B CE2  7  
ATOM 5026 C CZ   . PHE B 2 1  ? 7.988   15.143  1.130   1.00 0.00 ? 1  PHE B CZ   7  
ATOM 5027 H H1   . PHE B 2 1  ? 7.416   9.123   -2.385  1.00 0.00 ? 1  PHE B H1   7  
ATOM 5028 H H2   . PHE B 2 1  ? 9.057   9.567   -2.425  1.00 0.00 ? 1  PHE B H2   7  
ATOM 5029 H H3   . PHE B 2 1  ? 8.496   8.487   -1.235  1.00 0.00 ? 1  PHE B H3   7  
ATOM 5030 H HA   . PHE B 2 1  ? 8.035   10.109  0.133   1.00 0.00 ? 1  PHE B HA   7  
ATOM 5031 H HB2  . PHE B 2 1  ? 9.984   11.303  -0.903  1.00 0.00 ? 1  PHE B HB2  7  
ATOM 5032 H HB3  . PHE B 2 1  ? 8.964   11.874  -2.206  1.00 0.00 ? 1  PHE B HB3  7  
ATOM 5033 H HD1  . PHE B 2 1  ? 8.373   11.830  1.517   1.00 0.00 ? 1  PHE B HD1  7  
ATOM 5034 H HD2  . PHE B 2 1  ? 8.835   14.221  -1.989  1.00 0.00 ? 1  PHE B HD2  7  
ATOM 5035 H HE1  . PHE B 2 1  ? 7.794   13.844  2.799   1.00 0.00 ? 1  PHE B HE1  7  
ATOM 5036 H HE2  . PHE B 2 1  ? 8.249   16.219  -0.693  1.00 0.00 ? 1  PHE B HE2  7  
ATOM 5037 H HZ   . PHE B 2 1  ? 7.732   16.022  1.700   1.00 0.00 ? 1  PHE B HZ   7  
ATOM 5038 N N    . VAL B 2 2  ? 5.963   11.551  -0.085  1.00 0.00 ? 2  VAL B N    7  
ATOM 5039 C CA   . VAL B 2 2  ? 4.573   12.089  -0.119  1.00 0.00 ? 2  VAL B CA   7  
ATOM 5040 C C    . VAL B 2 2  ? 4.554   13.570  -0.470  1.00 0.00 ? 2  VAL B C    7  
ATOM 5041 O O    . VAL B 2 2  ? 5.591   14.193  -0.585  1.00 0.00 ? 2  VAL B O    7  
ATOM 5042 C CB   . VAL B 2 2  ? 3.891   11.877  1.271   1.00 0.00 ? 2  VAL B CB   7  
ATOM 5043 C CG1  . VAL B 2 2  ? 3.504   10.410  1.385   1.00 0.00 ? 2  VAL B CG1  7  
ATOM 5044 C CG2  . VAL B 2 2  ? 4.856   12.215  2.443   1.00 0.00 ? 2  VAL B CG2  7  
ATOM 5045 H H    . VAL B 2 2  ? 6.484   11.648  0.733   1.00 0.00 ? 2  VAL B H    7  
ATOM 5046 H HA   . VAL B 2 2  ? 4.017   11.562  -0.879  1.00 0.00 ? 2  VAL B HA   7  
ATOM 5047 H HB   . VAL B 2 2  ? 2.999   12.483  1.350   1.00 0.00 ? 2  VAL B HB   7  
ATOM 5048 H HG11 . VAL B 2 2  ? 4.380   9.781   1.306   1.00 0.00 ? 2  VAL B HG11 7  
ATOM 5049 H HG12 . VAL B 2 2  ? 3.028   10.230  2.336   1.00 0.00 ? 2  VAL B HG12 7  
ATOM 5050 H HG13 . VAL B 2 2  ? 2.807   10.164  0.600   1.00 0.00 ? 2  VAL B HG13 7  
ATOM 5051 H HG21 . VAL B 2 2  ? 5.209   13.235  2.382   1.00 0.00 ? 2  VAL B HG21 7  
ATOM 5052 H HG22 . VAL B 2 2  ? 4.334   12.091  3.382   1.00 0.00 ? 2  VAL B HG22 7  
ATOM 5053 H HG23 . VAL B 2 2  ? 5.712   11.556  2.446   1.00 0.00 ? 2  VAL B HG23 7  
ATOM 5054 N N    . ASN B 2 3  ? 3.349   14.066  -0.631  1.00 0.00 ? 3  ASN B N    7  
ATOM 5055 C CA   . ASN B 2 3  ? 3.078   15.501  -0.989  1.00 0.00 ? 3  ASN B CA   7  
ATOM 5056 C C    . ASN B 2 3  ? 3.500   15.563  -2.469  1.00 0.00 ? 3  ASN B C    7  
ATOM 5057 O O    . ASN B 2 3  ? 4.140   16.497  -2.914  1.00 0.00 ? 3  ASN B O    7  
ATOM 5058 C CB   . ASN B 2 3  ? 3.955   16.483  -0.129  1.00 0.00 ? 3  ASN B CB   7  
ATOM 5059 C CG   . ASN B 2 3  ? 3.789   16.240  1.383   1.00 0.00 ? 3  ASN B CG   7  
ATOM 5060 O OD1  . ASN B 2 3  ? 3.611   15.137  1.856   1.00 0.00 ? 3  ASN B OD1  7  
ATOM 5061 N ND2  . ASN B 2 3  ? 3.853   17.265  2.190   1.00 0.00 ? 3  ASN B ND2  7  
ATOM 5062 H H    . ASN B 2 3  ? 2.589   13.455  -0.507  1.00 0.00 ? 3  ASN B H    7  
ATOM 5063 H HA   . ASN B 2 3  ? 2.023   15.710  -0.905  1.00 0.00 ? 3  ASN B HA   7  
ATOM 5064 H HB2  . ASN B 2 3  ? 4.999   16.429  -0.392  1.00 0.00 ? 3  ASN B HB2  7  
ATOM 5065 H HB3  . ASN B 2 3  ? 3.617   17.489  -0.336  1.00 0.00 ? 3  ASN B HB3  7  
ATOM 5066 H HD21 . ASN B 2 3  ? 3.996   18.166  1.831   1.00 0.00 ? 3  ASN B HD21 7  
ATOM 5067 H HD22 . ASN B 2 3  ? 3.753   17.121  3.156   1.00 0.00 ? 3  ASN B HD22 7  
ATOM 5068 N N    . GLN B 2 4  ? 3.110   14.528  -3.174  1.00 0.00 ? 4  GLN B N    7  
ATOM 5069 C CA   . GLN B 2 4  ? 3.419   14.375  -4.624  1.00 0.00 ? 4  GLN B CA   7  
ATOM 5070 C C    . GLN B 2 4  ? 2.133   13.883  -5.366  1.00 0.00 ? 4  GLN B C    7  
ATOM 5071 O O    . GLN B 2 4  ? 1.052   13.950  -4.812  1.00 0.00 ? 4  GLN B O    7  
ATOM 5072 C CB   . GLN B 2 4  ? 4.603   13.366  -4.655  1.00 0.00 ? 4  GLN B CB   7  
ATOM 5073 C CG   . GLN B 2 4  ? 5.374   13.276  -5.992  1.00 0.00 ? 4  GLN B CG   7  
ATOM 5074 C CD   . GLN B 2 4  ? 6.411   12.152  -5.864  1.00 0.00 ? 4  GLN B CD   7  
ATOM 5075 O OE1  . GLN B 2 4  ? 7.332   12.203  -5.071  1.00 0.00 ? 4  GLN B OE1  7  
ATOM 5076 N NE2  . GLN B 2 4  ? 6.287   11.110  -6.635  1.00 0.00 ? 4  GLN B NE2  7  
ATOM 5077 H H    . GLN B 2 4  ? 2.589   13.825  -2.737  1.00 0.00 ? 4  GLN B H    7  
ATOM 5078 H HA   . GLN B 2 4  ? 3.692   15.360  -4.984  1.00 0.00 ? 4  GLN B HA   7  
ATOM 5079 H HB2  . GLN B 2 4  ? 5.301   13.646  -3.881  1.00 0.00 ? 4  GLN B HB2  7  
ATOM 5080 H HB3  . GLN B 2 4  ? 4.230   12.384  -4.402  1.00 0.00 ? 4  GLN B HB3  7  
ATOM 5081 H HG2  . GLN B 2 4  ? 4.739   13.030  -6.821  1.00 0.00 ? 4  GLN B HG2  7  
ATOM 5082 H HG3  . GLN B 2 4  ? 5.895   14.201  -6.202  1.00 0.00 ? 4  GLN B HG3  7  
ATOM 5083 H HE21 . GLN B 2 4  ? 5.550   11.071  -7.278  1.00 0.00 ? 4  GLN B HE21 7  
ATOM 5084 H HE22 . GLN B 2 4  ? 6.925   10.371  -6.574  1.00 0.00 ? 4  GLN B HE22 7  
ATOM 5085 N N    . HIS B 2 5  ? 2.280   13.413  -6.587  1.00 0.00 ? 5  HIS B N    7  
ATOM 5086 C CA   . HIS B 2 5  ? 1.149   12.909  -7.417  1.00 0.00 ? 5  HIS B CA   7  
ATOM 5087 C C    . HIS B 2 5  ? 1.306   11.377  -7.553  1.00 0.00 ? 5  HIS B C    7  
ATOM 5088 O O    . HIS B 2 5  ? 1.600   10.864  -8.616  1.00 0.00 ? 5  HIS B O    7  
ATOM 5089 C CB   . HIS B 2 5  ? 1.224   13.609  -8.786  1.00 0.00 ? 5  HIS B CB   7  
ATOM 5090 C CG   . HIS B 2 5  ? 1.246   15.129  -8.581  1.00 0.00 ? 5  HIS B CG   7  
ATOM 5091 N ND1  . HIS B 2 5  ? 0.262   15.838  -8.140  1.00 0.00 ? 5  HIS B ND1  7  
ATOM 5092 C CD2  . HIS B 2 5  ? 2.261   16.049  -8.796  1.00 0.00 ? 5  HIS B CD2  7  
ATOM 5093 C CE1  . HIS B 2 5  ? 0.613   17.083  -8.080  1.00 0.00 ? 5  HIS B CE1  7  
ATOM 5094 N NE2  . HIS B 2 5  ? 1.848   17.260  -8.477  1.00 0.00 ? 5  HIS B NE2  7  
ATOM 5095 H H    . HIS B 2 5  ? 3.155   13.370  -7.007  1.00 0.00 ? 5  HIS B H    7  
ATOM 5096 H HA   . HIS B 2 5  ? 0.202   13.126  -6.938  1.00 0.00 ? 5  HIS B HA   7  
ATOM 5097 H HB2  . HIS B 2 5  ? 2.113   13.318  -9.326  1.00 0.00 ? 5  HIS B HB2  7  
ATOM 5098 H HB3  . HIS B 2 5  ? 0.354   13.355  -9.375  1.00 0.00 ? 5  HIS B HB3  7  
ATOM 5099 H HD1  . HIS B 2 5  ? -0.620  15.491  -7.889  1.00 0.00 ? 5  HIS B HD1  7  
ATOM 5100 H HD2  . HIS B 2 5  ? 3.242   15.803  -9.174  1.00 0.00 ? 5  HIS B HD2  7  
ATOM 5101 H HE1  . HIS B 2 5  ? -0.036  17.877  -7.742  1.00 0.00 ? 5  HIS B HE1  7  
ATOM 5102 N N    . LEU B 2 6  ? 1.105   10.703  -6.451  1.00 0.00 ? 6  LEU B N    7  
ATOM 5103 C CA   . LEU B 2 6  ? 1.217   9.205   -6.405  1.00 0.00 ? 6  LEU B CA   7  
ATOM 5104 C C    . LEU B 2 6  ? -0.188  8.572   -6.326  1.00 0.00 ? 6  LEU B C    7  
ATOM 5105 O O    . LEU B 2 6  ? -0.649  8.226   -5.256  1.00 0.00 ? 6  LEU B O    7  
ATOM 5106 C CB   . LEU B 2 6  ? 2.054   8.799   -5.165  1.00 0.00 ? 6  LEU B CB   7  
ATOM 5107 C CG   . LEU B 2 6  ? 3.521   9.303   -5.218  1.00 0.00 ? 6  LEU B CG   7  
ATOM 5108 C CD1  . LEU B 2 6  ? 4.218   8.830   -3.922  1.00 0.00 ? 6  LEU B CD1  7  
ATOM 5109 C CD2  . LEU B 2 6  ? 4.262   8.689   -6.428  1.00 0.00 ? 6  LEU B CD2  7  
ATOM 5110 H H    . LEU B 2 6  ? 0.877   11.200  -5.638  1.00 0.00 ? 6  LEU B H    7  
ATOM 5111 H HA   . LEU B 2 6  ? 1.701   8.837   -7.299  1.00 0.00 ? 6  LEU B HA   7  
ATOM 5112 H HB2  . LEU B 2 6  ? 1.576   9.170   -4.269  1.00 0.00 ? 6  LEU B HB2  7  
ATOM 5113 H HB3  . LEU B 2 6  ? 2.086   7.726   -5.111  1.00 0.00 ? 6  LEU B HB3  7  
ATOM 5114 H HG   . LEU B 2 6  ? 3.544   10.385  -5.261  1.00 0.00 ? 6  LEU B HG   7  
ATOM 5115 H HD11 . LEU B 2 6  ? 4.177   7.751   -3.858  1.00 0.00 ? 6  LEU B HD11 7  
ATOM 5116 H HD12 . LEU B 2 6  ? 5.253   9.145   -3.902  1.00 0.00 ? 6  LEU B HD12 7  
ATOM 5117 H HD13 . LEU B 2 6  ? 3.713   9.245   -3.057  1.00 0.00 ? 6  LEU B HD13 7  
ATOM 5118 H HD21 . LEU B 2 6  ? 4.211   7.611   -6.393  1.00 0.00 ? 6  LEU B HD21 7  
ATOM 5119 H HD22 . LEU B 2 6  ? 3.813   9.023   -7.349  1.00 0.00 ? 6  LEU B HD22 7  
ATOM 5120 H HD23 . LEU B 2 6  ? 5.300   8.978   -6.430  1.00 0.00 ? 6  LEU B HD23 7  
ATOM 5121 N N    . CYS B 2 7  ? -0.830  8.421   -7.464  1.00 0.00 ? 7  CYS B N    7  
ATOM 5122 C CA   . CYS B 2 7  ? -2.205  7.823   -7.466  1.00 0.00 ? 7  CYS B CA   7  
ATOM 5123 C C    . CYS B 2 7  ? -2.249  6.294   -7.705  1.00 0.00 ? 7  CYS B C    7  
ATOM 5124 O O    . CYS B 2 7  ? -2.745  5.617   -6.829  1.00 0.00 ? 7  CYS B O    7  
ATOM 5125 C CB   . CYS B 2 7  ? -3.079  8.567   -8.539  1.00 0.00 ? 7  CYS B CB   7  
ATOM 5126 S SG   . CYS B 2 7  ? -4.522  7.680   -9.184  1.00 0.00 ? 7  CYS B SG   7  
ATOM 5127 H H    . CYS B 2 7  ? -0.405  8.694   -8.303  1.00 0.00 ? 7  CYS B H    7  
ATOM 5128 H HA   . CYS B 2 7  ? -2.647  8.020   -6.499  1.00 0.00 ? 7  CYS B HA   7  
ATOM 5129 H HB2  . CYS B 2 7  ? -3.490  9.417   -8.020  1.00 0.00 ? 7  CYS B HB2  7  
ATOM 5130 H HB3  . CYS B 2 7  ? -2.511  8.997   -9.348  1.00 0.00 ? 7  CYS B HB3  7  
ATOM 5131 N N    . GLY B 2 8  ? -1.770  5.763   -8.817  1.00 0.00 ? 8  GLY B N    7  
ATOM 5132 C CA   . GLY B 2 8  ? -1.821  4.279   -9.025  1.00 0.00 ? 8  GLY B CA   7  
ATOM 5133 C C    . GLY B 2 8  ? -0.538  3.710   -9.683  1.00 0.00 ? 8  GLY B C    7  
ATOM 5134 O O    . GLY B 2 8  ? 0.091   2.874   -9.068  1.00 0.00 ? 8  GLY B O    7  
ATOM 5135 H H    . GLY B 2 8  ? -1.370  6.305   -9.521  1.00 0.00 ? 8  GLY B H    7  
ATOM 5136 H HA2  . GLY B 2 8  ? -1.874  3.814   -8.056  1.00 0.00 ? 8  GLY B HA2  7  
ATOM 5137 H HA3  . GLY B 2 8  ? -2.729  3.984   -9.548  1.00 0.00 ? 8  GLY B HA3  7  
ATOM 5138 N N    . SER B 2 9  ? -0.162  4.132   -10.878 1.00 0.00 ? 9  SER B N    7  
ATOM 5139 C CA   . SER B 2 9  ? 1.076   3.608   -11.560 1.00 0.00 ? 9  SER B CA   7  
ATOM 5140 C C    . SER B 2 9  ? 2.313   3.354   -10.691 1.00 0.00 ? 9  SER B C    7  
ATOM 5141 O O    . SER B 2 9  ? 3.070   2.437   -10.931 1.00 0.00 ? 9  SER B O    7  
ATOM 5142 C CB   . SER B 2 9  ? 1.468   4.586   -12.707 1.00 0.00 ? 9  SER B CB   7  
ATOM 5143 O OG   . SER B 2 9  ? 0.357   4.520   -13.587 1.00 0.00 ? 9  SER B OG   7  
ATOM 5144 H H    . SER B 2 9  ? -0.668  4.814   -11.376 1.00 0.00 ? 9  SER B H    7  
ATOM 5145 H HA   . SER B 2 9  ? 0.821   2.653   -11.991 1.00 0.00 ? 9  SER B HA   7  
ATOM 5146 H HB2  . SER B 2 9  ? 1.599   5.613   -12.397 1.00 0.00 ? 9  SER B HB2  7  
ATOM 5147 H HB3  . SER B 2 9  ? 2.355   4.254   -13.224 1.00 0.00 ? 9  SER B HB3  7  
ATOM 5148 H HG   . SER B 2 9  ? 0.069   5.418   -13.755 1.00 0.00 ? 9  SER B HG   7  
ATOM 5149 N N    . HIS B 2 10 ? 2.472   4.169   -9.691  1.00 0.00 ? 10 HIS B N    7  
ATOM 5150 C CA   . HIS B 2 10 ? 3.627   4.072   -8.766  1.00 0.00 ? 10 HIS B CA   7  
ATOM 5151 C C    . HIS B 2 10 ? 3.277   3.151   -7.593  1.00 0.00 ? 10 HIS B C    7  
ATOM 5152 O O    . HIS B 2 10 ? 4.129   2.414   -7.141  1.00 0.00 ? 10 HIS B O    7  
ATOM 5153 C CB   . HIS B 2 10 ? 3.975   5.527   -8.319  1.00 0.00 ? 10 HIS B CB   7  
ATOM 5154 C CG   . HIS B 2 10 ? 4.595   6.297   -9.502  1.00 0.00 ? 10 HIS B CG   7  
ATOM 5155 N ND1  . HIS B 2 10 ? 5.500   5.853   -10.316 1.00 0.00 ? 10 HIS B ND1  7  
ATOM 5156 C CD2  . HIS B 2 10 ? 4.349   7.582   -9.945  1.00 0.00 ? 10 HIS B CD2  7  
ATOM 5157 C CE1  . HIS B 2 10 ? 5.799   6.767   -11.183 1.00 0.00 ? 10 HIS B CE1  7  
ATOM 5158 N NE2  . HIS B 2 10 ? 5.106   7.859   -10.989 1.00 0.00 ? 10 HIS B NE2  7  
ATOM 5159 H H    . HIS B 2 10 ? 1.808   4.851   -9.535  1.00 0.00 ? 10 HIS B H    7  
ATOM 5160 H HA   . HIS B 2 10 ? 4.464   3.655   -9.300  1.00 0.00 ? 10 HIS B HA   7  
ATOM 5161 H HB2  . HIS B 2 10 ? 3.094   6.081   -8.027  1.00 0.00 ? 10 HIS B HB2  7  
ATOM 5162 H HB3  . HIS B 2 10 ? 4.666   5.539   -7.487  1.00 0.00 ? 10 HIS B HB3  7  
ATOM 5163 H HD1  . HIS B 2 10 ? 5.902   4.966   -10.304 1.00 0.00 ? 10 HIS B HD1  7  
ATOM 5164 H HD2  . HIS B 2 10 ? 3.648   8.265   -9.502  1.00 0.00 ? 10 HIS B HD2  7  
ATOM 5165 H HE1  . HIS B 2 10 ? 6.533   6.655   -11.970 1.00 0.00 ? 10 HIS B HE1  7  
ATOM 5166 N N    . LEU B 2 11 ? 2.051   3.183   -7.124  1.00 0.00 ? 11 LEU B N    7  
ATOM 5167 C CA   . LEU B 2 11 ? 1.671   2.295   -5.986  1.00 0.00 ? 11 LEU B CA   7  
ATOM 5168 C C    . LEU B 2 11 ? 1.815   0.863   -6.501  1.00 0.00 ? 11 LEU B C    7  
ATOM 5169 O O    . LEU B 2 11 ? 2.188   -0.030  -5.773  1.00 0.00 ? 11 LEU B O    7  
ATOM 5170 C CB   . LEU B 2 11 ? 0.205   2.600   -5.547  1.00 0.00 ? 11 LEU B CB   7  
ATOM 5171 C CG   . LEU B 2 11 ? 0.181   3.811   -4.573  1.00 0.00 ? 11 LEU B CG   7  
ATOM 5172 C CD1  . LEU B 2 11 ? 0.736   5.074   -5.236  1.00 0.00 ? 11 LEU B CD1  7  
ATOM 5173 C CD2  . LEU B 2 11 ? -1.267  4.084   -4.144  1.00 0.00 ? 11 LEU B CD2  7  
ATOM 5174 H H    . LEU B 2 11 ? 1.364   3.764   -7.506  1.00 0.00 ? 11 LEU B H    7  
ATOM 5175 H HA   . LEU B 2 11 ? 2.369   2.439   -5.174  1.00 0.00 ? 11 LEU B HA   7  
ATOM 5176 H HB2  . LEU B 2 11 ? -0.427  2.885   -6.377  1.00 0.00 ? 11 LEU B HB2  7  
ATOM 5177 H HB3  . LEU B 2 11 ? -0.232  1.728   -5.075  1.00 0.00 ? 11 LEU B HB3  7  
ATOM 5178 H HG   . LEU B 2 11 ? 0.772   3.589   -3.698  1.00 0.00 ? 11 LEU B HG   7  
ATOM 5179 H HD11 . LEU B 2 11 ? 0.171   5.320   -6.124  1.00 0.00 ? 11 LEU B HD11 7  
ATOM 5180 H HD12 . LEU B 2 11 ? 0.664   5.894   -4.541  1.00 0.00 ? 11 LEU B HD12 7  
ATOM 5181 H HD13 . LEU B 2 11 ? 1.775   4.949   -5.491  1.00 0.00 ? 11 LEU B HD13 7  
ATOM 5182 H HD21 . LEU B 2 11 ? -1.682  3.210   -3.660  1.00 0.00 ? 11 LEU B HD21 7  
ATOM 5183 H HD22 . LEU B 2 11 ? -1.289  4.926   -3.470  1.00 0.00 ? 11 LEU B HD22 7  
ATOM 5184 H HD23 . LEU B 2 11 ? -1.870  4.320   -5.007  1.00 0.00 ? 11 LEU B HD23 7  
ATOM 5185 N N    . VAL B 2 12 ? 1.517   0.689   -7.760  1.00 0.00 ? 12 VAL B N    7  
ATOM 5186 C CA   . VAL B 2 12 ? 1.608   -0.632  -8.410  1.00 0.00 ? 12 VAL B CA   7  
ATOM 5187 C C    . VAL B 2 12 ? 3.085   -0.997  -8.555  1.00 0.00 ? 12 VAL B C    7  
ATOM 5188 O O    . VAL B 2 12 ? 3.416   -2.121  -8.235  1.00 0.00 ? 12 VAL B O    7  
ATOM 5189 C CB   . VAL B 2 12 ? 0.830   -0.500  -9.765  1.00 0.00 ? 12 VAL B CB   7  
ATOM 5190 C CG1  . VAL B 2 12 ? 1.299   -1.502  -10.837 1.00 0.00 ? 12 VAL B CG1  7  
ATOM 5191 C CG2  . VAL B 2 12 ? -0.672  -0.745  -9.455  1.00 0.00 ? 12 VAL B CG2  7  
ATOM 5192 H H    . VAL B 2 12 ? 1.221   1.439   -8.303  1.00 0.00 ? 12 VAL B H    7  
ATOM 5193 H HA   . VAL B 2 12 ? 1.142   -1.361  -7.767  1.00 0.00 ? 12 VAL B HA   7  
ATOM 5194 H HB   . VAL B 2 12 ? 0.943   0.503   -10.148 1.00 0.00 ? 12 VAL B HB   7  
ATOM 5195 H HG11 . VAL B 2 12 ? 1.225   -2.508  -10.471 1.00 0.00 ? 12 VAL B HG11 7  
ATOM 5196 H HG12 . VAL B 2 12 ? 0.685   -1.400  -11.722 1.00 0.00 ? 12 VAL B HG12 7  
ATOM 5197 H HG13 . VAL B 2 12 ? 2.324   -1.316  -11.112 1.00 0.00 ? 12 VAL B HG13 7  
ATOM 5198 H HG21 . VAL B 2 12 ? -0.815  -1.715  -9.007  1.00 0.00 ? 12 VAL B HG21 7  
ATOM 5199 H HG22 . VAL B 2 12 ? -1.040  -0.001  -8.760  1.00 0.00 ? 12 VAL B HG22 7  
ATOM 5200 H HG23 . VAL B 2 12 ? -1.255  -0.693  -10.362 1.00 0.00 ? 12 VAL B HG23 7  
ATOM 5201 N N    . GLU B 2 13 ? 3.947   -0.106  -9.005  1.00 0.00 ? 13 GLU B N    7  
ATOM 5202 C CA   . GLU B 2 13 ? 5.390   -0.567  -9.110  1.00 0.00 ? 13 GLU B CA   7  
ATOM 5203 C C    . GLU B 2 13 ? 6.019   -0.876  -7.736  1.00 0.00 ? 13 GLU B C    7  
ATOM 5204 O O    . GLU B 2 13 ? 6.886   -1.723  -7.641  1.00 0.00 ? 13 GLU B O    7  
ATOM 5205 C CB   . GLU B 2 13 ? 6.323   0.489   -9.765  1.00 0.00 ? 13 GLU B CB   7  
ATOM 5206 C CG   . GLU B 2 13 ? 5.856   0.845   -11.176 1.00 0.00 ? 13 GLU B CG   7  
ATOM 5207 C CD   . GLU B 2 13 ? 6.630   2.084   -11.672 1.00 0.00 ? 13 GLU B CD   7  
ATOM 5208 O OE1  . GLU B 2 13 ? 6.460   3.117   -11.039 1.00 0.00 ? 13 GLU B OE1  7  
ATOM 5209 O OE2  . GLU B 2 13 ? 7.347   1.944   -12.649 1.00 0.00 ? 13 GLU B OE2  7  
ATOM 5210 H H    . GLU B 2 13 ? 3.655   0.811   -9.257  1.00 0.00 ? 13 GLU B H    7  
ATOM 5211 H HA   . GLU B 2 13 ? 5.423   -1.478  -9.695  1.00 0.00 ? 13 GLU B HA   7  
ATOM 5212 H HB2  . GLU B 2 13 ? 6.463   1.370   -9.154  1.00 0.00 ? 13 GLU B HB2  7  
ATOM 5213 H HB3  . GLU B 2 13 ? 7.296   0.026   -9.876  1.00 0.00 ? 13 GLU B HB3  7  
ATOM 5214 H HG2  . GLU B 2 13 ? 6.050   0.012   -11.833 1.00 0.00 ? 13 GLU B HG2  7  
ATOM 5215 H HG3  . GLU B 2 13 ? 4.801   1.060   -11.190 1.00 0.00 ? 13 GLU B HG3  7  
ATOM 5216 N N    . ALA B 2 14 ? 5.557   -0.190  -6.721  1.00 0.00 ? 14 ALA B N    7  
ATOM 5217 C CA   . ALA B 2 14 ? 6.092   -0.381  -5.340  1.00 0.00 ? 14 ALA B CA   7  
ATOM 5218 C C    . ALA B 2 14 ? 5.477   -1.508  -4.492  1.00 0.00 ? 14 ALA B C    7  
ATOM 5219 O O    . ALA B 2 14 ? 6.222   -2.207  -3.831  1.00 0.00 ? 14 ALA B O    7  
ATOM 5220 C CB   . ALA B 2 14 ? 5.929   0.959   -4.629  1.00 0.00 ? 14 ALA B CB   7  
ATOM 5221 H H    . ALA B 2 14 ? 4.847   0.467   -6.853  1.00 0.00 ? 14 ALA B H    7  
ATOM 5222 H HA   . ALA B 2 14 ? 7.153   -0.576  -5.426  1.00 0.00 ? 14 ALA B HA   7  
ATOM 5223 H HB1  . ALA B 2 14 ? 4.888   1.246   -4.619  1.00 0.00 ? 14 ALA B HB1  7  
ATOM 5224 H HB2  . ALA B 2 14 ? 6.290   0.896   -3.615  1.00 0.00 ? 14 ALA B HB2  7  
ATOM 5225 H HB3  . ALA B 2 14 ? 6.499   1.706   -5.160  1.00 0.00 ? 14 ALA B HB3  7  
ATOM 5226 N N    . LEU B 2 15 ? 4.180   -1.692  -4.508  1.00 0.00 ? 15 LEU B N    7  
ATOM 5227 C CA   . LEU B 2 15 ? 3.605   -2.788  -3.670  1.00 0.00 ? 15 LEU B CA   7  
ATOM 5228 C C    . LEU B 2 15 ? 3.808   -4.113  -4.405  1.00 0.00 ? 15 LEU B C    7  
ATOM 5229 O O    . LEU B 2 15 ? 3.729   -5.161  -3.793  1.00 0.00 ? 15 LEU B O    7  
ATOM 5230 C CB   . LEU B 2 15 ? 2.082   -2.440  -3.392  1.00 0.00 ? 15 LEU B CB   7  
ATOM 5231 C CG   . LEU B 2 15 ? 1.074   -2.689  -4.546  1.00 0.00 ? 15 LEU B CG   7  
ATOM 5232 C CD1  . LEU B 2 15 ? 0.553   -4.139  -4.441  1.00 0.00 ? 15 LEU B CD1  7  
ATOM 5233 C CD2  . LEU B 2 15 ? -0.141  -1.727  -4.425  1.00 0.00 ? 15 LEU B CD2  7  
ATOM 5234 H H    . LEU B 2 15 ? 3.591   -1.133  -5.049  1.00 0.00 ? 15 LEU B H    7  
ATOM 5235 H HA   . LEU B 2 15 ? 4.137   -2.840  -2.734  1.00 0.00 ? 15 LEU B HA   7  
ATOM 5236 H HB2  . LEU B 2 15 ? 1.779   -3.008  -2.532  1.00 0.00 ? 15 LEU B HB2  7  
ATOM 5237 H HB3  . LEU B 2 15 ? 2.018   -1.403  -3.113  1.00 0.00 ? 15 LEU B HB3  7  
ATOM 5238 H HG   . LEU B 2 15 ? 1.553   -2.511  -5.496  1.00 0.00 ? 15 LEU B HG   7  
ATOM 5239 H HD11 . LEU B 2 15 ? 1.358   -4.852  -4.518  1.00 0.00 ? 15 LEU B HD11 7  
ATOM 5240 H HD12 . LEU B 2 15 ? 0.061   -4.271  -3.488  1.00 0.00 ? 15 LEU B HD12 7  
ATOM 5241 H HD13 . LEU B 2 15 ? -0.165  -4.334  -5.220  1.00 0.00 ? 15 LEU B HD13 7  
ATOM 5242 H HD21 . LEU B 2 15 ? -0.645  -1.883  -3.487  1.00 0.00 ? 15 LEU B HD21 7  
ATOM 5243 H HD22 . LEU B 2 15 ? 0.180   -0.696  -4.476  1.00 0.00 ? 15 LEU B HD22 7  
ATOM 5244 H HD23 . LEU B 2 15 ? -0.851  -1.914  -5.220  1.00 0.00 ? 15 LEU B HD23 7  
ATOM 5245 N N    . TYR B 2 16 ? 4.077   -4.034  -5.691  1.00 0.00 ? 16 TYR B N    7  
ATOM 5246 C CA   . TYR B 2 16 ? 4.300   -5.290  -6.472  1.00 0.00 ? 16 TYR B CA   7  
ATOM 5247 C C    . TYR B 2 16 ? 5.800   -5.678  -6.336  1.00 0.00 ? 16 TYR B C    7  
ATOM 5248 O O    . TYR B 2 16 ? 6.119   -6.853  -6.363  1.00 0.00 ? 16 TYR B O    7  
ATOM 5249 C CB   . TYR B 2 16 ? 4.004   -5.134  -8.023  1.00 0.00 ? 16 TYR B CB   7  
ATOM 5250 C CG   . TYR B 2 16 ? 2.542   -4.857  -8.452  1.00 0.00 ? 16 TYR B CG   7  
ATOM 5251 C CD1  . TYR B 2 16 ? 1.594   -4.316  -7.612  1.00 0.00 ? 16 TYR B CD1  7  
ATOM 5252 C CD2  . TYR B 2 16 ? 2.159   -5.156  -9.749  1.00 0.00 ? 16 TYR B CD2  7  
ATOM 5253 C CE1  . TYR B 2 16 ? 0.301   -4.069  -8.046  1.00 0.00 ? 16 TYR B CE1  7  
ATOM 5254 C CE2  . TYR B 2 16 ? 0.873   -4.915  -10.191 1.00 0.00 ? 16 TYR B CE2  7  
ATOM 5255 C CZ   . TYR B 2 16 ? -0.069  -4.369  -9.341  1.00 0.00 ? 16 TYR B CZ   7  
ATOM 5256 O OH   . TYR B 2 16 ? -1.354  -4.122  -9.781  1.00 0.00 ? 16 TYR B OH   7  
ATOM 5257 H H    . TYR B 2 16 ? 4.129   -3.162  -6.139  1.00 0.00 ? 16 TYR B H    7  
ATOM 5258 H HA   . TYR B 2 16 ? 3.694   -6.077  -6.045  1.00 0.00 ? 16 TYR B HA   7  
ATOM 5259 H HB2  . TYR B 2 16 ? 4.618   -4.362  -8.460  1.00 0.00 ? 16 TYR B HB2  7  
ATOM 5260 H HB3  . TYR B 2 16 ? 4.299   -6.063  -8.478  1.00 0.00 ? 16 TYR B HB3  7  
ATOM 5261 H HD1  . TYR B 2 16 ? 1.873   -4.084  -6.602  1.00 0.00 ? 16 TYR B HD1  7  
ATOM 5262 H HD2  . TYR B 2 16 ? 2.878   -5.584  -10.431 1.00 0.00 ? 16 TYR B HD2  7  
ATOM 5263 H HE1  . TYR B 2 16 ? -0.423  -3.643  -7.366  1.00 0.00 ? 16 TYR B HE1  7  
ATOM 5264 H HE2  . TYR B 2 16 ? 0.602   -5.155  -11.207 1.00 0.00 ? 16 TYR B HE2  7  
ATOM 5265 H HH   . TYR B 2 16 ? -1.440  -4.410  -10.694 1.00 0.00 ? 16 TYR B HH   7  
ATOM 5266 N N    . LEU B 2 17 ? 6.675   -4.703  -6.183  1.00 0.00 ? 17 LEU B N    7  
ATOM 5267 C CA   . LEU B 2 17 ? 8.145   -4.987  -6.045  1.00 0.00 ? 17 LEU B CA   7  
ATOM 5268 C C    . LEU B 2 17 ? 8.467   -5.437  -4.605  1.00 0.00 ? 17 LEU B C    7  
ATOM 5269 O O    . LEU B 2 17 ? 9.509   -6.027  -4.391  1.00 0.00 ? 17 LEU B O    7  
ATOM 5270 C CB   . LEU B 2 17 ? 8.905   -3.684  -6.445  1.00 0.00 ? 17 LEU B CB   7  
ATOM 5271 C CG   . LEU B 2 17 ? 10.464  -3.711  -6.254  1.00 0.00 ? 17 LEU B CG   7  
ATOM 5272 C CD1  . LEU B 2 17 ? 11.148  -4.766  -7.152  1.00 0.00 ? 17 LEU B CD1  7  
ATOM 5273 C CD2  . LEU B 2 17 ? 11.005  -2.329  -6.670  1.00 0.00 ? 17 LEU B CD2  7  
ATOM 5274 H H    . LEU B 2 17 ? 6.383   -3.769  -6.152  1.00 0.00 ? 17 LEU B H    7  
ATOM 5275 H HA   . LEU B 2 17 ? 8.424   -5.782  -6.726  1.00 0.00 ? 17 LEU B HA   7  
ATOM 5276 H HB2  . LEU B 2 17 ? 8.705   -3.512  -7.492  1.00 0.00 ? 17 LEU B HB2  7  
ATOM 5277 H HB3  . LEU B 2 17 ? 8.484   -2.860  -5.891  1.00 0.00 ? 17 LEU B HB3  7  
ATOM 5278 H HG   . LEU B 2 17 ? 10.717  -3.899  -5.224  1.00 0.00 ? 17 LEU B HG   7  
ATOM 5279 H HD11 . LEU B 2 17 ? 10.950  -4.548  -8.188  1.00 0.00 ? 17 LEU B HD11 7  
ATOM 5280 H HD12 . LEU B 2 17 ? 12.219  -4.726  -6.997  1.00 0.00 ? 17 LEU B HD12 7  
ATOM 5281 H HD13 . LEU B 2 17 ? 10.800  -5.765  -6.928  1.00 0.00 ? 17 LEU B HD13 7  
ATOM 5282 H HD21 . LEU B 2 17 ? 10.554  -1.546  -6.081  1.00 0.00 ? 17 LEU B HD21 7  
ATOM 5283 H HD22 . LEU B 2 17 ? 12.077  -2.283  -6.538  1.00 0.00 ? 17 LEU B HD22 7  
ATOM 5284 H HD23 . LEU B 2 17 ? 10.775  -2.147  -7.710  1.00 0.00 ? 17 LEU B HD23 7  
ATOM 5285 N N    . VAL B 2 18 ? 7.584   -5.163  -3.663  1.00 0.00 ? 18 VAL B N    7  
ATOM 5286 C CA   . VAL B 2 18 ? 7.841   -5.583  -2.237  1.00 0.00 ? 18 VAL B CA   7  
ATOM 5287 C C    . VAL B 2 18 ? 7.064   -6.893  -2.003  1.00 0.00 ? 18 VAL B C    7  
ATOM 5288 O O    . VAL B 2 18 ? 7.668   -7.946  -1.918  1.00 0.00 ? 18 VAL B O    7  
ATOM 5289 C CB   . VAL B 2 18 ? 7.325   -4.497  -1.208  1.00 0.00 ? 18 VAL B CB   7  
ATOM 5290 C CG1  . VAL B 2 18 ? 7.551   -5.016  0.241   1.00 0.00 ? 18 VAL B CG1  7  
ATOM 5291 C CG2  . VAL B 2 18 ? 8.121   -3.178  -1.381  1.00 0.00 ? 18 VAL B CG2  7  
ATOM 5292 H H    . VAL B 2 18 ? 6.759   -4.681  -3.884  1.00 0.00 ? 18 VAL B H    7  
ATOM 5293 H HA   . VAL B 2 18 ? 8.898   -5.755  -2.094  1.00 0.00 ? 18 VAL B HA   7  
ATOM 5294 H HB   . VAL B 2 18 ? 6.272   -4.298  -1.359  1.00 0.00 ? 18 VAL B HB   7  
ATOM 5295 H HG11 . VAL B 2 18 ? 7.024   -5.942  0.394   1.00 0.00 ? 18 VAL B HG11 7  
ATOM 5296 H HG12 . VAL B 2 18 ? 8.597   -5.191  0.420   1.00 0.00 ? 18 VAL B HG12 7  
ATOM 5297 H HG13 . VAL B 2 18 ? 7.192   -4.307  0.973   1.00 0.00 ? 18 VAL B HG13 7  
ATOM 5298 H HG21 . VAL B 2 18 ? 8.010   -2.798  -2.385  1.00 0.00 ? 18 VAL B HG21 7  
ATOM 5299 H HG22 . VAL B 2 18 ? 7.765   -2.432  -0.688  1.00 0.00 ? 18 VAL B HG22 7  
ATOM 5300 H HG23 . VAL B 2 18 ? 9.173   -3.345  -1.195  1.00 0.00 ? 18 VAL B HG23 7  
ATOM 5301 N N    . CYS B 2 19 ? 5.756   -6.795  -1.902  1.00 0.00 ? 19 CYS B N    7  
ATOM 5302 C CA   . CYS B 2 19 ? 4.922   -8.009  -1.671  1.00 0.00 ? 19 CYS B CA   7  
ATOM 5303 C C    . CYS B 2 19 ? 3.483   -7.964  -2.274  1.00 0.00 ? 19 CYS B C    7  
ATOM 5304 O O    . CYS B 2 19 ? 3.138   -8.912  -2.958  1.00 0.00 ? 19 CYS B O    7  
ATOM 5305 C CB   . CYS B 2 19 ? 4.929   -8.245  -0.131  1.00 0.00 ? 19 CYS B CB   7  
ATOM 5306 S SG   . CYS B 2 19 ? 6.543   -8.500  0.650   1.00 0.00 ? 19 CYS B SG   7  
ATOM 5307 H H    . CYS B 2 19 ? 5.324   -5.919  -1.989  1.00 0.00 ? 19 CYS B H    7  
ATOM 5308 H HA   . CYS B 2 19 ? 5.416   -8.871  -2.083  1.00 0.00 ? 19 CYS B HA   7  
ATOM 5309 H HB2  . CYS B 2 19 ? 4.558   -7.391  0.402   1.00 0.00 ? 19 CYS B HB2  7  
ATOM 5310 H HB3  . CYS B 2 19 ? 4.305   -9.100  0.089   1.00 0.00 ? 19 CYS B HB3  7  
ATOM 5311 N N    . GLY B 2 20 ? 2.670   -6.940  -2.055  1.00 0.00 ? 20 GLY B N    7  
ATOM 5312 C CA   . GLY B 2 20 ? 1.288   -6.915  -2.638  1.00 0.00 ? 20 GLY B CA   7  
ATOM 5313 C C    . GLY B 2 20 ? 0.286   -7.841  -1.909  1.00 0.00 ? 20 GLY B C    7  
ATOM 5314 O O    . GLY B 2 20 ? -0.905  -7.607  -1.936  1.00 0.00 ? 20 GLY B O    7  
ATOM 5315 H H    . GLY B 2 20 ? 2.919   -6.152  -1.532  1.00 0.00 ? 20 GLY B H    7  
ATOM 5316 H HA2  . GLY B 2 20 ? 0.925   -5.909  -2.536  1.00 0.00 ? 20 GLY B HA2  7  
ATOM 5317 H HA3  . GLY B 2 20 ? 1.326   -7.156  -3.689  1.00 0.00 ? 20 GLY B HA3  7  
ATOM 5318 N N    . GLU B 2 21 ? 0.859   -8.848  -1.295  1.00 0.00 ? 21 GLU B N    7  
ATOM 5319 C CA   . GLU B 2 21 ? 0.238   -9.957  -0.492  1.00 0.00 ? 21 GLU B CA   7  
ATOM 5320 C C    . GLU B 2 21 ? 0.617   -11.162 -1.344  1.00 0.00 ? 21 GLU B C    7  
ATOM 5321 O O    . GLU B 2 21 ? -0.200  -11.994 -1.680  1.00 0.00 ? 21 GLU B O    7  
ATOM 5322 C CB   . GLU B 2 21 ? -1.327  -9.845  -0.370  1.00 0.00 ? 21 GLU B CB   7  
ATOM 5323 C CG   . GLU B 2 21 ? -1.694  -8.783  0.700   1.00 0.00 ? 21 GLU B CG   7  
ATOM 5324 C CD   . GLU B 2 21 ? -3.188  -8.442  0.619   1.00 0.00 ? 21 GLU B CD   7  
ATOM 5325 O OE1  . GLU B 2 21 ? -3.982  -9.357  0.762   1.00 0.00 ? 21 GLU B OE1  7  
ATOM 5326 O OE2  . GLU B 2 21 ? -3.448  -7.269  0.417   1.00 0.00 ? 21 GLU B OE2  7  
ATOM 5327 H H    . GLU B 2 21 ? 1.832   -8.899  -1.353  1.00 0.00 ? 21 GLU B H    7  
ATOM 5328 H HA   . GLU B 2 21 ? 0.724   -10.043 0.467   1.00 0.00 ? 21 GLU B HA   7  
ATOM 5329 H HB2  . GLU B 2 21 ? -1.788  -9.625  -1.315  1.00 0.00 ? 21 GLU B HB2  7  
ATOM 5330 H HB3  . GLU B 2 21 ? -1.712  -10.803 -0.047  1.00 0.00 ? 21 GLU B HB3  7  
ATOM 5331 H HG2  . GLU B 2 21 ? -1.506  -9.195  1.678   1.00 0.00 ? 21 GLU B HG2  7  
ATOM 5332 H HG3  . GLU B 2 21 ? -1.111  -7.880  0.586   1.00 0.00 ? 21 GLU B HG3  7  
ATOM 5333 N N    . ARG B 2 22 ? 1.901   -11.146 -1.641  1.00 0.00 ? 22 ARG B N    7  
ATOM 5334 C CA   . ARG B 2 22 ? 2.627   -12.169 -2.457  1.00 0.00 ? 22 ARG B CA   7  
ATOM 5335 C C    . ARG B 2 22 ? 1.678   -13.134 -3.200  1.00 0.00 ? 22 ARG B C    7  
ATOM 5336 O O    . ARG B 2 22 ? 1.335   -14.202 -2.741  1.00 0.00 ? 22 ARG B O    7  
ATOM 5337 C CB   . ARG B 2 22 ? 3.579   -12.845 -1.439  1.00 0.00 ? 22 ARG B CB   7  
ATOM 5338 C CG   . ARG B 2 22 ? 4.334   -14.033 -2.050  1.00 0.00 ? 22 ARG B CG   7  
ATOM 5339 C CD   . ARG B 2 22 ? 5.459   -13.538 -2.982  1.00 0.00 ? 22 ARG B CD   7  
ATOM 5340 N NE   . ARG B 2 22 ? 6.205   -14.747 -3.438  1.00 0.00 ? 22 ARG B NE   7  
ATOM 5341 C CZ   . ARG B 2 22 ? 6.429   -14.961 -4.705  1.00 0.00 ? 22 ARG B CZ   7  
ATOM 5342 N NH1  . ARG B 2 22 ? 5.435   -15.326 -5.464  1.00 0.00 ? 22 ARG B NH1  7  
ATOM 5343 N NH2  . ARG B 2 22 ? 7.641   -14.807 -5.169  1.00 0.00 ? 22 ARG B NH2  7  
ATOM 5344 H H    . ARG B 2 22 ? 2.430   -10.395 -1.295  1.00 0.00 ? 22 ARG B H    7  
ATOM 5345 H HA   . ARG B 2 22 ? 3.230   -11.654 -3.187  1.00 0.00 ? 22 ARG B HA   7  
ATOM 5346 H HB2  . ARG B 2 22 ? 4.337   -12.118 -1.179  1.00 0.00 ? 22 ARG B HB2  7  
ATOM 5347 H HB3  . ARG B 2 22 ? 3.080   -13.097 -0.511  1.00 0.00 ? 22 ARG B HB3  7  
ATOM 5348 H HG2  . ARG B 2 22 ? 4.765   -14.610 -1.248  1.00 0.00 ? 22 ARG B HG2  7  
ATOM 5349 H HG3  . ARG B 2 22 ? 3.656   -14.674 -2.592  1.00 0.00 ? 22 ARG B HG3  7  
ATOM 5350 H HD2  . ARG B 2 22 ? 5.073   -12.990 -3.829  1.00 0.00 ? 22 ARG B HD2  7  
ATOM 5351 H HD3  . ARG B 2 22 ? 6.146   -12.912 -2.429  1.00 0.00 ? 22 ARG B HD3  7  
ATOM 5352 H HE   . ARG B 2 22 ? 6.519   -15.378 -2.762  1.00 0.00 ? 22 ARG B HE   7  
ATOM 5353 H HH11 . ARG B 2 22 ? 4.524   -15.426 -5.065  1.00 0.00 ? 22 ARG B HH11 7  
ATOM 5354 H HH12 . ARG B 2 22 ? 5.583   -15.499 -6.437  1.00 0.00 ? 22 ARG B HH12 7  
ATOM 5355 H HH21 . ARG B 2 22 ? 8.387   -14.511 -4.569  1.00 0.00 ? 22 ARG B HH21 7  
ATOM 5356 H HH22 . ARG B 2 22 ? 7.819   -14.983 -6.135  1.00 0.00 ? 22 ARG B HH22 7  
ATOM 5357 N N    . GLY B 2 23 ? 1.293   -12.661 -4.359  1.00 0.00 ? 23 GLY B N    7  
ATOM 5358 C CA   . GLY B 2 23 ? 0.369   -13.395 -5.274  1.00 0.00 ? 23 GLY B CA   7  
ATOM 5359 C C    . GLY B 2 23 ? -0.777  -12.420 -5.653  1.00 0.00 ? 23 GLY B C    7  
ATOM 5360 O O    . GLY B 2 23 ? -1.054  -12.302 -6.830  1.00 0.00 ? 23 GLY B O    7  
ATOM 5361 H H    . GLY B 2 23 ? 1.626   -11.785 -4.640  1.00 0.00 ? 23 GLY B H    7  
ATOM 5362 H HA2  . GLY B 2 23 ? 0.921   -13.643 -6.170  1.00 0.00 ? 23 GLY B HA2  7  
ATOM 5363 H HA3  . GLY B 2 23 ? 0.002   -14.319 -4.840  1.00 0.00 ? 23 GLY B HA3  7  
ATOM 5364 N N    . PHE B 2 24 ? -1.398  -11.767 -4.684  1.00 0.00 ? 24 PHE B N    7  
ATOM 5365 C CA   . PHE B 2 24 ? -2.520  -10.791 -4.902  1.00 0.00 ? 24 PHE B CA   7  
ATOM 5366 C C    . PHE B 2 24 ? -2.933  -10.540 -6.399  1.00 0.00 ? 24 PHE B C    7  
ATOM 5367 O O    . PHE B 2 24 ? -2.355  -9.666  -7.012  1.00 0.00 ? 24 PHE B O    7  
ATOM 5368 C CB   . PHE B 2 24 ? -2.145  -9.419  -4.284  1.00 0.00 ? 24 PHE B CB   7  
ATOM 5369 C CG   . PHE B 2 24 ? -0.961  -8.736  -4.996  1.00 0.00 ? 24 PHE B CG   7  
ATOM 5370 C CD1  . PHE B 2 24 ? 0.294   -9.318  -5.052  1.00 0.00 ? 24 PHE B CD1  7  
ATOM 5371 C CD2  . PHE B 2 24 ? -1.175  -7.524  -5.617  1.00 0.00 ? 24 PHE B CD2  7  
ATOM 5372 C CE1  . PHE B 2 24 ? 1.318   -8.699  -5.725  1.00 0.00 ? 24 PHE B CE1  7  
ATOM 5373 C CE2  . PHE B 2 24 ? -0.156  -6.909  -6.285  1.00 0.00 ? 24 PHE B CE2  7  
ATOM 5374 C CZ   . PHE B 2 24 ? 1.093   -7.491  -6.346  1.00 0.00 ? 24 PHE B CZ   7  
ATOM 5375 H H    . PHE B 2 24 ? -1.148  -11.897 -3.749  1.00 0.00 ? 24 PHE B H    7  
ATOM 5376 H HA   . PHE B 2 24 ? -3.331  -11.080 -4.245  1.00 0.00 ? 24 PHE B HA   7  
ATOM 5377 H HB2  . PHE B 2 24 ? -3.034  -8.806  -4.401  1.00 0.00 ? 24 PHE B HB2  7  
ATOM 5378 H HB3  . PHE B 2 24 ? -1.908  -9.533  -3.242  1.00 0.00 ? 24 PHE B HB3  7  
ATOM 5379 H HD1  . PHE B 2 24 ? 0.480   -10.259 -4.564  1.00 0.00 ? 24 PHE B HD1  7  
ATOM 5380 H HD2  . PHE B 2 24 ? -2.144  -7.050  -5.576  1.00 0.00 ? 24 PHE B HD2  7  
ATOM 5381 H HE1  . PHE B 2 24 ? 2.296   -9.158  -5.769  1.00 0.00 ? 24 PHE B HE1  7  
ATOM 5382 H HE2  . PHE B 2 24 ? -0.347  -5.967  -6.762  1.00 0.00 ? 24 PHE B HE2  7  
ATOM 5383 H HZ   . PHE B 2 24 ? 1.899   -7.006  -6.877  1.00 0.00 ? 24 PHE B HZ   7  
ATOM 5384 N N    . PHE B 2 25 ? -3.865  -11.234 -7.017  1.00 0.00 ? 25 PHE B N    7  
ATOM 5385 C CA   . PHE B 2 25 ? -4.170  -10.908 -8.431  1.00 0.00 ? 25 PHE B CA   7  
ATOM 5386 C C    . PHE B 2 25 ? -5.416  -10.020 -8.390  1.00 0.00 ? 25 PHE B C    7  
ATOM 5387 O O    . PHE B 2 25 ? -6.223  -10.097 -7.478  1.00 0.00 ? 25 PHE B O    7  
