data_1XHU
# 
_entry.id   1XHU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XHU         
NDB   PD0594       
RCSB  RCSB030379   
WWPDB D_1000030379 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KC6 'HincII bound to cognate DNA containing GTCGAC'          unspecified 
PDB 1TW8 'HincII bound to cognate DNA containing GTCGAC and Ca2+' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XHU 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Etzkorn, C.'  1 
'Horton, N.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            343 
_citation.page_first                833 
_citation.page_last                 849 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15476804 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2004.08.082 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Etzkorn, C.'  1 
primary 'Horton, N.C.' 2 
# 
_cell.entry_id           1XHU 
_cell.length_a           67.20 
_cell.length_b           177.2 
_cell.length_c           256.0 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              32 
# 
_symmetry.entry_id                         1XHU 
_symmetry.space_group_name_H-M             'I 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                24 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*GP*CP*CP*GP*GP*TP*C)-3'"     2114.398  4   ?        ? ? ? 
2 polymer syn "5'-D(P*GP*AP*CP*CP*GP*G)-3'"       1834.230  4   ?        ? ? ? 
3 polymer man 'Type II restriction enzyme HincII' 29820.066 4   3.1.21.4 ? ? ? 
4 water   nat water                               18.015    559 ?        ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'Endonuclease HincII, R.HincII' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)(DG)(DT)(DC)' GCCGGTC E,G,I,K ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DC)(DC)(DG)(DG)' GACCGG F,H,J,L ? 
3 'polypeptide(L)'        no no 
;SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAIIGHEARYKLFN
SPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQR
AISMIDKFVKPFKKYIL
;
;SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAIIGHEARYKLFN
SPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQR
AISMIDKFVKPFKKYIL
;
A,B,C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DC  n 
1 4   DG  n 
1 5   DG  n 
1 6   DT  n 
1 7   DC  n 
2 1   DG  n 
2 2   DA  n 
2 3   DC  n 
2 4   DC  n 
2 5   DG  n 
2 6   DG  n 
3 1   SER n 
3 2   PHE n 
3 3   ILE n 
3 4   LYS n 
3 5   PRO n 
3 6   ILE n 
3 7   TYR n 
3 8   GLN n 
3 9   ASP n 
3 10  ILE n 
3 11  ASN n 
3 12  SER n 
3 13  ILE n 
3 14  LEU n 
3 15  ILE n 
3 16  GLY n 
3 17  GLN n 
3 18  LYS n 
3 19  VAL n 
3 20  LYS n 
3 21  ARG n 
3 22  PRO n 
3 23  LYS n 
3 24  SER n 
3 25  GLY n 
3 26  THR n 
3 27  LEU n 
3 28  SER n 
3 29  GLY n 
3 30  HIS n 
3 31  ALA n 
3 32  ALA n 
3 33  GLY n 
3 34  GLU n 
3 35  PRO n 
3 36  PHE n 
3 37  GLU n 
3 38  LYS n 
3 39  LEU n 
3 40  VAL n 
3 41  TYR n 
3 42  LYS n 
3 43  PHE n 
3 44  LEU n 
3 45  LYS n 
3 46  GLU n 
3 47  ASN n 
3 48  LEU n 
3 49  SER n 
3 50  ASP n 
3 51  LEU n 
3 52  THR n 
3 53  PHE n 
3 54  LYS n 
3 55  GLN n 
3 56  TYR n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  ASN n 
3 61  ASP n 
3 62  LEU n 
3 63  PHE n 
3 64  MET n 
3 65  LYS n 
3 66  ASN n 
3 67  PRO n 
3 68  ALA n 
3 69  ILE n 
3 70  ILE n 
3 71  GLY n 
3 72  HIS n 
3 73  GLU n 
3 74  ALA n 
3 75  ARG n 
3 76  TYR n 
3 77  LYS n 
3 78  LEU n 
3 79  PHE n 
3 80  ASN n 
3 81  SER n 
3 82  PRO n 
3 83  THR n 
3 84  LEU n 
3 85  LEU n 
3 86  PHE n 
3 87  LEU n 
3 88  LEU n 
3 89  SER n 
3 90  ARG n 
3 91  GLY n 
3 92  LYS n 
3 93  ALA n 
3 94  ALA n 
3 95  THR n 
3 96  GLU n 
3 97  ASN n 
3 98  TRP n 
3 99  SER n 
3 100 ILE n 
3 101 GLU n 
3 102 ASN n 
3 103 LEU n 
3 104 PHE n 
3 105 GLU n 
3 106 GLU n 
3 107 LYS n 
3 108 GLN n 
3 109 ASN n 
3 110 ASP n 
3 111 THR n 
3 112 ALA n 
3 113 ASP n 
3 114 ILE n 
3 115 LEU n 
3 116 LEU n 
3 117 VAL n 
3 118 LYS n 
3 119 ASP n 
3 120 GLN n 
3 121 PHE n 
3 122 TYR n 
3 123 GLU n 
3 124 LEU n 
3 125 LEU n 
3 126 ASP n 
3 127 VAL n 
3 128 LYS n 
3 129 THR n 
3 130 ARG n 
3 131 ASN n 
3 132 ILE n 
3 133 SER n 
3 134 LYS n 
3 135 SER n 
3 136 ALA n 
3 137 GLN n 
3 138 ALA n 
3 139 PRO n 
3 140 ASN n 
3 141 ILE n 
3 142 ILE n 
3 143 SER n 
3 144 ALA n 
3 145 TYR n 
3 146 LYS n 
3 147 LEU n 
3 148 ALA n 
3 149 GLN n 
3 150 THR n 
3 151 CYS n 
3 152 ALA n 
3 153 LYS n 
3 154 MET n 
3 155 ILE n 
3 156 ASP n 
3 157 ASN n 
3 158 LYS n 
3 159 GLU n 
3 160 PHE n 
3 161 ASP n 
3 162 LEU n 
3 163 PHE n 
3 164 ASP n 
3 165 ILE n 
3 166 ASN n 
3 167 TYR n 
3 168 LEU n 
3 169 GLU n 
3 170 VAL n 
3 171 ASP n 
3 172 TRP n 
3 173 GLU n 
3 174 LEU n 
3 175 ASN n 
3 176 GLY n 
3 177 GLU n 
3 178 ASP n 
3 179 LEU n 
3 180 VAL n 
3 181 CYS n 
3 182 VAL n 
3 183 SER n 
3 184 THR n 
3 185 SER n 
3 186 PHE n 
3 187 ALA n 
3 188 GLU n 
3 189 LEU n 
3 190 PHE n 
3 191 LYS n 
3 192 SER n 
3 193 GLU n 
3 194 PRO n 
3 195 SER n 
3 196 GLU n 
3 197 LEU n 
3 198 TYR n 
3 199 ILE n 
3 200 ASN n 
3 201 TRP n 
3 202 ALA n 
3 203 ALA n 
3 204 ALA n 
3 205 MET n 
3 206 GLN n 
3 207 ILE n 
3 208 GLN n 
3 209 PHE n 
3 210 HIS n 
3 211 VAL n 
3 212 ARG n 
3 213 ASP n 
3 214 LEU n 
3 215 ASP n 
3 216 GLN n 
3 217 GLY n 
3 218 PHE n 
3 219 ASN n 
3 220 GLY n 
3 221 THR n 
3 222 ARG n 
3 223 GLU n 
3 224 GLU n 
3 225 TRP n 
3 226 ALA n 
3 227 LYS n 
3 228 SER n 
3 229 TYR n 
3 230 LEU n 
3 231 LYS n 
3 232 HIS n 
3 233 PHE n 
3 234 VAL n 
3 235 THR n 
3 236 GLN n 
3 237 ALA n 
3 238 GLU n 
3 239 GLN n 
3 240 ARG n 
3 241 ALA n 
3 242 ILE n 
3 243 SER n 
3 244 MET n 
3 245 ILE n 
3 246 ASP n 
3 247 LYS n 
3 248 PHE n 
3 249 VAL n 
3 250 LYS n 
3 251 PRO n 
3 252 PHE n 
3 253 LYS n 
3 254 LYS n 
3 255 TYR n 
3 256 ILE n 
3 257 LEU n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Haemophilus 
_entity_src_gen.pdbx_gene_src_gene                 hincIIR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Haemophilus influenzae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     727 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'phosphoramidite synthetic chemistry' 
2 1 sample ? ? ? ? ? 'phosphoramidite synthetic chemistry' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP T2C2_HAEIN P17743 3 
;SFIKPIYQDINSILIGQKVKRPKSGTLSGHAAGEPFEKLVYKFLKENLSDLTFKQYEYLNDLFMKNPAIIGHEARYKLFN
SPTLLFLLSRGKAATENWSIENLFEEKQNDTADILLVKDQFYELLDVKRRNISKSAQAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDSELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQR
AISMIDKFVKPFKKYIL
;
1 ? 
2 PDB 1XHU       1XHU   1 ? ? ? 
3 PDB 1XHU       1XHU   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1XHU A 1 ? 257 ? P17743 1 ? 257 ? 2 258 
2  1 1XHU B 1 ? 257 ? P17743 1 ? 257 ? 2 258 
3  1 1XHU C 1 ? 257 ? P17743 1 ? 257 ? 2 258 
4  1 1XHU D 1 ? 257 ? P17743 1 ? 257 ? 2 258 
5  2 1XHU E 1 ? 7   ? 1XHU   1 ? 7   ? 1 7   
6  3 1XHU F 1 ? 6   ? 1XHU   8 ? 13  ? 8 13  
7  2 1XHU G 1 ? 7   ? 1XHU   1 ? 7   ? 1 7   
8  3 1XHU H 1 ? 6   ? 1XHU   8 ? 13  ? 8 13  
9  2 1XHU I 1 ? 7   ? 1XHU   1 ? 7   ? 1 7   
10 3 1XHU J 1 ? 6   ? 1XHU   8 ? 13  ? 8 13  
11 2 1XHU K 1 ? 7   ? 1XHU   1 ? 7   ? 1 7   
12 3 1XHU L 1 ? 6   ? 1XHU   8 ? 13  ? 8 13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XHU THR A 129 ? UNP P17743 ARG 129 CONFLICT 130 1 
1 1XHU TRP A 172 ? UNP P17743 SER 172 CONFLICT 173 2 
2 1XHU THR B 129 ? UNP P17743 ARG 129 CONFLICT 130 3 
2 1XHU TRP B 172 ? UNP P17743 SER 172 CONFLICT 173 4 
3 1XHU THR C 129 ? UNP P17743 ARG 129 CONFLICT 130 5 
3 1XHU TRP C 172 ? UNP P17743 SER 172 CONFLICT 173 6 
4 1XHU THR D 129 ? UNP P17743 ARG 129 CONFLICT 130 7 
4 1XHU TRP D 172 ? UNP P17743 SER 172 CONFLICT 173 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1XHU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.82 
_exptl_crystal.density_percent_sol   56.40 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, NaCl, citrate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000' ? ? ? 
1 2 1 NaCl       ? ? ? 
1 3 1 citrate    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9 
# 
_reflns.entry_id                     1XHU 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.95 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   27364 
_reflns.percent_possible_obs         85.4 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_Rsym_value              0.078 
_reflns.pdbx_netI_over_sigmaI        6.1 
_reflns.B_iso_Wilson_estimate        46.2 
_reflns.pdbx_redundancy              2.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1XHU 
_refine.ls_d_res_high                            2.95 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          3 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     27364 
_refine.ls_number_reflns_obs                     23369 
_refine.ls_number_reflns_R_free                  1368 
_refine.ls_percent_reflns_obs                    85.4 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.277 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KC6 with water removed' 
_refine.pdbx_ls_cross_valid_method               'R free' 
_refine.pdbx_R_Free_selection_details            '5% random' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'as in CNS' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8135 
_refine_hist.pdbx_number_atoms_nucleic_acid   1064 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             559 
_refine_hist.number_atoms_total               9758 
_refine_hist.d_res_high                       2.95 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.38  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1XHU 
_struct.title                     'HincII bound to cleaved, cognate DNA containing GTCGAC' 
_struct.pdbx_descriptor           
;5'-D(*GP*CP*CP*GP*GP*TP*C)-3'/ 5'-D(P*GP*AP*CP*CP*GP*G)-3'/ Type II restriction enzyme HincII
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XHU 
_struct_keywords.pdbx_keywords   hydrolase/DNA 
_struct_keywords.text            'restriction endonuclease, phosphoryl transfer, hydrolase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
W N N 4 ? 
X N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE I 3   ? PRO I 5   ? ILE A 4   PRO A 6   5 ? 3  
HELX_P HELX_P2  2  ILE I 6   ? ILE I 15  ? ILE A 7   ILE A 16  1 ? 10 
HELX_P HELX_P3  3  SER I 28  ? ALA I 32  ? SER A 29  ALA A 33  5 ? 5  
HELX_P HELX_P4  4  GLY I 33  ? LEU I 48  ? GLY A 34  LEU A 49  1 ? 16 
HELX_P HELX_P5  5  LYS I 54  ? LYS I 65  ? LYS A 55  LYS A 66  1 ? 12 
HELX_P HELX_P6  6  GLY I 71  ? TYR I 76  ? GLY A 72  TYR A 77  1 ? 6  
HELX_P HELX_P7  7  SER I 81  ? SER I 89  ? SER A 82  SER A 90  1 ? 9  
HELX_P HELX_P8  8  GLY I 91  ? TRP I 98  ? GLY A 92  TRP A 99  1 ? 8  
HELX_P HELX_P9  9  ALA I 144 ? LYS I 158 ? ALA A 145 LYS A 159 1 ? 15 
HELX_P HELX_P10 10 PHE I 190 ? SER I 192 ? PHE A 191 SER A 193 5 ? 3  
HELX_P HELX_P11 11 HIS I 210 ? LEU I 214 ? HIS A 211 LEU A 215 5 ? 5  
HELX_P HELX_P12 12 THR I 221 ? VAL I 249 ? THR A 222 VAL A 250 1 ? 29 
HELX_P HELX_P13 13 LYS I 250 ? LYS I 253 ? LYS A 251 LYS A 254 5 ? 4  
HELX_P HELX_P14 14 ILE J 3   ? PRO J 5   ? ILE B 4   PRO B 6   5 ? 3  
HELX_P HELX_P15 15 ILE J 6   ? ILE J 15  ? ILE B 7   ILE B 16  1 ? 10 
HELX_P HELX_P16 16 PRO J 22  ? GLY J 25  ? PRO B 23  GLY B 26  5 ? 4  
HELX_P HELX_P17 17 PRO J 35  ? LEU J 48  ? PRO B 36  LEU B 49  1 ? 14 
HELX_P HELX_P18 18 LYS J 54  ? LYS J 65  ? LYS B 55  LYS B 66  1 ? 12 
HELX_P HELX_P19 19 ILE J 70  ? LYS J 77  ? ILE B 71  LYS B 78  1 ? 8  
HELX_P HELX_P20 20 SER J 81  ? SER J 89  ? SER B 82  SER B 90  1 ? 9  
HELX_P HELX_P21 21 GLY J 91  ? ASN J 97  ? GLY B 92  ASN B 98  1 ? 7  
HELX_P HELX_P22 22 ALA J 144 ? LYS J 158 ? ALA B 145 LYS B 159 1 ? 15 
HELX_P HELX_P23 23 PHE J 190 ? SER J 192 ? PHE B 191 SER B 193 5 ? 3  
HELX_P HELX_P24 24 THR J 221 ? VAL J 249 ? THR B 222 VAL B 250 1 ? 29 
HELX_P HELX_P25 25 PHE K 2   ? ILE K 15  ? PHE C 3   ILE C 16  1 ? 14 
HELX_P HELX_P26 26 PRO K 22  ? GLY K 25  ? PRO C 23  GLY C 26  5 ? 4  
HELX_P HELX_P27 27 SER K 28  ? ALA K 32  ? SER C 29  ALA C 33  5 ? 5  
HELX_P HELX_P28 28 GLY K 33  ? GLU K 46  ? GLY C 34  GLU C 47  1 ? 14 
HELX_P HELX_P29 29 GLN K 55  ? PHE K 63  ? GLN C 56  PHE C 64  1 ? 9  
HELX_P HELX_P30 30 GLY K 71  ? TYR K 76  ? GLY C 72  TYR C 77  1 ? 6  
HELX_P HELX_P31 31 ASN K 80  ? LEU K 87  ? ASN C 81  LEU C 88  1 ? 8  
HELX_P HELX_P32 32 ALA K 93  ? ASN K 97  ? ALA C 94  ASN C 98  5 ? 5  
HELX_P HELX_P33 33 ALA K 144 ? ILE K 155 ? ALA C 145 ILE C 156 1 ? 12 
HELX_P HELX_P34 34 PHE K 190 ? SER K 192 ? PHE C 191 SER C 193 5 ? 3  
HELX_P HELX_P35 35 HIS K 210 ? LEU K 214 ? HIS C 211 LEU C 215 5 ? 5  
HELX_P HELX_P36 36 THR K 221 ? MET K 244 ? THR C 222 MET C 245 1 ? 24 
HELX_P HELX_P37 37 MET K 244 ? VAL K 249 ? MET C 245 VAL C 250 1 ? 6  
HELX_P HELX_P38 38 LYS K 250 ? LYS K 253 ? LYS C 251 LYS C 254 5 ? 4  
HELX_P HELX_P39 39 ILE L 3   ? ILE L 15  ? ILE D 4   ILE D 16  1 ? 13 
HELX_P HELX_P40 40 GLY L 33  ? LEU L 48  ? GLY D 34  LEU D 49  1 ? 16 
HELX_P HELX_P41 41 LYS L 54  ? LYS L 65  ? LYS D 55  LYS D 66  1 ? 12 
HELX_P HELX_P42 42 ILE L 70  ? TYR L 76  ? ILE D 71  TYR D 77  1 ? 7  
HELX_P HELX_P43 43 LYS L 77  ? PHE L 79  ? LYS D 78  PHE D 80  5 ? 3  
HELX_P HELX_P44 44 SER L 81  ? SER L 89  ? SER D 82  SER D 90  1 ? 9  
HELX_P HELX_P45 45 GLY L 91  ? ASN L 97  ? GLY D 92  ASN D 98  1 ? 7  
HELX_P HELX_P46 46 ALA L 144 ? LYS L 158 ? ALA D 145 LYS D 159 1 ? 15 
HELX_P HELX_P47 47 PHE L 190 ? SER L 192 ? PHE D 191 SER D 193 5 ? 3  
HELX_P HELX_P48 48 GLU L 193 ? LEU L 197 ? GLU D 194 LEU D 198 5 ? 5  
HELX_P HELX_P49 49 HIS L 210 ? LEU L 214 ? HIS D 211 LEU D 215 5 ? 5  
HELX_P HELX_P50 50 THR L 221 ? SER L 243 ? THR D 222 SER D 244 1 ? 23 
HELX_P HELX_P51 51 VAL L 249 ? LYS L 253 ? VAL D 250 LYS D 254 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 1 N1 ? ? ? 1_555 E DC 2 N3 ? ? E DG 1  I DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 1 N2 ? ? ? 1_555 E DC 2 O2 ? ? E DG 1  I DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 1 O6 ? ? ? 1_555 E DC 2 N4 ? ? E DG 1  I DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DC 2 N4 ? ? ? 1_555 E DG 1 O6 ? ? E DC 2  I DG 1  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog5  hydrog ? ? A DC 3 N3 ? ? ? 1_555 D DG 5 N1 ? ? E DC 3  H DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DC 3 N4 ? ? ? 1_555 D DG 5 O6 ? ? E DC 3  H DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DC 3 O2 ? ? ? 1_555 D DG 5 N2 ? ? E DC 3  H DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4 N1 ? ? ? 1_555 D DC 4 N3 ? ? E DG 4  H DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 4 N2 ? ? ? 1_555 D DC 4 O2 ? ? E DG 4  H DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 4 O6 ? ? ? 1_555 D DC 4 N4 ? ? E DG 4  H DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5 N1 ? ? ? 1_555 D DC 3 N3 ? ? E DG 5  H DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 5 N2 ? ? ? 1_555 D DC 3 O2 ? ? E DG 5  H DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 5 O6 ? ? ? 1_555 D DC 3 N4 ? ? E DG 5  H DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 6 N3 ? ? ? 1_555 D DA 2 N1 ? ? E DT 6  H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 6 O4 ? ? ? 1_555 D DA 2 N6 ? ? E DT 6  H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DC 7 N3 ? ? ? 1_555 D DG 1 N1 ? ? E DC 7  H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DC 7 N4 ? ? ? 1_555 D DG 1 O6 ? ? E DC 7  H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DC 7 O2 ? ? ? 1_555 D DG 1 N2 ? ? E DC 7  H DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DG 1 N1 ? ? ? 1_555 C DC 7 N3 ? ? F DG 8  G DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DG 1 N2 ? ? ? 1_555 C DC 7 O2 ? ? F DG 8  G DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DG 1 O6 ? ? ? 1_555 C DC 7 N4 ? ? F DG 8  G DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DA 2 N1 ? ? ? 1_555 C DT 6 N3 ? ? F DA 9  G DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DA 2 N6 ? ? ? 1_555 C DT 6 O4 ? ? F DA 9  G DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DC 3 N3 ? ? ? 1_555 C DG 5 N1 ? ? F DC 10 G DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? B DC 3 N4 ? ? ? 1_555 C DG 5 O6 ? ? F DC 10 G DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? B DC 3 O2 ? ? ? 1_555 C DG 5 N2 ? ? F DC 10 G DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DC 4 N3 ? ? ? 1_555 C DG 4 N1 ? ? F DC 11 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DC 4 N4 ? ? ? 1_555 C DG 4 O6 ? ? F DC 11 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DC 4 O2 ? ? ? 1_555 C DG 4 N2 ? ? F DC 11 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DG 5 N1 ? ? ? 1_555 C DC 3 N3 ? ? F DG 12 G DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DG 5 N2 ? ? ? 1_555 C DC 3 O2 ? ? F DG 12 G DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? B DG 5 O6 ? ? ? 1_555 C DC 3 N4 ? ? F DG 12 G DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? E DC 3 N3 ? ? ? 1_555 H DG 5 N1 ? ? I DC 3  L DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? E DC 3 N4 ? ? ? 1_555 H DG 5 O6 ? ? I DC 3  L DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? E DC 3 O2 ? ? ? 1_555 H DG 5 N2 ? ? I DC 3  L DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? E DG 4 N1 ? ? ? 1_555 H DC 4 N3 ? ? I DG 4  L DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? E DG 4 N2 ? ? ? 1_555 H DC 4 O2 ? ? I DG 4  L DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? E DG 4 O6 ? ? ? 1_555 H DC 4 N4 ? ? I DG 4  L DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? E DG 5 N1 ? ? ? 1_555 H DC 3 N3 ? ? I DG 5  L DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? E DG 5 N2 ? ? ? 1_555 H DC 3 O2 ? ? I DG 5  L DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? E DG 5 O6 ? ? ? 1_555 H DC 3 N4 ? ? I DG 5  L DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? E DT 6 N3 ? ? ? 1_555 H DA 2 N1 ? ? I DT 6  L DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? E DT 6 O4 ? ? ? 1_555 H DA 2 N6 ? ? I DT 6  L DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? E DC 7 N3 ? ? ? 1_555 H DG 1 N1 ? ? I DC 7  L DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? E DC 7 N4 ? ? ? 1_555 H DG 1 O6 ? ? I DC 7  L DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? E DC 7 O2 ? ? ? 1_555 H DG 1 N2 ? ? I DC 7  L DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? F DG 1 N1 ? ? ? 1_555 G DC 7 N3 ? ? J DG 8  K DC 7  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? 
hydrog48 hydrog ? ? F DA 2 N1 ? ? ? 1_555 G DT 6 N3 ? ? J DA 9  K DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? F DA 2 N6 ? ? ? 1_555 G DT 6 O4 ? ? J DA 9  K DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? F DC 3 N3 ? ? ? 1_555 G DG 5 N1 ? ? J DC 10 K DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? F DC 3 N4 ? ? ? 1_555 G DG 5 O6 ? ? J DC 10 K DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? F DC 3 O2 ? ? ? 1_555 G DG 5 N2 ? ? J DC 10 K DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? F DC 4 N3 ? ? ? 1_555 G DG 4 N1 ? ? J DC 11 K DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? F DC 4 N4 ? ? ? 1_555 G DG 4 O6 ? ? J DC 11 K DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? F DC 4 O2 ? ? ? 1_555 G DG 4 N2 ? ? J DC 11 K DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? F DG 5 N1 ? ? ? 1_555 G DC 3 N3 ? ? J DG 12 K DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? F DG 5 N2 ? ? ? 1_555 G DC 3 O2 ? ? J DG 12 K DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? F DG 5 O6 ? ? ? 1_555 G DC 3 N4 ? ? J DG 12 K DC 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 6 ? 
D ? 3 ? 
E ? 6 ? 
F ? 3 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS I 18  ? VAL I 19  ? LYS A 19  VAL A 20  
A 2 LEU I 179 ? GLU I 188 ? LEU A 180 GLU A 189 
A 3 PHE I 163 ? GLU I 173 ? PHE A 164 GLU A 174 
A 4 PHE I 121 ? ASN I 131 ? PHE A 122 ASN A 132 
A 5 ILE I 114 ? LYS I 118 ? ILE A 115 LYS A 119 
A 6 THR I 52  ? PHE I 53  ? THR A 53  PHE A 54  
B 1 ASN I 140 ? SER I 143 ? ASN A 141 SER A 144 
B 2 GLN I 206 ? GLN I 208 ? GLN A 207 GLN A 209 
B 3 ILE I 199 ? ASN I 200 ? ILE A 200 ASN A 201 
C 1 LYS J 18  ? LYS J 20  ? LYS B 19  LYS B 21  
C 2 ASP J 178 ? GLU J 188 ? ASP B 179 GLU B 189 
C 3 PHE J 163 ? LEU J 174 ? PHE B 164 LEU B 175 
C 4 TYR J 122 ? ASN J 131 ? TYR B 123 ASN B 132 
C 5 ILE J 114 ? LEU J 116 ? ILE B 115 LEU B 117 
C 6 THR J 52  ? PHE J 53  ? THR B 53  PHE B 54  
D 1 ASN J 140 ? SER J 143 ? ASN B 141 SER B 144 
D 2 GLN J 206 ? GLN J 208 ? GLN B 207 GLN B 209 
D 3 TYR J 198 ? ASN J 200 ? TYR B 199 ASN B 201 
E 1 LYS K 18  ? LYS K 20  ? LYS C 19  LYS C 21  
E 2 ASP K 178 ? GLU K 188 ? ASP C 179 GLU C 189 
E 3 ILE K 165 ? GLU K 173 ? ILE C 166 GLU C 174 
E 4 TYR K 122 ? LYS K 128 ? TYR C 123 LYS C 129 
E 5 ILE K 114 ? VAL K 117 ? ILE C 115 VAL C 118 
E 6 THR K 52  ? PHE K 53  ? THR C 53  PHE C 54  
F 1 ASN K 140 ? SER K 143 ? ASN C 141 SER C 144 
F 2 GLN K 206 ? GLN K 208 ? GLN C 207 GLN C 209 
F 3 TYR K 198 ? ASN K 200 ? TYR C 199 ASN C 201 
G 1 ILE L 114 ? LYS L 118 ? ILE D 115 LYS D 119 
G 2 PHE L 121 ? ASP L 126 ? PHE D 122 ASP D 127 
G 3 PHE L 163 ? TYR L 167 ? PHE D 164 TYR D 168 
G 4 ALA L 187 ? GLU L 188 ? ALA D 188 GLU D 189 
H 1 THR L 129 ? ASN L 131 ? THR D 130 ASN D 132 
H 2 VAL L 170 ? ASN L 175 ? VAL D 171 ASN D 176 
H 3 ASP L 178 ? THR L 184 ? ASP D 179 THR D 185 
I 1 ASN L 140 ? SER L 143 ? ASN D 141 SER D 144 
I 2 GLN L 206 ? GLN L 208 ? GLN D 207 GLN D 209 
I 3 ILE L 199 ? ASN L 200 ? ILE D 200 ASN D 201 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL I 19  ? N VAL A 20  O LEU I 179 ? O LEU A 180 
A 2 3 O SER I 185 ? O SER A 186 N GLU I 169 ? N GLU A 170 
A 3 4 O VAL I 170 ? O VAL A 171 N LYS I 128 ? N LYS A 129 
A 4 5 O LEU I 125 ? O LEU A 126 N ILE I 114 ? N ILE A 115 
A 5 6 O LEU I 115 ? O LEU A 116 N PHE I 53  ? N PHE A 54  
B 1 2 N ILE I 142 ? N ILE A 143 O ILE I 207 ? O ILE A 208 
B 2 3 O GLN I 206 ? O GLN A 207 N ASN I 200 ? N ASN A 201 
C 1 2 N VAL J 19  ? N VAL B 20  O LEU J 179 ? O LEU B 180 
C 2 3 O VAL J 180 ? O VAL B 181 N GLU J 173 ? N GLU B 174 
C 3 4 O VAL J 170 ? O VAL B 171 N LYS J 128 ? N LYS B 129 
C 4 5 O LEU J 125 ? O LEU B 126 N ILE J 114 ? N ILE B 115 
C 5 6 O LEU J 115 ? O LEU B 116 N PHE J 53  ? N PHE B 54  
D 1 2 N ILE J 141 ? N ILE B 142 O ILE J 207 ? O ILE B 208 
D 2 3 O GLN J 206 ? O GLN B 207 N ASN J 200 ? N ASN B 201 
E 1 2 N VAL K 19  ? N VAL C 20  O LEU K 179 ? O LEU C 180 
E 2 3 O SER K 185 ? O SER C 186 N GLU K 169 ? N GLU C 170 
E 3 4 O LEU K 168 ? O LEU C 169 N ASP K 126 ? N ASP C 127 
E 4 5 O LEU K 125 ? O LEU C 126 N ILE K 114 ? N ILE C 115 
E 5 6 O LEU K 115 ? O LEU C 116 N PHE K 53  ? N PHE C 54  
F 1 2 N ILE K 141 ? N ILE C 142 O ILE K 207 ? O ILE C 208 
F 2 3 O GLN K 206 ? O GLN C 207 N ASN K 200 ? N ASN C 201 
G 1 2 N LEU L 116 ? N LEU D 117 O GLU L 123 ? O GLU D 124 
G 2 3 N ASP L 126 ? N ASP D 127 O ASN L 166 ? O ASN D 167 
G 3 4 N TYR L 167 ? N TYR D 168 O ALA L 187 ? O ALA D 188 
H 1 2 N ARG L 130 ? N ARG D 131 O TRP L 172 ? O TRP D 173 
H 2 3 N ASP L 171 ? N ASP D 172 O SER L 183 ? O SER D 184 
I 1 2 N ILE L 142 ? N ILE D 143 O ILE L 207 ? O ILE D 208 
I 2 3 O GLN L 206 ? O GLN D 207 N ASN L 200 ? N ASN D 201 
# 
_database_PDB_matrix.entry_id          1XHU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XHU 
_atom_sites.fract_transf_matrix[1][1]   0.014881 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005643 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003906 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DG  A 1 1   ? 19.727  -0.522  221.282 1.00 102.47 ? 1   DG  E "O5'" 1 
ATOM   2    C "C5'" . DG  A 1 1   ? 18.687  -0.210  220.331 1.00 104.02 ? 1   DG  E "C5'" 1 
ATOM   3    C "C4'" . DG  A 1 1   ? 18.752  1.251   219.947 1.00 100.94 ? 1   DG  E "C4'" 1 
ATOM   4    O "O4'" . DG  A 1 1   ? 20.081  1.557   219.471 1.00 97.49  ? 1   DG  E "O4'" 1 
ATOM   5    C "C3'" . DG  A 1 1   ? 17.807  1.648   218.817 1.00 97.05  ? 1   DG  E "C3'" 1 
ATOM   6    O "O3'" . DG  A 1 1   ? 17.433  3.021   218.960 1.00 113.92 ? 1   DG  E "O3'" 1 
ATOM   7    C "C2'" . DG  A 1 1   ? 18.672  1.483   217.586 1.00 91.98  ? 1   DG  E "C2'" 1 
ATOM   8    C "C1'" . DG  A 1 1   ? 20.033  1.918   218.101 1.00 92.89  ? 1   DG  E "C1'" 1 
ATOM   9    N N9    . DG  A 1 1   ? 21.158  1.272   217.440 1.00 92.71  ? 1   DG  E N9    1 
ATOM   10   C C8    . DG  A 1 1   ? 21.117  0.382   216.392 1.00 95.44  ? 1   DG  E C8    1 
ATOM   11   N N7    . DG  A 1 1   ? 22.301  0.005   215.993 1.00 95.89  ? 1   DG  E N7    1 
ATOM   12   C C5    . DG  A 1 1   ? 23.174  0.683   216.833 1.00 96.85  ? 1   DG  E C5    1 
ATOM   13   C C6    . DG  A 1 1   ? 24.599  0.687   216.873 1.00 99.19  ? 1   DG  E C6    1 
ATOM   14   O O6    . DG  A 1 1   ? 25.401  0.091   216.128 1.00 96.84  ? 1   DG  E O6    1 
ATOM   15   N N1    . DG  A 1 1   ? 25.074  1.500   217.901 1.00 99.38  ? 1   DG  E N1    1 
ATOM   16   C C2    . DG  A 1 1   ? 24.283  2.231   218.764 1.00 99.05  ? 1   DG  E C2    1 
ATOM   17   N N2    . DG  A 1 1   ? 24.931  2.954   219.688 1.00 97.00  ? 1   DG  E N2    1 
ATOM   18   N N3    . DG  A 1 1   ? 22.959  2.250   218.721 1.00 91.70  ? 1   DG  E N3    1 
ATOM   19   C C4    . DG  A 1 1   ? 22.478  1.457   217.741 1.00 93.48  ? 1   DG  E C4    1 
ATOM   20   P P     . DC  A 1 2   ? 15.989  3.397   219.562 1.00 129.79 ? 2   DC  E P     1 
ATOM   21   O OP1   . DC  A 1 2   ? 15.995  2.962   220.985 1.00 130.65 ? 2   DC  E OP1   1 
ATOM   22   O OP2   . DC  A 1 2   ? 14.930  2.897   218.637 1.00 131.33 ? 2   DC  E OP2   1 
ATOM   23   O "O5'" . DC  A 1 2   ? 15.935  4.993   219.552 1.00 126.50 ? 2   DC  E "O5'" 1 
ATOM   24   C "C5'" . DC  A 1 2   ? 16.805  5.773   218.724 1.00 115.72 ? 2   DC  E "C5'" 1 
ATOM   25   C "C4'" . DC  A 1 2   ? 17.892  6.392   219.569 1.00 102.33 ? 2   DC  E "C4'" 1 
ATOM   26   O "O4'" . DC  A 1 2   ? 19.112  5.637   219.391 1.00 87.29  ? 2   DC  E "O4'" 1 
ATOM   27   C "C3'" . DC  A 1 2   ? 18.243  7.840   219.228 1.00 99.77  ? 2   DC  E "C3'" 1 
ATOM   28   O "O3'" . DC  A 1 2   ? 18.617  8.522   220.433 1.00 105.66 ? 2   DC  E "O3'" 1 
ATOM   29   C "C2'" . DC  A 1 2   ? 19.435  7.689   218.309 1.00 91.23  ? 2   DC  E "C2'" 1 
ATOM   30   C "C1'" . DC  A 1 2   ? 20.133  6.487   218.912 1.00 79.71  ? 2   DC  E "C1'" 1 
ATOM   31   N N1    . DC  A 1 2   ? 20.938  5.742   217.940 1.00 70.16  ? 2   DC  E N1    1 
ATOM   32   C C2    . DC  A 1 2   ? 22.302  5.624   218.171 1.00 72.30  ? 2   DC  E C2    1 
ATOM   33   O O2    . DC  A 1 2   ? 22.766  6.065   219.237 1.00 79.88  ? 2   DC  E O2    1 
ATOM   34   N N3    . DC  A 1 2   ? 23.082  5.031   217.237 1.00 64.26  ? 2   DC  E N3    1 
ATOM   35   C C4    . DC  A 1 2   ? 22.534  4.543   216.124 1.00 49.58  ? 2   DC  E C4    1 
ATOM   36   N N4    . DC  A 1 2   ? 23.350  3.992   215.221 1.00 31.03  ? 2   DC  E N4    1 
ATOM   37   C C5    . DC  A 1 2   ? 21.133  4.605   215.887 1.00 45.73  ? 2   DC  E C5    1 
ATOM   38   C C6    . DC  A 1 2   ? 20.378  5.207   216.813 1.00 58.95  ? 2   DC  E C6    1 
ATOM   39   P P     . DC  A 1 3   ? 18.979  10.086  220.398 1.00 100.16 ? 3   DC  E P     1 
ATOM   40   O OP1   . DC  A 1 3   ? 19.026  10.561  221.812 1.00 94.25  ? 3   DC  E OP1   1 
ATOM   41   O OP2   . DC  A 1 3   ? 18.110  10.777  219.401 1.00 93.00  ? 3   DC  E OP2   1 
ATOM   42   O "O5'" . DC  A 1 3   ? 20.479  10.108  219.889 1.00 87.80  ? 3   DC  E "O5'" 1 
ATOM   43   C "C5'" . DC  A 1 3   ? 21.543  10.005  220.816 1.00 70.09  ? 3   DC  E "C5'" 1 
ATOM   44   C "C4'" . DC  A 1 3   ? 22.806  10.531  220.185 1.00 64.54  ? 3   DC  E "C4'" 1 
ATOM   45   O "O4'" . DC  A 1 3   ? 23.187  9.669   219.084 1.00 65.50  ? 3   DC  E "O4'" 1 
ATOM   46   C "C3'" . DC  A 1 3   ? 22.658  11.930  219.593 1.00 52.66  ? 3   DC  E "C3'" 1 
ATOM   47   O "O3'" . DC  A 1 3   ? 23.859  12.640  219.841 1.00 43.65  ? 3   DC  E "O3'" 1 
ATOM   48   C "C2'" . DC  A 1 3   ? 22.495  11.666  218.107 1.00 58.13  ? 3   DC  E "C2'" 1 
ATOM   49   C "C1'" . DC  A 1 3   ? 23.358  10.435  217.910 1.00 61.43  ? 3   DC  E "C1'" 1 
ATOM   50   N N1    . DC  A 1 3   ? 23.026  9.586   216.744 1.00 57.28  ? 3   DC  E N1    1 
ATOM   51   C C2    . DC  A 1 3   ? 24.075  9.081   215.951 1.00 61.00  ? 3   DC  E C2    1 
ATOM   52   O O2    . DC  A 1 3   ? 25.246  9.358   216.250 1.00 66.71  ? 3   DC  E O2    1 
ATOM   53   N N3    . DC  A 1 3   ? 23.785  8.312   214.880 1.00 54.55  ? 3   DC  E N3    1 
ATOM   54   C C4    . DC  A 1 3   ? 22.516  8.035   214.589 1.00 57.17  ? 3   DC  E C4    1 
ATOM   55   N N4    . DC  A 1 3   ? 22.283  7.254   213.541 1.00 63.89  ? 3   DC  E N4    1 
ATOM   56   C C5    . DC  A 1 3   ? 21.432  8.539   215.365 1.00 48.18  ? 3   DC  E C5    1 
ATOM   57   C C6    . DC  A 1 3   ? 21.730  9.301   216.425 1.00 52.26  ? 3   DC  E C6    1 
ATOM   58   P P     . DG  A 1 4   ? 23.875  14.240  219.821 1.00 43.14  ? 4   DG  E P     1 
ATOM   59   O OP1   . DG  A 1 4   ? 24.462  14.671  221.105 1.00 33.69  ? 4   DG  E OP1   1 
ATOM   60   O OP2   . DG  A 1 4   ? 22.582  14.811  219.386 1.00 34.02  ? 4   DG  E OP2   1 
ATOM   61   O "O5'" . DG  A 1 4   ? 24.975  14.518  218.716 1.00 47.01  ? 4   DG  E "O5'" 1 
ATOM   62   C "C5'" . DG  A 1 4   ? 26.229  13.847  218.777 1.00 41.87  ? 4   DG  E "C5'" 1 
ATOM   63   C "C4'" . DG  A 1 4   ? 26.920  13.961  217.443 1.00 45.08  ? 4   DG  E "C4'" 1 
ATOM   64   O "O4'" . DG  A 1 4   ? 26.403  13.000  216.487 1.00 38.17  ? 4   DG  E "O4'" 1 
ATOM   65   C "C3'" . DG  A 1 4   ? 26.682  15.336  216.831 1.00 40.73  ? 4   DG  E "C3'" 1 
ATOM   66   O "O3'" . DG  A 1 4   ? 27.862  15.748  216.156 1.00 48.03  ? 4   DG  E "O3'" 1 
ATOM   67   C "C2'" . DG  A 1 4   ? 25.576  15.060  215.834 1.00 36.42  ? 4   DG  E "C2'" 1 
ATOM   68   C "C1'" . DG  A 1 4   ? 25.992  13.691  215.333 1.00 41.47  ? 4   DG  E "C1'" 1 
ATOM   69   N N9    . DG  A 1 4   ? 24.960  12.909  214.649 1.00 37.15  ? 4   DG  E N9    1 
ATOM   70   C C8    . DG  A 1 4   ? 23.601  13.126  214.710 1.00 45.74  ? 4   DG  E C8    1 
ATOM   71   N N7    . DG  A 1 4   ? 22.910  12.292  213.980 1.00 47.07  ? 4   DG  E N7    1 
ATOM   72   C C5    . DG  A 1 4   ? 23.868  11.468  213.400 1.00 44.35  ? 4   DG  E C5    1 
ATOM   73   C C6    . DG  A 1 4   ? 23.713  10.357  212.518 1.00 45.13  ? 4   DG  E C6    1 
ATOM   74   O O6    . DG  A 1 4   ? 22.678  9.886   212.055 1.00 51.43  ? 4   DG  E O6    1 
ATOM   75   N N1    . DG  A 1 4   ? 24.932  9.793   212.181 1.00 35.48  ? 4   DG  E N1    1 
ATOM   76   C C2    . DG  A 1 4   ? 26.147  10.245  212.616 1.00 38.64  ? 4   DG  E C2    1 
ATOM   77   N N2    . DG  A 1 4   ? 27.211  9.589   212.125 1.00 30.95  ? 4   DG  E N2    1 
ATOM   78   N N3    . DG  A 1 4   ? 26.312  11.272  213.455 1.00 26.88  ? 4   DG  E N3    1 
ATOM   79   C C4    . DG  A 1 4   ? 25.139  11.832  213.802 1.00 27.15  ? 4   DG  E C4    1 
ATOM   80   P P     . DG  A 1 5   ? 28.967  16.607  216.935 1.00 48.13  ? 5   DG  E P     1 
ATOM   81   O OP1   . DG  A 1 5   ? 29.173  16.022  218.273 1.00 46.80  ? 5   DG  E OP1   1 
ATOM   82   O OP2   . DG  A 1 5   ? 28.627  18.044  216.805 1.00 45.25  ? 5   DG  E OP2   1 
ATOM   83   O "O5'" . DG  A 1 5   ? 30.285  16.315  216.110 1.00 29.81  ? 5   DG  E "O5'" 1 
ATOM   84   C "C5'" . DG  A 1 5   ? 30.885  15.030  216.137 1.00 31.31  ? 5   DG  E "C5'" 1 
ATOM   85   C "C4'" . DG  A 1 5   ? 31.424  14.686  214.768 1.00 39.69  ? 5   DG  E "C4'" 1 
ATOM   86   O "O4'" . DG  A 1 5   ? 30.330  14.383  213.866 1.00 41.36  ? 5   DG  E "O4'" 1 
ATOM   87   C "C3'" . DG  A 1 5   ? 32.196  15.826  214.112 1.00 39.18  ? 5   DG  E "C3'" 1 
ATOM   88   O "O3'" . DG  A 1 5   ? 33.395  15.373  213.495 1.00 32.20  ? 5   DG  E "O3'" 1 
ATOM   89   C "C2'" . DG  A 1 5   ? 31.238  16.342  213.054 1.00 44.23  ? 5   DG  E "C2'" 1 
ATOM   90   C "C1'" . DG  A 1 5   ? 30.502  15.096  212.666 1.00 24.93  ? 5   DG  E "C1'" 1 
ATOM   91   N N9    . DG  A 1 5   ? 29.193  15.350  212.090 1.00 13.44  ? 5   DG  E N9    1 
ATOM   92   C C8    . DG  A 1 5   ? 28.071  15.773  212.740 1.00 14.84  ? 5   DG  E C8    1 
ATOM   93   N N7    . DG  A 1 5   ? 27.042  15.921  211.945 1.00 21.20  ? 5   DG  E N7    1 
ATOM   94   C C5    . DG  A 1 5   ? 27.525  15.572  210.688 1.00 17.61  ? 5   DG  E C5    1 
ATOM   95   C C6    . DG  A 1 5   ? 26.872  15.520  209.412 1.00 11.06  ? 5   DG  E C6    1 
ATOM   96   O O6    . DG  A 1 5   ? 25.702  15.785  209.122 1.00 15.98  ? 5   DG  E O6    1 
ATOM   97   N N1    . DG  A 1 5   ? 27.731  15.088  208.419 1.00 1.00   ? 5   DG  E N1    1 
ATOM   98   C C2    . DG  A 1 5   ? 29.033  14.726  208.610 1.00 19.37  ? 5   DG  E C2    1 
ATOM   99   N N2    . DG  A 1 5   ? 29.664  14.240  207.535 1.00 23.17  ? 5   DG  E N2    1 
ATOM   100  N N3    . DG  A 1 5   ? 29.663  14.799  209.769 1.00 11.80  ? 5   DG  E N3    1 
ATOM   101  C C4    . DG  A 1 5   ? 28.849  15.215  210.761 1.00 16.95  ? 5   DG  E C4    1 
ATOM   102  P P     . DT  A 1 6   ? 34.310  16.426  212.694 1.00 44.39  ? 6   DT  E P     1 
ATOM   103  O OP1   . DT  A 1 6   ? 35.695  15.935  212.801 1.00 20.62  ? 6   DT  E OP1   1 
ATOM   104  O OP2   . DT  A 1 6   ? 34.000  17.834  213.069 1.00 42.81  ? 6   DT  E OP2   1 
ATOM   105  O "O5'" . DT  A 1 6   ? 33.808  16.245  211.201 1.00 34.64  ? 6   DT  E "O5'" 1 
ATOM   106  C "C5'" . DT  A 1 6   ? 34.099  15.049  210.512 1.00 44.77  ? 6   DT  E "C5'" 1 
ATOM   107  C "C4'" . DT  A 1 6   ? 34.109  15.310  209.031 1.00 40.08  ? 6   DT  E "C4'" 1 
ATOM   108  O "O4'" . DT  A 1 6   ? 32.750  15.477  208.565 1.00 55.73  ? 6   DT  E "O4'" 1 
ATOM   109  C "C3'" . DT  A 1 6   ? 34.843  16.594  208.681 1.00 46.39  ? 6   DT  E "C3'" 1 
ATOM   110  O "O3'" . DT  A 1 6   ? 35.684  16.339  207.576 1.00 43.16  ? 6   DT  E "O3'" 1 
ATOM   111  C "C2'" . DT  A 1 6   ? 33.740  17.580  208.334 1.00 48.68  ? 6   DT  E "C2'" 1 
ATOM   112  C "C1'" . DT  A 1 6   ? 32.645  16.664  207.794 1.00 47.05  ? 6   DT  E "C1'" 1 
ATOM   113  N N1    . DT  A 1 6   ? 31.251  17.161  207.925 1.00 31.87  ? 6   DT  E N1    1 
ATOM   114  C C2    . DT  A 1 6   ? 30.420  17.120  206.828 1.00 23.01  ? 6   DT  E C2    1 
ATOM   115  O O2    . DT  A 1 6   ? 30.759  16.699  205.733 1.00 29.50  ? 6   DT  E O2    1 
ATOM   116  N N3    . DT  A 1 6   ? 29.176  17.596  207.052 1.00 16.40  ? 6   DT  E N3    1 
ATOM   117  C C4    . DT  A 1 6   ? 28.687  18.124  208.217 1.00 23.35  ? 6   DT  E C4    1 
ATOM   118  O O4    . DT  A 1 6   ? 27.544  18.548  208.245 1.00 36.33  ? 6   DT  E O4    1 
ATOM   119  C C5    . DT  A 1 6   ? 29.607  18.130  209.331 1.00 29.75  ? 6   DT  E C5    1 
ATOM   120  C C7    . DT  A 1 6   ? 29.161  18.656  210.660 1.00 34.89  ? 6   DT  E C7    1 
ATOM   121  C C6    . DT  A 1 6   ? 30.825  17.659  209.126 1.00 22.36  ? 6   DT  E C6    1 
ATOM   122  P P     . DC  A 1 7   ? 36.664  17.476  207.056 1.00 38.98  ? 7   DC  E P     1 
ATOM   123  O OP1   . DC  A 1 7   ? 38.027  16.900  207.028 1.00 13.44  ? 7   DC  E OP1   1 
ATOM   124  O OP2   . DC  A 1 7   ? 36.405  18.701  207.852 1.00 38.83  ? 7   DC  E OP2   1 
ATOM   125  O "O5'" . DC  A 1 7   ? 36.139  17.648  205.567 1.00 26.85  ? 7   DC  E "O5'" 1 
ATOM   126  C "C5'" . DC  A 1 7   ? 36.145  16.536  204.701 1.00 22.87  ? 7   DC  E "C5'" 1 
ATOM   127  C "C4'" . DC  A 1 7   ? 35.299  16.787  203.475 1.00 39.12  ? 7   DC  E "C4'" 1 
ATOM   128  O "O4'" . DC  A 1 7   ? 33.926  17.008  203.861 1.00 33.50  ? 7   DC  E "O4'" 1 
ATOM   129  C "C3'" . DC  A 1 7   ? 35.702  17.956  202.579 1.00 35.87  ? 7   DC  E "C3'" 1 
ATOM   130  O "O3'" . DC  A 1 7   ? 36.133  17.557  201.286 1.00 47.04  ? 7   DC  E "O3'" 1 
ATOM   131  C "C2'" . DC  A 1 7   ? 34.456  18.816  202.490 1.00 43.95  ? 7   DC  E "C2'" 1 
ATOM   132  C "C1'" . DC  A 1 7   ? 33.336  17.924  202.981 1.00 20.00  ? 7   DC  E "C1'" 1 
ATOM   133  N N1    . DC  A 1 7   ? 32.353  18.670  203.749 1.00 30.02  ? 7   DC  E N1    1 
ATOM   134  C C2    . DC  A 1 7   ? 31.043  18.603  203.353 1.00 27.07  ? 7   DC  E C2    1 
ATOM   135  O O2    . DC  A 1 7   ? 30.763  17.869  202.404 1.00 18.90  ? 7   DC  E O2    1 
ATOM   136  N N3    . DC  A 1 7   ? 30.110  19.334  204.016 1.00 25.54  ? 7   DC  E N3    1 
ATOM   137  C C4    . DC  A 1 7   ? 30.476  20.100  205.051 1.00 17.66  ? 7   DC  E C4    1 
ATOM   138  N N4    . DC  A 1 7   ? 29.549  20.805  205.644 1.00 23.76  ? 7   DC  E N4    1 
ATOM   139  C C5    . DC  A 1 7   ? 31.817  20.164  205.501 1.00 2.83   ? 7   DC  E C5    1 
ATOM   140  C C6    . DC  A 1 7   ? 32.723  19.435  204.827 1.00 17.35  ? 7   DC  E C6    1 
ATOM   141  O OP3   . DG  B 2 1   ? 35.556  16.028  197.450 1.00 83.24  ? 8   DG  F OP3   1 
ATOM   142  P P     . DG  B 2 1   ? 35.647  17.546  197.413 1.00 67.57  ? 8   DG  F P     1 
ATOM   143  O OP1   . DG  B 2 1   ? 35.311  18.091  196.024 1.00 68.77  ? 8   DG  F OP1   1 
ATOM   144  O OP2   . DG  B 2 1   ? 36.995  18.008  197.947 1.00 43.81  ? 8   DG  F OP2   1 
ATOM   145  O "O5'" . DG  B 2 1   ? 34.426  18.035  198.396 1.00 73.36  ? 8   DG  F "O5'" 1 
ATOM   146  C "C5'" . DG  B 2 1   ? 34.447  19.309  199.111 1.00 54.51  ? 8   DG  F "C5'" 1 
ATOM   147  C "C4'" . DG  B 2 1   ? 33.548  20.322  198.438 1.00 45.63  ? 8   DG  F "C4'" 1 
ATOM   148  O "O4'" . DG  B 2 1   ? 32.274  20.388  199.144 1.00 32.95  ? 8   DG  F "O4'" 1 
ATOM   149  C "C3'" . DG  B 2 1   ? 34.147  21.720  198.528 1.00 47.51  ? 8   DG  F "C3'" 1 
ATOM   150  O "O3'" . DG  B 2 1   ? 34.404  22.361  197.299 1.00 36.07  ? 8   DG  F "O3'" 1 
ATOM   151  C "C2'" . DG  B 2 1   ? 33.132  22.539  199.289 1.00 40.51  ? 8   DG  F "C2'" 1 
ATOM   152  C "C1'" . DG  B 2 1   ? 31.858  21.731  199.237 1.00 19.76  ? 8   DG  F "C1'" 1 
ATOM   153  N N9    . DG  B 2 1   ? 31.201  21.958  200.515 1.00 23.81  ? 8   DG  F N9    1 
ATOM   154  C C8    . DG  B 2 1   ? 31.785  21.853  201.750 1.00 18.50  ? 8   DG  F C8    1 
ATOM   155  N N7    . DG  B 2 1   ? 31.033  22.304  202.713 1.00 16.38  ? 8   DG  F N7    1 
ATOM   156  C C5    . DG  B 2 1   ? 29.866  22.687  202.081 1.00 1.00   ? 8   DG  F C5    1 
ATOM   157  C C6    . DG  B 2 1   ? 28.697  23.256  202.612 1.00 8.21   ? 8   DG  F C6    1 
ATOM   158  O O6    . DG  B 2 1   ? 28.448  23.540  203.780 1.00 7.25   ? 8   DG  F O6    1 
ATOM   159  N N1    . DG  B 2 1   ? 27.747  23.504  201.627 1.00 6.14   ? 8   DG  F N1    1 
ATOM   160  C C2    . DG  B 2 1   ? 27.911  23.229  200.291 1.00 20.93  ? 8   DG  F C2    1 
ATOM   161  N N2    . DG  B 2 1   ? 26.894  23.558  199.508 1.00 23.71  ? 8   DG  F N2    1 
ATOM   162  N N3    . DG  B 2 1   ? 29.009  22.674  199.772 1.00 12.07  ? 8   DG  F N3    1 
ATOM   163  C C4    . DG  B 2 1   ? 29.939  22.441  200.724 1.00 5.29   ? 8   DG  F C4    1 
ATOM   164  P P     . DA  B 2 2   ? 35.301  23.701  197.338 1.00 37.76  ? 9   DA  F P     1 
ATOM   165  O OP1   . DA  B 2 2   ? 36.049  23.865  196.070 1.00 37.52  ? 9   DA  F OP1   1 
ATOM   166  O OP2   . DA  B 2 2   ? 36.074  23.645  198.631 1.00 27.29  ? 9   DA  F OP2   1 
ATOM   167  O "O5'" . DA  B 2 2   ? 34.212  24.858  197.445 1.00 31.85  ? 9   DA  F "O5'" 1 
ATOM   168  C "C5'" . DA  B 2 2   ? 33.145  24.887  196.541 1.00 28.53  ? 9   DA  F "C5'" 1 
ATOM   169  C "C4'" . DA  B 2 2   ? 32.190  25.979  196.919 1.00 28.55  ? 9   DA  F "C4'" 1 
ATOM   170  O "O4'" . DA  B 2 2   ? 31.643  25.692  198.237 1.00 39.51  ? 9   DA  F "O4'" 1 
ATOM   171  C "C3'" . DA  B 2 2   ? 32.892  27.334  197.038 1.00 38.93  ? 9   DA  F "C3'" 1 
ATOM   172  O "O3'" . DA  B 2 2   ? 32.036  28.365  196.511 1.00 42.91  ? 9   DA  F "O3'" 1 
ATOM   173  C "C2'" . DA  B 2 2   ? 33.064  27.494  198.540 1.00 30.66  ? 9   DA  F "C2'" 1 
ATOM   174  C "C1'" . DA  B 2 2   ? 31.775  26.868  199.008 1.00 38.14  ? 9   DA  F "C1'" 1 
ATOM   175  N N9    . DA  B 2 2   ? 31.681  26.584  200.443 1.00 27.09  ? 9   DA  F N9    1 
ATOM   176  C C8    . DA  B 2 2   ? 32.698  26.371  201.341 1.00 22.70  ? 9   DA  F C8    1 
ATOM   177  N N7    . DA  B 2 2   ? 32.309  26.403  202.586 1.00 18.70  ? 9   DA  F N7    1 
ATOM   178  C C5    . DA  B 2 2   ? 30.938  26.598  202.503 1.00 12.34  ? 9   DA  F C5    1 
ATOM   179  C C6    . DA  B 2 2   ? 29.940  26.779  203.496 1.00 25.97  ? 9   DA  F C6    1 
ATOM   180  N N6    . DA  B 2 2   ? 30.228  26.889  204.791 1.00 25.86  ? 9   DA  F N6    1 
ATOM   181  N N1    . DA  B 2 2   ? 28.636  26.888  203.097 1.00 4.98   ? 9   DA  F N1    1 
ATOM   182  C C2    . DA  B 2 2   ? 28.389  26.878  201.771 1.00 26.65  ? 9   DA  F C2    1 
ATOM   183  N N3    . DA  B 2 2   ? 29.270  26.780  200.734 1.00 18.09  ? 9   DA  F N3    1 
ATOM   184  C C4    . DA  B 2 2   ? 30.530  26.637  201.187 1.00 12.90  ? 9   DA  F C4    1 
ATOM   185  P P     . DC  B 2 3   ? 32.678  29.706  195.897 1.00 41.37  ? 10  DC  F P     1 
ATOM   186  O OP1   . DC  B 2 3   ? 33.240  29.487  194.531 1.00 42.71  ? 10  DC  F OP1   1 
ATOM   187  O OP2   . DC  B 2 3   ? 33.534  30.330  196.940 1.00 53.93  ? 10  DC  F OP2   1 
ATOM   188  O "O5'" . DC  B 2 3   ? 31.403  30.607  195.691 1.00 35.06  ? 10  DC  F "O5'" 1 
ATOM   189  C "C5'" . DC  B 2 3   ? 30.957  31.416  196.725 1.00 39.31  ? 10  DC  F "C5'" 1 
ATOM   190  C "C4'" . DC  B 2 3   ? 29.589  30.981  197.179 1.00 40.86  ? 10  DC  F "C4'" 1 
ATOM   191  O "O4'" . DC  B 2 3   ? 29.739  29.977  198.218 1.00 44.68  ? 10  DC  F "O4'" 1 
ATOM   192  C "C3'" . DC  B 2 3   ? 28.874  32.161  197.815 1.00 48.76  ? 10  DC  F "C3'" 1 
ATOM   193  O "O3'" . DC  B 2 3   ? 27.661  32.470  197.186 1.00 48.26  ? 10  DC  F "O3'" 1 
ATOM   194  C "C2'" . DC  B 2 3   ? 28.632  31.778  199.256 1.00 51.09  ? 10  DC  F "C2'" 1 
ATOM   195  C "C1'" . DC  B 2 3   ? 28.948  30.302  199.354 1.00 43.34  ? 10  DC  F "C1'" 1 
ATOM   196  N N1    . DC  B 2 3   ? 29.776  30.185  200.551 1.00 33.03  ? 10  DC  F N1    1 
ATOM   197  C C2    . DC  B 2 3   ? 29.137  30.122  201.792 1.00 27.60  ? 10  DC  F C2    1 
ATOM   198  O O2    . DC  B 2 3   ? 27.898  30.083  201.825 1.00 32.78  ? 10  DC  F O2    1 
ATOM   199  N N3    . DC  B 2 3   ? 29.875  30.112  202.918 1.00 14.42  ? 10  DC  F N3    1 
ATOM   200  C C4    . DC  B 2 3   ? 31.198  30.155  202.833 1.00 27.33  ? 10  DC  F C4    1 
ATOM   201  N N4    . DC  B 2 3   ? 31.896  30.138  203.962 1.00 19.33  ? 10  DC  F N4    1 
ATOM   202  C C5    . DC  B 2 3   ? 31.873  30.211  201.579 1.00 33.32  ? 10  DC  F C5    1 
ATOM   203  C C6    . DC  B 2 3   ? 31.131  30.207  200.473 1.00 21.14  ? 10  DC  F C6    1 
ATOM   204  P P     . DC  B 2 4   ? 27.079  33.942  197.366 1.00 38.55  ? 11  DC  F P     1 
ATOM   205  O OP1   . DC  B 2 4   ? 26.439  33.965  198.734 1.00 24.31  ? 11  DC  F OP1   1 
ATOM   206  O OP2   . DC  B 2 4   ? 26.289  34.274  196.143 1.00 16.94  ? 11  DC  F OP2   1 
ATOM   207  O "O5'" . DC  B 2 4   ? 28.364  34.887  197.426 1.00 40.07  ? 11  DC  F "O5'" 1 
ATOM   208  C "C5'" . DC  B 2 4   ? 28.220  36.322  197.393 1.00 36.60  ? 11  DC  F "C5'" 1 
ATOM   209  C "C4'" . DC  B 2 4   ? 27.495  36.807  198.626 1.00 26.00  ? 11  DC  F "C4'" 1 
ATOM   210  O "O4'" . DC  B 2 4   ? 28.233  36.473  199.835 1.00 35.10  ? 11  DC  F "O4'" 1 
ATOM   211  C "C3'" . DC  B 2 4   ? 27.238  38.308  198.678 1.00 26.10  ? 11  DC  F "C3'" 1 
ATOM   212  O "O3'" . DC  B 2 4   ? 25.904  38.499  199.136 1.00 39.98  ? 11  DC  F "O3'" 1 
ATOM   213  C "C2'" . DC  B 2 4   ? 28.202  38.794  199.746 1.00 39.13  ? 11  DC  F "C2'" 1 
ATOM   214  C "C1'" . DC  B 2 4   ? 28.281  37.605  200.688 1.00 30.99  ? 11  DC  F "C1'" 1 
ATOM   215  N N1    . DC  B 2 4   ? 29.521  37.548  201.507 1.00 24.36  ? 11  DC  F N1    1 
ATOM   216  C C2    . DC  B 2 4   ? 29.460  37.111  202.859 1.00 19.98  ? 11  DC  F C2    1 
ATOM   217  O O2    . DC  B 2 4   ? 28.391  36.761  203.332 1.00 24.78  ? 11  DC  F O2    1 
ATOM   218  N N3    . DC  B 2 4   ? 30.585  37.107  203.605 1.00 14.70  ? 11  DC  F N3    1 
ATOM   219  C C4    . DC  B 2 4   ? 31.740  37.520  203.065 1.00 34.28  ? 11  DC  F C4    1 
ATOM   220  N N4    . DC  B 2 4   ? 32.819  37.542  203.842 1.00 32.65  ? 11  DC  F N4    1 
ATOM   221  C C5    . DC  B 2 4   ? 31.834  37.942  201.703 1.00 23.85  ? 11  DC  F C5    1 
ATOM   222  C C6    . DC  B 2 4   ? 30.714  37.940  200.973 1.00 15.60  ? 11  DC  F C6    1 
ATOM   223  P P     . DG  B 2 5   ? 25.193  39.938  199.001 1.00 41.66  ? 12  DG  F P     1 
ATOM   224  O OP1   . DG  B 2 5   ? 23.874  39.732  198.349 1.00 22.20  ? 12  DG  F OP1   1 
ATOM   225  O OP2   . DG  B 2 5   ? 26.141  40.952  198.454 1.00 32.01  ? 12  DG  F OP2   1 
ATOM   226  O "O5'" . DG  B 2 5   ? 24.900  40.315  200.513 1.00 32.05  ? 12  DG  F "O5'" 1 
ATOM   227  C "C5'" . DG  B 2 5   ? 24.002  39.537  201.284 1.00 31.89  ? 12  DG  F "C5'" 1 
ATOM   228  C "C4'" . DG  B 2 5   ? 24.115  39.896  202.747 1.00 36.79  ? 12  DG  F "C4'" 1 
ATOM   229  O "O4'" . DG  B 2 5   ? 25.446  39.569  203.211 1.00 48.12  ? 12  DG  F "O4'" 1 
ATOM   230  C "C3'" . DG  B 2 5   ? 23.903  41.376  203.088 1.00 40.15  ? 12  DG  F "C3'" 1 
ATOM   231  O "O3'" . DG  B 2 5   ? 23.144  41.461  204.293 1.00 52.21  ? 12  DG  F "O3'" 1 
ATOM   232  C "C2'" . DG  B 2 5   ? 25.314  41.890  203.335 1.00 35.58  ? 12  DG  F "C2'" 1 
ATOM   233  C "C1'" . DG  B 2 5   ? 25.961  40.662  203.945 1.00 34.81  ? 12  DG  F "C1'" 1 
ATOM   234  N N9    . DG  B 2 5   ? 27.417  40.585  203.909 1.00 27.55  ? 12  DG  F N9    1 
ATOM   235  C C8    . DG  B 2 5   ? 28.251  40.786  202.833 1.00 19.47  ? 12  DG  F C8    1 
ATOM   236  N N7    . DG  B 2 5   ? 29.521  40.662  203.138 1.00 21.95  ? 12  DG  F N7    1 
ATOM   237  C C5    . DG  B 2 5   ? 29.521  40.356  204.497 1.00 17.68  ? 12  DG  F C5    1 
ATOM   238  C C6    . DG  B 2 5   ? 30.614  40.081  205.400 1.00 26.44  ? 12  DG  F C6    1 
ATOM   239  O O6    . DG  B 2 5   ? 31.837  40.022  205.158 1.00 13.47  ? 12  DG  F O6    1 
ATOM   240  N N1    . DG  B 2 5   ? 30.153  39.824  206.690 1.00 23.79  ? 12  DG  F N1    1 
ATOM   241  C C2    . DG  B 2 5   ? 28.827  39.793  207.066 1.00 37.51  ? 12  DG  F C2    1 
ATOM   242  N N2    . DG  B 2 5   ? 28.595  39.500  208.360 1.00 42.82  ? 12  DG  F N2    1 
ATOM   243  N N3    . DG  B 2 5   ? 27.807  40.024  206.238 1.00 22.64  ? 12  DG  F N3    1 
ATOM   244  C C4    . DG  B 2 5   ? 28.228  40.298  204.984 1.00 19.64  ? 12  DG  F C4    1 
ATOM   245  P P     . DG  B 2 6   ? 22.010  42.582  204.456 1.00 58.90  ? 13  DG  F P     1 
ATOM   246  O OP1   . DG  B 2 6   ? 22.266  43.639  203.457 1.00 52.45  ? 13  DG  F OP1   1 
ATOM   247  O OP2   . DG  B 2 6   ? 21.984  42.915  205.899 1.00 45.02  ? 13  DG  F OP2   1 
ATOM   248  O "O5'" . DG  B 2 6   ? 20.643  41.829  204.132 1.00 65.60  ? 13  DG  F "O5'" 1 
ATOM   249  C "C5'" . DG  B 2 6   ? 20.199  40.761  204.976 1.00 77.76  ? 13  DG  F "C5'" 1 
ATOM   250  C "C4'" . DG  B 2 6   ? 18.693  40.766  205.123 1.00 89.94  ? 13  DG  F "C4'" 1 
ATOM   251  O "O4'" . DG  B 2 6   ? 18.231  41.986  205.762 1.00 97.50  ? 13  DG  F "O4'" 1 
ATOM   252  C "C3'" . DG  B 2 6   ? 17.870  40.619  203.840 1.00 95.60  ? 13  DG  F "C3'" 1 
ATOM   253  O "O3'" . DG  B 2 6   ? 16.744  39.761  204.069 1.00 107.36 ? 13  DG  F "O3'" 1 
ATOM   254  C "C2'" . DG  B 2 6   ? 17.304  42.009  203.628 1.00 98.85  ? 13  DG  F "C2'" 1 
ATOM   255  C "C1'" . DG  B 2 6   ? 17.108  42.487  205.056 1.00 100.64 ? 13  DG  F "C1'" 1 
ATOM   256  N N9    . DG  B 2 6   ? 17.073  43.944  205.196 1.00 103.37 ? 13  DG  F N9    1 
ATOM   257  C C8    . DG  B 2 6   ? 17.970  44.836  204.662 1.00 104.63 ? 13  DG  F C8    1 
ATOM   258  N N7    . DG  B 2 6   ? 17.647  46.082  204.877 1.00 109.80 ? 13  DG  F N7    1 
ATOM   259  C C5    . DG  B 2 6   ? 16.473  46.015  205.616 1.00 110.82 ? 13  DG  F C5    1 
ATOM   260  C C6    . DG  B 2 6   ? 15.650  47.056  206.128 1.00 114.33 ? 13  DG  F C6    1 
ATOM   261  O O6    . DG  B 2 6   ? 15.789  48.283  206.008 1.00 115.66 ? 13  DG  F O6    1 
ATOM   262  N N1    . DG  B 2 6   ? 14.565  46.548  206.839 1.00 113.30 ? 13  DG  F N1    1 
ATOM   263  C C2    . DG  B 2 6   ? 14.300  45.217  207.031 1.00 106.60 ? 13  DG  F C2    1 
ATOM   264  N N2    . DG  B 2 6   ? 13.212  44.937  207.771 1.00 101.53 ? 13  DG  F N2    1 
ATOM   265  N N3    . DG  B 2 6   ? 15.049  44.233  206.540 1.00 106.78 ? 13  DG  F N3    1 
ATOM   266  C C4    . DG  B 2 6   ? 16.114  44.703  205.846 1.00 107.06 ? 13  DG  F C4    1 
ATOM   267  O "O5'" . DG  C 1 1   ? 42.409  43.052  204.156 1.00 57.43  ? 1   DG  G "O5'" 1 
ATOM   268  C "C5'" . DG  C 1 1   ? 41.237  42.948  204.999 1.00 68.06  ? 1   DG  G "C5'" 1 
ATOM   269  C "C4'" . DG  C 1 1   ? 41.535  43.478  206.384 1.00 67.74  ? 1   DG  G "C4'" 1 
ATOM   270  O "O4'" . DG  C 1 1   ? 41.143  44.868  206.440 1.00 58.35  ? 1   DG  G "O4'" 1 
ATOM   271  C "C3'" . DG  C 1 1   ? 40.757  42.768  207.493 1.00 73.75  ? 1   DG  G "C3'" 1 
ATOM   272  O "O3'" . DG  C 1 1   ? 41.594  42.217  208.505 1.00 85.35  ? 1   DG  G "O3'" 1 
ATOM   273  C "C2'" . DG  C 1 1   ? 39.798  43.798  208.062 1.00 63.79  ? 1   DG  G "C2'" 1 
ATOM   274  C "C1'" . DG  C 1 1   ? 39.990  45.052  207.247 1.00 46.02  ? 1   DG  G "C1'" 1 
ATOM   275  N N9    . DG  C 1 1   ? 38.851  45.146  206.346 1.00 41.28  ? 1   DG  G N9    1 
ATOM   276  C C8    . DG  C 1 1   ? 38.856  44.984  204.978 1.00 50.52  ? 1   DG  G C8    1 
ATOM   277  N N7    . DG  C 1 1   ? 37.662  45.022  204.448 1.00 43.67  ? 1   DG  G N7    1 
ATOM   278  C C5    . DG  C 1 1   ? 36.822  45.252  205.526 1.00 30.01  ? 1   DG  G C5    1 
ATOM   279  C C6    . DG  C 1 1   ? 35.415  45.374  205.572 1.00 33.25  ? 1   DG  G C6    1 
ATOM   280  O O6    . DG  C 1 1   ? 34.596  45.306  204.627 1.00 44.64  ? 1   DG  G O6    1 
ATOM   281  N N1    . DG  C 1 1   ? 34.971  45.591  206.874 1.00 26.66  ? 1   DG  G N1    1 
ATOM   282  C C2    . DG  C 1 1   ? 35.783  45.685  207.985 1.00 31.00  ? 1   DG  G C2    1 
ATOM   283  N N2    . DG  C 1 1   ? 35.169  45.932  209.144 1.00 24.38  ? 1   DG  G N2    1 
ATOM   284  N N3    . DG  C 1 1   ? 37.099  45.556  207.956 1.00 21.43  ? 1   DG  G N3    1 
ATOM   285  C C4    . DG  C 1 1   ? 37.546  45.346  206.705 1.00 30.83  ? 1   DG  G C4    1 
ATOM   286  P P     . DC  C 1 2   ? 41.305  40.721  209.023 1.00 89.86  ? 2   DC  G P     1 
ATOM   287  O OP1   . DC  C 1 2   ? 42.536  40.191  209.681 1.00 88.05  ? 2   DC  G OP1   1 
ATOM   288  O OP2   . DC  C 1 2   ? 40.672  39.964  207.906 1.00 86.48  ? 2   DC  G OP2   1 
ATOM   289  O "O5'" . DC  C 1 2   ? 40.145  40.915  210.090 1.00 73.31  ? 2   DC  G "O5'" 1 
ATOM   290  C "C5'" . DC  C 1 2   ? 40.186  41.976  211.035 1.00 65.78  ? 2   DC  G "C5'" 1 
ATOM   291  C "C4'" . DC  C 1 2   ? 38.900  41.994  211.819 1.00 57.74  ? 2   DC  G "C4'" 1 
ATOM   292  O "O4'" . DC  C 1 2   ? 37.879  42.725  211.095 1.00 49.63  ? 2   DC  G "O4'" 1 
ATOM   293  C "C3'" . DC  C 1 2   ? 38.379  40.579  212.009 1.00 60.06  ? 2   DC  G "C3'" 1 
ATOM   294  O "O3'" . DC  C 1 2   ? 37.959  40.363  213.334 1.00 61.15  ? 2   DC  G "O3'" 1 
ATOM   295  C "C2'" . DC  C 1 2   ? 37.220  40.465  211.036 1.00 58.17  ? 2   DC  G "C2'" 1 
ATOM   296  C "C1'" . DC  C 1 2   ? 36.758  41.908  210.830 1.00 39.64  ? 2   DC  G "C1'" 1 
ATOM   297  N N1    . DC  C 1 2   ? 36.341  42.137  209.439 1.00 32.97  ? 2   DC  G N1    1 
ATOM   298  C C2    . DC  C 1 2   ? 34.993  42.418  209.167 1.00 33.77  ? 2   DC  G C2    1 
ATOM   299  O O2    . DC  C 1 2   ? 34.220  42.622  210.111 1.00 31.66  ? 2   DC  G O2    1 
ATOM   300  N N3    . DC  C 1 2   ? 34.576  42.459  207.875 1.00 26.53  ? 2   DC  G N3    1 
ATOM   301  C C4    . DC  C 1 2   ? 35.453  42.248  206.880 1.00 25.62  ? 2   DC  G C4    1 
ATOM   302  N N4    . DC  C 1 2   ? 34.982  42.209  205.628 1.00 19.68  ? 2   DC  G N4    1 
ATOM   303  C C5    . DC  C 1 2   ? 36.847  42.046  207.131 1.00 12.73  ? 2   DC  G C5    1 
ATOM   304  C C6    . DC  C 1 2   ? 37.241  42.008  208.414 1.00 21.56  ? 2   DC  G C6    1 
ATOM   305  P P     . DC  C 1 3   ? 37.678  38.869  213.810 1.00 72.35  ? 3   DC  G P     1 
ATOM   306  O OP1   . DC  C 1 3   ? 37.896  38.893  215.284 1.00 72.46  ? 3   DC  G OP1   1 
ATOM   307  O OP2   . DC  C 1 3   ? 38.474  37.926  212.951 1.00 58.73  ? 3   DC  G OP2   1 
ATOM   308  O "O5'" . DC  C 1 3   ? 36.134  38.662  213.469 1.00 60.65  ? 3   DC  G "O5'" 1 
ATOM   309  C "C5'" . DC  C 1 3   ? 35.130  39.302  214.249 1.00 44.18  ? 3   DC  G "C5'" 1 
ATOM   310  C "C4'" . DC  C 1 3   ? 33.750  38.892  213.785 1.00 41.45  ? 3   DC  G "C4'" 1 
ATOM   311  O "O4'" . DC  C 1 3   ? 33.463  39.432  212.467 1.00 42.46  ? 3   DC  G "O4'" 1 
ATOM   312  C "C3'" . DC  C 1 3   ? 33.483  37.389  213.700 1.00 36.55  ? 3   DC  G "C3'" 1 
ATOM   313  O "O3'" . DC  C 1 3   ? 32.229  37.096  214.316 1.00 37.39  ? 3   DC  G "O3'" 1 
ATOM   314  C "C2'" . DC  C 1 3   ? 33.374  37.127  212.206 1.00 40.45  ? 3   DC  G "C2'" 1 
ATOM   315  C "C1'" . DC  C 1 3   ? 32.858  38.450  211.655 1.00 24.30  ? 3   DC  G "C1'" 1 
ATOM   316  N N1    . DC  C 1 3   ? 33.247  38.714  210.259 1.00 34.02  ? 3   DC  G N1    1 
ATOM   317  C C2    . DC  C 1 3   ? 32.256  39.068  209.301 1.00 46.12  ? 3   DC  G C2    1 
ATOM   318  O O2    . DC  C 1 3   ? 31.074  39.229  209.663 1.00 49.24  ? 3   DC  G O2    1 
ATOM   319  N N3    . DC  C 1 3   ? 32.623  39.220  208.004 1.00 37.70  ? 3   DC  G N3    1 
ATOM   320  C C4    . DC  C 1 3   ? 33.898  39.044  207.648 1.00 40.33  ? 3   DC  G C4    1 
ATOM   321  N N4    . DC  C 1 3   ? 34.210  39.169  206.353 1.00 36.52  ? 3   DC  G N4    1 
ATOM   322  C C5    . DC  C 1 3   ? 34.914  38.725  208.600 1.00 33.47  ? 3   DC  G C5    1 
ATOM   323  C C6    . DC  C 1 3   ? 34.550  38.585  209.879 1.00 28.98  ? 3   DC  G C6    1 
ATOM   324  P P     . DG  C 1 4   ? 32.026  35.713  215.087 1.00 38.60  ? 4   DG  G P     1 
ATOM   325  O OP1   . DG  C 1 4   ? 31.512  35.947  216.447 1.00 31.23  ? 4   DG  G OP1   1 
ATOM   326  O OP2   . DG  C 1 4   ? 33.258  34.919  214.902 1.00 24.89  ? 4   DG  G OP2   1 
ATOM   327  O "O5'" . DG  C 1 4   ? 30.850  35.059  214.254 1.00 40.38  ? 4   DG  G "O5'" 1 
ATOM   328  C "C5'" . DG  C 1 4   ? 29.664  35.786  213.964 1.00 41.02  ? 4   DG  G "C5'" 1 
ATOM   329  C "C4'" . DG  C 1 4   ? 28.946  35.156  212.793 1.00 50.33  ? 4   DG  G "C4'" 1 
ATOM   330  O "O4'" . DG  C 1 4   ? 29.396  35.709  211.523 1.00 53.58  ? 4   DG  G "O4'" 1 
ATOM   331  C "C3'" . DG  C 1 4   ? 29.153  33.641  212.707 1.00 39.20  ? 4   DG  G "C3'" 1 
ATOM   332  O "O3'" . DG  C 1 4   ? 27.920  32.987  212.430 1.00 37.41  ? 4   DG  G "O3'" 1 
ATOM   333  C "C2'" . DG  C 1 4   ? 30.092  33.489  211.528 1.00 34.46  ? 4   DG  G "C2'" 1 
ATOM   334  C "C1'" . DG  C 1 4   ? 29.703  34.650  210.635 1.00 38.05  ? 4   DG  G "C1'" 1 
ATOM   335  N N9    . DG  C 1 4   ? 30.800  35.063  209.775 1.00 24.52  ? 4   DG  G N9    1 
ATOM   336  C C8    . DG  C 1 4   ? 32.124  34.900  210.071 1.00 26.86  ? 4   DG  G C8    1 
ATOM   337  N N7    . DG  C 1 4   ? 32.921  35.272  209.115 1.00 28.71  ? 4   DG  G N7    1 
ATOM   338  C C5    . DG  C 1 4   ? 32.072  35.723  208.118 1.00 19.52  ? 4   DG  G C5    1 
ATOM   339  C C6    . DG  C 1 4   ? 32.382  36.219  206.810 1.00 29.02  ? 4   DG  G C6    1 
ATOM   340  O O6    . DG  C 1 4   ? 33.501  36.347  206.274 1.00 47.35  ? 4   DG  G O6    1 
ATOM   341  N N1    . DG  C 1 4   ? 31.232  36.560  206.105 1.00 5.73   ? 4   DG  G N1    1 
ATOM   342  C C2    . DG  C 1 4   ? 29.939  36.429  206.591 1.00 28.96  ? 4   DG  G C2    1 
ATOM   343  N N2    . DG  C 1 4   ? 28.982  36.811  205.724 1.00 10.84  ? 4   DG  G N2    1 
ATOM   344  N N3    . DG  C 1 4   ? 29.628  35.956  207.823 1.00 10.81  ? 4   DG  G N3    1 
ATOM   345  C C4    . DG  C 1 4   ? 30.747  35.621  208.518 1.00 20.72  ? 4   DG  G C4    1 
ATOM   346  P P     . DG  C 1 5   ? 26.991  32.503  213.651 1.00 50.13  ? 5   DG  G P     1 
ATOM   347  O OP1   . DG  C 1 5   ? 27.195  33.356  214.851 1.00 41.95  ? 5   DG  G OP1   1 
ATOM   348  O OP2   . DG  C 1 5   ? 27.088  31.038  213.789 1.00 39.79  ? 5   DG  G OP2   1 
ATOM   349  O "O5'" . DG  C 1 5   ? 25.550  32.881  213.132 1.00 32.83  ? 5   DG  G "O5'" 1 
ATOM   350  C "C5'" . DG  C 1 5   ? 24.814  31.949  212.410 1.00 41.96  ? 5   DG  G "C5'" 1 
ATOM   351  C "C4'" . DG  C 1 5   ? 24.411  32.504  211.066 1.00 31.25  ? 5   DG  G "C4'" 1 
ATOM   352  O "O4'" . DG  C 1 5   ? 25.557  32.698  210.207 1.00 41.04  ? 5   DG  G "O4'" 1 
ATOM   353  C "C3'" . DG  C 1 5   ? 23.548  31.479  210.359 1.00 38.22  ? 5   DG  G "C3'" 1 
ATOM   354  O "O3'" . DG  C 1 5   ? 22.446  32.060  209.755 1.00 44.38  ? 5   DG  G "O3'" 1 
ATOM   355  C "C2'" . DG  C 1 5   ? 24.446  30.859  209.323 1.00 38.97  ? 5   DG  G "C2'" 1 
ATOM   356  C "C1'" . DG  C 1 5   ? 25.379  31.974  208.998 1.00 27.17  ? 5   DG  G "C1'" 1 
ATOM   357  N N9    . DG  C 1 5   ? 26.680  31.491  208.559 1.00 24.07  ? 5   DG  G N9    1 
ATOM   358  C C8    . DG  C 1 5   ? 27.803  31.353  209.331 1.00 29.09  ? 5   DG  G C8    1 
ATOM   359  N N7    . DG  C 1 5   ? 28.850  30.954  208.656 1.00 26.94  ? 5   DG  G N7    1 
ATOM   360  C C5    . DG  C 1 5   ? 28.382  30.791  207.362 1.00 12.52  ? 5   DG  G C5    1 
ATOM   361  C C6    . DG  C 1 5   ? 29.067  30.376  206.190 1.00 19.09  ? 5   DG  G C6    1 
ATOM   362  O O6    . DG  C 1 5   ? 30.257  30.041  206.071 1.00 12.96  ? 5   DG  G O6    1 
ATOM   363  N N1    . DG  C 1 5   ? 28.226  30.384  205.075 1.00 1.00   ? 5   DG  G N1    1 
ATOM   364  C C2    . DG  C 1 5   ? 26.891  30.752  205.095 1.00 24.11  ? 5   DG  G C2    1 
ATOM   365  N N2    . DG  C 1 5   ? 26.274  30.795  203.888 1.00 16.09  ? 5   DG  G N2    1 
ATOM   366  N N3    . DG  C 1 5   ? 26.226  31.090  206.202 1.00 3.70   ? 5   DG  G N3    1 
ATOM   367  C C4    . DG  C 1 5   ? 27.037  31.107  207.284 1.00 12.47  ? 5   DG  G C4    1 
ATOM   368  P P     . DT  C 1 6   ? 21.195  31.138  209.455 1.00 39.12  ? 6   DT  G P     1 
ATOM   369  O OP1   . DT  C 1 6   ? 20.014  32.053  209.387 1.00 46.29  ? 6   DT  G OP1   1 
ATOM   370  O OP2   . DT  C 1 6   ? 21.222  30.059  210.464 1.00 27.14  ? 6   DT  G OP2   1 
ATOM   371  O "O5'" . DT  C 1 6   ? 21.600  30.489  208.057 1.00 35.15  ? 6   DT  G "O5'" 1 
ATOM   372  C "C5'" . DT  C 1 6   ? 21.664  31.256  206.853 1.00 37.86  ? 6   DT  G "C5'" 1 
ATOM   373  C "C4'" . DT  C 1 6   ? 21.827  30.326  205.673 1.00 44.15  ? 6   DT  G "C4'" 1 
ATOM   374  O "O4'" . DT  C 1 6   ? 23.224  29.981  205.468 1.00 47.91  ? 6   DT  G "O4'" 1 
ATOM   375  C "C3'" . DT  C 1 6   ? 21.067  29.006  205.828 1.00 49.35  ? 6   DT  G "C3'" 1 
ATOM   376  O "O3'" . DT  C 1 6   ? 20.220  28.755  204.695 1.00 52.58  ? 6   DT  G "O3'" 1 
ATOM   377  C "C2'" . DT  C 1 6   ? 22.167  27.963  205.985 1.00 55.79  ? 6   DT  G "C2'" 1 
ATOM   378  C "C1'" . DT  C 1 6   ? 23.357  28.583  205.255 1.00 45.43  ? 6   DT  G "C1'" 1 
ATOM   379  N N1    . DT  C 1 6   ? 24.733  28.149  205.710 1.00 35.00  ? 6   DT  G N1    1 
ATOM   380  C C2    . DT  C 1 6   ? 25.629  27.772  204.748 1.00 15.40  ? 6   DT  G C2    1 
ATOM   381  O O2    . DT  C 1 6   ? 25.356  27.766  203.577 1.00 10.88  ? 6   DT  G O2    1 
ATOM   382  N N3    . DT  C 1 6   ? 26.857  27.401  205.215 1.00 26.21  ? 6   DT  G N3    1 
ATOM   383  C C4    . DT  C 1 6   ? 27.265  27.353  206.534 1.00 29.74  ? 6   DT  G C4    1 
ATOM   384  O O4    . DT  C 1 6   ? 28.404  26.998  206.823 1.00 30.60  ? 6   DT  G O4    1 
ATOM   385  C C5    . DT  C 1 6   ? 26.286  27.734  207.488 1.00 26.43  ? 6   DT  G C5    1 
ATOM   386  C C7    . DT  C 1 6   ? 26.647  27.669  208.936 1.00 36.12  ? 6   DT  G C7    1 
ATOM   387  C C6    . DT  C 1 6   ? 25.084  28.122  207.044 1.00 30.29  ? 6   DT  G C6    1 
ATOM   388  P P     . DC  C 1 7   ? 19.067  27.640  204.787 1.00 38.97  ? 7   DC  G P     1 
ATOM   389  O OP1   . DC  C 1 7   ? 17.913  28.050  203.958 1.00 45.47  ? 7   DC  G OP1   1 
ATOM   390  O OP2   . DC  C 1 7   ? 18.848  27.251  206.204 1.00 26.83  ? 7   DC  G OP2   1 
ATOM   391  O "O5'" . DC  C 1 7   ? 19.744  26.418  204.042 1.00 56.61  ? 7   DC  G "O5'" 1 
ATOM   392  C "C5'" . DC  C 1 7   ? 19.257  25.972  202.788 1.00 53.67  ? 7   DC  G "C5'" 1 
ATOM   393  C "C4'" . DC  C 1 7   ? 20.148  26.476  201.681 1.00 30.12  ? 7   DC  G "C4'" 1 
ATOM   394  O "O4'" . DC  C 1 7   ? 21.496  26.637  202.170 1.00 27.68  ? 7   DC  G "O4'" 1 
ATOM   395  C "C3'" . DC  C 1 7   ? 20.245  25.516  200.502 1.00 35.15  ? 7   DC  G "C3'" 1 
ATOM   396  O "O3'" . DC  C 1 7   ? 20.501  26.346  199.375 1.00 61.48  ? 7   DC  G "O3'" 1 
ATOM   397  C "C2'" . DC  C 1 7   ? 21.518  24.746  200.809 1.00 28.90  ? 7   DC  G "C2'" 1 
ATOM   398  C "C1'" . DC  C 1 7   ? 22.382  25.818  201.426 1.00 8.49   ? 7   DC  G "C1'" 1 
ATOM   399  N N1    . DC  C 1 7   ? 23.406  25.314  202.355 1.00 20.30  ? 7   DC  G N1    1 
ATOM   400  C C2    . DC  C 1 7   ? 24.718  25.008  201.865 1.00 21.62  ? 7   DC  G C2    1 
ATOM   401  O O2    . DC  C 1 7   ? 25.008  25.254  200.693 1.00 15.13  ? 7   DC  G O2    1 
ATOM   402  N N3    . DC  C 1 7   ? 25.630  24.481  202.718 1.00 12.02  ? 7   DC  G N3    1 
ATOM   403  C C4    . DC  C 1 7   ? 25.311  24.285  204.012 1.00 16.81  ? 7   DC  G C4    1 
ATOM   404  N N4    . DC  C 1 7   ? 26.245  23.740  204.796 1.00 13.02  ? 7   DC  G N4    1 
ATOM   405  C C5    . DC  C 1 7   ? 24.018  24.637  204.547 1.00 12.19  ? 7   DC  G C5    1 
ATOM   406  C C6    . DC  C 1 7   ? 23.103  25.133  203.684 1.00 11.77  ? 7   DC  G C6    1 
ATOM   407  O OP3   . DG  D 2 1   ? 20.290  24.730  196.362 1.00 89.55  ? 8   DG  H OP3   1 
ATOM   408  P P     . DG  D 2 1   ? 19.230  23.686  196.715 1.00 95.27  ? 8   DG  H P     1 
ATOM   409  O OP1   . DG  D 2 1   ? 18.544  23.192  195.444 1.00 92.72  ? 8   DG  H OP1   1 
ATOM   410  O OP2   . DG  D 2 1   ? 18.205  24.181  197.746 1.00 79.04  ? 8   DG  H OP2   1 
ATOM   411  O "O5'" . DG  D 2 1   ? 20.029  22.403  197.368 1.00 76.01  ? 8   DG  H "O5'" 1 
ATOM   412  C "C5'" . DG  D 2 1   ? 21.025  22.557  198.432 1.00 56.63  ? 8   DG  H "C5'" 1 
ATOM   413  C "C4'" . DG  D 2 1   ? 21.952  21.362  198.461 1.00 44.24  ? 8   DG  H "C4'" 1 
ATOM   414  O "O4'" . DG  D 2 1   ? 23.165  21.700  199.180 1.00 30.35  ? 8   DG  H "O4'" 1 
ATOM   415  C "C3'" . DG  D 2 1   ? 21.390  20.128  199.174 1.00 40.37  ? 8   DG  H "C3'" 1 
ATOM   416  O "O3'" . DG  D 2 1   ? 21.146  19.052  198.300 1.00 39.50  ? 8   DG  H "O3'" 1 
ATOM   417  C "C2'" . DG  D 2 1   ? 22.505  19.649  200.076 1.00 25.73  ? 8   DG  H "C2'" 1 
ATOM   418  C "C1'" . DG  D 2 1   ? 23.696  20.526  199.743 1.00 21.98  ? 8   DG  H "C1'" 1 
ATOM   419  N N9    . DG  D 2 1   ? 24.291  20.852  201.026 1.00 30.59  ? 8   DG  H N9    1 
ATOM   420  C C8    . DG  D 2 1   ? 23.643  21.364  202.131 1.00 21.48  ? 8   DG  H C8    1 
ATOM   421  N N7    . DG  D 2 1   ? 24.376  21.316  203.212 1.00 18.37  ? 8   DG  H N7    1 
ATOM   422  C C5    . DG  D 2 1   ? 25.594  20.814  202.777 1.00 11.01  ? 8   DG  H C5    1 
ATOM   423  C C6    . DG  D 2 1   ? 26.785  20.558  203.489 1.00 19.41  ? 8   DG  H C6    1 
ATOM   424  O O6    . DG  D 2 1   ? 27.005  20.707  204.698 1.00 17.43  ? 8   DG  H O6    1 
ATOM   425  N N1    . DG  D 2 1   ? 27.793  20.077  202.653 1.00 12.44  ? 8   DG  H N1    1 
ATOM   426  C C2    . DG  D 2 1   ? 27.658  19.869  201.301 1.00 28.06  ? 8   DG  H C2    1 
ATOM   427  N N2    . DG  D 2 1   ? 28.741  19.407  200.664 1.00 27.57  ? 8   DG  H N2    1 
ATOM   428  N N3    . DG  D 2 1   ? 26.546  20.102  200.626 1.00 20.61  ? 8   DG  H N3    1 
ATOM   429  C C4    . DG  D 2 1   ? 25.567  20.568  201.420 1.00 20.11  ? 8   DG  H C4    1 
ATOM   430  P P     . DA  D 2 2   ? 20.119  17.911  198.739 1.00 38.15  ? 9   DA  H P     1 
ATOM   431  O OP1   . DA  D 2 2   ? 19.343  17.648  197.532 1.00 35.99  ? 9   DA  H OP1   1 
ATOM   432  O OP2   . DA  D 2 2   ? 19.429  18.277  199.994 1.00 33.10  ? 9   DA  H OP2   1 
ATOM   433  O "O5'" . DA  D 2 2   ? 21.072  16.681  199.034 1.00 41.93  ? 9   DA  H "O5'" 1 
ATOM   434  C "C5'" . DA  D 2 2   ? 22.286  16.557  198.322 1.00 46.40  ? 9   DA  H "C5'" 1 
ATOM   435  C "C4'" . DA  D 2 2   ? 23.288  15.779  199.133 1.00 43.65  ? 9   DA  H "C4'" 1 
ATOM   436  O "O4'" . DA  D 2 2   ? 23.883  16.576  200.199 1.00 49.57  ? 9   DA  H "O4'" 1 
ATOM   437  C "C3'" . DA  D 2 2   ? 22.644  14.571  199.801 1.00 37.23  ? 9   DA  H "C3'" 1 
ATOM   438  O "O3'" . DA  D 2 2   ? 23.463  13.421  199.635 1.00 51.74  ? 9   DA  H "O3'" 1 
ATOM   439  C "C2'" . DA  D 2 2   ? 22.625  14.957  201.260 1.00 42.54  ? 9   DA  H "C2'" 1 
ATOM   440  C "C1'" . DA  D 2 2   ? 23.890  15.773  201.351 1.00 40.99  ? 9   DA  H "C1'" 1 
ATOM   441  N N9    . DA  D 2 2   ? 23.945  16.592  202.562 1.00 35.20  ? 9   DA  H N9    1 
ATOM   442  C C8    . DA  D 2 2   ? 22.893  17.075  203.293 1.00 40.60  ? 9   DA  H C8    1 
ATOM   443  N N7    . DA  D 2 2   ? 23.233  17.496  204.485 1.00 33.24  ? 9   DA  H N7    1 
ATOM   444  C C5    . DA  D 2 2   ? 24.606  17.339  204.511 1.00 22.04  ? 9   DA  H C5    1 
ATOM   445  C C6    . DA  D 2 2   ? 25.558  17.525  205.518 1.00 32.45  ? 9   DA  H C6    1 
ATOM   446  N N6    . DA  D 2 2   ? 25.252  17.877  206.772 1.00 25.50  ? 9   DA  H N6    1 
ATOM   447  N N1    . DA  D 2 2   ? 26.859  17.295  205.207 1.00 32.38  ? 9   DA  H N1    1 
ATOM   448  C C2    . DA  D 2 2   ? 27.157  16.875  203.974 1.00 15.40  ? 9   DA  H C2    1 
ATOM   449  N N3    . DA  D 2 2   ? 26.341  16.625  202.956 1.00 19.28  ? 9   DA  H N3    1 
ATOM   450  C C4    . DA  D 2 2   ? 25.066  16.870  203.298 1.00 17.23  ? 9   DA  H C4    1 
ATOM   451  P P     . DC  D 2 3   ? 22.780  11.970  199.602 1.00 39.32  ? 10  DC  H P     1 
ATOM   452  O OP1   . DC  D 2 3   ? 22.144  11.753  198.261 1.00 47.64  ? 10  DC  H OP1   1 
ATOM   453  O OP2   . DC  D 2 3   ? 21.953  11.886  200.822 1.00 48.54  ? 10  DC  H OP2   1 
ATOM   454  O "O5'" . DC  D 2 3   ? 24.022  10.999  199.767 1.00 42.76  ? 10  DC  H "O5'" 1 
ATOM   455  C "C5'" . DC  D 2 3   ? 24.461  10.632  201.045 1.00 39.38  ? 10  DC  H "C5'" 1 
ATOM   456  C "C4'" . DC  D 2 3   ? 25.895  11.055  201.253 1.00 42.75  ? 10  DC  H "C4'" 1 
ATOM   457  O "O4'" . DC  D 2 3   ? 25.930  12.409  201.790 1.00 46.60  ? 10  DC  H "O4'" 1 
ATOM   458  C "C3'" . DC  D 2 3   ? 26.586  10.166  202.278 1.00 41.02  ? 10  DC  H "C3'" 1 
ATOM   459  O "O3'" . DC  D 2 3   ? 27.744  9.533   201.764 1.00 36.69  ? 10  DC  H "O3'" 1 
ATOM   460  C "C2'" . DC  D 2 3   ? 26.995  11.083  203.413 1.00 40.48  ? 10  DC  H "C2'" 1 
ATOM   461  C "C1'" . DC  D 2 3   ? 26.826  12.503  202.898 1.00 36.67  ? 10  DC  H "C1'" 1 
ATOM   462  N N1    . DC  D 2 3   ? 26.149  13.240  203.969 1.00 43.49  ? 10  DC  H N1    1 
ATOM   463  C C2    . DC  D 2 3   ? 26.918  13.846  204.972 1.00 40.15  ? 10  DC  H C2    1 
ATOM   464  O O2    . DC  D 2 3   ? 28.148  13.939  204.813 1.00 35.12  ? 10  DC  H O2    1 
ATOM   465  N N3    . DC  D 2 3   ? 26.296  14.335  206.075 1.00 30.17  ? 10  DC  H N3    1 
ATOM   466  C C4    . DC  D 2 3   ? 24.962  14.282  206.164 1.00 34.36  ? 10  DC  H C4    1 
ATOM   467  N N4    . DC  D 2 3   ? 24.381  14.716  207.283 1.00 28.04  ? 10  DC  H N4    1 
ATOM   468  C C5    . DC  D 2 3   ? 24.160  13.767  205.112 1.00 40.68  ? 10  DC  H C5    1 
ATOM   469  C C6    . DC  D 2 3   ? 24.786  13.267  204.038 1.00 37.71  ? 10  DC  H C6    1 
ATOM   470  P P     . DC  D 2 4   ? 28.474  8.473   202.683 1.00 40.86  ? 11  DC  H P     1 
ATOM   471  O OP1   . DC  D 2 4   ? 29.099  9.365   203.711 1.00 34.43  ? 11  DC  H OP1   1 
ATOM   472  O OP2   . DC  D 2 4   ? 29.318  7.552   201.888 1.00 43.43  ? 11  DC  H OP2   1 
ATOM   473  O "O5'" . DC  D 2 4   ? 27.258  7.684   203.345 1.00 30.83  ? 11  DC  H "O5'" 1 
ATOM   474  C "C5'" . DC  D 2 4   ? 27.442  6.406   203.933 1.00 29.70  ? 11  DC  H "C5'" 1 
ATOM   475  C "C4'" . DC  D 2 4   ? 28.024  6.544   205.319 1.00 42.32  ? 11  DC  H "C4'" 1 
ATOM   476  O "O4'" . DC  D 2 4   ? 27.110  7.243   206.214 1.00 35.58  ? 11  DC  H "O4'" 1 
ATOM   477  C "C3'" . DC  D 2 4   ? 28.314  5.186   205.983 1.00 51.12  ? 11  DC  H "C3'" 1 
ATOM   478  O "O3'" . DC  D 2 4   ? 29.619  5.132   206.576 1.00 43.79  ? 11  DC  H "O3'" 1 
ATOM   479  C "C2'" . DC  D 2 4   ? 27.293  5.110   207.098 1.00 52.09  ? 11  DC  H "C2'" 1 
ATOM   480  C "C1'" . DC  D 2 4   ? 27.173  6.565   207.461 1.00 46.75  ? 11  DC  H "C1'" 1 
ATOM   481  N N1    . DC  D 2 4   ? 25.988  6.883   208.260 1.00 49.71  ? 11  DC  H N1    1 
ATOM   482  C C2    . DC  D 2 4   ? 26.095  7.885   209.216 1.00 50.06  ? 11  DC  H C2    1 
ATOM   483  O O2    . DC  D 2 4   ? 27.178  8.466   209.353 1.00 54.74  ? 11  DC  H O2    1 
ATOM   484  N N3    . DC  D 2 4   ? 25.025  8.190   209.973 1.00 49.73  ? 11  DC  H N3    1 
ATOM   485  C C4    . DC  D 2 4   ? 23.887  7.521   209.810 1.00 48.97  ? 11  DC  H C4    1 
ATOM   486  N N4    . DC  D 2 4   ? 22.870  7.845   210.596 1.00 57.81  ? 11  DC  H N4    1 
ATOM   487  C C5    . DC  D 2 4   ? 23.749  6.486   208.838 1.00 38.88  ? 11  DC  H C5    1 
ATOM   488  C C6    . DC  D 2 4   ? 24.812  6.206   208.089 1.00 40.46  ? 11  DC  H C6    1 
ATOM   489  P P     . DG  D 2 5   ? 30.473  3.773   206.475 1.00 41.40  ? 12  DG  H P     1 
ATOM   490  O OP1   . DG  D 2 5   ? 31.514  3.957   205.426 1.00 12.59  ? 12  DG  H OP1   1 
ATOM   491  O OP2   . DG  D 2 5   ? 29.500  2.661   206.362 1.00 45.25  ? 12  DG  H OP2   1 
ATOM   492  O "O5'" . DG  D 2 5   ? 31.203  3.664   207.876 1.00 40.39  ? 12  DG  H "O5'" 1 
ATOM   493  C "C5'" . DG  D 2 5   ? 32.000  4.737   208.325 1.00 46.43  ? 12  DG  H "C5'" 1 
ATOM   494  C "C4'" . DG  D 2 5   ? 31.753  4.995   209.788 1.00 44.10  ? 12  DG  H "C4'" 1 
ATOM   495  O "O4'" . DG  D 2 5   ? 30.354  5.304   210.044 1.00 42.09  ? 12  DG  H "O4'" 1 
ATOM   496  C "C3'" . DG  D 2 5   ? 32.072  3.796   210.674 1.00 47.72  ? 12  DG  H "C3'" 1 
ATOM   497  O "O3'" . DG  D 2 5   ? 32.820  4.240   211.798 1.00 48.12  ? 12  DG  H "O3'" 1 
ATOM   498  C "C2'" . DG  D 2 5   ? 30.701  3.307   211.116 1.00 41.43  ? 12  DG  H "C2'" 1 
ATOM   499  C "C1'" . DG  D 2 5   ? 29.985  4.620   211.227 1.00 32.97  ? 12  DG  H "C1'" 1 
ATOM   500  N N9    . DG  D 2 5   ? 28.532  4.598   211.331 1.00 37.68  ? 12  DG  H N9    1 
ATOM   501  C C8    . DG  D 2 5   ? 27.660  3.789   210.648 1.00 41.94  ? 12  DG  H C8    1 
ATOM   502  N N7    . DG  D 2 5   ? 26.404  4.078   210.884 1.00 45.94  ? 12  DG  H N7    1 
ATOM   503  C C5    . DG  D 2 5   ? 26.449  5.133   211.792 1.00 33.42  ? 12  DG  H C5    1 
ATOM   504  C C6    . DG  D 2 5   ? 25.390  5.896   212.392 1.00 38.07  ? 12  DG  H C6    1 
ATOM   505  O O6    . DG  D 2 5   ? 24.179  5.855   212.165 1.00 51.59  ? 12  DG  H O6    1 
ATOM   506  N N1    . DG  D 2 5   ? 25.875  6.809   213.311 1.00 35.28  ? 12  DG  H N1    1 
ATOM   507  C C2    . DG  D 2 5   ? 27.201  7.016   213.587 1.00 43.70  ? 12  DG  H C2    1 
ATOM   508  N N2    . DG  D 2 5   ? 27.454  7.939   214.531 1.00 49.67  ? 12  DG  H N2    1 
ATOM   509  N N3    . DG  D 2 5   ? 28.202  6.366   212.991 1.00 37.59  ? 12  DG  H N3    1 
ATOM   510  C C4    . DG  D 2 5   ? 27.750  5.438   212.117 1.00 34.91  ? 12  DG  H C4    1 
ATOM   511  P P     . DG  D 2 6   ? 33.639  3.179   212.657 1.00 70.02  ? 13  DG  H P     1 
ATOM   512  O OP1   . DG  D 2 6   ? 33.588  1.892   211.913 1.00 79.71  ? 13  DG  H OP1   1 
ATOM   513  O OP2   . DG  D 2 6   ? 33.108  3.251   214.039 1.00 79.09  ? 13  DG  H OP2   1 
ATOM   514  O "O5'" . DG  D 2 6   ? 35.135  3.717   212.615 1.00 78.55  ? 13  DG  H "O5'" 1 
ATOM   515  C "C5'" . DG  D 2 6   ? 35.430  5.073   212.940 1.00 103.44 ? 13  DG  H "C5'" 1 
ATOM   516  C "C4'" . DG  D 2 6   ? 36.896  5.365   212.711 1.00 111.92 ? 13  DG  H "C4'" 1 
ATOM   517  O "O4'" . DG  D 2 6   ? 37.682  4.554   213.617 1.00 120.94 ? 13  DG  H "O4'" 1 
ATOM   518  C "C3'" . DG  D 2 6   ? 37.430  5.063   211.309 1.00 112.17 ? 13  DG  H "C3'" 1 
ATOM   519  O "O3'" . DG  D 2 6   ? 38.536  5.919   210.980 1.00 98.02  ? 13  DG  H "O3'" 1 
ATOM   520  C "C2'" . DG  D 2 6   ? 38.008  3.669   211.465 1.00 118.86 ? 13  DG  H "C2'" 1 
ATOM   521  C "C1'" . DG  D 2 6   ? 38.567  3.718   212.879 1.00 128.93 ? 13  DG  H "C1'" 1 
ATOM   522  N N9    . DG  D 2 6   ? 38.635  2.422   213.554 1.00 135.97 ? 13  DG  H N9    1 
ATOM   523  C C8    . DG  D 2 6   ? 37.782  1.357   213.384 1.00 138.38 ? 13  DG  H C8    1 
ATOM   524  N N7    . DG  D 2 6   ? 38.104  0.321   214.111 1.00 139.92 ? 13  DG  H N7    1 
ATOM   525  C C5    . DG  D 2 6   ? 39.236  0.725   214.807 1.00 140.07 ? 13  DG  H C5    1 
ATOM   526  C C6    . DG  D 2 6   ? 40.037  0.022   215.745 1.00 142.40 ? 13  DG  H C6    1 
ATOM   527  O O6    . DG  D 2 6   ? 39.910  -1.142  216.151 1.00 143.88 ? 13  DG  H O6    1 
ATOM   528  N N1    . DG  D 2 6   ? 41.081  0.812   216.218 1.00 142.36 ? 13  DG  H N1    1 
ATOM   529  C C2    . DG  D 2 6   ? 41.329  2.107   215.837 1.00 140.33 ? 13  DG  H C2    1 
ATOM   530  N N2    . DG  D 2 6   ? 42.380  2.706   216.423 1.00 136.69 ? 13  DG  H N2    1 
ATOM   531  N N3    . DG  D 2 6   ? 40.598  2.768   214.953 1.00 140.17 ? 13  DG  H N3    1 
ATOM   532  C C4    . DG  D 2 6   ? 39.574  2.022   214.482 1.00 137.81 ? 13  DG  H C4    1 
ATOM   533  O "O5'" . DG  E 1 1   ? 30.598  8.957   213.943 1.00 109.50 ? 1   DG  I "O5'" 1 
ATOM   534  C "C5'" . DG  E 1 1   ? 31.548  7.868   213.928 1.00 118.70 ? 1   DG  I "C5'" 1 
ATOM   535  C "C4'" . DG  E 1 1   ? 32.017  7.567   215.334 1.00 123.26 ? 1   DG  I "C4'" 1 
ATOM   536  O "O4'" . DG  E 1 1   ? 30.909  6.971   216.052 1.00 121.33 ? 1   DG  I "O4'" 1 
ATOM   537  C "C3'" . DG  E 1 1   ? 33.179  6.576   215.457 1.00 121.56 ? 1   DG  I "C3'" 1 
ATOM   538  O "O3'" . DG  E 1 1   ? 34.191  7.050   216.379 1.00 125.42 ? 1   DG  I "O3'" 1 
ATOM   539  C "C2'" . DG  E 1 1   ? 32.524  5.244   215.798 1.00 112.59 ? 1   DG  I "C2'" 1 
ATOM   540  C "C1'" . DG  E 1 1   ? 31.177  5.613   216.410 1.00 108.43 ? 1   DG  I "C1'" 1 
ATOM   541  N N9    . DG  E 1 1   ? 30.057  4.812   215.921 1.00 94.62  ? 1   DG  I N9    1 
ATOM   542  C C8    . DG  E 1 1   ? 30.114  3.731   215.081 1.00 86.03  ? 1   DG  I C8    1 
ATOM   543  N N7    . DG  E 1 1   ? 28.935  3.247   214.789 1.00 80.09  ? 1   DG  I N7    1 
ATOM   544  C C5    . DG  E 1 1   ? 28.043  4.052   215.484 1.00 77.30  ? 1   DG  I C5    1 
ATOM   545  C C6    . DG  E 1 1   ? 26.622  4.017   215.545 1.00 71.39  ? 1   DG  I C6    1 
ATOM   546  O O6    . DG  E 1 1   ? 25.847  3.261   214.968 1.00 61.25  ? 1   DG  I O6    1 
ATOM   547  N N1    . DG  E 1 1   ? 26.121  5.002   216.382 1.00 81.67  ? 1   DG  I N1    1 
ATOM   548  C C2    . DG  E 1 1   ? 26.883  5.916   217.075 1.00 90.87  ? 1   DG  I C2    1 
ATOM   549  N N2    . DG  E 1 1   ? 26.209  6.771   217.861 1.00 94.24  ? 1   DG  I N2    1 
ATOM   550  N N3    . DG  E 1 1   ? 28.206  5.979   217.009 1.00 89.03  ? 1   DG  I N3    1 
ATOM   551  C C4    . DG  E 1 1   ? 28.716  5.018   216.200 1.00 88.72  ? 1   DG  I C4    1 
ATOM   552  P P     . DC  E 1 2   ? 33.927  7.059   217.974 1.00 130.19 ? 2   DC  I P     1 
ATOM   553  O OP1   . DC  E 1 2   ? 32.757  7.931   218.263 1.00 127.81 ? 2   DC  I OP1   1 
ATOM   554  O OP2   . DC  E 1 2   ? 35.242  7.384   218.586 1.00 134.32 ? 2   DC  I OP2   1 
ATOM   555  O "O5'" . DC  E 1 2   ? 33.546  5.555   218.361 1.00 128.25 ? 2   DC  I "O5'" 1 
ATOM   556  C "C5'" . DC  E 1 2   ? 33.703  5.065   219.707 1.00 114.93 ? 2   DC  I "C5'" 1 
ATOM   557  C "C4'" . DC  E 1 2   ? 32.516  5.466   220.555 1.00 110.10 ? 2   DC  I "C4'" 1 
ATOM   558  O "O4'" . DC  E 1 2   ? 31.293  5.156   219.848 1.00 102.04 ? 2   DC  I "O4'" 1 
ATOM   559  C "C3'" . DC  E 1 2   ? 32.386  4.775   221.918 1.00 109.21 ? 2   DC  I "C3'" 1 
ATOM   560  O "O3'" . DC  E 1 2   ? 31.764  5.675   222.859 1.00 110.80 ? 2   DC  I "O3'" 1 
ATOM   561  C "C2'" . DC  E 1 2   ? 31.449  3.623   221.611 1.00 102.32 ? 2   DC  I "C2'" 1 
ATOM   562  C "C1'" . DC  E 1 2   ? 30.497  4.286   220.635 1.00 88.70  ? 2   DC  I "C1'" 1 
ATOM   563  N N1    . DC  E 1 2   ? 29.793  3.375   219.723 1.00 65.89  ? 2   DC  I N1    1 
ATOM   564  C C2    . DC  E 1 2   ? 28.422  3.527   219.563 1.00 52.31  ? 2   DC  I C2    1 
ATOM   565  O O2    . DC  E 1 2   ? 27.850  4.409   220.199 1.00 51.56  ? 2   DC  I O2    1 
ATOM   566  N N3    . DC  E 1 2   ? 27.755  2.713   218.721 1.00 42.20  ? 2   DC  I N3    1 
ATOM   567  C C4    . DC  E 1 2   ? 28.412  1.764   218.058 1.00 59.88  ? 2   DC  I C4    1 
ATOM   568  N N4    . DC  E 1 2   ? 27.707  0.964   217.253 1.00 72.20  ? 2   DC  I N4    1 
ATOM   569  C C5    . DC  E 1 2   ? 29.820  1.584   218.199 1.00 61.37  ? 2   DC  I C5    1 
ATOM   570  C C6    . DC  E 1 2   ? 30.464  2.404   219.039 1.00 63.62  ? 2   DC  I C6    1 
ATOM   571  P P     . DC  E 1 3   ? 31.440  5.179   224.358 1.00 109.68 ? 3   DC  I P     1 
ATOM   572  O OP1   . DC  E 1 3   ? 31.571  6.353   225.263 1.00 116.32 ? 3   DC  I OP1   1 
ATOM   573  O OP2   . DC  E 1 3   ? 32.243  3.954   224.619 1.00 111.97 ? 3   DC  I OP2   1 
ATOM   574  O "O5'" . DC  E 1 3   ? 29.894  4.777   224.327 1.00 111.43 ? 3   DC  I "O5'" 1 
ATOM   575  C "C5'" . DC  E 1 3   ? 28.865  5.775   224.226 1.00 105.93 ? 3   DC  I "C5'" 1 
ATOM   576  C "C4'" . DC  E 1 3   ? 27.497  5.176   224.502 1.00 103.68 ? 3   DC  I "C4'" 1 
ATOM   577  O "O4'" . DC  E 1 3   ? 27.084  4.265   223.448 1.00 104.28 ? 3   DC  I "O4'" 1 
ATOM   578  C "C3'" . DC  E 1 3   ? 27.329  4.398   225.811 1.00 97.96  ? 3   DC  I "C3'" 1 
ATOM   579  O "O3'" . DC  E 1 3   ? 26.045  4.695   226.376 1.00 87.49  ? 3   DC  I "O3'" 1 
ATOM   580  C "C2'" . DC  E 1 3   ? 27.384  2.944   225.367 1.00 95.86  ? 3   DC  I "C2'" 1 
ATOM   581  C "C1'" . DC  E 1 3   ? 26.707  3.005   224.003 1.00 90.86  ? 3   DC  I "C1'" 1 
ATOM   582  N N1    . DC  E 1 3   ? 27.089  1.937   223.043 1.00 73.96  ? 3   DC  I N1    1 
ATOM   583  C C2    . DC  E 1 3   ? 26.079  1.202   222.438 1.00 65.43  ? 3   DC  I C2    1 
ATOM   584  O O2    . DC  E 1 3   ? 24.909  1.446   222.743 1.00 84.74  ? 3   DC  I O2    1 
ATOM   585  N N3    . DC  E 1 3   ? 26.393  0.243   221.545 1.00 57.67  ? 3   DC  I N3    1 
ATOM   586  C C4    . DC  E 1 3   ? 27.666  -0.006  221.260 1.00 62.24  ? 3   DC  I C4    1 
ATOM   587  N N4    . DC  E 1 3   ? 27.933  -0.962  220.363 1.00 58.08  ? 3   DC  I N4    1 
ATOM   588  C C5    . DC  E 1 3   ? 28.726  0.714   221.874 1.00 62.04  ? 3   DC  I C5    1 
ATOM   589  C C6    . DC  E 1 3   ? 28.397  1.670   222.750 1.00 67.97  ? 3   DC  I C6    1 
ATOM   590  P P     . DG  E 1 4   ? 25.702  4.225   227.870 1.00 75.87  ? 4   DG  I P     1 
ATOM   591  O OP1   . DG  E 1 4   ? 24.834  5.275   228.453 1.00 75.58  ? 4   DG  I OP1   1 
ATOM   592  O OP2   . DG  E 1 4   ? 26.952  3.816   228.563 1.00 57.32  ? 4   DG  I OP2   1 
ATOM   593  O "O5'" . DG  E 1 4   ? 24.829  2.914   227.656 1.00 77.49  ? 4   DG  I "O5'" 1 
ATOM   594  C "C5'" . DG  E 1 4   ? 23.434  2.987   227.361 1.00 72.95  ? 4   DG  I "C5'" 1 
ATOM   595  C "C4'" . DG  E 1 4   ? 22.813  1.612   227.462 1.00 72.16  ? 4   DG  I "C4'" 1 
ATOM   596  O "O4'" . DG  E 1 4   ? 23.275  0.754   226.397 1.00 68.85  ? 4   DG  I "O4'" 1 
ATOM   597  C "C3'" . DG  E 1 4   ? 23.139  0.862   228.754 1.00 71.89  ? 4   DG  I "C3'" 1 
ATOM   598  O "O3'" . DG  E 1 4   ? 22.008  0.092   229.100 1.00 67.78  ? 4   DG  I "O3'" 1 
ATOM   599  C "C2'" . DG  E 1 4   ? 24.266  -0.066  228.354 1.00 63.16  ? 4   DG  I "C2'" 1 
ATOM   600  C "C1'" . DG  E 1 4   ? 23.817  -0.433  226.965 1.00 72.00  ? 4   DG  I "C1'" 1 
ATOM   601  N N9    . DG  E 1 4   ? 24.855  -0.920  226.071 1.00 68.95  ? 4   DG  I N9    1 
ATOM   602  C C8    . DG  E 1 4   ? 26.215  -0.762  226.164 1.00 62.33  ? 4   DG  I C8    1 
ATOM   603  N N7    . DG  E 1 4   ? 26.853  -1.298  225.159 1.00 57.40  ? 4   DG  I N7    1 
ATOM   604  C C5    . DG  E 1 4   ? 25.851  -1.841  224.366 1.00 54.83  ? 4   DG  I C5    1 
ATOM   605  C C6    . DG  E 1 4   ? 25.923  -2.527  223.143 1.00 53.63  ? 4   DG  I C6    1 
ATOM   606  O O6    . DG  E 1 4   ? 26.921  -2.798  222.478 1.00 58.39  ? 4   DG  I O6    1 
ATOM   607  N N1    . DG  E 1 4   ? 24.659  -2.909  222.697 1.00 48.85  ? 4   DG  I N1    1 
ATOM   608  C C2    . DG  E 1 4   ? 23.479  -2.654  223.353 1.00 44.92  ? 4   DG  I C2    1 
ATOM   609  N N2    . DG  E 1 4   ? 22.354  -3.109  222.796 1.00 49.97  ? 4   DG  I N2    1 
ATOM   610  N N3    . DG  E 1 4   ? 23.405  -2.002  224.479 1.00 49.22  ? 4   DG  I N3    1 
ATOM   611  C C4    . DG  E 1 4   ? 24.619  -1.628  224.927 1.00 61.86  ? 4   DG  I C4    1 
ATOM   612  P P     . DG  E 1 5   ? 20.879  0.745   230.010 1.00 73.47  ? 5   DG  I P     1 
ATOM   613  O OP1   . DG  E 1 5   ? 20.642  2.111   229.495 1.00 67.18  ? 5   DG  I OP1   1 
ATOM   614  O OP2   . DG  E 1 5   ? 21.310  0.551   231.422 1.00 71.95  ? 5   DG  I OP2   1 
ATOM   615  O "O5'" . DG  E 1 5   ? 19.602  -0.125  229.645 1.00 66.13  ? 5   DG  I "O5'" 1 
ATOM   616  C "C5'" . DG  E 1 5   ? 18.933  0.085   228.406 1.00 56.70  ? 5   DG  I "C5'" 1 
ATOM   617  C "C4'" . DG  E 1 5   ? 18.447  -1.226  227.824 1.00 55.95  ? 5   DG  I "C4'" 1 
ATOM   618  O "O4'" . DG  E 1 5   ? 19.534  -2.008  227.284 1.00 45.66  ? 5   DG  I "O4'" 1 
ATOM   619  C "C3'" . DG  E 1 5   ? 17.705  -2.151  228.784 1.00 46.15  ? 5   DG  I "C3'" 1 
ATOM   620  O "O3'" . DG  E 1 5   ? 16.595  -2.724  228.141 1.00 34.28  ? 5   DG  I "O3'" 1 
ATOM   621  C "C2'" . DG  E 1 5   ? 18.687  -3.267  229.055 1.00 44.09  ? 5   DG  I "C2'" 1 
ATOM   622  C "C1'" . DG  E 1 5   ? 19.452  -3.339  227.751 1.00 33.32  ? 5   DG  I "C1'" 1 
ATOM   623  N N9    . DG  E 1 5   ? 20.814  -3.790  227.963 1.00 36.91  ? 5   DG  I N9    1 
ATOM   624  C C8    . DG  E 1 5   ? 21.871  -3.052  228.423 1.00 34.97  ? 5   DG  I C8    1 
ATOM   625  N N7    . DG  E 1 5   ? 22.970  -3.744  228.506 1.00 43.49  ? 5   DG  I N7    1 
ATOM   626  C C5    . DG  E 1 5   ? 22.607  -5.011  228.076 1.00 31.70  ? 5   DG  I C5    1 
ATOM   627  C C6    . DG  E 1 5   ? 23.380  -6.169  227.913 1.00 32.32  ? 5   DG  I C6    1 
ATOM   628  O O6    . DG  E 1 5   ? 24.590  -6.337  228.142 1.00 34.07  ? 5   DG  I O6    1 
ATOM   629  N N1    . DG  E 1 5   ? 22.622  -7.210  227.418 1.00 26.89  ? 5   DG  I N1    1 
ATOM   630  C C2    . DG  E 1 5   ? 21.287  -7.148  227.122 1.00 39.55  ? 5   DG  I C2    1 
ATOM   631  N N2    . DG  E 1 5   ? 20.727  -8.268  226.629 1.00 46.82  ? 5   DG  I N2    1 
ATOM   632  N N3    . DG  E 1 5   ? 20.554  -6.077  227.284 1.00 38.64  ? 5   DG  I N3    1 
ATOM   633  C C4    . DG  E 1 5   ? 21.279  -5.049  227.747 1.00 28.90  ? 5   DG  I C4    1 
ATOM   634  P P     . DT  E 1 6   ? 15.591  -3.608  228.990 1.00 49.09  ? 6   DT  I P     1 
ATOM   635  O OP1   . DT  E 1 6   ? 14.231  -3.455  228.399 1.00 48.39  ? 6   DT  I OP1   1 
ATOM   636  O OP2   . DT  E 1 6   ? 15.827  -3.241  230.399 1.00 57.45  ? 6   DT  I OP2   1 
ATOM   637  O "O5'" . DT  E 1 6   ? 16.105  -5.088  228.724 1.00 51.74  ? 6   DT  I "O5'" 1 
ATOM   638  C "C5'" . DT  E 1 6   ? 15.987  -5.648  227.417 1.00 56.95  ? 6   DT  I "C5'" 1 
ATOM   639  C "C4'" . DT  E 1 6   ? 15.993  -7.158  227.474 1.00 50.45  ? 6   DT  I "C4'" 1 
ATOM   640  O "O4'" . DT  E 1 6   ? 17.345  -7.665  227.531 1.00 37.15  ? 6   DT  I "O4'" 1 
ATOM   641  C "C3'" . DT  E 1 6   ? 15.239  -7.783  228.640 1.00 48.87  ? 6   DT  I "C3'" 1 
ATOM   642  O "O3'" . DT  E 1 6   ? 14.294  -8.752  228.161 1.00 45.37  ? 6   DT  I "O3'" 1 
ATOM   643  C "C2'" . DT  E 1 6   ? 16.338  -8.388  229.500 1.00 47.73  ? 6   DT  I "C2'" 1 
ATOM   644  C "C1'" . DT  E 1 6   ? 17.459  -8.660  228.515 1.00 34.45  ? 6   DT  I "C1'" 1 
ATOM   645  N N1    . DT  E 1 6   ? 18.829  -8.567  229.080 1.00 38.42  ? 6   DT  I N1    1 
ATOM   646  C C2    . DT  E 1 6   ? 19.688  -9.643  228.950 1.00 30.30  ? 6   DT  I C2    1 
ATOM   647  O O2    . DT  E 1 6   ? 19.395  -10.670 228.371 1.00 45.59  ? 6   DT  I O2    1 
ATOM   648  N N3    . DT  E 1 6   ? 20.924  -9.463  229.524 1.00 37.42  ? 6   DT  I N3    1 
ATOM   649  C C4    . DT  E 1 6   ? 21.387  -8.343  230.189 1.00 45.44  ? 6   DT  I C4    1 
ATOM   650  O O4    . DT  E 1 6   ? 22.525  -8.330  230.651 1.00 54.58  ? 6   DT  I O4    1 
ATOM   651  C C5    . DT  E 1 6   ? 20.450  -7.250  230.274 1.00 46.84  ? 6   DT  I C5    1 
ATOM   652  C C7    . DT  E 1 6   ? 20.873  -5.988  230.953 1.00 35.70  ? 6   DT  I C7    1 
ATOM   653  C C6    . DT  E 1 6   ? 19.231  -7.415  229.729 1.00 48.17  ? 6   DT  I C6    1 
ATOM   654  P P     . DC  E 1 7   ? 13.380  -9.560  229.197 1.00 47.43  ? 7   DC  I P     1 
ATOM   655  O OP1   . DC  E 1 7   ? 12.039  -9.736  228.596 1.00 28.50  ? 7   DC  I OP1   1 
ATOM   656  O OP2   . DC  E 1 7   ? 13.513  -9.009  230.573 1.00 33.98  ? 7   DC  I OP2   1 
ATOM   657  O "O5'" . DC  E 1 7   ? 14.074  -10.975 229.154 1.00 40.20  ? 7   DC  I "O5'" 1 
ATOM   658  C "C5'" . DC  E 1 7   ? 14.385  -11.546 227.908 1.00 34.37  ? 7   DC  I "C5'" 1 
ATOM   659  C "C4'" . DC  E 1 7   ? 15.280  -12.737 228.105 1.00 32.97  ? 7   DC  I "C4'" 1 
ATOM   660  O "O4'" . DC  E 1 7   ? 16.604  -12.302 228.477 1.00 25.26  ? 7   DC  I "O4'" 1 
ATOM   661  C "C3'" . DC  E 1 7   ? 14.803  -13.635 229.235 1.00 31.00  ? 7   DC  I "C3'" 1 
ATOM   662  O "O3'" . DC  E 1 7   ? 13.699  -14.514 228.984 1.00 30.96  ? 7   DC  I "O3'" 1 
ATOM   663  C "C2'" . DC  E 1 7   ? 16.059  -13.989 230.016 1.00 41.95  ? 7   DC  I "C2'" 1 
ATOM   664  C "C1'" . DC  E 1 7   ? 17.205  -13.350 229.224 1.00 41.62  ? 7   DC  I "C1'" 1 
ATOM   665  N N1    . DC  E 1 7   ? 18.231  -12.742 230.084 1.00 43.63  ? 7   DC  I N1    1 
ATOM   666  C C2    . DC  E 1 7   ? 19.566  -13.117 229.918 1.00 42.52  ? 7   DC  I C2    1 
ATOM   667  O O2    . DC  E 1 7   ? 19.848  -13.907 229.021 1.00 41.78  ? 7   DC  I O2    1 
ATOM   668  N N3    . DC  E 1 7   ? 20.507  -12.577 230.726 1.00 48.70  ? 7   DC  I N3    1 
ATOM   669  C C4    . DC  E 1 7   ? 20.148  -11.674 231.657 1.00 43.56  ? 7   DC  I C4    1 
ATOM   670  N N4    . DC  E 1 7   ? 21.093  -11.163 232.447 1.00 39.06  ? 7   DC  I N4    1 
ATOM   671  C C5    . DC  E 1 7   ? 18.797  -11.258 231.822 1.00 32.19  ? 7   DC  I C5    1 
ATOM   672  C C6    . DC  E 1 7   ? 17.881  -11.813 231.027 1.00 35.33  ? 7   DC  I C6    1 
ATOM   673  O OP3   . DG  F 2 1   ? 15.683  -19.095 227.415 1.00 100.01 ? 8   DG  J OP3   1 
ATOM   674  P P     . DG  F 2 1   ? 14.484  -19.173 228.347 1.00 100.50 ? 8   DG  J P     1 
ATOM   675  O OP1   . DG  F 2 1   ? 14.298  -20.566 228.923 1.00 98.30  ? 8   DG  J OP1   1 
ATOM   676  O OP2   . DG  F 2 1   ? 13.220  -18.630 227.688 1.00 90.32  ? 8   DG  J OP2   1 
ATOM   677  O "O5'" . DG  F 2 1   ? 14.803  -18.199 229.623 1.00 92.24  ? 8   DG  J "O5'" 1 
ATOM   678  C "C5'" . DG  F 2 1   ? 16.128  -17.640 229.847 1.00 84.62  ? 8   DG  J "C5'" 1 
ATOM   679  C "C4'" . DG  F 2 1   ? 16.773  -18.284 231.054 1.00 77.12  ? 8   DG  J "C4'" 1 
ATOM   680  O "O4'" . DG  F 2 1   ? 17.988  -17.564 231.425 1.00 75.22  ? 8   DG  J "O4'" 1 
ATOM   681  C "C3'" . DG  F 2 1   ? 15.879  -18.290 232.299 1.00 70.63  ? 8   DG  J "C3'" 1 
ATOM   682  O "O3'" . DG  F 2 1   ? 15.951  -19.538 232.975 1.00 63.32  ? 8   DG  J "O3'" 1 
ATOM   683  C "C2'" . DG  F 2 1   ? 16.505  -17.240 233.185 1.00 78.07  ? 8   DG  J "C2'" 1 
ATOM   684  C "C1'" . DG  F 2 1   ? 17.978  -17.336 232.818 1.00 67.20  ? 8   DG  J "C1'" 1 
ATOM   685  N N9    . DG  F 2 1   ? 18.668  -16.083 233.128 1.00 58.85  ? 8   DG  J N9    1 
ATOM   686  C C8    . DG  F 2 1   ? 18.086  -14.834 233.182 1.00 55.98  ? 8   DG  J C8    1 
ATOM   687  N N7    . DG  F 2 1   ? 18.876  -13.917 233.671 1.00 51.18  ? 8   DG  J N7    1 
ATOM   688  C C5    . DG  F 2 1   ? 20.068  -14.585 233.914 1.00 44.55  ? 8   DG  J C5    1 
ATOM   689  C C6    . DG  F 2 1   ? 21.294  -14.104 234.437 1.00 39.84  ? 8   DG  J C6    1 
ATOM   690  O O6    . DG  F 2 1   ? 21.576  -12.968 234.812 1.00 35.89  ? 8   DG  J O6    1 
ATOM   691  N N1    . DG  F 2 1   ? 22.253  -15.106 234.493 1.00 41.70  ? 8   DG  J N1    1 
ATOM   692  C C2    . DG  F 2 1   ? 22.058  -16.408 234.090 1.00 51.86  ? 8   DG  J C2    1 
ATOM   693  N N2    . DG  F 2 1   ? 23.117  -17.221 234.220 1.00 46.74  ? 8   DG  J N2    1 
ATOM   694  N N3    . DG  F 2 1   ? 20.913  -16.874 233.597 1.00 44.42  ? 8   DG  J N3    1 
ATOM   695  C C4    . DG  F 2 1   ? 19.969  -15.916 233.539 1.00 45.25  ? 8   DG  J C4    1 
ATOM   696  P P     . DA  F 2 2   ? 14.767  -19.979 233.973 1.00 65.95  ? 9   DA  J P     1 
ATOM   697  O OP1   . DA  F 2 2   ? 14.147  -21.206 233.400 1.00 57.13  ? 9   DA  J OP1   1 
ATOM   698  O OP2   . DA  F 2 2   ? 13.907  -18.829 234.346 1.00 50.99  ? 9   DA  J OP2   1 
ATOM   699  O "O5'" . DA  F 2 2   ? 15.570  -20.332 235.285 1.00 60.25  ? 9   DA  J "O5'" 1 
ATOM   700  C "C5'" . DA  F 2 2   ? 16.522  -19.418 235.740 1.00 59.34  ? 9   DA  J "C5'" 1 
ATOM   701  C "C4'" . DA  F 2 2   ? 17.684  -20.145 236.356 1.00 71.03  ? 9   DA  J "C4'" 1 
ATOM   702  O "O4'" . DA  F 2 2   ? 18.822  -19.263 236.290 1.00 73.53  ? 9   DA  J "O4'" 1 
ATOM   703  C "C3'" . DA  F 2 2   ? 17.469  -20.472 237.826 1.00 79.48  ? 9   DA  J "C3'" 1 
ATOM   704  O "O3'" . DA  F 2 2   ? 18.151  -21.679 238.164 1.00 86.49  ? 9   DA  J "O3'" 1 
ATOM   705  C "C2'" . DA  F 2 2   ? 18.047  -19.263 238.539 1.00 74.96  ? 9   DA  J "C2'" 1 
ATOM   706  C "C1'" . DA  F 2 2   ? 19.069  -18.681 237.552 1.00 67.76  ? 9   DA  J "C1'" 1 
ATOM   707  N N9    . DA  F 2 2   ? 18.891  -17.240 237.419 1.00 53.39  ? 9   DA  J N9    1 
ATOM   708  C C8    . DA  F 2 2   ? 17.734  -16.540 237.167 1.00 41.76  ? 9   DA  J C8    1 
ATOM   709  N N7    . DA  F 2 2   ? 17.873  -15.249 237.278 1.00 36.33  ? 9   DA  J N7    1 
ATOM   710  C C5    . DA  F 2 2   ? 19.216  -15.086 237.596 1.00 28.44  ? 9   DA  J C5    1 
ATOM   711  C C6    . DA  F 2 2   ? 19.983  -13.957 237.896 1.00 29.32  ? 9   DA  J C6    1 
ATOM   712  N N6    . DA  F 2 2   ? 19.491  -12.722 237.959 1.00 39.38  ? 9   DA  J N6    1 
ATOM   713  N N1    . DA  F 2 2   ? 21.295  -14.138 238.150 1.00 36.70  ? 9   DA  J N1    1 
ATOM   714  C C2    . DA  F 2 2   ? 21.787  -15.384 238.124 1.00 43.90  ? 9   DA  J C2    1 
ATOM   715  N N3    . DA  F 2 2   ? 21.159  -16.527 237.888 1.00 41.94  ? 9   DA  J N3    1 
ATOM   716  C C4    . DA  F 2 2   ? 19.861  -16.301 237.629 1.00 38.54  ? 9   DA  J C4    1 
ATOM   717  P P     . DC  F 2 3   ? 17.882  -22.389 239.581 1.00 86.46  ? 10  DC  J P     1 
ATOM   718  O OP1   . DC  F 2 3   ? 17.502  -23.780 239.245 1.00 85.38  ? 10  DC  J OP1   1 
ATOM   719  O OP2   . DC  F 2 3   ? 16.994  -21.582 240.465 1.00 71.82  ? 10  DC  J OP2   1 
ATOM   720  O "O5'" . DC  F 2 3   ? 19.339  -22.386 240.219 1.00 78.50  ? 10  DC  J "O5'" 1 
ATOM   721  C "C5'" . DC  F 2 3   ? 19.601  -21.687 241.425 1.00 69.07  ? 10  DC  J "C5'" 1 
ATOM   722  C "C4'" . DC  F 2 3   ? 20.939  -20.988 241.357 1.00 62.34  ? 10  DC  J "C4'" 1 
ATOM   723  O "O4'" . DC  F 2 3   ? 20.771  -19.726 240.650 1.00 61.73  ? 10  DC  J "O4'" 1 
ATOM   724  C "C3'" . DC  F 2 3   ? 21.443  -20.620 242.755 1.00 63.69  ? 10  DC  J "C3'" 1 
ATOM   725  O "O3'" . DC  F 2 3   ? 22.823  -20.885 242.950 1.00 66.85  ? 10  DC  J "O3'" 1 
ATOM   726  C "C2'" . DC  F 2 3   ? 21.220  -19.129 242.864 1.00 63.32  ? 10  DC  J "C2'" 1 
ATOM   727  C "C1'" . DC  F 2 3   ? 21.306  -18.661 241.433 1.00 52.09  ? 10  DC  J "C1'" 1 
ATOM   728  N N1    . DC  F 2 3   ? 20.475  -17.459 241.275 1.00 39.65  ? 10  DC  J N1    1 
ATOM   729  C C2    . DC  F 2 3   ? 21.111  -16.221 241.281 1.00 33.61  ? 10  DC  J C2    1 
ATOM   730  O O2    . DC  F 2 3   ? 22.338  -16.195 241.293 1.00 37.62  ? 10  DC  J O2    1 
ATOM   731  N N3    . DC  F 2 3   ? 20.372  -15.089 241.268 1.00 22.51  ? 10  DC  J N3    1 
ATOM   732  C C4    . DC  F 2 3   ? 19.038  -15.172 241.222 1.00 29.14  ? 10  DC  J C4    1 
ATOM   733  N N4    . DC  F 2 3   ? 18.345  -14.042 241.243 1.00 34.14  ? 10  DC  J N4    1 
ATOM   734  C C5    . DC  F 2 3   ? 18.359  -16.427 241.163 1.00 18.70  ? 10  DC  J C5    1 
ATOM   735  C C6    . DC  F 2 3   ? 19.110  -17.536 241.187 1.00 31.87  ? 10  DC  J C6    1 
ATOM   736  P P     . DC  F 2 4   ? 23.387  -21.000 244.449 1.00 65.33  ? 11  DC  J P     1 
ATOM   737  O OP1   . DC  F 2 4   ? 24.152  -19.767 244.773 1.00 62.36  ? 11  DC  J OP1   1 
ATOM   738  O OP2   . DC  F 2 4   ? 24.042  -22.322 244.567 1.00 74.00  ? 11  DC  J OP2   1 
ATOM   739  O "O5'" . DC  F 2 4   ? 22.074  -21.015 245.353 1.00 62.01  ? 11  DC  J "O5'" 1 
ATOM   740  C "C5'" . DC  F 2 4   ? 22.162  -21.208 246.750 1.00 53.19  ? 11  DC  J "C5'" 1 
ATOM   741  C "C4'" . DC  F 2 4   ? 22.838  -20.013 247.370 1.00 65.11  ? 11  DC  J "C4'" 1 
ATOM   742  O "O4'" . DC  F 2 4   ? 21.983  -18.850 247.253 1.00 76.69  ? 11  DC  J "O4'" 1 
ATOM   743  C "C3'" . DC  F 2 4   ? 23.156  -20.147 248.857 1.00 73.32  ? 11  DC  J "C3'" 1 
ATOM   744  O "O3'" . DC  F 2 4   ? 24.470  -19.647 249.085 1.00 73.74  ? 11  DC  J "O3'" 1 
ATOM   745  C "C2'" . DC  F 2 4   ? 22.131  -19.254 249.542 1.00 72.83  ? 11  DC  J "C2'" 1 
ATOM   746  C "C1'" . DC  F 2 4   ? 21.945  -18.169 248.506 1.00 70.13  ? 11  DC  J "C1'" 1 
ATOM   747  N N1    . DC  F 2 4   ? 20.685  -17.404 248.578 1.00 63.65  ? 11  DC  J N1    1 
ATOM   748  C C2    . DC  F 2 4   ? 20.718  -16.007 248.335 1.00 53.33  ? 11  DC  J C2    1 
ATOM   749  O O2    . DC  F 2 4   ? 21.809  -15.451 248.115 1.00 52.19  ? 11  DC  J O2    1 
ATOM   750  N N3    . DC  F 2 4   ? 19.559  -15.304 248.352 1.00 33.06  ? 11  DC  J N3    1 
ATOM   751  C C4    . DC  F 2 4   ? 18.404  -15.926 248.612 1.00 44.69  ? 11  DC  J C4    1 
ATOM   752  N N4    . DC  F 2 4   ? 17.289  -15.195 248.597 1.00 33.38  ? 11  DC  J N4    1 
ATOM   753  C C5    . DC  F 2 4   ? 18.343  -17.332 248.892 1.00 53.73  ? 11  DC  J C5    1 
ATOM   754  C C6    . DC  F 2 4   ? 19.498  -18.026 248.857 1.00 61.80  ? 11  DC  J C6    1 
ATOM   755  P P     . DG  F 2 5   ? 25.272  -20.121 250.376 1.00 77.59  ? 12  DG  J P     1 
ATOM   756  O OP1   . DG  F 2 5   ? 26.523  -20.758 249.910 1.00 68.78  ? 12  DG  J OP1   1 
ATOM   757  O OP2   . DG  F 2 5   ? 24.305  -20.905 251.182 1.00 77.98  ? 12  DG  J OP2   1 
ATOM   758  O "O5'" . DG  F 2 5   ? 25.593  -18.742 251.111 1.00 81.46  ? 12  DG  J "O5'" 1 
ATOM   759  C "C5'" . DG  F 2 5   ? 26.226  -17.675 250.403 1.00 87.51  ? 12  DG  J "C5'" 1 
ATOM   760  C "C4'" . DG  F 2 5   ? 25.944  -16.336 251.051 1.00 88.72  ? 12  DG  J "C4'" 1 
ATOM   761  O "O4'" . DG  F 2 5   ? 24.576  -15.914 250.830 1.00 88.10  ? 12  DG  J "O4'" 1 
ATOM   762  C "C3'" . DG  F 2 5   ? 26.184  -16.239 252.558 1.00 96.19  ? 12  DG  J "C3'" 1 
ATOM   763  O "O3'" . DG  F 2 5   ? 26.865  -15.016 252.868 1.00 107.58 ? 12  DG  J "O3'" 1 
ATOM   764  C "C2'" . DG  F 2 5   ? 24.779  -16.187 253.132 1.00 93.32  ? 12  DG  J "C2'" 1 
ATOM   765  C "C1'" . DG  F 2 5   ? 24.028  -15.436 252.050 1.00 83.49  ? 12  DG  J "C1'" 1 
ATOM   766  N N9    . DG  F 2 5   ? 22.577  -15.646 252.020 1.00 76.35  ? 12  DG  J N9    1 
ATOM   767  C C8    . DG  F 2 5   ? 21.893  -16.830 252.214 1.00 72.84  ? 12  DG  J C8    1 
ATOM   768  N N7    . DG  F 2 5   ? 20.594  -16.703 252.104 1.00 52.55  ? 12  DG  J N7    1 
ATOM   769  C C5    . DG  F 2 5   ? 20.404  -15.356 251.822 1.00 54.92  ? 12  DG  J C5    1 
ATOM   770  C C6    . DG  F 2 5   ? 19.205  -14.625 251.589 1.00 51.50  ? 12  DG  J C6    1 
ATOM   771  O O6    . DG  F 2 5   ? 18.040  -15.047 251.569 1.00 47.94  ? 12  DG  J O6    1 
ATOM   772  N N1    . DG  F 2 5   ? 19.465  -13.271 251.355 1.00 35.46  ? 12  DG  J N1    1 
ATOM   773  C C2    . DG  F 2 5   ? 20.719  -12.699 251.338 1.00 57.15  ? 12  DG  J C2    1 
ATOM   774  N N2    . DG  F 2 5   ? 20.774  -11.371 251.097 1.00 58.17  ? 12  DG  J N2    1 
ATOM   775  N N3    . DG  F 2 5   ? 21.844  -13.374 251.543 1.00 56.17  ? 12  DG  J N3    1 
ATOM   776  C C4    . DG  F 2 5   ? 21.614  -14.685 251.777 1.00 63.11  ? 12  DG  J C4    1 
ATOM   777  P P     . DG  F 2 6   ? 28.014  -15.000 253.996 1.00 116.53 ? 13  DG  J P     1 
ATOM   778  O OP1   . DG  F 2 6   ? 27.873  -16.218 254.833 1.00 118.49 ? 13  DG  J OP1   1 
ATOM   779  O OP2   . DG  F 2 6   ? 27.998  -13.659 254.631 1.00 119.88 ? 13  DG  J OP2   1 
ATOM   780  O "O5'" . DG  F 2 6   ? 29.374  -15.145 253.185 1.00 127.74 ? 13  DG  J "O5'" 1 
ATOM   781  C "C5'" . DG  F 2 6   ? 29.731  -14.196 252.187 1.00 145.62 ? 13  DG  J "C5'" 1 
ATOM   782  C "C4'" . DG  F 2 6   ? 31.232  -14.038 252.136 1.00 157.78 ? 13  DG  J "C4'" 1 
ATOM   783  O "O4'" . DG  F 2 6   ? 31.692  -13.397 253.353 1.00 163.74 ? 13  DG  J "O4'" 1 
ATOM   784  C "C3'" . DG  F 2 6   ? 31.996  -15.358 252.044 1.00 161.98 ? 13  DG  J "C3'" 1 
ATOM   785  O "O3'" . DG  F 2 6   ? 33.222  -15.166 251.336 1.00 166.69 ? 13  DG  J "O3'" 1 
ATOM   786  C "C2'" . DG  F 2 6   ? 32.355  -15.639 253.491 1.00 164.81 ? 13  DG  J "C2'" 1 
ATOM   787  C "C1'" . DG  F 2 6   ? 32.621  -14.240 254.020 1.00 166.13 ? 13  DG  J "C1'" 1 
ATOM   788  N N9    . DG  F 2 6   ? 32.430  -14.081 255.460 1.00 168.25 ? 13  DG  J N9    1 
ATOM   789  C C8    . DG  F 2 6   ? 31.243  -14.132 256.152 1.00 169.17 ? 13  DG  J C8    1 
ATOM   790  N N7    . DG  F 2 6   ? 31.394  -13.965 257.439 1.00 170.08 ? 13  DG  J N7    1 
ATOM   791  C C5    . DG  F 2 6   ? 32.762  -13.790 257.607 1.00 168.83 ? 13  DG  J C5    1 
ATOM   792  C C6    . DG  F 2 6   ? 33.527  -13.567 258.787 1.00 167.44 ? 13  DG  J C6    1 
ATOM   793  O O6    . DG  F 2 6   ? 33.136  -13.481 259.960 1.00 170.20 ? 13  DG  J O6    1 
ATOM   794  N N1    . DG  F 2 6   ? 34.880  -13.441 258.501 1.00 163.59 ? 13  DG  J N1    1 
ATOM   795  C C2    . DG  F 2 6   ? 35.433  -13.522 257.250 1.00 163.25 ? 13  DG  J C2    1 
ATOM   796  N N2    . DG  F 2 6   ? 36.763  -13.372 257.184 1.00 164.42 ? 13  DG  J N2    1 
ATOM   797  N N3    . DG  F 2 6   ? 34.736  -13.733 256.146 1.00 166.38 ? 13  DG  J N3    1 
ATOM   798  C C4    . DG  F 2 6   ? 33.416  -13.855 256.396 1.00 168.03 ? 13  DG  J C4    1 
ATOM   799  O "O5'" . DG  G 1 1   ? 8.060   -15.151 255.763 1.00 79.42  ? 1   DG  K "O5'" 1 
ATOM   800  C "C5'" . DG  G 1 1   ? 8.783   -14.154 255.034 1.00 83.42  ? 1   DG  K "C5'" 1 
ATOM   801  C "C4'" . DG  G 1 1   ? 8.557   -12.793 255.650 1.00 90.84  ? 1   DG  K "C4'" 1 
ATOM   802  O "O4'" . DG  G 1 1   ? 9.155   -12.793 256.965 1.00 87.29  ? 1   DG  K "O4'" 1 
ATOM   803  C "C3'" . DG  G 1 1   ? 9.225   -11.662 254.869 1.00 102.46 ? 1   DG  K "C3'" 1 
ATOM   804  O "O3'" . DG  G 1 1   ? 8.343   -10.559 254.601 1.00 113.71 ? 1   DG  K "O3'" 1 
ATOM   805  C "C2'" . DG  G 1 1   ? 10.460  -11.288 255.677 1.00 94.13  ? 1   DG  K "C2'" 1 
ATOM   806  C "C1'" . DG  G 1 1   ? 10.376  -12.068 256.982 1.00 77.17  ? 1   DG  K "C1'" 1 
ATOM   807  N N9    . DG  G 1 1   ? 11.455  -13.051 257.033 1.00 63.36  ? 1   DG  K N9    1 
ATOM   808  C C8    . DG  G 1 1   ? 11.343  -14.423 256.918 1.00 62.50  ? 1   DG  K C8    1 
ATOM   809  N N7    . DG  G 1 1   ? 12.498  -15.035 256.899 1.00 56.75  ? 1   DG  K N7    1 
ATOM   810  C C5    . DG  G 1 1   ? 13.429  -14.011 257.035 1.00 45.45  ? 1   DG  K C5    1 
ATOM   811  C C6    . DG  G 1 1   ? 14.852  -14.058 257.060 1.00 49.33  ? 1   DG  K C6    1 
ATOM   812  O O6    . DG  G 1 1   ? 15.605  -15.053 256.938 1.00 54.90  ? 1   DG  K O6    1 
ATOM   813  N N1    . DG  G 1 1   ? 15.397  -12.787 257.232 1.00 39.85  ? 1   DG  K N1    1 
ATOM   814  C C2    . DG  G 1 1   ? 14.676  -11.622 257.349 1.00 38.41  ? 1   DG  K C2    1 
ATOM   815  N N2    . DG  G 1 1   ? 15.404  -10.494 257.546 1.00 10.82  ? 1   DG  K N2    1 
ATOM   816  N N3    . DG  G 1 1   ? 13.350  -11.561 257.292 1.00 28.51  ? 1   DG  K N3    1 
ATOM   817  C C4    . DG  G 1 1   ? 12.799  -12.783 257.142 1.00 44.59  ? 1   DG  K C4    1 
ATOM   818  P P     . DC  G 1 2   ? 8.377   -9.862  253.146 1.00 114.92 ? 2   DC  K P     1 
ATOM   819  O OP1   . DC  G 1 2   ? 7.257   -8.890  253.037 1.00 112.27 ? 2   DC  K OP1   1 
ATOM   820  O OP2   . DC  G 1 2   ? 8.545   -10.921 252.108 1.00 116.56 ? 2   DC  K OP2   1 
ATOM   821  O "O5'" . DC  G 1 2   ? 9.729   -9.037  253.196 1.00 106.93 ? 2   DC  K "O5'" 1 
ATOM   822  C "C5'" . DC  G 1 2   ? 10.049  -8.259  254.338 1.00 107.90 ? 2   DC  K "C5'" 1 
ATOM   823  C "C4'" . DC  G 1 2   ? 11.479  -7.791  254.252 1.00 108.93 ? 2   DC  K "C4'" 1 
ATOM   824  O "O4'" . DC  G 1 2   ? 12.385  -8.816  254.735 1.00 100.99 ? 2   DC  K "O4'" 1 
ATOM   825  C "C3'" . DC  G 1 2   ? 11.905  -7.462  252.823 1.00 107.31 ? 2   DC  K "C3'" 1 
ATOM   826  O "O3'" . DC  G 1 2   ? 12.519  -6.182  252.764 1.00 117.66 ? 2   DC  K "O3'" 1 
ATOM   827  C "C2'" . DC  G 1 2   ? 12.866  -8.577  252.454 1.00 98.72  ? 2   DC  K "C2'" 1 
ATOM   828  C "C1'" . DC  G 1 2   ? 13.432  -9.015  253.801 1.00 85.50  ? 2   DC  K "C1'" 1 
ATOM   829  N N1    . DC  G 1 2   ? 13.826  -10.437 253.851 1.00 62.14  ? 2   DC  K N1    1 
ATOM   830  C C2    . DC  G 1 2   ? 15.174  -10.769 254.113 1.00 46.75  ? 2   DC  K C2    1 
ATOM   831  O O2    . DC  G 1 2   ? 15.987  -9.858  254.347 1.00 23.65  ? 2   DC  K O2    1 
ATOM   832  N N3    . DC  G 1 2   ? 15.546  -12.075 254.092 1.00 33.16  ? 2   DC  K N3    1 
ATOM   833  C C4    . DC  G 1 2   ? 14.639  -13.027 253.805 1.00 54.98  ? 2   DC  K C4    1 
ATOM   834  N N4    . DC  G 1 2   ? 15.064  -14.301 253.713 1.00 46.49  ? 2   DC  K N4    1 
ATOM   835  C C5    . DC  G 1 2   ? 13.258  -12.715 253.576 1.00 49.82  ? 2   DC  K C5    1 
ATOM   836  C C6    . DC  G 1 2   ? 12.902  -11.422 253.616 1.00 57.94  ? 2   DC  K C6    1 
ATOM   837  P P     . DC  G 1 3   ? 12.025  -5.130  251.653 1.00 129.85 ? 3   DC  K P     1 
ATOM   838  O OP1   . DC  G 1 3   ? 11.848  -3.807  252.323 1.00 128.69 ? 3   DC  K OP1   1 
ATOM   839  O OP2   . DC  G 1 3   ? 10.874  -5.743  250.930 1.00 133.82 ? 3   DC  K OP2   1 
ATOM   840  O "O5'" . DC  G 1 3   ? 13.257  -5.061  250.641 1.00 117.91 ? 3   DC  K "O5'" 1 
ATOM   841  C "C5'" . DC  G 1 3   ? 14.175  -6.144  250.558 1.00 88.81  ? 3   DC  K "C5'" 1 
ATOM   842  C "C4'" . DC  G 1 3   ? 15.583  -5.653  250.796 1.00 71.52  ? 3   DC  K "C4'" 1 
ATOM   843  O "O4'" . DC  G 1 3   ? 16.309  -6.680  251.495 1.00 72.52  ? 3   DC  K "O4'" 1 
ATOM   844  C "C3'" . DC  G 1 3   ? 16.381  -5.355  249.533 1.00 70.24  ? 3   DC  K "C3'" 1 
ATOM   845  O "O3'" . DC  G 1 3   ? 17.269  -4.239  249.734 1.00 74.92  ? 3   DC  K "O3'" 1 
ATOM   846  C "C2'" . DC  G 1 3   ? 17.135  -6.652  249.283 1.00 55.79  ? 3   DC  K "C2'" 1 
ATOM   847  C "C1'" . DC  G 1 3   ? 17.304  -7.258  250.671 1.00 51.40  ? 3   DC  K "C1'" 1 
ATOM   848  N N1    . DC  G 1 3   ? 17.114  -8.717  250.737 1.00 43.25  ? 3   DC  K N1    1 
ATOM   849  C C2    . DC  G 1 3   ? 18.222  -9.540  250.997 1.00 44.96  ? 3   DC  K C2    1 
ATOM   850  O O2    . DC  G 1 3   ? 19.332  -9.010  251.187 1.00 53.09  ? 3   DC  K O2    1 
ATOM   851  N N3    . DC  G 1 3   ? 18.052  -10.890 251.035 1.00 26.18  ? 3   DC  K N3    1 
ATOM   852  C C4    . DC  G 1 3   ? 16.835  -11.418 250.831 1.00 41.02  ? 3   DC  K C4    1 
ATOM   853  N N4    . DC  G 1 3   ? 16.717  -12.759 250.860 1.00 29.64  ? 3   DC  K N4    1 
ATOM   854  C C5    . DC  G 1 3   ? 15.687  -10.599 250.583 1.00 25.09  ? 3   DC  K C5    1 
ATOM   855  C C6    . DC  G 1 3   ? 15.874  -9.268  250.545 1.00 36.66  ? 3   DC  K C6    1 
ATOM   856  P P     . DG  G 1 4   ? 17.793  -3.405  248.459 1.00 76.58  ? 4   DG  K P     1 
ATOM   857  O OP1   . DG  G 1 4   ? 18.614  -2.248  248.885 1.00 71.73  ? 4   DG  K OP1   1 
ATOM   858  O OP2   . DG  G 1 4   ? 16.612  -3.168  247.586 1.00 72.75  ? 4   DG  K OP2   1 
ATOM   859  O "O5'" . DG  G 1 4   ? 18.765  -4.448  247.745 1.00 82.09  ? 4   DG  K "O5'" 1 
ATOM   860  C "C5'" . DG  G 1 4   ? 20.030  -4.780  248.324 1.00 74.83  ? 4   DG  K "C5'" 1 
ATOM   861  C "C4'" . DG  G 1 4   ? 20.718  -5.866  247.528 1.00 76.83  ? 4   DG  K "C4'" 1 
ATOM   862  O "O4'" . DG  G 1 4   ? 20.234  -7.189  247.889 1.00 74.53  ? 4   DG  K "O4'" 1 
ATOM   863  C "C3'" . DG  G 1 4   ? 20.583  -5.757  246.004 1.00 74.79  ? 4   DG  K "C3'" 1 
ATOM   864  O "O3'" . DG  G 1 4   ? 21.860  -5.999  245.376 1.00 79.68  ? 4   DG  K "O3'" 1 
ATOM   865  C "C2'" . DG  G 1 4   ? 19.634  -6.902  245.671 1.00 65.68  ? 4   DG  K "C2'" 1 
ATOM   866  C "C1'" . DG  G 1 4   ? 20.027  -7.938  246.708 1.00 49.03  ? 4   DG  K "C1'" 1 
ATOM   867  N N9    . DG  G 1 4   ? 19.044  -8.984  246.988 1.00 36.51  ? 4   DG  K N9    1 
ATOM   868  C C8    . DG  G 1 4   ? 17.675  -8.863  246.959 1.00 49.65  ? 4   DG  K C8    1 
ATOM   869  N N7    . DG  G 1 4   ? 17.049  -9.979  247.243 1.00 36.54  ? 4   DG  K N7    1 
ATOM   870  C C5    . DG  G 1 4   ? 18.066  -10.891 247.474 1.00 20.33  ? 4   DG  K C5    1 
ATOM   871  C C6    . DG  G 1 4   ? 18.001  -12.261 247.823 1.00 25.13  ? 4   DG  K C6    1 
ATOM   872  O O6    . DG  G 1 4   ? 17.000  -12.971 247.981 1.00 40.62  ? 4   DG  K O6    1 
ATOM   873  N N1    . DG  G 1 4   ? 19.265  -12.810 247.982 1.00 23.71  ? 4   DG  K N1    1 
ATOM   874  C C2    . DG  G 1 4   ? 20.447  -12.132 247.812 1.00 32.29  ? 4   DG  K C2    1 
ATOM   875  N N2    . DG  G 1 4   ? 21.570  -12.855 247.997 1.00 21.25  ? 4   DG  K N2    1 
ATOM   876  N N3    . DG  G 1 4   ? 20.524  -10.848 247.482 1.00 24.48  ? 4   DG  K N3    1 
ATOM   877  C C4    . DG  G 1 4   ? 19.306  -10.295 247.328 1.00 25.24  ? 4   DG  K C4    1 
ATOM   878  P P     . DG  G 1 5   ? 22.930  -4.800  245.231 1.00 78.09  ? 5   DG  K P     1 
ATOM   879  O OP1   . DG  G 1 5   ? 22.683  -3.803  246.312 1.00 83.99  ? 5   DG  K OP1   1 
ATOM   880  O OP2   . DG  G 1 5   ? 22.943  -4.351  243.833 1.00 76.68  ? 5   DG  K OP2   1 
ATOM   881  O "O5'" . DG  G 1 5   ? 24.310  -5.510  245.570 1.00 59.04  ? 5   DG  K "O5'" 1 
ATOM   882  C "C5'" . DG  G 1 5   ? 25.129  -5.997  244.541 1.00 59.75  ? 5   DG  K "C5'" 1 
ATOM   883  C "C4'" . DG  G 1 5   ? 25.636  -7.386  244.857 1.00 62.64  ? 5   DG  K "C4'" 1 
ATOM   884  O "O4'" . DG  G 1 5   ? 24.531  -8.320  244.943 1.00 59.27  ? 5   DG  K "O4'" 1 
ATOM   885  C "C3'" . DG  G 1 5   ? 26.534  -7.908  243.740 1.00 66.29  ? 5   DG  K "C3'" 1 
ATOM   886  O "O3'" . DG  G 1 5   ? 27.708  -8.513  244.226 1.00 66.98  ? 5   DG  K "O3'" 1 
ATOM   887  C "C2'" . DG  G 1 5   ? 25.684  -8.912  242.987 1.00 67.39  ? 5   DG  K "C2'" 1 
ATOM   888  C "C1'" . DG  G 1 5   ? 24.690  -9.392  244.014 1.00 49.01  ? 5   DG  K "C1'" 1 
ATOM   889  N N9    . DG  G 1 5   ? 23.385  -9.643  243.418 1.00 45.72  ? 5   DG  K N9    1 
ATOM   890  C C8    . DG  G 1 5   ? 22.318  -8.779  243.420 1.00 47.10  ? 5   DG  K C8    1 
ATOM   891  N N7    . DG  G 1 5   ? 21.245  -9.288  242.879 1.00 41.15  ? 5   DG  K N7    1 
ATOM   892  C C5    . DG  G 1 5   ? 21.629  -10.561 242.487 1.00 31.28  ? 5   DG  K C5    1 
ATOM   893  C C6    . DG  G 1 5   ? 20.870  -11.598 241.887 1.00 41.50  ? 5   DG  K C6    1 
ATOM   894  O O6    . DG  G 1 5   ? 19.659  -11.600 241.586 1.00 39.74  ? 5   DG  K O6    1 
ATOM   895  N N1    . DG  G 1 5   ? 21.645  -12.727 241.650 1.00 31.44  ? 5   DG  K N1    1 
ATOM   896  C C2    . DG  G 1 5   ? 22.970  -12.844 241.954 1.00 39.67  ? 5   DG  K C2    1 
ATOM   897  N N2    . DG  G 1 5   ? 23.544  -14.010 241.621 1.00 32.84  ? 5   DG  K N2    1 
ATOM   898  N N3    . DG  G 1 5   ? 23.687  -11.889 242.537 1.00 44.29  ? 5   DG  K N3    1 
ATOM   899  C C4    . DG  G 1 5   ? 22.955  -10.786 242.777 1.00 36.51  ? 5   DG  K C4    1 
ATOM   900  P P     . DT  G 1 6   ? 29.023  -8.438  243.330 1.00 79.78  ? 6   DT  K P     1 
ATOM   901  O OP1   . DT  G 1 6   ? 30.168  -8.136  244.237 1.00 82.99  ? 6   DT  K OP1   1 
ATOM   902  O OP2   . DT  G 1 6   ? 28.676  -7.484  242.243 1.00 69.94  ? 6   DT  K OP2   1 
ATOM   903  O "O5'" . DT  G 1 6   ? 29.189  -9.916  242.739 1.00 71.00  ? 6   DT  K "O5'" 1 
ATOM   904  C "C5'" . DT  G 1 6   ? 28.054  -10.689 242.364 1.00 59.87  ? 6   DT  K "C5'" 1 
ATOM   905  C "C4'" . DT  G 1 6   ? 28.466  -11.924 241.594 1.00 64.12  ? 6   DT  K "C4'" 1 
ATOM   906  O "O4'" . DT  G 1 6   ? 27.247  -12.641 241.262 1.00 66.24  ? 6   DT  K "O4'" 1 
ATOM   907  C "C3'" . DT  G 1 6   ? 29.166  -11.654 240.262 1.00 66.16  ? 6   DT  K "C3'" 1 
ATOM   908  O "O3'" . DT  G 1 6   ? 30.150  -12.668 239.979 1.00 71.22  ? 6   DT  K "O3'" 1 
ATOM   909  C "C2'" . DT  G 1 6   ? 28.031  -11.690 239.249 1.00 63.39  ? 6   DT  K "C2'" 1 
ATOM   910  C "C1'" . DT  G 1 6   ? 26.991  -12.630 239.861 1.00 44.23  ? 6   DT  K "C1'" 1 
ATOM   911  N N1    . DT  G 1 6   ? 25.584  -12.163 239.656 1.00 27.54  ? 6   DT  K N1    1 
ATOM   912  C C2    . DT  G 1 6   ? 24.618  -13.062 239.247 1.00 23.96  ? 6   DT  K C2    1 
ATOM   913  O O2    . DT  G 1 6   ? 24.808  -14.263 239.158 1.00 31.93  ? 6   DT  K O2    1 
ATOM   914  N N3    . DT  G 1 6   ? 23.394  -12.499 238.976 1.00 25.99  ? 6   DT  K N3    1 
ATOM   915  C C4    . DT  G 1 6   ? 23.036  -11.159 239.091 1.00 37.57  ? 6   DT  K C4    1 
ATOM   916  O O4    . DT  G 1 6   ? 21.903  -10.783 238.755 1.00 40.30  ? 6   DT  K O4    1 
ATOM   917  C C5    . DT  G 1 6   ? 24.071  -10.289 239.601 1.00 30.48  ? 6   DT  K C5    1 
ATOM   918  C C7    . DT  G 1 6   ? 23.752  -8.840  239.832 1.00 16.20  ? 6   DT  K C7    1 
ATOM   919  C C6    . DT  G 1 6   ? 25.278  -10.826 239.837 1.00 24.43  ? 6   DT  K C6    1 
ATOM   920  P P     . DC  G 1 7   ? 31.276  -12.413 238.851 1.00 72.13  ? 7   DC  K P     1 