ATOM 5388 C CB   . PHE B 2 25 ? -4.466  -12.228 -9.182  1.00 0.00 ? 25 PHE B CB   7  
ATOM 5389 C CG   . PHE B 2 25 ? -5.927  -12.648 -8.909  1.00 0.00 ? 25 PHE B CG   7  
ATOM 5390 C CD1  . PHE B 2 25 ? -6.949  -12.075 -9.650  1.00 0.00 ? 25 PHE B CD1  7  
ATOM 5391 C CD2  . PHE B 2 25 ? -6.253  -13.576 -7.937  1.00 0.00 ? 25 PHE B CD2  7  
ATOM 5392 C CE1  . PHE B 2 25 ? -8.262  -12.412 -9.429  1.00 0.00 ? 25 PHE B CE1  7  
ATOM 5393 C CE2  . PHE B 2 25 ? -7.566  -13.919 -7.710  1.00 0.00 ? 25 PHE B CE2  7  
ATOM 5394 C CZ   . PHE B 2 25 ? -8.571  -13.337 -8.454  1.00 0.00 ? 25 PHE B CZ   7  
ATOM 5395 H H    . PHE B 2 25 ? -4.398  -11.961 -6.649  1.00 0.00 ? 25 PHE B H    7  
ATOM 5396 H HA   . PHE B 2 25 ? -3.353  -10.382 -8.901  1.00 0.00 ? 25 PHE B HA   7  
ATOM 5397 H HB2  . PHE B 2 25 ? -4.319  -12.131 -10.245 1.00 0.00 ? 25 PHE B HB2  7  
ATOM 5398 H HB3  . PHE B 2 25 ? -3.800  -13.005 -8.834  1.00 0.00 ? 25 PHE B HB3  7  
ATOM 5399 H HD1  . PHE B 2 25 ? -6.714  -11.347 -10.412 1.00 0.00 ? 25 PHE B HD1  7  
ATOM 5400 H HD2  . PHE B 2 25 ? -5.471  -14.032 -7.354  1.00 0.00 ? 25 PHE B HD2  7  
ATOM 5401 H HE1  . PHE B 2 25 ? -9.048  -11.954 -10.010 1.00 0.00 ? 25 PHE B HE1  7  
ATOM 5402 H HE2  . PHE B 2 25 ? -7.813  -14.645 -6.950  1.00 0.00 ? 25 PHE B HE2  7  
ATOM 5403 H HZ   . PHE B 2 25 ? -9.597  -13.612 -8.266  1.00 0.00 ? 25 PHE B HZ   7  
ATOM 5404 N N    . TYR B 2 26 ? -5.510  -9.202  -9.394  1.00 0.00 ? 26 TYR B N    7  
ATOM 5405 C CA   . TYR B 2 26 ? -6.666  -8.284  -9.528  1.00 0.00 ? 26 TYR B CA   7  
ATOM 5406 C C    . TYR B 2 26 ? -7.278  -8.656  -10.871 1.00 0.00 ? 26 TYR B C    7  
ATOM 5407 O O    . TYR B 2 26 ? -8.428  -9.026  -11.007 1.00 0.00 ? 26 TYR B O    7  
ATOM 5408 C CB   . TYR B 2 26 ? -6.109  -6.825  -9.383  1.00 0.00 ? 26 TYR B CB   7  
ATOM 5409 C CG   . TYR B 2 26 ? -5.010  -6.402  -10.359 1.00 0.00 ? 26 TYR B CG   7  
ATOM 5410 C CD1  . TYR B 2 26 ? -3.690  -6.769  -10.172 1.00 0.00 ? 26 TYR B CD1  7  
ATOM 5411 C CD2  . TYR B 2 26 ? -5.348  -5.620  -11.436 1.00 0.00 ? 26 TYR B CD2  7  
ATOM 5412 C CE1  . TYR B 2 26 ? -2.728  -6.347  -11.063 1.00 0.00 ? 26 TYR B CE1  7  
ATOM 5413 C CE2  . TYR B 2 26 ? -4.387  -5.201  -12.328 1.00 0.00 ? 26 TYR B CE2  7  
ATOM 5414 C CZ   . TYR B 2 26 ? -3.068  -5.562  -12.143 1.00 0.00 ? 26 TYR B CZ   7  
ATOM 5415 O OH   . TYR B 2 26 ? -2.088  -5.147  -13.018 1.00 0.00 ? 26 TYR B OH   7  
ATOM 5416 H H    . TYR B 2 26 ? -4.788  -9.200  -10.050 1.00 0.00 ? 26 TYR B H    7  
ATOM 5417 H HA   . TYR B 2 26 ? -7.380  -8.515  -8.828  1.00 0.00 ? 26 TYR B HA   7  
ATOM 5418 H HB2  . TYR B 2 26 ? -6.929  -6.130  -9.462  1.00 0.00 ? 26 TYR B HB2  7  
ATOM 5419 H HB3  . TYR B 2 26 ? -5.706  -6.736  -8.382  1.00 0.00 ? 26 TYR B HB3  7  
ATOM 5420 H HD1  . TYR B 2 26 ? -3.407  -7.389  -9.336  1.00 0.00 ? 26 TYR B HD1  7  
ATOM 5421 H HD2  . TYR B 2 26 ? -6.377  -5.328  -11.581 1.00 0.00 ? 26 TYR B HD2  7  
ATOM 5422 H HE1  . TYR B 2 26 ? -1.696  -6.625  -10.918 1.00 0.00 ? 26 TYR B HE1  7  
ATOM 5423 H HE2  . TYR B 2 26 ? -4.676  -4.591  -13.169 1.00 0.00 ? 26 TYR B HE2  7  
ATOM 5424 H HH   . TYR B 2 26 ? -2.516  -4.843  -13.823 1.00 0.00 ? 26 TYR B HH   7  
ATOM 5425 N N    . THR B 2 27 ? -6.391  -8.532  -11.787 1.00 0.00 ? 27 THR B N    7  
ATOM 5426 C CA   . THR B 2 27 ? -6.592  -8.826  -13.253 1.00 0.00 ? 27 THR B CA   7  
ATOM 5427 C C    . THR B 2 27 ? -5.259  -9.039  -14.045 1.00 0.00 ? 27 THR B C    7  
ATOM 5428 O O    . THR B 2 27 ? -5.129  -8.497  -15.128 1.00 0.00 ? 27 THR B O    7  
ATOM 5429 C CB   . THR B 2 27 ? -7.411  -7.664  -13.938 1.00 0.00 ? 27 THR B CB   7  
ATOM 5430 O OG1  . THR B 2 27 ? -6.683  -6.457  -13.754 1.00 0.00 ? 27 THR B OG1  7  
ATOM 5431 C CG2  . THR B 2 27 ? -8.794  -7.405  -13.323 1.00 0.00 ? 27 THR B CG2  7  
ATOM 5432 H H    . THR B 2 27 ? -5.581  -8.217  -11.349 1.00 0.00 ? 27 THR B H    7  
ATOM 5433 H HA   . THR B 2 27 ? -7.150  -9.750  -13.358 1.00 0.00 ? 27 THR B HA   7  
ATOM 5434 H HB   . THR B 2 27 ? -7.517  -7.856  -14.993 1.00 0.00 ? 27 THR B HB   7  
ATOM 5435 H HG1  . THR B 2 27 ? -5.813  -6.680  -13.420 1.00 0.00 ? 27 THR B HG1  7  
ATOM 5436 H HG21 . THR B 2 27 ? -9.387  -8.308  -13.387 1.00 0.00 ? 27 THR B HG21 7  
ATOM 5437 H HG22 . THR B 2 27 ? -8.723  -7.094  -12.294 1.00 0.00 ? 27 THR B HG22 7  
ATOM 5438 H HG23 . THR B 2 27 ? -9.292  -6.621  -13.877 1.00 0.00 ? 27 THR B HG23 7  
ATOM 5439 N N    . PRO B 2 28 ? -4.302  -9.798  -13.537 1.00 0.00 ? 28 PRO B N    7  
ATOM 5440 C CA   . PRO B 2 28 ? -3.001  -10.067 -14.221 1.00 0.00 ? 28 PRO B CA   7  
ATOM 5441 C C    . PRO B 2 28 ? -2.886  -11.493 -14.854 1.00 0.00 ? 28 PRO B C    7  
ATOM 5442 O O    . PRO B 2 28 ? -3.688  -12.359 -14.561 1.00 0.00 ? 28 PRO B O    7  
ATOM 5443 C CB   . PRO B 2 28 ? -2.011  -9.802  -13.084 1.00 0.00 ? 28 PRO B CB   7  
ATOM 5444 C CG   . PRO B 2 28 ? -2.800  -10.165 -11.777 1.00 0.00 ? 28 PRO B CG   7  
ATOM 5445 C CD   . PRO B 2 28 ? -4.243  -10.499 -12.223 1.00 0.00 ? 28 PRO B CD   7  
ATOM 5446 H HA   . PRO B 2 28 ? -2.849  -9.328  -14.995 1.00 0.00 ? 28 PRO B HA   7  
ATOM 5447 H HB2  . PRO B 2 28 ? -1.161  -10.455 -13.100 1.00 0.00 ? 28 PRO B HB2  7  
ATOM 5448 H HB3  . PRO B 2 28 ? -1.678  -8.776  -13.070 1.00 0.00 ? 28 PRO B HB3  7  
ATOM 5449 H HG2  . PRO B 2 28 ? -2.343  -11.024 -11.310 1.00 0.00 ? 28 PRO B HG2  7  
ATOM 5450 H HG3  . PRO B 2 28 ? -2.784  -9.332  -11.089 1.00 0.00 ? 28 PRO B HG3  7  
ATOM 5451 H HD2  . PRO B 2 28 ? -4.378  -11.561 -12.369 1.00 0.00 ? 28 PRO B HD2  7  
ATOM 5452 H HD3  . PRO B 2 28 ? -4.927  -10.132 -11.491 1.00 0.00 ? 28 PRO B HD3  7  
ATOM 5453 N N    . LYS B 2 29 ? -1.894  -11.695 -15.701 1.00 0.00 ? 29 LYS B N    7  
ATOM 5454 C CA   . LYS B 2 29 ? -1.692  -13.035 -16.356 1.00 0.00 ? 29 LYS B CA   7  
ATOM 5455 C C    . LYS B 2 29 ? -0.639  -13.816 -15.552 1.00 0.00 ? 29 LYS B C    7  
ATOM 5456 O O    . LYS B 2 29 ? 0.383   -13.264 -15.193 1.00 0.00 ? 29 LYS B O    7  
ATOM 5457 C CB   . LYS B 2 29 ? -1.183  -12.825 -17.786 1.00 0.00 ? 29 LYS B CB   7  
ATOM 5458 C CG   . LYS B 2 29 ? -2.166  -11.966 -18.609 1.00 0.00 ? 29 LYS B CG   7  
ATOM 5459 C CD   . LYS B 2 29 ? -3.564  -12.639 -18.740 1.00 0.00 ? 29 LYS B CD   7  
ATOM 5460 C CE   . LYS B 2 29 ? -3.459  -13.985 -19.474 1.00 0.00 ? 29 LYS B CE   7  
ATOM 5461 N NZ   . LYS B 2 29 ? -2.907  -13.778 -20.847 1.00 0.00 ? 29 LYS B NZ   7  
ATOM 5462 H H    . LYS B 2 29 ? -1.272  -10.974 -15.938 1.00 0.00 ? 29 LYS B H    7  
ATOM 5463 H HA   . LYS B 2 29 ? -2.617  -13.589 -16.358 1.00 0.00 ? 29 LYS B HA   7  
ATOM 5464 H HB2  . LYS B 2 29 ? -0.236  -12.308 -17.744 1.00 0.00 ? 29 LYS B HB2  7  
ATOM 5465 H HB3  . LYS B 2 29 ? -0.998  -13.775 -18.266 1.00 0.00 ? 29 LYS B HB3  7  
ATOM 5466 H HG2  . LYS B 2 29 ? -2.281  -11.002 -18.133 1.00 0.00 ? 29 LYS B HG2  7  
ATOM 5467 H HG3  . LYS B 2 29 ? -1.744  -11.806 -19.594 1.00 0.00 ? 29 LYS B HG3  7  
ATOM 5468 H HD2  . LYS B 2 29 ? -4.005  -12.792 -17.767 1.00 0.00 ? 29 LYS B HD2  7  
ATOM 5469 H HD3  . LYS B 2 29 ? -4.201  -11.978 -19.304 1.00 0.00 ? 29 LYS B HD3  7  
ATOM 5470 H HE2  . LYS B 2 29 ? -2.815  -14.661 -18.932 1.00 0.00 ? 29 LYS B HE2  7  
ATOM 5471 H HE3  . LYS B 2 29 ? -4.435  -14.432 -19.565 1.00 0.00 ? 29 LYS B HE3  7  
ATOM 5472 H HZ1  . LYS B 2 29 ? -2.736  -12.764 -21.011 1.00 0.00 ? 29 LYS B HZ1  7  
ATOM 5473 H HZ2  . LYS B 2 29 ? -2.008  -14.297 -20.928 1.00 0.00 ? 29 LYS B HZ2  7  
ATOM 5474 H HZ3  . LYS B 2 29 ? -3.588  -14.136 -21.551 1.00 0.00 ? 29 LYS B HZ3  7  
ATOM 5475 N N    . THR B 2 30 ? -0.928  -15.072 -15.296 1.00 0.00 ? 30 THR B N    7  
ATOM 5476 C CA   . THR B 2 30 ? 0.008   -15.951 -14.527 1.00 0.00 ? 30 THR B CA   7  
ATOM 5477 C C    . THR B 2 30 ? 0.251   -17.267 -15.276 1.00 0.00 ? 30 THR B C    7  
ATOM 5478 O O    . THR B 2 30 ? 0.422   -17.300 -16.479 1.00 0.00 ? 30 THR B O    7  
ATOM 5479 C CB   . THR B 2 30 ? -0.595  -16.234 -13.118 1.00 0.00 ? 30 THR B CB   7  
ATOM 5480 O OG1  . THR B 2 30 ? 0.444   -16.961 -12.476 1.00 0.00 ? 30 THR B OG1  7  
ATOM 5481 C CG2  . THR B 2 30 ? -1.794  -17.224 -13.109 1.00 0.00 ? 30 THR B CG2  7  
ATOM 5482 H H    . THR B 2 30 ? -1.778  -15.443 -15.614 1.00 0.00 ? 30 THR B H    7  
ATOM 5483 H HA   . THR B 2 30 ? 0.961   -15.451 -14.409 1.00 0.00 ? 30 THR B HA   7  
ATOM 5484 H HB   . THR B 2 30 ? -0.805  -15.331 -12.563 1.00 0.00 ? 30 THR B HB   7  
ATOM 5485 H HG1  . THR B 2 30 ? 1.039   -16.333 -12.062 1.00 0.00 ? 30 THR B HG1  7  
ATOM 5486 H HG21 . THR B 2 30 ? -2.621  -16.852 -13.699 1.00 0.00 ? 30 THR B HG21 7  
ATOM 5487 H HG22 . THR B 2 30 ? -1.488  -18.188 -13.488 1.00 0.00 ? 30 THR B HG22 7  
ATOM 5488 H HG23 . THR B 2 30 ? -2.144  -17.355 -12.095 1.00 0.00 ? 30 THR B HG23 7  
ATOM 5489 N N    . GLY A 1 1  ? -7.623  -2.803  -0.788  1.00 0.00 ? 1  GLY A N    8  
ATOM 5490 C CA   . GLY A 1 1  ? -8.296  -1.848  -1.711  1.00 0.00 ? 1  GLY A CA   8  
ATOM 5491 C C    . GLY A 1 1  ? -7.265  -0.876  -2.271  1.00 0.00 ? 1  GLY A C    8  
ATOM 5492 O O    . GLY A 1 1  ? -6.537  -1.215  -3.185  1.00 0.00 ? 1  GLY A O    8  
ATOM 5493 H H1   . GLY A 1 1  ? -6.596  -2.650  -0.786  1.00 0.00 ? 1  GLY A H1   8  
ATOM 5494 H H2   . GLY A 1 1  ? -8.000  -2.682  0.174   1.00 0.00 ? 1  GLY A H2   8  
ATOM 5495 H H3   . GLY A 1 1  ? -7.808  -3.770  -1.120  1.00 0.00 ? 1  GLY A H3   8  
ATOM 5496 H HA2  . GLY A 1 1  ? -8.748  -2.398  -2.525  1.00 0.00 ? 1  GLY A HA2  8  
ATOM 5497 H HA3  . GLY A 1 1  ? -9.064  -1.309  -1.175  1.00 0.00 ? 1  GLY A HA3  8  
ATOM 5498 N N    . ILE A 1 2  ? -7.234  0.306   -1.699  1.00 0.00 ? 2  ILE A N    8  
ATOM 5499 C CA   . ILE A 1 2  ? -6.267  1.370   -2.143  1.00 0.00 ? 2  ILE A CA   8  
ATOM 5500 C C    . ILE A 1 2  ? -6.532  1.648   -3.631  1.00 0.00 ? 2  ILE A C    8  
ATOM 5501 O O    . ILE A 1 2  ? -7.551  1.232   -4.148  1.00 0.00 ? 2  ILE A O    8  
ATOM 5502 C CB   . ILE A 1 2  ? -4.806  0.834   -1.853  1.00 0.00 ? 2  ILE A CB   8  
ATOM 5503 C CG1  . ILE A 1 2  ? -4.753  0.102   -0.460  1.00 0.00 ? 2  ILE A CG1  8  
ATOM 5504 C CG2  . ILE A 1 2  ? -3.762  1.995   -1.808  1.00 0.00 ? 2  ILE A CG2  8  
ATOM 5505 C CD1  . ILE A 1 2  ? -5.220  1.014   0.710   1.00 0.00 ? 2  ILE A CD1  8  
ATOM 5506 H H    . ILE A 1 2  ? -7.857  0.500   -0.971  1.00 0.00 ? 2  ILE A H    8  
ATOM 5507 H HA   . ILE A 1 2  ? -6.434  2.279   -1.580  1.00 0.00 ? 2  ILE A HA   8  
ATOM 5508 H HB   . ILE A 1 2  ? -4.514  0.160   -2.638  1.00 0.00 ? 2  ILE A HB   8  
ATOM 5509 H HG12 . ILE A 1 2  ? -5.368  -0.785  -0.495  1.00 0.00 ? 2  ILE A HG12 8  
ATOM 5510 H HG13 . ILE A 1 2  ? -3.739  -0.214  -0.270  1.00 0.00 ? 2  ILE A HG13 8  
ATOM 5511 H HG21 . ILE A 1 2  ? -4.086  2.741   -1.094  1.00 0.00 ? 2  ILE A HG21 8  
ATOM 5512 H HG22 . ILE A 1 2  ? -2.795  1.616   -1.518  1.00 0.00 ? 2  ILE A HG22 8  
ATOM 5513 H HG23 . ILE A 1 2  ? -3.622  2.479   -2.754  1.00 0.00 ? 2  ILE A HG23 8  
ATOM 5514 H HD11 . ILE A 1 2  ? -6.242  1.343   0.577   1.00 0.00 ? 2  ILE A HD11 8  
ATOM 5515 H HD12 . ILE A 1 2  ? -5.151  0.468   1.635   1.00 0.00 ? 2  ILE A HD12 8  
ATOM 5516 H HD13 . ILE A 1 2  ? -4.590  1.884   0.800   1.00 0.00 ? 2  ILE A HD13 8  
ATOM 5517 N N    . VAL A 1 3  ? -5.622  2.336   -4.268  1.00 0.00 ? 3  VAL A N    8  
ATOM 5518 C CA   . VAL A 1 3  ? -5.712  2.702   -5.725  1.00 0.00 ? 3  VAL A CA   8  
ATOM 5519 C C    . VAL A 1 3  ? -7.111  3.227   -6.070  1.00 0.00 ? 3  VAL A C    8  
ATOM 5520 O O    . VAL A 1 3  ? -7.869  3.567   -5.179  1.00 0.00 ? 3  VAL A O    8  
ATOM 5521 C CB   . VAL A 1 3  ? -5.327  1.414   -6.593  1.00 0.00 ? 3  VAL A CB   8  
ATOM 5522 C CG1  . VAL A 1 3  ? -4.116  0.696   -5.957  1.00 0.00 ? 3  VAL A CG1  8  
ATOM 5523 C CG2  . VAL A 1 3  ? -6.453  0.343   -6.752  1.00 0.00 ? 3  VAL A CG2  8  
ATOM 5524 H H    . VAL A 1 3  ? -4.847  2.628   -3.758  1.00 0.00 ? 3  VAL A H    8  
ATOM 5525 H HA   . VAL A 1 3  ? -5.020  3.497   -5.940  1.00 0.00 ? 3  VAL A HA   8  
ATOM 5526 H HB   . VAL A 1 3  ? -5.025  1.757   -7.574  1.00 0.00 ? 3  VAL A HB   8  
ATOM 5527 H HG11 . VAL A 1 3  ? -3.271  1.357   -5.881  1.00 0.00 ? 3  VAL A HG11 8  
ATOM 5528 H HG12 . VAL A 1 3  ? -4.374  0.350   -4.967  1.00 0.00 ? 3  VAL A HG12 8  
ATOM 5529 H HG13 . VAL A 1 3  ? -3.831  -0.160  -6.548  1.00 0.00 ? 3  VAL A HG13 8  
ATOM 5530 H HG21 . VAL A 1 3  ? -7.325  0.745   -7.243  1.00 0.00 ? 3  VAL A HG21 8  
ATOM 5531 H HG22 . VAL A 1 3  ? -6.087  -0.459  -7.372  1.00 0.00 ? 3  VAL A HG22 8  
ATOM 5532 H HG23 . VAL A 1 3  ? -6.744  -0.074  -5.800  1.00 0.00 ? 3  VAL A HG23 8  
ATOM 5533 N N    . GLU A 1 4  ? -7.414  3.300   -7.341  1.00 0.00 ? 4  GLU A N    8  
ATOM 5534 C CA   . GLU A 1 4  ? -8.767  3.803   -7.773  1.00 0.00 ? 4  GLU A CA   8  
ATOM 5535 C C    . GLU A 1 4  ? -9.059  5.138   -7.034  1.00 0.00 ? 4  GLU A C    8  
ATOM 5536 O O    . GLU A 1 4  ? -9.940  5.219   -6.203  1.00 0.00 ? 4  GLU A O    8  
ATOM 5537 C CB   . GLU A 1 4  ? -9.775  2.685   -7.408  1.00 0.00 ? 4  GLU A CB   8  
ATOM 5538 C CG   . GLU A 1 4  ? -11.188 2.877   -7.991  1.00 0.00 ? 4  GLU A CG   8  
ATOM 5539 C CD   . GLU A 1 4  ? -11.204 2.544   -9.497  1.00 0.00 ? 4  GLU A CD   8  
ATOM 5540 O OE1  . GLU A 1 4  ? -10.717 3.365   -10.255 1.00 0.00 ? 4  GLU A OE1  8  
ATOM 5541 O OE2  . GLU A 1 4  ? -11.707 1.474   -9.799  1.00 0.00 ? 4  GLU A OE2  8  
ATOM 5542 H H    . GLU A 1 4  ? -6.747  3.026   -8.010  1.00 0.00 ? 4  GLU A H    8  
ATOM 5543 H HA   . GLU A 1 4  ? -8.735  3.985   -8.831  1.00 0.00 ? 4  GLU A HA   8  
ATOM 5544 H HB2  . GLU A 1 4  ? -9.379  1.744   -7.765  1.00 0.00 ? 4  GLU A HB2  8  
ATOM 5545 H HB3  . GLU A 1 4  ? -9.854  2.631   -6.334  1.00 0.00 ? 4  GLU A HB3  8  
ATOM 5546 H HG2  . GLU A 1 4  ? -11.863 2.216   -7.463  1.00 0.00 ? 4  GLU A HG2  8  
ATOM 5547 H HG3  . GLU A 1 4  ? -11.527 3.896   -7.860  1.00 0.00 ? 4  GLU A HG3  8  
ATOM 5548 N N    . GLN A 1 5  ? -8.256  6.106   -7.413  1.00 0.00 ? 5  GLN A N    8  
ATOM 5549 C CA   . GLN A 1 5  ? -8.209  7.536   -6.940  1.00 0.00 ? 5  GLN A CA   8  
ATOM 5550 C C    . GLN A 1 5  ? -6.695  7.766   -6.755  1.00 0.00 ? 5  GLN A C    8  
ATOM 5551 O O    . GLN A 1 5  ? -5.931  6.815   -6.759  1.00 0.00 ? 5  GLN A O    8  
ATOM 5552 C CB   . GLN A 1 5  ? -8.968  7.760   -5.556  1.00 0.00 ? 5  GLN A CB   8  
ATOM 5553 C CG   . GLN A 1 5  ? -9.052  9.282   -5.138  1.00 0.00 ? 5  GLN A CG   8  
ATOM 5554 C CD   . GLN A 1 5  ? -9.408  10.239  -6.300  1.00 0.00 ? 5  GLN A CD   8  
ATOM 5555 O OE1  . GLN A 1 5  ? -8.587  10.549  -7.137  1.00 0.00 ? 5  GLN A OE1  8  
ATOM 5556 N NE2  . GLN A 1 5  ? -10.610 10.737  -6.396  1.00 0.00 ? 5  GLN A NE2  8  
ATOM 5557 H H    . GLN A 1 5  ? -7.599  5.874   -8.096  1.00 0.00 ? 5  GLN A H    8  
ATOM 5558 H HA   . GLN A 1 5  ? -8.586  8.171   -7.723  1.00 0.00 ? 5  GLN A HA   8  
ATOM 5559 H HB2  . GLN A 1 5  ? -9.981  7.384   -5.589  1.00 0.00 ? 5  GLN A HB2  8  
ATOM 5560 H HB3  . GLN A 1 5  ? -8.443  7.227   -4.771  1.00 0.00 ? 5  GLN A HB3  8  
ATOM 5561 H HG2  . GLN A 1 5  ? -9.822  9.380   -4.390  1.00 0.00 ? 5  GLN A HG2  8  
ATOM 5562 H HG3  . GLN A 1 5  ? -8.121  9.597   -4.686  1.00 0.00 ? 5  GLN A HG3  8  
ATOM 5563 H HE21 . GLN A 1 5  ? -11.305 10.496  -5.746  1.00 0.00 ? 5  GLN A HE21 8  
ATOM 5564 H HE22 . GLN A 1 5  ? -10.810 11.355  -7.132  1.00 0.00 ? 5  GLN A HE22 8  
ATOM 5565 N N    . CYS A 1 6  ? -6.284  8.998   -6.589  1.00 0.00 ? 6  CYS A N    8  
ATOM 5566 C CA   . CYS A 1 6  ? -4.824  9.277   -6.423  1.00 0.00 ? 6  CYS A CA   8  
ATOM 5567 C C    . CYS A 1 6  ? -4.479  9.675   -4.990  1.00 0.00 ? 6  CYS A C    8  
ATOM 5568 O O    . CYS A 1 6  ? -5.233  10.369  -4.329  1.00 0.00 ? 6  CYS A O    8  
ATOM 5569 C CB   . CYS A 1 6  ? -4.446  10.406  -7.381  1.00 0.00 ? 6  CYS A CB   8  
ATOM 5570 S SG   . CYS A 1 6  ? -5.053  10.318  -9.085  1.00 0.00 ? 6  CYS A SG   8  
ATOM 5571 H H    . CYS A 1 6  ? -6.922  9.733   -6.575  1.00 0.00 ? 6  CYS A H    8  
ATOM 5572 H HA   . CYS A 1 6  ? -4.251  8.403   -6.681  1.00 0.00 ? 6  CYS A HA   8  
ATOM 5573 H HB2  . CYS A 1 6  ? -4.803  11.316  -6.930  1.00 0.00 ? 6  CYS A HB2  8  
ATOM 5574 H HB3  . CYS A 1 6  ? -3.369  10.480  -7.460  1.00 0.00 ? 6  CYS A HB3  8  
ATOM 5575 N N    . CYS A 1 7  ? -3.323  9.207   -4.581  1.00 0.00 ? 7  CYS A N    8  
ATOM 5576 C CA   . CYS A 1 7  ? -2.734  9.434   -3.224  1.00 0.00 ? 7  CYS A CA   8  
ATOM 5577 C C    . CYS A 1 7  ? -3.886  9.211   -2.212  1.00 0.00 ? 7  CYS A C    8  
ATOM 5578 O O    . CYS A 1 7  ? -4.074  9.934   -1.256  1.00 0.00 ? 7  CYS A O    8  
ATOM 5579 C CB   . CYS A 1 7  ? -2.158  10.895  -3.191  1.00 0.00 ? 7  CYS A CB   8  
ATOM 5580 S SG   . CYS A 1 7  ? -0.467  11.176  -2.598  1.00 0.00 ? 7  CYS A SG   8  
ATOM 5581 H H    . CYS A 1 7  ? -2.811  8.660   -5.207  1.00 0.00 ? 7  CYS A H    8  
ATOM 5582 H HA   . CYS A 1 7  ? -1.968  8.700   -3.058  1.00 0.00 ? 7  CYS A HA   8  
ATOM 5583 H HB2  . CYS A 1 7  ? -2.082  11.216  -4.221  1.00 0.00 ? 7  CYS A HB2  8  
ATOM 5584 H HB3  . CYS A 1 7  ? -2.819  11.567  -2.664  1.00 0.00 ? 7  CYS A HB3  8  
ATOM 5585 N N    . THR A 1 8  ? -4.596  8.159   -2.550  1.00 0.00 ? 8  THR A N    8  
ATOM 5586 C CA   . THR A 1 8  ? -5.793  7.596   -1.849  1.00 0.00 ? 8  THR A CA   8  
ATOM 5587 C C    . THR A 1 8  ? -6.223  8.181   -0.501  1.00 0.00 ? 8  THR A C    8  
ATOM 5588 O O    . THR A 1 8  ? -7.363  8.563   -0.327  1.00 0.00 ? 8  THR A O    8  
ATOM 5589 C CB   . THR A 1 8  ? -5.542  6.081   -1.687  1.00 0.00 ? 8  THR A CB   8  
ATOM 5590 O OG1  . THR A 1 8  ? -4.298  5.998   -0.993  1.00 0.00 ? 8  THR A OG1  8  
ATOM 5591 C CG2  . THR A 1 8  ? -5.249  5.425   -3.054  1.00 0.00 ? 8  THR A CG2  8  
ATOM 5592 H H    . THR A 1 8  ? -4.307  7.685   -3.355  1.00 0.00 ? 8  THR A H    8  
ATOM 5593 H HA   . THR A 1 8  ? -6.630  7.702   -2.525  1.00 0.00 ? 8  THR A HA   8  
ATOM 5594 H HB   . THR A 1 8  ? -6.312  5.552   -1.143  1.00 0.00 ? 8  THR A HB   8  
ATOM 5595 H HG1  . THR A 1 8  ? -4.459  6.028   -0.048  1.00 0.00 ? 8  THR A HG1  8  
ATOM 5596 H HG21 . THR A 1 8  ? -6.068  5.553   -3.749  1.00 0.00 ? 8  THR A HG21 8  
ATOM 5597 H HG22 . THR A 1 8  ? -4.348  5.840   -3.483  1.00 0.00 ? 8  THR A HG22 8  
ATOM 5598 H HG23 . THR A 1 8  ? -5.095  4.368   -2.894  1.00 0.00 ? 8  THR A HG23 8  
ATOM 5599 N N    . SER A 1 9  ? -5.289  8.218   0.406   1.00 0.00 ? 9  SER A N    8  
ATOM 5600 C CA   . SER A 1 9  ? -5.559  8.756   1.769   1.00 0.00 ? 9  SER A CA   8  
ATOM 5601 C C    . SER A 1 9  ? -4.369  9.546   2.302   1.00 0.00 ? 9  SER A C    8  
ATOM 5602 O O    . SER A 1 9  ? -4.458  10.733  2.548   1.00 0.00 ? 9  SER A O    8  
ATOM 5603 C CB   . SER A 1 9  ? -5.908  7.533   2.665   1.00 0.00 ? 9  SER A CB   8  
ATOM 5604 O OG   . SER A 1 9  ? -4.869  6.585   2.444   1.00 0.00 ? 9  SER A OG   8  
ATOM 5605 H H    . SER A 1 9  ? -4.391  7.899   0.181   1.00 0.00 ? 9  SER A H    8  
ATOM 5606 H HA   . SER A 1 9  ? -6.401  9.423   1.730   1.00 0.00 ? 9  SER A HA   8  
ATOM 5607 H HB2  . SER A 1 9  ? -5.943  7.788   3.714   1.00 0.00 ? 9  SER A HB2  8  
ATOM 5608 H HB3  . SER A 1 9  ? -6.848  7.094   2.366   1.00 0.00 ? 9  SER A HB3  8  
ATOM 5609 H HG   . SER A 1 9  ? -5.261  5.790   2.080   1.00 0.00 ? 9  SER A HG   8  
ATOM 5610 N N    . ILE A 1 10 ? -3.289  8.827   2.461   1.00 0.00 ? 10 ILE A N    8  
ATOM 5611 C CA   . ILE A 1 10 ? -2.019  9.419   2.981   1.00 0.00 ? 10 ILE A CA   8  
ATOM 5612 C C    . ILE A 1 10 ? -0.818  8.938   2.135   1.00 0.00 ? 10 ILE A C    8  
ATOM 5613 O O    . ILE A 1 10 ? 0.299   9.241   2.498   1.00 0.00 ? 10 ILE A O    8  
ATOM 5614 C CB   . ILE A 1 10 ? -1.834  8.982   4.479   1.00 0.00 ? 10 ILE A CB   8  
ATOM 5615 C CG1  . ILE A 1 10 ? -3.220  9.000   5.204   1.00 0.00 ? 10 ILE A CG1  8  
ATOM 5616 C CG2  . ILE A 1 10 ? -0.867  9.981   5.186   1.00 0.00 ? 10 ILE A CG2  8  
ATOM 5617 C CD1  . ILE A 1 10 ? -3.092  8.608   6.689   1.00 0.00 ? 10 ILE A CD1  8  
ATOM 5618 H H    . ILE A 1 10 ? -3.348  7.883   2.223   1.00 0.00 ? 10 ILE A H    8  
ATOM 5619 H HA   . ILE A 1 10 ? -2.068  10.494  2.915   1.00 0.00 ? 10 ILE A HA   8  
ATOM 5620 H HB   . ILE A 1 10 ? -1.419  7.988   4.508   1.00 0.00 ? 10 ILE A HB   8  
ATOM 5621 H HG12 . ILE A 1 10 ? -3.684  9.976   5.132   1.00 0.00 ? 10 ILE A HG12 8  
ATOM 5622 H HG13 . ILE A 1 10 ? -3.874  8.277   4.735   1.00 0.00 ? 10 ILE A HG13 8  
ATOM 5623 H HG21 . ILE A 1 10 ? 0.093   10.012  4.689   1.00 0.00 ? 10 ILE A HG21 8  
ATOM 5624 H HG22 . ILE A 1 10 ? -1.282  10.978  5.200   1.00 0.00 ? 10 ILE A HG22 8  
ATOM 5625 H HG23 . ILE A 1 10 ? -0.696  9.679   6.207   1.00 0.00 ? 10 ILE A HG23 8  
ATOM 5626 H HD11 . ILE A 1 10 ? -2.661  7.622   6.797   1.00 0.00 ? 10 ILE A HD11 8  
ATOM 5627 H HD12 . ILE A 1 10 ? -2.473  9.312   7.219   1.00 0.00 ? 10 ILE A HD12 8  
ATOM 5628 H HD13 . ILE A 1 10 ? -4.075  8.601   7.147   1.00 0.00 ? 10 ILE A HD13 8  
ATOM 5629 N N    . CYS A 1 11 ? -1.070  8.227   1.049   1.00 0.00 ? 11 CYS A N    8  
ATOM 5630 C CA   . CYS A 1 11 ? 0.037   7.701   0.156   1.00 0.00 ? 11 CYS A CA   8  
ATOM 5631 C C    . CYS A 1 11 ? 1.366   7.494   0.933   1.00 0.00 ? 11 CYS A C    8  
ATOM 5632 O O    . CYS A 1 11 ? 2.374   8.124   0.672   1.00 0.00 ? 11 CYS A O    8  
ATOM 5633 C CB   . CYS A 1 11 ? 0.205   8.717   -1.010  1.00 0.00 ? 11 CYS A CB   8  
ATOM 5634 S SG   . CYS A 1 11 ? -0.287  10.435  -0.728  1.00 0.00 ? 11 CYS A SG   8  
ATOM 5635 H H    . CYS A 1 11 ? -2.008  8.042   0.824   1.00 0.00 ? 11 CYS A H    8  
ATOM 5636 H HA   . CYS A 1 11 ? -0.278  6.747   -0.235  1.00 0.00 ? 11 CYS A HA   8  
ATOM 5637 H HB2  . CYS A 1 11 ? 1.243   8.732   -1.322  1.00 0.00 ? 11 CYS A HB2  8  
ATOM 5638 H HB3  . CYS A 1 11 ? -0.360  8.353   -1.856  1.00 0.00 ? 11 CYS A HB3  8  
ATOM 5639 N N    . SER A 1 12 ? 1.284   6.582   1.882   1.00 0.00 ? 12 SER A N    8  
ATOM 5640 C CA   . SER A 1 12 ? 2.441   6.222   2.764   1.00 0.00 ? 12 SER A CA   8  
ATOM 5641 C C    . SER A 1 12 ? 2.747   4.709   2.740   1.00 0.00 ? 12 SER A C    8  
ATOM 5642 O O    . SER A 1 12 ? 1.861   3.883   2.675   1.00 0.00 ? 12 SER A O    8  
ATOM 5643 C CB   . SER A 1 12 ? 2.105   6.678   4.204   1.00 0.00 ? 12 SER A CB   8  
ATOM 5644 O OG   . SER A 1 12 ? 0.963   5.926   4.583   1.00 0.00 ? 12 SER A OG   8  
ATOM 5645 H H    . SER A 1 12 ? 0.440   6.112   2.023   1.00 0.00 ? 12 SER A H    8  
ATOM 5646 H HA   . SER A 1 12 ? 3.318   6.752   2.422   1.00 0.00 ? 12 SER A HA   8  
ATOM 5647 H HB2  . SER A 1 12 ? 2.907   6.480   4.902   1.00 0.00 ? 12 SER A HB2  8  
ATOM 5648 H HB3  . SER A 1 12 ? 1.842   7.725   4.213   1.00 0.00 ? 12 SER A HB3  8  
ATOM 5649 H HG   . SER A 1 12 ? 0.306   6.525   4.947   1.00 0.00 ? 12 SER A HG   8  
ATOM 5650 N N    . LEU A 1 13 ? 4.019   4.427   2.795   1.00 0.00 ? 13 LEU A N    8  
ATOM 5651 C CA   . LEU A 1 13 ? 4.572   3.030   2.790   1.00 0.00 ? 13 LEU A CA   8  
ATOM 5652 C C    . LEU A 1 13 ? 3.910   1.911   3.599   1.00 0.00 ? 13 LEU A C    8  
ATOM 5653 O O    . LEU A 1 13 ? 3.849   0.792   3.133   1.00 0.00 ? 13 LEU A O    8  
ATOM 5654 C CB   . LEU A 1 13 ? 6.092   3.095   3.182   1.00 0.00 ? 13 LEU A CB   8  
ATOM 5655 C CG   . LEU A 1 13 ? 6.503   4.121   4.289   1.00 0.00 ? 13 LEU A CG   8  
ATOM 5656 C CD1  . LEU A 1 13 ? 6.137   3.644   5.720   1.00 0.00 ? 13 LEU A CD1  8  
ATOM 5657 C CD2  . LEU A 1 13 ? 8.036   4.279   4.238   1.00 0.00 ? 13 LEU A CD2  8  
ATOM 5658 H H    . LEU A 1 13 ? 4.627   5.191   2.832   1.00 0.00 ? 13 LEU A H    8  
ATOM 5659 H HA   . LEU A 1 13 ? 4.519   2.699   1.770   1.00 0.00 ? 13 LEU A HA   8  
ATOM 5660 H HB2  . LEU A 1 13 ? 6.396   2.118   3.526   1.00 0.00 ? 13 LEU A HB2  8  
ATOM 5661 H HB3  . LEU A 1 13 ? 6.636   3.298   2.276   1.00 0.00 ? 13 LEU A HB3  8  
ATOM 5662 H HG   . LEU A 1 13 ? 6.050   5.084   4.100   1.00 0.00 ? 13 LEU A HG   8  
ATOM 5663 H HD11 . LEU A 1 13 ? 5.080   3.470   5.833   1.00 0.00 ? 13 LEU A HD11 8  
ATOM 5664 H HD12 . LEU A 1 13 ? 6.659   2.726   5.948   1.00 0.00 ? 13 LEU A HD12 8  
ATOM 5665 H HD13 . LEU A 1 13 ? 6.443   4.392   6.443   1.00 0.00 ? 13 LEU A HD13 8  
ATOM 5666 H HD21 . LEU A 1 13 ? 8.509   3.325   4.418   1.00 0.00 ? 13 LEU A HD21 8  
ATOM 5667 H HD22 . LEU A 1 13 ? 8.335   4.641   3.266   1.00 0.00 ? 13 LEU A HD22 8  
ATOM 5668 H HD23 . LEU A 1 13 ? 8.369   4.978   4.990   1.00 0.00 ? 13 LEU A HD23 8  
ATOM 5669 N N    . TYR A 1 14 ? 3.430   2.212   4.769   1.00 0.00 ? 14 TYR A N    8  
ATOM 5670 C CA   . TYR A 1 14 ? 2.773   1.153   5.610   1.00 0.00 ? 14 TYR A CA   8  
ATOM 5671 C C    . TYR A 1 14 ? 1.558   0.597   4.848   1.00 0.00 ? 14 TYR A C    8  
ATOM 5672 O O    . TYR A 1 14 ? 1.181   -0.547  5.004   1.00 0.00 ? 14 TYR A O    8  
ATOM 5673 C CB   . TYR A 1 14 ? 2.341   1.774   6.957   1.00 0.00 ? 14 TYR A CB   8  
ATOM 5674 C CG   . TYR A 1 14 ? 2.559   0.742   8.079   1.00 0.00 ? 14 TYR A CG   8  
ATOM 5675 C CD1  . TYR A 1 14 ? 1.863   -0.456  8.110   1.00 0.00 ? 14 TYR A CD1  8  
ATOM 5676 C CD2  . TYR A 1 14 ? 3.478   0.999   9.084   1.00 0.00 ? 14 TYR A CD2  8  
ATOM 5677 C CE1  . TYR A 1 14 ? 2.079   -1.371  9.120   1.00 0.00 ? 14 TYR A CE1  8  
ATOM 5678 C CE2  . TYR A 1 14 ? 3.692   0.082   10.094  1.00 0.00 ? 14 TYR A CE2  8  
ATOM 5679 C CZ   . TYR A 1 14 ? 2.993   -1.109  10.116  1.00 0.00 ? 14 TYR A CZ   8  
ATOM 5680 O OH   . TYR A 1 14 ? 3.213   -2.016  11.132  1.00 0.00 ? 14 TYR A OH   8  
ATOM 5681 H H    . TYR A 1 14 ? 3.513   3.138   5.069   1.00 0.00 ? 14 TYR A H    8  
ATOM 5682 H HA   . TYR A 1 14 ? 3.482   0.347   5.760   1.00 0.00 ? 14 TYR A HA   8  
ATOM 5683 H HB2  . TYR A 1 14 ? 2.936   2.655   7.161   1.00 0.00 ? 14 TYR A HB2  8  
ATOM 5684 H HB3  . TYR A 1 14 ? 1.299   2.053   6.952   1.00 0.00 ? 14 TYR A HB3  8  
ATOM 5685 H HD1  . TYR A 1 14 ? 1.140   -0.686  7.341   1.00 0.00 ? 14 TYR A HD1  8  
ATOM 5686 H HD2  . TYR A 1 14 ? 4.032   1.921   9.073   1.00 0.00 ? 14 TYR A HD2  8  
ATOM 5687 H HE1  . TYR A 1 14 ? 1.530   -2.302  9.124   1.00 0.00 ? 14 TYR A HE1  8  
ATOM 5688 H HE2  . TYR A 1 14 ? 4.408   0.299   10.874  1.00 0.00 ? 14 TYR A HE2  8  
ATOM 5689 H HH   . TYR A 1 14 ? 2.763   -2.831  10.905  1.00 0.00 ? 14 TYR A HH   8  
ATOM 5690 N N    . GLN A 1 15 ? 0.978   1.447   4.038   1.00 0.00 ? 15 GLN A N    8  
ATOM 5691 C CA   . GLN A 1 15 ? -0.203  1.044   3.236   1.00 0.00 ? 15 GLN A CA   8  
ATOM 5692 C C    . GLN A 1 15 ? 0.290   -0.004  2.224   1.00 0.00 ? 15 GLN A C    8  
ATOM 5693 O O    . GLN A 1 15 ? -0.435  -0.936  1.931   1.00 0.00 ? 15 GLN A O    8  
ATOM 5694 C CB   . GLN A 1 15 ? -0.772  2.320   2.541   1.00 0.00 ? 15 GLN A CB   8  
ATOM 5695 C CG   . GLN A 1 15 ? -2.036  2.022   1.727   1.00 0.00 ? 15 GLN A CG   8  
ATOM 5696 C CD   . GLN A 1 15 ? -2.337  3.236   0.828   1.00 0.00 ? 15 GLN A CD   8  
ATOM 5697 O OE1  . GLN A 1 15 ? -1.618  3.506   -0.115  1.00 0.00 ? 15 GLN A OE1  8  
ATOM 5698 N NE2  . GLN A 1 15 ? -3.371  3.989   1.074   1.00 0.00 ? 15 GLN A NE2  8  
ATOM 5699 H H    . GLN A 1 15 ? 1.321   2.358   3.952   1.00 0.00 ? 15 GLN A H    8  
ATOM 5700 H HA   . GLN A 1 15 ? -0.939  0.602   3.891   1.00 0.00 ? 15 GLN A HA   8  
ATOM 5701 H HB2  . GLN A 1 15 ? -1.033  3.016   3.322   1.00 0.00 ? 15 GLN A HB2  8  
ATOM 5702 H HB3  . GLN A 1 15 ? -0.064  2.808   1.898   1.00 0.00 ? 15 GLN A HB3  8  
ATOM 5703 H HG2  . GLN A 1 15 ? -1.894  1.153   1.100   1.00 0.00 ? 15 GLN A HG2  8  
ATOM 5704 H HG3  . GLN A 1 15 ? -2.879  1.844   2.378   1.00 0.00 ? 15 GLN A HG3  8  
ATOM 5705 H HE21 . GLN A 1 15 ? -3.938  3.806   1.849   1.00 0.00 ? 15 GLN A HE21 8  
ATOM 5706 H HE22 . GLN A 1 15 ? -3.580  4.734   0.475   1.00 0.00 ? 15 GLN A HE22 8  
ATOM 5707 N N    . LEU A 1 16 ? 1.504   0.143   1.733   1.00 0.00 ? 16 LEU A N    8  
ATOM 5708 C CA   . LEU A 1 16 ? 2.012   -0.852  0.743   1.00 0.00 ? 16 LEU A CA   8  
ATOM 5709 C C    . LEU A 1 16 ? 2.471   -2.093  1.529   1.00 0.00 ? 16 LEU A C    8  
ATOM 5710 O O    . LEU A 1 16 ? 2.520   -3.187  1.001   1.00 0.00 ? 16 LEU A O    8  
ATOM 5711 C CB   . LEU A 1 16 ? 3.196   -0.230  -0.042  1.00 0.00 ? 16 LEU A CB   8  
ATOM 5712 C CG   . LEU A 1 16 ? 2.837   1.168   -0.667  1.00 0.00 ? 16 LEU A CG   8  
ATOM 5713 C CD1  . LEU A 1 16 ? 4.123   1.726   -1.320  1.00 0.00 ? 16 LEU A CD1  8  
ATOM 5714 C CD2  . LEU A 1 16 ? 1.758   1.053   -1.757  1.00 0.00 ? 16 LEU A CD2  8  
ATOM 5715 H H    . LEU A 1 16 ? 2.106   0.873   2.002   1.00 0.00 ? 16 LEU A H    8  
ATOM 5716 H HA   . LEU A 1 16 ? 1.204   -1.127  0.081   1.00 0.00 ? 16 LEU A HA   8  
ATOM 5717 H HB2  . LEU A 1 16 ? 4.054   -0.122  0.608   1.00 0.00 ? 16 LEU A HB2  8  
ATOM 5718 H HB3  . LEU A 1 16 ? 3.459   -0.908  -0.844  1.00 0.00 ? 16 LEU A HB3  8  
ATOM 5719 H HG   . LEU A 1 16 ? 2.508   1.851   0.104   1.00 0.00 ? 16 LEU A HG   8  
ATOM 5720 H HD11 . LEU A 1 16 ? 4.483   1.035   -2.073  1.00 0.00 ? 16 LEU A HD11 8  
ATOM 5721 H HD12 . LEU A 1 16 ? 3.928   2.675   -1.789  1.00 0.00 ? 16 LEU A HD12 8  
ATOM 5722 H HD13 . LEU A 1 16 ? 4.892   1.863   -0.570  1.00 0.00 ? 16 LEU A HD13 8  
ATOM 5723 H HD21 . LEU A 1 16 ? 0.852   0.627   -1.359  1.00 0.00 ? 16 LEU A HD21 8  
ATOM 5724 H HD22 . LEU A 1 16 ? 1.532   2.028   -2.159  1.00 0.00 ? 16 LEU A HD22 8  
ATOM 5725 H HD23 . LEU A 1 16 ? 2.120   0.442   -2.567  1.00 0.00 ? 16 LEU A HD23 8  
ATOM 5726 N N    . GLU A 1 17 ? 2.801   -1.881  2.780   1.00 0.00 ? 17 GLU A N    8  
ATOM 5727 C CA   . GLU A 1 17 ? 3.259   -3.000  3.659   1.00 0.00 ? 17 GLU A CA   8  
ATOM 5728 C C    . GLU A 1 17 ? 2.071   -3.918  4.010   1.00 0.00 ? 17 GLU A C    8  
ATOM 5729 O O    . GLU A 1 17 ? 2.264   -5.000  4.530   1.00 0.00 ? 17 GLU A O    8  
ATOM 5730 C CB   . GLU A 1 17 ? 3.891   -2.377  4.916   1.00 0.00 ? 17 GLU A CB   8  
ATOM 5731 C CG   . GLU A 1 17 ? 5.299   -1.813  4.544   1.00 0.00 ? 17 GLU A CG   8  
ATOM 5732 C CD   . GLU A 1 17 ? 5.858   -0.904  5.665   1.00 0.00 ? 17 GLU A CD   8  
ATOM 5733 O OE1  . GLU A 1 17 ? 5.727   -1.279  6.820   1.00 0.00 ? 17 GLU A OE1  8  
ATOM 5734 O OE2  . GLU A 1 17 ? 6.395   0.132   5.302   1.00 0.00 ? 17 GLU A OE2  8  
ATOM 5735 H H    . GLU A 1 17 ? 2.748   -0.976  3.150   1.00 0.00 ? 17 GLU A H    8  
ATOM 5736 H HA   . GLU A 1 17 ? 3.998   -3.579  3.128   1.00 0.00 ? 17 GLU A HA   8  
ATOM 5737 H HB2  . GLU A 1 17 ? 3.250   -1.601  5.294   1.00 0.00 ? 17 GLU A HB2  8  
ATOM 5738 H HB3  . GLU A 1 17 ? 3.990   -3.126  5.688   1.00 0.00 ? 17 GLU A HB3  8  
ATOM 5739 H HG2  . GLU A 1 17 ? 5.980   -2.642  4.404   1.00 0.00 ? 17 GLU A HG2  8  
ATOM 5740 H HG3  . GLU A 1 17 ? 5.260   -1.254  3.618   1.00 0.00 ? 17 GLU A HG3  8  
ATOM 5741 N N    . ASN A 1 18 ? 0.875   -3.457  3.707   1.00 0.00 ? 18 ASN A N    8  
ATOM 5742 C CA   . ASN A 1 18 ? -0.362  -4.261  3.991   1.00 0.00 ? 18 ASN A CA   8  
ATOM 5743 C C    . ASN A 1 18 ? -0.346  -5.508  3.069   1.00 0.00 ? 18 ASN A C    8  
ATOM 5744 O O    . ASN A 1 18 ? -1.069  -6.460  3.283   1.00 0.00 ? 18 ASN A O    8  
ATOM 5745 C CB   . ASN A 1 18 ? -1.611  -3.396  3.679   1.00 0.00 ? 18 ASN A CB   8  
ATOM 5746 C CG   . ASN A 1 18 ? -2.942  -4.160  3.841   1.00 0.00 ? 18 ASN A CG   8  
ATOM 5747 O OD1  . ASN A 1 18 ? -3.961  -3.753  3.319   1.00 0.00 ? 18 ASN A OD1  8  
ATOM 5748 N ND2  . ASN A 1 18 ? -3.005  -5.256  4.547   1.00 0.00 ? 18 ASN A ND2  8  
ATOM 5749 H H    . ASN A 1 18 ? 0.788   -2.575  3.291   1.00 0.00 ? 18 ASN A H    8  
ATOM 5750 H HA   . ASN A 1 18 ? -0.361  -4.570  5.028   1.00 0.00 ? 18 ASN A HA   8  