ATOM   921  O OP1   . DC  G 1 7   ? 32.549  -12.085 239.509 1.00 72.24  ? 7   DC  K OP1   1 
ATOM   922  O OP2   . DC  G 1 7   ? 30.735  -11.503 237.820 1.00 78.18  ? 7   DC  K OP2   1 
ATOM   923  O "O5'" . DC  G 1 7   ? 31.440  -13.839 238.172 1.00 73.95  ? 7   DC  K "O5'" 1 
ATOM   924  C "C5'" . DC  G 1 7   ? 31.161  -15.024 238.907 1.00 81.88  ? 7   DC  K "C5'" 1 
ATOM   925  C "C4'" . DC  G 1 7   ? 30.363  -15.990 238.064 1.00 81.05  ? 7   DC  K "C4'" 1 
ATOM   926  O "O4'" . DC  G 1 7   ? 28.972  -15.580 237.981 1.00 73.89  ? 7   DC  K "O4'" 1 
ATOM   927  C "C3'" . DC  G 1 7   ? 30.863  -16.122 236.624 1.00 83.34  ? 7   DC  K "C3'" 1 
ATOM   928  O "O3'" . DC  G 1 7   ? 30.909  -17.490 236.220 1.00 93.37  ? 7   DC  K "O3'" 1 
ATOM   929  C "C2'" . DC  G 1 7   ? 29.802  -15.393 235.820 1.00 79.06  ? 7   DC  K "C2'" 1 
ATOM   930  C "C1'" . DC  G 1 7   ? 28.553  -15.665 236.636 1.00 61.15  ? 7   DC  K "C1'" 1 
ATOM   931  N N1    . DC  G 1 7   ? 27.423  -14.730 236.410 1.00 55.08  ? 7   DC  K N1    1 
ATOM   932  C C2    . DC  G 1 7   ? 26.164  -15.275 236.164 1.00 44.48  ? 7   DC  K C2    1 
ATOM   933  O O2    . DC  G 1 7   ? 26.022  -16.500 236.258 1.00 53.73  ? 7   DC  K O2    1 
ATOM   934  N N3    . DC  G 1 7   ? 25.133  -14.454 235.836 1.00 35.39  ? 7   DC  K N3    1 
ATOM   935  C C4    . DC  G 1 7   ? 25.322  -13.127 235.766 1.00 34.72  ? 7   DC  K C4    1 
ATOM   936  N N4    . DC  G 1 7   ? 24.284  -12.371 235.382 1.00 26.68  ? 7   DC  K N4    1 
ATOM   937  C C5    . DC  G 1 7   ? 26.581  -12.529 236.070 1.00 16.24  ? 7   DC  K C5    1 
ATOM   938  C C6    . DC  G 1 7   ? 27.598  -13.363 236.390 1.00 49.86  ? 7   DC  K C6    1 
ATOM   939  O OP3   . DG  H 2 1   ? 31.380  -20.459 235.278 1.00 106.33 ? 8   DG  L OP3   1 
ATOM   940  P P     . DG  H 2 1   ? 31.020  -20.203 233.821 1.00 106.69 ? 8   DG  L P     1 
ATOM   941  O OP1   . DG  H 2 1   ? 32.100  -20.670 232.858 1.00 102.95 ? 8   DG  L OP1   1 
ATOM   942  O OP2   . DG  H 2 1   ? 29.647  -20.763 233.472 1.00 101.76 ? 8   DG  L OP2   1 
ATOM   943  O "O5'" . DG  H 2 1   ? 30.934  -18.581 233.634 1.00 95.94  ? 8   DG  L "O5'" 1 
ATOM   944  C "C5'" . DG  H 2 1   ? 29.675  -17.878 233.745 1.00 91.50  ? 8   DG  L "C5'" 1 
ATOM   945  C "C4'" . DG  H 2 1   ? 28.936  -17.911 232.428 1.00 87.94  ? 8   DG  L "C4'" 1 
ATOM   946  O "O4'" . DG  H 2 1   ? 27.624  -17.290 232.586 1.00 84.48  ? 8   DG  L "O4'" 1 
ATOM   947  C "C3'" . DG  H 2 1   ? 29.646  -17.142 231.305 1.00 87.41  ? 8   DG  L "C3'" 1 
ATOM   948  O "O3'" . DG  H 2 1   ? 29.579  -17.855 230.067 1.00 74.00  ? 8   DG  L "O3'" 1 
ATOM   949  C "C2'" . DG  H 2 1   ? 28.846  -15.859 231.189 1.00 84.50  ? 8   DG  L "C2'" 1 
ATOM   950  C "C1'" . DG  H 2 1   ? 27.442  -16.312 231.569 1.00 70.59  ? 8   DG  L "C1'" 1 
ATOM   951  N N9    . DG  H 2 1   ? 26.630  -15.201 232.067 1.00 49.25  ? 8   DG  L N9    1 
ATOM   952  C C8    . DG  H 2 1   ? 27.104  -14.090 232.722 1.00 40.47  ? 8   DG  L C8    1 
ATOM   953  N N7    . DG  H 2 1   ? 26.205  -13.162 232.871 1.00 46.06  ? 8   DG  L N7    1 
ATOM   954  C C5    . DG  H 2 1   ? 25.051  -13.710 232.328 1.00 44.80  ? 8   DG  L C5    1 
ATOM   955  C C6    . DG  H 2 1   ? 23.754  -13.148 232.179 1.00 48.45  ? 8   DG  L C6    1 
ATOM   956  O O6    . DG  H 2 1   ? 23.353  -12.031 232.521 1.00 49.21  ? 8   DG  L O6    1 
ATOM   957  N N1    . DG  H 2 1   ? 22.884  -14.028 231.552 1.00 42.18  ? 8   DG  L N1    1 
ATOM   958  C C2    . DG  H 2 1   ? 23.213  -15.286 231.131 1.00 47.46  ? 8   DG  L C2    1 
ATOM   959  N N2    . DG  H 2 1   ? 22.231  -15.968 230.532 1.00 45.79  ? 8   DG  L N2    1 
ATOM   960  N N3    . DG  H 2 1   ? 24.418  -15.834 231.278 1.00 43.80  ? 8   DG  L N3    1 
ATOM   961  C C4    . DG  H 2 1   ? 25.285  -14.988 231.870 1.00 36.93  ? 8   DG  L C4    1 
ATOM   962  P P     . DA  H 2 2   ? 30.319  -17.271 228.770 1.00 64.35  ? 9   DA  L P     1 
ATOM   963  O OP1   . DA  H 2 2   ? 30.761  -18.451 227.997 1.00 71.67  ? 9   DA  L OP1   1 
ATOM   964  O OP2   . DA  H 2 2   ? 31.303  -16.216 229.146 1.00 65.29  ? 9   DA  L OP2   1 
ATOM   965  O "O5'" . DA  H 2 2   ? 29.144  -16.592 227.952 1.00 68.16  ? 9   DA  L "O5'" 1 
ATOM   966  C "C5'" . DA  H 2 2   ? 28.112  -17.395 227.417 1.00 68.03  ? 9   DA  L "C5'" 1 
ATOM   967  C "C4'" . DA  H 2 2   ? 27.203  -16.556 226.561 1.00 63.35  ? 9   DA  L "C4'" 1 
ATOM   968  O "O4'" . DA  H 2 2   ? 26.530  -15.549 227.362 1.00 62.79  ? 9   DA  L "O4'" 1 
ATOM   969  C "C3'" . DA  H 2 2   ? 27.947  -15.794 225.467 1.00 62.93  ? 9   DA  L "C3'" 1 
ATOM   970  O "O3'" . DA  H 2 2   ? 27.131  -15.817 224.296 1.00 65.84  ? 9   DA  L "O3'" 1 
ATOM   971  C "C2'" . DA  H 2 2   ? 28.011  -14.385 226.019 1.00 55.06  ? 9   DA  L "C2'" 1 
ATOM   972  C "C1'" . DA  H 2 2   ? 26.667  -14.315 226.694 1.00 57.81  ? 9   DA  L "C1'" 1 
ATOM   973  N N9    . DA  H 2 2   ? 26.508  -13.225 227.650 1.00 52.35  ? 9   DA  L N9    1 
ATOM   974  C C8    . DA  H 2 2   ? 27.478  -12.555 228.345 1.00 49.88  ? 9   DA  L C8    1 
ATOM   975  N N7    . DA  H 2 2   ? 27.021  -11.551 229.047 1.00 56.52  ? 9   DA  L N7    1 
ATOM   976  C C5    . DA  H 2 2   ? 25.651  -11.577 228.818 1.00 42.38  ? 9   DA  L C5    1 
ATOM   977  C C6    . DA  H 2 2   ? 24.597  -10.756 229.263 1.00 35.64  ? 9   DA  L C6    1 
ATOM   978  N N6    . DA  H 2 2   ? 24.761  -9.707  230.057 1.00 47.24  ? 9   DA  L N6    1 
ATOM   979  N N1    . DA  H 2 2   ? 23.350  -11.052 228.853 1.00 41.45  ? 9   DA  L N1    1 
ATOM   980  C C2    . DA  H 2 2   ? 23.180  -12.107 228.042 1.00 57.30  ? 9   DA  L C2    1 
ATOM   981  N N3    . DA  H 2 2   ? 24.093  -12.945 227.543 1.00 51.17  ? 9   DA  L N3    1 
ATOM   982  C C4    . DA  H 2 2   ? 25.321  -12.618 227.977 1.00 42.98  ? 9   DA  L C4    1 
ATOM   983  P P     . DC  H 2 3   ? 27.732  -15.353 222.880 1.00 62.71  ? 10  DC  L P     1 
ATOM   984  O OP1   . DC  H 2 3   ? 28.306  -16.531 222.175 1.00 40.26  ? 10  DC  L OP1   1 
ATOM   985  O OP2   . DC  H 2 3   ? 28.571  -14.131 223.080 1.00 41.74  ? 10  DC  L OP2   1 
ATOM   986  O "O5'" . DC  H 2 3   ? 26.406  -14.955 222.110 1.00 54.01  ? 10  DC  L "O5'" 1 
ATOM   987  C "C5'" . DC  H 2 3   ? 25.936  -13.618 222.135 1.00 62.90  ? 10  DC  L "C5'" 1 
ATOM   988  C "C4'" . DC  H 2 3   ? 24.485  -13.580 222.545 1.00 56.70  ? 10  DC  L "C4'" 1 
ATOM   989  O "O4'" . DC  H 2 3   ? 24.462  -13.230 223.948 1.00 47.18  ? 10  DC  L "O4'" 1 
ATOM   990  C "C3'" . DC  H 2 3   ? 23.709  -12.491 221.805 1.00 59.85  ? 10  DC  L "C3'" 1 
ATOM   991  O "O3'" . DC  H 2 3   ? 22.435  -12.913 221.315 1.00 59.69  ? 10  DC  L "O3'" 1 
ATOM   992  C "C2'" . DC  H 2 3   ? 23.542  -11.378 222.813 1.00 61.69  ? 10  DC  L "C2'" 1 
ATOM   993  C "C1'" . DC  H 2 3   ? 23.741  -12.033 224.166 1.00 46.78  ? 10  DC  L "C1'" 1 
ATOM   994  N N1    . DC  H 2 3   ? 24.577  -11.135 224.958 1.00 47.26  ? 10  DC  L N1    1 
ATOM   995  C C2    . DC  H 2 3   ? 23.945  -10.135 225.668 1.00 44.26  ? 10  DC  L C2    1 
ATOM   996  O O2    . DC  H 2 3   ? 22.711  -10.111 225.668 1.00 26.29  ? 10  DC  L O2    1 
ATOM   997  N N3    . DC  H 2 3   ? 24.678  -9.219  226.332 1.00 42.87  ? 10  DC  L N3    1 
ATOM   998  C C4    . DC  H 2 3   ? 26.004  -9.284  226.305 1.00 51.96  ? 10  DC  L C4    1 
ATOM   999  N N4    . DC  H 2 3   ? 26.686  -8.334  226.954 1.00 59.85  ? 10  DC  L N4    1 
ATOM   1000 C C5    . DC  H 2 3   ? 26.688  -10.323 225.610 1.00 56.18  ? 10  DC  L C5    1 
ATOM   1001 C C6    . DC  H 2 3   ? 25.940  -11.228 224.960 1.00 53.81  ? 10  DC  L C6    1 
ATOM   1002 P P     . DC  H 2 4   ? 21.877  -12.287 219.939 1.00 51.01  ? 11  DC  L P     1 
ATOM   1003 O OP1   . DC  H 2 4   ? 20.757  -11.378 220.264 1.00 64.49  ? 11  DC  L OP1   1 
ATOM   1004 O OP2   . DC  H 2 4   ? 21.681  -13.345 218.931 1.00 64.16  ? 11  DC  L OP2   1 
ATOM   1005 O "O5'" . DC  H 2 4   ? 23.067  -11.382 219.410 1.00 54.74  ? 11  DC  L "O5'" 1 
ATOM   1006 C "C5'" . DC  H 2 4   ? 22.909  -10.654 218.210 1.00 41.37  ? 11  DC  L "C5'" 1 
ATOM   1007 C "C4'" . DC  H 2 4   ? 22.066  -9.433  218.469 1.00 37.46  ? 11  DC  L "C4'" 1 
ATOM   1008 O "O4'" . DC  H 2 4   ? 22.855  -8.539  219.290 1.00 43.33  ? 11  DC  L "O4'" 1 
ATOM   1009 C "C3'" . DC  H 2 4   ? 21.711  -8.649  217.208 1.00 43.22  ? 11  DC  L "C3'" 1 
ATOM   1010 O "O3'" . DC  H 2 4   ? 20.356  -8.205  217.238 1.00 44.21  ? 11  DC  L "O3'" 1 
ATOM   1011 C "C2'" . DC  H 2 4   ? 22.645  -7.450  217.244 1.00 46.59  ? 11  DC  L "C2'" 1 
ATOM   1012 C "C1'" . DC  H 2 4   ? 22.815  -7.240  218.724 1.00 43.07  ? 11  DC  L "C1'" 1 
ATOM   1013 N N1    . DC  H 2 4   ? 24.034  -6.534  219.105 1.00 34.46  ? 11  DC  L N1    1 
ATOM   1014 C C2    . DC  H 2 4   ? 23.912  -5.433  219.932 1.00 37.36  ? 11  DC  L C2    1 
ATOM   1015 O O2    . DC  H 2 4   ? 22.783  -5.117  220.328 1.00 44.42  ? 11  DC  L O2    1 
ATOM   1016 N N3    . DC  H 2 4   ? 25.018  -4.742  220.289 1.00 39.69  ? 11  DC  L N3    1 
ATOM   1017 C C4    . DC  H 2 4   ? 26.217  -5.124  219.838 1.00 46.46  ? 11  DC  L C4    1 
ATOM   1018 N N4    . DC  H 2 4   ? 27.277  -4.402  220.185 1.00 51.26  ? 11  DC  L N4    1 
ATOM   1019 C C5    . DC  H 2 4   ? 26.375  -6.263  219.001 1.00 50.42  ? 11  DC  L C5    1 
ATOM   1020 C C6    . DC  H 2 4   ? 25.261  -6.936  218.660 1.00 49.07  ? 11  DC  L C6    1 
ATOM   1021 P P     . DG  H 2 5   ? 19.700  -7.685  215.880 1.00 49.29  ? 12  DG  L P     1 
ATOM   1022 O OP1   . DG  H 2 5   ? 18.645  -8.634  215.501 1.00 39.61  ? 12  DG  L OP1   1 
ATOM   1023 O OP2   . DG  H 2 5   ? 20.877  -7.480  214.982 1.00 47.95  ? 12  DG  L OP2   1 
ATOM   1024 O "O5'" . DG  H 2 5   ? 19.094  -6.250  216.213 1.00 39.79  ? 12  DG  L "O5'" 1 
ATOM   1025 C "C5'" . DG  H 2 5   ? 18.483  -5.993  217.455 1.00 49.41  ? 12  DG  L "C5'" 1 
ATOM   1026 C "C4'" . DG  H 2 5   ? 18.617  -4.535  217.820 1.00 54.90  ? 12  DG  L "C4'" 1 
ATOM   1027 O "O4'" . DG  H 2 5   ? 19.987  -4.219  218.154 1.00 58.74  ? 12  DG  L "O4'" 1 
ATOM   1028 C "C3'" . DG  H 2 5   ? 18.210  -3.532  216.737 1.00 59.34  ? 12  DG  L "C3'" 1 
ATOM   1029 O "O3'" . DG  H 2 5   ? 17.476  -2.467  217.333 1.00 68.33  ? 12  DG  L "O3'" 1 
ATOM   1030 C "C2'" . DG  H 2 5   ? 19.537  -2.953  216.281 1.00 61.49  ? 12  DG  L "C2'" 1 
ATOM   1031 C "C1'" . DG  H 2 5   ? 20.274  -2.950  217.599 1.00 53.46  ? 12  DG  L "C1'" 1 
ATOM   1032 N N9    . DG  H 2 5   ? 21.721  -2.796  217.565 1.00 41.84  ? 12  DG  L N9    1 
ATOM   1033 C C8    . DG  H 2 5   ? 22.592  -3.281  216.622 1.00 51.95  ? 12  DG  L C8    1 
ATOM   1034 N N7    . DG  H 2 5   ? 23.848  -3.063  216.921 1.00 44.06  ? 12  DG  L N7    1 
ATOM   1035 C C5    . DG  H 2 5   ? 23.799  -2.385  218.128 1.00 37.05  ? 12  DG  L C5    1 
ATOM   1036 C C6    . DG  H 2 5   ? 24.849  -1.929  218.966 1.00 39.48  ? 12  DG  L C6    1 
ATOM   1037 O O6    . DG  H 2 5   ? 26.068  -2.067  218.816 1.00 38.28  ? 12  DG  L O6    1 
ATOM   1038 N N1    . DG  H 2 5   ? 24.357  -1.271  220.088 1.00 41.01  ? 12  DG  L N1    1 
ATOM   1039 C C2    . DG  H 2 5   ? 23.025  -1.093  220.379 1.00 47.58  ? 12  DG  L C2    1 
ATOM   1040 N N2    . DG  H 2 5   ? 22.758  -0.411  221.499 1.00 50.78  ? 12  DG  L N2    1 
ATOM   1041 N N3    . DG  H 2 5   ? 22.031  -1.546  219.622 1.00 39.41  ? 12  DG  L N3    1 
ATOM   1042 C C4    . DG  H 2 5   ? 22.490  -2.177  218.520 1.00 39.19  ? 12  DG  L C4    1 
ATOM   1043 P P     . DG  H 2 6   ? 16.373  -1.693  216.473 1.00 74.61  ? 13  DG  L P     1 
ATOM   1044 O OP1   . DG  H 2 6   ? 16.646  -2.005  215.055 1.00 81.98  ? 13  DG  L OP1   1 
ATOM   1045 O OP2   . DG  H 2 6   ? 16.368  -0.285  216.925 1.00 78.63  ? 13  DG  L OP2   1 
ATOM   1046 O "O5'" . DG  H 2 6   ? 15.004  -2.358  216.941 1.00 82.89  ? 13  DG  L "O5'" 1 
ATOM   1047 C "C5'" . DG  H 2 6   ? 14.674  -2.408  218.331 1.00 105.52 ? 13  DG  L "C5'" 1 
ATOM   1048 C "C4'" . DG  H 2 6   ? 13.191  -2.205  218.549 1.00 118.84 ? 13  DG  L "C4'" 1 
ATOM   1049 O "O4'" . DG  H 2 6   ? 12.765  -0.998  217.867 1.00 122.10 ? 13  DG  L "O4'" 1 
ATOM   1050 C "C3'" . DG  H 2 6   ? 12.277  -3.322  218.041 1.00 121.74 ? 13  DG  L "C3'" 1 
ATOM   1051 O "O3'" . DG  H 2 6   ? 11.089  -3.449  218.837 1.00 118.32 ? 13  DG  L "O3'" 1 
ATOM   1052 C "C2'" . DG  H 2 6   ? 11.822  -2.802  216.693 1.00 126.37 ? 13  DG  L "C2'" 1 
ATOM   1053 C "C1'" . DG  H 2 6   ? 11.737  -1.304  216.937 1.00 128.84 ? 13  DG  L "C1'" 1 
ATOM   1054 N N9    . DG  H 2 6   ? 11.955  -0.498  215.739 1.00 135.29 ? 13  DG  L N9    1 
ATOM   1055 C C8    . DG  H 2 6   ? 13.117  -0.381  215.009 1.00 138.40 ? 13  DG  L C8    1 
ATOM   1056 N N7    . DG  H 2 6   ? 12.994  0.404   213.971 1.00 136.76 ? 13  DG  L N7    1 
ATOM   1057 C C5    . DG  H 2 6   ? 11.675  0.836   214.024 1.00 136.61 ? 13  DG  L C5    1 
ATOM   1058 C C6    . DG  H 2 6   ? 10.955  1.708   213.162 1.00 134.04 ? 13  DG  L C6    1 
ATOM   1059 O O6    . DG  H 2 6   ? 11.355  2.294   212.146 1.00 125.55 ? 13  DG  L O6    1 
ATOM   1060 N N1    . DG  H 2 6   ? 9.638   1.869   213.585 1.00 134.04 ? 13  DG  L N1    1 
ATOM   1061 C C2    . DG  H 2 6   ? 9.083   1.271   214.693 1.00 135.51 ? 13  DG  L C2    1 
ATOM   1062 N N2    . DG  H 2 6   ? 7.795   1.548   214.935 1.00 134.58 ? 13  DG  L N2    1 
ATOM   1063 N N3    . DG  H 2 6   ? 9.742   0.461   215.504 1.00 136.87 ? 13  DG  L N3    1 
ATOM   1064 C C4    . DG  H 2 6   ? 11.022  0.289   215.112 1.00 137.18 ? 13  DG  L C4    1 
ATOM   1065 N N     . SER I 3 1   ? -1.154  22.940  201.478 1.00 47.95  ? 2   SER A N     1 
ATOM   1066 C CA    . SER I 3 1   ? -0.311  22.582  200.293 1.00 52.60  ? 2   SER A CA    1 
ATOM   1067 C C     . SER I 3 1   ? -1.001  22.594  198.912 1.00 55.22  ? 2   SER A C     1 
ATOM   1068 O O     . SER I 3 1   ? -1.959  21.861  198.695 1.00 59.83  ? 2   SER A O     1 
ATOM   1069 C CB    . SER I 3 1   ? 0.300   21.196  200.509 1.00 45.38  ? 2   SER A CB    1 
ATOM   1070 O OG    . SER I 3 1   ? 0.693   20.644  199.258 1.00 34.08  ? 2   SER A OG    1 
ATOM   1071 N N     . PHE I 3 2   ? -0.505  23.406  197.978 1.00 56.87  ? 3   PHE A N     1 
ATOM   1072 C CA    . PHE I 3 2   ? -1.069  23.446  196.621 1.00 56.80  ? 3   PHE A CA    1 
ATOM   1073 C C     . PHE I 3 2   ? -0.504  22.261  195.830 1.00 54.20  ? 3   PHE A C     1 
ATOM   1074 O O     . PHE I 3 2   ? -0.946  21.964  194.735 1.00 52.36  ? 3   PHE A O     1 
ATOM   1075 C CB    . PHE I 3 2   ? -0.696  24.750  195.876 1.00 57.29  ? 3   PHE A CB    1 
ATOM   1076 C CG    . PHE I 3 2   ? -1.133  26.018  196.578 1.00 69.08  ? 3   PHE A CG    1 
ATOM   1077 C CD1   . PHE I 3 2   ? -2.474  26.387  196.628 1.00 70.80  ? 3   PHE A CD1   1 
ATOM   1078 C CD2   . PHE I 3 2   ? -0.199  26.818  197.238 1.00 66.49  ? 3   PHE A CD2   1 
ATOM   1079 C CE1   . PHE I 3 2   ? -2.870  27.532  197.335 1.00 73.78  ? 3   PHE A CE1   1 
ATOM   1080 C CE2   . PHE I 3 2   ? -0.590  27.956  197.942 1.00 58.84  ? 3   PHE A CE2   1 
ATOM   1081 C CZ    . PHE I 3 2   ? -1.920  28.311  197.993 1.00 63.23  ? 3   PHE A CZ    1 
ATOM   1082 N N     . ILE I 3 3   ? 0.482   21.586  196.394 1.00 60.61  ? 4   ILE A N     1 
ATOM   1083 C CA    . ILE I 3 3   ? 1.097   20.469  195.710 1.00 63.80  ? 4   ILE A CA    1 
ATOM   1084 C C     . ILE I 3 3   ? 0.468   19.149  196.183 1.00 64.79  ? 4   ILE A C     1 
ATOM   1085 O O     . ILE I 3 3   ? 0.322   18.201  195.408 1.00 62.93  ? 4   ILE A O     1 
ATOM   1086 C CB    . ILE I 3 3   ? 2.666   20.517  195.924 1.00 65.62  ? 4   ILE A CB    1 
ATOM   1087 C CG1   . ILE I 3 3   ? 3.383   19.945  194.698 1.00 72.34  ? 4   ILE A CG1   1 
ATOM   1088 C CG2   . ILE I 3 3   ? 3.077   19.763  197.192 1.00 50.10  ? 4   ILE A CG2   1 
ATOM   1089 C CD1   . ILE I 3 3   ? 4.886   20.126  194.708 1.00 70.06  ? 4   ILE A CD1   1 
ATOM   1090 N N     . LYS I 3 4   ? 0.055   19.099  197.444 1.00 61.87  ? 5   LYS A N     1 
ATOM   1091 C CA    . LYS I 3 4   ? -0.556  17.890  197.988 1.00 62.77  ? 5   LYS A CA    1 
ATOM   1092 C C     . LYS I 3 4   ? -1.604  17.271  197.084 1.00 65.40  ? 5   LYS A C     1 
ATOM   1093 O O     . LYS I 3 4   ? -1.494  16.103  196.723 1.00 66.24  ? 5   LYS A O     1 
ATOM   1094 C CB    . LYS I 3 4   ? -1.183  18.173  199.341 1.00 58.40  ? 5   LYS A CB    1 
ATOM   1095 C CG    . LYS I 3 4   ? -0.660  17.272  200.404 1.00 61.84  ? 5   LYS A CG    1 
ATOM   1096 C CD    . LYS I 3 4   ? -0.972  15.828  200.090 1.00 55.64  ? 5   LYS A CD    1 
ATOM   1097 C CE    . LYS I 3 4   ? -0.463  14.961  201.224 1.00 64.61  ? 5   LYS A CE    1 
ATOM   1098 N NZ    . LYS I 3 4   ? -0.826  15.546  202.562 1.00 56.38  ? 5   LYS A NZ    1 
ATOM   1099 N N     . PRO I 3 5   ? -2.637  18.048  196.702 1.00 68.06  ? 6   PRO A N     1 
ATOM   1100 C CA    . PRO I 3 5   ? -3.700  17.536  195.828 1.00 65.59  ? 6   PRO A CA    1 
ATOM   1101 C C     . PRO I 3 5   ? -3.197  16.884  194.541 1.00 60.44  ? 6   PRO A C     1 
ATOM   1102 O O     . PRO I 3 5   ? -3.908  16.093  193.920 1.00 53.28  ? 6   PRO A O     1 
ATOM   1103 C CB    . PRO I 3 5   ? -4.556  18.782  195.555 1.00 68.36  ? 6   PRO A CB    1 
ATOM   1104 C CG    . PRO I 3 5   ? -3.585  19.901  195.660 1.00 64.99  ? 6   PRO A CG    1 
ATOM   1105 C CD    . PRO I 3 5   ? -2.787  19.504  196.884 1.00 67.96  ? 6   PRO A CD    1 
ATOM   1106 N N     . ILE I 3 6   ? -1.977  17.226  194.139 1.00 55.70  ? 7   ILE A N     1 
ATOM   1107 C CA    . ILE I 3 6   ? -1.413  16.646  192.934 1.00 56.87  ? 7   ILE A CA    1 
ATOM   1108 C C     . ILE I 3 6   ? -0.153  15.870  193.229 1.00 58.70  ? 7   ILE A C     1 
ATOM   1109 O O     . ILE I 3 6   ? 0.617   15.598  192.303 1.00 57.09  ? 7   ILE A O     1 
ATOM   1110 C CB    . ILE I 3 6   ? -1.036  17.685  191.886 1.00 49.55  ? 7   ILE A CB    1 
ATOM   1111 C CG1   . ILE I 3 6   ? -0.027  18.650  192.463 1.00 54.72  ? 7   ILE A CG1   1 
ATOM   1112 C CG2   . ILE I 3 6   ? -2.245  18.426  191.426 1.00 48.32  ? 7   ILE A CG2   1 
ATOM   1113 C CD1   . ILE I 3 6   ? 0.469   19.616  191.442 1.00 62.01  ? 7   ILE A CD1   1 
ATOM   1114 N N     . TYR I 3 7   ? 0.058   15.519  194.503 1.00 58.31  ? 8   TYR A N     1 
ATOM   1115 C CA    . TYR I 3 7   ? 1.250   14.762  194.917 1.00 58.81  ? 8   TYR A CA    1 
ATOM   1116 C C     . TYR I 3 7   ? 1.378   13.501  194.102 1.00 53.35  ? 8   TYR A C     1 
ATOM   1117 O O     . TYR I 3 7   ? 2.474   13.102  193.713 1.00 56.05  ? 8   TYR A O     1 
ATOM   1118 C CB    . TYR I 3 7   ? 1.181   14.385  196.393 1.00 58.33  ? 8   TYR A CB    1 
ATOM   1119 C CG    . TYR I 3 7   ? 2.332   13.502  196.834 1.00 56.37  ? 8   TYR A CG    1 
ATOM   1120 C CD1   . TYR I 3 7   ? 3.644   13.933  196.732 1.00 52.19  ? 8   TYR A CD1   1 
ATOM   1121 C CD2   . TYR I 3 7   ? 2.100   12.228  197.345 1.00 60.84  ? 8   TYR A CD2   1 
ATOM   1122 C CE1   . TYR I 3 7   ? 4.696   13.122  197.129 1.00 56.37  ? 8   TYR A CE1   1 
ATOM   1123 C CE2   . TYR I 3 7   ? 3.141   11.403  197.742 1.00 56.84  ? 8   TYR A CE2   1 
ATOM   1124 C CZ    . TYR I 3 7   ? 4.439   11.857  197.633 1.00 60.77  ? 8   TYR A CZ    1 
ATOM   1125 O OH    . TYR I 3 7   ? 5.476   11.046  198.039 1.00 60.41  ? 8   TYR A OH    1 
ATOM   1126 N N     . GLN I 3 8   ? 0.236   12.872  193.882 1.00 51.42  ? 9   GLN A N     1 
ATOM   1127 C CA    . GLN I 3 8   ? 0.146   11.668  193.081 1.00 59.34  ? 9   GLN A CA    1 
ATOM   1128 C C     . GLN I 3 8   ? 0.676   12.002  191.697 1.00 53.99  ? 9   GLN A C     1 
ATOM   1129 O O     . GLN I 3 8   ? 1.741   11.556  191.296 1.00 47.28  ? 9   GLN A O     1 
ATOM   1130 C CB    . GLN I 3 8   ? -1.326  11.214  192.995 1.00 71.71  ? 9   GLN A CB    1 
ATOM   1131 C CG    . GLN I 3 8   ? -2.352  12.363  192.880 1.00 75.29  ? 9   GLN A CG    1 
ATOM   1132 C CD    . GLN I 3 8   ? -3.801  11.881  192.950 1.00 83.37  ? 9   GLN A CD    1 
ATOM   1133 O OE1   . GLN I 3 8   ? -4.131  10.999  193.743 1.00 89.10  ? 9   GLN A OE1   1 
ATOM   1134 N NE2   . GLN I 3 8   ? -4.674  12.477  192.137 1.00 81.50  ? 9   GLN A NE2   1 
ATOM   1135 N N     . ASP I 3 9   ? -0.084  12.815  190.979 1.00 60.30  ? 10  ASP A N     1 
ATOM   1136 C CA    . ASP I 3 9   ? 0.287   13.228  189.642 1.00 66.28  ? 10  ASP A CA    1 
ATOM   1137 C C     . ASP I 3 9   ? 1.807   13.445  189.530 1.00 69.71  ? 10  ASP A C     1 
ATOM   1138 O O     . ASP I 3 9   ? 2.394   13.202  188.475 1.00 80.13  ? 10  ASP A O     1 
ATOM   1139 C CB    . ASP I 3 9   ? -0.482  14.507  189.275 1.00 74.95  ? 10  ASP A CB    1 
ATOM   1140 C CG    . ASP I 3 9   ? -2.004  14.331  189.383 1.00 87.42  ? 10  ASP A CG    1 
ATOM   1141 O OD1   . ASP I 3 9   ? -2.770  15.286  189.097 1.00 85.92  ? 10  ASP A OD1   1 
ATOM   1142 O OD2   . ASP I 3 9   ? -2.443  13.227  189.761 1.00 96.23  ? 10  ASP A OD2   1 
ATOM   1143 N N     . ILE I 3 10  ? 2.446   13.886  190.612 1.00 60.91  ? 11  ILE A N     1 
ATOM   1144 C CA    . ILE I 3 10  ? 3.888   14.122  190.598 1.00 58.70  ? 11  ILE A CA    1 
ATOM   1145 C C     . ILE I 3 10  ? 4.649   12.807  190.805 1.00 64.27  ? 11  ILE A C     1 
ATOM   1146 O O     . ILE I 3 10  ? 5.523   12.433  190.006 1.00 60.72  ? 11  ILE A O     1 
ATOM   1147 C CB    . ILE I 3 10  ? 4.304   15.143  191.706 1.00 50.65  ? 11  ILE A CB    1 
ATOM   1148 C CG1   . ILE I 3 10  ? 3.503   16.426  191.544 1.00 51.02  ? 11  ILE A CG1   1 
ATOM   1149 C CG2   . ILE I 3 10  ? 5.775   15.512  191.581 1.00 25.37  ? 11  ILE A CG2   1 
ATOM   1150 C CD1   . ILE I 3 10  ? 3.820   17.494  192.560 1.00 53.62  ? 11  ILE A CD1   1 
ATOM   1151 N N     . ASN I 3 11  ? 4.300   12.103  191.877 1.00 70.48  ? 12  ASN A N     1 
ATOM   1152 C CA    . ASN I 3 11  ? 4.945   10.838  192.213 1.00 70.88  ? 12  ASN A CA    1 
ATOM   1153 C C     . ASN I 3 11  ? 5.019   9.901   191.010 1.00 68.23  ? 12  ASN A C     1 
ATOM   1154 O O     . ASN I 3 11  ? 5.998   9.175   190.821 1.00 68.65  ? 12  ASN A O     1 
ATOM   1155 C CB    . ASN I 3 11  ? 4.192   10.136  193.333 1.00 67.37  ? 12  ASN A CB    1 
ATOM   1156 C CG    . ASN I 3 11  ? 5.118   9.413   194.261 1.00 77.48  ? 12  ASN A CG    1 
ATOM   1157 O OD1   . ASN I 3 11  ? 6.143   8.879   193.840 1.00 70.45  ? 12  ASN A OD1   1 
ATOM   1158 N ND2   . ASN I 3 11  ? 4.769   9.386   195.539 1.00 95.19  ? 12  ASN A ND2   1 
ATOM   1159 N N     . SER I 3 12  ? 3.978   9.924   190.195 1.00 55.91  ? 13  SER A N     1 
ATOM   1160 C CA    . SER I 3 12  ? 3.957   9.066   189.045 1.00 59.86  ? 13  SER A CA    1 
ATOM   1161 C C     . SER I 3 12  ? 4.966   9.500   187.993 1.00 58.70  ? 13  SER A C     1 
ATOM   1162 O O     . SER I 3 12  ? 5.881   8.744   187.644 1.00 54.99  ? 13  SER A O     1 
ATOM   1163 C CB    . SER I 3 12  ? 2.557   9.032   188.444 1.00 62.45  ? 13  SER A CB    1 
ATOM   1164 O OG    . SER I 3 12  ? 2.130   10.330  188.073 1.00 65.12  ? 13  SER A OG    1 
ATOM   1165 N N     . ILE I 3 13  ? 4.812   10.722  187.499 1.00 54.40  ? 14  ILE A N     1 
ATOM   1166 C CA    . ILE I 3 13  ? 5.699   11.220  186.466 1.00 66.47  ? 14  ILE A CA    1 
ATOM   1167 C C     . ILE I 3 13  ? 7.190   11.136  186.815 1.00 71.19  ? 14  ILE A C     1 
ATOM   1168 O O     . ILE I 3 13  ? 8.048   11.203  185.928 1.00 72.27  ? 14  ILE A O     1 
ATOM   1169 C CB    . ILE I 3 13  ? 5.359   12.669  186.106 1.00 69.60  ? 14  ILE A CB    1 
ATOM   1170 C CG1   . ILE I 3 13  ? 6.207   13.111  184.902 1.00 76.25  ? 14  ILE A CG1   1 
ATOM   1171 C CG2   . ILE I 3 13  ? 5.598   13.562  187.297 1.00 69.45  ? 14  ILE A CG2   1 
ATOM   1172 C CD1   . ILE I 3 13  ? 5.953   14.530  184.444 1.00 68.52  ? 14  ILE A CD1   1 
ATOM   1173 N N     . LEU I 3 14  ? 7.508   10.978  188.096 1.00 67.07  ? 15  LEU A N     1 
ATOM   1174 C CA    . LEU I 3 14  ? 8.905   10.902  188.494 1.00 60.25  ? 15  LEU A CA    1 
ATOM   1175 C C     . LEU I 3 14  ? 9.458   9.485   188.549 1.00 61.19  ? 15  LEU A C     1 
ATOM   1176 O O     . LEU I 3 14  ? 10.420  9.158   187.858 1.00 64.75  ? 15  LEU A O     1 
ATOM   1177 C CB    . LEU I 3 14  ? 9.116   11.581  189.855 1.00 60.08  ? 15  LEU A CB    1 
ATOM   1178 C CG    . LEU I 3 14  ? 9.400   13.086  189.932 1.00 56.58  ? 15  LEU A CG    1 
ATOM   1179 C CD1   . LEU I 3 14  ? 10.063  13.397  191.260 1.00 61.22  ? 15  LEU A CD1   1 
ATOM   1180 C CD2   . LEU I 3 14  ? 10.335  13.508  188.830 1.00 59.53  ? 15  LEU A CD2   1 
ATOM   1181 N N     . ILE I 3 15  ? 8.850   8.646   189.376 1.00 62.16  ? 16  ILE A N     1 
ATOM   1182 C CA    . ILE I 3 15  ? 9.303   7.271   189.540 1.00 57.34  ? 16  ILE A CA    1 
ATOM   1183 C C     . ILE I 3 15  ? 9.559   6.521   188.235 1.00 57.96  ? 16  ILE A C     1 
ATOM   1184 O O     . ILE I 3 15  ? 8.623   6.190   187.508 1.00 50.55  ? 16  ILE A O     1 
ATOM   1185 C CB    . ILE I 3 15  ? 8.288   6.436   190.342 1.00 52.75  ? 16  ILE A CB    1 
ATOM   1186 C CG1   . ILE I 3 15  ? 7.968   7.116   191.657 1.00 41.25  ? 16  ILE A CG1   1 
ATOM   1187 C CG2   . ILE I 3 15  ? 8.878   5.080   190.640 1.00 47.12  ? 16  ILE A CG2   1 
ATOM   1188 C CD1   . ILE I 3 15  ? 9.160   7.199   192.562 1.00 57.76  ? 16  ILE A CD1   1 
ATOM   1189 N N     . GLY I 3 16  ? 10.825  6.241   187.949 1.00 57.62  ? 17  GLY A N     1 
ATOM   1190 C CA    . GLY I 3 16  ? 11.136  5.492   186.748 1.00 61.93  ? 17  GLY A CA    1 
ATOM   1191 C C     . GLY I 3 16  ? 11.758  6.283   185.626 1.00 63.67  ? 17  GLY A C     1 
ATOM   1192 O O     . GLY I 3 16  ? 12.233  5.727   184.627 1.00 61.92  ? 17  GLY A O     1 
ATOM   1193 N N     . GLN I 3 17  ? 11.751  7.594   185.790 1.00 65.52  ? 18  GLN A N     1 
ATOM   1194 C CA    . GLN I 3 17  ? 12.324  8.458   184.791 1.00 63.14  ? 18  GLN A CA    1 
ATOM   1195 C C     . GLN I 3 17  ? 13.849  8.374   184.896 1.00 63.97  ? 18  GLN A C     1 
ATOM   1196 O O     . GLN I 3 17  ? 14.419  8.349   186.000 1.00 60.42  ? 18  GLN A O     1 
ATOM   1197 C CB    . GLN I 3 17  ? 11.831  9.889   185.009 1.00 59.57  ? 18  GLN A CB    1 
ATOM   1198 C CG    . GLN I 3 17  ? 11.945  10.759  183.785 1.00 62.22  ? 18  GLN A CG    1 
ATOM   1199 C CD    . GLN I 3 17  ? 11.209  10.174  182.599 1.00 71.52  ? 18  GLN A CD    1 
ATOM   1200 O OE1   . GLN I 3 17  ? 10.003  9.931   182.664 1.00 78.05  ? 18  GLN A OE1   1 
ATOM   1201 N NE2   . GLN I 3 17  ? 11.934  9.939   181.502 1.00 74.31  ? 18  GLN A NE2   1 
ATOM   1202 N N     . LYS I 3 18  ? 14.487  8.312   183.728 1.00 63.06  ? 19  LYS A N     1 
ATOM   1203 C CA    . LYS I 3 18  ? 15.935  8.229   183.604 1.00 64.72  ? 19  LYS A CA    1 
ATOM   1204 C C     . LYS I 3 18  ? 16.551  9.530   183.081 1.00 65.41  ? 19  LYS A C     1 
ATOM   1205 O O     . LYS I 3 18  ? 16.264  9.971   181.961 1.00 56.19  ? 19  LYS A O     1 
ATOM   1206 C CB    . LYS I 3 18  ? 16.317  7.075   182.664 1.00 60.64  ? 19  LYS A CB    1 
ATOM   1207 C CG    . LYS I 3 18  ? 15.800  5.710   183.103 1.00 66.06  ? 19  LYS A CG    1 
ATOM   1208 C CD    . LYS I 3 18  ? 16.530  4.564   182.399 1.00 70.03  ? 19  LYS A CD    1 
ATOM   1209 C CE    . LYS I 3 18  ? 15.930  3.203   182.761 1.00 73.73  ? 19  LYS A CE    1 
ATOM   1210 N NZ    . LYS I 3 18  ? 16.632  2.075   182.072 1.00 72.12  ? 19  LYS A NZ    1 
ATOM   1211 N N     . VAL I 3 19  ? 17.390  10.140  183.912 1.00 71.17  ? 20  VAL A N     1 
ATOM   1212 C CA    . VAL I 3 19  ? 18.086  11.371  183.555 1.00 79.09  ? 20  VAL A CA    1 
ATOM   1213 C C     . VAL I 3 19  ? 19.574  11.046  183.418 1.00 87.04  ? 20  VAL A C     1 
ATOM   1214 O O     . VAL I 3 19  ? 20.044  10.017  183.901 1.00 91.41  ? 20  VAL A O     1 
ATOM   1215 C CB    . VAL I 3 19  ? 17.895  12.496  184.637 1.00 76.05  ? 20  VAL A CB    1 
ATOM   1216 C CG1   . VAL I 3 19  ? 16.425  12.748  184.864 1.00 71.51  ? 20  VAL A CG1   1 
ATOM   1217 C CG2   . VAL I 3 19  ? 18.583  12.120  185.956 1.00 75.85  ? 20  VAL A CG2   1 
ATOM   1218 N N     . LYS I 3 20  ? 20.311  11.920  182.749 1.00 93.68  ? 21  LYS A N     1 
ATOM   1219 C CA    . LYS I 3 20  ? 21.733  11.721  182.556 1.00 97.97  ? 21  LYS A CA    1 
ATOM   1220 C C     . LYS I 3 20  ? 22.443  11.860  183.899 1.00 103.86 ? 21  LYS A C     1 
ATOM   1221 O O     . LYS I 3 20  ? 21.884  12.422  184.839 1.00 99.93  ? 21  LYS A O     1 
ATOM   1222 C CB    . LYS I 3 20  ? 22.234  12.757  181.567 1.00 97.60  ? 21  LYS A CB    1 
ATOM   1223 C CG    . LYS I 3 20  ? 21.409  12.781  180.296 1.00 100.99 ? 21  LYS A CG    1 
ATOM   1224 C CD    . LYS I 3 20  ? 21.521  11.452  179.559 1.00 96.52  ? 21  LYS A CD    1 
ATOM   1225 C CE    . LYS I 3 20  ? 20.744  11.464  178.242 1.00 95.95  ? 21  LYS A CE    1 
ATOM   1226 N NZ    . LYS I 3 20  ? 21.143  12.552  177.292 1.00 81.24  ? 21  LYS A NZ    1 
ATOM   1227 N N     . ARG I 3 21  ? 23.665  11.338  183.989 1.00 113.40 ? 22  ARG A N     1 
ATOM   1228 C CA    . ARG I 3 21  ? 24.448  11.405  185.224 1.00 125.76 ? 22  ARG A CA    1 
ATOM   1229 C C     . ARG I 3 21  ? 25.053  12.800  185.431 1.00 137.00 ? 22  ARG A C     1 
ATOM   1230 O O     . ARG I 3 21  ? 25.515  13.430  184.483 1.00 138.02 ? 22  ARG A O     1 
ATOM   1231 C CB    . ARG I 3 21  ? 25.560  10.351  185.199 1.00 119.48 ? 22  ARG A CB    1 
ATOM   1232 N N     . PRO I 3 22  ? 25.058  13.298  186.683 1.00 147.65 ? 23  PRO A N     1 
ATOM   1233 C CA    . PRO I 3 22  ? 25.600  14.621  187.036 1.00 154.23 ? 23  PRO A CA    1 
ATOM   1234 C C     . PRO I 3 22  ? 27.071  14.880  186.666 1.00 157.13 ? 23  PRO A C     1 
ATOM   1235 O O     . PRO I 3 22  ? 27.981  14.634  187.465 1.00 158.82 ? 23  PRO A O     1 
ATOM   1236 C CB    . PRO I 3 22  ? 25.364  14.696  188.545 1.00 158.04 ? 23  PRO A CB    1 
ATOM   1237 C CG    . PRO I 3 22  ? 24.111  13.881  188.727 1.00 156.88 ? 23  PRO A CG    1 
ATOM   1238 C CD    . PRO I 3 22  ? 24.394  12.683  187.848 1.00 152.18 ? 23  PRO A CD    1 
ATOM   1239 N N     . LYS I 3 23  ? 27.285  15.396  185.456 1.00 157.53 ? 24  LYS A N     1 
ATOM   1240 C CA    . LYS I 3 23  ? 28.619  15.714  184.941 1.00 155.41 ? 24  LYS A CA    1 
ATOM   1241 C C     . LYS I 3 23  ? 29.664  14.644  185.241 1.00 152.25 ? 24  LYS A C     1 
ATOM   1242 O O     . LYS I 3 23  ? 30.860  14.934  185.296 1.00 152.61 ? 24  LYS A O     1 
ATOM   1243 C CB    . LYS I 3 23  ? 29.098  17.059  185.500 1.00 157.69 ? 24  LYS A CB    1 
ATOM   1244 N N     . SER I 3 24  ? 29.209  13.411  185.432 1.00 147.23 ? 25  SER A N     1 
ATOM   1245 C CA    . SER I 3 24  ? 30.107  12.304  185.722 1.00 140.88 ? 25  SER A CA    1 
ATOM   1246 C C     . SER I 3 24  ? 31.108  12.677  186.824 1.00 139.32 ? 25  SER A C     1 
ATOM   1247 O O     . SER I 3 24  ? 32.265  12.259  186.796 1.00 140.95 ? 25  SER A O     1 
ATOM   1248 C CB    . SER I 3 24  ? 30.852  11.900  184.443 1.00 137.99 ? 25  SER A CB    1 
ATOM   1249 O OG    . SER I 3 24  ? 29.945  11.590  183.398 1.00 128.78 ? 25  SER A OG    1 
ATOM   1250 N N     . GLY I 3 25  ? 30.657  13.467  187.793 1.00 134.87 ? 26  GLY A N     1 
ATOM   1251 C CA    . GLY I 3 25  ? 31.532  13.867  188.878 1.00 129.50 ? 26  GLY A CA    1 
ATOM   1252 C C     . GLY I 3 25  ? 31.059  13.357  190.225 1.00 127.76 ? 26  GLY A C     1 
ATOM   1253 O O     . GLY I 3 25  ? 30.399  12.325  190.315 1.00 125.04 ? 26  GLY A O     1 
ATOM   1254 N N     . THR I 3 26  ? 31.400  14.090  191.278 1.00 128.75 ? 27  THR A N     1 
ATOM   1255 C CA    . THR I 3 26  ? 31.013  13.729  192.639 1.00 124.93 ? 27  THR A CA    1 
ATOM   1256 C C     . THR I 3 26  ? 29.511  13.954  192.817 1.00 117.21 ? 27  THR A C     1 
ATOM   1257 O O     . THR I 3 26  ? 29.050  15.095  192.845 1.00 120.86 ? 27  THR A O     1 
ATOM   1258 C CB    . THR I 3 26  ? 31.766  14.602  193.679 1.00 130.09 ? 27  THR A CB    1 
ATOM   1259 O OG1   . THR I 3 26  ? 33.149  14.706  193.310 1.00 133.11 ? 27  THR A OG1   1 
ATOM   1260 C CG2   . THR I 3 26  ? 31.674  13.983  195.071 1.00 131.65 ? 27  THR A CG2   1 
ATOM   1261 N N     . LEU I 3 27  ? 28.757  12.865  192.940 1.00 104.85 ? 28  LEU A N     1 
ATOM   1262 C CA    . LEU I 3 27  ? 27.304  12.919  193.122 1.00 92.73  ? 28  LEU A CA    1 
ATOM   1263 C C     . LEU I 3 27  ? 26.947  13.473  194.496 1.00 89.14  ? 28  LEU A C     1 
ATOM   1264 O O     . LEU I 3 27  ? 25.979  13.027  195.109 1.00 94.52  ? 28  LEU A O     1 
ATOM   1265 C CB    . LEU I 3 27  ? 26.724  11.517  193.018 1.00 83.86  ? 28  LEU A CB    1 
ATOM   1266 C CG    . LEU I 3 27  ? 27.278  10.680  191.877 1.00 88.80  ? 28  LEU A CG    1 
ATOM   1267 C CD1   . LEU I 3 27  ? 27.540  9.244   192.337 1.00 84.41  ? 28  LEU A CD1   1 
ATOM   1268 C CD2   . LEU I 3 27  ? 26.299  10.738  190.726 1.00 90.91  ? 28  LEU A CD2   1 
ATOM   1269 N N     . SER I 3 28  ? 27.715  14.445  194.973 1.00 82.80  ? 29  SER A N     1 
ATOM   1270 C CA    . SER I 3 28  ? 27.491  15.016  196.300 1.00 79.40  ? 29  SER A CA    1 
ATOM   1271 C C     . SER I 3 28  ? 27.042  16.486  196.287 1.00 81.48  ? 29  SER A C     1 
ATOM   1272 O O     . SER I 3 28  ? 27.189  17.176  195.279 1.00 88.39  ? 29  SER A O     1 
ATOM   1273 C CB    . SER I 3 28  ? 28.781  14.882  197.115 1.00 76.27  ? 29  SER A CB    1 
ATOM   1274 O OG    . SER I 3 28  ? 29.455  13.664  196.832 1.00 48.46  ? 29  SER A OG    1 
ATOM   1275 N N     . GLY I 3 29  ? 26.501  16.957  197.411 1.00 78.56  ? 30  GLY A N     1 
ATOM   1276 C CA    . GLY I 3 29  ? 26.062  18.341  197.513 1.00 89.33  ? 30  GLY A CA    1 
ATOM   1277 C C     . GLY I 3 29  ? 25.080  18.817  196.454 1.00 98.78  ? 30  GLY A C     1 
ATOM   1278 O O     . GLY I 3 29  ? 24.145  18.099  196.102 1.00 103.11 ? 30  GLY A O     1 
ATOM   1279 N N     . HIS I 3 30  ? 25.288  20.028  195.938 1.00 103.63 ? 31  HIS A N     1 
ATOM   1280 C CA    . HIS I 3 30  ? 24.400  20.602  194.916 1.00 106.13 ? 31  HIS A CA    1 
ATOM   1281 C C     . HIS I 3 30  ? 24.475  19.931  193.548 1.00 101.39 ? 31  HIS A C     1 
ATOM   1282 O O     . HIS I 3 30  ? 24.137  20.548  192.536 1.00 102.97 ? 31  HIS A O     1 
ATOM   1283 C CB    . HIS I 3 30  ? 24.702  22.090  194.717 1.00 114.52 ? 31  HIS A CB    1 
ATOM   1284 C CG    . HIS I 3 30  ? 24.341  22.950  195.886 1.00 121.26 ? 31  HIS A CG    1 
ATOM   1285 N ND1   . HIS I 3 30  ? 24.999  22.880  197.095 1.00 120.68 ? 31  HIS A ND1   1 
ATOM   1286 C CD2   . HIS I 3 30  ? 23.402  23.916  196.022 1.00 125.00 ? 31  HIS A CD2   1 
ATOM   1287 C CE1   . HIS I 3 30  ? 24.480  23.769  197.924 1.00 124.65 ? 31  HIS A CE1   1 
ATOM   1288 N NE2   . HIS I 3 30  ? 23.510  24.410  197.298 1.00 123.62 ? 31  HIS A NE2   1 
ATOM   1289 N N     . ALA I 3 31  ? 24.907  18.678  193.515 1.00 94.58  ? 32  ALA A N     1 
ATOM   1290 C CA    . ALA I 3 31  ? 25.043  17.966  192.256 1.00 92.73  ? 32  ALA A CA    1 
ATOM   1291 C C     . ALA I 3 31  ? 24.386  16.587  192.273 1.00 94.57  ? 32  ALA A C     1 
ATOM   1292 O O     . ALA I 3 31  ? 24.228  15.960  191.224 1.00 91.03  ? 32  ALA A O     1 
ATOM   1293 C CB    . ALA I 3 31  ? 26.521  17.833  191.912 1.00 85.81  ? 32  ALA A CB    1 
ATOM   1294 N N     . ALA I 3 32  ? 24.007  16.120  193.461 1.00 92.12  ? 33  ALA A N     1 
ATOM   1295 C CA    . ALA I 3 32  ? 23.383  14.815  193.604 1.00 86.20  ? 33  ALA A CA    1 
ATOM   1296 C C     . ALA I 3 32  ? 22.331  14.581  192.522 1.00 86.71  ? 33  ALA A C     1 
ATOM   1297 O O     . ALA I 3 32  ? 22.655  14.151  191.415 1.00 79.52  ? 33  ALA A O     1 
ATOM   1298 C CB    . ALA I 3 32  ? 22.762  14.678  194.992 1.00 82.86  ? 33  ALA A CB    1 
ATOM   1299 N N     . GLY I 3 33  ? 21.076  14.882  192.839 1.00 88.72  ? 34  GLY A N     1 
ATOM   1300 C CA    . GLY I 3 33  ? 20.006  14.669  191.883 1.00 87.10  ? 34  GLY A CA    1 
ATOM   1301 C C     . GLY I 3 33  ? 19.429  15.940  191.310 1.00 88.69  ? 34  GLY A C     1 
ATOM   1302 O O     . GLY I 3 33  ? 18.214  16.083  191.181 1.00 95.51  ? 34  GLY A O     1 
ATOM   1303 N N     . GLU I 3 34  ? 20.302  16.873  190.971 1.00 84.81  ? 35  GLU A N     1 
ATOM   1304 C CA    . GLU I 3 34  ? 19.878  18.133  190.388 1.00 82.08  ? 35  GLU A CA    1 
ATOM   1305 C C     . GLU I 3 34  ? 18.727  17.978  189.375 1.00 78.59  ? 35  GLU A C     1 
ATOM   1306 O O     . GLU I 3 34  ? 17.660  18.555  189.548 1.00 76.94  ? 35  GLU A O     1 
ATOM   1307 C CB    . GLU I 3 34  ? 21.090  18.797  189.733 1.00 88.00  ? 35  GLU A CB    1 
ATOM   1308 C CG    . GLU I 3 34  ? 20.746  19.943  188.845 1.00 96.68  ? 35  GLU A CG    1 
ATOM   1309 C CD    . GLU I 3 34  ? 19.956  20.999  189.575 1.00 105.75 ? 35  GLU A CD    1 
ATOM   1310 O OE1   . GLU I 3 34  ? 19.569  21.984  188.917 1.00 112.44 ? 35  GLU A OE1   1 
ATOM   1311 O OE2   . GLU I 3 34  ? 19.723  20.847  190.798 1.00 105.65 ? 35  GLU A OE2   1 
ATOM   1312 N N     . PRO I 3 35  ? 18.928  17.176  188.318 1.00 78.43  ? 36  PRO A N     1 
ATOM   1313 C CA    . PRO I 3 35  ? 17.916  16.941  187.275 1.00 80.19  ? 36  PRO A CA    1 
ATOM   1314 C C     . PRO I 3 35  ? 16.476  16.747  187.752 1.00 80.61  ? 36  PRO A C     1 
ATOM   1315 O O     . PRO I 3 35  ? 15.544  17.291  187.161 1.00 80.66  ? 36  PRO A O     1 
ATOM   1316 C CB    . PRO I 3 35  ? 18.427  15.687  186.570 1.00 82.07  ? 36  PRO A CB    1 
ATOM   1317 C CG    . PRO I 3 35  ? 19.902  15.812  186.700 1.00 82.79  ? 36  PRO A CG    1 
ATOM   1318 C CD    . PRO I 3 35  ? 20.085  16.282  188.122 1.00 78.90  ? 36  PRO A CD    1 
ATOM   1319 N N     . PHE I 3 36  ? 16.297  15.952  188.804 1.00 81.66  ? 37  PHE A N     1 
ATOM   1320 C CA    . PHE I 3 36  ? 14.967  15.671  189.344 1.00 76.00  ? 37  PHE A CA    1 
ATOM   1321 C C     . PHE I 3 36  ? 14.284  16.933  189.769 1.00 70.11  ? 37  PHE A C     1 
ATOM   1322 O O     . PHE I 3 36  ? 13.108  17.117  189.480 1.00 64.11  ? 37  PHE A O     1 
ATOM   1323 C CB    . PHE I 3 36  ? 15.043  14.751  190.560 1.00 78.22  ? 37  PHE A CB    1 
ATOM   1324 C CG    . PHE I 3 36  ? 15.770  13.488  190.299 1.00 74.63  ? 37  PHE A CG    1 
ATOM   1325 C CD1   . PHE I 3 36  ? 17.060  13.303  190.788 1.00 75.30  ? 37  PHE A CD1   1 
ATOM   1326 C CD2   . PHE I 3 36  ? 15.195  12.507  189.506 1.00 67.62  ? 37  PHE A CD2   1 
ATOM   1327 C CE1   . PHE I 3 36  ? 17.773  12.159  190.487 1.00 76.56  ? 37  PHE A CE1   1 
ATOM   1328 C CE2   . PHE I 3 36  ? 15.894  11.359  189.195 1.00 74.94  ? 37  PHE A CE2   1 
ATOM   1329 C CZ    . PHE I 3 36  ? 17.190  11.182  189.687 1.00 79.89  ? 37  PHE A CZ    1 
ATOM   1330 N N     . GLU I 3 37  ? 15.019  17.785  190.481 1.00 64.02  ? 38  GLU A N     1 
ATOM   1331 C CA    . GLU I 3 37  ? 14.467  19.055  190.945 1.00 67.68  ? 38  GLU A CA    1 
ATOM   1332 C C     . GLU I 3 37  ? 13.888  19.822  189.728 1.00 67.57  ? 38  GLU A C     1 
ATOM   1333 O O     . GLU I 3 37  ? 12.707  20.197  189.710 1.00 60.26  ? 38  GLU A O     1 
ATOM   1334 C CB    . GLU I 3 37  ? 15.566  19.868  191.655 1.00 63.99  ? 38  GLU A CB    1 
ATOM   1335 C CG    . GLU I 3 37  ? 15.080  21.034  192.531 1.00 68.07  ? 38  GLU A CG    1 
ATOM   1336 C CD    . GLU I 3 37  ? 14.565  22.250  191.746 1.00 78.18  ? 38  GLU A CD    1 
ATOM   1337 O OE1   . GLU I 3 37  ? 14.172  23.254  192.388 1.00 73.88  ? 38  GLU A OE1   1 
ATOM   1338 O OE2   . GLU I 3 37  ? 14.553  22.215  190.494 1.00 87.67  ? 38  GLU A OE2   1 
ATOM   1339 N N     . LYS I 3 38  ? 14.715  20.037  188.707 1.00 68.68  ? 39  LYS A N     1 
ATOM   1340 C CA    . LYS I 3 38  ? 14.269  20.734  187.501 1.00 68.90  ? 39  LYS A CA    1 
ATOM   1341 C C     . LYS I 3 38  ? 13.063  19.982  186.925 1.00 61.98  ? 39  LYS A C     1 
ATOM   1342 O O     . LYS I 3 38  ? 12.186  20.550  186.265 1.00 56.35  ? 39  LYS A O     1 
ATOM   1343 C CB    . LYS I 3 38  ? 15.399  20.771  186.463 1.00 67.29  ? 39  LYS A CB    1 
ATOM   1344 C CG    . LYS I 3 38  ? 15.564  22.116  185.744 1.00 67.77  ? 39  LYS A CG    1 
ATOM   1345 C CD    . LYS I 3 38  ? 16.737  22.069  184.757 1.00 82.47  ? 39  LYS A CD    1 
ATOM   1346 C CE    . LYS I 3 38  ? 18.065  21.736  185.462 1.00 87.19  ? 39  LYS A CE    1 
ATOM   1347 N NZ    . LYS I 3 38  ? 19.141  21.218  184.553 1.00 84.22  ? 39  LYS A NZ    1 
ATOM   1348 N N     . LEU I 3 39  ? 13.034  18.688  187.200 1.00 51.91  ? 40  LEU A N     1 
ATOM   1349 C CA    . LEU I 3 39  ? 11.973  17.831  186.733 1.00 43.26  ? 40  LEU A CA    1 
ATOM   1350 C C     . LEU I 3 39  ? 10.651  18.082  187.448 1.00 49.94  ? 40  LEU A C     1 
ATOM   1351 O O     . LEU I 3 39  ? 9.598   18.258  186.818 1.00 49.86  ? 40  LEU A O     1 
ATOM   1352 C CB    . LEU I 3 39  ? 12.381  16.390  186.931 1.00 32.85  ? 40  LEU A CB    1 
ATOM   1353 C CG    . LEU I 3 39  ? 11.420  15.503  186.165 1.00 36.87  ? 40  LEU A CG    1 
ATOM   1354 C CD1   . LEU I 3 39  ? 11.136  16.068  184.759 1.00 28.59  ? 40  LEU A CD1   1 
ATOM   1355 C CD2   . LEU I 3 39  ? 12.043  14.157  186.090 1.00 46.25  ? 40  LEU A CD2   1 
ATOM   1356 N N     . VAL I 3 40  ? 10.720  18.072  188.774 1.00 44.48  ? 41  VAL A N     1 
ATOM   1357 C CA    . VAL I 3 40  ? 9.570   18.299  189.613 1.00 35.24  ? 41  VAL A CA    1 
ATOM   1358 C C     . VAL I 3 40  ? 9.081   19.703  189.296 1.00 43.27  ? 41  VAL A C     1 
ATOM   1359 O O     . VAL I 3 40  ? 7.873   19.956  189.163 1.00 44.04  ? 41  VAL A O     1 
ATOM   1360 C CB    . VAL I 3 40  ? 9.971   18.211  191.099 1.00 35.68  ? 41  VAL A CB    1 
ATOM   1361 C CG1   . VAL I 3 40  ? 8.779   18.412  191.989 1.00 56.23  ? 41  VAL A CG1   1 
ATOM   1362 C CG2   . VAL I 3 40  ? 10.571  16.878  191.381 1.00 51.18  ? 41  VAL A CG2   1 
ATOM   1363 N N     . TYR I 3 41  ? 10.028  20.622  189.136 1.00 44.56  ? 42  TYR A N     1 
ATOM   1364 C CA    . TYR I 3 41  ? 9.663   22.006  188.868 1.00 46.29  ? 42  TYR A CA    1 
ATOM   1365 C C     . TYR I 3 41  ? 8.903   22.171  187.558 1.00 46.60  ? 42  TYR A C     1 
ATOM   1366 O O     . TYR I 3 41  ? 7.767   22.661  187.555 1.00 45.49  ? 42  TYR A O     1 
ATOM   1367 C CB    . TYR I 3 41  ? 10.910  22.916  188.914 1.00 37.34  ? 42  TYR A CB    1 
ATOM   1368 C CG    . TYR I 3 41  ? 10.634  24.349  188.475 1.00 44.74  ? 42  TYR A CG    1 
ATOM   1369 C CD1   . TYR I 3 41  ? 10.765  24.721  187.137 1.00 42.48  ? 42  TYR A CD1   1 
ATOM   1370 C CD2   . TYR I 3 41  ? 10.193  25.321  189.380 1.00 53.32  ? 42  TYR A CD2   1 
ATOM   1371 C CE1   . TYR I 3 41  ? 10.468  26.006  186.706 1.00 40.45  ? 42  TYR A CE1   1 
ATOM   1372 C CE2   . TYR I 3 41  ? 9.889   26.630  188.949 1.00 47.75  ? 42  TYR A CE2   1 
ATOM   1373 C CZ    . TYR I 3 41  ? 10.033  26.951  187.606 1.00 46.09  ? 42  TYR A CZ    1 
ATOM   1374 O OH    . TYR I 3 41  ? 9.731   28.202  187.123 1.00 58.53  ? 42  TYR A OH    1 
ATOM   1375 N N     . LYS I 3 42  ? 9.516   21.755  186.452 1.00 44.75  ? 43  LYS A N     1 
ATOM   1376 C CA    . LYS I 3 42  ? 8.874   21.883  185.149 1.00 39.84  ? 43  LYS A CA    1 
ATOM   1377 C C     . LYS I 3 42  ? 7.483   21.271  185.204 1.00 40.85  ? 43  LYS A C     1 
ATOM   1378 O O     . LYS I 3 42  ? 6.554   21.791  184.591 1.00 28.70  ? 43  LYS A O     1 
ATOM   1379 C CB    . LYS I 3 42  ? 9.745   21.232  184.064 1.00 40.19  ? 43  LYS A CB    1 
ATOM   1380 C CG    . LYS I 3 42  ? 9.028   20.856  182.765 1.00 38.32  ? 43  LYS A CG    1 
ATOM   1381 C CD    . LYS I 3 42  ? 8.329   22.013  182.053 1.00 45.21  ? 43  LYS A CD    1 
ATOM   1382 C CE    . LYS I 3 42  ? 9.271   22.924  181.285 1.00 38.52  ? 43  LYS A CE    1 
ATOM   1383 N NZ    . LYS I 3 42  ? 10.174  23.671  182.200 1.00 48.04  ? 43  LYS A NZ    1 
ATOM   1384 N N     . PHE I 3 43  ? 7.328   20.187  185.962 1.00 42.79  ? 44  PHE A N     1 
ATOM   1385 C CA    . PHE I 3 43  ? 6.015   19.565  186.079 1.00 47.92  ? 44  PHE A CA    1 
ATOM   1386 C C     . PHE I 3 43  ? 5.004   20.560  186.633 1.00 42.85  ? 44  PHE A C     1 
ATOM   1387 O O     . PHE I 3 43  ? 3.999   20.845  185.987 1.00 33.83  ? 44  PHE A O     1 
ATOM   1388 C CB    . PHE I 3 43  ? 6.046   18.351  186.999 1.00 62.01  ? 44  PHE A CB    1 
ATOM   1389 C CG    . PHE I 3 43  ? 4.676   17.797  187.295 1.00 75.17  ? 44  PHE A CG    1 
ATOM   1390 C CD1   . PHE I 3 43  ? 3.925   17.191  186.292 1.00 75.78  ? 44  PHE A CD1   1 
ATOM   1391 C CD2   . PHE I 3 43  ? 4.122   17.911  188.567 1.00 75.93  ? 44  PHE A CD2   1 
ATOM   1392 C CE1   . PHE I 3 43  ? 2.645   16.711  186.551 1.00 73.84  ? 44  PHE A CE1   1 
ATOM   1393 C CE2   . PHE I 3 43  ? 2.842   17.434  188.831 1.00 72.08  ? 44  PHE A CE2   1 
ATOM   1394 C CZ    . PHE I 3 43  ? 2.106   16.834  187.827 1.00 71.73  ? 44  PHE A CZ    1 
ATOM   1395 N N     . LEU I 3 44  ? 5.266   21.053  187.842 1.00 40.75  ? 45  LEU A N     1 
ATOM   1396 C CA    . LEU I 3 44  ? 4.395   22.040  188.485 1.00 44.71  ? 45  LEU A CA    1 
ATOM   1397 C C     . LEU I 3 44  ? 4.150   23.252  187.584 1.00 47.85  ? 45  LEU A C     1 
ATOM   1398 O O     . LEU I 3 44  ? 3.028   23.730  187.477 1.00 49.53  ? 45  LEU A O     1 
ATOM   1399 C CB    . LEU I 3 44  ? 5.010   22.550  189.792 1.00 29.61  ? 45  LEU A CB    1 
ATOM   1400 C CG    . LEU I 3 44  ? 4.859   21.766  191.076 1.00 35.70  ? 45  LEU A CG    1 
ATOM   1401 C CD1   . LEU I 3 44  ? 4.588   20.334  190.703 1.00 56.84  ? 45  LEU A CD1   1 
ATOM   1402 C CD2   . LEU I 3 44  ? 6.133   21.898  191.960 1.00 12.16  ? 45  LEU A CD2   1 
ATOM   1403 N N     . LYS I 3 45  ? 5.200   23.756  186.947 1.00 47.54  ? 46  LYS A N     1 
ATOM   1404 C CA    . LYS I 3 45  ? 5.056   24.926  186.094 1.00 58.10  ? 46  LYS A CA    1 
ATOM   1405 C C     . LYS I 3 45  ? 4.036   24.681  184.966 1.00 62.31  ? 46  LYS A C     1 
ATOM   1406 O O     . LYS I 3 45  ? 3.443   25.622  184.438 1.00 58.00  ? 46  LYS A O     1 
ATOM   1407 C CB    . LYS I 3 45  ? 6.427   25.325  185.513 1.00 58.63  ? 46  LYS A CB    1 
ATOM   1408 C CG    . LYS I 3 45  ? 6.642   26.836  185.317 1.00 47.86  ? 46  LYS A CG    1 
ATOM   1409 C CD    . LYS I 3 45  ? 6.619   27.584  186.649 1.00 59.07  ? 46  LYS A CD    1 
ATOM   1410 C CE    . LYS I 3 45  ? 6.709   29.098  186.474 1.00 64.02  ? 46  LYS A CE    1 
ATOM   1411 N NZ    . LYS I 3 45  ? 5.560   29.635  185.691 1.00 75.88  ? 46  LYS A NZ    1 
ATOM   1412 N N     . GLU I 3 46  ? 3.825   23.412  184.617 1.00 67.08  ? 47  GLU A N     1 
ATOM   1413 C CA    . GLU I 3 46  ? 2.885   23.029  183.568 1.00 63.07  ? 47  GLU A CA    1 
ATOM   1414 C C     . GLU I 3 46  ? 1.507   22.818  184.173 1.00 60.87  ? 47  GLU A C     1 
ATOM   1415 O O     . GLU I 3 46  ? 0.480   23.183  183.599 1.00 61.91  ? 47  GLU A O     1 
ATOM   1416 C CB    . GLU I 3 46  ? 3.340   21.738  182.903 1.00 70.99  ? 47  GLU A CB    1 
ATOM   1417 C CG    . GLU I 3 46  ? 2.840   21.579  181.480 1.00 88.42  ? 47  GLU A CG    1 
ATOM   1418 C CD    . GLU I 3 46  ? 3.096   22.823  180.640 1.00 92.07  ? 47  GLU A CD    1 
ATOM   1419 O OE1   . GLU I 3 46  ? 2.295   23.781  180.737 1.00 87.85  ? 47  GLU A OE1   1 
ATOM   1420 O OE2   . GLU I 3 46  ? 4.103   22.848  179.894 1.00 96.90  ? 47  GLU A OE2   1 
ATOM   1421 N N     . ASN I 3 47  ? 1.499   22.212  185.347 1.00 56.55  ? 48  ASN A N     1 
ATOM   1422 C CA    . ASN I 3 47  ? 0.269   21.958  186.055 1.00 53.19  ? 48  ASN A CA    1 
ATOM   1423 C C     . ASN I 3 47  ? -0.153  23.195  186.789 1.00 44.40  ? 48  ASN A C     1 
ATOM   1424 O O     . ASN I 3 47  ? -1.087  23.853  186.379 1.00 54.24  ? 48  ASN A O     1 
ATOM   1425 C CB    . ASN I 3 47  ? 0.481   20.790  186.995 1.00 61.55  ? 48  ASN A CB    1 
ATOM   1426 C CG    . ASN I 3 47  ? 0.680   19.508  186.237 1.00 72.56  ? 48  ASN A CG    1 
ATOM   1427 O OD1   . ASN I 3 47  ? 1.397   19.478  185.225 1.00 68.54  ? 48  ASN A OD1   1 
ATOM   1428 N ND2   . ASN I 3 47  ? 0.036   18.441  186.700 1.00 79.40  ? 48  ASN A ND2   1 
ATOM   1429 N N     . LEU I 3 48  ? 0.533   23.527  187.867 1.00 36.55  ? 49  LEU A N     1 
ATOM   1430 C CA    . LEU I 3 48  ? 0.199   24.739  188.601 1.00 35.99  ? 49  LEU A CA    1 
ATOM   1431 C C     . LEU I 3 48  ? 0.847   25.990  187.937 1.00 34.81  ? 49  LEU A C     1 
ATOM   1432 O O     . LEU I 3 48  ? 1.409   26.841  188.607 1.00 36.27  ? 49  LEU A O     1 
ATOM   1433 C CB    . LEU I 3 48  ? 0.661   24.566  190.054 1.00 25.78  ? 49  LEU A CB    1 
ATOM   1434 C CG    . LEU I 3 48  ? 0.033   23.328  190.691 1.00 22.18  ? 49  LEU A CG    1 
ATOM   1435 C CD1   . LEU I 3 48  ? 0.408   23.197  192.142 1.00 20.08  ? 49  LEU A CD1   1 
ATOM   1436 C CD2   . LEU I 3 48  ? -1.456  23.413  190.566 1.00 10.26  ? 49  LEU A CD2   1 
ATOM   1437 N N     . SER I 3 49  ? 0.733   26.097  186.618 1.00 33.94  ? 50  SER A N     1 
ATOM   1438 C CA    . SER I 3 49  ? 1.339   27.189  185.863 1.00 46.78  ? 50  SER A CA    1 
ATOM   1439 C C     . SER I 3 49  ? 1.313   28.599  186.462 1.00 54.22  ? 50  SER A C     1 
ATOM   1440 O O     . SER I 3 49  ? 2.252   29.378  186.258 1.00 60.27  ? 50  SER A O     1 
ATOM   1441 C CB    . SER I 3 49  ? 0.750   27.243  184.444 1.00 43.71  ? 50  SER A CB    1 
ATOM   1442 N N     . ASP I 3 50  ? 0.271   28.939  187.210 1.00 52.61  ? 51  ASP A N     1 
ATOM   1443 C CA    . ASP I 3 50  ? 0.180   30.287  187.758 1.00 53.87  ? 51  ASP A CA    1 
ATOM   1444 C C     . ASP I 3 50  ? 0.551   30.444  189.216 1.00 46.81  ? 51  ASP A C     1 
ATOM   1445 O O     . ASP I 3 50  ? 0.592   31.554  189.739 1.00 48.04  ? 51  ASP A O     1 
ATOM   1446 C CB    . ASP I 3 50  ? -1.234  30.834  187.545 1.00 67.92  ? 51  ASP A CB    1 
ATOM   1447 C CG    . ASP I 3 50  ? -1.661  30.820  186.087 1.00 71.42  ? 51  ASP A CG    1 
ATOM   1448 O OD1   . ASP I 3 50  ? -2.448  31.713  185.708 1.00 63.84  ? 51  ASP A OD1   1 
ATOM   1449 O OD2   . ASP I 3 50  ? -1.225  29.920  185.331 1.00 75.59  ? 51  ASP A OD2   1 
ATOM   1450 N N     . LEU I 3 51  ? 0.809   29.331  189.878 1.00 51.40  ? 52  LEU A N     1 
ATOM   1451 C CA    . LEU I 3 51  ? 1.161   29.354  191.292 1.00 54.33  ? 52  LEU A CA    1 
ATOM   1452 C C     . LEU I 3 51  ? 2.639   29.062  191.522 1.00 55.44  ? 52  LEU A C     1 
ATOM   1453 O O     . LEU I 3 51  ? 3.194   29.409  192.569 1.00 54.81  ? 52  LEU A O     1 
ATOM   1454 C CB    . LEU I 3 51  ? 0.339   28.311  192.047 1.00 53.00  ? 52  LEU A CB    1 
ATOM   1455 C CG    . LEU I 3 51  ? -1.168  28.501  192.040 1.00 51.31  ? 52  LEU A CG    1 
ATOM   1456 C CD1   . LEU I 3 51  ? -1.720  28.298  190.642 1.00 49.22  ? 52  LEU A CD1   1 
ATOM   1457 C CD2   . LEU I 3 51  ? -1.782  27.519  193.009 1.00 55.73  ? 52  LEU A CD2   1 
ATOM   1458 N N     . THR I 3 52  ? 3.250   28.422  190.526 1.00 51.79  ? 53  THR A N     1 
ATOM   1459 C CA    . THR I 3 52  ? 4.638   28.001  190.572 1.00 44.57  ? 53  THR A CA    1 
ATOM   1460 C C     . THR I 3 52  ? 5.681   29.075  190.272 1.00 39.88  ? 53  THR A C     1 
ATOM   1461 O O     . THR I 3 52  ? 5.652   29.763  189.249 1.00 36.63  ? 53  THR A O     1 
ATOM   1462 C CB    . THR I 3 52  ? 4.855   26.794  189.647 1.00 39.56  ? 53  THR A CB    1 
ATOM   1463 O OG1   . THR I 3 52  ? 3.762   25.898  189.810 1.00 60.23  ? 53  THR A OG1   1 
ATOM   1464 C CG2   . THR I 3 52  ? 6.114   26.044  190.022 1.00 42.82  ? 53  THR A CG2   1 
ATOM   1465 N N     . PHE I 3 53  ? 6.623   29.179  191.196 1.00 37.88  ? 54  PHE A N     1 
ATOM   1466 C CA    . PHE I 3 53  ? 7.685   30.144  191.117 1.00 42.11  ? 54  PHE A CA    1 
ATOM   1467 C C     . PHE I 3 53  ? 8.924   29.571  191.739 1.00 41.28  ? 54  PHE A C     1 
ATOM   1468 O O     . PHE I 3 53  ? 8.887   28.592  192.469 1.00 40.98  ? 54  PHE A O     1 
ATOM   1469 C CB    . PHE I 3 53  ? 7.296   31.408  191.893 1.00 45.59  ? 54  PHE A CB    1 
ATOM   1470 C CG    . PHE I 3 53  ? 6.247   32.227  191.221 1.00 46.73  ? 54  PHE A CG    1 
ATOM   1471 C CD1   . PHE I 3 53  ? 6.598   33.101  190.211 1.00 48.37  ? 54  PHE A CD1   1 
ATOM   1472 C CD2   . PHE I 3 53  ? 4.899   32.068  191.545 1.00 41.26  ? 54  PHE A CD2   1 
ATOM   1473 C CE1   . PHE I 3 53  ? 5.626   33.806  189.519 1.00 66.27  ? 54  PHE A CE1   1 
ATOM   1474 C CE2   . PHE I 3 53  ? 3.919   32.764  190.863 1.00 46.04  ? 54  PHE A CE2   1 
ATOM   1475 C CZ    . PHE I 3 53  ? 4.276   33.635  189.845 1.00 60.42  ? 54  PHE A CZ    1 
ATOM   1476 N N     . LYS I 3 54  ? 10.038  30.196  191.439 1.00 39.41  ? 55  LYS A N     1 
ATOM   1477 C CA    . LYS I 3 54  ? 11.264  29.769  192.036 1.00 33.39  ? 55  LYS A CA    1 
ATOM   1478 C C     . LYS I 3 54  ? 11.686  31.005  192.832 1.00 31.35  ? 55  LYS A C     1 
ATOM   1479 O O     . LYS I 3 54  ? 11.825  32.087  192.275 1.00 26.84  ? 55  LYS A O     1 
ATOM   1480 C CB    . LYS I 3 54  ? 12.267  29.429  190.951 1.00 35.37  ? 55  LYS A CB    1 
ATOM   1481 C CG    . LYS I 3 54  ? 12.888  28.055  191.101 1.00 43.02  ? 55  LYS A CG    1 
ATOM   1482 C CD    . LYS I 3 54  ? 13.875  27.801  189.974 1.00 62.39  ? 55  LYS A CD    1 
ATOM   1483 C CE    . LYS I 3 54  ? 14.600  26.464  190.112 1.00 73.49  ? 55  LYS A CE    1 
ATOM   1484 N NZ    . LYS I 3 54  ? 13.734  25.288  189.803 1.00 82.72  ? 55  LYS A NZ    1 
ATOM   1485 N N     . GLN I 3 55  ? 11.844  30.846  194.139 1.00 22.70  ? 56  GLN A N     1 
ATOM   1486 C CA    . GLN I 3 55  ? 12.227  31.945  194.991 1.00 20.16  ? 56  GLN A CA    1 
ATOM   1487 C C     . GLN I 3 55  ? 12.646  33.206  194.231 1.00 30.01  ? 56  GLN A C     1 
ATOM   1488 O O     . GLN I 3 55  ? 11.888  34.175  194.165 1.00 30.47  ? 56  GLN A O     1 
ATOM   1489 C CB    . GLN I 3 55  ? 13.345  31.508  195.916 1.00 15.28  ? 56  GLN A CB    1 
ATOM   1490 C CG    . GLN I 3 55  ? 13.925  32.632  196.737 1.00 21.40  ? 56  GLN A CG    1 
ATOM   1491 C CD    . GLN I 3 55  ? 13.829  32.370  198.202 1.00 22.90  ? 56  GLN A CD    1 
ATOM   1492 O OE1   . GLN I 3 55  ? 12.873  31.770  198.655 1.00 26.36  ? 56  GLN A OE1   1 
ATOM   1493 N NE2   . GLN I 3 55  ? 14.805  32.845  198.962 1.00 33.42  ? 56  GLN A NE2   1 
ATOM   1494 N N     . TYR I 3 56  ? 13.835  33.188  193.629 1.00 35.10  ? 57  TYR A N     1 
ATOM   1495 C CA    . TYR I 3 56  ? 14.323  34.365  192.927 1.00 33.39  ? 57  TYR A CA    1 
ATOM   1496 C C     . TYR I 3 56  ? 13.413  34.762  191.808 1.00 38.65  ? 57  TYR A C     1 
ATOM   1497 O O     . TYR I 3 56  ? 13.030  35.923  191.702 1.00 51.71  ? 57  TYR A O     1 
ATOM   1498 C CB    . TYR I 3 56  ? 15.737  34.160  192.382 1.00 37.47  ? 57  TYR A CB    1 
ATOM   1499 C CG    . TYR I 3 56  ? 15.798  33.465  191.051 1.00 26.80  ? 57  TYR A CG    1 
ATOM   1500 C CD1   . TYR I 3 56  ? 15.674  32.100  190.971 1.00 28.08  ? 57  TYR A CD1   1 
ATOM   1501 C CD2   . TYR I 3 56  ? 15.950  34.182  189.871 1.00 34.36  ? 57  TYR A CD2   1 
ATOM   1502 C CE1   . TYR I 3 56  ? 15.699  31.448  189.762 1.00 32.71  ? 57  TYR A CE1   1 
ATOM   1503 C CE2   . TYR I 3 56  ? 15.971  33.538  188.649 1.00 34.71  ? 57  TYR A CE2   1 
ATOM   1504 C CZ    . TYR I 3 56  ? 15.844  32.156  188.611 1.00 37.05  ? 57  TYR A CZ    1 
ATOM   1505 O OH    . TYR I 3 56  ? 15.865  31.461  187.424 1.00 53.18  ? 57  TYR A OH    1 
ATOM   1506 N N     . GLU I 3 57  ? 13.078  33.807  190.957 1.00 43.01  ? 58  GLU A N     1 
ATOM   1507 C CA    . GLU I 3 57  ? 12.170  34.056  189.841 1.00 52.36  ? 58  GLU A CA    1 
ATOM   1508 C C     . GLU I 3 57  ? 10.948  34.827  190.396 1.00 57.64  ? 58  GLU A C     1 
ATOM   1509 O O     . GLU I 3 57  ? 10.464  35.783  189.788 1.00 52.43  ? 58  GLU A O     1 
ATOM   1510 C CB    . GLU I 3 57  ? 11.757  32.707  189.277 1.00 49.12  ? 58  GLU A CB    1 
ATOM   1511 C CG    . GLU I 3 57  ? 10.877  32.723  188.083 1.00 65.08  ? 58  GLU A CG    1 
ATOM   1512 C CD    . GLU I 3 57  ? 10.401  31.320  187.769 1.00 74.71  ? 58  GLU A CD    1 
ATOM   1513 O OE1   . GLU I 3 57  ? 11.266  30.427  187.648 1.00 77.43  ? 58  GLU A OE1   1 
ATOM   1514 O OE2   . GLU I 3 57  ? 9.172   31.104  187.658 1.00 79.44  ? 58  GLU A OE2   1 
ATOM   1515 N N     . TYR I 3 58  ? 10.476  34.416  191.572 1.00 60.83  ? 59  TYR A N     1 
ATOM   1516 C CA    . TYR I 3 58  ? 9.341   35.065  192.215 1.00 61.71  ? 59  TYR A CA    1 
ATOM   1517 C C     . TYR I 3 58  ? 9.659   36.520  192.544 1.00 60.59  ? 59  TYR A C     1 
ATOM   1518 O O     . TYR I 3 58  ? 8.907   37.431  192.196 1.00 65.73  ? 59  TYR A O     1 
ATOM   1519 C CB    . TYR I 3 58  ? 8.964   34.319  193.492 1.00 62.50  ? 59  TYR A CB    1 
ATOM   1520 C CG    . TYR I 3 58  ? 8.119   35.142  194.428 1.00 65.96  ? 59  TYR A CG    1 
ATOM   1521 C CD1   . TYR I 3 58  ? 6.800   35.447  194.126 1.00 65.06  ? 59  TYR A CD1   1 
ATOM   1522 C CD2   . TYR I 3 58  ? 8.666   35.658  195.603 1.00 71.13  ? 59  TYR A CD2   1 
ATOM   1523 C CE1   . TYR I 3 58  ? 6.046   36.255  194.975 1.00 77.27  ? 59  TYR A CE1   1 
ATOM   1524 C CE2   . TYR I 3 58  ? 7.933   36.457  196.458 1.00 70.83  ? 59  TYR A CE2   1 
ATOM   1525 C CZ    . TYR I 3 58  ? 6.626   36.757  196.142 1.00 78.82  ? 59  TYR A CZ    1 
ATOM   1526 O OH    . TYR I 3 58  ? 5.910   37.572  196.992 1.00 82.66  ? 59  TYR A OH    1 
ATOM   1527 N N     . LEU I 3 59  ? 10.772  36.730  193.235 1.00 57.17  ? 60  LEU A N     1 
ATOM   1528 C CA    . LEU I 3 59  ? 11.210  38.071  193.609 1.00 51.82  ? 60  LEU A CA    1 
ATOM   1529 C C     . LEU I 3 59  ? 11.229  38.982  192.393 1.00 56.66  ? 60  LEU A C     1 
ATOM   1530 O O     . LEU I 3 59  ? 10.655  40.072  192.417 1.00 55.97  ? 60  LEU A O     1 
ATOM   1531 C CB    . LEU I 3 59  ? 12.610  38.014  194.213 1.00 37.45  ? 60  LEU A CB    1 
ATOM   1532 C CG    . LEU I 3 59  ? 12.632  37.452  195.622 1.00 33.75  ? 60  LEU A CG    1 
ATOM   1533 C CD1   . LEU I 3 59  ? 14.031  37.151  196.058 1.00 27.72  ? 60  LEU A CD1   1 
ATOM   1534 C CD2   . LEU I 3 59  ? 11.977  38.443  196.533 1.00 24.96  ? 60  LEU A CD2   1 
ATOM   1535 N N     . ASN I 3 60  ? 11.888  38.532  191.330 1.00 55.18  ? 61  ASN A N     1 
ATOM   1536 C CA    . ASN I 3 60  ? 11.976  39.333  190.120 1.00 58.16  ? 61  ASN A CA    1 
ATOM   1537 C C     . ASN I 3 60  ? 10.625  39.767  189.581 1.00 61.41  ? 61  ASN A C     1 
ATOM   1538 O O     . ASN I 3 60  ? 10.522  40.768  188.863 1.00 58.63  ? 61  ASN A O     1 
ATOM   1539 C CB    . ASN I 3 60  ? 12.732  38.590  189.030 1.00 47.38  ? 61  ASN A CB    1 
ATOM   1540 C CG    . ASN I 3 60  ? 14.204  38.552  189.286 1.00 56.07  ? 61  ASN A CG    1 
ATOM   1541 O OD1   . ASN I 3 60  ? 14.817  39.562  189.650 1.00 43.55  ? 61  ASN A OD1   1 
ATOM   1542 N ND2   . ASN I 3 60  ? 14.798  37.381  189.092 1.00 68.55  ? 61  ASN A ND2   1 
ATOM   1543 N N     . ASP I 3 61  ? 9.591   39.004  189.911 1.00 60.47  ? 62  ASP A N     1 
ATOM   1544 C CA    . ASP I 3 61  ? 8.252   39.339  189.462 1.00 64.71  ? 62  ASP A CA    1 
ATOM   1545 C C     . ASP I 3 61  ? 7.696   40.389  190.428 1.00 62.47  ? 62  ASP A C     1 
ATOM   1546 O O     . ASP I 3 61  ? 7.238   41.454  190.007 1.00 65.23  ? 62  ASP A O     1 
ATOM   1547 C CB    . ASP I 3 61  ? 7.379   38.084  189.439 1.00 71.85  ? 62  ASP A CB    1 
ATOM   1548 C CG    . ASP I 3 61  ? 7.126   37.574  188.027 1.00 80.05  ? 62  ASP A CG    1 
ATOM   1549 O OD1   . ASP I 3 61  ? 8.055   37.614  187.175 1.00 71.95  ? 62  ASP A OD1   1 
ATOM   1550 O OD2   . ASP I 3 61  ? 5.988   37.117  187.778 1.00 88.55  ? 62  ASP A OD2   1 
ATOM   1551 N N     . LEU I 3 62  ? 7.764   40.097  191.723 1.00 51.39  ? 63  LEU A N     1 
ATOM   1552 C CA    . LEU I 3 62  ? 7.287   41.026  192.728 1.00 39.92  ? 63  LEU A CA    1 
ATOM   1553 C C     . LEU I 3 62  ? 7.792   42.425  192.395 1.00 41.75  ? 63  LEU A C     1 
ATOM   1554 O O     . LEU I 3 62  ? 7.043   43.388  192.433 1.00 49.69  ? 63  LEU A O     1 
ATOM   1555 C CB    . LEU I 3 62  ? 7.808   40.616  194.098 1.00 32.44  ? 63  LEU A CB    1 
ATOM   1556 C CG    . LEU I 3 62  ? 7.315   41.439  195.287 1.00 28.01  ? 63  LEU A CG    1 
ATOM   1557 C CD1   . LEU I 3 62  ? 5.826   41.199  195.461 1.00 40.52  ? 63  LEU A CD1   1 
ATOM   1558 C CD2   . LEU I 3 62  ? 8.051   41.034  196.555 1.00 20.83  ? 63  LEU A CD2   1 
ATOM   1559 N N     . PHE I 3 63  ? 9.069   42.541  192.054 1.00 42.59  ? 64  PHE A N     1 
ATOM   1560 C CA    . PHE I 3 63  ? 9.628   43.847  191.744 1.00 41.41  ? 64  PHE A CA    1 
ATOM   1561 C C     . PHE I 3 63  ? 9.234   44.378  190.388 1.00 46.99  ? 64  PHE A C     1 
ATOM   1562 O O     . PHE I 3 63  ? 8.789   45.511  190.273 1.00 50.66  ? 64  PHE A O     1 
ATOM   1563 C CB    . PHE I 3 63  ? 11.143  43.817  191.876 1.00 35.45  ? 64  PHE A CB    1 
ATOM   1564 C CG    . PHE I 3 63  ? 11.625  43.783  193.310 1.00 35.26  ? 64  PHE A CG    1 
ATOM   1565 C CD1   . PHE I 3 63  ? 10.735  43.544  194.364 1.00 32.67  ? 64  PHE A CD1   1 
ATOM   1566 C CD2   . PHE I 3 63  ? 12.972  43.961  193.608 1.00 27.40  ? 64  PHE A CD2   1 
ATOM   1567 C CE1   . PHE I 3 63  ? 11.176  43.486  195.697 1.00 21.35  ? 64  PHE A CE1   1 
ATOM   1568 C CE2   . PHE I 3 63  ? 13.409  43.904  194.922 1.00 30.26  ? 64  PHE A CE2   1 
ATOM   1569 C CZ    . PHE I 3 63  ? 12.501  43.663  195.969 1.00 19.22  ? 64  PHE A CZ    1 
ATOM   1570 N N     . MET I 3 64  ? 9.398   43.564  189.355 1.00 58.17  ? 65  MET A N     1 
ATOM   1571 C CA    . MET I 3 64  ? 9.049   43.957  187.985 1.00 60.95  ? 65  MET A CA    1 
ATOM   1572 C C     . MET I 3 64  ? 7.584   44.416  187.913 1.00 58.99  ? 65  MET A C     1 
ATOM   1573 O O     . MET I 3 64  ? 7.256   45.368  187.209 1.00 61.18  ? 65  MET A O     1 
ATOM   1574 C CB    . MET I 3 64  ? 9.318   42.760  187.056 1.00 67.60  ? 65  MET A CB    1 
ATOM   1575 C CG    . MET I 3 64  ? 9.101   42.961  185.550 1.00 69.15  ? 65  MET A CG    1 
ATOM   1576 S SD    . MET I 3 64  ? 9.721   41.486  184.591 1.00 69.34  ? 65  MET A SD    1 
ATOM   1577 C CE    . MET I 3 64  ? 8.589   40.137  185.115 1.00 52.69  ? 65  MET A CE    1 
ATOM   1578 N N     . LYS I 3 65  ? 6.721   43.755  188.675 1.00 48.83  ? 66  LYS A N     1 
ATOM   1579 C CA    . LYS I 3 65  ? 5.301   44.071  188.709 1.00 47.46  ? 66  LYS A CA    1 
ATOM   1580 C C     . LYS I 3 65  ? 5.029   45.430  189.377 1.00 61.17  ? 66  LYS A C     1 
ATOM   1581 O O     . LYS I 3 65  ? 3.916   45.963  189.288 1.00 59.12  ? 66  LYS A O     1 
ATOM   1582 C CB    . LYS I 3 65  ? 4.585   42.963  189.464 1.00 49.72  ? 66  LYS A CB    1 
ATOM   1583 C CG    . LYS I 3 65  ? 3.102   42.831  189.214 1.00 66.05  ? 66  LYS A CG    1 
ATOM   1584 C CD    . LYS I 3 65  ? 2.566   41.456  189.707 1.00 66.83  ? 66  LYS A CD    1 
ATOM   1585 C CE    . LYS I 3 65  ? 2.698   41.264  191.221 1.00 59.40  ? 66  LYS A CE    1 
ATOM   1586 N NZ    . LYS I 3 65  ? 2.257   39.899  191.612 1.00 51.99  ? 66  LYS A NZ    1 
ATOM   1587 N N     . ASN I 3 66  ? 6.043   45.976  190.055 1.00 63.33  ? 67  ASN A N     1 
ATOM   1588 C CA    . ASN I 3 66  ? 5.950   47.274  190.739 1.00 58.62  ? 67  ASN A CA    1 
ATOM   1589 C C     . ASN I 3 66  ? 7.088   48.118  190.246 1.00 60.60  ? 67  ASN A C     1 
ATOM   1590 O O     . ASN I 3 66  ? 7.963   48.500  191.028 1.00 68.40  ? 67  ASN A O     1 
ATOM   1591 C CB    . ASN I 3 66  ? 6.132   47.134  192.246 1.00 55.69  ? 67  ASN A CB    1 
ATOM   1592 C CG    . ASN I 3 66  ? 5.014   46.394  192.898 1.00 57.91  ? 67  ASN A CG    1 
ATOM   1593 O OD1   . ASN I 3 66  ? 3.880   46.854  192.919 1.00 53.26  ? 67  ASN A OD1   1 
ATOM   1594 N ND2   . ASN I 3 66  ? 5.325   45.233  193.444 1.00 56.84  ? 67  ASN A ND2   1 
ATOM   1595 N N     . PRO I 3 67  ? 7.096   48.433  188.952 1.00 61.64  ? 68  PRO A N     1 
ATOM   1596 C CA    . PRO I 3 67  ? 8.137   49.240  188.309 1.00 64.95  ? 68  PRO A CA    1 
ATOM   1597 C C     . PRO I 3 67  ? 8.395   50.620  188.928 1.00 66.43  ? 68  PRO A C     1 
ATOM   1598 O O     . PRO I 3 67  ? 9.532   51.088  188.983 1.00 64.20  ? 68  PRO A O     1 
ATOM   1599 C CB    . PRO I 3 67  ? 7.659   49.323  186.863 1.00 57.97  ? 68  PRO A CB    1 
ATOM   1600 C CG    . PRO I 3 67  ? 6.171   49.317  187.022 1.00 63.13  ? 68  PRO A CG    1 
ATOM   1601 C CD    . PRO I 3 67  ? 5.950   48.245  188.055 1.00 59.49  ? 68  PRO A CD    1 
ATOM   1602 N N     . ALA I 3 68  ? 7.350   51.270  189.416 1.00 71.00  ? 69  ALA A N     1 
ATOM   1603 C CA    . ALA I 3 68  ? 7.533   52.589  190.001 1.00 72.19  ? 69  ALA A CA    1 
ATOM   1604 C C     . ALA I 3 68  ? 8.218   52.572  191.374 1.00 71.47  ? 69  ALA A C     1 
ATOM   1605 O O     . ALA I 3 68  ? 8.572   53.627  191.909 1.00 77.11  ? 69  ALA A O     1 
ATOM   1606 C CB    . ALA I 3 68  ? 6.184   53.312  190.092 1.00 76.69  ? 69  ALA A CB    1 
ATOM   1607 N N     . ILE I 3 69  ? 8.424   51.391  191.943 1.00 59.53  ? 70  ILE A N     1 
ATOM   1608 C CA    . ILE I 3 69  ? 9.046   51.317  193.255 1.00 53.30  ? 70  ILE A CA    1 
ATOM   1609 C C     . ILE I 3 69  ? 10.548  51.112  193.222 1.00 57.64  ? 70  ILE A C     1 
ATOM   1610 O O     . ILE I 3 69  ? 11.037  50.057  192.813 1.00 63.29  ? 70  ILE A O     1 
ATOM   1611 C CB    . ILE I 3 69  ? 8.407   50.220  194.079 1.00 46.93  ? 70  ILE A CB    1 
ATOM   1612 C CG1   . ILE I 3 69  ? 6.898   50.397  194.029 1.00 56.04  ? 70  ILE A CG1   1 
ATOM   1613 C CG2   . ILE I 3 69  ? 8.888   50.296  195.533 1.00 39.65  ? 70  ILE A CG2   1 
ATOM   1614 C CD1   . ILE I 3 69  ? 6.431   51.761  194.534 1.00 51.29  ? 70  ILE A CD1   1 
ATOM   1615 N N     . ILE I 3 70  ? 11.276  52.132  193.664 1.00 53.78  ? 71  ILE A N     1 
ATOM   1616 C CA    . ILE I 3 70  ? 12.728  52.084  193.684 1.00 51.96  ? 71  ILE A CA    1 
ATOM   1617 C C     . ILE I 3 70  ? 13.231  52.274  195.100 1.00 56.19  ? 71  ILE A C     1 
ATOM   1618 O O     . ILE I 3 70  ? 12.519  52.802  195.954 1.00 55.90  ? 71  ILE A O     1 
ATOM   1619 C CB    . ILE I 3 70  ? 13.320  53.180  192.806 1.00 47.91  ? 71  ILE A CB    1 
ATOM   1620 C CG1   . ILE I 3 70  ? 12.958  54.559  193.363 1.00 50.84  ? 71  ILE A CG1   1 
ATOM   1621 C CG2   . ILE I 3 70  ? 12.806  53.035  191.411 1.00 49.52  ? 71  ILE A CG2   1 
ATOM   1622 C CD1   . ILE I 3 70  ? 13.907  55.089  194.463 1.00 53.82  ? 71  ILE A CD1   1 
ATOM   1623 N N     . GLY I 3 71  ? 14.467  51.857  195.346 1.00 57.53  ? 72  GLY A N     1 
ATOM   1624 C CA    . GLY I 3 71  ? 15.022  52.000  196.674 1.00 60.16  ? 72  GLY A CA    1 
ATOM   1625 C C     . GLY I 3 71  ? 14.625  50.810  197.520 1.00 61.83  ? 72  GLY A C     1 
ATOM   1626 O O     . GLY I 3 71  ? 13.469  50.374  197.522 1.00 57.59  ? 72  GLY A O     1 
ATOM   1627 N N     . HIS I 3 72  ? 15.584  50.275  198.253 1.00 57.61  ? 73  HIS A N     1 
ATOM   1628 C CA    . HIS I 3 72  ? 15.295  49.121  199.056 1.00 62.37  ? 73  HIS A CA    1 
ATOM   1629 C C     . HIS I 3 72  ? 14.171  49.403  200.037 1.00 66.63  ? 73  HIS A C     1 
ATOM   1630 O O     . HIS I 3 72  ? 13.282  48.570  200.221 1.00 78.10  ? 73  HIS A O     1 
ATOM   1631 C CB    . HIS I 3 72  ? 16.554  48.665  199.787 1.00 65.18  ? 73  HIS A CB    1 
ATOM   1632 C CG    . HIS I 3 72  ? 17.096  49.671  200.749 1.00 61.84  ? 73  HIS A CG    1 
ATOM   1633 N ND1   . HIS I 3 72  ? 17.378  50.968  200.385 1.00 58.32  ? 73  HIS A ND1   1 
ATOM   1634 C CD2   . HIS I 3 72  ? 17.406  49.570  202.062 1.00 60.06  ? 73  HIS A CD2   1 
ATOM   1635 C CE1   . HIS I 3 72  ? 17.836  51.624  201.434 1.00 57.30  ? 73  HIS A CE1   1 
ATOM   1636 N NE2   . HIS I 3 72  ? 17.863  50.800  202.464 1.00 51.45  ? 73  HIS A NE2   1 
ATOM   1637 N N     . GLU I 3 73  ? 14.189  50.586  200.644 1.00 62.49  ? 74  GLU A N     1 
ATOM   1638 C CA    . GLU I 3 73  ? 13.177  50.964  201.630 1.00 53.34  ? 74  GLU A CA    1 
ATOM   1639 C C     . GLU I 3 73  ? 11.757  50.612  201.203 1.00 50.40  ? 74  GLU A C     1 
ATOM   1640 O O     . GLU I 3 73  ? 11.051  49.890  201.906 1.00 40.04  ? 74  GLU A O     1 
ATOM   1641 C CB    . GLU I 3 73  ? 13.261  52.462  201.901 1.00 75.66  ? 74  GLU A CB    1 
ATOM   1642 C CG    . GLU I 3 73  ? 12.573  52.894  203.186 1.00 85.50  ? 74  GLU A CG    1 
ATOM   1643 C CD    . GLU I 3 73  ? 13.399  52.567  204.419 1.00 87.39  ? 74  GLU A CD    1 
ATOM   1644 O OE1   . GLU I 3 73  ? 13.829  51.404  204.563 1.00 90.15  ? 74  GLU A OE1   1 
ATOM   1645 O OE2   . GLU I 3 73  ? 13.615  53.475  205.243 1.00 86.43  ? 74  GLU A OE2   1 
ATOM   1646 N N     . ALA I 3 74  ? 11.341  51.135  200.052 1.00 52.80  ? 75  ALA A N     1 
ATOM   1647 C CA    . ALA I 3 74  ? 9.997   50.889  199.529 1.00 53.17  ? 75  ALA A CA    1 
ATOM   1648 C C     . ALA I 3 74  ? 9.838   49.474  199.018 1.00 54.21  ? 75  ALA A C     1 
ATOM   1649 O O     . ALA I 3 74  ? 8.797   48.852  199.211 1.00 64.00  ? 75  ALA A O     1 
ATOM   1650 C CB    . ALA I 3 74  ? 9.676   51.863  198.414 1.00 48.22  ? 75  ALA A CB    1 
ATOM   1651 N N     . ARG I 3 75  ? 10.861  48.954  198.355 1.00 52.58  ? 76  ARG A N     1 
ATOM   1652 C CA    . ARG I 3 75  ? 10.754  47.603  197.839 1.00 47.36  ? 76  ARG A CA    1 
ATOM   1653 C C     . ARG I 3 75  ? 10.488  46.601  198.947 1.00 45.05  ? 76  ARG A C     1 
ATOM   1654 O O     . ARG I 3 75  ? 9.701   45.685  198.754 1.00 49.52  ? 76  ARG A O     1 
ATOM   1655 C CB    . ARG I 3 75  ? 11.984  47.252  197.002 1.00 43.42  ? 76  ARG A CB    1 
ATOM   1656 C CG    . ARG I 3 75  ? 11.898  47.886  195.604 1.00 35.75  ? 76  ARG A CG    1 
ATOM   1657 C CD    . ARG I 3 75  ? 13.199  47.818  194.860 1.00 32.66  ? 76  ARG A CD    1 
ATOM   1658 N NE    . ARG I 3 75  ? 13.120  48.429  193.538 1.00 44.60  ? 76  ARG A NE    1 
ATOM   1659 C CZ    . ARG I 3 75  ? 14.148  48.507  192.693 1.00 58.58  ? 76  ARG A CZ    1 
ATOM   1660 N NH1   . ARG I 3 75  ? 15.327  48.012  193.038 1.00 66.98  ? 76  ARG A NH1   1 
ATOM   1661 N NH2   . ARG I 3 75  ? 14.012  49.083  191.503 1.00 61.33  ? 76  ARG A NH2   1 
ATOM   1662 N N     . TYR I 3 76  ? 11.103  46.786  200.111 1.00 44.39  ? 77  TYR A N     1 
ATOM   1663 C CA    . TYR I 3 76  ? 10.858  45.880  201.236 1.00 50.66  ? 77  TYR A CA    1 
ATOM   1664 C C     . TYR I 3 76  ? 9.427   45.997  201.718 1.00 56.98  ? 77  TYR A C     1 
ATOM   1665 O O     . TYR I 3 76  ? 8.971   45.206  202.552 1.00 58.56  ? 77  TYR A O     1 
ATOM   1666 C CB    . TYR I 3 76  ? 11.791  46.163  202.417 1.00 46.18  ? 77  TYR A CB    1 
ATOM   1667 C CG    . TYR I 3 76  ? 13.202  45.711  202.173 1.00 53.82  ? 77  TYR A CG    1 
ATOM   1668 C CD1   . TYR I 3 76  ? 13.457  44.505  201.528 1.00 55.56  ? 77  TYR A CD1   1 
ATOM   1669 C CD2   . TYR I 3 76  ? 14.285  46.485  202.573 1.00 58.25  ? 77  TYR A CD2   1 
ATOM   1670 C CE1   . TYR I 3 76  ? 14.750  44.076  201.278 1.00 46.02  ? 77  TYR A CE1   1 
ATOM   1671 C CE2   . TYR I 3 76  ? 15.591  46.064  202.330 1.00 57.18  ? 77  TYR A CE2   1 
ATOM   1672 C CZ    . TYR I 3 76  ? 15.812  44.853  201.679 1.00 53.17  ? 77  TYR A CZ    1 
ATOM   1673 O OH    . TYR I 3 76  ? 17.092  44.415  201.417 1.00 46.48  ? 77  TYR A OH    1 
ATOM   1674 N N     . LYS I 3 77  ? 8.714   46.999  201.218 1.00 64.50  ? 78  LYS A N     1 
ATOM   1675 C CA    . LYS I 3 77  ? 7.327   47.159  201.622 1.00 67.60  ? 78  LYS A CA    1 
ATOM   1676 C C     . LYS I 3 77  ? 6.487   46.400  200.613 1.00 70.53  ? 78  LYS A C     1 
ATOM   1677 O O     . LYS I 3 77  ? 5.289   46.217  200.814 1.00 78.62  ? 78  LYS A O     1 
ATOM   1678 C CB    . LYS I 3 77  ? 6.913   48.638  201.654 1.00 68.53  ? 78  LYS A CB    1 
ATOM   1679 C CG    . LYS I 3 77  ? 7.679   49.489  202.647 1.00 68.89  ? 78  LYS A CG    1 
ATOM   1680 C CD    . LYS I 3 77  ? 6.812   50.600  203.229 1.00 76.80  ? 78  LYS A CD    1 
ATOM   1681 C CE    . LYS I 3 77  ? 6.268   51.568  202.173 1.00 77.67  ? 78  LYS A CE    1 
ATOM   1682 N NZ    . LYS I 3 77  ? 5.378   52.639  202.777 1.00 65.18  ? 78  LYS A NZ    1 
ATOM   1683 N N     . LEU I 3 78  ? 7.125   45.963  199.528 1.00 64.57  ? 79  LEU A N     1 
ATOM   1684 C CA    . LEU I 3 78  ? 6.438   45.203  198.491 1.00 61.19  ? 79  LEU A CA    1 
ATOM   1685 C C     . LEU I 3 78  ? 6.109   43.783  198.948 1.00 60.93  ? 79  LEU A C     1 
ATOM   1686 O O     . LEU I 3 78  ? 5.441   43.042  198.237 1.00 61.12  ? 79  LEU A O     1 
ATOM   1687 C CB    . LEU I 3 78  ? 7.285   45.130  197.231 1.00 55.07  ? 79  LEU A CB    1 
ATOM   1688 C CG    . LEU I 3 78  ? 7.633   46.489  196.664 1.00 61.94  ? 79  LEU A CG    1 
ATOM   1689 C CD1   . LEU I 3 78  ? 8.255   46.294  195.294 1.00 63.85  ? 79  LEU A CD1   1 
ATOM   1690 C CD2   . LEU I 3 78  ? 6.379   47.358  196.570 1.00 63.58  ? 79  LEU A CD2   1 
ATOM   1691 N N     . PHE I 3 79  ? 6.588   43.413  200.131 1.00 55.62  ? 80  PHE A N     1 
ATOM   1692 C CA    . PHE I 3 79  ? 6.323   42.103  200.665 1.00 57.69  ? 80  PHE A CA    1 
ATOM   1693 C C     . PHE I 3 79  ? 5.056   42.145  201.511 1.00 64.70  ? 80  PHE A C     1 
ATOM   1694 O O     . PHE I 3 79  ? 4.273   41.197  201.534 1.00 76.28  ? 80  PHE A O     1 
ATOM   1695 C CB    . PHE I 3 79  ? 7.518   41.607  201.486 1.00 57.36  ? 80  PHE A CB    1 
ATOM   1696 C CG    . PHE I 3 79  ? 8.732   41.314  200.654 1.00 53.23  ? 80  PHE A CG    1 
ATOM   1697 C CD1   . PHE I 3 79  ? 9.660   42.303  200.382 1.00 58.17  ? 80  PHE A CD1   1 
ATOM   1698 C CD2   . PHE I 3 79  ? 8.881   40.085  200.040 1.00 62.48  ? 80  PHE A CD2   1 
ATOM   1699 C CE1   . PHE I 3 79  ? 10.709  42.084  199.504 1.00 48.13  ? 80  PHE A CE1   1 
ATOM   1700 C CE2   . PHE I 3 79  ? 9.926   39.854  199.158 1.00 55.84  ? 80  PHE A CE2   1 
ATOM   1701 C CZ    . PHE I 3 79  ? 10.838  40.862  198.893 1.00 60.32  ? 80  PHE A CZ    1 
ATOM   1702 N N     . ASN I 3 80  ? 4.844   43.256  202.196 1.00 67.47  ? 81  ASN A N     1 
ATOM   1703 C CA    . ASN I 3 80  ? 3.667   43.415  203.034 1.00 63.32  ? 81  ASN A CA    1 
ATOM   1704 C C     . ASN I 3 80  ? 3.703   42.462  204.199 1.00 54.66  ? 81  ASN A C     1 
ATOM   1705 O O     . ASN I 3 80  ? 2.653   42.151  204.744 1.00 58.92  ? 81  ASN A O     1 
ATOM   1706 C CB    . ASN I 3 80  ? 2.365   43.171  202.252 1.00 70.56  ? 81  ASN A CB    1 
ATOM   1707 C CG    . ASN I 3 80  ? 2.105   44.224  201.174 1.00 83.80  ? 81  ASN A CG    1 
ATOM   1708 O OD1   . ASN I 3 80  ? 1.919   45.408  201.468 1.00 90.52  ? 81  ASN A OD1   1 
ATOM   1709 N ND2   . ASN I 3 80  ? 2.090   43.789  199.916 1.00 80.91  ? 81  ASN A ND2   1 
ATOM   1710 N N     . SER I 3 81  ? 4.893   41.988  204.570 1.00 44.59  ? 82  SER A N     1 
ATOM   1711 C CA    . SER I 3 81  ? 5.037   41.076  205.719 1.00 55.05  ? 82  SER A CA    1 
ATOM   1712 C C     . SER I 3 81  ? 6.476   40.842  206.175 1.00 50.35  ? 82  SER A C     1 
ATOM   1713 O O     . SER I 3 81  ? 7.306   40.348  205.424 1.00 54.10  ? 82  SER A O     1 
ATOM   1714 C CB    . SER I 3 81  ? 4.363   39.719  205.454 1.00 52.82  ? 82  SER A CB    1 
ATOM   1715 O OG    . SER I 3 81  ? 4.174   39.486  204.070 1.00 64.49  ? 82  SER A OG    1 
ATOM   1716 N N     . PRO I 3 82  ? 6.780   41.179  207.438 1.00 49.15  ? 83  PRO A N     1 
ATOM   1717 C CA    . PRO I 3 82  ? 8.126   41.009  207.985 1.00 45.12  ? 83  PRO A CA    1 
ATOM   1718 C C     . PRO I 3 82  ? 8.633   39.601  207.837 1.00 40.97  ? 83  PRO A C     1 
ATOM   1719 O O     . PRO I 3 82  ? 9.709   39.363  207.283 1.00 34.87  ? 83  PRO A O     1 
ATOM   1720 C CB    . PRO I 3 82  ? 7.955   41.373  209.461 1.00 46.63  ? 83  PRO A CB    1 
ATOM   1721 C CG    . PRO I 3 82  ? 6.835   42.299  209.459 1.00 51.63  ? 83  PRO A CG    1 
ATOM   1722 C CD    . PRO I 3 82  ? 5.868   41.670  208.485 1.00 50.82  ? 83  PRO A CD    1 
ATOM   1723 N N     . THR I 3 83  ? 7.850   38.670  208.367 1.00 39.49  ? 84  THR A N     1 
ATOM   1724 C CA    . THR I 3 83  ? 8.223   37.275  208.328 1.00 41.77  ? 84  THR A CA    1 
ATOM   1725 C C     . THR I 3 83  ? 8.502   36.849  206.897 1.00 37.58  ? 84  THR A C     1 
ATOM   1726 O O     . THR I 3 83  ? 9.630   36.476  206.576 1.00 31.47  ? 84  THR A O     1 
ATOM   1727 C CB    . THR I 3 83  ? 7.132   36.383  208.946 1.00 46.68  ? 84  THR A CB    1 
ATOM   1728 O OG1   . THR I 3 83  ? 6.985   36.696  210.341 1.00 45.29  ? 84  THR A OG1   1 
ATOM   1729 C CG2   . THR I 3 83  ? 7.528   34.930  208.820 1.00 40.21  ? 84  THR A CG2   1 
ATOM   1730 N N     . LEU I 3 84  ? 7.491   36.918  206.037 1.00 25.27  ? 85  LEU A N     1 
ATOM   1731 C CA    . LEU I 3 84  ? 7.694   36.529  204.652 1.00 29.03  ? 85  LEU A CA    1 
ATOM   1732 C C     . LEU I 3 84  ? 8.909   37.220  204.025 1.00 30.66  ? 85  LEU A C     1 
ATOM   1733 O O     . LEU I 3 84  ? 9.642   36.644  203.224 1.00 37.60  ? 85  LEU A O     1 
ATOM   1734 C CB    . LEU I 3 84  ? 6.459   36.840  203.834 1.00 32.15  ? 85  LEU A CB    1 
ATOM   1735 C CG    . LEU I 3 84  ? 6.474   36.254  202.427 1.00 41.45  ? 85  LEU A CG    1 
ATOM   1736 C CD1   . LEU I 3 84  ? 6.805   34.769  202.508 1.00 28.57  ? 85  LEU A CD1   1 
ATOM   1737 C CD2   . LEU I 3 84  ? 5.100   36.469  201.778 1.00 41.96  ? 85  LEU A CD2   1 
ATOM   1738 N N     . LEU I 3 85  ? 9.111   38.471  204.393 1.00 31.41  ? 86  LEU A N     1 
ATOM   1739 C CA    . LEU I 3 85  ? 10.239  39.231  203.896 1.00 30.24  ? 86  LEU A CA    1 
ATOM   1740 C C     . LEU I 3 85  ? 11.507  38.534  204.378 1.00 27.86  ? 86  LEU A C     1 
ATOM   1741 O O     . LEU I 3 85  ? 12.410  38.219  203.609 1.00 28.69  ? 86  LEU A O     1 
ATOM   1742 C CB    . LEU I 3 85  ? 10.172  40.638  204.454 1.00 18.41  ? 86  LEU A CB    1 
ATOM   1743 C CG    . LEU I 3 85  ? 11.399  41.523  204.409 1.00 18.58  ? 86  LEU A CG    1 
ATOM   1744 C CD1   . LEU I 3 85  ? 11.306  42.483  203.268 1.00 14.11  ? 86  LEU A CD1   1 
ATOM   1745 C CD2   . LEU I 3 85  ? 11.485  42.260  205.714 1.00 12.15  ? 86  LEU A CD2   1 
ATOM   1746 N N     . PHE I 3 86  ? 11.570  38.278  205.669 1.00 30.75  ? 87  PHE A N     1 
ATOM   1747 C CA    . PHE I 3 86  ? 12.737  37.620  206.213 1.00 36.04  ? 87  PHE A CA    1 
ATOM   1748 C C     . PHE I 3 86  ? 13.163  36.414  205.401 1.00 40.31  ? 87  PHE A C     1 
ATOM   1749 O O     . PHE I 3 86  ? 14.346  36.207  205.152 1.00 41.00  ? 87  PHE A O     1 
ATOM   1750 C CB    . PHE I 3 86  ? 12.457  37.188  207.637 1.00 20.03  ? 87  PHE A CB    1 
ATOM   1751 C CG    . PHE I 3 86  ? 13.549  36.381  208.237 1.00 16.23  ? 87  PHE A CG    1 
ATOM   1752 C CD1   . PHE I 3 86  ? 14.844  36.846  208.235 1.00 9.88   ? 87  PHE A CD1   1 
ATOM   1753 C CD2   . PHE I 3 86  ? 13.268  35.177  208.864 1.00 24.04  ? 87  PHE A CD2   1 
ATOM   1754 C CE1   . PHE I 3 86  ? 15.845  36.126  208.863 1.00 26.97  ? 87  PHE A CE1   1 
ATOM   1755 C CE2   . PHE I 3 86  ? 14.256  34.447  209.494 1.00 18.47  ? 87  PHE A CE2   1 
ATOM   1756 C CZ    . PHE I 3 86  ? 15.551  34.921  209.495 1.00 26.75  ? 87  PHE A CZ    1 
ATOM   1757 N N     . LEU I 3 87  ? 12.173  35.643  204.970 1.00 48.52  ? 88  LEU A N     1 
ATOM   1758 C CA    . LEU I 3 87  ? 12.395  34.407  204.226 1.00 52.87  ? 88  LEU A CA    1 
ATOM   1759 C C     . LEU I 3 87  ? 12.641  34.472  202.711 1.00 54.33  ? 88  LEU A C     1 
ATOM   1760 O O     . LEU I 3 87  ? 13.078  33.480  202.123 1.00 58.71  ? 88  LEU A O     1 
ATOM   1761 C CB    . LEU I 3 87  ? 11.215  33.461  204.495 1.00 53.60  ? 88  LEU A CB    1 
ATOM   1762 C CG    . LEU I 3 87  ? 11.274  32.334  205.539 1.00 50.95  ? 88  LEU A CG    1 
ATOM   1763 C CD1   . LEU I 3 87  ? 12.276  32.612  206.640 1.00 40.78  ? 88  LEU A CD1   1 
ATOM   1764 C CD2   . LEU I 3 87  ? 9.879   32.146  206.106 1.00 41.45  ? 88  LEU A CD2   1 
ATOM   1765 N N     . LEU I 3 88  ? 12.402  35.613  202.074 1.00 45.11  ? 89  LEU A N     1 
ATOM   1766 C CA    . LEU I 3 88  ? 12.563  35.660  200.631 1.00 33.13  ? 89  LEU A CA    1 
ATOM   1767 C C     . LEU I 3 88  ? 13.388  36.837  200.101 1.00 36.52  ? 89  LEU A C     1 
ATOM   1768 O O     . LEU I 3 88  ? 13.783  36.836  198.939 1.00 31.31  ? 89  LEU A O     1 
ATOM   1769 C CB    . LEU I 3 88  ? 11.150  35.638  200.002 1.00 39.45  ? 89  LEU A CB    1 
ATOM   1770 C CG    . LEU I 3 88  ? 10.043  34.678  200.556 1.00 43.69  ? 89  LEU A CG    1 
ATOM   1771 C CD1   . LEU I 3 88  ? 8.702   34.917  199.852 1.00 42.16  ? 89  LEU A CD1   1 
ATOM   1772 C CD2   . LEU I 3 88  ? 10.426  33.229  200.365 1.00 37.80  ? 89  LEU A CD2   1 
ATOM   1773 N N     . SER I 3 89  ? 13.645  37.820  200.967 1.00 41.73  ? 90  SER A N     1 
ATOM   1774 C CA    . SER I 3 89  ? 14.404  39.041  200.655 1.00 44.02  ? 90  SER A CA    1 
ATOM   1775 C C     . SER I 3 89  ? 15.836  38.817  200.210 1.00 46.86  ? 90  SER A C     1 
ATOM   1776 O O     . SER I 3 89  ? 16.376  37.733  200.355 1.00 45.41  ? 90  SER A O     1 
ATOM   1777 C CB    . SER I 3 89  ? 14.455  39.946  201.869 1.00 50.36  ? 90  SER A CB    1 
ATOM   1778 O OG    . SER I 3 89  ? 13.152  40.327  202.248 1.00 73.50  ? 90  SER A OG    1 
ATOM   1779 N N     . ARG I 3 90  ? 16.472  39.875  199.723 1.00 46.83  ? 91  ARG A N     1 
ATOM   1780 C CA    . ARG I 3 90  ? 17.814  39.732  199.227 1.00 40.72  ? 91  ARG A CA    1 
ATOM   1781 C C     . ARG I 3 90  ? 18.911  40.611  199.793 1.00 49.54  ? 91  ARG A C     1 
ATOM   1782 O O     . ARG I 3 90  ? 20.062  40.547  199.337 1.00 54.50  ? 91  ARG A O     1 
ATOM   1783 C CB    . ARG I 3 90  ? 17.813  39.862  197.698 1.00 43.24  ? 91  ARG A CB    1 
ATOM   1784 C CG    . ARG I 3 90  ? 17.427  38.572  196.953 1.00 48.04  ? 91  ARG A CG    1 
ATOM   1785 C CD    . ARG I 3 90  ? 18.230  37.331  197.423 1.00 47.65  ? 91  ARG A CD    1 
ATOM   1786 N NE    . ARG I 3 90  ? 17.888  36.152  196.636 1.00 49.20  ? 91  ARG A NE    1 
ATOM   1787 C CZ    . ARG I 3 90  ? 18.298  35.944  195.387 1.00 47.51  ? 91  ARG A CZ    1 
ATOM   1788 N NH1   . ARG I 3 90  ? 17.922  34.843  194.720 1.00 29.44  ? 91  ARG A NH1   1 
ATOM   1789 N NH2   . ARG I 3 90  ? 19.107  36.828  194.817 1.00 31.79  ? 91  ARG A NH2   1 
ATOM   1790 N N     . GLY I 3 91  ? 18.601  41.429  200.783 1.00 50.39  ? 92  GLY A N     1 
ATOM   1791 C CA    . GLY I 3 91  ? 19.650  42.284  201.315 1.00 56.73  ? 92  GLY A CA    1 
ATOM   1792 C C     . GLY I 3 91  ? 19.662  43.658  200.659 1.00 56.12  ? 92  GLY A C     1 
ATOM   1793 O O     . GLY I 3 91  ? 19.411  43.789  199.459 1.00 51.36  ? 92  GLY A O     1 
ATOM   1794 N N     . LYS I 3 92  ? 19.960  44.673  201.474 1.00 55.85  ? 93  LYS A N     1 
ATOM   1795 C CA    . LYS I 3 92  ? 20.013  46.082  201.078 1.00 49.16  ? 93  LYS A CA    1 
ATOM   1796 C C     . LYS I 3 92  ? 20.648  46.308  199.702 1.00 41.66  ? 93  LYS A C     1 
ATOM   1797 O O     . LYS I 3 92  ? 19.973  46.703  198.744 1.00 31.35  ? 93  LYS A O     1 
ATOM   1798 C CB    . LYS I 3 92  ? 20.756  46.882  202.154 1.00 53.35  ? 93  LYS A CB    1 
ATOM   1799 C CG    . LYS I 3 92  ? 20.577  48.392  202.048 1.00 65.15  ? 93  LYS A CG    1 
ATOM   1800 C CD    . LYS I 3 92  ? 21.081  49.126  203.292 1.00 63.80  ? 93  LYS A CD    1 
ATOM   1801 C CE    . LYS I 3 92  ? 20.163  48.877  204.487 1.00 56.86  ? 93  LYS A CE    1 
ATOM   1802 N NZ    . LYS I 3 92  ? 20.578  49.659  205.689 1.00 66.64  ? 93  LYS A NZ    1 
ATOM   1803 N N     . ALA I 3 93  ? 21.943  46.071  199.600 1.00 27.53  ? 94  ALA A N     1 
ATOM   1804 C CA    . ALA I 3 93  ? 22.607  46.220  198.322 1.00 27.52  ? 94  ALA A CA    1 
ATOM   1805 C C     . ALA I 3 93  ? 21.792  45.617  197.167 1.00 28.17  ? 94  ALA A C     1 
ATOM   1806 O O     . ALA I 3 93  ? 21.321  46.323  196.290 1.00 28.54  ? 94  ALA A O     1 
ATOM   1807 C CB    . ALA I 3 93  ? 23.970  45.549  198.379 1.00 21.19  ? 94  ALA A CB    1 
ATOM   1808 N N     . ALA I 3 94  ? 21.628  44.296  197.187 1.00 43.68  ? 95  ALA A N     1 
ATOM   1809 C CA    . ALA I 3 94  ? 20.917  43.555  196.143 1.00 35.55  ? 95  ALA A CA    1 
ATOM   1810 C C     . ALA I 3 94  ? 19.555  44.129  195.800 1.00 34.07  ? 95  ALA A C     1 
ATOM   1811 O O     . ALA I 3 94  ? 19.211  44.255  194.634 1.00 24.70  ? 95  ALA A O     1 
ATOM   1812 C CB    . ALA I 3 94  ? 20.784  42.089  196.561 1.00 40.14  ? 95  ALA A CB    1 
ATOM   1813 N N     . THR I 3 95  ? 18.787  44.462  196.829 1.00 28.94  ? 96  THR A N     1 
ATOM   1814 C CA    . THR I 3 95  ? 17.459  45.026  196.663 1.00 35.46  ? 96  THR A CA    1 
ATOM   1815 C C     . THR I 3 95  ? 17.499  46.377  195.936 1.00 46.33  ? 96  THR A C     1 
ATOM   1816 O O     . THR I 3 95  ? 16.787  46.593  194.948 1.00 37.82  ? 96  THR A O     1 
ATOM   1817 C CB    . THR I 3 95  ? 16.818  45.233  198.027 1.00 26.03  ? 96  THR A CB    1 
ATOM   1818 O OG1   . THR I 3 95  ? 16.771  43.984  198.721 1.00 47.04  ? 96  THR A OG1   1 
ATOM   1819 C CG2   . THR I 3 95  ? 15.434  45.774  197.878 1.00 20.42  ? 96  THR A CG2   1 
ATOM   1820 N N     . GLU I 3 96  ? 18.338  47.275  196.466 1.00 51.49  ? 97  GLU A N     1 
ATOM   1821 C CA    . GLU I 3 96  ? 18.550  48.629  195.954 1.00 48.57  ? 97  GLU A CA    1 
ATOM   1822 C C     . GLU I 3 96  ? 19.114  48.584  194.539 1.00 44.45  ? 97  GLU A C     1 
ATOM   1823 O O     . GLU I 3 96  ? 18.769  49.393  193.678 1.00 45.68  ? 97  GLU A O     1 
ATOM   1824 C CB    . GLU I 3 96  ? 19.531  49.379  196.870 1.00 53.71  ? 97  GLU A CB    1 
ATOM   1825 C CG    . GLU I 3 96  ? 19.776  50.855  196.518 1.00 67.08  ? 97  GLU A CG    1 
ATOM   1826 C CD    . GLU I 3 96  ? 18.745  51.796  197.125 1.00 65.17  ? 97  GLU A CD    1 
ATOM   1827 O OE1   . GLU I 3 96  ? 18.569  52.918  196.602 1.00 66.55  ? 97  GLU A OE1   1 
ATOM   1828 O OE2   . GLU I 3 96  ? 18.126  51.415  198.135 1.00 61.92  ? 97  GLU A OE2   1 
ATOM   1829 N N     . ASN I 3 97  ? 19.989  47.627  194.305 1.00 35.20  ? 98  ASN A N     1 
ATOM   1830 C CA    . ASN I 3 97  ? 20.587  47.499  193.012 1.00 38.37  ? 98  ASN A CA    1 
ATOM   1831 C C     . ASN I 3 97  ? 19.686  46.867  191.967 1.00 39.14  ? 98  ASN A C     1 
ATOM   1832 O O     . ASN I 3 97  ? 19.874  47.112  190.787 1.00 41.20  ? 98  ASN A O     1 
ATOM   1833 C CB    . ASN I 3 97  ? 21.912  46.742  193.142 1.00 49.78  ? 98  ASN A CB    1 
ATOM   1834 C CG    . ASN I 3 97  ? 23.094  47.674  193.497 1.00 64.56  ? 98  ASN A CG    1 
ATOM   1835 O OD1   . ASN I 3 97  ? 23.066  48.412  194.495 1.00 55.48  ? 98  ASN A OD1   1 
ATOM   1836 N ND2   . ASN I 3 97  ? 24.136  47.639  192.664 1.00 78.62  ? 98  ASN A ND2   1 
ATOM   1837 N N     . TRP I 3 98  ? 18.686  46.093  192.377 1.00 48.31  ? 99  TRP A N     1 
ATOM   1838 C CA    . TRP I 3 98  ? 17.788  45.431  191.408 1.00 55.03  ? 99  TRP A CA    1 
ATOM   1839 C C     . TRP I 3 98  ? 17.396  46.300  190.221 1.00 55.42  ? 99  TRP A C     1 
ATOM   1840 O O     . TRP I 3 98  ? 17.330  47.526  190.327 1.00 55.99  ? 99  TRP A O     1 
ATOM   1841 C CB    . TRP I 3 98  ? 16.493  44.937  192.065 1.00 59.15  ? 99  TRP A CB    1 
ATOM   1842 C CG    . TRP I 3 98  ? 15.764  43.966  191.179 1.00 59.74  ? 99  TRP A CG    1 
ATOM   1843 C CD1   . TRP I 3 98  ? 16.113  42.678  190.932 1.00 64.13  ? 99  TRP A CD1   1 
ATOM   1844 C CD2   . TRP I 3 98  ? 14.585  44.214  190.403 1.00 70.58  ? 99  TRP A CD2   1 
ATOM   1845 N NE1   . TRP I 3 98  ? 15.232  42.101  190.051 1.00 64.25  ? 99  TRP A NE1   1 
ATOM   1846 C CE2   . TRP I 3 98  ? 14.288  43.027  189.701 1.00 67.03  ? 99  TRP A CE2   1 
ATOM   1847 C CE3   . TRP I 3 98  ? 13.764  45.329  190.214 1.00 74.53  ? 99  TRP A CE3   1 
ATOM   1848 C CZ2   . TRP I 3 98  ? 13.188  42.914  188.848 1.00 64.49  ? 99  TRP A CZ2   1 
ATOM   1849 C CZ3   . TRP I 3 98  ? 12.667  45.213  189.359 1.00 74.92  ? 99  TRP A CZ3   1 
ATOM   1850 C CH2   . TRP I 3 98  ? 12.400  44.016  188.681 1.00 67.96  ? 99  TRP A CH2   1 
ATOM   1851 N N     . SER I 3 99  ? 17.108  45.645  189.101 1.00 50.39  ? 100 SER A N     1 
ATOM   1852 C CA    . SER I 3 99  ? 16.730  46.337  187.882 1.00 52.17  ? 100 SER A CA    1 
ATOM   1853 C C     . SER I 3 99  ? 16.331  45.353  186.823 1.00 53.58  ? 100 SER A C     1 
ATOM   1854 O O     . SER I 3 99  ? 16.691  44.196  186.896 1.00 63.03  ? 100 SER A O     1 
ATOM   1855 C CB    . SER I 3 99  ? 17.900  47.150  187.355 1.00 56.99  ? 100 SER A CB    1 
ATOM   1856 O OG    . SER I 3 99  ? 17.909  47.148  185.940 1.00 52.29  ? 100 SER A OG    1 
ATOM   1857 N N     . ILE I 3 100 ? 15.590  45.813  185.827 1.00 59.45  ? 101 ILE A N     1 
ATOM   1858 C CA    . ILE I 3 100 ? 15.173  44.934  184.749 1.00 61.29  ? 101 ILE A CA    1 
ATOM   1859 C C     . ILE I 3 100 ? 16.421  44.515  183.962 1.00 58.27  ? 101 ILE A C     1 
ATOM   1860 O O     . ILE I 3 100 ? 16.387  43.585  183.161 1.00 51.92  ? 101 ILE A O     1 
ATOM   1861 C CB    . ILE I 3 100 ? 14.137  45.652  183.826 1.00 60.97  ? 101 ILE A CB    1 
ATOM   1862 C CG1   . ILE I 3 100 ? 13.659  44.700  182.735 1.00 74.67  ? 101 ILE A CG1   1 
ATOM   1863 C CG2   . ILE I 3 100 ? 14.761  46.864  183.179 1.00 68.12  ? 101 ILE A CG2   1 
ATOM   1864 C CD1   . ILE I 3 100 ? 13.049  43.406  183.259 1.00 78.65  ? 101 ILE A CD1   1 
ATOM   1865 N N     . GLU I 3 101 ? 17.527  45.200  184.228 1.00 65.29  ? 102 GLU A N     1 
ATOM   1866 C CA    . GLU I 3 101 ? 18.798  44.938  183.558 1.00 73.53  ? 102 GLU A CA    1 
ATOM   1867 C C     . GLU I 3 101 ? 19.805  44.356  184.533 1.00 71.60  ? 102 GLU A C     1 
ATOM   1868 O O     . GLU I 3 101 ? 21.004  44.248  184.244 1.00 69.70  ? 102 GLU A O     1 
ATOM   1869 C CB    . GLU I 3 101 ? 19.339  46.238  182.968 1.00 79.99  ? 102 GLU A CB    1 
ATOM   1870 C CG    . GLU I 3 101 ? 18.295  46.961  182.163 1.00 90.15  ? 102 GLU A CG    1 
ATOM   1871 C CD    . GLU I 3 101 ? 17.632  46.045  181.155 1.00 99.93  ? 102 GLU A CD    1 
ATOM   1872 O OE1   . GLU I 3 101 ? 16.522  46.380  180.695 1.00 103.18 ? 102 GLU A OE1   1 
ATOM   1873 O OE2   . GLU I 3 101 ? 18.224  44.994  180.817 1.00 109.10 ? 102 GLU A OE2   1 
ATOM   1874 N N     . ASN I 3 102 ? 19.295  44.006  185.707 1.00 68.06  ? 103 ASN A N     1 
ATOM   1875 C CA    . ASN I 3 102 ? 20.092  43.414  186.772 1.00 65.67  ? 103 ASN A CA    1 
ATOM   1876 C C     . ASN I 3 102 ? 19.163  42.556  187.612 1.00 62.11  ? 103 ASN A C     1 
ATOM   1877 O O     . ASN I 3 102 ? 19.075  42.713  188.837 1.00 57.22  ? 103 ASN A O     1 
ATOM   1878 C CB    . ASN I 3 102 ? 20.718  44.481  187.650 1.00 77.19  ? 103 ASN A CB    1 
ATOM   1879 C CG    . ASN I 3 102 ? 21.777  43.915  188.559 1.00 81.30  ? 103 ASN A CG    1 
ATOM   1880 O OD1   . ASN I 3 102 ? 22.683  43.237  188.092 1.00 88.58  ? 103 ASN A OD1   1 
ATOM   1881 N ND2   . ASN I 3 102 ? 21.675  44.188  189.861 1.00 91.07  ? 103 ASN A ND2   1 
ATOM   1882 N N     . LEU I 3 103 ? 18.472  41.657  186.916 1.00 51.17  ? 104 LEU A N     1 
ATOM   1883 C CA    . LEU I 3 103 ? 17.527  40.743  187.508 1.00 39.79  ? 104 LEU A CA    1 
ATOM   1884 C C     . LEU I 3 103 ? 18.173  39.864  188.556 1.00 42.94  ? 104 LEU A C     1 
ATOM   1885 O O     . LEU I 3 103 ? 19.370  39.603  188.487 1.00 43.53  ? 104 LEU A O     1 
ATOM   1886 C CB    . LEU I 3 103 ? 16.939  39.862  186.422 1.00 41.10  ? 104 LEU A CB    1 
ATOM   1887 C CG    . LEU I 3 103 ? 15.854  40.439  185.526 1.00 47.29  ? 104 LEU A CG    1 
ATOM   1888 C CD1   . LEU I 3 103 ? 15.343  39.335  184.610 1.00 30.49  ? 104 LEU A CD1   1 
ATOM   1889 C CD2   . LEU I 3 103 ? 14.719  41.004  186.361 1.00 46.90  ? 104 LEU A CD2   1 
ATOM   1890 N N     . PHE I 3 104 ? 17.375  39.410  189.522 1.00 39.50  ? 105 PHE A N     1 
ATOM   1891 C CA    . PHE I 3 104 ? 17.857  38.511  190.567 1.00 37.67  ? 105 PHE A CA    1 
ATOM   1892 C C     . PHE I 3 104 ? 18.125  37.132  189.949 1.00 45.11  ? 105 PHE A C     1 
ATOM   1893 O O     . PHE I 3 104 ? 17.424  36.710  189.020 1.00 44.76  ? 105 PHE A O     1 
ATOM   1894 C CB    . PHE I 3 104 ? 16.807  38.328  191.654 1.00 28.81  ? 105 PHE A CB    1 
ATOM   1895 C CG    . PHE I 3 104 ? 16.744  39.433  192.637 1.00 31.24  ? 105 PHE A CG    1 
ATOM   1896 C CD1   . PHE I 3 104 ? 15.560  40.125  192.838 1.00 47.50  ? 105 PHE A CD1   1 
ATOM   1897 C CD2   . PHE I 3 104 ? 17.829  39.737  193.427 1.00 34.15  ? 105 PHE A CD2   1 
ATOM   1898 C CE1   . PHE I 3 104 ? 15.456  41.114  193.832 1.00 43.90  ? 105 PHE A CE1   1 
ATOM   1899 C CE2   . PHE I 3 104 ? 17.742  40.719  194.423 1.00 41.48  ? 105 PHE A CE2   1 
ATOM   1900 C CZ    . PHE I 3 104 ? 16.554  41.404  194.624 1.00 43.86  ? 105 PHE A CZ    1 
ATOM   1901 N N     . GLU I 3 105 ? 19.135  36.432  190.461 1.00 47.16  ? 106 GLU A N     1 
ATOM   1902 C CA    . GLU I 3 105 ? 19.457  35.099  189.973 1.00 50.01  ? 106 GLU A CA    1 
ATOM   1903 C C     . GLU I 3 105 ? 19.368  34.112  191.124 1.00 53.42  ? 106 GLU A C     1 
ATOM   1904 O O     . GLU I 3 105 ? 18.959  34.495  192.223 1.00 57.78  ? 106 GLU A O     1 
ATOM   1905 C CB    . GLU I 3 105 ? 20.845  35.078  189.352 1.00 47.80  ? 106 GLU A CB    1 
ATOM   1906 C CG    . GLU I 3 105 ? 20.849  35.607  187.938 1.00 56.12  ? 106 GLU A CG    1 
ATOM   1907 C CD    . GLU I 3 105 ? 22.226  35.596  187.313 1.00 68.59  ? 106 GLU A CD    1 
ATOM   1908 O OE1   . GLU I 3 105 ? 22.335  35.939  186.108 1.00 69.23  ? 106 GLU A OE1   1 
ATOM   1909 O OE2   . GLU I 3 105 ? 23.198  35.247  188.026 1.00 70.99  ? 106 GLU A OE2   1 
ATOM   1910 N N     . GLU I 3 106 ? 19.721  32.848  190.889 1.00 51.59  ? 107 GLU A N     1 
ATOM   1911 C CA    . GLU I 3 106 ? 19.652  31.852  191.956 1.00 44.14  ? 107 GLU A CA    1 
ATOM   1912 C C     . GLU I 3 106 ? 20.788  32.097  192.927 1.00 41.76  ? 107 GLU A C     1 
ATOM   1913 O O     . GLU I 3 106 ? 21.903  32.395  192.512 1.00 36.11  ? 107 GLU A O     1 
ATOM   1914 C CB    . GLU I 3 106 ? 19.758  30.457  191.366 1.00 57.70  ? 107 GLU A CB    1 
ATOM   1915 C CG    . GLU I 3 106 ? 19.323  29.347  192.308 1.00 85.48  ? 107 GLU A CG    1 
ATOM   1916 C CD    . GLU I 3 106 ? 18.577  28.225  191.581 1.00 98.11  ? 107 GLU A CD    1 
ATOM   1917 O OE1   . GLU I 3 106 ? 18.360  27.148  192.195 1.00 109.10 ? 107 GLU A OE1   1 
ATOM   1918 O OE2   . GLU I 3 106 ? 18.199  28.426  190.394 1.00 102.93 ? 107 GLU A OE2   1 
ATOM   1919 N N     . LYS I 3 107 ? 20.499  32.005  194.221 1.00 39.41  ? 108 LYS A N     1 
ATOM   1920 C CA    . LYS I 3 107 ? 21.515  32.212  195.264 1.00 39.86  ? 108 LYS A CA    1 
ATOM   1921 C C     . LYS I 3 107 ? 21.566  30.979  196.195 1.00 41.70  ? 108 LYS A C     1 
ATOM   1922 O O     . LYS I 3 107 ? 20.526  30.424  196.538 1.00 45.85  ? 108 LYS A O     1 
ATOM   1923 C CB    . LYS I 3 107 ? 21.185  33.479  196.068 1.00 36.66  ? 108 LYS A CB    1 
ATOM   1924 C CG    . LYS I 3 107 ? 22.228  33.846  197.113 1.00 49.07  ? 108 LYS A CG    1 
ATOM   1925 C CD    . LYS I 3 107 ? 21.817  35.066  197.893 1.00 43.02  ? 108 LYS A CD    1 
ATOM   1926 C CE    . LYS I 3 107 ? 23.000  35.723  198.568 1.00 22.87  ? 108 LYS A CE    1 
ATOM   1927 N NZ    . LYS I 3 107 ? 22.536  36.962  199.250 1.00 29.33  ? 108 LYS A NZ    1 
ATOM   1928 N N     . GLN I 3 108 ? 22.762  30.563  196.612 1.00 36.39  ? 109 GLN A N     1 
ATOM   1929 C CA    . GLN I 3 108 ? 22.910  29.381  197.469 1.00 31.26  ? 109 GLN A CA    1 
ATOM   1930 C C     . GLN I 3 108 ? 22.145  29.457  198.792 1.00 37.49  ? 109 GLN A C     1 
ATOM   1931 O O     . GLN I 3 108 ? 21.681  28.443  199.285 1.00 42.85  ? 109 GLN A O     1 
ATOM   1932 C CB    . GLN I 3 108 ? 24.402  29.117  197.735 1.00 22.43  ? 109 GLN A CB    1 
ATOM   1933 C CG    . GLN I 3 108 ? 24.787  27.719  198.221 1.00 17.36  ? 109 GLN A CG    1 
ATOM   1934 C CD    . GLN I 3 108 ? 26.303  27.480  198.187 1.00 22.51  ? 109 GLN A CD    1 
ATOM   1935 O OE1   . GLN I 3 108 ? 26.897  27.009  199.158 1.00 28.87  ? 109 GLN A OE1   1 
ATOM   1936 N NE2   . GLN I 3 108 ? 26.925  27.799  197.068 1.00 27.76  ? 109 GLN A NE2   1 
ATOM   1937 N N     . ASN I 3 109 ? 22.020  30.653  199.362 1.00 43.08  ? 110 ASN A N     1 
ATOM   1938 C CA    . ASN I 3 109 ? 21.308  30.846  200.632 1.00 44.64  ? 110 ASN A CA    1 
ATOM   1939 C C     . ASN I 3 109 ? 19.797  30.816  200.488 1.00 50.22  ? 110 ASN A C     1 
ATOM   1940 O O     . ASN I 3 109 ? 19.078  30.763  201.478 1.00 52.34  ? 110 ASN A O     1 
ATOM   1941 C CB    . ASN I 3 109 ? 21.628  32.196  201.245 1.00 47.42  ? 110 ASN A CB    1 
ATOM   1942 C CG    . ASN I 3 109 ? 23.039  32.320  201.636 1.00 67.24  ? 110 ASN A CG    1 
ATOM   1943 O OD1   . ASN I 3 109 ? 23.345  32.815  202.723 1.00 73.62  ? 110 ASN A OD1   1 
ATOM   1944 N ND2   . ASN I 3 109 ? 23.943  31.883  200.750 1.00 77.42  ? 110 ASN A ND2   1 
ATOM   1945 N N     . ASP I 3 110 ? 19.308  30.908  199.264 1.00 42.05  ? 111 ASP A N     1 
ATOM   1946 C CA    . ASP I 3 110 ? 17.889  30.927  199.068 1.00 36.87  ? 111 ASP A CA    1 
ATOM   1947 C C     . ASP I 3 110 ? 17.217  29.899  199.930 1.00 42.74  ? 111 ASP A C     1 
ATOM   1948 O O     . ASP I 3 110 ? 17.630  28.745  199.945 1.00 48.22  ? 111 ASP A O     1 
ATOM   1949 C CB    . ASP I 3 110 ? 17.569  30.708  197.607 1.00 37.21  ? 111 ASP A CB    1 
ATOM   1950 C CG    . ASP I 3 110 ? 17.855  31.942  196.776 1.00 57.22  ? 111 ASP A CG    1 
ATOM   1951 O OD1   . ASP I 3 110 ? 17.642  33.077  197.289 1.00 57.78  ? 111 ASP A OD1   1 
ATOM   1952 O OD2   . ASP I 3 110 ? 18.269  31.791  195.602 1.00 68.60  ? 111 ASP A OD2   1 
ATOM   1953 N N     . THR I 3 111 ? 16.198  30.335  200.673 1.00 46.91  ? 112 THR A N     1 
ATOM   1954 C CA    . THR I 3 111 ? 15.424  29.466  201.574 1.00 43.80  ? 112 THR A CA    1 
ATOM   1955 C C     . THR I 3 111 ? 14.728  28.317  200.853 1.00 44.57  ? 112 THR A C     1 
ATOM   1956 O O     . THR I 3 111 ? 15.034  27.157  201.065 1.00 48.43  ? 112 THR A O     1 
ATOM   1957 C CB    . THR I 3 111 ? 14.290  30.235  202.302 1.00 44.27  ? 112 THR A CB    1 
ATOM   1958 O OG1   . THR I 3 111 ? 14.837  31.237  203.173 1.00 41.13  ? 112 THR A OG1   1 
ATOM   1959 C CG2   . THR I 3 111 ? 13.438  29.253  203.107 1.00 29.51  ? 112 THR A CG2   1 
ATOM   1960 N N     . ALA I 3 112 ? 13.765  28.668  200.015 1.00 39.46  ? 113 ALA A N     1 
ATOM   1961 C CA    . ALA I 3 112 ? 12.991  27.690  199.299 1.00 34.35  ? 113 ALA A CA    1 
ATOM   1962 C C     . ALA I 3 112 ? 13.465  27.398  197.868 1.00 44.62  ? 113 ALA A C     1 
ATOM   1963 O O     . ALA I 3 112 ? 14.066  28.248  197.196 1.00 40.26  ? 113 ALA A O     1 
ATOM   1964 C CB    . ALA I 3 112 ? 11.547  28.139  199.282 1.00 36.75  ? 113 ALA A CB    1 
ATOM   1965 N N     . ASP I 3 113 ? 13.164  26.178  197.414 1.00 49.71  ? 114 ASP A N     1 
ATOM   1966 C CA    . ASP I 3 113 ? 13.492  25.701  196.071 1.00 43.18  ? 114 ASP A CA    1 
ATOM   1967 C C     . ASP I 3 113 ? 12.359  26.096  195.151 1.00 40.52  ? 114 ASP A C     1 
ATOM   1968 O O     . ASP I 3 113 ? 12.586  26.493  194.017 1.00 52.31  ? 114 ASP A O     1 
ATOM   1969 C CB    . ASP I 3 113 ? 13.622  24.181  196.040 1.00 37.00  ? 114 ASP A CB    1 
ATOM   1970 C CG    . ASP I 3 113 ? 14.910  23.684  196.656 1.00 61.40  ? 114 ASP A CG    1 
ATOM   1971 O OD1   . ASP I 3 113 ? 15.052  22.444  196.762 1.00 64.51  ? 114 ASP A OD1   1 
ATOM   1972 O OD2   . ASP I 3 113 ? 15.783  24.510  197.029 1.00 70.76  ? 114 ASP A OD2   1 
ATOM   1973 N N     . ILE I 3 114 ? 11.129  25.959  195.626 1.00 35.10  ? 115 ILE A N     1 
ATOM   1974 C CA    . ILE I 3 114 ? 9.991   26.347  194.811 1.00 33.34  ? 115 ILE A CA    1 
ATOM   1975 C C     . ILE I 3 114 ? 8.941   27.090  195.644 1.00 32.93  ? 115 ILE A C     1 
ATOM   1976 O O     . ILE I 3 114 ? 8.661   26.731  196.780 1.00 37.61  ? 115 ILE A O     1 
ATOM   1977 C CB    . ILE I 3 114 ? 9.357   25.105  194.102 1.00 35.64  ? 115 ILE A CB    1 
ATOM   1978 C CG1   . ILE I 3 114 ? 10.367  24.464  193.169 1.00 33.98  ? 115 ILE A CG1   1 
ATOM   1979 C CG2   . ILE I 3 114 ? 8.178   25.525  193.234 1.00 38.48  ? 115 ILE A CG2   1 
ATOM   1980 C CD1   . ILE I 3 114 ? 9.792   23.392  192.263 1.00 40.46  ? 115 ILE A CD1   1 
ATOM   1981 N N     . LEU I 3 115 ? 8.384   28.147  195.074 1.00 34.23  ? 116 LEU A N     1 
ATOM   1982 C CA    . LEU I 3 115 ? 7.347   28.926  195.741 1.00 38.23  ? 116 LEU A CA    1 
ATOM   1983 C C     . LEU I 3 115 ? 6.009   28.721  195.024 1.00 44.08  ? 116 LEU A C     1 
ATOM   1984 O O     . LEU I 3 115 ? 5.925   28.892  193.807 1.00 36.76  ? 116 LEU A O     1 
ATOM   1985 C CB    . LEU I 3 115 ? 7.653   30.422  195.672 1.00 34.56  ? 116 LEU A CB    1 
ATOM   1986 C CG    . LEU I 3 115 ? 8.291   31.228  196.793 1.00 23.17  ? 116 LEU A CG    1 
ATOM   1987 C CD1   . LEU I 3 115 ? 8.041   32.707  196.506 1.00 14.26  ? 116 LEU A CD1   1 
ATOM   1988 C CD2   . LEU I 3 115 ? 7.703   30.854  198.123 1.00 19.76  ? 116 LEU A CD2   1 
ATOM   1989 N N     . LEU I 3 116 ? 4.969   28.355  195.766 1.00 46.04  ? 117 LEU A N     1 
ATOM   1990 C CA    . LEU I 3 116 ? 3.636   28.207  195.187 1.00 44.99  ? 117 LEU A CA    1 
ATOM   1991 C C     . LEU I 3 116 ? 2.763   29.262  195.863 1.00 56.75  ? 117 LEU A C     1 
ATOM   1992 O O     . LEU I 3 116 ? 2.483   29.161  197.068 1.00 59.98  ? 117 LEU A O     1 
ATOM   1993 C CB    . LEU I 3 116 ? 3.091   26.822  195.476 1.00 31.83  ? 117 LEU A CB    1 
ATOM   1994 C CG    . LEU I 3 116 ? 4.015   25.740  194.935 1.00 38.88  ? 117 LEU A CG    1 
ATOM   1995 C CD1   . LEU I 3 116 ? 3.520   24.338  195.345 1.00 37.59  ? 117 LEU A CD1   1 
ATOM   1996 C CD2   . LEU I 3 116 ? 4.082   25.885  193.426 1.00 19.00  ? 117 LEU A CD2   1 
ATOM   1997 N N     . VAL I 3 117 ? 2.336   30.281  195.120 1.00 54.53  ? 118 VAL A N     1 
ATOM   1998 C CA    . VAL I 3 117 ? 1.512   31.315  195.749 1.00 61.29  ? 118 VAL A CA    1 
ATOM   1999 C C     . VAL I 3 117 ? 0.082   31.410  195.241 1.00 58.76  ? 118 VAL A C     1 
ATOM   2000 O O     . VAL I 3 117 ? -0.178  31.384  194.033 1.00 51.49  ? 118 VAL A O     1 
ATOM   2001 C CB    . VAL I 3 117 ? 2.149   32.705  195.610 1.00 62.34  ? 118 VAL A CB    1 
ATOM   2002 C CG1   . VAL I 3 117 ? 3.605   32.644  196.014 1.00 65.65  ? 118 VAL A CG1   1 
ATOM   2003 C CG2   . VAL I 3 117 ? 2.003   33.205  194.181 1.00 69.57  ? 118 VAL A CG2   1 
ATOM   2004 N N     . LYS I 3 118 ? -0.848  31.536  196.179 1.00 57.74  ? 119 LYS A N     1 
ATOM   2005 C CA    . LYS I 3 118 ? -2.249  31.658  195.816 1.00 62.26  ? 119 LYS A CA    1 
ATOM   2006 C C     . LYS I 3 118 ? -3.054  32.180  197.003 1.00 64.48  ? 119 LYS A C     1 
ATOM   2007 O O     . LYS I 3 118 ? -2.943  31.650  198.107 1.00 62.21  ? 119 LYS A O     1 
ATOM   2008 C CB    . LYS I 3 118 ? -2.786  30.301  195.368 1.00 61.48  ? 119 LYS A CB    1 
ATOM   2009 C CG    . LYS I 3 118 ? -4.077  30.372  194.584 1.00 63.76  ? 119 LYS A CG    1 
ATOM   2010 C CD    . LYS I 3 118 ? -4.808  29.024  194.530 1.00 57.41  ? 119 LYS A CD    1 
ATOM   2011 C CE    . LYS I 3 118 ? -6.011  29.128  193.606 1.00 60.79  ? 119 LYS A CE    1 
ATOM   2012 N NZ    . LYS I 3 118 ? -6.765  30.411  193.814 1.00 66.72  ? 119 LYS A NZ    1 
ATOM   2013 N N     . ASP I 3 119 ? -3.843  33.231  196.769 1.00 66.40  ? 120 ASP A N     1 
ATOM   2014 C CA    . ASP I 3 119 ? -4.683  33.844  197.800 1.00 69.09  ? 120 ASP A CA    1 
ATOM   2015 C C     . ASP I 3 119 ? -3.895  34.195  199.058 1.00 69.83  ? 120 ASP A C     1 
ATOM   2016 O O     . ASP I 3 119 ? -4.056  33.582  200.119 1.00 73.88  ? 120 ASP A O     1 
ATOM   2017 C CB    . ASP I 3 119 ? -5.835  32.903  198.144 1.00 69.37  ? 120 ASP A CB    1 
ATOM   2018 C CG    . ASP I 3 119 ? -6.639  32.515  196.925 1.00 74.44  ? 120 ASP A CG    1 
ATOM   2019 O OD1   . ASP I 3 119 ? -7.459  31.583  197.026 1.00 86.73  ? 120 ASP A OD1   1 
ATOM   2020 O OD2   . ASP I 3 119 ? -6.453  33.144  195.860 1.00 71.51  ? 120 ASP A OD2   1 
ATOM   2021 N N     . GLN I 3 120 ? -3.043  35.195  198.920 1.00 62.96  ? 121 GLN A N     1 
ATOM   2022 C CA    . GLN I 3 120 ? -2.208  35.657  200.002 1.00 68.82  ? 121 GLN A CA    1 
ATOM   2023 C C     . GLN I 3 120 ? -1.583  34.518  200.804 1.00 64.57  ? 121 GLN A C     1 
ATOM   2024 O O     . GLN I 3 120 ? -1.192  34.712  201.945 1.00 70.42  ? 121 GLN A O     1 
ATOM   2025 C CB    . GLN I 3 120 ? -3.014  36.564  200.931 1.00 83.40  ? 121 GLN A CB    1 
ATOM   2026 C CG    . GLN I 3 120 ? -2.177  37.619  201.642 1.00 97.41  ? 121 GLN A CG    1 
ATOM   2027 C CD    . GLN I 3 120 ? -1.674  38.693  200.696 1.00 105.34 ? 121 GLN A CD    1 
ATOM   2028 O OE1   . GLN I 3 120 ? -0.982  38.404  199.712 1.00 107.84 ? 121 GLN A OE1   1 
ATOM   2029 N NE2   . GLN I 3 120 ? -2.020  39.944  200.990 1.00 105.71 ? 121 GLN A NE2   1 
ATOM   2030 N N     . PHE I 3 121 ? -1.494  33.325  200.228 1.00 62.10  ? 122 PHE A N     1 
ATOM   2031 C CA    . PHE I 3 121 ? -0.870  32.212  200.948 1.00 57.53  ? 122 PHE A CA    1 
ATOM   2032 C C     . PHE I 3 121 ? 0.306   31.608  200.164 1.00 54.76  ? 122 PHE A C     1 
ATOM   2033 O O     . PHE I 3 121 ? 0.228   31.359  198.944 1.00 48.76  ? 122 PHE A O     1 
ATOM   2034 C CB    . PHE I 3 121 ? -1.897  31.137  201.268 1.00 57.60  ? 122 PHE A CB    1 
ATOM   2035 C CG    . PHE I 3 121 ? -1.445  30.169  202.318 1.00 58.18  ? 122 PHE A CG    1 
ATOM   2036 C CD1   . PHE I 3 121 ? -1.634  30.452  203.667 1.00 56.85  ? 122 PHE A CD1   1 
ATOM   2037 C CD2   . PHE I 3 121 ? -0.825  28.976  201.958 1.00 55.67  ? 122 PHE A CD2   1 
ATOM   2038 C CE1   . PHE I 3 121 ? -1.210  29.559  204.644 1.00 59.61  ? 122 PHE A CE1   1 
ATOM   2039 C CE2   . PHE I 3 121 ? -0.396  28.077  202.921 1.00 57.79  ? 122 PHE A CE2   1 
ATOM   2040 C CZ    . PHE I 3 121 ? -0.588  28.367  204.269 1.00 67.29  ? 122 PHE A CZ    1 
ATOM   2041 N N     . TYR I 3 122 ? 1.397   31.361  200.880 1.00 46.17  ? 123 TYR A N     1 
ATOM   2042 C CA    . TYR I 3 122 ? 2.608   30.843  200.255 1.00 46.43  ? 123 TYR A CA    1 
ATOM   2043 C C     . TYR I 3 122 ? 3.059   29.461  200.699 1.00 49.78  ? 123 TYR A C     1 
ATOM   2044 O O     . TYR I 3 122 ? 3.039   29.118  201.884 1.00 48.04  ? 123 TYR A O     1 
ATOM   2045 C CB    . TYR I 3 122 ? 3.769   31.803  200.512 1.00 39.39  ? 123 TYR A CB    1 
ATOM   2046 C CG    . TYR I 3 122 ? 3.535   33.216  200.046 1.00 50.02  ? 123 TYR A CG    1 
ATOM   2047 C CD1   . TYR I 3 122 ? 2.655   34.064  200.718 1.00 52.39  ? 123 TYR A CD1   1 
ATOM   2048 C CD2   . TYR I 3 122 ? 4.210   33.716  198.949 1.00 46.24  ? 123 TYR A CD2   1 
ATOM   2049 C CE1   . TYR I 3 122 ? 2.460   35.380  200.304 1.00 54.69  ? 123 TYR A CE1   1 
ATOM   2050 C CE2   . TYR I 3 122 ? 4.026   35.021  198.529 1.00 60.16  ? 123 TYR A CE2   1 
ATOM   2051 C CZ    . TYR I 3 122 ? 3.155   35.856  199.204 1.00 55.88  ? 123 TYR A CZ    1 
ATOM   2052 O OH    . TYR I 3 122 ? 3.009   37.159  198.770 1.00 44.30  ? 123 TYR A OH    1 
ATOM   2053 N N     . GLU I 3 123 ? 3.490   28.661  199.743 1.00 50.09  ? 124 GLU A N     1 
ATOM   2054 C CA    . GLU I 3 123 ? 4.009   27.355  200.098 1.00 46.75  ? 124 GLU A CA    1 
ATOM   2055 C C     . GLU I 3 123 ? 5.473   27.283  199.707 1.00 45.35  ? 124 GLU A C     1 
ATOM   2056 O O     . GLU I 3 123 ? 5.823   27.344  198.511 1.00 42.24  ? 124 GLU A O     1 
ATOM   2057 C CB    . GLU I 3 123 ? 3.252   26.244  199.389 1.00 45.79  ? 124 GLU A CB    1 
ATOM   2058 C CG    . GLU I 3 123 ? 3.684   24.868  199.844 1.00 47.00  ? 124 GLU A CG    1 
ATOM   2059 C CD    . GLU I 3 123 ? 2.964   23.763  199.113 1.00 50.86  ? 124 GLU A CD    1 
ATOM   2060 O OE1   . GLU I 3 123 ? 3.245   22.588  199.393 1.00 55.53  ? 124 GLU A OE1   1 
ATOM   2061 O OE2   . GLU I 3 123 ? 2.118   24.060  198.255 1.00 50.72  ? 124 GLU A OE2   1 
ATOM   2062 N N     . LEU I 3 124 ? 6.328   27.178  200.718 1.00 31.25  ? 125 LEU A N     1 
ATOM   2063 C CA    . LEU I 3 124 ? 7.758   27.057  200.479 1.00 34.29  ? 125 LEU A CA    1 
ATOM   2064 C C     . LEU I 3 124 ? 8.096   25.573  200.340 1.00 31.39  ? 125 LEU A C     1 
ATOM   2065 O O     . LEU I 3 124 ? 8.147   24.824  201.312 1.00 34.30  ? 125 LEU A O     1 
ATOM   2066 C CB    . LEU I 3 124 ? 8.552   27.691  201.625 1.00 38.31  ? 125 LEU A CB    1 
ATOM   2067 C CG    . LEU I 3 124 ? 8.792   29.201  201.559 1.00 36.60  ? 125 LEU A CG    1 
ATOM   2068 C CD1   . LEU I 3 124 ? 7.493   29.981  201.350 1.00 31.20  ? 125 LEU A CD1   1 
ATOM   2069 C CD2   . LEU I 3 124 ? 9.461   29.606  202.856 1.00 45.25  ? 125 LEU A CD2   1 
ATOM   2070 N N     . LEU I 3 125 ? 8.298   25.162  199.103 1.00 29.52  ? 126 LEU A N     1 
ATOM   2071 C CA    . LEU I 3 125 ? 8.596   23.790  198.790 1.00 33.21  ? 126 LEU A CA    1 
ATOM   2072 C C     . LEU I 3 125 ? 10.080  23.610  198.594 1.00 36.63  ? 126 LEU A C     1 
ATOM   2073 O O     . LEU I 3 125 ? 10.708  24.306  197.801 1.00 36.96  ? 126 LEU A O     1 
ATOM   2074 C CB    . LEU I 3 125 ? 7.863   23.392  197.523 1.00 32.65  ? 126 LEU A CB    1 
ATOM   2075 C CG    . LEU I 3 125 ? 8.202   21.981  197.063 1.00 41.03  ? 126 LEU A CG    1 
ATOM   2076 C CD1   . LEU I 3 125 ? 7.782   20.986  198.133 1.00 24.64  ? 126 LEU A CD1   1 
ATOM   2077 C CD2   . LEU I 3 125 ? 7.505   21.695  195.743 1.00 36.88  ? 126 LEU A CD2   1 
ATOM   2078 N N     . ASP I 3 126 ? 10.636  22.658  199.320 1.00 40.50  ? 127 ASP A N     1 
ATOM   2079 C CA    . ASP I 3 126 ? 12.058  22.374  199.249 1.00 43.46  ? 127 ASP A CA    1 
ATOM   2080 C C     . ASP I 3 126 ? 12.179  20.889  198.943 1.00 47.29  ? 127 ASP A C     1 
ATOM   2081 O O     . ASP I 3 126 ? 11.484  20.089  199.561 1.00 44.88  ? 127 ASP A O     1 
ATOM   2082 C CB    . ASP I 3 126 ? 12.689  22.679  200.599 1.00 41.32  ? 127 ASP A CB    1 
ATOM   2083 C CG    . ASP I 3 126 ? 14.173  22.769  200.529 1.00 53.91  ? 127 ASP A CG    1 
ATOM   2084 O OD1   . ASP I 3 126 ? 14.685  23.801  200.041 1.00 59.26  ? 127 ASP A OD1   1 
ATOM   2085 O OD2   . ASP I 3 126 ? 14.836  21.799  200.954 1.00 72.63  ? 127 ASP A OD2   1 
ATOM   2086 N N     . VAL I 3 127 ? 13.047  20.517  198.000 1.00 49.79  ? 128 VAL A N     1 
ATOM   2087 C CA    . VAL I 3 127 ? 13.210  19.106  197.636 1.00 46.66  ? 128 VAL A CA    1 
ATOM   2088 C C     . VAL I 3 127 ? 14.502  18.528  198.171 1.00 45.00  ? 128 VAL A C     1 
ATOM   2089 O O     . VAL I 3 127 ? 15.515  19.221  198.217 1.00 42.40  ? 128 VAL A O     1 
ATOM   2090 C CB    . VAL I 3 127 ? 13.197  18.898  196.102 1.00 46.13  ? 128 VAL A CB    1 
ATOM   2091 C CG1   . VAL I 3 127 ? 12.262  19.899  195.448 1.00 35.03  ? 128 VAL A CG1   1 
ATOM   2092 C CG2   . VAL I 3 127 ? 14.594  19.016  195.548 1.00 54.18  ? 128 VAL A CG2   1 
ATOM   2093 N N     . LYS I 3 128 ? 14.460  17.266  198.597 1.00 49.14  ? 129 LYS A N     1 
ATOM   2094 C CA    . LYS I 3 128 ? 15.662  16.600  199.107 1.00 53.73  ? 129 LYS A CA    1 
ATOM   2095 C C     . LYS I 3 128 ? 15.890  15.383  198.240 1.00 50.29  ? 129 LYS A C     1 
ATOM   2096 O O     . LYS I 3 128 ? 15.019  14.535  198.129 1.00 60.45  ? 129 LYS A O     1 
ATOM   2097 C CB    . LYS I 3 128 ? 15.499  16.154  200.564 1.00 47.17  ? 129 LYS A CB    1 
ATOM   2098 C CG    . LYS I 3 128 ? 15.020  17.237  201.523 1.00 35.62  ? 129 LYS A CG    1 
ATOM   2099 C CD    . LYS I 3 128 ? 16.054  18.297  201.816 1.00 30.96  ? 129 LYS A CD    1 
ATOM   2100 C CE    . LYS I 3 128 ? 15.438  19.378  202.706 1.00 45.27  ? 129 LYS A CE    1 
ATOM   2101 N NZ    . LYS I 3 128 ? 16.342  20.534  203.074 1.00 34.74  ? 129 LYS A NZ    1 
ATOM   2102 N N     . THR I 3 129 ? 17.055  15.310  197.613 1.00 47.80  ? 130 THR A N     1 
ATOM   2103 C CA    . THR I 3 129 ? 17.379  14.188  196.751 1.00 50.42  ? 130 THR A CA    1 
ATOM   2104 C C     . THR I 3 129 ? 18.303  13.244  197.501 1.00 56.56  ? 130 THR A C     1 
ATOM   2105 O O     . THR I 3 129 ? 19.406  13.637  197.912 1.00 50.09  ? 130 THR A O     1 
ATOM   2106 C CB    . THR I 3 129 ? 18.103  14.626  195.494 1.00 49.68  ? 130 THR A CB    1 
ATOM   2107 O OG1   . THR I 3 129 ? 19.377  15.167  195.850 1.00 38.55  ? 130 THR A OG1   1 
ATOM   2108 C CG2   . THR I 3 129 ? 17.298  15.640  194.760 1.00 46.79  ? 130 THR A CG2   1 
ATOM   2109 N N     . ARG I 3 130 ? 17.849  11.995  197.642 1.00 56.10  ? 131 ARG A N     1 
ATOM   2110 C CA    . ARG I 3 130 ? 18.579  10.944  198.352 1.00 57.49  ? 131 ARG A CA    1 
ATOM   2111 C C     . ARG I 3 130 ? 19.077  9.852   197.418 1.00 60.37  ? 131 ARG A C     1 
ATOM   2112 O O     . ARG I 3 130 ? 18.315  9.257   196.649 1.00 64.92  ? 131 ARG A O     1 
ATOM   2113 C CB    . ARG I 3 130 ? 17.676  10.321  199.439 1.00 53.49  ? 131 ARG A CB    1 
ATOM   2114 C CG    . ARG I 3 130 ? 18.294  9.216   200.338 1.00 42.77  ? 131 ARG A CG    1 
ATOM   2115 C CD    . ARG I 3 130 ? 17.229  8.667   201.336 1.00 51.61  ? 131 ARG A CD    1 
ATOM   2116 N NE    . ARG I 3 130 ? 17.762  7.860   202.452 1.00 56.48  ? 131 ARG A NE    1 
ATOM   2117 C CZ    . ARG I 3 130 ? 17.061  7.506   203.540 1.00 59.81  ? 131 ARG A CZ    1 
ATOM   2118 N NH1   . ARG I 3 130 ? 15.791  7.880   203.679 1.00 52.65  ? 131 ARG A NH1   1 
ATOM   2119 N NH2   . ARG I 3 130 ? 17.622  6.777   204.501 1.00 51.00  ? 131 ARG A NH2   1 
ATOM   2120 N N     . ASN I 3 131 ? 20.374  9.609   197.508 1.00 59.40  ? 132 ASN A N     1 
ATOM   2121 C CA    . ASN I 3 131 ? 21.044  8.578   196.746 1.00 60.89  ? 132 ASN A CA    1 
ATOM   2122 C C     . ASN I 3 131 ? 20.715  7.282   197.483 1.00 58.19  ? 132 ASN A C     1 
ATOM   2123 O O     . ASN I 3 131 ? 21.513  6.787   198.262 1.00 57.95  ? 132 ASN A O     1 
ATOM   2124 C CB    . ASN I 3 131 ? 22.542  8.835   196.796 1.00 65.59  ? 132 ASN A CB    1 
ATOM   2125 C CG    . ASN I 3 131 ? 23.322  7.846   195.993 1.00 69.48  ? 132 ASN A CG    1 
ATOM   2126 O OD1   . ASN I 3 131 ? 22.879  6.711   195.781 1.00 65.95  ? 132 ASN A OD1   1 
ATOM   2127 N ND2   . ASN I 3 131 ? 24.505  8.259   195.542 1.00 68.09  ? 132 ASN A ND2   1 
ATOM   2128 N N     . ILE I 3 132 ? 19.534  6.743   197.231 1.00 61.02  ? 133 ILE A N     1 
ATOM   2129 C CA    . ILE I 3 132 ? 19.064  5.539   197.897 1.00 63.00  ? 133 ILE A CA    1 
ATOM   2130 C C     . ILE I 3 132 ? 20.007  4.310   197.838 1.00 62.91  ? 133 ILE A C     1 
ATOM   2131 O O     . ILE I 3 132 ? 19.786  3.326   198.547 1.00 59.89  ? 133 ILE A O     1 
ATOM   2132 C CB    . ILE I 3 132 ? 17.649  5.194   197.356 1.00 68.09  ? 133 ILE A CB    1 
ATOM   2133 C CG1   . ILE I 3 132 ? 16.896  4.356   198.380 1.00 86.79  ? 133 ILE A CG1   1 
ATOM   2134 C CG2   . ILE I 3 132 ? 17.742  4.500   196.001 1.00 67.00  ? 133 ILE A CG2   1 
ATOM   2135 C CD1   . ILE I 3 132 ? 16.690  5.084   199.703 1.00 92.61  ? 133 ILE A CD1   1 
ATOM   2136 N N     . SER I 3 133 ? 21.055  4.372   197.009 1.00 62.98  ? 134 SER A N     1 
ATOM   2137 C CA    . SER I 3 133 ? 22.046  3.283   196.873 1.00 57.82  ? 134 SER A CA    1 
ATOM   2138 C C     . SER I 3 133 ? 22.918  3.149   198.119 1.00 59.59  ? 134 SER A C     1 
ATOM   2139 O O     . SER I 3 133 ? 24.085  2.769   198.040 1.00 63.27  ? 134 SER A O     1 
ATOM   2140 C CB    . SER I 3 133 ? 22.980  3.533   195.682 1.00 49.99  ? 134 SER A CB    1 
ATOM   2141 O OG    . SER I 3 133 ? 22.413  3.072   194.474 1.00 62.66  ? 134 SER A OG    1 
ATOM   2142 N N     . LYS I 3 134 ? 22.357  3.486   199.268 1.00 63.93  ? 135 LYS A N     1 
ATOM   2143 C CA    . LYS I 3 134 ? 23.086  3.410   200.525 1.00 61.17  ? 135 LYS A CA    1 
ATOM   2144 C C     . LYS I 3 134 ? 22.234  3.990   201.628 1.00 62.01  ? 135 LYS A C     1 
ATOM   2145 O O     . LYS I 3 134 ? 21.062  4.333   201.425 1.00 63.06  ? 135 LYS A O     1 
ATOM   2146 C CB    . LYS I 3 134 ? 24.386  4.193   200.452 1.00 57.05  ? 135 LYS A CB    1 
ATOM   2147 C CG    . LYS I 3 134 ? 24.177  5.676   200.320 1.00 53.41  ? 135 LYS A CG    1 
ATOM   2148 C CD    . LYS I 3 134 ? 25.492  6.402   200.423 1.00 55.10  ? 135 LYS A CD    1 
ATOM   2149 C CE    . LYS I 3 134 ? 26.395  6.118   199.250 1.00 34.92  ? 135 LYS A CE    1 
ATOM   2150 N NZ    . LYS I 3 134 ? 27.755  6.565   199.623 1.00 25.19  ? 135 LYS A NZ    1 
ATOM   2151 N N     . SER I 3 135 ? 22.829  4.114   202.800 1.00 58.91  ? 136 SER A N     1 
ATOM   2152 C CA    . SER I 3 135 ? 22.088  4.632   203.932 1.00 61.57  ? 136 SER A CA    1 
ATOM   2153 C C     . SER I 3 135 ? 22.946  5.653   204.637 1.00 59.90  ? 136 SER A C     1 
ATOM   2154 O O     . SER I 3 135 ? 23.915  5.318   205.318 1.00 64.45  ? 136 SER A O     1 
ATOM   2155 C CB    . SER I 3 135 ? 21.707  3.484   204.869 1.00 51.06  ? 136 SER A CB    1 
ATOM   2156 O OG    . SER I 3 135 ? 20.861  3.949   205.896 1.00 63.45  ? 136 SER A OG    1 
ATOM   2157 N N     . ALA I 3 136 ? 22.589  6.913   204.468 1.00 56.48  ? 137 ALA A N     1 
ATOM   2158 C CA    . ALA I 3 136 ? 23.378  7.960   205.075 1.00 59.50  ? 137 ALA A CA    1 
ATOM   2159 C C     . ALA I 3 136 ? 22.638  8.732   206.125 1.00 53.34  ? 137 ALA A C     1 
ATOM   2160 O O     . ALA I 3 136 ? 21.429  8.597   206.291 1.00 46.71  ? 137 ALA A O     1 
ATOM   2161 C CB    . ALA I 3 136 ? 23.878  8.918   204.014 1.00 70.37  ? 137 ALA A CB    1 
ATOM   2162 N N     . GLN I 3 137 ? 23.399  9.559   206.822 1.00 47.78  ? 138 GLN A N     1 
ATOM   2163 C CA    . GLN I 3 137 ? 22.853  10.389  207.854 1.00 41.45  ? 138 GLN A CA    1 
ATOM   2164 C C     . GLN I 3 137 ? 21.705  11.229  207.304 1.00 44.43  ? 138 GLN A C     1 
ATOM   2165 O O     . GLN I 3 137 ? 21.480  11.334  206.081 1.00 31.38  ? 138 GLN A O     1 
ATOM   2166 C CB    . GLN I 3 137 ? 23.955  11.285  208.422 1.00 42.22  ? 138 GLN A CB    1 
ATOM   2167 C CG    . GLN I 3 137 ? 23.545  12.029  209.673 1.00 48.48  ? 138 GLN A CG    1 
ATOM   2168 C CD    . GLN I 3 137 ? 24.703  12.681  210.390 1.00 47.47  ? 138 GLN A CD    1 
ATOM   2169 O OE1   . GLN I 3 137 ? 25.873  12.472  210.047 1.00 41.08  ? 138 GLN A OE1   1 
ATOM   2170 N NE2   . GLN I 3 137 ? 24.383  13.468  211.408 1.00 37.57  ? 138 GLN A NE2   1 
ATOM   2171 N N     . ALA I 3 138 ? 20.964  11.819  208.235 1.00 54.84  ? 139 ALA A N     1 
ATOM   2172 C CA    . ALA I 3 138 ? 19.828  12.672  207.912 1.00 51.01  ? 139 ALA A CA    1 
ATOM   2173 C C     . ALA I 3 138 ? 20.303  13.953  207.241 1.00 43.09  ? 139 ALA A C     1 
ATOM   2174 O O     . ALA I 3 138 ? 21.233  14.624  207.695 1.00 47.15  ? 139 ALA A O     1 
ATOM   2175 C CB    . ALA I 3 138 ? 19.055  12.993  209.183 1.00 52.21  ? 139 ALA A CB    1 
ATOM   2176 N N     . PRO I 3 139 ? 19.677  14.296  206.129 1.00 30.45  ? 140 PRO A N     1 
ATOM   2177 C CA    . PRO I 3 139 ? 20.023  15.504  205.377 1.00 22.15  ? 140 PRO A CA    1 
ATOM   2178 C C     . PRO I 3 139 ? 19.688  16.800  206.079 1.00 24.72  ? 140 PRO A C     1 
ATOM   2179 O O     . PRO I 3 139 ? 18.713  16.892  206.812 1.00 28.66  ? 140 PRO A O     1 
ATOM   2180 C CB    . PRO I 3 139 ? 19.208  15.368  204.096 1.00 16.56  ? 140 PRO A CB    1 
ATOM   2181 C CG    . PRO I 3 139 ? 18.048  14.531  204.526 1.00 36.71  ? 140 PRO A CG    1 
ATOM   2182 C CD    . PRO I 3 139 ? 18.694  13.484  205.409 1.00 22.99  ? 140 PRO A CD    1 
ATOM   2183 N N     . ASN I 3 140 ? 20.517  17.804  205.849 1.00 25.00  ? 141 ASN A N     1 
ATOM   2184 C CA    . ASN I 3 140 ? 20.255  19.093  206.409 1.00 16.40  ? 141 ASN A CA    1 
ATOM   2185 C C     . ASN I 3 140 ? 18.890  19.423  205.863 1.00 18.75  ? 141 ASN A C     1 
ATOM   2186 O O     . ASN I 3 140 ? 18.690  19.304  204.654 1.00 13.11  ? 141 ASN A O     1 
ATOM   2187 C CB    . ASN I 3 140 ? 21.240  20.119  205.879 1.00 18.60  ? 141 ASN A CB    1 
ATOM   2188 C CG    . ASN I 3 140 ? 22.577  20.031  206.538 1.00 31.85  ? 141 ASN A CG    1 
ATOM   2189 O OD1   . ASN I 3 140 ? 22.760  19.252  207.453 1.00 53.59  ? 141 ASN A OD1   1 
ATOM   2190 N ND2   . ASN I 3 140 ? 23.526  20.839  206.087 1.00 29.72  ? 141 ASN A ND2   1 
ATOM   2191 N N     . ILE I 3 141 ? 17.949  19.812  206.726 1.00 17.23  ? 142 ILE A N     1 
ATOM   2192 C CA    . ILE I 3 141 ? 16.638  20.177  206.226 1.00 27.58  ? 142 ILE A CA    1 
ATOM   2193 C C     . ILE I 3 141 ? 16.466  21.678  206.141 1.00 32.58  ? 142 ILE A C     1 
ATOM   2194 O O     . ILE I 3 141 ? 16.098  22.184  205.085 1.00 37.80  ? 142 ILE A O     1 
ATOM   2195 C CB    . ILE I 3 141 ? 15.501  19.572  207.055 1.00 32.81  ? 142 ILE A CB    1 
ATOM   2196 C CG1   . ILE I 3 141 ? 14.820  18.469  206.235 1.00 34.07  ? 142 ILE A CG1   1 
ATOM   2197 C CG2   . ILE I 3 141 ? 14.445  20.626  207.366 1.00 35.75  ? 142 ILE A CG2   1 
ATOM   2198 C CD1   . ILE I 3 141 ? 15.709  17.333  205.931 1.00 16.36  ? 142 ILE A CD1   1 
ATOM   2199 N N     . ILE I 3 142 ? 16.741  22.380  207.245 1.00 38.18  ? 143 ILE A N     1 
ATOM   2200 C CA    . ILE I 3 142 ? 16.627  23.845  207.327 1.00 28.53  ? 143 ILE A CA    1 
ATOM   2201 C C     . ILE I 3 142 ? 17.348  24.366  208.581 1.00 35.62  ? 143 ILE A C     1 
ATOM   2202 O O     . ILE I 3 142 ? 17.616  23.617  209.533 1.00 38.66  ? 143 ILE A O     1 
ATOM   2203 C CB    . ILE I 3 142 ? 15.153  24.269  207.364 1.00 29.99  ? 143 ILE A CB    1 
ATOM   2204 C CG1   . ILE I 3 142 ? 15.021  25.773  207.159 1.00 43.85  ? 143 ILE A CG1   1 
ATOM   2205 C CG2   . ILE I 3 142 ? 14.531  23.898  208.682 1.00 35.47  ? 143 ILE A CG2   1 
ATOM   2206 C CD1   . ILE I 3 142 ? 13.575  26.250  206.966 1.00 29.17  ? 143 ILE A CD1   1 
ATOM   2207 N N     . SER I 3 143 ? 17.681  25.649  208.604 1.00 37.30  ? 144 SER A N     1 
ATOM   2208 C CA    . SER I 3 143 ? 18.398  26.162  209.766 1.00 38.38  ? 144 SER A CA    1 
ATOM   2209 C C     . SER I 3 143 ? 17.580  26.275  211.033 1.00 33.59  ? 144 SER A C     1 
ATOM   2210 O O     . SER I 3 143 ? 16.532  26.883  211.048 1.00 38.21  ? 144 SER A O     1 
ATOM   2211 C CB    . SER I 3 143 ? 19.010  27.526  209.478 1.00 39.76  ? 144 SER A CB    1 
ATOM   2212 O OG    . SER I 3 143 ? 19.590  28.047  210.672 1.00 46.51  ? 144 SER A OG    1 
ATOM   2213 N N     . ALA I 3 144 ? 18.078  25.700  212.110 1.00 33.94  ? 145 ALA A N     1 
ATOM   2214 C CA    . ALA I 3 144 ? 17.367  25.801  213.360 1.00 41.91  ? 145 ALA A CA    1 
ATOM   2215 C C     . ALA I 3 144 ? 17.273  27.267  213.761 1.00 46.25  ? 145 ALA A C     1 
ATOM   2216 O O     . ALA I 3 144 ? 16.278  27.703  214.357 1.00 46.33  ? 145 ALA A O     1 
ATOM   2217 C CB    . ALA I 3 144 ? 18.082  25.020  214.449 1.00 42.32  ? 145 ALA A CB    1 
ATOM   2218 N N     . TYR I 3 145 ? 18.314  28.027  213.434 1.00 47.02  ? 146 TYR A N     1 
ATOM   2219 C CA    . TYR I 3 145 ? 18.360  29.450  213.773 1.00 53.44  ? 146 TYR A CA    1 
ATOM   2220 C C     . TYR I 3 145 ? 17.405  30.249  212.897 1.00 48.16  ? 146 TYR A C     1 
ATOM   2221 O O     . TYR I 3 145 ? 16.617  31.048  213.389 1.00 49.77  ? 146 TYR A O     1 
ATOM   2222 C CB    . TYR I 3 145 ? 19.786  29.967  213.623 1.00 64.53  ? 146 TYR A CB    1 
ATOM   2223 C CG    . TYR I 3 145 ? 19.948  31.376  214.079 1.00 65.22  ? 146 TYR A CG    1 
ATOM   2224 C CD1   . TYR I 3 145 ? 19.452  31.791  215.312 1.00 61.13  ? 146 TYR A CD1   1 
ATOM   2225 C CD2   . TYR I 3 145 ? 20.567  32.305  213.270 1.00 64.33  ? 146 TYR A CD2   1 
ATOM   2226 C CE1   . TYR I 3 145 ? 19.570  33.114  215.716 1.00 67.09  ? 146 TYR A CE1   1 
ATOM   2227 C CE2   . TYR I 3 145 ? 20.692  33.622  213.665 1.00 71.86  ? 146 TYR A CE2   1 
ATOM   2228 C CZ    . TYR I 3 145 ? 20.197  34.027  214.882 1.00 63.32  ? 146 TYR A CZ    1 
ATOM   2229 O OH    . TYR I 3 145 ? 20.358  35.338  215.258 1.00 60.39  ? 146 TYR A OH    1 
ATOM   2230 N N     . LYS I 3 146 ? 17.487  30.035  211.595 1.00 40.87  ? 147 LYS A N     1 
ATOM   2231 C CA    . LYS I 3 146 ? 16.567  30.689  210.704 1.00 36.06  ? 147 LYS A CA    1 
ATOM   2232 C C     . LYS I 3 146 ? 15.135  30.275  211.058 1.00 39.16  ? 147 LYS A C     1 
ATOM   2233 O O     . LYS I 3 146 ? 14.191  31.020  210.803 1.00 40.92  ? 147 LYS A O     1 
ATOM   2234 C CB    . LYS I 3 146 ? 16.819  30.286  209.268 1.00 28.26  ? 147 LYS A CB    1 
ATOM   2235 C CG    . LYS I 3 146 ? 15.797  30.907  208.358 1.00 38.70  ? 147 LYS A CG    1 
ATOM   2236 C CD    . LYS I 3 146 ? 15.927  30.418  206.948 1.00 44.93  ? 147 LYS A CD    1 
ATOM   2237 C CE    . LYS I 3 146 ? 17.325  30.584  206.416 1.00 25.33  ? 147 LYS A CE    1 
ATOM   2238 N NZ    . LYS I 3 146 ? 17.284  30.118  205.022 1.00 25.56  ? 147 LYS A NZ    1 
ATOM   2239 N N     . LEU I 3 147 ? 14.963  29.079  211.623 1.00 41.94  ? 148 LEU A N     1 
ATOM   2240 C CA    . LEU I 3 147 ? 13.622  28.614  211.978 1.00 43.97  ? 148 LEU A CA    1 
ATOM   2241 C C     . LEU I 3 147 ? 13.159  29.380  213.212 1.00 46.33  ? 148 LEU A C     1 
ATOM   2242 O O     . LEU I 3 147 ? 12.033  29.906  213.236 1.00 33.02  ? 148 LEU A O     1 
ATOM   2243 C CB    . LEU I 3 147 ? 13.598  27.100  212.262 1.00 36.79  ? 148 LEU A CB    1 
ATOM   2244 C CG    . LEU I 3 147 ? 12.484  26.274  211.584 1.00 36.37  ? 148 LEU A CG    1 
ATOM   2245 C CD1   . LEU I 3 147 ? 12.170  25.064  212.436 1.00 37.63  ? 148 LEU A CD1   1 
ATOM   2246 C CD2   . LEU I 3 147 ? 11.211  27.096  211.403 1.00 29.24  ? 148 LEU A CD2   1 
ATOM   2247 N N     . ALA I 3 148 ? 14.049  29.445  214.213 1.00 40.30  ? 149 ALA A N     1 
ATOM   2248 C CA    . ALA I 3 148 ? 13.819  30.154  215.481 1.00 34.39  ? 149 ALA A CA    1 
ATOM   2249 C C     . ALA I 3 148 ? 13.463  31.625  215.251 1.00 39.77  ? 149 ALA A C     1 
ATOM   2250 O O     . ALA I 3 148 ? 12.488  32.144  215.828 1.00 31.05  ? 149 ALA A O     1 
ATOM   2251 C CB    . ALA I 3 148 ? 15.038  30.061  216.342 1.00 38.97  ? 149 ALA A CB    1 
ATOM   2252 N N     . GLN I 3 149 ? 14.256  32.283  214.406 1.00 33.02  ? 150 GLN A N     1 
ATOM   2253 C CA    . GLN I 3 149 ? 14.004  33.668  214.065 1.00 41.68  ? 150 GLN A CA    1 
ATOM   2254 C C     . GLN I 3 149 ? 12.657  33.759  213.377 1.00 48.05  ? 150 GLN A C     1 
ATOM   2255 O O     . GLN I 3 149 ? 11.862  34.646  213.673 1.00 49.51  ? 150 GLN A O     1 
ATOM   2256 C CB    . GLN I 3 149 ? 15.055  34.210  213.108 1.00 41.74  ? 150 GLN A CB    1 
ATOM   2257 C CG    . GLN I 3 149 ? 16.478  34.166  213.627 1.00 59.28  ? 150 GLN A CG    1 
ATOM   2258 C CD    . GLN I 3 149 ? 17.453  34.762  212.638 1.00 66.28  ? 150 GLN A CD    1 
ATOM   2259 O OE1   . GLN I 3 149 ? 17.522  35.980  212.477 1.00 65.97  ? 150 GLN A OE1   1 
ATOM   2260 N NE2   . GLN I 3 149 ? 18.191  33.898  211.937 1.00 79.90  ? 150 GLN A NE2   1 
ATOM   2261 N N     . THR I 3 150 ? 12.397  32.841  212.453 1.00 52.50  ? 151 THR A N     1 
ATOM   2262 C CA    . THR I 3 150 ? 11.127  32.879  211.744 1.00 52.50  ? 151 THR A CA    1 
ATOM   2263 C C     . THR I 3 150 ? 9.970   32.778  212.724 1.00 56.15  ? 151 THR A C     1 
ATOM   2264 O O     . THR I 3 150 ? 8.983   33.499  212.610 1.00 53.23  ? 151 THR A O     1 
ATOM   2265 C CB    . THR I 3 150 ? 10.976  31.737  210.717 1.00 43.43  ? 151 THR A CB    1 
ATOM   2266 O OG1   . THR I 3 150 ? 11.999  31.834  209.718 1.00 40.66  ? 151 THR A OG1   1 
ATOM   2267 C CG2   . THR I 3 150 ? 9.615   31.844  210.035 1.00 35.54  ? 151 THR A CG2   1 
ATOM   2268 N N     . CYS I 3 151 ? 10.077  31.887  213.696 1.00 56.65  ? 152 CYS A N     1 
ATOM   2269 C CA    . CYS I 3 151 ? 8.984   31.757  214.632 1.00 57.22  ? 152 CYS A CA    1 
ATOM   2270 C C     . CYS I 3 151 ? 8.749   33.065  215.366 1.00 59.08  ? 152 CYS A C     1 
ATOM   2271 O O     . CYS I 3 151 ? 7.620   33.552  215.419 1.00 51.67  ? 152 CYS A O     1 
ATOM   2272 C CB    . CYS I 3 151 ? 9.260   30.613  215.595 1.00 60.72  ? 152 CYS A CB    1 
ATOM   2273 S SG    . CYS I 3 151 ? 8.879   29.060  214.837 1.00 37.72  ? 152 CYS A SG    1 
ATOM   2274 N N     . ALA I 3 152 ? 9.821   33.639  215.910 1.00 57.90  ? 153 ALA A N     1 
ATOM   2275 C CA    . ALA I 3 152 ? 9.746   34.914  216.625 1.00 51.58  ? 153 ALA A CA    1 
ATOM   2276 C C     . ALA I 3 152 ? 9.030   36.004  215.799 1.00 51.18  ? 153 ALA A C     1 
ATOM   2277 O O     . ALA I 3 152 ? 8.196   36.718  216.338 1.00 54.90  ? 153 ALA A O     1 
ATOM   2278 C CB    . ALA I 3 152 ? 11.133  35.370  216.983 1.00 60.15  ? 153 ALA A CB    1 
ATOM   2279 N N     . LYS I 3 153 ? 9.364   36.124  214.510 1.00 36.12  ? 154 LYS A N     1 
ATOM   2280 C CA    . LYS I 3 153 ? 8.733   37.091  213.622 1.00 37.70  ? 154 LYS A CA    1 
ATOM   2281 C C     . LYS I 3 153 ? 7.253   36.750  213.547 1.00 48.80  ? 154 LYS A C     1 
ATOM   2282 O O     . LYS I 3 153 ? 6.384   37.628  213.468 1.00 45.42  ? 154 LYS A O     1 
ATOM   2283 C CB    . LYS I 3 153 ? 9.303   36.998  212.198 1.00 40.50  ? 154 LYS A CB    1 
ATOM   2284 C CG    . LYS I 3 153 ? 10.461  37.937  211.829 1.00 50.39  ? 154 LYS A CG    1 
ATOM   2285 C CD    . LYS I 3 153 ? 11.712  37.735  212.671 1.00 62.80  ? 154 LYS A CD    1 
ATOM   2286 C CE    . LYS I 3 153 ? 12.838  38.638  212.190 1.00 65.57  ? 154 LYS A CE    1 
ATOM   2287 N NZ    . LYS I 3 153 ? 13.100  38.419  210.742 1.00 65.80  ? 154 LYS A NZ    1 
ATOM   2288 N N     . MET I 3 154 ? 6.968   35.453  213.542 1.00 56.18  ? 155 MET A N     1 
ATOM   2289 C CA    . MET I 3 154 ? 5.586   34.997  213.475 1.00 59.16  ? 155 MET A CA    1 
ATOM   2290 C C     . MET I 3 154 ? 4.809   35.510  214.694 1.00 59.21  ? 155 MET A C     1 
ATOM   2291 O O     . MET I 3 154 ? 3.832   36.242  214.551 1.00 57.63  ? 155 MET A O     1 
ATOM   2292 C CB    . MET I 3 154 ? 5.522   33.464  213.433 1.00 64.62  ? 155 MET A CB    1 
ATOM   2293 C CG    . MET I 3 154 ? 5.635   32.836  212.052 1.00 63.33  ? 155 MET A CG    1 
ATOM   2294 S SD    . MET I 3 154 ? 5.393   31.059  212.178 1.00 44.87  ? 155 MET A SD    1 
ATOM   2295 C CE    . MET I 3 154 ? 3.645   30.899  211.781 1.00 65.29  ? 155 MET A CE    1 
ATOM   2296 N N     . ILE I 3 155 ? 5.246   35.113  215.888 1.00 53.94  ? 156 ILE A N     1 
ATOM   2297 C CA    . ILE I 3 155 ? 4.598   35.534  217.116 1.00 44.75  ? 156 ILE A CA    1 
ATOM   2298 C C     . ILE I 3 155 ? 4.463   37.035  217.089 1.00 46.29  ? 156 ILE A C     1 
ATOM   2299 O O     . ILE I 3 155 ? 3.360   37.534  216.926 1.00 56.21  ? 156 ILE A O     1 
ATOM   2300 C CB    . ILE I 3 155 ? 5.403   35.089  218.326 1.00 44.57  ? 156 ILE A CB    1 
ATOM   2301 C CG1   . ILE I 3 155 ? 5.418   33.557  218.349 1.00 51.71  ? 156 ILE A CG1   1 
ATOM   2302 C CG2   . ILE I 3 155 ? 4.813   35.669  219.612 1.00 36.73  ? 156 ILE A CG2   1 
ATOM   2303 C CD1   . ILE I 3 155 ? 6.604   32.945  219.057 1.00 56.26  ? 156 ILE A CD1   1 
ATOM   2304 N N     . ASP I 3 156 ? 5.569   37.761  217.221 1.00 45.00  ? 157 ASP A N     1 
ATOM   2305 C CA    . ASP I 3 156 ? 5.526   39.231  217.181 1.00 38.17  ? 157 ASP A CA    1 
ATOM   2306 C C     . ASP I 3 156 ? 4.485   39.683  216.139 1.00 40.88  ? 157 ASP A C     1 
ATOM   2307 O O     . ASP I 3 156 ? 3.334   39.892  216.486 1.00 32.13  ? 157 ASP A O     1 
ATOM   2308 C CB    . ASP I 3 156 ? 6.920   39.769  216.831 1.00 39.61  ? 157 ASP A CB    1 
ATOM   2309 C CG    . ASP I 3 156 ? 7.977   39.396  217.880 1.00 49.14  ? 157 ASP A CG    1 
ATOM   2310 O OD1   . ASP I 3 156 ? 9.206   39.463  217.588 1.00 42.45  ? 157 ASP A OD1   1 
ATOM   2311 O OD2   . ASP I 3 156 ? 7.569   39.042  219.004 1.00 44.20  ? 157 ASP A OD2   1 
ATOM   2312 N N     . ASN I 3 157 ? 4.892   39.810  214.874 1.00 43.57  ? 158 ASN A N     1 
ATOM   2313 C CA    . ASN I 3 157 ? 4.012   40.211  213.769 1.00 42.85  ? 158 ASN A CA    1 
ATOM   2314 C C     . ASN I 3 157 ? 2.688   39.431  213.630 1.00 45.66  ? 158 ASN A C     1 
ATOM   2315 O O     . ASN I 3 157 ? 1.836   39.773  212.793 1.00 48.19  ? 158 ASN A O     1 
ATOM   2316 C CB    . ASN I 3 157 ? 4.787   40.109  212.457 1.00 54.16  ? 158 ASN A CB    1 
ATOM   2317 C CG    . ASN I 3 157 ? 5.778   41.245  212.274 1.00 62.57  ? 158 ASN A CG    1 
ATOM   2318 O OD1   . ASN I 3 157 ? 5.406   42.335  211.835 1.00 72.74  ? 158 ASN A OD1   1 
ATOM   2319 N ND2   . ASN I 3 157 ? 7.041   41.004  212.623 1.00 52.02  ? 158 ASN A ND2   1 
ATOM   2320 N N     . LYS I 3 158 ? 2.533   38.390  214.450 1.00 46.61  ? 159 LYS A N     1 
ATOM   2321 C CA    . LYS I 3 158 ? 1.351   37.517  214.482 1.00 43.73  ? 159 LYS A CA    1 
ATOM   2322 C C     . LYS I 3 158 ? 0.795   37.135  213.099 1.00 42.49  ? 159 LYS A C     1 
ATOM   2323 O O     . LYS I 3 158 ? -0.344  37.449  212.756 1.00 38.81  ? 159 LYS A O     1 
ATOM   2324 C CB    . LYS I 3 158 ? 0.259   38.163  215.347 1.00 38.91  ? 159 LYS A CB    1 
ATOM   2325 N N     . GLU I 3 159 ? 1.623   36.455  212.312 1.00 45.62  ? 160 GLU A N     1 
ATOM   2326 C CA    . GLU I 3 159 ? 1.243   35.996  210.982 1.00 49.35  ? 160 GLU A CA    1 
ATOM   2327 C C     . GLU I 3 159 ? 1.225   34.473  211.050 1.00 56.69  ? 160 GLU A C     1 
ATOM   2328 O O     . GLU I 3 159 ? 2.150   33.810  210.586 1.00 59.99  ? 160 GLU A O     1 
ATOM   2329 C CB    . GLU I 3 159 ? 2.269   36.439  209.948 1.00 46.24  ? 160 GLU A CB    1 
ATOM   2330 C CG    . GLU I 3 159 ? 2.895   37.781  210.226 1.00 56.56  ? 160 GLU A CG    1 
ATOM   2331 C CD    . GLU I 3 159 ? 3.727   38.296  209.060 1.00 71.60  ? 160 GLU A CD    1 
ATOM   2332 O OE1   . GLU I 3 159 ? 3.136   38.734  208.044 1.00 75.08  ? 160 GLU A OE1   1 
ATOM   2333 O OE2   . GLU I 3 159 ? 4.975   38.254  209.148 1.00 72.98  ? 160 GLU A OE2   1 
ATOM   2334 N N     . PHE I 3 160 ? 0.168   33.926  211.640 1.00 62.13  ? 161 PHE A N     1 
ATOM   2335 C CA    . PHE I 3 160 ? 0.031   32.486  211.810 1.00 61.68  ? 161 PHE A CA    1 
ATOM   2336 C C     . PHE I 3 160 ? -0.668  31.781  210.663 1.00 60.23  ? 161 PHE A C     1 
ATOM   2337 O O     . PHE I 3 160 ? -0.862  30.566  210.707 1.00 51.04  ? 161 PHE A O     1 
ATOM   2338 C CB    . PHE I 3 160 ? -0.720  32.205  213.095 1.00 72.08  ? 161 PHE A CB    1 
ATOM   2339 C CG    . PHE I 3 160 ? -0.110  32.849  214.298 1.00 80.52  ? 161 PHE A CG    1 
ATOM   2340 C CD1   . PHE I 3 160 ? 1.081   32.383  214.819 1.00 83.35  ? 161 PHE A CD1   1 
ATOM   2341 C CD2   . PHE I 3 160 ? -0.739  33.922  214.917 1.00 89.67  ? 161 PHE A CD2   1 
ATOM   2342 C CE1   . PHE I 3 160 ? 1.637   32.972  215.944 1.00 91.94  ? 161 PHE A CE1   1 
ATOM   2343 C CE2   . PHE I 3 160 ? -0.194  34.521  216.042 1.00 89.61  ? 161 PHE A CE2   1 
ATOM   2344 C CZ    . PHE I 3 160 ? 0.994   34.044  216.555 1.00 97.06  ? 161 PHE A CZ    1 
ATOM   2345 N N     . ASP I 3 161 ? -1.056  32.541  209.645 1.00 60.61  ? 162 ASP A N     1 
ATOM   2346 C CA    . ASP I 3 161 ? -1.714  31.962  208.488 1.00 66.69  ? 162 ASP A CA    1 
ATOM   2347 C C     . ASP I 3 161 ? -1.184  32.594  207.203 1.00 67.71  ? 162 ASP A C     1 
ATOM   2348 O O     . ASP I 3 161 ? -1.954  33.129  206.403 1.00 75.21  ? 162 ASP A O     1 
ATOM   2349 C CB    . ASP I 3 161 ? -3.227  32.163  208.583 1.00 85.62  ? 162 ASP A CB    1 
ATOM   2350 C CG    . ASP I 3 161 ? -3.997  31.242  207.646 1.00 107.60 ? 162 ASP A CG    1 
ATOM   2351 O OD1   . ASP I 3 161 ? -3.966  31.461  206.413 1.00 120.13 ? 162 ASP A OD1   1 
ATOM   2352 O OD2   . ASP I 3 161 ? -4.628  30.283  208.145 1.00 114.14 ? 162 ASP A OD2   1 
ATOM   2353 N N     . LEU I 3 162 ? 0.126   32.523  206.985 1.00 56.68  ? 163 LEU A N     1 
ATOM   2354 C CA    . LEU I 3 162 ? 0.690   33.132  205.792 1.00 50.09  ? 163 LEU A CA    1 
ATOM   2355 C C     . LEU I 3 162 ? 1.450   32.178  204.862 1.00 59.26  ? 163 LEU A C     1 
ATOM   2356 O O     . LEU I 3 162 ? 1.155   32.093  203.658 1.00 53.12  ? 163 LEU A O     1 
ATOM   2357 C CB    . LEU I 3 162 ? 1.618   34.259  206.217 1.00 51.82  ? 163 LEU A CB    1 
ATOM   2358 C CG    . LEU I 3 162 ? 1.676   35.569  205.427 1.00 44.73  ? 163 LEU A CG    1 
ATOM   2359 C CD1   . LEU I 3 162 ? 2.747   36.371  206.121 1.00 57.64  ? 163 LEU A CD1   1 
ATOM   2360 C CD2   . LEU I 3 162 ? 2.009   35.407  203.948 1.00 23.47  ? 163 LEU A CD2   1 
ATOM   2361 N N     . PHE I 3 163 ? 2.440   31.479  205.418 1.00 60.87  ? 164 PHE A N     1 
ATOM   2362 C CA    . PHE I 3 163 ? 3.254   30.552  204.638 1.00 59.27  ? 164 PHE A CA    1 
ATOM   2363 C C     . PHE I 3 163 ? 3.188   29.151  205.211 1.00 59.83  ? 164 PHE A C     1 
ATOM   2364 O O     . PHE I 3 163 ? 2.559   28.933  206.247 1.00 52.63  ? 164 PHE A O     1 
ATOM   2365 C CB    . PHE I 3 163 ? 4.716   31.027  204.597 1.00 65.25  ? 164 PHE A CB    1 
ATOM   2366 C CG    . PHE I 3 163 ? 5.404   31.054  205.950 1.00 69.79  ? 164 PHE A CG    1 
ATOM   2367 C CD1   . PHE I 3 163 ? 6.342   30.083  206.296 1.00 66.21  ? 164 PHE A CD1   1 
ATOM   2368 C CD2   . PHE I 3 163 ? 5.124   32.059  206.873 1.00 68.31  ? 164 PHE A CD2   1 
ATOM   2369 C CE1   . PHE I 3 163 ? 6.993   30.124  207.537 1.00 62.88  ? 164 PHE A CE1   1 
ATOM   2370 C CE2   . PHE I 3 163 ? 5.776   32.100  208.115 1.00 63.27  ? 164 PHE A CE2   1 
ATOM   2371 C CZ    . PHE I 3 163 ? 6.706   31.134  208.445 1.00 55.74  ? 164 PHE A CZ    1 
ATOM   2372 N N     . ASP I 3 164 ? 3.839   28.210  204.520 1.00 62.33  ? 165 ASP A N     1 
ATOM   2373 C CA    . ASP I 3 164 ? 3.899   26.799  204.925 1.00 57.94  ? 165 ASP A CA    1 
ATOM   2374 C C     . ASP I 3 164 ? 5.203   26.179  204.422 1.00 57.84  ? 165 ASP A C     1 
ATOM   2375 O O     . ASP I 3 164 ? 5.535   26.338  203.245 1.00 64.01  ? 165 ASP A O     1 
ATOM   2376 C CB    . ASP I 3 164 ? 2.733   26.039  204.309 1.00 55.26  ? 165 ASP A CB    1 
ATOM   2377 C CG    . ASP I 3 164 ? 1.960   25.263  205.317 1.00 55.24  ? 165 ASP A CG    1 
ATOM   2378 O OD1   . ASP I 3 164 ? 0.919   25.769  205.785 1.00 46.23  ? 165 ASP A OD1   1 
ATOM   2379 O OD2   . ASP I 3 164 ? 2.404   24.146  205.649 1.00 66.67  ? 165 ASP A OD2   1 
ATOM   2380 N N     . ILE I 3 165 ? 5.935   25.480  205.293 1.00 49.44  ? 166 ILE A N     1 
ATOM   2381 C CA    . ILE I 3 165 ? 7.202   24.825  204.904 1.00 46.50  ? 166 ILE A CA    1 
ATOM   2382 C C     . ILE I 3 165 ? 6.975   23.313  204.601 1.00 47.76  ? 166 ILE A C     1 
ATOM   2383 O O     . ILE I 3 165 ? 6.753   22.495  205.522 1.00 44.24  ? 166 ILE A O     1 
ATOM   2384 C CB    . ILE I 3 165 ? 8.309   24.919  206.051 1.00 55.30  ? 166 ILE A CB    1 
ATOM   2385 C CG1   . ILE I 3 165 ? 8.357   26.308  206.689 1.00 44.80  ? 166 ILE A CG1   1 
ATOM   2386 C CG2   . ILE I 3 165 ? 9.706   24.675  205.468 1.00 44.00  ? 166 ILE A CG2   1 
ATOM   2387 C CD1   . ILE I 3 165 ? 9.103   27.326  205.871 1.00 43.63  ? 166 ILE A CD1   1 
ATOM   2388 N N     . ASN I 3 166 ? 7.033   22.935  203.325 1.00 37.61  ? 167 ASN A N     1 
ATOM   2389 C CA    . ASN I 3 166 ? 6.850   21.524  202.966 1.00 35.71  ? 167 ASN A CA    1 
ATOM   2390 C C     . ASN I 3 166 ? 8.067   20.908  202.278 1.00 40.14  ? 167 ASN A C     1 
ATOM   2391 O O     . ASN I 3 166 ? 8.730   21.553  201.466 1.00 40.54  ? 167 ASN A O     1 
ATOM   2392 C CB    . ASN I 3 166 ? 5.655   21.343  202.045 1.00 42.44  ? 167 ASN A CB    1 
ATOM   2393 C CG    . ASN I 3 166 ? 4.390   21.961  202.592 1.00 42.40  ? 167 ASN A CG    1 
ATOM   2394 O OD1   . ASN I 3 166 ? 4.155   21.994  203.805 1.00 29.68  ? 167 ASN A OD1   1 
ATOM   2395 N ND2   . ASN I 3 166 ? 3.552   22.433  201.690 1.00 32.44  ? 167 ASN A ND2   1 
ATOM   2396 N N     . TYR I 3 167 ? 8.334   19.645  202.600 1.00 39.72  ? 168 TYR A N     1 
ATOM   2397 C CA    . TYR I 3 167 ? 9.462   18.907  202.048 1.00 30.21  ? 168 TYR A CA    1 
ATOM   2398 C C     . TYR I 3 167 ? 9.057   17.733  201.143 1.00 40.12  ? 168 TYR A C     1 
ATOM   2399 O O     . TYR I 3 167 ? 8.253   16.882  201.523 1.00 51.46  ? 168 TYR A O     1 
ATOM   2400 C CB    . TYR I 3 167 ? 10.324  18.417  203.202 1.00 25.04  ? 168 TYR A CB    1 
ATOM   2401 C CG    . TYR I 3 167 ? 11.008  19.556  203.910 1.00 37.15  ? 168 TYR A CG    1 
ATOM   2402 C CD1   . TYR I 3 167 ? 12.017  20.268  203.278 1.00 43.32  ? 168 TYR A CD1   1 
ATOM   2403 C CD2   . TYR I 3 167 ? 10.555  20.025  205.133 1.00 28.77  ? 168 TYR A CD2   1 
ATOM   2404 C CE1   . TYR I 3 167 ? 12.540  21.430  203.835 1.00 45.10  ? 168 TYR A CE1   1 
ATOM   2405 C CE2   . TYR I 3 167 ? 11.078  21.197  205.695 1.00 32.70  ? 168 TYR A CE2   1 
ATOM   2406 C CZ    . TYR I 3 167 ? 12.058  21.895  205.035 1.00 28.91  ? 168 TYR A CZ    1 
ATOM   2407 O OH    . TYR I 3 167 ? 12.507  23.113  205.486 1.00 34.09  ? 168 TYR A OH    1 
ATOM   2408 N N     . LEU I 3 168 ? 9.602   17.704  199.929 1.00 42.88  ? 169 LEU A N     1 
ATOM   2409 C CA    . LEU I 3 168 ? 9.328   16.635  198.965 1.00 37.88  ? 169 LEU A CA    1 
ATOM   2410 C C     . LEU I 3 168 ? 10.623  15.859  198.788 1.00 46.21  ? 169 LEU A C     1 
ATOM   2411 O O     . LEU I 3 168 ? 11.580  16.405  198.234 1.00 45.16  ? 169 LEU A O     1 
ATOM   2412 C CB    . LEU I 3 168 ? 8.928   17.218  197.610 1.00 24.30  ? 169 LEU A CB    1 
ATOM   2413 C CG    . LEU I 3 168 ? 8.950   16.155  196.527 1.00 24.10  ? 169 LEU A CG    1 
ATOM   2414 C CD1   . LEU I 3 168 ? 7.850   15.163  196.862 1.00 15.78  ? 169 LEU A CD1   1 
ATOM   2415 C CD2   . LEU I 3 168 ? 8.762   16.736  195.106 1.00 18.18  ? 169 LEU A CD2   1 
ATOM   2416 N N     . GLU I 3 169 ? 10.670  14.602  199.253 1.00 52.28  ? 170 GLU A N     1 
ATOM   2417 C CA    . GLU I 3 169 ? 11.889  13.762  199.111 1.00 45.43  ? 170 GLU A CA    1 
ATOM   2418 C C     . GLU I 3 169 ? 11.904  13.019  197.777 1.00 42.63  ? 170 GLU A C     1 
ATOM   2419 O O     . GLU I 3 169 ? 10.903  12.447  197.361 1.00 40.80  ? 170 GLU A O     1 
ATOM   2420 C CB    . GLU I 3 169 ? 11.991  12.745  200.250 1.00 43.56  ? 170 GLU A CB    1 
ATOM   2421 C CG    . GLU I 3 169 ? 13.266  11.868  200.243 1.00 52.46  ? 170 GLU A CG    1 
ATOM   2422 C CD    . GLU I 3 169 ? 13.338  10.912  201.466 1.00 65.04  ? 170 GLU A CD    1 
ATOM   2423 O OE1   . GLU I 3 169 ? 12.993  11.342  202.591 1.00 71.67  ? 170 GLU A OE1   1 
ATOM   2424 O OE2   . GLU I 3 169 ? 13.748  9.740   201.314 1.00 60.65  ? 170 GLU A OE2   1 
ATOM   2425 N N     . VAL I 3 170 ? 13.044  13.061  197.101 1.00 41.73  ? 171 VAL A N     1 
ATOM   2426 C CA    . VAL I 3 170 ? 13.210  12.380  195.828 1.00 40.20  ? 171 VAL A CA    1 
ATOM   2427 C C     . VAL I 3 170 ? 14.403  11.439  195.934 1.00 47.53  ? 171 VAL A C     1 
ATOM   2428 O O     . VAL I 3 170 ? 15.564  11.876  195.949 1.00 42.49  ? 171 VAL A O     1 
ATOM   2429 C CB    . VAL I 3 170 ? 13.433  13.365  194.673 1.00 43.09  ? 171 VAL A CB    1 
ATOM   2430 C CG1   . VAL I 3 170 ? 14.320  12.729  193.605 1.00 52.19  ? 171 VAL A CG1   1 
ATOM   2431 C CG2   . VAL I 3 170 ? 12.094  13.739  194.042 1.00 28.65  ? 171 VAL A CG2   1 
ATOM   2432 N N     . ASP I 3 171 ? 14.076  10.146  196.025 1.00 52.56  ? 172 ASP A N     1 
ATOM   2433 C CA    . ASP I 3 171 ? 15.022  9.031   196.143 1.00 47.44  ? 172 ASP A CA    1 
ATOM   2434 C C     . ASP I 3 171 ? 15.454  8.575   194.774 1.00 48.52  ? 172 ASP A C     1 
ATOM   2435 O O     . ASP I 3 171 ? 14.611  8.231   193.944 1.00 51.61  ? 172 ASP A O     1 
ATOM   2436 C CB    . ASP I 3 171 ? 14.349  7.845   196.802 1.00 43.91  ? 172 ASP A CB    1 
ATOM   2437 C CG    . ASP I 3 171 ? 13.761  8.191   198.116 1.00 50.61  ? 172 ASP A CG    1 
ATOM   2438 O OD1   . ASP I 3 171 ? 14.485  8.801   198.921 1.00 57.54  ? 172 ASP A OD1   1 
ATOM   2439 O OD2   . ASP I 3 171 ? 12.588  7.857   198.355 1.00 54.22  ? 172 ASP A OD2   1 
ATOM   2440 N N     . TRP I 3 172 ? 16.757  8.521   194.539 1.00 38.76  ? 173 TRP A N     1 
ATOM   2441 C CA    . TRP I 3 172 ? 17.242  8.084   193.241 1.00 41.94  ? 173 TRP A CA    1 
ATOM   2442 C C     . TRP I 3 172 ? 18.425  7.156   193.394 1.00 50.26  ? 173 TRP A C     1 
ATOM   2443 O O     . TRP I 3 172 ? 19.062  7.107   194.438 1.00 60.71  ? 173 TRP A O     1 
ATOM   2444 C CB    . TRP I 3 172 ? 17.690  9.286   192.436 1.00 44.10  ? 173 TRP A CB    1 
ATOM   2445 C CG    . TRP I 3 172 ? 18.826  9.996   193.095 1.00 49.04  ? 173 TRP A CG    1 
ATOM   2446 C CD1   . TRP I 3 172 ? 18.747  10.983  194.031 1.00 48.00  ? 173 TRP A CD1   1 
ATOM   2447 C CD2   . TRP I 3 172 ? 20.219  9.739   192.903 1.00 49.54  ? 173 TRP A CD2   1 
ATOM   2448 N NE1   . TRP I 3 172 ? 20.006  11.356  194.439 1.00 58.86  ? 173 TRP A NE1   1 
ATOM   2449 C CE2   . TRP I 3 172 ? 20.927  10.605  193.764 1.00 54.68  ? 173 TRP A CE2   1 
ATOM   2450 C CE3   . TRP I 3 172 ? 20.935  8.851   192.102 1.00 42.89  ? 173 TRP A CE3   1 
ATOM   2451 C CZ2   . TRP I 3 172 ? 22.320  10.624  193.828 1.00 56.61  ? 173 TRP A CZ2   1 
ATOM   2452 C CZ3   . TRP I 3 172 ? 22.326  8.869   192.169 1.00 56.14  ? 173 TRP A CZ3   1 
ATOM   2453 C CH2   . TRP I 3 172 ? 23.002  9.745   193.030 1.00 50.75  ? 173 TRP A CH2   1 
ATOM   2454 N N     . GLU I 3 173 ? 18.733  6.414   192.351 1.00 53.94  ? 174 GLU A N     1 
ATOM   2455 C CA    . GLU I 3 173 ? 19.894  5.561   192.426 1.00 66.02  ? 174 GLU A CA    1 
ATOM   2456 C C     . GLU I 3 173 ? 20.583  5.686   191.070 1.00 73.82  ? 174 GLU A C     1 
ATOM   2457 O O     . GLU I 3 173 ? 20.064  6.363   190.177 1.00 64.69  ? 174 GLU A O     1 
ATOM   2458 C CB    . GLU I 3 173 ? 19.481  4.126   192.707 1.00 61.30  ? 174 GLU A CB    1 
ATOM   2459 C CG    . GLU I 3 173 ? 18.689  3.545   191.587 1.00 74.77  ? 174 GLU A CG    1 
ATOM   2460 C CD    . GLU I 3 173 ? 18.320  2.118   191.826 1.00 73.11  ? 174 GLU A CD    1 
ATOM   2461 O OE1   . GLU I 3 173 ? 17.684  1.536   190.923 1.00 80.22  ? 174 GLU A OE1   1 
ATOM   2462 O OE2   . GLU I 3 173 ? 18.661  1.588   192.908 1.00 58.53  ? 174 GLU A OE2   1 
ATOM   2463 N N     . LEU I 3 174 ? 21.755  5.061   190.929 1.00 86.12  ? 175 LEU A N     1 
ATOM   2464 C CA    . LEU I 3 174 ? 22.520  5.092   189.676 1.00 90.82  ? 175 LEU A CA    1 
ATOM   2465 C C     . LEU I 3 174 ? 22.360  3.756   188.968 1.00 94.70  ? 175 LEU A C     1 
ATOM   2466 O O     . LEU I 3 174 ? 23.147  2.835   189.176 1.00 99.81  ? 175 LEU A O     1 
ATOM   2467 C CB    . LEU I 3 174 ? 24.014  5.345   189.940 1.00 91.43  ? 175 LEU A CB    1 
ATOM   2468 C CG    . LEU I 3 174 ? 24.938  5.515   188.725 1.00 94.03  ? 175 LEU A CG    1 
ATOM   2469 C CD1   . LEU I 3 174 ? 24.514  6.750   187.957 1.00 98.07  ? 175 LEU A CD1   1 
ATOM   2470 C CD2   . LEU I 3 174 ? 26.397  5.643   189.158 1.00 94.73  ? 175 LEU A CD2   1 
ATOM   2471 N N     . ASN I 3 175 ? 21.326  3.651   188.142 1.00 95.65  ? 176 ASN A N     1 
ATOM   2472 C CA    . ASN I 3 175 ? 21.066  2.430   187.402 1.00 93.33  ? 176 ASN A CA    1 
ATOM   2473 C C     . ASN I 3 175 ? 21.735  2.600   186.039 1.00 93.69  ? 176 ASN A C     1 
ATOM   2474 O O     . ASN I 3 175 ? 21.217  3.291   185.153 1.00 89.13  ? 176 ASN A O     1 
ATOM   2475 C CB    . ASN I 3 175 ? 19.555  2.223   187.263 1.00 94.46  ? 176 ASN A CB    1 
ATOM   2476 C CG    . ASN I 3 175 ? 19.173  0.765   187.056 1.00 94.68  ? 176 ASN A CG    1 
ATOM   2477 O OD1   . ASN I 3 175 ? 19.579  0.128   186.077 1.00 79.94  ? 176 ASN A OD1   1 
ATOM   2478 N ND2   . ASN I 3 175 ? 18.379  0.231   187.981 1.00 94.45  ? 176 ASN A ND2   1 
ATOM   2479 N N     . GLY I 3 176 ? 22.908  1.984   185.896 1.00 96.05  ? 177 GLY A N     1 
ATOM   2480 C CA    . GLY I 3 176 ? 23.664  2.070   184.659 1.00 94.04  ? 177 GLY A CA    1 
ATOM   2481 C C     . GLY I 3 176 ? 24.318  3.429   184.505 1.00 95.24  ? 177 GLY A C     1 
ATOM   2482 O O     . GLY I 3 176 ? 25.046  3.892   185.387 1.00 92.45  ? 177 GLY A O     1 
ATOM   2483 N N     . GLU I 3 177 ? 24.055  4.070   183.375 1.00 93.51  ? 178 GLU A N     1 
ATOM   2484 C CA    . GLU I 3 177 ? 24.608  5.382   183.089 1.00 89.75  ? 178 GLU A CA    1 
ATOM   2485 C C     . GLU I 3 177 ? 23.697  6.483   183.622 1.00 88.44  ? 178 GLU A C     1 
ATOM   2486 O O     . GLU I 3 177 ? 24.168  7.499   184.124 1.00 87.56  ? 178 GLU A O     1 
ATOM   2487 C CB    . GLU I 3 177 ? 24.796  5.543   181.580 1.00 94.65  ? 178 GLU A CB    1 
ATOM   2488 C CG    . GLU I 3 177 ? 26.192  5.214   181.072 1.00 96.71  ? 178 GLU A CG    1 
ATOM   2489 C CD    . GLU I 3 177 ? 27.183  6.333   181.340 1.00 98.53  ? 178 GLU A CD    1 
ATOM   2490 O OE1   . GLU I 3 177 ? 27.420  6.642   182.530 1.00 97.98  ? 178 GLU A OE1   1 
ATOM   2491 O OE2   . GLU I 3 177 ? 27.719  6.906   180.359 1.00 98.92  ? 178 GLU A OE2   1 
ATOM   2492 N N     . ASP I 3 178 ? 22.389  6.287   183.517 1.00 85.47  ? 179 ASP A N     1 
ATOM   2493 C CA    . ASP I 3 178 ? 21.471  7.298   184.011 1.00 88.01  ? 179 ASP A CA    1 
ATOM   2494 C C     . ASP I 3 178 ? 21.281  7.263   185.513 1.00 84.14  ? 179 ASP A C     1 
ATOM   2495 O O     . ASP I 3 178 ? 21.706  6.325   186.197 1.00 82.72  ? 179 ASP A O     1 
ATOM   2496 C CB    . ASP I 3 178 ? 20.099  7.177   183.355 1.00 97.23  ? 179 ASP A CB    1 
ATOM   2497 C CG    . ASP I 3 178 ? 20.026  7.900   182.037 1.00 114.28 ? 179 ASP A CG    1 
ATOM   2498 O OD1   . ASP I 3 178 ? 20.678  8.965   181.893 1.00 120.12 ? 179 ASP A OD1   1 
ATOM   2499 O OD2   . ASP I 3 178 ? 19.298  7.417   181.145 1.00 123.52 ? 179 ASP A OD2   1 
ATOM   2500 N N     . LEU I 3 179 ? 20.625  8.309   186.005 1.00 73.84  ? 180 LEU A N     1 
ATOM   2501 C CA    . LEU I 3 179 ? 20.304  8.486   187.417 1.00 63.98  ? 180 LEU A CA    1 
ATOM   2502 C C     . LEU I 3 179 ? 18.781  8.288   187.535 1.00 63.45  ? 180 LEU A C     1 
ATOM   2503 O O     . LEU I 3 179 ? 18.013  9.241   187.375 1.00 69.77  ? 180 LEU A O     1 
ATOM   2504 C CB    . LEU I 3 179 ? 20.678  9.911   187.853 1.00 53.11  ? 180 LEU A CB    1 
ATOM   2505 C CG    . LEU I 3 179 ? 21.380  10.141  189.189 1.00 47.71  ? 180 LEU A CG    1 
ATOM   2506 C CD1   . LEU I 3 179 ? 22.774  9.521   189.127 1.00 49.11  ? 180 LEU A CD1   1 
ATOM   2507 C CD2   . LEU I 3 179 ? 21.509  11.629  189.477 1.00 39.82  ? 180 LEU A CD2   1 
ATOM   2508 N N     . VAL I 3 180 ? 18.334  7.064   187.794 1.00 47.44  ? 181 VAL A N     1 
ATOM   2509 C CA    . VAL I 3 180 ? 16.905  6.835   187.908 1.00 38.90  ? 181 VAL A CA    1 
ATOM   2510 C C     . VAL I 3 180 ? 16.375  7.117   189.320 1.00 41.84  ? 181 VAL A C     1 
ATOM   2511 O O     . VAL I 3 180 ? 17.112  7.065   190.308 1.00 33.78  ? 181 VAL A O     1 
ATOM   2512 C CB    . VAL I 3 180 ? 16.516  5.378   187.478 1.00 30.84  ? 181 VAL A CB    1 
ATOM   2513 C CG1   . VAL I 3 180 ? 17.117  4.316   188.431 1.00 34.64  ? 181 VAL A CG1   1 
ATOM   2514 C CG2   . VAL I 3 180 ? 15.020  5.247   187.449 1.00 25.84  ? 181 VAL A CG2   1 
ATOM   2515 N N     . CYS I 3 181 ? 15.093  7.459   189.396 1.00 49.77  ? 182 CYS A N     1 
ATOM   2516 C CA    . CYS I 3 181 ? 14.429  7.737   190.665 1.00 48.40  ? 182 CYS A CA    1 
ATOM   2517 C C     . CYS I 3 181 ? 13.646  6.477   190.992 1.00 50.52  ? 182 CYS A C     1 
ATOM   2518 O O     . CYS I 3 181 ? 13.106  5.820   190.099 1.00 50.37  ? 182 CYS A O     1 
ATOM   2519 C CB    . CYS I 3 181 ? 13.478  8.939   190.517 1.00 51.40  ? 182 CYS A CB    1 
ATOM   2520 S SG    . CYS I 3 181 ? 12.150  9.073   191.776 1.00 43.31  ? 182 CYS A SG    1 
ATOM   2521 N N     . VAL I 3 182 ? 13.576  6.139   192.268 1.00 49.14  ? 183 VAL A N     1 
ATOM   2522 C CA    . VAL I 3 182 ? 12.873  4.936   192.673 1.00 52.50  ? 183 VAL A CA    1 
ATOM   2523 C C     . VAL I 3 182 ? 11.670  5.227   193.558 1.00 53.00  ? 183 VAL A C     1 
ATOM   2524 O O     . VAL I 3 182 ? 10.624  4.604   193.406 1.00 56.91  ? 183 VAL A O     1 
ATOM   2525 C CB    . VAL I 3 182 ? 13.846  3.969   193.397 1.00 52.92  ? 183 VAL A CB    1 
ATOM   2526 C CG1   . VAL I 3 182 ? 14.945  3.495   192.422 1.00 45.54  ? 183 VAL A CG1   1 
ATOM   2527 C CG2   . VAL I 3 182 ? 14.490  4.670   194.578 1.00 57.33  ? 183 VAL A CG2   1 
ATOM   2528 N N     . SER I 3 183 ? 11.807  6.195   194.460 1.00 59.23  ? 184 SER A N     1 
ATOM   2529 C CA    . SER I 3 183 ? 10.720  6.558   195.371 1.00 57.08  ? 184 SER A CA    1 
ATOM   2530 C C     . SER I 3 183 ? 10.560  8.070   195.589 1.00 49.78  ? 184 SER A C     1 
ATOM   2531 O O     . SER I 3 183 ? 11.387  8.857   195.135 1.00 38.80  ? 184 SER A O     1 
ATOM   2532 C CB    . SER I 3 183 ? 10.955  5.866   196.712 1.00 52.33  ? 184 SER A CB    1 
ATOM   2533 O OG    . SER I 3 183 ? 12.306  6.022   197.095 1.00 55.50  ? 184 SER A OG    1 
ATOM   2534 N N     . THR I 3 184 ? 9.487   8.448   196.293 1.00 51.55  ? 185 THR A N     1 
ATOM   2535 C CA    . THR I 3 184 ? 9.168   9.848   196.636 1.00 41.70  ? 185 THR A CA    1 
ATOM   2536 C C     . THR I 3 184 ? 8.373   9.978   197.944 1.00 35.30  ? 185 THR A C     1 
ATOM   2537 O O     . THR I 3 184 ? 7.445   9.225   198.178 1.00 47.15  ? 185 THR A O     1 
ATOM   2538 C CB    . THR I 3 184 ? 8.316   10.511  195.531 1.00 41.79  ? 185 THR A CB    1 
ATOM   2539 O OG1   . THR I 3 184 ? 9.157   11.269  194.653 1.00 52.40  ? 185 THR A OG1   1 
ATOM   2540 C CG2   . THR I 3 184 ? 7.278   11.432  196.135 1.00 31.42  ? 185 THR A CG2   1 
ATOM   2541 N N     . SER I 3 185 ? 8.716   10.934  198.792 1.00 45.84  ? 186 SER A N     1 
ATOM   2542 C CA    . SER I 3 185 ? 7.946   11.141  200.023 1.00 54.07  ? 186 SER A CA    1 
ATOM   2543 C C     . SER I 3 185 ? 7.647   12.623  200.195 1.00 61.71  ? 186 SER A C     1 
ATOM   2544 O O     . SER I 3 185 ? 8.400   13.482  199.700 1.00 63.91  ? 186 SER A O     1 
ATOM   2545 C CB    . SER I 3 185 ? 8.703   10.659  201.259 1.00 55.42  ? 186 SER A CB    1 
ATOM   2546 O OG    . SER I 3 185 ? 8.853   9.249   201.275 1.00 73.72  ? 186 SER A OG    1 
ATOM   2547 N N     . PHE I 3 186 ? 6.550   12.925  200.893 1.00 60.39  ? 187 PHE A N     1 
ATOM   2548 C CA    . PHE I 3 186 ? 6.161   14.317  201.152 1.00 56.05  ? 187 PHE A CA    1 
ATOM   2549 C C     . PHE I 3 186 ? 5.809   14.511  202.604 1.00 49.89  ? 187 PHE A C     1 
ATOM   2550 O O     . PHE I 3 186 ? 5.296   13.600  203.244 1.00 54.96  ? 187 PHE A O     1 
ATOM   2551 C CB    . PHE I 3 186 ? 4.957   14.718  200.325 1.00 51.56  ? 187 PHE A CB    1 
ATOM   2552 C CG    . PHE I 3 186 ? 4.518   16.140  200.548 1.00 58.58  ? 187 PHE A CG    1 
ATOM   2553 C CD1   . PHE I 3 186 ? 5.042   17.173  199.777 1.00 53.77  ? 187 PHE A CD1   1 
ATOM   2554 C CD2   . PHE I 3 186 ? 3.525   16.442  201.477 1.00 58.47  ? 187 PHE A CD2   1 
ATOM   2555 C CE1   . PHE I 3 186 ? 4.576   18.481  199.916 1.00 36.66  ? 187 PHE A CE1   1 
ATOM   2556 C CE2   . PHE I 3 186 ? 3.060   17.744  201.622 1.00 51.23  ? 187 PHE A CE2   1 
ATOM   2557 C CZ    . PHE I 3 186 ? 3.589   18.762  200.832 1.00 42.93  ? 187 PHE A CZ    1 
ATOM   2558 N N     . ALA I 3 187 ? 6.067   15.713  203.110 1.00 52.60  ? 188 ALA A N     1 
ATOM   2559 C CA    . ALA I 3 187 ? 5.780   16.042  204.507 1.00 54.99  ? 188 ALA A CA    1 
ATOM   2560 C C     . ALA I 3 187 ? 5.723   17.547  204.785 1.00 52.28  ? 188 ALA A C     1 
ATOM   2561 O O     . ALA I 3 187 ? 6.472   18.327  204.195 1.00 53.99  ? 188 ALA A O     1 
ATOM   2562 C CB    . ALA I 3 187 ? 6.820   15.395  205.403 1.00 52.26  ? 188 ALA A CB    1 
ATOM   2563 N N     . GLU I 3 188 ? 4.840   17.950  205.696 1.00 50.31  ? 189 GLU A N     1 
ATOM   2564 C CA    . GLU I 3 188 ? 4.701   19.363  206.061 1.00 52.07  ? 189 GLU A CA    1 
ATOM   2565 C C     . GLU I 3 188 ? 5.527   19.598  207.323 1.00 54.12  ? 189 GLU A C     1 
ATOM   2566 O O     . GLU I 3 188 ? 5.506   18.771  208.233 1.00 58.35  ? 189 GLU A O     1 
ATOM   2567 C CB    . GLU I 3 188 ? 3.231   19.700  206.333 1.00 47.55  ? 189 GLU A CB    1 
ATOM   2568 C CG    . GLU I 3 188 ? 2.275   18.982  205.421 1.00 57.81  ? 189 GLU A CG    1 
ATOM   2569 C CD    . GLU I 3 188 ? 1.292   19.890  204.725 1.00 66.21  ? 189 GLU A CD    1 
ATOM   2570 O OE1   . GLU I 3 188 ? 0.407   19.354  204.032 1.00 72.77  ? 189 GLU A OE1   1 
ATOM   2571 O OE2   . GLU I 3 188 ? 1.395   21.128  204.852 1.00 77.94  ? 189 GLU A OE2   1 
ATOM   2572 N N     . LEU I 3 189 ? 6.259   20.706  207.395 1.00 46.62  ? 190 LEU A N     1 
ATOM   2573 C CA    . LEU I 3 189 ? 7.072   20.946  208.588 1.00 46.72  ? 190 LEU A CA    1 
ATOM   2574 C C     . LEU I 3 189 ? 6.218   21.262  209.833 1.00 47.46  ? 190 LEU A C     1 
ATOM   2575 O O     . LEU I 3 189 ? 6.339   20.616  210.875 1.00 49.46  ? 190 LEU A O     1 
ATOM   2576 C CB    . LEU I 3 189 ? 8.058   22.082  208.328 1.00 34.97  ? 190 LEU A CB    1 
ATOM   2577 C CG    . LEU I 3 189 ? 8.962   22.403  209.504 1.00 27.60  ? 190 LEU A CG    1 
ATOM   2578 C CD1   . LEU I 3 189 ? 10.272  21.666  209.370 1.00 35.34  ? 190 LEU A CD1   1 
ATOM   2579 C CD2   . LEU I 3 189 ? 9.218   23.889  209.520 1.00 40.47  ? 190 LEU A CD2   1 
ATOM   2580 N N     . PHE I 3 190 ? 5.346   22.251  209.696 1.00 45.85  ? 191 PHE A N     1 
ATOM   2581 C CA    . PHE I 3 190 ? 4.465   22.695  210.758 1.00 50.28  ? 191 PHE A CA    1 
ATOM   2582 C C     . PHE I 3 190 ? 3.411   21.668  211.090 1.00 57.48  ? 191 PHE A C     1 
ATOM   2583 O O     . PHE I 3 190 ? 2.469   21.941  211.832 1.00 67.55  ? 191 PHE A O     1 
ATOM   2584 C CB    . PHE I 3 190 ? 3.785   23.981  210.326 1.00 45.43  ? 191 PHE A CB    1 
ATOM   2585 C CG    . PHE I 3 190 ? 4.744   25.079  210.028 1.00 41.41  ? 191 PHE A CG    1 
ATOM   2586 C CD1   . PHE I 3 190 ? 4.511   25.959  208.979 1.00 35.75  ? 191 PHE A CD1   1 
ATOM   2587 C CD2   . PHE I 3 190 ? 5.881   25.244  210.809 1.00 37.16  ? 191 PHE A CD2   1 
ATOM   2588 C CE1   . PHE I 3 190 ? 5.386   26.985  208.711 1.00 42.33  ? 191 PHE A CE1   1 
ATOM   2589 C CE2   . PHE I 3 190 ? 6.757   26.264  210.550 1.00 46.24  ? 191 PHE A CE2   1 
ATOM   2590 C CZ    . PHE I 3 190 ? 6.512   27.142  209.496 1.00 46.52  ? 191 PHE A CZ    1 
ATOM   2591 N N     . LYS I 3 191 ? 3.560   20.484  210.524 1.00 53.13  ? 192 LYS A N     1 
ATOM   2592 C CA    . LYS I 3 191 ? 2.615   19.422  210.764 1.00 43.89  ? 192 LYS A CA    1 
ATOM   2593 C C     . LYS I 3 191 ? 3.378   18.364  211.556 1.00 49.02  ? 192 LYS A C     1 
ATOM   2594 O O     . LYS I 3 191 ? 2.869   17.280  211.830 1.00 47.34  ? 192 LYS A O     1 
ATOM   2595 C CB    . LYS I 3 191 ? 2.112   18.886  209.422 1.00 35.62  ? 192 LYS A CB    1 
ATOM   2596 C CG    . LYS I 3 191 ? 0.718   18.327  209.476 1.00 32.08  ? 192 LYS A CG    1 
ATOM   2597 C CD    . LYS I 3 191 ? 0.049   18.270  208.111 1.00 40.64  ? 192 LYS A CD    1 
ATOM   2598 C CE    . LYS I 3 191 ? -1.467  18.089  208.339 1.00 62.86  ? 192 LYS A CE    1 
ATOM   2599 N NZ    . LYS I 3 191 ? -2.392  18.360  207.181 1.00 58.14  ? 192 LYS A NZ    1 
ATOM   2600 N N     . SER I 3 192 ? 4.611   18.708  211.921 1.00 44.08  ? 193 SER A N     1 
ATOM   2601 C CA    . SER I 3 192 ? 5.475   17.840  212.706 1.00 48.94  ? 193 SER A CA    1 
ATOM   2602 C C     . SER I 3 192 ? 5.560   18.290  214.161 1.00 52.25  ? 193 SER A C     1 
ATOM   2603 O O     . SER I 3 192 ? 5.233   19.427  214.484 1.00 55.50  ? 193 SER A O     1 
ATOM   2604 C CB    . SER I 3 192 ? 6.882   17.843  212.143 1.00 51.18  ? 193 SER A CB    1 
ATOM   2605 O OG    . SER I 3 192 ? 7.804   17.559  213.186 1.00 64.81  ? 193 SER A OG    1 
ATOM   2606 N N     . GLU I 3 193 ? 6.019   17.405  215.039 1.00 53.69  ? 194 GLU A N     1 
ATOM   2607 C CA    . GLU I 3 193 ? 6.138   17.768  216.443 1.00 60.33  ? 194 GLU A CA    1 
ATOM   2608 C C     . GLU I 3 193 ? 7.469   18.465  216.697 1.00 63.75  ? 194 GLU A C     1 
ATOM   2609 O O     . GLU I 3 193 ? 8.507   17.819  216.797 1.00 67.42  ? 194 GLU A O     1 
ATOM   2610 C CB    . GLU I 3 193 ? 6.025   16.533  217.335 1.00 57.26  ? 194 GLU A CB    1 
ATOM   2611 C CG    . GLU I 3 193 ? 6.129   16.828  218.835 1.00 60.50  ? 194 GLU A CG    1 
ATOM   2612 C CD    . GLU I 3 193 ? 5.060   17.804  219.342 1.00 65.73  ? 194 GLU A CD    1 
ATOM   2613 O OE1   . GLU I 3 193 ? 3.876   17.685  218.944 1.00 66.78  ? 194 GLU A OE1   1 
ATOM   2614 O OE2   . GLU I 3 193 ? 5.402   18.683  220.161 1.00 69.33  ? 194 GLU A OE2   1 
ATOM   2615 N N     . PRO I 3 194 ? 7.446   19.799  216.836 1.00 67.21  ? 195 PRO A N     1 
ATOM   2616 C CA    . PRO I 3 194 ? 8.667   20.574  217.074 1.00 66.75  ? 195 PRO A CA    1 
ATOM   2617 C C     . PRO I 3 194 ? 9.566   20.087  218.192 1.00 65.06  ? 195 PRO A C     1 
ATOM   2618 O O     . PRO I 3 194 ? 10.786  20.204  218.095 1.00 69.22  ? 195 PRO A O     1 
ATOM   2619 C CB    . PRO I 3 194 ? 8.139   21.984  217.316 1.00 66.69  ? 195 PRO A CB    1 
ATOM   2620 C CG    . PRO I 3 194 ? 6.795   21.741  217.900 1.00 67.77  ? 195 PRO A CG    1 
ATOM   2621 C CD    . PRO I 3 194 ? 6.260   20.656  217.000 1.00 66.65  ? 195 PRO A CD    1 
ATOM   2622 N N     . SER I 3 195 ? 8.982   19.547  219.254 1.00 65.17  ? 196 SER A N     1 
ATOM   2623 C CA    . SER I 3 195 ? 9.795   19.058  220.370 1.00 68.77  ? 196 SER A CA    1 
ATOM   2624 C C     . SER I 3 195 ? 10.644  17.865  219.930 1.00 67.93  ? 196 SER A C     1 
ATOM   2625 O O     . SER I 3 195 ? 11.626  17.512  220.582 1.00 65.14  ? 196 SER A O     1 
ATOM   2626 C CB    . SER I 3 195 ? 8.907   18.613  221.526 1.00 72.76  ? 196 SER A CB    1 
ATOM   2627 O OG    . SER I 3 195 ? 8.476   17.275  221.329 1.00 77.16  ? 196 SER A OG    1 
ATOM   2628 N N     . GLU I 3 196 ? 10.243  17.240  218.827 1.00 63.95  ? 197 GLU A N     1 
ATOM   2629 C CA    . GLU I 3 196 ? 10.948  16.086  218.293 1.00 62.95  ? 197 GLU A CA    1 
ATOM   2630 C C     . GLU I 3 196 ? 12.100  16.517  217.384 1.00 56.16  ? 197 GLU A C     1 
ATOM   2631 O O     . GLU I 3 196 ? 13.155  15.879  217.355 1.00 51.62  ? 197 GLU A O     1 
ATOM   2632 C CB    . GLU I 3 196 ? 9.983   15.209  217.485 1.00 74.63  ? 197 GLU A CB    1 
ATOM   2633 C CG    . GLU I 3 196 ? 8.741   14.736  218.231 1.00 82.24  ? 197 GLU A CG    1 
ATOM   2634 C CD    . GLU I 3 196 ? 9.054   13.739  219.330 1.00 90.15  ? 197 GLU A CD    1 
ATOM   2635 O OE1   . GLU I 3 196 ? 9.723   14.122  220.318 1.00 90.79  ? 197 GLU A OE1   1 
ATOM   2636 O OE2   . GLU I 3 196 ? 8.632   12.569  219.198 1.00 91.24  ? 197 GLU A OE2   1 
ATOM   2637 N N     . LEU I 3 197 ? 11.867  17.599  216.642 1.00 47.92  ? 198 LEU A N     1 
ATOM   2638 C CA    . LEU I 3 197 ? 12.815  18.155  215.687 1.00 41.24  ? 198 LEU A CA    1 
ATOM   2639 C C     . LEU I 3 197 ? 14.252  18.110  216.181 1.00 42.87  ? 198 LEU A C     1 
ATOM   2640 O O     . LEU I 3 197 ? 14.565  18.628  217.262 1.00 49.56  ? 198 LEU A O     1 
ATOM   2641 C CB    . LEU I 3 197 ? 12.379  19.581  215.308 1.00 28.76  ? 198 LEU A CB    1 
ATOM   2642 C CG    . LEU I 3 197 ? 11.685  19.760  213.930 1.00 38.20  ? 198 LEU A CG    1 
ATOM   2643 C CD1   . LEU I 3 197 ? 10.559  18.775  213.742 1.00 36.68  ? 198 LEU A CD1   1 
ATOM   2644 C CD2   . LEU I 3 197 ? 11.155  21.184  213.776 1.00 46.58  ? 198 LEU A CD2   1 
ATOM   2645 N N     . TYR I 3 198 ? 15.119  17.462  215.391 1.00 38.84  ? 199 TYR A N     1 
ATOM   2646 C CA    . TYR I 3 198 ? 16.541  17.310  215.738 1.00 37.52  ? 199 TYR A CA    1 
ATOM   2647 C C     . TYR I 3 198 ? 17.404  18.445  215.242 1.00 39.76  ? 199 TYR A C     1 
ATOM   2648 O O     . TYR I 3 198 ? 17.457  18.710  214.052 1.00 49.71  ? 199 TYR A O     1 
ATOM   2649 C CB    . TYR I 3 198 ? 17.142  16.012  215.168 1.00 10.56  ? 199 TYR A CB    1 
ATOM   2650 C CG    . TYR I 3 198 ? 18.592  15.828  215.576 1.00 7.93   ? 199 TYR A CG    1 
ATOM   2651 C CD1   . TYR I 3 198 ? 18.935  15.543  216.907 1.00 16.67  ? 199 TYR A CD1   1 
ATOM   2652 C CD2   . TYR I 3 198 ? 19.614  15.976  214.669 1.00 13.17  ? 199 TYR A CD2   1 
ATOM   2653 C CE1   . TYR I 3 198 ? 20.255  15.403  217.319 1.00 1.00   ? 199 TYR A CE1   1 
ATOM   2654 C CE2   . TYR I 3 198 ? 20.947  15.833  215.069 1.00 22.18  ? 199 TYR A CE2   1 
ATOM   2655 C CZ    . TYR I 3 198 ? 21.260  15.555  216.387 1.00 21.94  ? 199 TYR A CZ    1 
ATOM   2656 O OH    . TYR I 3 198 ? 22.585  15.427  216.760 1.00 34.97  ? 199 TYR A OH    1 
ATOM   2657 N N     . ILE I 3 199 ? 18.112  19.095  216.147 1.00 39.73  ? 200 ILE A N     1 
ATOM   2658 C CA    . ILE I 3 199 ? 18.970  20.174  215.716 1.00 38.05  ? 200 ILE A CA    1 
ATOM   2659 C C     . ILE I 3 199 ? 20.436  19.774  215.775 1.00 39.03  ? 200 ILE A C     1 
ATOM   2660 O O     . ILE I 3 199 ? 20.996  19.540  216.855 1.00 42.42  ? 200 ILE A O     1 
ATOM   2661 C CB    . ILE I 3 199 ? 18.744  21.439  216.568 1.00 32.66  ? 200 ILE A CB    1 
ATOM   2662 C CG1   . ILE I 3 199 ? 17.302  21.901  216.440 1.00 24.63  ? 200 ILE A CG1   1 
ATOM   2663 C CG2   . ILE I 3 199 ? 19.669  22.527  216.115 1.00 25.75  ? 200 ILE A CG2   1 
ATOM   2664 C CD1   . ILE I 3 199 ? 16.946  23.037  217.366 1.00 17.28  ? 200 ILE A CD1   1 
ATOM   2665 N N     . ASN I 3 200 ? 21.046  19.663  214.603 1.00 39.55  ? 201 ASN A N     1 
ATOM   2666 C CA    . ASN I 3 200 ? 22.461  19.305  214.527 1.00 44.49  ? 201 ASN A CA    1 
ATOM   2667 C C     . ASN I 3 200 ? 23.269  20.613  214.494 1.00 46.47  ? 201 ASN A C     1 
ATOM   2668 O O     . ASN I 3 200 ? 23.396  21.272  213.451 1.00 42.33  ? 201 ASN A O     1 
ATOM   2669 C CB    . ASN I 3 200 ? 22.721  18.459  213.271 1.00 39.57  ? 201 ASN A CB    1 
ATOM   2670 C CG    . ASN I 3 200 ? 24.048  17.732  213.321 1.00 37.10  ? 201 ASN A CG    1 
ATOM   2671 O OD1   . ASN I 3 200 ? 25.092  18.343  213.464 1.00 40.09  ? 201 ASN A OD1   1 
ATOM   2672 N ND2   . ASN I 3 200 ? 24.008  16.422  213.202 1.00 37.68  ? 201 ASN A ND2   1 
ATOM   2673 N N     . TRP I 3 201 ? 23.806  20.992  215.647 1.00 42.13  ? 202 TRP A N     1 
ATOM   2674 C CA    . TRP I 3 201 ? 24.567  22.231  215.746 1.00 42.51  ? 202 TRP A CA    1 
ATOM   2675 C C     . TRP I 3 201 ? 25.718  22.305  214.751 1.00 38.59  ? 202 TRP A C     1 
ATOM   2676 O O     . TRP I 3 201 ? 25.725  23.182  213.897 1.00 39.25  ? 202 TRP A O     1 
ATOM   2677 C CB    . TRP I 3 201 ? 25.022  22.449  217.202 1.00 35.95  ? 202 TRP A CB    1 
ATOM   2678 C CG    . TRP I 3 201 ? 23.810  22.538  218.111 1.00 37.03  ? 202 TRP A CG    1 
ATOM   2679 C CD1   . TRP I 3 201 ? 23.214  21.501  218.779 1.00 38.83  ? 202 TRP A CD1   1 
ATOM   2680 C CD2   . TRP I 3 201 ? 22.919  23.661  218.258 1.00 31.34  ? 202 TRP A CD2   1 
ATOM   2681 N NE1   . TRP I 3 201 ? 22.006  21.896  219.303 1.00 38.18  ? 202 TRP A NE1   1 
ATOM   2682 C CE2   . TRP I 3 201 ? 21.794  23.210  218.994 1.00 31.22  ? 202 TRP A CE2   1 
ATOM   2683 C CE3   . TRP I 3 201 ? 22.942  24.986  217.804 1.00 17.09  ? 202 TRP A CE3   1 
ATOM   2684 C CZ2   . TRP I 3 201 ? 20.727  24.043  219.316 1.00 29.72  ? 202 TRP A CZ2   1 
ATOM   2685 C CZ3   . TRP I 3 201 ? 21.876  25.817  218.117 1.00 30.00  ? 202 TRP A CZ3   1 
ATOM   2686 C CH2   . TRP I 3 201 ? 20.771  25.339  218.857 1.00 33.18  ? 202 TRP A CH2   1 
ATOM   2687 N N     . ALA I 3 202 ? 26.671  21.385  214.842 1.00 28.24  ? 203 ALA A N     1 
ATOM   2688 C CA    . ALA I 3 202 ? 27.781  21.370  213.896 1.00 31.73  ? 203 ALA A CA    1 
ATOM   2689 C C     . ALA I 3 202 ? 27.283  21.463  212.430 1.00 31.19  ? 203 ALA A C     1 
ATOM   2690 O O     . ALA I 3 202 ? 27.750  22.303  211.656 1.00 26.86  ? 203 ALA A O     1 
ATOM   2691 C CB    . ALA I 3 202 ? 28.623  20.099  214.091 1.00 26.68  ? 203 ALA A CB    1 
ATOM   2692 N N     . ALA I 3 203 ? 26.347  20.597  212.056 1.00 22.56  ? 204 ALA A N     1 
ATOM   2693 C CA    . ALA I 3 203 ? 25.791  20.588  210.708 1.00 24.40  ? 204 ALA A CA    1 
ATOM   2694 C C     . ALA I 3 203 ? 25.073  21.888  210.336 1.00 27.13  ? 204 ALA A C     1 
ATOM   2695 O O     . ALA I 3 203 ? 23.907  21.862  209.894 1.00 24.33  ? 204 ALA A O     1 
ATOM   2696 C CB    . ALA I 3 203 ? 24.829  19.414  210.558 1.00 15.46  ? 204 ALA A CB    1 
ATOM   2697 N N     . ALA I 3 204 ? 25.762  23.019  210.511 1.00 17.08  ? 205 ALA A N     1 
ATOM   2698 C CA    . ALA I 3 204 ? 25.193  24.335  210.213 1.00 9.39   ? 205 ALA A CA    1 
ATOM   2699 C C     . ALA I 3 204 ? 23.976  24.550  211.079 1.00 20.30  ? 205 ALA A C     1 
ATOM   2700 O O     . ALA I 3 204 ? 22.979  25.086  210.621 1.00 26.80  ? 205 ALA A O     1 
ATOM   2701 C CB    . ALA I 3 204 ? 24.786  24.410  208.767 1.00 17.35  ? 205 ALA A CB    1 
ATOM   2702 N N     . MET I 3 205 ? 24.033  24.100  212.326 1.00 32.04  ? 206 MET A N     1 
ATOM   2703 C CA    . MET I 3 205 ? 22.884  24.263  213.194 1.00 36.33  ? 206 MET A CA    1 
ATOM   2704 C C     . MET I 3 205 ? 21.590  23.853  212.458 1.00 35.17  ? 206 MET A C     1 
ATOM   2705 O O     . MET I 3 205 ? 20.507  24.250  212.850 1.00 37.00  ? 206 MET A O     1 
ATOM   2706 C CB    . MET I 3 205 ? 22.794  25.729  213.614 1.00 36.46  ? 206 MET A CB    1 
ATOM   2707 C CG    . MET I 3 205 ? 24.140  26.345  213.950 1.00 43.03  ? 206 MET A CG    1 
ATOM   2708 S SD    . MET I 3 205 ? 23.979  27.833  214.935 1.00 46.55  ? 206 MET A SD    1 
ATOM   2709 C CE    . MET I 3 205 ? 23.365  29.050  213.660 1.00 33.05  ? 206 MET A CE    1 
ATOM   2710 N N     . GLN I 3 206 ? 21.686  23.062  211.396 1.00 33.43  ? 207 GLN A N     1 
ATOM   2711 C CA    . GLN I 3 206 ? 20.482  22.685  210.661 1.00 38.64  ? 207 GLN A CA    1 
ATOM   2712 C C     . GLN I 3 206 ? 19.660  21.574  211.327 1.00 42.73  ? 207 GLN A C     1 
ATOM   2713 O O     . GLN I 3 206 ? 20.202  20.636  211.953 1.00 21.66  ? 207 GLN A O     1 
ATOM   2714 C CB    . GLN I 3 206 ? 20.854  22.219  209.253 1.00 36.88  ? 207 GLN A CB    1 
ATOM   2715 C CG    . GLN I 3 206 ? 21.467  23.258  208.391 1.00 44.02  ? 207 GLN A CG    1 
ATOM   2716 C CD    . GLN I 3 206 ? 20.446  24.010  207.578 1.00 54.10  ? 207 GLN A CD    1 
ATOM   2717 O OE1   . GLN I 3 206 ? 19.627  23.401  206.888 1.00 54.88  ? 207 GLN A OE1   1 
ATOM   2718 N NE2   . GLN I 3 206 ? 20.491  25.347  207.639 1.00 48.04  ? 207 GLN A NE2   1 
ATOM   2719 N N     . ILE I 3 207 ? 18.341  21.668  211.218 1.00 38.66  ? 208 ILE A N     1 
ATOM   2720 C CA    . ILE I 3 207 ? 17.573  20.577  211.765 1.00 40.13  ? 208 ILE A CA    1 
ATOM   2721 C C     . ILE I 3 207 ? 17.565  19.549  210.621 1.00 47.50  ? 208 ILE A C     1 
ATOM   2722 O O     . ILE I 3 207 ? 17.383  19.912  209.449 1.00 41.08  ? 208 ILE A O     1 
ATOM   2723 C CB    . ILE I 3 207 ? 16.157  20.988  212.197 1.00 36.52  ? 208 ILE A CB    1 
ATOM   2724 C CG1   . ILE I 3 207 ? 15.145  20.254  211.371 1.00 29.42  ? 208 ILE A CG1   1 
ATOM   2725 C CG2   . ILE I 3 207 ? 15.954  22.485  212.097 1.00 43.15  ? 208 ILE A CG2   1 
ATOM   2726 C CD1   . ILE I 3 207 ? 13.763  20.620  211.788 1.00 57.34  ? 208 ILE A CD1   1 
ATOM   2727 N N     . GLN I 3 208 ? 17.808  18.279  210.974 1.00 52.55  ? 209 GLN A N     1 
ATOM   2728 C CA    . GLN I 3 208 ? 17.900  17.170  210.016 1.00 45.09  ? 209 GLN A CA    1 
ATOM   2729 C C     . GLN I 3 208 ? 16.893  16.052  210.210 1.00 46.95  ? 209 GLN A C     1 
ATOM   2730 O O     . GLN I 3 208 ? 16.623  15.634  211.331 1.00 46.63  ? 209 GLN A O     1 
ATOM   2731 C CB    . GLN I 3 208 ? 19.287  16.542  210.084 1.00 41.93  ? 209 GLN A CB    1 
ATOM   2732 C CG    . GLN I 3 208 ? 20.434  17.518  210.007 1.00 50.82  ? 209 GLN A CG    1 
ATOM   2733 C CD    . GLN I 3 208 ? 21.772  16.864  210.316 1.00 53.64  ? 209 GLN A CD    1 
ATOM   2734 O OE1   . GLN I 3 208 ? 21.874  16.008  211.192 1.00 52.89  ? 209 GLN A OE1   1 
ATOM   2735 N NE2   . GLN I 3 208 ? 22.806  17.277  209.605 1.00 53.66  ? 209 GLN A NE2   1 
ATOM   2736 N N     . PHE I 3 209 ? 16.362  15.553  209.101 1.00 47.27  ? 210 PHE A N     1 
ATOM   2737 C CA    . PHE I 3 209 ? 15.412  14.466  209.159 1.00 45.77  ? 210 PHE A CA    1 
ATOM   2738 C C     . PHE I 3 209 ? 15.044  13.997  207.767 1.00 50.79  ? 210 PHE A C     1 
ATOM   2739 O O     . PHE I 3 209 ? 15.021  14.796  206.821 1.00 37.49  ? 210 PHE A O     1 
ATOM   2740 C CB    . PHE I 3 209 ? 14.160  14.889  209.938 1.00 36.31  ? 210 PHE A CB    1 
ATOM   2741 C CG    . PHE I 3 209 ? 13.321  15.945  209.256 1.00 40.69  ? 210 PHE A CG    1 
ATOM   2742 C CD1   . PHE I 3 209 ? 12.534  15.627  208.157 1.00 42.03  ? 210 PHE A CD1   1 
ATOM   2743 C CD2   . PHE I 3 209 ? 13.273  17.253  209.751 1.00 42.41  ? 210 PHE A CD2   1 
ATOM   2744 C CE1   . PHE I 3 209 ? 11.703  16.597  207.563 1.00 50.13  ? 210 PHE A CE1   1 
ATOM   2745 C CE2   . PHE I 3 209 ? 12.446  18.233  209.165 1.00 21.26  ? 210 PHE A CE2   1 
ATOM   2746 C CZ    . PHE I 3 209 ? 11.662  17.906  208.076 1.00 37.88  ? 210 PHE A CZ    1 
ATOM   2747 N N     . HIS I 3 210 ? 14.783  12.692  207.642 1.00 54.00  ? 211 HIS A N     1 
ATOM   2748 C CA    . HIS I 3 210 ? 14.376  12.107  206.355 1.00 42.65  ? 211 HIS A CA    1 
ATOM   2749 C C     . HIS I 3 210 ? 12.897  12.313  206.210 1.00 39.31  ? 211 HIS A C     1 
ATOM   2750 O O     . HIS I 3 210 ? 12.136  11.849  207.057 1.00 35.24  ? 211 HIS A O     1 
ATOM   2751 C CB    . HIS I 3 210 ? 14.648  10.618  206.307 1.00 20.97  ? 211 HIS A CB    1 
ATOM   2752 C CG    . HIS I 3 210 ? 16.058  10.280  205.962 1.00 33.76  ? 211 HIS A CG    1 
ATOM   2753 N ND1   . HIS I 3 210 ? 16.953  9.788   206.890 1.00 31.61  ? 211 HIS A ND1   1 
ATOM   2754 C CD2   . HIS I 3 210 ? 16.739  10.381  204.793 1.00 27.13  ? 211 HIS A CD2   1 
ATOM   2755 C CE1   . HIS I 3 210 ? 18.125  9.598   206.308 1.00 25.94  ? 211 HIS A CE1   1 
ATOM   2756 N NE2   . HIS I 3 210 ? 18.022  9.949   205.037 1.00 32.85  ? 211 HIS A NE2   1 
ATOM   2757 N N     . VAL I 3 211 ? 12.498  13.006  205.143 1.00 38.06  ? 212 VAL A N     1 
ATOM   2758 C CA    . VAL I 3 211 ? 11.089  13.296  204.891 1.00 33.60  ? 212 VAL A CA    1 
ATOM   2759 C C     . VAL I 3 211 ? 10.246  12.085  205.151 1.00 26.66  ? 212 VAL A C     1 
ATOM   2760 O O     . VAL I 3 211 ? 9.245   12.165  205.840 1.00 35.92  ? 212 VAL A O     1 
ATOM   2761 C CB    . VAL I 3 211 ? 10.831  13.725  203.443 1.00 34.97  ? 212 VAL A CB    1 
ATOM   2762 C CG1   . VAL I 3 211 ? 9.379   14.161  203.308 1.00 35.78  ? 212 VAL A CG1   1 
ATOM   2763 C CG2   . VAL I 3 211 ? 11.767  14.851  203.055 1.00 25.56  ? 212 VAL A CG2   1 
ATOM   2764 N N     . ARG I 3 212 ? 10.676  10.973  204.573 1.00 31.35  ? 213 ARG A N     1 
ATOM   2765 C CA    . ARG I 3 212 ? 10.034  9.676   204.699 1.00 32.09  ? 213 ARG A CA    1 
ATOM   2766 C C     . ARG I 3 212 ? 9.662   9.335   206.142 1.00 42.50  ? 213 ARG A C     1 
ATOM   2767 O O     . ARG I 3 212 ? 8.534   8.912   206.419 1.00 57.11  ? 213 ARG A O     1 
ATOM   2768 C CB    . ARG I 3 212 ? 10.979  8.628   204.134 1.00 42.47  ? 213 ARG A CB    1 
ATOM   2769 C CG    . ARG I 3 212 ? 10.700  7.189   204.498 1.00 55.49  ? 213 ARG A CG    1 
ATOM   2770 C CD    . ARG I 3 212 ? 11.800  6.267   203.957 1.00 49.48  ? 213 ARG A CD    1 
ATOM   2771 N NE    . ARG I 3 212 ? 12.097  6.521   202.547 1.00 50.91  ? 213 ARG A NE    1 
ATOM   2772 C CZ    . ARG I 3 212 ? 12.922  5.782   201.814 1.00 56.53  ? 213 ARG A CZ    1 
ATOM   2773 N NH1   . ARG I 3 212 ? 13.531  4.735   202.350 1.00 54.29  ? 213 ARG A NH1   1 
ATOM   2774 N NH2   . ARG I 3 212 ? 13.153  6.096   200.548 1.00 59.36  ? 213 ARG A NH2   1 
ATOM   2775 N N     . ASP I 3 213 ? 10.595  9.544   207.065 1.00 38.87  ? 214 ASP A N     1 
ATOM   2776 C CA    . ASP I 3 213 ? 10.358  9.245   208.463 1.00 38.56  ? 214 ASP A CA    1 
ATOM   2777 C C     . ASP I 3 213 ? 9.750   10.399  209.259 1.00 50.03  ? 214 ASP A C     1 
ATOM   2778 O O     . ASP I 3 213 ? 9.318   10.202  210.402 1.00 57.59  ? 214 ASP A O     1 
ATOM   2779 C CB    . ASP I 3 213 ? 11.665  8.847   209.140 1.00 43.58  ? 214 ASP A CB    1 
ATOM   2780 C CG    . ASP I 3 213 ? 12.586  8.078   208.231 1.00 60.68  ? 214 ASP A CG    1 
ATOM   2781 O OD1   . ASP I 3 213 ? 13.783  7.934   208.583 1.00 51.98  ? 214 ASP A OD1   1 
ATOM   2782 O OD2   . ASP I 3 213 ? 12.119  7.614   207.164 1.00 76.88  ? 214 ASP A OD2   1 
ATOM   2783 N N     . LEU I 3 214 ? 9.714   11.601  208.693 1.00 52.09  ? 215 LEU A N     1 
ATOM   2784 C CA    . LEU I 3 214 ? 9.177   12.733  209.445 1.00 60.54  ? 215 LEU A CA    1 
ATOM   2785 C C     . LEU I 3 214 ? 7.796   12.498  210.047 1.00 65.58  ? 215 LEU A C     1 
ATOM   2786 O O     . LEU I 3 214 ? 6.851   12.122  209.351 1.00 70.17  ? 215 LEU A O     1 
ATOM   2787 C CB    . LEU I 3 214 ? 9.133   14.012  208.590 1.00 61.20  ? 215 LEU A CB    1 
ATOM   2788 C CG    . LEU I 3 214 ? 8.488   15.210  209.335 1.00 56.74  ? 215 LEU A CG    1 
ATOM   2789 C CD1   . LEU I 3 214 ? 9.286   15.493  210.591 1.00 30.14  ? 215 LEU A CD1   1 
ATOM   2790 C CD2   . LEU I 3 214 ? 8.394   16.449  208.434 1.00 42.98  ? 215 LEU A CD2   1 
ATOM   2791 N N     . ASP I 3 215 ? 7.697   12.735  211.352 1.00 65.99  ? 216 ASP A N     1 
ATOM   2792 C CA    . ASP I 3 215 ? 6.444   12.589  212.089 1.00 60.33  ? 216 ASP A CA    1 
ATOM   2793 C C     . ASP I 3 215 ? 5.492   13.722  211.706 1.00 52.15  ? 216 ASP A C     1 
ATOM   2794 O O     . ASP I 3 215 ? 5.890   14.887  211.612 1.00 51.38  ? 216 ASP A O     1 
ATOM   2795 C CB    . ASP I 3 215 ? 6.731   12.623  213.601 1.00 67.09  ? 216 ASP A CB    1 
ATOM   2796 C CG    . ASP I 3 215 ? 5.767   13.524  214.370 1.00 67.69  ? 216 ASP A CG    1 
ATOM   2797 O OD1   . ASP I 3 215 ? 4.711   13.034  214.837 1.00 61.26  ? 216 ASP A OD1   1 
ATOM   2798 O OD2   . ASP I 3 215 ? 6.070   14.736  214.504 1.00 64.99  ? 216 ASP A OD2   1 
ATOM   2799 N N     . GLN I 3 216 ? 4.235   13.368  211.484 1.00 48.84  ? 217 GLN A N     1 
ATOM   2800 C CA    . GLN I 3 216 ? 3.204   14.334  211.111 1.00 52.95  ? 217 GLN A CA    1 
ATOM   2801 C C     . GLN I 3 216 ? 2.069   14.331  212.133 1.00 53.63  ? 217 GLN A C     1 
ATOM   2802 O O     . GLN I 3 216 ? 0.929   14.644  211.805 1.00 46.81  ? 217 GLN A O     1 
ATOM   2803 C CB    . GLN I 3 216 ? 2.636   13.978  209.744 1.00 50.87  ? 217 GLN A CB    1 
ATOM   2804 C CG    . GLN I 3 216 ? 3.622   14.080  208.630 1.00 52.11  ? 217 GLN A CG    1 
ATOM   2805 C CD    . GLN I 3 216 ? 3.718   15.482  208.108 1.00 59.41  ? 217 GLN A CD    1 
ATOM   2806 O OE1   . GLN I 3 216 ? 2.700   16.108  207.828 1.00 61.83  ? 217 GLN A OE1   1 
ATOM   2807 N NE2   . GLN I 3 216 ? 4.941   15.987  207.954 1.00 62.77  ? 217 GLN A NE2   1 
ATOM   2808 N N     . GLY I 3 217 ? 2.387   13.972  213.371 1.00 61.82  ? 218 GLY A N     1 
ATOM   2809 C CA    . GLY I 3 217 ? 1.377   13.929  214.409 1.00 68.09  ? 218 GLY A CA    1 
ATOM   2810 C C     . GLY I 3 217 ? 1.383   15.143  215.308 1.00 66.98  ? 218 GLY A C     1 
ATOM   2811 O O     . GLY I 3 217 ? 1.951   15.106  216.402 1.00 72.06  ? 218 GLY A O     1 
ATOM   2812 N N     . PHE I 3 218 ? 0.763   16.219  214.829 1.00 64.04  ? 219 PHE A N     1 
ATOM   2813 C CA    . PHE I 3 218 ? 0.656   17.471  215.572 1.00 59.67  ? 219 PHE A CA    1 
ATOM   2814 C C     . PHE I 3 218 ? -0.757  17.954  215.377 1.00 56.29  ? 219 PHE A C     1 
ATOM   2815 O O     . PHE I 3 218 ? -1.208  18.129  214.241 1.00 33.87  ? 219 PHE A O     1 
ATOM   2816 C CB    . PHE I 3 218 ? 1.601   18.542  215.027 1.00 59.79  ? 219 PHE A CB    1 
ATOM   2817 C CG    . PHE I 3 218 ? 1.668   19.766  215.888 1.00 49.33  ? 219 PHE A CG    1 
ATOM   2818 C CD1   . PHE I 3 218 ? 2.480   19.793  217.012 1.00 49.75  ? 219 PHE A CD1   1 
ATOM   2819 C CD2   . PHE I 3 218 ? 0.878   20.872  215.618 1.00 50.18  ? 219 PHE A CD2   1 
ATOM   2820 C CE1   . PHE I 3 218 ? 2.496   20.904  217.867 1.00 40.10  ? 219 PHE A CE1   1 
ATOM   2821 C CE2   . PHE I 3 218 ? 0.890   21.990  216.473 1.00 39.64  ? 219 PHE A CE2   1 
ATOM   2822 C CZ    . PHE I 3 218 ? 1.701   21.994  217.590 1.00 26.55  ? 219 PHE A CZ    1 
ATOM   2823 N N     . ASN I 3 219 ? -1.454  18.182  216.484 1.00 63.49  ? 220 ASN A N     1 
ATOM   2824 C CA    . ASN I 3 219 ? -2.840  18.619  216.405 1.00 74.64  ? 220 ASN A CA    1 
ATOM   2825 C C     . ASN I 3 219 ? -3.163  19.909  217.148 1.00 70.80  ? 220 ASN A C     1 
ATOM   2826 O O     . ASN I 3 219 ? -4.218  20.014  217.774 1.00 75.76  ? 220 ASN A O     1 
ATOM   2827 C CB    . ASN I 3 219 ? -3.764  17.475  216.863 1.00 85.46  ? 220 ASN A CB    1 
ATOM   2828 C CG    . ASN I 3 219 ? -3.402  16.937  218.239 1.00 96.69  ? 220 ASN A CG    1 
ATOM   2829 O OD1   . ASN I 3 219 ? -2.233  16.948  218.641 1.00 94.99  ? 220 ASN A OD1   1 
ATOM   2830 N ND2   . ASN I 3 219 ? -4.406  16.438  218.962 1.00 104.54 ? 220 ASN A ND2   1 
ATOM   2831 N N     . GLY I 3 220 ? -2.259  20.889  217.052 1.00 66.45  ? 221 GLY A N     1 
ATOM   2832 C CA    . GLY I 3 220 ? -2.457  22.184  217.690 1.00 56.11  ? 221 GLY A CA    1 
ATOM   2833 C C     . GLY I 3 220 ? -2.605  23.280  216.648 1.00 60.59  ? 221 GLY A C     1 
ATOM   2834 O O     . GLY I 3 220 ? -2.980  23.012  215.503 1.00 62.81  ? 221 GLY A O     1 
ATOM   2835 N N     . THR I 3 221 ? -2.305  24.518  217.038 1.00 63.42  ? 222 THR A N     1 
ATOM   2836 C CA    . THR I 3 221 ? -2.395  25.677  216.135 1.00 59.26  ? 222 THR A CA    1 
ATOM   2837 C C     . THR I 3 221 ? -0.988  26.097  215.674 1.00 58.48  ? 222 THR A C     1 
ATOM   2838 O O     . THR I 3 221 ? -0.003  25.782  216.344 1.00 58.92  ? 222 THR A O     1 
ATOM   2839 C CB    . THR I 3 221 ? -3.106  26.869  216.852 1.00 52.51  ? 222 THR A CB    1 
ATOM   2840 O OG1   . THR I 3 221 ? -3.071  28.038  216.019 1.00 45.39  ? 222 THR A OG1   1 
ATOM   2841 C CG2   . THR I 3 221 ? -2.438  27.157  218.203 1.00 46.93  ? 222 THR A CG2   1 
ATOM   2842 N N     . ARG I 3 222 ? -0.895  26.794  214.540 1.00 56.80  ? 223 ARG A N     1 
ATOM   2843 C CA    . ARG I 3 222 ? 0.402   27.237  214.010 1.00 58.95  ? 223 ARG A CA    1 
ATOM   2844 C C     . ARG I 3 222 ? 1.088   28.186  214.979 1.00 59.85  ? 223 ARG A C     1 
ATOM   2845 O O     . ARG I 3 222 ? 2.326   28.314  214.994 1.00 47.77  ? 223 ARG A O     1 
ATOM   2846 C CB    . ARG I 3 222 ? 0.237   27.936  212.659 1.00 62.50  ? 223 ARG A CB    1 
ATOM   2847 C CG    . ARG I 3 222 ? 1.560   28.220  211.963 1.00 62.95  ? 223 ARG A CG    1 
ATOM   2848 C CD    . ARG I 3 222 ? 2.296   26.922  211.683 1.00 57.93  ? 223 ARG A CD    1 
ATOM   2849 N NE    . ARG I 3 222 ? 1.529   26.099  210.760 1.00 63.05  ? 223 ARG A NE    1 
ATOM   2850 C CZ    . ARG I 3 222 ? 1.436   26.322  209.450 1.00 59.28  ? 223 ARG A CZ    1 
ATOM   2851 N NH1   . ARG I 3 222 ? 2.076   27.339  208.901 1.00 47.26  ? 223 ARG A NH1   1 
ATOM   2852 N NH2   . ARG I 3 222 ? 0.677   25.543  208.686 1.00 58.69  ? 223 ARG A NH2   1 
ATOM   2853 N N     . GLU I 3 223 ? 0.269   28.859  215.783 1.00 61.92  ? 224 GLU A N     1 
ATOM   2854 C CA    . GLU I 3 223 ? 0.773   29.779  216.791 1.00 64.36  ? 224 GLU A CA    1 
ATOM   2855 C C     . GLU I 3 223 ? 1.384   28.957  217.913 1.00 54.45  ? 224 GLU A C     1 
ATOM   2856 O O     . GLU I 3 223 ? 2.318   29.398  218.576 1.00 55.44  ? 224 GLU A O     1 
ATOM   2857 C CB    . GLU I 3 223 ? -0.359  30.666  217.328 1.00 72.56  ? 224 GLU A CB    1 
ATOM   2858 C CG    . GLU I 3 223 ? 0.005   31.461  218.580 1.00 79.58  ? 224 GLU A CG    1 
ATOM   2859 C CD    . GLU I 3 223 ? -1.113  32.381  219.049 1.00 84.77  ? 224 GLU A CD    1 
ATOM   2860 O OE1   . GLU I 3 223 ? -1.036  32.871  220.199 1.00 89.95  ? 224 GLU A OE1   1 
ATOM   2861 O OE2   . GLU I 3 223 ? -2.062  32.618  218.267 1.00 88.11  ? 224 GLU A OE2   1 
ATOM   2862 N N     . GLU I 3 224 ? 0.860   27.755  218.116 1.00 48.78  ? 225 GLU A N     1 
ATOM   2863 C CA    . GLU I 3 224 ? 1.388   26.880  219.155 1.00 62.89  ? 225 GLU A CA    1 
ATOM   2864 C C     . GLU I 3 224 ? 2.703   26.229  218.743 1.00 62.92  ? 225 GLU A C     1 
ATOM   2865 O O     . GLU I 3 224 ? 3.567   25.974  219.584 1.00 63.25  ? 225 GLU A O     1 
ATOM   2866 C CB    . GLU I 3 224 ? 0.370   25.806  219.503 1.00 70.81  ? 225 GLU A CB    1 
ATOM   2867 C CG    . GLU I 3 224 ? -0.208  25.986  220.891 1.00 92.39  ? 225 GLU A CG    1 
ATOM   2868 C CD    . GLU I 3 224 ? -1.692  25.698  220.932 1.00 94.50  ? 225 GLU A CD    1 
ATOM   2869 O OE1   . GLU I 3 224 ? -2.082  24.532  220.706 1.00 90.20  ? 225 GLU A OE1   1 
ATOM   2870 O OE2   . GLU I 3 224 ? -2.462  26.649  221.178 1.00 101.64 ? 225 GLU A OE2   1 
ATOM   2871 N N     . TRP I 3 225 ? 2.836   25.969  217.444 1.00 59.12  ? 226 TRP A N     1 
ATOM   2872 C CA    . TRP I 3 225 ? 4.026   25.363  216.870 1.00 53.16  ? 226 TRP A CA    1 
ATOM   2873 C C     . TRP I 3 225 ? 5.169   26.352  217.113 1.00 60.23  ? 226 TRP A C     1 
ATOM   2874 O O     . TRP I 3 225 ? 6.193   26.041  217.754 1.00 49.18  ? 226 TRP A O     1 
ATOM   2875 C CB    . TRP I 3 225 ? 3.810   25.164  215.362 1.00 57.28  ? 226 TRP A CB    1 
ATOM   2876 C CG    . TRP I 3 225 ? 4.633   24.058  214.757 1.00 58.56  ? 226 TRP A CG    1 
ATOM   2877 C CD1   . TRP I 3 225 ? 4.275   22.748  214.632 1.00 58.06  ? 226 TRP A CD1   1 
ATOM   2878 C CD2   . TRP I 3 225 ? 6.000   24.138  214.335 1.00 57.87  ? 226 TRP A CD2   1 
ATOM   2879 N NE1   . TRP I 3 225 ? 5.334   22.004  214.177 1.00 56.16  ? 226 TRP A NE1   1 
ATOM   2880 C CE2   . TRP I 3 225 ? 6.409   22.832  213.989 1.00 58.94  ? 226 TRP A CE2   1 
ATOM   2881 C CE3   . TRP I 3 225 ? 6.922   25.185  214.227 1.00 53.15  ? 226 TRP A CE3   1 
ATOM   2882 C CZ2   . TRP I 3 225 ? 7.703   22.544  213.547 1.00 55.47  ? 226 TRP A CZ2   1 
ATOM   2883 C CZ3   . TRP I 3 225 ? 8.200   24.902  213.789 1.00 50.27  ? 226 TRP A CZ3   1 
ATOM   2884 C CH2   . TRP I 3 225 ? 8.582   23.590  213.456 1.00 55.38  ? 226 TRP A CH2   1 
ATOM   2885 N N     . ALA I 3 226 ? 4.970   27.566  216.604 1.00 64.06  ? 227 ALA A N     1 
ATOM   2886 C CA    . ALA I 3 226 ? 5.958   28.638  216.734 1.00 66.99  ? 227 ALA A CA    1 
ATOM   2887 C C     . ALA I 3 226 ? 6.483   28.748  218.160 1.00 59.43  ? 227 ALA A C     1 
ATOM   2888 O O     . ALA I 3 226 ? 7.699   28.800  218.386 1.00 61.19  ? 227 ALA A O     1 
ATOM   2889 C CB    . ALA I 3 226 ? 5.340   29.986  216.287 1.00 66.65  ? 227 ALA A CB    1 
ATOM   2890 N N     . LYS I 3 227 ? 5.552   28.775  219.110 1.00 54.55  ? 228 LYS A N     1 
ATOM   2891 C CA    . LYS I 3 227 ? 5.886   28.891  220.524 1.00 58.99  ? 228 LYS A CA    1 
ATOM   2892 C C     . LYS I 3 227 ? 6.644   27.676  221.087 1.00 58.94  ? 228 LYS A C     1 
ATOM   2893 O O     . LYS I 3 227 ? 7.661   27.821  221.781 1.00 47.76  ? 228 LYS A O     1 
ATOM   2894 C CB    . LYS I 3 227 ? 4.605   29.141  221.337 1.00 49.30  ? 228 LYS A CB    1 
ATOM   2895 N N     . SER I 3 228 ? 6.162   26.480  220.776 1.00 57.22  ? 229 SER A N     1 
ATOM   2896 C CA    . SER I 3 228 ? 6.785   25.267  221.290 1.00 57.86  ? 229 SER A CA    1 
ATOM   2897 C C     . SER I 3 228 ? 8.167   25.020  220.723 1.00 58.31  ? 229 SER A C     1 
ATOM   2898 O O     . SER I 3 228 ? 9.084   24.616  221.445 1.00 56.56  ? 229 SER A O     1 
ATOM   2899 C CB    . SER I 3 228 ? 5.893   24.066  220.994 1.00 61.02  ? 229 SER A CB    1 
ATOM   2900 O OG    . SER I 3 228 ? 4.584   24.294  221.494 1.00 72.29  ? 229 SER A OG    1 
ATOM   2901 N N     . TYR I 3 229 ? 8.307   25.262  219.424 1.00 52.77  ? 230 TYR A N     1 
ATOM   2902 C CA    . TYR I 3 229 ? 9.571   25.040  218.744 1.00 47.16  ? 230 TYR A CA    1 
ATOM   2903 C C     . TYR I 3 229 ? 10.628  25.970  219.291 1.00 45.03  ? 230 TYR A C     1 
ATOM   2904 O O     . TYR I 3 229 ? 11.801  25.612  219.483 1.00 32.80  ? 230 TYR A O     1 
ATOM   2905 C CB    . TYR I 3 229 ? 9.411   25.295  217.246 1.00 49.17  ? 230 TYR A CB    1 
ATOM   2906 C CG    . TYR I 3 229 ? 10.747  25.411  216.552 1.00 54.87  ? 230 TYR A CG    1 
ATOM   2907 C CD1   . TYR I 3 229 ? 11.616  24.323  216.486 1.00 50.13  ? 230 TYR A CD1   1 
ATOM   2908 C CD2   . TYR I 3 229 ? 11.189  26.632  216.062 1.00 59.38  ? 230 TYR A CD2   1 
ATOM   2909 C CE1   . TYR I 3 229 ? 12.890  24.455  215.968 1.00 48.04  ? 230 TYR A CE1   1 
ATOM   2910 C CE2   . TYR I 3 229 ? 12.464  26.771  215.536 1.00 63.70  ? 230 TYR A CE2   1 
ATOM   2911 C CZ    . TYR I 3 229 ? 13.311  25.682  215.500 1.00 55.62  ? 230 TYR A CZ    1 
ATOM   2912 O OH    . TYR I 3 229 ? 14.594  25.858  215.050 1.00 60.97  ? 230 TYR A OH    1 
ATOM   2913 N N     . LEU I 3 230 ? 10.185  27.190  219.524 1.00 47.01  ? 231 LEU A N     1 
ATOM   2914 C CA    . LEU I 3 230 ? 11.056  28.221  220.022 1.00 48.94  ? 231 LEU A CA    1 
ATOM   2915 C C     . LEU I 3 230 ? 11.571  27.798  221.404 1.00 46.32  ? 231 LEU A C     1 
ATOM   2916 O O     . LEU I 3 230 ? 12.714  28.065  221.761 1.00 43.71  ? 231 LEU A O     1 
ATOM   2917 C CB    . LEU I 3 230 ? 10.276  29.543  220.035 1.00 46.24  ? 231 LEU A CB    1 
ATOM   2918 C CG    . LEU I 3 230 ? 10.997  30.829  219.612 1.00 53.15  ? 231 LEU A CG    1 
ATOM   2919 C CD1   . LEU I 3 230 ? 11.868  30.623  218.393 1.00 45.79  ? 231 LEU A CD1   1 
ATOM   2920 C CD2   . LEU I 3 230 ? 9.949   31.891  219.345 1.00 54.48  ? 231 LEU A CD2   1 
ATOM   2921 N N     . LYS I 3 231 ? 10.740  27.099  222.168 1.00 46.44  ? 232 LYS A N     1 
ATOM   2922 C CA    . LYS I 3 231 ? 11.160  26.640  223.481 1.00 50.40  ? 232 LYS A CA    1 
ATOM   2923 C C     . LYS I 3 231 ? 12.158  25.508  223.268 1.00 51.71  ? 232 LYS A C     1 
ATOM   2924 O O     . LYS I 3 231 ? 13.183  25.410  223.937 1.00 53.86  ? 232 LYS A O     1 
ATOM   2925 C CB    . LYS I 3 231 ? 9.965   26.120  224.277 1.00 65.82  ? 232 LYS A CB    1 
ATOM   2926 C CG    . LYS I 3 231 ? 10.183  26.100  225.791 1.00 77.05  ? 232 LYS A CG    1 
ATOM   2927 C CD    . LYS I 3 231 ? 9.323   25.043  226.464 1.00 78.79  ? 232 LYS A CD    1 
ATOM   2928 C CE    . LYS I 3 231 ? 7.835   25.253  226.203 1.00 86.35  ? 232 LYS A CE    1 
ATOM   2929 N NZ    . LYS I 3 231 ? 7.044   24.032  226.587 1.00 89.03  ? 232 LYS A NZ    1 
ATOM   2930 N N     . HIS I 3 232 ? 11.852  24.639  222.322 1.00 55.26  ? 233 HIS A N     1 
ATOM   2931 C CA    . HIS I 3 232 ? 12.745  23.538  222.033 1.00 47.75  ? 233 HIS A CA    1 
ATOM   2932 C C     . HIS I 3 232 ? 14.115  24.076  221.662 1.00 41.48  ? 233 HIS A C     1 
ATOM   2933 O O     . HIS I 3 232 ? 15.125  23.619  222.188 1.00 39.61  ? 233 HIS A O     1 
ATOM   2934 C CB    . HIS I 3 232 ? 12.187  22.709  220.885 1.00 52.82  ? 233 HIS A CB    1 
ATOM   2935 C CG    . HIS I 3 232 ? 13.052  21.550  220.509 1.00 56.19  ? 233 HIS A CG    1 
ATOM   2936 N ND1   . HIS I 3 232 ? 13.421  20.575  221.410 1.00 61.25  ? 233 HIS A ND1   1 
ATOM   2937 C CD2   . HIS I 3 232 ? 13.629  21.214  219.332 1.00 63.84  ? 233 HIS A CD2   1 
ATOM   2938 C CE1   . HIS I 3 232 ? 14.189  19.687  220.802 1.00 66.62  ? 233 HIS A CE1   1 
ATOM   2939 N NE2   . HIS I 3 232 ? 14.332  20.050  219.541 1.00 61.99  ? 233 HIS A NE2   1 
ATOM   2940 N N     . PHE I 3 233 ? 14.145  25.048  220.752 1.00 36.59  ? 234 PHE A N     1 
ATOM   2941 C CA    . PHE I 3 233 ? 15.404  25.640  220.305 1.00 38.28  ? 234 PHE A CA    1 
ATOM   2942 C C     . PHE I 3 233 ? 16.275  26.085  221.475 1.00 43.83  ? 234 PHE A C     1 
ATOM   2943 O O     . PHE I 3 233 ? 17.443  25.664  221.594 1.00 33.05  ? 234 PHE A O     1 
ATOM   2944 C CB    . PHE I 3 233 ? 15.126  26.828  219.371 1.00 42.07  ? 234 PHE A CB    1 
ATOM   2945 C CG    . PHE I 3 233 ? 16.362  27.415  218.715 1.00 40.51  ? 234 PHE A CG    1 
ATOM   2946 C CD1   . PHE I 3 233 ? 17.080  28.436  219.331 1.00 42.03  ? 234 PHE A CD1   1 
ATOM   2947 C CD2   . PHE I 3 233 ? 16.824  26.924  217.492 1.00 42.49  ? 234 PHE A CD2   1 
ATOM   2948 C CE1   . PHE I 3 233 ? 18.243  28.956  218.744 1.00 45.20  ? 234 PHE A CE1   1 
ATOM   2949 C CE2   . PHE I 3 233 ? 17.984  27.441  216.906 1.00 44.76  ? 234 PHE A CE2   1 
ATOM   2950 C CZ    . PHE I 3 233 ? 18.695  28.457  217.534 1.00 40.46  ? 234 PHE A CZ    1 
ATOM   2951 N N     . VAL I 3 234 ? 15.696  26.921  222.345 1.00 45.58  ? 235 VAL A N     1 
ATOM   2952 C CA    . VAL I 3 234 ? 16.385  27.491  223.534 1.00 53.24  ? 235 VAL A CA    1 
ATOM   2953 C C     . VAL I 3 234 ? 17.033  26.475  224.474 1.00 44.21  ? 235 VAL A C     1 
ATOM   2954 O O     . VAL I 3 234 ? 18.119  26.696  224.995 1.00 38.26  ? 235 VAL A O     1 
ATOM   2955 C CB    . VAL I 3 234 ? 15.419  28.358  224.410 1.00 56.10  ? 235 VAL A CB    1 
ATOM   2956 C CG1   . VAL I 3 234 ? 16.212  29.064  225.480 1.00 58.02  ? 235 VAL A CG1   1 
ATOM   2957 C CG2   . VAL I 3 234 ? 14.679  29.371  223.567 1.00 65.37  ? 235 VAL A CG2   1 
ATOM   2958 N N     . THR I 3 235 ? 16.339  25.373  224.698 1.00 41.91  ? 236 THR A N     1 
ATOM   2959 C CA    . THR I 3 235 ? 16.832  24.328  225.568 1.00 51.67  ? 236 THR A CA    1 
ATOM   2960 C C     . THR I 3 235 ? 18.016  23.637  224.943 1.00 53.29  ? 236 THR A C     1 
ATOM   2961 O O     . THR I 3 235 ? 19.069  23.486  225.562 1.00 55.37  ? 236 THR A O     1 
ATOM   2962 C CB    . THR I 3 235 ? 15.774  23.298  225.777 1.00 56.89  ? 236 THR A CB    1 
ATOM   2963 O OG1   . THR I 3 235 ? 14.550  23.795  225.225 1.00 58.20  ? 236 THR A OG1   1 
ATOM   2964 C CG2   . THR I 3 235 ? 15.617  23.002  227.257 1.00 57.31  ? 236 THR A CG2   1 
ATOM   2965 N N     . GLN I 3 236 ? 17.827  23.183  223.713 1.00 55.71  ? 237 GLN A N     1 
ATOM   2966 C CA    . GLN I 3 236 ? 18.893  22.499  222.998 1.00 59.08  ? 237 GLN A CA    1 
ATOM   2967 C C     . GLN I 3 236 ? 20.099  23.424  222.860 1.00 57.57  ? 237 GLN A C     1 
ATOM   2968 O O     . GLN I 3 236 ? 21.256  22.985  222.973 1.00 38.69  ? 237 GLN A O     1 
ATOM   2969 C CB    . GLN I 3 236 ? 18.381  22.061  221.632 1.00 62.26  ? 237 GLN A CB    1 
ATOM   2970 C CG    . GLN I 3 236 ? 17.222  21.114  221.762 1.00 60.00  ? 237 GLN A CG    1 
ATOM   2971 C CD    . GLN I 3 236 ? 17.614  19.852  222.496 1.00 51.46  ? 237 GLN A CD    1 
ATOM   2972 O OE1   . GLN I 3 236 ? 16.766  19.113  222.993 1.00 54.74  ? 237 GLN A OE1   1 
ATOM   2973 N NE2   . GLN I 3 236 ? 18.908  19.594  222.558 1.00 40.06  ? 237 GLN A NE2   1 
ATOM   2974 N N     . ALA I 3 237 ? 19.809  24.704  222.617 1.00 54.39  ? 238 ALA A N     1 
ATOM   2975 C CA    . ALA I 3 237 ? 20.845  25.720  222.499 1.00 56.94  ? 238 ALA A CA    1 
ATOM   2976 C C     . ALA I 3 237 ? 21.699  25.639  223.769 1.00 56.99  ? 238 ALA A C     1 
ATOM   2977 O O     . ALA I 3 237 ? 22.881  25.281  223.712 1.00 55.70  ? 238 ALA A O     1 
ATOM   2978 C CB    . ALA I 3 237 ? 20.214  27.096  222.373 1.00 47.04  ? 238 ALA A CB    1 
ATOM   2979 N N     . GLU I 3 238 ? 21.086  25.952  224.912 1.00 51.15  ? 239 GLU A N     1 
ATOM   2980 C CA    . GLU I 3 238 ? 21.785  25.894  226.183 1.00 44.96  ? 239 GLU A CA    1 
ATOM   2981 C C     . GLU I 3 238 ? 22.493  24.556  226.245 1.00 42.37  ? 239 GLU A C     1 
ATOM   2982 O O     . GLU I 3 238 ? 23.708  24.495  226.422 1.00 44.99  ? 239 GLU A O     1 
ATOM   2983 C CB    . GLU I 3 238 ? 20.808  25.996  227.358 1.00 41.30  ? 239 GLU A CB    1 
ATOM   2984 C CG    . GLU I 3 238 ? 19.799  27.126  227.237 1.00 55.92  ? 239 GLU A CG    1 
ATOM   2985 C CD    . GLU I 3 238 ? 18.908  27.281  228.479 1.00 71.59  ? 239 GLU A CD    1 
ATOM   2986 O OE1   . GLU I 3 238 ? 18.293  26.277  228.915 1.00 73.87  ? 239 GLU A OE1   1 
ATOM   2987 O OE2   . GLU I 3 238 ? 18.813  28.415  229.017 1.00 70.56  ? 239 GLU A OE2   1 
ATOM   2988 N N     . GLN I 3 239 ? 21.736  23.479  226.070 1.00 41.16  ? 240 GLN A N     1 
ATOM   2989 C CA    . GLN I 3 239 ? 22.309  22.145  226.146 1.00 44.19  ? 240 GLN A CA    1 
ATOM   2990 C C     . GLN I 3 239 ? 23.616  22.009  225.373 1.00 48.18  ? 240 GLN A C     1 
ATOM   2991 O O     . GLN I 3 239 ? 24.603  21.545  225.937 1.00 42.25  ? 240 GLN A O     1 
ATOM   2992 C CB    . GLN I 3 239 ? 21.283  21.109  225.689 1.00 50.59  ? 240 GLN A CB    1 
ATOM   2993 C CG    . GLN I 3 239 ? 21.714  19.659  225.910 1.00 69.80  ? 240 GLN A CG    1 
ATOM   2994 C CD    . GLN I 3 239 ? 22.313  19.400  227.293 1.00 77.22  ? 240 GLN A CD    1 
ATOM   2995 O OE1   . GLN I 3 239 ? 23.541  19.423  227.469 1.00 75.94  ? 240 GLN A OE1   1 
ATOM   2996 N NE2   . GLN I 3 239 ? 21.448  19.154  228.281 1.00 80.45  ? 240 GLN A NE2   1 
ATOM   2997 N N     . ARG I 3 240 ? 23.631  22.422  224.101 1.00 54.84  ? 241 ARG A N     1 
ATOM   2998 C CA    . ARG I 3 240 ? 24.846  22.357  223.268 1.00 54.11  ? 241 ARG A CA    1 
ATOM   2999 C C     . ARG I 3 240 ? 25.984  23.134  223.925 1.00 51.52  ? 241 ARG A C     1 
ATOM   3000 O O     . ARG I 3 240 ? 27.140  22.718  223.913 1.00 46.25  ? 241 ARG A O     1 
ATOM   3001 C CB    . ARG I 3 240 ? 24.588  22.956  221.879 1.00 56.04  ? 241 ARG A CB    1 
ATOM   3002 C CG    . ARG I 3 240 ? 25.841  23.050  220.997 1.00 51.19  ? 241 ARG A CG    1 
ATOM   3003 C CD    . ARG I 3 240 ? 26.287  21.687  220.516 1.00 53.39  ? 241 ARG A CD    1 
ATOM   3004 N NE    . ARG I 3 240 ? 27.524  21.723  219.747 1.00 57.42  ? 241 ARG A NE    1 
ATOM   3005 C CZ    . ARG I 3 240 ? 27.898  20.778  218.885 1.00 62.59  ? 241 ARG A CZ    1 
ATOM   3006 N NH1   . ARG I 3 240 ? 27.125  19.716  218.676 1.00 54.78  ? 241 ARG A NH1   1 
ATOM   3007 N NH2   . ARG I 3 240 ? 29.050  20.893  218.226 1.00 56.95  ? 241 ARG A NH2   1 
ATOM   3008 N N     . ALA I 3 241 ? 25.642  24.285  224.479 1.00 50.97  ? 242 ALA A N     1 
ATOM   3009 C CA    . ALA I 3 241 ? 26.626  25.107  225.150 1.00 56.40  ? 242 ALA A CA    1 
ATOM   3010 C C     . ALA I 3 241 ? 27.338  24.272  226.209 1.00 53.66  ? 242 ALA A C     1 
ATOM   3011 O O     . ALA I 3 241 ? 28.529  24.452  226.426 1.00 57.18  ? 242 ALA A O     1 
ATOM   3012 C CB    . ALA I 3 241 ? 25.943  26.318  225.794 1.00 62.02  ? 242 ALA A CB    1 
ATOM   3013 N N     . ILE I 3 242 ? 26.600  23.362  226.851 1.00 47.58  ? 243 ILE A N     1 
ATOM   3014 C CA    . ILE I 3 242 ? 27.136  22.485  227.895 1.00 45.96  ? 243 ILE A CA    1 
ATOM   3015 C C     . ILE I 3 242 ? 27.992  21.382  227.291 1.00 46.78  ? 243 ILE A C     1 
ATOM   3016 O O     . ILE I 3 242 ? 29.145  21.175  227.682 1.00 41.56  ? 243 ILE A O     1 
ATOM   3017 C CB    . ILE I 3 242 ? 25.983  21.833  228.734 1.00 54.22  ? 243 ILE A CB    1 
ATOM   3018 C CG1   . ILE I 3 242 ? 25.297  22.891  229.601 1.00 55.19  ? 243 ILE A CG1   1 
ATOM   3019 C CG2   . ILE I 3 242 ? 26.519  20.721  229.627 1.00 42.50  ? 243 ILE A CG2   1 
ATOM   3020 C CD1   . ILE I 3 242 ? 26.258  23.610  230.553 1.00 71.65  ? 243 ILE A CD1   1 
ATOM   3021 N N     . SER I 3 243 ? 27.417  20.669  226.331 1.00 53.46  ? 244 SER A N     1 
ATOM   3022 C CA    . SER I 3 243 ? 28.127  19.584  225.667 1.00 66.16  ? 244 SER A CA    1 
ATOM   3023 C C     . SER I 3 243 ? 29.398  20.085  224.950 1.00 65.31  ? 244 SER A C     1 
ATOM   3024 O O     . SER I 3 243 ? 30.367  19.336  224.782 1.00 69.75  ? 244 SER A O     1 
ATOM   3025 C CB    . SER I 3 243 ? 27.193  18.875  224.680 1.00 66.78  ? 244 SER A CB    1 
ATOM   3026 O OG    . SER I 3 243 ? 26.644  19.794  223.755 1.00 76.92  ? 244 SER A OG    1 
ATOM   3027 N N     . MET I 3 244 ? 29.406  21.351  224.549 1.00 54.89  ? 245 MET A N     1 
ATOM   3028 C CA    . MET I 3 244 ? 30.571  21.894  223.878 1.00 54.12  ? 245 MET A CA    1 
ATOM   3029 C C     . MET I 3 244 ? 31.812  21.960  224.768 1.00 51.40  ? 245 MET A C     1 
ATOM   3030 O O     . MET I 3 244 ? 32.917  21.712  224.298 1.00 51.12  ? 245 MET A O     1 
ATOM   3031 C CB    . MET I 3 244 ? 30.259  23.279  223.294 1.00 61.72  ? 245 MET A CB    1 
ATOM   3032 C CG    . MET I 3 244 ? 29.656  23.257  221.882 1.00 57.81  ? 245 MET A CG    1 
ATOM   3033 S SD    . MET I 3 244 ? 29.776  24.871  221.072 1.00 52.07  ? 245 MET A SD    1 
ATOM   3034 C CE    . MET I 3 244 ? 31.584  24.971  220.932 1.00 28.11  ? 245 MET A CE    1 
ATOM   3035 N N     . ILE I 3 245 ? 31.648  22.285  226.048 1.00 57.40  ? 246 ILE A N     1 
ATOM   3036 C CA    . ILE I 3 245 ? 32.802  22.359  226.960 1.00 59.08  ? 246 ILE A CA    1 
ATOM   3037 C C     . ILE I 3 245 ? 33.301  20.966  227.316 1.00 66.00  ? 246 ILE A C     1 
ATOM   3038 O O     . ILE I 3 245 ? 34.501  20.740  227.474 1.00 69.05  ? 246 ILE A O     1 
ATOM   3039 C CB    . ILE I 3 245 ? 32.469  23.096  228.275 1.00 52.08  ? 246 ILE A CB    1 
ATOM   3040 C CG1   . ILE I 3 245 ? 30.952  23.210  228.431 1.00 57.68  ? 246 ILE A CG1   1 
ATOM   3041 C CG2   . ILE I 3 245 ? 33.164  24.441  228.294 1.00 31.57  ? 246 ILE A CG2   1 
ATOM   3042 C CD1   . ILE I 3 245 ? 30.482  23.800  229.745 1.00 68.57  ? 246 ILE A CD1   1 
ATOM   3043 N N     . ASP I 3 246 ? 32.378  20.025  227.443 1.00 67.75  ? 247 ASP A N     1 
ATOM   3044 C CA    . ASP I 3 246 ? 32.785  18.678  227.764 1.00 71.47  ? 247 ASP A CA    1 
ATOM   3045 C C     . ASP I 3 246 ? 33.585  18.094  226.616 1.00 68.65  ? 247 ASP A C     1 
ATOM   3046 O O     . ASP I 3 246 ? 34.733  17.704  226.787 1.00 67.48  ? 247 ASP A O     1 
ATOM   3047 C CB    . ASP I 3 246 ? 31.567  17.819  228.023 1.00 84.91  ? 247 ASP A CB    1 
ATOM   3048 C CG    . ASP I 3 246 ? 30.667  18.423  229.050 1.00 102.75 ? 247 ASP A CG    1 
ATOM   3049 O OD1   . ASP I 3 246 ? 29.638  17.799  229.373 1.00 111.17 ? 247 ASP A OD1   1 
ATOM   3050 O OD2   . ASP I 3 246 ? 30.991  19.532  229.535 1.00 113.42 ? 247 ASP A OD2   1 
ATOM   3051 N N     . LYS I 3 247 ? 32.990  18.065  225.433 1.00 57.82  ? 248 LYS A N     1 
ATOM   3052 C CA    . LYS I 3 247 ? 33.660  17.478  224.292 1.00 52.83  ? 248 LYS A CA    1 
ATOM   3053 C C     . LYS I 3 247 ? 34.851  18.224  223.712 1.00 55.56  ? 248 LYS A C     1 
ATOM   3054 O O     . LYS I 3 247 ? 35.841  17.600  223.326 1.00 51.42  ? 248 LYS A O     1 
ATOM   3055 C CB    . LYS I 3 247 ? 32.648  17.226  223.181 1.00 54.53  ? 248 LYS A CB    1 
ATOM   3056 C CG    . LYS I 3 247 ? 33.186  16.376  222.036 1.00 49.66  ? 248 LYS A CG    1 
ATOM   3057 C CD    . LYS I 3 247 ? 32.069  15.972  221.088 1.00 47.94  ? 248 LYS A CD    1 
ATOM   3058 C CE    . LYS I 3 247 ? 32.580  15.076  219.970 1.00 47.94  ? 248 LYS A CE    1 
ATOM   3059 N NZ    . LYS I 3 247 ? 31.504  14.693  218.991 1.00 49.69  ? 248 LYS A NZ    1 
ATOM   3060 N N     . PHE I 3 248 ? 34.771  19.550  223.660 1.00 57.92  ? 249 PHE A N     1 
ATOM   3061 C CA    . PHE I 3 248 ? 35.837  20.340  223.064 1.00 57.56  ? 249 PHE A CA    1 
ATOM   3062 C C     . PHE I 3 248 ? 36.753  21.104  223.993 1.00 59.72  ? 249 PHE A C     1 
ATOM   3063 O O     . PHE I 3 248 ? 37.616  21.855  223.532 1.00 59.87  ? 249 PHE A O     1 
ATOM   3064 C CB    . PHE I 3 248 ? 35.232  21.317  222.066 1.00 63.59  ? 249 PHE A CB    1 
ATOM   3065 C CG    . PHE I 3 248 ? 34.215  20.697  221.159 1.00 60.75  ? 249 PHE A CG    1 
ATOM   3066 C CD1   . PHE I 3 248 ? 34.550  19.601  220.367 1.00 46.09  ? 249 PHE A CD1   1 
ATOM   3067 C CD2   . PHE I 3 248 ? 32.916  21.205  221.108 1.00 59.51  ? 249 PHE A CD2   1 
ATOM   3068 C CE1   . PHE I 3 248 ? 33.622  19.024  219.544 1.00 55.06  ? 249 PHE A CE1   1 
ATOM   3069 C CE2   . PHE I 3 248 ? 31.970  20.631  220.281 1.00 67.41  ? 249 PHE A CE2   1 
ATOM   3070 C CZ    . PHE I 3 248 ? 32.321  19.533  219.495 1.00 65.95  ? 249 PHE A CZ    1 
ATOM   3071 N N     . VAL I 3 249 ? 36.582  20.929  225.294 1.00 66.24  ? 250 VAL A N     1 
ATOM   3072 C CA    . VAL I 3 249 ? 37.442  21.641  226.227 1.00 76.22  ? 250 VAL A CA    1 
ATOM   3073 C C     . VAL I 3 249 ? 38.186  20.732  227.196 1.00 75.82  ? 250 VAL A C     1 
ATOM   3074 O O     . VAL I 3 249 ? 39.419  20.644  227.160 1.00 76.23  ? 250 VAL A O     1 
ATOM   3075 C CB    . VAL I 3 249 ? 36.647  22.680  227.052 1.00 81.71  ? 250 VAL A CB    1 
ATOM   3076 C CG1   . VAL I 3 249 ? 37.589  23.408  228.009 1.00 84.88  ? 250 VAL A CG1   1 
ATOM   3077 C CG2   . VAL I 3 249 ? 35.962  23.672  226.123 1.00 84.75  ? 250 VAL A CG2   1 
ATOM   3078 N N     . LYS I 3 250 ? 37.422  20.067  228.058 1.00 72.08  ? 251 LYS A N     1 
ATOM   3079 C CA    . LYS I 3 250 ? 37.968  19.179  229.075 1.00 66.53  ? 251 LYS A CA    1 
ATOM   3080 C C     . LYS I 3 250 ? 39.060  18.269  228.533 1.00 65.12  ? 251 LYS A C     1 
ATOM   3081 O O     . LYS I 3 250 ? 40.210  18.333  228.967 1.00 71.29  ? 251 LYS A O     1 
ATOM   3082 C CB    . LYS I 3 250 ? 36.844  18.347  229.677 1.00 65.39  ? 251 LYS A CB    1 
ATOM   3083 C CG    . LYS I 3 250 ? 35.608  19.168  230.019 1.00 69.81  ? 251 LYS A CG    1 
ATOM   3084 N N     . PRO I 3 251 ? 38.727  17.424  227.554 1.00 63.43  ? 252 PRO A N     1 
ATOM   3085 C CA    . PRO I 3 251 ? 39.768  16.544  227.033 1.00 61.95  ? 252 PRO A CA    1 
ATOM   3086 C C     . PRO I 3 251 ? 40.974  17.232  226.398 1.00 63.05  ? 252 PRO A C     1 
ATOM   3087 O O     . PRO I 3 251 ? 41.950  16.566  226.069 1.00 71.54  ? 252 PRO A O     1 
ATOM   3088 C CB    . PRO I 3 251 ? 39.007  15.662  226.049 1.00 57.39  ? 252 PRO A CB    1 
ATOM   3089 C CG    . PRO I 3 251 ? 37.964  16.572  225.526 1.00 56.57  ? 252 PRO A CG    1 
ATOM   3090 C CD    . PRO I 3 251 ? 37.487  17.295  226.771 1.00 61.23  ? 252 PRO A CD    1 
ATOM   3091 N N     . PHE I 3 252 ? 40.938  18.549  226.218 1.00 57.47  ? 253 PHE A N     1 
ATOM   3092 C CA    . PHE I 3 252 ? 42.096  19.203  225.606 1.00 62.04  ? 253 PHE A CA    1 
ATOM   3093 C C     . PHE I 3 252 ? 42.857  20.141  226.534 1.00 65.24  ? 253 PHE A C     1 
ATOM   3094 O O     . PHE I 3 252 ? 44.020  20.485  226.266 1.00 56.99  ? 253 PHE A O     1 
ATOM   3095 C CB    . PHE I 3 252 ? 41.691  19.957  224.333 1.00 62.43  ? 253 PHE A CB    1 
ATOM   3096 C CG    . PHE I 3 252 ? 41.256  19.067  223.218 1.00 45.42  ? 253 PHE A CG    1 
ATOM   3097 C CD1   . PHE I 3 252 ? 39.917  18.807  223.009 1.00 47.56  ? 253 PHE A CD1   1 
ATOM   3098 C CD2   . PHE I 3 252 ? 42.190  18.441  222.412 1.00 52.75  ? 253 PHE A CD2   1 
ATOM   3099 C CE1   . PHE I 3 252 ? 39.510  17.928  222.005 1.00 50.04  ? 253 PHE A CE1   1 
ATOM   3100 C CE2   . PHE I 3 252 ? 41.795  17.554  221.403 1.00 53.39  ? 253 PHE A CE2   1 
ATOM   3101 C CZ    . PHE I 3 252 ? 40.456  17.297  221.202 1.00 43.92  ? 253 PHE A CZ    1 
ATOM   3102 N N     . LYS I 3 253 ? 42.201  20.528  227.627 1.00 63.70  ? 254 LYS A N     1 
ATOM   3103 C CA    . LYS I 3 253 ? 42.774  21.430  228.628 1.00 61.31  ? 254 LYS A CA    1 
ATOM   3104 C C     . LYS I 3 253 ? 44.038  20.860  229.269 1.00 56.48  ? 254 LYS A C     1 
ATOM   3105 O O     . LYS I 3 253 ? 44.679  21.521  230.088 1.00 54.62  ? 254 LYS A O     1 
ATOM   3106 C CB    . LYS I 3 253 ? 41.729  21.736  229.715 1.00 62.92  ? 254 LYS A CB    1 
ATOM   3107 C CG    . LYS I 3 253 ? 41.965  23.049  230.427 1.00 66.91  ? 254 LYS A CG    1 
ATOM   3108 C CD    . LYS I 3 253 ? 40.706  23.600  231.073 1.00 71.92  ? 254 LYS A CD    1 
ATOM   3109 C CE    . LYS I 3 253 ? 40.876  25.102  231.380 1.00 83.39  ? 254 LYS A CE    1 
ATOM   3110 N NZ    . LYS I 3 253 ? 41.088  25.959  230.156 1.00 79.27  ? 254 LYS A NZ    1 
ATOM   3111 N N     . LYS I 3 254 ? 44.385  19.635  228.871 1.00 60.51  ? 255 LYS A N     1 
ATOM   3112 C CA    . LYS I 3 254 ? 45.553  18.903  229.378 1.00 61.13  ? 255 LYS A CA    1 
ATOM   3113 C C     . LYS I 3 254 ? 46.807  19.128  228.548 1.00 60.07  ? 255 LYS A C     1 
ATOM   3114 O O     . LYS I 3 254 ? 47.922  18.911  229.011 1.00 63.96  ? 255 LYS A O     1 
ATOM   3115 C CB    . LYS I 3 254 ? 45.229  17.398  229.450 1.00 66.25  ? 255 LYS A CB    1 
ATOM   3116 C CG    . LYS I 3 254 ? 44.397  16.855  228.272 1.00 75.17  ? 255 LYS A CG    1 
ATOM   3117 C CD    . LYS I 3 254 ? 43.684  15.531  228.604 1.00 73.20  ? 255 LYS A CD    1 
ATOM   3118 C CE    . LYS I 3 254 ? 44.676  14.447  228.919 1.00 63.05  ? 255 LYS A CE    1 
ATOM   3119 N NZ    . LYS I 3 254 ? 45.737  14.490  227.883 1.00 64.09  ? 255 LYS A NZ    1 
ATOM   3120 N N     . TYR I 3 255 ? 46.608  19.577  227.318 1.00 64.40  ? 256 TYR A N     1 
ATOM   3121 C CA    . TYR I 3 255 ? 47.699  19.849  226.392 1.00 64.75  ? 256 TYR A CA    1 
ATOM   3122 C C     . TYR I 3 255 ? 48.119  21.322  226.533 1.00 71.35  ? 256 TYR A C     1 
ATOM   3123 O O     . TYR I 3 255 ? 49.246  21.709  226.167 1.00 63.59  ? 256 TYR A O     1 
ATOM   3124 C CB    . TYR I 3 255 ? 47.202  19.570  224.978 1.00 62.59  ? 256 TYR A CB    1 
ATOM   3125 C CG    . TYR I 3 255 ? 46.795  18.135  224.751 1.00 51.76  ? 256 TYR A CG    1 
ATOM   3126 C CD1   . TYR I 3 255 ? 47.749  17.169  224.415 1.00 49.34  ? 256 TYR A CD1   1 
ATOM   3127 C CD2   . TYR I 3 255 ? 45.462  17.738  224.875 1.00 46.55  ? 256 TYR A CD2   1 
ATOM   3128 C CE1   . TYR I 3 255 ? 47.395  15.842  224.206 1.00 45.87  ? 256 TYR A CE1   1 
ATOM   3129 C CE2   . TYR I 3 255 ? 45.089  16.410  224.670 1.00 52.20  ? 256 TYR A CE2   1 
ATOM   3130 C CZ    . TYR I 3 255 ? 46.063  15.463  224.334 1.00 52.33  ? 256 TYR A CZ    1 
ATOM   3131 O OH    . TYR I 3 255 ? 45.710  14.144  224.140 1.00 51.21  ? 256 TYR A OH    1 
ATOM   3132 N N     . ILE I 3 256 ? 47.190  22.119  227.077 1.00 74.27  ? 257 ILE A N     1 
ATOM   3133 C CA    . ILE I 3 256 ? 47.367  23.556  227.310 1.00 75.96  ? 257 ILE A CA    1 
ATOM   3134 C C     . ILE I 3 256 ? 48.429  23.801  228.374 1.00 79.23  ? 257 ILE A C     1 
ATOM   3135 O O     . ILE I 3 256 ? 48.184  24.506  229.356 1.00 83.86  ? 257 ILE A O     1 
ATOM   3136 C CB    . ILE I 3 256 ? 46.060  24.251  227.813 1.00 74.58  ? 257 ILE A CB    1 
ATOM   3137 C CG1   . ILE I 3 256 ? 44.836  23.768  227.041 1.00 61.63  ? 257 ILE A CG1   1 
ATOM   3138 C CG2   . ILE I 3 256 ? 46.169  25.749  227.602 1.00 78.10  ? 257 ILE A CG2   1 
ATOM   3139 C CD1   . ILE I 3 256 ? 44.927  24.020  225.578 1.00 68.30  ? 257 ILE A CD1   1 
ATOM   3140 N N     . LEU I 3 257 ? 49.605  23.216  228.171 1.00 79.43  ? 258 LEU A N     1 
ATOM   3141 C CA    . LEU I 3 257 ? 50.706  23.359  229.111 1.00 76.71  ? 258 LEU A CA    1 
ATOM   3142 C C     . LEU I 3 257 ? 50.275  22.978  230.531 1.00 60.34  ? 258 LEU A C     1 
ATOM   3143 C CB    . LEU I 3 257 ? 51.229  24.800  229.081 1.00 72.42  ? 258 LEU A CB    1 
ATOM   3144 N N     . SER J 3 1   ? 56.786  20.479  200.962 1.00 49.35  ? 2   SER B N     1 
ATOM   3145 C CA    . SER J 3 1   ? 55.742  20.024  200.018 1.00 52.80  ? 2   SER B CA    1 
ATOM   3146 C C     . SER J 3 1   ? 56.445  19.531  198.773 1.00 59.60  ? 2   SER B C     1 
ATOM   3147 O O     . SER J 3 1   ? 57.539  19.988  198.445 1.00 53.50  ? 2   SER B O     1 
ATOM   3148 C CB    . SER J 3 1   ? 54.791  21.175  199.659 1.00 50.85  ? 2   SER B CB    1 
ATOM   3149 O OG    . SER J 3 1   ? 53.992  20.883  198.512 1.00 42.24  ? 2   SER B OG    1 
ATOM   3150 N N     . PHE J 3 2   ? 55.802  18.587  198.096 1.00 66.44  ? 3   PHE B N     1 
ATOM   3151 C CA    . PHE J 3 2   ? 56.321  17.985  196.881 1.00 64.12  ? 3   PHE B CA    1 
ATOM   3152 C C     . PHE J 3 2   ? 55.725  18.746  195.717 1.00 65.67  ? 3   PHE B C     1 
ATOM   3153 O O     . PHE J 3 2   ? 56.162  18.621  194.576 1.00 73.93  ? 3   PHE B O     1 
ATOM   3154 C CB    . PHE J 3 2   ? 55.882  16.527  196.812 1.00 57.64  ? 3   PHE B CB    1 
ATOM   3155 C CG    . PHE J 3 2   ? 56.267  15.724  198.014 1.00 49.01  ? 3   PHE B CG    1 
ATOM   3156 C CD1   . PHE J 3 2   ? 57.580  15.361  198.226 1.00 46.91  ? 3   PHE B CD1   1 
ATOM   3157 C CD2   . PHE J 3 2   ? 55.311  15.296  198.918 1.00 53.81  ? 3   PHE B CD2   1 
ATOM   3158 C CE1   . PHE J 3 2   ? 57.940  14.588  199.317 1.00 33.02  ? 3   PHE B CE1   1 
ATOM   3159 C CE2   . PHE J 3 2   ? 55.674  14.523  200.011 1.00 53.08  ? 3   PHE B CE2   1 
ATOM   3160 C CZ    . PHE J 3 2   ? 56.993  14.168  200.198 1.00 36.80  ? 3   PHE B CZ    1 
ATOM   3161 N N     . ILE J 3 3   ? 54.692  19.516  196.014 1.00 63.79  ? 4   ILE B N     1 
ATOM   3162 C CA    . ILE J 3 3   ? 54.048  20.303  194.994 1.00 60.16  ? 4   ILE B CA    1 
ATOM   3163 C C     . ILE J 3 3   ? 54.845  21.577  194.911 1.00 53.55  ? 4   ILE B C     1 
ATOM   3164 O O     . ILE J 3 3   ? 55.379  21.930  193.846 1.00 36.90  ? 4   ILE B O     1 
ATOM   3165 C CB    . ILE J 3 3   ? 52.600  20.615  195.389 1.00 61.20  ? 4   ILE B CB    1 
ATOM   3166 C CG1   . ILE J 3 3   ? 51.818  19.312  195.425 1.00 75.18  ? 4   ILE B CG1   1 
ATOM   3167 C CG2   . ILE J 3 3   ? 51.949  21.563  194.391 1.00 54.03  ? 4   ILE B CG2   1 
ATOM   3168 C CD1   . ILE J 3 3   ? 50.388  19.495  195.814 1.00 84.85  ? 4   ILE B CD1   1 
ATOM   3169 N N     . LYS J 3 4   ? 54.964  22.228  196.067 1.00 48.87  ? 5   LYS B N     1 
ATOM   3170 C CA    . LYS J 3 4   ? 55.664  23.500  196.170 1.00 43.85  ? 5   LYS B CA    1 
ATOM   3171 C C     . LYS J 3 4   ? 56.722  23.638  195.105 1.00 38.24  ? 5   LYS B C     1 
ATOM   3172 O O     . LYS J 3 4   ? 56.575  24.467  194.230 1.00 36.50  ? 5   LYS B O     1 
ATOM   3173 C CB    . LYS J 3 4   ? 56.303  23.691  197.552 1.00 39.21  ? 5   LYS B CB    1 
ATOM   3174 C CG    . LYS J 3 4   ? 57.076  25.000  197.644 1.00 56.31  ? 5   LYS B CG    1 
ATOM   3175 C CD    . LYS J 3 4   ? 56.178  26.209  197.889 1.00 55.50  ? 5   LYS B CD    1 
ATOM   3176 C CE    . LYS J 3 4   ? 56.173  26.560  199.371 1.00 59.93  ? 5   LYS B CE    1 
ATOM   3177 N NZ    . LYS J 3 4   ? 55.852  25.352  200.188 1.00 67.69  ? 5   LYS B NZ    1 
ATOM   3178 N N     . PRO J 3 5   ? 57.777  22.794  195.145 1.00 40.92  ? 6   PRO B N     1 
ATOM   3179 C CA    . PRO J 3 5   ? 58.887  22.805  194.195 1.00 37.77  ? 6   PRO B CA    1 
ATOM   3180 C C     . PRO J 3 5   ? 58.484  22.954  192.762 1.00 40.94  ? 6   PRO B C     1 
ATOM   3181 O O     . PRO J 3 5   ? 59.273  23.406  191.940 1.00 52.92  ? 6   PRO B O     1 
ATOM   3182 C CB    . PRO J 3 5   ? 59.583  21.496  194.469 1.00 32.17  ? 6   PRO B CB    1 
ATOM   3183 C CG    . PRO J 3 5   ? 59.421  21.387  195.930 1.00 34.71  ? 6   PRO B CG    1 
ATOM   3184 C CD    . PRO J 3 5   ? 57.950  21.666  196.073 1.00 40.05  ? 6   PRO B CD    1 
ATOM   3185 N N     . ILE J 3 6   ? 57.269  22.573  192.424 1.00 35.72  ? 7   ILE B N     1 
ATOM   3186 C CA    . ILE J 3 6   ? 56.886  22.767  191.044 1.00 39.58  ? 7   ILE B CA    1 
ATOM   3187 C C     . ILE J 3 6   ? 55.644  23.617  190.884 1.00 44.05  ? 7   ILE B C     1 
ATOM   3188 O O     . ILE J 3 6   ? 55.098  23.704  189.794 1.00 51.24  ? 7   ILE B O     1 
ATOM   3189 C CB    . ILE J 3 6   ? 56.665  21.441  190.347 1.00 40.21  ? 7   ILE B CB    1 
ATOM   3190 C CG1   . ILE J 3 6   ? 55.862  20.510  191.253 1.00 33.18  ? 7   ILE B CG1   1 
ATOM   3191 C CG2   . ILE J 3 6   ? 57.996  20.842  189.975 1.00 50.59  ? 7   ILE B CG2   1 
ATOM   3192 C CD1   . ILE J 3 6   ? 55.618  19.180  190.633 1.00 23.19  ? 7   ILE B CD1   1 
ATOM   3193 N N     . TYR J 3 7   ? 55.203  24.261  191.955 1.00 42.27  ? 8   TYR B N     1 
ATOM   3194 C CA    . TYR J 3 7   ? 54.003  25.078  191.881 1.00 42.53  ? 8   TYR B CA    1 
ATOM   3195 C C     . TYR J 3 7   ? 53.914  25.966  190.652 1.00 49.01  ? 8   TYR B C     1 
ATOM   3196 O O     . TYR J 3 7   ? 52.876  26.007  189.971 1.00 44.31  ? 8   TYR B O     1 
ATOM   3197 C CB    . TYR J 3 7   ? 53.882  25.970  193.114 1.00 46.74  ? 8   TYR B CB    1 
ATOM   3198 C CG    . TYR J 3 7   ? 52.663  26.860  193.057 1.00 44.30  ? 8   TYR B CG    1 
ATOM   3199 C CD1   . TYR J 3 7   ? 51.471  26.481  193.650 1.00 41.91  ? 8   TYR B CD1   1 
ATOM   3200 C CD2   . TYR J 3 7   ? 52.692  28.056  192.357 1.00 48.92  ? 8   TYR B CD2   1 
ATOM   3201 C CE1   . TYR J 3 7   ? 50.342  27.268  193.552 1.00 51.77  ? 8   TYR B CE1   1 
ATOM   3202 C CE2   . TYR J 3 7   ? 51.572  28.853  192.246 1.00 59.08  ? 8   TYR B CE2   1 
ATOM   3203 C CZ    . TYR J 3 7   ? 50.398  28.455  192.846 1.00 62.32  ? 8   TYR B CZ    1 
ATOM   3204 O OH    . TYR J 3 7   ? 49.292  29.265  192.739 1.00 71.80  ? 8   TYR B OH    1 
ATOM   3205 N N     . GLN J 3 8   ? 54.990  26.712  190.398 1.00 56.20  ? 9   GLN B N     1 
ATOM   3206 C CA    . GLN J 3 8   ? 55.047  27.645  189.264 1.00 58.85  ? 9   GLN B CA    1 
ATOM   3207 C C     . GLN J 3 8   ? 54.722  26.939  187.940 1.00 56.16  ? 9   GLN B C     1 
ATOM   3208 O O     . GLN J 3 8   ? 54.077  27.513  187.072 1.00 59.50  ? 9   GLN B O     1 
ATOM   3209 C CB    . GLN J 3 8   ? 56.426  28.325  189.211 1.00 45.96  ? 9   GLN B CB    1 
ATOM   3210 N N     . ASP J 3 9   ? 55.152  25.687  187.806 1.00 54.69  ? 10  ASP B N     1 
ATOM   3211 C CA    . ASP J 3 9   ? 54.880  24.916  186.606 1.00 52.60  ? 10  ASP B CA    1 
ATOM   3212 C C     . ASP J 3 9   ? 53.411  24.533  186.589 1.00 48.84  ? 10  ASP B C     1 
ATOM   3213 O O     . ASP J 3 9   ? 52.781  24.457  185.534 1.00 50.09  ? 10  ASP B O     1 
ATOM   3214 C CB    . ASP J 3 9   ? 55.740  23.660  186.563 1.00 54.54  ? 10  ASP B CB    1 
ATOM   3215 C CG    . ASP J 3 9   ? 56.320  23.411  185.184 1.00 74.74  ? 10  ASP B CG    1 
ATOM   3216 O OD1   . ASP J 3 9   ? 55.546  23.104  184.243 1.00 74.19  ? 10  ASP B OD1   1 
ATOM   3217 O OD2   . ASP J 3 9   ? 57.558  23.529  185.035 1.00 86.80  ? 10  ASP B OD2   1 
ATOM   3218 N N     . ILE J 3 10  ? 52.871  24.289  187.773 1.00 49.72  ? 11  ILE B N     1 
ATOM   3219 C CA    . ILE J 3 10  ? 51.470  23.938  187.931 1.00 49.53  ? 11  ILE B CA    1 
ATOM   3220 C C     . ILE J 3 10  ? 50.607  25.150  187.568 1.00 58.04  ? 11  ILE B C     1 
ATOM   3221 O O     . ILE J 3 10  ? 49.697  25.054  186.731 1.00 56.07  ? 11  ILE B O     1 
ATOM   3222 C CB    . ILE J 3 10  ? 51.210  23.537  189.368 1.00 42.34  ? 11  ILE B CB    1 
ATOM   3223 C CG1   . ILE J 3 10  ? 51.856  22.188  189.607 1.00 46.42  ? 11  ILE B CG1   1 
ATOM   3224 C CG2   . ILE J 3 10  ? 49.729  23.547  189.671 1.00 34.70  ? 11  ILE B CG2   1 
ATOM   3225 C CD1   . ILE J 3 10  ? 51.666  21.658  191.017 1.00 77.66  ? 11  ILE B CD1   1 
ATOM   3226 N N     . ASN J 3 11  ? 50.912  26.288  188.195 1.00 55.61  ? 12  ASN B N     1 
ATOM   3227 C CA    . ASN J 3 11  ? 50.190  27.530  187.949 1.00 55.74  ? 12  ASN B CA    1 
ATOM   3228 C C     . ASN J 3 11  ? 50.042  27.790  186.433 1.00 53.60  ? 12  ASN B C     1 
ATOM   3229 O O     . ASN J 3 11  ? 48.997  28.250  185.975 1.00 56.03  ? 12  ASN B O     1 
ATOM   3230 C CB    . ASN J 3 11  ? 50.923  28.689  188.627 1.00 52.76  ? 12  ASN B CB    1 
ATOM   3231 C CG    . ASN J 3 11  ? 49.993  29.828  189.006 1.00 53.03  ? 12  ASN B CG    1 
ATOM   3232 O OD1   . ASN J 3 11  ? 48.914  29.601  189.537 1.00 62.35  ? 12  ASN B OD1   1 
ATOM   3233 N ND2   . ASN J 3 11  ? 50.420  31.059  188.761 1.00 57.68  ? 12  ASN B ND2   1 
ATOM   3234 N N     . SER J 3 12  ? 51.082  27.483  185.663 1.00 46.52  ? 13  SER B N     1 
ATOM   3235 C CA    . SER J 3 12  ? 51.069  27.672  184.213 1.00 49.81  ? 13  SER B CA    1 
ATOM   3236 C C     . SER J 3 12  ? 50.125  26.733  183.475 1.00 53.59  ? 13  SER B C     1 
ATOM   3237 O O     . SER J 3 12  ? 49.441  27.130  182.516 1.00 46.41  ? 13  SER B O     1 
ATOM   3238 C CB    . SER J 3 12  ? 52.466  27.481  183.645 1.00 43.57  ? 13  SER B CB    1 
ATOM   3239 O OG    . SER J 3 12  ? 53.317  28.497  184.124 1.00 72.54  ? 13  SER B OG    1 
ATOM   3240 N N     . ILE J 3 13  ? 50.109  25.480  183.916 1.00 54.76  ? 14  ILE B N     1 
ATOM   3241 C CA    . ILE J 3 13  ? 49.259  24.466  183.314 1.00 51.30  ? 14  ILE B CA    1 
ATOM   3242 C C     . ILE J 3 13  ? 47.812  24.642  183.750 1.00 48.68  ? 14  ILE B C     1 
ATOM   3243 O O     . ILE J 3 13  ? 46.895  24.429  182.968 1.00 43.71  ? 14  ILE B O     1 
ATOM   3244 C CB    . ILE J 3 13  ? 49.740  23.045  183.686 1.00 52.07  ? 14  ILE B CB    1 
ATOM   3245 C CG1   . ILE J 3 13  ? 50.927  22.658  182.806 1.00 59.82  ? 14  ILE B CG1   1 
ATOM   3246 C CG2   . ILE J 3 13  ? 48.620  22.034  183.474 1.00 40.87  ? 14  ILE B CG2   1 
ATOM   3247 C CD1   . ILE J 3 13  ? 52.101  23.619  182.871 1.00 77.72  ? 14  ILE B CD1   1 
ATOM   3248 N N     . LEU J 3 14  ? 47.599  25.041  184.996 1.00 49.06  ? 15  LEU B N     1 
ATOM   3249 C CA    . LEU J 3 14  ? 46.234  25.212  185.460 1.00 51.88  ? 15  LEU B CA    1 
ATOM   3250 C C     . LEU J 3 14  ? 45.599  26.477  184.920 1.00 57.91  ? 15  LEU B C     1 
ATOM   3251 O O     . LEU J 3 14  ? 44.449  26.470  184.492 1.00 61.93  ? 15  LEU B O     1 
ATOM   3252 C CB    . LEU J 3 14  ? 46.176  25.231  186.982 1.00 48.45  ? 15  LEU B CB    1 
ATOM   3253 C CG    . LEU J 3 14  ? 46.223  23.878  187.672 1.00 42.01  ? 15  LEU B CG    1 
ATOM   3254 C CD1   . LEU J 3 14  ? 46.069  24.088  189.162 1.00 47.51  ? 15  LEU B CD1   1 
ATOM   3255 C CD2   . LEU J 3 14  ? 45.118  22.975  187.137 1.00 42.19  ? 15  LEU B CD2   1 
ATOM   3256 N N     . ILE J 3 15  ? 46.340  27.573  184.947 1.00 56.86  ? 16  ILE B N     1 
ATOM   3257 C CA    . ILE J 3 15  ? 45.795  28.813  184.450 1.00 52.26  ? 16  ILE B CA    1 
ATOM   3258 C C     . ILE J 3 15  ? 45.510  28.712  182.966 1.00 54.06  ? 16  ILE B C     1 
ATOM   3259 O O     . ILE J 3 15  ? 46.430  28.518  182.158 1.00 62.31  ? 16  ILE B O     1 
ATOM   3260 C CB    . ILE J 3 15  ? 46.756  29.990  184.714 1.00 51.42  ? 16  ILE B CB    1 
ATOM   3261 C CG1   . ILE J 3 15  ? 46.670  30.389  186.193 1.00 44.13  ? 16  ILE B CG1   1 
ATOM   3262 C CG2   . ILE J 3 15  ? 46.408  31.167  183.800 1.00 45.59  ? 16  ILE B CG2   1 
ATOM   3263 C CD1   . ILE J 3 15  ? 47.616  31.451  186.601 1.00 31.56  ? 16  ILE B CD1   1 