ATOM 5751 H HB2  . ASN A 1 18 ? -1.635  -2.539  4.334   1.00 0.00 ? 18 ASN A HB2  8  
ATOM 5752 H HB3  . ASN A 1 18 ? -1.553  -3.040  2.660   1.00 0.00 ? 18 ASN A HB3  8  
ATOM 5753 H HD21 . ASN A 1 18 ? -2.200  -5.605  4.988   1.00 0.00 ? 18 ASN A HD21 8  
ATOM 5754 H HD22 . ASN A 1 18 ? -3.858  -5.732  4.629   1.00 0.00 ? 18 ASN A HD22 8  
ATOM 5755 N N    . TYR A 1 19 ? 0.493   -5.455  2.064   1.00 0.00 ? 19 TYR A N    8  
ATOM 5756 C CA   . TYR A 1 19 ? 0.612   -6.585  1.090   1.00 0.00 ? 19 TYR A CA   8  
ATOM 5757 C C    . TYR A 1 19 ? 1.825   -7.479  1.385   1.00 0.00 ? 19 TYR A C    8  
ATOM 5758 O O    . TYR A 1 19 ? 1.962   -8.535  0.798   1.00 0.00 ? 19 TYR A O    8  
ATOM 5759 C CB   . TYR A 1 19 ? 0.698   -5.962  -0.308  1.00 0.00 ? 19 TYR A CB   8  
ATOM 5760 C CG   . TYR A 1 19 ? -0.594  -5.140  -0.520  1.00 0.00 ? 19 TYR A CG   8  
ATOM 5761 C CD1  . TYR A 1 19 ? -1.727  -5.735  -1.038  1.00 0.00 ? 19 TYR A CD1  8  
ATOM 5762 C CD2  . TYR A 1 19 ? -0.652  -3.801  -0.181  1.00 0.00 ? 19 TYR A CD2  8  
ATOM 5763 C CE1  . TYR A 1 19 ? -2.887  -5.009  -1.216  1.00 0.00 ? 19 TYR A CE1  8  
ATOM 5764 C CE2  . TYR A 1 19 ? -1.812  -3.069  -0.360  1.00 0.00 ? 19 TYR A CE2  8  
ATOM 5765 C CZ   . TYR A 1 19 ? -2.943  -3.669  -0.880  1.00 0.00 ? 19 TYR A CZ   8  
ATOM 5766 O OH   . TYR A 1 19 ? -4.108  -2.944  -1.068  1.00 0.00 ? 19 TYR A OH   8  
ATOM 5767 H H    . TYR A 1 19 ? 1.056   -4.663  1.942   1.00 0.00 ? 19 TYR A H    8  
ATOM 5768 H HA   . TYR A 1 19 ? -0.272  -7.206  1.138   1.00 0.00 ? 19 TYR A HA   8  
ATOM 5769 H HB2  . TYR A 1 19 ? 1.559   -5.311  -0.376  1.00 0.00 ? 19 TYR A HB2  8  
ATOM 5770 H HB3  . TYR A 1 19 ? 0.769   -6.723  -1.069  1.00 0.00 ? 19 TYR A HB3  8  
ATOM 5771 H HD1  . TYR A 1 19 ? -1.708  -6.779  -1.310  1.00 0.00 ? 19 TYR A HD1  8  
ATOM 5772 H HD2  . TYR A 1 19 ? 0.223   -3.321  0.228   1.00 0.00 ? 19 TYR A HD2  8  
ATOM 5773 H HE1  . TYR A 1 19 ? -3.756  -5.503  -1.619  1.00 0.00 ? 19 TYR A HE1  8  
ATOM 5774 H HE2  . TYR A 1 19 ? -1.826  -2.022  -0.095  1.00 0.00 ? 19 TYR A HE2  8  
ATOM 5775 H HH   . TYR A 1 19 ? -4.666  -3.058  -0.293  1.00 0.00 ? 19 TYR A HH   8  
ATOM 5776 N N    . CYS A 1 20 ? 2.660   -7.027  2.288   1.00 0.00 ? 20 CYS A N    8  
ATOM 5777 C CA   . CYS A 1 20 ? 3.883   -7.800  2.681   1.00 0.00 ? 20 CYS A CA   8  
ATOM 5778 C C    . CYS A 1 20 ? 3.676   -8.513  4.037   1.00 0.00 ? 20 CYS A C    8  
ATOM 5779 O O    . CYS A 1 20 ? 4.110   -9.641  4.166   1.00 0.00 ? 20 CYS A O    8  
ATOM 5780 C CB   . CYS A 1 20 ? 5.090   -6.826  2.740   1.00 0.00 ? 20 CYS A CB   8  
ATOM 5781 S SG   . CYS A 1 20 ? 5.970   -6.528  1.187   1.00 0.00 ? 20 CYS A SG   8  
ATOM 5782 H H    . CYS A 1 20 ? 2.481   -6.164  2.713   1.00 0.00 ? 20 CYS A H    8  
ATOM 5783 H HA   . CYS A 1 20 ? 4.097   -8.545  1.933   1.00 0.00 ? 20 CYS A HA   8  
ATOM 5784 H HB2  . CYS A 1 20 ? 4.792   -5.860  3.116   1.00 0.00 ? 20 CYS A HB2  8  
ATOM 5785 H HB3  . CYS A 1 20 ? 5.814   -7.228  3.432   1.00 0.00 ? 20 CYS A HB3  8  
ATOM 5786 N N    . ASN A 1 21 ? 3.048   -7.889  5.013   1.00 0.00 ? 21 ASN A N    8  
ATOM 5787 C CA   . ASN A 1 21 ? 2.833   -8.578  6.337   1.00 0.00 ? 21 ASN A CA   8  
ATOM 5788 C C    . ASN A 1 21 ? 1.338   -8.618  6.668   1.00 0.00 ? 21 ASN A C    8  
ATOM 5789 O O    . ASN A 1 21 ? 0.475   -8.326  5.862   1.00 0.00 ? 21 ASN A O    8  
ATOM 5790 C CB   . ASN A 1 21 ? 3.603   -7.823  7.488   1.00 0.00 ? 21 ASN A CB   8  
ATOM 5791 C CG   . ASN A 1 21 ? 3.068   -6.410  7.780   1.00 0.00 ? 21 ASN A CG   8  
ATOM 5792 O OD1  . ASN A 1 21 ? 1.914   -6.221  8.113   1.00 0.00 ? 21 ASN A OD1  8  
ATOM 5793 N ND2  . ASN A 1 21 ? 3.878   -5.393  7.671   1.00 0.00 ? 21 ASN A ND2  8  
ATOM 5794 H H    . ASN A 1 21 ? 2.712   -6.980  4.890   1.00 0.00 ? 21 ASN A H    8  
ATOM 5795 H HA   . ASN A 1 21 ? 3.180   -9.601  6.281   1.00 0.00 ? 21 ASN A HA   8  
ATOM 5796 H HB2  . ASN A 1 21 ? 3.526   -8.402  8.401   1.00 0.00 ? 21 ASN A HB2  8  
ATOM 5797 H HB3  . ASN A 1 21 ? 4.649   -7.760  7.218   1.00 0.00 ? 21 ASN A HB3  8  
ATOM 5798 H HD21 . ASN A 1 21 ? 4.808   -5.543  7.405   1.00 0.00 ? 21 ASN A HD21 8  
ATOM 5799 H HD22 . ASN A 1 21 ? 3.551   -4.487  7.858   1.00 0.00 ? 21 ASN A HD22 8  
ATOM 5800 N N    . PHE B 2 1  ? 6.109   9.555   3.320   1.00 0.00 ? 1  PHE B N    8  
ATOM 5801 C CA   . PHE B 2 1  ? 4.859   10.181  2.794   1.00 0.00 ? 1  PHE B CA   8  
ATOM 5802 C C    . PHE B 2 1  ? 5.192   11.358  1.862   1.00 0.00 ? 1  PHE B C    8  
ATOM 5803 O O    . PHE B 2 1  ? 5.815   12.316  2.270   1.00 0.00 ? 1  PHE B O    8  
ATOM 5804 C CB   . PHE B 2 1  ? 4.011   10.623  4.026   1.00 0.00 ? 1  PHE B CB   8  
ATOM 5805 C CG   . PHE B 2 1  ? 3.017   11.758  3.745   1.00 0.00 ? 1  PHE B CG   8  
ATOM 5806 C CD1  . PHE B 2 1  ? 2.102   11.679  2.710   1.00 0.00 ? 1  PHE B CD1  8  
ATOM 5807 C CD2  . PHE B 2 1  ? 3.028   12.880  4.555   1.00 0.00 ? 1  PHE B CD2  8  
ATOM 5808 C CE1  . PHE B 2 1  ? 1.211   12.706  2.490   1.00 0.00 ? 1  PHE B CE1  8  
ATOM 5809 C CE2  . PHE B 2 1  ? 2.136   13.908  4.334   1.00 0.00 ? 1  PHE B CE2  8  
ATOM 5810 C CZ   . PHE B 2 1  ? 1.227   13.820  3.300   1.00 0.00 ? 1  PHE B CZ   8  
ATOM 5811 H H1   . PHE B 2 1  ? 6.932   10.073  2.947   1.00 0.00 ? 1  PHE B H1   8  
ATOM 5812 H H2   . PHE B 2 1  ? 6.111   9.612   4.361   1.00 0.00 ? 1  PHE B H2   8  
ATOM 5813 H H3   . PHE B 2 1  ? 6.160   8.558   3.023   1.00 0.00 ? 1  PHE B H3   8  
ATOM 5814 H HA   . PHE B 2 1  ? 4.317   9.431   2.234   1.00 0.00 ? 1  PHE B HA   8  
ATOM 5815 H HB2  . PHE B 2 1  ? 3.428   9.769   4.350   1.00 0.00 ? 1  PHE B HB2  8  
ATOM 5816 H HB3  . PHE B 2 1  ? 4.665   10.921  4.831   1.00 0.00 ? 1  PHE B HB3  8  
ATOM 5817 H HD1  . PHE B 2 1  ? 2.077   10.808  2.069   1.00 0.00 ? 1  PHE B HD1  8  
ATOM 5818 H HD2  . PHE B 2 1  ? 3.735   12.965  5.371   1.00 0.00 ? 1  PHE B HD2  8  
ATOM 5819 H HE1  . PHE B 2 1  ? 0.499   12.647  1.678   1.00 0.00 ? 1  PHE B HE1  8  
ATOM 5820 H HE2  . PHE B 2 1  ? 2.149   14.777  4.972   1.00 0.00 ? 1  PHE B HE2  8  
ATOM 5821 H HZ   . PHE B 2 1  ? 0.517   14.617  3.120   1.00 0.00 ? 1  PHE B HZ   8  
ATOM 5822 N N    . VAL B 2 2  ? 4.757   11.223  0.634   1.00 0.00 ? 2  VAL B N    8  
ATOM 5823 C CA   . VAL B 2 2  ? 4.994   12.271  -0.413  1.00 0.00 ? 2  VAL B CA   8  
ATOM 5824 C C    . VAL B 2 2  ? 3.654   12.871  -0.873  1.00 0.00 ? 2  VAL B C    8  
ATOM 5825 O O    . VAL B 2 2  ? 2.607   12.576  -0.327  1.00 0.00 ? 2  VAL B O    8  
ATOM 5826 C CB   . VAL B 2 2  ? 5.718   11.646  -1.649  1.00 0.00 ? 2  VAL B CB   8  
ATOM 5827 C CG1  . VAL B 2 2  ? 7.101   11.082  -1.270  1.00 0.00 ? 2  VAL B CG1  8  
ATOM 5828 C CG2  . VAL B 2 2  ? 4.844   10.519  -2.268  1.00 0.00 ? 2  VAL B CG2  8  
ATOM 5829 H H    . VAL B 2 2  ? 4.264   10.413  0.391   1.00 0.00 ? 2  VAL B H    8  
ATOM 5830 H HA   . VAL B 2 2  ? 5.602   13.064  -0.001  1.00 0.00 ? 2  VAL B HA   8  
ATOM 5831 H HB   . VAL B 2 2  ? 5.862   12.411  -2.398  1.00 0.00 ? 2  VAL B HB   8  
ATOM 5832 H HG11 . VAL B 2 2  ? 7.003   10.318  -0.514  1.00 0.00 ? 2  VAL B HG11 8  
ATOM 5833 H HG12 . VAL B 2 2  ? 7.568   10.655  -2.146  1.00 0.00 ? 2  VAL B HG12 8  
ATOM 5834 H HG13 . VAL B 2 2  ? 7.737   11.869  -0.897  1.00 0.00 ? 2  VAL B HG13 8  
ATOM 5835 H HG21 . VAL B 2 2  ? 4.657   9.738   -1.545  1.00 0.00 ? 2  VAL B HG21 8  
ATOM 5836 H HG22 . VAL B 2 2  ? 3.893   10.914  -2.601  1.00 0.00 ? 2  VAL B HG22 8  
ATOM 5837 H HG23 . VAL B 2 2  ? 5.351   10.081  -3.114  1.00 0.00 ? 2  VAL B HG23 8  
ATOM 5838 N N    . ASN B 2 3  ? 3.756   13.707  -1.872  1.00 0.00 ? 3  ASN B N    8  
ATOM 5839 C CA   . ASN B 2 3  ? 2.574   14.389  -2.471  1.00 0.00 ? 3  ASN B CA   8  
ATOM 5840 C C    . ASN B 2 3  ? 2.759   14.395  -4.006  1.00 0.00 ? 3  ASN B C    8  
ATOM 5841 O O    . ASN B 2 3  ? 3.154   15.391  -4.584  1.00 0.00 ? 3  ASN B O    8  
ATOM 5842 C CB   . ASN B 2 3  ? 2.489   15.835  -1.900  1.00 0.00 ? 3  ASN B CB   8  
ATOM 5843 C CG   . ASN B 2 3  ? 3.846   16.547  -2.008  1.00 0.00 ? 3  ASN B CG   8  
ATOM 5844 O OD1  . ASN B 2 3  ? 4.788   16.244  -1.301  1.00 0.00 ? 3  ASN B OD1  8  
ATOM 5845 N ND2  . ASN B 2 3  ? 3.977   17.494  -2.892  1.00 0.00 ? 3  ASN B ND2  8  
ATOM 5846 H H    . ASN B 2 3  ? 4.646   13.893  -2.240  1.00 0.00 ? 3  ASN B H    8  
ATOM 5847 H HA   . ASN B 2 3  ? 1.673   13.843  -2.228  1.00 0.00 ? 3  ASN B HA   8  
ATOM 5848 H HB2  . ASN B 2 3  ? 1.752   16.391  -2.462  1.00 0.00 ? 3  ASN B HB2  8  
ATOM 5849 H HB3  . ASN B 2 3  ? 2.188   15.818  -0.859  1.00 0.00 ? 3  ASN B HB3  8  
ATOM 5850 H HD21 . ASN B 2 3  ? 3.214   17.724  -3.460  1.00 0.00 ? 3  ASN B HD21 8  
ATOM 5851 H HD22 . ASN B 2 3  ? 4.830   17.973  -2.991  1.00 0.00 ? 3  ASN B HD22 8  
ATOM 5852 N N    . GLN B 2 4  ? 2.476   13.279  -4.628  1.00 0.00 ? 4  GLN B N    8  
ATOM 5853 C CA   . GLN B 2 4  ? 2.613   13.133  -6.110  1.00 0.00 ? 4  GLN B CA   8  
ATOM 5854 C C    . GLN B 2 4  ? 1.211   12.767  -6.694  1.00 0.00 ? 4  GLN B C    8  
ATOM 5855 O O    . GLN B 2 4  ? 0.229   12.842  -5.980  1.00 0.00 ? 4  GLN B O    8  
ATOM 5856 C CB   . GLN B 2 4  ? 3.694   12.023  -6.297  1.00 0.00 ? 4  GLN B CB   8  
ATOM 5857 C CG   . GLN B 2 4  ? 4.006   11.649  -7.774  1.00 0.00 ? 4  GLN B CG   8  
ATOM 5858 C CD   . GLN B 2 4  ? 4.491   12.888  -8.533  1.00 0.00 ? 4  GLN B CD   8  
ATOM 5859 O OE1  . GLN B 2 4  ? 5.490   13.478  -8.178  1.00 0.00 ? 4  GLN B OE1  8  
ATOM 5860 N NE2  . GLN B 2 4  ? 3.833   13.318  -9.574  1.00 0.00 ? 4  GLN B NE2  8  
ATOM 5861 H H    . GLN B 2 4  ? 2.162   12.499  -4.133  1.00 0.00 ? 4  GLN B H    8  
ATOM 5862 H HA   . GLN B 2 4  ? 2.954   14.096  -6.494  1.00 0.00 ? 4  GLN B HA   8  
ATOM 5863 H HB2  . GLN B 2 4  ? 4.607   12.363  -5.830  1.00 0.00 ? 4  GLN B HB2  8  
ATOM 5864 H HB3  . GLN B 2 4  ? 3.374   11.142  -5.763  1.00 0.00 ? 4  GLN B HB3  8  
ATOM 5865 H HG2  . GLN B 2 4  ? 4.812   10.933  -7.777  1.00 0.00 ? 4  GLN B HG2  8  
ATOM 5866 H HG3  . GLN B 2 4  ? 3.165   11.196  -8.280  1.00 0.00 ? 4  GLN B HG3  8  
ATOM 5867 H HE21 . GLN B 2 4  ? 3.031   12.854  -9.885  1.00 0.00 ? 4  GLN B HE21 8  
ATOM 5868 H HE22 . GLN B 2 4  ? 4.146   14.119  -10.047 1.00 0.00 ? 4  GLN B HE22 8  
ATOM 5869 N N    . HIS B 2 5  ? 1.141   12.392  -7.957  1.00 0.00 ? 5  HIS B N    8  
ATOM 5870 C CA   . HIS B 2 5  ? -0.150  12.018  -8.615  1.00 0.00 ? 5  HIS B CA   8  
ATOM 5871 C C    . HIS B 2 5  ? -0.045  10.484  -8.774  1.00 0.00 ? 5  HIS B C    8  
ATOM 5872 O O    . HIS B 2 5  ? 0.075   9.951   -9.859  1.00 0.00 ? 5  HIS B O    8  
ATOM 5873 C CB   . HIS B 2 5  ? -0.245  12.737  -9.985  1.00 0.00 ? 5  HIS B CB   8  
ATOM 5874 C CG   . HIS B 2 5  ? -0.033  14.241  -9.786  1.00 0.00 ? 5  HIS B CG   8  
ATOM 5875 N ND1  . HIS B 2 5  ? -0.857  15.076  -9.238  1.00 0.00 ? 5  HIS B ND1  8  
ATOM 5876 C CD2  . HIS B 2 5  ? 1.059   15.017  -10.128 1.00 0.00 ? 5  HIS B CD2  8  
ATOM 5877 C CE1  . HIS B 2 5  ? -0.334  16.265  -9.234  1.00 0.00 ? 5  HIS B CE1  8  
ATOM 5878 N NE2  . HIS B 2 5  ? 0.859   16.269  -9.779  1.00 0.00 ? 5  HIS B NE2  8  
ATOM 5879 H H    . HIS B 2 5  ? 1.941   12.338  -8.507  1.00 0.00 ? 5  HIS B H    8  
ATOM 5880 H HA   . HIS B 2 5  ? -0.994  12.263  -7.989  1.00 0.00 ? 5  HIS B HA   8  
ATOM 5881 H HB2  . HIS B 2 5  ? 0.516   12.365  -10.656 1.00 0.00 ? 5  HIS B HB2  8  
ATOM 5882 H HB3  . HIS B 2 5  ? -1.218  12.575  -10.433 1.00 0.00 ? 5  HIS B HB3  8  
ATOM 5883 H HD1  . HIS B 2 5  ? -1.741  14.849  -8.881  1.00 0.00 ? 5  HIS B HD1  8  
ATOM 5884 H HD2  . HIS B 2 5  ? 1.950   14.644  -10.613 1.00 0.00 ? 5  HIS B HD2  8  
ATOM 5885 H HE1  . HIS B 2 5  ? -0.813  17.145  -8.833  1.00 0.00 ? 5  HIS B HE1  8  
ATOM 5886 N N    . LEU B 2 6  ? -0.092  9.829   -7.640  1.00 0.00 ? 6  LEU B N    8  
ATOM 5887 C CA   . LEU B 2 6  ? 0.000   8.331   -7.549  1.00 0.00 ? 6  LEU B CA   8  
ATOM 5888 C C    . LEU B 2 6  ? -1.424  7.807   -7.692  1.00 0.00 ? 6  LEU B C    8  
ATOM 5889 O O    . LEU B 2 6  ? -2.119  7.669   -6.706  1.00 0.00 ? 6  LEU B O    8  
ATOM 5890 C CB   . LEU B 2 6  ? 0.628   7.999   -6.163  1.00 0.00 ? 6  LEU B CB   8  
ATOM 5891 C CG   . LEU B 2 6  ? 2.001   8.719   -6.030  1.00 0.00 ? 6  LEU B CG   8  
ATOM 5892 C CD1  . LEU B 2 6  ? 2.562   8.540   -4.615  1.00 0.00 ? 6  LEU B CD1  8  
ATOM 5893 C CD2  . LEU B 2 6  ? 3.028   8.138   -7.042  1.00 0.00 ? 6  LEU B CD2  8  
ATOM 5894 H H    . LEU B 2 6  ? -0.198  10.349  -6.816  1.00 0.00 ? 6  LEU B H    8  
ATOM 5895 H HA   . LEU B 2 6  ? 0.600   7.957   -8.353  1.00 0.00 ? 6  LEU B HA   8  
ATOM 5896 H HB2  . LEU B 2 6  ? -0.027  8.351   -5.377  1.00 0.00 ? 6  LEU B HB2  8  
ATOM 5897 H HB3  . LEU B 2 6  ? 0.758   6.933   -6.048  1.00 0.00 ? 6  LEU B HB3  8  
ATOM 5898 H HG   . LEU B 2 6  ? 1.849   9.772   -6.201  1.00 0.00 ? 6  LEU B HG   8  
ATOM 5899 H HD11 . LEU B 2 6  ? 2.679   7.492   -4.377  1.00 0.00 ? 6  LEU B HD11 8  
ATOM 5900 H HD12 . LEU B 2 6  ? 3.520   9.036   -4.548  1.00 0.00 ? 6  LEU B HD12 8  
ATOM 5901 H HD13 . LEU B 2 6  ? 1.890   8.983   -3.898  1.00 0.00 ? 6  LEU B HD13 8  
ATOM 5902 H HD21 . LEU B 2 6  ? 3.167   7.078   -6.874  1.00 0.00 ? 6  LEU B HD21 8  
ATOM 5903 H HD22 . LEU B 2 6  ? 2.685   8.271   -8.053  1.00 0.00 ? 6  LEU B HD22 8  
ATOM 5904 H HD23 . LEU B 2 6  ? 3.979   8.642   -6.943  1.00 0.00 ? 6  LEU B HD23 8  
ATOM 5905 N N    . CYS B 2 7  ? -1.807  7.533   -8.917  1.00 0.00 ? 7  CYS B N    8  
ATOM 5906 C CA   . CYS B 2 7  ? -3.190  7.030   -9.204  1.00 0.00 ? 7  CYS B CA   8  
ATOM 5907 C C    . CYS B 2 7  ? -3.316  5.533   -9.553  1.00 0.00 ? 7  CYS B C    8  
ATOM 5908 O O    . CYS B 2 7  ? -4.061  5.167   -10.442 1.00 0.00 ? 7  CYS B O    8  
ATOM 5909 C CB   . CYS B 2 7  ? -3.719  7.896   -10.352 1.00 0.00 ? 7  CYS B CB   8  
ATOM 5910 S SG   . CYS B 2 7  ? -3.485  9.685   -10.191 1.00 0.00 ? 7  CYS B SG   8  
ATOM 5911 H H    . CYS B 2 7  ? -1.183  7.660   -9.661  1.00 0.00 ? 7  CYS B H    8  
ATOM 5912 H HA   . CYS B 2 7  ? -3.825  7.210   -8.353  1.00 0.00 ? 7  CYS B HA   8  
ATOM 5913 H HB2  . CYS B 2 7  ? -3.241  7.583   -11.269 1.00 0.00 ? 7  CYS B HB2  8  
ATOM 5914 H HB3  . CYS B 2 7  ? -4.777  7.710   -10.464 1.00 0.00 ? 7  CYS B HB3  8  
ATOM 5915 N N    . GLY B 2 8  ? -2.596  4.696   -8.854  1.00 0.00 ? 8  GLY B N    8  
ATOM 5916 C CA   . GLY B 2 8  ? -2.671  3.226   -9.131  1.00 0.00 ? 8  GLY B CA   8  
ATOM 5917 C C    . GLY B 2 8  ? -1.412  2.745   -9.885  1.00 0.00 ? 8  GLY B C    8  
ATOM 5918 O O    . GLY B 2 8  ? -0.766  1.837   -9.410  1.00 0.00 ? 8  GLY B O    8  
ATOM 5919 H H    . GLY B 2 8  ? -2.006  5.032   -8.146  1.00 0.00 ? 8  GLY B H    8  
ATOM 5920 H HA2  . GLY B 2 8  ? -2.707  2.708   -8.188  1.00 0.00 ? 8  GLY B HA2  8  
ATOM 5921 H HA3  . GLY B 2 8  ? -3.586  2.959   -9.639  1.00 0.00 ? 8  GLY B HA3  8  
ATOM 5922 N N    . SER B 2 9  ? -1.072  3.327   -11.022 1.00 0.00 ? 9  SER B N    8  
ATOM 5923 C CA   . SER B 2 9  ? 0.146   2.892   -11.793 1.00 0.00 ? 9  SER B CA   8  
ATOM 5924 C C    . SER B 2 9  ? 1.406   2.644   -10.940 1.00 0.00 ? 9  SER B C    8  
ATOM 5925 O O    . SER B 2 9  ? 2.151   1.706   -11.150 1.00 0.00 ? 9  SER B O    8  
ATOM 5926 C CB   . SER B 2 9  ? 0.453   3.965   -12.878 1.00 0.00 ? 9  SER B CB   8  
ATOM 5927 O OG   . SER B 2 9  ? 0.848   5.134   -12.166 1.00 0.00 ? 9  SER B OG   8  
ATOM 5928 H H    . SER B 2 9  ? -1.602  4.061   -11.409 1.00 0.00 ? 9  SER B H    8  
ATOM 5929 H HA   . SER B 2 9  ? -0.097  1.971   -12.294 1.00 0.00 ? 9  SER B HA   8  
ATOM 5930 H HB2  . SER B 2 9  ? 1.233   3.643   -13.549 1.00 0.00 ? 9  SER B HB2  8  
ATOM 5931 H HB3  . SER B 2 9  ? -0.445  4.178   -13.444 1.00 0.00 ? 9  SER B HB3  8  
ATOM 5932 H HG   . SER B 2 9  ? 1.767   5.355   -12.330 1.00 0.00 ? 9  SER B HG   8  
ATOM 5933 N N    . HIS B 2 10 ? 1.571   3.517   -9.983  1.00 0.00 ? 10 HIS B N    8  
ATOM 5934 C CA   . HIS B 2 10 ? 2.719   3.483   -9.046  1.00 0.00 ? 10 HIS B CA   8  
ATOM 5935 C C    . HIS B 2 10 ? 2.401   2.649   -7.813  1.00 0.00 ? 10 HIS B C    8  
ATOM 5936 O O    . HIS B 2 10 ? 3.292   2.086   -7.205  1.00 0.00 ? 10 HIS B O    8  
ATOM 5937 C CB   . HIS B 2 10 ? 3.077   4.925   -8.647  1.00 0.00 ? 10 HIS B CB   8  
ATOM 5938 C CG   . HIS B 2 10 ? 3.641   5.654   -9.867  1.00 0.00 ? 10 HIS B CG   8  
ATOM 5939 N ND1  . HIS B 2 10 ? 4.192   6.822   -9.843  1.00 0.00 ? 10 HIS B ND1  8  
ATOM 5940 C CD2  . HIS B 2 10 ? 3.707   5.279   -11.197 1.00 0.00 ? 10 HIS B CD2  8  
ATOM 5941 C CE1  . HIS B 2 10 ? 4.569   7.158   -11.037 1.00 0.00 ? 10 HIS B CE1  8  
ATOM 5942 N NE2  . HIS B 2 10 ? 4.284   6.221   -11.912 1.00 0.00 ? 10 HIS B NE2  8  
ATOM 5943 H H    . HIS B 2 10 ? 0.914   4.212   -9.879  1.00 0.00 ? 10 HIS B H    8  
ATOM 5944 H HA   . HIS B 2 10 ? 3.556   3.075   -9.570  1.00 0.00 ? 10 HIS B HA   8  
ATOM 5945 H HB2  . HIS B 2 10 ? 2.221   5.465   -8.286  1.00 0.00 ? 10 HIS B HB2  8  
ATOM 5946 H HB3  . HIS B 2 10 ? 3.837   4.914   -7.884  1.00 0.00 ? 10 HIS B HB3  8  
ATOM 5947 H HD1  . HIS B 2 10 ? 4.310   7.367   -9.038  1.00 0.00 ? 10 HIS B HD1  8  
ATOM 5948 H HD2  . HIS B 2 10 ? 3.351   4.342   -11.594 1.00 0.00 ? 10 HIS B HD2  8  
ATOM 5949 H HE1  . HIS B 2 10 ? 5.062   8.089   -11.284 1.00 0.00 ? 10 HIS B HE1  8  
ATOM 5950 N N    . LEU B 2 11 ? 1.138   2.577   -7.480  1.00 0.00 ? 11 LEU B N    8  
ATOM 5951 C CA   . LEU B 2 11 ? 0.715   1.783   -6.288  1.00 0.00 ? 11 LEU B CA   8  
ATOM 5952 C C    . LEU B 2 11 ? 0.855   0.300   -6.699  1.00 0.00 ? 11 LEU B C    8  
ATOM 5953 O O    . LEU B 2 11 ? 0.981   -0.591  -5.881  1.00 0.00 ? 11 LEU B O    8  
ATOM 5954 C CB   . LEU B 2 11 ? -0.764  2.106   -5.950  1.00 0.00 ? 11 LEU B CB   8  
ATOM 5955 C CG   . LEU B 2 11 ? -1.032  3.643   -5.817  1.00 0.00 ? 11 LEU B CG   8  
ATOM 5956 C CD1  . LEU B 2 11 ? -2.521  3.861   -5.515  1.00 0.00 ? 11 LEU B CD1  8  
ATOM 5957 C CD2  . LEU B 2 11 ? -0.209  4.267   -4.682  1.00 0.00 ? 11 LEU B CD2  8  
ATOM 5958 H H    . LEU B 2 11 ? 0.460   3.038   -8.013  1.00 0.00 ? 11 LEU B H    8  
ATOM 5959 H HA   . LEU B 2 11 ? 1.374   2.000   -5.466  1.00 0.00 ? 11 LEU B HA   8  
ATOM 5960 H HB2  . LEU B 2 11 ? -1.406  1.712   -6.724  1.00 0.00 ? 11 LEU B HB2  8  
ATOM 5961 H HB3  . LEU B 2 11 ? -1.019  1.610   -5.023  1.00 0.00 ? 11 LEU B HB3  8  
ATOM 5962 H HG   . LEU B 2 11 ? -0.795  4.139   -6.748  1.00 0.00 ? 11 LEU B HG   8  
ATOM 5963 H HD11 . LEU B 2 11 ? -2.817  3.330   -4.620  1.00 0.00 ? 11 LEU B HD11 8  
ATOM 5964 H HD12 . LEU B 2 11 ? -2.745  4.912   -5.396  1.00 0.00 ? 11 LEU B HD12 8  
ATOM 5965 H HD13 . LEU B 2 11 ? -3.092  3.480   -6.343  1.00 0.00 ? 11 LEU B HD13 8  
ATOM 5966 H HD21 . LEU B 2 11 ? -0.436  3.785   -3.742  1.00 0.00 ? 11 LEU B HD21 8  
ATOM 5967 H HD22 . LEU B 2 11 ? 0.843   4.143   -4.890  1.00 0.00 ? 11 LEU B HD22 8  
ATOM 5968 H HD23 . LEU B 2 11 ? -0.432  5.319   -4.606  1.00 0.00 ? 11 LEU B HD23 8  
ATOM 5969 N N    . VAL B 2 12 ? 0.836   0.112   -7.994  1.00 0.00 ? 12 VAL B N    8  
ATOM 5970 C CA   . VAL B 2 12 ? 0.948   -1.201  -8.679  1.00 0.00 ? 12 VAL B CA   8  
ATOM 5971 C C    . VAL B 2 12 ? 2.415   -1.542  -8.848  1.00 0.00 ? 12 VAL B C    8  
ATOM 5972 O O    . VAL B 2 12 ? 2.806   -2.625  -8.469  1.00 0.00 ? 12 VAL B O    8  
ATOM 5973 C CB   . VAL B 2 12 ? 0.186   -1.048  -10.027 1.00 0.00 ? 12 VAL B CB   8  
ATOM 5974 C CG1  . VAL B 2 12 ? 0.527   -2.148  -11.053 1.00 0.00 ? 12 VAL B CG1  8  
ATOM 5975 C CG2  . VAL B 2 12 ? -1.296  -1.176  -9.695  1.00 0.00 ? 12 VAL B CG2  8  
ATOM 5976 H H    . VAL B 2 12 ? 0.744   0.889   -8.577  1.00 0.00 ? 12 VAL B H    8  
ATOM 5977 H HA   . VAL B 2 12 ? 0.486   -1.965  -8.072  1.00 0.00 ? 12 VAL B HA   8  
ATOM 5978 H HB   . VAL B 2 12 ? 0.359   -0.072  -10.452 1.00 0.00 ? 12 VAL B HB   8  
ATOM 5979 H HG11 . VAL B 2 12 ? 0.300   -3.123  -10.654 1.00 0.00 ? 12 VAL B HG11 8  
ATOM 5980 H HG12 . VAL B 2 12 ? -0.050  -1.995  -11.958 1.00 0.00 ? 12 VAL B HG12 8  
ATOM 5981 H HG13 . VAL B 2 12 ? 1.571   -2.107  -11.313 1.00 0.00 ? 12 VAL B HG13 8  
ATOM 5982 H HG21 . VAL B 2 12 ? -1.589  -0.422  -8.984  1.00 0.00 ? 12 VAL B HG21 8  
ATOM 5983 H HG22 . VAL B 2 12 ? -1.909  -1.046  -10.575 1.00 0.00 ? 12 VAL B HG22 8  
ATOM 5984 H HG23 . VAL B 2 12 ? -1.500  -2.145  -9.252  1.00 0.00 ? 12 VAL B HG23 8  
ATOM 5985 N N    . GLU B 2 13 ? 3.199   -0.638  -9.390  1.00 0.00 ? 13 GLU B N    8  
ATOM 5986 C CA   . GLU B 2 13 ? 4.642   -1.004  -9.539  1.00 0.00 ? 13 GLU B CA   8  
ATOM 5987 C C    . GLU B 2 13 ? 5.315   -1.177  -8.156  1.00 0.00 ? 13 GLU B C    8  
ATOM 5988 O O    . GLU B 2 13 ? 6.221   -1.980  -8.018  1.00 0.00 ? 13 GLU B O    8  
ATOM 5989 C CB   . GLU B 2 13 ? 5.372   0.086   -10.362 1.00 0.00 ? 13 GLU B CB   8  
ATOM 5990 C CG   . GLU B 2 13 ? 6.825   -0.312  -10.643 1.00 0.00 ? 13 GLU B CG   8  
ATOM 5991 C CD   . GLU B 2 13 ? 7.008   -1.737  -11.220 1.00 0.00 ? 13 GLU B CD   8  
ATOM 5992 O OE1  . GLU B 2 13 ? 6.641   -1.933  -12.369 1.00 0.00 ? 13 GLU B OE1  8  
ATOM 5993 O OE2  . GLU B 2 13 ? 7.510   -2.555  -10.465 1.00 0.00 ? 13 GLU B OE2  8  
ATOM 5994 H H    . GLU B 2 13 ? 2.848   0.241   -9.686  1.00 0.00 ? 13 GLU B H    8  
ATOM 5995 H HA   . GLU B 2 13 ? 4.707   -1.924  -10.098 1.00 0.00 ? 13 GLU B HA   8  
ATOM 5996 H HB2  . GLU B 2 13 ? 4.833   0.333   -11.264 1.00 0.00 ? 13 GLU B HB2  8  
ATOM 5997 H HB3  . GLU B 2 13 ? 5.497   0.969   -9.777  1.00 0.00 ? 13 GLU B HB3  8  
ATOM 5998 H HG2  . GLU B 2 13 ? 7.174   0.397   -11.368 1.00 0.00 ? 13 GLU B HG2  8  
ATOM 5999 H HG3  . GLU B 2 13 ? 7.399   -0.209  -9.739  1.00 0.00 ? 13 GLU B HG3  8  
ATOM 6000 N N    . ALA B 2 14 ? 4.861   -0.446  -7.162  1.00 0.00 ? 14 ALA B N    8  
ATOM 6001 C CA   . ALA B 2 14 ? 5.467   -0.555  -5.796  1.00 0.00 ? 14 ALA B CA   8  
ATOM 6002 C C    . ALA B 2 14 ? 4.996   -1.833  -5.085  1.00 0.00 ? 14 ALA B C    8  
ATOM 6003 O O    . ALA B 2 14 ? 5.750   -2.392  -4.309  1.00 0.00 ? 14 ALA B O    8  
ATOM 6004 C CB   . ALA B 2 14 ? 5.068   0.681   -4.979  1.00 0.00 ? 14 ALA B CB   8  
ATOM 6005 H H    . ALA B 2 14 ? 4.117   0.178   -7.296  1.00 0.00 ? 14 ALA B H    8  
ATOM 6006 H HA   . ALA B 2 14 ? 6.547   -0.590  -5.885  1.00 0.00 ? 14 ALA B HA   8  
ATOM 6007 H HB1  . ALA B 2 14 ? 5.431   1.574   -5.467  1.00 0.00 ? 14 ALA B HB1  8  
ATOM 6008 H HB2  . ALA B 2 14 ? 3.992   0.739   -4.890  1.00 0.00 ? 14 ALA B HB2  8  
ATOM 6009 H HB3  . ALA B 2 14 ? 5.499   0.627   -3.987  1.00 0.00 ? 14 ALA B HB3  8  
ATOM 6010 N N    . LEU B 2 15 ? 3.787   -2.284  -5.349  1.00 0.00 ? 15 LEU B N    8  
ATOM 6011 C CA   . LEU B 2 15 ? 3.307   -3.530  -4.668  1.00 0.00 ? 15 LEU B CA   8  
ATOM 6012 C C    . LEU B 2 15 ? 3.881   -4.743  -5.400  1.00 0.00 ? 15 LEU B C    8  
ATOM 6013 O O    . LEU B 2 15 ? 4.321   -5.678  -4.775  1.00 0.00 ? 15 LEU B O    8  
ATOM 6014 C CB   . LEU B 2 15 ? 1.727   -3.690  -4.696  1.00 0.00 ? 15 LEU B CB   8  
ATOM 6015 C CG   . LEU B 2 15 ? 0.964   -3.402  -3.374  1.00 0.00 ? 15 LEU B CG   8  
ATOM 6016 C CD1  . LEU B 2 15 ? 1.106   -1.935  -2.919  1.00 0.00 ? 15 LEU B CD1  8  
ATOM 6017 C CD2  . LEU B 2 15 ? -0.533  -3.703  -3.655  1.00 0.00 ? 15 LEU B CD2  8  
ATOM 6018 H H    . LEU B 2 15 ? 3.200   -1.820  -5.986  1.00 0.00 ? 15 LEU B H    8  
ATOM 6019 H HA   . LEU B 2 15 ? 3.735   -3.547  -3.678  1.00 0.00 ? 15 LEU B HA   8  
ATOM 6020 H HB2  . LEU B 2 15 ? 1.279   -3.048  -5.428  1.00 0.00 ? 15 LEU B HB2  8  
ATOM 6021 H HB3  . LEU B 2 15 ? 1.486   -4.709  -4.970  1.00 0.00 ? 15 LEU B HB3  8  
ATOM 6022 H HG   . LEU B 2 15 ? 1.318   -4.075  -2.607  1.00 0.00 ? 15 LEU B HG   8  
ATOM 6023 H HD11 . LEU B 2 15 ? 0.708   -1.263  -3.660  1.00 0.00 ? 15 LEU B HD11 8  
ATOM 6024 H HD12 . LEU B 2 15 ? 0.552   -1.775  -2.004  1.00 0.00 ? 15 LEU B HD12 8  
ATOM 6025 H HD13 . LEU B 2 15 ? 2.142   -1.693  -2.743  1.00 0.00 ? 15 LEU B HD13 8  
ATOM 6026 H HD21 . LEU B 2 15 ? -0.889  -3.103  -4.484  1.00 0.00 ? 15 LEU B HD21 8  
ATOM 6027 H HD22 . LEU B 2 15 ? -0.663  -4.740  -3.910  1.00 0.00 ? 15 LEU B HD22 8  
ATOM 6028 H HD23 . LEU B 2 15 ? -1.132  -3.509  -2.785  1.00 0.00 ? 15 LEU B HD23 8  
ATOM 6029 N N    . TYR B 2 16 ? 3.876   -4.700  -6.702  1.00 0.00 ? 16 TYR B N    8  
ATOM 6030 C CA   . TYR B 2 16 ? 4.403   -5.837  -7.517  1.00 0.00 ? 16 TYR B CA   8  
ATOM 6031 C C    . TYR B 2 16 ? 5.926   -6.003  -7.437  1.00 0.00 ? 16 TYR B C    8  
ATOM 6032 O O    . TYR B 2 16 ? 6.449   -7.024  -7.841  1.00 0.00 ? 16 TYR B O    8  
ATOM 6033 C CB   . TYR B 2 16 ? 4.043   -5.669  -9.013  1.00 0.00 ? 16 TYR B CB   8  
ATOM 6034 C CG   . TYR B 2 16 ? 2.536   -5.616  -9.343  1.00 0.00 ? 16 TYR B CG   8  
ATOM 6035 C CD1  . TYR B 2 16 ? 1.538   -5.369  -8.416  1.00 0.00 ? 16 TYR B CD1  8  
ATOM 6036 C CD2  . TYR B 2 16 ? 2.173   -5.834  -10.656 1.00 0.00 ? 16 TYR B CD2  8  
ATOM 6037 C CE1  . TYR B 2 16 ? 0.211   -5.341  -8.803  1.00 0.00 ? 16 TYR B CE1  8  
ATOM 6038 C CE2  . TYR B 2 16 ? 0.852   -5.807  -11.039 1.00 0.00 ? 16 TYR B CE2  8  
ATOM 6039 C CZ   . TYR B 2 16 ? -0.145  -5.559  -10.115 1.00 0.00 ? 16 TYR B CZ   8  
ATOM 6040 O OH   . TYR B 2 16 ? -1.471  -5.528  -10.496 1.00 0.00 ? 16 TYR B OH   8  
ATOM 6041 H H    . TYR B 2 16 ? 3.526   -3.911  -7.147  1.00 0.00 ? 16 TYR B H    8  
ATOM 6042 H HA   . TYR B 2 16 ? 3.938   -6.737  -7.152  1.00 0.00 ? 16 TYR B HA   8  
ATOM 6043 H HB2  . TYR B 2 16 ? 4.503   -4.783  -9.407  1.00 0.00 ? 16 TYR B HB2  8  
ATOM 6044 H HB3  . TYR B 2 16 ? 4.463   -6.515  -9.536  1.00 0.00 ? 16 TYR B HB3  8  
ATOM 6045 H HD1  . TYR B 2 16 ? 1.774   -5.199  -7.377  1.00 0.00 ? 16 TYR B HD1  8  
ATOM 6046 H HD2  . TYR B 2 16 ? 2.943   -6.021  -11.388 1.00 0.00 ? 16 TYR B HD2  8  
ATOM 6047 H HE1  . TYR B 2 16 ? -0.550  -5.143  -8.061  1.00 0.00 ? 16 TYR B HE1  8  
ATOM 6048 H HE2  . TYR B 2 16 ? 0.604   -5.987  -12.072 1.00 0.00 ? 16 TYR B HE2  8  
ATOM 6049 H HH   . TYR B 2 16 ? -1.538  -5.904  -11.375 1.00 0.00 ? 16 TYR B HH   8  
ATOM 6050 N N    . LEU B 2 17 ? 6.611   -5.014  -6.926  1.00 0.00 ? 17 LEU B N    8  
ATOM 6051 C CA   . LEU B 2 17 ? 8.097   -5.100  -6.816  1.00 0.00 ? 17 LEU B CA   8  
ATOM 6052 C C    . LEU B 2 17 ? 8.547   -5.400  -5.378  1.00 0.00 ? 17 LEU B C    8  
ATOM 6053 O O    . LEU B 2 17 ? 9.589   -6.003  -5.202  1.00 0.00 ? 17 LEU B O    8  
ATOM 6054 C CB   . LEU B 2 17 ? 8.683   -3.759  -7.304  1.00 0.00 ? 17 LEU B CB   8  
ATOM 6055 C CG   . LEU B 2 17 ? 10.238  -3.724  -7.247  1.00 0.00 ? 17 LEU B CG   8  
ATOM 6056 C CD1  . LEU B 2 17 ? 10.852  -4.705  -8.267  1.00 0.00 ? 17 LEU B CD1  8  
ATOM 6057 C CD2  . LEU B 2 17 ? 10.719  -2.302  -7.590  1.00 0.00 ? 17 LEU B CD2  8  
ATOM 6058 H H    . LEU B 2 17 ? 6.155   -4.204  -6.618  1.00 0.00 ? 17 LEU B H    8  
ATOM 6059 H HA   . LEU B 2 17 ? 8.455   -5.890  -7.460  1.00 0.00 ? 17 LEU B HA   8  
ATOM 6060 H HB2  . LEU B 2 17 ? 8.367   -3.601  -8.318  1.00 0.00 ? 17 LEU B HB2  8  
ATOM 6061 H HB3  . LEU B 2 17 ? 8.289   -2.951  -6.705  1.00 0.00 ? 17 LEU B HB3  8  
ATOM 6062 H HG   . LEU B 2 17 ? 10.577  -3.976  -6.253  1.00 0.00 ? 17 LEU B HG   8  
ATOM 6063 H HD11 . LEU B 2 17 ? 10.533  -4.446  -9.269  1.00 0.00 ? 17 LEU B HD11 8  
ATOM 6064 H HD12 . LEU B 2 17 ? 11.934  -4.659  -8.212  1.00 0.00 ? 17 LEU B HD12 8  
ATOM 6065 H HD13 . LEU B 2 17 ? 10.544  -5.715  -8.058  1.00 0.00 ? 17 LEU B HD13 8  
ATOM 6066 H HD21 . LEU B 2 17 ? 10.387  -2.025  -8.581  1.00 0.00 ? 17 LEU B HD21 8  
ATOM 6067 H HD22 . LEU B 2 17 ? 10.330  -1.590  -6.877  1.00 0.00 ? 17 LEU B HD22 8  
ATOM 6068 H HD23 . LEU B 2 17 ? 11.800  -2.261  -7.561  1.00 0.00 ? 17 LEU B HD23 8  
ATOM 6069 N N    . VAL B 2 18 ? 7.765   -4.990  -4.402  1.00 0.00 ? 18 VAL B N    8  
ATOM 6070 C CA   . VAL B 2 18 ? 8.142   -5.232  -2.971  1.00 0.00 ? 18 VAL B CA   8  
ATOM 6071 C C    . VAL B 2 18 ? 7.317   -6.360  -2.328  1.00 0.00 ? 18 VAL B C    8  
ATOM 6072 O O    . VAL B 2 18 ? 7.838   -7.171  -1.586  1.00 0.00 ? 18 VAL B O    8  
ATOM 6073 C CB   . VAL B 2 18 ? 7.941   -3.892  -2.208  1.00 0.00 ? 18 VAL B CB   8  
ATOM 6074 C CG1  . VAL B 2 18 ? 8.602   -4.014  -0.822  1.00 0.00 ? 18 VAL B CG1  8  
ATOM 6075 C CG2  . VAL B 2 18 ? 8.645   -2.740  -2.976  1.00 0.00 ? 18 VAL B CG2  8  
ATOM 6076 H H    . VAL B 2 18 ? 6.920   -4.521  -4.583  1.00 0.00 ? 18 VAL B H    8  
ATOM 6077 H HA   . VAL B 2 18 ? 9.181   -5.516  -2.923  1.00 0.00 ? 18 VAL B HA   8  
ATOM 6078 H HB   . VAL B 2 18 ? 6.872   -3.675  -2.136  1.00 0.00 ? 18 VAL B HB   8  
ATOM 6079 H HG11 . VAL B 2 18 ? 9.648   -4.248  -0.954  1.00 0.00 ? 18 VAL B HG11 8  
ATOM 6080 H HG12 . VAL B 2 18 ? 8.526   -3.084  -0.278  1.00 0.00 ? 18 VAL B HG12 8  
ATOM 6081 H HG13 . VAL B 2 18 ? 8.146   -4.803  -0.243  1.00 0.00 ? 18 VAL B HG13 8  
ATOM 6082 H HG21 . VAL B 2 18 ? 9.696   -2.970  -3.093  1.00 0.00 ? 18 VAL B HG21 8  
ATOM 6083 H HG22 . VAL B 2 18 ? 8.215   -2.611  -3.956  1.00 0.00 ? 18 VAL B HG22 8  
ATOM 6084 H HG23 . VAL B 2 18 ? 8.540   -1.810  -2.433  1.00 0.00 ? 18 VAL B HG23 8  
ATOM 6085 N N    . CYS B 2 19 ? 6.052   -6.353  -2.647  1.00 0.00 ? 19 CYS B N    8  
ATOM 6086 C CA   . CYS B 2 19 ? 5.081   -7.360  -2.128  1.00 0.00 ? 19 CYS B CA   8  
ATOM 6087 C C    . CYS B 2 19 ? 4.410   -7.971  -3.392  1.00 0.00 ? 19 CYS B C    8  
ATOM 6088 O O    . CYS B 2 19 ? 3.212   -8.184  -3.405  1.00 0.00 ? 19 CYS B O    8  
ATOM 6089 C CB   . CYS B 2 19 ? 4.071   -6.610  -1.236  1.00 0.00 ? 19 CYS B CB   8  
ATOM 6090 S SG   . CYS B 2 19 ? 4.730   -5.461  0.002   1.00 0.00 ? 19 CYS B SG   8  
ATOM 6091 H H    . CYS B 2 19 ? 5.736   -5.662  -3.256  1.00 0.00 ? 19 CYS B H    8  
ATOM 6092 H HA   . CYS B 2 19 ? 5.568   -8.124  -1.529  1.00 0.00 ? 19 CYS B HA   8  
ATOM 6093 H HB2  . CYS B 2 19 ? 3.433   -6.018  -1.876  1.00 0.00 ? 19 CYS B HB2  8  
ATOM 6094 H HB3  . CYS B 2 19 ? 3.449   -7.340  -0.745  1.00 0.00 ? 19 CYS B HB3  8  
ATOM 6095 N N    . GLY B 2 20 ? 5.190   -8.241  -4.423  1.00 0.00 ? 20 GLY B N    8  
ATOM 6096 C CA   . GLY B 2 20 ? 4.633   -8.821  -5.688  1.00 0.00 ? 20 GLY B CA   8  
ATOM 6097 C C    . GLY B 2 20 ? 4.902   -10.314 -5.884  1.00 0.00 ? 20 GLY B C    8  
ATOM 6098 O O    . GLY B 2 20 ? 4.237   -10.960 -6.671  1.00 0.00 ? 20 GLY B O    8  
ATOM 6099 H H    . GLY B 2 20 ? 6.155   -8.064  -4.399  1.00 0.00 ? 20 GLY B H    8  
ATOM 6100 H HA2  . GLY B 2 20 ? 3.574   -8.638  -5.730  1.00 0.00 ? 20 GLY B HA2  8  
ATOM 6101 H HA3  . GLY B 2 20 ? 5.097   -8.313  -6.508  1.00 0.00 ? 20 GLY B HA3  8  
ATOM 6102 N N    . GLU B 2 21 ? 5.874   -10.812 -5.169  1.00 0.00 ? 21 GLU B N    8  
ATOM 6103 C CA   . GLU B 2 21 ? 6.253   -12.258 -5.253  1.00 0.00 ? 21 GLU B CA   8  
ATOM 6104 C C    . GLU B 2 21 ? 5.791   -12.798 -3.896  1.00 0.00 ? 21 GLU B C    8  
ATOM 6105 O O    . GLU B 2 21 ? 6.463   -13.580 -3.246  1.00 0.00 ? 21 GLU B O    8  
ATOM 6106 C CB   . GLU B 2 21 ? 7.788   -12.388 -5.389  1.00 0.00 ? 21 GLU B CB   8  
ATOM 6107 C CG   . GLU B 2 21 ? 8.338   -11.643 -6.637  1.00 0.00 ? 21 GLU B CG   8  
ATOM 6108 C CD   . GLU B 2 21 ? 8.128   -10.107 -6.555  1.00 0.00 ? 21 GLU B CD   8  
ATOM 6109 O OE1  . GLU B 2 21 ? 8.557   -9.527  -5.570  1.00 0.00 ? 21 GLU B OE1  8  
ATOM 6110 O OE2  . GLU B 2 21 ? 7.534   -9.593  -7.489  1.00 0.00 ? 21 GLU B OE2  8  
ATOM 6111 H H    . GLU B 2 21 ? 6.363   -10.225 -4.558  1.00 0.00 ? 21 GLU B H    8  
ATOM 6112 H HA   . GLU B 2 21 ? 5.719   -12.762 -6.043  1.00 0.00 ? 21 GLU B HA   8  