ATOM   3264 N N     . GLY J 3 16  ? 44.230  28.818  182.610 1.00 46.97  ? 17  GLY B N     1 
ATOM   3265 C CA    . GLY J 3 16  ? 43.845  28.770  181.203 1.00 51.69  ? 17  GLY B CA    1 
ATOM   3266 C C     . GLY J 3 16  ? 42.971  27.594  180.847 1.00 55.63  ? 17  GLY B C     1 
ATOM   3267 O O     . GLY J 3 16  ? 42.325  27.558  179.797 1.00 66.51  ? 17  GLY B O     1 
ATOM   3268 N N     . GLN J 3 17  ? 42.966  26.618  181.740 1.00 57.30  ? 18  GLN B N     1 
ATOM   3269 C CA    . GLN J 3 17  ? 42.180  25.420  181.561 1.00 53.86  ? 18  GLN B CA    1 
ATOM   3270 C C     . GLN J 3 17  ? 40.711  25.766  181.653 1.00 58.04  ? 18  GLN B C     1 
ATOM   3271 O O     . GLN J 3 17  ? 40.319  26.721  182.329 1.00 52.36  ? 18  GLN B O     1 
ATOM   3272 C CB    . GLN J 3 17  ? 42.562  24.415  182.633 1.00 46.50  ? 18  GLN B CB    1 
ATOM   3273 C CG    . GLN J 3 17  ? 43.993  24.005  182.524 1.00 44.08  ? 18  GLN B CG    1 
ATOM   3274 C CD    . GLN J 3 17  ? 44.142  22.725  181.763 1.00 53.22  ? 18  GLN B CD    1 
ATOM   3275 O OE1   . GLN J 3 17  ? 43.407  22.462  180.810 1.00 60.98  ? 18  GLN B OE1   1 
ATOM   3276 N NE2   . GLN J 3 17  ? 45.098  21.908  182.176 1.00 58.78  ? 18  GLN B NE2   1 
ATOM   3277 N N     . LYS J 3 18  ? 39.904  24.976  180.961 1.00 68.02  ? 19  LYS B N     1 
ATOM   3278 C CA    . LYS J 3 18  ? 38.470  25.176  180.936 1.00 70.70  ? 19  LYS B CA    1 
ATOM   3279 C C     . LYS J 3 18  ? 37.733  23.878  181.218 1.00 69.52  ? 19  LYS B C     1 
ATOM   3280 O O     . LYS J 3 18  ? 38.181  22.786  180.865 1.00 70.53  ? 19  LYS B O     1 
ATOM   3281 C CB    . LYS J 3 18  ? 38.050  25.752  179.576 1.00 77.82  ? 19  LYS B CB    1 
ATOM   3282 C CG    . LYS J 3 18  ? 38.516  27.196  179.355 1.00 85.29  ? 19  LYS B CG    1 
ATOM   3283 C CD    . LYS J 3 18  ? 37.945  27.824  178.080 1.00 87.62  ? 19  LYS B CD    1 
ATOM   3284 C CE    . LYS J 3 18  ? 38.725  27.444  176.832 1.00 87.92  ? 19  LYS B CE    1 
ATOM   3285 N NZ    . LYS J 3 18  ? 38.181  28.146  175.634 1.00 82.71  ? 19  LYS B NZ    1 
ATOM   3286 N N     . VAL J 3 19  ? 36.588  24.013  181.864 1.00 70.26  ? 20  VAL B N     1 
ATOM   3287 C CA    . VAL J 3 19  ? 35.773  22.869  182.215 1.00 70.57  ? 20  VAL B CA    1 
ATOM   3288 C C     . VAL J 3 19  ? 34.314  23.245  181.958 1.00 73.54  ? 20  VAL B C     1 
ATOM   3289 O O     . VAL J 3 19  ? 33.859  24.316  182.371 1.00 77.63  ? 20  VAL B O     1 
ATOM   3290 C CB    . VAL J 3 19  ? 35.997  22.521  183.695 1.00 72.46  ? 20  VAL B CB    1 
ATOM   3291 C CG1   . VAL J 3 19  ? 37.493  22.415  183.969 1.00 72.56  ? 20  VAL B CG1   1 
ATOM   3292 C CG2   . VAL J 3 19  ? 35.396  23.583  184.589 1.00 70.86  ? 20  VAL B CG2   1 
ATOM   3293 N N     . LYS J 3 20  ? 33.583  22.380  181.265 1.00 70.60  ? 21  LYS B N     1 
ATOM   3294 C CA    . LYS J 3 20  ? 32.185  22.669  180.954 1.00 70.36  ? 21  LYS B CA    1 
ATOM   3295 C C     . LYS J 3 20  ? 31.327  22.777  182.221 1.00 71.25  ? 21  LYS B C     1 
ATOM   3296 O O     . LYS J 3 20  ? 31.434  21.944  183.116 1.00 70.85  ? 21  LYS B O     1 
ATOM   3297 C CB    . LYS J 3 20  ? 31.633  21.593  180.020 1.00 67.82  ? 21  LYS B CB    1 
ATOM   3298 N N     . ARG J 3 21  ? 30.486  23.809  182.293 1.00 71.72  ? 22  ARG B N     1 
ATOM   3299 C CA    . ARG J 3 21  ? 29.621  24.032  183.452 1.00 75.02  ? 22  ARG B CA    1 
ATOM   3300 C C     . ARG J 3 21  ? 28.645  22.877  183.705 1.00 80.54  ? 22  ARG B C     1 
ATOM   3301 O O     . ARG J 3 21  ? 28.013  22.377  182.781 1.00 73.85  ? 22  ARG B O     1 
ATOM   3302 C CB    . ARG J 3 21  ? 28.812  25.320  183.277 1.00 72.99  ? 22  ARG B CB    1 
ATOM   3303 C CG    . ARG J 3 21  ? 28.244  25.841  184.589 1.00 79.91  ? 22  ARG B CG    1 
ATOM   3304 C CD    . ARG J 3 21  ? 27.093  26.795  184.390 1.00 69.90  ? 22  ARG B CD    1 
ATOM   3305 N NE    . ARG J 3 21  ? 27.325  27.700  183.274 1.00 82.38  ? 22  ARG B NE    1 
ATOM   3306 C CZ    . ARG J 3 21  ? 26.533  28.725  182.979 1.00 87.60  ? 22  ARG B CZ    1 
ATOM   3307 N NH1   . ARG J 3 21  ? 25.464  28.969  183.727 1.00 92.86  ? 22  ARG B NH1   1 
ATOM   3308 N NH2   . ARG J 3 21  ? 26.801  29.497  181.934 1.00 88.37  ? 22  ARG B NH2   1 
ATOM   3309 N N     . PRO J 3 22  ? 28.497  22.448  184.972 1.00 92.48  ? 23  PRO B N     1 
ATOM   3310 C CA    . PRO J 3 22  ? 27.581  21.345  185.284 1.00 100.57 ? 23  PRO B CA    1 
ATOM   3311 C C     . PRO J 3 22  ? 26.130  21.670  184.959 1.00 106.71 ? 23  PRO B C     1 
ATOM   3312 O O     . PRO J 3 22  ? 25.528  22.520  185.604 1.00 107.49 ? 23  PRO B O     1 
ATOM   3313 C CB    . PRO J 3 22  ? 27.795  21.128  186.783 1.00 99.58  ? 23  PRO B CB    1 
ATOM   3314 C CG    . PRO J 3 22  ? 29.208  21.545  186.995 1.00 97.72  ? 23  PRO B CG    1 
ATOM   3315 C CD    . PRO J 3 22  ? 29.279  22.818  186.165 1.00 98.30  ? 23  PRO B CD    1 
ATOM   3316 N N     . LYS J 3 23  ? 25.576  20.986  183.961 1.00 116.96 ? 24  LYS B N     1 
ATOM   3317 C CA    . LYS J 3 23  ? 24.186  21.184  183.542 1.00 127.00 ? 24  LYS B CA    1 
ATOM   3318 C C     . LYS J 3 23  ? 23.865  22.635  183.177 1.00 134.07 ? 24  LYS B C     1 
ATOM   3319 O O     . LYS J 3 23  ? 22.716  22.970  182.881 1.00 135.43 ? 24  LYS B O     1 
ATOM   3320 C CB    . LYS J 3 23  ? 23.230  20.703  184.641 1.00 124.76 ? 24  LYS B CB    1 
ATOM   3321 N N     . SER J 3 24  ? 24.890  23.484  183.198 1.00 141.40 ? 25  SER B N     1 
ATOM   3322 C CA    . SER J 3 24  ? 24.763  24.910  182.875 1.00 144.98 ? 25  SER B CA    1 
ATOM   3323 C C     . SER J 3 24  ? 23.856  25.645  183.876 1.00 145.83 ? 25  SER B C     1 
ATOM   3324 O O     . SER J 3 24  ? 23.666  26.861  183.783 1.00 148.19 ? 25  SER B O     1 
ATOM   3325 C CB    . SER J 3 24  ? 24.241  25.085  181.435 1.00 143.63 ? 25  SER B CB    1 
ATOM   3326 O OG    . SER J 3 24  ? 24.574  26.361  180.899 1.00 137.47 ? 25  SER B OG    1 
ATOM   3327 N N     . GLY J 3 25  ? 23.314  24.900  184.838 1.00 143.94 ? 26  GLY B N     1 
ATOM   3328 C CA    . GLY J 3 25  ? 22.447  25.491  185.843 1.00 140.14 ? 26  GLY B CA    1 
ATOM   3329 C C     . GLY J 3 25  ? 23.207  26.250  186.922 1.00 138.29 ? 26  GLY B C     1 
ATOM   3330 O O     . GLY J 3 25  ? 24.183  26.953  186.638 1.00 136.35 ? 26  GLY B O     1 
ATOM   3331 N N     . THR J 3 26  ? 22.756  26.104  188.167 1.00 133.66 ? 27  THR B N     1 
ATOM   3332 C CA    . THR J 3 26  ? 23.373  26.774  189.310 1.00 128.88 ? 27  THR B CA    1 
ATOM   3333 C C     . THR J 3 26  ? 24.710  26.160  189.708 1.00 127.07 ? 27  THR B C     1 
ATOM   3334 O O     . THR J 3 26  ? 24.768  25.080  190.307 1.00 125.71 ? 27  THR B O     1 
ATOM   3335 C CB    . THR J 3 26  ? 22.436  26.751  190.532 1.00 128.79 ? 27  THR B CB    1 
ATOM   3336 O OG1   . THR J 3 26  ? 21.308  27.589  190.267 1.00 129.79 ? 27  THR B OG1   1 
ATOM   3337 C CG2   . THR J 3 26  ? 23.151  27.244  191.790 1.00 126.79 ? 27  THR B CG2   1 
ATOM   3338 N N     . LEU J 3 27  ? 25.783  26.874  189.378 1.00 121.34 ? 28  LEU B N     1 
ATOM   3339 C CA    . LEU J 3 27  ? 27.135  26.428  189.683 1.00 109.23 ? 28  LEU B CA    1 
ATOM   3340 C C     . LEU J 3 27  ? 27.593  26.939  191.031 1.00 99.80  ? 28  LEU B C     1 
ATOM   3341 O O     . LEU J 3 27  ? 28.255  27.965  191.116 1.00 94.01  ? 28  LEU B O     1 
ATOM   3342 C CB    . LEU J 3 27  ? 28.108  26.897  188.601 1.00 105.03 ? 28  LEU B CB    1 
ATOM   3343 C CG    . LEU J 3 27  ? 27.997  28.344  188.146 1.00 101.31 ? 28  LEU B CG    1 
ATOM   3344 C CD1   . LEU J 3 27  ? 29.212  28.697  187.317 1.00 105.26 ? 28  LEU B CD1   1 
ATOM   3345 C CD2   . LEU J 3 27  ? 26.730  28.531  187.332 1.00 105.89 ? 28  LEU B CD2   1 
ATOM   3346 N N     . SER J 3 28  ? 27.231  26.211  192.081 1.00 96.37  ? 29  SER B N     1 
ATOM   3347 C CA    . SER J 3 28  ? 27.609  26.575  193.440 1.00 93.80  ? 29  SER B CA    1 
ATOM   3348 C C     . SER J 3 28  ? 27.573  25.343  194.338 1.00 93.92  ? 29  SER B C     1 
ATOM   3349 O O     . SER J 3 28  ? 27.310  24.230  193.873 1.00 90.23  ? 29  SER B O     1 
ATOM   3350 C CB    . SER J 3 28  ? 26.662  27.640  193.992 1.00 82.88  ? 29  SER B CB    1 
ATOM   3351 O OG    . SER J 3 28  ? 25.336  27.149  194.028 1.00 80.06  ? 29  SER B OG    1 
ATOM   3352 N N     . GLY J 3 29  ? 27.849  25.554  195.622 1.00 94.88  ? 30  GLY B N     1 
ATOM   3353 C CA    . GLY J 3 29  ? 27.841  24.463  196.582 1.00 97.84  ? 30  GLY B CA    1 
ATOM   3354 C C     . GLY J 3 29  ? 28.922  23.425  196.343 1.00 99.39  ? 30  GLY B C     1 
ATOM   3355 O O     . GLY J 3 29  ? 29.887  23.684  195.621 1.00 93.48  ? 30  GLY B O     1 
ATOM   3356 N N     . HIS J 3 30  ? 28.761  22.251  196.955 1.00 100.31 ? 31  HIS B N     1 
ATOM   3357 C CA    . HIS J 3 30  ? 29.723  21.162  196.805 1.00 104.37 ? 31  HIS B CA    1 
ATOM   3358 C C     . HIS J 3 30  ? 30.314  21.173  195.398 1.00 107.49 ? 31  HIS B C     1 
ATOM   3359 O O     . HIS J 3 30  ? 31.488  21.489  195.197 1.00 112.11 ? 31  HIS B O     1 
ATOM   3360 C CB    . HIS J 3 30  ? 29.047  19.806  197.045 1.00 99.79  ? 31  HIS B CB    1 
ATOM   3361 C CG    . HIS J 3 30  ? 29.983  18.638  196.937 1.00 94.40  ? 31  HIS B CG    1 
ATOM   3362 N ND1   . HIS J 3 30  ? 30.693  18.146  198.013 1.00 90.47  ? 31  HIS B ND1   1 
ATOM   3363 C CD2   . HIS J 3 30  ? 30.359  17.893  195.869 1.00 85.95  ? 31  HIS B CD2   1 
ATOM   3364 C CE1   . HIS J 3 30  ? 31.465  17.151  197.613 1.00 91.12  ? 31  HIS B CE1   1 
ATOM   3365 N NE2   . HIS J 3 30  ? 31.281  16.978  196.316 1.00 91.55  ? 31  HIS B NE2   1 
ATOM   3366 N N     . ALA J 3 31  ? 29.487  20.812  194.426 1.00 108.25 ? 32  ALA B N     1 
ATOM   3367 C CA    . ALA J 3 31  ? 29.911  20.792  193.041 1.00 103.36 ? 32  ALA B CA    1 
ATOM   3368 C C     . ALA J 3 31  ? 29.625  22.158  192.431 1.00 103.05 ? 32  ALA B C     1 
ATOM   3369 O O     . ALA J 3 31  ? 28.555  22.390  191.863 1.00 98.23  ? 32  ALA B O     1 
ATOM   3370 C CB    . ALA J 3 31  ? 29.169  19.703  192.286 1.00 101.69 ? 32  ALA B CB    1 
ATOM   3371 N N     . ALA J 3 32  ? 30.582  23.068  192.582 1.00 102.33 ? 33  ALA B N     1 
ATOM   3372 C CA    . ALA J 3 32  ? 30.467  24.413  192.036 1.00 98.64  ? 33  ALA B CA    1 
ATOM   3373 C C     . ALA J 3 32  ? 31.500  24.562  190.927 1.00 95.07  ? 33  ALA B C     1 
ATOM   3374 O O     . ALA J 3 32  ? 31.202  25.086  189.861 1.00 104.76 ? 33  ALA B O     1 
ATOM   3375 C CB    . ALA J 3 32  ? 30.713  25.448  193.123 1.00 98.68  ? 33  ALA B CB    1 
ATOM   3376 N N     . GLY J 3 33  ? 32.711  24.084  191.188 1.00 85.67  ? 34  GLY B N     1 
ATOM   3377 C CA    . GLY J 3 33  ? 33.785  24.172  190.216 1.00 72.81  ? 34  GLY B CA    1 
ATOM   3378 C C     . GLY J 3 33  ? 34.915  23.287  190.699 1.00 73.60  ? 34  GLY B C     1 
ATOM   3379 O O     . GLY J 3 33  ? 36.081  23.440  190.320 1.00 57.00  ? 34  GLY B O     1 
ATOM   3380 N N     . GLU J 3 34  ? 34.546  22.345  191.560 1.00 80.52  ? 35  GLU B N     1 
ATOM   3381 C CA    . GLU J 3 34  ? 35.496  21.402  192.125 1.00 86.60  ? 35  GLU B CA    1 
ATOM   3382 C C     . GLU J 3 34  ? 36.104  20.488  191.053 1.00 85.03  ? 35  GLU B C     1 
ATOM   3383 O O     . GLU J 3 34  ? 37.179  19.935  191.258 1.00 94.50  ? 35  GLU B O     1 
ATOM   3384 C CB    . GLU J 3 34  ? 34.825  20.590  193.246 1.00 93.32  ? 35  GLU B CB    1 
ATOM   3385 C CG    . GLU J 3 34  ? 33.643  19.721  192.818 1.00 106.07 ? 35  GLU B CG    1 
ATOM   3386 C CD    . GLU J 3 34  ? 34.048  18.281  192.534 1.00 109.13 ? 35  GLU B CD    1 
ATOM   3387 O OE1   . GLU J 3 34  ? 34.797  18.043  191.557 1.00 107.44 ? 35  GLU B OE1   1 
ATOM   3388 O OE2   . GLU J 3 34  ? 33.619  17.389  193.300 1.00 112.49 ? 35  GLU B OE2   1 
ATOM   3389 N N     . PRO J 3 35  ? 35.424  20.305  189.902 1.00 80.40  ? 36  PRO B N     1 
ATOM   3390 C CA    . PRO J 3 35  ? 36.002  19.443  188.860 1.00 73.09  ? 36  PRO B CA    1 
ATOM   3391 C C     . PRO J 3 35  ? 37.435  19.849  188.499 1.00 65.47  ? 36  PRO B C     1 
ATOM   3392 O O     . PRO J 3 35  ? 38.128  19.138  187.767 1.00 58.58  ? 36  PRO B O     1 
ATOM   3393 C CB    . PRO J 3 35  ? 35.043  19.634  187.694 1.00 78.48  ? 36  PRO B CB    1 
ATOM   3394 C CG    . PRO J 3 35  ? 33.713  19.740  188.399 1.00 78.82  ? 36  PRO B CG    1 
ATOM   3395 C CD    . PRO J 3 35  ? 34.015  20.630  189.587 1.00 79.49  ? 36  PRO B CD    1 
ATOM   3396 N N     . PHE J 3 36  ? 37.863  21.005  189.002 1.00 55.74  ? 37  PHE B N     1 
ATOM   3397 C CA    . PHE J 3 36  ? 39.216  21.478  188.760 1.00 54.46  ? 37  PHE B CA    1 
ATOM   3398 C C     . PHE J 3 36  ? 40.193  20.609  189.549 1.00 57.44  ? 37  PHE B C     1 
ATOM   3399 O O     . PHE J 3 36  ? 41.332  20.401  189.119 1.00 58.65  ? 37  PHE B O     1 
ATOM   3400 C CB    . PHE J 3 36  ? 39.385  22.940  189.195 1.00 57.63  ? 37  PHE B CB    1 
ATOM   3401 C CG    . PHE J 3 36  ? 39.008  23.937  188.146 1.00 57.36  ? 37  PHE B CG    1 
ATOM   3402 C CD1   . PHE J 3 36  ? 37.712  24.438  188.074 1.00 51.89  ? 37  PHE B CD1   1 
ATOM   3403 C CD2   . PHE J 3 36  ? 39.944  24.347  187.196 1.00 54.57  ? 37  PHE B CD2   1 
ATOM   3404 C CE1   . PHE J 3 36  ? 37.348  25.336  187.064 1.00 50.19  ? 37  PHE B CE1   1 
ATOM   3405 C CE2   . PHE J 3 36  ? 39.590  25.246  186.177 1.00 54.83  ? 37  PHE B CE2   1 
ATOM   3406 C CZ    . PHE J 3 36  ? 38.290  25.737  186.114 1.00 52.39  ? 37  PHE B CZ    1 
ATOM   3407 N N     . GLU J 3 37  ? 39.743  20.114  190.706 1.00 47.99  ? 38  GLU B N     1 
ATOM   3408 C CA    . GLU J 3 37  ? 40.572  19.263  191.550 1.00 46.79  ? 38  GLU B CA    1 
ATOM   3409 C C     . GLU J 3 37  ? 41.169  18.122  190.734 1.00 34.82  ? 38  GLU B C     1 
ATOM   3410 O O     . GLU J 3 37  ? 42.314  17.739  190.935 1.00 41.51  ? 38  GLU B O     1 
ATOM   3411 C CB    . GLU J 3 37  ? 39.771  18.690  192.723 1.00 63.57  ? 38  GLU B CB    1 
ATOM   3412 C CG    . GLU J 3 37  ? 38.698  17.693  192.319 1.00 92.64  ? 38  GLU B CG    1 
ATOM   3413 C CD    . GLU J 3 37  ? 38.857  16.344  193.000 1.00 102.50 ? 38  GLU B CD    1 
ATOM   3414 O OE1   . GLU J 3 37  ? 38.748  16.286  194.245 1.00 108.75 ? 38  GLU B OE1   1 
ATOM   3415 O OE2   . GLU J 3 37  ? 39.096  15.344  192.287 1.00 110.00 ? 38  GLU B OE2   1 
ATOM   3416 N N     . LYS J 3 38  ? 40.397  17.598  189.795 1.00 34.21  ? 39  LYS B N     1 
ATOM   3417 C CA    . LYS J 3 38  ? 40.871  16.522  188.945 1.00 39.31  ? 39  LYS B CA    1 
ATOM   3418 C C     . LYS J 3 38  ? 42.062  17.027  188.151 1.00 41.70  ? 39  LYS B C     1 
ATOM   3419 O O     . LYS J 3 38  ? 43.130  16.404  188.133 1.00 42.96  ? 39  LYS B O     1 
ATOM   3420 C CB    . LYS J 3 38  ? 39.767  16.049  187.991 1.00 38.97  ? 39  LYS B CB    1 
ATOM   3421 C CG    . LYS J 3 38  ? 38.448  15.713  188.694 1.00 41.02  ? 39  LYS B CG    1 
ATOM   3422 C CD    . LYS J 3 38  ? 37.410  15.142  187.751 1.00 28.12  ? 39  LYS B CD    1 
ATOM   3423 C CE    . LYS J 3 38  ? 36.056  15.054  188.448 1.00 55.16  ? 39  LYS B CE    1 
ATOM   3424 N NZ    . LYS J 3 38  ? 36.144  14.826  189.944 1.00 53.39  ? 39  LYS B NZ    1 
ATOM   3425 N N     . LEU J 3 39  ? 41.903  18.167  187.502 1.00 40.27  ? 40  LEU B N     1 
ATOM   3426 C CA    . LEU J 3 39  ? 43.014  18.690  186.729 1.00 42.01  ? 40  LEU B CA    1 
ATOM   3427 C C     . LEU J 3 39  ? 44.293  18.752  187.554 1.00 37.31  ? 40  LEU B C     1 
ATOM   3428 O O     . LEU J 3 39  ? 45.380  18.565  187.023 1.00 42.17  ? 40  LEU B O     1 
ATOM   3429 C CB    . LEU J 3 39  ? 42.667  20.068  186.153 1.00 48.75  ? 40  LEU B CB    1 
ATOM   3430 C CG    . LEU J 3 39  ? 41.933  20.033  184.808 1.00 44.90  ? 40  LEU B CG    1 
ATOM   3431 C CD1   . LEU J 3 39  ? 40.839  18.968  184.793 1.00 50.38  ? 40  LEU B CD1   1 
ATOM   3432 C CD2   . LEU J 3 39  ? 41.347  21.399  184.544 1.00 49.64  ? 40  LEU B CD2   1 
ATOM   3433 N N     . VAL J 3 40  ? 44.172  19.010  188.849 1.00 29.07  ? 41  VAL B N     1 
ATOM   3434 C CA    . VAL J 3 40  ? 45.363  19.062  189.675 1.00 25.03  ? 41  VAL B CA    1 
ATOM   3435 C C     . VAL J 3 40  ? 45.939  17.647  189.795 1.00 32.85  ? 41  VAL B C     1 
ATOM   3436 O O     . VAL J 3 40  ? 47.129  17.402  189.501 1.00 24.49  ? 41  VAL B O     1 
ATOM   3437 C CB    . VAL J 3 40  ? 45.042  19.662  191.032 1.00 24.62  ? 41  VAL B CB    1 
ATOM   3438 C CG1   . VAL J 3 40  ? 46.162  19.416  192.015 1.00 36.98  ? 41  VAL B CG1   1 
ATOM   3439 C CG2   . VAL J 3 40  ? 44.845  21.134  190.864 1.00 32.04  ? 41  VAL B CG2   1 
ATOM   3440 N N     . TYR J 3 41  ? 45.090  16.707  190.199 1.00 32.27  ? 42  TYR B N     1 
ATOM   3441 C CA    . TYR J 3 41  ? 45.505  15.314  190.306 1.00 33.64  ? 42  TYR B CA    1 
ATOM   3442 C C     . TYR J 3 41  ? 46.140  14.880  188.974 1.00 32.39  ? 42  TYR B C     1 
ATOM   3443 O O     . TYR J 3 41  ? 47.264  14.388  188.951 1.00 26.87  ? 42  TYR B O     1 
ATOM   3444 C CB    . TYR J 3 41  ? 44.298  14.430  190.617 1.00 36.05  ? 42  TYR B CB    1 
ATOM   3445 C CG    . TYR J 3 41  ? 44.650  12.976  190.698 1.00 35.91  ? 42  TYR B CG    1 
ATOM   3446 C CD1   . TYR J 3 41  ? 45.370  12.470  191.781 1.00 30.63  ? 42  TYR B CD1   1 
ATOM   3447 C CD2   . TYR J 3 41  ? 44.328  12.116  189.659 1.00 41.01  ? 42  TYR B CD2   1 
ATOM   3448 C CE1   . TYR J 3 41  ? 45.768  11.135  191.819 1.00 40.58  ? 42  TYR B CE1   1 
ATOM   3449 C CE2   . TYR J 3 41  ? 44.721  10.789  189.685 1.00 47.79  ? 42  TYR B CE2   1 
ATOM   3450 C CZ    . TYR J 3 41  ? 45.435  10.302  190.765 1.00 46.36  ? 42  TYR B CZ    1 
ATOM   3451 O OH    . TYR J 3 41  ? 45.792  8.978   190.781 1.00 55.23  ? 42  TYR B OH    1 
ATOM   3452 N N     . LYS J 3 42  ? 45.415  15.061  187.869 1.00 25.88  ? 43  LYS B N     1 
ATOM   3453 C CA    . LYS J 3 42  ? 45.934  14.712  186.543 1.00 21.48  ? 43  LYS B CA    1 
ATOM   3454 C C     . LYS J 3 42  ? 47.339  15.263  186.346 1.00 28.69  ? 43  LYS B C     1 
ATOM   3455 O O     . LYS J 3 42  ? 48.282  14.524  186.070 1.00 30.00  ? 43  LYS B O     1 
ATOM   3456 C CB    . LYS J 3 42  ? 45.023  15.270  185.436 1.00 14.02  ? 43  LYS B CB    1 
ATOM   3457 C CG    . LYS J 3 42  ? 45.578  15.141  184.002 1.00 15.03  ? 43  LYS B CG    1 
ATOM   3458 C CD    . LYS J 3 42  ? 44.561  15.669  182.964 1.00 32.19  ? 43  LYS B CD    1 
ATOM   3459 C CE    . LYS J 3 42  ? 44.892  15.362  181.462 1.00 34.63  ? 43  LYS B CE    1 
ATOM   3460 N NZ    . LYS J 3 42  ? 46.365  15.436  181.080 1.00 27.90  ? 43  LYS B NZ    1 
ATOM   3461 N N     . PHE J 3 43  ? 47.479  16.575  186.489 1.00 37.63  ? 44  PHE B N     1 
ATOM   3462 C CA    . PHE J 3 43  ? 48.771  17.186  186.311 1.00 40.99  ? 44  PHE B CA    1 
ATOM   3463 C C     . PHE J 3 43  ? 49.754  16.587  187.306 1.00 37.71  ? 44  PHE B C     1 
ATOM   3464 O O     . PHE J 3 43  ? 50.786  16.060  186.906 1.00 29.38  ? 44  PHE B O     1 
ATOM   3465 C CB    . PHE J 3 43  ? 48.698  18.702  186.498 1.00 58.75  ? 44  PHE B CB    1 
ATOM   3466 C CG    . PHE J 3 43  ? 50.047  19.374  186.411 1.00 77.07  ? 44  PHE B CG    1 
ATOM   3467 C CD1   . PHE J 3 43  ? 50.641  19.606  185.171 1.00 78.05  ? 44  PHE B CD1   1 
ATOM   3468 C CD2   . PHE J 3 43  ? 50.774  19.668  187.569 1.00 73.64  ? 44  PHE B CD2   1 
ATOM   3469 C CE1   . PHE J 3 43  ? 51.933  20.108  185.086 1.00 75.50  ? 44  PHE B CE1   1 
ATOM   3470 C CE2   . PHE J 3 43  ? 52.062  20.167  187.488 1.00 69.99  ? 44  PHE B CE2   1 
ATOM   3471 C CZ    . PHE J 3 43  ? 52.643  20.387  186.248 1.00 76.26  ? 44  PHE B CZ    1 
ATOM   3472 N N     . LEU J 3 44  ? 49.448  16.683  188.596 1.00 26.81  ? 45  LEU B N     1 
ATOM   3473 C CA    . LEU J 3 44  ? 50.326  16.108  189.604 1.00 30.66  ? 45  LEU B CA    1 
ATOM   3474 C C     . LEU J 3 44  ? 50.727  14.659  189.254 1.00 37.97  ? 45  LEU B C     1 
ATOM   3475 O O     . LEU J 3 44  ? 51.900  14.297  189.353 1.00 36.42  ? 45  LEU B O     1 
ATOM   3476 C CB    . LEU J 3 44  ? 49.640  16.131  190.970 1.00 19.85  ? 45  LEU B CB    1 
ATOM   3477 C CG    . LEU J 3 44  ? 50.173  17.118  191.993 1.00 27.82  ? 45  LEU B CG    1 
ATOM   3478 C CD1   . LEU J 3 44  ? 50.599  18.483  191.376 1.00 11.58  ? 45  LEU B CD1   1 
ATOM   3479 C CD2   . LEU J 3 44  ? 49.065  17.300  193.001 1.00 28.93  ? 45  LEU B CD2   1 
ATOM   3480 N N     . LYS J 3 45  ? 49.754  13.844  188.836 1.00 40.93  ? 46  LYS B N     1 
ATOM   3481 C CA    . LYS J 3 45  ? 49.991  12.445  188.486 1.00 42.11  ? 46  LYS B CA    1 
ATOM   3482 C C     . LYS J 3 45  ? 51.024  12.303  187.370 1.00 48.19  ? 46  LYS B C     1 
ATOM   3483 O O     . LYS J 3 45  ? 51.880  11.428  187.441 1.00 54.13  ? 46  LYS B O     1 
ATOM   3484 C CB    . LYS J 3 45  ? 48.677  11.764  188.076 1.00 49.05  ? 46  LYS B CB    1 
ATOM   3485 C CG    . LYS J 3 45  ? 48.711  10.223  188.051 1.00 43.52  ? 46  LYS B CG    1 
ATOM   3486 C CD    . LYS J 3 45  ? 48.932  9.666   189.428 1.00 44.68  ? 46  LYS B CD    1 
ATOM   3487 C CE    . LYS J 3 45  ? 48.946  8.147   189.466 1.00 49.19  ? 46  LYS B CE    1 
ATOM   3488 N NZ    . LYS J 3 45  ? 48.961  7.683   190.911 1.00 37.26  ? 46  LYS B NZ    1 
ATOM   3489 N N     . GLU J 3 46  ? 50.954  13.151  186.344 1.00 49.41  ? 47  GLU B N     1 
ATOM   3490 C CA    . GLU J 3 46  ? 51.940  13.089  185.265 1.00 50.77  ? 47  GLU B CA    1 
ATOM   3491 C C     . GLU J 3 46  ? 53.339  13.536  185.742 1.00 50.43  ? 47  GLU B C     1 
ATOM   3492 O O     . GLU J 3 46  ? 54.334  12.848  185.505 1.00 56.52  ? 47  GLU B O     1 
ATOM   3493 C CB    . GLU J 3 46  ? 51.532  13.963  184.084 1.00 42.82  ? 47  GLU B CB    1 
ATOM   3494 C CG    . GLU J 3 46  ? 50.131  13.770  183.580 1.00 55.62  ? 47  GLU B CG    1 
ATOM   3495 C CD    . GLU J 3 46  ? 49.891  14.565  182.301 1.00 69.89  ? 47  GLU B CD    1 
ATOM   3496 O OE1   . GLU J 3 46  ? 48.719  14.664  181.836 1.00 66.36  ? 47  GLU B OE1   1 
ATOM   3497 O OE2   . GLU J 3 46  ? 50.896  15.090  181.759 1.00 65.24  ? 47  GLU B OE2   1 
ATOM   3498 N N     . ASN J 3 47  ? 53.434  14.676  186.412 1.00 41.72  ? 48  ASN B N     1 
ATOM   3499 C CA    . ASN J 3 47  ? 54.744  15.118  186.870 1.00 55.81  ? 48  ASN B CA    1 
ATOM   3500 C C     . ASN J 3 47  ? 55.308  14.381  188.080 1.00 61.45  ? 48  ASN B C     1 
ATOM   3501 O O     . ASN J 3 47  ? 56.524  14.327  188.259 1.00 66.83  ? 48  ASN B O     1 
ATOM   3502 C CB    . ASN J 3 47  ? 54.731  16.616  187.158 1.00 52.42  ? 48  ASN B CB    1 
ATOM   3503 C CG    . ASN J 3 47  ? 54.442  17.432  185.926 1.00 59.06  ? 48  ASN B CG    1 
ATOM   3504 O OD1   . ASN J 3 47  ? 53.334  17.392  185.388 1.00 51.58  ? 48  ASN B OD1   1 
ATOM   3505 N ND2   . ASN J 3 47  ? 55.447  18.170  185.455 1.00 66.80  ? 48  ASN B ND2   1 
ATOM   3506 N N     . LEU J 3 48  ? 54.432  13.819  188.905 1.00 58.17  ? 49  LEU B N     1 
ATOM   3507 C CA    . LEU J 3 48  ? 54.859  13.099  190.094 1.00 61.33  ? 49  LEU B CA    1 
ATOM   3508 C C     . LEU J 3 48  ? 54.072  11.796  190.189 1.00 69.50  ? 49  LEU B C     1 
ATOM   3509 O O     . LEU J 3 48  ? 53.350  11.579  191.163 1.00 78.20  ? 49  LEU B O     1 
ATOM   3510 C CB    . LEU J 3 48  ? 54.596  13.957  191.337 1.00 57.80  ? 49  LEU B CB    1 
ATOM   3511 C CG    . LEU J 3 48  ? 55.137  15.391  191.344 1.00 52.38  ? 49  LEU B CG    1 
ATOM   3512 C CD1   . LEU J 3 48  ? 54.726  16.152  192.611 1.00 45.36  ? 49  LEU B CD1   1 
ATOM   3513 C CD2   . LEU J 3 48  ? 56.620  15.329  191.237 1.00 48.98  ? 49  LEU B CD2   1 
ATOM   3514 N N     . SER J 3 49  ? 54.216  10.931  189.181 1.00 70.42  ? 50  SER B N     1 
ATOM   3515 C CA    . SER J 3 49  ? 53.489  9.654   189.126 1.00 65.20  ? 50  SER B CA    1 
ATOM   3516 C C     . SER J 3 49  ? 53.648  8.733   190.318 1.00 58.05  ? 50  SER B C     1 
ATOM   3517 O O     . SER J 3 49  ? 52.676  8.117   190.766 1.00 48.20  ? 50  SER B O     1 
ATOM   3518 C CB    . SER J 3 49  ? 53.878  8.862   187.889 1.00 67.63  ? 50  SER B CB    1 
ATOM   3519 O OG    . SER J 3 49  ? 53.100  7.684   187.848 1.00 73.17  ? 50  SER B OG    1 
ATOM   3520 N N     . ASP J 3 50  ? 54.883  8.625   190.803 1.00 50.76  ? 51  ASP B N     1 
ATOM   3521 C CA    . ASP J 3 50  ? 55.177  7.780   191.942 1.00 45.58  ? 51  ASP B CA    1 
ATOM   3522 C C     . ASP J 3 50  ? 54.736  8.359   193.298 1.00 38.76  ? 51  ASP B C     1 
ATOM   3523 O O     . ASP J 3 50  ? 54.719  7.644   194.284 1.00 35.68  ? 51  ASP B O     1 
ATOM   3524 C CB    . ASP J 3 50  ? 56.679  7.419   191.979 1.00 60.73  ? 51  ASP B CB    1 
ATOM   3525 C CG    . ASP J 3 50  ? 57.089  6.370   190.910 1.00 75.36  ? 51  ASP B CG    1 
ATOM   3526 O OD1   . ASP J 3 50  ? 56.381  5.346   190.740 1.00 85.58  ? 51  ASP B OD1   1 
ATOM   3527 O OD2   . ASP J 3 50  ? 58.144  6.554   190.254 1.00 73.00  ? 51  ASP B OD2   1 
ATOM   3528 N N     . LEU J 3 51  ? 54.371  9.632   193.392 1.00 38.10  ? 52  LEU B N     1 
ATOM   3529 C CA    . LEU J 3 51  ? 53.945  10.106  194.715 1.00 39.07  ? 52  LEU B CA    1 
ATOM   3530 C C     . LEU J 3 51  ? 52.467  10.399  194.779 1.00 37.96  ? 52  LEU B C     1 
ATOM   3531 O O     . LEU J 3 51  ? 51.817  10.154  195.796 1.00 33.59  ? 52  LEU B O     1 
ATOM   3532 C CB    . LEU J 3 51  ? 54.686  11.361  195.128 1.00 36.98  ? 52  LEU B CB    1 
ATOM   3533 C CG    . LEU J 3 51  ? 56.183  11.353  194.904 1.00 46.43  ? 52  LEU B CG    1 
ATOM   3534 C CD1   . LEU J 3 51  ? 56.522  11.300  193.403 1.00 39.89  ? 52  LEU B CD1   1 
ATOM   3535 C CD2   . LEU J 3 51  ? 56.713  12.616  195.525 1.00 54.27  ? 52  LEU B CD2   1 
ATOM   3536 N N     . THR J 3 52  ? 51.961  10.933  193.675 1.00 26.81  ? 53  THR B N     1 
ATOM   3537 C CA    . THR J 3 52  ? 50.570  11.299  193.540 1.00 24.59  ? 53  THR B CA    1 
ATOM   3538 C C     . THR J 3 52  ? 49.595  10.135  193.759 1.00 28.97  ? 53  THR B C     1 
ATOM   3539 O O     . THR J 3 52  ? 49.717  9.058   193.160 1.00 21.97  ? 53  THR B O     1 
ATOM   3540 C CB    . THR J 3 52  ? 50.331  11.935  192.167 1.00 27.61  ? 53  THR B CB    1 
ATOM   3541 O OG1   . THR J 3 52  ? 51.113  13.128  192.057 1.00 29.50  ? 53  THR B OG1   1 
ATOM   3542 C CG2   . THR J 3 52  ? 48.873  12.261  191.989 1.00 34.58  ? 53  THR B CG2   1 
ATOM   3543 N N     . PHE J 3 53  ? 48.619  10.386  194.623 1.00 30.77  ? 54  PHE B N     1 
ATOM   3544 C CA    . PHE J 3 53  ? 47.615  9.407   194.976 1.00 32.32  ? 54  PHE B CA    1 
ATOM   3545 C C     . PHE J 3 53  ? 46.304  10.059  195.316 1.00 37.48  ? 54  PHE B C     1 
ATOM   3546 O O     . PHE J 3 53  ? 46.226  11.255  195.560 1.00 47.51  ? 54  PHE B O     1 
ATOM   3547 C CB    . PHE J 3 53  ? 48.041  8.641   196.212 1.00 33.36  ? 54  PHE B CB    1 
ATOM   3548 C CG    . PHE J 3 53  ? 48.964  7.516   195.943 1.00 36.24  ? 54  PHE B CG    1 
ATOM   3549 C CD1   . PHE J 3 53  ? 48.544  6.433   195.189 1.00 44.68  ? 54  PHE B CD1   1 
ATOM   3550 C CD2   . PHE J 3 53  ? 50.245  7.515   196.472 1.00 33.16  ? 54  PHE B CD2   1 
ATOM   3551 C CE1   . PHE J 3 53  ? 49.386  5.361   194.965 1.00 44.36  ? 54  PHE B CE1   1 
ATOM   3552 C CE2   . PHE J 3 53  ? 51.101  6.452   196.258 1.00 28.26  ? 54  PHE B CE2   1 
ATOM   3553 C CZ    . PHE J 3 53  ? 50.674  5.374   195.507 1.00 42.18  ? 54  PHE B CZ    1 
ATOM   3554 N N     . LYS J 3 54  ? 45.269  9.246   195.344 1.00 38.94  ? 55  LYS B N     1 
ATOM   3555 C CA    . LYS J 3 54  ? 43.953  9.705   195.735 1.00 40.47  ? 55  LYS B CA    1 
ATOM   3556 C C     . LYS J 3 54  ? 43.808  9.060   197.123 1.00 43.31  ? 55  LYS B C     1 
ATOM   3557 O O     . LYS J 3 54  ? 44.271  7.942   197.332 1.00 43.93  ? 55  LYS B O     1 
ATOM   3558 C CB    . LYS J 3 54  ? 42.908  9.174   194.763 1.00 35.13  ? 55  LYS B CB    1 
ATOM   3559 C CG    . LYS J 3 54  ? 42.337  10.242  193.839 1.00 56.84  ? 55  LYS B CG    1 
ATOM   3560 C CD    . LYS J 3 54  ? 41.536  11.297  194.652 1.00 64.30  ? 55  LYS B CD    1 
ATOM   3561 C CE    . LYS J 3 54  ? 40.761  12.288  193.772 1.00 49.34  ? 55  LYS B CE    1 
ATOM   3562 N NZ    . LYS J 3 54  ? 41.630  13.010  192.808 1.00 59.62  ? 55  LYS B NZ    1 
ATOM   3563 N N     . GLN J 3 55  ? 43.200  9.746   198.082 1.00 40.73  ? 56  GLN B N     1 
ATOM   3564 C CA    . GLN J 3 55  ? 43.118  9.141   199.389 1.00 34.04  ? 56  GLN B CA    1 
ATOM   3565 C C     . GLN J 3 55  ? 42.773  7.671   199.219 1.00 36.64  ? 56  GLN B C     1 
ATOM   3566 O O     . GLN J 3 55  ? 43.531  6.803   199.640 1.00 42.83  ? 56  GLN B O     1 
ATOM   3567 C CB    . GLN J 3 55  ? 42.093  9.841   200.297 1.00 27.31  ? 56  GLN B CB    1 
ATOM   3568 C CG    . GLN J 3 55  ? 42.087  9.269   201.724 1.00 21.25  ? 56  GLN B CG    1 
ATOM   3569 C CD    . GLN J 3 55  ? 41.712  10.283  202.787 1.00 42.69  ? 56  GLN B CD    1 
ATOM   3570 O OE1   . GLN J 3 55  ? 41.914  11.485  202.604 1.00 49.73  ? 56  GLN B OE1   1 
ATOM   3571 N NE2   . GLN J 3 55  ? 41.200  9.804   203.926 1.00 33.81  ? 56  GLN B NE2   1 
ATOM   3572 N N     . TYR J 3 56  ? 41.666  7.375   198.552 1.00 31.94  ? 57  TYR B N     1 
ATOM   3573 C CA    . TYR J 3 56  ? 41.270  5.986   198.390 1.00 36.53  ? 57  TYR B CA    1 
ATOM   3574 C C     . TYR J 3 56  ? 42.296  5.172   197.624 1.00 40.82  ? 57  TYR B C     1 
ATOM   3575 O O     . TYR J 3 56  ? 42.653  4.074   198.038 1.00 42.75  ? 57  TYR B O     1 
ATOM   3576 C CB    . TYR J 3 56  ? 39.898  5.906   197.727 1.00 31.33  ? 57  TYR B CB    1 
ATOM   3577 C CG    . TYR J 3 56  ? 39.741  6.698   196.454 1.00 32.64  ? 57  TYR B CG    1 
ATOM   3578 C CD1   . TYR J 3 56  ? 40.050  6.132   195.215 1.00 40.73  ? 57  TYR B CD1   1 
ATOM   3579 C CD2   . TYR J 3 56  ? 39.220  7.998   196.473 1.00 35.62  ? 57  TYR B CD2   1 
ATOM   3580 C CE1   . TYR J 3 56  ? 39.834  6.839   194.022 1.00 23.25  ? 57  TYR B CE1   1 
ATOM   3581 C CE2   . TYR J 3 56  ? 38.998  8.723   195.277 1.00 6.68   ? 57  TYR B CE2   1 
ATOM   3582 C CZ    . TYR J 3 56  ? 39.303  8.134   194.073 1.00 23.59  ? 57  TYR B CZ    1 
ATOM   3583 O OH    . TYR J 3 56  ? 39.051  8.819   192.906 1.00 23.27  ? 57  TYR B OH    1 
ATOM   3584 N N     . GLU J 3 57  ? 42.794  5.727   196.528 1.00 43.89  ? 58  GLU B N     1 
ATOM   3585 C CA    . GLU J 3 57  ? 43.792  5.047   195.715 1.00 44.61  ? 58  GLU B CA    1 
ATOM   3586 C C     . GLU J 3 57  ? 44.983  4.653   196.587 1.00 42.57  ? 58  GLU B C     1 
ATOM   3587 O O     . GLU J 3 57  ? 45.546  3.573   196.426 1.00 45.79  ? 58  GLU B O     1 
ATOM   3588 C CB    . GLU J 3 57  ? 44.237  5.963   194.565 1.00 44.81  ? 58  GLU B CB    1 
ATOM   3589 C CG    . GLU J 3 57  ? 45.179  5.328   193.570 1.00 44.23  ? 58  GLU B CG    1 
ATOM   3590 C CD    . GLU J 3 57  ? 45.791  6.326   192.613 1.00 42.58  ? 58  GLU B CD    1 
ATOM   3591 O OE1   . GLU J 3 57  ? 46.938  6.081   192.185 1.00 37.28  ? 58  GLU B OE1   1 
ATOM   3592 O OE2   . GLU J 3 57  ? 45.130  7.335   192.289 1.00 43.45  ? 58  GLU B OE2   1 
ATOM   3593 N N     . TYR J 3 58  ? 45.372  5.522   197.514 1.00 46.18  ? 59  TYR B N     1 
ATOM   3594 C CA    . TYR J 3 58  ? 46.495  5.199   198.398 1.00 41.35  ? 59  TYR B CA    1 
ATOM   3595 C C     . TYR J 3 58  ? 46.105  4.057   199.340 1.00 39.54  ? 59  TYR B C     1 
ATOM   3596 O O     . TYR J 3 58  ? 46.856  3.092   199.481 1.00 34.61  ? 59  TYR B O     1 
ATOM   3597 C CB    . TYR J 3 58  ? 46.950  6.427   199.202 1.00 26.28  ? 59  TYR B CB    1 
ATOM   3598 C CG    . TYR J 3 58  ? 47.837  6.051   200.350 1.00 24.31  ? 59  TYR B CG    1 
ATOM   3599 C CD1   . TYR J 3 58  ? 47.285  5.662   201.580 1.00 35.57  ? 59  TYR B CD1   1 
ATOM   3600 C CD2   . TYR J 3 58  ? 49.220  6.018   200.206 1.00 34.77  ? 59  TYR B CD2   1 
ATOM   3601 C CE1   . TYR J 3 58  ? 48.087  5.251   202.646 1.00 30.60  ? 59  TYR B CE1   1 
ATOM   3602 C CE2   . TYR J 3 58  ? 50.044  5.599   201.269 1.00 38.39  ? 59  TYR B CE2   1 
ATOM   3603 C CZ    . TYR J 3 58  ? 49.463  5.225   202.481 1.00 45.82  ? 59  TYR B CZ    1 
ATOM   3604 O OH    . TYR J 3 58  ? 50.254  4.865   203.543 1.00 57.98  ? 59  TYR B OH    1 
ATOM   3605 N N     . LEU J 3 59  ? 44.935  4.160   199.971 1.00 29.69  ? 60  LEU B N     1 
ATOM   3606 C CA    . LEU J 3 59  ? 44.501  3.098   200.857 1.00 38.53  ? 60  LEU B CA    1 
ATOM   3607 C C     . LEU J 3 59  ? 44.456  1.734   200.114 1.00 42.54  ? 60  LEU B C     1 
ATOM   3608 O O     . LEU J 3 59  ? 44.991  0.735   200.592 1.00 45.91  ? 60  LEU B O     1 
ATOM   3609 C CB    . LEU J 3 59  ? 43.136  3.424   201.471 1.00 34.75  ? 60  LEU B CB    1 
ATOM   3610 C CG    . LEU J 3 59  ? 43.027  4.354   202.688 1.00 37.69  ? 60  LEU B CG    1 
ATOM   3611 C CD1   . LEU J 3 59  ? 41.553  4.693   202.943 1.00 43.44  ? 60  LEU B CD1   1 
ATOM   3612 C CD2   . LEU J 3 59  ? 43.600  3.713   203.909 1.00 24.05  ? 60  LEU B CD2   1 
ATOM   3613 N N     . ASN J 3 60  ? 43.843  1.693   198.940 1.00 38.08  ? 61  ASN B N     1 
ATOM   3614 C CA    . ASN J 3 60  ? 43.756  0.455   198.193 1.00 34.08  ? 61  ASN B CA    1 
ATOM   3615 C C     . ASN J 3 60  ? 45.132  -0.071  197.851 1.00 38.75  ? 61  ASN B C     1 
ATOM   3616 O O     . ASN J 3 60  ? 45.364  -1.263  197.865 1.00 47.16  ? 61  ASN B O     1 
ATOM   3617 C CB    . ASN J 3 60  ? 42.929  0.652   196.916 1.00 21.82  ? 61  ASN B CB    1 
ATOM   3618 C CG    . ASN J 3 60  ? 41.454  0.922   197.215 1.00 26.67  ? 61  ASN B CG    1 
ATOM   3619 O OD1   . ASN J 3 60  ? 41.031  0.812   198.361 1.00 24.19  ? 61  ASN B OD1   1 
ATOM   3620 N ND2   . ASN J 3 60  ? 40.668  1.260   196.188 1.00 12.99  ? 61  ASN B ND2   1 
ATOM   3621 N N     . ASP J 3 61  ? 46.060  0.814   197.545 1.00 42.76  ? 62  ASP B N     1 
ATOM   3622 C CA    . ASP J 3 61  ? 47.404  0.374   197.217 1.00 47.11  ? 62  ASP B CA    1 
ATOM   3623 C C     . ASP J 3 61  ? 48.060  -0.193  198.483 1.00 51.65  ? 62  ASP B C     1 
ATOM   3624 O O     . ASP J 3 61  ? 48.791  -1.177  198.427 1.00 38.74  ? 62  ASP B O     1 
ATOM   3625 C CB    . ASP J 3 61  ? 48.207  1.559   196.694 1.00 62.22  ? 62  ASP B CB    1 
ATOM   3626 C CG    . ASP J 3 61  ? 49.593  1.172   196.251 1.00 70.98  ? 62  ASP B CG    1 
ATOM   3627 O OD1   . ASP J 3 61  ? 49.694  0.557   195.165 1.00 79.70  ? 62  ASP B OD1   1 
ATOM   3628 O OD2   . ASP J 3 61  ? 50.566  1.479   196.991 1.00 62.55  ? 62  ASP B OD2   1 
ATOM   3629 N N     . LEU J 3 62  ? 47.793  0.440   199.625 1.00 54.92  ? 63  LEU B N     1 
ATOM   3630 C CA    . LEU J 3 62  ? 48.345  -0.013  200.897 1.00 49.50  ? 63  LEU B CA    1 
ATOM   3631 C C     . LEU J 3 62  ? 47.917  -1.460  201.147 1.00 48.85  ? 63  LEU B C     1 
ATOM   3632 O O     . LEU J 3 62  ? 48.737  -2.337  201.382 1.00 50.87  ? 63  LEU B O     1 
ATOM   3633 C CB    . LEU J 3 62  ? 47.848  0.871   202.040 1.00 33.98  ? 63  LEU B CB    1 
ATOM   3634 C CG    . LEU J 3 62  ? 48.380  0.458   203.421 1.00 49.70  ? 63  LEU B CG    1 
ATOM   3635 C CD1   . LEU J 3 62  ? 49.905  0.642   203.477 1.00 35.43  ? 63  LEU B CD1   1 
ATOM   3636 C CD2   . LEU J 3 62  ? 47.693  1.268   204.520 1.00 45.03  ? 63  LEU B CD2   1 
ATOM   3637 N N     . PHE J 3 63  ? 46.621  -1.706  201.083 1.00 45.86  ? 64  PHE B N     1 
ATOM   3638 C CA    . PHE J 3 63  ? 46.098  -3.036  201.300 1.00 45.01  ? 64  PHE B CA    1 
ATOM   3639 C C     . PHE J 3 63  ? 46.469  -4.071  200.251 1.00 47.68  ? 64  PHE B C     1 
ATOM   3640 O O     . PHE J 3 63  ? 46.542  -5.256  200.554 1.00 46.16  ? 64  PHE B O     1 
ATOM   3641 C CB    . PHE J 3 63  ? 44.586  -2.958  201.426 1.00 38.92  ? 64  PHE B CB    1 
ATOM   3642 C CG    . PHE J 3 63  ? 44.138  -2.255  202.654 1.00 35.30  ? 64  PHE B CG    1 
ATOM   3643 C CD1   . PHE J 3 63  ? 45.048  -1.525  203.412 1.00 28.19  ? 64  PHE B CD1   1 
ATOM   3644 C CD2   . PHE J 3 63  ? 42.808  -2.277  203.032 1.00 36.23  ? 64  PHE B CD2   1 
ATOM   3645 C CE1   . PHE J 3 63  ? 44.642  -0.829  204.516 1.00 31.75  ? 64  PHE B CE1   1 
ATOM   3646 C CE2   . PHE J 3 63  ? 42.392  -1.577  204.144 1.00 41.49  ? 64  PHE B CE2   1 
ATOM   3647 C CZ    . PHE J 3 63  ? 43.310  -0.850  204.886 1.00 40.41  ? 64  PHE B CZ    1 
ATOM   3648 N N     . MET J 3 64  ? 46.694  -3.617  199.022 1.00 48.57  ? 65  MET B N     1 
ATOM   3649 C CA    . MET J 3 64  ? 47.052  -4.492  197.903 1.00 43.91  ? 65  MET B CA    1 
ATOM   3650 C C     . MET J 3 64  ? 48.457  -5.065  198.002 1.00 45.68  ? 65  MET B C     1 
ATOM   3651 O O     . MET J 3 64  ? 48.720  -6.150  197.485 1.00 49.35  ? 65  MET B O     1 
ATOM   3652 C CB    . MET J 3 64  ? 46.921  -3.737  196.573 1.00 38.99  ? 65  MET B CB    1 
ATOM   3653 C CG    . MET J 3 64  ? 45.497  -3.356  196.229 1.00 39.27  ? 65  MET B CG    1 
ATOM   3654 S SD    . MET J 3 64  ? 45.305  -2.464  194.675 1.00 54.85  ? 65  MET B SD    1 
ATOM   3655 C CE    . MET J 3 64  ? 44.485  -3.726  193.520 1.00 33.60  ? 65  MET B CE    1 
ATOM   3656 N N     . LYS J 3 65  ? 49.356  -4.327  198.650 1.00 47.89  ? 66  LYS B N     1 
ATOM   3657 C CA    . LYS J 3 65  ? 50.730  -4.765  198.811 1.00 48.81  ? 66  LYS B CA    1 
ATOM   3658 C C     . LYS J 3 65  ? 50.976  -5.354  200.198 1.00 56.38  ? 66  LYS B C     1 
ATOM   3659 O O     . LYS J 3 65  ? 52.062  -5.205  200.757 1.00 60.28  ? 66  LYS B O     1 
ATOM   3660 C CB    . LYS J 3 65  ? 51.685  -3.607  198.552 1.00 43.10  ? 66  LYS B CB    1 
ATOM   3661 C CG    . LYS J 3 65  ? 51.733  -2.563  199.654 1.00 57.88  ? 66  LYS B CG    1 
ATOM   3662 C CD    . LYS J 3 65  ? 52.842  -1.526  199.374 1.00 67.67  ? 66  LYS B CD    1 
ATOM   3663 C CE    . LYS J 3 65  ? 52.995  -0.494  200.491 1.00 67.78  ? 66  LYS B CE    1 
ATOM   3664 N NZ    . LYS J 3 65  ? 54.106  0.449   200.204 1.00 62.00  ? 66  LYS B NZ    1 
ATOM   3665 N N     . ASN J 3 66  ? 49.947  -6.015  200.736 1.00 59.02  ? 67  ASN B N     1 
ATOM   3666 C CA    . ASN J 3 66  ? 49.970  -6.690  202.043 1.00 59.93  ? 67  ASN B CA    1 
ATOM   3667 C C     . ASN J 3 66  ? 48.845  -7.713  202.074 1.00 60.79  ? 67  ASN B C     1 
ATOM   3668 O O     . ASN J 3 66  ? 47.991  -7.692  202.962 1.00 59.79  ? 67  ASN B O     1 
ATOM   3669 C CB    . ASN J 3 66  ? 49.762  -5.699  203.174 1.00 60.17  ? 67  ASN B CB    1 
ATOM   3670 C CG    . ASN J 3 66  ? 50.929  -4.756  203.325 1.00 76.05  ? 67  ASN B CG    1 
ATOM   3671 O OD1   . ASN J 3 66  ? 52.065  -5.185  203.524 1.00 77.01  ? 67  ASN B OD1   1 
ATOM   3672 N ND2   . ASN J 3 66  ? 50.659  -3.460  203.228 1.00 87.88  ? 67  ASN B ND2   1 
ATOM   3673 N N     . PRO J 3 67  ? 48.842  -8.636  201.099 1.00 56.72  ? 68  PRO B N     1 
ATOM   3674 C CA    . PRO J 3 67  ? 47.824  -9.684  200.971 1.00 57.76  ? 68  PRO B CA    1 
ATOM   3675 C C     . PRO J 3 67  ? 47.720  -10.574 202.200 1.00 67.95  ? 68  PRO B C     1 
ATOM   3676 O O     . PRO J 3 67  ? 46.629  -11.040 202.548 1.00 71.80  ? 68  PRO B O     1 
ATOM   3677 C CB    . PRO J 3 67  ? 48.284  -10.473 199.743 1.00 50.60  ? 68  PRO B CB    1 
ATOM   3678 C CG    . PRO J 3 67  ? 49.145  -9.499  198.992 1.00 48.95  ? 68  PRO B CG    1 
ATOM   3679 C CD    . PRO J 3 67  ? 49.895  -8.802  200.082 1.00 43.59  ? 68  PRO B CD    1 
ATOM   3680 N N     . ALA J 3 68  ? 48.862  -10.815 202.839 1.00 68.58  ? 69  ALA B N     1 
ATOM   3681 C CA    . ALA J 3 68  ? 48.928  -11.666 204.023 1.00 71.73  ? 69  ALA B CA    1 
ATOM   3682 C C     . ALA J 3 68  ? 48.114  -11.120 205.183 1.00 73.72  ? 69  ALA B C     1 
ATOM   3683 O O     . ALA J 3 68  ? 47.733  -11.859 206.092 1.00 77.13  ? 69  ALA B O     1 
ATOM   3684 C CB    . ALA J 3 68  ? 50.365  -11.826 204.450 1.00 72.08  ? 69  ALA B CB    1 
ATOM   3685 N N     . ILE J 3 69  ? 47.851  -9.820  205.146 1.00 71.75  ? 70  ILE B N     1 
ATOM   3686 C CA    . ILE J 3 69  ? 47.105  -9.164  206.206 1.00 66.07  ? 70  ILE B CA    1 
ATOM   3687 C C     . ILE J 3 69  ? 45.634  -8.974  205.847 1.00 67.25  ? 70  ILE B C     1 
ATOM   3688 O O     . ILE J 3 69  ? 45.304  -8.439  204.780 1.00 67.95  ? 70  ILE B O     1 
ATOM   3689 C CB    . ILE J 3 69  ? 47.727  -7.779  206.532 1.00 64.34  ? 70  ILE B CB    1 
ATOM   3690 C CG1   . ILE J 3 69  ? 49.213  -7.916  206.881 1.00 66.11  ? 70  ILE B CG1   1 
ATOM   3691 C CG2   . ILE J 3 69  ? 47.023  -7.158  207.703 1.00 55.62  ? 70  ILE B CG2   1 
ATOM   3692 C CD1   . ILE J 3 69  ? 50.141  -8.132  205.697 1.00 67.62  ? 70  ILE B CD1   1 
ATOM   3693 N N     . ILE J 3 70  ? 44.745  -9.433  206.724 1.00 66.20  ? 71  ILE B N     1 
ATOM   3694 C CA    . ILE J 3 70  ? 43.315  -9.255  206.488 1.00 70.08  ? 71  ILE B CA    1 
ATOM   3695 C C     . ILE J 3 70  ? 42.673  -8.897  207.807 1.00 72.41  ? 71  ILE B C     1 
ATOM   3696 O O     . ILE J 3 70  ? 43.342  -8.943  208.834 1.00 76.39  ? 71  ILE B O     1 
ATOM   3697 C CB    . ILE J 3 70  ? 42.635  -10.499 205.923 1.00 65.27  ? 71  ILE B CB    1 
ATOM   3698 C CG1   . ILE J 3 70  ? 42.742  -11.651 206.895 1.00 67.74  ? 71  ILE B CG1   1 
ATOM   3699 C CG2   . ILE J 3 70  ? 43.271  -10.867 204.607 1.00 79.65  ? 71  ILE B CG2   1 
ATOM   3700 C CD1   . ILE J 3 70  ? 41.896  -12.834 206.493 1.00 64.74  ? 71  ILE B CD1   1 
ATOM   3701 N N     . GLY J 3 71  ? 41.392  -8.526  207.776 1.00 72.76  ? 72  GLY B N     1 
ATOM   3702 C CA    . GLY J 3 71  ? 40.699  -8.133  208.990 1.00 70.86  ? 72  GLY B CA    1 
ATOM   3703 C C     . GLY J 3 71  ? 41.124  -6.755  209.498 1.00 71.14  ? 72  GLY B C     1 
ATOM   3704 O O     . GLY J 3 71  ? 42.300  -6.523  209.799 1.00 62.95  ? 72  GLY B O     1 
ATOM   3705 N N     . HIS J 3 72  ? 40.156  -5.844  209.603 1.00 75.27  ? 73  HIS B N     1 
ATOM   3706 C CA    . HIS J 3 72  ? 40.388  -4.473  210.070 1.00 72.64  ? 73  HIS B CA    1 
ATOM   3707 C C     . HIS J 3 72  ? 41.478  -4.391  211.133 1.00 68.98  ? 73  HIS B C     1 
ATOM   3708 O O     . HIS J 3 72  ? 42.314  -3.484  211.128 1.00 62.96  ? 73  HIS B O     1 
ATOM   3709 C CB    . HIS J 3 72  ? 39.086  -3.868  210.626 1.00 75.72  ? 73  HIS B CB    1 
ATOM   3710 C CG    . HIS J 3 72  ? 38.699  -4.376  211.986 1.00 79.41  ? 73  HIS B CG    1 
ATOM   3711 N ND1   . HIS J 3 72  ? 37.771  -5.377  212.172 1.00 83.13  ? 73  HIS B ND1   1 
ATOM   3712 C CD2   . HIS J 3 72  ? 39.110  -4.012  213.225 1.00 80.00  ? 73  HIS B CD2   1 
ATOM   3713 C CE1   . HIS J 3 72  ? 37.625  -5.607  213.465 1.00 85.58  ? 73  HIS B CE1   1 
ATOM   3714 N NE2   . HIS J 3 72  ? 38.427  -4.792  214.126 1.00 80.02  ? 73  HIS B NE2   1 
ATOM   3715 N N     . GLU J 3 73  ? 41.449  -5.354  212.045 1.00 71.85  ? 74  GLU B N     1 
ATOM   3716 C CA    . GLU J 3 73  ? 42.407  -5.437  213.129 1.00 74.25  ? 74  GLU B CA    1 
ATOM   3717 C C     . GLU J 3 73  ? 43.829  -5.210  212.619 1.00 76.19  ? 74  GLU B C     1 
ATOM   3718 O O     . GLU J 3 73  ? 44.434  -4.150  212.849 1.00 66.27  ? 74  GLU B O     1 
ATOM   3719 C CB    . GLU J 3 73  ? 42.307  -6.812  213.795 1.00 76.64  ? 74  GLU B CB    1 
ATOM   3720 N N     . ALA J 3 74  ? 44.353  -6.206  211.911 1.00 75.59  ? 75  ALA B N     1 
ATOM   3721 C CA    . ALA J 3 74  ? 45.707  -6.119  211.385 1.00 77.46  ? 75  ALA B CA    1 
ATOM   3722 C C     . ALA J 3 74  ? 45.887  -5.018  210.333 1.00 74.60  ? 75  ALA B C     1 
ATOM   3723 O O     . ALA J 3 74  ? 46.961  -4.408  210.244 1.00 72.34  ? 75  ALA B O     1 
ATOM   3724 C CB    . ALA J 3 74  ? 46.121  -7.466  210.816 1.00 84.08  ? 75  ALA B CB    1 
ATOM   3725 N N     . ARG J 3 75  ? 44.840  -4.759  209.548 1.00 65.49  ? 76  ARG B N     1 
ATOM   3726 C CA    . ARG J 3 75  ? 44.902  -3.738  208.506 1.00 62.10  ? 76  ARG B CA    1 
ATOM   3727 C C     . ARG J 3 75  ? 45.231  -2.354  209.055 1.00 66.52  ? 76  ARG B C     1 
ATOM   3728 O O     . ARG J 3 75  ? 46.128  -1.685  208.535 1.00 61.86  ? 76  ARG B O     1 
ATOM   3729 C CB    . ARG J 3 75  ? 43.594  -3.714  207.704 1.00 50.44  ? 76  ARG B CB    1 
ATOM   3730 C CG    . ARG J 3 75  ? 43.438  -4.986  206.906 1.00 49.53  ? 76  ARG B CG    1 
ATOM   3731 C CD    . ARG J 3 75  ? 42.199  -5.102  206.018 1.00 55.77  ? 76  ARG B CD    1 
ATOM   3732 N NE    . ARG J 3 75  ? 42.456  -6.143  205.003 1.00 62.78  ? 76  ARG B NE    1 
ATOM   3733 C CZ    . ARG J 3 75  ? 41.618  -6.530  204.040 1.00 59.02  ? 76  ARG B CZ    1 
ATOM   3734 N NH1   . ARG J 3 75  ? 40.417  -5.981  203.912 1.00 51.22  ? 76  ARG B NH1   1 
ATOM   3735 N NH2   . ARG J 3 75  ? 41.996  -7.476  203.198 1.00 56.17  ? 76  ARG B NH2   1 
ATOM   3736 N N     . TYR J 3 76  ? 44.524  -1.932  210.107 1.00 67.67  ? 77  TYR B N     1 
ATOM   3737 C CA    . TYR J 3 76  ? 44.786  -0.624  210.713 1.00 67.20  ? 77  TYR B CA    1 
ATOM   3738 C C     . TYR J 3 76  ? 46.207  -0.557  211.252 1.00 72.43  ? 77  TYR B C     1 
ATOM   3739 O O     . TYR J 3 76  ? 46.755  0.527   211.447 1.00 74.80  ? 77  TYR B O     1 
ATOM   3740 C CB    . TYR J 3 76  ? 43.845  -0.326  211.875 1.00 62.31  ? 77  TYR B CB    1 
ATOM   3741 C CG    . TYR J 3 76  ? 42.439  0.040   211.492 1.00 53.96  ? 77  TYR B CG    1 
ATOM   3742 C CD1   . TYR J 3 76  ? 42.174  1.077   210.617 1.00 56.79  ? 77  TYR B CD1   1 
ATOM   3743 C CD2   . TYR J 3 76  ? 41.371  -0.665  212.002 1.00 60.72  ? 77  TYR B CD2   1 
ATOM   3744 C CE1   . TYR J 3 76  ? 40.866  1.396   210.257 1.00 53.58  ? 77  TYR B CE1   1 
ATOM   3745 C CE2   . TYR J 3 76  ? 40.071  -0.356  211.649 1.00 59.78  ? 77  TYR B CE2   1 
ATOM   3746 C CZ    . TYR J 3 76  ? 39.825  0.666   210.777 1.00 49.63  ? 77  TYR B CZ    1 
ATOM   3747 O OH    . TYR J 3 76  ? 38.534  0.905   210.403 1.00 45.75  ? 77  TYR B OH    1 
ATOM   3748 N N     . LYS J 3 77  ? 46.799  -1.714  211.514 1.00 76.62  ? 78  LYS B N     1 
ATOM   3749 C CA    . LYS J 3 77  ? 48.153  -1.744  212.029 1.00 76.60  ? 78  LYS B CA    1 
ATOM   3750 C C     . LYS J 3 77  ? 49.171  -1.471  210.919 1.00 75.75  ? 78  LYS B C     1 
ATOM   3751 O O     . LYS J 3 77  ? 50.338  -1.181  211.202 1.00 79.68  ? 78  LYS B O     1 
ATOM   3752 C CB    . LYS J 3 77  ? 48.429  -3.092  212.696 1.00 79.89  ? 78  LYS B CB    1 
ATOM   3753 N N     . LEU J 3 78  ? 48.743  -1.543  209.659 1.00 64.17  ? 79  LEU B N     1 
ATOM   3754 C CA    . LEU J 3 78  ? 49.665  -1.277  208.549 1.00 62.03  ? 79  LEU B CA    1 
ATOM   3755 C C     . LEU J 3 78  ? 50.099  0.176   208.416 1.00 58.91  ? 79  LEU B C     1 
ATOM   3756 O O     . LEU J 3 78  ? 51.137  0.456   207.823 1.00 54.65  ? 79  LEU B O     1 
ATOM   3757 C CB    . LEU J 3 78  ? 49.059  -1.703  207.219 1.00 59.30  ? 79  LEU B CB    1 
ATOM   3758 C CG    . LEU J 3 78  ? 49.062  -3.194  206.966 1.00 55.33  ? 79  LEU B CG    1 
ATOM   3759 C CD1   . LEU J 3 78  ? 48.409  -3.445  205.636 1.00 39.20  ? 79  LEU B CD1   1 
ATOM   3760 C CD2   . LEU J 3 78  ? 50.501  -3.723  206.992 1.00 57.63  ? 79  LEU B CD2   1 
ATOM   3761 N N     . PHE J 3 79  ? 49.303  1.096   208.956 1.00 56.01  ? 80  PHE B N     1 
ATOM   3762 C CA    . PHE J 3 79  ? 49.613  2.515   208.874 1.00 50.23  ? 80  PHE B CA    1 
ATOM   3763 C C     . PHE J 3 79  ? 50.881  2.920   209.593 1.00 49.57  ? 80  PHE B C     1 
ATOM   3764 O O     . PHE J 3 79  ? 51.663  3.716   209.084 1.00 45.68  ? 80  PHE B O     1 
ATOM   3765 C CB    . PHE J 3 79  ? 48.448  3.343   209.413 1.00 51.20  ? 80  PHE B CB    1 
ATOM   3766 C CG    . PHE J 3 79  ? 47.252  3.336   208.520 1.00 52.96  ? 80  PHE B CG    1 
ATOM   3767 C CD1   . PHE J 3 79  ? 46.238  2.425   208.708 1.00 38.66  ? 80  PHE B CD1   1 
ATOM   3768 C CD2   . PHE J 3 79  ? 47.171  4.209   207.439 1.00 57.62  ? 80  PHE B CD2   1 
ATOM   3769 C CE1   . PHE J 3 79  ? 45.160  2.378   207.828 1.00 45.53  ? 80  PHE B CE1   1 
ATOM   3770 C CE2   . PHE J 3 79  ? 46.089  4.162   206.560 1.00 46.15  ? 80  PHE B CE2   1 
ATOM   3771 C CZ    . PHE J 3 79  ? 45.091  3.248   206.756 1.00 28.42  ? 80  PHE B CZ    1 
ATOM   3772 N N     . ASN J 3 80  ? 51.073  2.361   210.780 1.00 54.07  ? 81  ASN B N     1 
ATOM   3773 C CA    . ASN J 3 80  ? 52.234  2.655   211.618 1.00 60.17  ? 81  ASN B CA    1 
ATOM   3774 C C     . ASN J 3 80  ? 52.227  4.054   212.155 1.00 56.61  ? 81  ASN B C     1 
ATOM   3775 O O     . ASN J 3 80  ? 53.280  4.620   212.435 1.00 53.40  ? 81  ASN B O     1 
ATOM   3776 C CB    . ASN J 3 80  ? 53.543  2.433   210.880 1.00 64.42  ? 81  ASN B CB    1 
ATOM   3777 C CG    . ASN J 3 80  ? 54.051  1.028   211.041 1.00 76.44  ? 81  ASN B CG    1 
ATOM   3778 O OD1   . ASN J 3 80  ? 54.136  0.515   212.160 1.00 76.87  ? 81  ASN B OD1   1 
ATOM   3779 N ND2   . ASN J 3 80  ? 54.397  0.392   209.929 1.00 86.82  ? 81  ASN B ND2   1 
ATOM   3780 N N     . SER J 3 81  ? 51.031  4.604   212.304 1.00 54.10  ? 82  SER B N     1 
ATOM   3781 C CA    . SER J 3 81  ? 50.873  5.948   212.824 1.00 60.17  ? 82  SER B CA    1 
ATOM   3782 C C     . SER J 3 81  ? 49.453  6.164   213.265 1.00 57.21  ? 82  SER B C     1 
ATOM   3783 O O     . SER J 3 81  ? 48.541  6.199   212.447 1.00 67.17  ? 82  SER B O     1 
ATOM   3784 C CB    . SER J 3 81  ? 51.202  6.990   211.769 1.00 70.38  ? 82  SER B CB    1 
ATOM   3785 O OG    . SER J 3 81  ? 50.707  8.254   212.195 1.00 76.24  ? 82  SER B OG    1 
ATOM   3786 N N     . PRO J 3 82  ? 49.244  6.332   214.566 1.00 51.39  ? 83  PRO B N     1 
ATOM   3787 C CA    . PRO J 3 82  ? 47.889  6.545   215.071 1.00 49.03  ? 83  PRO B CA    1 
ATOM   3788 C C     . PRO J 3 82  ? 47.285  7.782   214.424 1.00 48.75  ? 83  PRO B C     1 
ATOM   3789 O O     . PRO J 3 82  ? 46.080  7.854   214.197 1.00 39.04  ? 83  PRO B O     1 
ATOM   3790 C CB    . PRO J 3 82  ? 48.110  6.741   216.566 1.00 54.04  ? 83  PRO B CB    1 
ATOM   3791 C CG    . PRO J 3 82  ? 49.379  5.989   216.832 1.00 43.73  ? 83  PRO B CG    1 
ATOM   3792 C CD    . PRO J 3 82  ? 50.229  6.349   215.655 1.00 42.22  ? 83  PRO B CD    1 
ATOM   3793 N N     . THR J 3 83  ? 48.150  8.751   214.133 1.00 48.20  ? 84  THR B N     1 
ATOM   3794 C CA    . THR J 3 83  ? 47.730  10.002  213.532 1.00 45.67  ? 84  THR B CA    1 
ATOM   3795 C C     . THR J 3 83  ? 47.275  9.771   212.084 1.00 48.36  ? 84  THR B C     1 
ATOM   3796 O O     . THR J 3 83  ? 46.079  9.882   211.794 1.00 52.28  ? 84  THR B O     1 
ATOM   3797 C CB    . THR J 3 83  ? 48.870  11.031  213.598 1.00 43.88  ? 84  THR B CB    1 
ATOM   3798 O OG1   . THR J 3 83  ? 49.406  11.050  214.924 1.00 53.77  ? 84  THR B OG1   1 
ATOM   3799 C CG2   . THR J 3 83  ? 48.363  12.407  213.282 1.00 23.91  ? 84  THR B CG2   1 
ATOM   3800 N N     . LEU J 3 84  ? 48.211  9.446   211.188 1.00 37.38  ? 85  LEU B N     1 
ATOM   3801 C CA    . LEU J 3 84  ? 47.883  9.191   209.778 1.00 42.19  ? 85  LEU B CA    1 
ATOM   3802 C C     . LEU J 3 84  ? 46.627  8.313   209.672 1.00 46.88  ? 85  LEU B C     1 
ATOM   3803 O O     . LEU J 3 84  ? 45.781  8.483   208.768 1.00 40.03  ? 85  LEU B O     1 
ATOM   3804 C CB    . LEU J 3 84  ? 49.060  8.492   209.057 1.00 41.70  ? 85  LEU B CB    1 
ATOM   3805 C CG    . LEU J 3 84  ? 50.053  9.393   208.308 1.00 52.71  ? 85  LEU B CG    1 
ATOM   3806 C CD1   . LEU J 3 84  ? 51.341  8.698   207.862 1.00 44.02  ? 85  LEU B CD1   1 
ATOM   3807 C CD2   . LEU J 3 84  ? 49.307  9.897   207.122 1.00 64.88  ? 85  LEU B CD2   1 
ATOM   3808 N N     . LEU J 3 85  ? 46.532  7.370   210.608 1.00 39.79  ? 86  LEU B N     1 
ATOM   3809 C CA    . LEU J 3 85  ? 45.429  6.432   210.681 1.00 36.70  ? 86  LEU B CA    1 
ATOM   3810 C C     . LEU J 3 85  ? 44.166  7.226   210.796 1.00 35.98  ? 86  LEU B C     1 
ATOM   3811 O O     . LEU J 3 85  ? 43.311  7.162   209.925 1.00 40.20  ? 86  LEU B O     1 
ATOM   3812 C CB    . LEU J 3 85  ? 45.579  5.542   211.914 1.00 46.44  ? 86  LEU B CB    1 
ATOM   3813 C CG    . LEU J 3 85  ? 44.386  4.694   212.379 1.00 41.94  ? 86  LEU B CG    1 
ATOM   3814 C CD1   . LEU J 3 85  ? 44.061  3.633   211.373 1.00 50.37  ? 86  LEU B CD1   1 
ATOM   3815 C CD2   . LEU J 3 85  ? 44.759  4.055   213.696 1.00 51.71  ? 86  LEU B CD2   1 
ATOM   3816 N N     . PHE J 3 86  ? 44.074  7.987   211.883 1.00 36.36  ? 87  PHE B N     1 
ATOM   3817 C CA    . PHE J 3 86  ? 42.921  8.820   212.171 1.00 24.33  ? 87  PHE B CA    1 
ATOM   3818 C C     . PHE J 3 86  ? 42.585  9.723   211.012 1.00 29.18  ? 87  PHE B C     1 
ATOM   3819 O O     . PHE J 3 86  ? 41.417  9.953   210.727 1.00 37.99  ? 87  PHE B O     1 
ATOM   3820 C CB    . PHE J 3 86  ? 43.183  9.661   213.411 1.00 21.28  ? 87  PHE B CB    1 
ATOM   3821 C CG    . PHE J 3 86  ? 42.128  10.702  213.671 1.00 32.39  ? 87  PHE B CG    1 
ATOM   3822 C CD1   . PHE J 3 86  ? 40.839  10.338  213.991 1.00 31.70  ? 87  PHE B CD1   1 
ATOM   3823 C CD2   . PHE J 3 86  ? 42.425  12.056  213.572 1.00 37.08  ? 87  PHE B CD2   1 
ATOM   3824 C CE1   . PHE J 3 86  ? 39.865  11.301  214.206 1.00 37.15  ? 87  PHE B CE1   1 
ATOM   3825 C CE2   . PHE J 3 86  ? 41.456  13.019  213.784 1.00 20.24  ? 87  PHE B CE2   1 
ATOM   3826 C CZ    . PHE J 3 86  ? 40.182  12.643  214.100 1.00 36.31  ? 87  PHE B CZ    1 
ATOM   3827 N N     . LEU J 3 87  ? 43.602  10.241  210.337 1.00 32.61  ? 88  LEU B N     1 
ATOM   3828 C CA    . LEU J 3 87  ? 43.366  11.139  209.218 1.00 32.29  ? 88  LEU B CA    1 
ATOM   3829 C C     . LEU J 3 87  ? 43.066  10.454  207.903 1.00 34.41  ? 88  LEU B C     1 
ATOM   3830 O O     . LEU J 3 87  ? 42.309  10.980  207.086 1.00 37.83  ? 88  LEU B O     1 
ATOM   3831 C CB    . LEU J 3 87  ? 44.572  12.053  208.998 1.00 35.45  ? 88  LEU B CB    1 
ATOM   3832 C CG    . LEU J 3 87  ? 45.060  13.170  209.935 1.00 29.57  ? 88  LEU B CG    1 
ATOM   3833 C CD1   . LEU J 3 87  ? 46.504  13.444  209.535 1.00 15.63  ? 88  LEU B CD1   1 
ATOM   3834 C CD2   . LEU J 3 87  ? 44.221  14.448  209.831 1.00 10.72  ? 88  LEU B CD2   1 
ATOM   3835 N N     . LEU J 3 88  ? 43.653  9.286   207.671 1.00 41.60  ? 89  LEU B N     1 
ATOM   3836 C CA    . LEU J 3 88  ? 43.438  8.620   206.385 1.00 40.45  ? 89  LEU B CA    1 
ATOM   3837 C C     . LEU J 3 88  ? 42.530  7.407   206.400 1.00 39.42  ? 89  LEU B C     1 
ATOM   3838 O O     . LEU J 3 88  ? 41.661  7.280   205.552 1.00 41.05  ? 89  LEU B O     1 
ATOM   3839 C CB    . LEU J 3 88  ? 44.792  8.233   205.781 1.00 37.50  ? 89  LEU B CB    1 
ATOM   3840 C CG    . LEU J 3 88  ? 45.942  9.251   205.835 1.00 41.34  ? 89  LEU B CG    1 
ATOM   3841 C CD1   . LEU J 3 88  ? 47.017  8.836   204.836 1.00 40.55  ? 89  LEU B CD1   1 
ATOM   3842 C CD2   . LEU J 3 88  ? 45.446  10.659  205.483 1.00 40.62  ? 89  LEU B CD2   1 
ATOM   3843 N N     . SER J 3 89  ? 42.731  6.522   207.371 1.00 50.03  ? 90  SER B N     1 
ATOM   3844 C CA    . SER J 3 89  ? 41.954  5.286   207.466 1.00 47.84  ? 90  SER B CA    1 
ATOM   3845 C C     . SER J 3 89  ? 40.472  5.426   207.135 1.00 45.35  ? 90  SER B C     1 
ATOM   3846 O O     . SER J 3 89  ? 39.886  6.517   207.135 1.00 36.92  ? 90  SER B O     1 
ATOM   3847 C CB    . SER J 3 89  ? 42.107  4.645   208.854 1.00 40.62  ? 90  SER B CB    1 
ATOM   3848 O OG    . SER J 3 89  ? 41.172  5.185   209.774 1.00 57.79  ? 90  SER B OG    1 
ATOM   3849 N N     . ARG J 3 90  ? 39.872  4.278   206.867 1.00 41.48  ? 91  ARG B N     1 
ATOM   3850 C CA    . ARG J 3 90  ? 38.483  4.223   206.517 1.00 31.24  ? 91  ARG B CA    1 
ATOM   3851 C C     . ARG J 3 90  ? 37.791  3.538   207.677 1.00 38.43  ? 91  ARG B C     1 
ATOM   3852 O O     . ARG J 3 90  ? 38.459  3.163   208.630 1.00 49.83  ? 91  ARG B O     1 
ATOM   3853 C CB    . ARG J 3 90  ? 38.354  3.424   205.244 1.00 32.63  ? 91  ARG B CB    1 
ATOM   3854 C CG    . ARG J 3 90  ? 37.114  3.700   204.483 1.00 37.81  ? 91  ARG B CG    1 
ATOM   3855 C CD    . ARG J 3 90  ? 37.181  5.053   203.847 1.00 35.12  ? 91  ARG B CD    1 
ATOM   3856 N NE    . ARG J 3 90  ? 36.534  4.963   202.552 1.00 49.10  ? 91  ARG B NE    1 
ATOM   3857 C CZ    . ARG J 3 90  ? 36.697  5.842   201.580 1.00 44.87  ? 91  ARG B CZ    1 
ATOM   3858 N NH1   . ARG J 3 90  ? 37.485  6.885   201.764 1.00 34.13  ? 91  ARG B NH1   1 
ATOM   3859 N NH2   . ARG J 3 90  ? 36.084  5.663   200.424 1.00 54.53  ? 91  ARG B NH2   1 
ATOM   3860 N N     . GLY J 3 91  ? 36.471  3.371   207.614 1.00 36.41  ? 92  GLY B N     1 
ATOM   3861 C CA    . GLY J 3 91  ? 35.752  2.730   208.707 1.00 46.43  ? 92  GLY B CA    1 
ATOM   3862 C C     . GLY J 3 91  ? 36.091  1.274   209.002 1.00 54.83  ? 92  GLY B C     1 
ATOM   3863 O O     . GLY J 3 91  ? 36.625  0.572   208.142 1.00 61.05  ? 92  GLY B O     1 
ATOM   3864 N N     . LYS J 3 92  ? 35.779  0.808   210.215 1.00 63.23  ? 93  LYS B N     1 
ATOM   3865 C CA    . LYS J 3 92  ? 36.066  -0.586  210.598 1.00 62.03  ? 93  LYS B CA    1 
ATOM   3866 C C     . LYS J 3 92  ? 35.429  -1.575  209.632 1.00 51.82  ? 93  LYS B C     1 
ATOM   3867 O O     . LYS J 3 92  ? 36.117  -2.269  208.904 1.00 46.43  ? 93  LYS B O     1 
ATOM   3868 C CB    . LYS J 3 92  ? 35.572  -0.886  212.024 1.00 60.89  ? 93  LYS B CB    1 
ATOM   3869 N N     . ALA J 3 93  ? 34.112  -1.638  209.610 1.00 48.51  ? 94  ALA B N     1 
ATOM   3870 C CA    . ALA J 3 93  ? 33.488  -2.578  208.702 1.00 58.66  ? 94  ALA B CA    1 
ATOM   3871 C C     . ALA J 3 93  ? 33.957  -2.331  207.267 1.00 60.30  ? 94  ALA B C     1 
ATOM   3872 O O     . ALA J 3 93  ? 33.884  -3.221  206.422 1.00 62.47  ? 94  ALA B O     1 
ATOM   3873 C CB    . ALA J 3 93  ? 31.971  -2.481  208.790 1.00 57.72  ? 94  ALA B CB    1 
ATOM   3874 N N     . ALA J 3 94  ? 34.443  -1.126  206.989 1.00 60.45  ? 95  ALA B N     1 
ATOM   3875 C CA    . ALA J 3 94  ? 34.904  -0.811  205.638 1.00 62.53  ? 95  ALA B CA    1 
ATOM   3876 C C     . ALA J 3 94  ? 36.281  -1.409  205.386 1.00 55.84  ? 95  ALA B C     1 
ATOM   3877 O O     . ALA J 3 94  ? 36.619  -1.834  204.281 1.00 53.62  ? 95  ALA B O     1 
ATOM   3878 C CB    . ALA J 3 94  ? 34.951  0.693   205.435 1.00 69.35  ? 95  ALA B CB    1 
ATOM   3879 N N     . THR J 3 95  ? 37.078  -1.411  206.431 1.00 48.41  ? 96  THR B N     1 
ATOM   3880 C CA    . THR J 3 95  ? 38.403  -1.951  206.358 1.00 51.13  ? 96  THR B CA    1 
ATOM   3881 C C     . THR J 3 95  ? 38.282  -3.473  206.332 1.00 55.79  ? 96  THR B C     1 
ATOM   3882 O O     . THR J 3 95  ? 38.917  -4.164  205.529 1.00 52.02  ? 96  THR B O     1 
ATOM   3883 C CB    . THR J 3 95  ? 39.189  -1.522  207.585 1.00 43.39  ? 96  THR B CB    1 
ATOM   3884 O OG1   . THR J 3 95  ? 39.129  -0.099  207.688 1.00 34.40  ? 96  THR B OG1   1 
ATOM   3885 C CG2   . THR J 3 95  ? 40.628  -1.987  207.493 1.00 36.48  ? 96  THR B CG2   1 
ATOM   3886 N N     . GLU J 3 96  ? 37.438  -3.989  207.210 1.00 58.16  ? 97  GLU B N     1 
ATOM   3887 C CA    . GLU J 3 96  ? 37.259  -5.417  207.305 1.00 59.24  ? 97  GLU B CA    1 
ATOM   3888 C C     . GLU J 3 96  ? 36.982  -6.015  205.950 1.00 51.47  ? 97  GLU B C     1 
ATOM   3889 O O     . GLU J 3 96  ? 37.758  -6.831  205.470 1.00 55.76  ? 97  GLU B O     1 
ATOM   3890 C CB    . GLU J 3 96  ? 36.119  -5.752  208.284 1.00 64.93  ? 97  GLU B CB    1 
ATOM   3891 C CG    . GLU J 3 96  ? 35.934  -7.248  208.626 1.00 73.70  ? 97  GLU B CG    1 
ATOM   3892 C CD    . GLU J 3 96  ? 37.192  -7.929  209.200 1.00 77.34  ? 97  GLU B CD    1 
ATOM   3893 O OE1   . GLU J 3 96  ? 37.809  -7.386  210.141 1.00 79.80  ? 97  GLU B OE1   1 
ATOM   3894 O OE2   . GLU J 3 96  ? 37.556  -9.024  208.718 1.00 76.58  ? 97  GLU B OE2   1 
ATOM   3895 N N     . ASN J 3 97  ? 35.889  -5.580  205.330 1.00 52.03  ? 98  ASN B N     1 
ATOM   3896 C CA    . ASN J 3 97  ? 35.425  -6.087  204.023 1.00 57.80  ? 98  ASN B CA    1 
ATOM   3897 C C     . ASN J 3 97  ? 36.151  -5.563  202.777 1.00 64.75  ? 98  ASN B C     1 
ATOM   3898 O O     . ASN J 3 97  ? 35.516  -5.321  201.754 1.00 71.86  ? 98  ASN B O     1 
ATOM   3899 C CB    . ASN J 3 97  ? 33.942  -5.767  203.882 1.00 50.56  ? 98  ASN B CB    1 
ATOM   3900 C CG    . ASN J 3 97  ? 33.135  -6.206  205.090 1.00 57.56  ? 98  ASN B CG    1 
ATOM   3901 O OD1   . ASN J 3 97  ? 32.052  -5.694  205.338 1.00 49.02  ? 98  ASN B OD1   1 
ATOM   3902 N ND2   . ASN J 3 97  ? 33.655  -7.174  205.839 1.00 66.80  ? 98  ASN B ND2   1 
ATOM   3903 N N     . TRP J 3 98  ? 37.470  -5.408  202.850 1.00 66.25  ? 99  TRP B N     1 
ATOM   3904 C CA    . TRP J 3 98  ? 38.242  -4.893  201.726 1.00 59.56  ? 99  TRP B CA    1 
ATOM   3905 C C     . TRP J 3 98  ? 38.949  -5.980  200.925 1.00 62.03  ? 99  TRP B C     1 
ATOM   3906 O O     . TRP J 3 98  ? 39.536  -6.910  201.492 1.00 62.88  ? 99  TRP B O     1 
ATOM   3907 C CB    . TRP J 3 98  ? 39.285  -3.894  202.222 1.00 61.94  ? 99  TRP B CB    1 
ATOM   3908 C CG    . TRP J 3 98  ? 40.088  -3.339  201.104 1.00 57.66  ? 99  TRP B CG    1 
ATOM   3909 C CD1   . TRP J 3 98  ? 39.851  -2.186  200.428 1.00 57.24  ? 99  TRP B CD1   1 
ATOM   3910 C CD2   . TRP J 3 98  ? 41.196  -3.966  200.454 1.00 56.44  ? 99  TRP B CD2   1 
ATOM   3911 N NE1   . TRP J 3 98  ? 40.735  -2.054  199.399 1.00 54.37  ? 99  TRP B NE1   1 
ATOM   3912 C CE2   . TRP J 3 98  ? 41.577  -3.132  199.394 1.00 56.73  ? 99  TRP B CE2   1 
ATOM   3913 C CE3   . TRP J 3 98  ? 41.905  -5.156  200.668 1.00 60.62  ? 99  TRP B CE3   1 
ATOM   3914 C CZ2   . TRP J 3 98  ? 42.637  -3.446  198.541 1.00 69.63  ? 99  TRP B CZ2   1 
ATOM   3915 C CZ3   . TRP J 3 98  ? 42.959  -5.469  199.821 1.00 56.62  ? 99  TRP B CZ3   1 
ATOM   3916 C CH2   . TRP J 3 98  ? 43.316  -4.616  198.773 1.00 62.41  ? 99  TRP B CH2   1 
ATOM   3917 N N     . SER J 3 99  ? 38.940  -5.823  199.607 1.00 49.52  ? 100 SER B N     1 
ATOM   3918 C CA    . SER J 3 99  ? 39.564  -6.797  198.746 1.00 43.91  ? 100 SER B CA    1 
ATOM   3919 C C     . SER J 3 99  ? 39.511  -6.278  197.319 1.00 46.36  ? 100 SER B C     1 
ATOM   3920 O O     . SER J 3 99  ? 38.673  -5.461  197.001 1.00 40.17  ? 100 SER B O     1 
ATOM   3921 C CB    . SER J 3 99  ? 38.772  -8.084  198.818 1.00 44.22  ? 100 SER B CB    1 
ATOM   3922 O OG    . SER J 3 99  ? 37.465  -7.833  198.323 1.00 55.18  ? 100 SER B OG    1 
ATOM   3923 N N     . ILE J 3 100 ? 40.405  -6.758  196.466 1.00 45.82  ? 101 ILE B N     1 
ATOM   3924 C CA    . ILE J 3 100 ? 40.430  -6.360  195.072 1.00 46.64  ? 101 ILE B CA    1 
ATOM   3925 C C     . ILE J 3 100 ? 39.072  -6.460  194.400 1.00 52.48  ? 101 ILE B C     1 
ATOM   3926 O O     . ILE J 3 100 ? 38.814  -5.769  193.419 1.00 59.82  ? 101 ILE B O     1 
ATOM   3927 C CB    . ILE J 3 100 ? 41.331  -7.260  194.242 1.00 53.04  ? 101 ILE B CB    1 
ATOM   3928 C CG1   . ILE J 3 100 ? 41.284  -8.688  194.829 1.00 43.29  ? 101 ILE B CG1   1 
ATOM   3929 C CG2   . ILE J 3 100 ? 42.687  -6.588  194.012 1.00 45.29  ? 101 ILE B CG2   1 
ATOM   3930 C CD1   . ILE J 3 100 ? 41.816  -8.843  196.237 1.00 51.71  ? 101 ILE B CD1   1 
ATOM   3931 N N     . GLU J 3 101 ? 38.222  -7.350  194.887 1.00 48.81  ? 102 GLU B N     1 
ATOM   3932 C CA    . GLU J 3 101 ? 36.918  -7.526  194.282 1.00 51.15  ? 102 GLU B CA    1 
ATOM   3933 C C     . GLU J 3 101 ? 35.979  -6.476  194.849 1.00 53.47  ? 102 GLU B C     1 
ATOM   3934 O O     . GLU J 3 101 ? 34.836  -6.337  194.419 1.00 63.26  ? 102 GLU B O     1 
ATOM   3935 C CB    . GLU J 3 101 ? 36.413  -8.931  194.586 1.00 58.85  ? 102 GLU B CB    1 
ATOM   3936 C CG    . GLU J 3 101 ? 35.908  -9.704  193.390 1.00 69.30  ? 102 GLU B CG    1 
ATOM   3937 C CD    . GLU J 3 101 ? 35.807  -11.181 193.706 1.00 79.90  ? 102 GLU B CD    1 
ATOM   3938 O OE1   . GLU J 3 101 ? 35.011  -11.913 193.059 1.00 78.86  ? 102 GLU B OE1   1 
ATOM   3939 O OE2   . GLU J 3 101 ? 36.547  -11.605 194.620 1.00 83.52  ? 102 GLU B OE2   1 
ATOM   3940 N N     . ASN J 3 102 ? 36.475  -5.733  195.829 1.00 54.55  ? 103 ASN B N     1 
ATOM   3941 C CA    . ASN J 3 102 ? 35.710  -4.661  196.478 1.00 51.90  ? 103 ASN B CA    1 
ATOM   3942 C C     . ASN J 3 102 ? 36.689  -3.632  197.083 1.00 45.85  ? 103 ASN B C     1 
ATOM   3943 O O     . ASN J 3 102 ? 37.036  -3.705  198.261 1.00 36.31  ? 103 ASN B O     1 
ATOM   3944 C CB    . ASN J 3 102 ? 34.821  -5.261  197.566 1.00 48.99  ? 103 ASN B CB    1 
ATOM   3945 C CG    . ASN J 3 102 ? 34.087  -4.209  198.361 1.00 54.36  ? 103 ASN B CG    1 
ATOM   3946 O OD1   . ASN J 3 102 ? 33.350  -3.382  197.803 1.00 66.52  ? 103 ASN B OD1   1 
ATOM   3947 N ND2   . ASN J 3 102 ? 34.274  -4.233  199.674 1.00 25.58  ? 103 ASN B ND2   1 
ATOM   3948 N N     . LEU J 3 103 ? 37.128  -2.690  196.251 1.00 42.46  ? 104 LEU B N     1 
ATOM   3949 C CA    . LEU J 3 103 ? 38.095  -1.662  196.642 1.00 48.08  ? 104 LEU B CA    1 
ATOM   3950 C C     . LEU J 3 103 ? 37.451  -0.453  197.261 1.00 45.28  ? 104 LEU B C     1 
ATOM   3951 O O     . LEU J 3 103 ? 36.229  -0.291  197.189 1.00 35.33  ? 104 LEU B O     1 
ATOM   3952 C CB    . LEU J 3 103 ? 38.878  -1.169  195.423 1.00 43.72  ? 104 LEU B CB    1 
ATOM   3953 C CG    . LEU J 3 103 ? 39.607  -2.217  194.602 1.00 46.45  ? 104 LEU B CG    1 
ATOM   3954 C CD1   . LEU J 3 103 ? 40.127  -1.580  193.327 1.00 40.73  ? 104 LEU B CD1   1 
ATOM   3955 C CD2   . LEU J 3 103 ? 40.731  -2.815  195.445 1.00 48.96  ? 104 LEU B CD2   1 
ATOM   3956 N N     . PHE J 3 104 ? 38.292  0.401   197.847 1.00 42.00  ? 105 PHE B N     1 
ATOM   3957 C CA    . PHE J 3 104 ? 37.835  1.658   198.442 1.00 41.25  ? 105 PHE B CA    1 
ATOM   3958 C C     . PHE J 3 104 ? 37.494  2.611   197.297 1.00 38.84  ? 105 PHE B C     1 
ATOM   3959 O O     . PHE J 3 104 ? 38.141  2.594   196.244 1.00 35.79  ? 105 PHE B O     1 
ATOM   3960 C CB    . PHE J 3 104 ? 38.934  2.300   199.296 1.00 31.49  ? 105 PHE B CB    1 
ATOM   3961 C CG    . PHE J 3 104 ? 39.170  1.610   200.584 1.00 26.52  ? 105 PHE B CG    1 
ATOM   3962 C CD1   . PHE J 3 104 ? 40.446  1.239   200.966 1.00 23.85  ? 105 PHE B CD1   1 
ATOM   3963 C CD2   . PHE J 3 104 ? 38.112  1.331   201.421 1.00 29.17  ? 105 PHE B CD2   1 
ATOM   3964 C CE1   . PHE J 3 104 ? 40.666  0.593   202.168 1.00 24.30  ? 105 PHE B CE1   1 
ATOM   3965 C CE2   . PHE J 3 104 ? 38.314  0.688   202.622 1.00 31.55  ? 105 PHE B CE2   1 
ATOM   3966 C CZ    . PHE J 3 104 ? 39.595  0.317   202.997 1.00 34.86  ? 105 PHE B CZ    1 
ATOM   3967 N N     . GLU J 3 105 ? 36.478  3.437   197.506 1.00 35.18  ? 106 GLU B N     1 
ATOM   3968 C CA    . GLU J 3 105 ? 36.067  4.399   196.496 1.00 42.79  ? 106 GLU B CA    1 
ATOM   3969 C C     . GLU J 3 105 ? 36.076  5.791   197.100 1.00 44.46  ? 106 GLU B C     1 
ATOM   3970 O O     . GLU J 3 105 ? 36.610  6.001   198.186 1.00 42.77  ? 106 GLU B O     1 
ATOM   3971 C CB    . GLU J 3 105 ? 34.665  4.071   195.998 1.00 44.64  ? 106 GLU B CB    1 
ATOM   3972 C CG    . GLU J 3 105 ? 34.515  4.023   194.510 1.00 43.22  ? 106 GLU B CG    1 
ATOM   3973 C CD    . GLU J 3 105 ? 33.433  3.051   194.106 1.00 55.85  ? 106 GLU B CD    1 
ATOM   3974 O OE1   . GLU J 3 105 ? 32.242  3.350   194.355 1.00 55.03  ? 106 GLU B OE1   1 
ATOM   3975 O OE2   . GLU J 3 105 ? 33.776  1.975   193.566 1.00 53.34  ? 106 GLU B OE2   1 
ATOM   3976 N N     . GLU J 3 106 ? 35.478  6.740   196.390 1.00 52.03  ? 107 GLU B N     1 
ATOM   3977 C CA    . GLU J 3 106 ? 35.409  8.120   196.856 1.00 46.36  ? 107 GLU B CA    1 
ATOM   3978 C C     . GLU J 3 106 ? 34.402  8.285   197.958 1.00 45.45  ? 107 GLU B C     1 
ATOM   3979 O O     . GLU J 3 106 ? 33.218  8.034   197.758 1.00 56.96  ? 107 GLU B O     1 
ATOM   3980 C CB    . GLU J 3 106 ? 35.004  9.018   195.725 1.00 37.69  ? 107 GLU B CB    1 
ATOM   3981 C CG    . GLU J 3 106 ? 35.005  10.433  196.083 1.00 60.32  ? 107 GLU B CG    1 
ATOM   3982 C CD    . GLU J 3 106 ? 35.031  11.257  194.842 1.00 82.54  ? 107 GLU B CD    1 
ATOM   3983 O OE1   . GLU J 3 106 ? 34.121  11.053  194.001 1.00 89.61  ? 107 GLU B OE1   1 
ATOM   3984 O OE2   . GLU J 3 106 ? 35.964  12.083  194.694 1.00 96.30  ? 107 GLU B OE2   1 
ATOM   3985 N N     . LYS J 3 107 ? 34.868  8.709   199.121 1.00 35.60  ? 108 LYS B N     1 
ATOM   3986 C CA    . LYS J 3 107 ? 33.974  8.939   200.247 1.00 27.38  ? 108 LYS B CA    1 
ATOM   3987 C C     . LYS J 3 107 ? 33.857  10.485  200.342 1.00 32.79  ? 108 LYS B C     1 
ATOM   3988 O O     . LYS J 3 107 ? 34.826  11.202  200.081 1.00 21.09  ? 108 LYS B O     1 
ATOM   3989 C CB    . LYS J 3 107 ? 34.606  8.338   201.480 1.00 22.28  ? 108 LYS B CB    1 
ATOM   3990 C CG    . LYS J 3 107 ? 33.824  8.465   202.762 1.00 30.12  ? 108 LYS B CG    1 
ATOM   3991 C CD    . LYS J 3 107 ? 32.579  7.615   202.791 1.00 26.30  ? 108 LYS B CD    1 
ATOM   3992 C CE    . LYS J 3 107 ? 32.394  6.975   204.179 1.00 41.68  ? 108 LYS B CE    1 
ATOM   3993 N NZ    . LYS J 3 107 ? 32.220  7.908   205.350 1.00 23.05  ? 108 LYS B NZ    1 
ATOM   3994 N N     . GLN J 3 108 ? 32.691  11.011  200.704 1.00 24.83  ? 109 GLN B N     1 
ATOM   3995 C CA    . GLN J 3 108 ? 32.556  12.452  200.720 1.00 22.98  ? 109 GLN B CA    1 
ATOM   3996 C C     . GLN J 3 108 ? 33.394  13.194  201.741 1.00 31.84  ? 109 GLN B C     1 
ATOM   3997 O O     . GLN J 3 108 ? 33.769  14.345  201.517 1.00 37.50  ? 109 GLN B O     1 
ATOM   3998 C CB    . GLN J 3 108 ? 31.085  12.865  200.855 1.00 27.35  ? 109 GLN B CB    1 
ATOM   3999 C CG    . GLN J 3 108 ? 30.750  14.339  200.459 1.00 16.83  ? 109 GLN B CG    1 
ATOM   4000 C CD    . GLN J 3 108 ? 29.268  14.656  200.662 1.00 35.83  ? 109 GLN B CD    1 
ATOM   4001 O OE1   . GLN J 3 108 ? 28.393  14.026  200.061 1.00 33.40  ? 109 GLN B OE1   1 
ATOM   4002 N NE2   . GLN J 3 108 ? 28.985  15.631  201.513 1.00 33.75  ? 109 GLN B NE2   1 
ATOM   4003 N N     . ASN J 3 109 ? 33.729  12.557  202.846 1.00 32.99  ? 110 ASN B N     1 
ATOM   4004 C CA    . ASN J 3 109 ? 34.486  13.271  203.852 1.00 33.27  ? 110 ASN B CA    1 
ATOM   4005 C C     . ASN J 3 109 ? 35.933  12.845  203.994 1.00 40.48  ? 110 ASN B C     1 
ATOM   4006 O O     . ASN J 3 109 ? 36.525  12.959  205.079 1.00 44.08  ? 110 ASN B O     1 
ATOM   4007 C CB    . ASN J 3 109 ? 33.783  13.141  205.194 1.00 36.90  ? 110 ASN B CB    1 
ATOM   4008 C CG    . ASN J 3 109 ? 33.663  11.705  205.634 1.00 46.90  ? 110 ASN B CG    1 
ATOM   4009 O OD1   . ASN J 3 109 ? 33.280  10.837  204.851 1.00 49.53  ? 110 ASN B OD1   1 
ATOM   4010 N ND2   . ASN J 3 109 ? 33.984  11.444  206.890 1.00 45.52  ? 110 ASN B ND2   1 
ATOM   4011 N N     . ASP J 3 110 ? 36.537  12.355  202.923 1.00 36.70  ? 111 ASP B N     1 
ATOM   4012 C CA    . ASP J 3 110 ? 37.931  11.981  203.080 1.00 42.73  ? 111 ASP B CA    1 
ATOM   4013 C C     . ASP J 3 110 ? 38.733  13.214  203.419 1.00 43.47  ? 111 ASP B C     1 
ATOM   4014 O O     . ASP J 3 110 ? 38.630  14.242  202.752 1.00 47.19  ? 111 ASP B O     1 
ATOM   4015 C CB    . ASP J 3 110 ? 38.522  11.352  201.816 1.00 45.05  ? 111 ASP B CB    1 
ATOM   4016 C CG    . ASP J 3 110 ? 38.122  9.900   201.637 1.00 49.98  ? 111 ASP B CG    1 
ATOM   4017 O OD1   . ASP J 3 110 ? 37.901  9.190   202.647 1.00 45.25  ? 111 ASP B OD1   1 
ATOM   4018 O OD2   . ASP J 3 110 ? 38.044  9.475   200.467 1.00 59.19  ? 111 ASP B OD2   1 
ATOM   4019 N N     . THR J 3 111 ? 39.527  13.116  204.471 1.00 44.24  ? 112 THR B N     1 
ATOM   4020 C CA    . THR J 3 111 ? 40.362  14.232  204.846 1.00 35.49  ? 112 THR B CA    1 
ATOM   4021 C C     . THR J 3 111 ? 41.042  14.885  203.641 1.00 35.20  ? 112 THR B C     1 
ATOM   4022 O O     . THR J 3 111 ? 40.937  16.084  203.494 1.00 37.20  ? 112 THR B O     1 
ATOM   4023 C CB    . THR J 3 111 ? 41.420  13.804  205.858 1.00 31.86  ? 112 THR B CB    1 
ATOM   4024 O OG1   . THR J 3 111 ? 40.963  14.114  207.180 1.00 47.59  ? 112 THR B OG1   1 
ATOM   4025 C CG2   . THR J 3 111 ? 42.722  14.518  205.599 1.00 39.63  ? 112 THR B CG2   1 
ATOM   4026 N N     . ALA J 3 112 ? 41.716  14.138  202.762 1.00 31.43  ? 113 ALA B N     1 
ATOM   4027 C CA    . ALA J 3 112 ? 42.375  14.816  201.633 1.00 28.23  ? 113 ALA B CA    1 
ATOM   4028 C C     . ALA J 3 112 ? 41.919  14.583  200.197 1.00 34.57  ? 113 ALA B C     1 
ATOM   4029 O O     . ALA J 3 112 ? 41.275  13.595  199.856 1.00 38.34  ? 113 ALA B O     1 
ATOM   4030 C CB    . ALA J 3 112 ? 43.848  14.589  201.697 1.00 38.23  ? 113 ALA B CB    1 
ATOM   4031 N N     . ASP J 3 113 ? 42.273  15.531  199.349 1.00 38.11  ? 114 ASP B N     1 
ATOM   4032 C CA    . ASP J 3 113 ? 41.925  15.454  197.952 1.00 40.44  ? 114 ASP B CA    1 
ATOM   4033 C C     . ASP J 3 113 ? 43.066  14.733  197.280 1.00 34.61  ? 114 ASP B C     1 
ATOM   4034 O O     . ASP J 3 113 ? 42.850  13.902  196.416 1.00 45.40  ? 114 ASP B O     1 
ATOM   4035 C CB    . ASP J 3 113 ? 41.734  16.859  197.358 1.00 45.90  ? 114 ASP B CB    1 
ATOM   4036 C CG    . ASP J 3 113 ? 40.288  17.368  197.467 1.00 51.19  ? 114 ASP B CG    1 
ATOM   4037 O OD1   . ASP J 3 113 ? 40.040  18.534  197.092 1.00 55.62  ? 114 ASP B OD1   1 
ATOM   4038 O OD2   . ASP J 3 113 ? 39.396  16.618  197.912 1.00 56.35  ? 114 ASP B OD2   1 
ATOM   4039 N N     . ILE J 3 114 ? 44.292  15.039  197.676 1.00 33.82  ? 115 ILE B N     1 
ATOM   4040 C CA    . ILE J 3 114 ? 45.437  14.358  197.080 1.00 31.63  ? 115 ILE B CA    1 
ATOM   4041 C C     . ILE J 3 114 ? 46.484  14.034  198.109 1.00 31.75  ? 115 ILE B C     1 
ATOM   4042 O O     . ILE J 3 114 ? 46.724  14.786  199.045 1.00 31.99  ? 115 ILE B O     1 
ATOM   4043 C CB    . ILE J 3 114 ? 46.120  15.172  195.963 1.00 21.55  ? 115 ILE B CB    1 
ATOM   4044 C CG1   . ILE J 3 114 ? 45.086  15.572  194.914 1.00 32.59  ? 115 ILE B CG1   1 
ATOM   4045 C CG2   . ILE J 3 114 ? 47.191  14.338  195.303 1.00 2.32   ? 115 ILE B CG2   1 
ATOM   4046 C CD1   . ILE J 3 114 ? 45.680  16.090  193.623 1.00 36.44  ? 115 ILE B CD1   1 
ATOM   4047 N N     . LEU J 3 115 ? 47.080  12.871  197.928 1.00 33.29  ? 116 LEU B N     1 
ATOM   4048 C CA    . LEU J 3 115 ? 48.124  12.402  198.792 1.00 39.99  ? 116 LEU B CA    1 
ATOM   4049 C C     . LEU J 3 115 ? 49.327  12.257  197.921 1.00 43.75  ? 116 LEU B C     1 
ATOM   4050 O O     . LEU J 3 115 ? 49.240  11.635  196.868 1.00 44.52  ? 116 LEU B O     1 
ATOM   4051 C CB    . LEU J 3 115 ? 47.794  11.032  199.360 1.00 44.88  ? 116 LEU B CB    1 
ATOM   4052 C CG    . LEU J 3 115 ? 47.295  11.003  200.792 1.00 49.81  ? 116 LEU B CG    1 
ATOM   4053 C CD1   . LEU J 3 115 ? 47.447  9.594   201.368 1.00 33.53  ? 116 LEU B CD1   1 
ATOM   4054 C CD2   . LEU J 3 115 ? 48.110  12.007  201.598 1.00 59.54  ? 116 LEU B CD2   1 
ATOM   4055 N N     . LEU J 3 116 ? 50.443  12.844  198.339 1.00 46.64  ? 117 LEU B N     1 
ATOM   4056 C CA    . LEU J 3 116 ? 51.692  12.718  197.589 1.00 52.15  ? 117 LEU B CA    1 
ATOM   4057 C C     . LEU J 3 116 ? 52.708  12.156  198.559 1.00 53.91  ? 117 LEU B C     1 
ATOM   4058 O O     . LEU J 3 116 ? 53.521  12.892  199.101 1.00 56.55  ? 117 LEU B O     1 
ATOM   4059 C CB    . LEU J 3 116 ? 52.166  14.074  197.075 1.00 47.93  ? 117 LEU B CB    1 
ATOM   4060 C CG    . LEU J 3 116 ? 51.345  14.667  195.941 1.00 38.63  ? 117 LEU B CG    1 
ATOM   4061 C CD1   . LEU J 3 116 ? 51.001  16.090  196.314 1.00 43.58  ? 117 LEU B CD1   1 
ATOM   4062 C CD2   . LEU J 3 116 ? 52.134  14.600  194.642 1.00 26.71  ? 117 LEU B CD2   1 
ATOM   4063 N N     . VAL J 3 117 ? 52.656  10.846  198.774 1.00 50.85  ? 118 VAL B N     1 
ATOM   4064 C CA    . VAL J 3 117 ? 53.557  10.201  199.715 1.00 48.93  ? 118 VAL B CA    1 
ATOM   4065 C C     . VAL J 3 117 ? 54.935  9.942   199.139 1.00 50.29  ? 118 VAL B C     1 
ATOM   4066 O O     . VAL J 3 117 ? 55.094  9.685   197.952 1.00 51.35  ? 118 VAL B O     1 
ATOM   4067 C CB    . VAL J 3 117 ? 52.971  8.868   200.214 1.00 49.71  ? 118 VAL B CB    1 
ATOM   4068 C CG1   . VAL J 3 117 ? 53.432  8.608   201.642 1.00 47.00  ? 118 VAL B CG1   1 
ATOM   4069 C CG2   . VAL J 3 117 ? 51.446  8.897   200.130 1.00 49.98  ? 118 VAL B CG2   1 
ATOM   4070 N N     . LYS J 3 118 ? 55.936  10.010  200.001 1.00 55.37  ? 119 LYS B N     1 
ATOM   4071 C CA    . LYS J 3 118 ? 57.306  9.782   199.582 1.00 63.42  ? 119 LYS B CA    1 
ATOM   4072 C C     . LYS J 3 118 ? 58.196  9.624   200.799 1.00 66.89  ? 119 LYS B C     1 
ATOM   4073 O O     . LYS J 3 118 ? 58.243  10.518  201.640 1.00 69.39  ? 119 LYS B O     1 
ATOM   4074 C CB    . LYS J 3 118 ? 57.793  10.963  198.758 1.00 70.88  ? 119 LYS B CB    1 
ATOM   4075 C CG    . LYS J 3 118 ? 59.306  11.036  198.613 1.00 76.40  ? 119 LYS B CG    1 
ATOM   4076 C CD    . LYS J 3 118 ? 59.847  9.957   197.686 1.00 76.65  ? 119 LYS B CD    1 
ATOM   4077 C CE    . LYS J 3 118 ? 61.338  10.142  197.465 1.00 77.01  ? 119 LYS B CE    1 
ATOM   4078 N NZ    . LYS J 3 118 ? 61.683  11.527  197.007 1.00 67.07  ? 119 LYS B NZ    1 
ATOM   4079 N N     . ASP J 3 119 ? 58.891  8.491   200.891 1.00 71.08  ? 120 ASP B N     1 
ATOM   4080 C CA    . ASP J 3 119 ? 59.785  8.217   202.014 1.00 80.40  ? 120 ASP B CA    1 
ATOM   4081 C C     . ASP J 3 119 ? 59.127  8.353   203.412 1.00 83.33  ? 120 ASP B C     1 
ATOM   4082 O O     . ASP J 3 119 ? 59.609  9.105   204.273 1.00 88.38  ? 120 ASP B O     1 
ATOM   4083 C CB    . ASP J 3 119 ? 61.021  9.138   201.931 1.00 87.98  ? 120 ASP B CB    1 
ATOM   4084 C CG    . ASP J 3 119 ? 62.136  8.565   201.064 1.00 90.13  ? 120 ASP B CG    1 
ATOM   4085 O OD1   . ASP J 3 119 ? 62.693  7.507   201.433 1.00 92.32  ? 120 ASP B OD1   1 
ATOM   4086 O OD2   . ASP J 3 119 ? 62.464  9.173   200.020 1.00 96.95  ? 120 ASP B OD2   1 
ATOM   4087 N N     . GLN J 3 120 ? 58.039  7.626   203.643 1.00 73.92  ? 121 GLN B N     1 
ATOM   4088 C CA    . GLN J 3 120 ? 57.366  7.693   204.924 1.00 70.46  ? 121 GLN B CA    1 
ATOM   4089 C C     . GLN J 3 120 ? 56.798  9.094   205.249 1.00 73.02  ? 121 GLN B C     1 
ATOM   4090 O O     . GLN J 3 120 ? 56.053  9.254   206.218 1.00 76.36  ? 121 GLN B O     1 
ATOM   4091 C CB    . GLN J 3 120 ? 58.317  7.231   206.026 1.00 65.17  ? 121 GLN B CB    1 
ATOM   4092 N N     . PHE J 3 121 ? 57.135  10.108  204.448 1.00 72.91  ? 122 PHE B N     1 
ATOM   4093 C CA    . PHE J 3 121 ? 56.602  11.462  204.669 1.00 67.80  ? 122 PHE B CA    1 
ATOM   4094 C C     . PHE J 3 121 ? 55.353  11.719  203.819 1.00 59.83  ? 122 PHE B C     1 
ATOM   4095 O O     . PHE J 3 121 ? 55.374  11.542  202.594 1.00 43.47  ? 122 PHE B O     1 
ATOM   4096 C CB    . PHE J 3 121 ? 57.651  12.545  204.356 1.00 77.94  ? 122 PHE B CB    1 
ATOM   4097 C CG    . PHE J 3 121 ? 57.154  13.970  204.600 1.00 89.14  ? 122 PHE B CG    1 
ATOM   4098 C CD1   . PHE J 3 121 ? 56.627  14.336  205.843 1.00 83.53  ? 122 PHE B CD1   1 
ATOM   4099 C CD2   . PHE J 3 121 ? 57.195  14.936  203.584 1.00 82.39  ? 122 PHE B CD2   1 
ATOM   4100 C CE1   . PHE J 3 121 ? 56.149  15.625  206.066 1.00 77.38  ? 122 PHE B CE1   1 
ATOM   4101 C CE2   . PHE J 3 121 ? 56.716  16.232  203.806 1.00 72.85  ? 122 PHE B CE2   1 
ATOM   4102 C CZ    . PHE J 3 121 ? 56.194  16.572  205.046 1.00 75.72  ? 122 PHE B CZ    1 
ATOM   4103 N N     . TYR J 3 122 ? 54.280  12.158  204.484 1.00 54.68  ? 123 TYR B N     1 
ATOM   4104 C CA    . TYR J 3 122 ? 52.990  12.450  203.832 1.00 53.82  ? 123 TYR B CA    1 
ATOM   4105 C C     . TYR J 3 122 ? 52.589  13.932  203.770 1.00 53.04  ? 123 TYR B C     1 
ATOM   4106 O O     . TYR J 3 122 ? 52.623  14.632  204.786 1.00 55.15  ? 123 TYR B O     1 
ATOM   4107 C CB    . TYR J 3 122 ? 51.858  11.710  204.554 1.00 35.04  ? 123 TYR B CB    1 
ATOM   4108 C CG    . TYR J 3 122 ? 52.008  10.219  204.554 1.00 46.03  ? 123 TYR B CG    1 
ATOM   4109 C CD1   . TYR J 3 122 ? 53.118  9.610   205.135 1.00 40.54  ? 123 TYR B CD1   1 
ATOM   4110 C CD2   . TYR J 3 122 ? 51.044  9.410   203.953 1.00 48.96  ? 123 TYR B CD2   1 
ATOM   4111 C CE1   . TYR J 3 122 ? 53.263  8.238   205.112 1.00 37.99  ? 123 TYR B CE1   1 
ATOM   4112 C CE2   . TYR J 3 122 ? 51.176  8.033   203.926 1.00 46.48  ? 123 TYR B CE2   1 
ATOM   4113 C CZ    . TYR J 3 122 ? 52.281  7.447   204.507 1.00 48.67  ? 123 TYR B CZ    1 
ATOM   4114 O OH    . TYR J 3 122 ? 52.379  6.068   204.514 1.00 49.98  ? 123 TYR B OH    1 
ATOM   4115 N N     . GLU J 3 123 ? 52.213  14.398  202.578 1.00 40.43  ? 124 GLU B N     1 
ATOM   4116 C CA    . GLU J 3 123 ? 51.718  15.769  202.391 1.00 38.18  ? 124 GLU B CA    1 
ATOM   4117 C C     . GLU J 3 123 ? 50.250  15.709  201.946 1.00 34.28  ? 124 GLU B C     1 
ATOM   4118 O O     . GLU J 3 123 ? 49.978  15.584  200.752 1.00 39.34  ? 124 GLU B O     1 
ATOM   4119 C CB    . GLU J 3 123 ? 52.511  16.531  201.314 1.00 50.77  ? 124 GLU B CB    1 
ATOM   4120 C CG    . GLU J 3 123 ? 52.025  17.995  201.129 1.00 48.78  ? 124 GLU B CG    1 
ATOM   4121 C CD    . GLU J 3 123 ? 52.397  18.650  199.782 1.00 47.89  ? 124 GLU B CD    1 
ATOM   4122 O OE1   . GLU J 3 123 ? 51.953  19.806  199.559 1.00 39.98  ? 124 GLU B OE1   1 
ATOM   4123 O OE2   . GLU J 3 123 ? 53.111  18.029  198.951 1.00 38.53  ? 124 GLU B OE2   1 
ATOM   4124 N N     . LEU J 3 124 ? 49.311  15.776  202.891 1.00 31.47  ? 125 LEU B N     1 
ATOM   4125 C CA    . LEU J 3 124 ? 47.874  15.731  202.560 1.00 32.34  ? 125 LEU B CA    1 
ATOM   4126 C C     . LEU J 3 124 ? 47.461  17.057  201.921 1.00 32.62  ? 125 LEU B C     1 
ATOM   4127 O O     . LEU J 3 124 ? 47.261  18.043  202.612 1.00 36.76  ? 125 LEU B O     1 
ATOM   4128 C CB    . LEU J 3 124 ? 47.014  15.504  203.810 1.00 18.63  ? 125 LEU B CB    1 
ATOM   4129 C CG    . LEU J 3 124 ? 47.110  14.191  204.600 1.00 34.49  ? 125 LEU B CG    1 
ATOM   4130 C CD1   . LEU J 3 124 ? 48.534  13.915  205.034 1.00 30.65  ? 125 LEU B CD1   1 
ATOM   4131 C CD2   . LEU J 3 124 ? 46.203  14.283  205.838 1.00 40.84  ? 125 LEU B CD2   1 
ATOM   4132 N N     . LEU J 3 125 ? 47.332  17.051  200.601 1.00 25.42  ? 126 LEU B N     1 
ATOM   4133 C CA    . LEU J 3 125 ? 46.969  18.216  199.832 1.00 27.23  ? 126 LEU B CA    1 
ATOM   4134 C C     . LEU J 3 125 ? 45.464  18.333  199.647 1.00 28.69  ? 126 LEU B C     1 
ATOM   4135 O O     . LEU J 3 125 ? 44.785  17.345  199.438 1.00 34.66  ? 126 LEU B O     1 
ATOM   4136 C CB    . LEU J 3 125 ? 47.631  18.146  198.456 1.00 27.27  ? 126 LEU B CB    1 
ATOM   4137 C CG    . LEU J 3 125 ? 47.113  19.182  197.456 1.00 32.87  ? 126 LEU B CG    1 
ATOM   4138 C CD1   . LEU J 3 125 ? 47.804  20.522  197.776 1.00 21.21  ? 126 LEU B CD1   1 
ATOM   4139 C CD2   . LEU J 3 125 ? 47.363  18.738  195.993 1.00 25.77  ? 126 LEU B CD2   1 
ATOM   4140 N N     . ASP J 3 126 ? 44.954  19.552  199.696 1.00 38.24  ? 127 ASP B N     1 
ATOM   4141 C CA    . ASP J 3 126 ? 43.529  19.805  199.519 1.00 47.85  ? 127 ASP B CA    1 
ATOM   4142 C C     . ASP J 3 126 ? 43.344  20.889  198.439 1.00 49.45  ? 127 ASP B C     1 
ATOM   4143 O O     . ASP J 3 126 ? 44.058  21.892  198.438 1.00 51.42  ? 127 ASP B O     1 
ATOM   4144 C CB    . ASP J 3 126 ? 42.938  20.285  200.852 1.00 60.63  ? 127 ASP B CB    1 
ATOM   4145 C CG    . ASP J 3 126 ? 41.424  20.414  200.814 1.00 71.71  ? 127 ASP B CG    1 
ATOM   4146 O OD1   . ASP J 3 126 ? 40.841  20.849  201.828 1.00 74.61  ? 127 ASP B OD1   1 
ATOM   4147 O OD2   . ASP J 3 126 ? 40.815  20.076  199.775 1.00 86.47  ? 127 ASP B OD2   1 
ATOM   4148 N N     . VAL J 3 127 ? 42.400  20.687  197.522 1.00 32.75  ? 128 VAL B N     1 
ATOM   4149 C CA    . VAL J 3 127 ? 42.157  21.680  196.494 1.00 31.08  ? 128 VAL B CA    1 
ATOM   4150 C C     . VAL J 3 127 ? 40.908  22.476  196.846 1.00 30.67  ? 128 VAL B C     1 
ATOM   4151 O O     . VAL J 3 127 ? 39.910  21.906  197.276 1.00 22.56  ? 128 VAL B O     1 
ATOM   4152 C CB    . VAL J 3 127 ? 41.997  21.032  195.097 1.00 34.75  ? 128 VAL B CB    1 
ATOM   4153 C CG1   . VAL J 3 127 ? 41.314  22.000  194.125 1.00 32.61  ? 128 VAL B CG1   1 
ATOM   4154 C CG2   . VAL J 3 127 ? 43.372  20.663  194.551 1.00 42.07  ? 128 VAL B CG2   1 
ATOM   4155 N N     . LYS J 3 128 ? 40.995  23.798  196.691 1.00 31.83  ? 129 LYS B N     1 
ATOM   4156 C CA    . LYS J 3 128 ? 39.887  24.716  196.990 1.00 40.98  ? 129 LYS B CA    1 
ATOM   4157 C C     . LYS J 3 128 ? 39.605  25.603  195.780 1.00 39.02  ? 129 LYS B C     1 
ATOM   4158 O O     . LYS J 3 128 ? 40.465  26.379  195.377 1.00 43.51  ? 129 LYS B O     1 
ATOM   4159 C CB    . LYS J 3 128 ? 40.226  25.614  198.209 1.00 38.01  ? 129 LYS B CB    1 
ATOM   4160 C CG    . LYS J 3 128 ? 40.275  24.891  199.570 1.00 33.38  ? 129 LYS B CG    1 
ATOM   4161 C CD    . LYS J 3 128 ? 38.970  24.152  199.872 1.00 32.60  ? 129 LYS B CD    1 
ATOM   4162 C CE    . LYS J 3 128 ? 39.097  23.107  200.984 1.00 34.26  ? 129 LYS B CE    1 
ATOM   4163 N NZ    . LYS J 3 128 ? 39.211  23.632  202.366 1.00 15.54  ? 129 LYS B NZ    1 
ATOM   4164 N N     . THR J 3 129 ? 38.412  25.495  195.199 1.00 37.29  ? 130 THR B N     1 
ATOM   4165 C CA    . THR J 3 129 ? 38.080  26.327  194.037 1.00 42.86  ? 130 THR B CA    1 
ATOM   4166 C C     . THR J 3 129 ? 37.263  27.537  194.460 1.00 42.69  ? 130 THR B C     1 
ATOM   4167 O O     . THR J 3 129 ? 36.456  27.454  195.383 1.00 48.57  ? 130 THR B O     1 
ATOM   4168 C CB    . THR J 3 129 ? 37.254  25.589  192.998 1.00 38.97  ? 130 THR B CB    1 
ATOM   4169 O OG1   . THR J 3 129 ? 35.869  25.754  193.311 1.00 34.71  ? 130 THR B OG1   1 
ATOM   4170 C CG2   . THR J 3 129 ? 37.603  24.129  192.993 1.00 30.48  ? 130 THR B CG2   1 
ATOM   4171 N N     . ARG J 3 130 ? 37.479  28.655  193.770 1.00 45.42  ? 131 ARG B N     1 
ATOM   4172 C CA    . ARG J 3 130 ? 36.785  29.904  194.071 1.00 49.79  ? 131 ARG B CA    1 
ATOM   4173 C C     . ARG J 3 130 ? 36.238  30.572  192.825 1.00 52.13  ? 131 ARG B C     1 
ATOM   4174 O O     . ARG J 3 130 ? 36.919  30.634  191.797 1.00 60.09  ? 131 ARG B O     1 
ATOM   4175 C CB    . ARG J 3 130 ? 37.714  30.925  194.770 1.00 39.39  ? 131 ARG B CB    1 
ATOM   4176 C CG    . ARG J 3 130 ? 36.947  31.931  195.670 1.00 47.30  ? 131 ARG B CG    1 
ATOM   4177 C CD    . ARG J 3 130 ? 37.358  33.430  195.624 1.00 39.76  ? 131 ARG B CD    1 
ATOM   4178 N NE    . ARG J 3 130 ? 38.689  33.720  196.168 1.00 44.73  ? 131 ARG B NE    1 
ATOM   4179 C CZ    . ARG J 3 130 ? 39.003  34.759  196.952 1.00 47.86  ? 131 ARG B CZ    1 
ATOM   4180 N NH1   . ARG J 3 130 ? 38.102  35.658  197.337 1.00 30.07  ? 131 ARG B NH1   1 
ATOM   4181 N NH2   . ARG J 3 130 ? 40.252  34.905  197.357 1.00 54.19  ? 131 ARG B NH2   1 
ATOM   4182 N N     . ASN J 3 131 ? 35.005  31.070  192.927 1.00 52.74  ? 132 ASN B N     1 
ATOM   4183 C CA    . ASN J 3 131 ? 34.362  31.811  191.841 1.00 50.57  ? 132 ASN B CA    1 
ATOM   4184 C C     . ASN J 3 131 ? 34.838  33.244  192.049 1.00 48.77  ? 132 ASN B C     1 
ATOM   4185 O O     . ASN J 3 131 ? 34.231  33.999  192.800 1.00 55.37  ? 132 ASN B O     1 
ATOM   4186 C CB    . ASN J 3 131 ? 32.846  31.743  191.977 1.00 50.67  ? 132 ASN B CB    1 
ATOM   4187 C CG    . ASN J 3 131 ? 32.134  32.652  190.996 1.00 58.33  ? 132 ASN B CG    1 
ATOM   4188 O OD1   . ASN J 3 131 ? 32.523  32.755  189.831 1.00 69.30  ? 132 ASN B OD1   1 
ATOM   4189 N ND2   . ASN J 3 131 ? 31.077  33.300  191.453 1.00 61.17  ? 132 ASN B ND2   1 
ATOM   4190 N N     . ILE J 3 132 ? 35.933  33.596  191.380 1.00 46.37  ? 133 ILE B N     1 
ATOM   4191 C CA    . ILE J 3 132 ? 36.566  34.910  191.487 1.00 44.32  ? 133 ILE B CA    1 
ATOM   4192 C C     . ILE J 3 132 ? 35.670  36.104  191.039 1.00 42.09  ? 133 ILE B C     1 
ATOM   4193 O O     . ILE J 3 132 ? 35.905  37.251  191.408 1.00 41.17  ? 133 ILE B O     1 
ATOM   4194 C CB    . ILE J 3 132 ? 37.926  34.865  190.719 1.00 45.44  ? 133 ILE B CB    1 
ATOM   4195 C CG1   . ILE J 3 132 ? 38.944  35.726  191.445 1.00 53.79  ? 133 ILE B CG1   1 
ATOM   4196 C CG2   . ILE J 3 132 ? 37.739  35.226  189.241 1.00 38.71  ? 133 ILE B CG2   1 
ATOM   4197 C CD1   . ILE J 3 132 ? 39.095  35.335  192.895 1.00 55.94  ? 133 ILE B CD1   1 
ATOM   4198 N N     . SER J 3 133 ? 34.623  35.807  190.280 1.00 36.74  ? 134 SER B N     1 
ATOM   4199 C CA    . SER J 3 133 ? 33.695  36.811  189.827 1.00 34.76  ? 134 SER B CA    1 
ATOM   4200 C C     . SER J 3 133 ? 32.962  37.449  190.986 1.00 39.45  ? 134 SER B C     1 
ATOM   4201 O O     . SER J 3 133 ? 32.141  38.337  190.784 1.00 41.29  ? 134 SER B O     1 
ATOM   4202 C CB    . SER J 3 133 ? 32.676  36.214  188.856 1.00 37.21  ? 134 SER B CB    1 
ATOM   4203 O OG    . SER J 3 133 ? 33.141  36.307  187.519 1.00 47.04  ? 134 SER B OG    1 
ATOM   4204 N N     . LYS J 3 134 ? 33.233  37.005  192.208 1.00 37.11  ? 135 LYS B N     1 
ATOM   4205 C CA    . LYS J 3 134 ? 32.563  37.605  193.361 1.00 40.25  ? 135 LYS B CA    1 
ATOM   4206 C C     . LYS J 3 134 ? 33.391  37.648  194.623 1.00 41.98  ? 135 LYS B C     1 
ATOM   4207 O O     . LYS J 3 134 ? 34.474  37.069  194.693 1.00 39.18  ? 135 LYS B O     1 
ATOM   4208 C CB    . LYS J 3 134 ? 31.235  36.909  193.659 1.00 38.31  ? 135 LYS B CB    1 
ATOM   4209 C CG    . LYS J 3 134 ? 31.277  35.420  193.579 1.00 25.53  ? 135 LYS B CG    1 
ATOM   4210 C CD    . LYS J 3 134 ? 30.015  34.800  194.163 1.00 34.91  ? 135 LYS B CD    1 
ATOM   4211 C CE    . LYS J 3 134 ? 28.859  34.813  193.210 1.00 24.47  ? 135 LYS B CE    1 
ATOM   4212 N NZ    . LYS J 3 134 ? 27.704  34.071  193.784 1.00 29.47  ? 135 LYS B NZ    1 
ATOM   4213 N N     . SER J 3 135 ? 32.885  38.380  195.608 1.00 44.62  ? 136 SER B N     1 
ATOM   4214 C CA    . SER J 3 135 ? 33.576  38.503  196.872 1.00 58.99  ? 136 SER B CA    1 
ATOM   4215 C C     . SER J 3 135 ? 32.821  37.661  197.883 1.00 62.15  ? 136 SER B C     1 
ATOM   4216 O O     . SER J 3 135 ? 32.060  38.177  198.699 1.00 66.63  ? 136 SER B O     1 
ATOM   4217 C CB    . SER J 3 135 ? 33.633  39.959  197.329 1.00 60.45  ? 136 SER B CB    1 
ATOM   4218 O OG    . SER J 3 135 ? 34.254  40.061  198.613 1.00 58.71  ? 136 SER B OG    1 
ATOM   4219 N N     . ALA J 3 136 ? 33.043  36.354  197.801 1.00 59.22  ? 137 ALA B N     1 
ATOM   4220 C CA    . ALA J 3 136 ? 32.406  35.380  198.670 1.00 48.86  ? 137 ALA B CA    1 
ATOM   4221 C C     . ALA J 3 136 ? 33.157  35.300  199.977 1.00 42.70  ? 137 ALA B C     1 
ATOM   4222 O O     . ALA J 3 136 ? 34.242  35.863  200.106 1.00 48.34  ? 137 ALA B O     1 
ATOM   4223 C CB    . ALA J 3 136 ? 32.414  34.030  197.996 1.00 44.02  ? 137 ALA B CB    1 
ATOM   4224 N N     . GLN J 3 137 ? 32.570  34.602  200.942 1.00 32.21  ? 138 GLN B N     1 
ATOM   4225 C CA    . GLN J 3 137 ? 33.190  34.408  202.239 1.00 32.73  ? 138 GLN B CA    1 
ATOM   4226 C C     . GLN J 3 137 ? 34.214  33.276  202.135 1.00 37.43  ? 138 GLN B C     1 
ATOM   4227 O O     . GLN J 3 137 ? 34.177  32.482  201.191 1.00 43.75  ? 138 GLN B O     1 
ATOM   4228 C CB    . GLN J 3 137 ? 32.128  34.043  203.262 1.00 14.16  ? 138 GLN B CB    1 
ATOM   4229 C CG    . GLN J 3 137 ? 32.682  33.567  204.583 1.00 23.60  ? 138 GLN B CG    1 
ATOM   4230 C CD    . GLN J 3 137 ? 31.566  33.231  205.547 1.00 34.65  ? 138 GLN B CD    1 
ATOM   4231 O OE1   . GLN J 3 137 ? 30.400  33.290  205.170 1.00 35.94  ? 138 GLN B OE1   1 
ATOM   4232 N NE2   . GLN J 3 137 ? 31.906  32.882  206.794 1.00 27.15  ? 138 GLN B NE2   1 
ATOM   4233 N N     . ALA J 3 138 ? 35.139  33.207  203.086 1.00 38.59  ? 139 ALA B N     1 
ATOM   4234 C CA    . ALA J 3 138 ? 36.124  32.138  203.059 1.00 38.94  ? 139 ALA B CA    1 
ATOM   4235 C C     . ALA J 3 138 ? 35.434  30.762  203.122 1.00 42.34  ? 139 ALA B C     1 
ATOM   4236 O O     . ALA J 3 138 ? 34.437  30.562  203.836 1.00 35.94  ? 139 ALA B O     1 
ATOM   4237 C CB    . ALA J 3 138 ? 37.077  32.279  204.214 1.00 40.80  ? 139 ALA B CB    1 
ATOM   4238 N N     . PRO J 3 139 ? 35.959  29.793  202.366 1.00 37.38  ? 140 PRO B N     1 
ATOM   4239 C CA    . PRO J 3 139 ? 35.391  28.455  202.342 1.00 28.71  ? 140 PRO B CA    1 
ATOM   4240 C C     . PRO J 3 139 ? 35.900  27.683  203.513 1.00 35.75  ? 140 PRO B C     1 
ATOM   4241 O O     . PRO J 3 139 ? 36.917  28.064  204.110 1.00 26.44  ? 140 PRO B O     1 
ATOM   4242 C CB    . PRO J 3 139 ? 35.943  27.903  201.059 1.00 33.81  ? 140 PRO B CB    1 
ATOM   4243 C CG    . PRO J 3 139 ? 37.326  28.458  201.107 1.00 14.60  ? 140 PRO B CG    1 
ATOM   4244 C CD    . PRO J 3 139 ? 37.058  29.888  201.394 1.00 25.44  ? 140 PRO B CD    1 
ATOM   4245 N N     . ASN J 3 140 ? 35.208  26.580  203.815 1.00 38.60  ? 141 ASN B N     1 
ATOM   4246 C CA    . ASN J 3 140 ? 35.598  25.683  204.912 1.00 40.69  ? 141 ASN B CA    1 
ATOM   4247 C C     . ASN J 3 140 ? 36.920  25.027  204.511 1.00 43.08  ? 141 ASN B C     1 
ATOM   4248 O O     . ASN J 3 140 ? 36.997  24.386  203.454 1.00 43.86  ? 141 ASN B O     1 
ATOM   4249 C CB    . ASN J 3 140 ? 34.575  24.556  205.113 1.00 32.54  ? 141 ASN B CB    1 
ATOM   4250 C CG    . ASN J 3 140 ? 33.170  25.046  205.441 1.00 41.59  ? 141 ASN B CG    1 
ATOM   4251 O OD1   . ASN J 3 140 ? 32.980  26.161  205.920 1.00 36.75  ? 141 ASN B OD1   1 
ATOM   4252 N ND2   . ASN J 3 140 ? 32.166  24.175  205.209 1.00 26.59  ? 141 ASN B ND2   1 
ATOM   4253 N N     . ILE J 3 141 ? 37.951  25.167  205.341 1.00 38.34  ? 142 ILE B N     1 
ATOM   4254 C CA    . ILE J 3 141 ? 39.247  24.548  205.032 1.00 36.37  ? 142 ILE B CA    1 
ATOM   4255 C C     . ILE J 3 141 ? 39.347  23.132  205.637 1.00 31.63  ? 142 ILE B C     1 
ATOM   4256 O O     . ILE J 3 141 ? 39.706  22.193  204.940 1.00 20.97  ? 142 ILE B O     1 
ATOM   4257 C CB    . ILE J 3 141 ? 40.428  25.484  205.484 1.00 32.97  ? 142 ILE B CB    1 
ATOM   4258 C CG1   . ILE J 3 141 ? 41.348  25.760  204.292 1.00 40.63  ? 142 ILE B CG1   1 
ATOM   4259 C CG2   . ILE J 3 141 ? 41.213  24.891  206.620 1.00 36.50  ? 142 ILE B CG2   1 
ATOM   4260 C CD1   . ILE J 3 141 ? 40.755  26.719  203.210 1.00 27.15  ? 142 ILE B CD1   1 
ATOM   4261 N N     . ILE J 3 142 ? 38.999  22.996  206.919 1.00 34.16  ? 143 ILE B N     1 
ATOM   4262 C CA    . ILE J 3 142 ? 39.021  21.720  207.629 1.00 35.78  ? 143 ILE B CA    1 
ATOM   4263 C C     . ILE J 3 142 ? 38.460  21.892  209.023 1.00 40.70  ? 143 ILE B C     1 
ATOM   4264 O O     . ILE J 3 142 ? 38.605  22.947  209.626 1.00 38.87  ? 143 ILE B O     1 
ATOM   4265 C CB    . ILE J 3 142 ? 40.428  21.163  207.799 1.00 34.09  ? 143 ILE B CB    1 
ATOM   4266 C CG1   . ILE J 3 142 ? 40.351  19.752  208.374 1.00 38.35  ? 143 ILE B CG1   1 
ATOM   4267 C CG2   . ILE J 3 142 ? 41.205  22.035  208.754 1.00 38.55  ? 143 ILE B CG2   1 
ATOM   4268 C CD1   . ILE J 3 142 ? 41.678  19.027  208.329 1.00 41.22  ? 143 ILE B CD1   1 
ATOM   4269 N N     . SER J 3 143 ? 37.829  20.842  209.531 1.00 42.41  ? 144 SER B N     1 
ATOM   4270 C CA    . SER J 3 143 ? 37.246  20.884  210.855 1.00 43.78  ? 144 SER B CA    1 
ATOM   4271 C C     . SER J 3 143 ? 38.271  21.316  211.877 1.00 44.02  ? 144 SER B C     1 
ATOM   4272 O O     . SER J 3 143 ? 39.439  20.934  211.810 1.00 44.31  ? 144 SER B O     1 
ATOM   4273 C CB    . SER J 3 143 ? 36.699  19.507  211.233 1.00 55.60  ? 144 SER B CB    1 
ATOM   4274 O OG    . SER J 3 143 ? 36.235  19.478  212.574 1.00 51.85  ? 144 SER B OG    1 
ATOM   4275 N N     . ALA J 3 144 ? 37.816  22.124  212.823 1.00 43.29  ? 145 ALA B N     1 
ATOM   4276 C CA    . ALA J 3 144 ? 38.665  22.610  213.895 1.00 46.22  ? 145 ALA B CA    1 
ATOM   4277 C C     . ALA J 3 144 ? 38.841  21.448  214.864 1.00 46.85  ? 145 ALA B C     1 
ATOM   4278 O O     . ALA J 3 144 ? 39.910  21.267  215.444 1.00 44.85  ? 145 ALA B O     1 
ATOM   4279 C CB    . ALA J 3 144 ? 37.994  23.795  214.597 1.00 33.42  ? 145 ALA B CB    1 
ATOM   4280 N N     . TYR J 3 145 ? 37.776  20.657  215.011 1.00 47.51  ? 146 TYR B N     1 
ATOM   4281 C CA    . TYR J 3 145 ? 37.763  19.500  215.903 1.00 45.27  ? 146 TYR B CA    1 
ATOM   4282 C C     . TYR J 3 145 ? 38.694  18.422  215.395 1.00 41.74  ? 146 TYR B C     1 
ATOM   4283 O O     . TYR J 3 145 ? 39.519  17.894  216.140 1.00 33.73  ? 146 TYR B O     1 
ATOM   4284 C CB    . TYR J 3 145 ? 36.355  18.934  216.024 1.00 48.92  ? 146 TYR B CB    1 
ATOM   4285 C CG    . TYR J 3 145 ? 36.251  17.754  216.957 1.00 54.51  ? 146 TYR B CG    1 
ATOM   4286 C CD1   . TYR J 3 145 ? 36.813  17.801  218.228 1.00 51.13  ? 146 TYR B CD1   1 
ATOM   4287 C CD2   . TYR J 3 145 ? 35.542  16.614  216.594 1.00 48.70  ? 146 TYR B CD2   1 
ATOM   4288 C CE1   . TYR J 3 145 ? 36.675  16.745  219.116 1.00 51.98  ? 146 TYR B CE1   1 
ATOM   4289 C CE2   . TYR J 3 145 ? 35.393  15.555  217.482 1.00 58.08  ? 146 TYR B CE2   1 
ATOM   4290 C CZ    . TYR J 3 145 ? 35.960  15.625  218.746 1.00 54.76  ? 146 TYR B CZ    1 
ATOM   4291 O OH    . TYR J 3 145 ? 35.789  14.591  219.649 1.00 52.76  ? 146 TYR B OH    1 
ATOM   4292 N N     . LYS J 3 146 ? 38.558  18.089  214.121 1.00 32.85  ? 147 LYS B N     1 
ATOM   4293 C CA    . LYS J 3 146 ? 39.426  17.089  213.557 1.00 33.67  ? 147 LYS B CA    1 
ATOM   4294 C C     . LYS J 3 146 ? 40.859  17.545  213.702 1.00 39.15  ? 147 LYS B C     1 
ATOM   4295 O O     . LYS J 3 146 ? 41.732  16.723  213.996 1.00 35.55  ? 147 LYS B O     1 
ATOM   4296 C CB    . LYS J 3 146 ? 39.152  16.864  212.073 1.00 26.41  ? 147 LYS B CB    1 
ATOM   4297 C CG    . LYS J 3 146 ? 40.232  16.005  211.471 1.00 20.42  ? 147 LYS B CG    1 
ATOM   4298 C CD    . LYS J 3 146 ? 40.100  15.781  209.986 1.00 28.22  ? 147 LYS B CD    1 
ATOM   4299 C CE    . LYS J 3 146 ? 38.825  15.038  209.663 1.00 19.04  ? 147 LYS B CE    1 
ATOM   4300 N NZ    . LYS J 3 146 ? 38.778  14.634  208.240 1.00 20.51  ? 147 LYS B NZ    1 
ATOM   4301 N N     . LEU J 3 147 ? 41.100  18.846  213.481 1.00 41.13  ? 148 LEU B N     1 
ATOM   4302 C CA    . LEU J 3 147 ? 42.453  19.416  213.555 1.00 41.59  ? 148 LEU B CA    1 
ATOM   4303 C C     . LEU J 3 147 ? 42.954  19.298  214.971 1.00 37.10  ? 148 LEU B C     1 
ATOM   4304 O O     . LEU J 3 147 ? 44.125  19.013  215.198 1.00 26.69  ? 148 LEU B O     1 
ATOM   4305 C CB    . LEU J 3 147 ? 42.467  20.907  213.162 1.00 50.33  ? 148 LEU B CB    1 
ATOM   4306 C CG    . LEU J 3 147 ? 43.654  21.553  212.378 1.00 42.01  ? 148 LEU B CG    1 
ATOM   4307 C CD1   . LEU J 3 147 ? 43.669  23.052  212.647 1.00 33.75  ? 148 LEU B CD1   1 
ATOM   4308 C CD2   . LEU J 3 147 ? 44.986  20.947  212.761 1.00 27.77  ? 148 LEU B CD2   1 
ATOM   4309 N N     . ALA J 3 148 ? 42.050  19.532  215.915 1.00 30.28  ? 149 ALA B N     1 
ATOM   4310 C CA    . ALA J 3 148 ? 42.383  19.458  217.327 1.00 34.90  ? 149 ALA B CA    1 
ATOM   4311 C C     . ALA J 3 148 ? 42.811  18.029  217.680 1.00 44.04  ? 149 ALA B C     1 
ATOM   4312 O O     . ALA J 3 148 ? 43.897  17.819  218.241 1.00 46.08  ? 149 ALA B O     1 
ATOM   4313 C CB    . ALA J 3 148 ? 41.177  19.888  218.168 1.00 25.74  ? 149 ALA B CB    1 
ATOM   4314 N N     . GLN J 3 149 ? 41.955  17.058  217.341 1.00 41.15  ? 150 GLN B N     1 
ATOM   4315 C CA    . GLN J 3 149 ? 42.222  15.644  217.608 1.00 40.95  ? 150 GLN B CA    1 
ATOM   4316 C C     . GLN J 3 149 ? 43.534  15.210  216.936 1.00 38.45  ? 150 GLN B C     1 
ATOM   4317 O O     . GLN J 3 149 ? 44.223  14.324  217.413 1.00 41.43  ? 150 GLN B O     1 
ATOM   4318 C CB    . GLN J 3 149 ? 41.069  14.751  217.088 1.00 46.55  ? 150 GLN B CB    1 
ATOM   4319 C CG    . GLN J 3 149 ? 39.728  14.716  217.882 1.00 47.98  ? 150 GLN B CG    1 
ATOM   4320 C CD    . GLN J 3 149 ? 38.614  13.977  217.109 1.00 58.63  ? 150 GLN B CD    1 
ATOM   4321 O OE1   . GLN J 3 149 ? 38.023  14.519  216.167 1.00 60.48  ? 150 GLN B OE1   1 
ATOM   4322 N NE2   . GLN J 3 149 ? 38.351  12.731  217.490 1.00 61.40  ? 150 GLN B NE2   1 
ATOM   4323 N N     . THR J 3 150 ? 43.871  15.834  215.821 1.00 33.42  ? 151 THR B N     1 
ATOM   4324 C CA    . THR J 3 150 ? 45.092  15.491  215.116 1.00 36.14  ? 151 THR B CA    1 
ATOM   4325 C C     . THR J 3 150 ? 46.246  16.112  215.916 1.00 44.50  ? 151 THR B C     1 
ATOM   4326 O O     . THR J 3 150 ? 47.293  15.504  216.101 1.00 48.86  ? 151 THR B O     1 
ATOM   4327 C CB    . THR J 3 150 ? 45.049  16.043  213.663 1.00 32.43  ? 151 THR B CB    1 
ATOM   4328 O OG1   . THR J 3 150 ? 43.789  15.714  213.076 1.00 22.42  ? 151 THR B OG1   1 
ATOM   4329 C CG2   . THR J 3 150 ? 46.144  15.450  212.800 1.00 5.48   ? 151 THR B CG2   1 
ATOM   4330 N N     . CYS J 3 151 ? 46.052  17.322  216.414 1.00 50.03  ? 152 CYS B N     1 
ATOM   4331 C CA    . CYS J 3 151 ? 47.100  17.946  217.202 1.00 55.62  ? 152 CYS B CA    1 
ATOM   4332 C C     . CYS J 3 151 ? 47.319  17.167  218.489 1.00 60.93  ? 152 CYS B C     1 
ATOM   4333 O O     . CYS J 3 151 ? 48.435  17.066  218.983 1.00 65.27  ? 152 CYS B O     1 
ATOM   4334 C CB    . CYS J 3 151 ? 46.747  19.387  217.540 1.00 50.30  ? 152 CYS B CB    1 
ATOM   4335 S SG    . CYS J 3 151 ? 47.130  20.514  216.216 1.00 44.61  ? 152 CYS B SG    1 
ATOM   4336 N N     . ALA J 3 152 ? 46.260  16.603  219.042 1.00 57.35  ? 153 ALA B N     1 
ATOM   4337 C CA    . ALA J 3 152 ? 46.453  15.861  220.259 1.00 61.76  ? 153 ALA B CA    1 
ATOM   4338 C C     . ALA J 3 152 ? 47.226  14.578  219.972 1.00 65.27  ? 153 ALA B C     1 
ATOM   4339 O O     . ALA J 3 152 ? 48.056  14.149  220.767 1.00 71.77  ? 153 ALA B O     1 
ATOM   4340 C CB    . ALA J 3 152 ? 45.131  15.544  220.888 1.00 60.69  ? 153 ALA B CB    1 
ATOM   4341 N N     . LYS J 3 153 ? 46.985  13.967  218.825 1.00 59.87  ? 154 LYS B N     1 
ATOM   4342 C CA    . LYS J 3 153 ? 47.671  12.724  218.528 1.00 55.64  ? 154 LYS B CA    1 
ATOM   4343 C C     . LYS J 3 153 ? 49.138  12.926  218.209 1.00 56.02  ? 154 LYS B C     1 
ATOM   4344 O O     . LYS J 3 153 ? 49.976  12.119  218.607 1.00 53.70  ? 154 LYS B O     1 
ATOM   4345 C CB    . LYS J 3 153 ? 46.964  11.991  217.385 1.00 62.87  ? 154 LYS B CB    1 
ATOM   4346 C CG    . LYS J 3 153 ? 45.475  11.751  217.654 1.00 55.92  ? 154 LYS B CG    1 
ATOM   4347 C CD    . LYS J 3 153 ? 44.858  10.852  216.616 1.00 53.80  ? 154 LYS B CD    1 
ATOM   4348 C CE    . LYS J 3 153 ? 43.379  10.704  216.852 1.00 50.95  ? 154 LYS B CE    1 
ATOM   4349 N NZ    . LYS J 3 153 ? 43.117  10.373  218.268 1.00 46.80  ? 154 LYS B NZ    1 
ATOM   4350 N N     . MET J 3 154 ? 49.458  13.997  217.494 1.00 55.45  ? 155 MET B N     1 
ATOM   4351 C CA    . MET J 3 154 ? 50.853  14.267  217.167 1.00 57.79  ? 155 MET B CA    1 
ATOM   4352 C C     . MET J 3 154 ? 51.669  14.291  218.460 1.00 58.81  ? 155 MET B C     1 
ATOM   4353 O O     . MET J 3 154 ? 52.800  13.802  218.512 1.00 55.38  ? 155 MET B O     1 
ATOM   4354 C CB    . MET J 3 154 ? 50.986  15.614  216.464 1.00 53.17  ? 155 MET B CB    1 
ATOM   4355 C CG    . MET J 3 154 ? 50.221  15.728  215.180 1.00 56.33  ? 155 MET B CG    1 
ATOM   4356 S SD    . MET J 3 154 ? 50.722  17.208  214.296 1.00 65.29  ? 155 MET B SD    1 
ATOM   4357 C CE    . MET J 3 154 ? 49.657  18.454  215.092 1.00 64.27  ? 155 MET B CE    1 
ATOM   4358 N N     . ILE J 3 155 ? 51.074  14.867  219.498 1.00 57.33  ? 156 ILE B N     1 
ATOM   4359 C CA    . ILE J 3 155 ? 51.701  14.961  220.805 1.00 64.77  ? 156 ILE B CA    1 
ATOM   4360 C C     . ILE J 3 155 ? 51.903  13.566  221.397 1.00 66.23  ? 156 ILE B C     1 
ATOM   4361 O O     . ILE J 3 155 ? 53.016  13.034  221.428 1.00 64.25  ? 156 ILE B O     1 
ATOM   4362 C CB    . ILE J 3 155 ? 50.811  15.737  221.796 1.00 69.44  ? 156 ILE B CB    1 
ATOM   4363 C CG1   . ILE J 3 155 ? 50.310  17.030  221.164 1.00 71.55  ? 156 ILE B CG1   1 
ATOM   4364 C CG2   . ILE J 3 155 ? 51.593  16.023  223.056 1.00 73.44  ? 156 ILE B CG2   1 
ATOM   4365 C CD1   . ILE J 3 155 ? 51.411  17.950  220.702 1.00 75.04  ? 156 ILE B CD1   1 
ATOM   4366 N N     . ASP J 3 156 ? 50.794  12.998  221.871 1.00 65.01  ? 157 ASP B N     1 
ATOM   4367 C CA    . ASP J 3 156 ? 50.759  11.681  222.490 1.00 57.39  ? 157 ASP B CA    1 
ATOM   4368 C C     . ASP J 3 156 ? 51.702  10.686  221.864 1.00 59.69  ? 157 ASP B C     1 
ATOM   4369 O O     . ASP J 3 156 ? 52.334  9.897   222.568 1.00 65.62  ? 157 ASP B O     1 
ATOM   4370 C CB    . ASP J 3 156 ? 49.345  11.123  222.440 1.00 47.44  ? 157 ASP B CB    1 
ATOM   4371 C CG    . ASP J 3 156 ? 48.405  11.894  223.305 1.00 48.26  ? 157 ASP B CG    1 
ATOM   4372 O OD1   . ASP J 3 156 ? 48.809  12.980  223.756 1.00 55.01  ? 157 ASP B OD1   1 
ATOM   4373 O OD2   . ASP J 3 156 ? 47.268  11.431  223.541 1.00 53.40  ? 157 ASP B OD2   1 
ATOM   4374 N N     . ASN J 3 157 ? 51.804  10.730  220.542 1.00 51.50  ? 158 ASN B N     1 
ATOM   4375 C CA    . ASN J 3 157 ? 52.654  9.802   219.827 1.00 48.51  ? 158 ASN B CA    1 
ATOM   4376 C C     . ASN J 3 157 ? 53.961  10.393  219.323 1.00 45.64  ? 158 ASN B C     1 
ATOM   4377 O O     . ASN J 3 157 ? 54.751  9.688   218.708 1.00 46.33  ? 158 ASN B O     1 
ATOM   4378 C CB    . ASN J 3 157 ? 51.869  9.196   218.664 1.00 54.40  ? 158 ASN B CB    1 
ATOM   4379 C CG    . ASN J 3 157 ? 50.541  8.586   219.109 1.00 62.25  ? 158 ASN B CG    1 
ATOM   4380 O OD1   . ASN J 3 157 ? 50.472  7.426   219.532 1.00 58.30  ? 158 ASN B OD1   1 
ATOM   4381 N ND2   . ASN J 3 157 ? 49.480  9.378   219.029 1.00 64.08  ? 158 ASN B ND2   1 
ATOM   4382 N N     . LYS J 3 158 ? 54.193  11.676  219.582 1.00 45.14  ? 159 LYS B N     1 
ATOM   4383 C CA    . LYS J 3 158 ? 55.423  12.351  219.151 1.00 51.07  ? 159 LYS B CA    1 
ATOM   4384 C C     . LYS J 3 158 ? 55.663  12.397  217.631 1.00 51.93  ? 159 LYS B C     1 
ATOM   4385 O O     . LYS J 3 158 ? 56.817  12.490  217.177 1.00 51.85  ? 159 LYS B O     1 
ATOM   4386 C CB    . LYS J 3 158 ? 56.649  11.728  219.840 1.00 53.96  ? 159 LYS B CB    1 
ATOM   4387 C CG    . LYS J 3 158 ? 56.819  12.072  221.330 1.00 66.09  ? 159 LYS B CG    1 
ATOM   4388 C CD    . LYS J 3 158 ? 57.325  13.498  221.515 1.00 74.21  ? 159 LYS B CD    1 
ATOM   4389 C CE    . LYS J 3 158 ? 57.244  14.009  222.958 1.00 66.64  ? 159 LYS B CE    1 
ATOM   4390 N NZ    . LYS J 3 158 ? 57.741  15.433  223.021 1.00 57.08  ? 159 LYS B NZ    1 
ATOM   4391 N N     . GLU J 3 159 ? 54.583  12.350  216.848 1.00 45.75  ? 160 GLU B N     1 
ATOM   4392 C CA    . GLU J 3 159 ? 54.698  12.411  215.386 1.00 49.69  ? 160 GLU B CA    1 
ATOM   4393 C C     . GLU J 3 159 ? 54.703  13.877  214.919 1.00 54.04  ? 160 GLU B C     1 
ATOM   4394 O O     . GLU J 3 159 ? 53.692  14.413  214.469 1.00 43.81  ? 160 GLU B O     1 
ATOM   4395 C CB    . GLU J 3 159 ? 53.559  11.622  214.736 1.00 37.07  ? 160 GLU B CB    1 
ATOM   4396 C CG    . GLU J 3 159 ? 53.951  10.196  214.413 1.00 51.92  ? 160 GLU B CG    1 
ATOM   4397 C CD    . GLU J 3 159 ? 52.800  9.203   214.535 1.00 60.35  ? 160 GLU B CD    1 
ATOM   4398 O OE1   . GLU J 3 159 ? 53.029  7.988   214.293 1.00 52.06  ? 160 GLU B OE1   1 
ATOM   4399 O OE2   . GLU J 3 159 ? 51.672  9.633   214.873 1.00 67.19  ? 160 GLU B OE2   1 
ATOM   4400 N N     . PHE J 3 160 ? 55.862  14.521  215.039 1.00 58.32  ? 161 PHE B N     1 
ATOM   4401 C CA    . PHE J 3 160 ? 55.984  15.920  214.670 1.00 56.40  ? 161 PHE B CA    1 
ATOM   4402 C C     . PHE J 3 160 ? 56.723  16.120  213.377 1.00 57.56  ? 161 PHE B C     1 
ATOM   4403 O O     . PHE J 3 160 ? 57.322  17.169  213.172 1.00 59.38  ? 161 PHE B O     1 
ATOM   4404 C CB    . PHE J 3 160 ? 56.691  16.701  215.780 1.00 55.99  ? 161 PHE B CB    1 
ATOM   4405 C CG    . PHE J 3 160 ? 55.976  16.661  217.101 1.00 59.15  ? 161 PHE B CG    1 
ATOM   4406 C CD1   . PHE J 3 160 ? 54.696  17.202  217.241 1.00 53.99  ? 161 PHE B CD1   1 
ATOM   4407 C CD2   . PHE J 3 160 ? 56.573  16.064  218.204 1.00 54.30  ? 161 PHE B CD2   1 
ATOM   4408 C CE1   . PHE J 3 160 ? 54.022  17.138  218.457 1.00 47.73  ? 161 PHE B CE1   1 
ATOM   4409 C CE2   . PHE J 3 160 ? 55.900  15.997  219.425 1.00 58.60  ? 161 PHE B CE2   1 
ATOM   4410 C CZ    . PHE J 3 160 ? 54.627  16.534  219.553 1.00 51.45  ? 161 PHE B CZ    1 
ATOM   4411 N N     . ASP J 3 161 ? 56.666  15.125  212.499 1.00 57.96  ? 162 ASP B N     1 
ATOM   4412 C CA    . ASP J 3 161 ? 57.350  15.218  211.214 1.00 66.13  ? 162 ASP B CA    1 
ATOM   4413 C C     . ASP J 3 161 ? 57.041  14.013  210.342 1.00 55.93  ? 162 ASP B C     1 
ATOM   4414 O O     . ASP J 3 161 ? 57.923  13.450  209.703 1.00 56.77  ? 162 ASP B O     1 
ATOM   4415 C CB    . ASP J 3 161 ? 58.859  15.316  211.441 1.00 82.81  ? 162 ASP B CB    1 
ATOM   4416 C CG    . ASP J 3 161 ? 59.631  15.641  210.171 1.00 96.83  ? 162 ASP B CG    1 
ATOM   4417 O OD1   . ASP J 3 161 ? 60.867  15.441  210.180 1.00 105.92 ? 162 ASP B OD1   1 
ATOM   4418 O OD2   . ASP J 3 161 ? 59.012  16.102  209.181 1.00 98.84  ? 162 ASP B OD2   1 
ATOM   4419 N N     . LEU J 3 162 ? 55.774  13.635  210.315 1.00 50.14  ? 163 LEU B N     1 
ATOM   4420 C CA    . LEU J 3 162 ? 55.345  12.490  209.547 1.00 43.38  ? 163 LEU B CA    1 
ATOM   4421 C C     . LEU J 3 162 ? 54.531  12.913  208.329 1.00 46.24  ? 163 LEU B C     1 
ATOM   4422 O O     . LEU J 3 162 ? 54.741  12.404  207.214 1.00 46.31  ? 163 LEU B O     1 
ATOM   4423 C CB    . LEU J 3 162 ? 54.531  11.572  210.445 1.00 40.89  ? 163 LEU B CB    1 
ATOM   4424 C CG    . LEU J 3 162 ? 53.847  10.440  209.712 1.00 44.95  ? 163 LEU B CG    1 
ATOM   4425 C CD1   . LEU J 3 162 ? 54.896  9.541   209.136 1.00 41.76  ? 163 LEU B CD1   1 
ATOM   4426 C CD2   . LEU J 3 162 ? 52.919  9.699   210.641 1.00 32.20  ? 163 LEU B CD2   1 
ATOM   4427 N N     . PHE J 3 163 ? 53.609  13.852  208.542 1.00 43.37  ? 164 PHE B N     1 
ATOM   4428 C CA    . PHE J 3 163 ? 52.753  14.376  207.471 1.00 41.65  ? 164 PHE B CA    1 
ATOM   4429 C C     . PHE J 3 163 ? 52.760  15.885  207.393 1.00 41.86  ? 164 PHE B C     1 
ATOM   4430 O O     . PHE J 3 163 ? 53.361  16.556  208.222 1.00 32.19  ? 164 PHE B O     1 
ATOM   4431 C CB    . PHE J 3 163 ? 51.313  13.990  207.702 1.00 46.75  ? 164 PHE B CB    1 
ATOM   4432 C CG    . PHE J 3 163 ? 50.674  14.707  208.857 1.00 41.70  ? 164 PHE B CG    1 
ATOM   4433 C CD1   . PHE J 3 163 ? 49.500  15.409  208.683 1.00 46.23  ? 164 PHE B CD1   1 
ATOM   4434 C CD2   . PHE J 3 163 ? 51.172  14.565  210.142 1.00 49.03  ? 164 PHE B CD2   1 
ATOM   4435 C CE1   . PHE J 3 163 ? 48.821  15.946  209.788 1.00 57.20  ? 164 PHE B CE1   1 