ATOM 6113 H HB2  . GLU B 2 21 ? 8.248   -11.991 -4.493  1.00 0.00 ? 21 GLU B HB2  8  
ATOM 6114 H HB3  . GLU B 2 21 ? 8.030   -13.439 -5.468  1.00 0.00 ? 21 GLU B HB3  8  
ATOM 6115 H HG2  . GLU B 2 21 ? 9.400   -11.833 -6.729  1.00 0.00 ? 21 GLU B HG2  8  
ATOM 6116 H HG3  . GLU B 2 21 ? 7.848   -12.035 -7.517  1.00 0.00 ? 21 GLU B HG3  8  
ATOM 6117 N N    . ARG B 2 22 ? 4.620   -12.339 -3.525  1.00 0.00 ? 22 ARG B N    8  
ATOM 6118 C CA   . ARG B 2 22 ? 4.029   -12.748 -2.230  1.00 0.00 ? 22 ARG B CA   8  
ATOM 6119 C C    . ARG B 2 22 ? 2.495   -12.810 -2.259  1.00 0.00 ? 22 ARG B C    8  
ATOM 6120 O O    . ARG B 2 22 ? 1.876   -12.048 -1.543  1.00 0.00 ? 22 ARG B O    8  
ATOM 6121 C CB   . ARG B 2 22 ? 4.569   -11.727 -1.230  1.00 0.00 ? 22 ARG B CB   8  
ATOM 6122 C CG   . ARG B 2 22 ? 4.420   -12.226 0.207   1.00 0.00 ? 22 ARG B CG   8  
ATOM 6123 C CD   . ARG B 2 22 ? 3.486   -11.287 0.964   1.00 0.00 ? 22 ARG B CD   8  
ATOM 6124 N NE   . ARG B 2 22 ? 3.637   -11.588 2.410   1.00 0.00 ? 22 ARG B NE   8  
ATOM 6125 C CZ   . ARG B 2 22 ? 2.617   -12.018 3.105   1.00 0.00 ? 22 ARG B CZ   8  
ATOM 6126 N NH1  . ARG B 2 22 ? 1.615   -11.212 3.315   1.00 0.00 ? 22 ARG B NH1  8  
ATOM 6127 N NH2  . ARG B 2 22 ? 2.649   -13.234 3.568   1.00 0.00 ? 22 ARG B NH2  8  
ATOM 6128 H H    . ARG B 2 22 ? 4.132   -11.722 -4.110  1.00 0.00 ? 22 ARG B H    8  
ATOM 6129 H HA   . ARG B 2 22 ? 4.386   -13.738 -1.975  1.00 0.00 ? 22 ARG B HA   8  
ATOM 6130 H HB2  . ARG B 2 22 ? 5.611   -11.537 -1.441  1.00 0.00 ? 22 ARG B HB2  8  
ATOM 6131 H HB3  . ARG B 2 22 ? 4.036   -10.796 -1.377  1.00 0.00 ? 22 ARG B HB3  8  
ATOM 6132 H HG2  . ARG B 2 22 ? 4.038   -13.237 0.222   1.00 0.00 ? 22 ARG B HG2  8  
ATOM 6133 H HG3  . ARG B 2 22 ? 5.393   -12.227 0.670   1.00 0.00 ? 22 ARG B HG3  8  
ATOM 6134 H HD2  . ARG B 2 22 ? 3.773   -10.264 0.771   1.00 0.00 ? 22 ARG B HD2  8  
ATOM 6135 H HD3  . ARG B 2 22 ? 2.455   -11.417 0.679   1.00 0.00 ? 22 ARG B HD3  8  
ATOM 6136 H HE   . ARG B 2 22 ? 4.504   -11.463 2.838   1.00 0.00 ? 22 ARG B HE   8  
ATOM 6137 H HH11 . ARG B 2 22 ? 1.633   -10.287 2.938   1.00 0.00 ? 22 ARG B HH11 8  
ATOM 6138 H HH12 . ARG B 2 22 ? 0.829   -11.520 3.850   1.00 0.00 ? 22 ARG B HH12 8  
ATOM 6139 H HH21 . ARG B 2 22 ? 3.433   -13.822 3.370   1.00 0.00 ? 22 ARG B HH21 8  
ATOM 6140 H HH22 . ARG B 2 22 ? 1.887   -13.582 4.116   1.00 0.00 ? 22 ARG B HH22 8  
ATOM 6141 N N    . GLY B 2 23 ? 1.949   -13.700 -3.060  1.00 0.00 ? 23 GLY B N    8  
ATOM 6142 C CA   . GLY B 2 23 ? 0.455   -13.898 -3.208  1.00 0.00 ? 23 GLY B CA   8  
ATOM 6143 C C    . GLY B 2 23 ? -0.358  -12.728 -2.573  1.00 0.00 ? 23 GLY B C    8  
ATOM 6144 O O    . GLY B 2 23 ? -1.040  -12.947 -1.589  1.00 0.00 ? 23 GLY B O    8  
ATOM 6145 H H    . GLY B 2 23 ? 2.560   -14.258 -3.579  1.00 0.00 ? 23 GLY B H    8  
ATOM 6146 H HA2  . GLY B 2 23 ? 0.188   -14.133 -4.234  1.00 0.00 ? 23 GLY B HA2  8  
ATOM 6147 H HA3  . GLY B 2 23 ? 0.214   -14.785 -2.642  1.00 0.00 ? 23 GLY B HA3  8  
ATOM 6148 N N    . PHE B 2 24 ? -0.275  -11.533 -3.126  1.00 0.00 ? 24 PHE B N    8  
ATOM 6149 C CA   . PHE B 2 24 ? -0.973  -10.357 -2.608  1.00 0.00 ? 24 PHE B CA   8  
ATOM 6150 C C    . PHE B 2 24 ? -2.174  -10.063 -3.552  1.00 0.00 ? 24 PHE B C    8  
ATOM 6151 O O    . PHE B 2 24 ? -2.176  -10.527 -4.677  1.00 0.00 ? 24 PHE B O    8  
ATOM 6152 C CB   . PHE B 2 24 ? 0.014   -9.180  -2.640  1.00 0.00 ? 24 PHE B CB   8  
ATOM 6153 C CG   . PHE B 2 24 ? 0.369   -8.800  -4.110  1.00 0.00 ? 24 PHE B CG   8  
ATOM 6154 C CD1  . PHE B 2 24 ? 1.079   -9.638  -4.966  1.00 0.00 ? 24 PHE B CD1  8  
ATOM 6155 C CD2  . PHE B 2 24 ? -0.059  -7.580  -4.600  1.00 0.00 ? 24 PHE B CD2  8  
ATOM 6156 C CE1  . PHE B 2 24 ? 1.342   -9.260  -6.262  1.00 0.00 ? 24 PHE B CE1  8  
ATOM 6157 C CE2  . PHE B 2 24 ? 0.207   -7.203  -5.897  1.00 0.00 ? 24 PHE B CE2  8  
ATOM 6158 C CZ   . PHE B 2 24 ? 0.906   -8.045  -6.731  1.00 0.00 ? 24 PHE B CZ   8  
ATOM 6159 H H    . PHE B 2 24 ? 0.225   -11.299 -3.911  1.00 0.00 ? 24 PHE B H    8  
ATOM 6160 H HA   . PHE B 2 24 ? -1.200  -10.632 -1.582  1.00 0.00 ? 24 PHE B HA   8  
ATOM 6161 H HB2  . PHE B 2 24 ? -0.464  -8.320  -2.211  1.00 0.00 ? 24 PHE B HB2  8  
ATOM 6162 H HB3  . PHE B 2 24 ? 0.922   -9.415  -2.100  1.00 0.00 ? 24 PHE B HB3  8  
ATOM 6163 H HD1  . PHE B 2 24 ? 1.454   -10.592 -4.638  1.00 0.00 ? 24 PHE B HD1  8  
ATOM 6164 H HD2  . PHE B 2 24 ? -0.603  -6.904  -3.958  1.00 0.00 ? 24 PHE B HD2  8  
ATOM 6165 H HE1  . PHE B 2 24 ? 1.888   -9.925  -6.917  1.00 0.00 ? 24 PHE B HE1  8  
ATOM 6166 H HE2  . PHE B 2 24 ? -0.135  -6.248  -6.260  1.00 0.00 ? 24 PHE B HE2  8  
ATOM 6167 H HZ   . PHE B 2 24 ? 1.111   -7.744  -7.746  1.00 0.00 ? 24 PHE B HZ   8  
ATOM 6168 N N    . PHE B 2 25 ? -3.158  -9.318  -3.116  1.00 0.00 ? 25 PHE B N    8  
ATOM 6169 C CA   . PHE B 2 25 ? -4.307  -9.006  -3.973  1.00 0.00 ? 25 PHE B CA   8  
ATOM 6170 C C    . PHE B 2 25 ? -4.833  -7.683  -3.427  1.00 0.00 ? 25 PHE B C    8  
ATOM 6171 O O    . PHE B 2 25 ? -5.096  -7.605  -2.240  1.00 0.00 ? 25 PHE B O    8  
ATOM 6172 C CB   . PHE B 2 25 ? -5.344  -10.092 -3.822  1.00 0.00 ? 25 PHE B CB   8  
ATOM 6173 C CG   . PHE B 2 25 ? -6.488  -9.722  -4.752  1.00 0.00 ? 25 PHE B CG   8  
ATOM 6174 C CD1  . PHE B 2 25 ? -7.521  -8.917  -4.304  1.00 0.00 ? 25 PHE B CD1  8  
ATOM 6175 C CD2  . PHE B 2 25 ? -6.519  -10.170 -6.062  1.00 0.00 ? 25 PHE B CD2  8  
ATOM 6176 C CE1  . PHE B 2 25 ? -8.558  -8.566  -5.142  1.00 0.00 ? 25 PHE B CE1  8  
ATOM 6177 C CE2  . PHE B 2 25 ? -7.554  -9.820  -6.906  1.00 0.00 ? 25 PHE B CE2  8  
ATOM 6178 C CZ   . PHE B 2 25 ? -8.579  -9.016  -6.447  1.00 0.00 ? 25 PHE B CZ   8  
ATOM 6179 H H    . PHE B 2 25 ? -3.225  -8.927  -2.230  1.00 0.00 ? 25 PHE B H    8  
ATOM 6180 H HA   . PHE B 2 25 ? -3.994  -8.884  -5.002  1.00 0.00 ? 25 PHE B HA   8  
ATOM 6181 H HB2  . PHE B 2 25 ? -4.942  -11.047 -4.118  1.00 0.00 ? 25 PHE B HB2  8  
ATOM 6182 H HB3  . PHE B 2 25 ? -5.699  -10.160 -2.800  1.00 0.00 ? 25 PHE B HB3  8  
ATOM 6183 H HD1  . PHE B 2 25 ? -7.515  -8.557  -3.289  1.00 0.00 ? 25 PHE B HD1  8  
ATOM 6184 H HD2  . PHE B 2 25 ? -5.729  -10.798 -6.438  1.00 0.00 ? 25 PHE B HD2  8  
ATOM 6185 H HE1  . PHE B 2 25 ? -9.352  -7.931  -4.779  1.00 0.00 ? 25 PHE B HE1  8  
ATOM 6186 H HE2  . PHE B 2 25 ? -7.552  -10.178 -7.926  1.00 0.00 ? 25 PHE B HE2  8  
ATOM 6187 H HZ   . PHE B 2 25 ? -9.394  -8.733  -7.101  1.00 0.00 ? 25 PHE B HZ   8  
ATOM 6188 N N    . TYR B 2 26 ? -4.977  -6.693  -4.267  1.00 0.00 ? 26 TYR B N    8  
ATOM 6189 C CA   . TYR B 2 26 ? -5.501  -5.408  -3.748  1.00 0.00 ? 26 TYR B CA   8  
ATOM 6190 C C    . TYR B 2 26 ? -6.910  -5.355  -4.268  1.00 0.00 ? 26 TYR B C    8  
ATOM 6191 O O    . TYR B 2 26 ? -7.884  -5.438  -3.547  1.00 0.00 ? 26 TYR B O    8  
ATOM 6192 C CB   . TYR B 2 26 ? -4.520  -4.214  -4.219  1.00 0.00 ? 26 TYR B CB   8  
ATOM 6193 C CG   . TYR B 2 26 ? -4.274  -4.027  -5.729  1.00 0.00 ? 26 TYR B CG   8  
ATOM 6194 C CD1  . TYR B 2 26 ? -3.552  -4.961  -6.441  1.00 0.00 ? 26 TYR B CD1  8  
ATOM 6195 C CD2  . TYR B 2 26 ? -4.772  -2.922  -6.395  1.00 0.00 ? 26 TYR B CD2  8  
ATOM 6196 C CE1  . TYR B 2 26 ? -3.336  -4.797  -7.792  1.00 0.00 ? 26 TYR B CE1  8  
ATOM 6197 C CE2  . TYR B 2 26 ? -4.553  -2.763  -7.747  1.00 0.00 ? 26 TYR B CE2  8  
ATOM 6198 C CZ   . TYR B 2 26 ? -3.833  -3.700  -8.456  1.00 0.00 ? 26 TYR B CZ   8  
ATOM 6199 O OH   . TYR B 2 26 ? -3.607  -3.549  -9.809  1.00 0.00 ? 26 TYR B OH   8  
ATOM 6200 H H    . TYR B 2 26 ? -4.740  -6.801  -5.212  1.00 0.00 ? 26 TYR B H    8  
ATOM 6201 H HA   . TYR B 2 26 ? -5.594  -5.420  -2.732  1.00 0.00 ? 26 TYR B HA   8  
ATOM 6202 H HB2  . TYR B 2 26 ? -4.875  -3.282  -3.802  1.00 0.00 ? 26 TYR B HB2  8  
ATOM 6203 H HB3  . TYR B 2 26 ? -3.559  -4.410  -3.772  1.00 0.00 ? 26 TYR B HB3  8  
ATOM 6204 H HD1  . TYR B 2 26 ? -3.150  -5.828  -5.940  1.00 0.00 ? 26 TYR B HD1  8  
ATOM 6205 H HD2  . TYR B 2 26 ? -5.330  -2.173  -5.853  1.00 0.00 ? 26 TYR B HD2  8  
ATOM 6206 H HE1  . TYR B 2 26 ? -2.772  -5.535  -8.339  1.00 0.00 ? 26 TYR B HE1  8  
ATOM 6207 H HE2  . TYR B 2 26 ? -4.944  -1.893  -8.260  1.00 0.00 ? 26 TYR B HE2  8  
ATOM 6208 H HH   . TYR B 2 26 ? -2.973  -4.218  -10.071 1.00 0.00 ? 26 TYR B HH   8  
ATOM 6209 N N    . THR B 2 27 ? -6.907  -5.218  -5.534  1.00 0.00 ? 27 THR B N    8  
ATOM 6210 C CA   . THR B 2 27 ? -8.149  -5.147  -6.359  1.00 0.00 ? 27 THR B CA   8  
ATOM 6211 C C    . THR B 2 27 ? -7.909  -5.204  -7.898  1.00 0.00 ? 27 THR B C    8  
ATOM 6212 O O    . THR B 2 27 ? -8.441  -4.378  -8.610  1.00 0.00 ? 27 THR B O    8  
ATOM 6213 C CB   . THR B 2 27 ? -8.917  -3.839  -5.888  1.00 0.00 ? 27 THR B CB   8  
ATOM 6214 O OG1  . THR B 2 27 ? -10.024 -3.650  -6.756  1.00 0.00 ? 27 THR B OG1  8  
ATOM 6215 C CG2  . THR B 2 27 ? -8.067  -2.582  -5.921  1.00 0.00 ? 27 THR B CG2  8  
ATOM 6216 H H    . THR B 2 27 ? -5.984  -5.187  -5.817  1.00 0.00 ? 27 THR B H    8  
ATOM 6217 H HA   . THR B 2 27 ? -8.785  -5.982  -6.107  1.00 0.00 ? 27 THR B HA   8  
ATOM 6218 H HB   . THR B 2 27 ? -9.299  -3.970  -4.889  1.00 0.00 ? 27 THR B HB   8  
ATOM 6219 H HG1  . THR B 2 27 ? -10.823 -3.812  -6.251  1.00 0.00 ? 27 THR B HG1  8  
ATOM 6220 H HG21 . THR B 2 27 ? -7.689  -2.384  -6.911  1.00 0.00 ? 27 THR B HG21 8  
ATOM 6221 H HG22 . THR B 2 27 ? -8.656  -1.744  -5.588  1.00 0.00 ? 27 THR B HG22 8  
ATOM 6222 H HG23 . THR B 2 27 ? -7.242  -2.709  -5.238  1.00 0.00 ? 27 THR B HG23 8  
ATOM 6223 N N    . PRO B 2 28 ? -7.133  -6.138  -8.417  1.00 0.00 ? 28 PRO B N    8  
ATOM 6224 C CA   . PRO B 2 28 ? -7.157  -6.460  -9.880  1.00 0.00 ? 28 PRO B CA   8  
ATOM 6225 C C    . PRO B 2 28 ? -8.241  -7.502  -10.286 1.00 0.00 ? 28 PRO B C    8  
ATOM 6226 O O    . PRO B 2 28 ? -7.896  -8.617  -10.629 1.00 0.00 ? 28 PRO B O    8  
ATOM 6227 C CB   . PRO B 2 28 ? -5.728  -6.931  -10.131 1.00 0.00 ? 28 PRO B CB   8  
ATOM 6228 C CG   . PRO B 2 28 ? -5.475  -7.793  -8.875  1.00 0.00 ? 28 PRO B CG   8  
ATOM 6229 C CD   . PRO B 2 28 ? -6.101  -6.970  -7.716  1.00 0.00 ? 28 PRO B CD   8  
ATOM 6230 H HA   . PRO B 2 28 ? -7.332  -5.554  -10.446 1.00 0.00 ? 28 PRO B HA   8  
ATOM 6231 H HB2  . PRO B 2 28 ? -5.678  -7.536  -11.019 1.00 0.00 ? 28 PRO B HB2  8  
ATOM 6232 H HB3  . PRO B 2 28 ? -5.033  -6.110  -10.223 1.00 0.00 ? 28 PRO B HB3  8  
ATOM 6233 H HG2  . PRO B 2 28 ? -5.985  -8.734  -8.985  1.00 0.00 ? 28 PRO B HG2  8  
ATOM 6234 H HG3  . PRO B 2 28 ? -4.422  -7.967  -8.731  1.00 0.00 ? 28 PRO B HG3  8  
ATOM 6235 H HD2  . PRO B 2 28 ? -6.522  -7.618  -6.970  1.00 0.00 ? 28 PRO B HD2  8  
ATOM 6236 H HD3  . PRO B 2 28 ? -5.360  -6.341  -7.272  1.00 0.00 ? 28 PRO B HD3  8  
ATOM 6237 N N    . LYS B 2 29 ? -9.495  -7.102  -10.236 1.00 0.00 ? 29 LYS B N    8  
ATOM 6238 C CA   . LYS B 2 29 ? -10.686 -7.977  -10.594 1.00 0.00 ? 29 LYS B CA   8  
ATOM 6239 C C    . LYS B 2 29 ? -10.361 -9.411  -11.049 1.00 0.00 ? 29 LYS B C    8  
ATOM 6240 O O    . LYS B 2 29 ? -10.020 -9.654  -12.192 1.00 0.00 ? 29 LYS B O    8  
ATOM 6241 C CB   . LYS B 2 29 ? -11.549 -7.323  -11.738 1.00 0.00 ? 29 LYS B CB   8  
ATOM 6242 C CG   . LYS B 2 29 ? -12.785 -8.242  -12.083 1.00 0.00 ? 29 LYS B CG   8  
ATOM 6243 C CD   . LYS B 2 29 ? -13.640 -7.633  -13.221 1.00 0.00 ? 29 LYS B CD   8  
ATOM 6244 C CE   . LYS B 2 29 ? -14.779 -8.618  -13.610 1.00 0.00 ? 29 LYS B CE   8  
ATOM 6245 N NZ   . LYS B 2 29 ? -15.743 -8.835  -12.488 1.00 0.00 ? 29 LYS B NZ   8  
ATOM 6246 H H    . LYS B 2 29 ? -9.661  -6.181  -9.949  1.00 0.00 ? 29 LYS B H    8  
ATOM 6247 H HA   . LYS B 2 29 ? -11.302 -8.050  -9.706  1.00 0.00 ? 29 LYS B HA   8  
ATOM 6248 H HB2  . LYS B 2 29 ? -11.904 -6.359  -11.415 1.00 0.00 ? 29 LYS B HB2  8  
ATOM 6249 H HB3  . LYS B 2 29 ? -10.943 -7.197  -12.622 1.00 0.00 ? 29 LYS B HB3  8  
ATOM 6250 H HG2  . LYS B 2 29 ? -12.456 -9.223  -12.404 1.00 0.00 ? 29 LYS B HG2  8  
ATOM 6251 H HG3  . LYS B 2 29 ? -13.397 -8.364  -11.199 1.00 0.00 ? 29 LYS B HG3  8  
ATOM 6252 H HD2  . LYS B 2 29 ? -14.052 -6.690  -12.897 1.00 0.00 ? 29 LYS B HD2  8  
ATOM 6253 H HD3  . LYS B 2 29 ? -13.018 -7.452  -14.085 1.00 0.00 ? 29 LYS B HD3  8  
ATOM 6254 H HE2  . LYS B 2 29 ? -15.324 -8.239  -14.463 1.00 0.00 ? 29 LYS B HE2  8  
ATOM 6255 H HE3  . LYS B 2 29 ? -14.353 -9.577  -13.871 1.00 0.00 ? 29 LYS B HE3  8  
ATOM 6256 H HZ1  . LYS B 2 29 ? -15.453 -8.286  -11.654 1.00 0.00 ? 29 LYS B HZ1  8  
ATOM 6257 H HZ2  . LYS B 2 29 ? -16.691 -8.532  -12.787 1.00 0.00 ? 29 LYS B HZ2  8  
ATOM 6258 H HZ3  . LYS B 2 29 ? -15.767 -9.849  -12.247 1.00 0.00 ? 29 LYS B HZ3  8  
ATOM 6259 N N    . THR B 2 30 ? -10.481 -10.315 -10.117 1.00 0.00 ? 30 THR B N    8  
ATOM 6260 C CA   . THR B 2 30 ? -10.208 -11.759 -10.410 1.00 0.00 ? 30 THR B CA   8  
ATOM 6261 C C    . THR B 2 30 ? -11.376 -12.620 -9.917  1.00 0.00 ? 30 THR B C    8  
ATOM 6262 O O    . THR B 2 30 ? -12.390 -12.151 -9.440  1.00 0.00 ? 30 THR B O    8  
ATOM 6263 C CB   . THR B 2 30 ? -8.873  -12.155 -9.711  1.00 0.00 ? 30 THR B CB   8  
ATOM 6264 O OG1  . THR B 2 30 ? -8.527  -13.390 -10.320 1.00 0.00 ? 30 THR B OG1  8  
ATOM 6265 C CG2  . THR B 2 30 ? -9.010  -12.553 -8.235  1.00 0.00 ? 30 THR B CG2  8  
ATOM 6266 H H    . THR B 2 30 ? -10.757 -10.022 -9.224  1.00 0.00 ? 30 THR B H    8  
ATOM 6267 H HA   . THR B 2 30 ? -10.126 -11.903 -11.475 1.00 0.00 ? 30 THR B HA   8  
ATOM 6268 H HB   . THR B 2 30 ? -8.085  -11.434 -9.867  1.00 0.00 ? 30 THR B HB   8  
ATOM 6269 H HG1  . THR B 2 30 ? -7.616  -13.313 -10.612 1.00 0.00 ? 30 THR B HG1  8  
ATOM 6270 H HG21 . THR B 2 30 ? -9.418  -11.744 -7.652  1.00 0.00 ? 30 THR B HG21 8  
ATOM 6271 H HG22 . THR B 2 30 ? -9.645  -13.421 -8.128  1.00 0.00 ? 30 THR B HG22 8  
ATOM 6272 H HG23 . THR B 2 30 ? -8.024  -12.787 -7.861  1.00 0.00 ? 30 THR B HG23 8  
ATOM 6273 N N    . GLY A 1 1  ? -7.233  -2.679  -0.459  1.00 0.00 ? 1  GLY A N    9  
ATOM 6274 C CA   . GLY A 1 1  ? -7.924  -1.753  -1.396  1.00 0.00 ? 1  GLY A CA   9  
ATOM 6275 C C    . GLY A 1 1  ? -6.901  -0.814  -2.024  1.00 0.00 ? 1  GLY A C    9  
ATOM 6276 O O    . GLY A 1 1  ? -6.205  -1.196  -2.947  1.00 0.00 ? 1  GLY A O    9  
ATOM 6277 H H1   . GLY A 1 1  ? -6.205  -2.538  -0.493  1.00 0.00 ? 1  GLY A H1   9  
ATOM 6278 H H2   . GLY A 1 1  ? -7.580  -2.517  0.509   1.00 0.00 ? 1  GLY A H2   9  
ATOM 6279 H H3   . GLY A 1 1  ? -7.438  -3.656  -0.748  1.00 0.00 ? 1  GLY A H3   9  
ATOM 6280 H HA2  . GLY A 1 1  ? -8.406  -2.328  -2.174  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 6281 H HA3  . GLY A 1 1  ? -8.670  -1.185  -0.858  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 6282 N N    . ILE A 1 2  ? -6.840  0.389   -1.499  1.00 0.00 ? 2  ILE A N    9  
ATOM 6283 C CA   . ILE A 1 2  ? -5.876  1.423   -2.012  1.00 0.00 ? 2  ILE A CA   9  
ATOM 6284 C C    . ILE A 1 2  ? -6.185  1.648   -3.502  1.00 0.00 ? 2  ILE A C    9  
ATOM 6285 O O    . ILE A 1 2  ? -7.223  1.224   -3.970  1.00 0.00 ? 2  ILE A O    9  
ATOM 6286 C CB   . ILE A 1 2  ? -4.412  0.882   -1.747  1.00 0.00 ? 2  ILE A CB   9  
ATOM 6287 C CG1  . ILE A 1 2  ? -4.324  0.202   -0.330  1.00 0.00 ? 2  ILE A CG1  9  
ATOM 6288 C CG2  . ILE A 1 2  ? -3.356  2.032   -1.778  1.00 0.00 ? 2  ILE A CG2  9  
ATOM 6289 C CD1  . ILE A 1 2  ? -4.745  1.164   0.818   1.00 0.00 ? 2  ILE A CD1  9  
ATOM 6290 H H    . ILE A 1 2  ? -7.438  0.617   -0.761  1.00 0.00 ? 2  ILE A H    9  
ATOM 6291 H HA   . ILE A 1 2  ? -6.016  2.354   -1.480  1.00 0.00 ? 2  ILE A HA   9  
ATOM 6292 H HB   . ILE A 1 2  ? -4.152  0.175   -2.514  1.00 0.00 ? 2  ILE A HB   9  
ATOM 6293 H HG12 . ILE A 1 2  ? -4.949  -0.677  -0.311  1.00 0.00 ? 2  ILE A HG12 9  
ATOM 6294 H HG13 . ILE A 1 2  ? -3.308  -0.117  -0.158  1.00 0.00 ? 2  ILE A HG13 9  
ATOM 6295 H HG21 . ILE A 1 2  ? -3.650  2.807   -1.084  1.00 0.00 ? 2  ILE A HG21 9  
ATOM 6296 H HG22 . ILE A 1 2  ? -2.384  1.653   -1.504  1.00 0.00 ? 2  ILE A HG22 9  
ATOM 6297 H HG23 . ILE A 1 2  ? -3.240  2.477   -2.746  1.00 0.00 ? 2  ILE A HG23 9  
ATOM 6298 H HD11 . ILE A 1 2  ? -5.768  1.499   0.705   1.00 0.00 ? 2  ILE A HD11 9  
ATOM 6299 H HD12 . ILE A 1 2  ? -4.654  0.653   1.762   1.00 0.00 ? 2  ILE A HD12 9  
ATOM 6300 H HD13 . ILE A 1 2  ? -4.104  2.029   0.856   1.00 0.00 ? 2  ILE A HD13 9  
ATOM 6301 N N    . VAL A 1 3  ? -5.287  2.301   -4.192  1.00 0.00 ? 3  VAL A N    9  
ATOM 6302 C CA   . VAL A 1 3  ? -5.418  2.612   -5.658  1.00 0.00 ? 3  VAL A CA   9  
ATOM 6303 C C    . VAL A 1 3  ? -6.822  3.140   -5.981  1.00 0.00 ? 3  VAL A C    9  
ATOM 6304 O O    . VAL A 1 3  ? -7.549  3.522   -5.080  1.00 0.00 ? 3  VAL A O    9  
ATOM 6305 C CB   . VAL A 1 3  ? -5.074  1.288   -6.488  1.00 0.00 ? 3  VAL A CB   9  
ATOM 6306 C CG1  . VAL A 1 3  ? -3.850  0.581   -5.862  1.00 0.00 ? 3  VAL A CG1  9  
ATOM 6307 C CG2  . VAL A 1 3  ? -6.215  0.224   -6.572  1.00 0.00 ? 3  VAL A CG2  9  
ATOM 6308 H H    . VAL A 1 3  ? -4.494  2.603   -3.717  1.00 0.00 ? 3  VAL A H    9  
ATOM 6309 H HA   . VAL A 1 3  ? -4.725  3.390   -5.924  1.00 0.00 ? 3  VAL A HA   9  
ATOM 6310 H HB   . VAL A 1 3  ? -4.799  1.590   -7.490  1.00 0.00 ? 3  VAL A HB   9  
ATOM 6311 H HG11 . VAL A 1 3  ? -2.997  1.234   -5.836  1.00 0.00 ? 3  VAL A HG11 9  
ATOM 6312 H HG12 . VAL A 1 3  ? -4.082  0.275   -4.852  1.00 0.00 ? 3  VAL A HG12 9  
ATOM 6313 H HG13 . VAL A 1 3  ? -3.592  -0.300  -6.428  1.00 0.00 ? 3  VAL A HG13 9  
ATOM 6314 H HG21 . VAL A 1 3  ? -7.098  0.617   -7.051  1.00 0.00 ? 3  VAL A HG21 9  
ATOM 6315 H HG22 . VAL A 1 3  ? -5.877  -0.605  -7.171  1.00 0.00 ? 3  VAL A HG22 9  
ATOM 6316 H HG23 . VAL A 1 3  ? -6.481  -0.152  -5.596  1.00 0.00 ? 3  VAL A HG23 9  
ATOM 6317 N N    . GLU A 1 4  ? -7.163  3.168   -7.243  1.00 0.00 ? 4  GLU A N    9  
ATOM 6318 C CA   . GLU A 1 4  ? -8.523  3.669   -7.652  1.00 0.00 ? 4  GLU A CA   9  
ATOM 6319 C C    . GLU A 1 4  ? -8.779  5.035   -6.956  1.00 0.00 ? 4  GLU A C    9  
ATOM 6320 O O    . GLU A 1 4  ? -9.633  5.158   -6.103  1.00 0.00 ? 4  GLU A O    9  
ATOM 6321 C CB   . GLU A 1 4  ? -9.530  2.578   -7.215  1.00 0.00 ? 4  GLU A CB   9  
ATOM 6322 C CG   . GLU A 1 4  ? -10.959 2.764   -7.762  1.00 0.00 ? 4  GLU A CG   9  
ATOM 6323 C CD   . GLU A 1 4  ? -11.025 2.374   -9.252  1.00 0.00 ? 4  GLU A CD   9  
ATOM 6324 O OE1  . GLU A 1 4  ? -10.553 3.161   -10.056 1.00 0.00 ? 4  GLU A OE1  9  
ATOM 6325 O OE2  . GLU A 1 4  ? -11.549 1.300   -9.499  1.00 0.00 ? 4  GLU A OE2  9  
ATOM 6326 H H    . GLU A 1 4  ? -6.519  2.862   -7.921  1.00 0.00 ? 4  GLU A H    9  
ATOM 6327 H HA   . GLU A 1 4  ? -8.522  3.811   -8.719  1.00 0.00 ? 4  GLU A HA   9  
ATOM 6328 H HB2  . GLU A 1 4  ? -9.157  1.620   -7.547  1.00 0.00 ? 4  GLU A HB2  9  
ATOM 6329 H HB3  . GLU A 1 4  ? -9.578  2.566   -6.138  1.00 0.00 ? 4  GLU A HB3  9  
ATOM 6330 H HG2  . GLU A 1 4  ? -11.624 2.131   -7.188  1.00 0.00 ? 4  GLU A HG2  9  
ATOM 6331 H HG3  . GLU A 1 4  ? -11.284 3.791   -7.659  1.00 0.00 ? 4  GLU A HG3  9  
ATOM 6332 N N    . GLN A 1 5  ? -7.978  5.979   -7.397  1.00 0.00 ? 5  GLN A N    9  
ATOM 6333 C CA   . GLN A 1 5  ? -7.901  7.425   -6.981  1.00 0.00 ? 5  GLN A CA   9  
ATOM 6334 C C    . GLN A 1 5  ? -6.380  7.645   -6.851  1.00 0.00 ? 5  GLN A C    9  
ATOM 6335 O O    . GLN A 1 5  ? -5.626  6.686   -6.842  1.00 0.00 ? 5  GLN A O    9  
ATOM 6336 C CB   . GLN A 1 5  ? -8.615  7.709   -5.584  1.00 0.00 ? 5  GLN A CB   9  
ATOM 6337 C CG   . GLN A 1 5  ? -8.669  9.247   -5.223  1.00 0.00 ? 5  GLN A CG   9  
ATOM 6338 C CD   . GLN A 1 5  ? -9.052  10.164  -6.408  1.00 0.00 ? 5  GLN A CD   9  
ATOM 6339 O OE1  . GLN A 1 5  ? -8.253  10.433  -7.282  1.00 0.00 ? 5  GLN A OE1  9  
ATOM 6340 N NE2  . GLN A 1 5  ? -10.252 10.671  -6.487  1.00 0.00 ? 5  GLN A NE2  9  
ATOM 6341 H H    . GLN A 1 5  ? -7.345  5.713   -8.091  1.00 0.00 ? 5  GLN A H    9  
ATOM 6342 H HA   . GLN A 1 5  ? -8.296  8.035   -7.776  1.00 0.00 ? 5  GLN A HA   9  
ATOM 6343 H HB2  . GLN A 1 5  ? -9.633  7.344   -5.571  1.00 0.00 ? 5  GLN A HB2  9  
ATOM 6344 H HB3  . GLN A 1 5  ? -8.071  7.201   -4.796  1.00 0.00 ? 5  GLN A HB3  9  
ATOM 6345 H HG2  . GLN A 1 5  ? -9.416  9.382   -4.455  1.00 0.00 ? 5  GLN A HG2  9  
ATOM 6346 H HG3  . GLN A 1 5  ? -7.723  9.569   -4.811  1.00 0.00 ? 5  GLN A HG3  9  
ATOM 6347 H HE21 . GLN A 1 5  ? -10.928 10.463  -5.807  1.00 0.00 ? 5  GLN A HE21 9  
ATOM 6348 H HE22 . GLN A 1 5  ? -10.467 11.264  -7.239  1.00 0.00 ? 5  GLN A HE22 9  
ATOM 6349 N N    . CYS A 1 6  ? -5.951  8.877   -6.745  1.00 0.00 ? 6  CYS A N    9  
ATOM 6350 C CA   . CYS A 1 6  ? -4.484  9.145   -6.633  1.00 0.00 ? 6  CYS A CA   9  
ATOM 6351 C C    . CYS A 1 6  ? -4.092  9.593   -5.228  1.00 0.00 ? 6  CYS A C    9  
ATOM 6352 O O    . CYS A 1 6  ? -4.817  10.320  -4.572  1.00 0.00 ? 6  CYS A O    9  
ATOM 6353 C CB   . CYS A 1 6  ? -4.124  10.232  -7.645  1.00 0.00 ? 6  CYS A CB   9  
ATOM 6354 S SG   . CYS A 1 6  ? -4.784  10.087  -9.326  1.00 0.00 ? 6  CYS A SG   9  
ATOM 6355 H H    . CYS A 1 6  ? -6.581  9.620   -6.739  1.00 0.00 ? 6  CYS A H    9  
ATOM 6356 H HA   . CYS A 1 6  ? -3.928  8.256   -6.876  1.00 0.00 ? 6  CYS A HA   9  
ATOM 6357 H HB2  . CYS A 1 6  ? -4.457  11.163  -7.220  1.00 0.00 ? 6  CYS A HB2  9  
ATOM 6358 H HB3  . CYS A 1 6  ? -3.050  10.292  -7.760  1.00 0.00 ? 6  CYS A HB3  9  
ATOM 6359 N N    . CYS A 1 7  ? -2.927  9.127   -4.837  1.00 0.00 ? 7  CYS A N    9  
ATOM 6360 C CA   . CYS A 1 7  ? -2.295  9.399   -3.509  1.00 0.00 ? 7  CYS A CA   9  
ATOM 6361 C C    . CYS A 1 7  ? -3.418  9.228   -2.453  1.00 0.00 ? 7  CYS A C    9  
ATOM 6362 O O    . CYS A 1 7  ? -3.568  9.989   -1.521  1.00 0.00 ? 7  CYS A O    9  
ATOM 6363 C CB   . CYS A 1 7  ? -1.703  10.854  -3.549  1.00 0.00 ? 7  CYS A CB   9  
ATOM 6364 S SG   . CYS A 1 7  ? 0.008   11.137  -3.019  1.00 0.00 ? 7  CYS A SG   9  
ATOM 6365 H H    . CYS A 1 7  ? -2.441  8.552   -5.456  1.00 0.00 ? 7  CYS A H    9  
ATOM 6366 H HA   . CYS A 1 7  ? -1.531  8.663   -3.338  1.00 0.00 ? 7  CYS A HA   9  
ATOM 6367 H HB2  . CYS A 1 7  ? -1.655  11.135  -4.593  1.00 0.00 ? 7  CYS A HB2  9  
ATOM 6368 H HB3  . CYS A 1 7  ? -2.340  11.552  -3.029  1.00 0.00 ? 7  CYS A HB3  9  
ATOM 6369 N N    . THR A 1 8  ? -4.149  8.173   -2.729  1.00 0.00 ? 8  THR A N    9  
ATOM 6370 C CA   . THR A 1 8  ? -5.329  7.650   -1.972  1.00 0.00 ? 8  THR A CA   9  
ATOM 6371 C C    . THR A 1 8  ? -5.711  8.291   -0.635  1.00 0.00 ? 8  THR A C    9  
ATOM 6372 O O    . THR A 1 8  ? -6.841  8.693   -0.441  1.00 0.00 ? 8  THR A O    9  
ATOM 6373 C CB   . THR A 1 8  ? -5.088  6.139   -1.759  1.00 0.00 ? 8  THR A CB   9  
ATOM 6374 O OG1  . THR A 1 8  ? -3.825  6.068   -1.100  1.00 0.00 ? 8  THR A OG1  9  
ATOM 6375 C CG2  . THR A 1 8  ? -4.845  5.429   -3.109  1.00 0.00 ? 8  THR A CG2  9  
ATOM 6376 H H    . THR A 1 8  ? -3.889  7.664   -3.524  1.00 0.00 ? 8  THR A H    9  
ATOM 6377 H HA   . THR A 1 8  ? -6.185  7.740   -2.625  1.00 0.00 ? 8  THR A HA   9  
ATOM 6378 H HB   . THR A 1 8  ? -5.847  5.640   -1.172  1.00 0.00 ? 8  THR A HB   9  
ATOM 6379 H HG1  . THR A 1 8  ? -3.957  6.137   -0.153  1.00 0.00 ? 8  THR A HG1  9  
ATOM 6380 H HG21 . THR A 1 8  ? -5.683  5.540   -3.783  1.00 0.00 ? 8  THR A HG21 9  
ATOM 6381 H HG22 . THR A 1 8  ? -3.954  5.817   -3.580  1.00 0.00 ? 8  THR A HG22 9  
ATOM 6382 H HG23 . THR A 1 8  ? -4.697  4.378   -2.913  1.00 0.00 ? 8  THR A HG23 9  
ATOM 6383 N N    . SER A 1 9  ? -4.749  8.352   0.242   1.00 0.00 ? 9  SER A N    9  
ATOM 6384 C CA   . SER A 1 9  ? -4.972  8.944   1.590   1.00 0.00 ? 9  SER A CA   9  
ATOM 6385 C C    . SER A 1 9  ? -3.757  9.740   2.057   1.00 0.00 ? 9  SER A C    9  
ATOM 6386 O O    . SER A 1 9  ? -3.827  10.936  2.260   1.00 0.00 ? 9  SER A O    9  
ATOM 6387 C CB   . SER A 1 9  ? -5.305  7.760   2.543   1.00 0.00 ? 9  SER A CB   9  
ATOM 6388 O OG   . SER A 1 9  ? -4.284  6.791   2.326   1.00 0.00 ? 9  SER A OG   9  
ATOM 6389 H H    . SER A 1 9  ? -3.862  8.013   0.002   1.00 0.00 ? 9  SER A H    9  
ATOM 6390 H HA   . SER A 1 9  ? -5.808  9.618   1.552   1.00 0.00 ? 9  SER A HA   9  
ATOM 6391 H HB2  . SER A 1 9  ? -5.305  8.055   3.582   1.00 0.00 ? 9  SER A HB2  9  
ATOM 6392 H HB3  . SER A 1 9  ? -6.258  7.320   2.289   1.00 0.00 ? 9  SER A HB3  9  
ATOM 6393 H HG   . SER A 1 9  ? -4.695  5.988   2.006   1.00 0.00 ? 9  SER A HG   9  
ATOM 6394 N N    . ILE A 1 10 ? -2.681  9.016   2.210   1.00 0.00 ? 10 ILE A N    9  
ATOM 6395 C CA   . ILE A 1 10 ? -1.389  9.611   2.668   1.00 0.00 ? 10 ILE A CA   9  
ATOM 6396 C C    . ILE A 1 10 ? -0.220  9.084   1.805   1.00 0.00 ? 10 ILE A C    9  
ATOM 6397 O O    . ILE A 1 10 ? 0.911   9.389   2.122   1.00 0.00 ? 10 ILE A O    9  
ATOM 6398 C CB   . ILE A 1 10 ? -1.162  9.230   4.176   1.00 0.00 ? 10 ILE A CB   9  
ATOM 6399 C CG1  . ILE A 1 10 ? -2.525  9.291   4.941   1.00 0.00 ? 10 ILE A CG1  9  
ATOM 6400 C CG2  . ILE A 1 10 ? -0.164  10.243  4.814   1.00 0.00 ? 10 ILE A CG2  9  
ATOM 6401 C CD1  . ILE A 1 10 ? -2.356  8.954   6.435   1.00 0.00 ? 10 ILE A CD1  9  
ATOM 6402 H H    . ILE A 1 10 ? -2.756  8.063   2.010   1.00 0.00 ? 10 ILE A H    9  
ATOM 6403 H HA   . ILE A 1 10 ? -1.429  10.683  2.563   1.00 0.00 ? 10 ILE A HA   9  
ATOM 6404 H HB   . ILE A 1 10 ? -0.757  8.232   4.230   1.00 0.00 ? 10 ILE A HB   9  
ATOM 6405 H HG12 . ILE A 1 10 ? -2.981  10.268  4.845   1.00 0.00 ? 10 ILE A HG12 9  
ATOM 6406 H HG13 . ILE A 1 10 ? -3.201  8.558   4.520   1.00 0.00 ? 10 ILE A HG13 9  
ATOM 6407 H HG21 . ILE A 1 10 ? 0.780   10.245  4.287   1.00 0.00 ? 10 ILE A HG21 9  
ATOM 6408 H HG22 . ILE A 1 10 ? -0.567  11.244  4.803   1.00 0.00 ? 10 ILE A HG22 9  
ATOM 6409 H HG23 . ILE A 1 10 ? 0.035   9.979   5.840   1.00 0.00 ? 10 ILE A HG23 9  
ATOM 6410 H HD11 . ILE A 1 10 ? -1.932  7.968   6.568   1.00 0.00 ? 10 ILE A HD11 9  
ATOM 6411 H HD12 . ILE A 1 10 ? -1.713  9.670   6.919   1.00 0.00 ? 10 ILE A HD12 9  
ATOM 6412 H HD13 . ILE A 1 10 ? -3.324  8.976   6.924   1.00 0.00 ? 10 ILE A HD13 9  
ATOM 6413 N N    . CYS A 1 11 ? -0.512  8.336   0.755   1.00 0.00 ? 11 CYS A N    9  
ATOM 6414 C CA   . CYS A 1 11 ? 0.560   7.764   -0.151  1.00 0.00 ? 11 CYS A CA   9  
ATOM 6415 C C    . CYS A 1 11 ? 1.911   7.571   0.593   1.00 0.00 ? 11 CYS A C    9  
ATOM 6416 O O    . CYS A 1 11 ? 2.917   8.179   0.277   1.00 0.00 ? 11 CYS A O    9  
ATOM 6417 C CB   . CYS A 1 11 ? 0.704   8.732   -1.360  1.00 0.00 ? 11 CYS A CB   9  
ATOM 6418 S SG   . CYS A 1 11 ? 0.238   10.466  -1.128  1.00 0.00 ? 11 CYS A SG   9  
ATOM 6419 H H    . CYS A 1 11 ? -1.459  8.154   0.566   1.00 0.00 ? 11 CYS A H    9  
ATOM 6420 H HA   . CYS A 1 11 ? 0.224   6.799   -0.495  1.00 0.00 ? 11 CYS A HA   9  
ATOM 6421 H HB2  . CYS A 1 11 ? 1.731   8.724   -1.702  1.00 0.00 ? 11 CYS A HB2  9  
ATOM 6422 H HB3  . CYS A 1 11 ? 0.109   8.343   -2.173  1.00 0.00 ? 11 CYS A HB3  9  
ATOM 6423 N N    . SER A 1 12 ? 1.850   6.697   1.578   1.00 0.00 ? 12 SER A N    9  
ATOM 6424 C CA   . SER A 1 12 ? 3.029   6.357   2.437   1.00 0.00 ? 12 SER A CA   9  
ATOM 6425 C C    . SER A 1 12 ? 3.318   4.841   2.463   1.00 0.00 ? 12 SER A C    9  
ATOM 6426 O O    . SER A 1 12 ? 2.422   4.023   2.456   1.00 0.00 ? 12 SER A O    9  
ATOM 6427 C CB   . SER A 1 12 ? 2.742   6.872   3.869   1.00 0.00 ? 12 SER A CB   9  
ATOM 6428 O OG   . SER A 1 12 ? 1.604   6.147   4.310   1.00 0.00 ? 12 SER A OG   9  
ATOM 6429 H H    . SER A 1 12 ? 1.005   6.243   1.763   1.00 0.00 ? 12 SER A H    9  
ATOM 6430 H HA   . SER A 1 12 ? 3.901   6.864   2.049   1.00 0.00 ? 12 SER A HA   9  
ATOM 6431 H HB2  . SER A 1 12 ? 3.564   6.690   4.549   1.00 0.00 ? 12 SER A HB2  9  
ATOM 6432 H HB3  . SER A 1 12 ? 2.490   7.921   3.846   1.00 0.00 ? 12 SER A HB3  9  
ATOM 6433 H HG   . SER A 1 12 ? 0.966   6.767   4.672   1.00 0.00 ? 12 SER A HG   9  
ATOM 6434 N N    . LEU A 1 13 ? 4.589   4.546   2.489   1.00 0.00 ? 13 LEU A N    9  
ATOM 6435 C CA   . LEU A 1 13 ? 5.126   3.144   2.521   1.00 0.00 ? 13 LEU A CA   9  
ATOM 6436 C C    . LEU A 1 13 ? 4.478   2.064   3.393   1.00 0.00 ? 13 LEU A C    9  
ATOM 6437 O O    . LEU A 1 13 ? 4.391   0.930   2.971   1.00 0.00 ? 13 LEU A O    9  
ATOM 6438 C CB   . LEU A 1 13 ? 6.658   3.207   2.864   1.00 0.00 ? 13 LEU A CB   9  
ATOM 6439 C CG   . LEU A 1 13 ? 7.113   4.269   3.918   1.00 0.00 ? 13 LEU A CG   9  
ATOM 6440 C CD1  . LEU A 1 13 ? 6.787   3.851   5.376   1.00 0.00 ? 13 LEU A CD1  9  
ATOM 6441 C CD2  . LEU A 1 13 ? 8.646   4.407   3.814   1.00 0.00 ? 13 LEU A CD2  9  
ATOM 6442 H H    . LEU A 1 13 ? 5.205   5.305   2.479   1.00 0.00 ? 13 LEU A H    9  
ATOM 6443 H HA   . LEU A 1 13 ? 5.039   2.775   1.517   1.00 0.00 ? 13 LEU A HA   9  
ATOM 6444 H HB2  . LEU A 1 13 ? 6.963   2.240   3.235   1.00 0.00 ? 13 LEU A HB2  9  
ATOM 6445 H HB3  . LEU A 1 13 ? 7.176   3.369   1.935   1.00 0.00 ? 13 LEU A HB3  9  
ATOM 6446 H HG   . LEU A 1 13 ? 6.666   5.229   3.706   1.00 0.00 ? 13 LEU A HG   9  
ATOM 6447 H HD11 . LEU A 1 13 ? 5.732   3.694   5.529   1.00 0.00 ? 13 LEU A HD11 9  
ATOM 6448 H HD12 . LEU A 1 13 ? 7.307   2.936   5.623   1.00 0.00 ? 13 LEU A HD12 9  
ATOM 6449 H HD13 . LEU A 1 13 ? 7.123   4.622   6.061   1.00 0.00 ? 13 LEU A HD13 9  
ATOM 6450 H HD21 . LEU A 1 13 ? 9.114   3.456   4.016   1.00 0.00 ? 13 LEU A HD21 9  
ATOM 6451 H HD22 . LEU A 1 13 ? 8.918   4.728   2.821   1.00 0.00 ? 13 LEU A HD22 9  
ATOM 6452 H HD23 . LEU A 1 13 ? 9.010   5.131   4.528   1.00 0.00 ? 13 LEU A HD23 9  
ATOM 6453 N N    . TYR A 1 14 ? 4.038   2.415   4.564   1.00 0.00 ? 14 TYR A N    9  
ATOM 6454 C CA   . TYR A 1 14 ? 3.396   1.396   5.464   1.00 0.00 ? 14 TYR A CA   9  
ATOM 6455 C C    . TYR A 1 14 ? 2.152   0.826   4.761   1.00 0.00 ? 14 TYR A C    9  
ATOM 6456 O O    . TYR A 1 14 ? 1.769   -0.308  4.973   1.00 0.00 ? 14 TYR A O    9  
ATOM 6457 C CB   . TYR A 1 14 ? 3.012   2.073   6.799   1.00 0.00 ? 14 TYR A CB   9  
ATOM 6458 C CG   . TYR A 1 14 ? 3.254   1.082   7.953   1.00 0.00 ? 14 TYR A CG   9  
ATOM 6459 C CD1  . TYR A 1 14 ? 2.547   -0.106  8.051   1.00 0.00 ? 14 TYR A CD1  9  
ATOM 6460 C CD2  . TYR A 1 14 ? 4.206   1.366   8.919   1.00 0.00 ? 14 TYR A CD2  9  
ATOM 6461 C CE1  . TYR A 1 14 ? 2.784   -0.985  9.087   1.00 0.00 ? 14 TYR A CE1  9  
ATOM 6462 C CE2  . TYR A 1 14 ? 4.441   0.485   9.956   1.00 0.00 ? 14 TYR A CE2  9  
ATOM 6463 C CZ   . TYR A 1 14 ? 3.731   -0.695  10.045  1.00 0.00 ? 14 TYR A CZ   9  
ATOM 6464 O OH   . TYR A 1 14 ? 3.973   -1.566  11.087  1.00 0.00 ? 14 TYR A OH   9  
ATOM 6465 H H    . TYR A 1 14 ? 4.139   3.351   4.826   1.00 0.00 ? 14 TYR A H    9  
ATOM 6466 H HA   . TYR A 1 14 ? 4.101   0.588   5.623   1.00 0.00 ? 14 TYR A HA   9  
ATOM 6467 H HB2  . TYR A 1 14 ? 3.622   2.953   6.951   1.00 0.00 ? 14 TYR A HB2  9  
ATOM 6468 H HB3  . TYR A 1 14 ? 1.973   2.364   6.815   1.00 0.00 ? 14 TYR A HB3  9  
ATOM 6469 H HD1  . TYR A 1 14 ? 1.798   -0.357  7.314   1.00 0.00 ? 14 TYR A HD1  9  
ATOM 6470 H HD2  . TYR A 1 14 ? 4.770   2.281   8.856   1.00 0.00 ? 14 TYR A HD2  9  
ATOM 6471 H HE1  . TYR A 1 14 ? 2.225   -1.909  9.144   1.00 0.00 ? 14 TYR A HE1  9  
ATOM 6472 H HE2  . TYR A 1 14 ? 5.183   0.724   10.705  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 6473 H HH   . TYR A 1 14 ? 3.507   -2.384  10.906  1.00 0.00 ? 14 TYR A HH   9  
ATOM 6474 N N    . GLN A 1 15 ? 1.557   1.651   3.938   1.00 0.00 ? 15 GLN A N    9  
ATOM 6475 C CA   . GLN A 1 15 ? 0.347   1.232   3.187   1.00 0.00 ? 15 GLN A CA   9  
ATOM 6476 C C    . GLN A 1 15 ? 0.798   0.141   2.203   1.00 0.00 ? 15 GLN A C    9  
ATOM 6477 O O    . GLN A 1 15 ? 0.055   -0.793  1.967   1.00 0.00 ? 15 GLN A O    9  
ATOM 6478 C CB   . GLN A 1 15 ? -0.230  2.487   2.462   1.00 0.00 ? 15 GLN A CB   9  
ATOM 6479 C CG   . GLN A 1 15 ? -1.521  2.173   1.699   1.00 0.00 ? 15 GLN A CG   9  
ATOM 6480 C CD   . GLN A 1 15 ? -1.837  3.355   0.764   1.00 0.00 ? 15 GLN A CD   9  
ATOM 6481 O OE1  . GLN A 1 15 ? -1.145  3.580   -0.210  1.00 0.00 ? 15 GLN A OE1  9  
ATOM 6482 N NE2  . GLN A 1 15 ? -2.855  4.129   1.012   1.00 0.00 ? 15 GLN A NE2  9  
ATOM 6483 H H    . GLN A 1 15 ? 1.907   2.554   3.806   1.00 0.00 ? 15 GLN A H    9  
ATOM 6484 H HA   . GLN A 1 15 ? -0.373  0.824   3.881   1.00 0.00 ? 15 GLN A HA   9  
ATOM 6485 H HB2  . GLN A 1 15 ? -0.459  3.215   3.223   1.00 0.00 ? 15 GLN A HB2  9  
ATOM 6486 H HB3  . GLN A 1 15 ? 0.463   2.943   1.780   1.00 0.00 ? 15 GLN A HB3  9  
ATOM 6487 H HG2  . GLN A 1 15 ? -1.408  1.280   1.102   1.00 0.00 ? 15 GLN A HG2  9  
ATOM 6488 H HG3  . GLN A 1 15 ? -2.345  2.030   2.382   1.00 0.00 ? 15 GLN A HG3  9  
ATOM 6489 H HE21 . GLN A 1 15 ? -3.401  3.982   1.811   1.00 0.00 ? 15 GLN A HE21 9  
ATOM 6490 H HE22 . GLN A 1 15 ? -3.074  4.853   0.392   1.00 0.00 ? 15 GLN A HE22 9  
ATOM 6491 N N    . LEU A 1 16 ? 1.998   0.255   1.670   1.00 0.00 ? 16 LEU A N    9  
ATOM 6492 C CA   . LEU A 1 16 ? 2.464   -0.783  0.703   1.00 0.00 ? 16 LEU A CA   9  
ATOM 6493 C C    . LEU A 1 16 ? 2.935   -1.999  1.521   1.00 0.00 ? 16 LEU A C    9  
ATOM 6494 O O    . LEU A 1 16 ? 2.956   -3.112  1.035   1.00 0.00 ? 16 LEU A O    9  
ATOM 6495 C CB   . LEU A 1 16 ? 3.630   -0.205  -0.142  1.00 0.00 ? 16 LEU A CB   9  
ATOM 6496 C CG   . LEU A 1 16 ? 3.267   1.172   -0.807  1.00 0.00 ? 16 LEU A CG   9  
ATOM 6497 C CD1  . LEU A 1 16 ? 4.537   1.690   -1.520  1.00 0.00 ? 16 LEU A CD1  9  
ATOM 6498 C CD2  . LEU A 1 16 ? 2.153   1.029   -1.859  1.00 0.00 ? 16 LEU A CD2  9  
ATOM 6499 H H    . LEU A 1 16 ? 2.614   0.988   1.891   1.00 0.00 ? 16 LEU A H    9  
ATOM 6500 H HA   . LEU A 1 16 ? 1.633   -1.074  0.076   1.00 0.00 ? 16 LEU A HA   9  
ATOM 6501 H HB2  . LEU A 1 16 ? 4.509   -0.082  0.478   1.00 0.00 ? 16 LEU A HB2  9  
ATOM 6502 H HB3  . LEU A 1 16 ? 3.861   -0.916  -0.923  1.00 0.00 ? 16 LEU A HB3  9  
ATOM 6503 H HG   . LEU A 1 16 ? 2.969   1.888   -0.053  1.00 0.00 ? 16 LEU A HG   9  
ATOM 6504 H HD11 . LEU A 1 16 ? 4.866   0.967   -2.257  1.00 0.00 ? 16 LEU A HD11 9  
ATOM 6505 H HD12 . LEU A 1 16 ? 4.338   2.623   -2.020  1.00 0.00 ? 16 LEU A HD12 9  
ATOM 6506 H HD13 . LEU A 1 16 ? 5.330   1.847   -0.801  1.00 0.00 ? 16 LEU A HD13 9  
ATOM 6507 H HD21 . LEU A 1 16 ? 1.255   0.629   -1.417  1.00 0.00 ? 16 LEU A HD21 9  
ATOM 6508 H HD22 . LEU A 1 16 ? 1.925   1.991   -2.291  1.00 0.00 ? 16 LEU A HD22 9  
ATOM 6509 H HD23 . LEU A 1 16 ? 2.484   0.384   -2.656  1.00 0.00 ? 16 LEU A HD23 9  
ATOM 6510 N N    . GLU A 1 17 ? 3.306   -1.743  2.754   1.00 0.00 ? 17 GLU A N    9  
ATOM 6511 C CA   . GLU A 1 17 ? 3.778   -2.833  3.660   1.00 0.00 ? 17 GLU A CA   9  
ATOM 6512 C C    . GLU A 1 17 ? 2.592   -3.723  4.082   1.00 0.00 ? 17 GLU A C    9  
ATOM 6513 O O    . GLU A 1 17 ? 2.790   -4.787  4.637   1.00 0.00 ? 17 GLU A O    9  
ATOM 6514 C CB   . GLU A 1 17 ? 4.455   -2.170  4.873   1.00 0.00 ? 17 GLU A CB   9  
ATOM 6515 C CG   . GLU A 1 17 ? 5.857   -1.637  4.437   1.00 0.00 ? 17 GLU A CG   9  
ATOM 6516 C CD   . GLU A 1 17 ? 6.460   -0.692  5.504   1.00 0.00 ? 17 GLU A CD   9  
ATOM 6517 O OE1  . GLU A 1 17 ? 6.360   -1.022  6.676   1.00 0.00 ? 17 GLU A OE1  9  
ATOM 6518 O OE2  . GLU A 1 17 ? 6.996   0.322   5.086   1.00 0.00 ? 17 GLU A OE2  9  
ATOM 6519 H H    . GLU A 1 17 ? 3.273   -0.825  3.090   1.00 0.00 ? 17 GLU A H    9  
ATOM 6520 H HA   . GLU A 1 17 ? 4.495   -3.440  3.129   1.00 0.00 ? 17 GLU A HA   9  
ATOM 6521 H HB2  . GLU A 1 17 ? 3.835   -1.373  5.239   1.00 0.00 ? 17 GLU A HB2  9  
ATOM 6522 H HB3  . GLU A 1 17 ? 4.570   -2.891  5.669   1.00 0.00 ? 17 GLU A HB3  9  
ATOM 6523 H HG2  . GLU A 1 17 ? 6.526   -2.479  4.307   1.00 0.00 ? 17 GLU A HG2  9  
ATOM 6524 H HG3  . GLU A 1 17 ? 5.796   -1.113  3.492   1.00 0.00 ? 17 GLU A HG3  9  
ATOM 6525 N N    . ASN A 1 18 ? 1.393   -3.260  3.798   1.00 0.00 ? 18 ASN A N    9  
ATOM 6526 C CA   . ASN A 1 18 ? 0.156   -4.039  4.149   1.00 0.00 ? 18 ASN A CA   9  
ATOM 6527 C C    . ASN A 1 18 ? 0.132   -5.319  3.275   1.00 0.00 ? 18 ASN A C    9  
ATOM 6528 O O    . ASN A 1 18 ? -0.595  -6.255  3.548   1.00 0.00 ? 18 ASN A O    9  
ATOM 6529 C CB   . ASN A 1 18 ? -1.092  -3.172  3.843   1.00 0.00 ? 18 ASN A CB   9  
ATOM 6530 C CG   . ASN A 1 18 ? -2.426  -3.914  4.075   1.00 0.00 ? 18 ASN A CG   9  
ATOM 6531 O OD1  . ASN A 1 18 ? -3.457  -3.515  3.569   1.00 0.00 ? 18 ASN A OD1  9  
ATOM 6532 N ND2  . ASN A 1 18 ? -2.478  -4.981  4.823   1.00 0.00 ? 18 ASN A ND2  9  
ATOM 6533 H H    . ASN A 1 18 ? 1.302   -2.394  3.351   1.00 0.00 ? 18 ASN A H    9  
ATOM 6534 H HA   . ASN A 1 18 ? 0.187   -4.308  5.197   1.00 0.00 ? 18 ASN A HA   9  
ATOM 6535 H HB2  . ASN A 1 18 ? -1.088  -2.291  4.465   1.00 0.00 ? 18 ASN A HB2  9  
ATOM 6536 H HB3  . ASN A 1 18 ? -1.062  -2.856  2.810   1.00 0.00 ? 18 ASN A HB3  9  
ATOM 6537 H HD21 . ASN A 1 18 ? -1.664  -5.323  5.253   1.00 0.00 ? 18 ASN A HD21 9  
ATOM 6538 H HD22 . ASN A 1 18 ? -3.333  -5.444  4.950   1.00 0.00 ? 18 ASN A HD22 9  
ATOM 6539 N N    . TYR A 1 19 ? 0.939   -5.315  2.245   1.00 0.00 ? 19 TYR A N    9  
ATOM 6540 C CA   . TYR A 1 19 ? 1.017   -6.482  1.312   1.00 0.00 ? 19 TYR A CA   9  
ATOM 6541 C C    . TYR A 1 19 ? 2.229   -7.378  1.604   1.00 0.00 ? 19 TYR A C    9  
ATOM 6542 O O    . TYR A 1 19 ? 2.337   -8.457  1.053   1.00 0.00 ? 19 TYR A O    9  
ATOM 6543 C CB   . TYR A 1 19 ? 1.065   -5.914  -0.111  1.00 0.00 ? 19 TYR A CB   9  
ATOM 6544 C CG   . TYR A 1 19 ? -0.224  -5.086  -0.315  1.00 0.00 ? 19 TYR A CG   9  
ATOM 6545 C CD1  . TYR A 1 19 ? -1.379  -5.686  -0.776  1.00 0.00 ? 19 TYR A CD1  9  
ATOM 6546 C CD2  . TYR A 1 19 ? -0.258  -3.734  -0.027  1.00 0.00 ? 19 TYR A CD2  9  
ATOM 6547 C CE1  . TYR A 1 19 ? -2.536  -4.955  -0.946  1.00 0.00 ? 19 TYR A CE1  9  
ATOM 6548 C CE2  . TYR A 1 19 ? -1.414  -2.996  -0.197  1.00 0.00 ? 19 TYR A CE2  9  
ATOM 6549 C CZ   . TYR A 1 19 ? -2.567  -3.601  -0.659  1.00 0.00 ? 19 TYR A CZ   9  
ATOM 6550 O OH   . TYR A 1 19 ? -3.730  -2.871  -0.839  1.00 0.00 ? 19 TYR A OH   9  
ATOM 6551 H H    . TYR A 1 19 ? 1.507   -4.535  2.076   1.00 0.00 ? 19 TYR A H    9  
ATOM 6552 H HA   . TYR A 1 19 ? 0.128   -7.091  1.410   1.00 0.00 ? 19 TYR A HA   9  
ATOM 6553 H HB2  . TYR A 1 19 ? 1.930   -5.276  -0.230  1.00 0.00 ? 19 TYR A HB2  9  
ATOM 6554 H HB3  . TYR A 1 19 ? 1.106   -6.704  -0.845  1.00 0.00 ? 19 TYR A HB3  9  
ATOM 6555 H HD1  . TYR A 1 19 ? -1.377  -6.740  -1.007  1.00 0.00 ? 19 TYR A HD1  9  
ATOM 6556 H HD2  . TYR A 1 19 ? 0.635   -3.249  0.338   1.00 0.00 ? 19 TYR A HD2  9  
ATOM 6557 H HE1  . TYR A 1 19 ? -3.422  -5.453  -1.303  1.00 0.00 ? 19 TYR A HE1  9  
ATOM 6558 H HE2  . TYR A 1 19 ? -1.410  -1.940  0.027   1.00 0.00 ? 19 TYR A HE2  9  
ATOM 6559 H HH   . TYR A 1 19 ? -4.265  -2.949  -0.044  1.00 0.00 ? 19 TYR A HH   9  
ATOM 6560 N N    . CYS A 1 20 ? 3.096   -6.902  2.463   1.00 0.00 ? 20 CYS A N    9  
ATOM 6561 C CA   . CYS A 1 20 ? 4.322   -7.673  2.848   1.00 0.00 ? 20 CYS A CA   9  
ATOM 6562 C C    . CYS A 1 20 ? 4.150   -8.332  4.236   1.00 0.00 ? 20 CYS A C    9  
ATOM 6563 O O    . CYS A 1 20 ? 4.576   -9.459  4.394   1.00 0.00 ? 20 CYS A O    9  
ATOM 6564 C CB   . CYS A 1 20 ? 5.540   -6.712  2.833   1.00 0.00 ? 20 CYS A CB   9  
ATOM 6565 S SG   . CYS A 1 20 ? 6.376   -6.483  1.243   1.00 0.00 ? 20 CYS A SG   9  
ATOM 6566 H H    . CYS A 1 20 ? 2.939   -6.022  2.859   1.00 0.00 ? 20 CYS A H    9  
ATOM 6567 H HA   . CYS A 1 20 ? 4.505   -8.449  2.122   1.00 0.00 ? 20 CYS A HA   9  
ATOM 6568 H HB2  . CYS A 1 20 ? 5.265   -5.729  3.181   1.00 0.00 ? 20 CYS A HB2  9  
ATOM 6569 H HB3  . CYS A 1 20 ? 6.281   -7.095  3.517   1.00 0.00 ? 20 CYS A HB3  9  
ATOM 6570 N N    . ASN A 1 21 ? 3.558   -7.664  5.205   1.00 0.00 ? 21 ASN A N    9  
ATOM 6571 C CA   . ASN A 1 21 ? 3.378   -8.300  6.561   1.00 0.00 ? 21 ASN A CA   9  
ATOM 6572 C C    . ASN A 1 21 ? 1.893   -8.310  6.939   1.00 0.00 ? 21 ASN A C    9  
ATOM 6573 O O    . ASN A 1 21 ? 1.009   -8.039  6.149   1.00 0.00 ? 21 ASN A O    9  
ATOM 6574 C CB   . ASN A 1 21 ? 4.191   -7.511  7.658   1.00 0.00 ? 21 ASN A CB   9  
ATOM 6575 C CG   . ASN A 1 21 ? 3.679   -6.081  7.912   1.00 0.00 ? 21 ASN A CG   9  
ATOM 6576 O OD1  . ASN A 1 21 ? 2.538   -5.868  8.272   1.00 0.00 ? 21 ASN A OD1  9  
ATOM 6577 N ND2  . ASN A 1 21 ? 4.496   -5.080  7.740   1.00 0.00 ? 21 ASN A ND2  9  
ATOM 6578 H H    . ASN A 1 21 ? 3.228   -6.756  5.059   1.00 0.00 ? 21 ASN A H    9  
ATOM 6579 H HA   . ASN A 1 21 ? 3.712   -9.329  6.534   1.00 0.00 ? 21 ASN A HA   9  
ATOM 6580 H HB2  . ASN A 1 21 ? 4.136   -8.054  8.595   1.00 0.00 ? 21 ASN A HB2  9  
ATOM 6581 H HB3  . ASN A 1 21 ? 5.228   -7.470  7.355   1.00 0.00 ? 21 ASN A HB3  9  
ATOM 6582 H HD21 . ASN A 1 21 ? 5.416   -5.250  7.451   1.00 0.00 ? 21 ASN A HD21 9  
ATOM 6583 H HD22 . ASN A 1 21 ? 4.185   -4.164  7.902   1.00 0.00 ? 21 ASN A HD22 9  
ATOM 6584 N N    . PHE B 2 1  ? 6.746   9.667   2.754   1.00 0.00 ? 1  PHE B N    9  
ATOM 6585 C CA   . PHE B 2 1  ? 5.488   10.287  2.244   1.00 0.00 ? 1  PHE B CA   9  
ATOM 6586 C C    . PHE B 2 1  ? 5.804   11.424  1.257   1.00 0.00 ? 1  PHE B C    9  
ATOM 6587 O O    . PHE B 2 1  ? 6.449   12.389  1.609   1.00 0.00 ? 1  PHE B O    9  
ATOM 6588 C CB   . PHE B 2 1  ? 4.682   10.784  3.482   1.00 0.00 ? 1  PHE B CB   9  
ATOM 6589 C CG   . PHE B 2 1  ? 3.692   11.920  3.188   1.00 0.00 ? 1  PHE B CG   9  
ATOM 6590 C CD1  . PHE B 2 1  ? 2.744   11.811  2.185   1.00 0.00 ? 1  PHE B CD1  9  
ATOM 6591 C CD2  . PHE B 2 1  ? 3.740   13.072  3.954   1.00 0.00 ? 1  PHE B CD2  9  
ATOM 6592 C CE1  . PHE B 2 1  ? 1.858   12.840  1.954   1.00 0.00 ? 1  PHE B CE1  9  
ATOM 6593 C CE2  . PHE B 2 1  ? 2.852   14.100  3.722   1.00 0.00 ? 1  PHE B CE2  9  
ATOM 6594 C CZ   . PHE B 2 1  ? 1.910   13.983  2.719   1.00 0.00 ? 1  PHE B CZ   9  
ATOM 6595 H H1   . PHE B 2 1  ? 7.563   10.160  2.337   1.00 0.00 ? 1  PHE B H1   9  
ATOM 6596 H H2   . PHE B 2 1  ? 6.782   9.762   3.792   1.00 0.00 ? 1  PHE B H2   9  
ATOM 6597 H H3   . PHE B 2 1  ? 6.778   8.658   2.495   1.00 0.00 ? 1  PHE B H3   9  
ATOM 6598 H HA   . PHE B 2 1  ? 4.921   9.522   1.729   1.00 0.00 ? 1  PHE B HA   9  
ATOM 6599 H HB2  . PHE B 2 1  ? 4.102   9.951   3.856   1.00 0.00 ? 1  PHE B HB2  9  
ATOM 6600 H HB3  . PHE B 2 1  ? 5.364   11.106  4.255   1.00 0.00 ? 1  PHE B HB3  9  
ATOM 6601 H HD1  . PHE B 2 1  ? 2.692   10.918  1.580   1.00 0.00 ? 1  PHE B HD1  9  
ATOM 6602 H HD2  . PHE B 2 1  ? 4.473   13.179  4.744   1.00 0.00 ? 1  PHE B HD2  9  
ATOM 6603 H HE1  . PHE B 2 1  ? 1.121   12.759  1.167   1.00 0.00 ? 1  PHE B HE1  9  
ATOM 6604 H HE2  . PHE B 2 1  ? 2.893   14.993  4.326   1.00 0.00 ? 1  PHE B HE2  9  
ATOM 6605 H HZ   . PHE B 2 1  ? 1.204   14.781  2.531   1.00 0.00 ? 1  PHE B HZ   9  
ATOM 6606 N N    . VAL B 2 2  ? 5.330   11.247  0.049   1.00 0.00 ? 2  VAL B N    9  
ATOM 6607 C CA   . VAL B 2 2  ? 5.545   12.252  -1.044  1.00 0.00 ? 2  VAL B CA   9  
ATOM 6608 C C    . VAL B 2 2  ? 4.197   12.849  -1.486  1.00 0.00 ? 2  VAL B C    9  
ATOM 6609 O O    . VAL B 2 2  ? 3.166   12.586  -0.897  1.00 0.00 ? 2  VAL B O    9  
ATOM 6610 C CB   . VAL B 2 2  ? 6.224   11.572  -2.278  1.00 0.00 ? 2  VAL B CB   9  
ATOM 6611 C CG1  . VAL B 2 2  ? 7.612   11.007  -1.919  1.00 0.00 ? 2  VAL B CG1  9  
ATOM 6612 C CG2  . VAL B 2 2  ? 5.320   10.432  -2.826  1.00 0.00 ? 2  VAL B CG2  9  
ATOM 6613 H H    . VAL B 2 2  ? 4.821   10.434  -0.148  1.00 0.00 ? 2  VAL B H    9  
ATOM 6614 H HA   . VAL B 2 2  ? 6.173   13.053  -0.683  1.00 0.00 ? 2  VAL B HA   9  
ATOM 6615 H HB   . VAL B 2 2  ? 6.353   12.306  -3.059  1.00 0.00 ? 2  VAL B HB   9  
ATOM 6616 H HG11 . VAL B 2 2  ? 7.531   10.273  -1.132  1.00 0.00 ? 2  VAL B HG11 9  
ATOM 6617 H HG12 . VAL B 2 2  ? 8.048   10.542  -2.792  1.00 0.00 ? 2  VAL B HG12 9  
ATOM 6618 H HG13 . VAL B 2 2  ? 8.268   11.800  -1.596  1.00 0.00 ? 2  VAL B HG13 9  
ATOM 6619 H HG21 . VAL B 2 2  ? 5.148   9.682   -2.068  1.00 0.00 ? 2  VAL B HG21 9  
ATOM 6620 H HG22 . VAL B 2 2  ? 4.363   10.825  -3.144  1.00 0.00 ? 2  VAL B HG22 9  
ATOM 6621 H HG23 . VAL B 2 2  ? 5.796   9.958   -3.670  1.00 0.00 ? 2  VAL B HG23 9  
ATOM 6622 N N    . ASN B 2 3  ? 4.278   13.646  -2.518  1.00 0.00 ? 3  ASN B N    9  
ATOM 6623 C CA   . ASN B 2 3  ? 3.085   14.318  -3.108  1.00 0.00 ? 3  ASN B CA   9  
ATOM 6624 C C    . ASN B 2 3  ? 3.223   14.264  -4.646  1.00 0.00 ? 3  ASN B C    9  
ATOM 6625 O O    . ASN B 2 3  ? 3.610   15.232  -5.274  1.00 0.00 ? 3  ASN B O    9  
ATOM 6626 C CB   . ASN B 2 3  ? 3.032   15.786  -2.589  1.00 0.00 ? 3  ASN B CB   9  
ATOM 6627 C CG   . ASN B 2 3  ? 4.393   16.476  -2.766  1.00 0.00 ? 3  ASN B CG   9  
ATOM 6628 O OD1  . ASN B 2 3  ? 5.352   16.190  -2.077  1.00 0.00 ? 3  ASN B OD1  9  
ATOM 6629 N ND2  . ASN B 2 3  ? 4.506   17.387  -3.690  1.00 0.00 ? 3  ASN B ND2  9  
ATOM 6630 H H    . ASN B 2 3  ? 5.158   13.807  -2.921  1.00 0.00 ? 3  ASN B H    9  
ATOM 6631 H HA   . ASN B 2 3  ? 2.186   13.792  -2.816  1.00 0.00 ? 3  ASN B HA   9  
ATOM 6632 H HB2  . ASN B 2 3  ? 2.284   16.329  -3.150  1.00 0.00 ? 3  ASN B HB2  9  
ATOM 6633 H HB3  . ASN B 2 3  ? 2.763   15.812  -1.540  1.00 0.00 ? 3  ASN B HB3  9  
ATOM 6634 H HD21 . ASN B 2 3  ? 3.728   17.605  -4.243  1.00 0.00 ? 3  ASN B HD21 9  
ATOM 6635 H HD22 . ASN B 2 3  ? 5.360   17.852  -3.832  1.00 0.00 ? 3  ASN B HD22 9  
ATOM 6636 N N    . GLN B 2 4  ? 2.909   13.128  -5.216  1.00 0.00 ? 4  GLN B N    9  
ATOM 6637 C CA   . GLN B 2 4  ? 2.998   12.924  -6.695  1.00 0.00 ? 4  GLN B CA   9  
ATOM 6638 C C    . GLN B 2 4  ? 1.575   12.553  -7.222  1.00 0.00 ? 4  GLN B C    9  
ATOM 6639 O O    . GLN B 2 4  ? 0.616   12.665  -6.481  1.00 0.00 ? 4  GLN B O    9  
ATOM 6640 C CB   . GLN B 2 4  ? 4.062   11.795  -6.873  1.00 0.00 ? 4  GLN B CB   9  
ATOM 6641 C CG   . GLN B 2 4  ? 4.324   11.363  -8.343  1.00 0.00 ? 4  GLN B CG   9  
ATOM 6642 C CD   . GLN B 2 4  ? 4.799   12.566  -9.162  1.00 0.00 ? 4  GLN B CD   9  
ATOM 6643 O OE1  . GLN B 2 4  ? 5.814   13.157  -8.861  1.00 0.00 ? 4  GLN B OE1  9  
ATOM 6644 N NE2  . GLN B 2 4  ? 4.113   12.964  -10.199 1.00 0.00 ? 4  GLN B NE2  9  
ATOM 6645 H H    . GLN B 2 4  ? 2.602   12.371  -4.683  1.00 0.00 ? 4  GLN B H    9  
ATOM 6646 H HA   . GLN B 2 4  ? 3.337   13.868  -7.126  1.00 0.00 ? 4  GLN B HA   9  
ATOM 6647 H HB2  . GLN B 2 4  ? 4.992   12.143  -6.447  1.00 0.00 ? 4  GLN B HB2  9  
ATOM 6648 H HB3  . GLN B 2 4  ? 3.750   10.939  -6.296  1.00 0.00 ? 4  GLN B HB3  9  
ATOM 6649 H HG2  . GLN B 2 4  ? 5.123   10.638  -8.343  1.00 0.00 ? 4  GLN B HG2  9  
ATOM 6650 H HG3  . GLN B 2 4  ? 3.464   10.901  -8.805  1.00 0.00 ? 4  GLN B HG3  9  
ATOM 6651 H HE21 . GLN B 2 4  ? 3.296   12.497  -10.468 1.00 0.00 ? 4  GLN B HE21 9  
ATOM 6652 H HE22 . GLN B 2 4  ? 4.420   13.742  -10.712 1.00 0.00 ? 4  GLN B HE22 9  
ATOM 6653 N N    . HIS B 2 5  ? 1.463   12.131  -8.466  1.00 0.00 ? 5  HIS B N    9  
ATOM 6654 C CA   . HIS B 2 5  ? 0.148   11.747  -9.070  1.00 0.00 ? 5  HIS B CA   9  
ATOM 6655 C C    . HIS B 2 5  ? 0.233   10.207  -9.174  1.00 0.00 ? 5  HIS B C    9  
ATOM 6656 O O    . HIS B 2 5  ? 0.313   9.631   -10.241 1.00 0.00 ? 5  HIS B O    9  
ATOM 6657 C CB   . HIS B 2 5  ? 0.018   12.414  -10.464 1.00 0.00 ? 5  HIS B CB   9  
ATOM 6658 C CG   . HIS B 2 5  ? 0.253   13.923  -10.329 1.00 0.00 ? 5  HIS B CG   9  
ATOM 6659 N ND1  . HIS B 2 5  ? -0.546  14.787  -9.788  1.00 0.00 ? 5  HIS B ND1  9  
ATOM 6660 C CD2  . HIS B 2 5  ? 1.342   14.672  -10.734 1.00 0.00 ? 5  HIS B CD2  9  
ATOM 6661 C CE1  . HIS B 2 5  ? -0.011  15.969  -9.845  1.00 0.00 ? 5  HIS B CE1  9  
ATOM 6662 N NE2  . HIS B 2 5  ? 1.165   15.940  -10.427 1.00 0.00 ? 5  HIS B NE2  9  
ATOM 6663 H H    . HIS B 2 5  ? 2.245   12.047  -9.039  1.00 0.00 ? 5  HIS B H    9  
ATOM 6664 H HA   . HIS B 2 5  ? -0.673  12.025  -8.428  1.00 0.00 ? 5  HIS B HA   9  
ATOM 6665 H HB2  . HIS B 2 5  ? 0.754   12.009  -11.142 1.00 0.00 ? 5  HIS B HB2  9  
ATOM 6666 H HB3  . HIS B 2 5  ? -0.969  12.247  -10.875 1.00 0.00 ? 5  HIS B HB3  9  
ATOM 6667 H HD1  . HIS B 2 5  ? -1.420  14.584  -9.396  1.00 0.00 ? 5  HIS B HD1  9  
ATOM 6668 H HD2  . HIS B 2 5  ? 2.212   14.271  -11.231 1.00 0.00 ? 5  HIS B HD2  9  
ATOM 6669 H HE1  . HIS B 2 5  ? -0.468  16.870  -9.463  1.00 0.00 ? 5  HIS B HE1  9  
ATOM 6670 N N    . LEU B 2 6  ? 0.213   9.596   -8.015  1.00 0.00 ? 6  LEU B N    9  
ATOM 6671 C CA   . LEU B 2 6  ? 0.293   8.102   -7.869  1.00 0.00 ? 6  LEU B CA   9  
ATOM 6672 C C    . LEU B 2 6  ? -1.140  7.589   -7.949  1.00 0.00 ? 6  LEU B C    9  
ATOM 6673 O O    . LEU B 2 6  ? -1.805  7.496   -6.938  1.00 0.00 ? 6  LEU B O    9  
ATOM 6674 C CB   . LEU B 2 6  ? 0.960   7.815   -6.492  1.00 0.00 ? 6  LEU B CB   9  
ATOM 6675 C CG   . LEU B 2 6  ? 2.344   8.525   -6.428  1.00 0.00 ? 6  LEU B CG   9  
ATOM 6676 C CD1  . LEU B 2 6  ? 2.947   8.392   -5.024  1.00 0.00 ? 6  LEU B CD1  9  
ATOM 6677 C CD2  . LEU B 2 6  ? 3.333   7.893   -7.448  1.00 0.00 ? 6  LEU B CD2  9  
ATOM 6678 H H    . LEU B 2 6  ? 0.138   10.148  -7.208  1.00 0.00 ? 6  LEU B H    9  
ATOM 6679 H HA   . LEU B 2 6  ? 0.864   7.691   -8.676  1.00 0.00 ? 6  LEU B HA   9  
ATOM 6680 H HB2  . LEU B 2 6  ? 0.334   8.204   -5.700  1.00 0.00 ? 6  LEU B HB2  9  
ATOM 6681 H HB3  . LEU B 2 6  ? 1.082   6.753   -6.340  1.00 0.00 ? 6  LEU B HB3  9  
ATOM 6682 H HG   . LEU B 2 6  ? 2.198   9.571   -6.634  1.00 0.00 ? 6  LEU B HG   9  
ATOM 6683 H HD11 . LEU B 2 6  ? 3.060   7.352   -4.750  1.00 0.00 ? 6  LEU B HD11 9  
ATOM 6684 H HD12 . LEU B 2 6  ? 3.911   8.879   -5.006  1.00 0.00 ? 6  LEU B HD12 9  
ATOM 6685 H HD13 . LEU B 2 6  ? 2.301   8.870   -4.306  1.00 0.00 ? 6  LEU B HD13 9  
ATOM 6686 H HD21 . LEU B 2 6  ? 3.466   6.839   -7.244  1.00 0.00 ? 6  LEU B HD21 9  
ATOM 6687 H HD22 . LEU B 2 6  ? 2.960   7.992   -8.453  1.00 0.00 ? 6  LEU B HD22 9  
ATOM 6688 H HD23 . LEU B 2 6  ? 4.292   8.389   -7.397  1.00 0.00 ? 6  LEU B HD23 9  
ATOM 6689 N N    . CYS B 2 7  ? -1.564  7.273   -9.150  1.00 0.00 ? 7  CYS B N    9  
ATOM 6690 C CA   . CYS B 2 7  ? -2.961  6.775   -9.376  1.00 0.00 ? 7  CYS B CA   9  
ATOM 6691 C C    . CYS B 2 7  ? -3.112  5.268   -9.663  1.00 0.00 ? 7  CYS B C    9  
ATOM 6692 O O    . CYS B 2 7  ? -3.888  4.878   -10.515 1.00 0.00 ? 7  CYS B O    9  
ATOM 6693 C CB   . CYS B 2 7  ? -3.515  7.603   -10.539 1.00 0.00 ? 7  CYS B CB   9  
ATOM 6694 S SG   . CYS B 2 7  ? -3.258  9.394   -10.454 1.00 0.00 ? 7  CYS B SG   9  
ATOM 6695 H H    . CYS B 2 7  ? -0.961  7.365   -9.918  1.00 0.00 ? 7  CYS B H    9  
ATOM 6696 H HA   . CYS B 2 7  ? -3.566  6.996   -8.513  1.00 0.00 ? 7  CYS B HA   9  
ATOM 6697 H HB2  . CYS B 2 7  ? -3.070  7.251   -11.458 1.00 0.00 ? 7  CYS B HB2  9  
ATOM 6698 H HB3  . CYS B 2 7  ? -4.578  7.426   -10.612 1.00 0.00 ? 7  CYS B HB3  9  
ATOM 6699 N N    . GLY B 2 8  ? -2.380  4.450   -8.954  1.00 0.00 ? 8  GLY B N    9  
ATOM 6700 C CA   . GLY B 2 8  ? -2.479  2.972   -9.173  1.00 0.00 ? 8  GLY B CA   9  
ATOM 6701 C C    . GLY B 2 8  ? -1.248  2.447   -9.946  1.00 0.00 ? 8  GLY B C    9  
ATOM 6702 O O    . GLY B 2 8  ? -0.598  1.550   -9.456  1.00 0.00 ? 8  GLY B O    9  
ATOM 6703 H H    . GLY B 2 8  ? -1.765  4.805   -8.279  1.00 0.00 ? 8  GLY B H    9  
ATOM 6704 H HA2  . GLY B 2 8  ? -2.491  2.490   -8.209  1.00 0.00 ? 8  GLY B HA2  9  
ATOM 6705 H HA3  . GLY B 2 8  ? -3.412  2.696   -9.642  1.00 0.00 ? 8  GLY B HA3  9  
ATOM 6706 N N    . SER B 2 9  ? -0.938  2.982   -11.114 1.00 0.00 ? 9  SER B N    9  
ATOM 6707 C CA   . SER B 2 9  ? 0.252   2.503   -11.904 1.00 0.00 ? 9  SER B CA   9  
ATOM 6708 C C    . SER B 2 9  ? 1.534   2.274   -11.082 1.00 0.00 ? 9  SER B C    9  
ATOM 6709 O O    . SER B 2 9  ? 2.263   1.321   -11.279 1.00 0.00 ? 9  SER B O    9  
ATOM 6710 C CB   . SER B 2 9  ? 0.536   3.532   -13.039 1.00 0.00 ? 9  SER B CB   9  
ATOM 6711 O OG   . SER B 2 9  ? 0.965   4.723   -12.384 1.00 0.00 ? 9  SER B OG   9  
ATOM 6712 H H    . SER B 2 9  ? -1.472  3.708   -11.512 1.00 0.00 ? 9  SER B H    9  
ATOM 6713 H HA   . SER B 2 9  ? -0.017  1.569   -12.363 1.00 0.00 ? 9  SER B HA   9  
ATOM 6714 H HB2  . SER B 2 9  ? 1.292   3.176   -13.720 1.00 0.00 ? 9  SER B HB2  9  
ATOM 6715 H HB3  . SER B 2 9  ? -0.377  3.734   -13.585 1.00 0.00 ? 9  SER B HB3  9  
ATOM 6716 H HG   . SER B 2 9  ? 1.880   4.926   -12.584 1.00 0.00 ? 9  SER B HG   9  
ATOM 6717 N N    . HIS B 2 10 ? 1.739   3.180   -10.165 1.00 0.00 ? 10 HIS B N    9  
ATOM 6718 C CA   . HIS B 2 10 ? 2.914   3.169   -9.262  1.00 0.00 ? 10 HIS B CA   9  
ATOM 6719 C C    . HIS B 2 10 ? 2.626   2.386   -7.988  1.00 0.00 ? 10 HIS B C    9  
ATOM 6720 O O    . HIS B 2 10 ? 3.528   1.837   -7.387  1.00 0.00 ? 10 HIS B O    9  
ATOM 6721 C CB   . HIS B 2 10 ? 3.299   4.622   -8.929  1.00 0.00 ? 10 HIS B CB   9  
ATOM 6722 C CG   . HIS B 2 10 ? 3.833   5.296   -10.193 1.00 0.00 ? 10 HIS B CG   9  
ATOM 6723 N ND1  . HIS B 2 10 ? 4.396   6.458   -10.231 1.00 0.00 ? 10 HIS B ND1  9  
ATOM 6724 C CD2  . HIS B 2 10 ? 3.854   4.871   -11.509 1.00 0.00 ? 10 HIS B CD2  9  
ATOM 6725 C CE1  . HIS B 2 10 ? 4.740   6.744   -11.447 1.00 0.00 ? 10 HIS B CE1  9  
ATOM 6726 N NE2  . HIS B 2 10 ? 4.419   5.778   -12.277 1.00 0.00 ? 10 HIS B NE2  9  
ATOM 6727 H H    . HIS B 2 10 ? 1.091   3.887   -10.066 1.00 0.00 ? 10 HIS B H    9  
ATOM 6728 H HA   . HIS B 2 10 ? 3.731   2.732   -9.795  1.00 0.00 ? 10 HIS B HA   9  
ATOM 6729 H HB2  . HIS B 2 10 ? 2.460   5.184   -8.563  1.00 0.00 ? 10 HIS B HB2  9  
ATOM 6730 H HB3  . HIS B 2 10 ? 4.082   4.631   -8.191  1.00 0.00 ? 10 HIS B HB3  9  
ATOM 6731 H HD1  . HIS B 2 10 ? 4.545   7.033   -9.451  1.00 0.00 ? 10 HIS B HD1  9  
ATOM 6732 H HD2  . HIS B 2 10 ? 3.476   3.924   -11.858 1.00 0.00 ? 10 HIS B HD2  9  
ATOM 6733 H HE1  . HIS B 2 10 ? 5.235   7.660   -11.744 1.00 0.00 ? 10 HIS B HE1  9  
ATOM 6734 N N    . LEU B 2 11 ? 1.373   2.341   -7.615  1.00 0.00 ? 11 LEU B N    9  
ATOM 6735 C CA   . LEU B 2 11 ? 0.978   1.599   -6.381  1.00 0.00 ? 11 LEU B CA   9  
ATOM 6736 C C    . LEU B 2 11 ? 1.091   0.098   -6.739  1.00 0.00 ? 11 LEU B C    9  
ATOM 6737 O O    . LEU B 2 11 ? 1.233   -0.762  -5.892  1.00 0.00 ? 11 LEU B O    9  
ATOM 6738 C CB   . LEU B 2 11 ? -0.485  1.951   -6.011  1.00 0.00 ? 11 LEU B CB   9  
ATOM 6739 C CG   . LEU B 2 11 ? -0.733  3.494   -5.929  1.00 0.00 ? 11 LEU B CG   9  
ATOM 6740 C CD1  . LEU B 2 11 ? -2.210  3.741   -5.590  1.00 0.00 ? 11 LEU B CD1  9  
ATOM 6741 C CD2  . LEU B 2 11 ? 0.131   4.152   -4.844  1.00 0.00 ? 11 LEU B CD2  9  
ATOM 6742 H H    . LEU B 2 11 ? 0.683   2.790   -8.144  1.00 0.00 ? 11 LEU B H    9  
ATOM 6743 H HA   . LEU B 2 11 ? 1.665   1.838   -5.588  1.00 0.00 ? 11 LEU B HA   9  
ATOM 6744 H HB2  . LEU B 2 11 ? -1.155  1.535   -6.749  1.00 0.00 ? 11 LEU B HB2  9  
ATOM 6745 H HB3  . LEU B 2 11 ? -0.717  1.493   -5.059  1.00 0.00 ? 11 LEU B HB3  9  
ATOM 6746 H HG   . LEU B 2 11 ? -0.521  3.952   -6.885  1.00 0.00 ? 11 LEU B HG   9  
ATOM 6747 H HD11 . LEU B 2 11 ? -2.484  3.248   -4.667  1.00 0.00 ? 11 LEU B HD11 9  
ATOM 6748 H HD12 . LEU B 2 11 ? -2.419  4.798   -5.505  1.00 0.00 ? 11 LEU B HD12 9  
ATOM 6749 H HD13 . LEU B 2 11 ? -2.810  3.336   -6.384  1.00 0.00 ? 11 LEU B HD13 9  
ATOM 6750 H HD21 . LEU B 2 11 ? -0.072  3.709   -3.879  1.00 0.00 ? 11 LEU B HD21 9  
ATOM 6751 H HD22 . LEU B 2 11 ? 1.174   4.008   -5.079  1.00 0.00 ? 11 LEU B HD22 9  
ATOM 6752 H HD23 . LEU B 2 11 ? -0.079  5.209   -4.801  1.00 0.00 ? 11 LEU B HD23 9  
ATOM 6753 N N    . VAL B 2 12 ? 1.030   -0.138  -8.025  1.00 0.00 ? 12 VAL B N    9  
ATOM 6754 C CA   . VAL B 2 12 ? 1.106   -1.477  -8.662  1.00 0.00 ? 12 VAL B CA   9  
ATOM 6755 C C    . VAL B 2 12 ? 2.565   -1.840  -8.862  1.00 0.00 ? 12 VAL B C    9  
ATOM 6756 O O    . VAL B 2 12 ? 2.956   -2.913  -8.454  1.00 0.00 ? 12 VAL B O    9  
ATOM 6757 C CB   . VAL B 2 12 ? 0.305   -1.366  -9.991  1.00 0.00 ? 12 VAL B CB   9  
ATOM 6758 C CG1  . VAL B 2 12 ? 0.603   -2.508  -10.985 1.00 0.00 ? 12 VAL B CG1  9  
ATOM 6759 C CG2  . VAL B 2 12 ? -1.167  -1.465  -9.610  1.00 0.00 ? 12 VAL B CG2  9  
ATOM 6760 H H    . VAL B 2 12 ? 0.927   0.618   -8.634  1.00 0.00 ? 12 VAL B H    9  
ATOM 6761 H HA   . VAL B 2 12 ? 0.656   -2.212  -8.013  1.00 0.00 ? 12 VAL B HA   9  
ATOM 6762 H HB   . VAL B 2 12 ? 0.475   -0.409  -10.458 1.00 0.00 ? 12 VAL B HB   9  
ATOM 6763 H HG11 . VAL B 2 12 ? 0.377   -3.465  -10.541 1.00 0.00 ? 12 VAL B HG11 9  
ATOM 6764 H HG12 . VAL B 2 12 ? 0.000   -2.384  -11.876 1.00 0.00 ? 12 VAL B HG12 9  
ATOM 6765 H HG13 . VAL B 2 12 ? 1.639   -2.490  -11.276 1.00 0.00 ? 12 VAL B HG13 9  
ATOM 6766 H HG21 . VAL B 2 12 ? -1.430  -0.680  -8.919  1.00 0.00 ? 12 VAL B HG21 9  
ATOM 6767 H HG22 . VAL B 2 12 ? -1.806  -1.361  -10.475 1.00 0.00 ? 12 VAL B HG22 9  
ATOM 6768 H HG23 . VAL B 2 12 ? -1.368  -2.414  -9.123  1.00 0.00 ? 12 VAL B HG23 9  
ATOM 6769 N N    . GLU B 2 13 ? 3.340   -0.967  -9.463  1.00 0.00 ? 13 GLU B N    9  
ATOM 6770 C CA   . GLU B 2 13 ? 4.774   -1.355  -9.641  1.00 0.00 ? 13 GLU B CA   9  
ATOM 6771 C C    . GLU B 2 13 ? 5.488   -1.484  -8.273  1.00 0.00 ? 13 GLU B C    9  
ATOM 6772 O O    . GLU B 2 13 ? 6.389   -2.290  -8.132  1.00 0.00 ? 13 GLU B O    9  
ATOM 6773 C CB   . GLU B 2 13 ? 5.489   -0.306  -10.527 1.00 0.00 ? 13 GLU B CB   9  
ATOM 6774 C CG   . GLU B 2 13 ? 6.930   -0.731  -10.837 1.00 0.00 ? 13 GLU B CG   9  
ATOM 6775 C CD   . GLU B 2 13 ? 7.079   -2.178  -11.364 1.00 0.00 ? 13 GLU B CD   9  
ATOM 6776 O OE1  . GLU B 2 13 ? 6.675   -2.414  -12.492 1.00 0.00 ? 13 GLU B OE1  9  
ATOM 6777 O OE2  . GLU B 2 13 ? 7.596   -2.973  -10.594 1.00 0.00 ? 13 GLU B OE2  9  
ATOM 6778 H H    . GLU B 2 13 ? 2.989   -0.097  -9.781  1.00 0.00 ? 13 GLU B H    9  
ATOM 6779 H HA   . GLU B 2 13 ? 4.813   -2.296  -10.166 1.00 0.00 ? 13 GLU B HA   9  
ATOM 6780 H HB2  . GLU B 2 13 ? 4.926   -0.086  -11.421 1.00 0.00 ? 13 GLU B HB2  9  
ATOM 6781 H HB3  . GLU B 2 13 ? 5.642   0.598   -9.980  1.00 0.00 ? 13 GLU B HB3  9  
ATOM 6782 H HG2  . GLU B 2 13 ? 7.262   -0.054  -11.599 1.00 0.00 ? 13 GLU B HG2  9  
ATOM 6783 H HG3  . GLU B 2 13 ? 7.532   -0.600  -9.955  1.00 0.00 ? 13 GLU B HG3  9  
ATOM 6784 N N    . ALA B 2 14 ? 5.072   -0.709  -7.295  1.00 0.00 ? 14 ALA B N    9  
ATOM 6785 C CA   . ALA B 2 14 ? 5.719   -0.774  -5.944  1.00 0.00 ? 14 ALA B CA   9  
ATOM 6786 C C    . ALA B 2 14 ? 5.257   -2.019  -5.171  1.00 0.00 ? 14 ALA B C    9  
ATOM 6787 O O    . ALA B 2 14 ? 6.028   -2.557  -4.398  1.00 0.00 ? 14 ALA B O    9  
ATOM 6788 C CB   . ALA B 2 14 ? 5.358   0.497   -5.163  1.00 0.00 ? 14 ALA B CB   9  
ATOM 6789 H H    . ALA B 2 14 ? 4.331   -0.083  -7.430  1.00 0.00 ? 14 ALA B H    9  
ATOM 6790 H HA   . ALA B 2 14 ? 6.795   -0.825  -6.065  1.00 0.00 ? 14 ALA B HA   9  
ATOM 6791 H HB1  . ALA B 2 14 ? 5.716   1.366   -5.697  1.00 0.00 ? 14 ALA B HB1  9  
ATOM 6792 H HB2  . ALA B 2 14 ? 4.286   0.571   -5.044  1.00 0.00 ? 14 ALA B HB2  9  
ATOM 6793 H HB3  . ALA B 2 14 ? 5.819   0.476   -4.184  1.00 0.00 ? 14 ALA B HB3  9  
ATOM 6794 N N    . LEU B 2 15 ? 4.036   -2.465  -5.381  1.00 0.00 ? 15 LEU B N    9  
ATOM 6795 C CA   . LEU B 2 15 ? 3.564   -3.679  -4.638  1.00 0.00 ? 15 LEU B CA   9  
ATOM 6796 C C    . LEU B 2 15 ? 4.102   -4.926  -5.341  1.00 0.00 ? 15 LEU B C    9  
ATOM 6797 O O    . LEU B 2 15 ? 4.552   -5.841  -4.694  1.00 0.00 ? 15 LEU B O    9  
ATOM 6798 C CB   . LEU B 2 15 ? 1.983   -3.822  -4.612  1.00 0.00 ? 15 LEU B CB   9  
ATOM 6799 C CG   . LEU B 2 15 ? 1.263   -3.475  -3.280  1.00 0.00 ? 15 LEU B CG   9  
ATOM 6800 C CD1  . LEU B 2 15 ? 1.434   -1.993  -2.885  1.00 0.00 ? 15 LEU B CD1  9  
ATOM 6801 C CD2  . LEU B 2 15 ? -0.245  -3.769  -3.503  1.00 0.00 ? 15 LEU B CD2  9  
ATOM 6802 H H    . LEU B 2 15 ? 3.434   -2.019  -6.017  1.00 0.00 ? 15 LEU B H    9  
ATOM 6803 H HA   . LEU B 2 15 ? 4.023   -3.663  -3.662  1.00 0.00 ? 15 LEU B HA   9  
ATOM 6804 H HB2  . LEU B 2 15 ? 1.519   -3.203  -5.354  1.00 0.00 ? 15 LEU B HB2  9  
ATOM 6805 H HB3  . LEU B 2 15 ? 1.724   -4.848  -4.840  1.00 0.00 ? 15 LEU B HB3  9  
ATOM 6806 H HG   . LEU B 2 15 ? 1.634   -4.123  -2.498  1.00 0.00 ? 15 LEU B HG   9  
ATOM 6807 H HD11 . LEU B 2 15 ? 2.478   -1.757  -2.751  1.00 0.00 ? 15 LEU B HD11 9  
ATOM 6808 H HD12 . LEU B 2 15 ? 1.021   -1.345  -3.639  1.00 0.00 ? 15 LEU B HD12 9  
ATOM 6809 H HD13 . LEU B 2 15 ? 0.911   -1.793  -1.961  1.00 0.00 ? 15 LEU B HD13 9  
ATOM 6810 H HD21 . LEU B 2 15 ? -0.620  -3.197  -4.343  1.00 0.00 ? 15 LEU B HD21 9  
ATOM 6811 H HD22 . LEU B 2 15 ? -0.394  -4.814  -3.714  1.00 0.00 ? 15 LEU B HD22 9  
ATOM 6812 H HD23 . LEU B 2 15 ? -0.814  -3.535  -2.624  1.00 0.00 ? 15 LEU B HD23 9  
ATOM 6813 N N    . TYR B 2 16 ? 4.058   -4.932  -6.642  1.00 0.00 ? 16 TYR B N    9  
ATOM 6814 C CA   . TYR B 2 16 ? 4.547   -6.105  -7.429  1.00 0.00 ? 16 TYR B CA   9  
ATOM 6815 C C    . TYR B 2 16 ? 6.071   -6.285  -7.389  1.00 0.00 ? 16 TYR B C    9  
ATOM 6816 O O    . TYR B 2 16 ? 6.570   -7.326  -7.769  1.00 0.00 ? 16 TYR B O    9  
ATOM 6817 C CB   . TYR B 2 16 ? 4.143   -5.989  -8.919  1.00 0.00 ? 16 TYR B CB   9  
ATOM 6818 C CG   . TYR B 2 16 ? 2.628   -5.932  -9.205  1.00 0.00 ? 16 TYR B CG   9  
ATOM 6819 C CD1  . TYR B 2 16 ? 1.661   -5.638  -8.258  1.00 0.00 ? 16 TYR B CD1  9  
ATOM 6820 C CD2  . TYR B 2 16 ? 2.222   -6.195  -10.496 1.00 0.00 ? 16 TYR B CD2  9  
ATOM 6821 C CE1  . TYR B 2 16 ? 0.324   -5.609  -8.605  1.00 0.00 ? 16 TYR B CE1  9  
ATOM 6822 C CE2  . TYR B 2 16 ? 0.890   -6.167  -10.841 1.00 0.00 ? 16 TYR B CE2  9  
ATOM 6823 C CZ   . TYR B 2 16 ? -0.075  -5.873  -9.896  1.00 0.00 ? 16 TYR B CZ   9  
ATOM 6824 O OH   . TYR B 2 16 ? -1.413  -5.842  -10.237 1.00 0.00 ? 16 TYR B OH   9  
ATOM 6825 H H    . TYR B 2 16 ? 3.703   -4.156  -7.106  1.00 0.00 ? 16 TYR B H    9  
ATOM 6826 H HA   . TYR B 2 16 ? 4.084   -6.985  -7.016  1.00 0.00 ? 16 TYR B HA   9  
ATOM 6827 H HB2  . TYR B 2 16 ? 4.601   -5.124  -9.360  1.00 0.00 ? 16 TYR B HB2  9  
ATOM 6828 H HB3  . TYR B 2 16 ? 4.539   -6.859  -9.421  1.00 0.00 ? 16 TYR B HB3  9  
ATOM 6829 H HD1  . TYR B 2 16 ? 1.931   -5.431  -7.234  1.00 0.00 ? 16 TYR B HD1  9  
ATOM 6830 H HD2  . TYR B 2 16 ? 2.967   -6.419  -11.244 1.00 0.00 ? 16 TYR B HD2  9  
ATOM 6831 H HE1  . TYR B 2 16 ? -0.412  -5.375  -7.849  1.00 0.00 ? 16 TYR B HE1  9  
ATOM 6832 H HE2  . TYR B 2 16 ? 0.609   -6.384  -11.857 1.00 0.00 ? 16 TYR B HE2  9  
ATOM 6833 H HH   . TYR B 2 16 ? -1.509  -6.250  -11.099 1.00 0.00 ? 16 TYR B HH   9  
ATOM 6834 N N    . LEU B 2 17 ? 6.781   -5.285  -6.938  1.00 0.00 ? 17 LEU B N    9  
ATOM 6835 C CA   . LEU B 2 17 ? 8.269   -5.385  -6.870  1.00 0.00 ? 17 LEU B CA   9  
ATOM 6836 C C    . LEU B 2 17 ? 8.759   -5.635  -5.436  1.00 0.00 ? 17 LEU B C    9  