ATOM   4436 C CE2   . PHE J 3 163 ? 50.498  15.100  211.245 1.00 50.23  ? 164 PHE B CE2   1 
ATOM   4437 C CZ    . PHE J 3 163 ? 49.322  15.783  211.066 1.00 43.43  ? 164 PHE B CZ    1 
ATOM   4438 N N     . ASP J 3 164 ? 52.047  16.407  206.396 1.00 46.58  ? 165 ASP B N     1 
ATOM   4439 C CA    . ASP J 3 164 ? 51.882  17.858  206.189 1.00 47.20  ? 165 ASP B CA    1 
ATOM   4440 C C     . ASP J 3 164 ? 50.460  18.123  205.720 1.00 51.14  ? 165 ASP B C     1 
ATOM   4441 O O     . ASP J 3 164 ? 49.824  17.234  205.155 1.00 61.53  ? 165 ASP B O     1 
ATOM   4442 C CB    . ASP J 3 164 ? 52.857  18.381  205.142 1.00 29.49  ? 165 ASP B CB    1 
ATOM   4443 C CG    . ASP J 3 164 ? 54.003  19.151  205.761 1.00 52.80  ? 165 ASP B CG    1 
ATOM   4444 O OD1   . ASP J 3 164 ? 55.009  19.382  205.069 1.00 49.25  ? 165 ASP B OD1   1 
ATOM   4445 O OD2   . ASP J 3 164 ? 53.902  19.540  206.947 1.00 59.29  ? 165 ASP B OD2   1 
ATOM   4446 N N     . ILE J 3 165 ? 49.942  19.322  205.977 1.00 44.14  ? 166 ILE B N     1 
ATOM   4447 C CA    . ILE J 3 165 ? 48.593  19.663  205.521 1.00 38.98  ? 166 ILE B CA    1 
ATOM   4448 C C     . ILE J 3 165 ? 48.600  20.992  204.742 1.00 37.91  ? 166 ILE B C     1 
ATOM   4449 O O     . ILE J 3 165 ? 48.539  22.084  205.321 1.00 34.44  ? 166 ILE B O     1 
ATOM   4450 C CB    . ILE J 3 165 ? 47.579  19.703  206.707 1.00 45.66  ? 166 ILE B CB    1 
ATOM   4451 C CG1   . ILE J 3 165 ? 47.307  18.277  207.223 1.00 42.60  ? 166 ILE B CG1   1 
ATOM   4452 C CG2   . ILE J 3 165 ? 46.255  20.277  206.248 1.00 42.76  ? 166 ILE B CG2   1 
ATOM   4453 C CD1   . ILE J 3 165 ? 46.444  18.204  208.512 1.00 26.66  ? 166 ILE B CD1   1 
ATOM   4454 N N     . ASN J 3 166 ? 48.686  20.878  203.416 1.00 37.61  ? 167 ASN B N     1 
ATOM   4455 C CA    . ASN J 3 166 ? 48.731  22.042  202.529 1.00 40.04  ? 167 ASN B CA    1 
ATOM   4456 C C     . ASN J 3 166 ? 47.429  22.311  201.790 1.00 40.24  ? 167 ASN B C     1 
ATOM   4457 O O     . ASN J 3 166 ? 46.518  21.489  201.787 1.00 47.57  ? 167 ASN B O     1 
ATOM   4458 C CB    . ASN J 3 166 ? 49.876  21.867  201.549 1.00 42.08  ? 167 ASN B CB    1 
ATOM   4459 C CG    . ASN J 3 166 ? 51.168  21.513  202.259 1.00 51.40  ? 167 ASN B CG    1 
ATOM   4460 O OD1   . ASN J 3 166 ? 51.371  21.910  203.414 1.00 33.90  ? 167 ASN B OD1   1 
ATOM   4461 N ND2   . ASN J 3 166 ? 52.048  20.782  201.588 1.00 47.88  ? 167 ASN B ND2   1 
ATOM   4462 N N     . TYR J 3 167 ? 47.331  23.472  201.163 1.00 36.01  ? 168 TYR B N     1 
ATOM   4463 C CA    . TYR J 3 167 ? 46.107  23.827  200.464 1.00 31.57  ? 168 TYR B CA    1 
ATOM   4464 C C     . TYR J 3 167 ? 46.412  24.482  199.148 1.00 31.28  ? 168 TYR B C     1 
ATOM   4465 O O     . TYR J 3 167 ? 47.337  25.267  199.049 1.00 50.30  ? 168 TYR B O     1 
ATOM   4466 C CB    . TYR J 3 167 ? 45.283  24.757  201.351 1.00 24.99  ? 168 TYR B CB    1 
ATOM   4467 C CG    . TYR J 3 167 ? 44.665  24.023  202.526 1.00 32.13  ? 168 TYR B CG    1 
ATOM   4468 C CD1   . TYR J 3 167 ? 43.535  23.235  202.346 1.00 36.64  ? 168 TYR B CD1   1 
ATOM   4469 C CD2   . TYR J 3 167 ? 45.236  24.064  203.786 1.00 18.13  ? 168 TYR B CD2   1 
ATOM   4470 C CE1   . TYR J 3 167 ? 42.990  22.510  203.373 1.00 44.31  ? 168 TYR B CE1   1 
ATOM   4471 C CE2   . TYR J 3 167 ? 44.697  23.339  204.833 1.00 36.43  ? 168 TYR B CE2   1 
ATOM   4472 C CZ    . TYR J 3 167 ? 43.565  22.560  204.616 1.00 46.38  ? 168 TYR B CZ    1 
ATOM   4473 O OH    . TYR J 3 167 ? 42.982  21.826  205.625 1.00 59.77  ? 168 TYR B OH    1 
ATOM   4474 N N     . LEU J 3 168 ? 45.665  24.129  198.118 1.00 31.76  ? 169 LEU B N     1 
ATOM   4475 C CA    . LEU J 3 168 ? 45.860  24.726  196.802 1.00 24.67  ? 169 LEU B CA    1 
ATOM   4476 C C     . LEU J 3 168 ? 44.557  25.389  196.422 1.00 33.46  ? 169 LEU B C     1 
ATOM   4477 O O     . LEU J 3 168 ? 43.546  24.713  196.240 1.00 34.55  ? 169 LEU B O     1 
ATOM   4478 C CB    . LEU J 3 168 ? 46.188  23.669  195.758 1.00 23.49  ? 169 LEU B CB    1 
ATOM   4479 C CG    . LEU J 3 168 ? 46.265  24.135  194.303 1.00 37.83  ? 169 LEU B CG    1 
ATOM   4480 C CD1   . LEU J 3 168 ? 47.476  25.032  194.074 1.00 32.40  ? 169 LEU B CD1   1 
ATOM   4481 C CD2   . LEU J 3 168 ? 46.339  22.919  193.414 1.00 37.44  ? 169 LEU B CD2   1 
ATOM   4482 N N     . GLU J 3 169 ? 44.566  26.711  196.322 1.00 31.10  ? 170 GLU B N     1 
ATOM   4483 C CA    . GLU J 3 169 ? 43.363  27.432  195.933 1.00 29.31  ? 170 GLU B CA    1 
ATOM   4484 C C     . GLU J 3 169 ? 43.425  27.580  194.418 1.00 29.82  ? 170 GLU B C     1 
ATOM   4485 O O     . GLU J 3 169 ? 44.471  27.917  193.889 1.00 44.55  ? 170 GLU B O     1 
ATOM   4486 C CB    . GLU J 3 169 ? 43.353  28.800  196.592 1.00 28.27  ? 170 GLU B CB    1 
ATOM   4487 C CG    . GLU J 3 169 ? 42.323  29.745  196.028 1.00 34.84  ? 170 GLU B CG    1 
ATOM   4488 C CD    . GLU J 3 169 ? 42.462  31.134  196.612 1.00 50.06  ? 170 GLU B CD    1 
ATOM   4489 O OE1   . GLU J 3 169 ? 41.986  32.105  195.978 1.00 42.20  ? 170 GLU B OE1   1 
ATOM   4490 O OE2   . GLU J 3 169 ? 43.048  31.242  197.713 1.00 55.94  ? 170 GLU B OE2   1 
ATOM   4491 N N     . VAL J 3 170 ? 42.334  27.310  193.714 1.00 13.54  ? 171 VAL B N     1 
ATOM   4492 C CA    . VAL J 3 170 ? 42.346  27.450  192.267 1.00 20.41  ? 171 VAL B CA    1 
ATOM   4493 C C     . VAL J 3 170 ? 41.161  28.360  191.886 1.00 26.38  ? 171 VAL B C     1 
ATOM   4494 O O     . VAL J 3 170 ? 40.021  27.958  191.995 1.00 30.56  ? 171 VAL B O     1 
ATOM   4495 C CB    . VAL J 3 170 ? 42.298  26.042  191.571 1.00 25.66  ? 171 VAL B CB    1 
ATOM   4496 C CG1   . VAL J 3 170 ? 41.526  25.053  192.426 1.00 37.56  ? 171 VAL B CG1   1 
ATOM   4497 C CG2   . VAL J 3 170 ? 41.655  26.135  190.189 1.00 24.53  ? 171 VAL B CG2   1 
ATOM   4498 N N     . ASP J 3 171 ? 41.440  29.598  191.463 1.00 36.70  ? 172 ASP B N     1 
ATOM   4499 C CA    . ASP J 3 171 ? 40.388  30.568  191.121 1.00 34.10  ? 172 ASP B CA    1 
ATOM   4500 C C     . ASP J 3 171 ? 39.915  30.466  189.673 1.00 43.22  ? 172 ASP B C     1 
ATOM   4501 O O     . ASP J 3 171 ? 40.714  30.211  188.765 1.00 47.70  ? 172 ASP B O     1 
ATOM   4502 C CB    . ASP J 3 171 ? 40.869  32.000  191.373 1.00 24.14  ? 172 ASP B CB    1 
ATOM   4503 C CG    . ASP J 3 171 ? 41.692  32.135  192.636 1.00 36.83  ? 172 ASP B CG    1 
ATOM   4504 O OD1   . ASP J 3 171 ? 42.280  33.208  192.861 1.00 48.53  ? 172 ASP B OD1   1 
ATOM   4505 O OD2   . ASP J 3 171 ? 41.764  31.185  193.420 1.00 50.02  ? 172 ASP B OD2   1 
ATOM   4506 N N     . TRP J 3 172 ? 38.618  30.681  189.455 1.00 37.66  ? 173 TRP B N     1 
ATOM   4507 C CA    . TRP J 3 172 ? 38.065  30.617  188.103 1.00 41.44  ? 173 TRP B CA    1 
ATOM   4508 C C     . TRP J 3 172 ? 36.961  31.649  187.862 1.00 48.17  ? 173 TRP B C     1 
ATOM   4509 O O     . TRP J 3 172 ? 36.503  32.332  188.782 1.00 44.28  ? 173 TRP B O     1 
ATOM   4510 C CB    . TRP J 3 172 ? 37.506  29.210  187.799 1.00 41.55  ? 173 TRP B CB    1 
ATOM   4511 C CG    . TRP J 3 172 ? 36.377  28.754  188.706 1.00 41.24  ? 173 TRP B CG    1 
ATOM   4512 C CD1   . TRP J 3 172 ? 36.491  28.100  189.907 1.00 43.67  ? 173 TRP B CD1   1 
ATOM   4513 C CD2   . TRP J 3 172 ? 34.979  29.000  188.530 1.00 31.37  ? 173 TRP B CD2   1 
ATOM   4514 N NE1   . TRP J 3 172 ? 35.254  27.939  190.482 1.00 35.56  ? 173 TRP B NE1   1 
ATOM   4515 C CE2   . TRP J 3 172 ? 34.311  28.479  189.656 1.00 27.29  ? 173 TRP B CE2   1 
ATOM   4516 C CE3   . TRP J 3 172 ? 34.230  29.619  187.534 1.00 35.84  ? 173 TRP B CE3   1 
ATOM   4517 C CZ2   . TRP J 3 172 ? 32.928  28.552  189.808 1.00 32.07  ? 173 TRP B CZ2   1 
ATOM   4518 C CZ3   . TRP J 3 172 ? 32.842  29.702  187.688 1.00 36.78  ? 173 TRP B CZ3   1 
ATOM   4519 C CH2   . TRP J 3 172 ? 32.208  29.172  188.816 1.00 22.72  ? 173 TRP B CH2   1 
ATOM   4520 N N     . GLU J 3 173 ? 36.549  31.759  186.603 1.00 50.41  ? 174 GLU B N     1 
ATOM   4521 C CA    . GLU J 3 173 ? 35.476  32.664  186.210 1.00 50.64  ? 174 GLU B CA    1 
ATOM   4522 C C     . GLU J 3 173 ? 34.745  32.008  185.048 1.00 47.79  ? 174 GLU B C     1 
ATOM   4523 O O     . GLU J 3 173 ? 35.340  31.245  184.283 1.00 34.82  ? 174 GLU B O     1 
ATOM   4524 C CB    . GLU J 3 173 ? 36.020  34.035  185.794 1.00 50.51  ? 174 GLU B CB    1 
ATOM   4525 C CG    . GLU J 3 173 ? 36.655  34.079  184.416 1.00 59.84  ? 174 GLU B CG    1 
ATOM   4526 C CD    . GLU J 3 173 ? 37.298  35.433  184.095 1.00 65.83  ? 174 GLU B CD    1 
ATOM   4527 O OE1   . GLU J 3 173 ? 37.925  35.559  183.014 1.00 61.61  ? 174 GLU B OE1   1 
ATOM   4528 O OE2   . GLU J 3 173 ? 37.184  36.365  184.924 1.00 52.57  ? 174 GLU B OE2   1 
ATOM   4529 N N     . LEU J 3 174 ? 33.446  32.278  184.950 1.00 51.42  ? 175 LEU B N     1 
ATOM   4530 C CA    . LEU J 3 174 ? 32.622  31.714  183.894 1.00 56.39  ? 175 LEU B CA    1 
ATOM   4531 C C     . LEU J 3 174 ? 32.911  32.451  182.600 1.00 60.08  ? 175 LEU B C     1 
ATOM   4532 O O     . LEU J 3 174 ? 32.901  33.675  182.569 1.00 68.00  ? 175 LEU B O     1 
ATOM   4533 C CB    . LEU J 3 174 ? 31.136  31.832  184.252 1.00 53.92  ? 175 LEU B CB    1 
ATOM   4534 C CG    . LEU J 3 174 ? 30.153  31.304  183.193 1.00 61.67  ? 175 LEU B CG    1 
ATOM   4535 C CD1   . LEU J 3 174 ? 30.600  29.933  182.724 1.00 74.02  ? 175 LEU B CD1   1 
ATOM   4536 C CD2   . LEU J 3 174 ? 28.753  31.225  183.761 1.00 52.76  ? 175 LEU B CD2   1 
ATOM   4537 N N     . ASN J 3 175 ? 33.180  31.713  181.534 1.00 62.34  ? 176 ASN B N     1 
ATOM   4538 C CA    . ASN J 3 175 ? 33.480  32.354  180.275 1.00 68.68  ? 176 ASN B CA    1 
ATOM   4539 C C     . ASN J 3 175 ? 32.435  31.992  179.230 1.00 75.41  ? 176 ASN B C     1 
ATOM   4540 O O     . ASN J 3 175 ? 32.766  31.600  178.110 1.00 77.06  ? 176 ASN B O     1 
ATOM   4541 C CB    . ASN J 3 175 ? 34.869  31.938  179.803 1.00 78.24  ? 176 ASN B CB    1 
ATOM   4542 C CG    . ASN J 3 175 ? 35.699  33.113  179.349 1.00 82.99  ? 176 ASN B CG    1 
ATOM   4543 O OD1   . ASN J 3 175 ? 36.040  33.993  180.143 1.00 83.34  ? 176 ASN B OD1   1 
ATOM   4544 N ND2   . ASN J 3 175 ? 36.030  33.138  178.067 1.00 85.50  ? 176 ASN B ND2   1 
ATOM   4545 N N     . GLY J 3 176 ? 31.169  32.132  179.605 1.00 76.14  ? 177 GLY B N     1 
ATOM   4546 C CA    . GLY J 3 176 ? 30.091  31.815  178.695 1.00 76.90  ? 177 GLY B CA    1 
ATOM   4547 C C     . GLY J 3 176 ? 29.482  30.474  179.046 1.00 80.14  ? 177 GLY B C     1 
ATOM   4548 O O     . GLY J 3 176 ? 28.512  30.413  179.804 1.00 81.27  ? 177 GLY B O     1 
ATOM   4549 N N     . GLU J 3 177 ? 30.044  29.401  178.496 1.00 77.69  ? 178 GLU B N     1 
ATOM   4550 C CA    . GLU J 3 177 ? 29.542  28.069  178.780 1.00 73.61  ? 178 GLU B CA    1 
ATOM   4551 C C     . GLU J 3 177 ? 30.408  27.329  179.796 1.00 73.61  ? 178 GLU B C     1 
ATOM   4552 O O     . GLU J 3 177 ? 29.885  26.791  180.773 1.00 79.92  ? 178 GLU B O     1 
ATOM   4553 C CB    . GLU J 3 177 ? 29.430  27.261  177.496 1.00 73.97  ? 178 GLU B CB    1 
ATOM   4554 C CG    . GLU J 3 177 ? 28.003  26.997  177.075 1.00 83.44  ? 178 GLU B CG    1 
ATOM   4555 C CD    . GLU J 3 177 ? 27.172  26.392  178.199 1.00 91.87  ? 178 GLU B CD    1 
ATOM   4556 O OE1   . GLU J 3 177 ? 26.705  27.139  179.084 1.00 93.41  ? 178 GLU B OE1   1 
ATOM   4557 O OE2   . GLU J 3 177 ? 26.992  25.160  178.206 1.00 98.56  ? 178 GLU B OE2   1 
ATOM   4558 N N     . ASP J 3 178 ? 31.724  27.308  179.584 1.00 67.02  ? 179 ASP B N     1 
ATOM   4559 C CA    . ASP J 3 178 ? 32.632  26.622  180.509 1.00 62.90  ? 179 ASP B CA    1 
ATOM   4560 C C     . ASP J 3 178 ? 33.310  27.563  181.517 1.00 56.01  ? 179 ASP B C     1 
ATOM   4561 O O     . ASP J 3 178 ? 33.342  28.780  181.325 1.00 49.46  ? 179 ASP B O     1 
ATOM   4562 C CB    . ASP J 3 178 ? 33.718  25.850  179.739 1.00 73.28  ? 179 ASP B CB    1 
ATOM   4563 C CG    . ASP J 3 178 ? 33.459  25.782  178.236 1.00 85.22  ? 179 ASP B CG    1 
ATOM   4564 O OD1   . ASP J 3 178 ? 33.462  26.861  177.598 1.00 93.57  ? 179 ASP B OD1   1 
ATOM   4565 O OD2   . ASP J 3 178 ? 33.265  24.655  177.694 1.00 79.37  ? 179 ASP B OD2   1 
ATOM   4566 N N     . LEU J 3 179 ? 33.840  26.991  182.597 1.00 45.72  ? 180 LEU B N     1 
ATOM   4567 C CA    . LEU J 3 179 ? 34.528  27.776  183.618 1.00 46.81  ? 180 LEU B CA    1 
ATOM   4568 C C     . LEU J 3 179 ? 35.999  27.863  183.255 1.00 52.07  ? 180 LEU B C     1 
ATOM   4569 O O     . LEU J 3 179 ? 36.567  26.898  182.756 1.00 59.47  ? 180 LEU B O     1 
ATOM   4570 C CB    . LEU J 3 179 ? 34.414  27.108  184.972 1.00 36.41  ? 180 LEU B CB    1 
ATOM   4571 C CG    . LEU J 3 179 ? 33.009  26.675  185.309 1.00 43.79  ? 180 LEU B CG    1 
ATOM   4572 C CD1   . LEU J 3 179 ? 32.978  26.280  186.762 1.00 46.55  ? 180 LEU B CD1   1 
ATOM   4573 C CD2   . LEU J 3 179 ? 32.034  27.817  185.040 1.00 51.34  ? 180 LEU B CD2   1 
ATOM   4574 N N     . VAL J 3 180 ? 36.641  28.992  183.510 1.00 42.75  ? 181 VAL B N     1 
ATOM   4575 C CA    . VAL J 3 180 ? 38.040  29.054  183.141 1.00 45.59  ? 181 VAL B CA    1 
ATOM   4576 C C     . VAL J 3 180 ? 38.976  29.573  184.237 1.00 46.90  ? 181 VAL B C     1 
ATOM   4577 O O     . VAL J 3 180 ? 38.760  30.655  184.787 1.00 44.00  ? 181 VAL B O     1 
ATOM   4578 C CB    . VAL J 3 180 ? 38.194  29.849  181.820 1.00 47.80  ? 181 VAL B CB    1 
ATOM   4579 C CG1   . VAL J 3 180 ? 37.374  31.134  181.879 1.00 48.11  ? 181 VAL B CG1   1 
ATOM   4580 C CG2   . VAL J 3 180 ? 39.646  30.133  181.569 1.00 34.55  ? 181 VAL B CG2   1 
ATOM   4581 N N     . CYS J 3 181 ? 40.015  28.794  184.562 1.00 42.37  ? 182 CYS B N     1 
ATOM   4582 C CA    . CYS J 3 181 ? 40.926  29.212  185.624 1.00 42.05  ? 182 CYS B CA    1 
ATOM   4583 C C     . CYS J 3 181 ? 41.642  30.500  185.316 1.00 42.92  ? 182 CYS B C     1 
ATOM   4584 O O     . CYS J 3 181 ? 42.069  30.749  184.187 1.00 50.05  ? 182 CYS B O     1 
ATOM   4585 C CB    . CYS J 3 181 ? 41.972  28.152  185.950 1.00 38.93  ? 182 CYS B CB    1 
ATOM   4586 S SG    . CYS J 3 181 ? 42.945  28.588  187.444 1.00 55.71  ? 182 CYS B SG    1 
ATOM   4587 N N     . VAL J 3 182 ? 41.802  31.320  186.338 1.00 41.61  ? 183 VAL B N     1 
ATOM   4588 C CA    . VAL J 3 182 ? 42.451  32.587  186.122 1.00 41.23  ? 183 VAL B CA    1 
ATOM   4589 C C     . VAL J 3 182 ? 43.524  32.881  187.153 1.00 47.58  ? 183 VAL B C     1 
ATOM   4590 O O     . VAL J 3 182 ? 44.211  33.893  187.063 1.00 49.99  ? 183 VAL B O     1 
ATOM   4591 C CB    . VAL J 3 182 ? 41.392  33.709  186.078 1.00 36.52  ? 183 VAL B CB    1 
ATOM   4592 C CG1   . VAL J 3 182 ? 40.274  33.314  185.096 1.00 23.47  ? 183 VAL B CG1   1 
ATOM   4593 C CG2   . VAL J 3 182 ? 40.818  33.965  187.457 1.00 36.63  ? 183 VAL B CG2   1 
ATOM   4594 N N     . SER J 3 183 ? 43.682  31.989  188.129 1.00 53.66  ? 184 SER B N     1 
ATOM   4595 C CA    . SER J 3 183 ? 44.716  32.158  189.153 1.00 53.55  ? 184 SER B CA    1 
ATOM   4596 C C     . SER J 3 183 ? 44.887  30.950  190.058 1.00 44.76  ? 184 SER B C     1 
ATOM   4597 O O     . SER J 3 183 ? 44.177  29.959  189.937 1.00 48.39  ? 184 SER B O     1 
ATOM   4598 C CB    . SER J 3 183 ? 44.460  33.414  189.997 1.00 47.01  ? 184 SER B CB    1 
ATOM   4599 O OG    . SER J 3 183 ? 43.107  33.515  190.376 1.00 58.55  ? 184 SER B OG    1 
ATOM   4600 N N     . THR J 3 184 ? 45.835  31.055  190.974 1.00 36.92  ? 185 THR B N     1 
ATOM   4601 C CA    . THR J 3 184 ? 46.122  29.968  191.868 1.00 29.33  ? 185 THR B CA    1 
ATOM   4602 C C     . THR J 3 184 ? 46.970  30.407  193.035 1.00 35.56  ? 185 THR B C     1 
ATOM   4603 O O     . THR J 3 184 ? 47.750  31.351  192.927 1.00 40.42  ? 185 THR B O     1 
ATOM   4604 C CB    . THR J 3 184 ? 46.885  28.893  191.142 1.00 21.03  ? 185 THR B CB    1 
ATOM   4605 O OG1   . THR J 3 184 ? 46.129  28.460  190.012 1.00 32.55  ? 185 THR B OG1   1 
ATOM   4606 C CG2   . THR J 3 184 ? 47.144  27.714  192.052 1.00 30.47  ? 185 THR B CG2   1 
ATOM   4607 N N     . SER J 3 185 ? 46.836  29.693  194.144 1.00 36.58  ? 186 SER B N     1 
ATOM   4608 C CA    . SER J 3 185 ? 47.598  30.010  195.328 1.00 40.06  ? 186 SER B CA    1 
ATOM   4609 C C     . SER J 3 185 ? 47.875  28.753  196.150 1.00 44.72  ? 186 SER B C     1 
ATOM   4610 O O     . SER J 3 185 ? 47.048  27.838  196.217 1.00 42.06  ? 186 SER B O     1 
ATOM   4611 C CB    . SER J 3 185 ? 46.831  31.036  196.131 1.00 46.38  ? 186 SER B CB    1 
ATOM   4612 O OG    . SER J 3 185 ? 46.351  32.028  195.249 1.00 59.75  ? 186 SER B OG    1 
ATOM   4613 N N     . PHE J 3 186 ? 49.050  28.722  196.772 1.00 41.20  ? 187 PHE B N     1 
ATOM   4614 C CA    . PHE J 3 186 ? 49.481  27.587  197.567 1.00 35.74  ? 187 PHE B CA    1 
ATOM   4615 C C     . PHE J 3 186 ? 49.843  28.018  198.973 1.00 36.83  ? 187 PHE B C     1 
ATOM   4616 O O     . PHE J 3 186 ? 50.597  28.963  199.142 1.00 42.41  ? 187 PHE B O     1 
ATOM   4617 C CB    . PHE J 3 186 ? 50.707  26.939  196.922 1.00 37.51  ? 187 PHE B CB    1 
ATOM   4618 C CG    . PHE J 3 186 ? 51.095  25.633  197.558 1.00 40.88  ? 187 PHE B CG    1 
ATOM   4619 C CD1   . PHE J 3 186 ? 50.462  24.456  197.193 1.00 36.46  ? 187 PHE B CD1   1 
ATOM   4620 C CD2   . PHE J 3 186 ? 51.988  25.605  198.614 1.00 32.90  ? 187 PHE B CD2   1 
ATOM   4621 C CE1   . PHE J 3 186 ? 50.707  23.286  197.873 1.00 37.79  ? 187 PHE B CE1   1 
ATOM   4622 C CE2   . PHE J 3 186 ? 52.234  24.443  199.298 1.00 27.58  ? 187 PHE B CE2   1 
ATOM   4623 C CZ    . PHE J 3 186 ? 51.589  23.282  198.930 1.00 36.36  ? 187 PHE B CZ    1 
ATOM   4624 N N     . ALA J 3 187 ? 49.328  27.319  199.980 1.00 35.85  ? 188 ALA B N     1 
ATOM   4625 C CA    . ALA J 3 187 ? 49.635  27.652  201.373 1.00 37.57  ? 188 ALA B CA    1 
ATOM   4626 C C     . ALA J 3 187 ? 49.700  26.414  202.251 1.00 40.89  ? 188 ALA B C     1 
ATOM   4627 O O     . ALA J 3 187 ? 48.930  25.480  202.087 1.00 55.64  ? 188 ALA B O     1 
ATOM   4628 C CB    . ALA J 3 187 ? 48.607  28.602  201.935 1.00 32.10  ? 188 ALA B CB    1 
ATOM   4629 N N     . GLU J 3 188 ? 50.624  26.428  203.193 1.00 30.52  ? 189 GLU B N     1 
ATOM   4630 C CA    . GLU J 3 188 ? 50.806  25.335  204.115 1.00 30.98  ? 189 GLU B CA    1 
ATOM   4631 C C     . GLU J 3 188 ? 50.053  25.658  205.402 1.00 31.43  ? 189 GLU B C     1 
ATOM   4632 O O     . GLU J 3 188 ? 50.091  26.788  205.849 1.00 35.63  ? 189 GLU B O     1 
ATOM   4633 C CB    . GLU J 3 188 ? 52.288  25.180  204.391 1.00 36.36  ? 189 GLU B CB    1 
ATOM   4634 C CG    . GLU J 3 188 ? 53.090  24.854  203.147 1.00 38.79  ? 189 GLU B CG    1 
ATOM   4635 C CD    . GLU J 3 188 ? 54.474  24.363  203.506 1.00 49.02  ? 189 GLU B CD    1 
ATOM   4636 O OE1   . GLU J 3 188 ? 54.609  23.676  204.555 1.00 46.07  ? 189 GLU B OE1   1 
ATOM   4637 O OE2   . GLU J 3 188 ? 55.414  24.644  202.738 1.00 44.14  ? 189 GLU B OE2   1 
ATOM   4638 N N     . LEU J 3 189 ? 49.373  24.696  206.014 1.00 28.45  ? 190 LEU B N     1 
ATOM   4639 C CA    . LEU J 3 189 ? 48.643  25.035  207.220 1.00 25.49  ? 190 LEU B CA    1 
ATOM   4640 C C     . LEU J 3 189 ? 49.549  25.246  208.414 1.00 33.41  ? 190 LEU B C     1 
ATOM   4641 O O     . LEU J 3 189 ? 49.387  26.186  209.183 1.00 26.49  ? 190 LEU B O     1 
ATOM   4642 C CB    . LEU J 3 189 ? 47.614  23.959  207.539 1.00 28.83  ? 190 LEU B CB    1 
ATOM   4643 C CG    . LEU J 3 189 ? 46.935  24.065  208.922 1.00 36.99  ? 190 LEU B CG    1 
ATOM   4644 C CD1   . LEU J 3 189 ? 46.057  25.273  209.008 1.00 40.09  ? 190 LEU B CD1   1 
ATOM   4645 C CD2   . LEU J 3 189 ? 46.085  22.818  209.160 1.00 45.75  ? 190 LEU B CD2   1 
ATOM   4646 N N     . PHE J 3 190 ? 50.512  24.349  208.557 1.00 44.93  ? 191 PHE B N     1 
ATOM   4647 C CA    . PHE J 3 190 ? 51.466  24.364  209.669 1.00 50.10  ? 191 PHE B CA    1 
ATOM   4648 C C     . PHE J 3 190 ? 52.495  25.496  209.621 1.00 56.67  ? 191 PHE B C     1 
ATOM   4649 O O     . PHE J 3 190 ? 53.361  25.602  210.495 1.00 61.38  ? 191 PHE B O     1 
ATOM   4650 C CB    . PHE J 3 190 ? 52.165  23.000  209.715 1.00 25.66  ? 191 PHE B CB    1 
ATOM   4651 C CG    . PHE J 3 190 ? 51.247  21.883  210.108 1.00 44.00  ? 191 PHE B CG    1 
ATOM   4652 C CD1   . PHE J 3 190 ? 51.236  20.675  209.417 1.00 45.11  ? 191 PHE B CD1   1 
ATOM   4653 C CD2   . PHE J 3 190 ? 50.383  22.042  211.187 1.00 47.56  ? 191 PHE B CD2   1 
ATOM   4654 C CE1   . PHE J 3 190 ? 50.380  19.644  209.796 1.00 25.83  ? 191 PHE B CE1   1 
ATOM   4655 C CE2   . PHE J 3 190 ? 49.531  21.018  211.572 1.00 37.38  ? 191 PHE B CE2   1 
ATOM   4656 C CZ    . PHE J 3 190 ? 49.535  19.817  210.870 1.00 36.40  ? 191 PHE B CZ    1 
ATOM   4657 N N     . LYS J 3 191 ? 52.390  26.348  208.608 1.00 58.30  ? 192 LYS B N     1 
ATOM   4658 C CA    . LYS J 3 191 ? 53.329  27.449  208.445 1.00 54.08  ? 192 LYS B CA    1 
ATOM   4659 C C     . LYS J 3 191 ? 52.584  28.736  208.732 1.00 49.74  ? 192 LYS B C     1 
ATOM   4660 O O     . LYS J 3 191 ? 53.126  29.818  208.561 1.00 50.58  ? 192 LYS B O     1 
ATOM   4661 C CB    . LYS J 3 191 ? 53.867  27.474  207.009 1.00 55.83  ? 192 LYS B CB    1 
ATOM   4662 C CG    . LYS J 3 191 ? 55.240  28.103  206.862 1.00 63.19  ? 192 LYS B CG    1 
ATOM   4663 C CD    . LYS J 3 191 ? 55.573  28.495  205.405 1.00 83.65  ? 192 LYS B CD    1 
ATOM   4664 C CE    . LYS J 3 191 ? 55.829  27.312  204.451 1.00 85.69  ? 192 LYS B CE    1 
ATOM   4665 N NZ    . LYS J 3 191 ? 56.147  27.789  203.051 1.00 82.20  ? 192 LYS B NZ    1 
ATOM   4666 N N     . SER J 3 192 ? 51.329  28.610  209.149 1.00 38.37  ? 193 SER B N     1 
ATOM   4667 C CA    . SER J 3 192 ? 50.532  29.779  209.450 1.00 42.28  ? 193 SER B CA    1 
ATOM   4668 C C     . SER J 3 192 ? 50.424  29.925  210.952 1.00 45.83  ? 193 SER B C     1 
ATOM   4669 O O     . SER J 3 192 ? 50.839  29.047  211.706 1.00 48.61  ? 193 SER B O     1 
ATOM   4670 C CB    . SER J 3 192 ? 49.143  29.689  208.803 1.00 50.40  ? 193 SER B CB    1 
ATOM   4671 O OG    . SER J 3 192 ? 48.412  28.546  209.221 1.00 56.86  ? 193 SER B OG    1 
ATOM   4672 N N     . GLU J 3 193 ? 49.877  31.035  211.407 1.00 44.32  ? 194 GLU B N     1 
ATOM   4673 C CA    . GLU J 3 193 ? 49.803  31.216  212.835 1.00 52.64  ? 194 GLU B CA    1 
ATOM   4674 C C     . GLU J 3 193 ? 48.693  30.386  213.434 1.00 50.39  ? 194 GLU B C     1 
ATOM   4675 O O     . GLU J 3 193 ? 47.525  30.718  213.313 1.00 58.98  ? 194 GLU B O     1 
ATOM   4676 C CB    . GLU J 3 193 ? 49.614  32.687  213.163 1.00 60.19  ? 194 GLU B CB    1 
ATOM   4677 C CG    . GLU J 3 193 ? 49.894  32.973  214.607 1.00 63.95  ? 194 GLU B CG    1 
ATOM   4678 C CD    . GLU J 3 193 ? 51.206  32.356  215.052 1.00 70.15  ? 194 GLU B CD    1 
ATOM   4679 O OE1   . GLU J 3 193 ? 52.218  32.477  214.315 1.00 58.26  ? 194 GLU B OE1   1 
ATOM   4680 O OE2   . GLU J 3 193 ? 51.225  31.752  216.146 1.00 81.53  ? 194 GLU B OE2   1 
ATOM   4681 N N     . PRO J 3 194 ? 49.050  29.308  214.131 1.00 54.91  ? 195 PRO B N     1 
ATOM   4682 C CA    . PRO J 3 194 ? 48.038  28.442  214.732 1.00 60.67  ? 195 PRO B CA    1 
ATOM   4683 C C     . PRO J 3 194 ? 46.990  29.158  215.550 1.00 62.55  ? 195 PRO B C     1 
ATOM   4684 O O     . PRO J 3 194 ? 45.941  28.593  215.860 1.00 58.27  ? 195 PRO B O     1 
ATOM   4685 C CB    . PRO J 3 194 ? 48.863  27.489  215.589 1.00 56.58  ? 195 PRO B CB    1 
ATOM   4686 C CG    . PRO J 3 194 ? 49.983  28.356  216.033 1.00 54.27  ? 195 PRO B CG    1 
ATOM   4687 C CD    . PRO J 3 194 ? 50.361  29.052  214.745 1.00 60.12  ? 195 PRO B CD    1 
ATOM   4688 N N     . SER J 3 195 ? 47.241  30.412  215.877 1.00 59.56  ? 196 SER B N     1 
ATOM   4689 C CA    . SER J 3 195 ? 46.289  31.123  216.711 1.00 62.67  ? 196 SER B CA    1 
ATOM   4690 C C     . SER J 3 195 ? 45.383  32.093  215.996 1.00 57.98  ? 196 SER B C     1 
ATOM   4691 O O     . SER J 3 195 ? 44.335  32.465  216.521 1.00 53.18  ? 196 SER B O     1 
ATOM   4692 C CB    . SER J 3 195 ? 47.066  31.838  217.797 1.00 68.09  ? 196 SER B CB    1 
ATOM   4693 O OG    . SER J 3 195 ? 48.333  32.198  217.271 1.00 73.77  ? 196 SER B OG    1 
ATOM   4694 N N     . GLU J 3 196 ? 45.790  32.492  214.799 1.00 55.07  ? 197 GLU B N     1 
ATOM   4695 C CA    . GLU J 3 196 ? 45.024  33.445  214.013 1.00 56.35  ? 197 GLU B CA    1 
ATOM   4696 C C     . GLU J 3 196 ? 43.964  32.797  213.135 1.00 47.48  ? 197 GLU B C     1 
ATOM   4697 O O     . GLU J 3 196 ? 43.142  33.489  212.534 1.00 40.07  ? 197 GLU B O     1 
ATOM   4698 C CB    . GLU J 3 196 ? 45.972  34.282  213.165 1.00 65.61  ? 197 GLU B CB    1 
ATOM   4699 C CG    . GLU J 3 196 ? 46.933  35.118  213.985 1.00 81.25  ? 197 GLU B CG    1 
ATOM   4700 C CD    . GLU J 3 196 ? 47.923  35.878  213.119 1.00 100.97 ? 197 GLU B CD    1 
ATOM   4701 O OE1   . GLU J 3 196 ? 48.804  36.566  213.694 1.00 108.06 ? 197 GLU B OE1   1 
ATOM   4702 O OE2   . GLU J 3 196 ? 47.821  35.790  211.868 1.00 106.37 ? 197 GLU B OE2   1 
ATOM   4703 N N     . LEU J 3 197 ? 43.993  31.472  213.065 1.00 44.37  ? 198 LEU B N     1 
ATOM   4704 C CA    . LEU J 3 197 ? 43.018  30.719  212.287 1.00 41.25  ? 198 LEU B CA    1 
ATOM   4705 C C     . LEU J 3 197 ? 41.624  31.030  212.828 1.00 41.58  ? 198 LEU B C     1 
ATOM   4706 O O     . LEU J 3 197 ? 41.436  31.120  214.043 1.00 44.82  ? 198 LEU B O     1 
ATOM   4707 C CB    . LEU J 3 197 ? 43.308  29.223  212.404 1.00 35.24  ? 198 LEU B CB    1 
ATOM   4708 C CG    . LEU J 3 197 ? 44.310  28.630  211.416 1.00 29.99  ? 198 LEU B CG    1 
ATOM   4709 C CD1   . LEU J 3 197 ? 45.135  29.743  210.842 1.00 32.92  ? 198 LEU B CD1   1 
ATOM   4710 C CD2   . LEU J 3 197 ? 45.165  27.558  212.096 1.00 13.13  ? 198 LEU B CD2   1 
ATOM   4711 N N     . TYR J 3 198 ? 40.656  31.212  211.933 1.00 33.13  ? 199 TYR B N     1 
ATOM   4712 C CA    . TYR J 3 198 ? 39.298  31.524  212.350 1.00 36.96  ? 199 TYR B CA    1 
ATOM   4713 C C     . TYR J 3 198 ? 38.399  30.287  212.344 1.00 39.83  ? 199 TYR B C     1 
ATOM   4714 O O     . TYR J 3 198 ? 38.123  29.721  211.293 1.00 45.78  ? 199 TYR B O     1 
ATOM   4715 C CB    . TYR J 3 198 ? 38.675  32.608  211.442 1.00 32.87  ? 199 TYR B CB    1 
ATOM   4716 C CG    . TYR J 3 198 ? 37.190  32.849  211.720 1.00 38.44  ? 199 TYR B CG    1 
ATOM   4717 C CD1   . TYR J 3 198 ? 36.776  33.448  212.913 1.00 30.61  ? 199 TYR B CD1   1 
ATOM   4718 C CD2   . TYR J 3 198 ? 36.202  32.420  210.823 1.00 46.64  ? 199 TYR B CD2   1 
ATOM   4719 C CE1   . TYR J 3 198 ? 35.432  33.615  213.219 1.00 28.03  ? 199 TYR B CE1   1 
ATOM   4720 C CE2   . TYR J 3 198 ? 34.834  32.587  211.115 1.00 44.61  ? 199 TYR B CE2   1 
ATOM   4721 C CZ    . TYR J 3 198 ? 34.462  33.189  212.326 1.00 43.91  ? 199 TYR B CZ    1 
ATOM   4722 O OH    . TYR J 3 198 ? 33.134  33.399  212.644 1.00 36.56  ? 199 TYR B OH    1 
ATOM   4723 N N     . ILE J 3 199 ? 37.920  29.896  213.519 1.00 37.34  ? 200 ILE B N     1 
ATOM   4724 C CA    . ILE J 3 199 ? 37.047  28.735  213.648 1.00 37.19  ? 200 ILE B CA    1 
ATOM   4725 C C     . ILE J 3 199 ? 35.551  29.051  213.482 1.00 35.55  ? 200 ILE B C     1 
ATOM   4726 O O     . ILE J 3 199 ? 34.937  29.614  214.378 1.00 31.76  ? 200 ILE B O     1 
ATOM   4727 C CB    . ILE J 3 199 ? 37.255  28.069  215.020 1.00 34.99  ? 200 ILE B CB    1 
ATOM   4728 C CG1   . ILE J 3 199 ? 38.692  27.589  215.147 1.00 31.40  ? 200 ILE B CG1   1 
ATOM   4729 C CG2   . ILE J 3 199 ? 36.273  26.933  215.203 1.00 38.36  ? 200 ILE B CG2   1 
ATOM   4730 C CD1   . ILE J 3 199 ? 39.017  26.959  216.476 1.00 42.23  ? 200 ILE B CD1   1 
ATOM   4731 N N     . ASN J 3 200 ? 34.959  28.679  212.349 1.00 35.39  ? 201 ASN B N     1 
ATOM   4732 C CA    . ASN J 3 200 ? 33.534  28.949  212.125 1.00 41.62  ? 201 ASN B CA    1 
ATOM   4733 C C     . ASN J 3 200 ? 32.669  27.855  212.741 1.00 47.49  ? 201 ASN B C     1 
ATOM   4734 O O     . ASN J 3 200 ? 32.285  26.901  212.043 1.00 56.32  ? 201 ASN B O     1 
ATOM   4735 C CB    . ASN J 3 200 ? 33.241  29.037  210.624 1.00 37.32  ? 201 ASN B CB    1 
ATOM   4736 C CG    . ASN J 3 200 ? 31.904  29.691  210.334 1.00 41.08  ? 201 ASN B CG    1 
ATOM   4737 O OD1   . ASN J 3 200 ? 30.967  29.609  211.141 1.00 45.17  ? 201 ASN B OD1   1 
ATOM   4738 N ND2   . ASN J 3 200 ? 31.801  30.340  209.180 1.00 40.14  ? 201 ASN B ND2   1 
ATOM   4739 N N     . TRP J 3 201 ? 32.328  27.987  214.025 1.00 45.76  ? 202 TRP B N     1 
ATOM   4740 C CA    . TRP J 3 201 ? 31.548  26.931  214.712 1.00 41.57  ? 202 TRP B CA    1 
ATOM   4741 C C     . TRP J 3 201 ? 30.266  26.460  214.031 1.00 34.86  ? 202 TRP B C     1 
ATOM   4742 O O     . TRP J 3 201 ? 29.904  25.307  214.118 1.00 46.14  ? 202 TRP B O     1 
ATOM   4743 C CB    . TRP J 3 201 ? 31.259  27.341  216.173 1.00 35.21  ? 202 TRP B CB    1 
ATOM   4744 C CG    . TRP J 3 201 ? 32.515  27.576  216.979 1.00 25.53  ? 202 TRP B CG    1 
ATOM   4745 C CD1   . TRP J 3 201 ? 33.109  28.764  217.218 1.00 31.29  ? 202 TRP B CD1   1 
ATOM   4746 C CD2   . TRP J 3 201 ? 33.379  26.574  217.549 1.00 36.49  ? 202 TRP B CD2   1 
ATOM   4747 N NE1   . TRP J 3 201 ? 34.299  28.582  217.899 1.00 36.45  ? 202 TRP B NE1   1 
ATOM   4748 C CE2   . TRP J 3 201 ? 34.483  27.247  218.118 1.00 27.65  ? 202 TRP B CE2   1 
ATOM   4749 C CE3   . TRP J 3 201 ? 33.322  25.173  217.636 1.00 35.83  ? 202 TRP B CE3   1 
ATOM   4750 C CZ2   . TRP J 3 201 ? 35.522  26.579  218.757 1.00 27.72  ? 202 TRP B CZ2   1 
ATOM   4751 C CZ3   . TRP J 3 201 ? 34.364  24.504  218.278 1.00 31.64  ? 202 TRP B CZ3   1 
ATOM   4752 C CH2   . TRP J 3 201 ? 35.449  25.216  218.834 1.00 36.15  ? 202 TRP B CH2   1 
ATOM   4753 N N     . ALA J 3 202 ? 29.591  27.347  213.332 1.00 39.85  ? 203 ALA B N     1 
ATOM   4754 C CA    . ALA J 3 202 ? 28.371  26.962  212.657 1.00 40.46  ? 203 ALA B CA    1 
ATOM   4755 C C     . ALA J 3 202 ? 28.670  26.087  211.440 1.00 45.16  ? 203 ALA B C     1 
ATOM   4756 O O     . ALA J 3 202 ? 27.968  25.125  211.174 1.00 50.01  ? 203 ALA B O     1 
ATOM   4757 C CB    . ALA J 3 202 ? 27.623  28.209  212.227 1.00 53.49  ? 203 ALA B CB    1 
ATOM   4758 N N     . ALA J 3 203 ? 29.705  26.444  210.693 1.00 46.20  ? 204 ALA B N     1 
ATOM   4759 C CA    . ALA J 3 203 ? 30.083  25.715  209.493 1.00 45.98  ? 204 ALA B CA    1 
ATOM   4760 C C     . ALA J 3 203 ? 30.941  24.513  209.821 1.00 45.14  ? 204 ALA B C     1 
ATOM   4761 O O     . ALA J 3 203 ? 32.163  24.550  209.662 1.00 42.67  ? 204 ALA B O     1 
ATOM   4762 C CB    . ALA J 3 203 ? 30.830  26.627  208.554 1.00 50.46  ? 204 ALA B CB    1 
ATOM   4763 N N     . ALA J 3 204 ? 30.277  23.446  210.261 1.00 39.95  ? 205 ALA B N     1 
ATOM   4764 C CA    . ALA J 3 204 ? 30.916  22.188  210.652 1.00 37.11  ? 205 ALA B CA    1 
ATOM   4765 C C     . ALA J 3 204 ? 32.126  22.426  211.540 1.00 35.26  ? 205 ALA B C     1 
ATOM   4766 O O     . ALA J 3 204 ? 33.021  21.582  211.634 1.00 31.00  ? 205 ALA B O     1 
ATOM   4767 C CB    . ALA J 3 204 ? 31.322  21.365  209.429 1.00 30.15  ? 205 ALA B CB    1 
ATOM   4768 N N     . MET J 3 205 ? 32.156  23.578  212.196 1.00 32.58  ? 206 MET B N     1 
ATOM   4769 C CA    . MET J 3 205 ? 33.255  23.854  213.071 1.00 27.39  ? 206 MET B CA    1 
ATOM   4770 C C     . MET J 3 205 ? 34.516  23.862  212.217 1.00 23.88  ? 206 MET B C     1 
ATOM   4771 O O     . MET J 3 205 ? 35.589  23.479  212.664 1.00 27.72  ? 206 MET B O     1 
ATOM   4772 C CB    . MET J 3 205 ? 33.311  22.756  214.124 1.00 35.89  ? 206 MET B CB    1 
ATOM   4773 C CG    . MET J 3 205 ? 31.947  22.476  214.751 1.00 29.78  ? 206 MET B CG    1 
ATOM   4774 S SD    . MET J 3 205 ? 31.912  20.922  215.701 1.00 52.34  ? 206 MET B SD    1 
ATOM   4775 C CE    . MET J 3 205 ? 32.984  21.371  217.006 1.00 31.36  ? 206 MET B CE    1 
ATOM   4776 N N     . GLN J 3 206 ? 34.375  24.329  210.987 1.00 18.60  ? 207 GLN B N     1 
ATOM   4777 C CA    . GLN J 3 206 ? 35.488  24.392  210.052 1.00 31.55  ? 207 GLN B CA    1 
ATOM   4778 C C     . GLN J 3 206 ? 36.369  25.613  210.231 1.00 35.03  ? 207 GLN B C     1 
ATOM   4779 O O     . GLN J 3 206 ? 35.926  26.646  210.714 1.00 43.03  ? 207 GLN B O     1 
ATOM   4780 C CB    . GLN J 3 206 ? 34.972  24.412  208.614 1.00 31.68  ? 207 GLN B CB    1 
ATOM   4781 C CG    . GLN J 3 206 ? 34.250  23.155  208.195 1.00 29.47  ? 207 GLN B CG    1 
ATOM   4782 C CD    . GLN J 3 206 ? 35.193  22.042  207.813 1.00 31.01  ? 207 GLN B CD    1 
ATOM   4783 O OE1   . GLN J 3 206 ? 35.982  22.187  206.885 1.00 49.26  ? 207 GLN B OE1   1 
ATOM   4784 N NE2   . GLN J 3 206 ? 35.110  20.916  208.511 1.00 35.19  ? 207 GLN B NE2   1 
ATOM   4785 N N     . ILE J 3 207 ? 37.624  25.469  209.828 1.00 31.79  ? 208 ILE B N     1 
ATOM   4786 C CA    . ILE J 3 207 ? 38.584  26.549  209.859 1.00 26.35  ? 208 ILE B CA    1 
ATOM   4787 C C     . ILE J 3 207 ? 38.411  27.172  208.483 1.00 38.40  ? 208 ILE B C     1 
ATOM   4788 O O     . ILE J 3 207 ? 38.559  26.472  207.486 1.00 43.19  ? 208 ILE B O     1 
ATOM   4789 C CB    . ILE J 3 207 ? 39.997  26.035  209.910 1.00 30.77  ? 208 ILE B CB    1 
ATOM   4790 C CG1   . ILE J 3 207 ? 40.283  25.407  211.256 1.00 36.50  ? 208 ILE B CG1   1 
ATOM   4791 C CG2   . ILE J 3 207 ? 40.951  27.165  209.637 1.00 39.99  ? 208 ILE B CG2   1 
ATOM   4792 C CD1   . ILE J 3 207 ? 40.314  26.399  212.346 1.00 54.75  ? 208 ILE B CD1   1 
ATOM   4793 N N     . GLN J 3 208 ? 38.108  28.469  208.409 1.00 37.96  ? 209 GLN B N     1 
ATOM   4794 C CA    . GLN J 3 208 ? 37.920  29.113  207.108 1.00 36.23  ? 209 GLN B CA    1 
ATOM   4795 C C     . GLN J 3 208 ? 38.977  30.178  206.752 1.00 41.78  ? 209 GLN B C     1 
ATOM   4796 O O     . GLN J 3 208 ? 39.492  30.870  207.629 1.00 48.94  ? 209 GLN B O     1 
ATOM   4797 C CB    . GLN J 3 208 ? 36.530  29.747  207.032 1.00 28.17  ? 209 GLN B CB    1 
ATOM   4798 C CG    . GLN J 3 208 ? 35.359  28.815  207.321 1.00 32.06  ? 209 GLN B CG    1 
ATOM   4799 C CD    . GLN J 3 208 ? 34.003  29.515  207.233 1.00 24.82  ? 209 GLN B CD    1 
ATOM   4800 O OE1   . GLN J 3 208 ? 33.923  30.729  207.187 1.00 42.01  ? 209 GLN B OE1   1 
ATOM   4801 N NE2   . GLN J 3 208 ? 32.941  28.743  207.223 1.00 33.04  ? 209 GLN B NE2   1 
ATOM   4802 N N     . PHE J 3 209 ? 39.298  30.289  205.462 1.00 33.13  ? 210 PHE B N     1 
ATOM   4803 C CA    . PHE J 3 209 ? 40.245  31.282  204.960 1.00 28.14  ? 210 PHE B CA    1 
ATOM   4804 C C     . PHE J 3 209 ? 40.541  31.147  203.458 1.00 35.32  ? 210 PHE B C     1 
ATOM   4805 O O     . PHE J 3 209 ? 40.546  30.048  202.895 1.00 40.27  ? 210 PHE B O     1 
ATOM   4806 C CB    . PHE J 3 209 ? 41.562  31.240  205.755 1.00 35.29  ? 210 PHE B CB    1 
ATOM   4807 C CG    . PHE J 3 209 ? 42.371  29.973  205.565 1.00 40.44  ? 210 PHE B CG    1 
ATOM   4808 C CD1   . PHE J 3 209 ? 42.942  29.660  204.325 1.00 35.99  ? 210 PHE B CD1   1 
ATOM   4809 C CD2   . PHE J 3 209 ? 42.600  29.115  206.642 1.00 37.29  ? 210 PHE B CD2   1 
ATOM   4810 C CE1   . PHE J 3 209 ? 43.726  28.520  204.161 1.00 14.97  ? 210 PHE B CE1   1 
ATOM   4811 C CE2   . PHE J 3 209 ? 43.381  27.973  206.500 1.00 19.26  ? 210 PHE B CE2   1 
ATOM   4812 C CZ    . PHE J 3 209 ? 43.944  27.677  205.256 1.00 23.03  ? 210 PHE B CZ    1 
ATOM   4813 N N     . HIS J 3 210 ? 40.762  32.262  202.785 1.00 30.12  ? 211 HIS B N     1 
ATOM   4814 C CA    . HIS J 3 210 ? 41.106  32.142  201.387 1.00 41.53  ? 211 HIS B CA    1 
ATOM   4815 C C     . HIS J 3 210 ? 42.605  31.915  201.332 1.00 45.66  ? 211 HIS B C     1 
ATOM   4816 O O     . HIS J 3 210 ? 43.370  32.746  201.801 1.00 44.78  ? 211 HIS B O     1 
ATOM   4817 C CB    . HIS J 3 210 ? 40.760  33.397  200.625 1.00 37.23  ? 211 HIS B CB    1 
ATOM   4818 C CG    . HIS J 3 210 ? 39.310  33.521  200.315 1.00 47.45  ? 211 HIS B CG    1 
ATOM   4819 N ND1   . HIS J 3 210 ? 38.516  34.507  200.856 1.00 50.27  ? 211 HIS B ND1   1 
ATOM   4820 C CD2   . HIS J 3 210 ? 38.507  32.785  199.514 1.00 48.31  ? 211 HIS B CD2   1 
ATOM   4821 C CE1   . HIS J 3 210 ? 37.285  34.374  200.401 1.00 54.83  ? 211 HIS B CE1   1 
ATOM   4822 N NE2   . HIS J 3 210 ? 37.252  33.337  199.585 1.00 54.70  ? 211 HIS B NE2   1 
ATOM   4823 N N     . VAL J 3 211 ? 43.023  30.789  200.764 1.00 43.74  ? 212 VAL B N     1 
ATOM   4824 C CA    . VAL J 3 211 ? 44.436  30.475  200.689 1.00 35.88  ? 212 VAL B CA    1 
ATOM   4825 C C     . VAL J 3 211 ? 45.348  31.651  200.345 1.00 44.01  ? 212 VAL B C     1 
ATOM   4826 O O     . VAL J 3 211 ? 46.394  31.837  200.982 1.00 48.85  ? 212 VAL B O     1 
ATOM   4827 C CB    . VAL J 3 211 ? 44.680  29.338  199.720 1.00 29.90  ? 212 VAL B CB    1 
ATOM   4828 C CG1   . VAL J 3 211 ? 46.178  29.067  199.591 1.00 34.36  ? 212 VAL B CG1   1 
ATOM   4829 C CG2   . VAL J 3 211 ? 43.984  28.106  200.236 1.00 34.63  ? 212 VAL B CG2   1 
ATOM   4830 N N     . ARG J 3 212 ? 44.968  32.455  199.358 1.00 41.66  ? 213 ARG B N     1 
ATOM   4831 C CA    . ARG J 3 212 ? 45.800  33.595  198.999 1.00 35.50  ? 213 ARG B CA    1 
ATOM   4832 C C     . ARG J 3 212 ? 46.030  34.536  200.191 1.00 31.91  ? 213 ARG B C     1 
ATOM   4833 O O     . ARG J 3 212 ? 47.048  35.208  200.258 1.00 47.75  ? 213 ARG B O     1 
ATOM   4834 C CB    . ARG J 3 212 ? 45.174  34.375  197.843 1.00 31.04  ? 213 ARG B CB    1 
ATOM   4835 C CG    . ARG J 3 212 ? 43.758  34.786  198.137 1.00 49.04  ? 213 ARG B CG    1 
ATOM   4836 C CD    . ARG J 3 212 ? 43.265  35.947  197.294 1.00 46.07  ? 213 ARG B CD    1 
ATOM   4837 N NE    . ARG J 3 212 ? 43.344  35.733  195.851 1.00 47.62  ? 213 ARG B NE    1 
ATOM   4838 C CZ    . ARG J 3 212 ? 42.393  36.122  195.003 1.00 55.17  ? 213 ARG B CZ    1 
ATOM   4839 N NH1   . ARG J 3 212 ? 41.309  36.719  195.470 1.00 69.85  ? 213 ARG B NH1   1 
ATOM   4840 N NH2   . ARG J 3 212 ? 42.527  35.959  193.695 1.00 47.18  ? 213 ARG B NH2   1 
ATOM   4841 N N     . ASP J 3 213 ? 45.105  34.565  201.141 1.00 29.53  ? 214 ASP B N     1 
ATOM   4842 C CA    . ASP J 3 213 ? 45.212  35.453  202.309 1.00 35.20  ? 214 ASP B CA    1 
ATOM   4843 C C     . ASP J 3 213 ? 46.025  34.903  203.497 1.00 33.21  ? 214 ASP B C     1 
ATOM   4844 O O     . ASP J 3 213 ? 46.622  35.657  204.242 1.00 33.03  ? 214 ASP B O     1 
ATOM   4845 C CB    . ASP J 3 213 ? 43.810  35.823  202.831 1.00 30.61  ? 214 ASP B CB    1 
ATOM   4846 C CG    . ASP J 3 213 ? 42.846  36.234  201.731 1.00 39.10  ? 214 ASP B CG    1 
ATOM   4847 O OD1   . ASP J 3 213 ? 43.261  36.372  200.560 1.00 29.28  ? 214 ASP B OD1   1 
ATOM   4848 O OD2   . ASP J 3 213 ? 41.653  36.430  202.051 1.00 40.52  ? 214 ASP B OD2   1 
ATOM   4849 N N     . LEU J 3 214 ? 46.016  33.593  203.679 1.00 33.73  ? 215 LEU B N     1 
ATOM   4850 C CA    . LEU J 3 214 ? 46.719  32.944  204.770 1.00 28.60  ? 215 LEU B CA    1 
ATOM   4851 C C     . LEU J 3 214 ? 48.180  33.327  204.798 1.00 40.63  ? 215 LEU B C     1 
ATOM   4852 O O     . LEU J 3 214 ? 48.820  33.416  203.746 1.00 48.90  ? 215 LEU B O     1 
ATOM   4853 C CB    . LEU J 3 214 ? 46.621  31.436  204.603 1.00 20.34  ? 215 LEU B CB    1 
ATOM   4854 C CG    . LEU J 3 214 ? 47.024  30.652  205.827 1.00 31.12  ? 215 LEU B CG    1 
ATOM   4855 C CD1   . LEU J 3 214 ? 45.979  30.783  206.917 1.00 20.31  ? 215 LEU B CD1   1 
ATOM   4856 C CD2   . LEU J 3 214 ? 47.192  29.213  205.425 1.00 43.93  ? 215 LEU B CD2   1 
ATOM   4857 N N     . ASP J 3 215 ? 48.724  33.534  205.995 1.00 46.39  ? 216 ASP B N     1 
ATOM   4858 C CA    . ASP J 3 215 ? 50.140  33.881  206.116 1.00 49.83  ? 216 ASP B CA    1 
ATOM   4859 C C     . ASP J 3 215 ? 50.996  32.624  206.103 1.00 51.22  ? 216 ASP B C     1 
ATOM   4860 O O     . ASP J 3 215 ? 50.490  31.512  205.925 1.00 58.77  ? 216 ASP B O     1 
ATOM   4861 C CB    . ASP J 3 215 ? 50.388  34.661  207.394 1.00 54.65  ? 216 ASP B CB    1 
ATOM   4862 C CG    . ASP J 3 215 ? 49.783  33.990  208.592 1.00 70.42  ? 216 ASP B CG    1 
ATOM   4863 O OD1   . ASP J 3 215 ? 50.216  32.866  208.928 1.00 69.76  ? 216 ASP B OD1   1 
ATOM   4864 O OD2   . ASP J 3 215 ? 48.864  34.590  209.195 1.00 80.08  ? 216 ASP B OD2   1 
ATOM   4865 N N     . GLN J 3 216 ? 52.292  32.809  206.329 1.00 46.22  ? 217 GLN B N     1 
ATOM   4866 C CA    . GLN J 3 216 ? 53.271  31.718  206.281 1.00 39.57  ? 217 GLN B CA    1 
ATOM   4867 C C     . GLN J 3 216 ? 54.487  32.030  207.132 1.00 31.54  ? 217 GLN B C     1 
ATOM   4868 O O     . GLN J 3 216 ? 55.562  31.514  206.872 1.00 21.17  ? 217 GLN B O     1 
ATOM   4869 C CB    . GLN J 3 216 ? 53.747  31.550  204.827 1.00 41.97  ? 217 GLN B CB    1 
ATOM   4870 C CG    . GLN J 3 216 ? 52.663  31.104  203.838 1.00 38.70  ? 217 GLN B CG    1 
ATOM   4871 C CD    . GLN J 3 216 ? 52.326  29.628  204.008 1.00 39.12  ? 217 GLN B CD    1 
ATOM   4872 O OE1   . GLN J 3 216 ? 52.711  28.793  203.182 1.00 28.91  ? 217 GLN B OE1   1 
ATOM   4873 N NE2   . GLN J 3 216 ? 51.633  29.297  205.101 1.00 20.13  ? 217 GLN B NE2   1 
ATOM   4874 N N     . GLY J 3 217 ? 54.320  32.873  208.142 1.00 41.57  ? 218 GLY B N     1 
ATOM   4875 C CA    . GLY J 3 217 ? 55.462  33.280  208.942 1.00 51.61  ? 218 GLY B CA    1 
ATOM   4876 C C     . GLY J 3 217 ? 55.644  32.667  210.307 1.00 56.42  ? 218 GLY B C     1 
ATOM   4877 O O     . GLY J 3 217 ? 56.032  33.344  211.264 1.00 53.05  ? 218 GLY B O     1 
ATOM   4878 N N     . PHE J 3 218 ? 55.377  31.374  210.386 1.00 61.44  ? 219 PHE B N     1 
ATOM   4879 C CA    . PHE J 3 218 ? 55.522  30.661  211.627 1.00 61.82  ? 219 PHE B CA    1 
ATOM   4880 C C     . PHE J 3 218 ? 56.954  30.169  211.655 1.00 67.60  ? 219 PHE B C     1 
ATOM   4881 O O     . PHE J 3 218 ? 57.396  29.446  210.761 1.00 62.82  ? 219 PHE B O     1 
ATOM   4882 C CB    . PHE J 3 218 ? 54.557  29.500  211.671 1.00 53.49  ? 219 PHE B CB    1 
ATOM   4883 C CG    . PHE J 3 218 ? 54.527  28.807  212.986 1.00 53.21  ? 219 PHE B CG    1 
ATOM   4884 C CD1   . PHE J 3 218 ? 53.853  29.359  214.056 1.00 50.50  ? 219 PHE B CD1   1 
ATOM   4885 C CD2   . PHE J 3 218 ? 55.162  27.578  213.153 1.00 55.18  ? 219 PHE B CD2   1 
ATOM   4886 C CE1   . PHE J 3 218 ? 53.812  28.689  215.282 1.00 53.15  ? 219 PHE B CE1   1 
ATOM   4887 C CE2   . PHE J 3 218 ? 55.127  26.908  214.372 1.00 40.23  ? 219 PHE B CE2   1 
ATOM   4888 C CZ    . PHE J 3 218 ? 54.452  27.458  215.435 1.00 32.62  ? 219 PHE B CZ    1 
ATOM   4889 N N     . ASN J 3 219 ? 57.678  30.588  212.685 1.00 73.91  ? 220 ASN B N     1 
ATOM   4890 C CA    . ASN J 3 219 ? 59.068  30.221  212.842 1.00 73.83  ? 220 ASN B CA    1 
ATOM   4891 C C     . ASN J 3 219 ? 59.231  29.201  213.966 1.00 72.57  ? 220 ASN B C     1 
ATOM   4892 O O     . ASN J 3 219 ? 60.322  28.670  214.146 1.00 81.87  ? 220 ASN B O     1 
ATOM   4893 C CB    . ASN J 3 219 ? 59.889  31.467  213.153 1.00 82.89  ? 220 ASN B CB    1 
ATOM   4894 C CG    . ASN J 3 219 ? 59.658  31.969  214.564 1.00 91.83  ? 220 ASN B CG    1 
ATOM   4895 O OD1   . ASN J 3 219 ? 58.540  32.338  214.933 1.00 94.79  ? 220 ASN B OD1   1 
ATOM   4896 N ND2   . ASN J 3 219 ? 60.720  31.963  215.374 1.00 96.00  ? 220 ASN B ND2   1 
ATOM   4897 N N     . GLY J 3 220 ? 58.165  28.939  214.731 1.00 60.87  ? 221 GLY B N     1 
ATOM   4898 C CA    . GLY J 3 220 ? 58.238  27.954  215.808 1.00 50.25  ? 221 GLY B CA    1 
ATOM   4899 C C     . GLY J 3 220 ? 58.277  26.523  215.279 1.00 46.87  ? 221 GLY B C     1 
ATOM   4900 O O     . GLY J 3 220 ? 58.383  26.311  214.073 1.00 50.09  ? 221 GLY B O     1 
ATOM   4901 N N     . THR J 3 221 ? 58.185  25.528  216.154 1.00 44.52  ? 222 THR B N     1 
ATOM   4902 C CA    . THR J 3 221 ? 58.229  24.127  215.708 1.00 42.77  ? 222 THR B CA    1 
ATOM   4903 C C     . THR J 3 221 ? 56.878  23.414  215.642 1.00 44.06  ? 222 THR B C     1 
ATOM   4904 O O     . THR J 3 221 ? 55.899  23.842  216.265 1.00 39.45  ? 222 THR B O     1 
ATOM   4905 C CB    . THR J 3 221 ? 59.120  23.317  216.614 1.00 38.25  ? 222 THR B CB    1 
ATOM   4906 O OG1   . THR J 3 221 ? 58.647  23.434  217.964 1.00 33.62  ? 222 THR B OG1   1 
ATOM   4907 C CG2   . THR J 3 221 ? 60.545  23.824  216.522 1.00 45.16  ? 222 THR B CG2   1 
ATOM   4908 N N     . ARG J 3 222 ? 56.825  22.303  214.913 1.00 46.60  ? 223 ARG B N     1 
ATOM   4909 C CA    . ARG J 3 222 ? 55.559  21.579  214.789 1.00 48.53  ? 223 ARG B CA    1 
ATOM   4910 C C     . ARG J 3 222 ? 54.935  21.266  216.137 1.00 46.20  ? 223 ARG B C     1 
ATOM   4911 O O     . ARG J 3 222 ? 53.728  21.476  216.326 1.00 40.55  ? 223 ARG B O     1 
ATOM   4912 C CB    . ARG J 3 222 ? 55.721  20.284  213.985 1.00 52.11  ? 223 ARG B CB    1 
ATOM   4913 C CG    . ARG J 3 222 ? 54.388  19.724  213.484 1.00 56.01  ? 223 ARG B CG    1 
ATOM   4914 C CD    . ARG J 3 222 ? 53.620  20.769  212.667 1.00 53.99  ? 223 ARG B CD    1 
ATOM   4915 N NE    . ARG J 3 222 ? 54.474  21.385  211.656 1.00 64.83  ? 223 ARG B NE    1 
ATOM   4916 C CZ    . ARG J 3 222 ? 54.691  20.898  210.436 1.00 67.13  ? 223 ARG B CZ    1 
ATOM   4917 N NH1   . ARG J 3 222 ? 54.109  19.778  210.039 1.00 62.53  ? 223 ARG B NH1   1 
ATOM   4918 N NH2   . ARG J 3 222 ? 55.530  21.520  209.620 1.00 73.16  ? 223 ARG B NH2   1 
ATOM   4919 N N     . GLU J 3 223 ? 55.745  20.762  217.070 1.00 48.18  ? 224 GLU B N     1 
ATOM   4920 C CA    . GLU J 3 223 ? 55.242  20.433  218.408 1.00 50.76  ? 224 GLU B CA    1 
ATOM   4921 C C     . GLU J 3 223 ? 54.647  21.682  219.031 1.00 51.92  ? 224 GLU B C     1 
ATOM   4922 O O     . GLU J 3 223 ? 53.653  21.609  219.750 1.00 51.63  ? 224 GLU B O     1 
ATOM   4923 C CB    . GLU J 3 223 ? 56.365  19.885  219.298 1.00 55.69  ? 224 GLU B CB    1 
ATOM   4924 C CG    . GLU J 3 223 ? 56.072  19.903  220.818 1.00 63.30  ? 224 GLU B CG    1 
ATOM   4925 C CD    . GLU J 3 223 ? 57.068  19.056  221.640 1.00 72.74  ? 224 GLU B CD    1 
ATOM   4926 O OE1   . GLU J 3 223 ? 58.215  18.844  221.176 1.00 74.11  ? 224 GLU B OE1   1 
ATOM   4927 O OE2   . GLU J 3 223 ? 56.707  18.608  222.754 1.00 63.60  ? 224 GLU B OE2   1 
ATOM   4928 N N     . GLU J 3 224 ? 55.241  22.835  218.734 1.00 49.98  ? 225 GLU B N     1 
ATOM   4929 C CA    . GLU J 3 224 ? 54.743  24.082  219.294 1.00 53.96  ? 225 GLU B CA    1 
ATOM   4930 C C     . GLU J 3 224 ? 53.444  24.459  218.621 1.00 53.11  ? 225 GLU B C     1 
ATOM   4931 O O     . GLU J 3 224 ? 52.470  24.837  219.283 1.00 53.50  ? 225 GLU B O     1 
ATOM   4932 C CB    . GLU J 3 224 ? 55.765  25.206  219.124 1.00 56.01  ? 225 GLU B CB    1 
ATOM   4933 C CG    . GLU J 3 224 ? 57.110  24.893  219.746 1.00 65.59  ? 225 GLU B CG    1 
ATOM   4934 C CD    . GLU J 3 224 ? 58.084  26.039  219.633 1.00 61.83  ? 225 GLU B CD    1 
ATOM   4935 O OE1   . GLU J 3 224 ? 58.141  26.659  218.552 1.00 72.60  ? 225 GLU B OE1   1 
ATOM   4936 O OE2   . GLU J 3 224 ? 58.806  26.306  220.616 1.00 56.31  ? 225 GLU B OE2   1 
ATOM   4937 N N     . TRP J 3 225 ? 53.424  24.356  217.299 1.00 43.92  ? 226 TRP B N     1 
ATOM   4938 C CA    . TRP J 3 225 ? 52.218  24.687  216.560 1.00 42.93  ? 226 TRP B CA    1 
ATOM   4939 C C     . TRP J 3 225 ? 51.056  23.958  217.251 1.00 47.28  ? 226 TRP B C     1 
ATOM   4940 O O     . TRP J 3 225 ? 50.101  24.584  217.731 1.00 30.12  ? 226 TRP B O     1 
ATOM   4941 C CB    . TRP J 3 225 ? 52.365  24.208  215.129 1.00 40.34  ? 226 TRP B CB    1 
ATOM   4942 C CG    . TRP J 3 225 ? 51.425  24.817  214.201 1.00 38.43  ? 226 TRP B CG    1 
ATOM   4943 C CD1   . TRP J 3 225 ? 51.709  25.759  213.266 1.00 46.96  ? 226 TRP B CD1   1 
ATOM   4944 C CD2   . TRP J 3 225 ? 50.047  24.492  214.041 1.00 39.54  ? 226 TRP B CD2   1 
ATOM   4945 N NE1   . TRP J 3 225 ? 50.596  26.037  212.518 1.00 45.88  ? 226 TRP B NE1   1 
ATOM   4946 C CE2   . TRP J 3 225 ? 49.559  25.270  212.972 1.00 48.54  ? 226 TRP B CE2   1 
ATOM   4947 C CE3   . TRP J 3 225 ? 49.176  23.614  214.692 1.00 46.94  ? 226 TRP B CE3   1 
ATOM   4948 C CZ2   . TRP J 3 225 ? 48.236  25.198  212.536 1.00 53.52  ? 226 TRP B CZ2   1 
ATOM   4949 C CZ3   . TRP J 3 225 ? 47.859  23.541  214.264 1.00 48.73  ? 226 TRP B CZ3   1 
ATOM   4950 C CH2   . TRP J 3 225 ? 47.401  24.328  213.192 1.00 58.92  ? 226 TRP B CH2   1 
ATOM   4951 N N     . ALA J 3 226 ? 51.177  22.630  217.316 1.00 52.68  ? 227 ALA B N     1 
ATOM   4952 C CA    . ALA J 3 226 ? 50.183  21.755  217.935 1.00 48.05  ? 227 ALA B CA    1 
ATOM   4953 C C     . ALA J 3 226 ? 49.743  22.237  219.298 1.00 44.23  ? 227 ALA B C     1 
ATOM   4954 O O     . ALA J 3 226 ? 48.552  22.425  219.533 1.00 45.15  ? 227 ALA B O     1 
ATOM   4955 C CB    . ALA J 3 226 ? 50.738  20.355  218.049 1.00 52.67  ? 227 ALA B CB    1 
ATOM   4956 N N     . LYS J 3 227 ? 50.706  22.437  220.198 1.00 46.95  ? 228 LYS B N     1 
ATOM   4957 C CA    . LYS J 3 227 ? 50.396  22.898  221.557 1.00 50.50  ? 228 LYS B CA    1 
ATOM   4958 C C     . LYS J 3 227 ? 49.663  24.245  221.518 1.00 48.21  ? 228 LYS B C     1 
ATOM   4959 O O     . LYS J 3 227 ? 48.738  24.491  222.296 1.00 42.85  ? 228 LYS B O     1 
ATOM   4960 C CB    . LYS J 3 227 ? 51.684  23.014  222.405 1.00 54.73  ? 228 LYS B CB    1 
ATOM   4961 C CG    . LYS J 3 227 ? 52.534  21.716  222.492 1.00 68.60  ? 228 LYS B CG    1 
ATOM   4962 C CD    . LYS J 3 227 ? 53.517  21.658  223.702 1.00 63.89  ? 228 LYS B CD    1 
ATOM   4963 C CE    . LYS J 3 227 ? 52.763  21.616  225.055 1.00 76.47  ? 228 LYS B CE    1 
ATOM   4964 N NZ    . LYS J 3 227 ? 53.600  21.350  226.279 1.00 66.18  ? 228 LYS B NZ    1 
ATOM   4965 N N     . SER J 3 228 ? 50.062  25.104  220.587 1.00 47.27  ? 229 SER B N     1 
ATOM   4966 C CA    . SER J 3 228 ? 49.437  26.411  220.462 1.00 47.40  ? 229 SER B CA    1 
ATOM   4967 C C     . SER J 3 228 ? 48.010  26.353  219.866 1.00 47.88  ? 229 SER B C     1 
ATOM   4968 O O     . SER J 3 228 ? 47.108  27.088  220.307 1.00 38.95  ? 229 SER B O     1 
ATOM   4969 C CB    . SER J 3 228 ? 50.330  27.317  219.620 1.00 37.23  ? 229 SER B CB    1 
ATOM   4970 O OG    . SER J 3 228 ? 49.889  28.664  219.731 1.00 56.41  ? 229 SER B OG    1 
ATOM   4971 N N     . TYR J 3 229 ? 47.812  25.481  218.869 1.00 43.54  ? 230 TYR B N     1 
ATOM   4972 C CA    . TYR J 3 229 ? 46.510  25.341  218.232 1.00 38.01  ? 230 TYR B CA    1 
ATOM   4973 C C     . TYR J 3 229 ? 45.498  24.890  219.270 1.00 41.19  ? 230 TYR B C     1 
ATOM   4974 O O     . TYR J 3 229 ? 44.426  25.471  219.401 1.00 39.17  ? 230 TYR B O     1 
ATOM   4975 C CB    . TYR J 3 229 ? 46.551  24.342  217.056 1.00 28.64  ? 230 TYR B CB    1 
ATOM   4976 C CG    . TYR J 3 229 ? 45.172  24.113  216.468 1.00 34.03  ? 230 TYR B CG    1 
ATOM   4977 C CD1   . TYR J 3 229 ? 44.410  25.176  216.042 1.00 26.70  ? 230 TYR B CD1   1 
ATOM   4978 C CD2   . TYR J 3 229 ? 44.563  22.861  216.504 1.00 45.32  ? 230 TYR B CD2   1 
ATOM   4979 C CE1   . TYR J 3 229 ? 43.072  25.017  215.689 1.00 40.85  ? 230 TYR B CE1   1 
ATOM   4980 C CE2   . TYR J 3 229 ? 43.212  22.689  216.148 1.00 34.73  ? 230 TYR B CE2   1 
ATOM   4981 C CZ    . TYR J 3 229 ? 42.468  23.773  215.747 1.00 36.20  ? 230 TYR B CZ    1 
ATOM   4982 O OH    . TYR J 3 229 ? 41.118  23.639  215.434 1.00 18.73  ? 230 TYR B OH    1 
ATOM   4983 N N     . LEU J 3 230 ? 45.846  23.841  220.006 1.00 43.54  ? 231 LEU B N     1 
ATOM   4984 C CA    . LEU J 3 230 ? 44.980  23.322  221.057 1.00 41.37  ? 231 LEU B CA    1 
ATOM   4985 C C     . LEU J 3 230 ? 44.546  24.422  222.022 1.00 47.44  ? 231 LEU B C     1 
ATOM   4986 O O     . LEU J 3 230 ? 43.372  24.499  222.425 1.00 38.86  ? 231 LEU B O     1 
ATOM   4987 C CB    . LEU J 3 230 ? 45.700  22.250  221.867 1.00 33.97  ? 231 LEU B CB    1 
ATOM   4988 C CG    . LEU J 3 230 ? 45.495  20.828  221.426 1.00 30.89  ? 231 LEU B CG    1 
ATOM   4989 C CD1   . LEU J 3 230 ? 44.096  20.704  220.810 1.00 25.35  ? 231 LEU B CD1   1 
ATOM   4990 C CD2   . LEU J 3 230 ? 46.566  20.444  220.463 1.00 29.99  ? 231 LEU B CD2   1 
ATOM   4991 N N     . LYS J 3 231 ? 45.513  25.247  222.414 1.00 48.51  ? 232 LYS B N     1 
ATOM   4992 C CA    . LYS J 3 231 ? 45.252  26.334  223.340 1.00 59.56  ? 232 LYS B CA    1 
ATOM   4993 C C     . LYS J 3 231 ? 44.231  27.238  222.686 1.00 59.25  ? 232 LYS B C     1 
ATOM   4994 O O     . LYS J 3 231 ? 43.212  27.590  223.281 1.00 59.46  ? 232 LYS B O     1 
ATOM   4995 C CB    . LYS J 3 231 ? 46.551  27.106  223.645 1.00 69.31  ? 232 LYS B CB    1 
ATOM   4996 C CG    . LYS J 3 231 ? 46.418  28.241  224.678 1.00 67.68  ? 232 LYS B CG    1 
ATOM   4997 C CD    . LYS J 3 231 ? 47.780  28.869  225.002 1.00 74.10  ? 232 LYS B CD    1 
ATOM   4998 C CE    . LYS J 3 231 ? 47.656  30.190  225.779 1.00 83.91  ? 232 LYS B CE    1 
ATOM   4999 N NZ    . LYS J 3 231 ? 46.887  30.096  227.060 1.00 85.71  ? 232 LYS B NZ    1 
ATOM   5000 N N     . HIS J 3 232 ? 44.501  27.594  221.440 1.00 55.10  ? 233 HIS B N     1 
ATOM   5001 C CA    . HIS J 3 232 ? 43.606  28.462  220.699 1.00 51.01  ? 233 HIS B CA    1 
ATOM   5002 C C     . HIS J 3 232 ? 42.203  27.859  220.584 1.00 51.60  ? 233 HIS B C     1 
ATOM   5003 O O     . HIS J 3 232 ? 41.207  28.550  220.780 1.00 53.17  ? 233 HIS B O     1 
ATOM   5004 C CB    . HIS J 3 232 ? 44.204  28.709  219.321 1.00 51.23  ? 233 HIS B CB    1 
ATOM   5005 C CG    . HIS J 3 232 ? 43.272  29.377  218.369 1.00 46.56  ? 233 HIS B CG    1 
ATOM   5006 N ND1   . HIS J 3 232 ? 42.598  30.532  218.685 1.00 50.02  ? 233 HIS B ND1   1 
ATOM   5007 C CD2   . HIS J 3 232 ? 42.946  29.085  217.089 1.00 53.10  ? 233 HIS B CD2   1 
ATOM   5008 C CE1   . HIS J 3 232 ? 41.899  30.929  217.636 1.00 64.56  ? 233 HIS B CE1   1 
ATOM   5009 N NE2   . HIS J 3 232 ? 42.094  30.068  216.654 1.00 57.29  ? 233 HIS B NE2   1 
ATOM   5010 N N     . PHE J 3 233 ? 42.145  26.563  220.284 1.00 48.31  ? 234 PHE B N     1 
ATOM   5011 C CA    . PHE J 3 233 ? 40.894  25.839  220.123 1.00 40.97  ? 234 PHE B CA    1 
ATOM   5012 C C     . PHE J 3 233 ? 40.077  25.815  221.405 1.00 48.01  ? 234 PHE B C     1 
ATOM   5013 O O     . PHE J 3 233 ? 38.913  26.243  221.432 1.00 36.21  ? 234 PHE B O     1 
ATOM   5014 C CB    . PHE J 3 233 ? 41.196  24.408  219.664 1.00 31.88  ? 234 PHE B CB    1 
ATOM   5015 C CG    . PHE J 3 233 ? 39.969  23.550  219.474 1.00 32.31  ? 234 PHE B CG    1 
ATOM   5016 C CD1   . PHE J 3 233 ? 39.471  22.769  220.522 1.00 36.39  ? 234 PHE B CD1   1 
ATOM   5017 C CD2   . PHE J 3 233 ? 39.279  23.565  218.265 1.00 38.38  ? 234 PHE B CD2   1 
ATOM   5018 C CE1   . PHE J 3 233 ? 38.303  22.021  220.376 1.00 24.98  ? 234 PHE B CE1   1 
ATOM   5019 C CE2   . PHE J 3 233 ? 38.109  22.827  218.094 1.00 31.79  ? 234 PHE B CE2   1 
ATOM   5020 C CZ    . PHE J 3 233 ? 37.620  22.055  219.154 1.00 41.49  ? 234 PHE B CZ    1 
ATOM   5021 N N     . VAL J 3 234 ? 40.699  25.304  222.466 1.00 54.44  ? 235 VAL B N     1 
ATOM   5022 C CA    . VAL J 3 234 ? 40.054  25.172  223.776 1.00 52.27  ? 235 VAL B CA    1 
ATOM   5023 C C     . VAL J 3 234 ? 39.471  26.471  224.266 1.00 47.23  ? 235 VAL B C     1 
ATOM   5024 O O     . VAL J 3 234 ? 38.516  26.477  225.034 1.00 48.69  ? 235 VAL B O     1 
ATOM   5025 C CB    . VAL J 3 234 ? 41.041  24.656  224.830 1.00 54.35  ? 235 VAL B CB    1 
ATOM   5026 C CG1   . VAL J 3 234 ? 40.374  24.642  226.194 1.00 53.31  ? 235 VAL B CG1   1 
ATOM   5027 C CG2   . VAL J 3 234 ? 41.520  23.265  224.445 1.00 41.15  ? 235 VAL B CG2   1 
ATOM   5028 N N     . THR J 3 235 ? 40.057  27.570  223.814 1.00 47.97  ? 236 THR B N     1 
ATOM   5029 C CA    . THR J 3 235 ? 39.585  28.879  224.211 1.00 52.06  ? 236 THR B CA    1 
ATOM   5030 C C     . THR J 3 235 ? 38.404  29.274  223.349 1.00 53.69  ? 236 THR B C     1 
ATOM   5031 O O     . THR J 3 235 ? 37.354  29.648  223.864 1.00 59.81  ? 236 THR B O     1 
ATOM   5032 C CB    . THR J 3 235 ? 40.664  29.956  224.059 1.00 48.76  ? 236 THR B CB    1 
ATOM   5033 O OG1   . THR J 3 235 ? 41.817  29.592  224.822 1.00 58.66  ? 236 THR B OG1   1 
ATOM   5034 C CG2   . THR J 3 235 ? 40.142  31.286  224.562 1.00 39.58  ? 236 THR B CG2   1 
ATOM   5035 N N     . GLN J 3 236 ? 38.560  29.212  222.036 1.00 46.69  ? 237 GLN B N     1 
ATOM   5036 C CA    . GLN J 3 236 ? 37.432  29.583  221.206 1.00 53.12  ? 237 GLN B CA    1 
ATOM   5037 C C     . GLN J 3 236 ? 36.237  28.762  221.622 1.00 54.59  ? 237 GLN B C     1 
ATOM   5038 O O     . GLN J 3 236 ? 35.134  29.275  221.695 1.00 61.78  ? 237 GLN B O     1 
ATOM   5039 C CB    . GLN J 3 236 ? 37.684  29.319  219.724 1.00 60.43  ? 237 GLN B CB    1 
ATOM   5040 C CG    . GLN J 3 236 ? 38.912  29.956  219.204 1.00 58.42  ? 237 GLN B CG    1 
ATOM   5041 C CD    . GLN J 3 236 ? 39.020  31.359  219.675 1.00 56.98  ? 237 GLN B CD    1 
ATOM   5042 O OE1   . GLN J 3 236 ? 38.103  32.148  219.497 1.00 57.14  ? 237 GLN B OE1   1 
ATOM   5043 N NE2   . GLN J 3 236 ? 40.141  31.688  220.302 1.00 68.89  ? 237 GLN B NE2   1 
ATOM   5044 N N     . ALA J 3 237 ? 36.439  27.479  221.889 1.00 49.72  ? 238 ALA B N     1 
ATOM   5045 C CA    . ALA J 3 237 ? 35.303  26.670  222.256 1.00 46.11  ? 238 ALA B CA    1 
ATOM   5046 C C     . ALA J 3 237 ? 34.528  27.365  223.350 1.00 51.02  ? 238 ALA B C     1 
ATOM   5047 O O     . ALA J 3 237 ? 33.353  27.711  223.156 1.00 44.81  ? 238 ALA B O     1 
ATOM   5048 C CB    . ALA J 3 237 ? 35.742  25.329  222.711 1.00 50.54  ? 238 ALA B CB    1 
ATOM   5049 N N     . GLU J 3 238 ? 35.190  27.589  224.490 1.00 54.41  ? 239 GLU B N     1 
ATOM   5050 C CA    . GLU J 3 238 ? 34.564  28.243  225.650 1.00 52.71  ? 239 GLU B CA    1 
ATOM   5051 C C     . GLU J 3 238 ? 33.810  29.479  225.219 1.00 49.15  ? 239 GLU B C     1 
ATOM   5052 O O     . GLU J 3 238 ? 32.693  29.718  225.674 1.00 47.84  ? 239 GLU B O     1 
ATOM   5053 C CB    . GLU J 3 238 ? 35.617  28.589  226.716 1.00 56.91  ? 239 GLU B CB    1 
ATOM   5054 C CG    . GLU J 3 238 ? 36.039  27.382  227.570 1.00 70.77  ? 239 GLU B CG    1 
ATOM   5055 C CD    . GLU J 3 238 ? 36.992  27.725  228.715 1.00 80.61  ? 239 GLU B CD    1 
ATOM   5056 O OE1   . GLU J 3 238 ? 38.171  28.051  228.443 1.00 81.26  ? 239 GLU B OE1   1 
ATOM   5057 O OE2   . GLU J 3 238 ? 36.556  27.670  229.891 1.00 85.61  ? 239 GLU B OE2   1 
ATOM   5058 N N     . GLN J 3 239 ? 34.415  30.251  224.320 1.00 51.11  ? 240 GLN B N     1 
ATOM   5059 C CA    . GLN J 3 239 ? 33.772  31.455  223.803 1.00 53.66  ? 240 GLN B CA    1 
ATOM   5060 C C     . GLN J 3 239 ? 32.442  31.075  223.133 1.00 50.40  ? 240 GLN B C     1 
ATOM   5061 O O     . GLN J 3 239 ? 31.383  31.451  223.619 1.00 50.57  ? 240 GLN B O     1 
ATOM   5062 C CB    . GLN J 3 239 ? 34.697  32.170  222.812 1.00 61.59  ? 240 GLN B CB    1 
ATOM   5063 N N     . ARG J 3 240 ? 32.493  30.328  222.033 1.00 47.12  ? 241 ARG B N     1 
ATOM   5064 C CA    . ARG J 3 240 ? 31.274  29.891  221.355 1.00 44.73  ? 241 ARG B CA    1 
ATOM   5065 C C     . ARG J 3 240 ? 30.224  29.407  222.377 1.00 46.54  ? 241 ARG B C     1 
ATOM   5066 O O     . ARG J 3 240 ? 29.026  29.664  222.240 1.00 42.22  ? 241 ARG B O     1 
ATOM   5067 C CB    . ARG J 3 240 ? 31.588  28.753  220.389 1.00 47.10  ? 241 ARG B CB    1 
ATOM   5068 C CG    . ARG J 3 240 ? 30.376  28.231  219.671 1.00 42.70  ? 241 ARG B CG    1 
ATOM   5069 C CD    . ARG J 3 240 ? 29.879  29.252  218.696 1.00 51.03  ? 241 ARG B CD    1 
ATOM   5070 N NE    . ARG J 3 240 ? 28.594  28.854  218.135 1.00 65.10  ? 241 ARG B NE    1 
ATOM   5071 C CZ    . ARG J 3 240 ? 27.992  29.481  217.132 1.00 61.98  ? 241 ARG B CZ    1 
ATOM   5072 N NH1   . ARG J 3 240 ? 28.569  30.543  216.581 1.00 65.48  ? 241 ARG B NH1   1 
ATOM   5073 N NH2   . ARG J 3 240 ? 26.821  29.039  216.683 1.00 46.79  ? 241 ARG B NH2   1 
ATOM   5074 N N     . ALA J 3 241 ? 30.677  28.702  223.406 1.00 42.24  ? 242 ALA B N     1 
ATOM   5075 C CA    . ALA J 3 241 ? 29.762  28.227  224.425 1.00 38.42  ? 242 ALA B CA    1 
ATOM   5076 C C     . ALA J 3 241 ? 29.057  29.430  225.028 1.00 38.72  ? 242 ALA B C     1 
ATOM   5077 O O     . ALA J 3 241 ? 27.833  29.455  225.124 1.00 39.21  ? 242 ALA B O     1 
ATOM   5078 C CB    . ALA J 3 241 ? 30.518  27.448  225.505 1.00 38.08  ? 242 ALA B CB    1 
ATOM   5079 N N     . ILE J 3 242 ? 29.816  30.442  225.433 1.00 41.54  ? 243 ILE B N     1 
ATOM   5080 C CA    . ILE J 3 242 ? 29.169  31.615  226.019 1.00 48.81  ? 243 ILE B CA    1 
ATOM   5081 C C     . ILE J 3 242 ? 28.300  32.302  224.978 1.00 50.79  ? 243 ILE B C     1 
ATOM   5082 O O     . ILE J 3 242 ? 27.084  32.395  225.140 1.00 51.48  ? 243 ILE B O     1 
ATOM   5083 C CB    . ILE J 3 242 ? 30.178  32.634  226.576 1.00 49.65  ? 243 ILE B CB    1 
ATOM   5084 C CG1   . ILE J 3 242 ? 30.947  32.022  227.748 1.00 48.17  ? 243 ILE B CG1   1 
ATOM   5085 C CG2   . ILE J 3 242 ? 29.436  33.862  227.031 1.00 41.19  ? 243 ILE B CG2   1 
ATOM   5086 C CD1   . ILE J 3 242 ? 30.050  31.563  228.885 1.00 61.44  ? 243 ILE B CD1   1 
ATOM   5087 N N     . SER J 3 243 ? 28.937  32.774  223.912 1.00 46.33  ? 244 SER B N     1 
ATOM   5088 C CA    . SER J 3 243 ? 28.237  33.439  222.838 1.00 46.45  ? 244 SER B CA    1 
ATOM   5089 C C     . SER J 3 243 ? 26.943  32.705  222.459 1.00 48.95  ? 244 SER B C     1 
ATOM   5090 O O     . SER J 3 243 ? 25.882  33.315  222.395 1.00 53.08  ? 244 SER B O     1 
ATOM   5091 C CB    . SER J 3 243 ? 29.151  33.547  221.630 1.00 39.36  ? 244 SER B CB    1 
ATOM   5092 O OG    . SER J 3 243 ? 29.659  32.283  221.296 1.00 47.00  ? 244 SER B OG    1 
ATOM   5093 N N     . MET J 3 244 ? 27.012  31.402  222.221 1.00 40.48  ? 245 MET B N     1 
ATOM   5094 C CA    . MET J 3 244 ? 25.801  30.684  221.863 1.00 47.93  ? 245 MET B CA    1 
ATOM   5095 C C     . MET J 3 244 ? 24.604  31.014  222.752 1.00 51.06  ? 245 MET B C     1 
ATOM   5096 O O     . MET J 3 244 ? 23.456  31.062  222.295 1.00 50.30  ? 245 MET B O     1 
ATOM   5097 C CB    . MET J 3 244 ? 26.040  29.187  221.890 1.00 48.06  ? 245 MET B CB    1 
ATOM   5098 C CG    . MET J 3 244 ? 26.685  28.692  220.630 1.00 56.11  ? 245 MET B CG    1 
ATOM   5099 S SD    . MET J 3 244 ? 26.848  26.935  220.687 1.00 57.55  ? 245 MET B SD    1 
ATOM   5100 C CE    . MET J 3 244 ? 25.128  26.523  220.689 1.00 30.51  ? 245 MET B CE    1 
ATOM   5101 N N     . ILE J 3 245 ? 24.865  31.238  224.028 1.00 50.97  ? 246 ILE B N     1 
ATOM   5102 C CA    . ILE J 3 245 ? 23.792  31.559  224.946 1.00 54.01  ? 246 ILE B CA    1 
ATOM   5103 C C     . ILE J 3 245 ? 23.208  32.942  224.690 1.00 55.10  ? 246 ILE B C     1 
ATOM   5104 O O     . ILE J 3 245 ? 22.002  33.116  224.713 1.00 56.26  ? 246 ILE B O     1 
ATOM   5105 C CB    . ILE J 3 245 ? 24.287  31.493  226.380 1.00 56.09  ? 246 ILE B CB    1 
ATOM   5106 C CG1   . ILE J 3 245 ? 24.685  30.058  226.709 1.00 63.82  ? 246 ILE B CG1   1 
ATOM   5107 C CG2   . ILE J 3 245 ? 23.218  31.989  227.306 1.00 43.53  ? 246 ILE B CG2   1 
ATOM   5108 C CD1   . ILE J 3 245 ? 25.247  29.887  228.103 1.00 70.71  ? 246 ILE B CD1   1 
ATOM   5109 N N     . ASP J 3 246 ? 24.072  33.919  224.448 1.00 55.30  ? 247 ASP B N     1 
ATOM   5110 C CA    . ASP J 3 246 ? 23.638  35.282  224.197 1.00 59.80  ? 247 ASP B CA    1 
ATOM   5111 C C     . ASP J 3 246 ? 22.985  35.473  222.834 1.00 60.82  ? 247 ASP B C     1 
ATOM   5112 O O     . ASP J 3 246 ? 22.265  36.443  222.623 1.00 65.17  ? 247 ASP B O     1 
ATOM   5113 C CB    . ASP J 3 246 ? 24.825  36.245  224.296 1.00 73.80  ? 247 ASP B CB    1 
ATOM   5114 C CG    . ASP J 3 246 ? 25.285  36.472  225.722 1.00 91.57  ? 247 ASP B CG    1 
ATOM   5115 O OD1   . ASP J 3 246 ? 24.440  36.881  226.561 1.00 100.10 ? 247 ASP B OD1   1 
ATOM   5116 O OD2   . ASP J 3 246 ? 26.494  36.257  226.000 1.00 95.09  ? 247 ASP B OD2   1 
ATOM   5117 N N     . LYS J 3 247 ? 23.235  34.567  221.899 1.00 57.58  ? 248 LYS B N     1 
ATOM   5118 C CA    . LYS J 3 247 ? 22.663  34.733  220.574 1.00 56.17  ? 248 LYS B CA    1 
ATOM   5119 C C     . LYS J 3 247 ? 21.522  33.776  220.283 1.00 58.35  ? 248 LYS B C     1 
ATOM   5120 O O     . LYS J 3 247 ? 20.639  34.063  219.481 1.00 62.34  ? 248 LYS B O     1 
ATOM   5121 C CB    . LYS J 3 247 ? 23.753  34.578  219.509 1.00 52.39  ? 248 LYS B CB    1 
ATOM   5122 C CG    . LYS J 3 247 ? 23.321  35.065  218.126 1.00 43.73  ? 248 LYS B CG    1 
ATOM   5123 C CD    . LYS J 3 247 ? 24.490  35.278  217.208 1.00 36.58  ? 248 LYS B CD    1 
ATOM   5124 C CE    . LYS J 3 247 ? 24.006  35.511  215.799 1.00 42.31  ? 248 LYS B CE    1 
ATOM   5125 N NZ    . LYS J 3 247 ? 25.161  35.801  214.903 1.00 51.69  ? 248 LYS B NZ    1 
ATOM   5126 N N     . PHE J 3 248 ? 21.512  32.647  220.961 1.00 59.33  ? 249 PHE B N     1 
ATOM   5127 C CA    . PHE J 3 248 ? 20.484  31.682  220.698 1.00 58.60  ? 249 PHE B CA    1 
ATOM   5128 C C     . PHE J 3 248 ? 19.535  31.471  221.847 1.00 65.60  ? 249 PHE B C     1 
ATOM   5129 O O     . PHE J 3 248 ? 18.585  30.702  221.745 1.00 77.15  ? 249 PHE B O     1 
ATOM   5130 C CB    . PHE J 3 248 ? 21.163  30.379  220.327 1.00 60.37  ? 249 PHE B CB    1 
ATOM   5131 C CG    . PHE J 3 248 ? 22.142  30.514  219.200 1.00 47.71  ? 249 PHE B CG    1 
ATOM   5132 C CD1   . PHE J 3 248 ? 21.762  31.113  217.999 1.00 38.24  ? 249 PHE B CD1   1 
ATOM   5133 C CD2   . PHE J 3 248 ? 23.421  30.004  219.321 1.00 44.97  ? 249 PHE B CD2   1 
ATOM   5134 C CE1   . PHE J 3 248 ? 22.636  31.197  216.932 1.00 28.46  ? 249 PHE B CE1   1 
ATOM   5135 C CE2   . PHE J 3 248 ? 24.307  30.080  218.261 1.00 52.58  ? 249 PHE B CE2   1 
ATOM   5136 C CZ    . PHE J 3 248 ? 23.907  30.681  217.061 1.00 48.69  ? 249 PHE B CZ    1 
ATOM   5137 N N     . VAL J 3 249 ? 19.789  32.163  222.945 1.00 70.12  ? 250 VAL B N     1 
ATOM   5138 C CA    . VAL J 3 249 ? 18.961  32.019  224.126 1.00 73.37  ? 250 VAL B CA    1 
ATOM   5139 C C     . VAL J 3 249 ? 18.365  33.347  224.603 1.00 75.65  ? 250 VAL B C     1 
ATOM   5140 O O     . VAL J 3 249 ? 17.165  33.601  224.442 1.00 77.65  ? 250 VAL B O     1 
ATOM   5141 C CB    . VAL J 3 249 ? 19.786  31.412  225.262 1.00 72.77  ? 250 VAL B CB    1 
ATOM   5142 C CG1   . VAL J 3 249 ? 18.881  30.982  226.391 1.00 76.83  ? 250 VAL B CG1   1 
ATOM   5143 C CG2   . VAL J 3 249 ? 20.599  30.246  224.733 1.00 78.49  ? 250 VAL B CG2   1 
ATOM   5144 N N     . LYS J 3 250 ? 19.220  34.178  225.193 1.00 72.68  ? 251 LYS B N     1 
ATOM   5145 C CA    . LYS J 3 250 ? 18.828  35.473  225.723 1.00 73.58  ? 251 LYS B CA    1 
ATOM   5146 C C     . LYS J 3 250 ? 17.733  36.138  224.903 1.00 74.00  ? 251 LYS B C     1 
ATOM   5147 O O     . LYS J 3 250 ? 16.636  36.393  225.400 1.00 85.22  ? 251 LYS B O     1 
ATOM   5148 C CB    . LYS J 3 250 ? 20.049  36.408  225.812 1.00 78.05  ? 251 LYS B CB    1 
ATOM   5149 C CG    . LYS J 3 250 ? 19.756  37.901  225.533 1.00 80.45  ? 251 LYS B CG    1 
ATOM   5150 C CD    . LYS J 3 250 ? 19.755  38.766  226.800 1.00 95.71  ? 251 LYS B CD    1 
ATOM   5151 C CE    . LYS J 3 250 ? 18.703  38.326  227.830 1.00 99.95  ? 251 LYS B CE    1 
ATOM   5152 N NZ    . LYS J 3 250 ? 18.763  39.142  229.085 1.00 97.97  ? 251 LYS B NZ    1 
ATOM   5153 N N     . PRO J 3 251 ? 18.001  36.404  223.626 1.00 65.73  ? 252 PRO B N     1 
ATOM   5154 C CA    . PRO J 3 251 ? 17.006  37.056  222.785 1.00 69.42  ? 252 PRO B CA    1 
ATOM   5155 C C     . PRO J 3 251 ? 15.706  36.310  222.538 1.00 76.21  ? 252 PRO B C     1 
ATOM   5156 O O     . PRO J 3 251 ? 14.756  36.886  221.992 1.00 85.18  ? 252 PRO B O     1 
ATOM   5157 C CB    . PRO J 3 251 ? 17.768  37.300  221.496 1.00 67.68  ? 252 PRO B CB    1 
ATOM   5158 C CG    . PRO J 3 251 ? 18.652  36.116  221.427 1.00 61.40  ? 252 PRO B CG    1 
ATOM   5159 C CD    . PRO J 3 251 ? 19.179  36.032  222.832 1.00 61.42  ? 252 PRO B CD    1 
ATOM   5160 N N     . PHE J 3 252 ? 15.634  35.045  222.926 1.00 69.07  ? 253 PHE B N     1 
ATOM   5161 C CA    . PHE J 3 252 ? 14.411  34.295  222.668 1.00 62.49  ? 253 PHE B CA    1 
ATOM   5162 C C     . PHE J 3 252 ? 13.570  33.955  223.893 1.00 61.30  ? 253 PHE B C     1 
ATOM   5163 O O     . PHE J 3 252 ? 12.359  33.772  223.772 1.00 58.68  ? 253 PHE B O     1 
ATOM   5164 C CB    . PHE J 3 252 ? 14.750  33.023  221.870 1.00 61.56  ? 253 PHE B CB    1 
ATOM   5165 C CG    . PHE J 3 252 ? 15.049  33.278  220.407 1.00 50.92  ? 253 PHE B CG    1 
ATOM   5166 C CD1   . PHE J 3 252 ? 16.332  33.097  219.901 1.00 39.13  ? 253 PHE B CD1   1 
ATOM   5167 C CD2   . PHE J 3 252 ? 14.039  33.715  219.536 1.00 36.45  ? 253 PHE B CD2   1 
ATOM   5168 C CE1   . PHE J 3 252 ? 16.600  33.348  218.559 1.00 29.60  ? 253 PHE B CE1   1 
ATOM   5169 C CE2   . PHE J 3 252 ? 14.307  33.967  218.195 1.00 27.57  ? 253 PHE B CE2   1 
ATOM   5170 C CZ    . PHE J 3 252 ? 15.585  33.785  217.704 1.00 28.25  ? 253 PHE B CZ    1 
ATOM   5171 N N     . LYS J 3 253 ? 14.210  33.879  225.059 1.00 57.33  ? 254 LYS B N     1 
ATOM   5172 C CA    . LYS J 3 253 ? 13.522  33.567  226.311 1.00 53.52  ? 254 LYS B CA    1 
ATOM   5173 C C     . LYS J 3 253 ? 12.175  34.306  226.482 1.00 56.17  ? 254 LYS B C     1 
ATOM   5174 O O     . LYS J 3 253 ? 11.250  33.800  227.116 1.00 53.37  ? 254 LYS B O     1 
ATOM   5175 C CB    . LYS J 3 253 ? 14.445  33.888  227.490 1.00 54.33  ? 254 LYS B CB    1 
ATOM   5176 C CG    . LYS J 3 253 ? 15.566  32.894  227.736 1.00 41.01  ? 254 LYS B CG    1 
ATOM   5177 C CD    . LYS J 3 253 ? 15.046  31.675  228.458 1.00 43.93  ? 254 LYS B CD    1 
ATOM   5178 C CE    . LYS J 3 253 ? 16.193  30.806  228.973 1.00 58.81  ? 254 LYS B CE    1 
ATOM   5179 N NZ    . LYS J 3 253 ? 15.735  29.566  229.696 1.00 52.35  ? 254 LYS B NZ    1 
ATOM   5180 N N     . LYS J 3 254 ? 12.064  35.501  225.910 1.00 61.00  ? 255 LYS B N     1 
ATOM   5181 C CA    . LYS J 3 254 ? 10.837  36.290  225.998 1.00 60.64  ? 255 LYS B CA    1 
ATOM   5182 C C     . LYS J 3 254 ? 9.698   35.680  225.167 1.00 64.28  ? 255 LYS B C     1 
ATOM   5183 O O     . LYS J 3 254 ? 8.856   36.402  224.619 1.00 66.76  ? 255 LYS B O     1 
ATOM   5184 C CB    . LYS J 3 254 ? 11.106  37.717  225.509 1.00 61.48  ? 255 LYS B CB    1 
ATOM   5185 C CG    . LYS J 3 254 ? 11.415  37.807  224.015 1.00 68.13  ? 255 LYS B CG    1 
ATOM   5186 C CD    . LYS J 3 254 ? 11.881  39.194  223.574 1.00 67.28  ? 255 LYS B CD    1 
ATOM   5187 C CE    . LYS J 3 254 ? 13.217  39.616  224.230 1.00 76.70  ? 255 LYS B CE    1 
ATOM   5188 N NZ    . LYS J 3 254 ? 14.441  38.848  223.815 1.00 64.40  ? 255 LYS B NZ    1 
ATOM   5189 N N     . TYR J 3 255 ? 9.671   34.355  225.072 1.00 65.26  ? 256 TYR B N     1 
ATOM   5190 C CA    . TYR J 3 255 ? 8.641   33.669  224.297 1.00 63.02  ? 256 TYR B CA    1 
ATOM   5191 C C     . TYR J 3 255 ? 8.141   32.402  224.988 1.00 65.94  ? 256 TYR B C     1 
ATOM   5192 O O     . TYR J 3 255 ? 7.008   31.983  224.774 1.00 74.50  ? 256 TYR B O     1 
ATOM   5193 C CB    . TYR J 3 255 ? 9.168   33.309  222.901 1.00 59.70  ? 256 TYR B CB    1 
ATOM   5194 C CG    . TYR J 3 255 ? 9.345   34.482  221.947 1.00 48.85  ? 256 TYR B CG    1 
ATOM   5195 C CD1   . TYR J 3 255 ? 8.257   35.238  221.518 1.00 47.17  ? 256 TYR B CD1   1 
ATOM   5196 C CD2   . TYR J 3 255 ? 10.591  34.811  221.444 1.00 46.68  ? 256 TYR B CD2   1 
ATOM   5197 C CE1   . TYR J 3 255 ? 8.410   36.287  220.603 1.00 18.86  ? 256 TYR B CE1   1 
ATOM   5198 C CE2   . TYR J 3 255 ? 10.745  35.862  220.537 1.00 36.27  ? 256 TYR B CE2   1 
ATOM   5199 C CZ    . TYR J 3 255 ? 9.655   36.587  220.124 1.00 28.79  ? 256 TYR B CZ    1 
ATOM   5200 O OH    . TYR J 3 255 ? 9.830   37.609  219.222 1.00 29.17  ? 256 TYR B OH    1 
ATOM   5201 N N     . ILE J 3 256 ? 8.968   31.784  225.817 1.00 62.45  ? 257 ILE B N     1 
ATOM   5202 C CA    . ILE J 3 256 ? 8.522   30.579  226.492 1.00 67.75  ? 257 ILE B CA    1 
ATOM   5203 C C     . ILE J 3 256 ? 7.401   30.863  227.488 1.00 61.64  ? 257 ILE B C     1 
ATOM   5204 C CB    . ILE J 3 256 ? 9.672   29.894  227.233 1.00 76.89  ? 257 ILE B CB    1 
ATOM   5205 C CG1   . ILE J 3 256 ? 10.786  29.522  226.252 1.00 82.43  ? 257 ILE B CG1   1 
ATOM   5206 C CG2   . ILE J 3 256 ? 9.157   28.651  227.940 1.00 84.49  ? 257 ILE B CG2   1 
ATOM   5207 C CD1   . ILE J 3 256 ? 11.696  30.672  225.888 1.00 84.22  ? 257 ILE B CD1   1 
ATOM   5208 N N     . SER K 3 1   ? 51.423  -14.999 233.905 1.00 94.04  ? 2   SER C N     1 
ATOM   5209 C CA    . SER K 3 1   ? 50.585  -16.095 233.346 1.00 94.39  ? 2   SER C CA    1 
ATOM   5210 C C     . SER K 3 1   ? 51.325  -17.425 233.306 1.00 100.02 ? 2   SER C C     1 
ATOM   5211 O O     . SER K 3 1   ? 52.528  -17.463 233.071 1.00 102.72 ? 2   SER C O     1 
ATOM   5212 C CB    . SER K 3 1   ? 50.135  -15.745 231.932 1.00 90.91  ? 2   SER C CB    1 
ATOM   5213 O OG    . SER K 3 1   ? 49.502  -16.861 231.331 1.00 86.28  ? 2   SER C OG    1 
ATOM   5214 N N     . PHE K 3 2   ? 50.591  -18.514 233.525 1.00 105.63 ? 3   PHE C N     1 
ATOM   5215 C CA    . PHE K 3 2   ? 51.154  -19.864 233.512 1.00 107.00 ? 3   PHE C CA    1 
ATOM   5216 C C     . PHE K 3 2   ? 50.717  -20.659 232.287 1.00 104.59 ? 3   PHE C C     1 
ATOM   5217 O O     . PHE K 3 2   ? 51.316  -21.681 231.958 1.00 96.44  ? 3   PHE C O     1 
ATOM   5218 C CB    . PHE K 3 2   ? 50.732  -20.642 234.768 1.00 115.22 ? 3   PHE C CB    1 
ATOM   5219 C CG    . PHE K 3 2   ? 51.394  -20.178 236.031 1.00 122.08 ? 3   PHE C CG    1 
ATOM   5220 C CD1   . PHE K 3 2   ? 51.202  -20.876 237.221 1.00 121.78 ? 3   PHE C CD1   1 
ATOM   5221 C CD2   . PHE K 3 2   ? 52.212  -19.049 236.036 1.00 128.37 ? 3   PHE C CD2   1 
ATOM   5222 C CE1   . PHE K 3 2   ? 51.817  -20.460 238.399 1.00 130.35 ? 3   PHE C CE1   1 
ATOM   5223 C CE2   . PHE K 3 2   ? 52.833  -18.620 237.207 1.00 133.97 ? 3   PHE C CE2   1 
ATOM   5224 C CZ    . PHE K 3 2   ? 52.635  -19.328 238.395 1.00 135.86 ? 3   PHE C CZ    1 
ATOM   5225 N N     . ILE K 3 3   ? 49.655  -20.209 231.629 1.00 107.68 ? 4   ILE C N     1 
ATOM   5226 C CA    . ILE K 3 3   ? 49.171  -20.907 230.445 1.00 111.62 ? 4   ILE C CA    1 
ATOM   5227 C C     . ILE K 3 3   ? 49.694  -20.230 229.185 1.00 112.15 ? 4   ILE C C     1 
ATOM   5228 O O     . ILE K 3 3   ? 49.904  -20.895 228.170 1.00 113.14 ? 4   ILE C O     1 
ATOM   5229 C CB    . ILE K 3 3   ? 47.625  -20.939 230.354 1.00 110.94 ? 4   ILE C CB    1 
ATOM   5230 C CG1   . ILE K 3 3   ? 47.093  -19.538 230.040 1.00 112.02 ? 4   ILE C CG1   1 
ATOM   5231 C CG2   . ILE K 3 3   ? 47.041  -21.475 231.653 1.00 111.74 ? 4   ILE C CG2   1 
ATOM   5232 C CD1   . ILE K 3 3   ? 45.819  -19.541 229.226 1.00 107.76 ? 4   ILE C CD1   1 
ATOM   5233 N N     . LYS K 3 4   ? 49.901  -18.913 229.255 1.00 106.82 ? 5   LYS C N     1 
ATOM   5234 C CA    . LYS K 3 4   ? 50.393  -18.151 228.112 1.00 98.66  ? 5   LYS C CA    1 
ATOM   5235 C C     . LYS K 3 4   ? 51.471  -18.948 227.382 1.00 98.80  ? 5   LYS C C     1 
ATOM   5236 O O     . LYS K 3 4   ? 51.431  -19.082 226.157 1.00 100.23 ? 5   LYS C O     1 
ATOM   5237 C CB    . LYS K 3 4   ? 50.959  -16.804 228.557 1.00 90.41  ? 5   LYS C CB    1 
ATOM   5238 C CG    . LYS K 3 4   ? 51.318  -15.902 227.398 1.00 85.71  ? 5   LYS C CG    1 
ATOM   5239 C CD    . LYS K 3 4   ? 52.302  -14.834 227.805 1.00 90.85  ? 5   LYS C CD    1 
ATOM   5240 C CE    . LYS K 3 4   ? 53.483  -15.432 228.562 1.00 93.88  ? 5   LYS C CE    1 
ATOM   5241 N NZ    . LYS K 3 4   ? 54.049  -16.638 227.895 1.00 94.29  ? 5   LYS C NZ    1 
ATOM   5242 N N     . PRO K 3 5   ? 52.457  -19.483 228.122 1.00 97.48  ? 6   PRO C N     1 
ATOM   5243 C CA    . PRO K 3 5   ? 53.518  -20.264 227.491 1.00 98.76  ? 6   PRO C CA    1 
ATOM   5244 C C     . PRO K 3 5   ? 52.944  -21.480 226.780 1.00 101.56 ? 6   PRO C C     1 
ATOM   5245 O O     . PRO K 3 5   ? 53.010  -21.589 225.552 1.00 106.13 ? 6   PRO C O     1 
ATOM   5246 C CB    . PRO K 3 5   ? 54.400  -20.649 228.669 1.00 90.07  ? 6   PRO C CB    1 
ATOM   5247 C CG    . PRO K 3 5   ? 54.292  -19.468 229.536 1.00 90.19  ? 6   PRO C CG    1 
ATOM   5248 C CD    . PRO K 3 5   ? 52.800  -19.217 229.526 1.00 97.27  ? 6   PRO C CD    1 
ATOM   5249 N N     . ILE K 3 6   ? 52.369  -22.390 227.555 1.00 104.20 ? 7   ILE C N     1 
ATOM   5250 C CA    . ILE K 3 6   ? 51.783  -23.601 226.991 1.00 111.41 ? 7   ILE C CA    1 
ATOM   5251 C C     . ILE K 3 6   ? 50.540  -23.249 226.159 1.00 114.21 ? 7   ILE C C     1 
ATOM   5252 O O     . ILE K 3 6   ? 49.842  -24.128 225.652 1.00 113.36 ? 7   ILE C O     1 
ATOM   5253 C CB    . ILE K 3 6   ? 51.415  -24.622 228.124 1.00 107.20 ? 7   ILE C CB    1 
ATOM   5254 C CG1   . ILE K 3 6   ? 51.094  -25.994 227.528 1.00 105.28 ? 7   ILE C CG1   1 
ATOM   5255 C CG2   . ILE K 3 6   ? 50.236  -24.119 228.923 1.00 101.08 ? 7   ILE C CG2   1 
ATOM   5256 C CD1   . ILE K 3 6   ? 52.276  -26.674 226.865 1.00 106.21 ? 7   ILE C CD1   1 
ATOM   5257 N N     . TYR K 3 7   ? 50.285  -21.953 226.004 1.00 116.74 ? 8   TYR C N     1 
ATOM   5258 C CA    . TYR K 3 7   ? 49.134  -21.478 225.243 1.00 121.46 ? 8   TYR C CA    1 
ATOM   5259 C C     . TYR K 3 7   ? 49.349  -21.624 223.743 1.00 123.96 ? 8   TYR C C     1 
ATOM   5260 O O     . TYR K 3 7   ? 48.435  -22.021 223.020 1.00 128.46 ? 8   TYR C O     1 
ATOM   5261 C CB    . TYR K 3 7   ? 48.837  -20.005 225.586 1.00 119.98 ? 8   TYR C CB    1 
ATOM   5262 C CG    . TYR K 3 7   ? 47.745  -19.366 224.753 1.00 109.11 ? 8   TYR C CG    1 
ATOM   5263 C CD1   . TYR K 3 7   ? 46.446  -19.869 224.767 1.00 102.41 ? 8   TYR C CD1   1 
ATOM   5264 C CD2   . TYR K 3 7   ? 48.027  -18.292 223.915 1.00 107.04 ? 8   TYR C CD2   1 
ATOM   5265 C CE1   . TYR K 3 7   ? 45.457  -19.326 223.964 1.00 102.83 ? 8   TYR C CE1   1 
ATOM   5266 C CE2   . TYR K 3 7   ? 47.044  -17.740 223.106 1.00 108.88 ? 8   TYR C CE2   1 
ATOM   5267 C CZ    . TYR K 3 7   ? 45.760  -18.265 223.130 1.00 107.32 ? 8   TYR C CZ    1 
ATOM   5268 O OH    . TYR K 3 7   ? 44.792  -17.754 222.292 1.00 108.33 ? 8   TYR C OH    1 
ATOM   5269 N N     . GLN K 3 8   ? 50.557  -21.304 223.284 1.00 123.68 ? 9   GLN C N     1 
ATOM   5270 C CA    . GLN K 3 8   ? 50.897  -21.385 221.864 1.00 122.58 ? 9   GLN C CA    1 
ATOM   5271 C C     . GLN K 3 8   ? 50.304  -22.623 221.201 1.00 122.68 ? 9   GLN C C     1 
ATOM   5272 O O     . GLN K 3 8   ? 49.909  -22.584 220.031 1.00 119.64 ? 9   GLN C O     1 
ATOM   5273 C CB    . GLN K 3 8   ? 52.418  -21.389 221.690 1.00 123.06 ? 9   GLN C CB    1 
ATOM   5274 N N     . ASP K 3 9   ? 50.239  -23.713 221.965 1.00 123.85 ? 10  ASP C N     1 
ATOM   5275 C CA    . ASP K 3 9   ? 49.705  -24.988 221.491 1.00 121.90 ? 10  ASP C CA    1 
ATOM   5276 C C     . ASP K 3 9   ? 48.211  -25.110 221.767 1.00 119.24 ? 10  ASP C C     1 
ATOM   5277 O O     . ASP K 3 9   ? 47.436  -25.468 220.880 1.00 114.75 ? 10  ASP C O     1 
ATOM   5278 C CB    . ASP K 3 9   ? 50.445  -26.153 222.163 1.00 124.10 ? 10  ASP C CB    1 
ATOM   5279 N N     . ILE K 3 10  ? 47.818  -24.817 223.004 1.00 120.32 ? 11  ILE C N     1 
ATOM   5280 C CA    . ILE K 3 10  ? 46.420  -24.890 223.406 1.00 123.86 ? 11  ILE C CA    1 
ATOM   5281 C C     . ILE K 3 10  ? 45.536  -24.414 222.263 1.00 123.49 ? 11  ILE C C     1 
ATOM   5282 O O     . ILE K 3 10  ? 44.468  -24.970 222.010 1.00 124.73 ? 11  ILE C O     1 
ATOM   5283 C CB    . ILE K 3 10  ? 46.152  -24.022 224.671 1.00 124.23 ? 11  ILE C CB    1 
ATOM   5284 C CG1   . ILE K 3 10  ? 46.885  -24.619 225.874 1.00 124.48 ? 11  ILE C CG1   1 
ATOM   5285 C CG2   . ILE K 3 10  ? 44.659  -23.961 224.975 1.00 125.42 ? 11  ILE C CG2   1 
ATOM   5286 C CD1   . ILE K 3 10  ? 46.703  -23.839 227.158 1.00 122.28 ? 11  ILE C CD1   1 
ATOM   5287 N N     . ASN K 3 11  ? 45.997  -23.394 221.554 1.00 121.35 ? 12  ASN C N     1 
ATOM   5288 C CA    . ASN K 3 11  ? 45.229  -22.861 220.446 1.00 116.54 ? 12  ASN C CA    1 
ATOM   5289 C C     . ASN K 3 11  ? 44.858  -23.936 219.443 1.00 114.52 ? 12  ASN C C     1 
ATOM   5290 O O     . ASN K 3 11  ? 43.682  -24.125 219.137 1.00 111.75 ? 12  ASN C O     1 
ATOM   5291 C CB    . ASN K 3 11  ? 46.017  -21.757 219.748 1.00 113.16 ? 12  ASN C CB    1 
ATOM   5292 C CG    . ASN K 3 11  ? 45.292  -20.434 219.776 1.00 114.74 ? 12  ASN C CG    1 
ATOM   5293 O OD1   . ASN K 3 11  ? 44.162  -20.327 219.300 1.00 112.52 ? 12  ASN C OD1   1 
ATOM   5294 N ND2   . ASN K 3 11  ? 45.933  -19.417 220.341 1.00 113.03 ? 12  ASN C ND2   1 
ATOM   5295 N N     . SER K 3 12  ? 45.869  -24.651 218.959 1.00 115.12 ? 13  SER C N     1 
ATOM   5296 C CA    . SER K 3 12  ? 45.697  -25.701 217.951 1.00 116.44 ? 13  SER C CA    1 
ATOM   5297 C C     . SER K 3 12  ? 44.894  -26.942 218.361 1.00 114.61 ? 13  SER C C     1 
ATOM   5298 O O     . SER K 3 12  ? 44.109  -27.480 217.571 1.00 112.62 ? 13  SER C O     1 
ATOM   5299 C CB    . SER K 3 12  ? 47.076  -26.132 217.448 1.00 116.00 ? 13  SER C CB    1 
ATOM   5300 O OG    . SER K 3 12  ? 47.822  -25.003 217.012 1.00 109.29 ? 13  SER C OG    1 
ATOM   5301 N N     . ILE K 3 13  ? 45.099  -27.400 219.590 1.00 113.32 ? 14  ILE C N     1 
ATOM   5302 C CA    . ILE K 3 13  ? 44.404  -28.579 220.093 1.00 111.88 ? 14  ILE C CA    1 
ATOM   5303 C C     . ILE K 3 13  ? 42.899  -28.361 220.130 1.00 113.29 ? 14  ILE C C     1 
ATOM   5304 O O     . ILE K 3 13  ? 42.123  -29.285 219.892 1.00 112.88 ? 14  ILE C O     1 
ATOM   5305 C CB    . ILE K 3 13  ? 44.896  -28.934 221.517 1.00 109.86 ? 14  ILE C CB    1 
ATOM   5306 C CG1   . ILE K 3 13  ? 44.204  -30.204 222.023 1.00 106.56 ? 14  ILE C CG1   1 
ATOM   5307 C CG2   . ILE K 3 13  ? 44.651  -27.759 222.456 1.00 110.14 ? 14  ILE C CG2   1 
ATOM   5308 C CD1   . ILE K 3 13  ? 42.874  -29.973 222.715 1.00 102.09 ? 14  ILE C CD1   1 
ATOM   5309 N N     . LEU K 3 14  ? 42.501  -27.128 220.428 1.00 113.02 ? 15  LEU C N     1 
ATOM   5310 C CA    . LEU K 3 14  ? 41.096  -26.767 220.520 1.00 107.68 ? 15  LEU C CA    1 
ATOM   5311 C C     . LEU K 3 14  ? 40.465  -26.426 219.173 1.00 100.29 ? 15  LEU C C     1 
ATOM   5312 O O     . LEU K 3 14  ? 39.367  -26.885 218.860 1.00 101.47 ? 15  LEU C O     1 
ATOM   5313 C CB    . LEU K 3 14  ? 40.921  -25.588 221.490 1.00 115.57 ? 15  LEU C CB    1 
ATOM   5314 C CG    . LEU K 3 14  ? 41.159  -25.828 222.993 1.00 119.31 ? 15  LEU C CG    1 
ATOM   5315 C CD1   . LEU K 3 14  ? 40.922  -24.543 223.800 1.00 120.14 ? 15  LEU C CD1   1 
ATOM   5316 C CD2   . LEU K 3 14  ? 40.222  -26.920 223.477 1.00 120.70 ? 15  LEU C CD2   1 
ATOM   5317 N N     . ILE K 3 15  ? 41.149  -25.621 218.371 1.00 92.21  ? 16  ILE C N     1 
ATOM   5318 C CA    . ILE K 3 15  ? 40.601  -25.243 217.075 1.00 91.29  ? 16  ILE C CA    1 
ATOM   5319 C C     . ILE K 3 15  ? 40.254  -26.460 216.245 1.00 90.66  ? 16  ILE C C     1 
ATOM   5320 O O     . ILE K 3 15  ? 41.124  -27.060 215.609 1.00 93.06  ? 16  ILE C O     1 
ATOM   5321 C CB    . ILE K 3 15  ? 41.573  -24.368 216.266 1.00 87.81  ? 16  ILE C CB    1 
ATOM   5322 C CG1   . ILE K 3 15  ? 41.749  -23.016 216.950 1.00 87.44  ? 16  ILE C CG1   1 
ATOM   5323 C CG2   . ILE K 3 15  ? 41.029  -24.145 214.877 1.00 84.01  ? 16  ILE C CG2   1 
ATOM   5324 C CD1   . ILE K 3 15  ? 42.730  -22.123 216.263 1.00 78.68  ? 16  ILE C CD1   1 
ATOM   5325 N N     . GLY K 3 16  ? 38.972  -26.816 216.252 1.00 88.40  ? 17  GLY C N     1 
ATOM   5326 C CA    . GLY K 3 16  ? 38.512  -27.964 215.493 1.00 85.04  ? 17  GLY C CA    1 
ATOM   5327 C C     . GLY K 3 16  ? 37.745  -28.929 216.361 1.00 84.90  ? 17  GLY C C     1 
ATOM   5328 O O     . GLY K 3 16  ? 37.108  -29.849 215.853 1.00 78.74  ? 17  GLY C O     1 
ATOM   5329 N N     . GLN K 3 17  ? 37.815  -28.706 217.673 1.00 89.60  ? 18  GLN C N     1 
ATOM   5330 C CA    . GLN K 3 17  ? 37.136  -29.541 218.662 1.00 95.04  ? 18  GLN C CA    1 
ATOM   5331 C C     . GLN K 3 17  ? 35.636  -29.293 218.590 1.00 96.52  ? 18  GLN C C     1 
ATOM   5332 O O     . GLN K 3 17  ? 35.169  -28.159 218.693 1.00 91.60  ? 18  GLN C O     1 
ATOM   5333 C CB    . GLN K 3 17  ? 37.656  -29.217 220.057 1.00 96.41  ? 18  GLN C CB    1 
ATOM   5334 C CG    . GLN K 3 17  ? 37.893  -30.427 220.932 1.00 108.74 ? 18  GLN C CG    1 
ATOM   5335 C CD    . GLN K 3 17  ? 39.026  -30.197 221.921 1.00 118.38 ? 18  GLN C CD    1 
ATOM   5336 O OE1   . GLN K 3 17  ? 40.162  -29.924 221.524 1.00 121.48 ? 18  GLN C OE1   1 
ATOM   5337 N NE2   . GLN K 3 17  ? 38.723  -30.303 223.212 1.00 120.77 ? 18  GLN C NE2   1 
ATOM   5338 N N     . LYS K 3 18  ? 34.888  -30.375 218.422 1.00 103.12 ? 19  LYS C N     1 
ATOM   5339 C CA    . LYS K 3 18  ? 33.446  -30.296 218.290 1.00 108.43 ? 19  LYS C CA    1 
ATOM   5340 C C     . LYS K 3 18  ? 32.697  -30.857 219.499 1.00 109.81 ? 19  LYS C C     1 
ATOM   5341 O O     . LYS K 3 18  ? 33.206  -31.729 220.213 1.00 105.55 ? 19  LYS C O     1 
ATOM   5342 C CB    . LYS K 3 18  ? 33.024  -31.024 217.007 1.00 109.14 ? 19  LYS C CB    1 
ATOM   5343 C CG    . LYS K 3 18  ? 33.923  -30.690 215.820 1.00 108.96 ? 19  LYS C CG    1 
ATOM   5344 C CD    . LYS K 3 18  ? 33.298  -31.048 214.484 1.00 116.72 ? 19  LYS C CD    1 
ATOM   5345 C CE    . LYS K 3 18  ? 34.202  -30.612 213.327 1.00 120.82 ? 19  LYS C CE    1 
ATOM   5346 N NZ    . LYS K 3 18  ? 33.520  -30.661 211.995 1.00 123.14 ? 19  LYS C NZ    1 
ATOM   5347 N N     . VAL K 3 19  ? 31.491  -30.330 219.716 1.00 111.51 ? 20  VAL C N     1 
ATOM   5348 C CA    . VAL K 3 19  ? 30.610  -30.734 220.811 1.00 111.35 ? 20  VAL C CA    1 
ATOM   5349 C C     . VAL K 3 19  ? 29.164  -30.436 220.452 1.00 108.76 ? 20  VAL C C     1 
ATOM   5350 O O     . VAL K 3 19  ? 28.746  -29.287 220.484 1.00 110.35 ? 20  VAL C O     1 
ATOM   5351 C CB    . VAL K 3 19  ? 30.938  -29.981 222.118 1.00 113.52 ? 20  VAL C CB    1 
ATOM   5352 C CG1   . VAL K 3 19  ? 32.185  -30.566 222.763 1.00 117.67 ? 20  VAL C CG1   1 
ATOM   5353 C CG2   . VAL K 3 19  ? 31.148  -28.508 221.825 1.00 113.50 ? 20  VAL C CG2   1 
ATOM   5354 N N     . LYS K 3 20  ? 28.403  -31.470 220.112 1.00 107.93 ? 21  LYS C N     1 
ATOM   5355 C CA    . LYS K 3 20  ? 26.998  -31.300 219.747 1.00 111.73 ? 21  LYS C CA    1 
ATOM   5356 C C     . LYS K 3 20  ? 26.273  -30.337 220.686 1.00 117.17 ? 21  LYS C C     1 
ATOM   5357 O O     . LYS K 3 20  ? 26.611  -30.237 221.866 1.00 119.88 ? 21  LYS C O     1 
ATOM   5358 C CB    . LYS K 3 20  ? 26.293  -32.654 219.759 1.00 107.93 ? 21  LYS C CB    1 
ATOM   5359 N N     . ARG K 3 21  ? 25.275  -29.632 220.160 1.00 121.85 ? 22  ARG C N     1 
ATOM   5360 C CA    . ARG K 3 21  ? 24.508  -28.675 220.956 1.00 126.71 ? 22  ARG C CA    1 
ATOM   5361 C C     . ARG K 3 21  ? 23.860  -29.364 222.150 1.00 129.92 ? 22  ARG C C     1 
ATOM   5362 O O     . ARG K 3 21  ? 23.538  -30.551 222.090 1.00 130.66 ? 22  ARG C O     1 
ATOM   5363 C CB    . ARG K 3 21  ? 23.427  -28.008 220.097 1.00 128.23 ? 22  ARG C CB    1 
ATOM   5364 C CG    . ARG K 3 21  ? 22.133  -28.809 219.919 1.00 128.64 ? 22  ARG C CG    1 
ATOM   5365 C CD    . ARG K 3 21  ? 22.366  -30.219 219.380 1.00 128.67 ? 22  ARG C CD    1 
ATOM   5366 N NE    . ARG K 3 21  ? 21.107  -30.924 219.141 1.00 126.00 ? 22  ARG C NE    1 
ATOM   5367 C CZ    . ARG K 3 21  ? 21.003  -32.239 218.975 1.00 125.34 ? 22  ARG C CZ    1 
ATOM   5368 N NH1   . ARG K 3 21  ? 22.084  -33.001 219.026 1.00 124.49 ? 22  ARG C NH1   1 
ATOM   5369 N NH2   . ARG K 3 21  ? 19.818  -32.794 218.752 1.00 125.85 ? 22  ARG C NH2   1 
ATOM   5370 N N     . PRO K 3 22  ? 23.659  -28.628 223.253 1.00 132.19 ? 23  PRO C N     1 
ATOM   5371 C CA    . PRO K 3 22  ? 23.046  -29.182 224.464 1.00 137.17 ? 23  PRO C CA    1 
ATOM   5372 C C     . PRO K 3 22  ? 21.690  -29.886 224.262 1.00 141.92 ? 23  PRO C C     1 
ATOM   5373 O O     . PRO K 3 22  ? 20.635  -29.289 224.484 1.00 145.86 ? 23  PRO C O     1 
ATOM   5374 C CB    . PRO K 3 22  ? 22.948  -27.961 225.377 1.00 133.08 ? 23  PRO C CB    1 
ATOM   5375 C CG    . PRO K 3 22  ? 24.177  -27.194 225.004 1.00 131.20 ? 23  PRO C CG    1 
ATOM   5376 C CD    . PRO K 3 22  ? 24.131  -27.254 223.494 1.00 130.88 ? 23  PRO C CD    1 
ATOM   5377 N N     . LYS K 3 23  ? 21.734  -31.156 223.853 1.00 141.83 ? 24  LYS C N     1 
ATOM   5378 C CA    . LYS K 3 23  ? 20.536  -31.972 223.627 1.00 141.49 ? 24  LYS C CA    1 
ATOM   5379 C C     . LYS K 3 23  ? 19.373  -31.224 222.959 1.00 143.26 ? 24  LYS C C     1 
ATOM   5380 O O     . LYS K 3 23  ? 18.342  -30.975 223.589 1.00 144.00 ? 24  LYS C O     1 
ATOM   5381 C CB    . LYS K 3 23  ? 20.062  -32.580 224.954 1.00 135.64 ? 24  LYS C CB    1 
ATOM   5382 N N     . SER K 3 24  ? 19.548  -30.879 221.684 1.00 145.07 ? 25  SER C N     1 
ATOM   5383 C CA    . SER K 3 24  ? 18.534  -30.162 220.902 1.00 147.33 ? 25  SER C CA    1 
ATOM   5384 C C     . SER K 3 24  ? 18.226  -28.752 221.434 1.00 151.48 ? 25  SER C C     1 
ATOM   5385 O O     . SER K 3 24  ? 17.464  -27.999 220.817 1.00 152.68 ? 25  SER C O     1 
ATOM   5386 C CB    . SER K 3 24  ? 17.238  -30.986 220.835 1.00 142.32 ? 25  SER C CB    1 
ATOM   5387 O OG    . SER K 3 24  ? 17.468  -32.277 220.292 1.00 133.66 ? 25  SER C OG    1 
ATOM   5388 N N     . GLY K 3 25  ? 18.828  -28.399 222.571 1.00 152.50 ? 26  GLY C N     1 
ATOM   5389 C CA    . GLY K 3 25  ? 18.606  -27.094 223.179 1.00 147.63 ? 26  GLY C CA    1 
ATOM   5390 C C     . GLY K 3 25  ? 19.166  -25.924 222.391 1.00 144.70 ? 26  GLY C C     1 
ATOM   5391 O O     . GLY K 3 25  ? 19.772  -26.107 221.336 1.00 144.60 ? 26  GLY C O     1 
ATOM   5392 N N     . THR K 3 26  ? 18.965  -24.714 222.902 1.00 141.38 ? 27  THR C N     1 
ATOM   5393 C CA    . THR K 3 26  ? 19.453  -23.515 222.230 1.00 137.62 ? 27  THR C CA    1 
ATOM   5394 C C     . THR K 3 26  ? 20.893  -23.220 222.648 1.00 134.95 ? 27  THR C C     1 
ATOM   5395 O O     . THR K 3 26  ? 21.388  -23.793 223.623 1.00 137.78 ? 27  THR C O     1 
ATOM   5396 C CB    . THR K 3 26  ? 18.575  -22.303 222.568 1.00 137.60 ? 27  THR C CB    1 
ATOM   5397 O OG1   . THR K 3 26  ? 19.025  -21.158 221.832 1.00 135.05 ? 27  THR C OG1   1 
ATOM   5398 C CG2   . THR K 3 26  ? 18.635  -22.014 224.061 1.00 136.51 ? 27  THR C CG2   1 
ATOM   5399 N N     . LEU K 3 27  ? 21.551  -22.321 221.912 1.00 128.75 ? 28  LEU C N     1 
ATOM   5400 C CA    . LEU K 3 27  ? 22.949  -21.932 222.168 1.00 118.56 ? 28  LEU C CA    1 
ATOM   5401 C C     . LEU K 3 27  ? 23.031  -20.564 222.857 1.00 110.61 ? 28  LEU C C     1 
ATOM   5402 O O     . LEU K 3 27  ? 23.542  -19.596 222.285 1.00 101.52 ? 28  LEU C O     1 
ATOM   5403 C CB    . LEU K 3 27  ? 23.708  -21.875 220.841 1.00 116.70 ? 28  LEU C CB    1 
ATOM   5404 C CG    . LEU K 3 27  ? 23.319  -22.918 219.789 1.00 108.50 ? 28  LEU C CG    1 
ATOM   5405 C CD1   . LEU K 3 27  ? 24.121  -22.656 218.532 1.00 106.67 ? 28  LEU C CD1   1 
ATOM   5406 C CD2   . LEU K 3 27  ? 23.563  -24.323 220.308 1.00 100.51 ? 28  LEU C CD2   1 
ATOM   5407 N N     . SER K 3 28  ? 22.545  -20.512 224.096 1.00 107.01 ? 29  SER C N     1 
ATOM   5408 C CA    . SER K 3 28  ? 22.498  -19.279 224.884 1.00 101.57 ? 29  SER C CA    1 
ATOM   5409 C C     . SER K 3 28  ? 23.006  -19.437 226.327 1.00 96.95  ? 29  SER C C     1 
ATOM   5410 O O     . SER K 3 28  ? 22.642  -20.388 227.021 1.00 93.63  ? 29  SER C O     1 
ATOM   5411 C CB    . SER K 3 28  ? 21.053  -18.759 224.929 1.00 102.39 ? 29  SER C CB    1 
ATOM   5412 O OG    . SER K 3 28  ? 20.472  -18.668 223.633 1.00 104.72 ? 29  SER C OG    1 
ATOM   5413 N N     . GLY K 3 29  ? 23.826  -18.486 226.771 1.00 92.10  ? 30  GLY C N     1 
ATOM   5414 C CA    . GLY K 3 29  ? 24.367  -18.513 228.117 1.00 85.05  ? 30  GLY C CA    1 
ATOM   5415 C C     . GLY K 3 29  ? 25.072  -19.804 228.485 1.00 85.17  ? 30  GLY C C     1 
ATOM   5416 O O     . GLY K 3 29  ? 25.845  -20.344 227.700 1.00 69.39  ? 30  GLY C O     1 
ATOM   5417 N N     . HIS K 3 30  ? 24.794  -20.293 229.691 1.00 97.03  ? 31  HIS C N     1 
ATOM   5418 C CA    . HIS K 3 30  ? 25.381  -21.528 230.223 1.00 107.65 ? 31  HIS C CA    1 
ATOM   5419 C C     . HIS K 3 30  ? 25.138  -22.764 229.350 1.00 111.78 ? 31  HIS C C     1 
ATOM   5420 O O     . HIS K 3 30  ? 25.625  -23.853 229.665 1.00 112.36 ? 31  HIS C O     1 
ATOM   5421 C CB    . HIS K 3 30  ? 24.830  -21.807 231.633 1.00 111.30 ? 31  HIS C CB    1 
ATOM   5422 C CG    . HIS K 3 30  ? 25.306  -20.847 232.684 1.00 113.05 ? 31  HIS C CG    1 
ATOM   5423 N ND1   . HIS K 3 30  ? 25.061  -19.491 232.626 1.00 113.91 ? 31  HIS C ND1   1 
ATOM   5424 C CD2   . HIS K 3 30  ? 25.995  -21.054 233.832 1.00 113.52 ? 31  HIS C CD2   1 
ATOM   5425 C CE1   . HIS K 3 30  ? 25.577  -18.907 233.694 1.00 113.81 ? 31  HIS C CE1   1 
ATOM   5426 N NE2   . HIS K 3 30  ? 26.149  -19.833 234.442 1.00 109.78 ? 31  HIS C NE2   1 
ATOM   5427 N N     . ALA K 3 31  ? 24.377  -22.593 228.270 1.00 118.09 ? 32  ALA C N     1 
ATOM   5428 C CA    . ALA K 3 31  ? 24.052  -23.693 227.355 1.00 121.90 ? 32  ALA C CA    1 
ATOM   5429 C C     . ALA K 3 31  ? 24.728  -23.516 226.001 1.00 122.86 ? 32  ALA C C     1 
ATOM   5430 O O     . ALA K 3 31  ? 24.365  -24.175 225.027 1.00 125.11 ? 32  ALA C O     1 
ATOM   5431 C CB    . ALA K 3 31  ? 22.537  -23.785 227.164 1.00 121.23 ? 32  ALA C CB    1 
ATOM   5432 N N     . ALA K 3 32  ? 25.706  -22.621 225.940 1.00 120.78 ? 33  ALA C N     1 
ATOM   5433 C CA    . ALA K 3 32  ? 26.412  -22.370 224.695 1.00 116.45 ? 33  ALA C CA    1 
ATOM   5434 C C     . ALA K 3 32  ? 27.798  -22.987 224.744 1.00 114.03 ? 33  ALA C C     1 
ATOM   5435 O O     . ALA K 3 32  ? 27.953  -24.198 224.598 1.00 114.48 ? 33  ALA C O     1 
ATOM   5436 C CB    . ALA K 3 32  ? 26.508  -20.874 224.441 1.00 117.14 ? 33  ALA C CB    1 
ATOM   5437 N N     . GLY K 3 33  ? 28.804  -22.150 224.959 1.00 112.56 ? 34  GLY C N     1 
ATOM   5438 C CA    . GLY K 3 33  ? 30.167  -22.638 225.016 1.00 113.36 ? 34  GLY C CA    1 
ATOM   5439 C C     . GLY K 3 33  ? 30.527  -23.301 226.329 1.00 116.08 ? 34  GLY C C     1 
ATOM   5440 O O     . GLY K 3 33  ? 31.628  -23.825 226.476 1.00 117.39 ? 34  GLY C O     1 
ATOM   5441 N N     . GLU K 3 34  ? 29.603  -23.283 227.284 1.00 116.53 ? 35  GLU C N     1 
ATOM   5442 C CA    . GLU K 3 34  ? 29.834  -23.890 228.591 1.00 116.78 ? 35  GLU C CA    1 
ATOM   5443 C C     . GLU K 3 34  ? 30.660  -25.173 228.483 1.00 116.41 ? 35  GLU C C     1 
ATOM   5444 O O     . GLU K 3 34  ? 31.695  -25.315 229.134 1.00 115.36 ? 35  GLU C O     1 
ATOM   5445 C CB    . GLU K 3 34  ? 28.494  -24.194 229.270 1.00 120.26 ? 35  GLU C CB    1 
ATOM   5446 C CG    . GLU K 3 34  ? 28.598  -24.778 230.675 1.00 122.44 ? 35  GLU C CG    1 
ATOM   5447 C CD    . GLU K 3 34  ? 28.976  -23.740 231.718 1.00 121.04 ? 35  GLU C CD    1 
ATOM   5448 O OE1   . GLU K 3 34  ? 30.076  -23.160 231.629 1.00 119.27 ? 35  GLU C OE1   1 
ATOM   5449 O OE2   . GLU K 3 34  ? 28.160  -23.500 232.628 1.00 122.07 ? 35  GLU C OE2   1 
ATOM   5450 N N     . PRO K 3 35  ? 30.215  -26.126 227.652 1.00 117.11 ? 36  PRO C N     1 
ATOM   5451 C CA    . PRO K 3 35  ? 30.955  -27.383 227.497 1.00 116.19 ? 36  PRO C CA    1 
ATOM   5452 C C     . PRO K 3 35  ? 32.408  -27.163 227.101 1.00 111.10 ? 36  PRO C C     1 
ATOM   5453 O O     . PRO K 3 35  ? 33.306  -27.829 227.608 1.00 110.68 ? 36  PRO C O     1 
ATOM   5454 C CB    . PRO K 3 35  ? 30.169  -28.115 226.413 1.00 122.04 ? 36  PRO C CB    1 
ATOM   5455 C CG    . PRO K 3 35  ? 28.767  -27.625 226.635 1.00 124.57 ? 36  PRO C CG    1 
ATOM   5456 C CD    . PRO K 3 35  ? 28.983  -26.145 226.845 1.00 121.59 ? 36  PRO C CD    1 
ATOM   5457 N N     . PHE K 3 36  ? 32.633  -26.225 226.190 1.00 107.65 ? 37  PHE C N     1 
ATOM   5458 C CA    . PHE K 3 36  ? 33.982  -25.929 225.735 1.00 108.96 ? 37  PHE C CA    1 
ATOM   5459 C C     . PHE K 3 36  ? 34.913  -25.640 226.900 1.00 106.40 ? 37  PHE C C     1 
ATOM   5460 O O     . PHE K 3 36  ? 36.110  -25.888 226.821 1.00 109.56 ? 37  PHE C O     1 
ATOM   5461 C CB    . PHE K 3 36  ? 33.973  -24.741 224.772 1.00 111.27 ? 37  PHE C CB    1 
ATOM   5462 C CG    . PHE K 3 36  ? 33.610  -25.108 223.358 1.00 112.86 ? 37  PHE C CG    1 
ATOM   5463 C CD1   . PHE K 3 36  ? 32.743  -24.311 222.622 1.00 112.51 ? 37  PHE C CD1   1 
ATOM   5464 C CD2   . PHE K 3 36  ? 34.161  -26.230 222.750 1.00 110.51 ? 37  PHE C CD2   1 
ATOM   5465 C CE1   . PHE K 3 36  ? 32.432  -24.621 221.305 1.00 108.62 ? 37  PHE C CE1   1 
ATOM   5466 C CE2   . PHE K 3 36  ? 33.856  -26.547 221.431 1.00 109.88 ? 37  PHE C CE2   1 
ATOM   5467 C CZ    . PHE K 3 36  ? 32.991  -25.740 220.710 1.00 110.70 ? 37  PHE C CZ    1 
ATOM   5468 N N     . GLU K 3 37  ? 34.367  -25.113 227.986 1.00 104.46 ? 38  GLU C N     1 
ATOM   5469 C CA    . GLU K 3 37  ? 35.180  -24.811 229.149 1.00 102.62 ? 38  GLU C CA    1 
ATOM   5470 C C     . GLU K 3 37  ? 35.855  -26.094 229.611 1.00 102.40 ? 38  GLU C C     1 
ATOM   5471 O O     . GLU K 3 37  ? 37.029  -26.097 229.983 1.00 99.35  ? 38  GLU C O     1 
ATOM   5472 C CB    . GLU K 3 37  ? 34.303  -24.282 230.267 1.00 105.62 ? 38  GLU C CB    1 
ATOM   5473 C CG    . GLU K 3 37  ? 35.080  -23.827 231.473 1.00 119.95 ? 38  GLU C CG    1 
ATOM   5474 C CD    . GLU K 3 37  ? 34.227  -23.785 232.719 1.00 128.71 ? 38  GLU C CD    1 
ATOM   5475 O OE1   . GLU K 3 37  ? 34.640  -23.122 233.694 1.00 134.87 ? 38  GLU C OE1   1 
ATOM   5476 O OE2   . GLU K 3 37  ? 33.149  -24.426 232.726 1.00 133.51 ? 38  GLU C OE2   1 
ATOM   5477 N N     . LYS K 3 38  ? 35.089  -27.182 229.579 1.00 102.78 ? 39  LYS C N     1 
ATOM   5478 C CA    . LYS K 3 38  ? 35.563  -28.493 229.993 1.00 103.58 ? 39  LYS C CA    1 
ATOM   5479 C C     . LYS K 3 38  ? 36.676  -28.990 229.087 1.00 109.34 ? 39  LYS C C     1 
ATOM   5480 O O     . LYS K 3 38  ? 37.537  -29.760 229.508 1.00 107.97 ? 39  LYS C O     1 
ATOM   5481 C CB    . LYS K 3 38  ? 34.405  -29.493 229.986 1.00 100.51 ? 39  LYS C CB    1 
ATOM   5482 N N     . LEU K 3 39  ? 36.657  -28.552 227.834 1.00 119.01 ? 40  LEU C N     1 
ATOM   5483 C CA    . LEU K 3 39  ? 37.684  -28.962 226.879 1.00 125.78 ? 40  LEU C CA    1 
ATOM   5484 C C     . LEU K 3 39  ? 38.992  -28.202 227.115 1.00 127.36 ? 40  LEU C C     1 
ATOM   5485 O O     . LEU K 3 39  ? 40.069  -28.688 226.769 1.00 130.70 ? 40  LEU C O     1 
ATOM   5486 C CB    . LEU K 3 39  ? 37.199  -28.731 225.443 1.00 126.26 ? 40  LEU C CB    1 
ATOM   5487 C CG    . LEU K 3 39  ? 36.065  -29.608 224.905 1.00 124.86 ? 40  LEU C CG    1 
ATOM   5488 C CD1   . LEU K 3 39  ? 34.811  -29.458 225.757 1.00 119.17 ? 40  LEU C CD1   1 
ATOM   5489 C CD2   . LEU K 3 39  ? 35.783  -29.215 223.460 1.00 124.50 ? 40  LEU C CD2   1 
ATOM   5490 N N     . VAL K 3 40  ? 38.888  -27.012 227.702 1.00 125.88 ? 41  VAL C N     1 
ATOM   5491 C CA    . VAL K 3 40  ? 40.050  -26.187 227.994 1.00 121.09 ? 41  VAL C CA    1 
ATOM   5492 C C     . VAL K 3 40  ? 40.692  -26.643 229.295 1.00 124.00 ? 41  VAL C C     1 
ATOM   5493 O O     . VAL K 3 40  ? 41.914  -26.705 229.406 1.00 127.07 ? 41  VAL C O     1 
ATOM   5494 C CB    . VAL K 3 40  ? 39.653  -24.718 228.109 1.00 115.57 ? 41  VAL C CB    1 
ATOM   5495 C CG1   . VAL K 3 40  ? 40.820  -23.890 228.606 1.00 118.19 ? 41  VAL C CG1   1 
ATOM   5496 C CG2   . VAL K 3 40  ? 39.197  -24.228 226.764 1.00 112.87 ? 41  VAL C CG2   1 
ATOM   5497 N N     . TYR K 3 41  ? 39.862  -26.962 230.281 1.00 124.95 ? 42  TYR C N     1 
ATOM   5498 C CA    . TYR K 3 41  ? 40.359  -27.438 231.567 1.00 126.08 ? 42  TYR C CA    1 
ATOM   5499 C C     . TYR K 3 41  ? 41.078  -28.775 231.406 1.00 127.24 ? 42  TYR C C     1 
ATOM   5500 O O     . TYR K 3 41  ? 42.115  -29.000 232.026 1.00 128.35 ? 42  TYR C O     1 
ATOM   5501 C CB    . TYR K 3 41  ? 39.205  -27.611 232.551 1.00 128.59 ? 42  TYR C CB    1 
ATOM   5502 C CG    . TYR K 3 41  ? 39.579  -28.338 233.825 1.00 126.56 ? 42  TYR C CG    1 
ATOM   5503 C CD1   . TYR K 3 41  ? 40.561  -27.833 234.676 1.00 126.23 ? 42  TYR C CD1   1 
ATOM   5504 C CD2   . TYR K 3 41  ? 38.921  -29.511 234.199 1.00 124.81 ? 42  TYR C CD2   1 
ATOM   5505 C CE1   . TYR K 3 41  ? 40.877  -28.473 235.873 1.00 126.56 ? 42  TYR C CE1   1 
ATOM   5506 C CE2   . TYR K 3 41  ? 39.227  -30.160 235.393 1.00 126.37 ? 42  TYR C CE2   1 
ATOM   5507 C CZ    . TYR K 3 41  ? 40.205  -29.634 236.228 1.00 127.77 ? 42  TYR C CZ    1 
ATOM   5508 O OH    . TYR K 3 41  ? 40.499  -30.259 237.423 1.00 124.81 ? 42  TYR C OH    1 
ATOM   5509 N N     . LYS K 3 42  ? 40.515  -29.659 230.582 1.00 125.26 ? 43  LYS C N     1 
ATOM   5510 C CA    . LYS K 3 42  ? 41.102  -30.971 230.337 1.00 120.44 ? 43  LYS C CA    1 
ATOM   5511 C C     . LYS K 3 42  ? 42.438  -30.821 229.630 1.00 121.29 ? 43  LYS C C     1 
ATOM   5512 O O     . LYS K 3 42  ? 43.365  -31.585 229.876 1.00 121.79 ? 43  LYS C O     1 
ATOM   5513 C CB    . LYS K 3 42  ? 40.167  -31.824 229.481 1.00 117.60 ? 43  LYS C CB    1 
ATOM   5514 N N     . PHE K 3 43  ? 42.533  -29.833 228.748 1.00 125.62 ? 44  PHE C N     1 
ATOM   5515 C CA    . PHE K 3 43  ? 43.766  -29.587 228.012 1.00 129.05 ? 44  PHE C CA    1 
ATOM   5516 C C     . PHE K 3 43  ? 44.783  -28.881 228.904 1.00 130.70 ? 44  PHE C C     1 
ATOM   5517 O O     . PHE K 3 43  ? 45.986  -29.088 228.758 1.00 133.62 ? 44  PHE C O     1 
ATOM   5518 C CB    . PHE K 3 43  ? 43.485  -28.740 226.768 1.00 132.16 ? 44  PHE C CB    1 
ATOM   5519 N N     . LEU K 3 44  ? 44.291  -28.049 229.822 1.00 129.33 ? 45  LEU C N     1 
ATOM   5520 C CA    . LEU K 3 44  ? 45.147  -27.321 230.754 1.00 128.93 ? 45  LEU C CA    1 
ATOM   5521 C C     . LEU K 3 44  ? 45.745  -28.254 231.788 1.00 135.07 ? 45  LEU C C     1 
ATOM   5522 O O     . LEU K 3 44  ? 46.666  -27.881 232.512 1.00 139.63 ? 45  LEU C O     1 
ATOM   5523 C CB    . LEU K 3 44  ? 44.359  -26.237 231.474 1.00 121.20 ? 45  LEU C CB    1 
ATOM   5524 C CG    . LEU K 3 44  ? 44.158  -24.959 230.675 1.00 120.89 ? 45  LEU C CG    1 
ATOM   5525 C CD1   . LEU K 3 44  ? 43.125  -24.091 231.366 1.00 119.46 ? 45  LEU C CD1   1 
ATOM   5526 C CD2   . LEU K 3 44  ? 45.487  -24.232 230.535 1.00 113.77 ? 45  LEU C CD2   1 
ATOM   5527 N N     . LYS K 3 45  ? 45.203  -29.464 231.870 1.00 140.73 ? 46  LYS C N     1 
ATOM   5528 C CA    . LYS K 3 45  ? 45.706  -30.458 232.807 1.00 143.58 ? 46  LYS C CA    1 
ATOM   5529 C C     . LYS K 3 45  ? 46.624  -31.415 232.048 1.00 145.81 ? 46  LYS C C     1 
ATOM   5530 O O     . LYS K 3 45  ? 47.444  -32.110 232.645 1.00 145.33 ? 46  LYS C O     1 
ATOM   5531 C CB    . LYS K 3 45  ? 44.544  -31.227 233.440 1.00 143.14 ? 46  LYS C CB    1 
ATOM   5532 N N     . GLU K 3 46  ? 46.478  -31.434 230.724 1.00 149.51 ? 47  GLU C N     1 
ATOM   5533 C CA    . GLU K 3 46  ? 47.288  -32.283 229.854 1.00 152.85 ? 47  GLU C CA    1 
ATOM   5534 C C     . GLU K 3 46  ? 48.519  -31.517 229.383 1.00 153.53 ? 47  GLU C C     1 
ATOM   5535 O O     . GLU K 3 46  ? 49.046  -31.762 228.294 1.00 151.77 ? 47  GLU C O     1 
ATOM   5536 C CB    . GLU K 3 46  ? 46.473  -32.729 228.639 1.00 154.93 ? 47  GLU C CB    1 
ATOM   5537 N N     . ASN K 3 47  ? 48.965  -30.582 230.215 1.00 152.96 ? 48  ASN C N     1 
ATOM   5538 C CA    . ASN K 3 47  ? 50.132  -29.763 229.915 1.00 152.68 ? 48  ASN C CA    1 
ATOM   5539 C C     . ASN K 3 47  ? 50.565  -28.988 231.158 1.00 151.05 ? 48  ASN C C     1 
ATOM   5540 O O     . ASN K 3 47  ? 51.599  -28.319 231.151 1.00 152.81 ? 48  ASN C O     1 
ATOM   5541 C CB    . ASN K 3 47  ? 49.817  -28.786 228.777 1.00 152.49 ? 48  ASN C CB    1 
ATOM   5542 N N     . LEU K 3 48  ? 49.769  -29.087 232.221 1.00 147.40 ? 49  LEU C N     1 
ATOM   5543 C CA    . LEU K 3 48  ? 50.057  -28.404 233.483 1.00 143.64 ? 49  LEU C CA    1 
ATOM   5544 C C     . LEU K 3 48  ? 49.313  -29.066 234.642 1.00 142.14 ? 49  LEU C C     1 
ATOM   5545 O O     . LEU K 3 48  ? 48.675  -28.392 235.452 1.00 138.35 ? 49  LEU C O     1 
ATOM   5546 C CB    . LEU K 3 48  ? 49.654  -26.928 233.393 1.00 140.58 ? 49  LEU C CB    1 
ATOM   5547 C CG    . LEU K 3 48  ? 50.398  -26.049 232.385 1.00 137.10 ? 49  LEU C CG    1 
ATOM   5548 C CD1   . LEU K 3 48  ? 49.734  -24.690 232.296 1.00 138.79 ? 49  LEU C CD1   1 
ATOM   5549 C CD2   . LEU K 3 48  ? 51.846  -25.906 232.803 1.00 136.91 ? 49  LEU C CD2   1 
ATOM   5550 N N     . SER K 3 49  ? 49.405  -30.390 234.716 1.00 142.22 ? 50  SER C N     1 
ATOM   5551 C CA    . SER K 3 49  ? 48.741  -31.156 235.768 1.00 142.09 ? 50  SER C CA    1 
ATOM   5552 C C     . SER K 3 49  ? 49.532  -31.174 237.078 1.00 141.32 ? 50  SER C C     1 
ATOM   5553 O O     . SER K 3 49  ? 50.020  -32.224 237.501 1.00 139.70 ? 50  SER C O     1 
ATOM   5554 C CB    . SER K 3 49  ? 48.507  -32.591 235.293 1.00 140.54 ? 50  SER C CB    1 
ATOM   5555 N N     . ASP K 3 50  ? 49.650  -30.011 237.717 1.00 138.91 ? 51  ASP C N     1 
ATOM   5556 C CA    . ASP K 3 50  ? 50.377  -29.892 238.981 1.00 135.09 ? 51  ASP C CA    1 
ATOM   5557 C C     . ASP K 3 50  ? 50.209  -28.501 239.588 1.00 132.47 ? 51  ASP C C     1 
ATOM   5558 O O     . ASP K 3 50  ? 50.959  -28.105 240.483 1.00 129.48 ? 51  ASP C O     1 
ATOM   5559 C CB    . ASP K 3 50  ? 51.866  -30.185 238.770 1.00 135.62 ? 51  ASP C CB    1 
ATOM   5560 N N     . LEU K 3 51  ? 49.216  -27.767 239.096 1.00 129.43 ? 52  LEU C N     1 
ATOM   5561 C CA    . LEU K 3 51  ? 48.943  -26.421 239.583 1.00 127.30 ? 52  LEU C CA    1 
ATOM   5562 C C     . LEU K 3 51  ? 47.580  -25.924 239.095 1.00 130.62 ? 52  LEU C C     1 
ATOM   5563 O O     . LEU K 3 51  ? 47.182  -24.795 239.391 1.00 126.15 ? 52  LEU C O     1 
ATOM   5564 C CB    . LEU K 3 51  ? 50.036  -25.463 239.110 1.00 117.43 ? 52  LEU C CB    1 
ATOM   5565 C CG    . LEU K 3 51  ? 50.092  -25.186 237.604 1.00 113.48 ? 52  LEU C CG    1 
ATOM   5566 C CD1   . LEU K 3 51  ? 51.132  -24.120 237.348 1.00 110.85 ? 52  LEU C CD1   1 
ATOM   5567 C CD2   . LEU K 3 51  ? 50.411  -26.451 236.815 1.00 104.00 ? 52  LEU C CD2   1 
ATOM   5568 N N     . THR K 3 52  ? 46.874  -26.777 238.350 1.00 138.27 ? 53  THR C N     1 
ATOM   5569 C CA    . THR K 3 52  ? 45.552  -26.449 237.801 1.00 142.90 ? 53  THR C CA    1 
ATOM   5570 C C     . THR K 3 52  ? 44.385  -27.027 238.617 1.00 145.04 ? 53  THR C C     1 
ATOM   5571 O O     . THR K 3 52  ? 44.100  -28.228 238.558 1.00 142.62 ? 53  THR C O     1 
ATOM   5572 C CB    . THR K 3 52  ? 45.407  -26.950 236.332 1.00 141.67 ? 53  THR C CB    1 
ATOM   5573 O OG1   . THR K 3 52  ? 46.369  -26.297 235.495 1.00 139.60 ? 53  THR C OG1   1 
ATOM   5574 C CG2   . THR K 3 52  ? 44.016  -26.649 235.800 1.00 143.73 ? 53  THR C CG2   1 
ATOM   5575 N N     . PHE K 3 53  ? 43.716  -26.156 239.371 1.00 147.08 ? 54  PHE C N     1 
ATOM   5576 C CA    . PHE K 3 53  ? 42.569  -26.541 240.189 1.00 148.13 ? 54  PHE C CA    1 
ATOM   5577 C C     . PHE K 3 53  ? 41.350  -25.707 239.803 1.00 146.09 ? 54  PHE C C     1 
ATOM   5578 O O     . PHE K 3 53  ? 41.434  -24.484 239.669 1.00 143.60 ? 54  PHE C O     1 
ATOM   5579 C CB    . PHE K 3 53  ? 42.870  -26.349 241.681 1.00 154.07 ? 54  PHE C CB    1 
ATOM   5580 C CG    . PHE K 3 53  ? 43.725  -27.435 242.275 1.00 160.28 ? 54  PHE C CG    1 
ATOM   5581 C CD1   . PHE K 3 53  ? 45.055  -27.582 241.894 1.00 163.42 ? 54  PHE C CD1   1 
ATOM   5582 C CD2   . PHE K 3 53  ? 43.194  -28.323 243.207 1.00 163.41 ? 54  PHE C CD2   1 
ATOM   5583 C CE1   . PHE K 3 53  ? 45.847  -28.598 242.433 1.00 165.42 ? 54  PHE C CE1   1 
ATOM   5584 C CE2   . PHE K 3 53  ? 43.977  -29.344 243.753 1.00 166.18 ? 54  PHE C CE2   1 
ATOM   5585 C CZ    . PHE K 3 53  ? 45.307  -29.481 243.364 1.00 167.07 ? 54  PHE C CZ    1 
ATOM   5586 N N     . LYS K 3 54  ? 40.215  -26.378 239.632 1.00 141.21 ? 55  LYS C N     1 
ATOM   5587 C CA    . LYS K 3 54  ? 38.979  -25.712 239.249 1.00 136.98 ? 55  LYS C CA    1 
ATOM   5588 C C     . LYS K 3 54  ? 38.216  -25.117 240.431 1.00 134.92 ? 55  LYS C C     1 
ATOM   5589 O O     . LYS K 3 54  ? 37.185  -25.651 240.838 1.00 138.11 ? 55  LYS C O     1 
ATOM   5590 C CB    . LYS K 3 54  ? 38.071  -26.691 238.499 1.00 136.98 ? 55  LYS C CB    1 
ATOM   5591 N N     . GLN K 3 55  ? 38.724  -24.017 240.980 1.00 128.32 ? 56  GLN C N     1 
ATOM   5592 C CA    . GLN K 3 55  ? 38.074  -23.331 242.097 1.00 122.11 ? 56  GLN C CA    1 
ATOM   5593 C C     . GLN K 3 55  ? 37.518  -24.241 243.185 1.00 119.48 ? 56  GLN C C     1 
ATOM   5594 O O     . GLN K 3 55  ? 38.198  -24.527 244.163 1.00 115.65 ? 56  GLN C O     1 
ATOM   5595 C CB    . GLN K 3 55  ? 36.953  -22.430 241.563 1.00 122.90 ? 56  GLN C CB    1 
ATOM   5596 C CG    . GLN K 3 55  ? 36.101  -21.744 242.622 1.00 117.56 ? 56  GLN C CG    1 
ATOM   5597 C CD    . GLN K 3 55  ? 36.910  -21.258 243.802 1.00 118.07 ? 56  GLN C CD    1 
ATOM   5598 O OE1   . GLN K 3 55  ? 38.065  -20.868 243.658 1.00 115.18 ? 56  GLN C OE1   1 
ATOM   5599 N NE2   . GLN K 3 55  ? 36.300  -21.263 244.977 1.00 121.29 ? 56  GLN C NE2   1 
ATOM   5600 N N     . TYR K 3 56  ? 36.277  -24.687 243.016 1.00 120.89 ? 57  TYR C N     1 
ATOM   5601 C CA    . TYR K 3 56  ? 35.647  -25.546 244.005 1.00 122.79 ? 57  TYR C CA    1 
ATOM   5602 C C     . TYR K 3 56  ? 36.557  -26.714 244.355 1.00 124.44 ? 57  TYR C C     1 
ATOM   5603 O O     . TYR K 3 56  ? 36.609  -27.139 245.510 1.00 130.37 ? 57  TYR C O     1 
ATOM   5604 C CB    . TYR K 3 56  ? 34.290  -26.064 243.501 1.00 124.63 ? 57  TYR C CB    1 
ATOM   5605 C CG    . TYR K 3 56  ? 34.335  -27.401 242.789 1.00 128.69 ? 57  TYR C CG    1 
ATOM   5606 C CD1   . TYR K 3 56  ? 34.706  -27.495 241.452 1.00 131.11 ? 57  TYR C CD1   1 
ATOM   5607 C CD2   . TYR K 3 56  ? 34.024  -28.580 243.466 1.00 132.81 ? 57  TYR C CD2   1 
ATOM   5608 C CE1   . TYR K 3 56  ? 34.766  -28.733 240.808 1.00 132.36 ? 57  TYR C CE1   1 
ATOM   5609 C CE2   . TYR K 3 56  ? 34.083  -29.820 242.832 1.00 131.73 ? 57  TYR C CE2   1 
ATOM   5610 C CZ    . TYR K 3 56  ? 34.455  -29.889 241.506 1.00 130.42 ? 57  TYR C CZ    1 
ATOM   5611 O OH    . TYR K 3 56  ? 34.526  -31.113 240.886 1.00 128.68 ? 57  TYR C OH    1 
ATOM   5612 N N     . GLU K 3 57  ? 37.276  -27.228 243.360 1.00 121.93 ? 58  GLU C N     1 
ATOM   5613 C CA    . GLU K 3 57  ? 38.191  -28.343 243.586 1.00 118.06 ? 58  GLU C CA    1 
ATOM   5614 C C     . GLU K 3 57  ? 39.370  -27.852 244.422 1.00 118.46 ? 58  GLU C C     1 
ATOM   5615 O O     . GLU K 3 57  ? 39.897  -28.592 245.249 1.00 118.72 ? 58  GLU C O     1 
ATOM   5616 C CB    . GLU K 3 57  ? 38.687  -28.914 242.253 1.00 112.42 ? 58  GLU C CB    1 
ATOM   5617 N N     . TYR K 3 58  ? 39.772  -26.599 244.211 1.00 118.05 ? 59  TYR C N     1 
ATOM   5618 C CA    . TYR K 3 58  ? 40.881  -26.007 244.962 1.00 117.05 ? 59  TYR C CA    1 
ATOM   5619 C C     . TYR K 3 58  ? 40.496  -25.688 246.403 1.00 115.88 ? 59  TYR C C     1 
ATOM   5620 O O     . TYR K 3 58  ? 41.330  -25.761 247.308 1.00 117.08 ? 59  TYR C O     1 
ATOM   5621 C CB    . TYR K 3 58  ? 41.356  -24.717 244.311 1.00 117.36 ? 59  TYR C CB    1 
ATOM   5622 C CG    . TYR K 3 58  ? 42.290  -23.932 245.200 1.00 117.63 ? 59  TYR C CG    1 
ATOM   5623 C CD1   . TYR K 3 58  ? 43.566  -24.408 245.489 1.00 121.33 ? 59  TYR C CD1   1 
ATOM   5624 C CD2   . TYR K 3 58  ? 41.904  -22.705 245.734 1.00 118.66 ? 59  TYR C CD2   1 
ATOM   5625 C CE1   . TYR K 3 58  ? 44.442  -23.678 246.281 1.00 124.64 ? 59  TYR C CE1   1 
ATOM   5626 C CE2   . TYR K 3 58  ? 42.769  -21.965 246.527 1.00 123.98 ? 59  TYR C CE2   1 
ATOM   5627 C CZ    . TYR K 3 58  ? 44.037  -22.455 246.794 1.00 126.71 ? 59  TYR C CZ    1 
ATOM   5628 O OH    . TYR K 3 58  ? 44.908  -21.706 247.545 1.00 128.48 ? 59  TYR C OH    1 
ATOM   5629 N N     . LEU K 3 59  ? 39.241  -25.291 246.600 1.00 110.20 ? 60  LEU C N     1 
ATOM   5630 C CA    . LEU K 3 59  ? 38.752  -24.991 247.931 1.00 99.09  ? 60  LEU C CA    1 
ATOM   5631 C C     . LEU K 3 59  ? 38.561  -26.323 248.642 1.00 101.50 ? 60  LEU C C     1 
ATOM   5632 O O     . LEU K 3 59  ? 38.890  -26.456 249.814 1.00 101.99 ? 60  LEU C O     1 
ATOM   5633 C CB    . LEU K 3 59  ? 37.428  -24.233 247.874 1.00 84.71  ? 60  LEU C CB    1 
ATOM   5634 C CG    . LEU K 3 59  ? 37.418  -22.824 247.280 1.00 81.02  ? 60  LEU C CG    1 
ATOM   5635 C CD1   . LEU K 3 59  ? 36.101  -22.166 247.663 1.00 78.57  ? 60  LEU C CD1   1 
ATOM   5636 C CD2   . LEU K 3 59  ? 38.581  -21.991 247.791 1.00 69.54  ? 60  LEU C CD2   1 
ATOM   5637 N N     . ASN K 3 60  ? 38.042  -27.316 247.928 1.00 102.48 ? 61  ASN C N     1 
ATOM   5638 C CA    . ASN K 3 60  ? 37.842  -28.626 248.520 1.00 108.58 ? 61  ASN C CA    1 
ATOM   5639 C C     . ASN K 3 60  ? 39.188  -29.310 248.798 1.00 113.05 ? 61  ASN C C     1 
ATOM   5640 O O     . ASN K 3 60  ? 39.296  -30.117 249.721 1.00 116.38 ? 61  ASN C O     1 
ATOM   5641 C CB    . ASN K 3 60  ? 36.985  -29.504 247.602 1.00 110.16 ? 61  ASN C CB    1 
ATOM   5642 N N     . ASP K 3 61  ? 40.213  -28.983 248.011 1.00 115.79 ? 62  ASP C N     1 
ATOM   5643 C CA    . ASP K 3 61  ? 41.544  -29.579 248.192 1.00 118.19 ? 62  ASP C CA    1 
ATOM   5644 C C     . ASP K 3 61  ? 42.374  -28.740 249.149 1.00 118.18 ? 62  ASP C C     1 
ATOM   5645 O O     . ASP K 3 61  ? 43.395  -29.197 249.657 1.00 123.25 ? 62  ASP C O     1 
ATOM   5646 C CB    . ASP K 3 61  ? 42.291  -29.681 246.857 1.00 118.75 ? 62  ASP C CB    1 
ATOM   5647 C CG    . ASP K 3 61  ? 43.321  -30.804 246.841 1.00 115.00 ? 62  ASP C CG    1 
ATOM   5648 O OD1   . ASP K 3 61  ? 44.116  -30.922 247.801 1.00 106.25 ? 62  ASP C OD1   1 
ATOM   5649 O OD2   . ASP K 3 61  ? 43.332  -31.568 245.853 1.00 113.10 ? 62  ASP C OD2   1 
ATOM   5650 N N     . LEU K 3 62  ? 41.947  -27.502 249.369 1.00 119.01 ? 63  LEU C N     1 
ATOM   5651 C CA    . LEU K 3 62  ? 42.643  -26.615 250.291 1.00 119.52 ? 63  LEU C CA    1 
ATOM   5652 C C     . LEU K 3 62  ? 42.511  -27.305 251.648 1.00 123.18 ? 63  LEU C C     1 
ATOM   5653 O O     . LEU K 3 62  ? 43.460  -27.366 252.429 1.00 118.95 ? 63  LEU C O     1 
ATOM   5654 C CB    . LEU K 3 62  ? 41.969  -25.236 250.301 1.00 112.85 ? 63  LEU C CB    1 
ATOM   5655 C CG    . LEU K 3 62  ? 42.735  -24.047 250.886 1.00 101.56 ? 63  LEU C CG    1 
ATOM   5656 C CD1   . LEU K 3 62  ? 42.759  -24.104 252.394 1.00 96.14  ? 63  LEU C CD1   1 
ATOM   5657 C CD2   . LEU K 3 62  ? 44.138  -24.048 250.315 1.00 99.36  ? 63  LEU C CD2   1 
ATOM   5658 N N     . PHE K 3 63  ? 41.316  -27.834 251.906 1.00 129.63 ? 64  PHE C N     1 
ATOM   5659 C CA    . PHE K 3 63  ? 41.035  -28.573 253.132 1.00 134.32 ? 64  PHE C CA    1 
ATOM   5660 C C     . PHE K 3 63  ? 41.417  -30.010 252.779 1.00 139.52 ? 64  PHE C C     1 
ATOM   5661 O O     . PHE K 3 63  ? 42.016  -30.244 251.729 1.00 142.91 ? 64  PHE C O     1 
ATOM   5662 C CB    . PHE K 3 63  ? 39.544  -28.510 253.484 1.00 130.64 ? 64  PHE C CB    1 
ATOM   5663 C CG    . PHE K 3 63  ? 38.963  -27.116 253.473 1.00 133.14 ? 64  PHE C CG    1 
ATOM   5664 C CD1   . PHE K 3 63  ? 39.742  -26.008 253.812 1.00 132.34 ? 64  PHE C CD1   1 
ATOM   5665 C CD2   . PHE K 3 63  ? 37.616  -26.917 253.165 1.00 134.84 ? 64  PHE C CD2   1 
ATOM   5666 C CE1   . PHE K 3 63  ? 39.184  -24.723 253.853 1.00 131.49 ? 64  PHE C CE1   1 
ATOM   5667 C CE2   . PHE K 3 63  ? 37.047  -25.638 253.203 1.00 133.21 ? 64  PHE C CE2   1 
ATOM   5668 C CZ    . PHE K 3 63  ? 37.834  -24.539 253.547 1.00 132.64 ? 64  PHE C CZ    1 
ATOM   5669 N N     . MET K 3 64  ? 41.073  -30.974 253.628 1.00 142.69 ? 65  MET C N     1 
ATOM   5670 C CA    . MET K 3 64  ? 41.411  -32.371 253.346 1.00 144.35 ? 65  MET C CA    1 
ATOM   5671 C C     . MET K 3 64  ? 42.929  -32.577 253.389 1.00 145.95 ? 65  MET C C     1 
ATOM   5672 O O     . MET K 3 64  ? 43.414  -33.673 253.694 1.00 145.79 ? 65  MET C O     1 
ATOM   5673 C CB    . MET K 3 64  ? 40.871  -32.773 251.969 1.00 140.38 ? 65  MET C CB    1 
ATOM   5674 C CG    . MET K 3 64  ? 41.287  -34.162 251.516 1.00 140.54 ? 65  MET C CG    1 
ATOM   5675 S SD    . MET K 3 64  ? 40.834  -34.520 249.801 1.00 135.38 ? 65  MET C SD    1 
ATOM   5676 C CE    . MET K 3 64  ? 42.302  -33.948 248.930 1.00 137.90 ? 65  MET C CE    1 
ATOM   5677 N N     . LYS K 3 65  ? 43.667  -31.515 253.068 1.00 144.70 ? 66  LYS C N     1 
ATOM   5678 C CA    . LYS K 3 65  ? 45.124  -31.538 253.080 1.00 140.65 ? 66  LYS C CA    1 
ATOM   5679 C C     . LYS K 3 65  ? 45.574  -31.106 254.470 1.00 141.00 ? 66  LYS C C     1 
ATOM   5680 O O     . LYS K 3 65  ? 46.770  -31.046 254.762 1.00 143.47 ? 66  LYS C O     1 
ATOM   5681 C CB    . LYS K 3 65  ? 45.689  -30.572 252.035 1.00 135.19 ? 66  LYS C CB    1 
ATOM   5682 C CG    . LYS K 3 65  ? 47.189  -30.723 251.831 1.00 132.29 ? 66  LYS C CG    1 
ATOM   5683 C CD    . LYS K 3 65  ? 47.749  -29.793 250.760 1.00 121.82 ? 66  LYS C CD    1 
ATOM   5684 C CE    . LYS K 3 65  ? 47.792  -28.352 251.226 1.00 114.05 ? 66  LYS C CE    1 
ATOM   5685 N NZ    . LYS K 3 65  ? 48.608  -27.511 250.308 1.00 107.11 ? 66  LYS C NZ    1 
ATOM   5686 N N     . ASN K 3 66  ? 44.593  -30.806 255.316 1.00 137.47 ? 67  ASN C N     1 
ATOM   5687 C CA    . ASN K 3 66  ? 44.830  -30.378 256.688 1.00 132.64 ? 67  ASN C CA    1 
ATOM   5688 C C     . ASN K 3 66  ? 43.504  -30.345 257.433 1.00 128.81 ? 67  ASN C C     1 
ATOM   5689 O O     . ASN K 3 66  ? 42.980  -29.276 257.743 1.00 128.79 ? 67  ASN C O     1 
ATOM   5690 C CB    . ASN K 3 66  ? 45.469  -28.991 256.708 1.00 132.15 ? 67  ASN C CB    1 
ATOM   5691 C CG    . ASN K 3 66  ? 44.788  -28.033 255.763 1.00 135.41 ? 67  ASN C CG    1 
ATOM   5692 O OD1   . ASN K 3 66  ? 44.807  -28.231 254.545 1.00 133.67 ? 67  ASN C OD1   1 
ATOM   5693 N ND2   . ASN K 3 66  ? 44.175  -26.988 256.314 1.00 136.03 ? 67  ASN C ND2   1 
ATOM   5694 N N     . PRO K 3 67  ? 42.942  -31.529 257.722 1.00 125.89 ? 68  PRO C N     1 
ATOM   5695 C CA    . PRO K 3 67  ? 41.670  -31.693 258.432 1.00 125.19 ? 68  PRO C CA    1 
ATOM   5696 C C     . PRO K 3 67  ? 41.688  -31.266 259.901 1.00 123.57 ? 68  PRO C C     1 
ATOM   5697 O O     . PRO K 3 67  ? 40.704  -31.448 260.614 1.00 125.31 ? 68  PRO C O     1 
ATOM   5698 C CB    . PRO K 3 67  ? 41.385  -33.184 258.274 1.00 123.70 ? 68  PRO C CB    1 
ATOM   5699 C CG    . PRO K 3 67  ? 42.750  -33.774 258.282 1.00 123.68 ? 68  PRO C CG    1 
ATOM   5700 C CD    . PRO K 3 67  ? 43.493  -32.843 257.350 1.00 124.65 ? 68  PRO C CD    1 
ATOM   5701 N N     . ALA K 3 68  ? 42.800  -30.699 260.354 1.00 120.20 ? 69  ALA C N     1 
ATOM   5702 C CA    . ALA K 3 68  ? 42.898  -30.260 261.739 1.00 116.30 ? 69  ALA C CA    1 
ATOM   5703 C C     . ALA K 3 68  ? 41.912  -29.131 262.012 1.00 117.56 ? 69  ALA C C     1 
ATOM   5704 O O     . ALA K 3 68  ? 40.724  -29.377 262.243 1.00 111.86 ? 69  ALA C O     1 
ATOM   5705 C CB    . ALA K 3 68  ? 44.318  -29.802 262.046 1.00 115.25 ? 69  ALA C CB    1 
ATOM   5706 N N     . ILE K 3 69  ? 42.413  -27.895 261.970 1.00 122.79 ? 70  ILE C N     1 
ATOM   5707 C CA    . ILE K 3 69  ? 41.610  -26.694 262.226 1.00 127.33 ? 70  ILE C CA    1 
ATOM   5708 C C     . ILE K 3 69  ? 40.239  -26.734 261.545 1.00 128.72 ? 70  ILE C C     1 
ATOM   5709 O O     . ILE K 3 69  ? 40.109  -27.173 260.402 1.00 129.92 ? 70  ILE C O     1 
ATOM   5710 C CB    . ILE K 3 69  ? 42.367  -25.392 261.781 1.00 123.75 ? 70  ILE C CB    1 
ATOM   5711 C CG1   . ILE K 3 69  ? 41.605  -24.145 262.247 1.00 122.00 ? 70  ILE C CG1   1 
ATOM   5712 C CG2   . ILE K 3 69  ? 42.513  -25.350 260.268 1.00 121.46 ? 70  ILE C CG2   1 
ATOM   5713 C CD1   . ILE K 3 69  ? 41.530  -23.986 263.761 1.00 120.97 ? 70  ILE C CD1   1 
ATOM   5714 N N     . ILE K 3 70  ? 39.218  -26.287 262.270 1.00 128.48 ? 71  ILE C N     1 
ATOM   5715 C CA    . ILE K 3 70  ? 37.860  -26.253 261.751 1.00 129.10 ? 71  ILE C CA    1 
ATOM   5716 C C     . ILE K 3 70  ? 37.236  -24.912 262.124 1.00 132.28 ? 71  ILE C C     1 
ATOM   5717 O O     . ILE K 3 70  ? 37.947  -23.935 262.364 1.00 132.68 ? 71  ILE C O     1 
ATOM   5718 C CB    . ILE K 3 70  ? 36.987  -27.403 262.331 1.00 126.74 ? 71  ILE C CB    1 
ATOM   5719 C CG1   . ILE K 3 70  ? 36.803  -27.226 263.843 1.00 122.92 ? 71  ILE C CG1   1 
ATOM   5720 C CG2   . ILE K 3 70  ? 37.621  -28.752 262.009 1.00 126.75 ? 71  ILE C CG2   1 
ATOM   5721 C CD1   . ILE K 3 70  ? 38.058  -27.400 264.665 1.00 118.38 ? 71  ILE C CD1   1 
ATOM   5722 N N     . GLY K 3 71  ? 35.909  -24.866 262.171 1.00 135.71 ? 72  GLY C N     1 
ATOM   5723 C CA    . GLY K 3 71  ? 35.231  -23.630 262.521 1.00 136.43 ? 72  GLY C CA    1 
ATOM   5724 C C     . GLY K 3 71  ? 35.309  -22.611 261.407 1.00 135.45 ? 72  GLY C C     1 
ATOM   5725 O O     . GLY K 3 71  ? 36.389  -22.315 260.896 1.00 136.07 ? 72  GLY C O     1 
ATOM   5726 N N     . HIS K 3 72  ? 34.163  -22.063 261.026 1.00 133.40 ? 73  HIS C N     1 
ATOM   5727 C CA    . HIS K 3 72  ? 34.148  -21.085 259.957 1.00 133.73 ? 73  HIS C CA    1 
ATOM   5728 C C     . HIS K 3 72  ? 35.042  -19.888 260.302 1.00 135.36 ? 73  HIS C C     1 
ATOM   5729 O O     . HIS K 3 72  ? 35.790  -19.407 259.453 1.00 138.10 ? 73  HIS C O     1 
ATOM   5730 C CB    . HIS K 3 72  ? 32.715  -20.624 259.687 1.00 131.17 ? 73  HIS C CB    1 
ATOM   5731 C CG    . HIS K 3 72  ? 32.229  -19.590 260.646 1.00 127.97 ? 73  HIS C CG    1 
ATOM   5732 N ND1   . HIS K 3 72  ? 32.228  -19.787 262.008 1.00 125.95 ? 73  HIS C ND1   1 
ATOM   5733 C CD2   . HIS K 3 72  ? 31.785  -18.327 260.444 1.00 124.95 ? 73  HIS C CD2   1 
ATOM   5734 C CE1   . HIS K 3 72  ? 31.810  -18.687 262.607 1.00 127.91 ? 73  HIS C CE1   1 
ATOM   5735 N NE2   . HIS K 3 72  ? 31.536  -17.786 261.680 1.00 126.38 ? 73  HIS C NE2   1 
ATOM   5736 N N     . GLU K 3 73  ? 34.984  -19.421 261.548 1.00 136.51 ? 74  GLU C N     1 
ATOM   5737 C CA    . GLU K 3 73  ? 35.793  -18.272 261.971 1.00 135.66 ? 74  GLU C CA    1 
ATOM   5738 C C     . GLU K 3 73  ? 37.270  -18.616 262.126 1.00 134.16 ? 74  GLU C C     1 
ATOM   5739 O O     . GLU K 3 73  ? 38.108  -17.728 262.296 1.00 127.58 ? 74  GLU C O     1 
ATOM   5740 C CB    . GLU K 3 73  ? 35.265  -17.711 263.296 1.00 136.77 ? 74  GLU C CB    1 
ATOM   5741 N N     . ALA K 3 74  ? 37.574  -19.910 262.057 1.00 135.60 ? 75  ALA C N     1 
ATOM   5742 C CA    . ALA K 3 74  ? 38.939  -20.403 262.203 1.00 137.47 ? 75  ALA C CA    1 
ATOM   5743 C C     . ALA K 3 74  ? 39.448  -21.070 260.926 1.00 136.55 ? 75  ALA C C     1 
ATOM   5744 O O     . ALA K 3 74  ? 40.585  -21.559 260.877 1.00 133.65 ? 75  ALA C O     1 
ATOM   5745 C CB    . ALA K 3 74  ? 39.004  -21.385 263.371 1.00 141.26 ? 75  ALA C CB    1 
ATOM   5746 N N     . ARG K 3 75  ? 38.598  -21.081 259.899 1.00 134.53 ? 76  ARG C N     1 
ATOM   5747 C CA    . ARG K 3 75  ? 38.928  -21.689 258.607 1.00 131.84 ? 76  ARG C CA    1 
ATOM   5748 C C     . ARG K 3 75  ? 39.335  -20.648 257.557 1.00 129.33 ? 76  ARG C C     1 
ATOM   5749 O O     . ARG K 3 75  ? 39.908  -20.988 256.518 1.00 119.94 ? 76  ARG C O     1 
ATOM   5750 C CB    . ARG K 3 75  ? 37.734  -22.504 258.094 1.00 125.42 ? 76  ARG C CB    1 
ATOM   5751 N N     . TYR K 3 76  ? 39.032  -19.382 257.839 1.00 131.40 ? 77  TYR C N     1 
ATOM   5752 C CA    . TYR K 3 76  ? 39.372  -18.289 256.933 1.00 134.83 ? 77  TYR C CA    1 
ATOM   5753 C C     . TYR K 3 76  ? 40.816  -17.850 257.144 1.00 134.79 ? 77  TYR C C     1 
ATOM   5754 O O     . TYR K 3 76  ? 41.277  -16.853 256.583 1.00 127.50 ? 77  TYR C O     1 
ATOM   5755 C CB    . TYR K 3 76  ? 38.423  -17.098 257.134 1.00 140.19 ? 77  TYR C CB    1 
ATOM   5756 C CG    . TYR K 3 76  ? 36.998  -17.358 256.670 1.00 142.86 ? 77  TYR C CG    1 
ATOM   5757 C CD1   . TYR K 3 76  ? 36.748  -18.083 255.502 1.00 143.84 ? 77  TYR C CD1   1 
ATOM   5758 C CD2   . TYR K 3 76  ? 35.901  -16.876 257.390 1.00 140.72 ? 77  TYR C CD2   1 
ATOM   5759 C CE1   . TYR K 3 76  ? 35.448  -18.326 255.066 1.00 139.85 ? 77  TYR C CE1   1 
ATOM   5760 C CE2   . TYR K 3 76  ? 34.595  -17.113 256.957 1.00 135.84 ? 77  TYR C CE2   1 
ATOM   5761 C CZ    . TYR K 3 76  ? 34.382  -17.839 255.797 1.00 137.66 ? 77  TYR C CZ    1 
ATOM   5762 O OH    . TYR K 3 76  ? 33.104  -18.094 255.370 1.00 139.94 ? 77  TYR C OH    1 
ATOM   5763 N N     . LYS K 3 77  ? 41.522  -18.606 257.973 1.00 139.89 ? 78  LYS C N     1 
ATOM   5764 C CA    . LYS K 3 77  ? 42.922  -18.339 258.253 1.00 144.57 ? 78  LYS C CA    1 
ATOM   5765 C C     . LYS K 3 77  ? 43.693  -19.261 257.320 1.00 145.24 ? 78  LYS C C     1 
ATOM   5766 O O     . LYS K 3 77  ? 44.922  -19.224 257.239 1.00 144.28 ? 78  LYS C O     1 
ATOM   5767 C CB    . LYS K 3 77  ? 43.241  -18.674 259.712 1.00 147.39 ? 78  LYS C CB    1 
ATOM   5768 N N     . LEU K 3 78  ? 42.937  -20.089 256.611 1.00 145.86 ? 79  LEU C N     1 
ATOM   5769 C CA    . LEU K 3 78  ? 43.494  -21.042 255.670 1.00 149.20 ? 79  LEU C CA    1 
ATOM   5770 C C     . LEU K 3 78  ? 43.717  -20.384 254.306 1.00 151.12 ? 79  LEU C C     1 
ATOM   5771 O O     . LEU K 3 78  ? 43.994  -21.066 253.315 1.00 150.12 ? 79  LEU C O     1 
ATOM   5772 C CB    . LEU K 3 78  ? 42.540  -22.229 255.541 1.00 154.12 ? 79  LEU C CB    1 
ATOM   5773 C CG    . LEU K 3 78  ? 42.164  -22.906 256.865 1.00 158.04 ? 79  LEU C CG    1 
ATOM   5774 C CD1   . LEU K 3 78  ? 40.954  -23.803 256.663 1.00 159.88 ? 79  LEU C CD1   1 
ATOM   5775 C CD2   . LEU K 3 78  ? 43.348  -23.704 257.396 1.00 161.52 ? 79  LEU C CD2   1 
ATOM   5776 N N     . PHE K 3 79  ? 43.590  -19.056 254.270 1.00 151.79 ? 80  PHE C N     1 
ATOM   5777 C CA    . PHE K 3 79  ? 43.778  -18.269 253.046 1.00 148.96 ? 80  PHE C CA    1 
ATOM   5778 C C     . PHE K 3 79  ? 44.869  -17.210 253.215 1.00 146.37 ? 80  PHE C C     1 
ATOM   5779 O O     . PHE K 3 79  ? 45.177  -16.777 254.326 1.00 144.57 ? 80  PHE C O     1 
ATOM   5780 C CB    . PHE K 3 79  ? 42.464  -17.579 252.631 1.00 150.91 ? 80  PHE C CB    1 
ATOM   5781 C CG    . PHE K 3 79  ? 41.514  -18.468 251.860 1.00 148.87 ? 80  PHE C CG    1 
ATOM   5782 C CD1   . PHE K 3 79  ? 41.861  -18.956 250.605 1.00 148.08 ? 80  PHE C CD1   1 
ATOM   5783 C CD2   . PHE K 3 79  ? 40.278  -18.821 252.394 1.00 146.55 ? 80  PHE C CD2   1 
ATOM   5784 C CE1   . PHE K 3 79  ? 40.991  -19.782 249.895 1.00 146.27 ? 80  PHE C CE1   1 
ATOM   5785 C CE2   . PHE K 3 79  ? 39.403  -19.646 251.690 1.00 144.51 ? 80  PHE C CE2   1 
ATOM   5786 C CZ    . PHE K 3 79  ? 39.761  -20.128 250.440 1.00 143.85 ? 80  PHE C CZ    1 
ATOM   5787 N N     . ASN K 3 80  ? 45.448  -16.795 252.097 1.00 144.22 ? 81  ASN C N     1 
ATOM   5788 C CA    . ASN K 3 80  ? 46.502  -15.795 252.109 1.00 143.79 ? 81  ASN C CA    1 
ATOM   5789 C C     . ASN K 3 80  ? 45.914  -14.401 251.920 1.00 143.31 ? 81  ASN C C     1 
ATOM   5790 O O     . ASN K 3 80  ? 45.394  -14.076 250.851 1.00 149.11 ? 81  ASN C O     1 
ATOM   5791 C CB    . ASN K 3 80  ? 47.506  -16.079 250.990 1.00 143.02 ? 81  ASN C CB    1 
ATOM   5792 C CG    . ASN K 3 80  ? 48.091  -17.471 251.073 1.00 143.00 ? 81  ASN C CG    1 
ATOM   5793 O OD1   . ASN K 3 80  ? 47.360  -18.457 251.098 1.00 143.26 ? 81  ASN C OD1   1 
ATOM   5794 N ND2   . ASN K 3 80  ? 49.416  -17.559 251.109 1.00 143.28 ? 81  ASN C ND2   1 
ATOM   5795 N N     . SER K 3 81  ? 45.990  -13.581 252.962 1.00 135.64 ? 82  SER C N     1 
ATOM   5796 C CA    . SER K 3 81  ? 45.485  -12.214 252.897 1.00 125.44 ? 82  SER C CA    1 
ATOM   5797 C C     . SER K 3 81  ? 43.983  -12.164 252.660 1.00 116.85 ? 82  SER C C     1 
ATOM   5798 O O     . SER K 3 81  ? 43.382  -13.122 252.177 1.00 106.79 ? 82  SER C O     1 
ATOM   5799 C CB    . SER K 3 81  ? 46.212  -11.439 251.785 1.00 127.41 ? 82  SER C CB    1 
ATOM   5800 O OG    . SER K 3 81  ? 45.802  -10.085 251.736 1.00 126.61 ? 82  SER C OG    1 
ATOM   5801 N N     . PRO K 3 82  ? 43.357  -11.034 253.013 1.00 116.22 ? 83  PRO C N     1 
ATOM   5802 C CA    . PRO K 3 82  ? 41.916  -10.833 252.843 1.00 118.21 ? 83  PRO C CA    1 
ATOM   5803 C C     . PRO K 3 82  ? 41.477  -10.967 251.386 1.00 117.93 ? 83  PRO C C     1 
ATOM   5804 O O     . PRO K 3 82  ? 40.407  -11.495 251.090 1.00 117.00 ? 83  PRO C O     1 
ATOM   5805 C CB    . PRO K 3 82  ? 41.708  -9.415  253.366 1.00 117.07 ? 83  PRO C CB    1 
ATOM   5806 C CG    . PRO K 3 82  ? 42.764  -9.288  254.412 1.00 118.49 ? 83  PRO C CG    1 
ATOM   5807 C CD    . PRO K 3 82  ? 43.956  -9.901  253.742 1.00 115.69 ? 83  PRO C CD    1 
ATOM   5808 N N     . THR K 3 83  ? 42.316  -10.472 250.483 1.00 116.80 ? 84  THR C N     1 
ATOM   5809 C CA    . THR K 3 83  ? 42.032  -10.515 249.059 1.00 112.50 ? 84  THR C CA    1 
ATOM   5810 C C     . THR K 3 83  ? 41.590  -11.888 248.581 1.00 110.66 ? 84  THR C C     1 
ATOM   5811 O O     . THR K 3 83  ? 40.416  -12.087 248.288 1.00 108.69 ? 84  THR C O     1 
ATOM   5812 C CB    . THR K 3 83  ? 43.253  -10.066 248.256 1.00 111.27 ? 84  THR C CB    1 
ATOM   5813 O OG1   . THR K 3 83  ? 44.411  -10.759 248.732 1.00 109.14 ? 84  THR C OG1   1 
ATOM   5814 C CG2   . THR K 3 83  ? 43.463  -8.563  248.414 1.00 111.92 ? 84  THR C CG2   1 
ATOM   5815 N N     . LEU K 3 84  ? 42.521  -12.833 248.500 1.00 113.21 ? 85  LEU C N     1 
ATOM   5816 C CA    . LEU K 3 84  ? 42.184  -14.182 248.051 1.00 117.17 ? 85  LEU C CA    1 
ATOM   5817 C C     . LEU K 3 84  ? 40.940  -14.681 248.772 1.00 116.17 ? 85  LEU C C     1 
ATOM   5818 O O     . LEU K 3 84  ? 40.088  -15.340 248.176 1.00 116.46 ? 85  LEU C O     1 
ATOM   5819 C CB    . LEU K 3 84  ? 43.350  -15.143 248.298 1.00 121.91 ? 85  LEU C CB    1 
ATOM   5820 C CG    . LEU K 3 84  ? 44.601  -14.932 247.440 1.00 125.59 ? 85  LEU C CG    1 
ATOM   5821 C CD1   . LEU K 3 84  ? 45.659  -15.959 247.812 1.00 127.74 ? 85  LEU C CD1   1 
ATOM   5822 C CD2   . LEU K 3 84  ? 44.240  -15.053 245.967 1.00 128.52 ? 85  LEU C CD2   1 
ATOM   5823 N N     . LEU K 3 85  ? 40.848  -14.366 250.060 1.00 113.26 ? 86  LEU C N     1 
ATOM   5824 C CA    . LEU K 3 85  ? 39.696  -14.747 250.870 1.00 108.71 ? 86  LEU C CA    1 
ATOM   5825 C C     . LEU K 3 85  ? 38.455  -14.240 250.155 1.00 107.56 ? 86  LEU C C     1 
ATOM   5826 O O     . LEU K 3 85  ? 37.547  -15.003 249.827 1.00 108.56 ? 86  LEU C O     1 
ATOM   5827 C CB    . LEU K 3 85  ? 39.787  -14.080 252.248 1.00 105.80 ? 86  LEU C CB    1 
ATOM   5828 C CG    . LEU K 3 85  ? 38.509  -13.880 253.076 1.00 95.37  ? 86  LEU C CG    1 
ATOM   5829 C CD1   . LEU K 3 85  ? 38.065  -15.204 253.672 1.00 91.41  ? 86  LEU C CD1   1 
ATOM   5830 C CD2   . LEU K 3 85  ? 38.775  -12.862 254.176 1.00 78.21  ? 86  LEU C CD2   1 
ATOM   5831 N N     . PHE K 3 86  ? 38.446  -12.932 249.919 1.00 104.11 ? 87  PHE C N     1 
ATOM   5832 C CA    . PHE K 3 86  ? 37.347  -12.251 249.252 1.00 98.96  ? 87  PHE C CA    1 
ATOM   5833 C C     . PHE K 3 86  ? 37.026  -12.825 247.883 1.00 98.04  ? 87  PHE C C     1 
ATOM   5834 O O     . PHE K 3 86  ? 35.864  -12.882 247.493 1.00 105.01 ? 87  PHE C O     1 
ATOM   5835 C CB    . PHE K 3 86  ? 37.679  -10.769 249.101 1.00 96.34  ? 87  PHE C CB    1 
ATOM   5836 C CG    . PHE K 3 86  ? 36.717  -10.012 248.226 1.00 98.16  ? 87  PHE C CG    1 
ATOM   5837 C CD1   . PHE K 3 86  ? 35.487  -9.590  248.712 1.00 97.71  ? 87  PHE C CD1   1 
ATOM   5838 C CD2   . PHE K 3 86  ? 37.059  -9.688  246.918 1.00 101.12 ? 87  PHE C CD2   1 
ATOM   5839 C CE1   . PHE K 3 86  ? 34.611  -8.852  247.906 1.00 95.71  ? 87  PHE C CE1   1 
ATOM   5840 C CE2   . PHE K 3 86  ? 36.189  -8.952  246.107 1.00 100.93 ? 87  PHE C CE2   1 
ATOM   5841 C CZ    . PHE K 3 86  ? 34.966  -8.533  246.605 1.00 95.56  ? 87  PHE C CZ    1 
ATOM   5842 N N     . LEU K 3 87  ? 38.050  -13.256 247.158 1.00 92.44  ? 88  LEU C N     1 
ATOM   5843 C CA    . LEU K 3 87  ? 37.849  -13.787 245.818 1.00 84.29  ? 88  LEU C CA    1 
ATOM   5844 C C     . LEU K 3 87  ? 37.895  -15.303 245.672 1.00 80.95  ? 88  LEU C C     1 
ATOM   5845 O O     . LEU K 3 87  ? 38.223  -15.795 244.599 1.00 81.38  ? 88  LEU C O     1 
ATOM   5846 C CB    . LEU K 3 87  ? 38.870  -13.153 244.869 1.00 76.72  ? 88  LEU C CB    1 
ATOM   5847 C CG    . LEU K 3 87  ? 38.680  -11.654 244.645 1.00 72.10  ? 88  LEU C CG    1 
ATOM   5848 C CD1   . LEU K 3 87  ? 39.870  -11.042 243.918 1.00 75.20  ? 88  LEU C CD1   1 
ATOM   5849 C CD2   . LEU K 3 87  ? 37.420  -11.455 243.848 1.00 73.68  ? 88  LEU C CD2   1 
ATOM   5850 N N     . LEU K 3 88  ? 37.554  -16.049 246.717 1.00 74.73  ? 89  LEU C N     1 
ATOM   5851 C CA    . LEU K 3 88  ? 37.602  -17.505 246.607 1.00 76.42  ? 89  LEU C CA    1 
ATOM   5852 C C     . LEU K 3 88  ? 36.802  -18.267 247.658 1.00 80.87  ? 89  LEU C C     1 
ATOM   5853 O O     . LEU K 3 88  ? 36.179  -19.287 247.350 1.00 83.08  ? 89  LEU C O     1 
ATOM   5854 C CB    . LEU K 3 88  ? 39.060  -17.984 246.652 1.00 75.16  ? 89  LEU C CB    1 
ATOM   5855 C CG    . LEU K 3 88  ? 39.993  -17.702 245.468 1.00 67.43  ? 89  LEU C CG    1 
ATOM   5856 C CD1   . LEU K 3 88  ? 41.431  -18.158 245.740 1.00 67.62  ? 89  LEU C CD1   1 
ATOM   5857 C CD2   . LEU K 3 88  ? 39.439  -18.432 244.277 1.00 71.51  ? 89  LEU C CD2   1 
ATOM   5858 N N     . SER K 3 89  ? 36.825  -17.778 248.895 1.00 80.77  ? 90  SER C N     1 
ATOM   5859 C CA    . SER K 3 89  ? 36.123  -18.439 249.991 1.00 77.52  ? 90  SER C CA    1 
ATOM   5860 C C     . SER K 3 89  ? 34.623  -18.346 249.866 1.00 73.80  ? 90  SER C C     1 
ATOM   5861 O O     . SER K 3 89  ? 34.079  -17.310 249.498 1.00 66.47  ? 90  SER C O     1 
ATOM   5862 C CB    . SER K 3 89  ? 36.533  -17.841 251.334 1.00 83.46  ? 90  SER C CB    1 
ATOM   5863 O OG    . SER K 3 89  ? 35.912  -16.586 251.539 1.00 85.89  ? 90  SER C OG    1 
ATOM   5864 N N     . ARG K 3 90  ? 33.956  -19.442 250.193 1.00 76.64  ? 91  ARG C N     1 
ATOM   5865 C CA    . ARG K 3 90  ? 32.509  -19.485 250.127 1.00 84.42  ? 91  ARG C CA    1 
ATOM   5866 C C     . ARG K 3 90  ? 31.920  -18.778 251.340 1.00 85.31  ? 91  ARG C C     1 
ATOM   5867 O O     . ARG K 3 90  ? 32.654  -18.281 252.193 1.00 84.62  ? 91  ARG C O     1 
ATOM   5868 C CB    . ARG K 3 90  ? 32.027  -20.939 250.059 1.00 86.40  ? 91  ARG C CB    1 
ATOM   5869 C CG    . ARG K 3 90  ? 32.462  -21.694 248.792 1.00 80.82  ? 91  ARG C CG    1 
ATOM   5870 C CD    . ARG K 3 90  ? 31.893  -21.084 247.502 1.00 75.88  ? 91  ARG C CD    1 
ATOM   5871 N NE    . ARG K 3 90  ? 32.311  -21.847 246.331 1.00 69.71  ? 91  ARG C NE    1 
ATOM   5872 C CZ    . ARG K 3 90  ? 31.929  -23.098 246.084 1.00 66.27  ? 91  ARG C CZ    1 
ATOM   5873 N NH1   . ARG K 3 90  ? 31.117  -23.719 246.920 1.00 64.02  ? 91  ARG C NH1   1 
ATOM   5874 N NH2   . ARG K 3 90  ? 32.370  -23.745 245.014 1.00 63.75  ? 91  ARG C NH2   1 
ATOM   5875 N N     . GLY K 3 91  ? 30.594  -18.733 251.406 1.00 91.00  ? 92  GLY C N     1 
ATOM   5876 C CA    . GLY K 3 91  ? 29.917  -18.069 252.508 1.00 99.71  ? 92  GLY C CA    1 
ATOM   5877 C C     . GLY K 3 91  ? 30.245  -18.666 253.858 1.00 102.57 ? 92  GLY C C     1 
ATOM   5878 O O     . GLY K 3 91  ? 30.793  -19.768 253.925 1.00 107.38 ? 92  GLY C O     1 
ATOM   5879 N N     . LYS K 3 92  ? 29.905  -17.948 254.929 1.00 100.20 ? 93  LYS C N     1 
ATOM   5880 C CA    . LYS K 3 92  ? 30.175  -18.413 256.289 1.00 102.04 ? 93  LYS C CA    1 
ATOM   5881 C C     . LYS K 3 92  ? 29.542  -19.775 256.563 1.00 105.44 ? 93  LYS C C     1 
ATOM   5882 O O     . LYS K 3 92  ? 30.199  -20.679 257.083 1.00 105.38 ? 93  LYS C O     1 
ATOM   5883 C CB    . LYS K 3 92  ? 29.666  -17.393 257.313 1.00 95.24  ? 93  LYS C CB    1 
ATOM   5884 N N     . ALA K 3 93  ? 28.265  -19.914 256.211 1.00 109.36 ? 94  ALA C N     1 
ATOM   5885 C CA    . ALA K 3 93  ? 27.534  -21.168 256.410 1.00 112.00 ? 94  ALA C CA    1 
ATOM   5886 C C     . ALA K 3 93  ? 28.217  -22.309 255.661 1.00 116.48 ? 94  ALA C C     1 
ATOM   5887 O O     . ALA K 3 93  ? 28.388  -23.412 256.187 1.00 111.47 ? 94  ALA C O     1 
ATOM   5888 C CB    . ALA K 3 93  ? 26.095  -21.017 255.921 1.00 105.58 ? 94  ALA C CB    1 
ATOM   5889 N N     . ALA K 3 94  ? 28.596  -22.026 254.420 1.00 123.12 ? 95  ALA C N     1 
ATOM   5890 C CA    . ALA K 3 94  ? 29.259  -23.001 253.575 1.00 124.01 ? 95  ALA C CA    1 
ATOM   5891 C C     . ALA K 3 94  ? 30.573  -23.437 254.205 1.00 124.89 ? 95  ALA C C     1 
ATOM   5892 O O     . ALA K 3 94  ? 30.748  -24.611 254.528 1.00 122.60 ? 95  ALA C O     1 
ATOM   5893 C CB    . ALA K 3 94  ? 29.507  -22.402 252.197 1.00 126.43 ? 95  ALA C CB    1 
ATOM   5894 N N     . THR K 3 95  ? 31.489  -22.487 254.385 1.00 125.61 ? 96  THR C N     1 
ATOM   5895 C CA    . THR K 3 95  ? 32.794  -22.786 254.966 1.00 130.12 ? 96  THR C CA    1 
ATOM   5896 C C     . THR K 3 95  ? 32.694  -23.089 256.459 1.00 137.42 ? 96  THR C C     1 
ATOM   5897 O O     . THR K 3 95  ? 33.648  -22.870 257.203 1.00 142.76 ? 96  THR C O     1 
ATOM   5898 C CB    . THR K 3 95  ? 33.791  -21.620 254.772 1.00 124.11 ? 96  THR C CB    1 
ATOM   5899 O OG1   . THR K 3 95  ? 33.620  -20.655 255.814 1.00 118.64 ? 96  THR C OG1   1 
ATOM   5900 C CG2   . THR K 3 95  ? 33.555  -20.938 253.446 1.00 126.62 ? 96  THR C CG2   1 
ATOM   5901 N N     . GLU K 3 96  ? 31.543  -23.596 256.896 1.00 141.37 ? 97  GLU C N     1 
ATOM   5902 C CA    . GLU K 3 96  ? 31.347  -23.926 258.307 1.00 139.57 ? 97  GLU C CA    1 
ATOM   5903 C C     . GLU K 3 96  ? 31.424  -25.431 258.554 1.00 136.18 ? 97  GLU C C     1 
ATOM   5904 O O     . GLU K 3 96  ? 31.439  -25.877 259.699 1.00 137.48 ? 97  GLU C O     1 
ATOM   5905 C CB    . GLU K 3 96  ? 29.994  -23.397 258.796 1.00 142.69 ? 97  GLU C CB    1 
ATOM   5906 N N     . ASN K 3 97  ? 31.478  -26.214 257.482 1.00 130.14 ? 98  ASN C N     1 
ATOM   5907 C CA    . ASN K 3 97  ? 31.551  -27.657 257.619 1.00 126.08 ? 98  ASN C CA    1 
ATOM   5908 C C     . ASN K 3 97  ? 31.873  -28.333 256.300 1.00 128.61 ? 98  ASN C C     1 
ATOM   5909 O O     . ASN K 3 97  ? 31.021  -28.422 255.420 1.00 129.57 ? 98  ASN C O     1 
ATOM   5910 C CB    . ASN K 3 97  ? 30.229  -28.201 258.152 1.00 121.43 ? 98  ASN C CB    1 
ATOM   5911 C CG    . ASN K 3 97  ? 29.046  -27.758 257.324 1.00 117.70 ? 98  ASN C CG    1 
ATOM   5912 O OD1   . ASN K 3 97  ? 28.611  -26.608 257.397 1.00 110.70 ? 98  ASN C OD1   1 
ATOM   5913 N ND2   . ASN K 3 97  ? 28.522  -28.670 256.518 1.00 118.36 ? 98  ASN C ND2   1 
ATOM   5914 N N     . TRP K 3 98  ? 33.106  -28.812 256.172 1.00 133.66 ? 99  TRP C N     1 
ATOM   5915 C CA    . TRP K 3 98  ? 33.544  -29.490 254.959 1.00 140.32 ? 99  TRP C CA    1 
ATOM   5916 C C     . TRP K 3 98  ? 33.435  -31.008 255.123 1.00 141.62 ? 99  TRP C C     1 
ATOM   5917 O O     . TRP K 3 98  ? 34.280  -31.634 255.769 1.00 138.53 ? 99  TRP C O     1 
ATOM   5918 C CB    . TRP K 3 98  ? 34.992  -29.114 254.633 1.00 146.54 ? 99  TRP C CB    1 
ATOM   5919 C CG    . TRP K 3 98  ? 35.436  -29.607 253.290 1.00 159.08 ? 99  TRP C CG    1 
ATOM   5920 C CD1   . TRP K 3 98  ? 35.165  -29.039 252.075 1.00 160.00 ? 99  TRP C CD1   1 
ATOM   5921 C CD2   . TRP K 3 98  ? 36.182  -30.801 253.017 1.00 167.26 ? 99  TRP C CD2   1 
ATOM   5922 N NE1   . TRP K 3 98  ? 35.690  -29.809 251.063 1.00 165.29 ? 99  TRP C NE1   1 
ATOM   5923 C CE2   . TRP K 3 98  ? 36.316  -30.898 251.613 1.00 169.52 ? 99  TRP C CE2   1 
ATOM   5924 C CE3   . TRP K 3 98  ? 36.740  -31.808 253.823 1.00 169.18 ? 99  TRP C CE3   1 
ATOM   5925 C CZ2   . TRP K 3 98  ? 36.999  -31.956 250.996 1.00 170.98 ? 99  TRP C CZ2   1 
ATOM   5926 C CZ3   . TRP K 3 98  ? 37.417  -32.862 253.208 1.00 166.92 ? 99  TRP C CZ3   1 
ATOM   5927 C CH2   . TRP K 3 98  ? 37.536  -32.927 251.809 1.00 169.03 ? 99  TRP C CH2   1 
ATOM   5928 N N     . SER K 3 99  ? 32.393  -31.592 254.532 1.00 143.80 ? 100 SER C N     1 
ATOM   5929 C CA    . SER K 3 99  ? 32.155  -33.035 254.604 1.00 143.26 ? 100 SER C CA    1 
ATOM   5930 C C     . SER K 3 99  ? 33.068  -33.805 253.661 1.00 144.39 ? 100 SER C C     1 
ATOM   5931 O O     . SER K 3 99  ? 34.228  -34.082 253.982 1.00 143.14 ? 100 SER C O     1 
ATOM   5932 C CB    . SER K 3 99  ? 30.696  -33.349 254.256 1.00 141.86 ? 100 SER C CB    1 
ATOM   5933 N N     . ILE K 3 100 ? 32.528  -34.152 252.495 1.00 143.63 ? 101 ILE C N     1 
ATOM   5934 C CA    . ILE K 3 100 ? 33.278  -34.898 251.491 1.00 141.22 ? 101 ILE C CA    1 
ATOM   5935 C C     . ILE K 3 100 ? 33.257  -34.137 250.166 1.00 140.88 ? 101 ILE C C     1 
ATOM   5936 C CB    . ILE K 3 100 ? 32.671  -36.318 251.274 1.00 137.46 ? 101 ILE C CB    1 
ATOM   5937 C CG1   . ILE K 3 100 ? 32.497  -37.038 252.622 1.00 132.74 ? 101 ILE C CG1   1 
ATOM   5938 C CG2   . ILE K 3 100 ? 33.567  -37.132 250.352 1.00 131.65 ? 101 ILE C CG2   1 
ATOM   5939 C CD1   . ILE K 3 100 ? 33.787  -37.284 253.392 1.00 127.13 ? 101 ILE C CD1   1 
ATOM   5940 N N     . PHE K 3 104 ? 33.234  -29.245 248.809 1.00 109.07 ? 105 PHE C N     1 
ATOM   5941 C CA    . PHE K 3 104 ? 32.604  -28.189 248.028 1.00 104.30 ? 105 PHE C CA    1 
ATOM   5942 C C     . PHE K 3 104 ? 32.190  -28.613 246.625 1.00 108.65 ? 105 PHE C C     1 
ATOM   5943 O O     . PHE K 3 104 ? 32.738  -29.562 246.060 1.00 110.25 ? 105 PHE C O     1 
ATOM   5944 C CB    . PHE K 3 104 ? 33.539  -26.997 247.934 1.00 99.47  ? 105 PHE C CB    1 
ATOM   5945 C CG    . PHE K 3 104 ? 33.499  -26.116 249.133 1.00 100.68 ? 105 PHE C CG    1 
ATOM   5946 C CD1   . PHE K 3 104 ? 32.327  -25.451 249.473 1.00 102.85 ? 105 PHE C CD1   1 
ATOM   5947 C CD2   . PHE K 3 104 ? 34.631  -25.933 249.919 1.00 104.32 ? 105 PHE C CD2   1 
ATOM   5948 C CE1   . PHE K 3 104 ? 32.281  -24.608 250.579 1.00 102.20 ? 105 PHE C CE1   1 
ATOM   5949 C CE2   . PHE K 3 104 ? 34.600  -25.091 251.032 1.00 102.40 ? 105 PHE C CE2   1 
ATOM   5950 C CZ    . PHE K 3 104 ? 33.422  -24.427 251.361 1.00 105.22 ? 105 PHE C CZ    1 
ATOM   5951 N N     . GLU K 3 105 ? 31.216  -27.894 246.068 1.00 112.57 ? 106 GLU C N     1 
ATOM   5952 C CA    . GLU K 3 105 ? 30.703  -28.165 244.722 1.00 112.55 ? 106 GLU C CA    1 
ATOM   5953 C C     . GLU K 3 105 ? 30.778  -26.910 243.850 1.00 111.29 ? 106 GLU C C     1 
ATOM   5954 O O     . GLU K 3 105 ? 30.711  -25.788 244.358 1.00 115.11 ? 106 GLU C O     1 
ATOM   5955 C CB    . GLU K 3 105 ? 29.253  -28.639 244.800 1.00 110.44 ? 106 GLU C CB    1 
ATOM   5956 C CG    . GLU K 3 105 ? 29.063  -29.849 245.672 1.00 109.26 ? 106 GLU C CG    1 
ATOM   5957 C CD    . GLU K 3 105 ? 27.612  -30.149 245.918 1.00 107.04 ? 106 GLU C CD    1 
ATOM   5958 O OE1   . GLU K 3 105 ? 26.891  -30.384 244.928 1.00 110.37 ? 106 GLU C OE1   1 
ATOM   5959 O OE2   . GLU K 3 105 ? 27.194  -30.149 247.097 1.00 106.23 ? 106 GLU C OE2   1 
ATOM   5960 N N     . GLU K 3 106 ? 30.915  -27.103 242.541 1.00 103.01 ? 107 GLU C N     1 
ATOM   5961 C CA    . GLU K 3 106 ? 30.997  -25.982 241.615 1.00 95.26  ? 107 GLU C CA    1 
ATOM   5962 C C     . GLU K 3 106 ? 29.899  -24.970 241.928 1.00 90.05  ? 107 GLU C C     1 
ATOM   5963 O O     . GLU K 3 106 ? 28.725  -25.323 241.947 1.00 90.69  ? 107 GLU C O     1 
ATOM   5964 C CB    . GLU K 3 106 ? 30.848  -26.481 240.177 1.00 91.96  ? 107 GLU C CB    1 
ATOM   5965 N N     . LYS K 3 107 ? 30.287  -23.724 242.193 1.00 87.51  ? 108 LYS C N     1 
ATOM   5966 C CA    . LYS K 3 107 ? 29.326  -22.663 242.497 1.00 85.90  ? 108 LYS C CA    1 
ATOM   5967 C C     . LYS K 3 107 ? 29.102  -21.799 241.249 1.00 87.95  ? 108 LYS C C     1 
ATOM   5968 O O     . LYS K 3 107 ? 30.054  -21.415 240.558 1.00 78.95  ? 108 LYS C O     1 
ATOM   5969 C CB    . LYS K 3 107 ? 29.836  -21.790 243.652 1.00 90.95  ? 108 LYS C CB    1 
ATOM   5970 C CG    . LYS K 3 107 ? 28.788  -20.869 244.281 1.00 88.34  ? 108 LYS C CG    1 
ATOM   5971 C CD    . LYS K 3 107 ? 29.391  -19.941 245.346 1.00 89.40  ? 108 LYS C CD    1 
ATOM   5972 C CE    . LYS K 3 107 ? 28.422  -19.743 246.509 1.00 84.54  ? 108 LYS C CE    1 
ATOM   5973 N NZ    . LYS K 3 107 ? 27.009  -19.609 246.039 1.00 60.44  ? 108 LYS C NZ    1 
ATOM   5974 N N     . GLN K 3 108 ? 27.835  -21.499 240.971 1.00 90.03  ? 109 GLN C N     1 
ATOM   5975 C CA    . GLN K 3 108 ? 27.470  -20.713 239.801 1.00 89.02  ? 109 GLN C CA    1 
ATOM   5976 C C     . GLN K 3 108 ? 28.105  -19.331 239.823 1.00 87.29  ? 109 GLN C C     1 
ATOM   5977 O O     . GLN K 3 108 ? 28.298  -18.723 238.772 1.00 93.82  ? 109 GLN C O     1 
ATOM   5978 C CB    . GLN K 3 108 ? 25.943  -20.569 239.685 1.00 91.78  ? 109 GLN C CB    1 
ATOM   5979 C CG    . GLN K 3 108 ? 25.474  -20.019 238.326 1.00 93.48  ? 109 GLN C CG    1 
ATOM   5980 C CD    . GLN K 3 108 ? 24.104  -19.346 238.377 1.00 96.31  ? 109 GLN C CD    1 
ATOM   5981 O OE1   . GLN K 3 108 ? 23.893  -18.390 239.130 1.00 102.33 ? 109 GLN C OE1   1 
ATOM   5982 N NE2   . GLN K 3 108 ? 23.175  -19.829 237.561 1.00 91.11  ? 109 GLN C NE2   1 
ATOM   5983 N N     . ASN K 3 109 ? 28.436  -18.819 241.001 1.00 77.48  ? 110 ASN C N     1 
ATOM   5984 C CA    . ASN K 3 109 ? 29.041  -17.498 241.046 1.00 73.72  ? 110 ASN C CA    1 
ATOM   5985 C C     . ASN K 3 109 ? 30.507  -17.495 241.448 1.00 73.21  ? 110 ASN C C     1 
ATOM   5986 O O     . ASN K 3 109 ? 30.997  -16.499 241.980 1.00 78.43  ? 110 ASN C O     1 
ATOM   5987 C CB    . ASN K 3 109 ? 28.258  -16.574 241.985 1.00 71.25  ? 110 ASN C CB    1 
ATOM   5988 C CG    . ASN K 3 109 ? 28.246  -17.073 243.406 1.00 75.39  ? 110 ASN C CG    1 
ATOM   5989 O OD1   . ASN K 3 109 ? 27.671  -18.119 243.703 1.00 84.14  ? 110 ASN C OD1   1 
ATOM   5990 N ND2   . ASN K 3 109 ? 28.891  -16.336 244.295 1.00 74.27  ? 110 ASN C ND2   1 
ATOM   5991 N N     . ASP K 3 110 ? 31.223  -18.589 241.209 1.00 70.38  ? 111 ASP C N     1 
ATOM   5992 C CA    . ASP K 3 110 ? 32.639  -18.603 241.577 1.00 73.67  ? 111 ASP C CA    1 
ATOM   5993 C C     . ASP K 3 110 ? 33.384  -17.614 240.717 1.00 75.50  ? 111 ASP C C     1 
ATOM   5994 O O     . ASP K 3 110 ? 33.239  -17.612 239.497 1.00 82.63  ? 111 ASP C O     1 
ATOM   5995 C CB    . ASP K 3 110 ? 33.271  -19.977 241.385 1.00 73.49  ? 111 ASP C CB    1 
ATOM   5996 C CG    . ASP K 3 110 ? 32.873  -20.947 242.458 1.00 76.25  ? 111 ASP C CG    1 
ATOM   5997 O OD1   . ASP K 3 110 ? 32.755  -20.522 243.639 1.00 71.88  ? 111 ASP C OD1   1 
ATOM   5998 O OD2   . ASP K 3 110 ? 32.697  -22.139 242.121 1.00 73.20  ? 111 ASP C OD2   1 
ATOM   5999 N N     . THR K 3 111 ? 34.195  -16.780 241.348 1.00 74.21  ? 112 THR C N     1 
ATOM   6000 C CA    . THR K 3 111 ? 34.951  -15.786 240.607 1.00 75.06  ? 112 THR C CA    1 
ATOM   6001 C C     . THR K 3 111 ? 35.610  -16.336 239.328 1.00 79.38  ? 112 THR C C     1 
ATOM   6002 O O     . THR K 3 111 ? 35.184  -16.018 238.212 1.00 72.70  ? 112 THR C O     1 
ATOM   6003 C CB    . THR K 3 111 ? 36.020  -15.143 241.510 1.00 69.92  ? 112 THR C CB    1 
ATOM   6004 O OG1   . THR K 3 111 ? 35.389  -14.280 242.466 1.00 49.78  ? 112 THR C OG1   1 
ATOM   6005 C CG2   . THR K 3 111 ? 36.987  -14.340 240.681 1.00 73.27  ? 112 THR C CG2   1 
ATOM   6006 N N     . ALA K 3 112 ? 36.635  -17.167 239.491 1.00 82.09  ? 113 ALA C N     1 
ATOM   6007 C CA    . ALA K 3 112 ? 37.346  -17.729 238.347 1.00 89.19  ? 113 ALA C CA    1 
ATOM   6008 C C     . ALA K 3 112 ? 36.877  -19.134 237.955 1.00 94.18  ? 113 ALA C C     1 
ATOM   6009 O O     . ALA K 3 112 ? 36.364  -19.885 238.792 1.00 93.08  ? 113 ALA C O     1 
ATOM   6010 C CB    . ALA K 3 112 ? 38.847  -17.741 238.632 1.00 87.30  ? 113 ALA C CB    1 
ATOM   6011 N N     . ASP K 3 113 ? 37.054  -19.474 236.675 1.00 98.49  ? 114 ASP C N     1 
ATOM   6012 C CA    . ASP K 3 113 ? 36.677  -20.787 236.134 1.00 101.52 ? 114 ASP C CA    1 
ATOM   6013 C C     . ASP K 3 113 ? 37.752  -21.806 236.511 1.00 100.57 ? 114 ASP C C     1 
ATOM   6014 O O     . ASP K 3 113 ? 37.464  -22.846 237.109 1.00 99.74  ? 114 ASP C O     1 
ATOM   6015 C CB    . ASP K 3 113 ? 36.564  -20.747 234.593 1.00 104.53 ? 114 ASP C CB    1 
ATOM   6016 C CG    . ASP K 3 113 ? 35.342  -19.980 234.095 1.00 107.12 ? 114 ASP C CG    1 
ATOM   6017 O OD1   . ASP K 3 113 ? 35.155  -18.814 234.502 1.00 116.69 ? 114 ASP C OD1   1 
ATOM   6018 O OD2   . ASP K 3 113 ? 34.576  -20.538 233.281 1.00 94.97  ? 114 ASP C OD2   1 
ATOM   6019 N N     . ILE K 3 114 ? 38.992  -21.494 236.145 1.00 98.97  ? 115 ILE C N     1 
ATOM   6020 C CA    . ILE K 3 114 ? 40.123  -22.366 236.427 1.00 96.30  ? 115 ILE C CA    1 
ATOM   6021 C C     . ILE K 3 114 ? 41.198  -21.612 237.192 1.00 98.37  ? 115 ILE C C     1 
ATOM   6022 O O     . ILE K 3 114 ? 41.499  -20.456 236.894 1.00 97.23  ? 115 ILE C O     1 
ATOM   6023 C CB    . ILE K 3 114 ? 40.728  -22.930 235.130 1.00 92.71  ? 115 ILE C CB    1 
ATOM   6024 C CG1   . ILE K 3 114 ? 39.684  -23.773 234.395 1.00 87.51  ? 115 ILE C CG1   1 
ATOM   6025 C CG2   . ILE K 3 114 ? 41.940  -23.774 235.449 1.00 90.69  ? 115 ILE C CG2   1 
ATOM   6026 C CD1   . ILE K 3 114 ? 40.093  -24.179 232.997 1.00 92.02  ? 115 ILE C CD1   1 
ATOM   6027 N N     . LEU K 3 115 ? 41.773  -22.285 238.182 1.00 103.63 ? 116 LEU C N     1 
ATOM   6028 C CA    . LEU K 3 115 ? 42.806  -21.697 239.025 1.00 103.24 ? 116 LEU C CA    1 
ATOM   6029 C C     . LEU K 3 115 ? 44.156  -22.387 238.891 1.00 103.85 ? 116 LEU C C     1 
ATOM   6030 O O     . LEU K 3 115 ? 44.268  -23.604 239.059 1.00 98.67  ? 116 LEU C O     1 
ATOM   6031 C CB    . LEU K 3 115 ? 42.365  -21.743 240.492 1.00 104.26 ? 116 LEU C CB    1 
ATOM   6032 C CG    . LEU K 3 115 ? 41.316  -20.749 241.004 1.00 102.52 ? 116 LEU C CG    1 
ATOM   6033 C CD1   . LEU K 3 115 ? 40.836  -21.192 242.378 1.00 100.34 ? 116 LEU C CD1   1 
ATOM   6034 C CD2   . LEU K 3 115 ? 41.907  -19.336 241.065 1.00 97.43  ? 116 LEU C CD2   1 
ATOM   6035 N N     . LEU K 3 116 ? 45.180  -21.593 238.595 1.00 105.23 ? 117 LEU C N     1 
ATOM   6036 C CA    . LEU K 3 116 ? 46.534  -22.113 238.464 1.00 109.38 ? 117 LEU C CA    1 
ATOM   6037 C C     . LEU K 3 116 ? 47.460  -21.334 239.389 1.00 111.26 ? 117 LEU C C     1 
ATOM   6038 O O     . LEU K 3 116 ? 47.449  -20.102 239.398 1.00 106.79 ? 117 LEU C O     1 
ATOM   6039 C CB    . LEU K 3 116 ? 47.023  -22.000 237.018 1.00 110.63 ? 117 LEU C CB    1 
ATOM   6040 C CG    . LEU K 3 116 ? 46.258  -22.815 235.972 1.00 110.27 ? 117 LEU C CG    1 
ATOM   6041 C CD1   . LEU K 3 116 ? 44.972  -22.093 235.617 1.00 114.02 ? 117 LEU C CD1   1 
ATOM   6042 C CD2   . LEU K 3 116 ? 47.113  -22.996 234.728 1.00 112.70 ? 117 LEU C CD2   1 
ATOM   6043 N N     . VAL K 3 117 ? 48.258  -22.059 240.168 1.00 115.67 ? 118 VAL C N     1 
ATOM   6044 C CA    . VAL K 3 117 ? 49.174  -21.424 241.108 1.00 120.98 ? 118 VAL C CA    1 
ATOM   6045 C C     . VAL K 3 117 ? 50.466  -22.208 241.367 1.00 122.52 ? 118 VAL C C     1 
ATOM   6046 O O     . VAL K 3 117 ? 50.505  -23.437 241.251 1.00 118.38 ? 118 VAL C O     1 
ATOM   6047 C CB    . VAL K 3 117 ? 48.464  -21.169 242.464 1.00 123.21 ? 118 VAL C CB    1 
ATOM   6048 C CG1   . VAL K 3 117 ? 48.007  -22.490 243.073 1.00 124.06 ? 118 VAL C CG1   1 
ATOM   6049 C CG2   . VAL K 3 117 ? 49.393  -20.435 243.418 1.00 124.33 ? 118 VAL C CG2   1 
ATOM   6050 N N     . LYS K 3 118 ? 51.522  -21.466 241.703 1.00 124.44 ? 119 LYS C N     1 
ATOM   6051 C CA    . LYS K 3 118 ? 52.831  -22.030 242.017 1.00 126.88 ? 119 LYS C CA    1 
ATOM   6052 C C     . LYS K 3 118 ? 53.324  -21.375 243.308 1.00 131.70 ? 119 LYS C C     1 
ATOM   6053 O O     . LYS K 3 118 ? 54.206  -20.516 243.280 1.00 134.24 ? 119 LYS C O     1 
ATOM   6054 C CB    . LYS K 3 118 ? 53.825  -21.761 240.888 1.00 122.19 ? 119 LYS C CB    1 
ATOM   6055 N N     . ASP K 3 119 ? 52.720  -21.780 244.426 1.00 136.55 ? 120 ASP C N     1 
ATOM   6056 C CA    . ASP K 3 119 ? 53.041  -21.284 245.770 1.00 137.09 ? 120 ASP C CA    1 
ATOM   6057 C C     . ASP K 3 119 ? 52.480  -19.897 246.112 1.00 135.70 ? 120 ASP C C     1 
ATOM   6058 O O     . ASP K 3 119 ? 51.430  -19.787 246.744 1.00 128.23 ? 120 ASP C O     1 
ATOM   6059 C CB    . ASP K 3 119 ? 54.557  -21.291 245.994 1.00 140.95 ? 120 ASP C CB    1 
ATOM   6060 C CG    . ASP K 3 119 ? 54.940  -20.853 247.398 1.00 142.13 ? 120 ASP C CG    1 
ATOM   6061 O OD1   . ASP K 3 119 ? 56.153  -20.730 247.674 1.00 141.06 ? 120 ASP C OD1   1 
ATOM   6062 O OD2   . ASP K 3 119 ? 54.025  -20.635 248.224 1.00 141.69 ? 120 ASP C OD2   1 
ATOM   6063 N N     . GLN K 3 120 ? 53.191  -18.848 245.703 1.00 137.68 ? 121 GLN C N     1 
ATOM   6064 C CA    . GLN K 3 120 ? 52.773  -17.482 245.984 1.00 141.21 ? 121 GLN C CA    1 
ATOM   6065 C C     . GLN K 3 120 ? 52.063  -16.757 244.846 1.00 145.83 ? 121 GLN C C     1 
ATOM   6066 O O     . GLN K 3 120 ? 51.813  -15.558 244.957 1.00 149.12 ? 121 GLN C O     1 
ATOM   6067 C CB    . GLN K 3 120 ? 53.969  -16.629 246.401 1.00 140.67 ? 121 GLN C CB    1 
ATOM   6068 C CG    . GLN K 3 120 ? 54.666  -17.062 247.666 1.00 141.68 ? 121 GLN C CG    1 
ATOM   6069 C CD    . GLN K 3 120 ? 55.723  -16.058 248.098 1.00 147.20 ? 121 GLN C CD    1 
ATOM   6070 O OE1   . GLN K 3 120 ? 56.518  -16.321 248.997 1.00 146.36 ? 121 GLN C OE1   1 
ATOM   6071 N NE2   . GLN K 3 120 ? 55.729  -14.893 247.456 1.00 148.10 ? 121 GLN C NE2   1 
ATOM   6072 N N     . PHE K 3 121 ? 51.752  -17.443 243.749 1.00 148.97 ? 122 PHE C N     1 
ATOM   6073 C CA    . PHE K 3 121 ? 51.057  -16.765 242.650 1.00 151.38 ? 122 PHE C CA    1 
ATOM   6074 C C     . PHE K 3 121 ? 49.904  -17.576 242.065 1.00 150.20 ? 122 PHE C C     1 
ATOM   6075 O O     . PHE K 3 121 ? 50.105  -18.640 241.473 1.00 147.89 ? 122 PHE C O     1 
ATOM   6076 C CB    . PHE K 3 121 ? 52.039  -16.375 241.530 1.00 155.00 ? 122 PHE C CB    1 
ATOM   6077 C CG    . PHE K 3 121 ? 51.484  -15.357 240.542 1.00 155.62 ? 122 PHE C CG    1 
ATOM   6078 C CD1   . PHE K 3 121 ? 50.933  -14.154 240.987 1.00 154.31 ? 122 PHE C CD1   1 
ATOM   6079 C CD2   . PHE K 3 121 ? 51.545  -15.589 239.164 1.00 154.63 ? 122 PHE C CD2   1 
ATOM   6080 C CE1   . PHE K 3 121 ? 50.456  -13.202 240.079 1.00 153.78 ? 122 PHE C CE1   1 
ATOM   6081 C CE2   . PHE K 3 121 ? 51.070  -14.641 238.249 1.00 153.95 ? 122 PHE C CE2   1 
ATOM   6082 C CZ    . PHE K 3 121 ? 50.527  -13.447 238.711 1.00 153.75 ? 122 PHE C CZ    1 
ATOM   6083 N N     . TYR K 3 122 ? 48.696  -17.045 242.241 1.00 147.20 ? 123 TYR C N     1 
ATOM   6084 C CA    . TYR K 3 122 ? 47.478  -17.670 241.747 1.00 139.30 ? 123 TYR C CA    1 
ATOM   6085 C C     . TYR K 3 122 ? 47.049  -17.038 240.427 1.00 132.02 ? 123 TYR C C     1 
ATOM   6086 O O     . TYR K 3 122 ? 47.344  -15.869 240.153 1.00 124.50 ? 123 TYR C O     1 
ATOM   6087 C CB    . TYR K 3 122 ? 46.343  -17.511 242.766 1.00 147.25 ? 123 TYR C CB    1 
ATOM   6088 C CG    . TYR K 3 122 ? 46.617  -18.124 244.124 1.00 153.13 ? 123 TYR C CG    1 
ATOM   6089 C CD1   . TYR K 3 122 ? 47.533  -17.545 245.002 1.00 154.84 ? 123 TYR C CD1   1 
ATOM   6090 C CD2   . TYR K 3 122 ? 45.965  -19.291 244.527 1.00 155.17 ? 123 TYR C CD2   1 
ATOM   6091 C CE1   . TYR K 3 122 ? 47.795  -18.114 246.244 1.00 155.72 ? 123 TYR C CE1   1 
ATOM   6092 C CE2   . TYR K 3 122 ? 46.220  -19.868 245.766 1.00 155.03 ? 123 TYR C CE2   1 
ATOM   6093 C CZ    . TYR K 3 122 ? 47.135  -19.276 246.617 1.00 156.11 ? 123 TYR C CZ    1 
ATOM   6094 O OH    . TYR K 3 122 ? 47.403  -19.855 247.835 1.00 159.01 ? 123 TYR C OH    1 
ATOM   6095 N N     . GLU K 3 123 ? 46.340  -17.824 239.622 1.00 126.58 ? 124 GLU C N     1 
ATOM   6096 C CA    . GLU K 3 123 ? 45.843  -17.374 238.329 1.00 120.69 ? 124 GLU C CA    1 
ATOM   6097 C C     . GLU K 3 123 ? 44.341  -17.631 238.185 1.00 116.55 ? 124 GLU C C     1 
ATOM   6098 O O     . GLU K 3 123 ? 43.901  -18.773 238.005 1.00 109.34 ? 124 GLU C O     1 
ATOM   6099 C CB    . GLU K 3 123 ? 46.587  -18.088 237.205 1.00 119.42 ? 124 GLU C CB    1 
ATOM   6100 C CG    . GLU K 3 123 ? 46.655  -17.288 235.917 1.00 114.55 ? 124 GLU C CG    1 
ATOM   6101 C CD    . GLU K 3 123 ? 47.233  -18.085 234.772 1.00 112.01 ? 124 GLU C CD    1 
ATOM   6102 O OE1   . GLU K 3 123 ? 47.533  -17.473 233.724 1.00 110.99 ? 124 GLU C OE1   1 
ATOM   6103 O OE2   . GLU K 3 123 ? 47.376  -19.321 234.920 1.00 104.47 ? 124 GLU C OE2   1 
ATOM   6104 N N     . LEU K 3 124 ? 43.569  -16.550 238.264 1.00 112.85 ? 125 LEU C N     1 
ATOM   6105 C CA    . LEU K 3 124 ? 42.117  -16.591 238.147 1.00 109.46 ? 125 LEU C CA    1 
ATOM   6106 C C     . LEU K 3 124 ? 41.715  -16.644 236.680 1.00 105.57 ? 125 LEU C C     1 
ATOM   6107 O O     . LEU K 3 124 ? 41.436  -15.612 236.062 1.00 102.80 ? 125 LEU C O     1 
ATOM   6108 C CB    . LEU K 3 124 ? 41.511  -15.347 238.803 1.00 109.83 ? 125 LEU C CB    1 
ATOM   6109 C CG    . LEU K 3 124 ? 41.710  -15.226 240.316 1.00 102.23 ? 125 LEU C CG    1 
ATOM   6110 C CD1   . LEU K 3 124 ? 41.392  -13.821 240.784 1.00 90.79  ? 125 LEU C CD1   1 
ATOM   6111 C CD2   . LEU K 3 124 ? 40.832  -16.245 241.008 1.00 100.35 ? 125 LEU C CD2   1 
ATOM   6112 N N     . LEU K 3 125 ? 41.688  -17.855 236.134 1.00 99.88  ? 126 LEU C N     1 
ATOM   6113 C CA    . LEU K 3 125 ? 41.337  -18.064 234.737 1.00 100.91 ? 126 LEU C CA    1 
ATOM   6114 C C     . LEU K 3 125 ? 39.830  -18.077 234.519 1.00 102.63 ? 126 LEU C C     1 
ATOM   6115 O O     . LEU K 3 125 ? 39.078  -18.517 235.384 1.00 103.98 ? 126 LEU C O     1 
ATOM   6116 C CB    . LEU K 3 125 ? 41.937  -19.381 234.234 1.00 97.70  ? 126 LEU C CB    1 
ATOM   6117 C CG    . LEU K 3 125 ? 41.584  -19.780 232.801 1.00 98.76  ? 126 LEU C CG    1 
ATOM   6118 C CD1   . LEU K 3 125 ? 41.989  -18.665 231.867 1.00 101.97 ? 126 LEU C CD1   1 
ATOM   6119 C CD2   . LEU K 3 125 ? 42.281  -21.075 232.410 1.00 98.32  ? 126 LEU C CD2   1 
ATOM   6120 N N     . ASP K 3 126 ? 39.402  -17.584 233.358 1.00 103.70 ? 127 ASP C N     1 
ATOM   6121 C CA    . ASP K 3 126 ? 37.987  -17.541 232.990 1.00 98.80  ? 127 ASP C CA    1 
ATOM   6122 C C     . ASP K 3 126 ? 37.868  -17.749 231.475 1.00 91.96  ? 127 ASP C C     1 
ATOM   6123 O O     . ASP K 3 126 ? 38.738  -17.330 230.709 1.00 82.20  ? 127 ASP C O     1 
ATOM   6124 C CB    . ASP K 3 126 ? 37.365  -16.191 233.395 1.00 101.18 ? 127 ASP C CB    1 
ATOM   6125 C CG    . ASP K 3 126 ? 35.835  -16.239 233.469 1.00 101.00 ? 127 ASP C CG    1 
ATOM   6126 O OD1   . ASP K 3 126 ? 35.177  -16.438 232.425 1.00 96.77  ? 127 ASP C OD1   1 
ATOM   6127 O OD2   . ASP K 3 126 ? 35.288  -16.078 234.581 1.00 102.31 ? 127 ASP C OD2   1 
ATOM   6128 N N     . VAL K 3 127 ? 36.793  -18.410 231.055 1.00 86.98  ? 128 VAL C N     1 
ATOM   6129 C CA    . VAL K 3 127 ? 36.553  -18.687 229.641 1.00 79.74  ? 128 VAL C CA    1 
ATOM   6130 C C     . VAL K 3 127 ? 35.390  -17.853 229.121 1.00 77.07  ? 128 VAL C C     1 
ATOM   6131 O O     . VAL K 3 127 ? 34.374  -17.721 229.795 1.00 85.90  ? 128 VAL C O     1 
ATOM   6132 C CB    . VAL K 3 127 ? 36.179  -20.170 229.415 1.00 77.93  ? 128 VAL C CB    1 
ATOM   6133 C CG1   . VAL K 3 127 ? 36.190  -20.475 227.938 1.00 70.93  ? 128 VAL C CG1   1 
ATOM   6134 C CG2   . VAL K 3 127 ? 37.124  -21.086 230.170 1.00 67.59  ? 128 VAL C CG2   1 
ATOM   6135 N N     . LYS K 3 128 ? 35.530  -17.297 227.924 1.00 71.13  ? 129 LYS C N     1 
ATOM   6136 C CA    . LYS K 3 128 ? 34.457  -16.498 227.325 1.00 66.17  ? 129 LYS C CA    1 
ATOM   6137 C C     . LYS K 3 128 ? 34.179  -17.024 225.908 1.00 66.35  ? 129 LYS C C     1 
ATOM   6138 O O     . LYS K 3 128 ? 34.910  -16.692 224.972 1.00 75.13  ? 129 LYS C O     1 
ATOM   6139 C CB    . LYS K 3 128 ? 34.871  -15.027 227.228 1.00 59.96  ? 129 LYS C CB    1 
ATOM   6140 C CG    . LYS K 3 128 ? 35.427  -14.405 228.497 1.00 56.40  ? 129 LYS C CG    1 
ATOM   6141 C CD    . LYS K 3 128 ? 34.349  -14.049 229.493 1.00 65.59  ? 129 LYS C CD    1 
ATOM   6142 C CE    . LYS K 3 128 ? 34.930  -13.365 230.722 1.00 56.99  ? 129 LYS C CE    1 
ATOM   6143 N NZ    . LYS K 3 128 ? 33.907  -13.306 231.792 1.00 57.30  ? 129 LYS C NZ    1 
ATOM   6144 N N     . THR K 3 129 ? 33.133  -17.826 225.734 1.00 55.34  ? 130 THR C N     1 
ATOM   6145 C CA    . THR K 3 129 ? 32.838  -18.361 224.408 1.00 53.48  ? 130 THR C CA    1 
ATOM   6146 C C     . THR K 3 129 ? 31.935  -17.483 223.550 1.00 57.76  ? 130 THR C C     1 
ATOM   6147 O O     . THR K 3 129 ? 30.759  -17.291 223.848 1.00 53.26  ? 130 THR C O     1 
ATOM   6148 C CB    . THR K 3 129 ? 32.205  -19.740 224.489 1.00 48.96  ? 130 THR C CB    1 
ATOM   6149 O OG1   . THR K 3 129 ? 30.917  -19.645 225.107 1.00 47.60  ? 130 THR C OG1   1 
ATOM   6150 C CG2   . THR K 3 129 ? 33.091  -20.663 225.292 1.00 44.74  ? 130 THR C CG2   1 
ATOM   6151 N N     . ARG K 3 130 ? 32.505  -16.961 222.469 1.00 62.99  ? 131 ARG C N     1 
ATOM   6152 C CA    . ARG K 3 130 ? 31.771  -16.112 221.553 1.00 61.22  ? 131 ARG C CA    1 
ATOM   6153 C C     . ARG K 3 130 ? 31.246  -16.894 220.372 1.00 65.02  ? 131 ARG C C     1 
ATOM   6154 O O     . ARG K 3 130 ? 31.830  -17.888 219.940 1.00 68.37  ? 131 ARG C O     1 
ATOM   6155 C CB    . ARG K 3 130 ? 32.649  -14.968 221.045 1.00 56.36  ? 131 ARG C CB    1 
ATOM   6156 C CG    . ARG K 3 130 ? 32.006  -14.175 219.920 1.00 59.69  ? 131 ARG C CG    1 
ATOM   6157 C CD    . ARG K 3 130 ? 32.400  -12.704 219.917 1.00 60.49  ? 131 ARG C CD    1 
ATOM   6158 N NE    . ARG K 3 130 ? 33.836  -12.488 219.801 1.00 59.14  ? 131 ARG C NE    1 
ATOM   6159 C CZ    . ARG K 3 130 ? 34.393  -11.303 219.559 1.00 70.89  ? 131 ARG C CZ    1 
ATOM   6160 N NH1   . ARG K 3 130 ? 33.630  -10.224 219.403 1.00 69.46  ? 131 ARG C NH1   1 
ATOM   6161 N NH2   . ARG K 3 130 ? 35.718  -11.189 219.475 1.00 78.15  ? 131 ARG C NH2   1 
ATOM   6162 N N     . ASN K 3 131 ? 30.126  -16.433 219.848 1.00 65.58  ? 132 ASN C N     1 
ATOM   6163 C CA    . ASN K 3 131 ? 29.535  -17.078 218.710 1.00 67.56  ? 132 ASN C CA    1 
ATOM   6164 C C     . ASN K 3 131 ? 29.848  -16.215 217.503 1.00 74.55  ? 132 ASN C C     1 
ATOM   6165 O O     . ASN K 3 131 ? 29.227  -15.171 217.305 1.00 71.61  ? 132 ASN C O     1 
ATOM   6166 C CB    . ASN K 3 131 ? 28.042  -17.166 218.902 1.00 72.98  ? 132 ASN C CB    1 
ATOM   6167 C CG    . ASN K 3 131 ? 27.410  -18.126 217.953 1.00 76.33  ? 132 ASN C CG    1 
ATOM   6168 O OD1   . ASN K 3 131 ? 27.770  -18.170 216.778 1.00 80.94  ? 132 ASN C OD1   1 
ATOM   6169 N ND2   . ASN K 3 131 ? 26.454  -18.908 218.446 1.00 80.86  ? 132 ASN C ND2   1 
ATOM   6170 N N     . ILE K 3 132 ? 30.817  -16.655 216.704 1.00 81.05  ? 133 ILE C N     1 
ATOM   6171 C CA    . ILE K 3 132 ? 31.239  -15.929 215.504 1.00 86.52  ? 133 ILE C CA    1 
ATOM   6172 C C     . ILE K 3 132 ? 30.148  -15.830 214.428 1.00 81.46  ? 133 ILE C C     1 
ATOM   6173 O O     . ILE K 3 132 ? 30.107  -14.873 213.648 1.00 74.94  ? 133 ILE C O     1 
ATOM   6174 C CB    . ILE K 3 132 ? 32.501  -16.596 214.882 1.00 96.78  ? 133 ILE C CB    1 
ATOM   6175 C CG1   . ILE K 3 132 ? 32.888  -15.920 213.545 1.00 106.57 ? 133 ILE C CG1   1 
ATOM   6176 C CG2   . ILE K 3 132 ? 32.238  -18.078 214.672 1.00 94.15  ? 133 ILE C CG2   1 
ATOM   6177 C CD1   . ILE K 3 132 ? 33.257  -14.423 213.626 1.00 108.38 ? 133 ILE C CD1   1 
ATOM   6178 N N     . SER K 3 133 ? 29.268  -16.821 214.384 1.00 80.15  ? 134 SER C N     1 
ATOM   6179 C CA    . SER K 3 133 ? 28.202  -16.819 213.400 1.00 80.79  ? 134 SER C CA    1 
ATOM   6180 C C     . SER K 3 133 ? 27.439  -15.493 213.394 1.00 77.20  ? 134 SER C C     1 
ATOM   6181 O O     . SER K 3 133 ? 26.694  -15.201 212.463 1.00 83.71  ? 134 SER C O     1 
ATOM   6182 C CB    . SER K 3 133 ? 27.255  -18.006 213.659 1.00 85.00  ? 134 SER C CB    1 
ATOM   6183 O OG    . SER K 3 133 ? 25.912  -17.600 213.901 1.00 91.42  ? 134 SER C OG    1 
ATOM   6184 N N     . LYS K 3 134 ? 27.644  -14.672 214.416 1.00 75.27  ? 135 LYS C N     1 
ATOM   6185 C CA    . LYS K 3 134 ? 26.937  -13.401 214.494 1.00 70.43  ? 135 LYS C CA    1 
ATOM   6186 C C     . LYS K 3 134 ? 27.641  -12.434 215.414 1.00 66.74  ? 135 LYS C C     1 
ATOM   6187 O O     . LYS K 3 134 ? 27.942  -12.775 216.548 1.00 75.65  ? 135 LYS C O     1 
ATOM   6188 C CB    . LYS K 3 134 ? 25.520  -13.626 215.024 1.00 75.12  ? 135 LYS C CB    1 
ATOM   6189 C CG    . LYS K 3 134 ? 25.473  -14.229 216.434 1.00 75.50  ? 135 LYS C CG    1 
ATOM   6190 C CD    . LYS K 3 134 ? 24.044  -14.322 217.016 1.00 86.34  ? 135 LYS C CD    1 
ATOM   6191 C CE    . LYS K 3 134 ? 23.109  -15.226 216.200 1.00 90.77  ? 135 LYS C CE    1 
ATOM   6192 N NZ    . LYS K 3 134 ? 21.721  -15.338 216.757 1.00 87.94  ? 135 LYS C NZ    1 
ATOM   6193 N N     . SER K 3 135 ? 27.905  -11.229 214.930 1.00 64.32  ? 136 SER C N     1 
ATOM   6194 C CA    . SER K 3 135 ? 28.550  -10.238 215.764 1.00 67.28  ? 136 SER C CA    1 
ATOM   6195 C C     . SER K 3 135 ? 27.623  -10.063 216.963 1.00 70.81  ? 136 SER C C     1 
ATOM   6196 O O     . SER K 3 135 ? 26.399  -10.011 216.817 1.00 69.97  ? 136 SER C O     1 
ATOM   6197 C CB    . SER K 3 135 ? 28.733  -8.902  215.008 1.00 69.95  ? 136 SER C CB    1 
ATOM   6198 O OG    . SER K 3 135 ? 27.557  -8.107  214.977 1.00 60.87  ? 136 SER C OG    1 
ATOM   6199 N N     . ALA K 3 136 ? 28.200  -10.010 218.155 1.00 73.16  ? 137 ALA C N     1 
ATOM   6200 C CA    . ALA K 3 136 ? 27.393  -9.857  219.349 1.00 70.73  ? 137 ALA C CA    1 
ATOM   6201 C C     . ALA K 3 136 ? 27.888  -8.683  220.180 1.00 68.61  ? 137 ALA C C     1 
ATOM   6202 O O     . ALA K 3 136 ? 28.670  -7.865  219.702 1.00 71.77  ? 137 ALA C O     1 
ATOM   6203 C CB    . ALA K 3 136 ? 27.440  -11.144 220.159 1.00 81.56  ? 137 ALA C CB    1 
ATOM   6204 N N     . GLN K 3 137 ? 27.418  -8.601  221.420 1.00 63.96  ? 138 GLN C N     1 
ATOM   6205 C CA    . GLN K 3 137 ? 27.806  -7.539  222.339 1.00 59.18  ? 138 GLN C CA    1 
ATOM   6206 C C     . GLN K 3 137 ? 28.882  -8.079  223.288 1.00 62.14  ? 138 GLN C C     1 
ATOM   6207 O O     . GLN K 3 137 ? 29.032  -9.296  223.445 1.00 59.30  ? 138 GLN C O     1 
ATOM   6208 C CB    . GLN K 3 137 ? 26.581  -7.109  223.118 1.00 51.52  ? 138 GLN C CB    1 
ATOM   6209 C CG    . GLN K 3 137 ? 26.735  -5.843  223.903 1.00 60.04  ? 138 GLN C CG    1 
ATOM   6210 C CD    . GLN K 3 137 ? 25.478  -5.534  224.713 1.00 63.25  ? 138 GLN C CD    1 
ATOM   6211 O OE1   . GLN K 3 137 ? 24.355  -5.625  224.191 1.00 49.57  ? 138 GLN C OE1   1 
ATOM   6212 N NE2   . GLN K 3 137 ? 25.659  -5.162  225.989 1.00 53.91  ? 138 GLN C NE2   1 
ATOM   6213 N N     . ALA K 3 138 ? 29.632  -7.183  223.917 1.00 62.79  ? 139 ALA C N     1 
ATOM   6214 C CA    . ALA K 3 138 ? 30.694  -7.597  224.835 1.00 64.15  ? 139 ALA C CA    1 
ATOM   6215 C C     . ALA K 3 138 ? 30.129  -8.347  226.033 1.00 62.91  ? 139 ALA C C     1 
ATOM   6216 O O     . ALA K 3 138 ? 29.352  -7.803  226.818 1.00 63.23  ? 139 ALA C O     1 
ATOM   6217 C CB    . ALA K 3 138 ? 31.489  -6.377  225.308 1.00 74.03  ? 139 ALA C CB    1 
ATOM   6218 N N     . PRO K 3 139 ? 30.540  -9.605  226.203 1.00 57.90  ? 140 PRO C N     1 
ATOM   6219 C CA    . PRO K 3 139 ? 30.075  -10.448 227.305 1.00 53.41  ? 140 PRO C CA    1 
ATOM   6220 C C     . PRO K 3 139 ? 30.585  -10.003 228.659 1.00 51.67  ? 140 PRO C C     1 
ATOM   6221 O O     . PRO K 3 139 ? 31.663  -9.415  228.754 1.00 45.72  ? 140 PRO C O     1 
ATOM   6222 C CB    . PRO K 3 139 ? 30.591  -11.829 226.915 1.00 50.45  ? 140 PRO C CB    1 
ATOM   6223 C CG    . PRO K 3 139 ? 31.882  -11.510 226.273 1.00 56.95  ? 140 PRO C CG    1 
ATOM   6224 C CD    . PRO K 3 139 ? 31.567  -10.297 225.411 1.00 54.73  ? 140 PRO C CD    1 
ATOM   6225 N N     . ASN K 3 140 ? 29.790  -10.278 229.695 1.00 50.42  ? 141 ASN C N     1 
ATOM   6226 C CA    . ASN K 3 140 ? 30.142  -9.938  231.072 1.00 49.76  ? 141 ASN C CA    1 
ATOM   6227 C C     . ASN K 3 140 ? 31.501  -10.545 231.370 1.00 53.61  ? 141 ASN C C     1 
ATOM   6228 O O     . ASN K 3 140 ? 31.685  -11.748 231.207 1.00 60.23  ? 141 ASN C O     1 
ATOM   6229 C CB    . ASN K 3 140 ? 29.114  -10.523 232.051 1.00 47.23  ? 141 ASN C CB    1 
ATOM   6230 C CG    . ASN K 3 140 ? 27.711  -9.965  231.844 1.00 51.99  ? 141 ASN C CG    1 
ATOM   6231 O OD1   . ASN K 3 140 ? 27.494  -9.107  230.979 1.00 52.88  ? 141 ASN C OD1   1 
ATOM   6232 N ND2   . ASN K 3 140 ? 26.749  -10.451 232.640 1.00 24.38  ? 141 ASN C ND2   1 
ATOM   6233 N N     . ILE K 3 141 ? 32.457  -9.735  231.803 1.00 53.70  ? 142 ILE C N     1 
ATOM   6234 C CA    . ILE K 3 141 ? 33.773  -10.284 232.100 1.00 60.39  ? 142 ILE C CA    1 
ATOM   6235 C C     . ILE K 3 141 ? 33.892  -10.670 233.568 1.00 65.96  ? 142 ILE C C     1 
ATOM   6236 O O     . ILE K 3 141 ? 34.275  -11.793 233.906 1.00 65.21  ? 142 ILE C O     1 
ATOM   6237 C CB    . ILE K 3 141 ? 34.862  -9.286  231.745 1.00 64.94  ? 142 ILE C CB    1 
ATOM   6238 C CG1   . ILE K 3 141 ? 34.791  -8.967  230.246 1.00 64.75  ? 142 ILE C CG1   1 
ATOM   6239 C CG2   . ILE K 3 141 ? 36.214  -9.857  232.127 1.00 67.26  ? 142 ILE C CG2   1 
ATOM   6240 C CD1   . ILE K 3 141 ? 34.915  -10.200 229.346 1.00 62.67  ? 142 ILE C CD1   1 
ATOM   6241 N N     . ILE K 3 142 ? 33.570  -9.714  234.432 1.00 74.37  ? 143 ILE C N     1 
ATOM   6242 C CA    . ILE K 3 142 ? 33.571  -9.894  235.883 1.00 76.51  ? 143 ILE C CA    1 
ATOM   6243 C C     . ILE K 3 142 ? 32.704  -8.820  236.509 1.00 78.70  ? 143 ILE C C     1 
ATOM   6244 O O     . ILE K 3 142 ? 32.120  -7.980  235.817 1.00 77.23  ? 143 ILE C O     1 
ATOM   6245 C CB    . ILE K 3 142 ? 34.981  -9.802  236.524 1.00 76.07  ? 143 ILE C CB    1 
ATOM   6246 C CG1   . ILE K 3 142 ? 35.915  -8.952  235.658 1.00 86.76  ? 143 ILE C CG1   1 
ATOM   6247 C CG2   . ILE K 3 142 ? 35.527  -11.191 236.768 1.00 78.02  ? 143 ILE C CG2   1 
ATOM   6248 C CD1   . ILE K 3 142 ? 35.728  -7.459  235.813 1.00 88.40  ? 143 ILE C CD1   1 
ATOM   6249 N N     . SER K 3 143 ? 32.610  -8.850  237.827 1.00 79.27  ? 144 SER C N     1 
ATOM   6250 C CA    . SER K 3 143 ? 31.795  -7.872  238.519 1.00 81.96  ? 144 SER C CA    1 
ATOM   6251 C C     . SER K 3 143 ? 32.559  -6.565  238.670 1.00 81.09  ? 144 SER C C     1 
ATOM   6252 O O     . SER K 3 143 ? 33.642  -6.539  239.259 1.00 86.33  ? 144 SER C O     1 
ATOM   6253 C CB    . SER K 3 143 ? 31.393  -8.422  239.892 1.00 84.44  ? 144 SER C CB    1 
ATOM   6254 O OG    . SER K 3 143 ? 30.763  -7.430  240.686 1.00 87.61  ? 144 SER C OG    1 
ATOM   6255 N N     . ALA K 3 144 ? 32.009  -5.485  238.121 1.00 72.23  ? 145 ALA C N     1 
ATOM   6256 C CA    . ALA K 3 144 ? 32.653  -4.183  238.240 1.00 69.41  ? 145 ALA C CA    1 
ATOM   6257 C C     . ALA K 3 144 ? 32.863  -3.899  239.731 1.00 73.62  ? 145 ALA C C     1 
ATOM   6258 O O     . ALA K 3 144 ? 33.941  -3.488  240.158 1.00 74.06  ? 145 ALA C O     1 
ATOM   6259 C CB    . ALA K 3 144 ? 31.780  -3.106  237.627 1.00 59.46  ? 145 ALA C CB    1 
ATOM   6260 N N     . TYR K 3 145 ? 31.825  -4.141  240.521 1.00 73.01  ? 146 TYR C N     1 
ATOM   6261 C CA    . TYR K 3 145 ? 31.897  -3.914  241.949 1.00 73.40  ? 146 TYR C CA    1 
ATOM   6262 C C     . TYR K 3 145 ? 32.894  -4.845  242.602 1.00 71.24  ? 146 TYR C C     1 
ATOM   6263 O O     . TYR K 3 145 ? 33.730  -4.405  243.393 1.00 81.32  ? 146 TYR C O     1 
ATOM   6264 C CB    . TYR K 3 145 ? 30.522  -4.112  242.575 1.00 86.95  ? 146 TYR C CB    1 
ATOM   6265 C CG    . TYR K 3 145 ? 30.430  -3.720  244.029 1.00 92.81  ? 146 TYR C CG    1 
ATOM   6266 C CD1   . TYR K 3 145 ? 31.241  -2.720  244.559 1.00 94.83  ? 146 TYR C CD1   1 
ATOM   6267 C CD2   . TYR K 3 145 ? 29.474  -4.294  244.856 1.00 94.03  ? 146 TYR C CD2   1 
ATOM   6268 C CE1   . TYR K 3 145 ? 31.094  -2.300  245.879 1.00 101.95 ? 146 TYR C CE1   1 
ATOM   6269 C CE2   . TYR K 3 145 ? 29.317  -3.881  246.170 1.00 99.16  ? 146 TYR C CE2   1 
ATOM   6270 C CZ    . TYR K 3 145 ? 30.122  -2.888  246.678 1.00 101.05 ? 146 TYR C CZ    1 
ATOM   6271 O OH    . TYR K 3 145 ? 29.935  -2.479  247.979 1.00 107.77 ? 146 TYR C OH    1 
ATOM   6272 N N     . LYS K 3 146 ? 32.809  -6.133  242.279 1.00 61.75  ? 147 LYS C N     1 
ATOM   6273 C CA    . LYS K 3 146 ? 33.723  -7.117  242.855 1.00 58.21  ? 147 LYS C CA    1 
ATOM   6274 C C     . LYS K 3 146 ? 35.161  -6.718  242.603 1.00 63.17  ? 147 LYS C C     1 
ATOM   6275 O O     . LYS K 3 146 ? 36.036  -6.961  243.429 1.00 59.85  ? 147 LYS C O     1 
ATOM   6276 C CB    . LYS K 3 146 ? 33.480  -8.504  242.269 1.00 42.61  ? 147 LYS C CB    1 
ATOM   6277 C CG    . LYS K 3 146 ? 34.628  -9.431  242.522 1.00 34.13  ? 147 LYS C CG    1 
ATOM   6278 C CD    . LYS K 3 146 ? 34.374  -10.813 241.989 1.00 37.89  ? 147 LYS C CD    1 
ATOM   6279 C CE    . LYS K 3 146 ? 33.375  -11.560 242.843 1.00 49.31  ? 147 LYS C CE    1 
ATOM   6280 N NZ    . LYS K 3 146 ? 33.481  -13.009 242.561 1.00 54.48  ? 147 LYS C NZ    1 
ATOM   6281 N N     . LEU K 3 147 ? 35.401  -6.108  241.450 1.00 74.10  ? 148 LEU C N     1 
ATOM   6282 C CA    . LEU K 3 147 ? 36.742  -5.672  241.100 1.00 83.94  ? 148 LEU C CA    1 
ATOM   6283 C C     . LEU K 3 147 ? 37.057  -4.443  241.936 1.00 87.12  ? 148 LEU C C     1 
ATOM   6284 O O     . LEU K 3 147 ? 38.186  -4.264  242.385 1.00 89.56  ? 148 LEU C O     1 
ATOM   6285 C CB    . LEU K 3 147 ? 36.818  -5.335  239.604 1.00 88.43  ? 148 LEU C CB    1 
ATOM   6286 C CG    . LEU K 3 147 ? 38.199  -5.124  238.965 1.00 91.52  ? 148 LEU C CG    1 
ATOM   6287 C CD1   . LEU K 3 147 ? 39.011  -6.404  239.061 1.00 94.17  ? 148 LEU C CD1   1 
ATOM   6288 C CD2   . LEU K 3 147 ? 38.044  -4.725  237.507 1.00 95.45  ? 148 LEU C CD2   1 
ATOM   6289 N N     . ALA K 3 148 ? 36.046  -3.606  242.152 1.00 90.27  ? 149 ALA C N     1 
ATOM   6290 C CA    . ALA K 3 148 ? 36.216  -2.387  242.936 1.00 94.49  ? 149 ALA C CA    1 
ATOM   6291 C C     . ALA K 3 148 ? 36.720  -2.760  244.311 1.00 98.56  ? 149 ALA C C     1 
ATOM   6292 O O     . ALA K 3 148 ? 37.689  -2.188  244.813 1.00 101.38 ? 149 ALA C O     1 
ATOM   6293 C CB    . ALA K 3 148 ? 34.896  -1.637  243.047 1.00 91.47  ? 149 ALA C CB    1 
ATOM   6294 N N     . GLN K 3 149 ? 36.053  -3.727  244.922 1.00 102.31 ? 150 GLN C N     1 
ATOM   6295 C CA    . GLN K 3 149 ? 36.459  -4.178  246.238 1.00 105.33 ? 150 GLN C CA    1 
ATOM   6296 C C     . GLN K 3 149 ? 37.832  -4.823  246.122 1.00 101.92 ? 150 GLN C C     1 
ATOM   6297 O O     . GLN K 3 149 ? 38.732  -4.521  246.897 1.00 100.22 ? 150 GLN C O     1 
ATOM   6298 C CB    . GLN K 3 149 ? 35.457  -5.186  246.783 1.00 108.82 ? 150 GLN C CB    1 
ATOM   6299 C CG    . GLN K 3 149 ? 34.064  -4.635  246.916 1.00 115.65 ? 150 GLN C CG    1 
ATOM   6300 C CD    . GLN K 3 149 ? 33.177  -5.548  247.719 1.00 121.60 ? 150 GLN C CD    1 
ATOM   6301 O OE1   . GLN K 3 149 ? 33.397  -5.746  248.913 1.00 125.47 ? 150 GLN C OE1   1 
ATOM   6302 N NE2   . GLN K 3 149 ? 32.170  -6.119  247.070 1.00 128.57 ? 150 GLN C NE2   1 
ATOM   6303 N N     . THR K 3 150 ? 37.989  -5.699  245.137 1.00 100.01 ? 151 THR C N     1 
ATOM   6304 C CA    . THR K 3 150 ? 39.254  -6.382  244.934 1.00 100.08 ? 151 THR C CA    1 
ATOM   6305 C C     . THR K 3 150 ? 40.412  -5.397  244.874 1.00 102.31 ? 151 THR C C     1 
ATOM   6306 O O     . THR K 3 150 ? 41.526  -5.696  245.309 1.00 94.32  ? 151 THR C O     1 
ATOM   6307 C CB    . THR K 3 150 ? 39.228  -7.213  243.649 1.00 97.08  ? 151 THR C CB    1 
ATOM   6308 O OG1   . THR K 3 150 ? 38.198  -8.199  243.747 1.00 96.22  ? 151 THR C OG1   1 
ATOM   6309 C CG2   . THR K 3 150 ? 40.554  -7.920  243.445 1.00 102.31 ? 151 THR C CG2   1 
ATOM   6310 N N     . CYS K 3 151 ? 40.141  -4.214  244.341 1.00 111.81 ? 152 CYS C N     1 
ATOM   6311 C CA    . CYS K 3 151 ? 41.160  -3.185  244.229 1.00 122.51 ? 152 CYS C CA    1 
ATOM   6312 C C     . CYS K 3 151 ? 41.299  -2.441  245.545 1.00 129.81 ? 152 CYS C C     1 
ATOM   6313 O O     . CYS K 3 151 ? 42.366  -1.916  245.868 1.00 136.00 ? 152 CYS C O     1 
ATOM   6314 C CB    . CYS K 3 151 ? 40.797  -2.216  243.109 1.00 121.96 ? 152 CYS C CB    1 
ATOM   6315 S SG    . CYS K 3 151 ? 40.813  -3.006  241.502 1.00 114.99 ? 152 CYS C SG    1 
ATOM   6316 N N     . ALA K 3 152 ? 40.216  -2.400  246.308 1.00 133.80 ? 153 ALA C N     1 
ATOM   6317 C CA    . ALA K 3 152 ? 40.238  -1.731  247.597 1.00 138.16 ? 153 ALA C CA    1 
ATOM   6318 C C     . ALA K 3 152 ? 41.090  -2.544  248.572 1.00 141.79 ? 153 ALA C C     1 
ATOM   6319 O O     . ALA K 3 152 ? 41.860  -1.982  249.349 1.00 145.06 ? 153 ALA C O     1 
ATOM   6320 C CB    . ALA K 3 152 ? 38.824  -1.582  248.127 1.00 138.28 ? 153 ALA C CB    1 
ATOM   6321 N N     . LYS K 3 153 ? 40.954  -3.867  248.518 1.00 142.52 ? 154 LYS C N     1 
ATOM   6322 C CA    . LYS K 3 153 ? 41.712  -4.760  249.391 1.00 140.14 ? 154 LYS C CA    1 
ATOM   6323 C C     . LYS K 3 153 ? 43.200  -4.704  249.066 1.00 139.16 ? 154 LYS C C     1 
ATOM   6324 O O     . LYS K 3 153 ? 44.031  -4.676  249.969 1.00 143.80 ? 154 LYS C O     1 
ATOM   6325 C CB    . LYS K 3 153 ? 41.211  -6.199  249.249 1.00 137.63 ? 154 LYS C CB    1 
ATOM   6326 N N     . MET K 3 154 ? 43.532  -4.689  247.777 1.00 135.67 ? 155 MET C N     1 
ATOM   6327 C CA    . MET K 3 154 ? 44.925  -4.625  247.341 1.00 129.85 ? 155 MET C CA    1 
ATOM   6328 C C     . MET K 3 154 ? 45.656  -3.462  248.014 1.00 126.35 ? 155 MET C C     1 
ATOM   6329 O O     . MET K 3 154 ? 46.757  -3.632  248.537 1.00 126.42 ? 155 MET C O     1 
ATOM   6330 C CB    . MET K 3 154 ? 45.005  -4.450  245.821 1.00 129.60 ? 155 MET C CB    1 
ATOM   6331 C CG    . MET K 3 154 ? 44.423  -5.590  244.998 1.00 124.34 ? 155 MET C CG    1 
ATOM   6332 S SD    . MET K 3 154 ? 44.524  -5.240  243.230 1.00 113.74 ? 155 MET C SD    1 
ATOM   6333 C CE    . MET K 3 154 ? 45.849  -6.299  242.749 1.00 105.03 ? 155 MET C CE    1 
ATOM   6334 N N     . ILE K 3 155 ? 45.038  -2.283  247.992 1.00 120.85 ? 156 ILE C N     1 
ATOM   6335 C CA    . ILE K 3 155 ? 45.621  -1.087  248.598 1.00 120.18 ? 156 ILE C CA    1 
ATOM   6336 C C     . ILE K 3 155 ? 45.360  -1.045  250.104 1.00 121.84 ? 156 ILE C C     1 
ATOM   6337 O O     . ILE K 3 155 ? 45.452  0.014   250.730 1.00 123.68 ? 156 ILE C O     1 
ATOM   6338 C CB    . ILE K 3 155 ? 45.044  0.198   247.964 1.00 106.24 ? 156 ILE C CB    1 
ATOM   6339 C CD1   . ILE K 3 155 ? 45.394  3.545   251.084 1.00 68.92  ? 156 ILE C CD1   1 
ATOM   6340 N N     . ASP K 3 156 ? 45.037  -2.206  250.671 1.00 122.47 ? 157 ASP C N     1 
ATOM   6341 C CA    . ASP K 3 156 ? 44.749  -2.338  252.097 1.00 121.59 ? 157 ASP C CA    1 
ATOM   6342 C C     . ASP K 3 156 ? 45.340  -3.598  252.715 1.00 126.23 ? 157 ASP C C     1 
ATOM   6343 O O     . ASP K 3 156 ? 44.757  -4.182  253.629 1.00 126.18 ? 157 ASP C O     1 
ATOM   6344 C CB    . ASP K 3 156 ? 43.239  -2.323  252.336 1.00 115.79 ? 157 ASP C CB    1 
ATOM   6345 C CG    . ASP K 3 156 ? 42.669  -0.926  252.338 1.00 111.92 ? 157 ASP C CG    1 
ATOM   6346 O OD1   . ASP K 3 156 ? 41.433  -0.780  252.453 1.00 108.61 ? 157 ASP C OD1   1 
ATOM   6347 O OD2   . ASP K 3 156 ? 43.465  0.030   252.229 1.00 108.49 ? 157 ASP C OD2   1 
ATOM   6348 N N     . ASN K 3 157 ? 46.493  -4.016  252.204 1.00 132.41 ? 158 ASN C N     1 
ATOM   6349 C CA    . ASN K 3 157 ? 47.187  -5.194  252.718 1.00 139.45 ? 158 ASN C CA    1 
ATOM   6350 C C     . ASN K 3 157 ? 48.505  -5.438  251.984 1.00 137.04 ? 158 ASN C C     1 
ATOM   6351 O O     . ASN K 3 157 ? 49.065  -6.533  252.042 1.00 135.00 ? 158 ASN C O     1 
ATOM   6352 C CB    . ASN K 3 157 ? 46.299  -6.451  252.633 1.00 151.68 ? 158 ASN C CB    1 
ATOM   6353 C CG    . ASN K 3 157 ? 45.844  -6.764  251.214 1.00 163.54 ? 158 ASN C CG    1 
ATOM   6354 O OD1   . ASN K 3 157 ? 46.647  -6.785  250.276 1.00 169.06 ? 158 ASN C OD1   1 
ATOM   6355 N ND2   . ASN K 3 157 ? 44.551  -7.028  251.054 1.00 168.47 ? 158 ASN C ND2   1 
ATOM   6356 N N     . LYS K 3 158 ? 48.994  -4.410  251.298 1.00 132.44 ? 159 LYS C N     1 
ATOM   6357 C CA    . LYS K 3 158 ? 50.245  -4.512  250.565 1.00 130.92 ? 159 LYS C CA    1 
ATOM   6358 C C     . LYS K 3 158 ? 50.449  -5.900  249.948 1.00 129.74 ? 159 LYS C C     1 
ATOM   6359 O O     . LYS K 3 158 ? 51.294  -6.671  250.399 1.00 123.08 ? 159 LYS C O     1 
ATOM   6360 C CB    . LYS K 3 158 ? 51.413  -4.176  251.496 1.00 130.59 ? 159 LYS C CB    1 
ATOM   6361 N N     . GLU K 3 159 ? 49.660  -6.208  248.920 1.00 135.44 ? 160 GLU C N     1 
ATOM   6362 C CA    . GLU K 3 159 ? 49.742  -7.491  248.214 1.00 140.75 ? 160 GLU C CA    1 
ATOM   6363 C C     . GLU K 3 159 ? 49.597  -7.334  246.687 1.00 141.14 ? 160 GLU C C     1 
ATOM   6364 O O     . GLU K 3 159 ? 48.862  -8.086  246.035 1.00 143.03 ? 160 GLU C O     1 
ATOM   6365 C CB    . GLU K 3 159 ? 48.670  -8.460  248.735 1.00 141.89 ? 160 GLU C CB    1 
ATOM   6366 C CG    . GLU K 3 159 ? 48.846  -8.872  250.187 1.00 143.24 ? 160 GLU C CG    1 
ATOM   6367 N N     . PHE K 3 160 ? 50.306  -6.354  246.127 1.00 136.68 ? 161 PHE C N     1 
ATOM   6368 C CA    . PHE K 3 160 ? 50.277  -6.091  244.690 1.00 127.83 ? 161 PHE C CA    1 
ATOM   6369 C C     . PHE K 3 160 ? 51.053  -7.188  243.977 1.00 125.60 ? 161 PHE C C     1 
ATOM   6370 O O     . PHE K 3 160 ? 51.759  -6.932  243.005 1.00 125.60 ? 161 PHE C O     1 
ATOM   6371 C CB    . PHE K 3 160 ? 50.919  -4.737  244.382 1.00 122.35 ? 161 PHE C CB    1 
ATOM   6372 C CG    . PHE K 3 160 ? 50.307  -3.589  245.130 1.00 117.78 ? 161 PHE C CG    1 
ATOM   6373 C CD1   . PHE K 3 160 ? 48.963  -3.283  244.983 1.00 117.71 ? 161 PHE C CD1   1 
ATOM   6374 C CD2   . PHE K 3 160 ? 51.083  -2.791  245.961 1.00 118.54 ? 161 PHE C CD2   1 
ATOM   6375 C CE1   . PHE K 3 160 ? 48.400  -2.195  245.651 1.00 119.25 ? 161 PHE C CE1   1 
ATOM   6376 C CE2   . PHE K 3 160 ? 50.528  -1.700  246.633 1.00 117.96 ? 161 PHE C CE2   1 
ATOM   6377 C CZ    . PHE K 3 160 ? 49.186  -1.403  246.475 1.00 117.58 ? 161 PHE C CZ    1 
ATOM   6378 N N     . ASP K 3 161 ? 50.914  -8.412  244.470 1.00 123.98 ? 162 ASP C N     1 
ATOM   6379 C CA    . ASP K 3 161 ? 51.606  -9.548  243.894 1.00 126.82 ? 162 ASP C CA    1 
ATOM   6380 C C     . ASP K 3 161 ? 51.196  -10.851 244.569 1.00 126.31 ? 162 ASP C C     1 
ATOM   6381 O O     . ASP K 3 161 ? 51.759  -11.234 245.596 1.00 130.20 ? 162 ASP C O     1 
ATOM   6382 C CB    . ASP K 3 161 ? 53.120  -9.350  244.017 1.00 132.22 ? 162 ASP C CB    1 
ATOM   6383 C CG    . ASP K 3 161 ? 53.893  -10.637 243.810 1.00 140.76 ? 162 ASP C CG    1 
ATOM   6384 O OD1   . ASP K 3 161 ? 53.616  -11.352 242.821 1.00 145.36 ? 162 ASP C OD1   1 
ATOM   6385 O OD2   . ASP K 3 161 ? 54.783  -10.930 244.635 1.00 142.79 ? 162 ASP C OD2   1 
ATOM   6386 N N     . LEU K 3 162 ? 50.212  -11.532 243.991 1.00 121.17 ? 163 LEU C N     1 
ATOM   6387 C CA    . LEU K 3 162 ? 49.749  -12.798 244.544 1.00 113.92 ? 163 LEU C CA    1 
ATOM   6388 C C     . LEU K 3 162 ? 48.785  -13.534 243.620 1.00 111.38 ? 163 LEU C C     1 
ATOM   6389 O O     . LEU K 3 162 ? 48.723  -14.758 243.637 1.00 103.96 ? 163 LEU C O     1 
ATOM   6390 C CB    . LEU K 3 162 ? 49.086  -12.558 245.898 1.00 112.64 ? 163 LEU C CB    1 
ATOM   6391 C CG    . LEU K 3 162 ? 48.459  -13.775 246.576 1.00 115.78 ? 163 LEU C CG    1 
ATOM   6392 C CD1   . LEU K 3 162 ? 49.457  -14.914 246.691 1.00 115.44 ? 163 LEU C CD1   1 
ATOM   6393 C CD2   . LEU K 3 162 ? 47.972  -13.357 247.948 1.00 123.55 ? 163 LEU C CD2   1 
ATOM   6394 N N     . PHE K 3 163 ? 48.038  -12.781 242.814 1.00 115.98 ? 164 PHE C N     1 
ATOM   6395 C CA    . PHE K 3 163 ? 47.061  -13.355 241.882 1.00 113.69 ? 164 PHE C CA    1 
ATOM   6396 C C     . PHE K 3 163 ? 47.048  -12.672 240.512 1.00 113.24 ? 164 PHE C C     1 
ATOM   6397 O O     . PHE K 3 163 ? 47.732  -11.673 240.287 1.00 113.98 ? 164 PHE C O     1 
ATOM   6398 C CB    . PHE K 3 163 ? 45.640  -13.283 242.480 1.00 109.80 ? 164 PHE C CB    1 
ATOM   6399 C CG    . PHE K 3 163 ? 45.111  -11.863 242.690 1.00 101.87 ? 164 PHE C CG    1 
ATOM   6400 C CD1   . PHE K 3 163 ? 43.738  -11.628 242.745 1.00 96.34  ? 164 PHE C CD1   1 
ATOM   6401 C CD2   . PHE K 3 163 ? 45.976  -10.778 242.867 1.00 98.95  ? 164 PHE C CD2   1 
ATOM   6402 C CE1   . PHE K 3 163 ? 43.231  -10.348 242.976 1.00 85.24  ? 164 PHE C CE1   1 
ATOM   6403 C CE2   . PHE K 3 163 ? 45.476  -9.493  243.101 1.00 93.33  ? 164 PHE C CE2   1 
ATOM   6404 C CZ    . PHE K 3 163 ? 44.102  -9.281  243.154 1.00 87.08  ? 164 PHE C CZ    1 
ATOM   6405 N N     . ASP K 3 164 ? 46.243  -13.216 239.605 1.00 113.97 ? 165 ASP C N     1 
ATOM   6406 C CA    . ASP K 3 164 ? 46.098  -12.676 238.257 1.00 108.02 ? 165 ASP C CA    1 
ATOM   6407 C C     . ASP K 3 164 ? 44.828  -13.229 237.620 1.00 97.80  ? 165 ASP C C     1 
ATOM   6408 O O     . ASP K 3 164 ? 44.675  -14.440 237.471 1.00 87.26  ? 165 ASP C O     1 
ATOM   6409 C CB    . ASP K 3 164 ? 47.316  -13.051 237.401 1.00 118.81 ? 165 ASP C CB    1 
ATOM   6410 C CG    . ASP K 3 164 ? 48.232  -11.865 237.125 1.00 126.40 ? 165 ASP C CG    1 
ATOM   6411 O OD1   . ASP K 3 164 ? 49.305  -12.065 236.510 1.00 125.24 ? 165 ASP C OD1   1 
ATOM   6412 O OD2   . ASP K 3 164 ? 47.876  -10.731 237.520 1.00 131.82 ? 165 ASP C OD2   1 
ATOM   6413 N N     . ILE K 3 165 ? 43.913  -12.344 237.249 1.00 91.00  ? 166 ILE C N     1 
ATOM   6414 C CA    . ILE K 3 165 ? 42.672  -12.786 236.626 1.00 91.93  ? 166 ILE C CA    1 
ATOM   6415 C C     . ILE K 3 165 ? 42.779  -12.690 235.108 1.00 96.59  ? 166 ILE C C     1 
ATOM   6416 O O     . ILE K 3 165 ? 42.797  -11.589 234.552 1.00 101.39 ? 166 ILE C O     1 
ATOM   6417 C CB    . ILE K 3 165 ? 41.500  -11.918 237.045 1.00 86.91  ? 166 ILE C CB    1 
ATOM   6418 C CG1   . ILE K 3 165 ? 41.775  -11.302 238.410 1.00 83.05  ? 166 ILE C CG1   1 
ATOM   6419 C CG2   . ILE K 3 165 ? 40.236  -12.759 237.061 1.00 83.67  ? 166 ILE C CG2   1 
ATOM   6420 C CD1   . ILE K 3 165 ? 40.806  -10.207 238.785 1.00 75.72  ? 166 ILE C CD1   1 
ATOM   6421 N N     . ASN K 3 166 ? 42.842  -13.838 234.440 1.00 95.41  ? 167 ASN C N     1 
ATOM   6422 C CA    . ASN K 3 166 ? 42.958  -13.860 232.987 1.00 92.46  ? 167 ASN C CA    1 
ATOM   6423 C C     . ASN K 3 166 ? 41.699  -14.374 232.324 1.00 91.58  ? 167 ASN C C     1 
ATOM   6424 O O     . ASN K 3 166 ? 40.835  -14.956 232.976 1.00 90.62  ? 167 ASN C O     1 
ATOM   6425 C CB    . ASN K 3 166 ? 44.145  -14.720 232.541 1.00 90.18  ? 167 ASN C CB    1 
ATOM   6426 C CG    . ASN K 3 166 ? 45.489  -14.184 233.036 1.00 91.13  ? 167 ASN C CG    1 
ATOM   6427 O OD1   . ASN K 3 166 ? 45.761  -12.976 232.980 1.00 80.28  ? 167 ASN C OD1   1 
ATOM   6428 N ND2   . ASN K 3 166 ? 46.343  -15.091 233.509 1.00 85.62  ? 167 ASN C ND2   1 
ATOM   6429 N N     . TYR K 3 167 ? 41.610  -14.173 231.014 1.00 93.40  ? 168 TYR C N     1 
ATOM   6430 C CA    . TYR K 3 167 ? 40.438  -14.589 230.257 1.00 90.24  ? 168 TYR C CA    1 
ATOM   6431 C C     . TYR K 3 167 ? 40.752  -15.206 228.896 1.00 84.21  ? 168 TYR C C     1 
ATOM   6432 O O     . TYR K 3 167 ? 41.346  -14.561 228.044 1.00 86.91  ? 168 TYR C O     1 
ATOM   6433 C CB    . TYR K 3 167 ? 39.543  -13.376 230.058 1.00 94.90  ? 168 TYR C CB    1 
ATOM   6434 C CG    . TYR K 3 167 ? 39.151  -12.721 231.349 1.00 104.15 ? 168 TYR C CG    1 
ATOM   6435 C CD1   . TYR K 3 167 ? 38.092  -13.220 232.113 1.00 107.39 ? 168 TYR C CD1   1 
ATOM   6436 C CD2   . TYR K 3 167 ? 39.852  -11.617 231.824 1.00 104.31 ? 168 TYR C CD2   1 
ATOM   6437 C CE1   . TYR K 3 167 ? 37.738  -12.632 233.319 1.00 114.29 ? 168 TYR C CE1   1 
ATOM   6438 C CE2   . TYR K 3 167 ? 39.510  -11.019 233.027 1.00 115.39 ? 168 TYR C CE2   1 
ATOM   6439 C CZ    . TYR K 3 167 ? 38.453  -11.530 233.771 1.00 119.36 ? 168 TYR C CZ    1 
ATOM   6440 O OH    . TYR K 3 167 ? 38.108  -10.935 234.963 1.00 128.23 ? 168 TYR C OH    1 
ATOM   6441 N N     . LEU K 3 168 ? 40.328  -16.446 228.688 1.00 79.67  ? 169 LEU C N     1 
ATOM   6442 C CA    . LEU K 3 168 ? 40.553  -17.133 227.419 1.00 76.90  ? 169 LEU C CA    1 
ATOM   6443 C C     . LEU K 3 168 ? 39.268  -17.186 226.575 1.00 78.82  ? 169 LEU C C     1 
ATOM   6444 O O     . LEU K 3 168 ? 38.219  -17.610 227.078 1.00 84.08  ? 169 LEU C O     1 
ATOM   6445 C CB    . LEU K 3 168 ? 41.031  -18.560 227.676 1.00 64.88  ? 169 LEU C CB    1 
ATOM   6446 C CG    . LEU K 3 168 ? 41.264  -19.385 226.412 1.00 56.08  ? 169 LEU C CG    1 
ATOM   6447 C CD1   . LEU K 3 168 ? 42.480  -18.816 225.679 1.00 49.43  ? 169 LEU C CD1   1 
ATOM   6448 C CD2   . LEU K 3 168 ? 41.483  -20.843 226.767 1.00 47.70  ? 169 LEU C CD2   1 
ATOM   6449 N N     . GLU K 3 169 ? 39.345  -16.773 225.302 1.00 73.51  ? 170 GLU C N     1 
ATOM   6450 C CA    . GLU K 3 169 ? 38.172  -16.793 224.405 1.00 65.98  ? 170 GLU C CA    1 
ATOM   6451 C C     . GLU K 3 169 ? 38.071  -18.090 223.598 1.00 61.46  ? 170 GLU C C     1 
ATOM   6452 O O     . GLU K 3 169 ? 39.068  -18.614 223.130 1.00 63.02  ? 170 GLU C O     1 
ATOM   6453 C CB    . GLU K 3 169 ? 38.210  -15.606 223.441 1.00 59.18  ? 170 GLU C CB    1 
ATOM   6454 C CG    . GLU K 3 169 ? 36.858  -15.325 222.798 1.00 56.61  ? 170 GLU C CG    1 
ATOM   6455 C CD    . GLU K 3 169 ? 36.756  -13.913 222.209 1.00 65.00  ? 170 GLU C CD    1 
ATOM   6456 O OE1   . GLU K 3 169 ? 37.335  -12.962 222.787 1.00 56.39  ? 170 GLU C OE1   1 
ATOM   6457 O OE2   . GLU K 3 169 ? 36.071  -13.745 221.174 1.00 66.01  ? 170 GLU C OE2   1 
ATOM   6458 N N     . VAL K 3 170 ? 36.871  -18.621 223.442 1.00 61.12  ? 171 VAL C N     1 
ATOM   6459 C CA    . VAL K 3 170 ? 36.733  -19.851 222.682 1.00 68.91  ? 171 VAL C CA    1 
ATOM   6460 C C     . VAL K 3 170 ? 35.716  -19.638 221.584 1.00 75.97  ? 171 VAL C C     1 
ATOM   6461 O O     . VAL K 3 170 ? 34.532  -19.906 221.762 1.00 79.59  ? 171 VAL C O     1 
ATOM   6462 C CB    . VAL K 3 170 ? 36.299  -21.027 223.578 1.00 73.40  ? 171 VAL C CB    1 
ATOM   6463 C CG1   . VAL K 3 170 ? 36.192  -22.315 222.758 1.00 68.57  ? 171 VAL C CG1   1 
ATOM   6464 C CG2   . VAL K 3 170 ? 37.306  -21.205 224.703 1.00 74.14  ? 171 VAL C CG2   1 
ATOM   6465 N N     . ASP K 3 171 ? 36.199  -19.143 220.446 1.00 81.05  ? 172 ASP C N     1 
ATOM   6466 C CA    . ASP K 3 171 ? 35.358  -18.854 219.290 1.00 81.62  ? 172 ASP C CA    1 
ATOM   6467 C C     . ASP K 3 171 ? 34.837  -20.107 218.604 1.00 83.30  ? 172 ASP C C     1 
ATOM   6468 O O     . ASP K 3 171 ? 35.616  -20.990 218.245 1.00 83.76  ? 172 ASP C O     1 
ATOM   6469 C CB    . ASP K 3 171 ? 36.143  -18.014 218.290 1.00 75.28  ? 172 ASP C CB    1 
ATOM   6470 C CG    . ASP K 3 171 ? 36.566  -16.688 218.865 1.00 74.39  ? 172 ASP C CG    1 
ATOM   6471 O OD1   . ASP K 3 171 ? 37.755  -16.329 218.730 1.00 83.42  ? 172 ASP C OD1   1 
ATOM   6472 O OD2   . ASP K 3 171 ? 35.708  -16.000 219.452 1.00 72.76  ? 172 ASP C OD2   1 
ATOM   6473 N N     . TRP K 3 172 ? 33.520  -20.175 218.421 1.00 83.43  ? 173 TRP C N     1 
ATOM   6474 C CA    . TRP K 3 172 ? 32.892  -21.318 217.767 1.00 85.43  ? 173 TRP C CA    1 
ATOM   6475 C C     . TRP K 3 172 ? 31.740  -20.894 216.875 1.00 86.49  ? 173 TRP C C     1 
ATOM   6476 O O     . TRP K 3 172 ? 31.208  -19.784 216.996 1.00 86.31  ? 173 TRP C O     1 
ATOM   6477 C CB    . TRP K 3 172 ? 32.358  -22.309 218.799 1.00 87.92  ? 173 TRP C CB    1 
ATOM   6478 C CG    . TRP K 3 172 ? 31.303  -21.720 219.666 1.00 91.14  ? 173 TRP C CG    1 
ATOM   6479 C CD1   . TRP K 3 172 ? 31.491  -20.903 220.741 1.00 93.71  ? 173 TRP C CD1   1 
ATOM   6480 C CD2   . TRP K 3 172 ? 29.888  -21.831 219.490 1.00 92.98  ? 173 TRP C CD2   1 
ATOM   6481 N NE1   . TRP K 3 172 ? 30.282  -20.494 221.246 1.00 96.40  ? 173 TRP C NE1   1 
ATOM   6482 C CE2   . TRP K 3 172 ? 29.279  -21.050 220.496 1.00 95.58  ? 173 TRP C CE2   1 
ATOM   6483 C CE3   . TRP K 3 172 ? 29.072  -22.511 218.578 1.00 96.99  ? 173 TRP C CE3   1 
ATOM   6484 C CZ2   . TRP K 3 172 ? 27.884  -20.929 220.615 1.00 95.50  ? 173 TRP C CZ2   1 
ATOM   6485 C CZ3   . TRP K 3 172 ? 27.680  -22.387 218.698 1.00 91.35  ? 173 TRP C CZ3   1 
ATOM   6486 C CH2   . TRP K 3 172 ? 27.107  -21.605 219.708 1.00 87.51  ? 173 TRP C CH2   1 
ATOM   6487 N N     . GLU K 3 173 ? 31.361  -21.797 215.978 1.00 87.33  ? 174 GLU C N     1 
ATOM   6488 C CA    . GLU K 3 173 ? 30.254  -21.565 215.059 1.00 94.21  ? 174 GLU C CA    1 
ATOM   6489 C C     . GLU K 3 173 ? 29.423  -22.834 214.972 1.00 92.80  ? 174 GLU C C     1 
ATOM   6490 O O     . GLU K 3 173 ? 29.936  -23.940 215.120 1.00 87.37  ? 174 GLU C O     1 
ATOM   6491 C CB    . GLU K 3 173 ? 30.759  -21.172 213.661 1.00 94.94  ? 174 GLU C CB    1 
ATOM   6492 C CG    . GLU K 3 173 ? 31.665  -22.195 212.990 1.00 99.90  ? 174 GLU C CG    1 
ATOM   6493 C CD    . GLU K 3 173 ? 32.260  -21.693 211.680 1.00 101.32 ? 174 GLU C CD    1 
ATOM   6494 O OE1   . GLU K 3 173 ? 33.070  -22.428 211.066 1.00 99.24  ? 174 GLU C OE1   1 
ATOM   6495 O OE2   . GLU K 3 173 ? 31.919  -20.565 211.265 1.00 100.83 ? 174 GLU C OE2   1 
ATOM   6496 N N     . LEU K 3 174 ? 28.130  -22.668 214.754 1.00 95.27  ? 175 LEU C N     1 
ATOM   6497 C CA    . LEU K 3 174 ? 27.254  -23.811 214.652 1.00 98.06  ? 175 LEU C CA    1 
ATOM   6498 C C     . LEU K 3 174 ? 27.588  -24.572 213.372 1.00 99.86  ? 175 LEU C C     1 
ATOM   6499 O O     . LEU K 3 174 ? 26.888  -24.443 212.373 1.00 101.93 ? 175 LEU C O     1 
ATOM   6500 C CB    . LEU K 3 174 ? 25.803  -23.340 214.625 1.00 97.66  ? 175 LEU C CB    1 
ATOM   6501 C CG    . LEU K 3 174 ? 24.759  -24.446 214.692 1.00 98.13  ? 175 LEU C CG    1 
ATOM   6502 C CD1   . LEU K 3 174 ? 24.925  -25.236 215.981 1.00 94.76  ? 175 LEU C CD1   1 
ATOM   6503 C CD2   . LEU K 3 174 ? 23.380  -23.824 214.611 1.00 103.45 ? 175 LEU C CD2   1 
ATOM   6504 N N     . ASN K 3 175 ? 28.673  -25.342 213.394 1.00 101.28 ? 176 ASN C N     1 
ATOM   6505 C CA    . ASN K 3 175 ? 29.076  -26.121 212.225 1.00 102.11 ? 176 ASN C CA    1 
ATOM   6506 C C     . ASN K 3 175 ? 28.516  -27.536 212.324 1.00 105.49 ? 176 ASN C C     1 
ATOM   6507 O O     . ASN K 3 175 ? 28.858  -28.300 213.232 1.00 104.47 ? 176 ASN C O     1 
ATOM   6508 C CB    . ASN K 3 175 ? 30.603  -26.197 212.105 1.00 100.77 ? 176 ASN C CB    1 
ATOM   6509 C CG    . ASN K 3 175 ? 31.061  -27.007 210.888 1.00 103.90 ? 176 ASN C CG    1 
ATOM   6510 O OD1   . ASN K 3 175 ? 32.050  -27.748 210.946 1.00 98.10  ? 176 ASN C OD1   1 
ATOM   6511 N ND2   . ASN K 3 175 ? 30.347  -26.857 209.777 1.00 110.30 ? 176 ASN C ND2   1 
ATOM   6512 N N     . GLY K 3 176 ? 27.648  -27.874 211.379 1.00 108.55 ? 177 GLY C N     1 
ATOM   6513 C CA    . GLY K 3 176 ? 27.051  -29.193 211.355 1.00 108.67 ? 177 GLY C CA    1 
ATOM   6514 C C     . GLY K 3 176 ? 26.154  -29.518 212.532 1.00 109.76 ? 177 GLY C C     1 
ATOM   6515 O O     . GLY K 3 176 ? 25.126  -28.869 212.753 1.00 105.60 ? 177 GLY C O     1 
ATOM   6516 N N     . GLU K 3 177 ? 26.557  -30.535 213.288 1.00 113.26 ? 178 GLU C N     1 
ATOM   6517 C CA    . GLU K 3 177 ? 25.799  -31.009 214.443 1.00 116.48 ? 178 GLU C CA    1 
ATOM   6518 C C     . GLU K 3 177 ? 26.441  -30.566 215.757 1.00 116.80 ? 178 GLU C C     1 
ATOM   6519 O O     . GLU K 3 177 ? 25.747  -30.248 216.727 1.00 117.88 ? 178 GLU C O     1 
ATOM   6520 C CB    . GLU K 3 177 ? 25.708  -32.543 214.391 1.00 118.95 ? 178 GLU C CB    1 
ATOM   6521 C CG    . GLU K 3 177 ? 24.314  -33.130 214.618 1.00 118.78 ? 178 GLU C CG    1 
ATOM   6522 C CD    . GLU K 3 177 ? 24.039  -33.471 216.072 1.00 117.73 ? 178 GLU C CD    1 
ATOM   6523 O OE1   . GLU K 3 177 ? 24.768  -34.320 216.634 1.00 118.32 ? 178 GLU C OE1   1 
ATOM   6524 O OE2   . GLU K 3 177 ? 23.090  -32.895 216.648 1.00 110.95 ? 178 GLU C OE2   1 
ATOM   6525 N N     . ASP K 3 178 ? 27.768  -30.536 215.785 1.00 114.97 ? 179 ASP C N     1 
ATOM   6526 C CA    . ASP K 3 178 ? 28.472  -30.144 216.995 1.00 110.73 ? 179 ASP C CA    1 
ATOM   6527 C C     . ASP K 3 178 ? 29.064  -28.757 216.871 1.00 102.70 ? 179 ASP C C     1 
ATOM   6528 O O     . ASP K 3 178 ? 29.477  -28.341 215.790 1.00 98.37  ? 179 ASP C O     1 
ATOM   6529 C CB    . ASP K 3 178 ? 29.590  -31.138 217.297 1.00 116.96 ? 179 ASP C CB    1 
ATOM   6530 C CG    . ASP K 3 178 ? 29.232  -32.544 216.892 1.00 119.70 ? 179 ASP C CG    1 
ATOM   6531 O OD1   . ASP K 3 178 ? 28.141  -33.013 217.285 1.00 122.78 ? 179 ASP C OD1   1 
ATOM   6532 O OD2   . ASP K 3 178 ? 30.043  -33.176 216.181 1.00 117.09 ? 179 ASP C OD2   1 
ATOM   6533 N N     . LEU K 3 179 ? 29.094  -28.042 217.989 1.00 97.38  ? 180 LEU C N     1 
ATOM   6534 C CA    . LEU K 3 179 ? 29.662  -26.702 218.020 1.00 90.83  ? 180 LEU C CA    1 
ATOM   6535 C C     . LEU K 3 179 ? 31.152  -26.888 217.859 1.00 89.68  ? 180 LEU C C     1 
ATOM   6536 O O     . LEU K 3 179 ? 31.744  -27.722 218.546 1.00 95.10  ? 180 LEU C O     1 
ATOM   6537 C CB    . LEU K 3 179 ? 29.384  -26.026 219.360 1.00 79.81  ? 180 LEU C CB    1 
ATOM   6538 C CG    . LEU K 3 179 ? 27.939  -25.659 219.692 1.00 73.15  ? 180 LEU C CG    1 
ATOM   6539 C CD1   . LEU K 3 179 ? 27.065  -26.907 219.803 1.00 69.24  ? 180 LEU C CD1   1 
ATOM   6540 C CD2   . LEU K 3 179 ? 27.931  -24.882 220.997 1.00 73.47  ? 180 LEU C CD2   1 
ATOM   6541 N N     . VAL K 3 180 ? 31.769  -26.120 216.969 1.00 80.82  ? 181 VAL C N     1 
ATOM   6542 C CA    . VAL K 3 180 ? 33.197  -26.284 216.767 1.00 80.39  ? 181 VAL C CA    1 
ATOM   6543 C C     . VAL K 3 180 ? 34.006  -25.020 216.943 1.00 74.18  ? 181 VAL C C     1 
ATOM   6544 O O     . VAL K 3 180 ? 33.654  -23.974 216.416 1.00 74.96  ? 181 VAL C O     1 
ATOM   6545 C CB    . VAL K 3 180 ? 33.485  -26.850 215.380 1.00 85.43  ? 181 VAL C CB    1 
ATOM   6546 C CG1   . VAL K 3 180 ? 34.865  -27.493 215.370 1.00 90.37  ? 181 VAL C CG1   1 
ATOM   6547 C CG2   . VAL K 3 180 ? 32.405  -27.847 214.995 1.00 85.66  ? 181 VAL C CG2   1 
ATOM   6548 N N     . CYS K 3 181 ? 35.102  -25.124 217.683 1.00 74.27  ? 182 CYS C N     1 
ATOM   6549 C CA    . CYS K 3 181 ? 35.956  -23.966 217.905 1.00 77.85  ? 182 CYS C CA    1 
ATOM   6550 C C     . CYS K 3 181 ? 36.605  -23.532 216.592 1.00 74.72  ? 182 CYS C C     1 
ATOM   6551 O O     . CYS K 3 181 ? 36.749  -24.329 215.669 1.00 76.17  ? 182 CYS C O     1 
ATOM   6552 C CB    . CYS K 3 181 ? 37.037  -24.286 218.935 1.00 75.31  ? 182 CYS C CB    1 
ATOM   6553 S SG    . CYS K 3 181 ? 38.181  -22.913 219.178 1.00 90.84  ? 182 CYS C SG    1 
ATOM   6554 N N     . VAL K 3 182 ? 36.998  -22.269 216.500 1.00 68.92  ? 183 VAL C N     1 
ATOM   6555 C CA    . VAL K 3 182 ? 37.612  -21.798 215.270 1.00 73.67  ? 183 VAL C CA    1 
ATOM   6556 C C     . VAL K 3 182 ? 38.641  -20.702 215.513 1.00 77.74  ? 183 VAL C C     1 
ATOM   6557 O O     . VAL K 3 182 ? 39.380  -20.315 214.604 1.00 74.47  ? 183 VAL C O     1 
ATOM   6558 C CB    . VAL K 3 182 ? 36.544  -21.259 214.278 1.00 70.46  ? 183 VAL C CB    1 
ATOM   6559 C CG1   . VAL K 3 182 ? 35.362  -22.222 214.204 1.00 51.41  ? 183 VAL C CG1   1 
ATOM   6560 C CG2   . VAL K 3 182 ? 36.100  -19.863 214.692 1.00 74.62  ? 183 VAL C CG2   1 
ATOM   6561 N N     . SER K 3 183 ? 38.679  -20.199 216.742 1.00 81.92  ? 184 SER C N     1 
ATOM   6562 C CA    . SER K 3 183 ? 39.616  -19.141 217.107 1.00 81.36  ? 184 SER C CA    1 
ATOM   6563 C C     . SER K 3 183 ? 39.789  -19.140 218.618 1.00 78.81  ? 184 SER C C     1 
ATOM   6564 O O     . SER K 3 183 ? 38.957  -19.690 219.337 1.00 72.04  ? 184 SER C O     1 
ATOM   6565 C CB    . SER K 3 183 ? 39.078  -17.784 216.655 1.00 83.15  ? 184 SER C CB    1 
ATOM   6566 O OG    . SER K 3 183 ? 38.369  -17.897 215.433 1.00 83.39  ? 184 SER C OG    1 
ATOM   6567 N N     . THR K 3 184 ? 40.870  -18.526 219.091 1.00 79.28  ? 185 THR C N     1 
ATOM   6568 C CA    . THR K 3 184 ? 41.151  -18.454 220.524 1.00 83.44  ? 185 THR C CA    1 
ATOM   6569 C C     . THR K 3 184 ? 41.965  -17.199 220.853 1.00 83.40  ? 185 THR C C     1 
ATOM   6570 O O     . THR K 3 184 ? 42.804  -16.769 220.064 1.00 87.00  ? 185 THR C O     1 
ATOM   6571 C CB    . THR K 3 184 ? 41.935  -19.707 221.017 1.00 82.50  ? 185 THR C CB    1 
ATOM   6572 O OG1   . THR K 3 184 ? 41.271  -20.900 220.580 1.00 84.57  ? 185 THR C OG1   1 
ATOM   6573 C CG2   . THR K 3 184 ? 42.006  -19.726 222.528 1.00 79.76  ? 185 THR C CG2   1 
ATOM   6574 N N     . SER K 3 185 ? 41.702  -16.612 222.017 1.00 84.63  ? 186 SER C N     1 
ATOM   6575 C CA    . SER K 3 185 ? 42.403  -15.414 222.455 1.00 90.76  ? 186 SER C CA    1 
ATOM   6576 C C     . SER K 3 185 ? 42.560  -15.352 223.968 1.00 92.58  ? 186 SER C C     1 
ATOM   6577 O O     . SER K 3 185 ? 41.591  -15.461 224.724 1.00 88.71  ? 186 SER C O     1 
ATOM   6578 C CB    . SER K 3 185 ? 41.685  -14.159 221.962 1.00 98.47  ? 186 SER C CB    1 
ATOM   6579 O OG    . SER K 3 185 ? 41.779  -14.038 220.551 1.00 110.90 ? 186 SER C OG    1 
ATOM   6580 N N     . PHE K 3 186 ? 43.805  -15.161 224.390 1.00 98.86  ? 187 PHE C N     1 
ATOM   6581 C CA    . PHE K 3 186 ? 44.175  -15.090 225.795 1.00 101.58 ? 187 PHE C CA    1 
ATOM   6582 C C     . PHE K 3 186 ? 44.654  -13.696 226.179 1.00 97.32  ? 187 PHE C C     1 
ATOM   6583 O O     . PHE K 3 186 ? 45.768  -13.306 225.846 1.00 96.56  ? 187 PHE C O     1 
ATOM   6584 C CB    . PHE K 3 186 ? 45.294  -16.092 226.077 1.00 109.96 ? 187 PHE C CB    1 
ATOM   6585 C CG    . PHE K 3 186 ? 45.942  -15.906 227.412 1.00 114.50 ? 187 PHE C CG    1 
ATOM   6586 C CD1   . PHE K 3 186 ? 45.259  -16.231 228.573 1.00 111.64 ? 187 PHE C CD1   1 
ATOM   6587 C CD2   . PHE K 3 186 ? 47.225  -15.378 227.508 1.00 116.39 ? 187 PHE C CD2   1 
ATOM   6588 C CE1   . PHE K 3 186 ? 45.840  -16.032 229.807 1.00 116.53 ? 187 PHE C CE1   1 
ATOM   6589 C CE2   . PHE K 3 186 ? 47.816  -15.175 228.740 1.00 118.20 ? 187 PHE C CE2   1 
ATOM   6590 C CZ    . PHE K 3 186 ? 47.122  -15.503 229.894 1.00 119.76 ? 187 PHE C CZ    1 
ATOM   6591 N N     . ALA K 3 187 ? 43.815  -12.956 226.889 1.00 94.02  ? 188 ALA C N     1 
ATOM   6592 C CA    . ALA K 3 187 ? 44.174  -11.619 227.319 1.00 97.63  ? 188 ALA C CA    1 
ATOM   6593 C C     . ALA K 3 187 ? 44.429  -11.627 228.824 1.00 101.88 ? 188 ALA C C     1 
ATOM   6594 O O     . ALA K 3 187 ? 44.137  -12.613 229.506 1.00 98.34  ? 188 ALA C O     1 
ATOM   6595 C CB    . ALA K 3 187 ? 43.061  -10.634 226.969 1.00 92.01  ? 188 ALA C CB    1 
ATOM   6596 N N     . GLU K 3 188 ? 44.981  -10.527 229.334 1.00 106.06 ? 189 GLU C N     1 
ATOM   6597 C CA    . GLU K 3 188 ? 45.281  -10.401 230.756 1.00 105.42 ? 189 GLU C CA    1 
ATOM   6598 C C     . GLU K 3 188 ? 44.656  -9.135  231.321 1.00 99.08  ? 189 GLU C C     1 
ATOM   6599 O O     . GLU K 3 188 ? 45.107  -8.027  231.046 1.00 94.31  ? 189 GLU C O     1 
ATOM   6600 C CB    . GLU K 3 188 ? 46.796  -10.385 230.979 1.00 113.11 ? 189 GLU C CB    1 
ATOM   6601 C CG    . GLU K 3 188 ? 47.531  -11.537 230.288 1.00 124.36 ? 189 GLU C CG    1 
ATOM   6602 C CD    . GLU K 3 188 ? 48.912  -11.802 230.874 1.00 129.97 ? 189 GLU C CD    1 
ATOM   6603 O OE1   . GLU K 3 188 ? 49.654  -12.641 230.311 1.00 128.41 ? 189 GLU C OE1   1 
ATOM   6604 O OE2   . GLU K 3 188 ? 49.251  -11.178 231.903 1.00 134.45 ? 189 GLU C OE2   1 
ATOM   6605 N N     . LEU K 3 189 ? 43.607  -9.327  232.112 1.00 95.57  ? 190 LEU C N     1 
ATOM   6606 C CA    . LEU K 3 189 ? 42.864  -8.240  232.736 1.00 91.95  ? 190 LEU C CA    1 
ATOM   6607 C C     . LEU K 3 189 ? 43.741  -7.140  233.281 1.00 92.63  ? 190 LEU C C     1 
ATOM   6608 O O     . LEU K 3 189 ? 43.625  -5.980  232.888 1.00 88.12  ? 190 LEU C O     1 
ATOM   6609 C CB    . LEU K 3 189 ? 42.008  -8.783  233.877 1.00 84.53  ? 190 LEU C CB    1 
ATOM   6610 C CG    . LEU K 3 189 ? 41.208  -7.757  234.676 1.00 83.49  ? 190 LEU C CG    1 
ATOM   6611 C CD1   . LEU K 3 189 ? 40.130  -7.131  233.807 1.00 82.72  ? 190 LEU C CD1   1 
ATOM   6612 C CD2   . LEU K 3 189 ? 40.592  -8.444  235.883 1.00 81.80  ? 190 LEU C CD2   1 
ATOM   6613 N N     . PHE K 3 190 ? 44.615  -7.514  234.204 1.00 95.78  ? 191 PHE C N     1 
ATOM   6614 C CA    . PHE K 3 190 ? 45.497  -6.554  234.844 1.00 103.01 ? 191 PHE C CA    1 
ATOM   6615 C C     . PHE K 3 190 ? 46.406  -5.811  233.890 1.00 108.44 ? 191 PHE C C     1 
ATOM   6616 O O     . PHE K 3 190 ? 46.793  -4.667  234.161 1.00 112.26 ? 191 PHE C O     1 
ATOM   6617 C CB    . PHE K 3 190 ? 46.309  -7.254  235.926 1.00 98.73  ? 191 PHE C CB    1 
ATOM   6618 C CG    . PHE K 3 190 ? 45.472  -7.706  237.081 1.00 96.75  ? 191 PHE C CG    1 
ATOM   6619 C CD1   . PHE K 3 190 ? 45.517  -9.026  237.519 1.00 96.87  ? 191 PHE C CD1   1 
ATOM   6620 C CD2   . PHE K 3 190 ? 44.610  -6.811  237.715 1.00 90.61  ? 191 PHE C CD2   1 
ATOM   6621 C CE1   . PHE K 3 190 ? 44.717  -9.451  238.568 1.00 94.90  ? 191 PHE C CE1   1 
ATOM   6622 C CE2   . PHE K 3 190 ? 43.806  -7.220  238.763 1.00 86.73  ? 191 PHE C CE2   1 
ATOM   6623 C CZ    . PHE K 3 190 ? 43.856  -8.542  239.194 1.00 93.97  ? 191 PHE C CZ    1 
ATOM   6624 N N     . LYS K 3 191 ? 46.737  -6.451  232.769 1.00 106.98 ? 192 LYS C N     1 
ATOM   6625 C CA    . LYS K 3 191 ? 47.602  -5.835  231.762 1.00 97.87  ? 192 LYS C CA    1 
ATOM   6626 C C     . LYS K 3 191 ? 46.844  -4.879  230.834 1.00 87.80  ? 192 LYS C C     1 
ATOM   6627 O O     . LYS K 3 191 ? 47.323  -4.568  229.751 1.00 88.28  ? 192 LYS C O     1 
ATOM   6628 C CB    . LYS K 3 191 ? 48.295  -6.918  230.929 1.00 96.19  ? 192 LYS C CB    1 
ATOM   6629 C CG    . LYS K 3 191 ? 49.524  -7.533  231.578 1.00 103.14 ? 192 LYS C CG    1 
ATOM   6630 C CD    . LYS K 3 191 ? 50.235  -8.470  230.604 1.00 109.37 ? 192 LYS C CD    1 
ATOM   6631 C CE    . LYS K 3 191 ? 51.529  -9.035  231.184 1.00 113.63 ? 192 LYS C CE    1 
ATOM   6632 N NZ    . LYS K 3 191 ? 52.155  -10.044 230.272 1.00 113.38 ? 192 LYS C NZ    1 
ATOM   6633 N N     . SER K 3 192 ? 45.683  -4.398  231.276 1.00 77.97  ? 193 SER C N     1 
ATOM   6634 C CA    . SER K 3 192 ? 44.848  -3.498  230.479 1.00 67.75  ? 193 SER C CA    1 
ATOM   6635 C C     . SER K 3 192 ? 44.805  -2.115  231.093 1.00 59.71  ? 193 SER C C     1 
ATOM   6636 O O     . SER K 3 192 ? 45.236  -1.932  232.219 1.00 62.26  ? 193 SER C O     1 
ATOM   6637 C CB    . SER K 3 192 ? 43.430  -4.045  230.419 1.00 73.88  ? 193 SER C CB    1 
ATOM   6638 O OG    . SER K 3 192 ? 43.438  -5.465  230.353 1.00 74.37  ? 193 SER C OG    1 
ATOM   6639 N N     . GLU K 3 193 ? 44.290  -1.137  230.365 1.00 58.47  ? 194 GLU C N     1 
ATOM   6640 C CA    . GLU K 3 193 ? 44.211  0.210   230.922 1.00 76.30  ? 194 GLU C CA    1 
ATOM   6641 C C     . GLU K 3 193 ? 42.863  0.334   231.608 1.00 88.24  ? 194 GLU C C     1 
ATOM   6642 O O     . GLU K 3 193 ? 41.850  0.577   230.957 1.00 100.26 ? 194 GLU C O     1 
ATOM   6643 C CB    . GLU K 3 193 ? 44.333  1.276   229.828 1.00 74.38  ? 194 GLU C CB    1 
ATOM   6644 N N     . PRO K 3 194 ? 42.832  0.181   232.940 1.00 93.65  ? 195 PRO C N     1 
ATOM   6645 C CA    . PRO K 3 194 ? 41.579  0.271   233.701 1.00 97.96  ? 195 PRO C CA    1 
ATOM   6646 C C     . PRO K 3 194 ? 40.737  1.532   233.484 1.00 98.69  ? 195 PRO C C     1 
ATOM   6647 O O     . PRO K 3 194 ? 39.528  1.541   233.732 1.00 101.81 ? 195 PRO C O     1 
ATOM   6648 C CB    . PRO K 3 194 ? 42.042  0.092   235.152 1.00 98.24  ? 195 PRO C CB    1 
ATOM   6649 C CG    . PRO K 3 194 ? 43.450  0.582   235.135 1.00 93.24  ? 195 PRO C CG    1 
ATOM   6650 C CD    . PRO K 3 194 ? 43.989  0.048   233.842 1.00 91.28  ? 195 PRO C CD    1 
ATOM   6651 N N     . SER K 3 195 ? 41.378  2.586   233.003 1.00 101.66 ? 196 SER C N     1 
ATOM   6652 C CA    . SER K 3 195 ? 40.696  3.842   232.742 1.00 107.55 ? 196 SER C CA    1 
ATOM   6653 C C     . SER K 3 195 ? 39.670  3.725   231.597 1.00 108.06 ? 196 SER C C     1 
ATOM   6654 O O     . SER K 3 195 ? 38.688  4.473   231.542 1.00 105.14 ? 196 SER C O     1 
ATOM   6655 C CB    . SER K 3 195 ? 41.742  4.919   232.423 1.00 108.36 ? 196 SER C CB    1 
ATOM   6656 O OG    . SER K 3 195 ? 42.711  4.432   231.503 1.00 111.07 ? 196 SER C OG    1 
ATOM   6657 N N     . GLU K 3 196 ? 39.893  2.777   230.692 1.00 107.11 ? 197 GLU C N     1 
ATOM   6658 C CA    . GLU K 3 196 ? 38.998  2.585   229.553 1.00 107.52 ? 197 GLU C CA    1 
ATOM   6659 C C     . GLU K 3 196 ? 37.891  1.563   229.820 1.00 106.67 ? 197 GLU C C     1 
ATOM   6660 O O     . GLU K 3 196 ? 36.840  1.610   229.179 1.00 107.99 ? 197 GLU C O     1 
ATOM   6661 C CB    . GLU K 3 196 ? 39.795  2.153   228.313 1.00 112.82 ? 197 GLU C CB    1 
ATOM   6662 C CG    . GLU K 3 196 ? 40.799  3.181   227.762 1.00 114.44 ? 197 GLU C CG    1 
ATOM   6663 C CD    . GLU K 3 196 ? 40.145  4.437   227.192 1.00 113.51 ? 197 GLU C CD    1 
ATOM   6664 O OE1   . GLU K 3 196 ? 39.838  5.365   227.975 1.00 110.47 ? 197 GLU C OE1   1 
ATOM   6665 O OE2   . GLU K 3 196 ? 39.932  4.490   225.959 1.00 110.95 ? 197 GLU C OE2   1 
ATOM   6666 N N     . LEU K 3 197 ? 38.131  0.645   230.758 1.00 101.53 ? 198 LEU C N     1 
ATOM   6667 C CA    . LEU K 3 197 ? 37.159  -0.394  231.115 1.00 92.22  ? 198 LEU C CA    1 
ATOM   6668 C C     . LEU K 3 197 ? 35.716  0.075   231.221 1.00 93.79  ? 198 LEU C C     1 
ATOM   6669 O O     . LEU K 3 197 ? 35.408  1.010   231.971 1.00 98.22  ? 198 LEU C O     1 
ATOM   6670 C CB    . LEU K 3 197 ? 37.546  -1.036  232.430 1.00 80.11  ? 198 LEU C CB    1 
ATOM   6671 C CG    . LEU K 3 197 ? 38.636  -2.060  232.258 1.00 76.88  ? 198 LEU C CG    1 
ATOM   6672 C CD1   . LEU K 3 197 ? 39.009  -2.586  233.617 1.00 84.98  ? 198 LEU C CD1   1 
ATOM   6673 C CD2   . LEU K 3 197 ? 38.149  -3.177  231.347 1.00 77.85  ? 198 LEU C CD2   1 
ATOM   6674 N N     . TYR K 3 198 ? 34.827  -0.605  230.498 1.00 86.41  ? 199 TYR C N     1 
ATOM   6675 C CA    . TYR K 3 198 ? 33.411  -0.243  230.502 1.00 77.52  ? 199 TYR C CA    1 
ATOM   6676 C C     . TYR K 3 198 ? 32.589  -0.989  231.535 1.00 74.01  ? 199 TYR C C     1 
ATOM   6677 O O     . TYR K 3 198 ? 32.609  -2.226  231.596 1.00 75.75  ? 199 TYR C O     1 
ATOM   6678 C CB    . TYR K 3 198 ? 32.794  -0.474  229.123 1.00 65.49  ? 199 TYR C CB    1 
ATOM   6679 C CG    . TYR K 3 198 ? 31.331  -0.088  229.034 1.00 57.65  ? 199 TYR C CG    1 
ATOM   6680 C CD1   . TYR K 3 198 ? 30.337  -1.058  228.936 1.00 59.01  ? 199 TYR C CD1   1 
ATOM   6681 C CD2   . TYR K 3 198 ? 30.939  1.251   229.023 1.00 56.42  ? 199 TYR C CD2   1 
ATOM   6682 C CE1   . TYR K 3 198 ? 28.988  -0.704  228.821 1.00 49.08  ? 199 TYR C CE1   1 
ATOM   6683 C CE2   . TYR K 3 198 ? 29.595  1.611   228.912 1.00 55.82  ? 199 TYR C CE2   1 
ATOM   6684 C CZ    . TYR K 3 198 ? 28.631  0.627   228.811 1.00 55.16  ? 199 TYR C CZ    1 
ATOM   6685 O OH    . TYR K 3 198 ? 27.311  0.981   228.693 1.00 64.38  ? 199 TYR C OH    1 
ATOM   6686 N N     . ILE K 3 199 ? 31.853  -0.220  232.328 1.00 61.50  ? 200 ILE C N     1 
ATOM   6687 C CA    . ILE K 3 199 ? 31.017  -0.790  233.355 1.00 56.91  ? 200 ILE C CA    1 
ATOM   6688 C C     . ILE K 3 199 ? 29.562  -0.732  232.957 1.00 53.41  ? 200 ILE C C     1 
ATOM   6689 O O     . ILE K 3 199 ? 28.962  0.342   232.898 1.00 54.40  ? 200 ILE C O     1 
ATOM   6690 C CB    . ILE K 3 199 ? 31.227  -0.062  234.679 1.00 60.39  ? 200 ILE C CB    1 
ATOM   6691 C CG1   . ILE K 3 199 ? 32.680  -0.207  235.103 1.00 55.16  ? 200 ILE C CG1   1 
ATOM   6692 C CG2   . ILE K 3 199 ? 30.330  -0.643  235.749 1.00 70.37  ? 200 ILE C CG2   1 
ATOM   6693 C CD1   . ILE K 3 199 ? 32.948  0.291   236.484 1.00 56.36  ? 200 ILE C CD1   1 
ATOM   6694 N N     . ASN K 3 200 ? 28.999  -1.899  232.671 1.00 49.74  ? 201 ASN C N     1 
ATOM   6695 C CA    . ASN K 3 200 ? 27.609  -1.970  232.246 1.00 59.88  ? 201 ASN C CA    1 
ATOM   6696 C C     . ASN K 3 200 ? 26.728  -2.245  233.439 1.00 63.56  ? 201 ASN C C     1 
ATOM   6697 O O     . ASN K 3 200 ? 26.377  -3.391  233.731 1.00 68.45  ? 201 ASN C O     1 
ATOM   6698 C CB    . ASN K 3 200 ? 27.411  -3.074  231.201 1.00 54.45  ? 201 ASN C CB    1 
ATOM   6699 C CG    . ASN K 3 200 ? 26.037  -3.036  230.586 1.00 47.93  ? 201 ASN C CG    1 
ATOM   6700 O OD1   . ASN K 3 200 ? 25.067  -2.711  231.258 1.00 47.56  ? 201 ASN C OD1   1 
ATOM   6701 N ND2   . ASN K 3 200 ? 25.942  -3.371  229.307 1.00 60.52  ? 201 ASN C ND2   1 
ATOM   6702 N N     . TRP K 3 201 ? 26.360  -1.186  234.131 1.00 64.55  ? 202 TRP C N     1 
ATOM   6703 C CA    . TRP K 3 201 ? 25.526  -1.343  235.295 1.00 67.44  ? 202 TRP C CA    1 
ATOM   6704 C C     . TRP K 3 201 ? 24.352  -2.268  235.041 1.00 62.10  ? 202 TRP C C     1 
ATOM   6705 O O     . TRP K 3 201 ? 24.301  -3.358  235.593 1.00 64.17  ? 202 TRP C O     1 
ATOM   6706 C CB    . TRP K 3 201 ? 25.055  0.020   235.755 1.00 76.55  ? 202 TRP C CB    1 
ATOM   6707 C CG    . TRP K 3 201 ? 26.192  0.939   235.864 1.00 85.99  ? 202 TRP C CG    1 
ATOM   6708 C CD1   . TRP K 3 201 ? 26.616  1.818   234.922 1.00 91.33  ? 202 TRP C CD1   1 
ATOM   6709 C CD2   . TRP K 3 201 ? 27.109  1.038   236.955 1.00 92.85  ? 202 TRP C CD2   1 
ATOM   6710 N NE1   . TRP K 3 201 ? 27.743  2.468   235.354 1.00 95.43  ? 202 TRP C NE1   1 
ATOM   6711 C CE2   . TRP K 3 201 ? 28.068  2.009   236.603 1.00 95.25  ? 202 TRP C CE2   1 
ATOM   6712 C CE3   . TRP K 3 201 ? 27.214  0.403   238.198 1.00 97.27  ? 202 TRP C CE3   1 
ATOM   6713 C CZ2   . TRP K 3 201 ? 29.125  2.365   237.449 1.00 99.05  ? 202 TRP C CZ2   1 
ATOM   6714 C CZ3   . TRP K 3 201 ? 28.268  0.758   239.041 1.00 104.09 ? 202 TRP C CZ3   1 
ATOM   6715 C CH2   . TRP K 3 201 ? 29.208  1.732   238.660 1.00 98.48  ? 202 TRP C CH2   1 
ATOM   6716 N N     . ALA K 3 202 ? 23.422  -1.860  234.191 1.00 58.81  ? 203 ALA C N     1 
ATOM   6717 C CA    . ALA K 3 202 ? 22.266  -2.700  233.922 1.00 56.11  ? 203 ALA C CA    1 
ATOM   6718 C C     . ALA K 3 202 ? 22.600  -4.183  233.807 1.00 55.40  ? 203 ALA C C     1 
ATOM   6719 O O     . ALA K 3 202 ? 21.866  -5.013  234.318 1.00 60.38  ? 203 ALA C O     1 
ATOM   6720 C CB    . ALA K 3 202 ? 21.558  -2.235  232.658 1.00 62.28  ? 203 ALA C CB    1 
ATOM   6721 N N     . ALA K 3 203 ? 23.705  -4.531  233.153 1.00 54.98  ? 204 ALA C N     1 
ATOM   6722 C CA    . ALA K 3 203 ? 24.032  -5.947  232.993 1.00 54.98  ? 204 ALA C CA    1 
ATOM   6723 C C     . ALA K 3 203 ? 24.788  -6.532  234.171 1.00 58.24  ? 204 ALA C C     1 
ATOM   6724 O O     . ALA K 3 203 ? 25.892  -7.062  234.023 1.00 61.10  ? 204 ALA C O     1 
ATOM   6725 C CB    . ALA K 3 203 ? 24.801  -6.179  231.696 1.00 48.14  ? 204 ALA C CB    1 
ATOM   6726 N N     . ALA K 3 204 ? 24.172  -6.438  235.346 1.00 54.06  ? 205 ALA C N     1 
ATOM   6727 C CA    . ALA K 3 204 ? 24.766  -6.974  236.558 1.00 52.98  ? 205 ALA C CA    1 
ATOM   6728 C C     . ALA K 3 204 ? 26.046  -6.249  236.944 1.00 56.62  ? 205 ALA C C     1 
ATOM   6729 O O     . ALA K 3 204 ? 26.949  -6.853  237.515 1.00 56.21  ? 205 ALA C O     1 
ATOM   6730 C CB    . ALA K 3 204 ? 25.050  -8.455  236.378 1.00 50.49  ? 205 ALA C CB    1 
ATOM   6731 N N     . MET K 3 205 ? 26.119  -4.956  236.646 1.00 62.24  ? 206 MET C N     1 
ATOM   6732 C CA    . MET K 3 205 ? 27.303  -4.168  236.967 1.00 69.82  ? 206 MET C CA    1 
ATOM   6733 C C     . MET K 3 205 ? 28.536  -4.962  236.545 1.00 72.32  ? 206 MET C C     1 
ATOM   6734 O O     . MET K 3 205 ? 29.434  -5.243  237.345 1.00 75.27  ? 206 MET C O     1 
ATOM   6735 C CB    . MET K 3 205 ? 27.351  -3.883  238.462 1.00 73.66  ? 206 MET C CB    1 
ATOM   6736 C CG    . MET K 3 205 ? 26.086  -3.255  239.010 1.00 76.72  ? 206 MET C CG    1 
ATOM   6737 S SD    . MET K 3 205 ? 26.111  -3.167  240.810 1.00 73.53  ? 206 MET C SD    1 
ATOM   6738 C CE    . MET K 3 205 ? 26.544  -4.863  241.230 1.00 75.93  ? 206 MET C CE    1 
ATOM   6739 N N     . GLN K 3 206 ? 28.560  -5.320  235.268 1.00 70.59  ? 207 GLN C N     1 
ATOM   6740 C CA    . GLN K 3 206 ? 29.642  -6.097  234.697 1.00 69.15  ? 207 GLN C CA    1 
ATOM   6741 C C     . GLN K 3 206 ? 30.543  -5.291  233.781 1.00 68.03  ? 207 GLN C C     1 
ATOM   6742 O O     . GLN K 3 206 ? 30.082  -4.408  233.060 1.00 57.36  ? 207 GLN C O     1 
ATOM   6743 C CB    . GLN K 3 206 ? 29.056  -7.252  233.896 1.00 71.01  ? 207 GLN C CB    1 
ATOM   6744 C CG    . GLN K 3 206 ? 28.382  -8.275  234.734 1.00 61.18  ? 207 GLN C CG    1 
ATOM   6745 C CD    . GLN K 3 206 ? 29.371  -8.987  235.592 1.00 58.40  ? 207 GLN C CD    1 
ATOM   6746 O OE1   . GLN K 3 206 ? 30.290  -9.628  235.089 1.00 53.37  ? 207 GLN C OE1   1 
ATOM   6747 N NE2   . GLN K 3 206 ? 29.200  -8.881  236.898 1.00 63.62  ? 207 GLN C NE2   1 
ATOM   6748 N N     . ILE K 3 207 ? 31.833  -5.603  233.819 1.00 72.11  ? 208 ILE C N     1 
ATOM   6749 C CA    . ILE K 3 207 ? 32.796  -4.954  232.950 1.00 75.10  ? 208 ILE C CA    1 
ATOM   6750 C C     . ILE K 3 207 ? 32.676  -5.792  231.685 1.00 81.69  ? 208 ILE C C     1 
ATOM   6751 O O     . ILE K 3 207 ? 32.823  -7.024  231.728 1.00 79.72  ? 208 ILE C O     1 
ATOM   6752 C CB    . ILE K 3 207 ? 34.231  -5.094  233.467 1.00 75.96  ? 208 ILE C CB    1 
ATOM   6753 C CG1   . ILE K 3 207 ? 34.322  -4.662  234.933 1.00 75.71  ? 208 ILE C CG1   1 
ATOM   6754 C CG2   . ILE K 3 207 ? 35.157  -4.255  232.601 1.00 76.52  ? 208 ILE C CG2   1 
ATOM   6755 C CD1   . ILE K 3 207 ? 34.187  -3.188  235.148 1.00 75.40  ? 208 ILE C CD1   1 
ATOM   6756 N N     . GLN K 3 208 ? 32.400  -5.143  230.561 1.00 82.03  ? 209 GLN C N     1 
ATOM   6757 C CA    . GLN K 3 208 ? 32.251  -5.887  229.319 1.00 79.64  ? 209 GLN C CA    1 
ATOM   6758 C C     . GLN K 3 208 ? 33.300  -5.550  228.269 1.00 78.53  ? 209 GLN C C     1 
ATOM   6759 O O     . GLN K 3 208 ? 33.702  -4.397  228.113 1.00 77.56  ? 209 GLN C O     1 
ATOM   6760 C CB    . GLN K 3 208 ? 30.850  -5.661  228.747 1.00 71.85  ? 209 GLN C CB    1 
ATOM   6761 C CG    . GLN K 3 208 ? 29.732  -6.044  229.694 1.00 65.56  ? 209 GLN C CG    1 
ATOM   6762 C CD    . GLN K 3 208 ? 28.364  -5.730  229.131 1.00 68.29  ? 209 GLN C CD    1 
ATOM   6763 O OE1   . GLN K 3 208 ? 28.129  -4.627  228.637 1.00 63.45  ? 209 GLN C OE1   1 
ATOM   6764 N NE2   . GLN K 3 208 ? 27.446  -6.695  229.210 1.00 65.19  ? 209 GLN C NE2   1 
ATOM   6765 N N     . PHE K 3 209 ? 33.739  -6.582  227.559 1.00 79.72  ? 210 PHE C N     1 
ATOM   6766 C CA    . PHE K 3 209 ? 34.722  -6.438  226.498 1.00 87.98  ? 210 PHE C CA    1 
ATOM   6767 C C     . PHE K 3 209 ? 35.061  -7.801  225.878 1.00 93.83  ? 210 PHE C C     1 
ATOM   6768 O O     . PHE K 3 209 ? 34.837  -8.851  226.487 1.00 101.28 ? 210 PHE C O     1 
ATOM   6769 C CB    . PHE K 3 209 ? 35.986  -5.754  227.034 1.00 84.46  ? 210 PHE C CB    1 
ATOM   6770 C CG    . PHE K 3 209 ? 36.686  -6.517  228.125 1.00 83.21  ? 210 PHE C CG    1 
ATOM   6771 C CD1   . PHE K 3 209 ? 37.340  -7.709  227.854 1.00 80.72  ? 210 PHE C CD1   1 
ATOM   6772 C CD2   . PHE K 3 209 ? 36.731  -6.019  229.418 1.00 89.17  ? 210 PHE C CD2   1 
ATOM   6773 C CE1   . PHE K 3 209 ? 38.029  -8.386  228.851 1.00 77.35  ? 210 PHE C CE1   1 
ATOM   6774 C CE2   . PHE K 3 209 ? 37.421  -6.695  230.419 1.00 84.82  ? 210 PHE C CE2   1 
ATOM   6775 C CZ    . PHE K 3 209 ? 38.069  -7.877  230.131 1.00 77.49  ? 210 PHE C CZ    1 
ATOM   6776 N N     . HIS K 3 210 ? 35.589  -7.795  224.661 1.00 91.85  ? 211 HIS C N     1 
ATOM   6777 C CA    . HIS K 3 210 ? 35.937  -9.050  224.009 1.00 85.26  ? 211 HIS C CA    1 
ATOM   6778 C C     . HIS K 3 210 ? 37.400  -9.393  224.300 1.00 85.96  ? 211 HIS C C     1 