ATOM 6837 O O    . LEU B 2 17 ? 9.801   -6.243  -5.268  1.00 0.00 ? 17 LEU B O    9  
ATOM 6838 C CB   . LEU B 2 17 ? 8.853   -4.069  -7.425  1.00 0.00 ? 17 LEU B CB   9  
ATOM 6839 C CG   . LEU B 2 17 ? 10.410  -4.050  -7.417  1.00 0.00 ? 17 LEU B CG   9  
ATOM 6840 C CD1  . LEU B 2 17 ? 10.983  -5.077  -8.418  1.00 0.00 ? 17 LEU B CD1  9  
ATOM 6841 C CD2  . LEU B 2 17 ? 10.895  -2.648  -7.830  1.00 0.00 ? 17 LEU B CD2  9  
ATOM 6842 H H    . LEU B 2 17 ? 6.343   -4.460  -6.647  1.00 0.00 ? 17 LEU B H    9  
ATOM 6843 H HA   . LEU B 2 17 ? 8.598   -6.202  -7.494  1.00 0.00 ? 17 LEU B HA   9  
ATOM 6844 H HB2  . LEU B 2 17 ? 8.508   -3.946  -8.436  1.00 0.00 ? 17 LEU B HB2  9  
ATOM 6845 H HB3  . LEU B 2 17 ? 8.486   -3.235  -6.847  1.00 0.00 ? 17 LEU B HB3  9  
ATOM 6846 H HG   . LEU B 2 17 ? 10.777  -4.269  -6.426  1.00 0.00 ? 17 LEU B HG   9  
ATOM 6847 H HD11 . LEU B 2 17 ? 10.634  -4.852  -9.419  1.00 0.00 ? 17 LEU B HD11 9  
ATOM 6848 H HD12 . LEU B 2 17 ? 12.066  -5.041  -8.397  1.00 0.00 ? 17 LEU B HD12 9  
ATOM 6849 H HD13 . LEU B 2 17 ? 10.670  -6.075  -8.161  1.00 0.00 ? 17 LEU B HD13 9  
ATOM 6850 H HD21 . LEU B 2 17 ? 10.535  -2.405  -8.820  1.00 0.00 ? 17 LEU B HD21 9  
ATOM 6851 H HD22 . LEU B 2 17 ? 10.536  -1.906  -7.133  1.00 0.00 ? 17 LEU B HD22 9  
ATOM 6852 H HD23 . LEU B 2 17 ? 11.977  -2.618  -7.835  1.00 0.00 ? 17 LEU B HD23 9  
ATOM 6853 N N    . VAL B 2 18 ? 8.012   -5.179  -4.453  1.00 0.00 ? 18 VAL B N    9  
ATOM 6854 C CA   . VAL B 2 18 ? 8.431   -5.371  -3.025  1.00 0.00 ? 18 VAL B CA   9  
ATOM 6855 C C    . VAL B 2 18 ? 7.615   -6.464  -2.315  1.00 0.00 ? 18 VAL B C    9  
ATOM 6856 O O    . VAL B 2 18 ? 8.150   -7.252  -1.559  1.00 0.00 ? 18 VAL B O    9  
ATOM 6857 C CB   . VAL B 2 18 ? 8.268   -4.000  -2.309  1.00 0.00 ? 18 VAL B CB   9  
ATOM 6858 C CG1  . VAL B 2 18 ? 8.970   -4.078  -0.940  1.00 0.00 ? 18 VAL B CG1  9  
ATOM 6859 C CG2  . VAL B 2 18 ? 8.960   -2.886  -3.141  1.00 0.00 ? 18 VAL B CG2  9  
ATOM 6860 H H    . VAL B 2 18 ? 7.168   -4.707  -4.626  1.00 0.00 ? 18 VAL B H    9  
ATOM 6861 H HA   . VAL B 2 18 ? 9.469   -5.665  -2.999  1.00 0.00 ? 18 VAL B HA   9  
ATOM 6862 H HB   . VAL B 2 18 ? 7.204   -3.769  -2.212  1.00 0.00 ? 18 VAL B HB   9  
ATOM 6863 H HG11 . VAL B 2 18 ? 10.009  -4.329  -1.095  1.00 0.00 ? 18 VAL B HG11 9  
ATOM 6864 H HG12 . VAL B 2 18 ? 8.920   -3.128  -0.430  1.00 0.00 ? 18 VAL B HG12 9  
ATOM 6865 H HG13 . VAL B 2 18 ? 8.524   -4.839  -0.317  1.00 0.00 ? 18 VAL B HG13 9  
ATOM 6866 H HG21 . VAL B 2 18 ? 10.004  -3.133  -3.281  1.00 0.00 ? 18 VAL B HG21 9  
ATOM 6867 H HG22 . VAL B 2 18 ? 8.501   -2.791  -4.113  1.00 0.00 ? 18 VAL B HG22 9  
ATOM 6868 H HG23 . VAL B 2 18 ? 8.881   -1.936  -2.631  1.00 0.00 ? 18 VAL B HG23 9  
ATOM 6869 N N    . CYS B 2 19 ? 6.341   -6.455  -2.595  1.00 0.00 ? 19 CYS B N    9  
ATOM 6870 C CA   . CYS B 2 19 ? 5.376   -7.431  -2.009  1.00 0.00 ? 19 CYS B CA   9  
ATOM 6871 C C    . CYS B 2 19 ? 4.659   -8.081  -3.228  1.00 0.00 ? 19 CYS B C    9  
ATOM 6872 O O    . CYS B 2 19 ? 3.460   -8.280  -3.196  1.00 0.00 ? 19 CYS B O    9  
ATOM 6873 C CB   . CYS B 2 19 ? 4.401   -6.635  -1.116  1.00 0.00 ? 19 CYS B CB   9  
ATOM 6874 S SG   . CYS B 2 19 ? 5.110   -5.448  0.057   1.00 0.00 ? 19 CYS B SG   9  
ATOM 6875 H H    . CYS B 2 19 ? 6.013   -5.783  -3.221  1.00 0.00 ? 19 CYS B H    9  
ATOM 6876 H HA   . CYS B 2 19 ? 5.874   -8.176  -1.396  1.00 0.00 ? 19 CYS B HA   9  
ATOM 6877 H HB2  . CYS B 2 19 ? 3.751   -6.060  -1.758  1.00 0.00 ? 19 CYS B HB2  9  
ATOM 6878 H HB3  . CYS B 2 19 ? 3.787   -7.339  -0.579  1.00 0.00 ? 19 CYS B HB3  9  
ATOM 6879 N N    . GLY B 2 20 ? 5.405   -8.398  -4.271  1.00 0.00 ? 20 GLY B N    9  
ATOM 6880 C CA   . GLY B 2 20 ? 4.803   -9.020  -5.495  1.00 0.00 ? 20 GLY B CA   9  
ATOM 6881 C C    . GLY B 2 20 ? 5.051   -10.522 -5.642  1.00 0.00 ? 20 GLY B C    9  
ATOM 6882 O O    . GLY B 2 20 ? 4.355   -11.189 -6.383  1.00 0.00 ? 20 GLY B O    9  
ATOM 6883 H H    . GLY B 2 20 ? 6.372   -8.232  -4.284  1.00 0.00 ? 20 GLY B H    9  
ATOM 6884 H HA2  . GLY B 2 20 ? 3.745   -8.826  -5.511  1.00 0.00 ? 20 GLY B HA2  9  
ATOM 6885 H HA3  . GLY B 2 20 ? 5.248   -8.548  -6.348  1.00 0.00 ? 20 GLY B HA3  9  
ATOM 6886 N N    . GLU B 2 21 ? 6.039   -11.004 -4.939  1.00 0.00 ? 21 GLU B N    9  
ATOM 6887 C CA   . GLU B 2 21 ? 6.400   -12.456 -4.978  1.00 0.00 ? 21 GLU B CA   9  
ATOM 6888 C C    . GLU B 2 21 ? 5.975   -12.939 -3.589  1.00 0.00 ? 21 GLU B C    9  
ATOM 6889 O O    . GLU B 2 21 ? 6.658   -13.703 -2.929  1.00 0.00 ? 21 GLU B O    9  
ATOM 6890 C CB   . GLU B 2 21 ? 7.929   -12.609 -5.156  1.00 0.00 ? 21 GLU B CB   9  
ATOM 6891 C CG   . GLU B 2 21 ? 8.447   -11.918 -6.448  1.00 0.00 ? 21 GLU B CG   9  
ATOM 6892 C CD   . GLU B 2 21 ? 8.256   -10.378 -6.418  1.00 0.00 ? 21 GLU B CD   9  
ATOM 6893 O OE1  . GLU B 2 21 ? 8.721   -9.766  -5.470  1.00 0.00 ? 21 GLU B OE1  9  
ATOM 6894 O OE2  . GLU B 2 21 ? 7.639   -9.893  -7.353  1.00 0.00 ? 21 GLU B OE2  9  
ATOM 6895 H H    . GLU B 2 21 ? 6.553   -10.400 -4.365  1.00 0.00 ? 21 GLU B H    9  
ATOM 6896 H HA   . GLU B 2 21 ? 5.837   -12.983 -5.733  1.00 0.00 ? 21 GLU B HA   9  
ATOM 6897 H HB2  . GLU B 2 21 ? 8.420   -12.184 -4.290  1.00 0.00 ? 21 GLU B HB2  9  
ATOM 6898 H HB3  . GLU B 2 21 ? 8.157   -13.665 -5.202  1.00 0.00 ? 21 GLU B HB3  9  
ATOM 6899 H HG2  . GLU B 2 21 ? 9.505   -12.124 -6.565  1.00 0.00 ? 21 GLU B HG2  9  
ATOM 6900 H HG3  . GLU B 2 21 ? 7.926   -12.338 -7.296  1.00 0.00 ? 21 GLU B HG3  9  
ATOM 6901 N N    . ARG B 2 22 ? 4.821   -12.453 -3.200  1.00 0.00 ? 22 ARG B N    9  
ATOM 6902 C CA   . ARG B 2 22 ? 4.265   -12.806 -1.873  1.00 0.00 ? 22 ARG B CA   9  
ATOM 6903 C C    . ARG B 2 22 ? 2.731   -12.851 -1.853  1.00 0.00 ? 22 ARG B C    9  
ATOM 6904 O O    . ARG B 2 22 ? 2.142   -12.055 -1.148  1.00 0.00 ? 22 ARG B O    9  
ATOM 6905 C CB   . ARG B 2 22 ? 4.847   -11.754 -0.930  1.00 0.00 ? 22 ARG B CB   9  
ATOM 6906 C CG   . ARG B 2 22 ? 4.737   -12.196 0.529   1.00 0.00 ? 22 ARG B CG   9  
ATOM 6907 C CD   . ARG B 2 22 ? 3.836   -11.218 1.278   1.00 0.00 ? 22 ARG B CD   9  
ATOM 6908 N NE   . ARG B 2 22 ? 4.028   -11.466 2.729   1.00 0.00 ? 22 ARG B NE   9  
ATOM 6909 C CZ   . ARG B 2 22 ? 3.026   -11.857 3.471   1.00 0.00 ? 22 ARG B CZ   9  
ATOM 6910 N NH1  . ARG B 2 22 ? 2.039   -11.032 3.681   1.00 0.00 ? 22 ARG B NH1  9  
ATOM 6911 N NH2  . ARG B 2 22 ? 3.059   -13.056 3.979   1.00 0.00 ? 22 ARG B NH2  9  
ATOM 6912 H H    . ARG B 2 22 ? 4.321   -11.854 -3.793  1.00 0.00 ? 22 ARG B H    9  
ATOM 6913 H HA   . ARG B 2 22 ? 4.620   -13.789 -1.591  1.00 0.00 ? 22 ARG B HA   9  
ATOM 6914 H HB2  . ARG B 2 22 ? 5.884   -11.584 -1.180  1.00 0.00 ? 22 ARG B HB2  9  
ATOM 6915 H HB3  . ARG B 2 22 ? 4.319   -10.823 -1.096  1.00 0.00 ? 22 ARG B HB3  9  
ATOM 6916 H HG2  . ARG B 2 22 ? 4.345   -13.201 0.595   1.00 0.00 ? 22 ARG B HG2  9  
ATOM 6917 H HG3  . ARG B 2 22 ? 5.724   -12.191 0.962   1.00 0.00 ? 22 ARG B HG3  9  
ATOM 6918 H HD2  . ARG B 2 22 ? 4.128   -10.207 1.037   1.00 0.00 ? 22 ARG B HD2  9  
ATOM 6919 H HD3  . ARG B 2 22 ? 2.796   -11.348 1.030   1.00 0.00 ? 22 ARG B HD3  9  
ATOM 6920 H HE   . ARG B 2 22 ? 4.909   -11.335 3.125   1.00 0.00 ? 22 ARG B HE   9  
ATOM 6921 H HH11 . ARG B 2 22 ? 2.056   -10.123 3.268   1.00 0.00 ? 22 ARG B HH11 9  
ATOM 6922 H HH12 . ARG B 2 22 ? 1.267   -11.311 4.250   1.00 0.00 ? 22 ARG B HH12 9  
ATOM 6923 H HH21 . ARG B 2 22 ? 3.832   -13.660 3.780   1.00 0.00 ? 22 ARG B HH21 9  
ATOM 6924 H HH22 . ARG B 2 22 ? 2.312   -13.373 4.563   1.00 0.00 ? 22 ARG B HH22 9  
ATOM 6925 N N    . GLY B 2 23 ? 2.151   -13.764 -2.602  1.00 0.00 ? 23 GLY B N    9  
ATOM 6926 C CA   . GLY B 2 23 ? 0.651   -13.950 -2.697  1.00 0.00 ? 23 GLY B CA   9  
ATOM 6927 C C    . GLY B 2 23 ? -0.130  -12.748 -2.083  1.00 0.00 ? 23 GLY B C    9  
ATOM 6928 O O    . GLY B 2 23 ? -0.783  -12.922 -1.071  1.00 0.00 ? 23 GLY B O    9  
ATOM 6929 H H    . GLY B 2 23 ? 2.740   -14.349 -3.118  1.00 0.00 ? 23 GLY B H    9  
ATOM 6930 H HA2  . GLY B 2 23 ? 0.350   -14.221 -3.705  1.00 0.00 ? 23 GLY B HA2  9  
ATOM 6931 H HA3  . GLY B 2 23 ? 0.418   -14.812 -2.090  1.00 0.00 ? 23 GLY B HA3  9  
ATOM 6932 N N    . PHE B 2 24 ? -0.052  -11.576 -2.683  1.00 0.00 ? 24 PHE B N    9  
ATOM 6933 C CA   . PHE B 2 24 ? -0.721  -10.373 -2.190  1.00 0.00 ? 24 PHE B CA   9  
ATOM 6934 C C    . PHE B 2 24 ? -1.948  -10.101 -3.107  1.00 0.00 ? 24 PHE B C    9  
ATOM 6935 O O    . PHE B 2 24 ? -1.989  -10.608 -4.213  1.00 0.00 ? 24 PHE B O    9  
ATOM 6936 C CB   . PHE B 2 24 ? 0.276   -9.209  -2.297  1.00 0.00 ? 24 PHE B CB   9  
ATOM 6937 C CG   . PHE B 2 24 ? 0.590   -8.890  -3.790  1.00 0.00 ? 24 PHE B CG   9  
ATOM 6938 C CD1  . PHE B 2 24 ? 1.265   -9.768  -4.635  1.00 0.00 ? 24 PHE B CD1  9  
ATOM 6939 C CD2  . PHE B 2 24 ? 0.160   -7.684  -4.314  1.00 0.00 ? 24 PHE B CD2  9  
ATOM 6940 C CE1  . PHE B 2 24 ? 1.491   -9.442  -5.952  1.00 0.00 ? 24 PHE B CE1  9  
ATOM 6941 C CE2  . PHE B 2 24 ? 0.390   -7.360  -5.632  1.00 0.00 ? 24 PHE B CE2  9  
ATOM 6942 C CZ   . PHE B 2 24 ? 1.054   -8.240  -6.453  1.00 0.00 ? 24 PHE B CZ   9  
ATOM 6943 H H    . PHE B 2 24 ? 0.427   -11.378 -3.491  1.00 0.00 ? 24 PHE B H    9  
ATOM 6944 H HA   . PHE B 2 24 ? -0.918  -10.606 -1.147  1.00 0.00 ? 24 PHE B HA   9  
ATOM 6945 H HB2  . PHE B 2 24 ? -0.179  -8.329  -1.886  1.00 0.00 ? 24 PHE B HB2  9  
ATOM 6946 H HB3  . PHE B 2 24 ? 1.198   -9.435  -1.776  1.00 0.00 ? 24 PHE B HB3  9  
ATOM 6947 H HD1  . PHE B 2 24 ? 1.640   -10.713 -4.282  1.00 0.00 ? 24 PHE B HD1  9  
ATOM 6948 H HD2  . PHE B 2 24 ? -0.357  -6.978  -3.680  1.00 0.00 ? 24 PHE B HD2  9  
ATOM 6949 H HE1  . PHE B 2 24 ? 2.010   -10.138 -6.597  1.00 0.00 ? 24 PHE B HE1  9  
ATOM 6950 H HE2  . PHE B 2 24 ? 0.047   -6.415  -6.020  1.00 0.00 ? 24 PHE B HE2  9  
ATOM 6951 H HZ   . PHE B 2 24 ? 1.230   -7.981  -7.485  1.00 0.00 ? 24 PHE B HZ   9  
ATOM 6952 N N    . PHE B 2 25 ? -2.910  -9.329  -2.670  1.00 0.00 ? 25 PHE B N    9  
ATOM 6953 C CA   . PHE B 2 25 ? -4.080  -9.036  -3.503  1.00 0.00 ? 25 PHE B CA   9  
ATOM 6954 C C    . PHE B 2 25 ? -4.576  -7.688  -2.993  1.00 0.00 ? 25 PHE B C    9  
ATOM 6955 O O    . PHE B 2 25 ? -4.801  -7.562  -1.802  1.00 0.00 ? 25 PHE B O    9  
ATOM 6956 C CB   . PHE B 2 25 ? -5.124  -10.104 -3.279  1.00 0.00 ? 25 PHE B CB   9  
ATOM 6957 C CG   . PHE B 2 25 ? -6.292  -9.757  -4.187  1.00 0.00 ? 25 PHE B CG   9  
ATOM 6958 C CD1  . PHE B 2 25 ? -7.303  -8.923  -3.739  1.00 0.00 ? 25 PHE B CD1  9  
ATOM 6959 C CD2  . PHE B 2 25 ? -6.368  -10.253 -5.478  1.00 0.00 ? 25 PHE B CD2  9  
ATOM 6960 C CE1  . PHE B 2 25 ? -8.361  -8.593  -4.558  1.00 0.00 ? 25 PHE B CE1  9  
ATOM 6961 C CE2  . PHE B 2 25 ? -7.425  -9.923  -6.303  1.00 0.00 ? 25 PHE B CE2  9  
ATOM 6962 C CZ   . PHE B 2 25 ? -8.427  -9.091  -5.845  1.00 0.00 ? 25 PHE B CZ   9  
ATOM 6963 H H    . PHE B 2 25 ? -2.945  -8.904  -1.798  1.00 0.00 ? 25 PHE B H    9  
ATOM 6964 H HA   . PHE B 2 25 ? -3.799  -8.957  -4.545  1.00 0.00 ? 25 PHE B HA   9  
ATOM 6965 H HB2  . PHE B 2 25 ? -4.741  -11.074 -3.551  1.00 0.00 ? 25 PHE B HB2  9  
ATOM 6966 H HB3  . PHE B 2 25 ? -5.447  -10.129 -2.245  1.00 0.00 ? 25 PHE B HB3  9  
ATOM 6967 H HD1  . PHE B 2 25 ? -7.262  -8.525  -2.739  1.00 0.00 ? 25 PHE B HD1  9  
ATOM 6968 H HD2  . PHE B 2 25 ? -5.596  -10.904 -5.853  1.00 0.00 ? 25 PHE B HD2  9  
ATOM 6969 H HE1  . PHE B 2 25 ? -9.137  -7.935  -4.197  1.00 0.00 ? 25 PHE B HE1  9  
ATOM 6970 H HE2  . PHE B 2 25 ? -7.458  -10.320 -7.307  1.00 0.00 ? 25 PHE B HE2  9  
ATOM 6971 H HZ   . PHE B 2 25 ? -9.258  -8.824  -6.483  1.00 0.00 ? 25 PHE B HZ   9  
ATOM 6972 N N    . TYR B 2 26 ? -4.736  -6.729  -3.865  1.00 0.00 ? 26 TYR B N    9  
ATOM 6973 C CA   . TYR B 2 26 ? -5.231  -5.418  -3.380  1.00 0.00 ? 26 TYR B CA   9  
ATOM 6974 C C    . TYR B 2 26 ? -6.654  -5.369  -3.859  1.00 0.00 ? 26 TYR B C    9  
ATOM 6975 O O    . TYR B 2 26 ? -7.606  -5.414  -3.105  1.00 0.00 ? 26 TYR B O    9  
ATOM 6976 C CB   . TYR B 2 26 ? -4.252  -4.255  -3.926  1.00 0.00 ? 26 TYR B CB   9  
ATOM 6977 C CG   . TYR B 2 26 ? -4.051  -4.127  -5.448  1.00 0.00 ? 26 TYR B CG   9  
ATOM 6978 C CD1  . TYR B 2 26 ? -3.361  -5.097  -6.146  1.00 0.00 ? 26 TYR B CD1  9  
ATOM 6979 C CD2  . TYR B 2 26 ? -4.558  -3.044  -6.140  1.00 0.00 ? 26 TYR B CD2  9  
ATOM 6980 C CE1  . TYR B 2 26 ? -3.185  -4.987  -7.508  1.00 0.00 ? 26 TYR B CE1  9  
ATOM 6981 C CE2  . TYR B 2 26 ? -4.379  -2.938  -7.505  1.00 0.00 ? 26 TYR B CE2  9  
ATOM 6982 C CZ   . TYR B 2 26 ? -3.691  -3.910  -8.199  1.00 0.00 ? 26 TYR B CZ   9  
ATOM 6983 O OH   . TYR B 2 26 ? -3.505  -3.813  -9.563  1.00 0.00 ? 26 TYR B OH   9  
ATOM 6984 H H    . TYR B 2 26 ? -4.530  -6.875  -4.812  1.00 0.00 ? 26 TYR B H    9  
ATOM 6985 H HA   . TYR B 2 26 ? -5.292  -5.391  -2.361  1.00 0.00 ? 26 TYR B HA   9  
ATOM 6986 H HB2  . TYR B 2 26 ? -4.585  -3.305  -3.533  1.00 0.00 ? 26 TYR B HB2  9  
ATOM 6987 H HB3  . TYR B 2 26 ? -3.280  -4.444  -3.501  1.00 0.00 ? 26 TYR B HB3  9  
ATOM 6988 H HD1  . TYR B 2 26 ? -2.953  -5.949  -5.624  1.00 0.00 ? 26 TYR B HD1  9  
ATOM 6989 H HD2  . TYR B 2 26 ? -5.091  -2.268  -5.610  1.00 0.00 ? 26 TYR B HD2  9  
ATOM 6990 H HE1  . TYR B 2 26 ? -2.646  -5.752  -8.043  1.00 0.00 ? 26 TYR B HE1  9  
ATOM 6991 H HE2  . TYR B 2 26 ? -4.776  -2.084  -8.038  1.00 0.00 ? 26 TYR B HE2  9  
ATOM 6992 H HH   . TYR B 2 26 ? -2.887  -4.499  -9.817  1.00 0.00 ? 26 TYR B HH   9  
ATOM 6993 N N    . THR B 2 27 ? -6.689  -5.281  -5.128  1.00 0.00 ? 27 THR B N    9  
ATOM 6994 C CA   . THR B 2 27 ? -7.955  -5.227  -5.917  1.00 0.00 ? 27 THR B CA   9  
ATOM 6995 C C    . THR B 2 27 ? -7.763  -5.345  -7.459  1.00 0.00 ? 27 THR B C    9  
ATOM 6996 O O    . THR B 2 27 ? -8.308  -4.539  -8.186  1.00 0.00 ? 27 THR B O    9  
ATOM 6997 C CB   . THR B 2 27 ? -8.694  -3.894  -5.473  1.00 0.00 ? 27 THR B CB   9  
ATOM 6998 O OG1  . THR B 2 27 ? -9.825  -3.725  -6.314  1.00 0.00 ? 27 THR B OG1  9  
ATOM 6999 C CG2  . THR B 2 27 ? -7.832  -2.648  -5.580  1.00 0.00 ? 27 THR B CG2  9  
ATOM 7000 H H    . THR B 2 27 ? -5.775  -5.271  -5.441  1.00 0.00 ? 27 THR B H    9  
ATOM 7001 H HA   . THR B 2 27 ? -8.591  -6.045  -5.615  1.00 0.00 ? 27 THR B HA   9  
ATOM 7002 H HB   . THR B 2 27 ? -9.046  -3.982  -4.459  1.00 0.00 ? 27 THR B HB   9  
ATOM 7003 H HG1  . THR B 2 27 ? -10.611 -3.858  -5.779  1.00 0.00 ? 27 THR B HG1  9  
ATOM 7004 H HG21 . THR B 2 27 ? -7.483  -2.492  -6.588  1.00 0.00 ? 27 THR B HG21 9  
ATOM 7005 H HG22 . THR B 2 27 ? -8.402  -1.791  -5.261  1.00 0.00 ? 27 THR B HG22 9  
ATOM 7006 H HG23 . THR B 2 27 ? -6.988  -2.758  -4.918  1.00 0.00 ? 27 THR B HG23 9  
ATOM 7007 N N    . PRO B 2 28 ? -7.014  -6.307  -7.965  1.00 0.00 ? 28 PRO B N    9  
ATOM 7008 C CA   . PRO B 2 28 ? -7.086  -6.684  -9.414  1.00 0.00 ? 28 PRO B CA   9  
ATOM 7009 C C    . PRO B 2 28 ? -8.192  -7.728  -9.747  1.00 0.00 ? 28 PRO B C    9  
ATOM 7010 O O    . PRO B 2 28 ? -7.869  -8.859  -10.057 1.00 0.00 ? 28 PRO B O    9  
ATOM 7011 C CB   . PRO B 2 28 ? -5.670  -7.180  -9.690  1.00 0.00 ? 28 PRO B CB   9  
ATOM 7012 C CG   . PRO B 2 28 ? -5.387  -7.997  -8.410  1.00 0.00 ? 28 PRO B CG   9  
ATOM 7013 C CD   . PRO B 2 28 ? -5.969  -7.123  -7.264  1.00 0.00 ? 28 PRO B CD   9  
ATOM 7014 H HA   . PRO B 2 28 ? -7.268  -5.798  -10.008 1.00 0.00 ? 28 PRO B HA   9  
ATOM 7015 H HB2  . PRO B 2 28 ? -5.654  -7.819  -10.555 1.00 0.00 ? 28 PRO B HB2  9  
ATOM 7016 H HB3  . PRO B 2 28 ? -4.971  -6.371  -9.834  1.00 0.00 ? 28 PRO B HB3  9  
ATOM 7017 H HG2  . PRO B 2 28 ? -5.910  -8.935  -8.469  1.00 0.00 ? 28 PRO B HG2  9  
ATOM 7018 H HG3  . PRO B 2 28 ? -4.331  -8.177  -8.291  1.00 0.00 ? 28 PRO B HG3  9  
ATOM 7019 H HD2  . PRO B 2 28 ? -6.373  -7.738  -6.482  1.00 0.00 ? 28 PRO B HD2  9  
ATOM 7020 H HD3  . PRO B 2 28 ? -5.208  -6.487  -6.868  1.00 0.00 ? 28 PRO B HD3  9  
ATOM 7021 N N    . LYS B 2 29 ? -9.440  -7.312  -9.674  1.00 0.00 ? 29 LYS B N    9  
ATOM 7022 C CA   . LYS B 2 29 ? -10.650 -8.185  -9.962  1.00 0.00 ? 29 LYS B CA   9  
ATOM 7023 C C    . LYS B 2 29 ? -10.355 -9.640  -10.371 1.00 0.00 ? 29 LYS B C    9  
ATOM 7024 O O    . LYS B 2 29 ? -10.051 -9.930  -11.514 1.00 0.00 ? 29 LYS B O    9  
ATOM 7025 C CB   . LYS B 2 29 ? -11.541 -7.565  -11.103 1.00 0.00 ? 29 LYS B CB   9  
ATOM 7026 C CG   . LYS B 2 29 ? -12.797 -8.483  -11.375 1.00 0.00 ? 29 LYS B CG   9  
ATOM 7027 C CD   . LYS B 2 29 ? -13.679 -7.908  -12.508 1.00 0.00 ? 29 LYS B CD   9  
ATOM 7028 C CE   . LYS B 2 29 ? -14.841 -8.894  -12.825 1.00 0.00 ? 29 LYS B CE   9  
ATOM 7029 N NZ   . LYS B 2 29 ? -15.772 -9.057  -11.666 1.00 0.00 ? 29 LYS B NZ   9  
ATOM 7030 H H    . LYS B 2 29 ? -9.587  -6.379  -9.417  1.00 0.00 ? 29 LYS B H    9  
ATOM 7031 H HA   . LYS B 2 29 ? -11.240 -8.218  -9.052  1.00 0.00 ? 29 LYS B HA   9  
ATOM 7032 H HB2  . LYS B 2 29 ? -11.876 -6.586  -10.807 1.00 0.00 ? 29 LYS B HB2  9  
ATOM 7033 H HB3  . LYS B 2 29 ? -10.962 -7.480  -12.009 1.00 0.00 ? 29 LYS B HB3  9  
ATOM 7034 H HG2  . LYS B 2 29 ? -12.488 -9.479  -11.668 1.00 0.00 ? 29 LYS B HG2  9  
ATOM 7035 H HG3  . LYS B 2 29 ? -13.383 -8.564  -10.469 1.00 0.00 ? 29 LYS B HG3  9  
ATOM 7036 H HD2  . LYS B 2 29 ? -14.073 -6.948  -12.209 1.00 0.00 ? 29 LYS B HD2  9  
ATOM 7037 H HD3  . LYS B 2 29 ? -13.083 -7.767  -13.398 1.00 0.00 ? 29 LYS B HD3  9  
ATOM 7038 H HE2  . LYS B 2 29 ? -15.408 -8.541  -13.675 1.00 0.00 ? 29 LYS B HE2  9  
ATOM 7039 H HE3  . LYS B 2 29 ? -14.434 -9.866  -13.061 1.00 0.00 ? 29 LYS B HE3  9  
ATOM 7040 H HZ1  . LYS B 2 29 ? -15.452 -8.479  -10.864 1.00 0.00 ? 29 LYS B HZ1  9  
ATOM 7041 H HZ2  . LYS B 2 29 ? -16.726 -8.754  -11.948 1.00 0.00 ? 29 LYS B HZ2  9  
ATOM 7042 H HZ3  . LYS B 2 29 ? -15.800 -10.061 -11.387 1.00 0.00 ? 29 LYS B HZ3  9  
ATOM 7043 N N    . THR B 2 30 ? -10.455 -10.506 -9.402  1.00 0.00 ? 30 THR B N    9  
ATOM 7044 C CA   . THR B 2 30 ? -10.207 -11.963 -9.647  1.00 0.00 ? 30 THR B CA   9  
ATOM 7045 C C    . THR B 2 30 ? -11.367 -12.791 -9.087  1.00 0.00 ? 30 THR B C    9  
ATOM 7046 O O    . THR B 2 30 ? -12.361 -12.293 -8.598  1.00 0.00 ? 30 THR B O    9  
ATOM 7047 C CB   . THR B 2 30 ? -8.855  -12.348 -8.975  1.00 0.00 ? 30 THR B CB   9  
ATOM 7048 O OG1  . THR B 2 30 ? -8.540  -13.609 -9.546  1.00 0.00 ? 30 THR B OG1  9  
ATOM 7049 C CG2  . THR B 2 30 ? -8.950  -12.688 -7.481  1.00 0.00 ? 30 THR B CG2  9  
ATOM 7050 H H    . THR B 2 30 ? -10.700 -10.176 -8.513  1.00 0.00 ? 30 THR B H    9  
ATOM 7051 H HA   . THR B 2 30 ? -10.159 -12.149 -10.709 1.00 0.00 ? 30 THR B HA   9  
ATOM 7052 H HB   . THR B 2 30 ? -8.064  -11.642 -9.182  1.00 0.00 ? 30 THR B HB   9  
ATOM 7053 H HG1  . THR B 2 30 ? -7.637  -13.554 -9.869  1.00 0.00 ? 30 THR B HG1  9  
ATOM 7054 H HG21 . THR B 2 30 ? -9.332  -11.852 -6.918  1.00 0.00 ? 30 THR B HG21 9  
ATOM 7055 H HG22 . THR B 2 30 ? -9.590  -13.545 -7.322  1.00 0.00 ? 30 THR B HG22 9  
ATOM 7056 H HG23 . THR B 2 30 ? -7.956  -12.918 -7.129  1.00 0.00 ? 30 THR B HG23 9  
ATOM 7057 N N    . GLY A 1 1  ? -11.067 0.229   0.924   1.00 0.00 ? 1  GLY A N    10 
ATOM 7058 C CA   . GLY A 1 1  ? -10.671 1.285   0.008   1.00 0.00 ? 1  GLY A CA   10 
ATOM 7059 C C    . GLY A 1 1  ? -9.149  1.424   -0.050  1.00 0.00 ? 1  GLY A C    10 
ATOM 7060 O O    . GLY A 1 1  ? -8.559  2.122   0.776   1.00 0.00 ? 1  GLY A O    10 
ATOM 7061 H H1   . GLY A 1 1  ? -10.219 -0.205  1.343   1.00 0.00 ? 1  GLY A H1   10 
ATOM 7062 H H2   . GLY A 1 1  ? -11.660 0.630   1.679   1.00 0.00 ? 1  GLY A H2   10 
ATOM 7063 H H3   . GLY A 1 1  ? -11.607 -0.495  0.407   1.00 0.00 ? 1  GLY A H3   10 
ATOM 7064 H HA2  . GLY A 1 1  ? -11.031 1.037   -0.979  1.00 0.00 ? 1  GLY A HA2  10 
ATOM 7065 H HA3  . GLY A 1 1  ? -11.087 2.217   0.358   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 7066 N N    . ILE A 1 2  ? -8.552  0.752   -1.030  1.00 0.00 ? 2  ILE A N    10 
ATOM 7067 C CA   . ILE A 1 2  ? -7.113  0.805   -1.191  1.00 0.00 ? 2  ILE A CA   10 
ATOM 7068 C C    . ILE A 1 2  ? -6.725  2.033   -2.038  1.00 0.00 ? 2  ILE A C    10 
ATOM 7069 O O    . ILE A 1 2  ? -7.576  2.735   -2.579  1.00 0.00 ? 2  ILE A O    10 
ATOM 7070 C CB   . ILE A 1 2  ? -6.506  -0.486  -1.741  1.00 0.00 ? 2  ILE A CB   10 
ATOM 7071 C CG1  . ILE A 1 2  ? -7.435  -1.696  -1.672  1.00 0.00 ? 2  ILE A CG1  10 
ATOM 7072 C CG2  . ILE A 1 2  ? -5.165  -0.785  -1.051  1.00 0.00 ? 2  ILE A CG2  10 
ATOM 7073 C CD1  . ILE A 1 2  ? -8.277  -1.815  -2.944  1.00 0.00 ? 2  ILE A CD1  10 
ATOM 7074 H H    . ILE A 1 2  ? -9.090  0.216   -1.649  1.00 0.00 ? 2  ILE A H    10 
ATOM 7075 H HA   . ILE A 1 2  ? -6.679  0.994   -0.221  1.00 0.00 ? 2  ILE A HA   10 
ATOM 7076 H HB   . ILE A 1 2  ? -6.254  -0.319  -2.778  1.00 0.00 ? 2  ILE A HB   10 
ATOM 7077 H HG12 . ILE A 1 2  ? -6.836  -2.589  -1.569  1.00 0.00 ? 2  ILE A HG12 10 
ATOM 7078 H HG13 . ILE A 1 2  ? -8.098  -1.577  -0.828  1.00 0.00 ? 2  ILE A HG13 10 
ATOM 7079 H HG21 . ILE A 1 2  ? -4.485  0.037   -1.211  1.00 0.00 ? 2  ILE A HG21 10 
ATOM 7080 H HG22 . ILE A 1 2  ? -5.350  -0.893  0.007   1.00 0.00 ? 2  ILE A HG22 10 
ATOM 7081 H HG23 . ILE A 1 2  ? -4.758  -1.708  -1.436  1.00 0.00 ? 2  ILE A HG23 10 
ATOM 7082 H HD11 . ILE A 1 2  ? -8.862  -0.918  -3.075  1.00 0.00 ? 2  ILE A HD11 10 
ATOM 7083 H HD12 . ILE A 1 2  ? -7.604  -1.926  -3.781  1.00 0.00 ? 2  ILE A HD12 10 
ATOM 7084 H HD13 . ILE A 1 2  ? -8.909  -2.688  -2.878  1.00 0.00 ? 2  ILE A HD13 10 
ATOM 7085 N N    . VAL A 1 3  ? -5.417  2.235   -2.140  1.00 0.00 ? 3  VAL A N    10 
ATOM 7086 C CA   . VAL A 1 3  ? -4.855  3.312   -2.919  1.00 0.00 ? 3  VAL A CA   10 
ATOM 7087 C C    . VAL A 1 3  ? -5.098  3.031   -4.416  1.00 0.00 ? 3  VAL A C    10 
ATOM 7088 O O    . VAL A 1 3  ? -5.946  2.213   -4.752  1.00 0.00 ? 3  VAL A O    10 
ATOM 7089 C CB   . VAL A 1 3  ? -3.340  3.406   -2.644  1.00 0.00 ? 3  VAL A CB   10 
ATOM 7090 C CG1  . VAL A 1 3  ? -2.596  2.788   -1.210  1.00 0.00 ? 3  VAL A CG1  10 
ATOM 7091 C CG2  . VAL A 1 3  ? -2.581  2.240   -3.295  1.00 0.00 ? 3  VAL A CG2  10 
ATOM 7092 H H    . VAL A 1 3  ? -4.809  1.629   -1.668  1.00 0.00 ? 3  VAL A H    10 
ATOM 7093 H HA   . VAL A 1 3  ? -5.328  4.237   -2.628  1.00 0.00 ? 3  VAL A HA   10 
ATOM 7094 H HB   . VAL A 1 3  ? -3.107  4.460   -2.660  1.00 0.00 ? 3  VAL A HB   10 
ATOM 7095 H HG11 . VAL A 1 3  ? -3.029  3.264   -0.343  1.00 0.00 ? 3  VAL A HG11 10 
ATOM 7096 H HG12 . VAL A 1 3  ? -2.789  1.726   -1.165  1.00 0.00 ? 3  VAL A HG12 10 
ATOM 7097 H HG13 . VAL A 1 3  ? -1.530  2.954   -1.255  1.00 0.00 ? 3  VAL A HG13 10 
ATOM 7098 H HG21 . VAL A 1 3  ? -2.957  1.303   -2.912  1.00 0.00 ? 3  VAL A HG21 10 
ATOM 7099 H HG22 . VAL A 1 3  ? -2.753  2.282   -4.360  1.00 0.00 ? 3  VAL A HG22 10 
ATOM 7100 H HG23 . VAL A 1 3  ? -1.523  2.343   -3.102  1.00 0.00 ? 3  VAL A HG23 10 
ATOM 7101 N N    . GLU A 1 4  ? -4.292  3.705   -5.222  1.00 0.00 ? 4  GLU A N    10 
ATOM 7102 C CA   . GLU A 1 4  ? -4.286  3.527   -6.658  1.00 0.00 ? 4  GLU A CA   10 
ATOM 7103 C C    . GLU A 1 4  ? -4.844  4.660   -7.525  1.00 0.00 ? 4  GLU A C    10 
ATOM 7104 O O    . GLU A 1 4  ? -4.395  4.804   -8.670  1.00 0.00 ? 4  GLU A O    10 
ATOM 7105 C CB   . GLU A 1 4  ? -4.848  2.173   -7.132  1.00 0.00 ? 4  GLU A CB   10 
ATOM 7106 C CG   . GLU A 1 4  ? -4.250  0.974   -6.395  1.00 0.00 ? 4  GLU A CG   10 
ATOM 7107 C CD   . GLU A 1 4  ? -5.302  -0.122  -6.195  1.00 0.00 ? 4  GLU A CD   10 
ATOM 7108 O OE1  . GLU A 1 4  ? -6.322  -0.068  -6.916  1.00 0.00 ? 4  GLU A OE1  10 
ATOM 7109 O OE2  . GLU A 1 4  ? -5.061  -0.987  -5.325  1.00 0.00 ? 4  GLU A OE2  10 
ATOM 7110 H H    . GLU A 1 4  ? -3.672  4.353   -4.828  1.00 0.00 ? 4  GLU A H    10 
ATOM 7111 H HA   . GLU A 1 4  ? -3.262  3.600   -6.993  1.00 0.00 ? 4  GLU A HA   10 
ATOM 7112 H HB2  . GLU A 1 4  ? -5.914  2.174   -6.962  1.00 0.00 ? 4  GLU A HB2  10 
ATOM 7113 H HB3  . GLU A 1 4  ? -4.625  2.066   -8.183  1.00 0.00 ? 4  GLU A HB3  10 
ATOM 7114 H HG2  . GLU A 1 4  ? -3.440  0.570   -6.984  1.00 0.00 ? 4  GLU A HG2  10 
ATOM 7115 H HG3  . GLU A 1 4  ? -3.902  1.298   -5.425  1.00 0.00 ? 4  GLU A HG3  10 
ATOM 7116 N N    . GLN A 1 5  ? -5.777  5.431   -6.983  1.00 0.00 ? 5  GLN A N    10 
ATOM 7117 C CA   . GLN A 1 5  ? -6.350  6.528   -7.742  1.00 0.00 ? 5  GLN A CA   10 
ATOM 7118 C C    . GLN A 1 5  ? -5.571  7.835   -7.523  1.00 0.00 ? 5  GLN A C    10 
ATOM 7119 O O    . GLN A 1 5  ? -6.153  8.914   -7.580  1.00 0.00 ? 5  GLN A O    10 
ATOM 7120 C CB   . GLN A 1 5  ? -7.850  6.728   -7.544  1.00 0.00 ? 5  GLN A CB   10 
ATOM 7121 C CG   . GLN A 1 5  ? -8.490  7.310   -8.814  1.00 0.00 ? 5  GLN A CG   10 
ATOM 7122 C CD   . GLN A 1 5  ? -9.341  8.540   -8.496  1.00 0.00 ? 5  GLN A CD   10 
ATOM 7123 O OE1  . GLN A 1 5  ? -9.738  8.788   -7.370  1.00 0.00 ? 5  GLN A OE1  10 
ATOM 7124 N NE2  . GLN A 1 5  ? -9.603  9.301   -9.557  1.00 0.00 ? 5  GLN A NE2  10 
ATOM 7125 H H    . GLN A 1 5  ? -6.080  5.260   -6.067  1.00 0.00 ? 5  GLN A H    10 
ATOM 7126 H HA   . GLN A 1 5  ? -6.177  6.325   -8.789  1.00 0.00 ? 5  GLN A HA   10 
ATOM 7127 H HB2  . GLN A 1 5  ? -8.304  5.771   -7.332  1.00 0.00 ? 5  GLN A HB2  10 
ATOM 7128 H HB3  . GLN A 1 5  ? -8.005  7.418   -6.728  1.00 0.00 ? 5  GLN A HB3  10 
ATOM 7129 H HG2  . GLN A 1 5  ? -7.704  7.606   -9.493  1.00 0.00 ? 5  GLN A HG2  10 
ATOM 7130 H HG3  . GLN A 1 5  ? -9.127  6.560   -9.257  1.00 0.00 ? 5  GLN A HG3  10 
ATOM 7131 H HE21 . GLN A 1 5  ? -9.256  9.049   -10.439 1.00 0.00 ? 5  GLN A HE21 10 
ATOM 7132 H HE22 . GLN A 1 5  ? -10.143 10.113  -9.457  1.00 0.00 ? 5  GLN A HE22 10 
ATOM 7133 N N    . CYS A 1 6  ? -4.267  7.694   -7.327  1.00 0.00 ? 6  CYS A N    10 
ATOM 7134 C CA   . CYS A 1 6  ? -3.375  8.822   -7.174  1.00 0.00 ? 6  CYS A CA   10 
ATOM 7135 C C    . CYS A 1 6  ? -3.265  9.395   -5.764  1.00 0.00 ? 6  CYS A C    10 
ATOM 7136 O O    . CYS A 1 6  ? -3.316  10.617  -5.573  1.00 0.00 ? 6  CYS A O    10 
ATOM 7137 C CB   . CYS A 1 6  ? -3.670  9.945   -8.197  1.00 0.00 ? 6  CYS A CB   10 
ATOM 7138 S SG   . CYS A 1 6  ? -3.867  9.270   -9.878  1.00 0.00 ? 6  CYS A SG   10 
ATOM 7139 H H    . CYS A 1 6  ? -3.893  6.790   -7.284  1.00 0.00 ? 6  CYS A H    10 
ATOM 7140 H HA   . CYS A 1 6  ? -2.363  8.475   -7.327  1.00 0.00 ? 6  CYS A HA   10 
ATOM 7141 H HB2  . CYS A 1 6  ? -4.589  10.439  -7.918  1.00 0.00 ? 6  CYS A HB2  10 
ATOM 7142 H HB3  . CYS A 1 6  ? -2.841  10.638  -8.203  1.00 0.00 ? 6  CYS A HB3  10 
ATOM 7143 N N    . CYS A 1 7  ? -3.053  8.512   -4.800  1.00 0.00 ? 7  CYS A N    10 
ATOM 7144 C CA   . CYS A 1 7  ? -2.884  8.925   -3.416  1.00 0.00 ? 7  CYS A CA   10 
ATOM 7145 C C    . CYS A 1 7  ? -4.228  9.440   -2.899  1.00 0.00 ? 7  CYS A C    10 
ATOM 7146 O O    . CYS A 1 7  ? -4.363  10.614  -2.560  1.00 0.00 ? 7  CYS A O    10 
ATOM 7147 C CB   . CYS A 1 7  ? -1.764  9.956   -3.266  1.00 0.00 ? 7  CYS A CB   10 
ATOM 7148 S SG   . CYS A 1 7  ? -1.391  10.211  -1.492  1.00 0.00 ? 7  CYS A SG   10 
ATOM 7149 H H    . CYS A 1 7  ? -3.009  7.559   -5.024  1.00 0.00 ? 7  CYS A H    10 
ATOM 7150 H HA   . CYS A 1 7  ? -2.631  8.053   -2.831  1.00 0.00 ? 7  CYS A HA   10 
ATOM 7151 H HB2  . CYS A 1 7  ? -0.876  9.590   -3.759  1.00 0.00 ? 7  CYS A HB2  10 
ATOM 7152 H HB3  . CYS A 1 7  ? -2.087  10.895  -3.691  1.00 0.00 ? 7  CYS A HB3  10 
ATOM 7153 N N    . THR A 1 8  ? -5.194  8.529   -2.865  1.00 0.00 ? 8  THR A N    10 
ATOM 7154 C CA   . THR A 1 8  ? -6.531  8.879   -2.431  1.00 0.00 ? 8  THR A CA   10 
ATOM 7155 C C    . THR A 1 8  ? -6.630  9.445   -1.015  1.00 0.00 ? 8  THR A C    10 
ATOM 7156 O O    . THR A 1 8  ? -7.561  10.219  -0.748  1.00 0.00 ? 8  THR A O    10 
ATOM 7157 C CB   . THR A 1 8  ? -7.443  7.654   -2.625  1.00 0.00 ? 8  THR A CB   10 
ATOM 7158 O OG1  . THR A 1 8  ? -6.922  6.694   -1.711  1.00 0.00 ? 8  THR A OG1  10 
ATOM 7159 C CG2  . THR A 1 8  ? -7.303  6.990   -3.992  1.00 0.00 ? 8  THR A CG2  10 
ATOM 7160 H H    . THR A 1 8  ? -5.000  7.608   -3.137  1.00 0.00 ? 8  THR A H    10 
ATOM 7161 H HA   . THR A 1 8  ? -6.895  9.697   -3.034  1.00 0.00 ? 8  THR A HA   10 
ATOM 7162 H HB   . THR A 1 8  ? -8.462  7.896   -2.369  1.00 0.00 ? 8  THR A HB   10 
ATOM 7163 H HG1  . THR A 1 8  ? -7.618  6.467   -1.090  1.00 0.00 ? 8  THR A HG1  10 
ATOM 7164 H HG21 . THR A 1 8  ? -7.534  7.705   -4.768  1.00 0.00 ? 8  THR A HG21 10 
ATOM 7165 H HG22 . THR A 1 8  ? -6.279  6.665   -4.102  1.00 0.00 ? 8  THR A HG22 10 
ATOM 7166 H HG23 . THR A 1 8  ? -7.956  6.131   -4.046  1.00 0.00 ? 8  THR A HG23 10 
ATOM 7167 N N    . SER A 1 9  ? -5.722  9.042   -0.132  1.00 0.00 ? 9  SER A N    10 
ATOM 7168 C CA   . SER A 1 9  ? -5.779  9.490   1.248   1.00 0.00 ? 9  SER A CA   10 
ATOM 7169 C C    . SER A 1 9  ? -4.478  10.026  1.844   1.00 0.00 ? 9  SER A C    10 
ATOM 7170 O O    . SER A 1 9  ? -4.328  11.236  2.069   1.00 0.00 ? 9  SER A O    10 
ATOM 7171 C CB   . SER A 1 9  ? -6.392  8.376   2.132   1.00 0.00 ? 9  SER A CB   10 
ATOM 7172 O OG   . SER A 1 9  ? -5.713  7.133   2.037   1.00 0.00 ? 9  SER A OG   10 
ATOM 7173 H H    . SER A 1 9  ? -5.006  8.436   -0.416  1.00 0.00 ? 9  SER A H    10 
ATOM 7174 H HA   . SER A 1 9  ? -6.402  10.369  1.302   1.00 0.00 ? 9  SER A HA   10 
ATOM 7175 H HB2  . SER A 1 9  ? -6.348  8.699   3.162   1.00 0.00 ? 9  SER A HB2  10 
ATOM 7176 H HB3  . SER A 1 9  ? -7.413  8.219   1.818   1.00 0.00 ? 9  SER A HB3  10 
ATOM 7177 H HG   . SER A 1 9  ? -5.392  6.903   2.912   1.00 0.00 ? 9  SER A HG   10 
ATOM 7178 N N    . ILE A 1 10 ? -3.563  9.110   2.147   1.00 0.00 ? 10 ILE A N    10 
ATOM 7179 C CA   . ILE A 1 10 ? -2.312  9.478   2.786   1.00 0.00 ? 10 ILE A CA   10 
ATOM 7180 C C    . ILE A 1 10 ? -1.077  8.864   2.133   1.00 0.00 ? 10 ILE A C    10 
ATOM 7181 O O    . ILE A 1 10 ? 0.041   9.318   2.388   1.00 0.00 ? 10 ILE A O    10 
ATOM 7182 C CB   . ILE A 1 10 ? -2.416  9.179   4.295   1.00 0.00 ? 10 ILE A CB   10 
ATOM 7183 C CG1  . ILE A 1 10 ? -3.498  10.050  4.938   1.00 0.00 ? 10 ILE A CG1  10 
ATOM 7184 C CG2  . ILE A 1 10 ? -1.081  9.301   5.025   1.00 0.00 ? 10 ILE A CG2  10 
ATOM 7185 C CD1  . ILE A 1 10 ? -4.737  9.221   5.285   1.00 0.00 ? 10 ILE A CD1  10 
ATOM 7186 H H    . ILE A 1 10 ? -3.737  8.168   1.937   1.00 0.00 ? 10 ILE A H    10 
ATOM 7187 H HA   . ILE A 1 10 ? -2.141  10.534  2.641   1.00 0.00 ? 10 ILE A HA   10 
ATOM 7188 H HB   . ILE A 1 10 ? -2.677  8.140   4.428   1.00 0.00 ? 10 ILE A HB   10 
ATOM 7189 H HG12 . ILE A 1 10 ? -3.103  10.479  5.846   1.00 0.00 ? 10 ILE A HG12 10 
ATOM 7190 H HG13 . ILE A 1 10 ? -3.783  10.822  4.239   1.00 0.00 ? 10 ILE A HG13 10 
ATOM 7191 H HG21 . ILE A 1 10 ? -0.367  8.618   4.591   1.00 0.00 ? 10 ILE A HG21 10 
ATOM 7192 H HG22 . ILE A 1 10 ? -0.724  10.312  4.902   1.00 0.00 ? 10 ILE A HG22 10 
ATOM 7193 H HG23 . ILE A 1 10 ? -1.225  9.100   6.076   1.00 0.00 ? 10 ILE A HG23 10 
ATOM 7194 H HD11 . ILE A 1 10 ? -5.128  8.762   4.389   1.00 0.00 ? 10 ILE A HD11 10 
ATOM 7195 H HD12 . ILE A 1 10 ? -4.439  8.448   5.978   1.00 0.00 ? 10 ILE A HD12 10 
ATOM 7196 H HD13 . ILE A 1 10 ? -5.475  9.853   5.755   1.00 0.00 ? 10 ILE A HD13 10 
ATOM 7197 N N    . CYS A 1 11 ? -1.294  7.855   1.303   1.00 0.00 ? 11 CYS A N    10 
ATOM 7198 C CA   . CYS A 1 11 ? -0.223  7.162   0.615   1.00 0.00 ? 11 CYS A CA   10 