ATOM   6779 O O     . HIS K 3 210 ? 38.256  -8.513  224.435 1.00 84.96  ? 211 HIS C O     1 
ATOM   6780 C CB    . HIS K 3 210 ? 35.686  -8.936  222.500 1.00 81.95  ? 211 HIS C CB    1 
ATOM   6781 C CG    . HIS K 3 210 ? 34.248  -8.681  222.136 1.00 75.50  ? 211 HIS C CG    1 
ATOM   6782 N ND1   . HIS K 3 210 ? 33.255  -9.624  222.306 1.00 72.38  ? 211 HIS C ND1   1 
ATOM   6783 C CD2   . HIS K 3 210 ? 33.639  -7.589  221.617 1.00 71.19  ? 211 HIS C CD2   1 
ATOM   6784 C CE1   . HIS K 3 210 ? 32.098  -9.123  221.910 1.00 63.73  ? 211 HIS C CE1   1 
ATOM   6785 N NE2   . HIS K 3 210 ? 32.302  -7.890  221.488 1.00 64.16  ? 211 HIS C NE2   1 
ATOM   6786 N N     . VAL K 3 211 ? 37.690  -10.680 224.413 1.00 88.68  ? 212 VAL C N     1 
ATOM   6787 C CA    . VAL K 3 211 ? 39.054  -11.110 224.704 1.00 82.93  ? 212 VAL C CA    1 
ATOM   6788 C C     . VAL K 3 211 ? 39.969  -10.749 223.541 1.00 83.56  ? 212 VAL C C     1 
ATOM   6789 O O     . VAL K 3 211 ? 40.939  -10.011 223.717 1.00 77.68  ? 212 VAL C O     1 
ATOM   6790 C CB    . VAL K 3 211 ? 39.122  -12.645 224.941 1.00 74.44  ? 212 VAL C CB    1 
ATOM   6791 C CG1   . VAL K 3 211 ? 40.425  -13.016 225.592 1.00 67.29  ? 212 VAL C CG1   1 
ATOM   6792 C CG2   . VAL K 3 211 ? 37.960  -13.093 225.786 1.00 68.10  ? 212 VAL C CG2   1 
ATOM   6793 N N     . ARG K 3 212 ? 39.625  -11.255 222.354 1.00 87.15  ? 213 ARG C N     1 
ATOM   6794 C CA    . ARG K 3 212 ? 40.411  -11.041 221.143 1.00 92.79  ? 213 ARG C CA    1 
ATOM   6795 C C     . ARG K 3 212 ? 40.769  -9.586  220.875 1.00 94.63  ? 213 ARG C C     1 
ATOM   6796 O O     . ARG K 3 212 ? 41.627  -9.304  220.035 1.00 99.51  ? 213 ARG C O     1 
ATOM   6797 C CB    . ARG K 3 212 ? 39.700  -11.622 219.908 1.00 93.39  ? 213 ARG C CB    1 
ATOM   6798 C CG    . ARG K 3 212 ? 40.676  -11.906 218.759 1.00 100.10 ? 213 ARG C CG    1 
ATOM   6799 C CD    . ARG K 3 212 ? 40.023  -12.399 217.468 1.00 99.65  ? 213 ARG C CD    1 
ATOM   6800 N NE    . ARG K 3 212 ? 41.039  -12.637 216.431 1.00 97.15  ? 213 ARG C NE    1 
ATOM   6801 C CZ    . ARG K 3 212 ? 40.803  -12.669 215.118 1.00 90.43  ? 213 ARG C CZ    1 
ATOM   6802 N NH1   . ARG K 3 212 ? 39.578  -12.478 214.640 1.00 82.82  ? 213 ARG C NH1   1 
ATOM   6803 N NH2   . ARG K 3 212 ? 41.803  -12.882 214.276 1.00 90.16  ? 213 ARG C NH2   1 
ATOM   6804 N N     . ASP K 3 213 ? 40.119  -8.664  221.578 1.00 93.46  ? 214 ASP C N     1 
ATOM   6805 C CA    . ASP K 3 213 ? 40.405  -7.245  221.390 1.00 90.70  ? 214 ASP C CA    1 
ATOM   6806 C C     . ASP K 3 213 ? 40.283  -6.422  222.664 1.00 82.25  ? 214 ASP C C     1 
ATOM   6807 O O     . ASP K 3 213 ? 39.288  -5.747  222.878 1.00 76.11  ? 214 ASP C O     1 
ATOM   6808 C CB    . ASP K 3 213 ? 39.498  -6.656  220.301 1.00 96.96  ? 214 ASP C CB    1 
ATOM   6809 C CG    . ASP K 3 213 ? 38.145  -7.333  220.232 1.00 102.33 ? 214 ASP C CG    1 
ATOM   6810 O OD1   . ASP K 3 213 ? 38.108  -8.546  219.927 1.00 106.92 ? 214 ASP C OD1   1 
ATOM   6811 O OD2   . ASP K 3 213 ? 37.121  -6.651  220.474 1.00 107.25 ? 214 ASP C OD2   1 
ATOM   6812 N N     . LEU K 3 214 ? 41.303  -6.477  223.508 1.00 84.06  ? 215 LEU C N     1 
ATOM   6813 C CA    . LEU K 3 214 ? 41.278  -5.717  224.747 1.00 93.55  ? 215 LEU C CA    1 
ATOM   6814 C C     . LEU K 3 214 ? 42.393  -4.688  224.807 1.00 99.08  ? 215 LEU C C     1 
ATOM   6815 O O     . LEU K 3 214 ? 43.566  -5.017  224.657 1.00 99.00  ? 215 LEU C O     1 
ATOM   6816 C CB    . LEU K 3 214 ? 41.372  -6.655  225.952 1.00 87.01  ? 215 LEU C CB    1 
ATOM   6817 C CG    . LEU K 3 214 ? 41.554  -6.009  227.331 1.00 73.25  ? 215 LEU C CG    1 
ATOM   6818 C CD1   . LEU K 3 214 ? 40.651  -4.802  227.531 1.00 60.41  ? 215 LEU C CD1   1 
ATOM   6819 C CD2   . LEU K 3 214 ? 41.277  -7.070  228.364 1.00 75.73  ? 215 LEU C CD2   1 
ATOM   6820 N N     . ASP K 3 215 ? 42.015  -3.437  225.041 1.00 107.89 ? 216 ASP C N     1 
ATOM   6821 C CA    . ASP K 3 215 ? 42.985  -2.354  225.111 1.00 116.85 ? 216 ASP C CA    1 
ATOM   6822 C C     . ASP K 3 215 ? 43.952  -2.529  226.280 1.00 117.82 ? 216 ASP C C     1 
ATOM   6823 O O     . ASP K 3 215 ? 43.802  -1.900  227.333 1.00 116.54 ? 216 ASP C O     1 
ATOM   6824 C CB    . ASP K 3 215 ? 42.265  -1.010  225.228 1.00 126.84 ? 216 ASP C CB    1 
ATOM   6825 C CG    . ASP K 3 215 ? 41.117  -0.871  224.236 1.00 134.30 ? 216 ASP C CG    1 
ATOM   6826 O OD1   . ASP K 3 215 ? 41.316  -1.154  223.031 1.00 135.02 ? 216 ASP C OD1   1 
ATOM   6827 O OD2   . ASP K 3 215 ? 40.014  -0.468  224.666 1.00 138.31 ? 216 ASP C OD2   1 
ATOM   6828 N N     . GLN K 3 216 ? 44.948  -3.387  226.072 1.00 118.21 ? 217 GLN C N     1 
ATOM   6829 C CA    . GLN K 3 216 ? 45.967  -3.663  227.078 1.00 121.01 ? 217 GLN C CA    1 
ATOM   6830 C C     . GLN K 3 216 ? 47.081  -2.612  227.044 1.00 128.14 ? 217 GLN C C     1 
ATOM   6831 O O     . GLN K 3 216 ? 48.269  -2.943  227.116 1.00 128.78 ? 217 GLN C O     1 
ATOM   6832 C CB    . GLN K 3 216 ? 46.558  -5.056  226.853 1.00 107.16 ? 217 GLN C CB    1 
ATOM   6833 C CG    . GLN K 3 216 ? 45.509  -6.133  226.768 1.00 103.48 ? 217 GLN C CG    1 
ATOM   6834 C CD    . GLN K 3 216 ? 46.045  -7.513  227.103 1.00 105.59 ? 217 GLN C CD    1 
ATOM   6835 O OE1   . GLN K 3 216 ? 47.079  -7.932  226.586 1.00 99.88  ? 217 GLN C OE1   1 
ATOM   6836 N NE2   . GLN K 3 216 ? 45.330  -8.235  227.967 1.00 106.13 ? 217 GLN C NE2   1 
ATOM   6837 N N     . GLY K 3 217 ? 46.686  -1.344  226.939 1.00 132.24 ? 218 GLY C N     1 
ATOM   6838 C CA    . GLY K 3 217 ? 47.654  -0.263  226.897 1.00 136.88 ? 218 GLY C CA    1 
ATOM   6839 C C     . GLY K 3 217 ? 47.875  0.367   228.257 1.00 141.59 ? 218 GLY C C     1 
ATOM   6840 O O     . GLY K 3 217 ? 47.304  1.412   228.566 1.00 143.62 ? 218 GLY C O     1 
ATOM   6841 N N     . PHE K 3 218 ? 48.707  -0.272  229.074 1.00 144.68 ? 219 PHE C N     1 
ATOM   6842 C CA    . PHE K 3 218 ? 49.003  0.226   230.413 1.00 150.01 ? 219 PHE C CA    1 
ATOM   6843 C C     . PHE K 3 218 ? 50.410  -0.175  230.846 1.00 151.18 ? 219 PHE C C     1 
ATOM   6844 O O     . PHE K 3 218 ? 50.741  -1.363  230.903 1.00 150.27 ? 219 PHE C O     1 
ATOM   6845 C CB    . PHE K 3 218 ? 47.976  -0.316  231.417 1.00 154.61 ? 219 PHE C CB    1 
ATOM   6846 C CG    . PHE K 3 218 ? 48.242  0.090   232.846 1.00 157.94 ? 219 PHE C CG    1 
ATOM   6847 C CD1   . PHE K 3 218 ? 48.232  1.436   233.218 1.00 157.34 ? 219 PHE C CD1   1 
ATOM   6848 C CD2   . PHE K 3 218 ? 48.520  -0.874  233.816 1.00 156.02 ? 219 PHE C CD2   1 
ATOM   6849 C CE1   . PHE K 3 218 ? 48.496  1.815   234.533 1.00 155.60 ? 219 PHE C CE1   1 
ATOM   6850 C CE2   . PHE K 3 218 ? 48.786  -0.505  235.133 1.00 155.91 ? 219 PHE C CE2   1 
ATOM   6851 C CZ    . PHE K 3 218 ? 48.775  0.842   235.493 1.00 155.90 ? 219 PHE C CZ    1 
ATOM   6852 N N     . ASN K 3 219 ? 51.234  0.823   231.153 1.00 151.13 ? 220 ASN C N     1 
ATOM   6853 C CA    . ASN K 3 219 ? 52.604  0.578   231.585 1.00 149.94 ? 220 ASN C CA    1 
ATOM   6854 C C     . ASN K 3 219 ? 52.779  0.983   233.044 1.00 148.43 ? 220 ASN C C     1 
ATOM   6855 O O     . ASN K 3 219 ? 52.783  2.173   233.371 1.00 148.84 ? 220 ASN C O     1 
ATOM   6856 C CB    . ASN K 3 219 ? 53.582  1.363   230.711 1.00 150.99 ? 220 ASN C CB    1 
ATOM   6857 C CG    . ASN K 3 219 ? 55.020  0.968   230.954 1.00 150.21 ? 220 ASN C CG    1 
ATOM   6858 O OD1   . ASN K 3 219 ? 55.506  1.017   232.083 1.00 147.83 ? 220 ASN C OD1   1 
ATOM   6859 N ND2   . ASN K 3 219 ? 55.712  0.571   229.890 1.00 149.24 ? 220 ASN C ND2   1 
ATOM   6860 N N     . GLY K 3 220 ? 52.919  -0.015  233.914 1.00 145.43 ? 221 GLY C N     1 
ATOM   6861 C CA    . GLY K 3 220 ? 53.085  0.245   235.334 1.00 138.14 ? 221 GLY C CA    1 
ATOM   6862 C C     . GLY K 3 220 ? 52.752  -0.965  236.188 1.00 131.63 ? 221 GLY C C     1 
ATOM   6863 O O     . GLY K 3 220 ? 52.029  -1.861  235.752 1.00 128.30 ? 221 GLY C O     1 
ATOM   6864 N N     . THR K 3 221 ? 53.279  -0.988  237.409 1.00 128.70 ? 222 THR C N     1 
ATOM   6865 C CA    . THR K 3 221 ? 53.040  -2.097  238.329 1.00 126.18 ? 222 THR C CA    1 
ATOM   6866 C C     . THR K 3 221 ? 51.553  -2.200  238.669 1.00 122.46 ? 222 THR C C     1 
ATOM   6867 O O     . THR K 3 221 ? 50.764  -1.335  238.282 1.00 126.09 ? 222 THR C O     1 
ATOM   6868 C CB    . THR K 3 221 ? 53.849  -1.930  239.642 1.00 124.67 ? 222 THR C CB    1 
ATOM   6869 O OG1   . THR K 3 221 ? 53.256  -0.909  240.452 1.00 121.49 ? 222 THR C OG1   1 
ATOM   6870 C CG2   . THR K 3 221 ? 55.289  -1.540  239.331 1.00 123.74 ? 222 THR C CG2   1 
ATOM   6871 N N     . ARG K 3 222 ? 51.173  -3.256  239.391 1.00 115.00 ? 223 ARG C N     1 
ATOM   6872 C CA    . ARG K 3 222 ? 49.773  -3.469  239.769 1.00 102.22 ? 223 ARG C CA    1 
ATOM   6873 C C     . ARG K 3 222 ? 49.303  -2.341  240.670 1.00 100.69 ? 223 ARG C C     1 
ATOM   6874 O O     . ARG K 3 222 ? 48.111  -2.059  240.752 1.00 93.90  ? 223 ARG C O     1 
ATOM   6875 C CB    . ARG K 3 222 ? 49.609  -4.796  240.504 1.00 89.49  ? 223 ARG C CB    1 
ATOM   6876 C CG    . ARG K 3 222 ? 48.195  -5.339  240.468 1.00 79.61  ? 223 ARG C CG    1 
ATOM   6877 C CD    . ARG K 3 222 ? 47.884  -5.994  239.132 1.00 88.07  ? 223 ARG C CD    1 
ATOM   6878 N NE    . ARG K 3 222 ? 48.694  -7.194  238.885 1.00 91.28  ? 223 ARG C NE    1 
ATOM   6879 C CZ    . ARG K 3 222 ? 48.470  -8.398  239.415 1.00 83.70  ? 223 ARG C CZ    1 
ATOM   6880 N NH1   . ARG K 3 222 ? 47.447  -8.595  240.236 1.00 85.39  ? 223 ARG C NH1   1 
ATOM   6881 N NH2   . ARG K 3 222 ? 49.277  -9.410  239.125 1.00 74.50  ? 223 ARG C NH2   1 
ATOM   6882 N N     . GLU K 3 223 ? 50.261  -1.707  241.343 1.00 103.24 ? 224 GLU C N     1 
ATOM   6883 C CA    . GLU K 3 223 ? 49.991  -0.600  242.252 1.00 100.79 ? 224 GLU C CA    1 
ATOM   6884 C C     . GLU K 3 223 ? 49.084  0.424   241.600 1.00 102.63 ? 224 GLU C C     1 
ATOM   6885 O O     . GLU K 3 223 ? 47.953  0.629   242.034 1.00 100.40 ? 224 GLU C O     1 
ATOM   6886 C CB    . GLU K 3 223 ? 51.301  0.072   242.663 1.00 98.64  ? 224 GLU C CB    1 
ATOM   6887 N N     . GLU K 3 224 ? 49.590  1.073   240.558 1.00 106.95 ? 225 GLU C N     1 
ATOM   6888 C CA    . GLU K 3 224 ? 48.815  2.080   239.849 1.00 115.20 ? 225 GLU C CA    1 
ATOM   6889 C C     . GLU K 3 224 ? 47.437  1.540   239.478 1.00 119.98 ? 225 GLU C C     1 
ATOM   6890 O O     . GLU K 3 224 ? 46.435  2.246   239.605 1.00 118.80 ? 225 GLU C O     1 
ATOM   6891 C CB    . GLU K 3 224 ? 49.559  2.525   238.587 1.00 118.35 ? 225 GLU C CB    1 
ATOM   6892 C CG    . GLU K 3 224 ? 50.645  3.568   238.818 1.00 119.08 ? 225 GLU C CG    1 
ATOM   6893 C CD    . GLU K 3 224 ? 51.849  3.350   237.919 1.00 118.31 ? 225 GLU C CD    1 
ATOM   6894 O OE1   . GLU K 3 224 ? 51.660  2.929   236.758 1.00 115.66 ? 225 GLU C OE1   1 
ATOM   6895 O OE2   . GLU K 3 224 ? 52.985  3.605   238.371 1.00 115.47 ? 225 GLU C OE2   1 
ATOM   6896 N N     . TRP K 3 225 ? 47.394  0.286   239.028 1.00 124.01 ? 226 TRP C N     1 
ATOM   6897 C CA    . TRP K 3 225 ? 46.142  -0.350  238.630 1.00 128.03 ? 226 TRP C CA    1 
ATOM   6898 C C     . TRP K 3 225 ? 45.049  -0.118  239.668 1.00 127.02 ? 226 TRP C C     1 
ATOM   6899 O O     . TRP K 3 225 ? 43.964  0.361   239.340 1.00 124.74 ? 226 TRP C O     1 
ATOM   6900 C CB    . TRP K 3 225 ? 46.367  -1.855  238.405 1.00 137.30 ? 226 TRP C CB    1 
ATOM   6901 C CG    . TRP K 3 225 ? 45.106  -2.646  238.154 1.00 149.21 ? 226 TRP C CG    1 
ATOM   6902 C CD1   . TRP K 3 225 ? 44.238  -3.127  239.097 1.00 154.26 ? 226 TRP C CD1   1 
ATOM   6903 C CD2   . TRP K 3 225 ? 44.553  -3.014  236.881 1.00 151.18 ? 226 TRP C CD2   1 
ATOM   6904 N NE1   . TRP K 3 225 ? 43.183  -3.768  238.492 1.00 154.65 ? 226 TRP C NE1   1 
ATOM   6905 C CE2   . TRP K 3 225 ? 43.350  -3.713  237.133 1.00 152.89 ? 226 TRP C CE2   1 
ATOM   6906 C CE3   . TRP K 3 225 ? 44.956  -2.821  235.553 1.00 148.98 ? 226 TRP C CE3   1 
ATOM   6907 C CZ2   . TRP K 3 225 ? 42.546  -4.216  236.107 1.00 151.61 ? 226 TRP C CZ2   1 
ATOM   6908 C CZ3   . TRP K 3 225 ? 44.155  -3.323  234.532 1.00 148.17 ? 226 TRP C CZ3   1 
ATOM   6909 C CH2   . TRP K 3 225 ? 42.964  -4.012  234.818 1.00 149.12 ? 226 TRP C CH2   1 
ATOM   6910 N N     . ALA K 3 226 ? 45.348  -0.449  240.920 1.00 126.24 ? 227 ALA C N     1 
ATOM   6911 C CA    . ALA K 3 226 ? 44.395  -0.275  242.011 1.00 124.43 ? 227 ALA C CA    1 
ATOM   6912 C C     . ALA K 3 226 ? 43.943  1.173   242.105 1.00 123.37 ? 227 ALA C C     1 
ATOM   6913 O O     . ALA K 3 226 ? 42.776  1.485   241.863 1.00 121.57 ? 227 ALA C O     1 
ATOM   6914 C CB    . ALA K 3 226 ? 45.023  -0.704  243.328 1.00 127.14 ? 227 ALA C CB    1 
ATOM   6915 N N     . LYS K 3 227 ? 44.878  2.051   242.461 1.00 123.69 ? 228 LYS C N     1 
ATOM   6916 C CA    . LYS K 3 227 ? 44.592  3.476   242.597 1.00 124.88 ? 228 LYS C CA    1 
ATOM   6917 C C     . LYS K 3 227 ? 43.958  3.997   241.324 1.00 125.12 ? 228 LYS C C     1 
ATOM   6918 O O     . LYS K 3 227 ? 43.339  5.065   241.306 1.00 125.07 ? 228 LYS C O     1 
ATOM   6919 C CB    . LYS K 3 227 ? 45.879  4.260   242.891 1.00 124.24 ? 228 LYS C CB    1 
ATOM   6920 C CG    . LYS K 3 227 ? 46.481  3.988   244.269 1.00 123.30 ? 228 LYS C CG    1 
ATOM   6921 C CD    . LYS K 3 227 ? 45.547  4.430   245.404 1.00 120.20 ? 228 LYS C CD    1 
ATOM   6922 C CE    . LYS K 3 227 ? 45.608  5.928   245.646 1.00 113.19 ? 228 LYS C CE    1 
ATOM   6923 N NZ    . LYS K 3 227 ? 46.953  6.343   246.125 1.00 106.95 ? 228 LYS C NZ    1 
ATOM   6924 N N     . SER K 3 228 ? 44.113  3.231   240.255 1.00 123.97 ? 229 SER C N     1 
ATOM   6925 C CA    . SER K 3 228 ? 43.552  3.617   238.979 1.00 124.41 ? 229 SER C CA    1 
ATOM   6926 C C     . SER K 3 228 ? 42.079  3.246   238.893 1.00 125.10 ? 229 SER C C     1 
ATOM   6927 O O     . SER K 3 228 ? 41.207  4.120   238.880 1.00 124.20 ? 229 SER C O     1 
ATOM   6928 C CB    . SER K 3 228 ? 44.313  2.940   237.849 1.00 120.89 ? 229 SER C CB    1 
ATOM   6929 O OG    . SER K 3 228 ? 43.773  3.335   236.605 1.00 124.82 ? 229 SER C OG    1 
ATOM   6930 N N     . TYR K 3 229 ? 41.814  1.941   238.835 1.00 125.72 ? 230 TYR C N     1 
ATOM   6931 C CA    . TYR K 3 229 ? 40.453  1.419   238.732 1.00 121.36 ? 230 TYR C CA    1 
ATOM   6932 C C     . TYR K 3 229 ? 39.550  2.066   239.764 1.00 115.08 ? 230 TYR C C     1 
ATOM   6933 O O     . TYR K 3 229 ? 38.502  2.622   239.434 1.00 109.63 ? 230 TYR C O     1 
ATOM   6934 C CB    . TYR K 3 229 ? 40.449  -0.101  238.924 1.00 124.82 ? 230 TYR C CB    1 
ATOM   6935 C CG    . TYR K 3 229 ? 39.082  -0.723  238.736 1.00 130.09 ? 230 TYR C CG    1 
ATOM   6936 C CD1   . TYR K 3 229 ? 38.412  -0.624  237.520 1.00 130.87 ? 230 TYR C CD1   1 
ATOM   6937 C CD2   . TYR K 3 229 ? 38.444  -1.385  239.780 1.00 131.72 ? 230 TYR C CD2   1 
ATOM   6938 C CE1   . TYR K 3 229 ? 37.140  -1.164  237.352 1.00 130.34 ? 230 TYR C CE1   1 
ATOM   6939 C CE2   . TYR K 3 229 ? 37.171  -1.929  239.619 1.00 129.62 ? 230 TYR C CE2   1 
ATOM   6940 C CZ    . TYR K 3 229 ? 36.526  -1.814  238.405 1.00 126.63 ? 230 TYR C CZ    1 
ATOM   6941 O OH    . TYR K 3 229 ? 35.264  -2.338  238.249 1.00 123.70 ? 230 TYR C OH    1 
ATOM   6942 N N     . LEU K 3 230 ? 39.966  1.979   241.019 1.00 110.15 ? 231 LEU C N     1 
ATOM   6943 C CA    . LEU K 3 230 ? 39.214  2.565   242.107 1.00 110.23 ? 231 LEU C CA    1 
ATOM   6944 C C     . LEU K 3 230 ? 38.861  4.010   241.753 1.00 113.80 ? 231 LEU C C     1 
ATOM   6945 O O     . LEU K 3 230 ? 37.772  4.487   242.065 1.00 112.79 ? 231 LEU C O     1 
ATOM   6946 C CB    . LEU K 3 230 ? 40.050  2.524   243.389 1.00 107.79 ? 231 LEU C CB    1 
ATOM   6947 C CG    . LEU K 3 230 ? 40.304  1.161   244.031 1.00 103.17 ? 231 LEU C CG    1 
ATOM   6948 C CD1   . LEU K 3 230 ? 41.443  1.247   245.025 1.00 105.29 ? 231 LEU C CD1   1 
ATOM   6949 C CD2   . LEU K 3 230 ? 39.040  0.696   244.720 1.00 104.01 ? 231 LEU C CD2   1 
ATOM   6950 N N     . LYS K 3 231 ? 39.788  4.694   241.085 1.00 118.30 ? 232 LYS C N     1 
ATOM   6951 C CA    . LYS K 3 231 ? 39.603  6.091   240.697 1.00 122.00 ? 232 LYS C CA    1 
ATOM   6952 C C     . LYS K 3 231 ? 38.591  6.237   239.567 1.00 124.27 ? 232 LYS C C     1 
ATOM   6953 O O     . LYS K 3 231 ? 37.893  7.248   239.461 1.00 124.07 ? 232 LYS C O     1 
ATOM   6954 C CB    . LYS K 3 231 ? 40.953  6.692   240.279 1.00 119.30 ? 232 LYS C CB    1 
ATOM   6955 C CG    . LYS K 3 231 ? 40.915  8.167   239.901 1.00 121.17 ? 232 LYS C CG    1 
ATOM   6956 C CD    . LYS K 3 231 ? 40.616  8.374   238.428 1.00 119.20 ? 232 LYS C CD    1 
ATOM   6957 C CE    . LYS K 3 231 ? 40.634  9.853   238.073 1.00 120.21 ? 232 LYS C CE    1 
ATOM   6958 N NZ    . LYS K 3 231 ? 39.517  10.590  238.725 1.00 114.33 ? 232 LYS C NZ    1 
ATOM   6959 N N     . HIS K 3 232 ? 38.516  5.212   238.728 1.00 123.20 ? 233 HIS C N     1 
ATOM   6960 C CA    . HIS K 3 232 ? 37.604  5.211   237.596 1.00 121.76 ? 233 HIS C CA    1 
ATOM   6961 C C     . HIS K 3 232 ? 36.241  4.669   238.001 1.00 117.03 ? 233 HIS C C     1 
ATOM   6962 O O     . HIS K 3 232 ? 35.203  5.228   237.637 1.00 114.95 ? 233 HIS C O     1 
ATOM   6963 C CB    . HIS K 3 232 ? 38.192  4.353   236.466 1.00 127.21 ? 233 HIS C CB    1 
ATOM   6964 C CG    . HIS K 3 232 ? 37.360  4.323   235.219 1.00 126.70 ? 233 HIS C CG    1 
ATOM   6965 N ND1   . HIS K 3 232 ? 37.086  5.451   234.477 1.00 128.80 ? 233 HIS C ND1   1 
ATOM   6966 C CD2   . HIS K 3 232 ? 36.757  3.295   234.577 1.00 123.08 ? 233 HIS C CD2   1 
ATOM   6967 C CE1   . HIS K 3 232 ? 36.350  5.120   233.431 1.00 126.92 ? 233 HIS C CE1   1 
ATOM   6968 N NE2   . HIS K 3 232 ? 36.137  3.817   233.469 1.00 127.06 ? 233 HIS C NE2   1 
ATOM   6969 N N     . PHE K 3 233 ? 36.254  3.583   238.766 1.00 112.26 ? 234 PHE C N     1 
ATOM   6970 C CA    . PHE K 3 233 ? 35.022  2.937   239.207 1.00 111.00 ? 234 PHE C CA    1 
ATOM   6971 C C     . PHE K 3 233 ? 34.050  3.881   239.925 1.00 105.92 ? 234 PHE C C     1 
ATOM   6972 O O     . PHE K 3 233 ? 32.832  3.805   239.742 1.00 101.91 ? 234 PHE C O     1 
ATOM   6973 C CB    . PHE K 3 233 ? 35.368  1.731   240.093 1.00 114.81 ? 234 PHE C CB    1 
ATOM   6974 C CG    . PHE K 3 233 ? 34.168  0.976   240.590 1.00 117.60 ? 234 PHE C CG    1 
ATOM   6975 C CD1   . PHE K 3 233 ? 33.542  1.344   241.775 1.00 120.46 ? 234 PHE C CD1   1 
ATOM   6976 C CD2   . PHE K 3 233 ? 33.661  -0.097  239.869 1.00 117.06 ? 234 PHE C CD2   1 
ATOM   6977 C CE1   . PHE K 3 233 ? 32.429  0.655   242.237 1.00 121.78 ? 234 PHE C CE1   1 
ATOM   6978 C CE2   . PHE K 3 233 ? 32.548  -0.793  240.322 1.00 119.98 ? 234 PHE C CE2   1 
ATOM   6979 C CZ    . PHE K 3 233 ? 31.931  -0.416  241.509 1.00 121.54 ? 234 PHE C CZ    1 
ATOM   6980 N N     . VAL K 3 234 ? 34.594  4.777   240.734 1.00 100.37 ? 235 VAL C N     1 
ATOM   6981 C CA    . VAL K 3 234 ? 33.773  5.719   241.467 1.00 93.24  ? 235 VAL C CA    1 
ATOM   6982 C C     . VAL K 3 234 ? 33.110  6.678   240.497 1.00 88.45  ? 235 VAL C C     1 
ATOM   6983 O O     . VAL K 3 234 ? 31.884  6.765   240.421 1.00 81.93  ? 235 VAL C O     1 
ATOM   6984 C CB    . VAL K 3 234 ? 34.639  6.504   242.470 1.00 96.82  ? 235 VAL C CB    1 
ATOM   6985 C CG1   . VAL K 3 234 ? 33.812  7.557   243.190 1.00 94.03  ? 235 VAL C CG1   1 
ATOM   6986 C CG2   . VAL K 3 234 ? 35.257  5.531   243.469 1.00 100.41 ? 235 VAL C CG2   1 
ATOM   6987 N N     . THR K 3 235 ? 33.938  7.374   239.735 1.00 88.01  ? 236 THR C N     1 
ATOM   6988 C CA    . THR K 3 235 ? 33.463  8.353   238.777 1.00 89.08  ? 236 THR C CA    1 
ATOM   6989 C C     . THR K 3 235 ? 32.322  7.837   237.924 1.00 90.80  ? 236 THR C C     1 
ATOM   6990 O O     . THR K 3 235 ? 31.305  8.515   237.742 1.00 86.38  ? 236 THR C O     1 
ATOM   6991 C CB    . THR K 3 235 ? 34.589  8.787   237.859 1.00 90.05  ? 236 THR C CB    1 
ATOM   6992 O OG1   . THR K 3 235 ? 35.839  8.656   238.549 1.00 89.81  ? 236 THR C OG1   1 
ATOM   6993 C CG2   . THR K 3 235 ? 34.394  10.240  237.455 1.00 91.63  ? 236 THR C CG2   1 
ATOM   6994 N N     . GLN K 3 236 ? 32.496  6.634   237.394 1.00 94.96  ? 237 GLN C N     1 
ATOM   6995 C CA    . GLN K 3 236 ? 31.471  6.029   236.550 1.00 98.63  ? 237 GLN C CA    1 
ATOM   6996 C C     . GLN K 3 236 ? 30.206  5.725   237.345 1.00 98.10  ? 237 GLN C C     1 
ATOM   6997 O O     . GLN K 3 236 ? 29.089  5.829   236.830 1.00 95.15  ? 237 GLN C O     1 
ATOM   6998 C CB    . GLN K 3 236 ? 32.017  4.755   235.899 1.00 93.79  ? 237 GLN C CB    1 
ATOM   6999 C CG    . GLN K 3 236 ? 33.211  5.044   235.017 1.00 92.25  ? 237 GLN C CG    1 
ATOM   7000 C CD    . GLN K 3 236 ? 32.918  6.141   234.000 1.00 90.69  ? 237 GLN C CD    1 
ATOM   7001 O OE1   . GLN K 3 236 ? 33.807  6.897   233.622 1.00 94.95  ? 237 GLN C OE1   1 
ATOM   7002 N NE2   . GLN K 3 236 ? 31.670  6.224   233.551 1.00 83.37  ? 237 GLN C NE2   1 
ATOM   7003 N N     . ALA K 3 237 ? 30.387  5.356   238.607 1.00 94.04  ? 238 ALA C N     1 
ATOM   7004 C CA    . ALA K 3 237 ? 29.252  5.058   239.451 1.00 87.26  ? 238 ALA C CA    1 
ATOM   7005 C C     . ALA K 3 237 ? 28.453  6.338   239.626 1.00 88.89  ? 238 ALA C C     1 
ATOM   7006 O O     . ALA K 3 237 ? 27.234  6.362   239.441 1.00 82.21  ? 238 ALA C O     1 
ATOM   7007 C CB    . ALA K 3 237 ? 29.728  4.550   240.778 1.00 80.95  ? 238 ALA C CB    1 
ATOM   7008 N N     . GLU K 3 238 ? 29.156  7.410   239.969 1.00 94.36  ? 239 GLU C N     1 
ATOM   7009 C CA    . GLU K 3 238 ? 28.518  8.701   240.172 1.00 102.51 ? 239 GLU C CA    1 
ATOM   7010 C C     . GLU K 3 238 ? 27.691  9.038   238.933 1.00 101.31 ? 239 GLU C C     1 
ATOM   7011 O O     . GLU K 3 238 ? 26.510  9.382   239.030 1.00 98.42  ? 239 GLU C O     1 
ATOM   7012 C CB    . GLU K 3 238 ? 29.586  9.775   240.431 1.00 112.65 ? 239 GLU C CB    1 
ATOM   7013 C CG    . GLU K 3 238 ? 30.619  9.393   241.512 1.00 117.64 ? 239 GLU C CG    1 
ATOM   7014 C CD    . GLU K 3 238 ? 31.609  10.513  241.832 1.00 118.30 ? 239 GLU C CD    1 
ATOM   7015 O OE1   . GLU K 3 238 ? 32.643  10.239  242.482 1.00 109.43 ? 239 GLU C OE1   1 
ATOM   7016 O OE2   . GLU K 3 238 ? 31.347  11.671  241.441 1.00 126.19 ? 239 GLU C OE2   1 
ATOM   7017 N N     . GLN K 3 239 ? 28.315  8.922   237.767 1.00 102.29 ? 240 GLN C N     1 
ATOM   7018 C CA    . GLN K 3 239 ? 27.629  9.193   236.511 1.00 105.87 ? 240 GLN C CA    1 
ATOM   7019 C C     . GLN K 3 239 ? 26.323  8.393   236.434 1.00 105.63 ? 240 GLN C C     1 
ATOM   7020 O O     . GLN K 3 239 ? 25.254  8.957   236.201 1.00 104.87 ? 240 GLN C O     1 
ATOM   7021 C CB    . GLN K 3 239 ? 28.537  8.826   235.332 1.00 108.49 ? 240 GLN C CB    1 
ATOM   7022 C CG    . GLN K 3 239 ? 29.151  10.018  234.610 1.00 111.74 ? 240 GLN C CG    1 
ATOM   7023 C CD    . GLN K 3 239 ? 28.167  10.715  233.680 1.00 112.65 ? 240 GLN C CD    1 
ATOM   7024 O OE1   . GLN K 3 239 ? 27.655  10.113  232.733 1.00 115.77 ? 240 GLN C OE1   1 
ATOM   7025 N NE2   . GLN K 3 239 ? 27.902  11.988  233.944 1.00 111.77 ? 240 GLN C NE2   1 
ATOM   7026 N N     . ARG K 3 240 ? 26.425  7.081   236.640 1.00 102.48 ? 241 ARG C N     1 
ATOM   7027 C CA    . ARG K 3 240 ? 25.275  6.181   236.595 1.00 97.17  ? 241 ARG C CA    1 
ATOM   7028 C C     . ARG K 3 240 ? 24.163  6.665   237.504 1.00 91.89  ? 241 ARG C C     1 
ATOM   7029 O O     . ARG K 3 240 ? 22.985  6.400   237.265 1.00 88.12  ? 241 ARG C O     1 
ATOM   7030 C CB    . ARG K 3 240 ? 25.694  4.769   237.015 1.00 102.86 ? 241 ARG C CB    1 
ATOM   7031 C CG    . ARG K 3 240 ? 24.555  3.736   237.100 1.00 107.46 ? 241 ARG C CG    1 
ATOM   7032 C CD    . ARG K 3 240 ? 23.783  3.566   235.779 1.00 107.13 ? 241 ARG C CD    1 
ATOM   7033 N NE    . ARG K 3 240 ? 22.911  2.387   235.796 1.00 102.66 ? 241 ARG C NE    1 
ATOM   7034 C CZ    . ARG K 3 240 ? 21.938  2.148   234.920 1.00 96.32  ? 241 ARG C CZ    1 
ATOM   7035 N NH1   . ARG K 3 240 ? 21.694  3.008   233.943 1.00 96.09  ? 241 ARG C NH1   1 
ATOM   7036 N NH2   . ARG K 3 240 ? 21.212  1.044   235.022 1.00 89.42  ? 241 ARG C NH2   1 
ATOM   7037 N N     . ALA K 3 241 ? 24.548  7.366   238.558 1.00 88.42  ? 242 ALA C N     1 
ATOM   7038 C CA    . ALA K 3 241 ? 23.577  7.886   239.493 1.00 88.08  ? 242 ALA C CA    1 
ATOM   7039 C C     . ALA K 3 241 ? 22.732  8.923   238.779 1.00 90.85  ? 242 ALA C C     1 
ATOM   7040 O O     . ALA K 3 241 ? 21.544  9.089   239.068 1.00 91.29  ? 242 ALA C O     1 
ATOM   7041 C CB    . ALA K 3 241 ? 24.278  8.501   240.667 1.00 88.31  ? 242 ALA C CB    1 
ATOM   7042 N N     . ILE K 3 242 ? 23.342  9.616   237.828 1.00 89.69  ? 243 ILE C N     1 
ATOM   7043 C CA    . ILE K 3 242 ? 22.615  10.631  237.086 1.00 90.56  ? 243 ILE C CA    1 
ATOM   7044 C C     . ILE K 3 242 ? 21.864  10.031  235.906 1.00 87.35  ? 243 ILE C C     1 
ATOM   7045 O O     . ILE K 3 242 ? 20.639  10.119  235.837 1.00 87.57  ? 243 ILE C O     1 
ATOM   7046 C CB    . ILE K 3 242 ? 23.557  11.709  236.569 1.00 93.41  ? 243 ILE C CB    1 
ATOM   7047 C CG1   . ILE K 3 242 ? 24.450  12.193  237.717 1.00 99.73  ? 243 ILE C CG1   1 
ATOM   7048 C CG2   . ILE K 3 242 ? 22.739  12.848  235.963 1.00 87.14  ? 243 ILE C CG2   1 
ATOM   7049 C CD1   . ILE K 3 242 ? 23.683  12.772  238.907 1.00 106.83 ? 243 ILE C CD1   1 
ATOM   7050 N N     . SER K 3 243 ? 22.608  9.419   234.987 1.00 82.77  ? 244 SER C N     1 
ATOM   7051 C CA    . SER K 3 243 ? 22.029  8.794   233.801 1.00 78.23  ? 244 SER C CA    1 
ATOM   7052 C C     . SER K 3 243 ? 20.838  7.911   234.154 1.00 83.16  ? 244 SER C C     1 
ATOM   7053 O O     . SER K 3 243 ? 19.952  7.689   233.329 1.00 86.47  ? 244 SER C O     1 
ATOM   7054 C CB    . SER K 3 243 ? 23.091  7.971   233.068 1.00 73.67  ? 244 SER C CB    1 
ATOM   7055 O OG    . SER K 3 243 ? 23.840  7.177   233.970 1.00 63.45  ? 244 SER C OG    1 
ATOM   7056 N N     . MET K 3 244 ? 20.825  7.411   235.386 1.00 83.44  ? 245 MET C N     1 
ATOM   7057 C CA    . MET K 3 244 ? 19.743  6.566   235.858 1.00 77.90  ? 245 MET C CA    1 
ATOM   7058 C C     . MET K 3 244 ? 18.510  7.434   236.010 1.00 80.14  ? 245 MET C C     1 
ATOM   7059 O O     . MET K 3 244 ? 17.393  7.004   235.738 1.00 83.11  ? 245 MET C O     1 
ATOM   7060 C CB    . MET K 3 244 ? 20.109  5.948   237.203 1.00 67.94  ? 245 MET C CB    1 
ATOM   7061 C CG    . MET K 3 244 ? 19.212  4.805   237.629 1.00 68.31  ? 245 MET C CG    1 
ATOM   7062 S SD    . MET K 3 244 ? 20.204  3.390   238.157 1.00 72.53  ? 245 MET C SD    1 
ATOM   7063 C CE    . MET K 3 244 ? 21.013  4.078   239.533 1.00 72.53  ? 245 MET C CE    1 
ATOM   7064 N N     . ILE K 3 245 ? 18.716  8.674   236.430 1.00 86.29  ? 246 ILE C N     1 
ATOM   7065 C CA    . ILE K 3 245 ? 17.600  9.595   236.632 1.00 94.80  ? 246 ILE C CA    1 
ATOM   7066 C C     . ILE K 3 245 ? 17.036  10.127  235.328 1.00 94.59  ? 246 ILE C C     1 
ATOM   7067 O O     . ILE K 3 245 ? 15.819  10.145  235.121 1.00 93.19  ? 246 ILE C O     1 
ATOM   7068 C CB    . ILE K 3 245 ? 18.022  10.790  237.501 1.00 94.51  ? 246 ILE C CB    1 
ATOM   7069 C CG1   . ILE K 3 245 ? 18.640  10.281  238.808 1.00 101.60 ? 246 ILE C CG1   1 
ATOM   7070 C CG2   . ILE K 3 245 ? 16.822  11.667  237.791 1.00 90.69  ? 246 ILE C CG2   1 
ATOM   7071 C CD1   . ILE K 3 245 ? 17.686  9.459   239.667 1.00 99.07  ? 246 ILE C CD1   1 
ATOM   7072 N N     . ASP K 3 246 ? 17.935  10.567  234.456 1.00 98.24  ? 247 ASP C N     1 
ATOM   7073 C CA    . ASP K 3 246 ? 17.557  11.109  233.159 1.00 98.97  ? 247 ASP C CA    1 
ATOM   7074 C C     . ASP K 3 246 ? 17.109  10.026  232.196 1.00 98.61  ? 247 ASP C C     1 
ATOM   7075 O O     . ASP K 3 246 ? 16.894  10.312  231.023 1.00 102.99 ? 247 ASP C O     1 
ATOM   7076 C CB    . ASP K 3 246 ? 18.734  11.874  232.545 1.00 98.76  ? 247 ASP C CB    1 
ATOM   7077 C CG    . ASP K 3 246 ? 18.673  13.367  232.825 1.00 107.62 ? 247 ASP C CG    1 
ATOM   7078 O OD1   . ASP K 3 246 ? 17.849  14.065  232.194 1.00 106.83 ? 247 ASP C OD1   1 
ATOM   7079 O OD2   . ASP K 3 246 ? 19.446  13.845  233.681 1.00 114.02 ? 247 ASP C OD2   1 
ATOM   7080 N N     . LYS K 3 247 ? 16.962  8.792   232.678 1.00 96.58  ? 248 LYS C N     1 
ATOM   7081 C CA    . LYS K 3 247 ? 16.550  7.697   231.802 1.00 91.27  ? 248 LYS C CA    1 
ATOM   7082 C C     . LYS K 3 247 ? 15.353  6.899   232.298 1.00 87.95  ? 248 LYS C C     1 
ATOM   7083 O O     . LYS K 3 247 ? 14.494  6.512   231.507 1.00 83.77  ? 248 LYS C O     1 
ATOM   7084 C CB    . LYS K 3 247 ? 17.720  6.744   231.570 1.00 92.08  ? 248 LYS C CB    1 
ATOM   7085 C CG    . LYS K 3 247 ? 17.527  5.845   230.368 1.00 98.93  ? 248 LYS C CG    1 
ATOM   7086 C CD    . LYS K 3 247 ? 18.715  4.927   230.158 1.00 96.26  ? 248 LYS C CD    1 
ATOM   7087 C CE    . LYS K 3 247 ? 18.619  4.222   228.816 1.00 92.56  ? 248 LYS C CE    1 
ATOM   7088 N NZ    . LYS K 3 247 ? 18.695  5.211   227.703 1.00 98.04  ? 248 LYS C NZ    1 
ATOM   7089 N N     . PHE K 3 248 ? 15.300  6.660   233.604 1.00 86.19  ? 249 PHE C N     1 
ATOM   7090 C CA    . PHE K 3 248 ? 14.217  5.890   234.192 1.00 93.10  ? 249 PHE C CA    1 
ATOM   7091 C C     . PHE K 3 248 ? 13.250  6.733   235.016 1.00 98.76  ? 249 PHE C C     1 
ATOM   7092 O O     . PHE K 3 248 ? 12.103  6.338   235.227 1.00 100.54 ? 249 PHE C O     1 
ATOM   7093 C CB    . PHE K 3 248 ? 14.792  4.783   235.080 1.00 90.79  ? 249 PHE C CB    1 
ATOM   7094 C CG    . PHE K 3 248 ? 15.869  3.974   234.421 1.00 88.05  ? 249 PHE C CG    1 
ATOM   7095 C CD1   . PHE K 3 248 ? 15.586  3.196   233.309 1.00 85.47  ? 249 PHE C CD1   1 
ATOM   7096 C CD2   . PHE K 3 248 ? 17.178  4.008   234.900 1.00 87.21  ? 249 PHE C CD2   1 
ATOM   7097 C CE1   . PHE K 3 248 ? 16.590  2.465   232.681 1.00 84.71  ? 249 PHE C CE1   1 
ATOM   7098 C CE2   . PHE K 3 248 ? 18.190  3.280   234.278 1.00 80.59  ? 249 PHE C CE2   1 
ATOM   7099 C CZ    . PHE K 3 248 ? 17.893  2.509   233.166 1.00 78.63  ? 249 PHE C CZ    1 
ATOM   7100 N N     . VAL K 3 249 ? 13.707  7.892   235.483 1.00 104.42 ? 250 VAL C N     1 
ATOM   7101 C CA    . VAL K 3 249 ? 12.865  8.756   236.313 1.00 102.52 ? 250 VAL C CA    1 
ATOM   7102 C C     . VAL K 3 249 ? 12.112  9.853   235.565 1.00 98.17  ? 250 VAL C C     1 
ATOM   7103 O O     . VAL K 3 249 ? 10.887  9.787   235.407 1.00 91.85  ? 250 VAL C O     1 
ATOM   7104 C CB    . VAL K 3 249 ? 13.691  9.431   237.420 1.00 100.84 ? 250 VAL C CB    1 
ATOM   7105 C CG1   . VAL K 3 249 ? 12.765  10.126  238.391 1.00 102.33 ? 250 VAL C CG1   1 
ATOM   7106 C CG2   . VAL K 3 249 ? 14.538  8.402   238.136 1.00 103.31 ? 250 VAL C CG2   1 
ATOM   7107 N N     . LYS K 3 250 ? 12.858  10.864  235.121 1.00 97.53  ? 251 LYS C N     1 
ATOM   7108 C CA    . LYS K 3 250 ? 12.294  12.011  234.403 1.00 97.62  ? 251 LYS C CA    1 
ATOM   7109 C C     . LYS K 3 250 ? 11.274  11.602  233.348 1.00 92.20  ? 251 LYS C C     1 
ATOM   7110 O O     . LYS K 3 250 ? 10.098  12.002  233.404 1.00 84.20  ? 251 LYS C O     1 
ATOM   7111 C CB    . LYS K 3 250 ? 13.413  12.825  233.731 1.00 92.32  ? 251 LYS C CB    1 
ATOM   7112 N N     . PRO K 3 251 ? 11.715  10.788  232.371 1.00 89.87  ? 252 PRO C N     1 
ATOM   7113 C CA    . PRO K 3 251 ? 10.834  10.326  231.294 1.00 83.04  ? 252 PRO C CA    1 
ATOM   7114 C C     . PRO K 3 251 ? 9.463   9.822   231.751 1.00 80.56  ? 252 PRO C C     1 
ATOM   7115 O O     . PRO K 3 251 ? 8.497   9.911   231.004 1.00 73.41  ? 252 PRO C O     1 
ATOM   7116 C CB    . PRO K 3 251 ? 11.675  9.252   230.617 1.00 76.13  ? 252 PRO C CB    1 
ATOM   7117 C CG    . PRO K 3 251 ? 13.074  9.795   230.786 1.00 74.37  ? 252 PRO C CG    1 
ATOM   7118 C CD    . PRO K 3 251 ? 13.077  10.228  232.215 1.00 76.17  ? 252 PRO C CD    1 
ATOM   7119 N N     . PHE K 3 252 ? 9.379   9.315   232.981 1.00 88.20  ? 253 PHE C N     1 
ATOM   7120 C CA    . PHE K 3 252 ? 8.114   8.792   233.505 1.00 95.83  ? 253 PHE C CA    1 
ATOM   7121 C C     . PHE K 3 252 ? 7.495   9.664   234.582 1.00 98.45  ? 253 PHE C C     1 
ATOM   7122 O O     . PHE K 3 252 ? 6.351   9.440   234.992 1.00 99.86  ? 253 PHE C O     1 
ATOM   7123 C CB    . PHE K 3 252 ? 8.296   7.378   234.080 1.00 92.48  ? 253 PHE C CB    1 
ATOM   7124 C CG    . PHE K 3 252 ? 8.852   6.397   233.101 1.00 83.11  ? 253 PHE C CG    1 
ATOM   7125 C CD1   . PHE K 3 252 ? 10.225  6.303   232.897 1.00 79.19  ? 253 PHE C CD1   1 
ATOM   7126 C CD2   . PHE K 3 252 ? 8.001   5.618   232.332 1.00 76.78  ? 253 PHE C CD2   1 
ATOM   7127 C CE1   . PHE K 3 252 ? 10.736  5.458   231.942 1.00 72.77  ? 253 PHE C CE1   1 
ATOM   7128 C CE2   . PHE K 3 252 ? 8.502   4.772   231.375 1.00 66.84  ? 253 PHE C CE2   1 
ATOM   7129 C CZ    . PHE K 3 252 ? 9.873   4.692   231.179 1.00 73.35  ? 253 PHE C CZ    1 
ATOM   7130 N N     . LYS K 3 253 ? 8.241   10.655  235.050 1.00 97.92  ? 254 LYS C N     1 
ATOM   7131 C CA    . LYS K 3 253 ? 7.714   11.517  236.091 1.00 101.36 ? 254 LYS C CA    1 
ATOM   7132 C C     . LYS K 3 253 ? 6.450   12.212  235.584 1.00 101.80 ? 254 LYS C C     1 
ATOM   7133 O O     . LYS K 3 253 ? 5.759   12.887  236.347 1.00 106.20 ? 254 LYS C O     1 
ATOM   7134 C CB    . LYS K 3 253 ? 8.765   12.547  236.523 1.00 101.81 ? 254 LYS C CB    1 
ATOM   7135 C CG    . LYS K 3 253 ? 8.536   13.135  237.922 1.00 96.67  ? 254 LYS C CG    1 
ATOM   7136 C CD    . LYS K 3 253 ? 8.563   12.048  239.004 1.00 92.44  ? 254 LYS C CD    1 
ATOM   7137 C CE    . LYS K 3 253 ? 8.379   12.619  240.419 1.00 90.77  ? 254 LYS C CE    1 
ATOM   7138 N NZ    . LYS K 3 253 ? 8.440   11.585  241.506 1.00 70.99  ? 254 LYS C NZ    1 
ATOM   7139 N N     . LYS K 3 254 ? 6.148   12.025  234.298 1.00 97.16  ? 255 LYS C N     1 
ATOM   7140 C CA    . LYS K 3 254 ? 4.965   12.622  233.673 1.00 94.25  ? 255 LYS C CA    1 
ATOM   7141 C C     . LYS K 3 254 ? 3.744   11.697  233.692 1.00 94.60  ? 255 LYS C C     1 
ATOM   7142 O O     . LYS K 3 254 ? 2.725   11.979  233.055 1.00 87.65  ? 255 LYS C O     1 
ATOM   7143 C CB    . LYS K 3 254 ? 5.268   13.014  232.219 1.00 89.02  ? 255 LYS C CB    1 
ATOM   7144 C CG    . LYS K 3 254 ? 5.906   11.910  231.384 1.00 78.07  ? 255 LYS C CG    1 
ATOM   7145 C CD    . LYS K 3 254 ? 5.586   12.054  229.900 1.00 64.63  ? 255 LYS C CD    1 
ATOM   7146 C CE    . LYS K 3 254 ? 4.125   11.716  229.604 1.00 64.17  ? 255 LYS C CE    1 
ATOM   7147 N NZ    . LYS K 3 254 ? 3.772   11.884  228.157 1.00 67.18  ? 255 LYS C NZ    1 
ATOM   7148 N N     . TYR K 3 255 ? 3.848   10.592  234.421 1.00 98.40  ? 256 TYR C N     1 
ATOM   7149 C CA    . TYR K 3 255 ? 2.746   9.649   234.496 1.00 105.48 ? 256 TYR C CA    1 
ATOM   7150 C C     . TYR K 3 255 ? 2.211   9.543   235.914 1.00 112.64 ? 256 TYR C C     1 
ATOM   7151 O O     . TYR K 3 255 ? 1.102   9.052   236.129 1.00 117.52 ? 256 TYR C O     1 
ATOM   7152 C CB    . TYR K 3 255 ? 3.184   8.259   234.031 1.00 106.33 ? 256 TYR C CB    1 
ATOM   7153 C CG    . TYR K 3 255 ? 3.546   8.155   232.563 1.00 112.11 ? 256 TYR C CG    1 
ATOM   7154 C CD1   . TYR K 3 255 ? 4.814   8.520   232.105 1.00 113.55 ? 256 TYR C CD1   1 
ATOM   7155 C CD2   . TYR K 3 255 ? 2.622   7.674   231.630 1.00 109.38 ? 256 TYR C CD2   1 
ATOM   7156 C CE1   . TYR K 3 255 ? 5.154   8.408   230.753 1.00 109.97 ? 256 TYR C CE1   1 
ATOM   7157 C CE2   . TYR K 3 255 ? 2.951   7.558   230.277 1.00 102.16 ? 256 TYR C CE2   1 
ATOM   7158 C CZ    . TYR K 3 255 ? 4.218   7.927   229.845 1.00 105.61 ? 256 TYR C CZ    1 
ATOM   7159 O OH    . TYR K 3 255 ? 4.557   7.826   228.515 1.00 92.61  ? 256 TYR C OH    1 
ATOM   7160 N N     . ILE K 3 256 ? 2.999   10.003  236.880 1.00 114.93 ? 257 ILE C N     1 
ATOM   7161 C CA    . ILE K 3 256 ? 2.599   9.940   238.281 1.00 118.22 ? 257 ILE C CA    1 
ATOM   7162 C C     . ILE K 3 256 ? 1.720   11.132  238.673 1.00 121.20 ? 257 ILE C C     1 
ATOM   7163 O O     . ILE K 3 256 ? 1.954   12.251  238.215 1.00 124.62 ? 257 ILE C O     1 
ATOM   7164 C CB    . ILE K 3 256 ? 3.843   9.911   239.183 1.00 116.58 ? 257 ILE C CB    1 
ATOM   7165 C CG1   . ILE K 3 256 ? 4.801   8.826   238.698 1.00 115.50 ? 257 ILE C CG1   1 
ATOM   7166 C CG2   . ILE K 3 256 ? 3.441   9.641   240.617 1.00 119.62 ? 257 ILE C CG2   1 
ATOM   7167 C CD1   . ILE K 3 256 ? 6.131   8.823   239.412 1.00 118.09 ? 257 ILE C CD1   1 
ATOM   7168 N N     . LEU K 3 257 ? 0.708   10.889  239.509 1.00 120.61 ? 258 LEU C N     1 
ATOM   7169 C CA    . LEU K 3 257 ? -0.194  11.957  239.958 1.00 118.65 ? 258 LEU C CA    1 
ATOM   7170 C C     . LEU K 3 257 ? -0.161  12.106  241.478 1.00 117.66 ? 258 LEU C C     1 
ATOM   7171 C CB    . LEU K 3 257 ? -1.636  11.683  239.494 1.00 113.49 ? 258 LEU C CB    1 
ATOM   7172 C CG    . LEU K 3 257 ? -2.577  10.717  240.234 1.00 112.10 ? 258 LEU C CG    1 
ATOM   7173 C CD1   . LEU K 3 257 ? -1.812  9.481   240.685 1.00 112.05 ? 258 LEU C CD1   1 
ATOM   7174 C CD2   . LEU K 3 257 ? -3.212  11.411  241.428 1.00 107.38 ? 258 LEU C CD2   1 
ATOM   7175 N N     . SER L 3 1   ? -6.043  -15.248 231.160 1.00 69.03  ? 2   SER D N     1 
ATOM   7176 C CA    . SER L 3 1   ? -5.264  -16.480 230.838 1.00 65.16  ? 2   SER D CA    1 
ATOM   7177 C C     . SER L 3 1   ? -6.061  -17.625 230.203 1.00 67.67  ? 2   SER D C     1 
ATOM   7178 O O     . SER L 3 1   ? -7.273  -17.719 230.373 1.00 69.63  ? 2   SER D O     1 
ATOM   7179 C CB    . SER L 3 1   ? -4.600  -17.013 232.096 1.00 55.49  ? 2   SER D CB    1 
ATOM   7180 O OG    . SER L 3 1   ? -4.133  -18.334 231.863 1.00 54.37  ? 2   SER D OG    1 
ATOM   7181 N N     . PHE L 3 2   ? -5.360  -18.499 229.479 1.00 70.59  ? 3   PHE D N     1 
ATOM   7182 C CA    . PHE L 3 2   ? -5.976  -19.660 228.843 1.00 70.09  ? 3   PHE D CA    1 
ATOM   7183 C C     . PHE L 3 2   ? -5.351  -20.915 229.426 1.00 75.52  ? 3   PHE D C     1 
ATOM   7184 O O     . PHE L 3 2   ? -5.809  -22.023 229.158 1.00 82.77  ? 3   PHE D O     1 
ATOM   7185 C CB    . PHE L 3 2   ? -5.744  -19.675 227.327 1.00 67.55  ? 3   PHE D CB    1 
ATOM   7186 C CG    . PHE L 3 2   ? -6.293  -18.482 226.606 1.00 63.11  ? 3   PHE D CG    1 
ATOM   7187 C CD1   . PHE L 3 2   ? -7.621  -18.118 226.741 1.00 66.88  ? 3   PHE D CD1   1 
ATOM   7188 C CD2   . PHE L 3 2   ? -5.473  -17.719 225.783 1.00 65.05  ? 3   PHE D CD2   1 
ATOM   7189 C CE1   . PHE L 3 2   ? -8.128  -16.998 226.066 1.00 66.85  ? 3   PHE D CE1   1 
ATOM   7190 C CE2   . PHE L 3 2   ? -5.966  -16.601 225.105 1.00 61.13  ? 3   PHE D CE2   1 
ATOM   7191 C CZ    . PHE L 3 2   ? -7.292  -16.242 225.247 1.00 56.91  ? 3   PHE D CZ    1 
ATOM   7192 N N     . ILE L 3 3   ? -4.292  -20.735 230.210 1.00 79.62  ? 4   ILE D N     1 
ATOM   7193 C CA    . ILE L 3 3   ? -3.584  -21.853 230.838 1.00 87.15  ? 4   ILE D CA    1 
ATOM   7194 C C     . ILE L 3 3   ? -4.331  -22.286 232.096 1.00 93.30  ? 4   ILE D C     1 
ATOM   7195 O O     . ILE L 3 3   ? -4.557  -23.477 232.330 1.00 93.34  ? 4   ILE D O     1 
ATOM   7196 C CB    . ILE L 3 3   ? -2.160  -21.451 231.283 1.00 86.50  ? 4   ILE D CB    1 
ATOM   7197 C CG1   . ILE L 3 3   ? -1.638  -20.322 230.402 1.00 96.72  ? 4   ILE D CG1   1 
ATOM   7198 C CG2   . ILE L 3 3   ? -1.224  -22.649 231.201 1.00 85.07  ? 4   ILE D CG2   1 
ATOM   7199 C CD1   . ILE L 3 3   ? -0.306  -19.751 230.863 1.00 100.44 ? 4   ILE D CD1   1 
ATOM   7200 N N     . LYS L 3 4   ? -4.700  -21.295 232.905 1.00 97.46  ? 5   LYS D N     1 
ATOM   7201 C CA    . LYS L 3 4   ? -5.407  -21.524 234.159 1.00 93.74  ? 5   LYS D CA    1 
ATOM   7202 C C     . LYS L 3 4   ? -6.589  -22.467 233.982 1.00 94.41  ? 5   LYS D C     1 
ATOM   7203 O O     . LYS L 3 4   ? -6.682  -23.481 234.668 1.00 97.62  ? 5   LYS D O     1 
ATOM   7204 C CB    . LYS L 3 4   ? -5.878  -20.189 234.748 1.00 83.56  ? 5   LYS D CB    1 
ATOM   7205 N N     . PRO L 3 5   ? -7.501  -22.157 233.047 1.00 93.83  ? 6   PRO D N     1 
ATOM   7206 C CA    . PRO L 3 5   ? -8.655  -23.035 232.844 1.00 91.87  ? 6   PRO D CA    1 
ATOM   7207 C C     . PRO L 3 5   ? -8.313  -24.526 232.796 1.00 87.13  ? 6   PRO D C     1 
ATOM   7208 O O     . PRO L 3 5   ? -9.091  -25.355 233.272 1.00 83.32  ? 6   PRO D O     1 
ATOM   7209 C CB    . PRO L 3 5   ? -9.239  -22.527 231.528 1.00 93.09  ? 6   PRO D CB    1 
ATOM   7210 C CG    . PRO L 3 5   ? -8.966  -21.074 231.591 1.00 89.73  ? 6   PRO D CG    1 
ATOM   7211 C CD    . PRO L 3 5   ? -7.527  -21.043 232.082 1.00 94.04  ? 6   PRO D CD    1 
ATOM   7212 N N     . ILE L 3 6   ? -7.155  -24.859 232.226 1.00 83.13  ? 7   ILE D N     1 
ATOM   7213 C CA    . ILE L 3 6   ? -6.725  -26.250 232.109 1.00 80.68  ? 7   ILE D CA    1 
ATOM   7214 C C     . ILE L 3 6   ? -5.498  -26.494 232.966 1.00 83.88  ? 7   ILE D C     1 
ATOM   7215 O O     . ILE L 3 6   ? -4.878  -27.552 232.895 1.00 83.88  ? 7   ILE D O     1 
ATOM   7216 C CB    . ILE L 3 6   ? -6.386  -26.632 230.629 1.00 74.88  ? 7   ILE D CB    1 
ATOM   7217 C CG1   . ILE L 3 6   ? -4.917  -26.355 230.313 1.00 78.75  ? 7   ILE D CG1   1 
ATOM   7218 C CG2   . ILE L 3 6   ? -7.224  -25.804 229.671 1.00 71.87  ? 7   ILE D CG2   1 
ATOM   7219 C CD1   . ILE L 3 6   ? -4.095  -27.601 230.018 1.00 70.83  ? 7   ILE D CD1   1 
ATOM   7220 N N     . TYR L 3 7   ? -5.150  -25.509 233.781 1.00 90.26  ? 8   TYR D N     1 
ATOM   7221 C CA    . TYR L 3 7   ? -3.982  -25.636 234.638 1.00 103.53 ? 8   TYR D CA    1 
ATOM   7222 C C     . TYR L 3 7   ? -3.994  -26.951 235.426 1.00 107.78 ? 8   TYR D C     1 
ATOM   7223 O O     . TYR L 3 7   ? -3.020  -27.701 235.393 1.00 110.80 ? 8   TYR D O     1 
ATOM   7224 C CB    . TYR L 3 7   ? -3.900  -24.443 235.597 1.00 106.79 ? 8   TYR D CB    1 
ATOM   7225 C CG    . TYR L 3 7   ? -2.670  -24.452 236.474 1.00 111.74 ? 8   TYR D CG    1 
ATOM   7226 C CD1   . TYR L 3 7   ? -1.386  -24.390 235.920 1.00 110.95 ? 8   TYR D CD1   1 
ATOM   7227 C CD2   . TYR L 3 7   ? -2.788  -24.537 237.859 1.00 113.20 ? 8   TYR D CD2   1 
ATOM   7228 C CE1   . TYR L 3 7   ? -0.250  -24.414 236.731 1.00 114.24 ? 8   TYR D CE1   1 
ATOM   7229 C CE2   . TYR L 3 7   ? -1.661  -24.563 238.678 1.00 118.27 ? 8   TYR D CE2   1 
ATOM   7230 C CZ    . TYR L 3 7   ? -0.397  -24.503 238.112 1.00 117.57 ? 8   TYR D CZ    1 
ATOM   7231 O OH    . TYR L 3 7   ? 0.705   -24.544 238.937 1.00 117.23 ? 8   TYR D OH    1 
ATOM   7232 N N     . GLN L 3 8   ? -5.094  -27.234 236.122 1.00 111.29 ? 9   GLN D N     1 
ATOM   7233 C CA    . GLN L 3 8   ? -5.211  -28.461 236.914 1.00 107.99 ? 9   GLN D CA    1 
ATOM   7234 C C     . GLN L 3 8   ? -4.651  -29.668 236.169 1.00 104.43 ? 9   GLN D C     1 
ATOM   7235 O O     . GLN L 3 8   ? -4.054  -30.562 236.769 1.00 98.52  ? 9   GLN D O     1 
ATOM   7236 C CB    . GLN L 3 8   ? -6.678  -28.711 237.291 1.00 111.84 ? 9   GLN D CB    1 
ATOM   7237 C CG    . GLN L 3 8   ? -7.688  -28.121 236.314 1.00 117.90 ? 9   GLN D CG    1 
ATOM   7238 C CD    . GLN L 3 8   ? -8.053  -26.681 236.649 1.00 121.86 ? 9   GLN D CD    1 
ATOM   7239 O OE1   . GLN L 3 8   ? -7.185  -25.857 236.940 1.00 121.27 ? 9   GLN D OE1   1 
ATOM   7240 N NE2   . GLN L 3 8   ? -9.346  -26.372 236.599 1.00 125.80 ? 9   GLN D NE2   1 
ATOM   7241 N N     . ASP L 3 9   ? -4.846  -29.674 234.855 1.00 104.63 ? 10  ASP D N     1 
ATOM   7242 C CA    . ASP L 3 9   ? -4.375  -30.748 233.990 1.00 105.82 ? 10  ASP D CA    1 
ATOM   7243 C C     . ASP L 3 9   ? -2.877  -30.666 233.776 1.00 103.54 ? 10  ASP D C     1 
ATOM   7244 O O     . ASP L 3 9   ? -2.127  -31.527 234.210 1.00 101.26 ? 10  ASP D O     1 
ATOM   7245 C CB    . ASP L 3 9   ? -5.079  -30.665 232.637 1.00 108.29 ? 10  ASP D CB    1 
ATOM   7246 C CG    . ASP L 3 9   ? -6.463  -31.263 232.667 1.00 110.10 ? 10  ASP D CG    1 
ATOM   7247 O OD1   . ASP L 3 9   ? -6.570  -32.496 232.488 1.00 119.43 ? 10  ASP D OD1   1 
ATOM   7248 O OD2   . ASP L 3 9   ? -7.438  -30.510 232.882 1.00 108.45 ? 10  ASP D OD2   1 
ATOM   7249 N N     . ILE L 3 10  ? -2.445  -29.618 233.095 1.00 106.69 ? 11  ILE D N     1 
ATOM   7250 C CA    . ILE L 3 10  ? -1.036  -29.441 232.823 1.00 111.12 ? 11  ILE D CA    1 
ATOM   7251 C C     . ILE L 3 10  ? -0.203  -29.540 234.102 1.00 116.44 ? 11  ILE D C     1 
ATOM   7252 O O     . ILE L 3 10  ? 0.877   -30.138 234.101 1.00 116.46 ? 11  ILE D O     1 
ATOM   7253 C CB    . ILE L 3 10  ? -0.794  -28.084 232.120 1.00 110.56 ? 11  ILE D CB    1 
ATOM   7254 C CG1   . ILE L 3 10  ? 0.663   -27.973 231.688 1.00 110.85 ? 11  ILE D CG1   1 
ATOM   7255 C CG2   . ILE L 3 10  ? -1.169  -26.939 233.043 1.00 110.29 ? 11  ILE D CG2   1 
ATOM   7256 C CD1   . ILE L 3 10  ? 0.939   -26.783 230.810 1.00 113.85 ? 11  ILE D CD1   1 
ATOM   7257 N N     . ASN L 3 11  ? -0.719  -28.976 235.195 1.00 121.74 ? 12  ASN D N     1 
ATOM   7258 C CA    . ASN L 3 11  ? -0.025  -28.986 236.490 1.00 123.30 ? 12  ASN D CA    1 
ATOM   7259 C C     . ASN L 3 11  ? 0.314   -30.394 236.949 1.00 122.84 ? 12  ASN D C     1 
ATOM   7260 O O     . ASN L 3 11  ? 1.301   -30.615 237.656 1.00 121.44 ? 12  ASN D O     1 
ATOM   7261 C CB    . ASN L 3 11  ? -0.884  -28.315 237.566 1.00 122.48 ? 12  ASN D CB    1 
ATOM   7262 N N     . SER L 3 12  ? -0.524  -31.342 236.552 1.00 121.10 ? 13  SER D N     1 
ATOM   7263 C CA    . SER L 3 12  ? -0.316  -32.728 236.919 1.00 116.76 ? 13  SER D CA    1 
ATOM   7264 C C     . SER L 3 12  ? 0.601   -33.396 235.912 1.00 108.41 ? 13  SER D C     1 
ATOM   7265 O O     . SER L 3 12  ? 1.608   -33.998 236.284 1.00 106.64 ? 13  SER D O     1 
ATOM   7266 C CB    . SER L 3 12  ? -1.651  -33.468 236.962 1.00 122.09 ? 13  SER D CB    1 
ATOM   7267 O OG    . SER L 3 12  ? -2.246  -33.501 235.676 1.00 127.73 ? 13  SER D OG    1 
ATOM   7268 N N     . ILE L 3 13  ? 0.254   -33.286 234.634 1.00 103.06 ? 14  ILE D N     1 
ATOM   7269 C CA    . ILE L 3 13  ? 1.064   -33.913 233.601 1.00 101.30 ? 14  ILE D CA    1 
ATOM   7270 C C     . ILE L 3 13  ? 2.513   -33.503 233.776 1.00 103.06 ? 14  ILE D C     1 
ATOM   7271 O O     . ILE L 3 13  ? 3.421   -34.293 233.526 1.00 101.36 ? 14  ILE D O     1 
ATOM   7272 C CB    . ILE L 3 13  ? 0.611   -33.535 232.157 1.00 92.54  ? 14  ILE D CB    1 
ATOM   7273 C CG1   . ILE L 3 13  ? -0.767  -34.133 231.831 1.00 85.65  ? 14  ILE D CG1   1 
ATOM   7274 C CG2   . ILE L 3 13  ? 1.606   -34.099 231.149 1.00 88.53  ? 14  ILE D CG2   1 
ATOM   7275 C CD1   . ILE L 3 13  ? -1.966  -33.316 232.276 1.00 68.22  ? 14  ILE D CD1   1 
ATOM   7276 N N     . LEU L 3 14  ? 2.726   -32.270 234.220 1.00 107.13 ? 15  LEU D N     1 
ATOM   7277 C CA    . LEU L 3 14  ? 4.078   -31.768 234.414 1.00 116.96 ? 15  LEU D CA    1 
ATOM   7278 C C     . LEU L 3 14  ? 4.860   -32.539 235.474 1.00 122.62 ? 15  LEU D C     1 
ATOM   7279 O O     . LEU L 3 14  ? 6.033   -32.861 235.275 1.00 130.30 ? 15  LEU D O     1 
ATOM   7280 C CB    . LEU L 3 14  ? 4.045   -30.277 234.769 1.00 118.01 ? 15  LEU D CB    1 
ATOM   7281 C CG    . LEU L 3 14  ? 3.957   -29.285 233.604 1.00 120.55 ? 15  LEU D CG    1 
ATOM   7282 C CD1   . LEU L 3 14  ? 3.750   -27.872 234.134 1.00 119.98 ? 15  LEU D CD1   1 
ATOM   7283 C CD2   . LEU L 3 14  ? 5.237   -29.358 232.775 1.00 120.58 ? 15  LEU D CD2   1 
ATOM   7284 N N     . ILE L 3 15  ? 4.216   -32.843 236.595 1.00 123.25 ? 16  ILE D N     1 
ATOM   7285 C CA    . ILE L 3 15  ? 4.890   -33.564 237.664 1.00 119.61 ? 16  ILE D CA    1 
ATOM   7286 C C     . ILE L 3 15  ? 4.963   -35.052 237.359 1.00 121.96 ? 16  ILE D C     1 
ATOM   7287 O O     . ILE L 3 15  ? 3.936   -35.701 237.169 1.00 123.06 ? 16  ILE D O     1 
ATOM   7288 C CB    . ILE L 3 15  ? 4.167   -33.355 238.991 1.00 115.70 ? 16  ILE D CB    1 
ATOM   7289 C CG1   . ILE L 3 15  ? 3.916   -31.859 239.196 1.00 117.24 ? 16  ILE D CG1   1 
ATOM   7290 C CG2   . ILE L 3 15  ? 5.000   -33.924 240.124 1.00 110.93 ? 16  ILE D CG2   1 
ATOM   7291 C CD1   . ILE L 3 15  ? 3.053   -31.526 240.385 1.00 120.71 ? 16  ILE D CD1   1 
ATOM   7292 N N     . GLY L 3 16  ? 6.181   -35.583 237.300 1.00 123.05 ? 17  GLY D N     1 
ATOM   7293 C CA    . GLY L 3 16  ? 6.351   -36.995 237.017 1.00 125.50 ? 17  GLY D CA    1 
ATOM   7294 C C     . GLY L 3 16  ? 7.260   -37.295 235.841 1.00 129.61 ? 17  GLY D C     1 
ATOM   7295 O O     . GLY L 3 16  ? 7.502   -38.461 235.526 1.00 128.88 ? 17  GLY D O     1 
ATOM   7296 N N     . GLN L 3 17  ? 7.758   -36.251 235.185 1.00 133.80 ? 18  GLN D N     1 
ATOM   7297 C CA    . GLN L 3 17  ? 8.657   -36.412 234.039 1.00 136.53 ? 18  GLN D CA    1 
ATOM   7298 C C     . GLN L 3 17  ? 10.122  -36.377 234.477 1.00 137.05 ? 18  GLN D C     1 
ATOM   7299 O O     . GLN L 3 17  ? 10.425  -36.433 235.669 1.00 137.09 ? 18  GLN D O     1 
ATOM   7300 C CB    . GLN L 3 17  ? 8.404   -35.304 233.007 1.00 135.58 ? 18  GLN D CB    1 
ATOM   7301 C CG    . GLN L 3 17  ? 7.337   -35.624 231.973 1.00 133.71 ? 18  GLN D CG    1 
ATOM   7302 C CD    . GLN L 3 17  ? 6.123   -36.292 232.577 1.00 136.95 ? 18  GLN D CD    1 
ATOM   7303 O OE1   . GLN L 3 17  ? 5.552   -35.804 233.552 1.00 136.09 ? 18  GLN D OE1   1 
ATOM   7304 N NE2   . GLN L 3 17  ? 5.718   -37.418 231.997 1.00 138.18 ? 18  GLN D NE2   1 
ATOM   7305 N N     . LYS L 3 18  ? 11.025  -36.285 233.507 1.00 134.97 ? 19  LYS D N     1 
ATOM   7306 C CA    . LYS L 3 18  ? 12.453  -36.238 233.793 1.00 135.20 ? 19  LYS D CA    1 
ATOM   7307 C C     . LYS L 3 18  ? 13.243  -35.881 232.533 1.00 136.74 ? 19  LYS D C     1 
ATOM   7308 O O     . LYS L 3 18  ? 12.803  -36.164 231.418 1.00 141.45 ? 19  LYS D O     1 
ATOM   7309 C CB    . LYS L 3 18  ? 12.924  -37.589 234.335 1.00 132.68 ? 19  LYS D CB    1 
ATOM   7310 N N     . VAL L 3 19  ? 14.402  -35.252 232.717 1.00 133.41 ? 20  VAL D N     1 
ATOM   7311 C CA    . VAL L 3 19  ? 15.277  -34.859 231.609 1.00 126.77 ? 20  VAL D CA    1 
ATOM   7312 C C     . VAL L 3 19  ? 16.730  -34.957 232.069 1.00 125.78 ? 20  VAL D C     1 
ATOM   7313 O O     . VAL L 3 19  ? 17.243  -34.050 232.720 1.00 127.35 ? 20  VAL D O     1 
ATOM   7314 C CB    . VAL L 3 19  ? 14.987  -33.413 231.145 1.00 123.61 ? 20  VAL D CB    1 
ATOM   7315 C CG1   . VAL L 3 19  ? 13.749  -33.379 230.255 1.00 120.39 ? 20  VAL D CG1   1 
ATOM   7316 C CG2   . VAL L 3 19  ? 14.776  -32.523 232.352 1.00 118.59 ? 20  VAL D CG2   1 
ATOM   7317 N N     . LYS L 3 20  ? 17.382  -36.066 231.729 1.00 126.15 ? 21  LYS D N     1 
ATOM   7318 C CA    . LYS L 3 20  ? 18.772  -36.319 232.118 1.00 127.04 ? 21  LYS D CA    1 
ATOM   7319 C C     . LYS L 3 20  ? 19.660  -35.084 232.052 1.00 124.07 ? 21  LYS D C     1 
ATOM   7320 O O     . LYS L 3 20  ? 19.915  -34.550 230.977 1.00 121.94 ? 21  LYS D O     1 
ATOM   7321 C CB    . LYS L 3 20  ? 19.372  -37.418 231.237 1.00 134.25 ? 21  LYS D CB    1 
ATOM   7322 N N     . ARG L 3 21  ? 20.145  -34.645 233.206 1.00 120.40 ? 22  ARG D N     1 
ATOM   7323 C CA    . ARG L 3 21  ? 20.991  -33.469 233.253 1.00 123.35 ? 22  ARG D CA    1 
ATOM   7324 C C     . ARG L 3 21  ? 21.935  -33.404 232.055 1.00 128.45 ? 22  ARG D C     1 
ATOM   7325 O O     . ARG L 3 21  ? 22.382  -34.430 231.539 1.00 125.53 ? 22  ARG D O     1 
ATOM   7326 C CB    . ARG L 3 21  ? 21.772  -33.433 234.571 1.00 120.38 ? 22  ARG D CB    1 
ATOM   7327 C CG    . ARG L 3 21  ? 22.550  -34.696 234.895 1.00 120.59 ? 22  ARG D CG    1 
ATOM   7328 C CD    . ARG L 3 21  ? 23.953  -34.640 234.331 1.00 117.75 ? 22  ARG D CD    1 
ATOM   7329 N NE    . ARG L 3 21  ? 24.740  -33.559 234.923 1.00 115.09 ? 22  ARG D NE    1 
ATOM   7330 C CZ    . ARG L 3 21  ? 25.161  -33.539 236.183 1.00 111.00 ? 22  ARG D CZ    1 
ATOM   7331 N NH1   . ARG L 3 21  ? 24.870  -34.549 236.995 1.00 113.43 ? 22  ARG D NH1   1 
ATOM   7332 N NH2   . ARG L 3 21  ? 25.878  -32.512 236.625 1.00 105.22 ? 22  ARG D NH2   1 
ATOM   7333 N N     . PRO L 3 22  ? 22.222  -32.184 231.578 1.00 134.91 ? 23  PRO D N     1 
ATOM   7334 C CA    . PRO L 3 22  ? 23.106  -31.936 230.439 1.00 140.49 ? 23  PRO D CA    1 
ATOM   7335 C C     . PRO L 3 22  ? 24.411  -32.718 230.506 1.00 146.15 ? 23  PRO D C     1 
ATOM   7336 O O     . PRO L 3 22  ? 25.268  -32.431 231.339 1.00 148.03 ? 23  PRO D O     1 
ATOM   7337 C CB    . PRO L 3 22  ? 23.332  -30.430 230.513 1.00 140.68 ? 23  PRO D CB    1 
ATOM   7338 C CG    . PRO L 3 22  ? 22.014  -29.936 230.996 1.00 139.57 ? 23  PRO D CG    1 
ATOM   7339 C CD    . PRO L 3 22  ? 21.687  -30.915 232.104 1.00 137.55 ? 23  PRO D CD    1 
ATOM   7340 N N     . LYS L 3 23  ? 24.555  -33.704 229.623 1.00 153.42 ? 24  LYS D N     1 
ATOM   7341 C CA    . LYS L 3 23  ? 25.760  -34.528 229.568 1.00 159.78 ? 24  LYS D CA    1 
ATOM   7342 C C     . LYS L 3 23  ? 26.998  -33.651 229.355 1.00 163.58 ? 24  LYS D C     1 
ATOM   7343 O O     . LYS L 3 23  ? 27.095  -32.924 228.365 1.00 164.41 ? 24  LYS D O     1 
ATOM   7344 C CB    . LYS L 3 23  ? 25.643  -35.550 228.433 1.00 157.65 ? 24  LYS D CB    1 
ATOM   7345 N N     . SER L 3 24  ? 27.941  -33.727 230.291 1.00 167.20 ? 25  SER D N     1 
ATOM   7346 C CA    . SER L 3 24  ? 29.170  -32.938 230.232 1.00 170.07 ? 25  SER D CA    1 
ATOM   7347 C C     . SER L 3 24  ? 28.886  -31.432 230.244 1.00 170.02 ? 25  SER D C     1 
ATOM   7348 O O     . SER L 3 24  ? 29.546  -30.652 229.553 1.00 172.89 ? 25  SER D O     1 
ATOM   7349 C CB    . SER L 3 24  ? 29.991  -33.314 228.991 1.00 170.57 ? 25  SER D CB    1 
ATOM   7350 O OG    . SER L 3 24  ? 30.510  -34.628 229.107 1.00 172.13 ? 25  SER D OG    1 
ATOM   7351 N N     . GLY L 3 25  ? 27.902  -31.034 231.047 1.00 166.45 ? 26  GLY D N     1 
ATOM   7352 C CA    . GLY L 3 25  ? 27.543  -29.634 231.150 1.00 159.84 ? 26  GLY D CA    1 
ATOM   7353 C C     . GLY L 3 25  ? 27.338  -29.214 232.591 1.00 154.90 ? 26  GLY D C     1 
ATOM   7354 O O     . GLY L 3 25  ? 27.787  -29.892 233.518 1.00 152.03 ? 26  GLY D O     1 
ATOM   7355 N N     . THR L 3 26  ? 26.649  -28.094 232.778 1.00 150.23 ? 27  THR D N     1 
ATOM   7356 C CA    . THR L 3 26  ? 26.388  -27.567 234.108 1.00 144.21 ? 27  THR D CA    1 
ATOM   7357 C C     . THR L 3 26  ? 24.905  -27.555 234.430 1.00 142.74 ? 27  THR D C     1 
ATOM   7358 O O     . THR L 3 26  ? 24.067  -27.778 233.557 1.00 143.43 ? 27  THR D O     1 
ATOM   7359 C CB    . THR L 3 26  ? 26.913  -26.144 234.237 1.00 140.54 ? 27  THR D CB    1 
ATOM   7360 O OG1   . THR L 3 26  ? 26.344  -25.338 233.201 1.00 136.64 ? 27  THR D OG1   1 
ATOM   7361 C CG2   . THR L 3 26  ? 28.420  -26.129 234.108 1.00 143.68 ? 27  THR D CG2   1 
ATOM   7362 N N     . LEU L 3 27  ? 24.593  -27.285 235.693 1.00 139.23 ? 28  LEU D N     1 
ATOM   7363 C CA    . LEU L 3 27  ? 23.216  -27.240 236.171 1.00 134.66 ? 28  LEU D CA    1 
ATOM   7364 C C     . LEU L 3 27  ? 22.840  -25.856 236.713 1.00 132.07 ? 28  LEU D C     1 
ATOM   7365 O O     . LEU L 3 27  ? 22.436  -25.721 237.871 1.00 134.43 ? 28  LEU D O     1 
ATOM   7366 C CB    . LEU L 3 27  ? 23.006  -28.305 237.260 1.00 131.09 ? 28  LEU D CB    1 
ATOM   7367 C CG    . LEU L 3 27  ? 23.060  -29.787 236.862 1.00 128.60 ? 28  LEU D CG    1 
ATOM   7368 C CD1   . LEU L 3 27  ? 23.307  -30.643 238.090 1.00 126.61 ? 28  LEU D CD1   1 
ATOM   7369 C CD2   . LEU L 3 27  ? 21.763  -30.190 236.179 1.00 127.25 ? 28  LEU D CD2   1 
ATOM   7370 N N     . SER L 3 28  ? 22.985  -24.829 235.879 1.00 126.44 ? 29  SER D N     1 
ATOM   7371 C CA    . SER L 3 28  ? 22.636  -23.465 236.275 1.00 120.17 ? 29  SER D CA    1 
ATOM   7372 C C     . SER L 3 28  ? 22.457  -22.567 235.053 1.00 117.20 ? 29  SER D C     1 
ATOM   7373 O O     . SER L 3 28  ? 22.950  -22.869 233.964 1.00 109.26 ? 29  SER D O     1 
ATOM   7374 C CB    . SER L 3 28  ? 23.702  -22.869 237.206 1.00 118.55 ? 29  SER D CB    1 
ATOM   7375 O OG    . SER L 3 28  ? 24.883  -22.519 236.508 1.00 114.41 ? 29  SER D OG    1 
ATOM   7376 N N     . GLY L 3 29  ? 21.737  -21.467 235.240 1.00 117.23 ? 30  GLY D N     1 
ATOM   7377 C CA    . GLY L 3 29  ? 21.502  -20.545 234.146 1.00 120.68 ? 30  GLY D CA    1 
ATOM   7378 C C     . GLY L 3 29  ? 20.576  -21.106 233.080 1.00 120.37 ? 30  GLY D C     1 
ATOM   7379 O O     . GLY L 3 29  ? 19.591  -21.775 233.403 1.00 121.62 ? 30  GLY D O     1 
ATOM   7380 N N     . HIS L 3 30  ? 20.884  -20.829 231.812 1.00 116.63 ? 31  HIS D N     1 
ATOM   7381 C CA    . HIS L 3 30  ? 20.071  -21.319 230.704 1.00 109.07 ? 31  HIS D CA    1 
ATOM   7382 C C     . HIS L 3 30  ? 20.099  -22.838 230.643 1.00 111.41 ? 31  HIS D C     1 
ATOM   7383 O O     . HIS L 3 30  ? 19.114  -23.464 230.253 1.00 111.96 ? 31  HIS D O     1 
ATOM   7384 C CB    . HIS L 3 30  ? 20.559  -20.744 229.369 1.00 99.43  ? 31  HIS D CB    1 
ATOM   7385 C CG    . HIS L 3 30  ? 20.031  -19.375 229.069 1.00 91.77  ? 31  HIS D CG    1 
ATOM   7386 N ND1   . HIS L 3 30  ? 20.508  -18.236 229.683 1.00 90.22  ? 31  HIS D ND1   1 
ATOM   7387 C CD2   . HIS L 3 30  ? 19.037  -18.967 228.244 1.00 87.69  ? 31  HIS D CD2   1 
ATOM   7388 C CE1   . HIS L 3 30  ? 19.829  -17.188 229.251 1.00 85.20  ? 31  HIS D CE1   1 
ATOM   7389 N NE2   . HIS L 3 30  ? 18.929  -17.604 228.378 1.00 74.91  ? 31  HIS D NE2   1 
ATOM   7390 N N     . ALA L 3 31  ? 21.228  -23.424 231.041 1.00 113.11 ? 32  ALA D N     1 
ATOM   7391 C CA    . ALA L 3 31  ? 21.399  -24.879 231.035 1.00 113.96 ? 32  ALA D CA    1 
ATOM   7392 C C     . ALA L 3 31  ? 21.036  -25.507 232.382 1.00 112.34 ? 32  ALA D C     1 
ATOM   7393 O O     . ALA L 3 31  ? 21.895  -26.042 233.085 1.00 109.21 ? 32  ALA D O     1 
ATOM   7394 C CB    . ALA L 3 31  ? 22.840  -25.234 230.663 1.00 120.58 ? 32  ALA D CB    1 
ATOM   7395 N N     . ALA L 3 32  ? 19.755  -25.434 232.727 1.00 111.85 ? 33  ALA D N     1 
ATOM   7396 C CA    . ALA L 3 32  ? 19.249  -25.984 233.975 1.00 110.20 ? 33  ALA D CA    1 
ATOM   7397 C C     . ALA L 3 32  ? 17.887  -26.594 233.720 1.00 114.82 ? 33  ALA D C     1 
ATOM   7398 O O     . ALA L 3 32  ? 17.758  -27.808 233.592 1.00 118.78 ? 33  ALA D O     1 
ATOM   7399 C CB    . ALA L 3 32  ? 19.138  -24.897 235.028 1.00 107.79 ? 33  ALA D CB    1 
ATOM   7400 N N     . GLY L 3 33  ? 16.871  -25.742 233.636 1.00 120.12 ? 34  GLY D N     1 
ATOM   7401 C CA    . GLY L 3 33  ? 15.520  -26.223 233.401 1.00 124.50 ? 34  GLY D CA    1 
ATOM   7402 C C     . GLY L 3 33  ? 15.023  -25.976 231.992 1.00 128.76 ? 34  GLY D C     1 
ATOM   7403 O O     . GLY L 3 33  ? 13.854  -26.218 231.694 1.00 127.79 ? 34  GLY D O     1 
ATOM   7404 N N     . GLU L 3 34  ? 15.915  -25.498 231.128 1.00 132.75 ? 35  GLU D N     1 
ATOM   7405 C CA    . GLU L 3 34  ? 15.581  -25.208 229.737 1.00 135.82 ? 35  GLU D CA    1 
ATOM   7406 C C     . GLU L 3 34  ? 14.721  -26.305 229.118 1.00 136.67 ? 35  GLU D C     1 
ATOM   7407 O O     . GLU L 3 34  ? 13.700  -26.031 228.487 1.00 134.26 ? 35  GLU D O     1 
ATOM   7408 C CB    . GLU L 3 34  ? 16.859  -25.044 228.914 1.00 137.39 ? 35  GLU D CB    1 
ATOM   7409 C CG    . GLU L 3 34  ? 16.621  -24.482 227.531 1.00 142.34 ? 35  GLU D CG    1 
ATOM   7410 C CD    . GLU L 3 34  ? 16.069  -23.072 227.579 1.00 145.58 ? 35  GLU D CD    1 
ATOM   7411 O OE1   . GLU L 3 34  ? 15.738  -22.520 226.508 1.00 147.58 ? 35  GLU D OE1   1 
ATOM   7412 O OE2   . GLU L 3 34  ? 15.969  -22.512 228.693 1.00 144.82 ? 35  GLU D OE2   1 
ATOM   7413 N N     . PRO L 3 35  ? 15.134  -27.569 229.279 1.00 137.83 ? 36  PRO D N     1 
ATOM   7414 C CA    . PRO L 3 35  ? 14.345  -28.657 228.708 1.00 139.35 ? 36  PRO D CA    1 
ATOM   7415 C C     . PRO L 3 35  ? 12.906  -28.596 229.182 1.00 138.51 ? 36  PRO D C     1 
ATOM   7416 O O     . PRO L 3 35  ? 11.985  -28.844 228.410 1.00 142.05 ? 36  PRO D O     1 
ATOM   7417 C CB    . PRO L 3 35  ? 15.064  -29.902 229.211 1.00 141.94 ? 36  PRO D CB    1 
ATOM   7418 C CG    . PRO L 3 35  ? 16.485  -29.462 229.242 1.00 141.52 ? 36  PRO D CG    1 
ATOM   7419 C CD    . PRO L 3 35  ? 16.376  -28.088 229.876 1.00 140.33 ? 36  PRO D CD    1 
ATOM   7420 N N     . PHE L 3 36  ? 12.709  -28.262 230.452 1.00 135.96 ? 37  PHE D N     1 
ATOM   7421 C CA    . PHE L 3 36  ? 11.356  -28.186 230.986 1.00 135.47 ? 37  PHE D CA    1 
ATOM   7422 C C     . PHE L 3 36  ? 10.529  -27.134 230.262 1.00 132.45 ? 37  PHE D C     1 
ATOM   7423 O O     . PHE L 3 36  ? 9.354   -27.358 229.960 1.00 133.41 ? 37  PHE D O     1 
ATOM   7424 C CB    . PHE L 3 36  ? 11.375  -27.895 232.491 1.00 135.97 ? 37  PHE D CB    1 
ATOM   7425 C CG    . PHE L 3 36  ? 11.590  -29.115 233.338 1.00 133.56 ? 37  PHE D CG    1 
ATOM   7426 C CD1   . PHE L 3 36  ? 12.827  -29.372 233.911 1.00 132.36 ? 37  PHE D CD1   1 
ATOM   7427 C CD2   . PHE L 3 36  ? 10.556  -30.025 233.541 1.00 133.16 ? 37  PHE D CD2   1 
ATOM   7428 C CE1   . PHE L 3 36  ? 13.032  -30.519 234.675 1.00 130.62 ? 37  PHE D CE1   1 
ATOM   7429 C CE2   . PHE L 3 36  ? 10.750  -31.174 234.302 1.00 128.90 ? 37  PHE D CE2   1 
ATOM   7430 C CZ    . PHE L 3 36  ? 11.989  -31.422 234.869 1.00 129.41 ? 37  PHE D CZ    1 
ATOM   7431 N N     . GLU L 3 37  ? 11.140  -25.988 229.985 1.00 125.73 ? 38  GLU D N     1 
ATOM   7432 C CA    . GLU L 3 37  ? 10.433  -24.929 229.286 1.00 120.07 ? 38  GLU D CA    1 
ATOM   7433 C C     . GLU L 3 37  ? 10.143  -25.446 227.892 1.00 118.34 ? 38  GLU D C     1 
ATOM   7434 O O     . GLU L 3 37  ? 9.078   -25.199 227.327 1.00 116.75 ? 38  GLU D O     1 
ATOM   7435 C CB    . GLU L 3 37  ? 11.292  -23.672 229.207 1.00 120.52 ? 38  GLU D CB    1 
ATOM   7436 C CG    . GLU L 3 37  ? 10.562  -22.484 228.611 1.00 124.21 ? 38  GLU D CG    1 
ATOM   7437 C CD    . GLU L 3 37  ? 10.382  -22.587 227.107 1.00 124.70 ? 38  GLU D CD    1 
ATOM   7438 O OE1   . GLU L 3 37  ? 9.503   -21.880 226.564 1.00 121.66 ? 38  GLU D OE1   1 
ATOM   7439 O OE2   . GLU L 3 37  ? 11.127  -23.363 226.468 1.00 125.63 ? 38  GLU D OE2   1 
ATOM   7440 N N     . LYS L 3 38  ? 11.109  -26.172 227.343 1.00 115.67 ? 39  LYS D N     1 
ATOM   7441 C CA    . LYS L 3 38  ? 10.957  -26.744 226.018 1.00 112.66 ? 39  LYS D CA    1 
ATOM   7442 C C     . LYS L 3 38  ? 9.981   -27.927 226.106 1.00 109.22 ? 39  LYS D C     1 
ATOM   7443 O O     . LYS L 3 38  ? 9.766   -28.641 225.130 1.00 110.22 ? 39  LYS D O     1 
ATOM   7444 C CB    . LYS L 3 38  ? 12.323  -27.198 225.488 1.00 105.25 ? 39  LYS D CB    1 
ATOM   7445 N N     . LEU L 3 39  ? 9.387   -28.118 227.282 1.00 103.67 ? 40  LEU D N     1 
ATOM   7446 C CA    . LEU L 3 39  ? 8.440   -29.205 227.502 1.00 97.88  ? 40  LEU D CA    1 
ATOM   7447 C C     . LEU L 3 39  ? 7.012   -28.678 227.474 1.00 95.83  ? 40  LEU D C     1 
ATOM   7448 O O     . LEU L 3 39  ? 6.226   -29.051 226.608 1.00 96.75  ? 40  LEU D O     1 
ATOM   7449 C CB    . LEU L 3 39  ? 8.714   -29.879 228.843 1.00 99.06  ? 40  LEU D CB    1 
ATOM   7450 C CG    . LEU L 3 39  ? 8.625   -31.407 228.807 1.00 102.59 ? 40  LEU D CG    1 
ATOM   7451 C CD1   . LEU L 3 39  ? 9.142   -31.977 230.120 1.00 102.42 ? 40  LEU D CD1   1 
ATOM   7452 C CD2   . LEU L 3 39  ? 7.193   -31.836 228.531 1.00 100.06 ? 40  LEU D CD2   1 
ATOM   7453 N N     . VAL L 3 40  ? 6.689   -27.811 228.428 1.00 89.06  ? 41  VAL D N     1 
ATOM   7454 C CA    . VAL L 3 40  ? 5.367   -27.195 228.524 1.00 84.97  ? 41  VAL D CA    1 
ATOM   7455 C C     . VAL L 3 40  ? 4.760   -26.848 227.163 1.00 88.00  ? 41  VAL D C     1 
ATOM   7456 O O     . VAL L 3 40  ? 3.547   -26.930 226.964 1.00 82.33  ? 41  VAL D O     1 
ATOM   7457 C CB    . VAL L 3 40  ? 5.435   -25.898 229.338 1.00 83.27  ? 41  VAL D CB    1 
ATOM   7458 C CG1   . VAL L 3 40  ? 4.062   -25.230 229.371 1.00 69.26  ? 41  VAL D CG1   1 
ATOM   7459 C CG2   . VAL L 3 40  ? 5.956   -26.193 230.742 1.00 85.08  ? 41  VAL D CG2   1 
ATOM   7460 N N     . TYR L 3 41  ? 5.612   -26.432 226.235 1.00 94.31  ? 42  TYR D N     1 
ATOM   7461 C CA    . TYR L 3 41  ? 5.165   -26.078 224.894 1.00 100.13 ? 42  TYR D CA    1 
ATOM   7462 C C     . TYR L 3 41  ? 4.416   -27.253 224.273 1.00 101.70 ? 42  TYR D C     1 
ATOM   7463 O O     . TYR L 3 41  ? 3.439   -27.073 223.545 1.00 100.05 ? 42  TYR D O     1 
ATOM   7464 C CB    . TYR L 3 41  ? 6.373   -25.702 224.025 1.00 98.48  ? 42  TYR D CB    1 
ATOM   7465 C CG    . TYR L 3 41  ? 6.060   -25.523 222.554 1.00 99.02  ? 42  TYR D CG    1 
ATOM   7466 C CD1   . TYR L 3 41  ? 5.075   -24.632 222.137 1.00 103.64 ? 42  TYR D CD1   1 
ATOM   7467 C CD2   . TYR L 3 41  ? 6.752   -26.243 221.580 1.00 97.59  ? 42  TYR D CD2   1 
ATOM   7468 C CE1   . TYR L 3 41  ? 4.781   -24.461 220.787 1.00 106.20 ? 42  TYR D CE1   1 
ATOM   7469 C CE2   . TYR L 3 41  ? 6.468   -26.080 220.226 1.00 101.23 ? 42  TYR D CE2   1 
ATOM   7470 C CZ    . TYR L 3 41  ? 5.477   -25.186 219.839 1.00 106.24 ? 42  TYR D CZ    1 
ATOM   7471 O OH    . TYR L 3 41  ? 5.159   -25.019 218.509 1.00 109.86 ? 42  TYR D OH    1 
ATOM   7472 N N     . LYS L 3 42  ? 4.877   -28.460 224.576 1.00 103.83 ? 43  LYS D N     1 
ATOM   7473 C CA    . LYS L 3 42  ? 4.260   -29.660 224.039 1.00 105.71 ? 43  LYS D CA    1 
ATOM   7474 C C     . LYS L 3 42  ? 2.812   -29.815 224.483 1.00 106.13 ? 43  LYS D C     1 
ATOM   7475 O O     . LYS L 3 42  ? 1.897   -29.545 223.708 1.00 109.55 ? 43  LYS D O     1 
ATOM   7476 C CB    . LYS L 3 42  ? 5.068   -30.897 224.444 1.00 107.92 ? 43  LYS D CB    1 
ATOM   7477 N N     . PHE L 3 43  ? 2.608   -30.235 225.730 1.00 106.88 ? 44  PHE D N     1 
ATOM   7478 C CA    . PHE L 3 43  ? 1.264   -30.453 226.265 1.00 107.78 ? 44  PHE D CA    1 
ATOM   7479 C C     . PHE L 3 43  ? 0.322   -29.278 226.041 1.00 105.93 ? 44  PHE D C     1 
ATOM   7480 O O     . PHE L 3 43  ? -0.836  -29.452 225.645 1.00 96.65  ? 44  PHE D O     1 
ATOM   7481 C CB    . PHE L 3 43  ? 1.328   -30.760 227.762 1.00 113.95 ? 44  PHE D CB    1 
ATOM   7482 C CG    . PHE L 3 43  ? -0.014  -31.060 228.368 1.00 123.25 ? 44  PHE D CG    1 
ATOM   7483 C CD1   . PHE L 3 43  ? -0.664  -32.260 228.090 1.00 126.47 ? 44  PHE D CD1   1 
ATOM   7484 C CD2   . PHE L 3 43  ? -0.649  -30.125 229.182 1.00 127.39 ? 44  PHE D CD2   1 
ATOM   7485 C CE1   . PHE L 3 43  ? -1.931  -32.524 228.612 1.00 129.05 ? 44  PHE D CE1   1 
ATOM   7486 C CE2   . PHE L 3 43  ? -1.915  -30.377 229.710 1.00 128.85 ? 44  PHE D CE2   1 
ATOM   7487 C CZ    . PHE L 3 43  ? -2.558  -31.580 229.423 1.00 131.39 ? 44  PHE D CZ    1 
ATOM   7488 N N     . LEU L 3 44  ? 0.822   -28.079 226.309 1.00 109.64 ? 45  LEU D N     1 
ATOM   7489 C CA    . LEU L 3 44  ? 0.032   -26.873 226.138 1.00 111.93 ? 45  LEU D CA    1 
ATOM   7490 C C     . LEU L 3 44  ? -0.507  -26.798 224.718 1.00 116.81 ? 45  LEU D C     1 
ATOM   7491 O O     . LEU L 3 44  ? -1.532  -26.170 224.470 1.00 122.07 ? 45  LEU D O     1 
ATOM   7492 C CB    . LEU L 3 44  ? 0.887   -25.650 226.435 1.00 106.93 ? 45  LEU D CB    1 
ATOM   7493 C CG    . LEU L 3 44  ? 0.263   -24.711 227.456 1.00 106.98 ? 45  LEU D CG    1 
ATOM   7494 C CD1   . LEU L 3 44  ? 1.271   -23.632 227.803 1.00 111.39 ? 45  LEU D CD1   1 
ATOM   7495 C CD2   . LEU L 3 44  ? -1.031  -24.119 226.912 1.00 101.14 ? 45  LEU D CD2   1 
ATOM   7496 N N     . LYS L 3 45  ? 0.192   -27.447 223.791 1.00 118.84 ? 46  LYS D N     1 
ATOM   7497 C CA    . LYS L 3 45  ? -0.210  -27.465 222.388 1.00 119.49 ? 46  LYS D CA    1 
ATOM   7498 C C     . LYS L 3 45  ? -1.120  -28.660 222.109 1.00 121.34 ? 46  LYS D C     1 
ATOM   7499 O O     . LYS L 3 45  ? -1.959  -28.622 221.207 1.00 122.61 ? 46  LYS D O     1 
ATOM   7500 C CB    . LYS L 3 45  ? 1.029   -27.535 221.489 1.00 116.03 ? 46  LYS D CB    1 
ATOM   7501 N N     . GLU L 3 46  ? -0.945  -29.718 222.894 1.00 123.05 ? 47  GLU D N     1 
ATOM   7502 C CA    . GLU L 3 46  ? -1.733  -30.940 222.758 1.00 122.87 ? 47  GLU D CA    1 
ATOM   7503 C C     . GLU L 3 46  ? -3.219  -30.627 222.910 1.00 118.42 ? 47  GLU D C     1 
ATOM   7504 O O     . GLU L 3 46  ? -4.058  -31.203 222.220 1.00 115.66 ? 47  GLU D O     1 
ATOM   7505 C CB    . GLU L 3 46  ? -1.305  -31.948 223.834 1.00 129.40 ? 47  GLU D CB    1 
ATOM   7506 C CG    . GLU L 3 46  ? -0.989  -33.357 223.326 1.00 135.50 ? 47  GLU D CG    1 
ATOM   7507 C CD    . GLU L 3 46  ? -2.227  -34.161 222.952 1.00 139.78 ? 47  GLU D CD    1 
ATOM   7508 O OE1   . GLU L 3 46  ? -2.071  -35.328 222.530 1.00 136.93 ? 47  GLU D OE1   1 
ATOM   7509 O OE2   . GLU L 3 46  ? -3.354  -33.633 223.079 1.00 144.50 ? 47  GLU D OE2   1 
ATOM   7510 N N     . ASN L 3 47  ? -3.531  -29.700 223.809 1.00 114.47 ? 48  ASN D N     1 
ATOM   7511 C CA    . ASN L 3 47  ? -4.912  -29.322 224.074 1.00 111.13 ? 48  ASN D CA    1 
ATOM   7512 C C     . ASN L 3 47  ? -5.290  -28.004 223.428 1.00 106.28 ? 48  ASN D C     1 
ATOM   7513 O O     . ASN L 3 47  ? -6.467  -27.722 223.232 1.00 102.74 ? 48  ASN D O     1 
ATOM   7514 C CB    . ASN L 3 47  ? -5.128  -29.211 225.575 1.00 117.62 ? 48  ASN D CB    1 
ATOM   7515 C CG    . ASN L 3 47  ? -4.199  -30.110 226.354 1.00 122.45 ? 48  ASN D CG    1 
ATOM   7516 O OD1   . ASN L 3 47  ? -4.200  -31.326 226.174 1.00 122.88 ? 48  ASN D OD1   1 
ATOM   7517 N ND2   . ASN L 3 47  ? -3.387  -29.514 227.220 1.00 124.96 ? 48  ASN D ND2   1 
ATOM   7518 N N     . LEU L 3 48  ? -4.287  -27.194 223.108 1.00 104.13 ? 49  LEU D N     1 
ATOM   7519 C CA    . LEU L 3 48  ? -4.518  -25.891 222.489 1.00 101.33 ? 49  LEU D CA    1 
ATOM   7520 C C     . LEU L 3 48  ? -3.635  -25.715 221.250 1.00 101.30 ? 49  LEU D C     1 
ATOM   7521 O O     . LEU L 3 48  ? -2.950  -24.703 221.113 1.00 102.00 ? 49  LEU D O     1 
ATOM   7522 C CB    . LEU L 3 48  ? -4.218  -24.779 223.502 1.00 94.46  ? 49  LEU D CB    1 
ATOM   7523 C CG    . LEU L 3 48  ? -4.969  -24.801 224.839 1.00 84.74  ? 49  LEU D CG    1 
ATOM   7524 C CD1   . LEU L 3 48  ? -4.296  -23.881 225.846 1.00 88.86  ? 49  LEU D CD1   1 
ATOM   7525 C CD2   . LEU L 3 48  ? -6.394  -24.383 224.620 1.00 75.77  ? 49  LEU D CD2   1 
ATOM   7526 N N     . SER L 3 49  ? -3.664  -26.699 220.353 1.00 103.66 ? 50  SER D N     1 
ATOM   7527 C CA    . SER L 3 49  ? -2.857  -26.676 219.132 1.00 104.76 ? 50  SER D CA    1 
ATOM   7528 C C     . SER L 3 49  ? -3.176  -25.519 218.198 1.00 104.49 ? 50  SER D C     1 
ATOM   7529 O O     . SER L 3 49  ? -2.437  -25.257 217.250 1.00 103.97 ? 50  SER D O     1 
ATOM   7530 C CB    . SER L 3 49  ? -3.024  -27.991 218.369 1.00 105.45 ? 50  SER D CB    1 
ATOM   7531 N N     . ASP L 3 50  ? -4.272  -24.825 218.469 1.00 104.43 ? 51  ASP D N     1 
ATOM   7532 C CA    . ASP L 3 50  ? -4.676  -23.709 217.632 1.00 105.20 ? 51  ASP D CA    1 
ATOM   7533 C C     . ASP L 3 50  ? -4.480  -22.364 218.337 1.00 103.18 ? 51  ASP D C     1 
ATOM   7534 O O     . ASP L 3 50  ? -4.845  -21.320 217.804 1.00 103.34 ? 51  ASP D O     1 
ATOM   7535 C CB    . ASP L 3 50  ? -6.148  -23.875 217.225 1.00 115.05 ? 51  ASP D CB    1 
ATOM   7536 C CG    . ASP L 3 50  ? -6.428  -25.214 216.542 1.00 123.40 ? 51  ASP D CG    1 
ATOM   7537 O OD1   . ASP L 3 50  ? -7.590  -25.445 216.129 1.00 126.48 ? 51  ASP D OD1   1 
ATOM   7538 O OD2   . ASP L 3 50  ? -5.492  -26.037 216.421 1.00 129.49 ? 51  ASP D OD2   1 
ATOM   7539 N N     . LEU L 3 51  ? -3.905  -22.381 219.534 1.00 99.74  ? 52  LEU D N     1 
ATOM   7540 C CA    . LEU L 3 51  ? -3.695  -21.142 220.275 1.00 91.64  ? 52  LEU D CA    1 
ATOM   7541 C C     . LEU L 3 51  ? -2.241  -20.970 220.681 1.00 89.77  ? 52  LEU D C     1 
ATOM   7542 O O     . LEU L 3 51  ? -1.715  -19.853 220.710 1.00 93.78  ? 52  LEU D O     1 
ATOM   7543 C CB    . LEU L 3 51  ? -4.560  -21.125 221.532 1.00 87.36  ? 52  LEU D CB    1 
ATOM   7544 C CG    . LEU L 3 51  ? -5.573  -19.990 221.655 1.00 85.56  ? 52  LEU D CG    1 
ATOM   7545 C CD1   . LEU L 3 51  ? -6.655  -20.175 220.615 1.00 81.89  ? 52  LEU D CD1   1 
ATOM   7546 C CD2   . LEU L 3 51  ? -6.175  -19.982 223.056 1.00 85.19  ? 52  LEU D CD2   1 
ATOM   7547 N N     . THR L 3 52  ? -1.602  -22.086 221.000 1.00 78.16  ? 53  THR D N     1 
ATOM   7548 C CA    . THR L 3 52  ? -0.219  -22.078 221.423 1.00 73.55  ? 53  THR D CA    1 
ATOM   7549 C C     . THR L 3 52  ? 0.757   -21.689 220.312 1.00 71.05  ? 53  THR D C     1 
ATOM   7550 O O     . THR L 3 52  ? 0.621   -22.101 219.160 1.00 61.59  ? 53  THR D O     1 
ATOM   7551 C CB    . THR L 3 52  ? 0.165   -23.453 221.992 1.00 75.14  ? 53  THR D CB    1 
ATOM   7552 O OG1   . THR L 3 52  ? -0.639  -23.723 223.144 1.00 80.15  ? 53  THR D OG1   1 
ATOM   7553 C CG2   . THR L 3 52  ? 1.619   -23.485 222.390 1.00 76.54  ? 53  THR D CG2   1 
ATOM   7554 N N     . PHE L 3 53  ? 1.736   -20.871 220.683 1.00 74.14  ? 54  PHE D N     1 
ATOM   7555 C CA    . PHE L 3 53  ? 2.779   -20.393 219.774 1.00 73.70  ? 54  PHE D CA    1 
ATOM   7556 C C     . PHE L 3 53  ? 4.034   -20.031 220.562 1.00 73.78  ? 54  PHE D C     1 
ATOM   7557 O O     . PHE L 3 53  ? 3.982   -19.787 221.768 1.00 74.05  ? 54  PHE D O     1 
ATOM   7558 C CB    . PHE L 3 53  ? 2.330   -19.126 219.029 1.00 74.17  ? 54  PHE D CB    1 
ATOM   7559 C CG    . PHE L 3 53  ? 1.550   -19.387 217.780 1.00 74.31  ? 54  PHE D CG    1 
ATOM   7560 C CD1   . PHE L 3 53  ? 1.872   -20.463 216.960 1.00 81.56  ? 54  PHE D CD1   1 
ATOM   7561 C CD2   . PHE L 3 53  ? 0.515   -18.538 217.404 1.00 60.02  ? 54  PHE D CD2   1 
ATOM   7562 C CE1   . PHE L 3 53  ? 1.177   -20.696 215.780 1.00 82.51  ? 54  PHE D CE1   1 
ATOM   7563 C CE2   . PHE L 3 53  ? -0.182  -18.760 216.231 1.00 67.20  ? 54  PHE D CE2   1 
ATOM   7564 C CZ    . PHE L 3 53  ? 0.147   -19.843 215.412 1.00 75.00  ? 54  PHE D CZ    1 
ATOM   7565 N N     . LYS L 3 54  ? 5.168   -20.004 219.877 1.00 71.62  ? 55  LYS D N     1 
ATOM   7566 C CA    . LYS L 3 54  ? 6.407   -19.590 220.516 1.00 70.98  ? 55  LYS D CA    1 
ATOM   7567 C C     . LYS L 3 54  ? 6.602   -18.147 220.007 1.00 71.96  ? 55  LYS D C     1 
ATOM   7568 O O     . LYS L 3 54  ? 6.156   -17.803 218.905 1.00 67.76  ? 55  LYS D O     1 
ATOM   7569 C CB    . LYS L 3 54  ? 7.575   -20.485 220.085 1.00 56.22  ? 55  LYS D CB    1 
ATOM   7570 N N     . GLN L 3 55  ? 7.223   -17.301 220.823 1.00 69.49  ? 56  GLN D N     1 
ATOM   7571 C CA    . GLN L 3 55  ? 7.481   -15.910 220.463 1.00 60.44  ? 56  GLN D CA    1 
ATOM   7572 C C     . GLN L 3 55  ? 7.585   -15.768 218.949 1.00 61.72  ? 56  GLN D C     1 
ATOM   7573 O O     . GLN L 3 55  ? 6.675   -15.257 218.295 1.00 57.68  ? 56  GLN D O     1 
ATOM   7574 C CB    . GLN L 3 55  ? 8.795   -15.472 221.101 1.00 58.65  ? 56  GLN D CB    1 
ATOM   7575 C CG    . GLN L 3 55  ? 9.123   -14.006 221.017 1.00 59.09  ? 56  GLN D CG    1 
ATOM   7576 C CD    . GLN L 3 55  ? 8.145   -13.158 221.777 1.00 61.75  ? 56  GLN D CD    1 
ATOM   7577 O OE1   . GLN L 3 55  ? 7.014   -12.956 221.335 1.00 69.87  ? 56  GLN D OE1   1 
ATOM   7578 N NE2   . GLN L 3 55  ? 8.565   -12.666 222.941 1.00 45.38  ? 56  GLN D NE2   1 
ATOM   7579 N N     . TYR L 3 56  ? 8.700   -16.254 218.405 1.00 63.04  ? 57  TYR D N     1 
ATOM   7580 C CA    . TYR L 3 56  ? 8.985   -16.177 216.972 1.00 65.38  ? 57  TYR D CA    1 
ATOM   7581 C C     . TYR L 3 56  ? 7.989   -16.936 216.113 1.00 70.04  ? 57  TYR D C     1 
ATOM   7582 O O     . TYR L 3 56  ? 7.614   -16.470 215.042 1.00 66.28  ? 57  TYR D O     1 
ATOM   7583 C CB    . TYR L 3 56  ? 10.403  -16.686 216.696 1.00 62.99  ? 57  TYR D CB    1 
ATOM   7584 C CG    . TYR L 3 56  ? 10.578  -18.180 216.842 1.00 65.19  ? 57  TYR D CG    1 
ATOM   7585 C CD1   . TYR L 3 56  ? 10.235  -19.048 215.811 1.00 64.99  ? 57  TYR D CD1   1 
ATOM   7586 C CD2   . TYR L 3 56  ? 11.084  -18.726 218.013 1.00 75.03  ? 57  TYR D CD2   1 
ATOM   7587 C CE1   . TYR L 3 56  ? 10.397  -20.420 215.946 1.00 71.62  ? 57  TYR D CE1   1 
ATOM   7588 C CE2   . TYR L 3 56  ? 11.246  -20.097 218.157 1.00 79.46  ? 57  TYR D CE2   1 
ATOM   7589 C CZ    . TYR L 3 56  ? 10.900  -20.932 217.121 1.00 78.26  ? 57  TYR D CZ    1 
ATOM   7590 O OH    . TYR L 3 56  ? 11.053  -22.281 217.272 1.00 89.11  ? 57  TYR D OH    1 
ATOM   7591 N N     . GLU L 3 57  ? 7.578   -18.111 216.578 1.00 75.30  ? 58  GLU D N     1 
ATOM   7592 C CA    . GLU L 3 57  ? 6.608   -18.927 215.862 1.00 74.57  ? 58  GLU D CA    1 
ATOM   7593 C C     . GLU L 3 57  ? 5.405   -18.043 215.555 1.00 75.16  ? 58  GLU D C     1 
ATOM   7594 O O     . GLU L 3 57  ? 4.903   -18.046 214.435 1.00 79.17  ? 58  GLU D O     1 
ATOM   7595 C CB    . GLU L 3 57  ? 6.173   -20.092 216.739 1.00 84.77  ? 58  GLU D CB    1 
ATOM   7596 C CG    . GLU L 3 57  ? 5.915   -21.392 216.017 1.00 95.44  ? 58  GLU D CG    1 
ATOM   7597 C CD    . GLU L 3 57  ? 5.671   -22.537 216.989 1.00 101.38 ? 58  GLU D CD    1 
ATOM   7598 O OE1   . GLU L 3 57  ? 4.523   -22.683 217.471 1.00 100.22 ? 58  GLU D OE1   1 
ATOM   7599 O OE2   . GLU L 3 57  ? 6.642   -23.272 217.287 1.00 98.72  ? 58  GLU D OE2   1 
ATOM   7600 N N     . TYR L 3 58  ? 4.933   -17.282 216.540 1.00 69.85  ? 59  TYR D N     1 
ATOM   7601 C CA    . TYR L 3 58  ? 3.797   -16.408 216.281 1.00 65.90  ? 59  TYR D CA    1 
ATOM   7602 C C     . TYR L 3 58  ? 4.199   -15.382 215.258 1.00 62.24  ? 59  TYR D C     1 
ATOM   7603 O O     . TYR L 3 58  ? 3.416   -15.062 214.371 1.00 61.08  ? 59  TYR D O     1 
ATOM   7604 C CB    . TYR L 3 58  ? 3.339   -15.668 217.524 1.00 71.15  ? 59  TYR D CB    1 
ATOM   7605 C CG    . TYR L 3 58  ? 2.388   -14.532 217.200 1.00 73.84  ? 59  TYR D CG    1 
ATOM   7606 C CD1   . TYR L 3 58  ? 1.063   -14.783 216.850 1.00 81.84  ? 59  TYR D CD1   1 
ATOM   7607 C CD2   . TYR L 3 58  ? 2.821   -13.200 217.234 1.00 76.70  ? 59  TYR D CD2   1 
ATOM   7608 C CE1   . TYR L 3 58  ? 0.184   -13.736 216.545 1.00 86.77  ? 59  TYR D CE1   1 
ATOM   7609 C CE2   . TYR L 3 58  ? 1.954   -12.144 216.932 1.00 78.70  ? 59  TYR D CE2   1 
ATOM   7610 C CZ    . TYR L 3 58  ? 0.633   -12.425 216.590 1.00 84.87  ? 59  TYR D CZ    1 
ATOM   7611 O OH    . TYR L 3 58  ? -0.251  -11.408 216.310 1.00 86.78  ? 59  TYR D OH    1 
ATOM   7612 N N     . LEU L 3 59  ? 5.411   -14.850 215.403 1.00 55.64  ? 60  LEU D N     1 
ATOM   7613 C CA    . LEU L 3 59  ? 5.920   -13.858 214.466 1.00 59.82  ? 60  LEU D CA    1 
ATOM   7614 C C     . LEU L 3 59  ? 5.830   -14.356 213.019 1.00 64.78  ? 60  LEU D C     1 
ATOM   7615 O O     . LEU L 3 59  ? 5.173   -13.740 212.183 1.00 72.73  ? 60  LEU D O     1 
ATOM   7616 C CB    . LEU L 3 59  ? 7.369   -13.502 214.804 1.00 58.83  ? 60  LEU D CB    1 
ATOM   7617 C CG    . LEU L 3 59  ? 7.491   -12.511 215.963 1.00 61.53  ? 60  LEU D CG    1 
ATOM   7618 C CD1   . LEU L 3 59  ? 8.958   -12.285 216.367 1.00 48.02  ? 60  LEU D CD1   1 
ATOM   7619 C CD2   . LEU L 3 59  ? 6.841   -11.219 215.524 1.00 41.23  ? 60  LEU D CD2   1 
ATOM   7620 N N     . ASN L 3 60  ? 6.480   -15.478 212.732 1.00 64.21  ? 61  ASN D N     1 
ATOM   7621 C CA    . ASN L 3 60  ? 6.470   -16.045 211.397 1.00 58.30  ? 61  ASN D CA    1 
ATOM   7622 C C     . ASN L 3 60  ? 5.067   -16.207 210.809 1.00 64.92  ? 61  ASN D C     1 
ATOM   7623 O O     . ASN L 3 60  ? 4.851   -15.982 209.617 1.00 72.72  ? 61  ASN D O     1 
ATOM   7624 C CB    . ASN L 3 60  ? 7.185   -17.387 211.412 1.00 51.41  ? 61  ASN D CB    1 
ATOM   7625 C CG    . ASN L 3 60  ? 8.648   -17.256 211.775 1.00 62.24  ? 61  ASN D CG    1 
ATOM   7626 O OD1   . ASN L 3 60  ? 9.223   -16.173 211.658 1.00 71.50  ? 61  ASN D OD1   1 
ATOM   7627 N ND2   . ASN L 3 60  ? 9.268   -18.361 212.196 1.00 60.69  ? 61  ASN D ND2   1 
ATOM   7628 N N     . ASP L 3 61  ? 4.114   -16.598 211.643 1.00 67.17  ? 62  ASP D N     1 
ATOM   7629 C CA    . ASP L 3 61  ? 2.730   -16.786 211.214 1.00 66.46  ? 62  ASP D CA    1 
ATOM   7630 C C     . ASP L 3 61  ? 2.133   -15.414 210.847 1.00 59.05  ? 62  ASP D C     1 
ATOM   7631 O O     . ASP L 3 61  ? 1.230   -15.307 210.030 1.00 58.24  ? 62  ASP D O     1 
ATOM   7632 C CB    . ASP L 3 61  ? 1.958   -17.468 212.368 1.00 75.13  ? 62  ASP D CB    1 
ATOM   7633 C CG    . ASP L 3 61  ? 0.507   -17.800 212.024 1.00 81.92  ? 62  ASP D CG    1 
ATOM   7634 O OD1   . ASP L 3 61  ? -0.324  -16.868 211.977 1.00 84.87  ? 62  ASP D OD1   1 
ATOM   7635 O OD2   . ASP L 3 61  ? 0.194   -18.996 211.820 1.00 88.45  ? 62  ASP D OD2   1 
ATOM   7636 N N     . LEU L 3 62  ? 2.676   -14.354 211.423 1.00 51.86  ? 63  LEU D N     1 
ATOM   7637 C CA    . LEU L 3 62  ? 2.160   -13.028 211.160 1.00 48.66  ? 63  LEU D CA    1 
ATOM   7638 C C     . LEU L 3 62  ? 2.562   -12.442 209.805 1.00 47.39  ? 63  LEU D C     1 
ATOM   7639 O O     . LEU L 3 62  ? 1.735   -11.873 209.090 1.00 43.66  ? 63  LEU D O     1 
ATOM   7640 C CB    . LEU L 3 62  ? 2.588   -12.098 212.282 1.00 46.08  ? 63  LEU D CB    1 
ATOM   7641 C CG    . LEU L 3 62  ? 1.918   -10.733 212.265 1.00 48.48  ? 63  LEU D CG    1 
ATOM   7642 C CD1   . LEU L 3 62  ? 0.456   -10.850 212.692 1.00 45.20  ? 63  LEU D CD1   1 
ATOM   7643 C CD2   . LEU L 3 62  ? 2.691   -9.826  213.205 1.00 56.59  ? 63  LEU D CD2   1 
ATOM   7644 N N     . PHE L 3 63  ? 3.834   -12.572 209.455 1.00 44.11  ? 64  PHE D N     1 
ATOM   7645 C CA    . PHE L 3 63  ? 4.335   -12.063 208.179 1.00 50.47  ? 64  PHE D CA    1 
ATOM   7646 C C     . PHE L 3 63  ? 3.999   -13.008 207.016 1.00 51.29  ? 64  PHE D C     1 
ATOM   7647 O O     . PHE L 3 63  ? 4.042   -12.612 205.855 1.00 45.55  ? 64  PHE D O     1 
ATOM   7648 C CB    . PHE L 3 63  ? 5.852   -11.871 208.252 1.00 55.62  ? 64  PHE D CB    1 
ATOM   7649 C CG    . PHE L 3 63  ? 6.305   -11.000 209.391 1.00 53.51  ? 64  PHE D CG    1 
ATOM   7650 C CD1   . PHE L 3 63  ? 5.399   -10.203 210.087 1.00 43.41  ? 64  PHE D CD1   1 
ATOM   7651 C CD2   . PHE L 3 63  ? 7.653   -10.934 209.729 1.00 49.17  ? 64  PHE D CD2   1 
ATOM   7652 C CE1   . PHE L 3 63  ? 5.827   -9.358  211.090 1.00 43.57  ? 64  PHE D CE1   1 
ATOM   7653 C CE2   . PHE L 3 63  ? 8.090   -10.087 210.738 1.00 52.93  ? 64  PHE D CE2   1 
ATOM   7654 C CZ    . PHE L 3 63  ? 7.173   -9.295  211.415 1.00 52.43  ? 64  PHE D CZ    1 
ATOM   7655 N N     . MET L 3 64  ? 3.690   -14.261 207.345 1.00 56.99  ? 65  MET D N     1 
ATOM   7656 C CA    . MET L 3 64  ? 3.328   -15.254 206.351 1.00 60.51  ? 65  MET D CA    1 
ATOM   7657 C C     . MET L 3 64  ? 1.880   -15.057 205.891 1.00 67.52  ? 65  MET D C     1 
ATOM   7658 O O     . MET L 3 64  ? 1.560   -15.208 204.705 1.00 70.19  ? 65  MET D O     1 
ATOM   7659 C CB    . MET L 3 64  ? 3.499   -16.653 206.912 1.00 57.99  ? 65  MET D CB    1 
ATOM   7660 C CG    . MET L 3 64  ? 4.912   -17.176 206.852 1.00 70.00  ? 65  MET D CG    1 
ATOM   7661 S SD    . MET L 3 64  ? 4.971   -18.904 207.416 1.00 94.51  ? 65  MET D SD    1 
ATOM   7662 C CE    . MET L 3 64  ? 3.756   -19.688 206.274 1.00 73.35  ? 65  MET D CE    1 
ATOM   7663 N N     . LYS L 3 65  ? 1.005   -14.726 206.832 1.00 68.43  ? 66  LYS D N     1 
ATOM   7664 C CA    . LYS L 3 65  ? -0.397  -14.477 206.523 1.00 73.34  ? 66  LYS D CA    1 
ATOM   7665 C C     . LYS L 3 65  ? -0.513  -13.154 205.765 1.00 73.35  ? 66  LYS D C     1 
ATOM   7666 O O     . LYS L 3 65  ? -1.596  -12.787 205.326 1.00 76.49  ? 66  LYS D O     1 
ATOM   7667 C CB    . LYS L 3 65  ? -1.240  -14.397 207.818 1.00 81.09  ? 66  LYS D CB    1 
ATOM   7668 C CG    . LYS L 3 65  ? -1.607  -15.747 208.479 1.00 81.22  ? 66  LYS D CG    1 
ATOM   7669 C CD    . LYS L 3 65  ? -2.372  -15.577 209.808 1.00 75.89  ? 66  LYS D CD    1 
ATOM   7670 C CE    . LYS L 3 65  ? -3.679  -14.786 209.646 1.00 83.79  ? 66  LYS D CE    1 
ATOM   7671 N NZ    . LYS L 3 65  ? -4.424  -14.559 210.937 1.00 75.63  ? 66  LYS D NZ    1 
ATOM   7672 N N     . ASN L 3 66  ? 0.605   -12.446 205.618 1.00 73.32  ? 67  ASN D N     1 
ATOM   7673 C CA    . ASN L 3 66  ? 0.632   -11.156 204.928 1.00 71.66  ? 67  ASN D CA    1 
ATOM   7674 C C     . ASN L 3 66  ? 1.875   -11.038 204.055 1.00 75.11  ? 67  ASN D C     1 
ATOM   7675 O O     . ASN L 3 66  ? 2.779   -10.242 204.329 1.00 69.23  ? 67  ASN D O     1 
ATOM   7676 C CB    . ASN L 3 66  ? 0.632   -10.045 205.953 1.00 72.90  ? 67  ASN D CB    1 
ATOM   7677 C CG    . ASN L 3 66  ? -0.516  -10.158 206.914 1.00 73.67  ? 67  ASN D CG    1 
ATOM   7678 O OD1   . ASN L 3 66  ? -1.621  -9.720  206.619 1.00 87.61  ? 67  ASN D OD1   1 
ATOM   7679 N ND2   . ASN L 3 66  ? -0.269  -10.761 208.069 1.00 68.43  ? 67  ASN D ND2   1 
ATOM   7680 N N     . PRO L 3 67  ? 1.926   -11.826 202.975 1.00 76.54  ? 68  PRO D N     1 
ATOM   7681 C CA    . PRO L 3 67  ? 3.045   -11.849 202.036 1.00 77.32  ? 68  PRO D CA    1 
ATOM   7682 C C     . PRO L 3 67  ? 3.249   -10.556 201.287 1.00 70.99  ? 68  PRO D C     1 
ATOM   7683 O O     . PRO L 3 67  ? 4.382   -10.115 201.106 1.00 74.09  ? 68  PRO D O     1 
ATOM   7684 C CB    . PRO L 3 67  ? 2.672   -12.977 201.102 1.00 81.59  ? 68  PRO D CB    1 
ATOM   7685 C CG    . PRO L 3 67  ? 1.189   -12.785 201.003 1.00 86.21  ? 68  PRO D CG    1 
ATOM   7686 C CD    . PRO L 3 67  ? 0.814   -12.640 202.460 1.00 75.02  ? 68  PRO D CD    1 
ATOM   7687 N N     . ALA L 3 68  ? 2.159   -9.947  200.837 1.00 68.90  ? 69  ALA D N     1 
ATOM   7688 C CA    . ALA L 3 68  ? 2.271   -8.695  200.088 1.00 74.11  ? 69  ALA D CA    1 
ATOM   7689 C C     . ALA L 3 68  ? 2.935   -7.586  200.904 1.00 74.66  ? 69  ALA D C     1 
ATOM   7690 O O     . ALA L 3 68  ? 3.417   -6.604  200.341 1.00 71.03  ? 69  ALA D O     1 
ATOM   7691 C CB    . ALA L 3 68  ? 0.895   -8.245  199.609 1.00 66.60  ? 69  ALA D CB    1 
ATOM   7692 N N     . ILE L 3 69  ? 2.970   -7.767  202.225 1.00 78.56  ? 70  ILE D N     1 
ATOM   7693 C CA    . ILE L 3 69  ? 3.548   -6.784  203.140 1.00 74.40  ? 70  ILE D CA    1 
ATOM   7694 C C     . ILE L 3 69  ? 5.042   -7.003  203.360 1.00 78.79  ? 70  ILE D C     1 
ATOM   7695 O O     . ILE L 3 69  ? 5.465   -7.924  204.076 1.00 76.65  ? 70  ILE D O     1 
ATOM   7696 C CB    . ILE L 3 69  ? 2.859   -6.827  204.511 1.00 73.86  ? 70  ILE D CB    1 
ATOM   7697 C CG1   . ILE L 3 69  ? 1.383   -7.252  204.359 1.00 69.02  ? 70  ILE D CG1   1 
ATOM   7698 C CG2   . ILE L 3 69  ? 3.036   -5.492  205.208 1.00 67.98  ? 70  ILE D CG2   1 
ATOM   7699 C CD1   . ILE L 3 69  ? 0.572   -6.489  203.345 1.00 65.51  ? 70  ILE D CD1   1 
ATOM   7700 N N     . ILE L 3 70  ? 5.829   -6.121  202.749 1.00 82.92  ? 71  ILE D N     1 
ATOM   7701 C CA    . ILE L 3 70  ? 7.291   -6.161  202.805 1.00 82.77  ? 71  ILE D CA    1 
ATOM   7702 C C     . ILE L 3 70  ? 7.873   -4.891  203.467 1.00 78.91  ? 71  ILE D C     1 
ATOM   7703 O O     . ILE L 3 70  ? 7.168   -3.882  203.627 1.00 73.29  ? 71  ILE D O     1 
ATOM   7704 C CB    . ILE L 3 70  ? 7.867   -6.316  201.367 1.00 84.55  ? 71  ILE D CB    1 
ATOM   7705 C CG1   . ILE L 3 70  ? 7.167   -7.483  200.656 1.00 76.92  ? 71  ILE D CG1   1 
ATOM   7706 C CG2   . ILE L 3 70  ? 9.371   -6.542  201.422 1.00 93.35  ? 71  ILE D CG2   1 
ATOM   7707 C CD1   . ILE L 3 70  ? 7.548   -7.669  199.200 1.00 82.64  ? 71  ILE D CD1   1 
ATOM   7708 N N     . GLY L 3 71  ? 9.156   -4.950  203.833 1.00 71.11  ? 72  GLY D N     1 
ATOM   7709 C CA    . GLY L 3 71  ? 9.808   -3.832  204.492 1.00 68.02  ? 72  GLY D CA    1 
ATOM   7710 C C     . GLY L 3 71  ? 9.413   -3.743  205.960 1.00 70.49  ? 72  GLY D C     1 
ATOM   7711 O O     . GLY L 3 71  ? 8.227   -3.817  206.309 1.00 67.87  ? 72  GLY D O     1 
ATOM   7712 N N     . HIS L 3 72  ? 10.397  -3.592  206.836 1.00 67.50  ? 73  HIS D N     1 
ATOM   7713 C CA    . HIS L 3 72  ? 10.104  -3.502  208.263 1.00 73.77  ? 73  HIS D CA    1 
ATOM   7714 C C     . HIS L 3 72  ? 8.945   -2.531  208.527 1.00 69.61  ? 73  HIS D C     1 
ATOM   7715 O O     . HIS L 3 72  ? 8.025   -2.841  209.288 1.00 72.69  ? 73  HIS D O     1 
ATOM   7716 C CB    . HIS L 3 72  ? 11.354  -3.059  209.027 1.00 75.41  ? 73  HIS D CB    1 
ATOM   7717 C CG    . HIS L 3 72  ? 11.879  -1.733  208.586 1.00 86.93  ? 73  HIS D CG    1 
ATOM   7718 N ND1   . HIS L 3 72  ? 11.921  -1.360  207.260 1.00 95.54  ? 73  HIS D ND1   1 
ATOM   7719 C CD2   . HIS L 3 72  ? 12.388  -0.693  209.286 1.00 92.71  ? 73  HIS D CD2   1 
ATOM   7720 C CE1   . HIS L 3 72  ? 12.435  -0.147  207.163 1.00 99.17  ? 73  HIS D CE1   1 
ATOM   7721 N NE2   . HIS L 3 72  ? 12.727  0.281   208.378 1.00 92.38  ? 73  HIS D NE2   1 
ATOM   7722 N N     . GLU L 3 73  ? 8.980   -1.373  207.878 1.00 58.28  ? 74  GLU D N     1 
ATOM   7723 C CA    . GLU L 3 73  ? 7.941   -0.372  208.063 1.00 56.27  ? 74  GLU D CA    1 
ATOM   7724 C C     . GLU L 3 73  ? 6.531   -0.939  207.944 1.00 57.04  ? 74  GLU D C     1 
ATOM   7725 O O     . GLU L 3 73  ? 5.717   -0.846  208.875 1.00 40.81  ? 74  GLU D O     1 
ATOM   7726 C CB    . GLU L 3 73  ? 8.114   0.753   207.042 1.00 64.49  ? 74  GLU D CB    1 
ATOM   7727 N N     . ALA L 3 74  ? 6.250   -1.521  206.781 1.00 56.57  ? 75  ALA D N     1 
ATOM   7728 C CA    . ALA L 3 74  ? 4.946   -2.103  206.477 1.00 53.98  ? 75  ALA D CA    1 
ATOM   7729 C C     . ALA L 3 74  ? 4.574   -3.260  207.398 1.00 56.07  ? 75  ALA D C     1 
ATOM   7730 O O     . ALA L 3 74  ? 3.429   -3.372  207.834 1.00 48.30  ? 75  ALA D O     1 
ATOM   7731 C CB    . ALA L 3 74  ? 4.936   -2.574  205.035 1.00 56.92  ? 75  ALA D CB    1 
ATOM   7732 N N     . ARG L 3 75  ? 5.550   -4.118  207.682 1.00 57.36  ? 76  ARG D N     1 
ATOM   7733 C CA    . ARG L 3 75  ? 5.316   -5.265  208.539 1.00 59.22  ? 76  ARG D CA    1 
ATOM   7734 C C     . ARG L 3 75  ? 4.971   -4.847  209.969 1.00 56.43  ? 76  ARG D C     1 
ATOM   7735 O O     . ARG L 3 75  ? 3.948   -5.273  210.503 1.00 49.24  ? 76  ARG D O     1 
ATOM   7736 C CB    . ARG L 3 75  ? 6.523   -6.232  208.490 1.00 57.68  ? 76  ARG D CB    1 
ATOM   7737 C CG    . ARG L 3 75  ? 6.550   -7.085  207.198 1.00 51.01  ? 76  ARG D CG    1 
ATOM   7738 C CD    . ARG L 3 75  ? 7.847   -7.856  206.961 1.00 50.67  ? 76  ARG D CD    1 
ATOM   7739 N NE    . ARG L 3 75  ? 7.863   -8.461  205.618 1.00 64.92  ? 76  ARG D NE    1 
ATOM   7740 C CZ    . ARG L 3 75  ? 8.936   -8.987  205.017 1.00 63.33  ? 76  ARG D CZ    1 
ATOM   7741 N NH1   . ARG L 3 75  ? 10.122  -9.006  205.618 1.00 53.15  ? 76  ARG D NH1   1 
ATOM   7742 N NH2   . ARG L 3 75  ? 8.826   -9.484  203.794 1.00 55.07  ? 76  ARG D NH2   1 
ATOM   7743 N N     . TYR L 3 76  ? 5.790   -4.005  210.591 1.00 53.16  ? 77  TYR D N     1 
ATOM   7744 C CA    . TYR L 3 76  ? 5.468   -3.572  211.950 1.00 57.19  ? 77  TYR D CA    1 
ATOM   7745 C C     . TYR L 3 76  ? 4.009   -3.141  212.054 1.00 64.23  ? 77  TYR D C     1 
ATOM   7746 O O     . TYR L 3 76  ? 3.476   -3.000  213.150 1.00 64.27  ? 77  TYR D O     1 
ATOM   7747 C CB    . TYR L 3 76  ? 6.335   -2.398  212.392 1.00 47.55  ? 77  TYR D CB    1 
ATOM   7748 C CG    . TYR L 3 76  ? 7.729   -2.784  212.755 1.00 47.53  ? 77  TYR D CG    1 
ATOM   7749 C CD1   . TYR L 3 76  ? 7.975   -3.906  213.535 1.00 52.49  ? 77  TYR D CD1   1 
ATOM   7750 C CD2   . TYR L 3 76  ? 8.799   -2.015  212.360 1.00 49.54  ? 77  TYR D CD2   1 
ATOM   7751 C CE1   . TYR L 3 76  ? 9.258   -4.256  213.921 1.00 44.66  ? 77  TYR D CE1   1 
ATOM   7752 C CE2   . TYR L 3 76  ? 10.093  -2.349  212.736 1.00 61.74  ? 77  TYR D CE2   1 
ATOM   7753 C CZ    . TYR L 3 76  ? 10.317  -3.474  213.522 1.00 59.86  ? 77  TYR D CZ    1 
ATOM   7754 O OH    . TYR L 3 76  ? 11.603  -3.806  213.917 1.00 61.12  ? 77  TYR D OH    1 
ATOM   7755 N N     . LYS L 3 77  ? 3.362   -2.919  210.917 1.00 70.30  ? 78  LYS D N     1 
ATOM   7756 C CA    . LYS L 3 77  ? 1.975   -2.504  210.946 1.00 76.40  ? 78  LYS D CA    1 
ATOM   7757 C C     . LYS L 3 77  ? 1.031   -3.670  211.195 1.00 83.41  ? 78  LYS D C     1 
ATOM   7758 O O     . LYS L 3 77  ? -0.114  -3.476  211.612 1.00 84.07  ? 78  LYS D O     1 
ATOM   7759 C CB    . LYS L 3 77  ? 1.612   -1.782  209.654 1.00 73.59  ? 78  LYS D CB    1 
ATOM   7760 C CG    . LYS L 3 77  ? 1.961   -0.313  209.704 1.00 84.91  ? 78  LYS D CG    1 
ATOM   7761 C CD    . LYS L 3 77  ? 1.233   0.368   210.863 1.00 93.84  ? 78  LYS D CD    1 
ATOM   7762 C CE    . LYS L 3 77  ? 1.623   1.842   210.986 1.00 104.59 ? 78  LYS D CE    1 
ATOM   7763 N NZ    . LYS L 3 77  ? 0.997   2.504   212.170 1.00 108.89 ? 78  LYS D NZ    1 
ATOM   7764 N N     . LEU L 3 78  ? 1.517   -4.884  210.965 1.00 85.15  ? 79  LEU D N     1 
ATOM   7765 C CA    . LEU L 3 78  ? 0.706   -6.081  211.171 1.00 88.40  ? 79  LEU D CA    1 
ATOM   7766 C C     . LEU L 3 78  ? 0.319   -6.205  212.651 1.00 91.60  ? 79  LEU D C     1 
ATOM   7767 O O     . LEU L 3 78  ? -0.644  -6.891  213.012 1.00 88.99  ? 79  LEU D O     1 
ATOM   7768 C CB    . LEU L 3 78  ? 1.491   -7.307  210.709 1.00 89.15  ? 79  LEU D CB    1 
ATOM   7769 C CG    . LEU L 3 78  ? 2.166   -7.154  209.340 1.00 86.34  ? 79  LEU D CG    1 
ATOM   7770 C CD1   . LEU L 3 78  ? 2.857   -8.459  208.994 1.00 88.58  ? 79  LEU D CD1   1 
ATOM   7771 C CD2   . LEU L 3 78  ? 1.149   -6.781  208.265 1.00 81.81  ? 79  LEU D CD2   1 
ATOM   7772 N N     . PHE L 3 79  ? 1.090   -5.522  213.491 1.00 91.61  ? 80  PHE D N     1 
ATOM   7773 C CA    . PHE L 3 79  ? 0.879   -5.474  214.934 1.00 93.03  ? 80  PHE D CA    1 
ATOM   7774 C C     . PHE L 3 79  ? -0.026  -4.273  215.216 1.00 98.54  ? 80  PHE D C     1 
ATOM   7775 O O     . PHE L 3 79  ? 0.466   -3.163  215.443 1.00 103.53 ? 80  PHE D O     1 
ATOM   7776 C CB    . PHE L 3 79  ? 2.219   -5.254  215.642 1.00 85.11  ? 80  PHE D CB    1 
ATOM   7777 C CG    . PHE L 3 79  ? 3.085   -6.469  215.709 1.00 74.51  ? 80  PHE D CG    1 
ATOM   7778 C CD1   . PHE L 3 79  ? 4.400   -6.436  215.254 1.00 68.35  ? 80  PHE D CD1   1 
ATOM   7779 C CD2   . PHE L 3 79  ? 2.604   -7.635  216.284 1.00 78.61  ? 80  PHE D CD2   1 
ATOM   7780 C CE1   . PHE L 3 79  ? 5.216   -7.544  215.378 1.00 55.30  ? 80  PHE D CE1   1 
ATOM   7781 C CE2   . PHE L 3 79  ? 3.410   -8.751  216.415 1.00 67.37  ? 80  PHE D CE2   1 
ATOM   7782 C CZ    . PHE L 3 79  ? 4.719   -8.702  215.960 1.00 68.22  ? 80  PHE D CZ    1 
ATOM   7783 N N     . ASN L 3 80  ? -1.338  -4.471  215.199 1.00 97.11  ? 81  ASN D N     1 
ATOM   7784 C CA    . ASN L 3 80  ? -2.239  -3.349  215.444 1.00 97.44  ? 81  ASN D CA    1 
ATOM   7785 C C     . ASN L 3 80  ? -2.164  -2.887  216.886 1.00 96.76  ? 81  ASN D C     1 
ATOM   7786 O O     . ASN L 3 80  ? -3.185  -2.624  217.515 1.00 100.61 ? 81  ASN D O     1 
ATOM   7787 C CB    . ASN L 3 80  ? -3.676  -3.728  215.090 1.00 97.76  ? 81  ASN D CB    1 
ATOM   7788 C CG    . ASN L 3 80  ? -4.102  -3.202  213.731 1.00 100.44 ? 81  ASN D CG    1 
ATOM   7789 O OD1   . ASN L 3 80  ? -3.438  -3.432  212.718 1.00 103.08 ? 81  ASN D OD1   1 
ATOM   7790 N ND2   . ASN L 3 80  ? -5.222  -2.492  213.702 1.00 103.67 ? 81  ASN D ND2   1 
ATOM   7791 N N     . SER L 3 81  ? -0.946  -2.770  217.401 1.00 92.95  ? 82  SER D N     1 
ATOM   7792 C CA    . SER L 3 81  ? -0.749  -2.358  218.778 1.00 89.04  ? 82  SER D CA    1 
ATOM   7793 C C     . SER L 3 81  ? 0.681   -1.936  219.057 1.00 83.12  ? 82  SER D C     1 
ATOM   7794 O O     . SER L 3 81  ? 1.574   -2.776  219.135 1.00 85.78  ? 82  SER D O     1 
ATOM   7795 C CB    . SER L 3 81  ? -1.113  -3.509  219.708 1.00 93.15  ? 82  SER D CB    1 
ATOM   7796 O OG    . SER L 3 81  ? -0.704  -3.221  221.031 1.00 104.42 ? 82  SER D OG    1 
ATOM   7797 N N     . PRO L 3 82  ? 0.916   -0.629  219.221 1.00 78.10  ? 83  PRO D N     1 
ATOM   7798 C CA    . PRO L 3 82  ? 2.261   -0.120  219.498 1.00 79.59  ? 83  PRO D CA    1 
ATOM   7799 C C     . PRO L 3 82  ? 2.911   -0.819  220.696 1.00 80.24  ? 83  PRO D C     1 
ATOM   7800 O O     . PRO L 3 82  ? 4.122   -1.078  220.699 1.00 76.50  ? 83  PRO D O     1 
ATOM   7801 C CB    . PRO L 3 82  ? 2.021   1.368   219.746 1.00 78.47  ? 83  PRO D CB    1 
ATOM   7802 C CG    . PRO L 3 82  ? 0.876   1.662   218.834 1.00 79.41  ? 83  PRO D CG    1 
ATOM   7803 C CD    . PRO L 3 82  ? -0.041  0.478   219.075 1.00 76.74  ? 83  PRO D CD    1 
ATOM   7804 N N     . THR L 3 83  ? 2.101   -1.117  221.711 1.00 80.73  ? 84  THR D N     1 
ATOM   7805 C CA    . THR L 3 83  ? 2.583   -1.798  222.913 1.00 85.20  ? 84  THR D CA    1 
ATOM   7806 C C     . THR L 3 83  ? 3.025   -3.230  222.577 1.00 83.43  ? 84  THR D C     1 
ATOM   7807 O O     . THR L 3 83  ? 4.168   -3.632  222.832 1.00 81.78  ? 84  THR D O     1 
ATOM   7808 C CB    . THR L 3 83  ? 1.480   -1.831  224.007 1.00 86.68  ? 84  THR D CB    1 
ATOM   7809 O OG1   . THR L 3 83  ? 1.380   -0.537  224.613 1.00 82.87  ? 84  THR D OG1   1 
ATOM   7810 C CG2   . THR L 3 83  ? 1.796   -2.876  225.080 1.00 84.17  ? 84  THR D CG2   1 
ATOM   7811 N N     . LEU L 3 84  ? 2.101   -3.986  221.996 1.00 77.57  ? 85  LEU D N     1 
ATOM   7812 C CA    . LEU L 3 84  ? 2.354   -5.357  221.596 1.00 68.00  ? 85  LEU D CA    1 
ATOM   7813 C C     . LEU L 3 84  ? 3.636   -5.386  220.783 1.00 63.22  ? 85  LEU D C     1 
ATOM   7814 O O     . LEU L 3 84  ? 4.558   -6.143  221.085 1.00 59.28  ? 85  LEU D O     1 
ATOM   7815 C CB    . LEU L 3 84  ? 1.196   -5.855  220.744 1.00 75.42  ? 85  LEU D CB    1 
ATOM   7816 C CG    . LEU L 3 84  ? 0.980   -7.361  220.726 1.00 82.23  ? 85  LEU D CG    1 
ATOM   7817 C CD1   . LEU L 3 84  ? 0.681   -7.843  222.137 1.00 85.96  ? 85  LEU D CD1   1 
ATOM   7818 C CD2   . LEU L 3 84  ? -0.174  -7.691  219.789 1.00 82.23  ? 85  LEU D CD2   1 
ATOM   7819 N N     . LEU L 3 85  ? 3.690   -4.552  219.750 1.00 55.50  ? 86  LEU D N     1 
ATOM   7820 C CA    . LEU L 3 85  ? 4.875   -4.486  218.908 1.00 58.93  ? 86  LEU D CA    1 
ATOM   7821 C C     . LEU L 3 85  ? 6.107   -4.260  219.778 1.00 60.02  ? 86  LEU D C     1 
ATOM   7822 O O     . LEU L 3 85  ? 7.203   -4.703  219.438 1.00 61.88  ? 86  LEU D O     1 
ATOM   7823 C CB    . LEU L 3 85  ? 4.748   -3.350  217.880 1.00 56.31  ? 86  LEU D CB    1 
ATOM   7824 C CG    . LEU L 3 85  ? 5.820   -3.151  216.787 1.00 50.12  ? 86  LEU D CG    1 
ATOM   7825 C CD1   . LEU L 3 85  ? 5.105   -2.741  215.527 1.00 52.23  ? 86  LEU D CD1   1 
ATOM   7826 C CD2   . LEU L 3 85  ? 6.887   -2.104  217.168 1.00 32.79  ? 86  LEU D CD2   1 
ATOM   7827 N N     . PHE L 3 86  ? 5.932   -3.573  220.904 1.00 55.21  ? 87  PHE D N     1 
ATOM   7828 C CA    . PHE L 3 86  ? 7.060   -3.313  221.789 1.00 48.79  ? 87  PHE D CA    1 
ATOM   7829 C C     . PHE L 3 86  ? 7.529   -4.581  222.479 1.00 48.46  ? 87  PHE D C     1 
ATOM   7830 O O     . PHE L 3 86  ? 8.708   -4.731  222.829 1.00 43.28  ? 87  PHE D O     1 
ATOM   7831 C CB    . PHE L 3 86  ? 6.685   -2.261  222.823 1.00 43.99  ? 87  PHE D CB    1 
ATOM   7832 C CG    . PHE L 3 86  ? 7.690   -2.111  223.920 1.00 50.00  ? 87  PHE D CG    1 
ATOM   7833 C CD1   . PHE L 3 86  ? 9.043   -1.942  223.633 1.00 56.78  ? 87  PHE D CD1   1 
ATOM   7834 C CD2   . PHE L 3 86  ? 7.287   -2.136  225.248 1.00 58.32  ? 87  PHE D CD2   1 
ATOM   7835 C CE1   . PHE L 3 86  ? 9.986   -1.801  224.661 1.00 55.91  ? 87  PHE D CE1   1 
ATOM   7836 C CE2   . PHE L 3 86  ? 8.217   -1.996  226.284 1.00 63.03  ? 87  PHE D CE2   1 
ATOM   7837 C CZ    . PHE L 3 86  ? 9.569   -1.828  225.988 1.00 61.99  ? 87  PHE D CZ    1 
ATOM   7838 N N     . LEU L 3 87  ? 6.603   -5.511  222.658 1.00 49.66  ? 88  LEU D N     1 
ATOM   7839 C CA    . LEU L 3 87  ? 6.935   -6.766  223.311 1.00 51.02  ? 88  LEU D CA    1 
ATOM   7840 C C     . LEU L 3 87  ? 7.337   -7.897  222.369 1.00 57.79  ? 88  LEU D C     1 
ATOM   7841 O O     . LEU L 3 87  ? 8.267   -8.645  222.684 1.00 57.98  ? 88  LEU D O     1 
ATOM   7842 C CB    . LEU L 3 87  ? 5.760   -7.226  224.179 1.00 42.83  ? 88  LEU D CB    1 
ATOM   7843 C CG    . LEU L 3 87  ? 5.599   -6.780  225.641 1.00 32.24  ? 88  LEU D CG    1 
ATOM   7844 C CD1   . LEU L 3 87  ? 6.612   -5.723  226.026 1.00 44.54  ? 88  LEU D CD1   1 
ATOM   7845 C CD2   . LEU L 3 87  ? 4.193   -6.268  225.817 1.00 24.80  ? 88  LEU D CD2   1 
ATOM   7846 N N     . LEU L 3 88  ? 6.675   -8.000  221.210 1.00 56.80  ? 89  LEU D N     1 
ATOM   7847 C CA    . LEU L 3 88  ? 6.936   -9.105  220.275 1.00 54.06  ? 89  LEU D CA    1 
ATOM   7848 C C     . LEU L 3 88  ? 7.751   -8.856  219.004 1.00 57.25  ? 89  LEU D C     1 
ATOM   7849 O O     . LEU L 3 88  ? 8.060   -9.814  218.291 1.00 61.17  ? 89  LEU D O     1 
ATOM   7850 C CB    . LEU L 3 88  ? 5.605   -9.755  219.882 1.00 47.68  ? 89  LEU D CB    1 
ATOM   7851 C CG    . LEU L 3 88  ? 4.565   -9.892  221.005 1.00 52.78  ? 89  LEU D CG    1 
ATOM   7852 C CD1   . LEU L 3 88  ? 3.232   -10.412 220.474 1.00 44.91  ? 89  LEU D CD1   1 
ATOM   7853 C CD2   . LEU L 3 88  ? 5.124   -10.797 222.069 1.00 42.61  ? 89  LEU D CD2   1 
ATOM   7854 N N     . SER L 3 89  ? 8.092   -7.599  218.715 1.00 57.73  ? 90  SER D N     1 
ATOM   7855 C CA    . SER L 3 89  ? 8.884   -7.254  217.524 1.00 52.73  ? 90  SER D CA    1 
ATOM   7856 C C     . SER L 3 89  ? 10.243  -7.914  217.543 1.00 50.28  ? 90  SER D C     1 
ATOM   7857 O O     . SER L 3 89  ? 10.693  -8.377  218.584 1.00 46.27  ? 90  SER D O     1 
ATOM   7858 C CB    . SER L 3 89  ? 9.102   -5.749  217.429 1.00 53.80  ? 90  SER D CB    1 
ATOM   7859 O OG    . SER L 3 89  ? 8.023   -5.131  216.779 1.00 63.26  ? 90  SER D OG    1 
ATOM   7860 N N     . ARG L 3 90  ? 10.926  -7.916  216.405 1.00 47.37  ? 91  ARG D N     1 
ATOM   7861 C CA    . ARG L 3 90  ? 12.224  -8.561  216.373 1.00 52.09  ? 91  ARG D CA    1 
ATOM   7862 C C     . ARG L 3 90  ? 13.308  -7.772  215.641 1.00 52.71  ? 91  ARG D C     1 
ATOM   7863 O O     . ARG L 3 90  ? 13.902  -8.280  214.707 1.00 71.78  ? 91  ARG D O     1 
ATOM   7864 C CB    . ARG L 3 90  ? 12.062  -9.950  215.744 1.00 48.92  ? 91  ARG D CB    1 
ATOM   7865 C CG    . ARG L 3 90  ? 13.149  -10.963 216.087 1.00 50.60  ? 91  ARG D CG    1 
ATOM   7866 C CD    . ARG L 3 90  ? 13.179  -11.269 217.572 1.00 52.75  ? 91  ARG D CD    1 
ATOM   7867 N NE    . ARG L 3 90  ? 13.859  -12.528 217.844 1.00 47.44  ? 91  ARG D NE    1 
ATOM   7868 C CZ    . ARG L 3 90  ? 13.455  -13.695 217.365 1.00 49.54  ? 91  ARG D CZ    1 
ATOM   7869 N NH1   . ARG L 3 90  ? 12.385  -13.756 216.596 1.00 55.76  ? 91  ARG D NH1   1 
ATOM   7870 N NH2   . ARG L 3 90  ? 14.112  -14.804 217.655 1.00 64.62  ? 91  ARG D NH2   1 
ATOM   7871 N N     . GLY L 3 91  ? 13.590  -6.545  216.059 1.00 50.22  ? 92  GLY D N     1 
ATOM   7872 C CA    . GLY L 3 91  ? 14.610  -5.775  215.359 1.00 55.67  ? 92  GLY D CA    1 
ATOM   7873 C C     . GLY L 3 91  ? 14.180  -5.238  213.993 1.00 56.23  ? 92  GLY D C     1 
ATOM   7874 O O     . GLY L 3 91  ? 13.495  -5.913  213.228 1.00 53.71  ? 92  GLY D O     1 
ATOM   7875 N N     . LYS L 3 92  ? 14.595  -4.013  213.688 1.00 58.73  ? 93  LYS D N     1 
ATOM   7876 C CA    . LYS L 3 92  ? 14.260  -3.360  212.431 1.00 58.58  ? 93  LYS D CA    1 
ATOM   7877 C C     . LYS L 3 92  ? 14.909  -4.063  211.241 1.00 57.34  ? 93  LYS D C     1 
ATOM   7878 O O     . LYS L 3 92  ? 14.285  -4.223  210.196 1.00 52.56  ? 93  LYS D O     1 
ATOM   7879 C CB    . LYS L 3 92  ? 14.674  -1.879  212.488 1.00 61.62  ? 93  LYS D CB    1 
ATOM   7880 C CG    . LYS L 3 92  ? 14.975  -1.230  211.127 1.00 78.33  ? 93  LYS D CG    1 
ATOM   7881 C CD    . LYS L 3 92  ? 15.517  0.207   211.258 1.00 80.69  ? 93  LYS D CD    1 
ATOM   7882 C CE    . LYS L 3 92  ? 16.141  0.742   209.945 1.00 79.41  ? 93  LYS D CE    1 
ATOM   7883 N NZ    . LYS L 3 92  ? 17.474  0.160   209.539 1.00 56.62  ? 93  LYS D NZ    1 
ATOM   7884 N N     . ALA L 3 93  ? 16.154  -4.495  211.393 1.00 54.05  ? 94  ALA D N     1 
ATOM   7885 C CA    . ALA L 3 93  ? 16.821  -5.177  210.292 1.00 56.92  ? 94  ALA D CA    1 
ATOM   7886 C C     . ALA L 3 93  ? 16.147  -6.516  210.023 1.00 60.57  ? 94  ALA D C     1 
ATOM   7887 O O     . ALA L 3 93  ? 15.689  -6.770  208.920 1.00 60.51  ? 94  ALA D O     1 
ATOM   7888 C CB    . ALA L 3 93  ? 18.298  -5.387  210.606 1.00 46.52  ? 94  ALA D CB    1 
ATOM   7889 N N     . ALA L 3 94  ? 16.065  -7.363  211.043 1.00 65.00  ? 95  ALA D N     1 
ATOM   7890 C CA    . ALA L 3 94  ? 15.455  -8.681  210.884 1.00 71.34  ? 95  ALA D CA    1 
ATOM   7891 C C     . ALA L 3 94  ? 14.092  -8.675  210.173 1.00 64.21  ? 95  ALA D C     1 
ATOM   7892 O O     . ALA L 3 94  ? 13.838  -9.478  209.271 1.00 60.44  ? 95  ALA D O     1 
ATOM   7893 C CB    . ALA L 3 94  ? 15.330  -9.359  212.246 1.00 83.23  ? 95  ALA D CB    1 
ATOM   7894 N N     . THR L 3 95  ? 13.215  -7.779  210.598 1.00 56.49  ? 96  THR D N     1 
ATOM   7895 C CA    . THR L 3 95  ? 11.887  -7.659  210.013 1.00 50.31  ? 96  THR D CA    1 
ATOM   7896 C C     . THR L 3 95  ? 11.995  -7.420  208.496 1.00 52.11  ? 96  THR D C     1 
ATOM   7897 O O     . THR L 3 95  ? 11.106  -7.786  207.706 1.00 36.42  ? 96  THR D O     1 
ATOM   7898 C CB    . THR L 3 95  ? 11.140  -6.496  210.685 1.00 32.35  ? 96  THR D CB    1 
ATOM   7899 O OG1   . THR L 3 95  ? 11.151  -6.701  212.097 1.00 33.26  ? 96  THR D OG1   1 
ATOM   7900 C CG2   . THR L 3 95  ? 9.732   -6.436  210.227 1.00 28.33  ? 96  THR D CG2   1 
ATOM   7901 N N     . GLU L 3 96  ? 13.110  -6.814  208.106 1.00 50.42  ? 97  GLU D N     1 
ATOM   7902 C CA    . GLU L 3 96  ? 13.385  -6.494  206.714 1.00 57.12  ? 97  GLU D CA    1 
ATOM   7903 C C     . GLU L 3 96  ? 13.855  -7.734  205.955 1.00 59.22  ? 97  GLU D C     1 
ATOM   7904 O O     . GLU L 3 96  ? 13.260  -8.142  204.946 1.00 64.84  ? 97  GLU D O     1 
ATOM   7905 C CB    . GLU L 3 96  ? 14.470  -5.417  206.643 1.00 58.91  ? 97  GLU D CB    1 
ATOM   7906 C CG    . GLU L 3 96  ? 14.650  -4.848  205.272 1.00 53.31  ? 97  GLU D CG    1 
ATOM   7907 C CD    . GLU L 3 96  ? 13.378  -4.228  204.775 1.00 62.04  ? 97  GLU D CD    1 
ATOM   7908 O OE1   . GLU L 3 96  ? 13.215  -4.128  203.538 1.00 68.91  ? 97  GLU D OE1   1 
ATOM   7909 O OE2   . GLU L 3 96  ? 12.541  -3.839  205.625 1.00 56.22  ? 97  GLU D OE2   1 
ATOM   7910 N N     . ASN L 3 97  ? 14.938  -8.314  206.454 1.00 54.73  ? 98  ASN D N     1 
ATOM   7911 C CA    . ASN L 3 97  ? 15.517  -9.498  205.871 1.00 57.95  ? 98  ASN D CA    1 
ATOM   7912 C C     . ASN L 3 97  ? 14.714  -10.743 206.215 1.00 60.08  ? 98  ASN D C     1 
ATOM   7913 O O     . ASN L 3 97  ? 15.253  -11.841 206.245 1.00 59.44  ? 98  ASN D O     1 
ATOM   7914 C CB    . ASN L 3 97  ? 16.930  -9.691  206.377 1.00 66.52  ? 98  ASN D CB    1 
ATOM   7915 C CG    . ASN L 3 97  ? 17.704  -8.427  206.381 1.00 72.91  ? 98  ASN D CG    1 
ATOM   7916 O OD1   . ASN L 3 97  ? 17.781  -7.745  205.363 1.00 76.98  ? 98  ASN D OD1   1 
ATOM   7917 N ND2   . ASN L 3 97  ? 18.288  -8.088  207.534 1.00 78.09  ? 98  ASN D ND2   1 
ATOM   7918 N N     . TRP L 3 98  ? 13.436  -10.577 206.505 1.00 57.95  ? 99  TRP D N     1 
ATOM   7919 C CA    . TRP L 3 98  ? 12.621  -11.731 206.790 1.00 58.07  ? 99  TRP D CA    1 
ATOM   7920 C C     . TRP L 3 98  ? 11.916  -12.096 205.495 1.00 63.23  ? 99  TRP D C     1 
ATOM   7921 O O     . TRP L 3 98  ? 11.418  -11.202 204.784 1.00 57.99  ? 99  TRP D O     1 
ATOM   7922 C CB    . TRP L 3 98  ? 11.573  -11.422 207.842 1.00 57.70  ? 99  TRP D CB    1 
ATOM   7923 C CG    . TRP L 3 98  ? 10.648  -12.578 208.099 1.00 54.86  ? 99  TRP D CG    1 
ATOM   7924 C CD1   . TRP L 3 98  ? 10.742  -13.485 209.108 1.00 49.66  ? 99  TRP D CD1   1 
ATOM   7925 C CD2   . TRP L 3 98  ? 9.472   -12.931 207.349 1.00 63.34  ? 99  TRP D CD2   1 
ATOM   7926 N NE1   . TRP L 3 98  ? 9.697   -14.378 209.044 1.00 63.15  ? 99  TRP D NE1   1 
ATOM   7927 C CE2   . TRP L 3 98  ? 8.903   -14.061 207.973 1.00 67.09  ? 99  TRP D CE2   1 
ATOM   7928 C CE3   . TRP L 3 98  ? 8.846   -12.402 206.212 1.00 66.19  ? 99  TRP D CE3   1 
ATOM   7929 C CZ2   . TRP L 3 98  ? 7.735   -14.672 207.500 1.00 67.88  ? 99  TRP D CZ2   1 
ATOM   7930 C CZ3   . TRP L 3 98  ? 7.684   -13.015 205.741 1.00 70.76  ? 99  TRP D CZ3   1 
ATOM   7931 C CH2   . TRP L 3 98  ? 7.145   -14.136 206.387 1.00 67.72  ? 99  TRP D CH2   1 
ATOM   7932 N N     . SER L 3 99  ? 11.885  -13.407 205.210 1.00 62.04  ? 100 SER D N     1 
ATOM   7933 C CA    . SER L 3 99  ? 11.244  -14.005 204.021 1.00 57.30  ? 100 SER D CA    1 
ATOM   7934 C C     . SER L 3 99  ? 10.603  -15.319 204.422 1.00 58.72  ? 100 SER D C     1 
ATOM   7935 O O     . SER L 3 99  ? 10.915  -15.874 205.470 1.00 62.14  ? 100 SER D O     1 
ATOM   7936 C CB    . SER L 3 99  ? 12.281  -14.317 202.940 1.00 36.20  ? 100 SER D CB    1 
ATOM   7937 N N     . ILE L 3 100 ? 9.697   -15.806 203.587 1.00 59.46  ? 101 ILE D N     1 
ATOM   7938 C CA    . ILE L 3 100 ? 9.069   -17.092 203.837 1.00 58.68  ? 101 ILE D CA    1 
ATOM   7939 C C     . ILE L 3 100 ? 10.195  -18.105 203.642 1.00 66.20  ? 101 ILE D C     1 
ATOM   7940 O O     . ILE L 3 100 ? 10.113  -19.262 204.076 1.00 69.10  ? 101 ILE D O     1 
ATOM   7941 C CB    . ILE L 3 100 ? 7.959   -17.395 202.822 1.00 55.88  ? 101 ILE D CB    1 
ATOM   7942 C CG1   . ILE L 3 100 ? 8.511   -17.289 201.395 1.00 54.09  ? 101 ILE D CG1   1 
ATOM   7943 C CG2   . ILE L 3 100 ? 6.799   -16.439 203.039 1.00 63.63  ? 101 ILE D CG2   1 
ATOM   7944 C CD1   . ILE L 3 100 ? 7.478   -17.528 200.299 1.00 49.00  ? 101 ILE D CD1   1 
ATOM   7945 N N     . GLU L 3 101 ? 11.254  -17.653 202.979 1.00 65.41  ? 102 GLU D N     1 
ATOM   7946 C CA    . GLU L 3 101 ? 12.407  -18.497 202.723 1.00 71.71  ? 102 GLU D CA    1 
ATOM   7947 C C     . GLU L 3 101 ? 13.507  -18.181 203.720 1.00 78.19  ? 102 GLU D C     1 
ATOM   7948 O O     . GLU L 3 101 ? 14.615  -18.720 203.644 1.00 82.39  ? 102 GLU D O     1 
ATOM   7949 C CB    . GLU L 3 101 ? 12.911  -18.292 201.300 1.00 74.58  ? 102 GLU D CB    1 
ATOM   7950 C CG    . GLU L 3 101 ? 14.155  -19.084 200.980 1.00 77.08  ? 102 GLU D CG    1 