ATOM 7199 C C    . CYS A 1 11 ? 0.961   6.947   1.569   1.00 0.00 ? 11 CYS A C    10 
ATOM 7200 O O    . CYS A 1 11 ? 1.978   7.632   1.472   1.00 0.00 ? 11 CYS A O    10 
ATOM 7201 C CB   . CYS A 1 11 ? 0.233   7.800   -0.700  1.00 0.00 ? 11 CYS A CB   10 
ATOM 7202 S SG   . CYS A 1 11 ? 0.155   9.625   -0.666  1.00 0.00 ? 11 CYS A SG   10 
ATOM 7203 H H    . CYS A 1 11 ? -2.218  7.566   1.146   1.00 0.00 ? 11 CYS A H    10 
ATOM 7204 H HA   . CYS A 1 11 ? -0.573  6.165   0.394   1.00 0.00 ? 11 CYS A HA   10 
ATOM 7205 H HB2  . CYS A 1 11 ? 1.258   7.512   -0.881  1.00 0.00 ? 11 CYS A HB2  10 
ATOM 7206 H HB3  . CYS A 1 11 ? -0.414  7.451   -1.491  1.00 0.00 ? 11 CYS A HB3  10 
ATOM 7207 N N    . SER A 1 12 ? 0.791   5.978   2.456   1.00 0.00 ? 12 SER A N    10 
ATOM 7208 C CA   . SER A 1 12 ? 1.837   5.628   3.407   1.00 0.00 ? 12 SER A CA   10 
ATOM 7209 C C    . SER A 1 12 ? 2.544   4.365   2.898   1.00 0.00 ? 12 SER A C    10 
ATOM 7210 O O    . SER A 1 12 ? 1.900   3.340   2.683   1.00 0.00 ? 12 SER A O    10 
ATOM 7211 C CB   . SER A 1 12 ? 1.275   5.440   4.816   1.00 0.00 ? 12 SER A CB   10 
ATOM 7212 O OG   . SER A 1 12 ? 0.006   4.787   4.804   1.00 0.00 ? 12 SER A OG   10 
ATOM 7213 H H    . SER A 1 12 ? -0.056  5.486   2.472   1.00 0.00 ? 12 SER A H    10 
ATOM 7214 H HA   . SER A 1 12 ? 2.561   6.430   3.427   1.00 0.00 ? 12 SER A HA   10 
ATOM 7215 H HB2  . SER A 1 12 ? 1.963   4.830   5.382   1.00 0.00 ? 12 SER A HB2  10 
ATOM 7216 H HB3  . SER A 1 12 ? 1.151   6.412   5.269   1.00 0.00 ? 12 SER A HB3  10 
ATOM 7217 H HG   . SER A 1 12 ? 0.086   3.973   5.307   1.00 0.00 ? 12 SER A HG   10 
ATOM 7218 N N    . LEU A 1 13 ? 3.844   4.500   2.667   1.00 0.00 ? 13 LEU A N    10 
ATOM 7219 C CA   . LEU A 1 13 ? 4.618   3.410   2.103   1.00 0.00 ? 13 LEU A CA   10 
ATOM 7220 C C    . LEU A 1 13 ? 4.685   2.156   2.978   1.00 0.00 ? 13 LEU A C    10 
ATOM 7221 O O    . LEU A 1 13 ? 4.693   1.042   2.442   1.00 0.00 ? 13 LEU A O    10 
ATOM 7222 C CB   . LEU A 1 13 ? 6.010   3.889   1.651   1.00 0.00 ? 13 LEU A CB   10 
ATOM 7223 C CG   . LEU A 1 13 ? 6.108   5.334   1.168   1.00 0.00 ? 13 LEU A CG   10 
ATOM 7224 C CD1  . LEU A 1 13 ? 6.678   6.253   2.251   1.00 0.00 ? 13 LEU A CD1  10 
ATOM 7225 C CD2  . LEU A 1 13 ? 6.909   5.420   -0.137  1.00 0.00 ? 13 LEU A CD2  10 
ATOM 7226 H H    . LEU A 1 13 ? 4.287   5.348   2.881   1.00 0.00 ? 13 LEU A H    10 
ATOM 7227 H HA   . LEU A 1 13 ? 4.087   3.024   1.246   1.00 0.00 ? 13 LEU A HA   10 
ATOM 7228 H HB2  . LEU A 1 13 ? 6.676   3.785   2.495   1.00 0.00 ? 13 LEU A HB2  10 
ATOM 7229 H HB3  . LEU A 1 13 ? 6.320   3.255   0.834   1.00 0.00 ? 13 LEU A HB3  10 
ATOM 7230 H HG   . LEU A 1 13 ? 5.118   5.678   0.910   1.00 0.00 ? 13 LEU A HG   10 
ATOM 7231 H HD11 . LEU A 1 13 ? 6.048   6.212   3.127   1.00 0.00 ? 13 LEU A HD11 10 
ATOM 7232 H HD12 . LEU A 1 13 ? 7.665   5.897   2.505   1.00 0.00 ? 13 LEU A HD12 10 
ATOM 7233 H HD13 . LEU A 1 13 ? 6.752   7.259   1.869   1.00 0.00 ? 13 LEU A HD13 10 
ATOM 7234 H HD21 . LEU A 1 13 ? 7.900   5.021   0.019   1.00 0.00 ? 13 LEU A HD21 10 
ATOM 7235 H HD22 . LEU A 1 13 ? 6.400   4.824   -0.880  1.00 0.00 ? 13 LEU A HD22 10 
ATOM 7236 H HD23 . LEU A 1 13 ? 6.949   6.445   -0.470  1.00 0.00 ? 13 LEU A HD23 10 
ATOM 7237 N N    . TYR A 1 14 ? 4.739   2.369   4.288   1.00 0.00 ? 14 TYR A N    10 
ATOM 7238 C CA   . TYR A 1 14 ? 4.800   1.234   5.193   1.00 0.00 ? 14 TYR A CA   10 
ATOM 7239 C C    . TYR A 1 14 ? 3.485   0.448   5.130   1.00 0.00 ? 14 TYR A C    10 
ATOM 7240 O O    . TYR A 1 14 ? 3.455   -0.759  5.365   1.00 0.00 ? 14 TYR A O    10 
ATOM 7241 C CB   . TYR A 1 14 ? 5.056   1.739   6.609   1.00 0.00 ? 14 TYR A CB   10 
ATOM 7242 C CG   . TYR A 1 14 ? 5.055   0.614   7.655   1.00 0.00 ? 14 TYR A CG   10 
ATOM 7243 C CD1  . TYR A 1 14 ? 6.114   -0.269  7.711   1.00 0.00 ? 14 TYR A CD1  10 
ATOM 7244 C CD2  . TYR A 1 14 ? 3.989   0.471   8.518   1.00 0.00 ? 14 TYR A CD2  10 
ATOM 7245 C CE1  . TYR A 1 14 ? 6.102   -1.345  8.667   1.00 0.00 ? 14 TYR A CE1  10 
ATOM 7246 C CE2  . TYR A 1 14 ? 3.977   -0.607  9.474   1.00 0.00 ? 14 TYR A CE2  10 
ATOM 7247 C CZ   . TYR A 1 14 ? 5.035   -1.461  9.502   1.00 0.00 ? 14 TYR A CZ   10 
ATOM 7248 O OH   . TYR A 1 14 ? 5.022   -2.482  10.400  1.00 0.00 ? 14 TYR A OH   10 
ATOM 7249 H H    . TYR A 1 14 ? 4.739   3.284   4.641   1.00 0.00 ? 14 TYR A H    10 
ATOM 7250 H HA   . TYR A 1 14 ? 5.610   0.587   4.892   1.00 0.00 ? 14 TYR A HA   10 
ATOM 7251 H HB2  . TYR A 1 14 ? 6.026   2.214   6.631   1.00 0.00 ? 14 TYR A HB2  10 
ATOM 7252 H HB3  . TYR A 1 14 ? 4.274   2.437   6.869   1.00 0.00 ? 14 TYR A HB3  10 
ATOM 7253 H HD1  . TYR A 1 14 ? 6.951   -0.153  7.038   1.00 0.00 ? 14 TYR A HD1  10 
ATOM 7254 H HD2  . TYR A 1 14 ? 3.163   1.165   8.478   1.00 0.00 ? 14 TYR A HD2  10 
ATOM 7255 H HE1  . TYR A 1 14 ? 6.923   -2.045  8.721   1.00 0.00 ? 14 TYR A HE1  10 
ATOM 7256 H HE2  . TYR A 1 14 ? 3.148   -0.733  10.154  1.00 0.00 ? 14 TYR A HE2  10 
ATOM 7257 H HH   . TYR A 1 14 ? 4.208   -2.421  10.906  1.00 0.00 ? 14 TYR A HH   10 
ATOM 7258 N N    . GLN A 1 15 ? 2.428   1.169   4.783   1.00 0.00 ? 15 GLN A N    10 
ATOM 7259 C CA   . GLN A 1 15 ? 1.112   0.565   4.677   1.00 0.00 ? 15 GLN A CA   10 
ATOM 7260 C C    . GLN A 1 15 ? 0.981   -0.324  3.443   1.00 0.00 ? 15 GLN A C    10 
ATOM 7261 O O    . GLN A 1 15 ? 0.244   -1.315  3.482   1.00 0.00 ? 15 GLN A O    10 
ATOM 7262 C CB   . GLN A 1 15 ? 0.024   1.649   4.688   1.00 0.00 ? 15 GLN A CB   10 
ATOM 7263 C CG   . GLN A 1 15 ? -0.627  1.745   6.067   1.00 0.00 ? 15 GLN A CG   10 
ATOM 7264 C CD   . GLN A 1 15 ? -1.857  2.655   6.048   1.00 0.00 ? 15 GLN A CD   10 
ATOM 7265 O OE1  . GLN A 1 15 ? -2.223  3.230   5.038   1.00 0.00 ? 15 GLN A OE1  10 
ATOM 7266 N NE2  . GLN A 1 15 ? -2.471  2.750   7.226   1.00 0.00 ? 15 GLN A NE2  10 
ATOM 7267 H H    . GLN A 1 15 ? 2.537   2.125   4.596   1.00 0.00 ? 15 GLN A H    10 
ATOM 7268 H HA   . GLN A 1 15 ? 0.963   -0.090  5.522   1.00 0.00 ? 15 GLN A HA   10 
ATOM 7269 H HB2  . GLN A 1 15 ? 0.477   2.600   4.450   1.00 0.00 ? 15 GLN A HB2  10 
ATOM 7270 H HB3  . GLN A 1 15 ? -0.733  1.390   3.962   1.00 0.00 ? 15 GLN A HB3  10 
ATOM 7271 H HG2  . GLN A 1 15 ? -0.941  0.758   6.372   1.00 0.00 ? 15 GLN A HG2  10 
ATOM 7272 H HG3  . GLN A 1 15 ? 0.090   2.157   6.761   1.00 0.00 ? 15 GLN A HG3  10 
ATOM 7273 H HE21 . GLN A 1 15 ? -2.123  2.260   8.000   1.00 0.00 ? 15 GLN A HE21 10 
ATOM 7274 H HE22 . GLN A 1 15 ? -3.270  3.309   7.318   1.00 0.00 ? 15 GLN A HE22 10 
ATOM 7275 N N    . LEU A 1 16 ? 1.682   0.057   2.384   1.00 0.00 ? 16 LEU A N    10 
ATOM 7276 C CA   . LEU A 1 16 ? 1.599   -0.720  1.145   1.00 0.00 ? 16 LEU A CA   10 
ATOM 7277 C C    . LEU A 1 16 ? 2.424   -1.998  1.292   1.00 0.00 ? 16 LEU A C    10 
ATOM 7278 O O    . LEU A 1 16 ? 2.192   -2.965  0.561   1.00 0.00 ? 16 LEU A O    10 
ATOM 7279 C CB   . LEU A 1 16 ? 1.853   0.148   -0.084  1.00 0.00 ? 16 LEU A CB   10 
ATOM 7280 C CG   . LEU A 1 16 ? 2.979   -0.241  -1.044  1.00 0.00 ? 16 LEU A CG   10 
ATOM 7281 C CD1  . LEU A 1 16 ? 2.695   0.320   -2.447  1.00 0.00 ? 16 LEU A CD1  10 
ATOM 7282 C CD2  . LEU A 1 16 ? 4.351   0.198   -0.538  1.00 0.00 ? 16 LEU A CD2  10 
ATOM 7283 H H    . LEU A 1 16 ? 2.251   0.853   2.430   1.00 0.00 ? 16 LEU A H    10 
ATOM 7284 H HA   . LEU A 1 16 ? 0.606   -1.139  1.073   1.00 0.00 ? 16 LEU A HA   10 
ATOM 7285 H HB2  . LEU A 1 16 ? 0.940   0.149   -0.660  1.00 0.00 ? 16 LEU A HB2  10 
ATOM 7286 H HB3  . LEU A 1 16 ? 2.081   1.139   0.278   1.00 0.00 ? 16 LEU A HB3  10 
ATOM 7287 H HG   . LEU A 1 16 ? 3.034   -1.318  -1.102  1.00 0.00 ? 16 LEU A HG   10 
ATOM 7288 H HD11 . LEU A 1 16 ? 1.753   -0.066  -2.806  1.00 0.00 ? 16 LEU A HD11 10 
ATOM 7289 H HD12 . LEU A 1 16 ? 2.633   1.395   -2.370  1.00 0.00 ? 16 LEU A HD12 10 
ATOM 7290 H HD13 . LEU A 1 16 ? 3.503   0.057   -3.112  1.00 0.00 ? 16 LEU A HD13 10 
ATOM 7291 H HD21 . LEU A 1 16 ? 4.361   1.268   -0.404  1.00 0.00 ? 16 LEU A HD21 10 
ATOM 7292 H HD22 . LEU A 1 16 ? 4.524   -0.281  0.414   1.00 0.00 ? 16 LEU A HD22 10 
ATOM 7293 H HD23 . LEU A 1 16 ? 5.111   -0.116  -1.237  1.00 0.00 ? 16 LEU A HD23 10 
ATOM 7294 N N    . GLU A 1 17 ? 3.337   -1.981  2.253   1.00 0.00 ? 17 GLU A N    10 
ATOM 7295 C CA   . GLU A 1 17 ? 4.169   -3.153  2.492   1.00 0.00 ? 17 GLU A CA   10 
ATOM 7296 C C    . GLU A 1 17 ? 3.365   -4.254  3.189   1.00 0.00 ? 17 GLU A C    10 
ATOM 7297 O O    . GLU A 1 17 ? 3.773   -5.416  3.199   1.00 0.00 ? 17 GLU A O    10 
ATOM 7298 C CB   . GLU A 1 17 ? 5.423   -2.791  3.290   1.00 0.00 ? 17 GLU A CB   10 
ATOM 7299 C CG   . GLU A 1 17 ? 6.688   -3.052  2.469   1.00 0.00 ? 17 GLU A CG   10 
ATOM 7300 C CD   . GLU A 1 17 ? 7.377   -1.742  2.084   1.00 0.00 ? 17 GLU A CD   10 
ATOM 7301 O OE1  . GLU A 1 17 ? 6.647   -0.735  1.948   1.00 0.00 ? 17 GLU A OE1  10 
ATOM 7302 O OE2  . GLU A 1 17 ? 8.618   -1.773  1.935   1.00 0.00 ? 17 GLU A OE2  10 
ATOM 7303 H H    . GLU A 1 17 ? 3.452   -1.180  2.804   1.00 0.00 ? 17 GLU A H    10 
ATOM 7304 H HA   . GLU A 1 17 ? 4.470   -3.559  1.538   1.00 0.00 ? 17 GLU A HA   10 
ATOM 7305 H HB2  . GLU A 1 17 ? 5.383   -1.742  3.541   1.00 0.00 ? 17 GLU A HB2  10 
ATOM 7306 H HB3  . GLU A 1 17 ? 5.454   -3.400  4.181   1.00 0.00 ? 17 GLU A HB3  10 
ATOM 7307 H HG2  . GLU A 1 17 ? 7.374   -3.638  3.062   1.00 0.00 ? 17 GLU A HG2  10 
ATOM 7308 H HG3  . GLU A 1 17 ? 6.415   -3.573  1.563   1.00 0.00 ? 17 GLU A HG3  10 
ATOM 7309 N N    . ASN A 1 18 ? 2.236   -3.852  3.761   1.00 0.00 ? 18 ASN A N    10 
ATOM 7310 C CA   . ASN A 1 18 ? 1.388   -4.787  4.477   1.00 0.00 ? 18 ASN A CA   10 
ATOM 7311 C C    . ASN A 1 18 ? 0.549   -5.646  3.530   1.00 0.00 ? 18 ASN A C    10 
ATOM 7312 O O    . ASN A 1 18 ? 0.027   -6.681  3.953   1.00 0.00 ? 18 ASN A O    10 
ATOM 7313 C CB   . ASN A 1 18 ? 0.431   -4.077  5.437   1.00 0.00 ? 18 ASN A CB   10 
ATOM 7314 C CG   . ASN A 1 18 ? -1.027  -4.291  5.021   1.00 0.00 ? 18 ASN A CG   10 
ATOM 7315 O OD1  . ASN A 1 18 ? -1.742  -5.115  5.567   1.00 0.00 ? 18 ASN A OD1  10 
ATOM 7316 N ND2  . ASN A 1 18 ? -1.426  -3.502  4.027   1.00 0.00 ? 18 ASN A ND2  10 
ATOM 7317 H H    . ASN A 1 18 ? 1.972   -2.910  3.698   1.00 0.00 ? 18 ASN A H    10 
ATOM 7318 H HA   . ASN A 1 18 ? 2.022   -5.447  5.050   1.00 0.00 ? 18 ASN A HA   10 
ATOM 7319 H HB2  . ASN A 1 18 ? 0.567   -4.482  6.429   1.00 0.00 ? 18 ASN A HB2  10 
ATOM 7320 H HB3  . ASN A 1 18 ? 0.639   -3.017  5.418   1.00 0.00 ? 18 ASN A HB3  10 
ATOM 7321 H HD21 . ASN A 1 18 ? -0.802  -2.860  3.630   1.00 0.00 ? 18 ASN A HD21 10 
ATOM 7322 H HD22 . ASN A 1 18 ? -2.344  -3.564  3.691   1.00 0.00 ? 18 ASN A HD22 10 
ATOM 7323 N N    . TYR A 1 19 ? 0.459   -5.208  2.278   1.00 0.00 ? 19 TYR A N    10 
ATOM 7324 C CA   . TYR A 1 19 ? -0.279  -5.978  1.293   1.00 0.00 ? 19 TYR A CA   10 
ATOM 7325 C C    . TYR A 1 19 ? 0.511   -7.244  0.917   1.00 0.00 ? 19 TYR A C    10 
ATOM 7326 O O    . TYR A 1 19 ? -0.054  -8.207  0.397   1.00 0.00 ? 19 TYR A O    10 
ATOM 7327 C CB   . TYR A 1 19 ? -0.441  -5.122  0.040   1.00 0.00 ? 19 TYR A CB   10 
ATOM 7328 C CG   . TYR A 1 19 ? -1.051  -3.727  0.224   1.00 0.00 ? 19 TYR A CG   10 
ATOM 7329 C CD1  . TYR A 1 19 ? -2.013  -3.495  1.184   1.00 0.00 ? 19 TYR A CD1  10 
ATOM 7330 C CD2  . TYR A 1 19 ? -0.615  -2.690  -0.582  1.00 0.00 ? 19 TYR A CD2  10 
ATOM 7331 C CE1  . TYR A 1 19 ? -2.564  -2.173  1.346   1.00 0.00 ? 19 TYR A CE1  10 
ATOM 7332 C CE2  . TYR A 1 19 ? -1.170  -1.371  -0.423  1.00 0.00 ? 19 TYR A CE2  10 
ATOM 7333 C CZ   . TYR A 1 19 ? -2.110  -1.176  0.540   1.00 0.00 ? 19 TYR A CZ   10 
ATOM 7334 O OH   . TYR A 1 19 ? -2.579  0.084   0.741   1.00 0.00 ? 19 TYR A OH   10 
ATOM 7335 H H    . TYR A 1 19 ? 0.890   -4.366  2.020   1.00 0.00 ? 19 TYR A H    10 
ATOM 7336 H HA   . TYR A 1 19 ? -1.253  -6.222  1.691   1.00 0.00 ? 19 TYR A HA   10 
ATOM 7337 H HB2  . TYR A 1 19 ? 0.542   -4.983  -0.385  1.00 0.00 ? 19 TYR A HB2  10 
ATOM 7338 H HB3  . TYR A 1 19 ? -1.086  -5.661  -0.638  1.00 0.00 ? 19 TYR A HB3  10 
ATOM 7339 H HD1  . TYR A 1 19 ? -2.353  -4.304  1.813   1.00 0.00 ? 19 TYR A HD1  10 
ATOM 7340 H HD2  . TYR A 1 19 ? 0.141   -2.871  -1.332  1.00 0.00 ? 19 TYR A HD2  10 
ATOM 7341 H HE1  . TYR A 1 19 ? -3.320  -1.978  2.092   1.00 0.00 ? 19 TYR A HE1  10 
ATOM 7342 H HE2  . TYR A 1 19 ? -0.847  -0.556  -1.054  1.00 0.00 ? 19 TYR A HE2  10 
ATOM 7343 H HH   . TYR A 1 19 ? -3.228  0.050   1.447   1.00 0.00 ? 19 TYR A HH   10 
ATOM 7344 N N    . CYS A 1 20 ? 1.808   -7.201  1.187   1.00 0.00 ? 20 CYS A N    10 
ATOM 7345 C CA   . CYS A 1 20 ? 2.702   -8.298  0.872   1.00 0.00 ? 20 CYS A CA   10 
ATOM 7346 C C    . CYS A 1 20 ? 2.674   -9.384  1.944   1.00 0.00 ? 20 CYS A C    10 
ATOM 7347 O O    . CYS A 1 20 ? 3.402   -10.373 1.830   1.00 0.00 ? 20 CYS A O    10 
ATOM 7348 C CB   . CYS A 1 20 ? 4.137   -7.764  0.677   1.00 0.00 ? 20 CYS A CB   10 
ATOM 7349 S SG   . CYS A 1 20 ? 4.077   -6.279  -0.387  1.00 0.00 ? 20 CYS A SG   10 
ATOM 7350 H H    . CYS A 1 20 ? 2.176   -6.400  1.615   1.00 0.00 ? 20 CYS A H    10 
ATOM 7351 H HA   . CYS A 1 20 ? 2.371   -8.764  -0.044  1.00 0.00 ? 20 CYS A HA   10 
ATOM 7352 H HB2  . CYS A 1 20 ? 4.551   -7.492  1.635   1.00 0.00 ? 20 CYS A HB2  10 
ATOM 7353 H HB3  . CYS A 1 20 ? 4.737   -8.519  0.192   1.00 0.00 ? 20 CYS A HB3  10 
ATOM 7354 N N    . ASN A 1 21 ? 1.852   -9.177  2.962   1.00 0.00 ? 21 ASN A N    10 
ATOM 7355 C CA   . ASN A 1 21 ? 1.745   -10.128 4.053   1.00 0.00 ? 21 ASN A CA   10 
ATOM 7356 C C    . ASN A 1 21 ? 1.569   -11.546 3.506   1.00 0.00 ? 21 ASN A C    10 
ATOM 7357 O O    . ASN A 1 21 ? 1.329   -12.482 4.270   1.00 0.00 ? 21 ASN A O    10 
ATOM 7358 C CB   . ASN A 1 21 ? 0.544   -9.822  4.952   1.00 0.00 ? 21 ASN A CB   10 
ATOM 7359 C CG   . ASN A 1 21 ? -0.718  -9.535  4.136   1.00 0.00 ? 21 ASN A CG   10 
ATOM 7360 O OD1  . ASN A 1 21 ? -1.574  -8.756  4.526   1.00 0.00 ? 21 ASN A OD1  10 
ATOM 7361 N ND2  . ASN A 1 21 ? -0.796  -10.205 2.991   1.00 0.00 ? 21 ASN A ND2  10 
ATOM 7362 H H    . ASN A 1 21 ? 1.304   -8.364  2.978   1.00 0.00 ? 21 ASN A H    10 
ATOM 7363 H HA   . ASN A 1 21 ? 2.645   -10.068 4.646   1.00 0.00 ? 21 ASN A HA   10 
ATOM 7364 H HB2  . ASN A 1 21 ? 0.354   -10.679 5.580   1.00 0.00 ? 21 ASN A HB2  10 
ATOM 7365 H HB3  . ASN A 1 21 ? 0.771   -8.948  5.545   1.00 0.00 ? 21 ASN A HB3  10 
ATOM 7366 H HD21 . ASN A 1 21 ? -0.076  -10.817 2.731   1.00 0.00 ? 21 ASN A HD21 10 
ATOM 7367 H HD22 . ASN A 1 21 ? -1.573  -10.087 2.406   1.00 0.00 ? 21 ASN A HD22 10 
ATOM 7368 N N    . PHE B 2 1  ? 7.368   10.668  2.340   1.00 0.00 ? 1  PHE B N    10 
ATOM 7369 C CA   . PHE B 2 1  ? 6.302   11.496  1.800   1.00 0.00 ? 1  PHE B CA   10 
ATOM 7370 C C    . PHE B 2 1  ? 6.869   12.754  1.140   1.00 0.00 ? 1  PHE B C    10 
ATOM 7371 O O    . PHE B 2 1  ? 7.342   13.659  1.829   1.00 0.00 ? 1  PHE B O    10 
ATOM 7372 C CB   . PHE B 2 1  ? 5.420   11.912  2.981   1.00 0.00 ? 1  PHE B CB   10 
ATOM 7373 C CG   . PHE B 2 1  ? 4.323   12.912  2.608   1.00 0.00 ? 1  PHE B CG   10 
ATOM 7374 C CD1  . PHE B 2 1  ? 4.581   14.246  2.639   1.00 0.00 ? 1  PHE B CD1  10 
ATOM 7375 C CD2  . PHE B 2 1  ? 3.094   12.464  2.236   1.00 0.00 ? 1  PHE B CD2  10 
ATOM 7376 C CE1  . PHE B 2 1  ? 3.566   15.174  2.281   1.00 0.00 ? 1  PHE B CE1  10 
ATOM 7377 C CE2  . PHE B 2 1  ? 2.079   13.391  1.879   1.00 0.00 ? 1  PHE B CE2  10 
ATOM 7378 C CZ   . PHE B 2 1  ? 2.338   14.726  1.908   1.00 0.00 ? 1  PHE B CZ   10 
ATOM 7379 H H1   . PHE B 2 1  ? 8.286   11.120  2.155   1.00 0.00 ? 1  PHE B H1   10 
ATOM 7380 H H2   . PHE B 2 1  ? 7.236   10.558  3.365   1.00 0.00 ? 1  PHE B H2   10 
ATOM 7381 H H3   . PHE B 2 1  ? 7.343   9.732   1.885   1.00 0.00 ? 1  PHE B H3   10 
ATOM 7382 H HA   . PHE B 2 1  ? 5.722   10.921  1.095   1.00 0.00 ? 1  PHE B HA   10 
ATOM 7383 H HB2  . PHE B 2 1  ? 4.941   11.027  3.373   1.00 0.00 ? 1  PHE B HB2  10 
ATOM 7384 H HB3  . PHE B 2 1  ? 6.050   12.377  3.725   1.00 0.00 ? 1  PHE B HB3  10 
ATOM 7385 H HD1  . PHE B 2 1  ? 5.557   14.601  2.936   1.00 0.00 ? 1  PHE B HD1  10 
ATOM 7386 H HD2  . PHE B 2 1  ? 2.890   11.405  2.212   1.00 0.00 ? 1  PHE B HD2  10 
ATOM 7387 H HE1  . PHE B 2 1  ? 3.770   16.234  2.306   1.00 0.00 ? 1  PHE B HE1  10 
ATOM 7388 H HE2  . PHE B 2 1  ? 1.102   13.036  1.584   1.00 0.00 ? 1  PHE B HE2  10 
ATOM 7389 H HZ   . PHE B 2 1  ? 1.567   15.431  1.635   1.00 0.00 ? 1  PHE B HZ   10 
ATOM 7390 N N    . VAL B 2 2  ? 6.804   12.778  -0.183  1.00 0.00 ? 2  VAL B N    10 
ATOM 7391 C CA   . VAL B 2 2  ? 7.314   13.906  -0.942  1.00 0.00 ? 2  VAL B CA   10 
ATOM 7392 C C    . VAL B 2 2  ? 6.511   14.062  -2.236  1.00 0.00 ? 2  VAL B C    10 
ATOM 7393 O O    . VAL B 2 2  ? 5.753   13.165  -2.607  1.00 0.00 ? 2  VAL B O    10 
ATOM 7394 C CB   . VAL B 2 2  ? 8.813   13.723  -1.199  1.00 0.00 ? 2  VAL B CB   10 
ATOM 7395 C CG1  . VAL B 2 2  ? 9.726   12.324  -0.721  1.00 0.00 ? 2  VAL B CG1  10 
ATOM 7396 C CG2  . VAL B 2 2  ? 9.059   13.177  -2.609  1.00 0.00 ? 2  VAL B CG2  10 
ATOM 7397 H H    . VAL B 2 2  ? 6.405   12.020  -0.658  1.00 0.00 ? 2  VAL B H    10 
ATOM 7398 H HA   . VAL B 2 2  ? 7.161   14.809  -0.369  1.00 0.00 ? 2  VAL B HA   10 
ATOM 7399 H HB   . VAL B 2 2  ? 9.290   14.556  -0.708  1.00 0.00 ? 2  VAL B HB   10 
ATOM 7400 H HG11 . VAL B 2 2  ? 9.659   12.197  0.348   1.00 0.00 ? 2  VAL B HG11 10 
ATOM 7401 H HG12 . VAL B 2 2  ? 9.296   11.462  -1.210  1.00 0.00 ? 2  VAL B HG12 10 
ATOM 7402 H HG13 . VAL B 2 2  ? 10.751  12.437  -1.038  1.00 0.00 ? 2  VAL B HG13 10 
ATOM 7403 H HG21 . VAL B 2 2  ? 8.552   12.231  -2.724  1.00 0.00 ? 2  VAL B HG21 10 
ATOM 7404 H HG22 . VAL B 2 2  ? 8.654   13.885  -3.317  1.00 0.00 ? 2  VAL B HG22 10 
ATOM 7405 H HG23 . VAL B 2 2  ? 10.120  13.074  -2.777  1.00 0.00 ? 2  VAL B HG23 10 
ATOM 7406 N N    . ASN B 2 3  ? 6.724   15.191  -2.895  1.00 0.00 ? 3  ASN B N    10 
ATOM 7407 C CA   . ASN B 2 3  ? 6.044   15.450  -4.158  1.00 0.00 ? 3  ASN B CA   10 
ATOM 7408 C C    . ASN B 2 3  ? 6.535   14.409  -5.175  1.00 0.00 ? 3  ASN B C    10 
ATOM 7409 O O    . ASN B 2 3  ? 7.629   14.532  -5.722  1.00 0.00 ? 3  ASN B O    10 
ATOM 7410 C CB   . ASN B 2 3  ? 6.346   16.841  -4.703  1.00 0.00 ? 3  ASN B CB   10 
ATOM 7411 C CG   . ASN B 2 3  ? 5.076   17.698  -4.758  1.00 0.00 ? 3  ASN B CG   10 
ATOM 7412 O OD1  . ASN B 2 3  ? 4.477   17.900  -5.802  1.00 0.00 ? 3  ASN B OD1  10 
ATOM 7413 N ND2  . ASN B 2 3  ? 4.704   18.187  -3.577  1.00 0.00 ? 3  ASN B ND2  10 
ATOM 7414 H H    . ASN B 2 3  ? 7.343   15.858  -2.532  1.00 0.00 ? 3  ASN B H    10 
ATOM 7415 H HA   . ASN B 2 3  ? 4.980   15.370  -3.991  1.00 0.00 ? 3  ASN B HA   10 
ATOM 7416 H HB2  . ASN B 2 3  ? 7.057   17.325  -4.050  1.00 0.00 ? 3  ASN B HB2  10 
ATOM 7417 H HB3  . ASN B 2 3  ? 6.738   16.746  -5.704  1.00 0.00 ? 3  ASN B HB3  10 
ATOM 7418 H HD21 . ASN B 2 3  ? 5.230   17.986  -2.776  1.00 0.00 ? 3  ASN B HD21 10 
ATOM 7419 H HD22 . ASN B 2 3  ? 3.903   18.747  -3.510  1.00 0.00 ? 3  ASN B HD22 10 
ATOM 7420 N N    . GLN B 2 4  ? 5.715   13.389  -5.362  1.00 0.00 ? 4  GLN B N    10 
ATOM 7421 C CA   . GLN B 2 4  ? 6.054   12.287  -6.246  1.00 0.00 ? 4  GLN B CA   10 
ATOM 7422 C C    . GLN B 2 4  ? 4.839   11.882  -7.071  1.00 0.00 ? 4  GLN B C    10 
ATOM 7423 O O    . GLN B 2 4  ? 4.452   10.708  -7.040  1.00 0.00 ? 4  GLN B O    10 
ATOM 7424 C CB   . GLN B 2 4  ? 6.502   11.094  -5.346  1.00 0.00 ? 4  GLN B CB   10 
ATOM 7425 C CG   . GLN B 2 4  ? 7.180   10.029  -6.199  1.00 0.00 ? 4  GLN B CG   10 
ATOM 7426 C CD   . GLN B 2 4  ? 8.218   9.243   -5.393  1.00 0.00 ? 4  GLN B CD   10 
ATOM 7427 O OE1  . GLN B 2 4  ? 7.959   8.754   -4.306  1.00 0.00 ? 4  GLN B OE1  10 
ATOM 7428 N NE2  . GLN B 2 4  ? 9.402   9.145   -5.991  1.00 0.00 ? 4  GLN B NE2  10 
ATOM 7429 H H    . GLN B 2 4  ? 4.856   13.375  -4.892  1.00 0.00 ? 4  GLN B H    10 
ATOM 7430 H HA   . GLN B 2 4  ? 6.866   12.582  -6.892  1.00 0.00 ? 4  GLN B HA   10 
ATOM 7431 H HB2  . GLN B 2 4  ? 7.204   11.454  -4.609  1.00 0.00 ? 4  GLN B HB2  10 
ATOM 7432 H HB3  . GLN B 2 4  ? 5.632   10.664  -4.872  1.00 0.00 ? 4  GLN B HB3  10 
ATOM 7433 H HG2  . GLN B 2 4  ? 6.429   9.338   -6.553  1.00 0.00 ? 4  GLN B HG2  10 
ATOM 7434 H HG3  . GLN B 2 4  ? 7.684   10.513  -7.022  1.00 0.00 ? 4  GLN B HG3  10 
ATOM 7435 H HE21 . GLN B 2 4  ? 9.545   9.562   -6.866  1.00 0.00 ? 4  GLN B HE21 10 
ATOM 7436 H HE22 . GLN B 2 4  ? 10.131  8.656   -5.557  1.00 0.00 ? 4  GLN B HE22 10 
ATOM 7437 N N    . HIS B 2 5  ? 4.241   12.803  -7.814  1.00 0.00 ? 5  HIS B N    10 
ATOM 7438 C CA   . HIS B 2 5  ? 3.061   12.635  -8.662  1.00 0.00 ? 5  HIS B CA   10 
ATOM 7439 C C    . HIS B 2 5  ? 2.803   11.156  -8.990  1.00 0.00 ? 5  HIS B C    10 
ATOM 7440 O O    . HIS B 2 5  ? 2.969   10.646  -10.090 1.00 0.00 ? 5  HIS B O    10 
ATOM 7441 C CB   . HIS B 2 5  ? 3.202   13.473  -9.933  1.00 0.00 ? 5  HIS B CB   10 
ATOM 7442 C CG   . HIS B 2 5  ? 3.425   14.956  -9.744  1.00 0.00 ? 5  HIS B CG   10 
ATOM 7443 N ND1  . HIS B 2 5  ? 3.481   15.830  -10.820 1.00 0.00 ? 5  HIS B ND1  10 
ATOM 7444 C CD2  . HIS B 2 5  ? 3.604   15.720  -8.629  1.00 0.00 ? 5  HIS B CD2  10 
ATOM 7445 C CE1  . HIS B 2 5  ? 3.684   17.056  -10.359 1.00 0.00 ? 5  HIS B CE1  10 
ATOM 7446 N NE2  . HIS B 2 5  ? 3.756   16.985  -8.999  1.00 0.00 ? 5  HIS B NE2  10 
ATOM 7447 H H    . HIS B 2 5  ? 4.635   13.698  -7.793  1.00 0.00 ? 5  HIS B H    10 
ATOM 7448 H HA   . HIS B 2 5  ? 2.191   12.967  -8.116  1.00 0.00 ? 5  HIS B HA   10 
ATOM 7449 H HB2  . HIS B 2 5  ? 4.052   13.092  -10.480 1.00 0.00 ? 5  HIS B HB2  10 
ATOM 7450 H HB3  . HIS B 2 5  ? 2.291   13.359  -10.500 1.00 0.00 ? 5  HIS B HB3  10 
ATOM 7451 H HD1  . HIS B 2 5  ? 3.387   15.583  -11.759 1.00 0.00 ? 5  HIS B HD1  10 
ATOM 7452 H HD2  . HIS B 2 5  ? 3.620   15.358  -7.617  1.00 0.00 ? 5  HIS B HD2  10 
ATOM 7453 H HE1  . HIS B 2 5  ? 3.775   17.947  -10.951 1.00 0.00 ? 5  HIS B HE1  10 
ATOM 7454 N N    . LEU B 2 6  ? 2.336   10.491  -7.923  1.00 0.00 ? 6  LEU B N    10 
ATOM 7455 C CA   . LEU B 2 6  ? 2.017   9.080   -7.951  1.00 0.00 ? 6  LEU B CA   10 
ATOM 7456 C C    . LEU B 2 6  ? 0.591   8.892   -8.474  1.00 0.00 ? 6  LEU B C    10 
ATOM 7457 O O    . LEU B 2 6  ? -0.361  9.423   -7.906  1.00 0.00 ? 6  LEU B O    10 
ATOM 7458 C CB   . LEU B 2 6  ? 2.241   8.466   -6.559  1.00 0.00 ? 6  LEU B CB   10 
ATOM 7459 C CG   . LEU B 2 6  ? 3.615   7.870   -6.252  1.00 0.00 ? 6  LEU B CG   10 
ATOM 7460 C CD1  . LEU B 2 6  ? 3.608   7.209   -4.864  1.00 0.00 ? 6  LEU B CD1  10 
ATOM 7461 C CD2  . LEU B 2 6  ? 4.067   6.896   -7.338  1.00 0.00 ? 6  LEU B CD2  10 
ATOM 7462 H H    . LEU B 2 6  ? 2.205   10.984  -7.086  1.00 0.00 ? 6  LEU B H    10 
ATOM 7463 H HA   . LEU B 2 6  ? 2.666   8.591   -8.662  1.00 0.00 ? 6  LEU B HA   10 
ATOM 7464 H HB2  . LEU B 2 6  ? 2.069   9.250   -5.838  1.00 0.00 ? 6  LEU B HB2  10 
ATOM 7465 H HB3  . LEU B 2 6  ? 1.519   7.671   -6.445  1.00 0.00 ? 6  LEU B HB3  10 
ATOM 7466 H HG   . LEU B 2 6  ? 4.349   8.661   -6.259  1.00 0.00 ? 6  LEU B HG   10 
ATOM 7467 H HD11 . LEU B 2 6  ? 3.348   7.942   -4.116  1.00 0.00 ? 6  LEU B HD11 10 
ATOM 7468 H HD12 . LEU B 2 6  ? 2.862   6.428   -4.870  1.00 0.00 ? 6  LEU B HD12 10 
ATOM 7469 H HD13 . LEU B 2 6  ? 4.576   6.774   -4.666  1.00 0.00 ? 6  LEU B HD13 10 
ATOM 7470 H HD21 . LEU B 2 6  ? 3.347   6.097   -7.431  1.00 0.00 ? 6  LEU B HD21 10 
ATOM 7471 H HD22 . LEU B 2 6  ? 4.119   7.437   -8.272  1.00 0.00 ? 6  LEU B HD22 10 
ATOM 7472 H HD23 . LEU B 2 6  ? 5.047   6.512   -7.096  1.00 0.00 ? 6  LEU B HD23 10 
ATOM 7473 N N    . CYS B 2 7  ? 0.491   8.127   -9.554  1.00 0.00 ? 7  CYS B N    10 
ATOM 7474 C CA   . CYS B 2 7  ? -0.804  7.846   -10.157 1.00 0.00 ? 7  CYS B CA   10 
ATOM 7475 C C    . CYS B 2 7  ? -0.817  6.364   -10.558 1.00 0.00 ? 7  CYS B C    10 
ATOM 7476 O O    . CYS B 2 7  ? 0.091   5.903   -11.241 1.00 0.00 ? 7  CYS B O    10 
ATOM 7477 C CB   . CYS B 2 7  ? -1.137  8.781   -11.316 1.00 0.00 ? 7  CYS B CB   10 
ATOM 7478 S SG   . CYS B 2 7  ? -2.315  10.076  -10.774 1.00 0.00 ? 7  CYS B SG   10 
ATOM 7479 H H    . CYS B 2 7  ? 1.301   7.746   -9.953  1.00 0.00 ? 7  CYS B H    10 
ATOM 7480 H HA   . CYS B 2 7  ? -1.560  7.965   -9.395  1.00 0.00 ? 7  CYS B HA   10 
ATOM 7481 H HB2  . CYS B 2 7  ? -0.230  9.260   -11.654 1.00 0.00 ? 7  CYS B HB2  10 
ATOM 7482 H HB3  . CYS B 2 7  ? -1.595  8.209   -12.108 1.00 0.00 ? 7  CYS B HB3  10 
ATOM 7483 N N    . GLY B 2 8  ? -1.828  5.661   -10.083 1.00 0.00 ? 8  GLY B N    10 
ATOM 7484 C CA   . GLY B 2 8  ? -2.026  4.230   -10.264 1.00 0.00 ? 8  GLY B CA   10 
ATOM 7485 C C    . GLY B 2 8  ? -0.974  3.356   -10.915 1.00 0.00 ? 8  GLY B C    10 
ATOM 7486 O O    . GLY B 2 8  ? -0.544  2.340   -10.311 1.00 0.00 ? 8  GLY B O    10 
ATOM 7487 H H    . GLY B 2 8  ? -2.503  6.143   -9.564  1.00 0.00 ? 8  GLY B H    10 
ATOM 7488 H HA2  . GLY B 2 8  ? -2.177  3.824   -9.274  1.00 0.00 ? 8  GLY B HA2  10 
ATOM 7489 H HA3  . GLY B 2 8  ? -2.913  4.128   -10.871 1.00 0.00 ? 8  GLY B HA3  10 
ATOM 7490 N N    . SER B 2 9  ? -0.552  3.645   -12.140 1.00 0.00 ? 9  SER B N    10 
ATOM 7491 C CA   . SER B 2 9  ? 0.423   2.811   -12.838 1.00 0.00 ? 9  SER B CA   10 
ATOM 7492 C C    . SER B 2 9  ? 1.651   2.450   -11.990 1.00 0.00 ? 9  SER B C    10 
ATOM 7493 O O    . SER B 2 9  ? 2.215   1.362   -12.120 1.00 0.00 ? 9  SER B O    10 
ATOM 7494 C CB   . SER B 2 9  ? 0.859   3.408   -14.176 1.00 0.00 ? 9  SER B CB   10 
ATOM 7495 O OG   . SER B 2 9  ? -0.159  4.182   -14.802 1.00 0.00 ? 9  SER B OG   10 
ATOM 7496 H H    . SER B 2 9  ? -0.905  4.442   -12.589 1.00 0.00 ? 9  SER B H    10 
ATOM 7497 H HA   . SER B 2 9  ? -0.032  1.849   -13.025 1.00 0.00 ? 9  SER B HA   10 
ATOM 7498 H HB2  . SER B 2 9  ? 1.707   4.053   -13.999 1.00 0.00 ? 9  SER B HB2  10 
ATOM 7499 H HB3  . SER B 2 9  ? 1.119   2.597   -14.841 1.00 0.00 ? 9  SER B HB3  10 
ATOM 7500 H HG   . SER B 2 9  ? 0.172   5.077   -14.908 1.00 0.00 ? 9  SER B HG   10 
ATOM 7501 N N    . HIS B 2 10 ? 2.042   3.387   -11.144 1.00 0.00 ? 10 HIS B N    10 
ATOM 7502 C CA   . HIS B 2 10 ? 3.198   3.236   -10.271 1.00 0.00 ? 10 HIS B CA   10 
ATOM 7503 C C    . HIS B 2 10 ? 2.777   2.554   -8.976  1.00 0.00 ? 10 HIS B C    10 
ATOM 7504 O O    . HIS B 2 10 ? 3.543   1.773   -8.412  1.00 0.00 ? 10 HIS B O    10 
ATOM 7505 C CB   . HIS B 2 10 ? 3.876   4.599   -10.054 1.00 0.00 ? 10 HIS B CB   10 
ATOM 7506 C CG   . HIS B 2 10 ? 4.649   5.083   -11.259 1.00 0.00 ? 10 HIS B CG   10 
ATOM 7507 N ND1  . HIS B 2 10 ? 4.884   6.424   -11.508 1.00 0.00 ? 10 HIS B ND1  10 
ATOM 7508 C CD2  . HIS B 2 10 ? 5.234   4.392   -12.279 1.00 0.00 ? 10 HIS B CD2  10 
ATOM 7509 C CE1  . HIS B 2 10 ? 5.579   6.523   -12.631 1.00 0.00 ? 10 HIS B CE1  10 
ATOM 7510 N NE2  . HIS B 2 10 ? 5.797   5.263   -13.107 1.00 0.00 ? 10 HIS B NE2  10 
ATOM 7511 H H    . HIS B 2 10 ? 1.532   4.222   -11.103 1.00 0.00 ? 10 HIS B H    10 
ATOM 7512 H HA   . HIS B 2 10 ? 3.900   2.563   -10.739 1.00 0.00 ? 10 HIS B HA   10 
ATOM 7513 H HB2  . HIS B 2 10 ? 3.110   5.328   -9.836  1.00 0.00 ? 10 HIS B HB2  10 
ATOM 7514 H HB3  . HIS B 2 10 ? 4.569   4.506   -9.230  1.00 0.00 ? 10 HIS B HB3  10 
ATOM 7515 H HD1  . HIS B 2 10 ? 4.589   7.168   -10.952 1.00 0.00 ? 10 HIS B HD1  10 
ATOM 7516 H HD2  . HIS B 2 10 ? 5.239   3.323   -12.393 1.00 0.00 ? 10 HIS B HD2  10 
ATOM 7517 H HE1  . HIS B 2 10 ? 5.914   7.436   -13.088 1.00 0.00 ? 10 HIS B HE1  10 
ATOM 7518 N N    . LEU B 2 11 ? 1.561   2.864   -8.538  1.00 0.00 ? 11 LEU B N    10 
ATOM 7519 C CA   . LEU B 2 11 ? 1.045   2.263   -7.318  1.00 0.00 ? 11 LEU B CA   10 
ATOM 7520 C C    . LEU B 2 11 ? 1.106   0.737   -7.484  1.00 0.00 ? 11 LEU B C    10 
ATOM 7521 O O    . LEU B 2 11 ? 1.382   0.023   -6.524  1.00 0.00 ? 11 LEU B O    10 
ATOM 7522 C CB   . LEU B 2 11 ? -0.338  2.782   -6.938  1.00 0.00 ? 11 LEU B CB   10 
ATOM 7523 C CG   . LEU B 2 11 ? -0.398  4.183   -6.313  1.00 0.00 ? 11 LEU B CG   10 
ATOM 7524 C CD1  . LEU B 2 11 ? 0.584   4.332   -5.152  1.00 0.00 ? 11 LEU B CD1  10 
ATOM 7525 C CD2  . LEU B 2 11 ? -0.195  5.248   -7.392  1.00 0.00 ? 11 LEU B CD2  10 
ATOM 7526 H H    . LEU B 2 11 ? 1.010   3.501   -9.039  1.00 0.00 ? 11 LEU B H    10 
ATOM 7527 H HA   . LEU B 2 11 ? 1.729   2.496   -6.515  1.00 0.00 ? 11 LEU B HA   10 
ATOM 7528 H HB2  . LEU B 2 11 ? -0.932  2.806   -7.839  1.00 0.00 ? 11 LEU B HB2  10 
ATOM 7529 H HB3  . LEU B 2 11 ? -0.755  2.092   -6.220  1.00 0.00 ? 11 LEU B HB3  10 
ATOM 7530 H HG   . LEU B 2 11 ? -1.398  4.350   -5.940  1.00 0.00 ? 11 LEU B HG   10 
ATOM 7531 H HD11 . LEU B 2 11 ? 0.361   3.597   -4.393  1.00 0.00 ? 11 LEU B HD11 10 
ATOM 7532 H HD12 . LEU B 2 11 ? 1.580   4.159   -5.533  1.00 0.00 ? 11 LEU B HD12 10 
ATOM 7533 H HD13 . LEU B 2 11 ? 0.525   5.335   -4.755  1.00 0.00 ? 11 LEU B HD13 10 
ATOM 7534 H HD21 . LEU B 2 11 ? 0.760   5.097   -7.873  1.00 0.00 ? 11 LEU B HD21 10 
ATOM 7535 H HD22 . LEU B 2 11 ? -0.982  5.137   -8.123  1.00 0.00 ? 11 LEU B HD22 10 
ATOM 7536 H HD23 . LEU B 2 11 ? -0.259  6.230   -6.948  1.00 0.00 ? 11 LEU B HD23 10 
ATOM 7537 N N    . VAL B 2 12 ? 0.852   0.308   -8.712  1.00 0.00 ? 12 VAL B N    10 
ATOM 7538 C CA   . VAL B 2 12 ? 0.865   -1.114  -9.003  1.00 0.00 ? 12 VAL B CA   10 
ATOM 7539 C C    . VAL B 2 12 ? 2.300   -1.586  -9.234  1.00 0.00 ? 12 VAL B C    10 
ATOM 7540 O O    . VAL B 2 12 ? 2.705   -2.588  -8.651  1.00 0.00 ? 12 VAL B O    10 
ATOM 7541 C CB   . VAL B 2 12 ? -0.051  -1.492  -10.174 1.00 0.00 ? 12 VAL B CB   10 
ATOM 7542 C CG1  . VAL B 2 12 ? 0.408   -2.535  -11.494 1.00 0.00 ? 12 VAL B CG1  10 
ATOM 7543 C CG2  . VAL B 2 12 ? -0.935  -2.690  -9.802  1.00 0.00 ? 12 VAL B CG2  10 
ATOM 7544 H H    . VAL B 2 12 ? 0.654   0.951   -9.424  1.00 0.00 ? 12 VAL B H    10 
ATOM 7545 H HA   . VAL B 2 12 ? 0.526   -1.639  -8.122  1.00 0.00 ? 12 VAL B HA   10 
ATOM 7546 H HB   . VAL B 2 12 ? -0.324  -0.555  -10.634 1.00 0.00 ? 12 VAL B HB   10 
ATOM 7547 H HG11 . VAL B 2 12 ? 1.266   -2.120  -12.000 1.00 0.00 ? 12 VAL B HG11 10 
ATOM 7548 H HG12 . VAL B 2 12 ? 0.669   -3.498  -11.083 1.00 0.00 ? 12 VAL B HG12 10 
ATOM 7549 H HG13 . VAL B 2 12 ? -0.426  -2.652  -12.168 1.00 0.00 ? 12 VAL B HG13 10 
ATOM 7550 H HG21 . VAL B 2 12 ? -0.311  -3.531  -9.540  1.00 0.00 ? 12 VAL B HG21 10 
ATOM 7551 H HG22 . VAL B 2 12 ? -1.533  -2.411  -8.947  1.00 0.00 ? 12 VAL B HG22 10 
ATOM 7552 H HG23 . VAL B 2 12 ? -1.586  -2.930  -10.629 1.00 0.00 ? 12 VAL B HG23 10 
ATOM 7553 N N    . GLU B 2 13 ? 3.015   -0.879  -10.103 1.00 0.00 ? 13 GLU B N    10 
ATOM 7554 C CA   . GLU B 2 13 ? 4.381   -1.312  -10.392 1.00 0.00 ? 13 GLU B CA   10 
ATOM 7555 C C    . GLU B 2 13 ? 5.188   -1.386  -9.095  1.00 0.00 ? 13 GLU B C    10 
ATOM 7556 O O    . GLU B 2 13 ? 6.196   -2.090  -9.033  1.00 0.00 ? 13 GLU B O    10 
ATOM 7557 C CB   . GLU B 2 13 ? 5.056   -0.529  -11.510 1.00 0.00 ? 13 GLU B CB   10 
ATOM 7558 C CG   . GLU B 2 13 ? 5.875   -1.466  -12.412 1.00 0.00 ? 13 GLU B CG   10 
ATOM 7559 C CD   . GLU B 2 13 ? 7.359   -1.458  -12.045 1.00 0.00 ? 13 GLU B CD   10 
ATOM 7560 O OE1  . GLU B 2 13 ? 7.677   -0.922  -10.962 1.00 0.00 ? 13 GLU B OE1  10 
ATOM 7561 O OE2  . GLU B 2 13 ? 8.147   -1.990  -12.859 1.00 0.00 ? 13 GLU B OE2  10 
ATOM 7562 H H    . GLU B 2 13 ? 2.637   -0.087  -10.539 1.00 0.00 ? 13 GLU B H    10 
ATOM 7563 H HA   . GLU B 2 13 ? 4.341   -2.351  -10.686 1.00 0.00 ? 13 GLU B HA   10 
ATOM 7564 H HB2  . GLU B 2 13 ? 4.295   -0.047  -12.106 1.00 0.00 ? 13 GLU B HB2  10 
ATOM 7565 H HB3  . GLU B 2 13 ? 5.720   0.201   -11.070 1.00 0.00 ? 13 GLU B HB3  10 
ATOM 7566 H HG2  . GLU B 2 13 ? 5.503   -2.473  -12.293 1.00 0.00 ? 13 GLU B HG2  10 
ATOM 7567 H HG3  . GLU B 2 13 ? 5.777   -1.133  -13.434 1.00 0.00 ? 13 GLU B HG3  10 
ATOM 7568 N N    . ALA B 2 14 ? 4.716   -0.669  -8.085  1.00 0.00 ? 14 ALA B N    10 
ATOM 7569 C CA   . ALA B 2 14 ? 5.409   -0.630  -6.813  1.00 0.00 ? 14 ALA B CA   10 
ATOM 7570 C C    . ALA B 2 14 ? 5.090   -1.793  -5.881  1.00 0.00 ? 14 ALA B C    10 
ATOM 7571 O O    . ALA B 2 14 ? 5.988   -2.537  -5.478  1.00 0.00 ? 14 ALA B O    10 
ATOM 7572 C CB   . ALA B 2 14 ? 5.108   0.722   -6.133  1.00 0.00 ? 14 ALA B CB   10 
ATOM 7573 H H    . ALA B 2 14 ? 3.887   -0.159  -8.201  1.00 0.00 ? 14 ALA B H    10 
ATOM 7574 H HA   . ALA B 2 14 ? 6.472   -0.716  -6.986  1.00 0.00 ? 14 ALA B HA   10 
ATOM 7575 H HB1  . ALA B 2 14 ? 5.433   1.529   -6.773  1.00 0.00 ? 14 ALA B HB1  10 
ATOM 7576 H HB2  . ALA B 2 14 ? 4.040   0.791   -5.988  1.00 0.00 ? 14 ALA B HB2  10 
ATOM 7577 H HB3  . ALA B 2 14 ? 5.600   0.761   -5.173  1.00 0.00 ? 14 ALA B HB3  10 
ATOM 7578 N N    . LEU B 2 15 ? 3.821   -1.889  -5.512  1.00 0.00 ? 15 LEU B N    10 
ATOM 7579 C CA   . LEU B 2 15 ? 3.403   -2.934  -4.567  1.00 0.00 ? 15 LEU B CA   10 
ATOM 7580 C C    . LEU B 2 15 ? 3.531   -4.301  -5.245  1.00 0.00 ? 15 LEU B C    10 
ATOM 7581 O O    . LEU B 2 15 ? 3.929   -5.284  -4.623  1.00 0.00 ? 15 LEU B O    10 
ATOM 7582 C CB   . LEU B 2 15 ? 2.074   -2.552  -3.919  1.00 0.00 ? 15 LEU B CB   10 
ATOM 7583 C CG   . LEU B 2 15 ? 0.914   -3.525  -3.694  1.00 0.00 ? 15 LEU B CG   10 
ATOM 7584 C CD1  . LEU B 2 15 ? -0.418  -2.724  -3.721  1.00 0.00 ? 15 LEU B CD1  10 
ATOM 7585 C CD2  . LEU B 2 15 ? 0.811   -4.740  -4.602  1.00 0.00 ? 15 LEU B CD2  10 
ATOM 7586 H H    . LEU B 2 15 ? 3.159   -1.261  -5.871  1.00 0.00 ? 15 LEU B H    10 
ATOM 7587 H HA   . LEU B 2 15 ? 4.157   -3.029  -3.799  1.00 0.00 ? 15 LEU B HA   10 
ATOM 7588 H HB2  . LEU B 2 15 ? 2.331   -2.182  -2.939  1.00 0.00 ? 15 LEU B HB2  10 
ATOM 7589 H HB3  . LEU B 2 15 ? 1.671   -1.766  -4.538  1.00 0.00 ? 15 LEU B HB3  10 
ATOM 7590 H HG   . LEU B 2 15 ? 1.027   -3.997  -2.729  1.00 0.00 ? 15 LEU B HG   10 
ATOM 7591 H HD11 . LEU B 2 15 ? -0.399  -1.965  -2.953  1.00 0.00 ? 15 LEU B HD11 10 
ATOM 7592 H HD12 . LEU B 2 15 ? -0.502  -2.249  -4.688  1.00 0.00 ? 15 LEU B HD12 10 
ATOM 7593 H HD13 . LEU B 2 15 ? -1.249  -3.398  -3.584  1.00 0.00 ? 15 LEU B HD13 10 
ATOM 7594 H HD21 . LEU B 2 15 ? 0.729   -4.418  -5.629  1.00 0.00 ? 15 LEU B HD21 10 
ATOM 7595 H HD22 . LEU B 2 15 ? 1.713   -5.322  -4.484  1.00 0.00 ? 15 LEU B HD22 10 
ATOM 7596 H HD23 . LEU B 2 15 ? -0.039  -5.338  -4.311  1.00 0.00 ? 15 LEU B HD23 10 
ATOM 7597 N N    . TYR B 2 16 ? 3.178   -4.316  -6.521  1.00 0.00 ? 16 TYR B N    10 
ATOM 7598 C CA   . TYR B 2 16 ? 3.221   -5.546  -7.306  1.00 0.00 ? 16 TYR B CA   10 
ATOM 7599 C C    . TYR B 2 16 ? 4.653   -6.010  -7.546  1.00 0.00 ? 16 TYR B C    10 
ATOM 7600 O O    . TYR B 2 16 ? 4.882   -7.223  -7.661  1.00 0.00 ? 16 TYR B O    10 
ATOM 7601 C CB   . TYR B 2 16 ? 2.442   -5.217  -8.583  1.00 0.00 ? 16 TYR B CB   10 
ATOM 7602 C CG   . TYR B 2 16 ? 1.676   -6.303  -9.342  1.00 0.00 ? 16 TYR B CG   10 
ATOM 7603 C CD1  . TYR B 2 16 ? 2.357   -7.233  -10.099 1.00 0.00 ? 16 TYR B CD1  10 
ATOM 7604 C CD2  . TYR B 2 16 ? 0.292   -6.310  -9.327  1.00 0.00 ? 16 TYR B CD2  10 
ATOM 7605 C CE1  . TYR B 2 16 ? 1.630   -8.198  -10.883 1.00 0.00 ? 16 TYR B CE1  10 
ATOM 7606 C CE2  . TYR B 2 16 ? -0.435  -7.273  -10.110 1.00 0.00 ? 16 TYR B CE2  10 
ATOM 7607 C CZ   . TYR B 2 16 ? 0.271   -8.168  -10.847 1.00 0.00 ? 16 TYR B CZ   10 
ATOM 7608 O OH   . TYR B 2 16 ? -0.413  -9.084  -11.587 1.00 0.00 ? 16 TYR B OH   10 
ATOM 7609 H H    . TYR B 2 16 ? 2.882   -3.485  -6.947  1.00 0.00 ? 16 TYR B H    10 
ATOM 7610 H HA   . TYR B 2 16 ? 2.736   -6.345  -6.767  1.00 0.00 ? 16 TYR B HA   10 
ATOM 7611 H HB2  . TYR B 2 16 ? 1.710   -4.473  -8.309  1.00 0.00 ? 16 TYR B HB2  10 
ATOM 7612 H HB3  . TYR B 2 16 ? 3.161   -4.817  -9.282  1.00 0.00 ? 16 TYR B HB3  10 
ATOM 7613 H HD1  . TYR B 2 16 ? 3.437   -7.237  -10.104 1.00 0.00 ? 16 TYR B HD1  10 
ATOM 7614 H HD2  . TYR B 2 16 ? -0.244  -5.591  -8.724  1.00 0.00 ? 16 TYR B HD2  10 
ATOM 7615 H HE1  . TYR B 2 16 ? 2.152   -8.929  -11.484 1.00 0.00 ? 16 TYR B HE1  10 
ATOM 7616 H HE2  . TYR B 2 16 ? -1.515  -7.283  -10.111 1.00 0.00 ? 16 TYR B HE2  10 
ATOM 7617 H HH   . TYR B 2 16 ? 0.228   -9.635  -12.041 1.00 0.00 ? 16 TYR B HH   10 
ATOM 7618 N N    . LEU B 2 17 ? 5.593   -5.071  -7.609  1.00 0.00 ? 17 LEU B N    10 
ATOM 7619 C CA   . LEU B 2 17 ? 6.982   -5.437  -7.852  1.00 0.00 ? 17 LEU B CA   10 
ATOM 7620 C C    . LEU B 2 17 ? 7.779   -5.686  -6.581  1.00 0.00 ? 17 LEU B C    10 
ATOM 7621 O O    . LEU B 2 17 ? 8.762   -6.435  -6.600  1.00 0.00 ? 17 LEU B O    10 
ATOM 7622 C CB   . LEU B 2 17 ? 7.645   -4.379  -8.761  1.00 0.00 ? 17 LEU B CB   10 
ATOM 7623 C CG   . LEU B 2 17 ? 9.008   -4.731  -9.356  1.00 0.00 ? 17 LEU B CG   10 
ATOM 7624 C CD1  . LEU B 2 17 ? 10.129  -4.456  -8.344  1.00 0.00 ? 17 LEU B CD1  10 
ATOM 7625 C CD2  . LEU B 2 17 ? 9.053   -6.163  -9.887  1.00 0.00 ? 17 LEU B CD2  10 
ATOM 7626 H H    . LEU B 2 17 ? 5.351   -4.129  -7.492  1.00 0.00 ? 17 LEU B H    10 
ATOM 7627 H HA   . LEU B 2 17 ? 7.008   -6.396  -8.347  1.00 0.00 ? 17 LEU B HA   10 
ATOM 7628 H HB2  . LEU B 2 17 ? 6.972   -4.199  -9.586  1.00 0.00 ? 17 LEU B HB2  10 
ATOM 7629 H HB3  . LEU B 2 17 ? 7.776   -3.485  -8.168  1.00 0.00 ? 17 LEU B HB3  10 
ATOM 7630 H HG   . LEU B 2 17 ? 9.173   -4.121  -10.232 1.00 0.00 ? 17 LEU B HG   10 
ATOM 7631 H HD11 . LEU B 2 17 ? 10.112  -3.415  -8.061  1.00 0.00 ? 17 LEU B HD11 10 
ATOM 7632 H HD12 . LEU B 2 17 ? 9.946   -5.065  -7.471  1.00 0.00 ? 17 LEU B HD12 10 
ATOM 7633 H HD13 . LEU B 2 17 ? 11.080  -4.729  -8.775  1.00 0.00 ? 17 LEU B HD13 10 
ATOM 7634 H HD21 . LEU B 2 17 ? 8.831   -6.853  -9.086  1.00 0.00 ? 17 LEU B HD21 10 
ATOM 7635 H HD22 . LEU B 2 17 ? 8.300   -6.258  -10.656 1.00 0.00 ? 17 LEU B HD22 10 
ATOM 7636 H HD23 . LEU B 2 17 ? 10.024  -6.360  -10.315 1.00 0.00 ? 17 LEU B HD23 10 
ATOM 7637 N N    . VAL B 2 18 ? 7.405   -4.998  -5.510  1.00 0.00 ? 18 VAL B N    10 
ATOM 7638 C CA   . VAL B 2 18 ? 8.149   -5.052  -4.268  1.00 0.00 ? 18 VAL B CA   10 
ATOM 7639 C C    . VAL B 2 18 ? 7.770   -6.122  -3.258  1.00 0.00 ? 18 VAL B C    10 
ATOM 7640 O O    . VAL B 2 18 ? 8.518   -6.302  -2.285  1.00 0.00 ? 18 VAL B O    10 
ATOM 7641 C CB   . VAL B 2 18 ? 8.081   -3.634  -3.622  1.00 0.00 ? 18 VAL B CB   10 
ATOM 7642 C CG1  . VAL B 2 18 ? 9.203   -3.013  -2.463  1.00 0.00 ? 18 VAL B CG1  10 
ATOM 7643 C CG2  . VAL B 2 18 ? 8.746   -2.617  -4.551  1.00 0.00 ? 18 VAL B CG2  10 
ATOM 7644 H H    . VAL B 2 18 ? 6.602   -4.437  -5.562  1.00 0.00 ? 18 VAL B H    10 
ATOM 7645 H HA   . VAL B 2 18 ? 9.176   -5.308  -4.478  1.00 0.00 ? 18 VAL B HA   10 
ATOM 7646 H HB   . VAL B 2 18 ? 7.121   -3.595  -3.132  1.00 0.00 ? 18 VAL B HB   10 
ATOM 7647 H HG11 . VAL B 2 18 ? 9.216   -3.652  -1.593  1.00 0.00 ? 18 VAL B HG11 10 
ATOM 7648 H HG12 . VAL B 2 18 ? 10.184  -3.009  -2.916  1.00 0.00 ? 18 VAL B HG12 10 
ATOM 7649 H HG13 . VAL B 2 18 ? 8.930   -2.002  -2.200  1.00 0.00 ? 18 VAL B HG13 10 
ATOM 7650 H HG21 . VAL B 2 18 ? 9.773   -2.902  -4.723  1.00 0.00 ? 18 VAL B HG21 10 
ATOM 7651 H HG22 . VAL B 2 18 ? 8.213   -2.624  -5.490  1.00 0.00 ? 18 VAL B HG22 10 
ATOM 7652 H HG23 . VAL B 2 18 ? 8.682   -1.632  -4.113  1.00 0.00 ? 18 VAL B HG23 10 
ATOM 7653 N N    . CYS B 2 19 ? 6.637   -6.780  -3.457  1.00 0.00 ? 19 CYS B N    10 
ATOM 7654 C CA   . CYS B 2 19 ? 6.203   -7.790  -2.498  1.00 0.00 ? 19 CYS B CA   10 
ATOM 7655 C C    . CYS B 2 19 ? 7.261   -8.897  -2.443  1.00 0.00 ? 19 CYS B C    10 
ATOM 7656 O O    . CYS B 2 19 ? 7.641   -9.337  -1.353  1.00 0.00 ? 19 CYS B O    10 
ATOM 7657 C CB   . CYS B 2 19 ? 4.774   -8.277  -2.709  1.00 0.00 ? 19 CYS B CB   10 
ATOM 7658 S SG   . CYS B 2 19 ? 3.577   -7.000  -2.143  1.00 0.00 ? 19 CYS B SG   10 
ATOM 7659 H H    . CYS B 2 19 ? 6.091   -6.588  -4.248  1.00 0.00 ? 19 CYS B H    10 
ATOM 7660 H HA   . CYS B 2 19 ? 6.267   -7.356  -1.511  1.00 0.00 ? 19 CYS B HA   10 
ATOM 7661 H HB2  . CYS B 2 19 ? 4.615   -8.458  -3.761  1.00 0.00 ? 19 CYS B HB2  10 
ATOM 7662 H HB3  . CYS B 2 19 ? 4.619   -9.176  -2.131  1.00 0.00 ? 19 CYS B HB3  10 
ATOM 7663 N N    . GLY B 2 20 ? 7.735   -9.304  -3.612  1.00 0.00 ? 20 GLY B N    10 
ATOM 7664 C CA   . GLY B 2 20 ? 8.766   -10.325 -3.692  1.00 0.00 ? 20 GLY B CA   10 
ATOM 7665 C C    . GLY B 2 20 ? 8.213   -11.748 -3.617  1.00 0.00 ? 20 GLY B C    10 
ATOM 7666 O O    . GLY B 2 20 ? 8.679   -12.634 -4.340  1.00 0.00 ? 20 GLY B O    10 
ATOM 7667 H H    . GLY B 2 20 ? 7.384   -8.908  -4.437  1.00 0.00 ? 20 GLY B H    10 
ATOM 7668 H HA2  . GLY B 2 20 ? 9.275   -10.213 -4.638  1.00 0.00 ? 20 GLY B HA2  10 
ATOM 7669 H HA3  . GLY B 2 20 ? 9.443   -10.184 -2.863  1.00 0.00 ? 20 GLY B HA3  10 
ATOM 7670 N N    . GLU B 2 21 ? 7.222   -11.939 -2.763  1.00 0.00 ? 21 GLU B N    10 
ATOM 7671 C CA   . GLU B 2 21 ? 6.557   -13.232 -2.615  1.00 0.00 ? 21 GLU B CA   10 
ATOM 7672 C C    . GLU B 2 21 ? 5.059   -12.934 -2.377  1.00 0.00 ? 21 GLU B C    10 
ATOM 7673 O O    . GLU B 2 21 ? 4.401   -13.519 -1.522  1.00 0.00 ? 21 GLU B O    10 
ATOM 7674 C CB   . GLU B 2 21 ? 7.156   -14.104 -1.523  1.00 0.00 ? 21 GLU B CB   10 
ATOM 7675 C CG   . GLU B 2 21 ? 8.279   -13.404 -0.749  1.00 0.00 ? 21 GLU B CG   10 
ATOM 7676 C CD   . GLU B 2 21 ? 8.464   -14.043 0.630   1.00 0.00 ? 21 GLU B CD   10 
ATOM 7677 O OE1  . GLU B 2 21 ? 8.870   -15.224 0.661   1.00 0.00 ? 21 GLU B OE1  10 
ATOM 7678 O OE2  . GLU B 2 21 ? 8.191   -13.334 1.622   1.00 0.00 ? 21 GLU B OE2  10 
ATOM 7679 H H    . GLU B 2 21 ? 6.923   -11.188 -2.211  1.00 0.00 ? 21 GLU B H    10 
ATOM 7680 H HA   . GLU B 2 21 ? 6.645   -13.759 -3.554  1.00 0.00 ? 21 GLU B HA   10 
ATOM 7681 H HB2  . GLU B 2 21 ? 6.372   -14.359 -0.826  1.00 0.00 ? 21 GLU B HB2  10 
ATOM 7682 H HB3  . GLU B 2 21 ? 7.566   -14.990 -1.984  1.00 0.00 ? 21 GLU B HB3  10 
ATOM 7683 H HG2  . GLU B 2 21 ? 9.201   -13.505 -1.302  1.00 0.00 ? 21 GLU B HG2  10 
ATOM 7684 H HG3  . GLU B 2 21 ? 8.016   -12.365 -0.615  1.00 0.00 ? 21 GLU B HG3  10 
ATOM 7685 N N    . ARG B 2 22 ? 4.588   -11.966 -3.156  1.00 0.00 ? 22 ARG B N    10 
ATOM 7686 C CA   . ARG B 2 22 ? 3.217   -11.503 -3.049  1.00 0.00 ? 22 ARG B CA   10 
ATOM 7687 C C    . ARG B 2 22 ? 2.176   -12.619 -2.984  1.00 0.00 ? 22 ARG B C    10 
ATOM 7688 O O    . ARG B 2 22 ? 2.321   -13.675 -3.596  1.00 0.00 ? 22 ARG B O    10 
ATOM 7689 C CB   . ARG B 2 22 ? 2.876   -10.557 -4.211  1.00 0.00 ? 22 ARG B CB   10 
ATOM 7690 C CG   . ARG B 2 22 ? 2.135   -11.265 -5.342  1.00 0.00 ? 22 ARG B CG   10 
ATOM 7691 C CD   . ARG B 2 22 ? 3.055   -12.241 -6.077  1.00 0.00 ? 22 ARG B CD   10 
ATOM 7692 N NE   . ARG B 2 22 ? 2.964   -12.014 -7.538  1.00 0.00 ? 22 ARG B NE   10 
ATOM 7693 C CZ   . ARG B 2 22 ? 2.542   -12.942 -8.424  1.00 0.00 ? 22 ARG B CZ   10 
ATOM 7694 N NH1  . ARG B 2 22 ? 3.089   -14.179 -8.433  1.00 0.00 ? 22 ARG B NH1  10 
ATOM 7695 N NH2  . ARG B 2 22 ? 1.591   -12.626 -9.284  1.00 0.00 ? 22 ARG B NH2  10 
ATOM 7696 H H    . ARG B 2 22 ? 5.182   -11.555 -3.818  1.00 0.00 ? 22 ARG B H    10 
ATOM 7697 H HA   . ARG B 2 22 ? 3.106   -10.969 -2.117  1.00 0.00 ? 22 ARG B HA   10 
ATOM 7698 H HB2  . ARG B 2 22 ? 2.244   -9.768  -3.832  1.00 0.00 ? 22 ARG B HB2  10 
ATOM 7699 H HB3  . ARG B 2 22 ? 3.798   -10.158 -4.606  1.00 0.00 ? 22 ARG B HB3  10 
ATOM 7700 H HG2  . ARG B 2 22 ? 1.309   -11.818 -4.922  1.00 0.00 ? 22 ARG B HG2  10 
ATOM 7701 H HG3  . ARG B 2 22 ? 1.786   -10.522 -6.045  1.00 0.00 ? 22 ARG B HG3  10 
ATOM 7702 H HD2  . ARG B 2 22 ? 4.074   -12.073 -5.762  1.00 0.00 ? 22 ARG B HD2  10 
ATOM 7703 H HD3  . ARG B 2 22 ? 2.744   -13.252 -5.862  1.00 0.00 ? 22 ARG B HD3  10 
ATOM 7704 H HE   . ARG B 2 22 ? 3.227   -11.136 -7.883  1.00 0.00 ? 22 ARG B HE   10 
ATOM 7705 H HH11 . ARG B 2 22 ? 3.809   -14.412 -7.780  1.00 0.00 ? 22 ARG B HH11 10 
ATOM 7706 H HH12 . ARG B 2 22 ? 2.772   -14.860 -9.094  1.00 0.00 ? 22 ARG B HH12 10 
ATOM 7707 H HH21 . ARG B 2 22 ? 1.190   -11.711 -9.273  1.00 0.00 ? 22 ARG B HH21 10 
ATOM 7708 H HH22 . ARG B 2 22 ? 1.271   -13.304 -9.946  1.00 0.00 ? 22 ARG B HH22 10 
ATOM 7709 N N    . GLY B 2 23 ? 1.114   -12.334 -2.241  1.00 0.00 ? 23 GLY B N    10 
ATOM 7710 C CA   . GLY B 2 23 ? 0.003   -13.261 -2.082  1.00 0.00 ? 23 GLY B CA   10 
ATOM 7711 C C    . GLY B 2 23 ? -1.293  -12.454 -1.896  1.00 0.00 ? 23 GLY B C    10 
ATOM 7712 O O    . GLY B 2 23 ? -2.185  -12.821 -1.135  1.00 0.00 ? 23 GLY B O    10 
ATOM 7713 H H    . GLY B 2 23 ? 1.076   -11.469 -1.783  1.00 0.00 ? 23 GLY B H    10 
ATOM 7714 H HA2  . GLY B 2 23 ? -0.083  -13.867 -2.972  1.00 0.00 ? 23 GLY B HA2  10 
ATOM 7715 H HA3  . GLY B 2 23 ? 0.171   -13.868 -1.206  1.00 0.00 ? 23 GLY B HA3  10 
ATOM 7716 N N    . PHE B 2 24 ? -1.322  -11.337 -2.598  1.00 0.00 ? 24 PHE B N    10 
ATOM 7717 C CA   . PHE B 2 24 ? -2.479  -10.397 -2.530  1.00 0.00 ? 24 PHE B CA   10 
ATOM 7718 C C    . PHE B 2 24 ? -3.428  -10.748 -3.666  1.00 0.00 ? 24 PHE B C    10 
ATOM 7719 O O    . PHE B 2 24 ? -3.324  -11.839 -4.274  1.00 0.00 ? 24 PHE B O    10 
ATOM 7720 C CB   . PHE B 2 24 ? -1.801  -9.030  -2.505  1.00 0.00 ? 24 PHE B CB   10 
ATOM 7721 C CG   . PHE B 2 24 ? -1.666  -8.330  -3.858  1.00 0.00 ? 24 PHE B CG   10 
ATOM 7722 C CD1  . PHE B 2 24 ? -0.756  -8.784  -4.762  1.00 0.00 ? 24 PHE B CD1  10 
ATOM 7723 C CD2  . PHE B 2 24 ? -2.452  -7.263  -4.162  1.00 0.00 ? 24 PHE B CD2  10 
ATOM 7724 C CE1  . PHE B 2 24 ? -0.630  -8.147  -6.023  1.00 0.00 ? 24 PHE B CE1  10 
ATOM 7725 C CE2  . PHE B 2 24 ? -2.327  -6.626  -5.425  1.00 0.00 ? 24 PHE B CE2  10 
ATOM 7726 C CZ   . PHE B 2 24 ? -1.418  -7.081  -6.329  1.00 0.00 ? 24 PHE B CZ   10 
ATOM 7727 H H    . PHE B 2 24 ? -0.564  -11.120 -3.180  1.00 0.00 ? 24 PHE B H    10 
ATOM 7728 H HA   . PHE B 2 24 ? -3.044  -10.560 -1.626  1.00 0.00 ? 24 PHE B HA   10 
ATOM 7729 H HB2  . PHE B 2 24 ? -2.385  -8.384  -1.866  1.00 0.00 ? 24 PHE B HB2  10 
ATOM 7730 H HB3  . PHE B 2 24 ? -0.803  -9.166  -2.113  1.00 0.00 ? 24 PHE B HB3  10 
ATOM 7731 H HD1  . PHE B 2 24 ? -0.129  -9.629  -4.519  1.00 0.00 ? 24 PHE B HD1  10 
ATOM 7732 H HD2  . PHE B 2 24 ? -3.173  -6.901  -3.444  1.00 0.00 ? 24 PHE B HD2  10 
ATOM 7733 H HE1  . PHE B 2 24 ? 0.092   -8.508  -6.741  1.00 0.00 ? 24 PHE B HE1  10 
ATOM 7734 H HE2  . PHE B 2 24 ? -2.952  -5.779  -5.668  1.00 0.00 ? 24 PHE B HE2  10 
ATOM 7735 H HZ   . PHE B 2 24 ? -1.323  -6.597  -7.290  1.00 0.00 ? 24 PHE B HZ   10 
ATOM 7736 N N    . PHE B 2 25 ? -4.396  -9.898  -3.967  1.00 0.00 ? 25 PHE B N    10 
ATOM 7737 C CA   . PHE B 2 25 ? -5.399  -10.154 -5.005  1.00 0.00 ? 25 PHE B CA   10 
ATOM 7738 C C    . PHE B 2 25 ? -5.316  -9.069  -6.077  1.00 0.00 ? 25 PHE B C    10 
ATOM 7739 O O    . PHE B 2 25 ? -4.719  -8.013  -5.859  1.00 0.00 ? 25 PHE B O    10 
ATOM 7740 C CB   . PHE B 2 25 ? -6.751  -10.113 -4.293  1.00 0.00 ? 25 PHE B CB   10 
ATOM 7741 C CG   . PHE B 2 25 ? -7.527  -11.432 -4.357  1.00 0.00 ? 25 PHE B CG   10 
ATOM 7742 C CD1  . PHE B 2 25 ? -6.886  -12.611 -4.135  1.00 0.00 ? 25 PHE B CD1  10 
ATOM 7743 C CD2  . PHE B 2 25 ? -8.860  -11.423 -4.628  1.00 0.00 ? 25 PHE B CD2  10 
ATOM 7744 C CE1  . PHE B 2 25 ? -7.609  -13.833 -4.185  1.00 0.00 ? 25 PHE B CE1  10 
ATOM 7745 C CE2  . PHE B 2 25 ? -9.583  -12.645 -4.679  1.00 0.00 ? 25 PHE B CE2  10 
ATOM 7746 C CZ   . PHE B 2 25 ? -8.942  -13.824 -4.457  1.00 0.00 ? 25 PHE B CZ   10 
ATOM 7747 H H    . PHE B 2 25 ? -4.445  -9.056  -3.471  1.00 0.00 ? 25 PHE B H    10 
ATOM 7748 H HA   . PHE B 2 25 ? -5.236  -11.130 -5.435  1.00 0.00 ? 25 PHE B HA   10 
ATOM 7749 H HB2  . PHE B 2 25 ? -6.577  -9.884  -3.252  1.00 0.00 ? 25 PHE B HB2  10 
ATOM 7750 H HB3  . PHE B 2 25 ? -7.356  -9.351  -4.763  1.00 0.00 ? 25 PHE B HB3  10 
ATOM 7751 H HD1  . PHE B 2 25 ? -5.828  -12.618 -3.921  1.00 0.00 ? 25 PHE B HD1  10 
ATOM 7752 H HD2  . PHE B 2 25 ? -9.369  -10.487 -4.803  1.00 0.00 ? 25 PHE B HD2  10 
ATOM 7753 H HE1  . PHE B 2 25 ? -7.099  -14.769 -4.008  1.00 0.00 ? 25 PHE B HE1  10 
ATOM 7754 H HE2  . PHE B 2 25 ? -10.641 -12.638 -4.895  1.00 0.00 ? 25 PHE B HE2  10 
ATOM 7755 H HZ   . PHE B 2 25 ? -9.491  -14.753 -4.497  1.00 0.00 ? 25 PHE B HZ   10 
ATOM 7756 N N    . TYR B 2 26 ? -5.924  -9.354  -7.220  1.00 0.00 ? 26 TYR B N    10 
ATOM 7757 C CA   . TYR B 2 26 ? -5.957  -8.412  -8.322  1.00 0.00 ? 26 TYR B CA   10 
ATOM 7758 C C    . TYR B 2 26 ? -7.094  -8.780  -9.296  1.00 0.00 ? 26 TYR B C    10 
ATOM 7759 O O    . TYR B 2 26 ? -6.871  -9.146  -10.446 1.00 0.00 ? 26 TYR B O    10 
ATOM 7760 C CB   . TYR B 2 26 ? -4.620  -8.421  -9.053  1.00 0.00 ? 26 TYR B CB   10 
ATOM 7761 C CG   . TYR B 2 26 ? -4.352  -7.099  -9.790  1.00 0.00 ? 26 TYR B CG   10 
ATOM 7762 C CD1  . TYR B 2 26 ? -4.120  -5.949  -9.063  1.00 0.00 ? 26 TYR B CD1  10 
ATOM 7763 C CD2  . TYR B 2 26 ? -4.388  -7.052  -11.167 1.00 0.00 ? 26 TYR B CD2  10 
ATOM 7764 C CE1  . TYR B 2 26 ? -3.925  -4.696  -9.744  1.00 0.00 ? 26 TYR B CE1  10 
ATOM 7765 C CE2  . TYR B 2 26 ? -4.192  -5.799  -11.848 1.00 0.00 ? 26 TYR B CE2  10 
ATOM 7766 C CZ   . TYR B 2 26 ? -3.972  -4.683  -11.104 1.00 0.00 ? 26 TYR B CZ   10 
ATOM 7767 O OH   . TYR B 2 26 ? -3.781  -3.500  -11.748 1.00 0.00 ? 26 TYR B OH   10 
ATOM 7768 H H    . TYR B 2 26 ? -6.362  -10.224 -7.322  1.00 0.00 ? 26 TYR B H    10 
ATOM 7769 H HA   . TYR B 2 26 ? -6.138  -7.424  -7.928  1.00 0.00 ? 26 TYR B HA   10 
ATOM 7770 H HB2  . TYR B 2 26 ? -3.833  -8.569  -8.329  1.00 0.00 ? 26 TYR B HB2  10 
ATOM 7771 H HB3  . TYR B 2 26 ? -4.633  -9.217  -9.782  1.00 0.00 ? 26 TYR B HB3  10 
ATOM 7772 H HD1  . TYR B 2 26 ? -4.086  -5.989  -7.984  1.00 0.00 ? 26 TYR B HD1  10 
ATOM 7773 H HD2  . TYR B 2 26 ? -4.564  -7.955  -11.734 1.00 0.00 ? 26 TYR B HD2  10 
ATOM 7774 H HE1  . TYR B 2 26 ? -3.745  -3.788  -9.189  1.00 0.00 ? 26 TYR B HE1  10 
ATOM 7775 H HE2  . TYR B 2 26 ? -4.220  -5.748  -12.927 1.00 0.00 ? 26 TYR B HE2  10 
ATOM 7776 H HH   . TYR B 2 26 ? -3.634  -2.822  -11.085 1.00 0.00 ? 26 TYR B HH   10 
ATOM 7777 N N    . THR B 2 27 ? -8.304  -8.671  -8.770  1.00 0.00 ? 27 THR B N    10 
ATOM 7778 C CA   . THR B 2 27 ? -9.522  -8.988  -9.486  1.00 0.00 ? 27 THR B CA   10 
ATOM 7779 C C    . THR B 2 27 ? -10.355 -7.740  -9.747  1.00 0.00 ? 27 THR B C    10 
ATOM 7780 O O    . THR B 2 27 ? -11.586 -7.786  -9.560  1.00 0.00 ? 27 THR B O    10 
ATOM 7781 C CB   . THR B 2 27 ? -10.270 -9.983  -8.536  1.00 0.00 ? 27 THR B CB   10 
ATOM 7782 O OG1  . THR B 2 27 ? -10.627 -9.157  -7.439  1.00 0.00 ? 27 THR B OG1  10 
ATOM 7783 C CG2  . THR B 2 27 ? -9.330  -11.029 -7.959  1.00 0.00 ? 27 THR B CG2  10 
ATOM 7784 H H    . THR B 2 27 ? -8.379  -8.357  -7.845  1.00 0.00 ? 27 THR B H    10 
ATOM 7785 H HA   . THR B 2 27 ? -9.288  -9.465  -10.424 1.00 0.00 ? 27 THR B HA   10 
ATOM 7786 H HB   . THR B 2 27 ? -11.153 -10.376 -9.013  1.00 0.00 ? 27 THR B HB   10 
ATOM 7787 H HG1  . THR B 2 27 ? -10.215 -9.517  -6.650  1.00 0.00 ? 27 THR B HG1  10 
ATOM 7788 H HG21 . THR B 2 27 ? -8.870  -11.584 -8.762  1.00 0.00 ? 27 THR B HG21 10 
ATOM 7789 H HG22 . THR B 2 27 ? -8.563  -10.514 -7.398  1.00 0.00 ? 27 THR B HG22 10 
ATOM 7790 H HG23 . THR B 2 27 ? -9.878  -11.681 -7.296  1.00 0.00 ? 27 THR B HG23 10 
ATOM 7791 N N    . PRO B 2 28 ? -9.710  -6.608  -10.127 1.00 0.00 ? 28 PRO B N    10 
ATOM 7792 C CA   . PRO B 2 28 ? -10.445 -5.349  -10.343 1.00 0.00 ? 28 PRO B CA   10 
ATOM 7793 C C    . PRO B 2 28 ? -11.939 -5.419  -10.589 1.00 0.00 ? 28 PRO B C    10 
ATOM 7794 O O    . PRO B 2 28 ? -12.397 -5.919  -11.617 1.00 0.00 ? 28 PRO B O    10 
ATOM 7795 C CB   . PRO B 2 28 ? -9.644  -4.707  -11.482 1.00 0.00 ? 28 PRO B CB   10 
ATOM 7796 C CG   . PRO B 2 28 ? -8.213  -5.059  -11.110 1.00 0.00 ? 28 PRO B CG   10 
ATOM 7797 C CD   . PRO B 2 28 ? -8.281  -6.386  -10.333 1.00 0.00 ? 28 PRO B CD   10 
ATOM 7798 H HA   . PRO B 2 28 ? -10.414 -4.736  -9.457  1.00 0.00 ? 28 PRO B HA   10 
ATOM 7799 H HB2  . PRO B 2 28 ? -9.911  -5.144  -12.431 1.00 0.00 ? 28 PRO B HB2  10 
ATOM 7800 H HB3  . PRO B 2 28 ? -9.785  -3.638  -11.493 1.00 0.00 ? 28 PRO B HB3  10 
ATOM 7801 H HG2  . PRO B 2 28 ? -7.622  -5.188  -12.005 1.00 0.00 ? 28 PRO B HG2  10 
ATOM 7802 H HG3  . PRO B 2 28 ? -7.797  -4.287  -10.481 1.00 0.00 ? 28 PRO B HG3  10 
ATOM 7803 H HD2  . PRO B 2 28 ? -7.863  -7.189  -10.920 1.00 0.00 ? 28 PRO B HD2  10 
ATOM 7804 H HD3  . PRO B 2 28 ? -7.780  -6.292  -9.382  1.00 0.00 ? 28 PRO B HD3  10 
ATOM 7805 N N    . LYS B 2 29 ? -12.696 -4.899  -9.626  1.00 0.00 ? 29 LYS B N    10 
ATOM 7806 C CA   . LYS B 2 29 ? -14.150 -4.866  -9.709  1.00 0.00 ? 29 LYS B CA   10 
ATOM 7807 C C    . LYS B 2 29 ? -14.631 -3.597  -8.986  1.00 0.00 ? 29 LYS B C    10 
ATOM 7808 O O    . LYS B 2 29 ? -15.588 -3.623  -8.216  1.00 0.00 ? 29 LYS B O    10 
ATOM 7809 C CB   . LYS B 2 29 ? -14.762 -6.148  -9.154  1.00 0.00 ? 29 LYS B CB   10 
ATOM 7810 C CG   . LYS B 2 29 ? -15.343 -7.032  -10.260 1.00 0.00 ? 29 LYS B CG   10 
ATOM 7811 C CD   . LYS B 2 29 ? -16.743 -7.524  -9.883  1.00 0.00 ? 29 LYS B CD   10 
ATOM 7812 C CE   . LYS B 2 29 ? -17.648 -7.611  -11.112 1.00 0.00 ? 29 LYS B CE   10 
ATOM 7813 N NZ   . LYS B 2 29 ? -18.347 -8.915  -11.150 1.00 0.00 ? 29 LYS B NZ   10 
ATOM 7814 H H    . LYS B 2 29 ? -12.260 -4.524  -8.832  1.00 0.00 ? 29 LYS B H    10 
ATOM 7815 H HA   . LYS B 2 29 ? -14.430 -4.768  -10.748 1.00 0.00 ? 29 LYS B HA   10 
ATOM 7816 H HB2  . LYS B 2 29 ? -13.989 -6.702  -8.643  1.00 0.00 ? 29 LYS B HB2  10 
ATOM 7817 H HB3  . LYS B 2 29 ? -15.558 -5.881  -8.476  1.00 0.00 ? 29 LYS B HB3  10 
ATOM 7818 H HG2  . LYS B 2 29 ? -15.412 -6.453  -11.169 1.00 0.00 ? 29 LYS B HG2  10 
ATOM 7819 H HG3  . LYS B 2 29 ? -14.699 -7.888  -10.395 1.00 0.00 ? 29 LYS B HG3  10 
ATOM 7820 H HD2  . LYS B 2 29 ? -16.658 -8.508  -9.445  1.00 0.00 ? 29 LYS B HD2  10 
ATOM 7821 H HD3  . LYS B 2 29 ? -17.177 -6.826  -9.182  1.00 0.00 ? 29 LYS B HD3  10 
ATOM 7822 H HE2  . LYS B 2 29 ? -18.387 -6.825  -11.062 1.00 0.00 ? 29 LYS B HE2  10 
ATOM 7823 H HE3  . LYS B 2 29 ? -17.043 -7.519  -12.002 1.00 0.00 ? 29 LYS B HE3  10 
ATOM 7824 H HZ1  . LYS B 2 29 ? -18.064 -9.484  -10.326 1.00 0.00 ? 29 LYS B HZ1  10 
ATOM 7825 H HZ2  . LYS B 2 29 ? -19.375 -8.758  -11.127 1.00 0.00 ? 29 LYS B HZ2  10 
ATOM 7826 H HZ3  . LYS B 2 29 ? -18.093 -9.419  -12.023 1.00 0.00 ? 29 LYS B HZ3  10 
ATOM 7827 N N    . THR B 2 30 ? -13.918 -2.514  -9.268  1.00 0.00 ? 30 THR B N    10 
ATOM 7828 C CA   . THR B 2 30 ? -14.233 -1.231  -8.664  1.00 0.00 ? 30 THR B CA   10 
ATOM 7829 C C    . THR B 2 30 ? -15.442 -0.594  -9.350  1.00 0.00 ? 30 THR B C    10 
ATOM 7830 O O    . THR B 2 30 ? -15.325 -0.039  -10.442 1.00 0.00 ? 30 THR B O    10 
ATOM 7831 C CB   . THR B 2 30 ? -12.969 -0.367  -8.715  1.00 0.00 ? 30 THR B CB   10 
ATOM 7832 O OG1  . THR B 2 30 ? -11.923 -1.272  -8.365  1.00 0.00 ? 30 THR B OG1  10 
ATOM 7833 C CG2  . THR B 2 30 ? -12.926 0.692   -7.613  1.00 0.00 ? 30 THR B CG2  10 
ATOM 7834 H H    . THR B 2 30 ? -13.167 -2.581  -9.894  1.00 0.00 ? 30 THR B H    10 
ATOM 7835 H HA   . THR B 2 30 ? -14.526 -1.383  -7.637  1.00 0.00 ? 30 THR B HA   10 
ATOM 7836 H HB   . THR B 2 30 ? -12.812 0.015   -9.711  1.00 0.00 ? 30 THR B HB   10 
ATOM 7837 H HG1  . THR B 2 30 ? -11.496 -0.938  -7.573  1.00 0.00 ? 30 THR B HG1  10 
ATOM 7838 H HG21 . THR B 2 30 ? -13.787 1.338   -7.698  1.00 0.00 ? 30 THR B HG21 10 
ATOM 7839 H HG22 . THR B 2 30 ? -12.956 0.184   -6.660  1.00 0.00 ? 30 THR B HG22 10 
ATOM 7840 H HG23 . THR B 2 30 ? -12.008 1.254   -7.687  1.00 0.00 ? 30 THR B HG23 10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 THR 30 30 30 THR THR B . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-04-01 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 10 CB A VAL 3  ? ? CG1 A VAL 3  ? ? 1.730 1.524 0.206 0.021 N 
2 10 CB B VAL 2  ? ? CG1 B VAL 2  ? ? 1.738 1.524 0.214 0.021 N 
3 10 CB B VAL 12 ? ? CG1 B VAL 12 ? ? 1.744 1.524 0.220 0.021 N 
4 10 CB B VAL 18 ? ? CG1 B VAL 18 ? ? 1.729 1.524 0.205 0.021 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  2  CA  A CYS 6  ? ? CB A CYS 6  ? ? SG  A CYS 6  ? ? 121.33 114.20 7.13   1.10 N 
2  3  NE  B ARG 22 ? ? CZ B ARG 22 ? ? NH2 B ARG 22 ? ? 117.18 120.30 -3.12  0.50 N 
3  3  N   B TYR 26 ? ? CA B TYR 26 ? ? C   B TYR 26 ? ? 94.68  111.00 -16.32 2.70 N 
4  6  CA  A CYS 6  ? ? CB A CYS 6  ? ? SG  A CYS 6  ? ? 121.28 114.20 7.08   1.10 N 
5  7  CA  A CYS 11 ? ? CB A CYS 11 ? ? SG  A CYS 11 ? ? 121.36 114.20 7.16   1.10 N 
6  8  CB  B TYR 16 ? ? CG B TYR 16 ? ? CD2 B TYR 16 ? ? 117.06 121.00 -3.94  0.60 N 
7  9  CB  B TYR 16 ? ? CG B TYR 16 ? ? CD2 B TYR 16 ? ? 117.11 121.00 -3.89  0.60 N 
8  10 CG1 A VAL 3  ? ? CB A VAL 3  ? ? CG2 A VAL 3  ? ? 82.39  110.90 -28.51 1.60 N 
9  10 CA  A VAL 3  ? ? CB A VAL 3  ? ? CG1 A VAL 3  ? ? 123.26 110.90 12.36  1.50 N 
10 10 CG1 B VAL 2  ? ? CB B VAL 2  ? ? CG2 B VAL 2  ? ? 83.22  110.90 -27.68 1.60 N 
11 10 CA  B VAL 2  ? ? CB B VAL 2  ? ? CG1 B VAL 2  ? ? 124.35 110.90 13.45  1.50 N 
12 10 CG1 B VAL 12 ? ? CB B VAL 12 ? ? CG2 B VAL 12 ? ? 82.43  110.90 -28.47 1.60 N 
13 10 CA  B VAL 12 ? ? CB B VAL 12 ? ? CG1 B VAL 12 ? ? 124.61 110.90 13.71  1.50 N 
14 10 CG1 B VAL 18 ? ? CB B VAL 18 ? ? CG2 B VAL 18 ? ? 83.46  110.90 -27.44 1.60 N 
15 10 CA  B VAL 18 ? ? CB B VAL 18 ? ? CG1 B VAL 18 ? ? 125.17 110.90 14.27  1.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  GLU A 4  ? ? 146.25  -56.98  
2   1  GLN A 5  ? ? 40.59   -171.58 
3   1  CYS A 6  ? ? -10.97  -31.36  
4   1  CYS A 7  ? ? 128.52  73.57   
5   1  SER A 9  ? ? -120.13 -70.56  
6   1  CYS A 11 ? ? 5.89    73.42   
7   1  GLN B 4  ? ? -125.82 -166.60 
8   1  HIS B 5  ? ? -108.92 62.53   
9   1  SER B 9  ? ? -39.37  -39.72  
10  1  TYR B 26 ? ? 116.99  65.88   
11  1  PRO B 28 ? ? -19.71  100.93  
12  2  ILE A 2  ? ? -108.01 -168.52 
13  2  GLU A 4  ? ? 101.26  -38.99  
14  2  CYS A 6  ? ? 15.73   72.66   
15  2  THR A 8  ? ? -19.72  -59.71  
16  2  SER A 9  ? ? -120.73 -72.51  
17  2  CYS A 11 ? ? 20.15   79.51   
18  2  GLN B 4  ? ? -104.36 49.35   
19  2  HIS B 5  ? ? -16.33  79.22   
20  2  GLU B 21 ? ? -141.29 26.75   
21  2  ARG B 22 ? ? -22.01  152.77  
22  2  TYR B 26 ? ? -144.82 58.73   
23  2  THR B 27 ? ? -119.14 64.50   
24  2  PRO B 28 ? ? -35.10  150.87  
25  2  LYS B 29 ? ? -117.42 60.39   
26  3  CYS A 6  ? ? 3.43    58.83   
27  3  CYS A 7  ? ? 27.43   45.56   
28  3  THR A 8  ? ? -12.62  -61.89  
29  3  SER A 9  ? ? -146.90 -37.05  
30  3  ILE A 10 ? ? -147.63 59.33   
31  3  ASN B 3  ? ? -103.54 53.58   
32  3  SER B 9  ? ? -37.93  -36.29  
33  3  PHE B 24 ? ? -18.17  -52.93  
34  3  PHE B 25 ? ? -152.22 73.88   
35  3  TYR B 26 ? ? 142.66  85.31   
36  3  THR B 27 ? ? -101.88 68.85   
37  4  GLU A 4  ? ? -5.52   67.49   
38  4  GLN A 5  ? ? -27.68  -25.21  
39  4  CYS A 7  ? ? -157.60 53.38   
40  4  THR A 8  ? ? -15.02  -79.66  
41  4  SER A 9  ? ? -132.41 -69.11  
42  4  CYS A 11 ? ? -6.34   74.37   
43  4  GLN B 4  ? ? -83.65  40.78   
44  4  HIS B 5  ? ? -105.78 62.62   
45  4  CYS B 7  ? ? 134.19  90.27   
46  4  SER B 9  ? ? -23.60  -34.99  
47  4  GLU B 21 ? ? -159.02 41.29   
48  4  THR B 27 ? ? -112.96 71.49   
49  4  PRO B 28 ? ? -57.58  88.32   
50  4  LYS B 29 ? ? -117.42 50.35   
51  5  GLU A 4  ? ? 146.20  -56.96  
52  5  GLN A 5  ? ? 40.70   -171.62 
53  5  CYS A 6  ? ? -10.98  -31.27  
54  5  CYS A 7  ? ? 128.42  73.59   
55  5  SER A 9  ? ? -120.06 -70.59  
56  5  CYS A 11 ? ? 6.05    73.41   
57  5  GLN B 4  ? ? -125.78 -166.59 
58  5  HIS B 5  ? ? -108.92 62.56   
59  5  SER B 9  ? ? -39.35  -39.78  
60  5  TYR B 26 ? ? 117.08  65.90   
61  5  PRO B 28 ? ? -19.71  100.95  
62  6  ILE A 2  ? ? -108.08 -168.58 
63  6  GLU A 4  ? ? 101.22  -38.97  
64  6  CYS A 6  ? ? 15.75   72.67   
65  6  THR A 8  ? ? -19.69  -59.72  
66  6  SER A 9  ? ? -120.75 -72.52  
67  6  CYS A 11 ? ? 20.12   79.53   
68  6  GLN B 4  ? ? -104.35 49.28   
69  6  HIS B 5  ? ? -16.36  79.23   
70  6  GLU B 21 ? ? -141.27 26.73   
71  6  ARG B 22 ? ? -21.94  152.82  
72  6  TYR B 26 ? ? -144.84 58.67   
73  6  THR B 27 ? ? -119.06 64.43   
74  6  PRO B 28 ? ? -35.13  150.86  
75  6  LYS B 29 ? ? -117.32 60.30   
76  7  GLU A 4  ? ? -0.98   93.43   
77  7  GLN A 5  ? ? -151.85 48.53   
78  7  CYS A 6  ? ? 2.49    94.64   
79  7  CYS A 7  ? ? 33.42   39.62   
80  7  THR A 8  ? ? -7.37   -67.35  
81  7  SER A 9  ? ? -125.91 -66.34  
82  7  CYS A 11 ? ? 8.93    65.84   
83  7  TYR A 19 ? ? -90.64  30.12   
84  7  ASN B 3  ? ? 72.85   42.42   
85  7  HIS B 5  ? ? -110.44 69.12   
86  7  CYS B 7  ? ? -93.86  -60.07  
87  7  SER B 9  ? ? -39.09  -33.65  
88  7  VAL B 18 ? ? -98.44  -72.98  
89  7  CYS B 19 ? ? -149.53 -50.67  
90  7  GLU B 21 ? ? 116.49  49.43   
91  7  ARG B 22 ? ? 12.28   86.22   
92  7  PHE B 24 ? ? -1.16   91.08   
93  7  TYR B 26 ? ? -121.36 -57.30  
94  7  THR B 27 ? ? -161.01 44.99   
95  8  ILE A 2  ? ? 58.76   -166.34 
96  8  VAL A 3  ? ? 45.45   -165.36 
97  8  GLN A 5  ? ? 135.58  167.34  
98  8  THR A 8  ? ? -6.43   -53.74  
99  8  SER A 9  ? ? -142.13 -63.21  
100 8  CYS A 11 ? ? 26.59   63.48   
101 8  GLN B 4  ? ? -120.30 -169.85 
102 8  HIS B 5  ? ? -107.82 68.93   
103 8  CYS B 7  ? ? -105.72 41.40   
104 8  GLU B 21 ? ? -109.87 42.13   
105 8  TYR B 26 ? ? -106.22 -68.14  
106 8  THR B 27 ? ? -170.84 49.01   
107 8  LYS B 29 ? ? -0.48   98.44   
108 9  ILE A 2  ? ? 58.83   -166.36 
109 9  VAL A 3  ? ? 45.45   -165.36 
110 9  GLN A 5  ? ? 135.54  167.34  
111 9  THR A 8  ? ? -6.38   -53.76  
112 9  SER A 9  ? ? -142.18 -63.15  
113 9  CYS A 11 ? ? 26.58   63.48   
114 9  GLN B 4  ? ? -120.27 -169.82 
115 9  HIS B 5  ? ? -107.88 69.01   
116 9  CYS B 7  ? ? -105.70 41.43   
117 9  GLU B 21 ? ? -109.84 42.11   
118 9  TYR B 26 ? ? -106.24 -68.13  
119 9  THR B 27 ? ? -170.88 49.05   
120 9  LYS B 29 ? ? -0.41   98.36   
121 10 VAL A 3  ? ? -69.08  -160.18 
122 10 GLU A 4  ? ? 109.23  -28.14  
123 10 GLN A 5  ? ? -90.77  33.12   
124 10 CYS A 6  ? ? 84.92   48.93   
125 10 CYS A 7  ? ? 69.48   63.39   
126 10 SER A 9  ? ? -131.18 -74.48  
127 10 CYS A 11 ? ? 41.31   76.01   
128 10 ASN B 3  ? ? -64.66  99.82   
129 10 HIS B 5  ? ? -18.65  72.60   
130 10 GLU B 21 ? ? -142.80 41.95   
131 10 TYR B 26 ? ? -160.73 64.84   
132 10 PRO B 28 ? ? -20.06  112.85  
133 10 LYS B 29 ? ? -147.41 43.75   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1  ARG B 22 ? ? 0.299 'SIDE CHAIN' 
2 2  ARG B 22 ? ? 0.262 'SIDE CHAIN' 
3 4  ARG B 22 ? ? 0.301 'SIDE CHAIN' 
4 5  ARG B 22 ? ? 0.299 'SIDE CHAIN' 
5 6  ARG B 22 ? ? 0.263 'SIDE CHAIN' 
6 7  ARG B 22 ? ? 0.296 'SIDE CHAIN' 
7 8  ARG B 22 ? ? 0.287 'SIDE CHAIN' 
8 9  ARG B 22 ? ? 0.287 'SIDE CHAIN' 
9 10 ARG B 22 ? ? 0.231 'SIDE CHAIN' 
#