ATOM   7951 C CD    . GLU L 3 101 ? 14.064  -20.500 201.501 1.00 86.45  ? 102 GLU D CD    1 
ATOM   7952 O OE1   . GLU L 3 101 ? 13.019  -21.149 201.268 1.00 96.13  ? 102 GLU D OE1   1 
ATOM   7953 O OE2   . GLU L 3 101 ? 15.033  -20.967 202.139 1.00 84.94  ? 102 GLU D OE2   1 
ATOM   7954 N N     . ASN L 3 102 ? 13.193  -17.285 204.651 1.00 82.17  ? 103 ASN D N     1 
ATOM   7955 C CA    . ASN L 3 102 ? 14.124  -16.904 205.710 1.00 78.37  ? 103 ASN D CA    1 
ATOM   7956 C C     . ASN L 3 102 ? 13.368  -16.604 206.999 1.00 71.05  ? 103 ASN D C     1 
ATOM   7957 O O     . ASN L 3 102 ? 13.423  -15.489 207.495 1.00 67.93  ? 103 ASN D O     1 
ATOM   7958 C CB    . ASN L 3 102 ? 14.928  -15.667 205.326 1.00 78.86  ? 103 ASN D CB    1 
ATOM   7959 C CG    . ASN L 3 102 ? 15.847  -15.226 206.436 1.00 72.28  ? 103 ASN D CG    1 
ATOM   7960 O OD1   . ASN L 3 102 ? 16.806  -15.911 206.768 1.00 81.22  ? 103 ASN D OD1   1 
ATOM   7961 N ND2   . ASN L 3 102 ? 15.541  -14.094 207.039 1.00 83.53  ? 103 ASN D ND2   1 
ATOM   7962 N N     . LEU L 3 103 ? 12.675  -17.604 207.536 1.00 69.22  ? 104 LEU D N     1 
ATOM   7963 C CA    . LEU L 3 103 ? 11.898  -17.454 208.766 1.00 64.81  ? 104 LEU D CA    1 
ATOM   7964 C C     . LEU L 3 103 ? 12.733  -17.142 210.016 1.00 58.30  ? 104 LEU D C     1 
ATOM   7965 O O     . LEU L 3 103 ? 13.946  -17.383 210.049 1.00 41.78  ? 104 LEU D O     1 
ATOM   7966 C CB    . LEU L 3 103 ? 11.061  -18.719 209.026 1.00 64.52  ? 104 LEU D CB    1 
ATOM   7967 C CG    . LEU L 3 103 ? 9.896   -19.021 208.088 1.00 66.90  ? 104 LEU D CG    1 
ATOM   7968 C CD1   . LEU L 3 103 ? 9.264   -20.353 208.455 1.00 78.32  ? 104 LEU D CD1   1 
ATOM   7969 C CD2   . LEU L 3 103 ? 8.856   -17.916 208.187 1.00 74.87  ? 104 LEU D CD2   1 
ATOM   7970 N N     . PHE L 3 104 ? 12.056  -16.613 211.040 1.00 52.22  ? 105 PHE D N     1 
ATOM   7971 C CA    . PHE L 3 104 ? 12.682  -16.256 212.317 1.00 56.30  ? 105 PHE D CA    1 
ATOM   7972 C C     . PHE L 3 104 ? 13.067  -17.489 213.130 1.00 59.93  ? 105 PHE D C     1 
ATOM   7973 O O     . PHE L 3 104 ? 12.474  -18.565 212.990 1.00 56.26  ? 105 PHE D O     1 
ATOM   7974 C CB    . PHE L 3 104 ? 11.724  -15.427 213.191 1.00 41.44  ? 105 PHE D CB    1 
ATOM   7975 C CG    . PHE L 3 104 ? 11.647  -13.985 212.830 1.00 43.07  ? 105 PHE D CG    1 
ATOM   7976 C CD1   . PHE L 3 104 ? 10.394  -13.346 212.755 1.00 39.01  ? 105 PHE D CD1   1 
ATOM   7977 C CD2   . PHE L 3 104 ? 12.811  -13.263 212.537 1.00 38.16  ? 105 PHE D CD2   1 
ATOM   7978 C CE1   . PHE L 3 104 ? 10.298  -12.004 212.382 1.00 38.42  ? 105 PHE D CE1   1 
ATOM   7979 C CE2   . PHE L 3 104 ? 12.748  -11.916 212.161 1.00 38.96  ? 105 PHE D CE2   1 
ATOM   7980 C CZ    . PHE L 3 104 ? 11.487  -11.272 212.078 1.00 46.63  ? 105 PHE D CZ    1 
ATOM   7981 N N     . GLU L 3 105 ? 14.054  -17.315 213.997 1.00 61.12  ? 106 GLU D N     1 
ATOM   7982 C CA    . GLU L 3 105 ? 14.463  -18.390 214.875 1.00 71.15  ? 106 GLU D CA    1 
ATOM   7983 C C     . GLU L 3 105 ? 14.204  -17.907 216.299 1.00 73.22  ? 106 GLU D C     1 
ATOM   7984 O O     . GLU L 3 105 ? 13.395  -17.005 216.523 1.00 71.44  ? 106 GLU D O     1 
ATOM   7985 C CB    . GLU L 3 105 ? 15.939  -18.724 214.686 1.00 74.58  ? 106 GLU D CB    1 
ATOM   7986 C CG    . GLU L 3 105 ? 16.256  -19.203 213.296 1.00 86.97  ? 106 GLU D CG    1 
ATOM   7987 C CD    . GLU L 3 105 ? 17.567  -19.938 213.237 1.00 102.24 ? 106 GLU D CD    1 
ATOM   7988 O OE1   . GLU L 3 105 ? 18.484  -19.570 214.012 1.00 111.26 ? 106 GLU D OE1   1 
ATOM   7989 O OE2   . GLU L 3 105 ? 17.684  -20.872 212.410 1.00 109.87 ? 106 GLU D OE2   1 
ATOM   7990 N N     . GLU L 3 106 ? 14.873  -18.502 217.271 1.00 70.10  ? 107 GLU D N     1 
ATOM   7991 C CA    . GLU L 3 106 ? 14.662  -18.055 218.617 1.00 67.76  ? 107 GLU D CA    1 
ATOM   7992 C C     . GLU L 3 106 ? 15.766  -17.051 218.908 1.00 64.65  ? 107 GLU D C     1 
ATOM   7993 O O     . GLU L 3 106 ? 16.784  -17.055 218.225 1.00 60.14  ? 107 GLU D O     1 
ATOM   7994 C CB    . GLU L 3 106 ? 14.699  -19.247 219.573 1.00 79.71  ? 107 GLU D CB    1 
ATOM   7995 C CG    . GLU L 3 106 ? 14.227  -18.907 220.982 1.00 102.12 ? 107 GLU D CG    1 
ATOM   7996 C CD    . GLU L 3 106 ? 13.813  -20.129 221.786 1.00 111.74 ? 107 GLU D CD    1 
ATOM   7997 O OE1   . GLU L 3 106 ? 13.401  -19.948 222.956 1.00 111.97 ? 107 GLU D OE1   1 
ATOM   7998 O OE2   . GLU L 3 106 ? 13.895  -21.262 221.251 1.00 119.24 ? 107 GLU D OE2   1 
ATOM   7999 N N     . LYS L 3 107 ? 15.533  -16.180 219.896 1.00 69.12  ? 108 LYS D N     1 
ATOM   8000 C CA    . LYS L 3 107 ? 16.470  -15.125 220.342 1.00 61.69  ? 108 LYS D CA    1 
ATOM   8001 C C     . LYS L 3 107 ? 16.315  -14.936 221.875 1.00 61.87  ? 108 LYS D C     1 
ATOM   8002 O O     . LYS L 3 107 ? 15.194  -14.954 222.377 1.00 52.83  ? 108 LYS D O     1 
ATOM   8003 C CB    . LYS L 3 107 ? 16.144  -13.801 219.630 1.00 47.44  ? 108 LYS D CB    1 
ATOM   8004 C CG    . LYS L 3 107 ? 17.118  -12.683 219.933 1.00 54.84  ? 108 LYS D CG    1 
ATOM   8005 C CD    . LYS L 3 107 ? 16.691  -11.370 219.321 1.00 63.80  ? 108 LYS D CD    1 
ATOM   8006 C CE    . LYS L 3 107 ? 17.634  -10.225 219.740 1.00 79.39  ? 108 LYS D CE    1 
ATOM   8007 N NZ    . LYS L 3 107 ? 17.166  -8.847  219.324 1.00 70.77  ? 108 LYS D NZ    1 
ATOM   8008 N N     . GLN L 3 108 ? 17.421  -14.762 222.609 1.00 63.44  ? 109 GLN D N     1 
ATOM   8009 C CA    . GLN L 3 108 ? 17.358  -14.580 224.069 1.00 62.33  ? 109 GLN D CA    1 
ATOM   8010 C C     . GLN L 3 108 ? 16.388  -13.467 224.447 1.00 69.14  ? 109 GLN D C     1 
ATOM   8011 O O     . GLN L 3 108 ? 15.485  -13.662 225.258 1.00 68.59  ? 109 GLN D O     1 
ATOM   8012 C CB    . GLN L 3 108 ? 18.731  -14.243 224.656 1.00 59.62  ? 109 GLN D CB    1 
ATOM   8013 C CG    . GLN L 3 108 ? 19.790  -15.317 224.517 1.00 65.93  ? 109 GLN D CG    1 
ATOM   8014 C CD    . GLN L 3 108 ? 21.062  -14.983 225.293 1.00 74.52  ? 109 GLN D CD    1 
ATOM   8015 O OE1   . GLN L 3 108 ? 21.011  -14.697 226.491 1.00 80.34  ? 109 GLN D OE1   1 
ATOM   8016 N NE2   . GLN L 3 108 ? 22.208  -15.016 224.613 1.00 76.22  ? 109 GLN D NE2   1 
ATOM   8017 N N     . ASN L 3 109 ? 16.586  -12.293 223.864 1.00 69.18  ? 110 ASN D N     1 
ATOM   8018 C CA    . ASN L 3 109 ? 15.710  -11.171 224.128 1.00 67.78  ? 110 ASN D CA    1 
ATOM   8019 C C     . ASN L 3 109 ? 14.251  -11.568 224.210 1.00 68.37  ? 110 ASN D C     1 
ATOM   8020 O O     . ASN L 3 109 ? 13.541  -11.105 225.087 1.00 74.64  ? 110 ASN D O     1 
ATOM   8021 C CB    . ASN L 3 109 ? 15.852  -10.140 223.025 1.00 74.35  ? 110 ASN D CB    1 
ATOM   8022 C CG    . ASN L 3 109 ? 16.929  -9.157  223.305 1.00 83.67  ? 110 ASN D CG    1 
ATOM   8023 O OD1   . ASN L 3 109 ? 17.303  -8.361  222.440 1.00 84.64  ? 110 ASN D OD1   1 
ATOM   8024 N ND2   . ASN L 3 109 ? 17.444  -9.188  224.529 1.00 95.41  ? 110 ASN D ND2   1 
ATOM   8025 N N     . ASP L 3 110 ? 13.806  -12.412 223.279 1.00 71.40  ? 111 ASP D N     1 
ATOM   8026 C CA    . ASP L 3 110 ? 12.409  -12.842 223.222 1.00 69.11  ? 111 ASP D CA    1 
ATOM   8027 C C     . ASP L 3 110 ? 11.726  -12.752 224.559 1.00 63.71  ? 111 ASP D C     1 
ATOM   8028 O O     . ASP L 3 110 ? 12.050  -13.491 225.482 1.00 66.26  ? 111 ASP D O     1 
ATOM   8029 C CB    . ASP L 3 110 ? 12.272  -14.274 222.717 1.00 78.79  ? 111 ASP D CB    1 
ATOM   8030 C CG    . ASP L 3 110 ? 12.617  -14.419 221.254 1.00 77.81  ? 111 ASP D CG    1 
ATOM   8031 O OD1   . ASP L 3 110 ? 12.580  -13.406 220.520 1.00 71.40  ? 111 ASP D OD1   1 
ATOM   8032 O OD2   . ASP L 3 110 ? 12.913  -15.565 220.852 1.00 83.40  ? 111 ASP D OD2   1 
ATOM   8033 N N     . THR L 3 111 ? 10.763  -11.846 224.630 1.00 53.75  ? 112 THR D N     1 
ATOM   8034 C CA    . THR L 3 111 ? 10.014  -11.593 225.828 1.00 51.50  ? 112 THR D CA    1 
ATOM   8035 C C     . THR L 3 111 ? 9.315   -12.800 226.444 1.00 57.68  ? 112 THR D C     1 
ATOM   8036 O O     . THR L 3 111 ? 9.499   -13.097 227.626 1.00 56.32  ? 112 THR D O     1 
ATOM   8037 C CB    . THR L 3 111 ? 8.988   -10.513 225.562 1.00 57.99  ? 112 THR D CB    1 
ATOM   8038 O OG1   . THR L 3 111 ? 9.646   -9.371  225.004 1.00 53.62  ? 112 THR D OG1   1 
ATOM   8039 C CG2   . THR L 3 111 ? 8.288   -10.119 226.853 1.00 63.98  ? 112 THR D CG2   1 
ATOM   8040 N N     . ALA L 3 112 ? 8.522   -13.510 225.650 1.00 62.32  ? 113 ALA D N     1 
ATOM   8041 C CA    . ALA L 3 112 ? 7.783   -14.664 226.164 1.00 59.17  ? 113 ALA D CA    1 
ATOM   8042 C C     . ALA L 3 112 ? 8.398   -16.005 225.841 1.00 61.35  ? 113 ALA D C     1 
ATOM   8043 O O     . ALA L 3 112 ? 9.180   -16.134 224.904 1.00 65.35  ? 113 ALA D O     1 
ATOM   8044 C CB    . ALA L 3 112 ? 6.356   -14.631 225.641 1.00 54.47  ? 113 ALA D CB    1 
ATOM   8045 N N     . ASP L 3 113 ? 8.048   -17.015 226.626 1.00 58.62  ? 114 ASP D N     1 
ATOM   8046 C CA    . ASP L 3 113 ? 8.553   -18.346 226.350 1.00 58.83  ? 114 ASP D CA    1 
ATOM   8047 C C     . ASP L 3 113 ? 7.517   -19.079 225.516 1.00 62.19  ? 114 ASP D C     1 
ATOM   8048 O O     . ASP L 3 113 ? 7.838   -20.042 224.824 1.00 68.45  ? 114 ASP D O     1 
ATOM   8049 C CB    . ASP L 3 113 ? 8.823   -19.100 227.639 1.00 50.62  ? 114 ASP D CB    1 
ATOM   8050 C CG    . ASP L 3 113 ? 10.115  -18.690 228.271 1.00 58.40  ? 114 ASP D CG    1 
ATOM   8051 O OD1   . ASP L 3 113 ? 10.416  -19.177 229.379 1.00 63.06  ? 114 ASP D OD1   1 
ATOM   8052 O OD2   . ASP L 3 113 ? 10.840  -17.878 227.658 1.00 68.79  ? 114 ASP D OD2   1 
ATOM   8053 N N     . ILE L 3 114 ? 6.273   -18.609 225.604 1.00 56.78  ? 115 ILE D N     1 
ATOM   8054 C CA    . ILE L 3 114 ? 5.148   -19.164 224.864 1.00 50.06  ? 115 ILE D CA    1 
ATOM   8055 C C     . ILE L 3 114 ? 4.124   -18.050 224.728 1.00 57.03  ? 115 ILE D C     1 
ATOM   8056 O O     . ILE L 3 114 ? 3.883   -17.303 225.674 1.00 54.79  ? 115 ILE D O     1 
ATOM   8057 C CB    . ILE L 3 114 ? 4.482   -20.351 225.594 1.00 45.57  ? 115 ILE D CB    1 
ATOM   8058 C CG1   . ILE L 3 114 ? 5.363   -21.612 225.528 1.00 42.62  ? 115 ILE D CG1   1 
ATOM   8059 C CG2   . ILE L 3 114 ? 3.145   -20.648 224.945 1.00 52.97  ? 115 ILE D CG2   1 
ATOM   8060 C CD1   . ILE L 3 114 ? 6.459   -21.729 226.601 1.00 19.01  ? 115 ILE D CD1   1 
ATOM   8061 N N     . LEU L 3 115 ? 3.513   -17.947 223.554 1.00 64.92  ? 116 LEU D N     1 
ATOM   8062 C CA    . LEU L 3 115 ? 2.540   -16.890 223.295 1.00 70.12  ? 116 LEU D CA    1 
ATOM   8063 C C     . LEU L 3 115 ? 1.149   -17.425 222.989 1.00 75.77  ? 116 LEU D C     1 
ATOM   8064 O O     . LEU L 3 115 ? 0.871   -17.836 221.869 1.00 85.81  ? 116 LEU D O     1 
ATOM   8065 C CB    . LEU L 3 115 ? 3.035   -16.046 222.125 1.00 64.76  ? 116 LEU D CB    1 
ATOM   8066 C CG    . LEU L 3 115 ? 2.512   -14.628 222.025 1.00 62.66  ? 116 LEU D CG    1 
ATOM   8067 C CD1   . LEU L 3 115 ? 2.555   -13.963 223.400 1.00 69.77  ? 116 LEU D CD1   1 
ATOM   8068 C CD2   . LEU L 3 115 ? 3.375   -13.871 221.032 1.00 51.22  ? 116 LEU D CD2   1 
ATOM   8069 N N     . LEU L 3 116 ? 0.273   -17.410 223.986 1.00 76.55  ? 117 LEU D N     1 
ATOM   8070 C CA    . LEU L 3 116 ? -1.091  -17.895 223.814 1.00 73.59  ? 117 LEU D CA    1 
ATOM   8071 C C     . LEU L 3 116 ? -2.001  -16.804 223.296 1.00 72.46  ? 117 LEU D C     1 
ATOM   8072 O O     . LEU L 3 116 ? -2.497  -15.984 224.063 1.00 70.64  ? 117 LEU D O     1 
ATOM   8073 C CB    . LEU L 3 116 ? -1.635  -18.403 225.142 1.00 77.19  ? 117 LEU D CB    1 
ATOM   8074 C CG    . LEU L 3 116 ? -1.204  -19.805 225.538 1.00 83.58  ? 117 LEU D CG    1 
ATOM   8075 C CD1   . LEU L 3 116 ? -1.579  -20.052 226.978 1.00 84.89  ? 117 LEU D CD1   1 
ATOM   8076 C CD2   . LEU L 3 116 ? -1.867  -20.829 224.614 1.00 87.11  ? 117 LEU D CD2   1 
ATOM   8077 N N     . VAL L 3 117 ? -2.236  -16.796 221.994 1.00 72.88  ? 118 VAL D N     1 
ATOM   8078 C CA    . VAL L 3 117 ? -3.094  -15.771 221.428 1.00 75.77  ? 118 VAL D CA    1 
ATOM   8079 C C     . VAL L 3 117 ? -4.404  -16.370 220.936 1.00 78.92  ? 118 VAL D C     1 
ATOM   8080 O O     . VAL L 3 117 ? -4.450  -17.523 220.500 1.00 79.52  ? 118 VAL D O     1 
ATOM   8081 C CB    . VAL L 3 117 ? -2.392  -15.054 220.259 1.00 68.72  ? 118 VAL D CB    1 
ATOM   8082 C CG1   . VAL L 3 117 ? -2.164  -16.044 219.141 1.00 67.37  ? 118 VAL D CG1   1 
ATOM   8083 C CG2   . VAL L 3 117 ? -3.213  -13.840 219.791 1.00 49.30  ? 118 VAL D CG2   1 
ATOM   8084 N N     . LYS L 3 118 ? -5.463  -15.573 221.021 1.00 77.03  ? 119 LYS D N     1 
ATOM   8085 C CA    . LYS L 3 118 ? -6.783  -15.984 220.583 1.00 80.68  ? 119 LYS D CA    1 
ATOM   8086 C C     . LYS L 3 118 ? -7.735  -14.798 220.617 1.00 82.88  ? 119 LYS D C     1 
ATOM   8087 O O     . LYS L 3 118 ? -7.912  -14.167 221.654 1.00 81.86  ? 119 LYS D O     1 
ATOM   8088 C CB    . LYS L 3 118 ? -7.314  -17.100 221.477 1.00 86.46  ? 119 LYS D CB    1 
ATOM   8089 C CG    . LYS L 3 118 ? -8.778  -17.408 221.262 1.00 91.56  ? 119 LYS D CG    1 
ATOM   8090 C CD    . LYS L 3 118 ? -9.099  -17.567 219.782 1.00 99.97  ? 119 LYS D CD    1 
ATOM   8091 C CE    . LYS L 3 118 ? -10.600 -17.663 219.565 1.00 108.63 ? 119 LYS D CE    1 
ATOM   8092 N NZ    . LYS L 3 118 ? -10.975 -17.684 218.124 1.00 112.99 ? 119 LYS D NZ    1 
ATOM   8093 N N     . ASP L 3 119 ? -8.346  -14.500 219.477 1.00 83.23  ? 120 ASP D N     1 
ATOM   8094 C CA    . ASP L 3 119 ? -9.273  -13.386 219.377 1.00 85.96  ? 120 ASP D CA    1 
ATOM   8095 C C     . ASP L 3 119 ? -8.619  -12.062 219.794 1.00 87.13  ? 120 ASP D C     1 
ATOM   8096 O O     . ASP L 3 119 ? -9.193  -11.301 220.572 1.00 93.27  ? 120 ASP D O     1 
ATOM   8097 C CB    . ASP L 3 119 ? -10.532 -13.639 220.237 1.00 84.40  ? 120 ASP D CB    1 
ATOM   8098 C CG    . ASP L 3 119 ? -11.664 -14.339 219.464 1.00 85.96  ? 120 ASP D CG    1 
ATOM   8099 O OD1   . ASP L 3 119 ? -11.836 -14.044 218.258 1.00 91.00  ? 120 ASP D OD1   1 
ATOM   8100 O OD2   . ASP L 3 119 ? -12.398 -15.162 220.069 1.00 74.92  ? 120 ASP D OD2   1 
ATOM   8101 N N     . GLN L 3 120 ? -7.427  -11.781 219.281 1.00 83.55  ? 121 GLN D N     1 
ATOM   8102 C CA    . GLN L 3 120 ? -6.745  -10.537 219.615 1.00 97.36  ? 121 GLN D CA    1 
ATOM   8103 C C     . GLN L 3 120 ? -6.279  -10.411 221.068 1.00 101.21 ? 121 GLN D C     1 
ATOM   8104 O O     . GLN L 3 120 ? -5.628  -9.425  221.423 1.00 103.33 ? 121 GLN D O     1 
ATOM   8105 C CB    . GLN L 3 120 ? -7.632  -9.335  219.278 1.00 108.26 ? 121 GLN D CB    1 
ATOM   8106 C CG    . GLN L 3 120 ? -7.710  -9.005  217.800 1.00 125.51 ? 121 GLN D CG    1 
ATOM   8107 C CD    . GLN L 3 120 ? -8.032  -10.215 216.948 1.00 134.18 ? 121 GLN D CD    1 
ATOM   8108 O OE1   . GLN L 3 120 ? -7.190  -11.098 216.756 1.00 139.84 ? 121 GLN D OE1   1 
ATOM   8109 N NE2   . GLN L 3 120 ? -9.260  -10.272 216.441 1.00 137.60 ? 121 GLN D NE2   1 
ATOM   8110 N N     . PHE L 3 121 ? -6.623  -11.379 221.917 1.00 102.15 ? 122 PHE D N     1 
ATOM   8111 C CA    . PHE L 3 121 ? -6.189  -11.348 223.318 1.00 97.83  ? 122 PHE D CA    1 
ATOM   8112 C C     . PHE L 3 121 ? -4.943  -12.215 223.480 1.00 91.62  ? 122 PHE D C     1 
ATOM   8113 O O     . PHE L 3 121 ? -4.983  -13.437 223.317 1.00 93.15  ? 122 PHE D O     1 
ATOM   8114 C CB    . PHE L 3 121 ? -7.284  -11.857 224.255 1.00 107.37 ? 122 PHE D CB    1 
ATOM   8115 C CG    . PHE L 3 121 ? -6.873  -11.878 225.707 1.00 117.82 ? 122 PHE D CG    1 
ATOM   8116 C CD1   . PHE L 3 121 ? -6.408  -10.720 226.329 1.00 120.62 ? 122 PHE D CD1   1 
ATOM   8117 C CD2   . PHE L 3 121 ? -6.952  -13.052 226.455 1.00 120.02 ? 122 PHE D CD2   1 
ATOM   8118 C CE1   . PHE L 3 121 ? -6.031  -10.732 227.671 1.00 121.23 ? 122 PHE D CE1   1 
ATOM   8119 C CE2   . PHE L 3 121 ? -6.576  -13.074 227.798 1.00 119.75 ? 122 PHE D CE2   1 
ATOM   8120 C CZ    . PHE L 3 121 ? -6.116  -11.912 228.405 1.00 122.79 ? 122 PHE D CZ    1 
ATOM   8121 N N     . TYR L 3 122 ? -3.838  -11.573 223.823 1.00 79.22  ? 123 TYR D N     1 
ATOM   8122 C CA    . TYR L 3 122 ? -2.580  -12.268 223.961 1.00 71.00  ? 123 TYR D CA    1 
ATOM   8123 C C     . TYR L 3 122 ? -2.224  -12.615 225.392 1.00 67.45  ? 123 TYR D C     1 
ATOM   8124 O O     . TYR L 3 122 ? -2.469  -11.847 226.305 1.00 64.55  ? 123 TYR D O     1 
ATOM   8125 C CB    . TYR L 3 122 ? -1.458  -11.422 223.352 1.00 70.69  ? 123 TYR D CB    1 
ATOM   8126 C CG    . TYR L 3 122 ? -1.652  -11.078 221.892 1.00 65.00  ? 123 TYR D CG    1 
ATOM   8127 C CD1   . TYR L 3 122 ? -2.712  -10.273 221.477 1.00 58.16  ? 123 TYR D CD1   1 
ATOM   8128 C CD2   . TYR L 3 122 ? -0.771  -11.554 220.927 1.00 67.27  ? 123 TYR D CD2   1 
ATOM   8129 C CE1   . TYR L 3 122 ? -2.892  -9.950  220.148 1.00 59.91  ? 123 TYR D CE1   1 
ATOM   8130 C CE2   . TYR L 3 122 ? -0.940  -11.235 219.587 1.00 72.61  ? 123 TYR D CE2   1 
ATOM   8131 C CZ    . TYR L 3 122 ? -2.005  -10.431 219.204 1.00 71.13  ? 123 TYR D CZ    1 
ATOM   8132 O OH    . TYR L 3 122 ? -2.178  -10.105 217.875 1.00 76.41  ? 123 TYR D OH    1 
ATOM   8133 N N     . GLU L 3 123 ? -1.632  -13.789 225.567 1.00 71.41  ? 124 GLU D N     1 
ATOM   8134 C CA    . GLU L 3 123 ? -1.199  -14.249 226.871 1.00 71.19  ? 124 GLU D CA    1 
ATOM   8135 C C     . GLU L 3 123 ? 0.282   -14.644 226.793 1.00 73.94  ? 124 GLU D C     1 
ATOM   8136 O O     . GLU L 3 123 ? 0.620   -15.769 226.424 1.00 72.29  ? 124 GLU D O     1 
ATOM   8137 C CB    . GLU L 3 123 ? -2.015  -15.452 227.306 1.00 77.25  ? 124 GLU D CB    1 
ATOM   8138 C CG    . GLU L 3 123 ? -2.199  -15.529 228.806 1.00 90.12  ? 124 GLU D CG    1 
ATOM   8139 C CD    . GLU L 3 123 ? -2.456  -16.933 229.287 1.00 96.07  ? 124 GLU D CD    1 
ATOM   8140 O OE1   . GLU L 3 123 ? -2.954  -17.748 228.482 1.00 102.63 ? 124 GLU D OE1   1 
ATOM   8141 O OE2   . GLU L 3 123 ? -2.167  -17.218 230.470 1.00 98.60  ? 124 GLU D OE2   1 
ATOM   8142 N N     . LEU L 3 124 ? 1.160   -13.708 227.137 1.00 73.07  ? 125 LEU D N     1 
ATOM   8143 C CA    . LEU L 3 124 ? 2.589   -13.947 227.102 1.00 68.09  ? 125 LEU D CA    1 
ATOM   8144 C C     . LEU L 3 124 ? 3.034   -14.756 228.322 1.00 75.20  ? 125 LEU D C     1 
ATOM   8145 O O     . LEU L 3 124 ? 3.492   -14.196 229.320 1.00 79.14  ? 125 LEU D O     1 
ATOM   8146 C CB    . LEU L 3 124 ? 3.335   -12.617 227.060 1.00 57.35  ? 125 LEU D CB    1 
ATOM   8147 C CG    . LEU L 3 124 ? 3.080   -11.643 225.914 1.00 50.97  ? 125 LEU D CG    1 
ATOM   8148 C CD1   . LEU L 3 124 ? 1.686   -11.040 225.983 1.00 58.47  ? 125 LEU D CD1   1 
ATOM   8149 C CD2   . LEU L 3 124 ? 4.095   -10.536 226.018 1.00 48.04  ? 125 LEU D CD2   1 
ATOM   8150 N N     . LEU L 3 125 ? 2.890   -16.077 228.232 1.00 74.40  ? 126 LEU D N     1 
ATOM   8151 C CA    . LEU L 3 125 ? 3.279   -16.982 229.308 1.00 69.52  ? 126 LEU D CA    1 
ATOM   8152 C C     . LEU L 3 125 ? 4.781   -17.207 229.308 1.00 66.57  ? 126 LEU D C     1 
ATOM   8153 O O     . LEU L 3 125 ? 5.343   -17.676 228.325 1.00 64.67  ? 126 LEU D O     1 
ATOM   8154 C CB    . LEU L 3 125 ? 2.587   -18.333 229.139 1.00 75.93  ? 126 LEU D CB    1 
ATOM   8155 C CG    . LEU L 3 125 ? 3.261   -19.468 229.917 1.00 80.93  ? 126 LEU D CG    1 
ATOM   8156 C CD1   . LEU L 3 125 ? 3.055   -19.245 231.415 1.00 82.71  ? 126 LEU D CD1   1 
ATOM   8157 C CD2   . LEU L 3 125 ? 2.696   -20.811 229.473 1.00 80.14  ? 126 LEU D CD2   1 
ATOM   8158 N N     . ASP L 3 126 ? 5.431   -16.878 230.412 1.00 66.05  ? 127 ASP D N     1 
ATOM   8159 C CA    . ASP L 3 126 ? 6.866   -17.079 230.517 1.00 66.54  ? 127 ASP D CA    1 
ATOM   8160 C C     . ASP L 3 126 ? 7.023   -18.184 231.549 1.00 69.94  ? 127 ASP D C     1 
ATOM   8161 O O     . ASP L 3 126 ? 6.292   -18.218 232.531 1.00 75.56  ? 127 ASP D O     1 
ATOM   8162 C CB    . ASP L 3 126 ? 7.545   -15.780 230.973 1.00 64.48  ? 127 ASP D CB    1 
ATOM   8163 C CG    . ASP L 3 126 ? 9.060   -15.892 231.053 1.00 64.15  ? 127 ASP D CG    1 
ATOM   8164 O OD1   . ASP L 3 126 ? 9.736   -14.844 231.205 1.00 59.78  ? 127 ASP D OD1   1 
ATOM   8165 O OD2   . ASP L 3 126 ? 9.586   -17.019 230.974 1.00 74.39  ? 127 ASP D OD2   1 
ATOM   8166 N N     . VAL L 3 127 ? 7.952   -19.103 231.311 1.00 73.41  ? 128 VAL D N     1 
ATOM   8167 C CA    . VAL L 3 127 ? 8.173   -20.212 232.230 1.00 74.16  ? 128 VAL D CA    1 
ATOM   8168 C C     . VAL L 3 127 ? 9.457   -20.035 233.037 1.00 76.60  ? 128 VAL D C     1 
ATOM   8169 O O     . VAL L 3 127 ? 10.501  -19.710 232.473 1.00 81.24  ? 128 VAL D O     1 
ATOM   8170 C CB    . VAL L 3 127 ? 8.244   -21.543 231.460 1.00 71.17  ? 128 VAL D CB    1 
ATOM   8171 C CG1   . VAL L 3 127 ? 8.566   -22.682 232.411 1.00 71.55  ? 128 VAL D CG1   1 
ATOM   8172 C CG2   . VAL L 3 127 ? 6.928   -21.796 230.745 1.00 67.53  ? 128 VAL D CG2   1 
ATOM   8173 N N     . LYS L 3 128 ? 9.370   -20.243 234.353 1.00 74.41  ? 129 LYS D N     1 
ATOM   8174 C CA    . LYS L 3 128 ? 10.527  -20.126 235.246 1.00 70.41  ? 129 LYS D CA    1 
ATOM   8175 C C     . LYS L 3 128 ? 10.801  -21.477 235.910 1.00 73.89  ? 129 LYS D C     1 
ATOM   8176 O O     . LYS L 3 128 ? 9.873   -22.104 236.422 1.00 75.25  ? 129 LYS D O     1 
ATOM   8177 C CB    . LYS L 3 128 ? 10.255  -19.082 236.322 1.00 62.67  ? 129 LYS D CB    1 
ATOM   8178 C CG    . LYS L 3 128 ? 9.800   -17.739 235.784 1.00 54.21  ? 129 LYS D CG    1 
ATOM   8179 C CD    . LYS L 3 128 ? 10.886  -17.052 235.015 1.00 51.92  ? 129 LYS D CD    1 
ATOM   8180 C CE    . LYS L 3 128 ? 10.361  -15.792 234.363 1.00 62.72  ? 129 LYS D CE    1 
ATOM   8181 N NZ    . LYS L 3 128 ? 11.314  -15.233 233.340 1.00 70.68  ? 129 LYS D NZ    1 
ATOM   8182 N N     . THR L 3 129 ? 12.061  -21.925 235.889 1.00 72.92  ? 130 THR D N     1 
ATOM   8183 C CA    . THR L 3 129 ? 12.440  -23.206 236.497 1.00 73.03  ? 130 THR D CA    1 
ATOM   8184 C C     . THR L 3 129 ? 13.280  -23.045 237.761 1.00 76.68  ? 130 THR D C     1 
ATOM   8185 O O     . THR L 3 129 ? 14.399  -22.528 237.739 1.00 72.91  ? 130 THR D O     1 
ATOM   8186 C CB    . THR L 3 129 ? 13.229  -24.134 235.537 1.00 67.71  ? 130 THR D CB    1 
ATOM   8187 O OG1   . THR L 3 129 ? 14.472  -23.525 235.179 1.00 70.48  ? 130 THR D OG1   1 
ATOM   8188 C CG2   . THR L 3 129 ? 12.431  -24.429 234.309 1.00 61.93  ? 130 THR D CG2   1 
ATOM   8189 N N     . ARG L 3 130 ? 12.720  -23.534 238.861 1.00 85.12  ? 131 ARG D N     1 
ATOM   8190 C CA    . ARG L 3 130 ? 13.346  -23.469 240.167 1.00 86.14  ? 131 ARG D CA    1 
ATOM   8191 C C     . ARG L 3 130 ? 13.993  -24.781 240.594 1.00 86.40  ? 131 ARG D C     1 
ATOM   8192 O O     . ARG L 3 130 ? 13.439  -25.866 240.410 1.00 79.16  ? 131 ARG D O     1 
ATOM   8193 C CB    . ARG L 3 130 ? 12.305  -23.055 241.210 1.00 84.35  ? 131 ARG D CB    1 
ATOM   8194 C CG    . ARG L 3 130 ? 12.866  -22.906 242.610 1.00 81.82  ? 131 ARG D CG    1 
ATOM   8195 C CD    . ARG L 3 130 ? 11.863  -22.272 243.547 1.00 81.93  ? 131 ARG D CD    1 
ATOM   8196 N NE    . ARG L 3 130 ? 12.493  -21.818 244.783 1.00 80.79  ? 131 ARG D NE    1 
ATOM   8197 C CZ    . ARG L 3 130 ? 11.846  -21.204 245.768 1.00 81.49  ? 131 ARG D CZ    1 
ATOM   8198 N NH1   . ARG L 3 130 ? 10.546  -20.968 245.661 1.00 75.80  ? 131 ARG D NH1   1 
ATOM   8199 N NH2   . ARG L 3 130 ? 12.495  -20.833 246.866 1.00 87.74  ? 131 ARG D NH2   1 
ATOM   8200 N N     . ASN L 3 131 ? 15.173  -24.660 241.182 1.00 93.49  ? 132 ASN D N     1 
ATOM   8201 C CA    . ASN L 3 131 ? 15.912  -25.808 241.678 1.00 99.35  ? 132 ASN D CA    1 
ATOM   8202 C C     . ASN L 3 131 ? 15.603  -25.928 243.176 1.00 103.74 ? 132 ASN D C     1 
ATOM   8203 O O     . ASN L 3 131 ? 16.385  -25.467 244.018 1.00 105.73 ? 132 ASN D O     1 
ATOM   8204 C CB    . ASN L 3 131 ? 17.406  -25.573 241.474 1.00 100.67 ? 132 ASN D CB    1 
ATOM   8205 C CG    . ASN L 3 131 ? 18.201  -26.853 241.472 1.00 99.43  ? 132 ASN D CG    1 
ATOM   8206 O OD1   . ASN L 3 131 ? 17.950  -27.752 242.274 1.00 93.99  ? 132 ASN D OD1   1 
ATOM   8207 N ND2   . ASN L 3 131 ? 19.180  -26.938 240.578 1.00 100.90 ? 132 ASN D ND2   1 
ATOM   8208 N N     . ILE L 3 132 ? 14.466  -26.542 243.505 1.00 104.36 ? 133 ILE D N     1 
ATOM   8209 C CA    . ILE L 3 132 ? 14.041  -26.698 244.901 1.00 104.56 ? 133 ILE D CA    1 
ATOM   8210 C C     . ILE L 3 132 ? 15.057  -27.394 245.825 1.00 101.99 ? 133 ILE D C     1 
ATOM   8211 O O     . ILE L 3 132 ? 14.932  -27.344 247.051 1.00 100.29 ? 133 ILE D O     1 
ATOM   8212 C CB    . ILE L 3 132 ? 12.658  -27.416 244.981 1.00 105.62 ? 133 ILE D CB    1 
ATOM   8213 C CG1   . ILE L 3 132 ? 12.551  -28.500 243.908 1.00 104.54 ? 133 ILE D CG1   1 
ATOM   8214 C CG2   . ILE L 3 132 ? 11.532  -26.409 244.798 1.00 104.32 ? 133 ILE D CG2   1 
ATOM   8215 C CD1   . ILE L 3 132 ? 13.401  -29.708 244.189 1.00 115.35 ? 133 ILE D CD1   1 
ATOM   8216 N N     . SER L 3 133 ? 16.070  -28.013 245.226 1.00 96.95  ? 134 SER D N     1 
ATOM   8217 C CA    . SER L 3 133 ? 17.108  -28.695 245.975 1.00 89.58  ? 134 SER D CA    1 
ATOM   8218 C C     . SER L 3 133 ? 17.847  -27.740 246.900 1.00 88.77  ? 134 SER D C     1 
ATOM   8219 O O     . SER L 3 133 ? 18.733  -28.148 247.646 1.00 93.13  ? 134 SER D O     1 
ATOM   8220 C CB    . SER L 3 133 ? 18.101  -29.357 245.021 1.00 90.78  ? 134 SER D CB    1 
ATOM   8221 O OG    . SER L 3 133 ? 17.559  -30.541 244.459 1.00 94.74  ? 134 SER D OG    1 
ATOM   8222 N N     . LYS L 3 134 ? 17.486  -26.466 246.857 1.00 88.64  ? 135 LYS D N     1 
ATOM   8223 C CA    . LYS L 3 134 ? 18.128  -25.485 247.715 1.00 92.79  ? 135 LYS D CA    1 
ATOM   8224 C C     . LYS L 3 134 ? 17.402  -24.161 247.670 1.00 92.12  ? 135 LYS D C     1 
ATOM   8225 O O     . LYS L 3 134 ? 16.712  -23.866 246.701 1.00 96.43  ? 135 LYS D O     1 
ATOM   8226 C CB    . LYS L 3 134 ? 19.593  -25.295 247.311 1.00 94.40  ? 135 LYS D CB    1 
ATOM   8227 C CG    . LYS L 3 134 ? 19.811  -24.989 245.838 1.00 93.74  ? 135 LYS D CG    1 
ATOM   8228 C CD    . LYS L 3 134 ? 21.312  -24.892 245.493 1.00 90.67  ? 135 LYS D CD    1 
ATOM   8229 C CE    . LYS L 3 134 ? 21.544  -24.845 243.977 1.00 84.92  ? 135 LYS D CE    1 
ATOM   8230 N NZ    . LYS L 3 134 ? 22.986  -24.808 243.615 1.00 83.54  ? 135 LYS D NZ    1 
ATOM   8231 N N     . SER L 3 135 ? 17.555  -23.379 248.737 1.00 94.58  ? 136 SER D N     1 
ATOM   8232 C CA    . SER L 3 135 ? 16.926  -22.064 248.854 1.00 95.57  ? 136 SER D CA    1 
ATOM   8233 C C     . SER L 3 135 ? 17.625  -21.101 247.905 1.00 91.68  ? 136 SER D C     1 
ATOM   8234 O O     . SER L 3 135 ? 18.693  -20.568 248.214 1.00 90.22  ? 136 SER D O     1 
ATOM   8235 C CB    . SER L 3 135 ? 17.049  -21.547 250.286 1.00 103.42 ? 136 SER D CB    1 
ATOM   8236 O OG    . SER L 3 135 ? 16.479  -22.462 251.210 1.00 117.18 ? 136 SER D OG    1 
ATOM   8237 N N     . ALA L 3 136 ? 17.002  -20.879 246.753 1.00 83.38  ? 137 ALA D N     1 
ATOM   8238 C CA    . ALA L 3 136 ? 17.562  -20.020 245.727 1.00 71.62  ? 137 ALA D CA    1 
ATOM   8239 C C     . ALA L 3 136 ? 16.911  -18.655 245.662 1.00 64.81  ? 137 ALA D C     1 
ATOM   8240 O O     . ALA L 3 136 ? 15.690  -18.548 245.731 1.00 63.53  ? 137 ALA D O     1 
ATOM   8241 C CB    . ALA L 3 136 ? 17.439  -20.701 244.385 1.00 76.74  ? 137 ALA D CB    1 
ATOM   8242 N N     . GLN L 3 137 ? 17.733  -17.615 245.511 1.00 53.81  ? 138 GLN D N     1 
ATOM   8243 C CA    . GLN L 3 137 ? 17.230  -16.255 245.419 1.00 46.87  ? 138 GLN D CA    1 
ATOM   8244 C C     . GLN L 3 137 ? 16.144  -16.206 244.377 1.00 57.29  ? 138 GLN D C     1 
ATOM   8245 O O     . GLN L 3 137 ? 16.119  -17.028 243.451 1.00 67.11  ? 138 GLN D O     1 
ATOM   8246 C CB    . GLN L 3 137 ? 18.340  -15.288 245.025 1.00 44.39  ? 138 GLN D CB    1 
ATOM   8247 C CG    . GLN L 3 137 ? 17.818  -14.013 244.340 1.00 43.10  ? 138 GLN D CG    1 
ATOM   8248 C CD    . GLN L 3 137 ? 18.766  -12.818 244.453 1.00 44.60  ? 138 GLN D CD    1 
ATOM   8249 O OE1   . GLN L 3 137 ? 19.983  -12.974 244.655 1.00 37.82  ? 138 GLN D OE1   1 
ATOM   8250 N NE2   . GLN L 3 137 ? 18.211  -11.619 244.311 1.00 36.72  ? 138 GLN D NE2   1 
ATOM   8251 N N     . ALA L 3 138 ? 15.236  -15.251 244.514 1.00 55.76  ? 139 ALA D N     1 
ATOM   8252 C CA    . ALA L 3 138 ? 14.178  -15.154 243.532 1.00 57.37  ? 139 ALA D CA    1 
ATOM   8253 C C     . ALA L 3 138 ? 14.824  -15.046 242.150 1.00 66.42  ? 139 ALA D C     1 
ATOM   8254 O O     . ALA L 3 138 ? 15.765  -14.270 241.944 1.00 70.02  ? 139 ALA D O     1 
ATOM   8255 C CB    . ALA L 3 138 ? 13.313  -13.943 243.813 1.00 53.04  ? 139 ALA D CB    1 
ATOM   8256 N N     . PRO L 3 139 ? 14.349  -15.849 241.189 1.00 67.47  ? 140 PRO D N     1 
ATOM   8257 C CA    . PRO L 3 139 ? 14.892  -15.821 239.836 1.00 63.25  ? 140 PRO D CA    1 
ATOM   8258 C C     . PRO L 3 139 ? 14.383  -14.587 239.119 1.00 64.56  ? 140 PRO D C     1 
ATOM   8259 O O     . PRO L 3 139 ? 13.500  -13.880 239.627 1.00 56.79  ? 140 PRO D O     1 
ATOM   8260 C CB    . PRO L 3 139 ? 14.329  -17.089 239.228 1.00 61.83  ? 140 PRO D CB    1 
ATOM   8261 C CG    . PRO L 3 139 ? 12.952  -17.104 239.830 1.00 63.52  ? 140 PRO D CG    1 
ATOM   8262 C CD    . PRO L 3 139 ? 13.270  -16.844 241.285 1.00 66.93  ? 140 PRO D CD    1 
ATOM   8263 N N     . ASN L 3 140 ? 14.935  -14.347 237.930 1.00 65.76  ? 141 ASN D N     1 
ATOM   8264 C CA    . ASN L 3 140 ? 14.544  -13.204 237.106 1.00 59.02  ? 141 ASN D CA    1 
ATOM   8265 C C     . ASN L 3 140 ? 13.159  -13.391 236.488 1.00 55.51  ? 141 ASN D C     1 
ATOM   8266 O O     . ASN L 3 140 ? 12.739  -14.511 236.202 1.00 51.28  ? 141 ASN D O     1 
ATOM   8267 C CB    . ASN L 3 140 ? 15.577  -12.978 235.997 1.00 54.86  ? 141 ASN D CB    1 
ATOM   8268 C CG    . ASN L 3 140 ? 16.753  -12.161 236.460 1.00 48.87  ? 141 ASN D CG    1 
ATOM   8269 O OD1   . ASN L 3 140 ? 17.027  -12.079 237.649 1.00 51.98  ? 141 ASN D OD1   1 
ATOM   8270 N ND2   . ASN L 3 140 ? 17.462  -11.559 235.523 1.00 50.33  ? 141 ASN D ND2   1 
ATOM   8271 N N     . ILE L 3 141 ? 12.449  -12.286 236.299 1.00 53.47  ? 142 ILE D N     1 
ATOM   8272 C CA    . ILE L 3 141 ? 11.130  -12.337 235.703 1.00 49.81  ? 142 ILE D CA    1 
ATOM   8273 C C     . ILE L 3 141 ? 11.136  -11.521 234.432 1.00 54.94  ? 142 ILE D C     1 
ATOM   8274 O O     . ILE L 3 141 ? 11.267  -12.095 233.354 1.00 65.28  ? 142 ILE D O     1 
ATOM   8275 C CB    . ILE L 3 141 ? 10.070  -11.804 236.650 1.00 50.00  ? 142 ILE D CB    1 
ATOM   8276 C CG1   . ILE L 3 141 ? 10.135  -12.566 237.982 1.00 51.72  ? 142 ILE D CG1   1 
ATOM   8277 C CG2   . ILE L 3 141 ? 8.714   -11.935 236.005 1.00 43.24  ? 142 ILE D CG2   1 
ATOM   8278 C CD1   . ILE L 3 141 ? 9.994   -14.080 237.863 1.00 41.55  ? 142 ILE D CD1   1 
ATOM   8279 N N     . ILE L 3 142 ? 11.011  -10.195 234.557 1.00 54.74  ? 143 ILE D N     1 
ATOM   8280 C CA    . ILE L 3 142 ? 11.040  -9.277  233.402 1.00 60.50  ? 143 ILE D CA    1 
ATOM   8281 C C     . ILE L 3 142 ? 11.746  -7.990  233.766 1.00 65.64  ? 143 ILE D C     1 
ATOM   8282 O O     . ILE L 3 142 ? 11.864  -7.665  234.943 1.00 70.17  ? 143 ILE D O     1 
ATOM   8283 C CB    . ILE L 3 142 ? 9.635   -8.863  232.905 1.00 63.33  ? 143 ILE D CB    1 
ATOM   8284 C CG1   . ILE L 3 142 ? 8.562   -9.518  233.769 1.00 72.07  ? 143 ILE D CG1   1 
ATOM   8285 C CG2   . ILE L 3 142 ? 9.484   -9.160  231.407 1.00 59.05  ? 143 ILE D CG2   1 
ATOM   8286 C CD1   . ILE L 3 142 ? 8.368   -8.806  235.082 1.00 80.12  ? 143 ILE D CD1   1 
ATOM   8287 N N     . SER L 3 143 ? 12.208  -7.258  232.751 1.00 69.88  ? 144 SER D N     1 
ATOM   8288 C CA    . SER L 3 143 ? 12.899  -5.975  232.954 1.00 71.64  ? 144 SER D CA    1 
ATOM   8289 C C     . SER L 3 143 ? 11.962  -4.911  233.490 1.00 69.72  ? 144 SER D C     1 
ATOM   8290 O O     . SER L 3 143 ? 11.006  -4.527  232.808 1.00 71.64  ? 144 SER D O     1 
ATOM   8291 C CB    . SER L 3 143 ? 13.482  -5.439  231.638 1.00 79.37  ? 144 SER D CB    1 
ATOM   8292 O OG    . SER L 3 143 ? 13.628  -4.017  231.678 1.00 69.26  ? 144 SER D OG    1 
ATOM   8293 N N     . ALA L 3 144 ? 12.242  -4.411  234.690 1.00 59.81  ? 145 ALA D N     1 
ATOM   8294 C CA    . ALA L 3 144 ? 11.391  -3.374  235.257 1.00 53.22  ? 145 ALA D CA    1 
ATOM   8295 C C     . ALA L 3 144 ? 11.203  -2.269  234.207 1.00 52.68  ? 145 ALA D C     1 
ATOM   8296 O O     . ALA L 3 144 ? 10.089  -1.781  233.998 1.00 51.58  ? 145 ALA D O     1 
ATOM   8297 C CB    . ALA L 3 144 ? 12.007  -2.830  236.518 1.00 32.96  ? 145 ALA D CB    1 
ATOM   8298 N N     . TYR L 3 145 ? 12.287  -1.920  233.520 1.00 53.39  ? 146 TYR D N     1 
ATOM   8299 C CA    . TYR L 3 145 ? 12.260  -0.890  232.487 1.00 60.58  ? 146 TYR D CA    1 
ATOM   8300 C C     . TYR L 3 145 ? 11.389  -1.316  231.297 1.00 66.34  ? 146 TYR D C     1 
ATOM   8301 O O     . TYR L 3 145 ? 10.740  -0.483  230.643 1.00 65.44  ? 146 TYR D O     1 
ATOM   8302 C CB    . TYR L 3 145 ? 13.684  -0.598  232.022 1.00 63.86  ? 146 TYR D CB    1 
ATOM   8303 C CG    . TYR L 3 145 ? 13.804  0.598   231.117 1.00 64.99  ? 146 TYR D CG    1 
ATOM   8304 C CD1   . TYR L 3 145 ? 13.036  1.733   231.336 1.00 65.50  ? 146 TYR D CD1   1 
ATOM   8305 C CD2   . TYR L 3 145 ? 14.709  0.605   230.055 1.00 68.65  ? 146 TYR D CD2   1 
ATOM   8306 C CE1   . TYR L 3 145 ? 13.157  2.843   230.523 1.00 72.26  ? 146 TYR D CE1   1 
ATOM   8307 C CE2   . TYR L 3 145 ? 14.845  1.716   229.238 1.00 71.62  ? 146 TYR D CE2   1 
ATOM   8308 C CZ    . TYR L 3 145 ? 14.062  2.830   229.479 1.00 72.05  ? 146 TYR D CZ    1 
ATOM   8309 O OH    . TYR L 3 145 ? 14.172  3.935   228.676 1.00 88.74  ? 146 TYR D OH    1 
ATOM   8310 N N     . LYS L 3 146 ? 11.377  -2.613  231.008 1.00 60.89  ? 147 LYS D N     1 
ATOM   8311 C CA    . LYS L 3 146 ? 10.548  -3.097  229.925 1.00 55.61  ? 147 LYS D CA    1 
ATOM   8312 C C     . LYS L 3 146 ? 9.098   -2.917  230.337 1.00 57.25  ? 147 LYS D C     1 
ATOM   8313 O O     . LYS L 3 146 ? 8.270   -2.521  229.522 1.00 58.95  ? 147 LYS D O     1 
ATOM   8314 C CB    . LYS L 3 146 ? 10.821  -4.567  229.636 1.00 46.30  ? 147 LYS D CB    1 
ATOM   8315 C CG    . LYS L 3 146 ? 9.844   -5.125  228.626 1.00 50.83  ? 147 LYS D CG    1 
ATOM   8316 C CD    . LYS L 3 146 ? 10.266  -6.498  228.108 1.00 65.26  ? 147 LYS D CD    1 
ATOM   8317 C CE    . LYS L 3 146 ? 11.199  -6.411  226.905 1.00 61.08  ? 147 LYS D CE    1 
ATOM   8318 N NZ    . LYS L 3 146 ? 11.668  -7.760  226.501 1.00 43.24  ? 147 LYS D NZ    1 
ATOM   8319 N N     . LEU L 3 147 ? 8.799   -3.206  231.606 1.00 56.73  ? 148 LEU D N     1 
ATOM   8320 C CA    . LEU L 3 147 ? 7.436   -3.076  232.145 1.00 54.31  ? 148 LEU D CA    1 
ATOM   8321 C C     . LEU L 3 147 ? 7.076   -1.615  232.184 1.00 51.98  ? 148 LEU D C     1 
ATOM   8322 O O     . LEU L 3 147 ? 5.954   -1.223  231.874 1.00 44.32  ? 148 LEU D O     1 
ATOM   8323 C CB    . LEU L 3 147 ? 7.357   -3.609  233.566 1.00 53.12  ? 148 LEU D CB    1 
ATOM   8324 C CG    . LEU L 3 147 ? 6.203   -4.556  233.881 1.00 51.97  ? 148 LEU D CG    1 
ATOM   8325 C CD1   . LEU L 3 147 ? 6.213   -4.857  235.385 1.00 46.92  ? 148 LEU D CD1   1 
ATOM   8326 C CD2   . LEU L 3 147 ? 4.889   -3.950  233.444 1.00 51.57  ? 148 LEU D CD2   1 
ATOM   8327 N N     . ALA L 3 148 ? 8.048   -0.812  232.593 1.00 52.80  ? 149 ALA D N     1 
ATOM   8328 C CA    . ALA L 3 148 ? 7.870   0.628   232.668 1.00 52.99  ? 149 ALA D CA    1 
ATOM   8329 C C     . ALA L 3 148 ? 7.425   1.112   231.306 1.00 51.97  ? 149 ALA D C     1 
ATOM   8330 O O     . ALA L 3 148 ? 6.328   1.648   231.168 1.00 48.28  ? 149 ALA D O     1 
ATOM   8331 C CB    . ALA L 3 148 ? 9.175   1.287   233.056 1.00 47.03  ? 149 ALA D CB    1 
ATOM   8332 N N     . GLN L 3 149 ? 8.276   0.909   230.298 1.00 55.41  ? 150 GLN D N     1 
ATOM   8333 C CA    . GLN L 3 149 ? 7.956   1.329   228.931 1.00 58.21  ? 150 GLN D CA    1 
ATOM   8334 C C     . GLN L 3 149 ? 6.630   0.723   228.502 1.00 54.59  ? 150 GLN D C     1 
ATOM   8335 O O     . GLN L 3 149 ? 5.855   1.358   227.799 1.00 54.52  ? 150 GLN D O     1 
ATOM   8336 C CB    . GLN L 3 149 ? 9.050   0.896   227.946 1.00 62.44  ? 150 GLN D CB    1 
ATOM   8337 C CG    . GLN L 3 149 ? 10.454  1.423   228.247 1.00 66.29  ? 150 GLN D CG    1 
ATOM   8338 C CD    . GLN L 3 149 ? 11.508  0.898   227.275 1.00 69.24  ? 150 GLN D CD    1 
ATOM   8339 O OE1   . GLN L 3 149 ? 11.454  1.163   226.077 1.00 63.99  ? 150 GLN D OE1   1 
ATOM   8340 N NE2   . GLN L 3 149 ? 12.469  0.142   227.796 1.00 74.68  ? 150 GLN D NE2   1 
ATOM   8341 N N     . THR L 3 150 ? 6.380   -0.511  228.933 1.00 52.55  ? 151 THR D N     1 
ATOM   8342 C CA    . THR L 3 150 ? 5.141   -1.185  228.596 1.00 52.22  ? 151 THR D CA    1 
ATOM   8343 C C     . THR L 3 150 ? 3.963   -0.428  229.167 1.00 59.77  ? 151 THR D C     1 
ATOM   8344 O O     . THR L 3 150 ? 3.259   0.272   228.443 1.00 66.91  ? 151 THR D O     1 
ATOM   8345 C CB    . THR L 3 150 ? 5.088   -2.588  229.155 1.00 49.11  ? 151 THR D CB    1 
ATOM   8346 O OG1   . THR L 3 150 ? 6.160   -3.356  228.603 1.00 46.37  ? 151 THR D OG1   1 
ATOM   8347 C CG2   . THR L 3 150 ? 3.737   -3.241  228.812 1.00 39.20  ? 151 THR D CG2   1 
ATOM   8348 N N     . CYS L 3 151 ? 3.744   -0.571  230.467 1.00 61.21  ? 152 CYS D N     1 
ATOM   8349 C CA    . CYS L 3 151 ? 2.639   0.116   231.115 1.00 63.45  ? 152 CYS D CA    1 
ATOM   8350 C C     . CYS L 3 151 ? 2.378   1.465   230.458 1.00 59.51  ? 152 CYS D C     1 
ATOM   8351 O O     . CYS L 3 151 ? 1.255   1.752   230.035 1.00 42.80  ? 152 CYS D O     1 
ATOM   8352 C CB    . CYS L 3 151 ? 2.926   0.285   232.611 1.00 62.55  ? 152 CYS D CB    1 
ATOM   8353 S SG    . CYS L 3 151 ? 2.738   -1.281  233.525 1.00 81.74  ? 152 CYS D SG    1 
ATOM   8354 N N     . ALA L 3 152 ? 3.436   2.268   230.355 1.00 65.50  ? 153 ALA D N     1 
ATOM   8355 C CA    . ALA L 3 152 ? 3.376   3.598   229.744 1.00 71.05  ? 153 ALA D CA    1 
ATOM   8356 C C     . ALA L 3 152 ? 2.778   3.528   228.339 1.00 71.73  ? 153 ALA D C     1 
ATOM   8357 O O     . ALA L 3 152 ? 1.848   4.265   228.006 1.00 73.43  ? 153 ALA D O     1 
ATOM   8358 C CB    . ALA L 3 152 ? 4.782   4.211   229.686 1.00 70.38  ? 153 ALA D CB    1 
ATOM   8359 N N     . LYS L 3 153 ? 3.319   2.646   227.509 1.00 70.44  ? 154 LYS D N     1 
ATOM   8360 C CA    . LYS L 3 153 ? 2.800   2.504   226.159 1.00 69.97  ? 154 LYS D CA    1 
ATOM   8361 C C     . LYS L 3 153 ? 1.323   2.089   226.199 1.00 67.53  ? 154 LYS D C     1 
ATOM   8362 O O     . LYS L 3 153 ? 0.556   2.369   225.277 1.00 66.37  ? 154 LYS D O     1 
ATOM   8363 C CB    . LYS L 3 153 ? 3.666   1.509   225.351 1.00 65.58  ? 154 LYS D CB    1 
ATOM   8364 C CG    . LYS L 3 153 ? 4.921   2.174   224.761 1.00 44.23  ? 154 LYS D CG    1 
ATOM   8365 C CD    . LYS L 3 153 ? 5.972   1.194   224.284 1.00 47.04  ? 154 LYS D CD    1 
ATOM   8366 C CE    . LYS L 3 153 ? 7.390   1.832   224.247 1.00 47.07  ? 154 LYS D CE    1 
ATOM   8367 N NZ    . LYS L 3 153 ? 7.597   2.867   223.182 1.00 33.34  ? 154 LYS D NZ    1 
ATOM   8368 N N     . MET L 3 154 ? 0.913   1.443   227.280 1.00 68.34  ? 155 MET D N     1 
ATOM   8369 C CA    . MET L 3 154 ? -0.477  1.043   227.405 1.00 76.14  ? 155 MET D CA    1 
ATOM   8370 C C     . MET L 3 154 ? -1.311  2.292   227.661 1.00 79.74  ? 155 MET D C     1 
ATOM   8371 O O     . MET L 3 154 ? -2.366  2.486   227.067 1.00 80.01  ? 155 MET D O     1 
ATOM   8372 C CB    . MET L 3 154 ? -0.653  0.087   228.572 1.00 77.74  ? 155 MET D CB    1 
ATOM   8373 C CG    . MET L 3 154 ? 0.280   -1.079  228.554 1.00 77.98  ? 155 MET D CG    1 
ATOM   8374 S SD    . MET L 3 154 ? -0.362  -2.290  229.673 1.00 79.78  ? 155 MET D SD    1 
ATOM   8375 C CE    . MET L 3 154 ? -0.194  -1.406  231.197 1.00 77.29  ? 155 MET D CE    1 
ATOM   8376 N N     . ILE L 3 155 ? -0.821  3.135   228.562 1.00 83.37  ? 156 ILE D N     1 
ATOM   8377 C CA    . ILE L 3 155 ? -1.496  4.378   228.906 1.00 81.24  ? 156 ILE D CA    1 
ATOM   8378 C C     . ILE L 3 155 ? -1.504  5.322   227.709 1.00 78.31  ? 156 ILE D C     1 
ATOM   8379 O O     . ILE L 3 155 ? -2.555  5.762   227.274 1.00 81.20  ? 156 ILE D O     1 
ATOM   8380 C CB    . ILE L 3 155 ? -0.784  5.093   230.066 1.00 84.10  ? 156 ILE D CB    1 
ATOM   8381 C CG1   . ILE L 3 155 ? -0.571  4.120   231.235 1.00 82.46  ? 156 ILE D CG1   1 
ATOM   8382 C CG2   . ILE L 3 155 ? -1.579  6.311   230.477 1.00 83.46  ? 156 ILE D CG2   1 
ATOM   8383 C CD1   . ILE L 3 155 ? -1.813  3.368   231.655 1.00 83.61  ? 156 ILE D CD1   1 
ATOM   8384 N N     . ASP L 3 156 ? -0.324  5.633   227.186 1.00 76.31  ? 157 ASP D N     1 
ATOM   8385 C CA    . ASP L 3 156 ? -0.212  6.525   226.045 1.00 82.60  ? 157 ASP D CA    1 
ATOM   8386 C C     . ASP L 3 156 ? -1.188  6.149   224.928 1.00 85.74  ? 157 ASP D C     1 
ATOM   8387 O O     . ASP L 3 156 ? -1.706  7.024   224.230 1.00 93.31  ? 157 ASP D O     1 
ATOM   8388 C CB    . ASP L 3 156 ? 1.226   6.518   225.497 1.00 90.56  ? 157 ASP D CB    1 
ATOM   8389 C CG    . ASP L 3 156 ? 2.159   7.472   226.249 1.00 100.09 ? 157 ASP D CG    1 
ATOM   8390 O OD1   . ASP L 3 156 ? 2.165   7.444   227.500 1.00 103.76 ? 157 ASP D OD1   1 
ATOM   8391 O OD2   . ASP L 3 156 ? 2.905   8.242   225.589 1.00 101.66 ? 157 ASP D OD2   1 
ATOM   8392 N N     . ASN L 3 157 ? -1.452  4.857   224.760 1.00 85.51  ? 158 ASN D N     1 
ATOM   8393 C CA    . ASN L 3 157 ? -2.349  4.401   223.696 1.00 81.51  ? 158 ASN D CA    1 
ATOM   8394 C C     . ASN L 3 157 ? -3.667  3.857   224.191 1.00 79.46  ? 158 ASN D C     1 
ATOM   8395 O O     . ASN L 3 157 ? -4.523  3.472   223.393 1.00 71.05  ? 158 ASN D O     1 
ATOM   8396 C CB    . ASN L 3 157 ? -1.645  3.348   222.856 1.00 84.33  ? 158 ASN D CB    1 
ATOM   8397 C CG    . ASN L 3 157 ? -0.391  3.884   222.214 1.00 85.22  ? 158 ASN D CG    1 
ATOM   8398 O OD1   . ASN L 3 157 ? -0.445  4.823   221.414 1.00 84.69  ? 158 ASN D OD1   1 
ATOM   8399 N ND2   . ASN L 3 157 ? 0.753   3.305   222.570 1.00 82.43  ? 158 ASN D ND2   1 
ATOM   8400 N N     . LYS L 3 158 ? -3.817  3.848   225.514 1.00 84.90  ? 159 LYS D N     1 
ATOM   8401 C CA    . LYS L 3 158 ? -5.016  3.360   226.194 1.00 85.56  ? 159 LYS D CA    1 
ATOM   8402 C C     . LYS L 3 158 ? -5.341  1.929   225.763 1.00 88.57  ? 159 LYS D C     1 
ATOM   8403 O O     . LYS L 3 158 ? -6.406  1.653   225.209 1.00 84.88  ? 159 LYS D O     1 
ATOM   8404 C CB    . LYS L 3 158 ? -6.201  4.291   225.912 1.00 84.53  ? 159 LYS D CB    1 
ATOM   8405 N N     . GLU L 3 159 ? -4.400  1.028   226.036 1.00 91.24  ? 160 GLU D N     1 
ATOM   8406 C CA    . GLU L 3 159 ? -4.525  -0.381  225.687 1.00 87.82  ? 160 GLU D CA    1 
ATOM   8407 C C     . GLU L 3 159 ? -4.534  -1.269  226.914 1.00 86.40  ? 160 GLU D C     1 
ATOM   8408 O O     . GLU L 3 159 ? -3.542  -1.369  227.631 1.00 84.30  ? 160 GLU D O     1 
ATOM   8409 C CB    . GLU L 3 159 ? -3.370  -0.800  224.771 1.00 90.83  ? 160 GLU D CB    1 
ATOM   8410 C CG    . GLU L 3 159 ? -3.458  -0.242  223.357 1.00 92.02  ? 160 GLU D CG    1 
ATOM   8411 C CD    . GLU L 3 159 ? -2.159  -0.380  222.577 1.00 94.97  ? 160 GLU D CD    1 
ATOM   8412 O OE1   . GLU L 3 159 ? -1.155  0.259   222.959 1.00 96.39  ? 160 GLU D OE1   1 
ATOM   8413 O OE2   . GLU L 3 159 ? -2.142  -1.128  221.578 1.00 96.41  ? 160 GLU D OE2   1 
ATOM   8414 N N     . PHE L 3 160 ? -5.666  -1.916  227.140 1.00 89.87  ? 161 PHE D N     1 
ATOM   8415 C CA    . PHE L 3 160 ? -5.834  -2.822  228.264 1.00 93.77  ? 161 PHE D CA    1 
ATOM   8416 C C     . PHE L 3 160 ? -6.570  -4.030  227.734 1.00 101.09 ? 161 PHE D C     1 
ATOM   8417 O O     . PHE L 3 160 ? -6.847  -4.116  226.533 1.00 101.56 ? 161 PHE D O     1 
ATOM   8418 C CB    . PHE L 3 160 ? -6.658  -2.157  229.354 1.00 92.81  ? 161 PHE D CB    1 
ATOM   8419 C CG    . PHE L 3 160 ? -6.077  -0.866  229.829 1.00 90.19  ? 161 PHE D CG    1 
ATOM   8420 C CD1   . PHE L 3 160 ? -4.928  -0.857  230.607 1.00 87.59  ? 161 PHE D CD1   1 
ATOM   8421 C CD2   . PHE L 3 160 ? -6.660  0.344   229.477 1.00 85.06  ? 161 PHE D CD2   1 
ATOM   8422 C CE1   . PHE L 3 160 ? -4.366  0.332   231.026 1.00 77.16  ? 161 PHE D CE1   1 
ATOM   8423 C CE2   . PHE L 3 160 ? -6.107  1.540   229.890 1.00 79.21  ? 161 PHE D CE2   1 
ATOM   8424 C CZ    . PHE L 3 160 ? -4.957  1.533   230.668 1.00 84.37  ? 161 PHE D CZ    1 
ATOM   8425 N N     . ASP L 3 161 ? -6.896  -4.958  228.627 1.00 107.12 ? 162 ASP D N     1 
ATOM   8426 C CA    . ASP L 3 161 ? -7.605  -6.179  228.245 1.00 110.63 ? 162 ASP D CA    1 
ATOM   8427 C C     . ASP L 3 161 ? -7.127  -6.701  226.883 1.00 110.13 ? 162 ASP D C     1 
ATOM   8428 O O     . ASP L 3 161 ? -7.912  -7.266  226.116 1.00 114.91 ? 162 ASP D O     1 
ATOM   8429 C CB    . ASP L 3 161 ? -9.113  -5.916  228.197 1.00 106.47 ? 162 ASP D CB    1 
ATOM   8430 N N     . LEU L 3 162 ? -5.839  -6.500  226.593 1.00 101.19 ? 163 LEU D N     1 
ATOM   8431 C CA    . LEU L 3 162 ? -5.245  -6.946  225.340 1.00 85.91  ? 163 LEU D CA    1 
ATOM   8432 C C     . LEU L 3 162 ? -4.246  -8.073  225.592 1.00 79.34  ? 163 LEU D C     1 
ATOM   8433 O O     . LEU L 3 162 ? -4.207  -9.037  224.836 1.00 82.96  ? 163 LEU D O     1 
ATOM   8434 C CB    . LEU L 3 162 ? -4.553  -5.772  224.640 1.00 85.17  ? 163 LEU D CB    1 
ATOM   8435 C CG    . LEU L 3 162 ? -4.267  -5.863  223.131 1.00 79.15  ? 163 LEU D CG    1 
ATOM   8436 C CD1   . LEU L 3 162 ? -3.908  -4.482  222.622 1.00 77.64  ? 163 LEU D CD1   1 
ATOM   8437 C CD2   . LEU L 3 162 ? -3.149  -6.854  222.832 1.00 79.45  ? 163 LEU D CD2   1 
ATOM   8438 N N     . PHE L 3 163 ? -3.456  -7.962  226.658 1.00 69.38  ? 164 PHE D N     1 
ATOM   8439 C CA    . PHE L 3 163 ? -2.475  -8.991  226.969 1.00 65.96  ? 164 PHE D CA    1 
ATOM   8440 C C     . PHE L 3 163 ? -2.254  -9.210  228.465 1.00 65.07  ? 164 PHE D C     1 
ATOM   8441 O O     . PHE L 3 163 ? -2.446  -8.305  229.259 1.00 60.38  ? 164 PHE D O     1 
ATOM   8442 C CB    . PHE L 3 163 ? -1.149  -8.644  226.296 1.00 67.41  ? 164 PHE D CB    1 
ATOM   8443 C CG    . PHE L 3 163 ? -0.446  -7.472  226.910 1.00 66.80  ? 164 PHE D CG    1 
ATOM   8444 C CD1   . PHE L 3 163 ? 0.404   -7.645  227.999 1.00 65.51  ? 164 PHE D CD1   1 
ATOM   8445 C CD2   . PHE L 3 163 ? -0.628  -6.195  226.402 1.00 62.28  ? 164 PHE D CD2   1 
ATOM   8446 C CE1   . PHE L 3 163 ? 1.062   -6.556  228.571 1.00 64.72  ? 164 PHE D CE1   1 
ATOM   8447 C CE2   . PHE L 3 163 ? 0.027   -5.102  226.970 1.00 67.86  ? 164 PHE D CE2   1 
ATOM   8448 C CZ    . PHE L 3 163 ? 0.875   -5.281  228.055 1.00 61.79  ? 164 PHE D CZ    1 
ATOM   8449 N N     . ASP L 3 164 ? -1.846  -10.422 228.835 1.00 74.15  ? 165 ASP D N     1 
ATOM   8450 C CA    . ASP L 3 164 ? -1.586  -10.780 230.232 1.00 81.95  ? 165 ASP D CA    1 
ATOM   8451 C C     . ASP L 3 164 ? -0.262  -11.506 230.397 1.00 85.14  ? 165 ASP D C     1 
ATOM   8452 O O     . ASP L 3 164 ? 0.052   -12.419 229.635 1.00 94.43  ? 165 ASP D O     1 
ATOM   8453 C CB    . ASP L 3 164 ? -2.663  -11.714 230.782 1.00 82.74  ? 165 ASP D CB    1 
ATOM   8454 C CG    . ASP L 3 164 ? -3.992  -11.049 230.915 1.00 91.26  ? 165 ASP D CG    1 
ATOM   8455 O OD1   . ASP L 3 164 ? -4.032  -9.794  230.849 1.00 95.84  ? 165 ASP D OD1   1 
ATOM   8456 O OD2   . ASP L 3 164 ? -4.990  -11.784 231.098 1.00 87.67  ? 165 ASP D OD2   1 
ATOM   8457 N N     . ILE L 3 165 ? 0.505   -11.130 231.410 1.00 76.55  ? 166 ILE D N     1 
ATOM   8458 C CA    . ILE L 3 165 ? 1.766   -11.805 231.645 1.00 68.67  ? 166 ILE D CA    1 
ATOM   8459 C C     . ILE L 3 165 ? 1.567   -12.797 232.773 1.00 62.42  ? 166 ILE D C     1 
ATOM   8460 O O     . ILE L 3 165 ? 1.234   -12.411 233.889 1.00 61.38  ? 166 ILE D O     1 
ATOM   8461 C CB    . ILE L 3 165 ? 2.876   -10.812 232.041 1.00 75.56  ? 166 ILE D CB    1 
ATOM   8462 C CG1   . ILE L 3 165 ? 3.033   -9.733  230.969 1.00 79.93  ? 166 ILE D CG1   1 
ATOM   8463 C CG2   . ILE L 3 165 ? 4.197   -11.544 232.205 1.00 77.74  ? 166 ILE D CG2   1 
ATOM   8464 C CD1   . ILE L 3 165 ? 4.124   -8.740  231.282 1.00 66.46  ? 166 ILE D CD1   1 
ATOM   8465 N N     . ASN L 3 166 ? 1.745   -14.079 232.475 1.00 60.64  ? 167 ASN D N     1 
ATOM   8466 C CA    . ASN L 3 166 ? 1.594   -15.126 233.489 1.00 57.52  ? 167 ASN D CA    1 
ATOM   8467 C C     . ASN L 3 166 ? 2.839   -16.007 233.521 1.00 61.65  ? 167 ASN D C     1 
ATOM   8468 O O     . ASN L 3 166 ? 3.668   -15.983 232.607 1.00 58.26  ? 167 ASN D O     1 
ATOM   8469 C CB    . ASN L 3 166 ? 0.369   -16.002 233.209 1.00 48.32  ? 167 ASN D CB    1 
ATOM   8470 C CG    . ASN L 3 166 ? -0.912  -15.197 233.079 1.00 53.68  ? 167 ASN D CG    1 
ATOM   8471 O OD1   . ASN L 3 166 ? -1.029  -14.097 233.623 1.00 41.48  ? 167 ASN D OD1   1 
ATOM   8472 N ND2   . ASN L 3 166 ? -1.890  -15.755 232.366 1.00 48.25  ? 167 ASN D ND2   1 
ATOM   8473 N N     . TYR L 3 167 ? 2.961   -16.802 234.574 1.00 64.11  ? 168 TYR D N     1 
ATOM   8474 C CA    . TYR L 3 167 ? 4.122   -17.659 234.719 1.00 66.24  ? 168 TYR D CA    1 
ATOM   8475 C C     . TYR L 3 167 ? 3.794   -19.088 235.080 1.00 71.20  ? 168 TYR D C     1 
ATOM   8476 O O     . TYR L 3 167 ? 2.717   -19.369 235.593 1.00 76.86  ? 168 TYR D O     1 
ATOM   8477 C CB    . TYR L 3 167 ? 5.037   -17.072 235.775 1.00 53.93  ? 168 TYR D CB    1 
ATOM   8478 C CG    . TYR L 3 167 ? 5.365   -15.646 235.471 1.00 56.01  ? 168 TYR D CG    1 
ATOM   8479 C CD1   . TYR L 3 167 ? 4.472   -14.619 235.786 1.00 58.32  ? 168 TYR D CD1   1 
ATOM   8480 C CD2   . TYR L 3 167 ? 6.541   -15.320 234.811 1.00 56.95  ? 168 TYR D CD2   1 
ATOM   8481 C CE1   . TYR L 3 167 ? 4.750   -13.310 235.452 1.00 56.83  ? 168 TYR D CE1   1 
ATOM   8482 C CE2   . TYR L 3 167 ? 6.821   -14.024 234.471 1.00 62.58  ? 168 TYR D CE2   1 
ATOM   8483 C CZ    . TYR L 3 167 ? 5.928   -13.027 234.794 1.00 63.58  ? 168 TYR D CZ    1 
ATOM   8484 O OH    . TYR L 3 167 ? 6.249   -11.743 234.460 1.00 79.59  ? 168 TYR D OH    1 
ATOM   8485 N N     . LEU L 3 168 ? 4.731   -19.989 234.802 1.00 71.53  ? 169 LEU D N     1 
ATOM   8486 C CA    . LEU L 3 168 ? 4.554   -21.392 235.129 1.00 73.87  ? 169 LEU D CA    1 
ATOM   8487 C C     . LEU L 3 168 ? 5.793   -21.920 235.845 1.00 80.72  ? 169 LEU D C     1 
ATOM   8488 O O     . LEU L 3 168 ? 6.579   -22.658 235.260 1.00 87.73  ? 169 LEU D O     1 
ATOM   8489 C CB    . LEU L 3 168 ? 4.303   -22.234 233.874 1.00 59.64  ? 169 LEU D CB    1 
ATOM   8490 C CG    . LEU L 3 168 ? 3.913   -23.674 234.243 1.00 54.67  ? 169 LEU D CG    1 
ATOM   8491 C CD1   . LEU L 3 168 ? 2.627   -23.598 235.056 1.00 40.33  ? 169 LEU D CD1   1 
ATOM   8492 C CD2   . LEU L 3 168 ? 3.734   -24.570 233.018 1.00 48.57  ? 169 LEU D CD2   1 
ATOM   8493 N N     . GLU L 3 169 ? 5.973   -21.532 237.103 1.00 80.16  ? 170 GLU D N     1 
ATOM   8494 C CA    . GLU L 3 169 ? 7.113   -22.002 237.881 1.00 80.40  ? 170 GLU D CA    1 
ATOM   8495 C C     . GLU L 3 169 ? 7.120   -23.536 237.868 1.00 84.54  ? 170 GLU D C     1 
ATOM   8496 O O     . GLU L 3 169 ? 6.112   -24.175 238.193 1.00 87.22  ? 170 GLU D O     1 
ATOM   8497 C CB    . GLU L 3 169 ? 6.999   -21.476 239.315 1.00 79.47  ? 170 GLU D CB    1 
ATOM   8498 C CG    . GLU L 3 169 ? 8.087   -21.902 240.292 1.00 73.07  ? 170 GLU D CG    1 
ATOM   8499 C CD    . GLU L 3 169 ? 7.920   -21.241 241.649 1.00 72.01  ? 170 GLU D CD    1 
ATOM   8500 O OE1   . GLU L 3 169 ? 8.372   -20.090 241.829 1.00 72.07  ? 170 GLU D OE1   1 
ATOM   8501 O OE2   . GLU L 3 169 ? 7.312   -21.865 242.535 1.00 71.82  ? 170 GLU D OE2   1 
ATOM   8502 N N     . VAL L 3 170 ? 8.251   -24.119 237.472 1.00 82.77  ? 171 VAL D N     1 
ATOM   8503 C CA    . VAL L 3 170 ? 8.407   -25.571 237.408 1.00 79.18  ? 171 VAL D CA    1 
ATOM   8504 C C     . VAL L 3 170 ? 9.561   -26.034 238.286 1.00 80.81  ? 171 VAL D C     1 
ATOM   8505 O O     . VAL L 3 170 ? 10.715  -25.903 237.900 1.00 81.71  ? 171 VAL D O     1 
ATOM   8506 C CB    . VAL L 3 170 ? 8.689   -26.032 235.967 1.00 75.65  ? 171 VAL D CB    1 
ATOM   8507 C CG1   . VAL L 3 170 ? 8.966   -27.517 235.942 1.00 74.41  ? 171 VAL D CG1   1 
ATOM   8508 C CG2   . VAL L 3 170 ? 7.512   -25.702 235.077 1.00 74.16  ? 171 VAL D CG2   1 
ATOM   8509 N N     . ASP L 3 171 ? 9.248   -26.581 239.458 1.00 85.87  ? 172 ASP D N     1 
ATOM   8510 C CA    . ASP L 3 171 ? 10.275  -27.062 240.382 1.00 88.34  ? 172 ASP D CA    1 
ATOM   8511 C C     . ASP L 3 171 ? 10.733  -28.473 240.025 1.00 86.85  ? 172 ASP D C     1 
ATOM   8512 O O     . ASP L 3 171 ? 9.914   -29.367 239.804 1.00 76.25  ? 172 ASP D O     1 
ATOM   8513 C CB    . ASP L 3 171 ? 9.744   -27.047 241.817 1.00 94.13  ? 172 ASP D CB    1 
ATOM   8514 C CG    . ASP L 3 171 ? 9.230   -25.683 242.232 1.00 94.88  ? 172 ASP D CG    1 
ATOM   8515 O OD1   . ASP L 3 171 ? 9.984   -24.698 242.076 1.00 96.42  ? 172 ASP D OD1   1 
ATOM   8516 O OD2   . ASP L 3 171 ? 8.078   -25.599 242.718 1.00 92.33  ? 172 ASP D OD2   1 
ATOM   8517 N N     . TRP L 3 172 ? 12.051  -28.656 239.992 1.00 90.26  ? 173 TRP D N     1 
ATOM   8518 C CA    . TRP L 3 172 ? 12.675  -29.930 239.650 1.00 97.41  ? 173 TRP D CA    1 
ATOM   8519 C C     . TRP L 3 172 ? 13.827  -30.248 240.600 1.00 102.95 ? 173 TRP D C     1 
ATOM   8520 O O     . TRP L 3 172 ? 14.249  -29.391 241.375 1.00 105.10 ? 173 TRP D O     1 
ATOM   8521 C CB    . TRP L 3 172 ? 13.230  -29.865 238.233 1.00 100.62 ? 173 TRP D CB    1 
ATOM   8522 C CG    . TRP L 3 172 ? 14.140  -28.675 238.019 1.00 107.56 ? 173 TRP D CG    1 
ATOM   8523 C CD1   . TRP L 3 172 ? 13.760  -27.380 237.793 1.00 105.57 ? 173 TRP D CD1   1 
ATOM   8524 C CD2   . TRP L 3 172 ? 15.573  -28.669 238.049 1.00 108.82 ? 173 TRP D CD2   1 
ATOM   8525 N NE1   . TRP L 3 172 ? 14.864  -26.571 237.683 1.00 103.81 ? 173 TRP D NE1   1 
ATOM   8526 C CE2   . TRP L 3 172 ? 15.990  -27.334 237.838 1.00 107.61 ? 173 TRP D CE2   1 
ATOM   8527 C CE3   . TRP L 3 172 ? 16.546  -29.659 238.241 1.00 109.13 ? 173 TRP D CE3   1 
ATOM   8528 C CZ2   . TRP L 3 172 ? 17.340  -26.966 237.805 1.00 109.24 ? 173 TRP D CZ2   1 
ATOM   8529 C CZ3   . TRP L 3 172 ? 17.889  -29.291 238.209 1.00 109.60 ? 173 TRP D CZ3   1 
ATOM   8530 C CH2   . TRP L 3 172 ? 18.271  -27.954 237.996 1.00 107.42 ? 173 TRP D CH2   1 
ATOM   8531 N N     . GLU L 3 173 ? 14.339  -31.475 240.526 1.00 106.03 ? 174 GLU D N     1 
ATOM   8532 C CA    . GLU L 3 173 ? 15.457  -31.897 241.367 1.00 110.38 ? 174 GLU D CA    1 
ATOM   8533 C C     . GLU L 3 173 ? 16.248  -33.015 240.685 1.00 110.98 ? 174 GLU D C     1 
ATOM   8534 O O     . GLU L 3 173 ? 15.664  -33.949 240.136 1.00 110.65 ? 174 GLU D O     1 
ATOM   8535 C CB    . GLU L 3 173 ? 14.960  -32.380 242.736 1.00 114.62 ? 174 GLU D CB    1 
ATOM   8536 C CG    . GLU L 3 173 ? 14.293  -33.747 242.723 1.00 122.03 ? 174 GLU D CG    1 
ATOM   8537 C CD    . GLU L 3 173 ? 14.012  -34.284 244.118 1.00 121.89 ? 174 GLU D CD    1 
ATOM   8538 O OE1   . GLU L 3 173 ? 13.815  -35.514 244.250 1.00 124.05 ? 174 GLU D OE1   1 
ATOM   8539 O OE2   . GLU L 3 173 ? 13.981  -33.481 245.076 1.00 113.93 ? 174 GLU D OE2   1 
ATOM   8540 N N     . LEU L 3 174 ? 17.575  -32.917 240.718 1.00 111.32 ? 175 LEU D N     1 
ATOM   8541 C CA    . LEU L 3 174 ? 18.426  -33.924 240.092 1.00 109.91 ? 175 LEU D CA    1 
ATOM   8542 C C     . LEU L 3 174 ? 18.447  -35.215 240.896 1.00 111.32 ? 175 LEU D C     1 
ATOM   8543 O O     . LEU L 3 174 ? 19.199  -35.344 241.865 1.00 104.97 ? 175 LEU D O     1 
ATOM   8544 C CB    . LEU L 3 174 ? 19.852  -33.390 239.920 1.00 109.83 ? 175 LEU D CB    1 
ATOM   8545 C CG    . LEU L 3 174 ? 20.909  -34.374 239.401 1.00 111.35 ? 175 LEU D CG    1 
ATOM   8546 C CD1   . LEU L 3 174 ? 20.423  -35.049 238.132 1.00 109.54 ? 175 LEU D CD1   1 
ATOM   8547 C CD2   . LEU L 3 174 ? 22.218  -33.635 239.156 1.00 110.08 ? 175 LEU D CD2   1 
ATOM   8548 N N     . ASN L 3 175 ? 17.611  -36.167 240.489 1.00 118.04 ? 176 ASN D N     1 
ATOM   8549 C CA    . ASN L 3 175 ? 17.524  -37.461 241.163 1.00 122.44 ? 176 ASN D CA    1 
ATOM   8550 C C     . ASN L 3 175 ? 18.369  -38.485 240.405 1.00 117.27 ? 176 ASN D C     1 
ATOM   8551 O O     . ASN L 3 175 ? 17.848  -39.343 239.692 1.00 110.24 ? 176 ASN D O     1 
ATOM   8552 C CB    . ASN L 3 175 ? 16.062  -37.923 241.234 1.00 129.75 ? 176 ASN D CB    1 
ATOM   8553 C CG    . ASN L 3 175 ? 15.839  -39.012 242.277 1.00 137.64 ? 176 ASN D CG    1 
ATOM   8554 O OD1   . ASN L 3 175 ? 14.703  -39.411 242.537 1.00 142.32 ? 176 ASN D OD1   1 
ATOM   8555 N ND2   . ASN L 3 175 ? 16.926  -39.496 242.880 1.00 138.51 ? 176 ASN D ND2   1 
ATOM   8556 N N     . GLY L 3 176 ? 19.682  -38.371 240.572 1.00 115.35 ? 177 GLY D N     1 
ATOM   8557 C CA    . GLY L 3 176 ? 20.596  -39.269 239.906 1.00 117.03 ? 177 GLY D CA    1 
ATOM   8558 C C     . GLY L 3 176 ? 21.094  -38.670 238.609 1.00 120.25 ? 177 GLY D C     1 
ATOM   8559 O O     . GLY L 3 176 ? 22.026  -37.858 238.602 1.00 118.05 ? 177 GLY D O     1 
ATOM   8560 N N     . GLU L 3 177 ? 20.457  -39.074 237.511 1.00 123.73 ? 178 GLU D N     1 
ATOM   8561 C CA    . GLU L 3 177 ? 20.805  -38.605 236.169 1.00 126.18 ? 178 GLU D CA    1 
ATOM   8562 C C     . GLU L 3 177 ? 19.750  -37.690 235.552 1.00 125.50 ? 178 GLU D C     1 
ATOM   8563 O O     . GLU L 3 177 ? 20.079  -36.703 234.892 1.00 121.12 ? 178 GLU D O     1 
ATOM   8564 C CB    . GLU L 3 177 ? 21.029  -39.798 235.235 1.00 122.40 ? 178 GLU D CB    1 
ATOM   8565 C CG    . GLU L 3 177 ? 22.372  -40.471 235.395 1.00 120.35 ? 178 GLU D CG    1 
ATOM   8566 C CD    . GLU L 3 177 ? 23.525  -39.515 235.169 1.00 119.00 ? 178 GLU D CD    1 
ATOM   8567 O OE1   . GLU L 3 177 ? 23.811  -38.693 236.066 1.00 117.37 ? 178 GLU D OE1   1 
ATOM   8568 O OE2   . GLU L 3 177 ? 24.139  -39.576 234.084 1.00 119.22 ? 178 GLU D OE2   1 
ATOM   8569 N N     . ASP L 3 178 ? 18.483  -38.031 235.759 1.00 126.98 ? 179 ASP D N     1 
ATOM   8570 C CA    . ASP L 3 178 ? 17.389  -37.244 235.210 1.00 128.27 ? 179 ASP D CA    1 
ATOM   8571 C C     . ASP L 3 178 ? 16.961  -36.129 236.172 1.00 127.45 ? 179 ASP D C     1 
ATOM   8572 O O     . ASP L 3 178 ? 17.349  -36.122 237.343 1.00 130.72 ? 179 ASP D O     1 
ATOM   8573 C CB    . ASP L 3 178 ? 16.182  -38.146 234.898 1.00 128.92 ? 179 ASP D CB    1 
ATOM   8574 C CG    . ASP L 3 178 ? 16.562  -39.404 234.119 1.00 130.90 ? 179 ASP D CG    1 
ATOM   8575 O OD1   . ASP L 3 178 ? 17.508  -39.346 233.300 1.00 127.66 ? 179 ASP D OD1   1 
ATOM   8576 O OD2   . ASP L 3 178 ? 15.897  -40.449 234.316 1.00 132.31 ? 179 ASP D OD2   1 
ATOM   8577 N N     . LEU L 3 179 ? 16.171  -35.185 235.659 1.00 122.25 ? 180 LEU D N     1 
ATOM   8578 C CA    . LEU L 3 179 ? 15.653  -34.064 236.443 1.00 113.36 ? 180 LEU D CA    1 
ATOM   8579 C C     . LEU L 3 179 ? 14.133  -34.207 236.471 1.00 112.06 ? 180 LEU D C     1 
ATOM   8580 O O     . LEU L 3 179 ? 13.466  -34.054 235.448 1.00 110.35 ? 180 LEU D O     1 
ATOM   8581 C CB    . LEU L 3 179 ? 16.043  -32.726 235.799 1.00 108.00 ? 180 LEU D CB    1 
ATOM   8582 C CG    . LEU L 3 179 ? 17.535  -32.410 235.650 1.00 100.42 ? 180 LEU D CG    1 
ATOM   8583 C CD1   . LEU L 3 179 ? 17.725  -31.052 234.990 1.00 91.35  ? 180 LEU D CD1   1 
ATOM   8584 C CD2   . LEU L 3 179 ? 18.190  -32.429 237.015 1.00 100.58 ? 180 LEU D CD2   1 
ATOM   8585 N N     . VAL L 3 180 ? 13.586  -34.512 237.640 1.00 112.97 ? 181 VAL D N     1 
ATOM   8586 C CA    . VAL L 3 180 ? 12.147  -34.693 237.754 1.00 114.65 ? 181 VAL D CA    1 
ATOM   8587 C C     . VAL L 3 180 ? 11.460  -33.503 238.405 1.00 110.66 ? 181 VAL D C     1 
ATOM   8588 O O     . VAL L 3 180 ? 11.988  -32.892 239.337 1.00 108.85 ? 181 VAL D O     1 
ATOM   8589 C CB    . VAL L 3 180 ? 11.802  -35.973 238.556 1.00 119.61 ? 181 VAL D CB    1 
ATOM   8590 C CG1   . VAL L 3 180 ? 10.293  -36.227 238.510 1.00 121.19 ? 181 VAL D CG1   1 
ATOM   8591 C CG2   . VAL L 3 180 ? 12.566  -37.169 237.994 1.00 118.54 ? 181 VAL D CG2   1 
ATOM   8592 N N     . CYS L 3 181 ? 10.277  -33.181 237.894 1.00 107.91 ? 182 CYS D N     1 
ATOM   8593 C CA    . CYS L 3 181 ? 9.493   -32.072 238.411 1.00 105.48 ? 182 CYS D CA    1 
ATOM   8594 C C     . CYS L 3 181 ? 8.706   -32.484 239.630 1.00 105.55 ? 182 CYS D C     1 
ATOM   8595 O O     . CYS L 3 181 ? 7.927   -33.438 239.596 1.00 107.86 ? 182 CYS D O     1 
ATOM   8596 C CB    . CYS L 3 181 ? 8.505   -31.556 237.370 1.00 103.81 ? 182 CYS D CB    1 
ATOM   8597 S SG    . CYS L 3 181 ? 7.308   -30.407 238.099 1.00 94.53  ? 182 CYS D SG    1 
ATOM   8598 N N     . VAL L 3 182 ? 8.890   -31.736 240.702 1.00 103.10 ? 183 VAL D N     1 
ATOM   8599 C CA    . VAL L 3 182 ? 8.197   -32.029 241.931 1.00 102.68 ? 183 VAL D CA    1 
ATOM   8600 C C     . VAL L 3 182 ? 6.907   -31.224 242.044 1.00 101.57 ? 183 VAL D C     1 
ATOM   8601 O O     . VAL L 3 182 ? 5.893   -31.723 242.527 1.00 102.67 ? 183 VAL D O     1 
ATOM   8602 C CB    . VAL L 3 182 ? 9.113   -31.738 243.121 1.00 106.45 ? 183 VAL D CB    1 
ATOM   8603 C CG1   . VAL L 3 182 ? 10.339  -32.635 243.043 1.00 107.70 ? 183 VAL D CG1   1 
ATOM   8604 C CG2   . VAL L 3 182 ? 9.539   -30.277 243.102 1.00 111.34 ? 183 VAL D CG2   1 
ATOM   8605 N N     . SER L 3 183 ? 6.937   -29.981 241.582 1.00 99.87  ? 184 SER D N     1 
ATOM   8606 C CA    . SER L 3 183 ? 5.755   -29.132 241.653 1.00 95.40  ? 184 SER D CA    1 
ATOM   8607 C C     . SER L 3 183 ? 5.728   -28.083 240.551 1.00 91.89  ? 184 SER D C     1 
ATOM   8608 O O     . SER L 3 183 ? 6.724   -27.860 239.862 1.00 87.07  ? 184 SER D O     1 
ATOM   8609 C CB    . SER L 3 183 ? 5.683   -28.446 243.018 1.00 98.93  ? 184 SER D CB    1 
ATOM   8610 O OG    . SER L 3 183 ? 4.707   -27.418 243.027 1.00 99.52  ? 184 SER D OG    1 
ATOM   8611 N N     . THR L 3 184 ? 4.574   -27.441 240.403 1.00 90.67  ? 185 THR D N     1 
ATOM   8612 C CA    . THR L 3 184 ? 4.366   -26.418 239.389 1.00 88.31  ? 185 THR D CA    1 
ATOM   8613 C C     . THR L 3 184 ? 3.457   -25.326 239.930 1.00 84.76  ? 185 THR D C     1 
ATOM   8614 O O     . THR L 3 184 ? 2.382   -25.604 240.463 1.00 88.03  ? 185 THR D O     1 
ATOM   8615 C CB    . THR L 3 184 ? 3.689   -27.005 238.156 1.00 89.67  ? 185 THR D CB    1 
ATOM   8616 O OG1   . THR L 3 184 ? 2.339   -27.366 238.483 1.00 91.67  ? 185 THR D OG1   1 
ATOM   8617 C CG2   . THR L 3 184 ? 4.433   -28.247 237.692 1.00 93.78  ? 185 THR D CG2   1 
ATOM   8618 N N     . SER L 3 185 ? 3.887   -24.081 239.789 1.00 83.60  ? 186 SER D N     1 
ATOM   8619 C CA    . SER L 3 185 ? 3.091   -22.960 240.262 1.00 81.60  ? 186 SER D CA    1 
ATOM   8620 C C     . SER L 3 185 ? 2.483   -22.216 239.085 1.00 76.00  ? 186 SER D C     1 
ATOM   8621 O O     . SER L 3 185 ? 2.554   -22.672 237.943 1.00 78.50  ? 186 SER D O     1 
ATOM   8622 C CB    . SER L 3 185 ? 3.944   -22.007 241.103 1.00 81.93  ? 186 SER D CB    1 
ATOM   8623 O OG    . SER L 3 185 ? 4.417   -22.657 242.270 1.00 83.84  ? 186 SER D OG    1 
ATOM   8624 N N     . PHE L 3 186 ? 1.890   -21.064 239.371 1.00 69.79  ? 187 PHE D N     1 
ATOM   8625 C CA    . PHE L 3 186 ? 1.245   -20.260 238.343 1.00 65.88  ? 187 PHE D CA    1 
ATOM   8626 C C     . PHE L 3 186 ? 0.744   -18.938 238.944 1.00 62.73  ? 187 PHE D C     1 
ATOM   8627 O O     . PHE L 3 186 ? 0.372   -18.878 240.113 1.00 64.49  ? 187 PHE D O     1 
ATOM   8628 C CB    . PHE L 3 186 ? 0.070   -21.046 237.747 1.00 58.05  ? 187 PHE D CB    1 
ATOM   8629 C CG    . PHE L 3 186 ? -0.577  -20.365 236.589 1.00 70.57  ? 187 PHE D CG    1 
ATOM   8630 C CD1   . PHE L 3 186 ? -0.069  -20.522 235.308 1.00 77.90  ? 187 PHE D CD1   1 
ATOM   8631 C CD2   . PHE L 3 186 ? -1.654  -19.503 236.784 1.00 74.97  ? 187 PHE D CD2   1 
ATOM   8632 C CE1   . PHE L 3 186 ? -0.619  -19.824 234.231 1.00 83.69  ? 187 PHE D CE1   1 
ATOM   8633 C CE2   . PHE L 3 186 ? -2.213  -18.799 235.720 1.00 72.77  ? 187 PHE D CE2   1 
ATOM   8634 C CZ    . PHE L 3 186 ? -1.694  -18.959 234.441 1.00 77.84  ? 187 PHE D CZ    1 
ATOM   8635 N N     . ALA L 3 187 ? 0.725   -17.876 238.155 1.00 55.68  ? 188 ALA D N     1 
ATOM   8636 C CA    . ALA L 3 187 ? 0.257   -16.616 238.683 1.00 50.69  ? 188 ALA D CA    1 
ATOM   8637 C C     . ALA L 3 187 ? 0.040   -15.637 237.566 1.00 57.50  ? 188 ALA D C     1 
ATOM   8638 O O     . ALA L 3 187 ? 0.100   -15.996 236.399 1.00 70.26  ? 188 ALA D O     1 
ATOM   8639 C CB    . ALA L 3 187 ? 1.263   -16.073 239.646 1.00 41.58  ? 188 ALA D CB    1 
ATOM   8640 N N     . GLU L 3 188 ? -0.222  -14.392 237.924 1.00 60.50  ? 189 GLU D N     1 
ATOM   8641 C CA    . GLU L 3 188 ? -0.416  -13.368 236.921 1.00 67.41  ? 189 GLU D CA    1 
ATOM   8642 C C     . GLU L 3 188 ? 0.235   -12.078 237.383 1.00 61.84  ? 189 GLU D C     1 
ATOM   8643 O O     . GLU L 3 188 ? 0.017   -11.615 238.496 1.00 60.30  ? 189 GLU D O     1 
ATOM   8644 C CB    . GLU L 3 188 ? -1.905  -13.146 236.652 1.00 79.60  ? 189 GLU D CB    1 
ATOM   8645 C CG    . GLU L 3 188 ? -2.653  -14.373 236.122 1.00 88.00  ? 189 GLU D CG    1 
ATOM   8646 C CD    . GLU L 3 188 ? -3.941  -13.999 235.375 1.00 101.53 ? 189 GLU D CD    1 
ATOM   8647 O OE1   . GLU L 3 188 ? -4.758  -14.905 235.094 1.00 108.92 ? 189 GLU D OE1   1 
ATOM   8648 O OE2   . GLU L 3 188 ? -4.132  -12.800 235.057 1.00 96.01  ? 189 GLU D OE2   1 
ATOM   8649 N N     . LEU L 3 189 ? 1.045   -11.498 236.517 1.00 61.05  ? 190 LEU D N     1 
ATOM   8650 C CA    . LEU L 3 189 ? 1.726   -10.278 236.875 1.00 66.28  ? 190 LEU D CA    1 
ATOM   8651 C C     . LEU L 3 189 ? 0.726   -9.163  237.171 1.00 69.74  ? 190 LEU D C     1 
ATOM   8652 O O     . LEU L 3 189 ? 0.919   -8.381  238.099 1.00 62.89  ? 190 LEU D O     1 
ATOM   8653 C CB    . LEU L 3 189 ? 2.672   -9.868  235.747 1.00 59.15  ? 190 LEU D CB    1 
ATOM   8654 C CG    . LEU L 3 189 ? 3.629   -8.716  236.044 1.00 63.71  ? 190 LEU D CG    1 
ATOM   8655 C CD1   . LEU L 3 189 ? 4.640   -9.144  237.092 1.00 61.79  ? 190 LEU D CD1   1 
ATOM   8656 C CD2   . LEU L 3 189 ? 4.332   -8.292  234.763 1.00 69.82  ? 190 LEU D CD2   1 
ATOM   8657 N N     . PHE L 3 190 ? -0.351  -9.098  236.395 1.00 76.63  ? 191 PHE D N     1 
ATOM   8658 C CA    . PHE L 3 190 ? -1.348  -8.044  236.580 1.00 84.29  ? 191 PHE D CA    1 
ATOM   8659 C C     . PHE L 3 190 ? -2.391  -8.407  237.615 1.00 86.03  ? 191 PHE D C     1 
ATOM   8660 O O     . PHE L 3 190 ? -3.482  -7.833  237.647 1.00 87.97  ? 191 PHE D O     1 
ATOM   8661 C CB    . PHE L 3 190 ? -2.039  -7.729  235.255 1.00 87.78  ? 191 PHE D CB    1 
ATOM   8662 C CG    . PHE L 3 190 ? -1.104  -7.262  234.188 1.00 82.16  ? 191 PHE D CG    1 
ATOM   8663 C CD1   . PHE L 3 190 ? -1.080  -7.892  232.947 1.00 80.35  ? 191 PHE D CD1   1 
ATOM   8664 C CD2   . PHE L 3 190 ? -0.224  -6.215  234.432 1.00 69.91  ? 191 PHE D CD2   1 
ATOM   8665 C CE1   . PHE L 3 190 ? -0.194  -7.490  231.970 1.00 75.77  ? 191 PHE D CE1   1 
ATOM   8666 C CE2   . PHE L 3 190 ? 0.663   -5.807  233.461 1.00 75.21  ? 191 PHE D CE2   1 
ATOM   8667 C CZ    . PHE L 3 190 ? 0.680   -6.447  232.226 1.00 72.54  ? 191 PHE D CZ    1 
ATOM   8668 N N     . LYS L 3 191 ? -2.046  -9.373  238.454 1.00 85.57  ? 192 LYS D N     1 
ATOM   8669 C CA    . LYS L 3 191 ? -2.929  -9.829  239.516 1.00 82.55  ? 192 LYS D CA    1 
ATOM   8670 C C     . LYS L 3 191 ? -2.131  -9.713  240.817 1.00 85.75  ? 192 LYS D C     1 
ATOM   8671 O O     . LYS L 3 191 ? -2.462  -10.336 241.820 1.00 89.33  ? 192 LYS D O     1 
ATOM   8672 C CB    . LYS L 3 191 ? -3.337  -11.289 239.270 1.00 80.52  ? 192 LYS D CB    1 
ATOM   8673 C CG    . LYS L 3 191 ? -4.817  -11.612 239.514 1.00 72.75  ? 192 LYS D CG    1 
ATOM   8674 C CD    . LYS L 3 191 ? -5.720  -10.752 238.628 1.00 80.93  ? 192 LYS D CD    1 
ATOM   8675 C CE    . LYS L 3 191 ? -7.204  -10.960 238.903 1.00 80.42  ? 192 LYS D CE    1 
ATOM   8676 N NZ    . LYS L 3 191 ? -8.046  -10.126 237.998 1.00 78.38  ? 192 LYS D NZ    1 
ATOM   8677 N N     . SER L 3 192 ? -1.070  -8.912  240.780 1.00 84.53  ? 193 SER D N     1 
ATOM   8678 C CA    . SER L 3 192 ? -0.208  -8.693  241.939 1.00 80.76  ? 193 SER D CA    1 
ATOM   8679 C C     . SER L 3 192 ? -0.130  -7.222  242.272 1.00 76.84  ? 193 SER D C     1 
ATOM   8680 O O     . SER L 3 192 ? -0.258  -6.379  241.386 1.00 75.41  ? 193 SER D O     1 
ATOM   8681 C CB    . SER L 3 192 ? 1.209   -9.201  241.662 1.00 85.56  ? 193 SER D CB    1 
ATOM   8682 O OG    . SER L 3 192 ? 2.155   -8.580  242.529 1.00 83.39  ? 193 SER D OG    1 
ATOM   8683 N N     . GLU L 3 193 ? 0.101   -6.914  243.546 1.00 79.17  ? 194 GLU D N     1 
ATOM   8684 C CA    . GLU L 3 193 ? 0.203   -5.521  243.968 1.00 86.24  ? 194 GLU D CA    1 
ATOM   8685 C C     . GLU L 3 193 ? 1.507   -4.944  243.465 1.00 86.35  ? 194 GLU D C     1 
ATOM   8686 O O     . GLU L 3 193 ? 2.563   -5.159  244.057 1.00 78.02  ? 194 GLU D O     1 
ATOM   8687 C CB    . GLU L 3 193 ? 0.160   -5.385  245.483 1.00 92.13  ? 194 GLU D CB    1 
ATOM   8688 C CG    . GLU L 3 193 ? -0.225  -3.984  245.897 1.00 86.25  ? 194 GLU D CG    1 
ATOM   8689 C CD    . GLU L 3 193 ? -1.679  -3.700  245.590 1.00 82.85  ? 194 GLU D CD    1 
ATOM   8690 O OE1   . GLU L 3 193 ? -1.987  -2.567  245.166 1.00 80.34  ? 194 GLU D OE1   1 
ATOM   8691 O OE2   . GLU L 3 193 ? -2.510  -4.619  245.786 1.00 72.35  ? 194 GLU D OE2   1 
ATOM   8692 N N     . PRO L 3 194 ? 1.440   -4.168  242.381 1.00 92.12  ? 195 PRO D N     1 
ATOM   8693 C CA    . PRO L 3 194 ? 2.622   -3.559  241.781 1.00 96.75  ? 195 PRO D CA    1 
ATOM   8694 C C     . PRO L 3 194 ? 3.538   -2.847  242.757 1.00 100.84 ? 195 PRO D C     1 
ATOM   8695 O O     . PRO L 3 194 ? 4.741   -2.732  242.513 1.00 105.34 ? 195 PRO D O     1 
ATOM   8696 C CB    . PRO L 3 194 ? 2.027   -2.622  240.736 1.00 96.84  ? 195 PRO D CB    1 
ATOM   8697 C CG    . PRO L 3 194 ? 0.740   -2.216  241.350 1.00 94.98  ? 195 PRO D CG    1 
ATOM   8698 C CD    . PRO L 3 194 ? 0.216   -3.523  241.876 1.00 93.96  ? 195 PRO D CD    1 
ATOM   8699 N N     . SER L 3 195 ? 2.985   -2.383  243.871 1.00 102.16 ? 196 SER D N     1 
ATOM   8700 C CA    . SER L 3 195 ? 3.794   -1.662  244.849 1.00 99.29  ? 196 SER D CA    1 
ATOM   8701 C C     . SER L 3 195 ? 4.714   -2.589  245.651 1.00 98.62  ? 196 SER D C     1 
ATOM   8702 O O     . SER L 3 195 ? 5.678   -2.133  246.273 1.00 93.71  ? 196 SER D O     1 
ATOM   8703 C CB    . SER L 3 195 ? 2.876   -0.857  245.773 1.00 96.94  ? 196 SER D CB    1 
ATOM   8704 O OG    . SER L 3 195 ? 2.020   -0.014  245.009 1.00 83.44  ? 196 SER D OG    1 
ATOM   8705 N N     . GLU L 3 196 ? 4.421   -3.889  245.607 1.00 99.09  ? 197 GLU D N     1 
ATOM   8706 C CA    . GLU L 3 196 ? 5.203   -4.894  246.320 1.00 96.18  ? 197 GLU D CA    1 
ATOM   8707 C C     . GLU L 3 196 ? 6.161   -5.649  245.405 1.00 89.84  ? 197 GLU D C     1 
ATOM   8708 O O     . GLU L 3 196 ? 6.844   -6.577  245.837 1.00 91.98  ? 197 GLU D O     1 
ATOM   8709 C CB    . GLU L 3 196 ? 4.273   -5.887  247.024 1.00 101.52 ? 197 GLU D CB    1 
ATOM   8710 C CG    . GLU L 3 196 ? 3.557   -5.319  248.245 1.00 115.43 ? 197 GLU D CG    1 
ATOM   8711 C CD    . GLU L 3 196 ? 2.743   -6.369  248.993 1.00 127.23 ? 197 GLU D CD    1 
ATOM   8712 O OE1   . GLU L 3 196 ? 3.334   -7.380  249.440 1.00 131.53 ? 197 GLU D OE1   1 
ATOM   8713 O OE2   . GLU L 3 196 ? 1.512   -6.183  249.142 1.00 130.32 ? 197 GLU D OE2   1 
ATOM   8714 N N     . LEU L 3 197 ? 6.213   -5.248  244.141 1.00 79.83  ? 198 LEU D N     1 
ATOM   8715 C CA    . LEU L 3 197 ? 7.100   -5.887  243.178 1.00 75.18  ? 198 LEU D CA    1 
ATOM   8716 C C     . LEU L 3 197 ? 8.533   -5.415  243.390 1.00 78.20  ? 198 LEU D C     1 
ATOM   8717 O O     . LEU L 3 197 ? 8.851   -4.256  243.145 1.00 84.04  ? 198 LEU D O     1 
ATOM   8718 C CB    . LEU L 3 197 ? 6.647   -5.557  241.758 1.00 61.17  ? 198 LEU D CB    1 
ATOM   8719 C CG    . LEU L 3 197 ? 5.346   -6.255  241.367 1.00 61.93  ? 198 LEU D CG    1 
ATOM   8720 C CD1   . LEU L 3 197 ? 4.812   -5.689  240.067 1.00 60.52  ? 198 LEU D CD1   1 
ATOM   8721 C CD2   . LEU L 3 197 ? 5.586   -7.748  241.255 1.00 52.69  ? 198 LEU D CD2   1 
ATOM   8722 N N     . TYR L 3 198 ? 9.395   -6.313  243.853 1.00 79.43  ? 199 TYR D N     1 
ATOM   8723 C CA    . TYR L 3 198 ? 10.791  -5.972  244.095 1.00 84.39  ? 199 TYR D CA    1 
ATOM   8724 C C     . TYR L 3 198 ? 11.530  -5.721  242.787 1.00 84.28  ? 199 TYR D C     1 
ATOM   8725 O O     . TYR L 3 198 ? 11.349  -6.448  241.813 1.00 87.73  ? 199 TYR D O     1 
ATOM   8726 C CB    . TYR L 3 198 ? 11.490  -7.096  244.864 1.00 86.79  ? 199 TYR D CB    1 
ATOM   8727 C CG    . TYR L 3 198 ? 12.949  -6.825  245.169 1.00 89.72  ? 199 TYR D CG    1 
ATOM   8728 C CD1   . TYR L 3 198 ? 13.919  -7.802  244.939 1.00 91.73  ? 199 TYR D CD1   1 
ATOM   8729 C CD2   . TYR L 3 198 ? 13.360  -5.596  245.690 1.00 91.47  ? 199 TYR D CD2   1 
ATOM   8730 C CE1   . TYR L 3 198 ? 15.261  -7.566  245.215 1.00 92.96  ? 199 TYR D CE1   1 
ATOM   8731 C CE2   . TYR L 3 198 ? 14.703  -5.348  245.973 1.00 97.32  ? 199 TYR D CE2   1 
ATOM   8732 C CZ    . TYR L 3 198 ? 15.648  -6.338  245.732 1.00 97.23  ? 199 TYR D CZ    1 
ATOM   8733 O OH    . TYR L 3 198 ? 16.977  -6.097  246.004 1.00 93.34  ? 199 TYR D OH    1 
ATOM   8734 N N     . ILE L 3 199 ? 12.368  -4.691  242.769 1.00 79.97  ? 200 ILE D N     1 
ATOM   8735 C CA    . ILE L 3 199 ? 13.127  -4.360  241.574 1.00 66.07  ? 200 ILE D CA    1 
ATOM   8736 C C     . ILE L 3 199 ? 14.617  -4.401  241.866 1.00 63.48  ? 200 ILE D C     1 
ATOM   8737 O O     . ILE L 3 199 ? 15.141  -3.574  242.608 1.00 61.91  ? 200 ILE D O     1 
ATOM   8738 C CB    . ILE L 3 199 ? 12.750  -2.963  241.069 1.00 57.64  ? 200 ILE D CB    1 
ATOM   8739 C CG1   . ILE L 3 199 ? 11.286  -2.962  240.650 1.00 44.38  ? 200 ILE D CG1   1 
ATOM   8740 C CG2   . ILE L 3 199 ? 13.661  -2.555  239.929 1.00 50.30  ? 200 ILE D CG2   1 
ATOM   8741 C CD1   . ILE L 3 199 ? 10.781  -1.624  240.191 1.00 46.14  ? 200 ILE D CD1   1 
ATOM   8742 N N     . ASN L 3 200 ? 15.302  -5.373  241.284 1.00 58.46  ? 201 ASN D N     1 
ATOM   8743 C CA    . ASN L 3 200 ? 16.738  -5.504  241.502 1.00 55.50  ? 201 ASN D CA    1 
ATOM   8744 C C     . ASN L 3 200 ? 17.498  -4.838  240.351 1.00 57.91  ? 201 ASN D C     1 
ATOM   8745 O O     . ASN L 3 200 ? 17.820  -5.483  239.355 1.00 51.22  ? 201 ASN D O     1 
ATOM   8746 C CB    . ASN L 3 200 ? 17.100  -6.981  241.589 1.00 36.04  ? 201 ASN D CB    1 
ATOM   8747 C CG    . ASN L 3 200 ? 18.504  -7.197  242.040 1.00 36.57  ? 201 ASN D CG    1 
ATOM   8748 O OD1   . ASN L 3 200 ? 19.279  -6.245  242.187 1.00 42.83  ? 201 ASN D OD1   1 
ATOM   8749 N ND2   . ASN L 3 200 ? 18.858  -8.452  242.266 1.00 34.04  ? 201 ASN D ND2   1 
ATOM   8750 N N     . TRP L 3 201 ? 17.794  -3.549  240.492 1.00 63.74  ? 202 TRP D N     1 
ATOM   8751 C CA    . TRP L 3 201 ? 18.477  -2.809  239.431 1.00 68.98  ? 202 TRP D CA    1 
ATOM   8752 C C     . TRP L 3 201 ? 19.813  -3.385  238.954 1.00 68.56  ? 202 TRP D C     1 
ATOM   8753 O O     . TRP L 3 201 ? 20.206  -3.172  237.811 1.00 68.20  ? 202 TRP D O     1 
ATOM   8754 C CB    . TRP L 3 201 ? 18.643  -1.342  239.849 1.00 74.82  ? 202 TRP D CB    1 
ATOM   8755 C CG    . TRP L 3 201 ? 17.342  -0.708  240.259 1.00 73.81  ? 202 TRP D CG    1 
ATOM   8756 C CD1   . TRP L 3 201 ? 16.780  -0.734  241.497 1.00 72.69  ? 202 TRP D CD1   1 
ATOM   8757 C CD2   . TRP L 3 201 ? 16.417  -0.011  239.413 1.00 79.63  ? 202 TRP D CD2   1 
ATOM   8758 N NE1   . TRP L 3 201 ? 15.562  -0.099  241.485 1.00 75.69  ? 202 TRP D NE1   1 
ATOM   8759 C CE2   . TRP L 3 201 ? 15.313  0.357   240.218 1.00 83.51  ? 202 TRP D CE2   1 
ATOM   8760 C CE3   . TRP L 3 201 ? 16.413  0.340   238.056 1.00 76.33  ? 202 TRP D CE3   1 
ATOM   8761 C CZ2   . TRP L 3 201 ? 14.207  1.056   239.709 1.00 84.73  ? 202 TRP D CZ2   1 
ATOM   8762 C CZ3   . TRP L 3 201 ? 15.316  1.035   237.551 1.00 79.34  ? 202 TRP D CZ3   1 
ATOM   8763 C CH2   . TRP L 3 201 ? 14.229  1.386   238.380 1.00 82.84  ? 202 TRP D CH2   1 
ATOM   8764 N N     . ALA L 3 202 ? 20.507  -4.114  239.822 1.00 69.12  ? 203 ALA D N     1 
ATOM   8765 C CA    . ALA L 3 202 ? 21.785  -4.718  239.458 1.00 61.87  ? 203 ALA D CA    1 
ATOM   8766 C C     . ALA L 3 202 ? 21.550  -6.023  238.703 1.00 66.33  ? 203 ALA D C     1 
ATOM   8767 O O     . ALA L 3 202 ? 22.345  -6.404  237.853 1.00 69.21  ? 203 ALA D O     1 
ATOM   8768 C CB    . ALA L 3 202 ? 22.612  -4.983  240.702 1.00 59.61  ? 203 ALA D CB    1 
ATOM   8769 N N     . ALA L 3 203 ? 20.455  -6.709  239.016 1.00 68.03  ? 204 ALA D N     1 
ATOM   8770 C CA    . ALA L 3 203 ? 20.127  -7.965  238.343 1.00 68.39  ? 204 ALA D CA    1 
ATOM   8771 C C     . ALA L 3 203 ? 19.355  -7.681  237.056 1.00 66.11  ? 204 ALA D C     1 
ATOM   8772 O O     . ALA L 3 203 ? 18.257  -8.205  236.836 1.00 62.35  ? 204 ALA D O     1 
ATOM   8773 C CB    . ALA L 3 203 ? 19.307  -8.862  239.263 1.00 76.80  ? 204 ALA D CB    1 
ATOM   8774 N N     . ALA L 3 204 ? 19.958  -6.844  236.215 1.00 61.46  ? 205 ALA D N     1 
ATOM   8775 C CA    . ALA L 3 204 ? 19.392  -6.436  234.934 1.00 54.50  ? 205 ALA D CA    1 
ATOM   8776 C C     . ALA L 3 204 ? 18.081  -5.719  235.142 1.00 52.15  ? 205 ALA D C     1 
ATOM   8777 O O     . ALA L 3 204 ? 17.108  -6.013  234.466 1.00 61.10  ? 205 ALA D O     1 
ATOM   8778 C CB    . ALA L 3 204 ? 19.182  -7.647  234.026 1.00 58.68  ? 205 ALA D CB    1 
ATOM   8779 N N     . MET L 3 205 ? 18.046  -4.786  236.082 1.00 50.91  ? 206 MET D N     1 
ATOM   8780 C CA    . MET L 3 205 ? 16.824  -4.041  236.336 1.00 53.61  ? 206 MET D CA    1 
ATOM   8781 C C     . MET L 3 205 ? 15.604  -4.963  236.233 1.00 52.67  ? 206 MET D C     1 
ATOM   8782 O O     . MET L 3 205 ? 14.512  -4.547  235.844 1.00 50.43  ? 206 MET D O     1 
ATOM   8783 C CB    . MET L 3 205 ? 16.723  -2.900  235.330 1.00 50.59  ? 206 MET D CB    1 
ATOM   8784 C CG    . MET L 3 205 ? 18.050  -2.179  235.155 1.00 63.62  ? 206 MET D CG    1 
ATOM   8785 S SD    . MET L 3 205 ? 17.925  -0.756  234.075 1.00 73.54  ? 206 MET D SD    1 
ATOM   8786 C CE    . MET L 3 205 ? 17.081  -1.517  232.652 1.00 73.77  ? 206 MET D CE    1 
ATOM   8787 N N     . GLN L 3 206 ? 15.811  -6.217  236.609 1.00 48.72  ? 207 GLN D N     1 
ATOM   8788 C CA    . GLN L 3 206 ? 14.778  -7.247  236.574 1.00 59.21  ? 207 GLN D CA    1 
ATOM   8789 C C     . GLN L 3 206 ? 13.934  -7.326  237.868 1.00 60.36  ? 207 GLN D C     1 
ATOM   8790 O O     . GLN L 3 206 ? 14.449  -7.102  238.962 1.00 60.22  ? 207 GLN D O     1 
ATOM   8791 C CB    . GLN L 3 206 ? 15.448  -8.612  236.329 1.00 57.25  ? 207 GLN D CB    1 
ATOM   8792 C CG    . GLN L 3 206 ? 15.900  -8.872  234.899 1.00 45.23  ? 207 GLN D CG    1 
ATOM   8793 C CD    . GLN L 3 206 ? 14.796  -9.492  234.061 1.00 58.09  ? 207 GLN D CD    1 
ATOM   8794 O OE1   . GLN L 3 206 ? 14.295  -10.569 234.386 1.00 61.32  ? 207 GLN D OE1   1 
ATOM   8795 N NE2   . GLN L 3 206 ? 14.411  -8.820  232.980 1.00 55.91  ? 207 GLN D NE2   1 
ATOM   8796 N N     . ILE L 3 207 ? 12.638  -7.611  237.760 1.00 52.70  ? 208 ILE D N     1 
ATOM   8797 C CA    . ILE L 3 207 ? 11.877  -7.763  238.983 1.00 56.62  ? 208 ILE D CA    1 
ATOM   8798 C C     . ILE L 3 207 ? 12.108  -9.254  239.301 1.00 64.43  ? 208 ILE D C     1 
ATOM   8799 O O     . ILE L 3 207 ? 12.311  -10.052 238.382 1.00 65.95  ? 208 ILE D O     1 
ATOM   8800 C CB    . ILE L 3 207 ? 10.374  -7.465  238.808 1.00 50.50  ? 208 ILE D CB    1 
ATOM   8801 C CG1   . ILE L 3 207 ? 9.666   -8.667  238.201 1.00 57.35  ? 208 ILE D CG1   1 
ATOM   8802 C CG2   . ILE L 3 207 ? 10.187  -6.219  237.969 1.00 45.38  ? 208 ILE D CG2   1 
ATOM   8803 C CD1   . ILE L 3 207 ? 8.172   -8.670  238.426 1.00 58.23  ? 208 ILE D CD1   1 
ATOM   8804 N N     . GLN L 3 208 ? 12.115  -9.626  240.582 1.00 66.75  ? 209 GLN D N     1 
ATOM   8805 C CA    . GLN L 3 208 ? 12.367  -11.012 240.988 1.00 63.44  ? 209 GLN D CA    1 
ATOM   8806 C C     . GLN L 3 208 ? 11.344  -11.476 242.026 1.00 69.81  ? 209 GLN D C     1 
ATOM   8807 O O     . GLN L 3 208 ? 10.851  -10.685 242.842 1.00 70.15  ? 209 GLN D O     1 
ATOM   8808 C CB    . GLN L 3 208 ? 13.782  -11.152 241.585 1.00 58.19  ? 209 GLN D CB    1 
ATOM   8809 C CG    . GLN L 3 208 ? 14.965  -10.842 240.654 1.00 48.33  ? 209 GLN D CG    1 
ATOM   8810 C CD    . GLN L 3 208 ? 16.276  -10.553 241.403 1.00 43.07  ? 209 GLN D CD    1 
ATOM   8811 O OE1   . GLN L 3 208 ? 16.394  -9.549  242.096 1.00 47.67  ? 209 GLN D OE1   1 
ATOM   8812 N NE2   . GLN L 3 208 ? 17.256  -11.434 241.257 1.00 31.27  ? 209 GLN D NE2   1 
ATOM   8813 N N     . PHE L 3 209 ? 11.045  -12.773 241.991 1.00 67.77  ? 210 PHE D N     1 
ATOM   8814 C CA    . PHE L 3 209 ? 10.086  -13.389 242.902 1.00 57.32  ? 210 PHE D CA    1 
ATOM   8815 C C     . PHE L 3 209 ? 9.877   -14.803 242.427 1.00 52.07  ? 210 PHE D C     1 
ATOM   8816 O O     . PHE L 3 209 ? 10.196  -15.127 241.296 1.00 49.01  ? 210 PHE D O     1 
ATOM   8817 C CB    . PHE L 3 209 ? 8.751   -12.624 242.885 1.00 44.58  ? 210 PHE D CB    1 
ATOM   8818 C CG    . PHE L 3 209 ? 7.975   -12.750 241.592 1.00 51.91  ? 210 PHE D CG    1 
ATOM   8819 C CD1   . PHE L 3 209 ? 7.477   -13.988 241.159 1.00 47.68  ? 210 PHE D CD1   1 
ATOM   8820 C CD2   . PHE L 3 209 ? 7.691   -11.610 240.827 1.00 57.26  ? 210 PHE D CD2   1 
ATOM   8821 C CE1   . PHE L 3 209 ? 6.706   -14.086 239.986 1.00 48.59  ? 210 PHE D CE1   1 
ATOM   8822 C CE2   . PHE L 3 209 ? 6.918   -11.686 239.646 1.00 50.71  ? 210 PHE D CE2   1 
ATOM   8823 C CZ    . PHE L 3 209 ? 6.422   -12.928 239.224 1.00 54.54  ? 210 PHE D CZ    1 
ATOM   8824 N N     . HIS L 3 210 ? 9.343   -15.642 243.298 1.00 62.72  ? 211 HIS D N     1 
ATOM   8825 C CA    . HIS L 3 210 ? 9.054   -17.029 242.957 1.00 66.09  ? 211 HIS D CA    1 
ATOM   8826 C C     . HIS L 3 210 ? 7.554   -17.112 242.759 1.00 69.54  ? 211 HIS D C     1 
ATOM   8827 O O     . HIS L 3 210 ? 6.794   -16.590 243.572 1.00 64.21  ? 211 HIS D O     1 
ATOM   8828 C CB    . HIS L 3 210 ? 9.445   -17.946 244.102 1.00 60.33  ? 211 HIS D CB    1 
ATOM   8829 C CG    . HIS L 3 210 ? 10.917  -18.126 244.260 1.00 59.13  ? 211 HIS D CG    1 
ATOM   8830 N ND1   . HIS L 3 210 ? 11.662  -18.906 243.404 1.00 56.67  ? 211 HIS D ND1   1 
ATOM   8831 C CD2   . HIS L 3 210 ? 11.779  -17.652 245.189 1.00 64.38  ? 211 HIS D CD2   1 
ATOM   8832 C CE1   . HIS L 3 210 ? 12.921  -18.908 243.802 1.00 63.25  ? 211 HIS D CE1   1 
ATOM   8833 N NE2   . HIS L 3 210 ? 13.020  -18.155 244.883 1.00 68.87  ? 211 HIS D NE2   1 
ATOM   8834 N N     . VAL L 3 211 ? 7.126   -17.771 241.693 1.00 71.98  ? 212 VAL D N     1 
ATOM   8835 C CA    . VAL L 3 211 ? 5.702   -17.892 241.429 1.00 80.15  ? 212 VAL D CA    1 
ATOM   8836 C C     . VAL L 3 211 ? 4.899   -18.361 242.661 1.00 81.03  ? 212 VAL D C     1 
ATOM   8837 O O     . VAL L 3 211 ? 3.861   -17.779 242.999 1.00 75.43  ? 212 VAL D O     1 
ATOM   8838 C CB    . VAL L 3 211 ? 5.477   -18.823 240.218 1.00 83.18  ? 212 VAL D CB    1 
ATOM   8839 C CG1   . VAL L 3 211 ? 3.994   -18.944 239.882 1.00 85.88  ? 212 VAL D CG1   1 
ATOM   8840 C CG2   . VAL L 3 211 ? 6.232   -18.260 239.026 1.00 78.09  ? 212 VAL D CG2   1 
ATOM   8841 N N     . ARG L 3 212 ? 5.396   -19.376 243.358 1.00 84.45  ? 213 ARG D N     1 
ATOM   8842 C CA    . ARG L 3 212 ? 4.698   -19.893 244.535 1.00 84.10  ? 213 ARG D CA    1 
ATOM   8843 C C     . ARG L 3 212 ? 4.698   -18.950 245.741 1.00 83.09  ? 213 ARG D C     1 
ATOM   8844 O O     . ARG L 3 212 ? 4.321   -19.354 246.839 1.00 87.80  ? 213 ARG D O     1 
ATOM   8845 C CB    . ARG L 3 212 ? 5.309   -21.221 244.975 1.00 82.01  ? 213 ARG D CB    1 
ATOM   8846 C CG    . ARG L 3 212 ? 6.625   -21.048 245.675 1.00 81.47  ? 213 ARG D CG    1 
ATOM   8847 C CD    . ARG L 3 212 ? 6.776   -22.049 246.793 1.00 86.67  ? 213 ARG D CD    1 
ATOM   8848 N NE    . ARG L 3 212 ? 7.017   -23.395 246.294 1.00 88.31  ? 213 ARG D NE    1 
ATOM   8849 C CZ    . ARG L 3 212 ? 7.992   -24.177 246.742 1.00 90.92  ? 213 ARG D CZ    1 
ATOM   8850 N NH1   . ARG L 3 212 ? 8.807   -23.737 247.693 1.00 91.84  ? 213 ARG D NH1   1 
ATOM   8851 N NH2   . ARG L 3 212 ? 8.156   -25.394 246.239 1.00 96.36  ? 213 ARG D NH2   1 
ATOM   8852 N N     . ASP L 3 213 ? 5.120   -17.706 245.547 1.00 79.80  ? 214 ASP D N     1 
ATOM   8853 C CA    . ASP L 3 213 ? 5.175   -16.742 246.643 1.00 76.43  ? 214 ASP D CA    1 
ATOM   8854 C C     . ASP L 3 213 ? 4.810   -15.339 246.160 1.00 77.74  ? 214 ASP D C     1 
ATOM   8855 O O     . ASP L 3 213 ? 5.325   -14.334 246.663 1.00 75.32  ? 214 ASP D O     1 
ATOM   8856 C CB    . ASP L 3 213 ? 6.588   -16.722 247.256 1.00 78.80  ? 214 ASP D CB    1 
ATOM   8857 C CG    . ASP L 3 213 ? 6.881   -17.942 248.131 1.00 80.89  ? 214 ASP D CG    1 
ATOM   8858 O OD1   . ASP L 3 213 ? 6.377   -18.013 249.275 1.00 78.49  ? 214 ASP D OD1   1 
ATOM   8859 O OD2   . ASP L 3 213 ? 7.621   -18.838 247.677 1.00 84.57  ? 214 ASP D OD2   1 
ATOM   8860 N N     . LEU L 3 214 ? 3.924   -15.272 245.173 1.00 80.13  ? 215 LEU D N     1 
ATOM   8861 C CA    . LEU L 3 214 ? 3.500   -13.990 244.617 1.00 77.26  ? 215 LEU D CA    1 
ATOM   8862 C C     . LEU L 3 214 ? 2.072   -13.677 245.017 1.00 79.14  ? 215 LEU D C     1 
ATOM   8863 O O     . LEU L 3 214 ? 1.180   -14.520 244.896 1.00 75.18  ? 215 LEU D O     1 
ATOM   8864 C CB    . LEU L 3 214 ? 3.595   -14.000 243.091 1.00 68.41  ? 215 LEU D CB    1 
ATOM   8865 C CG    . LEU L 3 214 ? 3.048   -12.728 242.451 1.00 59.85  ? 215 LEU D CG    1 
ATOM   8866 C CD1   . LEU L 3 214 ? 4.025   -11.556 242.664 1.00 49.03  ? 215 LEU D CD1   1 
ATOM   8867 C CD2   . LEU L 3 214 ? 2.807   -12.988 240.976 1.00 58.71  ? 215 LEU D CD2   1 
ATOM   8868 N N     . ASP L 3 215 ? 1.864   -12.453 245.482 1.00 83.37  ? 216 ASP D N     1 
ATOM   8869 C CA    . ASP L 3 215 ? 0.546   -12.006 245.908 1.00 88.49  ? 216 ASP D CA    1 
ATOM   8870 C C     . ASP L 3 215 ? -0.437  -11.869 244.733 1.00 85.38  ? 216 ASP D C     1 
ATOM   8871 O O     . ASP L 3 215 ? -0.045  -11.550 243.616 1.00 84.46  ? 216 ASP D O     1 
ATOM   8872 C CB    . ASP L 3 215 ? 0.690   -10.690 246.680 1.00 94.50  ? 216 ASP D CB    1 
ATOM   8873 C CG    . ASP L 3 215 ? 1.744   -9.774  246.080 1.00 103.70 ? 216 ASP D CG    1 
ATOM   8874 O OD1   . ASP L 3 215 ? 1.465   -9.138  245.044 1.00 108.24 ? 216 ASP D OD1   1 
ATOM   8875 O OD2   . ASP L 3 215 ? 2.861   -9.694  246.637 1.00 110.41 ? 216 ASP D OD2   1 
ATOM   8876 N N     . GLN L 3 216 ? -1.713  -12.140 244.991 1.00 85.77  ? 217 GLN D N     1 
ATOM   8877 C CA    . GLN L 3 216 ? -2.734  -12.055 243.957 1.00 83.54  ? 217 GLN D CA    1 
ATOM   8878 C C     . GLN L 3 216 ? -3.869  -11.137 244.371 1.00 87.74  ? 217 GLN D C     1 
ATOM   8879 O O     . GLN L 3 216 ? -4.948  -11.124 243.770 1.00 85.90  ? 217 GLN D O     1 
ATOM   8880 C CB    . GLN L 3 216 ? -3.260  -13.448 243.632 1.00 78.56  ? 217 GLN D CB    1 
ATOM   8881 C CG    . GLN L 3 216 ? -2.202  -14.295 242.949 1.00 77.04  ? 217 GLN D CG    1 
ATOM   8882 C CD    . GLN L 3 216 ? -1.734  -13.670 241.650 1.00 74.08  ? 217 GLN D CD    1 
ATOM   8883 O OE1   . GLN L 3 216 ? -2.477  -13.624 240.673 1.00 67.67  ? 217 GLN D OE1   1 
ATOM   8884 N NE2   . GLN L 3 216 ? -0.506  -13.168 241.639 1.00 70.96  ? 217 GLN D NE2   1 
ATOM   8885 N N     . GLY L 3 217 ? -3.602  -10.350 245.406 1.00 92.42  ? 218 GLY D N     1 
ATOM   8886 C CA    . GLY L 3 217 ? -4.594  -9.422  245.899 1.00 91.29  ? 218 GLY D CA    1 
ATOM   8887 C C     . GLY L 3 217 ? -4.582  -8.115  245.138 1.00 90.99  ? 218 GLY D C     1 
ATOM   8888 O O     . GLY L 3 217 ? -3.772  -7.227  245.431 1.00 90.26  ? 218 GLY D O     1 
ATOM   8889 N N     . PHE L 3 218 ? -5.473  -7.998  244.155 1.00 85.95  ? 219 PHE D N     1 
ATOM   8890 C CA    . PHE L 3 218 ? -5.577  -6.777  243.365 1.00 85.35  ? 219 PHE D CA    1 
ATOM   8891 C C     . PHE L 3 218 ? -6.840  -6.757  242.529 1.00 89.39  ? 219 PHE D C     1 
ATOM   8892 O O     . PHE L 3 218 ? -6.842  -7.242  241.400 1.00 92.17  ? 219 PHE D O     1 
ATOM   8893 C CB    . PHE L 3 218 ? -4.387  -6.647  242.438 1.00 81.87  ? 219 PHE D CB    1 
ATOM   8894 C CG    . PHE L 3 218 ? -4.373  -5.377  241.662 1.00 77.52  ? 219 PHE D CG    1 
ATOM   8895 C CD1   . PHE L 3 218 ? -3.819  -4.230  242.209 1.00 70.81  ? 219 PHE D CD1   1 
ATOM   8896 C CD2   . PHE L 3 218 ? -4.909  -5.324  240.377 1.00 85.48  ? 219 PHE D CD2   1 
ATOM   8897 C CE1   . PHE L 3 218 ? -3.790  -3.041  241.491 1.00 82.84  ? 219 PHE D CE1   1 
ATOM   8898 C CE2   . PHE L 3 218 ? -4.889  -4.138  239.643 1.00 96.41  ? 219 PHE D CE2   1 
ATOM   8899 C CZ    . PHE L 3 218 ? -4.325  -2.990  240.202 1.00 93.06  ? 219 PHE D CZ    1 
ATOM   8900 N N     . ASN L 3 219 ? -7.907  -6.180  243.076 1.00 94.80  ? 220 ASN D N     1 
ATOM   8901 C CA    . ASN L 3 219 ? -9.188  -6.107  242.377 1.00 98.77  ? 220 ASN D CA    1 
ATOM   8902 C C     . ASN L 3 219 ? -9.425  -4.725  241.772 1.00 103.05 ? 220 ASN D C     1 
ATOM   8903 O O     . ASN L 3 219 ? -10.570 -4.325  241.559 1.00 107.55 ? 220 ASN D O     1 
ATOM   8904 C CB    . ASN L 3 219 ? -10.331 -6.463  243.334 1.00 96.03  ? 220 ASN D CB    1 
ATOM   8905 N N     . GLY L 3 220 ? -8.336  -4.006  241.495 1.00 104.28 ? 221 GLY D N     1 
ATOM   8906 C CA    . GLY L 3 220 ? -8.436  -2.676  240.914 1.00 98.28  ? 221 GLY D CA    1 
ATOM   8907 C C     . GLY L 3 220 ? -8.534  -2.704  239.400 1.00 100.03 ? 221 GLY D C     1 
ATOM   8908 O O     . GLY L 3 220 ? -9.080  -3.642  238.813 1.00 105.29 ? 221 GLY D O     1 
ATOM   8909 N N     . THR L 3 221 ? -7.991  -1.681  238.756 1.00 93.40  ? 222 THR D N     1 
ATOM   8910 C CA    . THR L 3 221 ? -8.049  -1.594  237.301 1.00 87.70  ? 222 THR D CA    1 
ATOM   8911 C C     . THR L 3 221 ? -6.682  -1.724  236.625 1.00 83.50  ? 222 THR D C     1 
ATOM   8912 O O     . THR L 3 221 ? -5.649  -1.513  237.256 1.00 83.01  ? 222 THR D O     1 
ATOM   8913 C CB    . THR L 3 221 ? -8.710  -0.269  236.891 1.00 84.85  ? 222 THR D CB    1 
ATOM   8914 O OG1   . THR L 3 221 ? -8.250  0.114   235.593 1.00 87.64  ? 222 THR D OG1   1 
ATOM   8915 C CG2   . THR L 3 221 ? -8.385  0.821   237.901 1.00 77.37  ? 222 THR D CG2   1 
ATOM   8916 N N     . ARG L 3 222 ? -6.674  -2.076  235.342 1.00 76.85  ? 223 ARG D N     1 
ATOM   8917 C CA    . ARG L 3 222 ? -5.409  -2.229  234.637 1.00 78.02  ? 223 ARG D CA    1 
ATOM   8918 C C     . ARG L 3 222 ? -4.733  -0.885  234.527 1.00 82.28  ? 223 ARG D C     1 
ATOM   8919 O O     . ARG L 3 222 ? -3.520  -0.770  234.734 1.00 89.07  ? 223 ARG D O     1 
ATOM   8920 C CB    . ARG L 3 222 ? -5.604  -2.822  233.237 1.00 67.23  ? 223 ARG D CB    1 
ATOM   8921 C CG    . ARG L 3 222 ? -4.327  -3.402  232.622 1.00 69.44  ? 223 ARG D CG    1 
ATOM   8922 C CD    . ARG L 3 222 ? -3.558  -4.328  233.600 1.00 80.03  ? 223 ARG D CD    1 
ATOM   8923 N NE    . ARG L 3 222 ? -4.431  -5.277  234.301 1.00 81.02  ? 223 ARG D NE    1 
ATOM   8924 C CZ    . ARG L 3 222 ? -4.768  -6.485  233.856 1.00 73.86  ? 223 ARG D CZ    1 
ATOM   8925 N NH1   . ARG L 3 222 ? -4.298  -6.934  232.691 1.00 55.44  ? 223 ARG D NH1   1 
ATOM   8926 N NH2   . ARG L 3 222 ? -5.603  -7.225  234.581 1.00 63.24  ? 223 ARG D NH2   1 
ATOM   8927 N N     . GLU L 3 223 ? -5.517  0.138   234.201 1.00 82.89  ? 224 GLU D N     1 
ATOM   8928 C CA    . GLU L 3 223 ? -4.977  1.489   234.084 1.00 82.35  ? 224 GLU D CA    1 
ATOM   8929 C C     . GLU L 3 223 ? -4.215  1.790   235.375 1.00 83.29  ? 224 GLU D C     1 
ATOM   8930 O O     . GLU L 3 223 ? -3.052  2.197   235.356 1.00 81.77  ? 224 GLU D O     1 
ATOM   8931 C CB    . GLU L 3 223 ? -6.112  2.506   233.892 1.00 75.91  ? 224 GLU D CB    1 
ATOM   8932 N N     . GLU L 3 224 ? -4.882  1.565   236.501 1.00 81.53  ? 225 GLU D N     1 
ATOM   8933 C CA    . GLU L 3 224 ? -4.276  1.812   237.790 1.00 79.47  ? 225 GLU D CA    1 
ATOM   8934 C C     . GLU L 3 224 ? -2.981  1.017   237.911 1.00 78.68  ? 225 GLU D C     1 
ATOM   8935 O O     . GLU L 3 224 ? -1.918  1.589   238.168 1.00 78.07  ? 225 GLU D O     1 
ATOM   8936 C CB    . GLU L 3 224 ? -5.252  1.433   238.902 1.00 81.77  ? 225 GLU D CB    1 
ATOM   8937 N N     . TRP L 3 225 ? -3.074  -0.299  237.718 1.00 76.28  ? 226 TRP D N     1 
ATOM   8938 C CA    . TRP L 3 225 ? -1.910  -1.183  237.790 1.00 71.05  ? 226 TRP D CA    1 
ATOM   8939 C C     . TRP L 3 225 ? -0.759  -0.535  237.025 1.00 68.62  ? 226 TRP D C     1 
ATOM   8940 O O     . TRP L 3 225 ? 0.378   -0.489  237.498 1.00 69.09  ? 226 TRP D O     1 
ATOM   8941 C CB    . TRP L 3 225 ? -2.237  -2.546  237.163 1.00 68.97  ? 226 TRP D CB    1 
ATOM   8942 C CG    . TRP L 3 225 ? -1.340  -3.642  237.642 1.00 68.21  ? 226 TRP D CG    1 
ATOM   8943 C CD1   . TRP L 3 225 ? -1.668  -4.649  238.505 1.00 56.79  ? 226 TRP D CD1   1 
ATOM   8944 C CD2   . TRP L 3 225 ? 0.058   -3.796  237.359 1.00 70.48  ? 226 TRP D CD2   1 
ATOM   8945 N NE1   . TRP L 3 225 ? -0.562  -5.412  238.787 1.00 55.38  ? 226 TRP D NE1   1 
ATOM   8946 C CE2   . TRP L 3 225 ? 0.513   -4.909  238.100 1.00 69.23  ? 226 TRP D CE2   1 
ATOM   8947 C CE3   . TRP L 3 225 ? 0.978   -3.091  236.559 1.00 67.94  ? 226 TRP D CE3   1 
ATOM   8948 C CZ2   . TRP L 3 225 ? 1.848   -5.343  238.056 1.00 73.23  ? 226 TRP D CZ2   1 
ATOM   8949 C CZ3   . TRP L 3 225 ? 2.303   -3.522  236.517 1.00 60.94  ? 226 TRP D CZ3   1 
ATOM   8950 C CH2   . TRP L 3 225 ? 2.725   -4.633  237.265 1.00 68.66  ? 226 TRP D CH2   1 
ATOM   8951 N N     . ALA L 3 226 ? -1.068  -0.022  235.841 1.00 62.06  ? 227 ALA D N     1 
ATOM   8952 C CA    . ALA L 3 226 ? -0.063  0.631   235.014 1.00 67.62  ? 227 ALA D CA    1 
ATOM   8953 C C     . ALA L 3 226 ? 0.479   1.897   235.674 1.00 66.59  ? 227 ALA D C     1 
ATOM   8954 O O     . ALA L 3 226 ? 1.687   2.120   235.736 1.00 51.68  ? 227 ALA D O     1 
ATOM   8955 C CB    . ALA L 3 226 ? -0.659  0.967   233.667 1.00 74.95  ? 227 ALA D CB    1 
ATOM   8956 N N     . LYS L 3 227 ? -0.439  2.730   236.148 1.00 74.03  ? 228 LYS D N     1 
ATOM   8957 C CA    . LYS L 3 227 ? -0.083  3.972   236.810 1.00 77.44  ? 228 LYS D CA    1 
ATOM   8958 C C     . LYS L 3 227 ? 0.735   3.663   238.045 1.00 74.25  ? 228 LYS D C     1 
ATOM   8959 O O     . LYS L 3 227 ? 1.917   3.992   238.120 1.00 69.98  ? 228 LYS D O     1 
ATOM   8960 C CB    . LYS L 3 227 ? -1.348  4.730   237.215 1.00 84.62  ? 228 LYS D CB    1 
ATOM   8961 C CG    . LYS L 3 227 ? -1.939  5.601   236.125 1.00 92.56  ? 228 LYS D CG    1 
ATOM   8962 C CD    . LYS L 3 227 ? -1.135  6.884   235.973 1.00 103.78 ? 228 LYS D CD    1 
ATOM   8963 C CE    . LYS L 3 227 ? -1.779  7.840   234.976 1.00 110.48 ? 228 LYS D CE    1 
ATOM   8964 N NZ    . LYS L 3 227 ? -3.173  8.218   235.363 1.00 113.06 ? 228 LYS D NZ    1 
ATOM   8965 N N     . SER L 3 228 ? 0.088   3.021   239.009 1.00 73.00  ? 229 SER D N     1 
ATOM   8966 C CA    . SER L 3 228 ? 0.734   2.664   240.261 1.00 78.34  ? 229 SER D CA    1 
ATOM   8967 C C     . SER L 3 228 ? 2.151   2.129   240.073 1.00 80.49  ? 229 SER D C     1 
ATOM   8968 O O     . SER L 3 228 ? 3.071   2.522   240.798 1.00 78.21  ? 229 SER D O     1 
ATOM   8969 C CB    . SER L 3 228 ? -0.106  1.633   241.010 1.00 73.72  ? 229 SER D CB    1 
ATOM   8970 O OG    . SER L 3 228 ? -0.386  0.524   240.179 1.00 81.20  ? 229 SER D OG    1 
ATOM   8971 N N     . TYR L 3 229 ? 2.341   1.241   239.101 1.00 78.79  ? 230 TYR D N     1 
ATOM   8972 C CA    . TYR L 3 229 ? 3.670   0.686   238.896 1.00 77.01  ? 230 TYR D CA    1 
ATOM   8973 C C     . TYR L 3 229 ? 4.668   1.775   238.550 1.00 80.07  ? 230 TYR D C     1 
ATOM   8974 O O     . TYR L 3 229 ? 5.766   1.829   239.116 1.00 73.90  ? 230 TYR D O     1 
ATOM   8975 C CB    . TYR L 3 229 ? 3.668   -0.360  237.785 1.00 69.24  ? 230 TYR D CB    1 
ATOM   8976 C CG    . TYR L 3 229 ? 5.043   -0.934  237.509 1.00 67.22  ? 230 TYR D CG    1 
ATOM   8977 C CD1   . TYR L 3 229 ? 5.724   -1.656  238.484 1.00 54.35  ? 230 TYR D CD1   1 
ATOM   8978 C CD2   . TYR L 3 229 ? 5.655   -0.766  236.262 1.00 69.68  ? 230 TYR D CD2   1 
ATOM   8979 C CE1   . TYR L 3 229 ? 6.978   -2.205  238.230 1.00 66.40  ? 230 TYR D CE1   1 
ATOM   8980 C CE2   . TYR L 3 229 ? 6.915   -1.311  235.992 1.00 72.53  ? 230 TYR D CE2   1 
ATOM   8981 C CZ    . TYR L 3 229 ? 7.574   -2.035  236.983 1.00 71.90  ? 230 TYR D CZ    1 
ATOM   8982 O OH    . TYR L 3 229 ? 8.815   -2.597  236.733 1.00 56.18  ? 230 TYR D OH    1 
ATOM   8983 N N     . LEU L 3 230 ? 4.275   2.641   237.617 1.00 82.15  ? 231 LEU D N     1 
ATOM   8984 C CA    . LEU L 3 230 ? 5.139   3.727   237.156 1.00 79.71  ? 231 LEU D CA    1 
ATOM   8985 C C     . LEU L 3 230 ? 5.626   4.567   238.328 1.00 79.91  ? 231 LEU D C     1 
ATOM   8986 O O     . LEU L 3 230 ? 6.749   5.081   238.319 1.00 79.52  ? 231 LEU D O     1 
ATOM   8987 C CB    . LEU L 3 230 ? 4.403   4.586   236.112 1.00 73.43  ? 231 LEU D CB    1 
ATOM   8988 C CG    . LEU L 3 230 ? 4.127   3.866   234.772 1.00 73.44  ? 231 LEU D CG    1 
ATOM   8989 C CD1   . LEU L 3 230 ? 3.218   4.702   233.882 1.00 70.74  ? 231 LEU D CD1   1 
ATOM   8990 C CD2   . LEU L 3 230 ? 5.443   3.573   234.070 1.00 53.66  ? 231 LEU D CD2   1 
ATOM   8991 N N     . LYS L 3 231 ? 4.786   4.688   239.350 1.00 79.63  ? 232 LYS D N     1 
ATOM   8992 C CA    . LYS L 3 231 ? 5.166   5.439   240.534 1.00 71.28  ? 232 LYS D CA    1 
ATOM   8993 C C     . LYS L 3 231 ? 6.198   4.598   241.281 1.00 65.85  ? 232 LYS D C     1 
ATOM   8994 O O     . LYS L 3 231 ? 7.250   5.100   241.691 1.00 53.35  ? 232 LYS D O     1 
ATOM   8995 C CB    . LYS L 3 231 ? 3.944   5.703   241.412 1.00 73.72  ? 232 LYS D CB    1 
ATOM   8996 C CG    . LYS L 3 231 ? 4.310   6.332   242.736 1.00 79.42  ? 232 LYS D CG    1 
ATOM   8997 C CD    . LYS L 3 231 ? 3.163   7.079   243.380 1.00 73.27  ? 232 LYS D CD    1 
ATOM   8998 C CE    . LYS L 3 231 ? 3.707   7.873   244.544 1.00 73.32  ? 232 LYS D CE    1 
ATOM   8999 N NZ    . LYS L 3 231 ? 4.970   8.561   244.135 1.00 67.73  ? 232 LYS D NZ    1 
ATOM   9000 N N     . HIS L 3 232 ? 5.898   3.309   241.433 1.00 62.11  ? 233 HIS D N     1 
ATOM   9001 C CA    . HIS L 3 232 ? 6.818   2.396   242.097 1.00 65.55  ? 233 HIS D CA    1 
ATOM   9002 C C     . HIS L 3 232 ? 8.132   2.302   241.315 1.00 71.76  ? 233 HIS D C     1 
ATOM   9003 O O     . HIS L 3 232 ? 9.225   2.336   241.902 1.00 70.76  ? 233 HIS D O     1 
ATOM   9004 C CB    . HIS L 3 232 ? 6.206   1.004   242.214 1.00 60.49  ? 233 HIS D CB    1 
ATOM   9005 C CG    . HIS L 3 232 ? 7.109   0.011   242.881 1.00 60.47  ? 233 HIS D CG    1 
ATOM   9006 N ND1   . HIS L 3 232 ? 7.729   0.262   244.087 1.00 71.71  ? 233 HIS D ND1   1 
ATOM   9007 C CD2   . HIS L 3 232 ? 7.517   -1.221  242.500 1.00 61.83  ? 233 HIS D CD2   1 
ATOM   9008 C CE1   . HIS L 3 232 ? 8.483   -0.772  244.418 1.00 71.06  ? 233 HIS D CE1   1 
ATOM   9009 N NE2   . HIS L 3 232 ? 8.373   -1.686  243.471 1.00 60.10  ? 233 HIS D NE2   1 
ATOM   9010 N N     . PHE L 3 233 ? 8.019   2.178   239.990 1.00 75.76  ? 234 PHE D N     1 
ATOM   9011 C CA    . PHE L 3 233 ? 9.190   2.089   239.112 1.00 78.69  ? 234 PHE D CA    1 
ATOM   9012 C C     . PHE L 3 233 ? 10.058  3.350   239.155 1.00 74.63  ? 234 PHE D C     1 
ATOM   9013 O O     . PHE L 3 233 ? 11.289  3.257   239.104 1.00 66.53  ? 234 PHE D O     1 
ATOM   9014 C CB    . PHE L 3 233 ? 8.764   1.807   237.657 1.00 76.18  ? 234 PHE D CB    1 
ATOM   9015 C CG    . PHE L 3 233 ? 9.904   1.897   236.664 1.00 70.48  ? 234 PHE D CG    1 
ATOM   9016 C CD1   . PHE L 3 233 ? 10.215  3.098   236.038 1.00 76.29  ? 234 PHE D CD1   1 
ATOM   9017 C CD2   . PHE L 3 233 ? 10.684  0.794   236.382 1.00 64.97  ? 234 PHE D CD2   1 
ATOM   9018 C CE1   . PHE L 3 233 ? 11.296  3.196   235.149 1.00 72.51  ? 234 PHE D CE1   1 
ATOM   9019 C CE2   . PHE L 3 233 ? 11.759  0.885   235.499 1.00 68.05  ? 234 PHE D CE2   1 
ATOM   9020 C CZ    . PHE L 3 233 ? 12.061  2.089   234.881 1.00 69.33  ? 234 PHE D CZ    1 
ATOM   9021 N N     . VAL L 3 234 ? 9.411   4.515   239.235 1.00 73.00  ? 235 VAL D N     1 
ATOM   9022 C CA    . VAL L 3 234 ? 10.116  5.798   239.293 1.00 79.79  ? 235 VAL D CA    1 
ATOM   9023 C C     . VAL L 3 234 ? 10.655  6.067   240.701 1.00 79.90  ? 235 VAL D C     1 
ATOM   9024 O O     . VAL L 3 234 ? 11.721  6.678   240.874 1.00 75.41  ? 235 VAL D O     1 
ATOM   9025 C CB    . VAL L 3 234 ? 9.201   6.977   238.886 1.00 74.90  ? 235 VAL D CB    1 
ATOM   9026 C CG1   . VAL L 3 234 ? 9.927   8.292   239.108 1.00 72.87  ? 235 VAL D CG1   1 
ATOM   9027 C CG2   . VAL L 3 234 ? 8.816   6.856   237.433 1.00 68.32  ? 235 VAL D CG2   1 
ATOM   9028 N N     . THR L 3 235 ? 9.900   5.608   241.695 1.00 78.32  ? 236 THR D N     1 
ATOM   9029 C CA    . THR L 3 235 ? 10.265  5.755   243.098 1.00 79.08  ? 236 THR D CA    1 
ATOM   9030 C C     . THR L 3 235 ? 11.617  5.093   243.354 1.00 81.18  ? 236 THR D C     1 
ATOM   9031 O O     . THR L 3 235 ? 12.579  5.732   243.792 1.00 83.17  ? 236 THR D O     1 
ATOM   9032 C CB    . THR L 3 235 ? 9.207   5.087   244.005 1.00 73.90  ? 236 THR D CB    1 
ATOM   9033 O OG1   . THR L 3 235 ? 8.000   5.853   243.978 1.00 83.69  ? 236 THR D OG1   1 
ATOM   9034 C CG2   . THR L 3 235 ? 9.706   4.978   245.424 1.00 69.21  ? 236 THR D CG2   1 
ATOM   9035 N N     . GLN L 3 236 ? 11.678  3.800   243.069 1.00 81.01  ? 237 GLN D N     1 
ATOM   9036 C CA    . GLN L 3 236 ? 12.893  3.033   243.263 1.00 79.47  ? 237 GLN D CA    1 
ATOM   9037 C C     . GLN L 3 236 ? 13.990  3.531   242.341 1.00 80.45  ? 237 GLN D C     1 
ATOM   9038 O O     . GLN L 3 236 ? 15.171  3.350   242.614 1.00 79.51  ? 237 GLN D O     1 
ATOM   9039 C CB    . GLN L 3 236 ? 12.593  1.566   243.000 1.00 75.72  ? 237 GLN D CB    1 
ATOM   9040 C CG    . GLN L 3 236 ? 11.312  1.163   243.669 1.00 67.92  ? 237 GLN D CG    1 
ATOM   9041 C CD    . GLN L 3 236 ? 11.343  1.463   245.158 1.00 75.07  ? 237 GLN D CD    1 
ATOM   9042 O OE1   . GLN L 3 236 ? 10.305  1.469   245.828 1.00 75.58  ? 237 GLN D OE1   1 
ATOM   9043 N NE2   . GLN L 3 236 ? 12.544  1.705   245.688 1.00 61.51  ? 237 GLN D NE2   1 
ATOM   9044 N N     . ALA L 3 237 ? 13.590  4.156   241.241 1.00 81.91  ? 238 ALA D N     1 
ATOM   9045 C CA    . ALA L 3 237 ? 14.550  4.689   240.295 1.00 83.29  ? 238 ALA D CA    1 
ATOM   9046 C C     . ALA L 3 237 ? 15.315  5.776   241.031 1.00 88.20  ? 238 ALA D C     1 
ATOM   9047 O O     . ALA L 3 237 ? 16.538  5.881   240.930 1.00 91.77  ? 238 ALA D O     1 
ATOM   9048 C CB    . ALA L 3 237 ? 13.832  5.269   239.087 1.00 77.40  ? 238 ALA D CB    1 
ATOM   9049 N N     . GLU L 3 238 ? 14.588  6.586   241.787 1.00 92.99  ? 239 GLU D N     1 
ATOM   9050 C CA    . GLU L 3 238 ? 15.222  7.652   242.541 1.00 95.00  ? 239 GLU D CA    1 
ATOM   9051 C C     . GLU L 3 238 ? 15.917  7.064   243.756 1.00 94.30  ? 239 GLU D C     1 
ATOM   9052 O O     . GLU L 3 238 ? 17.060  7.404   244.046 1.00 97.15  ? 239 GLU D O     1 
ATOM   9053 C CB    . GLU L 3 238 ? 14.179  8.693   242.956 1.00 97.43  ? 239 GLU D CB    1 
ATOM   9054 C CG    . GLU L 3 238 ? 14.357  10.032  242.254 1.00 96.03  ? 239 GLU D CG    1 
ATOM   9055 C CD    . GLU L 3 238 ? 13.072  10.827  242.171 1.00 100.07 ? 239 GLU D CD    1 
ATOM   9056 O OE1   . GLU L 3 238 ? 13.121  11.979  241.694 1.00 104.94 ? 239 GLU D OE1   1 
ATOM   9057 O OE2   . GLU L 3 238 ? 12.012  10.301  242.571 1.00 92.51  ? 239 GLU D OE2   1 
ATOM   9058 N N     . GLN L 3 239 ? 15.232  6.167   244.456 1.00 94.00  ? 240 GLN D N     1 
ATOM   9059 C CA    . GLN L 3 239 ? 15.815  5.538   245.631 1.00 95.14  ? 240 GLN D CA    1 
ATOM   9060 C C     . GLN L 3 239 ? 17.132  4.828   245.280 1.00 93.97  ? 240 GLN D C     1 
ATOM   9061 O O     . GLN L 3 239 ? 18.160  5.071   245.912 1.00 93.06  ? 240 GLN D O     1 
ATOM   9062 C CB    . GLN L 3 239 ? 14.818  4.552   246.243 1.00 95.52  ? 240 GLN D CB    1 
ATOM   9063 N N     . ARG L 3 240 ? 17.098  3.961   244.271 1.00 94.66  ? 241 ARG D N     1 
ATOM   9064 C CA    . ARG L 3 240 ? 18.283  3.223   243.835 1.00 94.92  ? 241 ARG D CA    1 
ATOM   9065 C C     . ARG L 3 240 ? 19.455  4.151   243.553 1.00 95.69  ? 241 ARG D C     1 
ATOM   9066 O O     . ARG L 3 240 ? 20.544  3.968   244.099 1.00 98.83  ? 241 ARG D O     1 
ATOM   9067 C CB    . ARG L 3 240 ? 17.965  2.419   242.575 1.00 95.62  ? 241 ARG D CB    1 
ATOM   9068 C CG    . ARG L 3 240 ? 19.182  1.971   241.789 1.00 94.07  ? 241 ARG D CG    1 
ATOM   9069 C CD    . ARG L 3 240 ? 20.083  1.051   242.586 1.00 87.01  ? 241 ARG D CD    1 
ATOM   9070 N NE    . ARG L 3 240 ? 21.145  0.550   241.726 1.00 90.13  ? 241 ARG D NE    1 
ATOM   9071 C CZ    . ARG L 3 240 ? 22.108  -0.272  242.118 1.00 94.16  ? 241 ARG D CZ    1 
ATOM   9072 N NH1   . ARG L 3 240 ? 22.152  -0.695  243.371 1.00 102.72 ? 241 ARG D NH1   1 
ATOM   9073 N NH2   . ARG L 3 240 ? 23.031  -0.667  241.253 1.00 92.02  ? 241 ARG D NH2   1 
ATOM   9074 N N     . ALA L 3 241 ? 19.222  5.135   242.687 1.00 92.16  ? 242 ALA D N     1 
ATOM   9075 C CA    . ALA L 3 241 ? 20.238  6.114   242.321 1.00 89.02  ? 242 ALA D CA    1 
ATOM   9076 C C     . ALA L 3 241 ? 20.947  6.613   243.577 1.00 90.49  ? 242 ALA D C     1 
ATOM   9077 O O     . ALA L 3 241 ? 22.178  6.671   243.629 1.00 84.73  ? 242 ALA D O     1 
ATOM   9078 C CB    . ALA L 3 241 ? 19.589  7.273   241.594 1.00 90.04  ? 242 ALA D CB    1 
ATOM   9079 N N     . ILE L 3 242 ? 20.149  6.964   244.585 1.00 91.84  ? 243 ILE D N     1 
ATOM   9080 C CA    . ILE L 3 242 ? 20.658  7.441   245.868 1.00 95.51  ? 243 ILE D CA    1 
ATOM   9081 C C     . ILE L 3 242 ? 21.403  6.333   246.606 1.00 99.00  ? 243 ILE D C     1 
ATOM   9082 O O     . ILE L 3 242 ? 22.542  6.522   247.025 1.00 102.18 ? 243 ILE D O     1 
ATOM   9083 C CB    . ILE L 3 242 ? 19.512  7.948   246.785 1.00 94.32  ? 243 ILE D CB    1 
ATOM   9084 C CG1   . ILE L 3 242 ? 18.929  9.242   246.226 1.00 94.85  ? 243 ILE D CG1   1 
ATOM   9085 C CG2   . ILE L 3 242 ? 20.031  8.203   248.188 1.00 88.40  ? 243 ILE D CG2   1 
ATOM   9086 C CD1   . ILE L 3 242 ? 19.930  10.375  246.169 1.00 101.00 ? 243 ILE D CD1   1 
ATOM   9087 N N     . SER L 3 243 ? 20.764  5.178   246.765 1.00 99.54  ? 244 SER D N     1 
ATOM   9088 C CA    . SER L 3 243 ? 21.391  4.064   247.471 1.00 105.17 ? 244 SER D CA    1 
ATOM   9089 C C     . SER L 3 243 ? 22.507  3.403   246.652 1.00 110.12 ? 244 SER D C     1 
ATOM   9090 O O     . SER L 3 243 ? 22.842  2.231   246.862 1.00 110.27 ? 244 SER D O     1 
ATOM   9091 C CB    . SER L 3 243 ? 20.336  3.023   247.851 1.00 102.03 ? 244 SER D CB    1 
ATOM   9092 O OG    . SER L 3 243 ? 20.895  2.006   248.665 1.00 100.79 ? 244 SER D OG    1 
ATOM   9093 N N     . MET L 3 244 ? 23.091  4.172   245.734 1.00 110.76 ? 245 MET D N     1 
ATOM   9094 C CA    . MET L 3 244 ? 24.161  3.683   244.869 1.00 108.70 ? 245 MET D CA    1 
ATOM   9095 C C     . MET L 3 244 ? 25.459  4.466   245.101 1.00 111.09 ? 245 MET D C     1 
ATOM   9096 O O     . MET L 3 244 ? 26.547  3.877   245.147 1.00 105.08 ? 245 MET D O     1 
ATOM   9097 C CB    . MET L 3 244 ? 23.714  3.798   243.402 1.00 105.67 ? 245 MET D CB    1 
ATOM   9098 C CG    . MET L 3 244 ? 24.541  3.001   242.399 1.00 94.65  ? 245 MET D CG    1 
ATOM   9099 S SD    . MET L 3 244 ? 23.805  2.999   240.743 1.00 89.91  ? 245 MET D SD    1 
ATOM   9100 C CE    . MET L 3 244 ? 24.224  4.638   240.168 1.00 82.23  ? 245 MET D CE    1 
ATOM   9101 N N     . ILE L 3 245 ? 25.337  5.789   245.248 1.00 113.89 ? 246 ILE D N     1 
ATOM   9102 C CA    . ILE L 3 245 ? 26.493  6.666   245.483 1.00 114.21 ? 246 ILE D CA    1 
ATOM   9103 C C     . ILE L 3 245 ? 26.990  6.584   246.911 1.00 116.69 ? 246 ILE D C     1 
ATOM   9104 O O     . ILE L 3 245 ? 27.787  7.412   247.347 1.00 116.94 ? 246 ILE D O     1 
ATOM   9105 C CB    . ILE L 3 245 ? 26.185  8.161   245.208 1.00 106.84 ? 246 ILE D CB    1 
ATOM   9106 C CG1   . ILE L 3 245 ? 24.837  8.546   245.819 1.00 98.75  ? 246 ILE D CG1   1 
ATOM   9107 C CG2   . ILE L 3 245 ? 26.261  8.441   243.724 1.00 108.31 ? 246 ILE D CG2   1 
ATOM   9108 C CD1   . ILE L 3 245 ? 24.475  10.001  245.635 1.00 88.06  ? 246 ILE D CD1   1 
ATOM   9109 N N     . ASP L 3 246 ? 26.510  5.578   247.630 1.00 121.63 ? 247 ASP D N     1 
ATOM   9110 C CA    . ASP L 3 246 ? 26.888  5.375   249.019 1.00 122.76 ? 247 ASP D CA    1 
ATOM   9111 C C     . ASP L 3 246 ? 27.170  3.908   249.292 1.00 118.03 ? 247 ASP D C     1 
ATOM   9112 O O     . ASP L 3 246 ? 27.385  3.508   250.435 1.00 119.88 ? 247 ASP D O     1 
ATOM   9113 C CB    . ASP L 3 246 ? 25.771  5.877   249.939 1.00 132.20 ? 247 ASP D CB    1 
ATOM   9114 C CG    . ASP L 3 246 ? 24.420  5.264   249.610 1.00 140.21 ? 247 ASP D CG    1 
ATOM   9115 O OD1   . ASP L 3 246 ? 23.395  5.793   250.096 1.00 144.23 ? 247 ASP D OD1   1 
ATOM   9116 O OD2   . ASP L 3 246 ? 24.378  4.252   248.874 1.00 147.42 ? 247 ASP D OD2   1 
ATOM   9117 N N     . LYS L 3 247 ? 27.158  3.099   248.240 1.00 110.48 ? 248 LYS D N     1 
ATOM   9118 C CA    . LYS L 3 247 ? 27.430  1.680   248.402 1.00 101.54 ? 248 LYS D CA    1 
ATOM   9119 C C     . LYS L 3 247 ? 28.630  1.340   247.521 1.00 99.19  ? 248 LYS D C     1 
ATOM   9120 O O     . LYS L 3 247 ? 29.290  0.319   247.727 1.00 97.08  ? 248 LYS D O     1 
ATOM   9121 C CB    . LYS L 3 247 ? 26.190  0.857   248.013 1.00 91.92  ? 248 LYS D CB    1 
ATOM   9122 C CG    . LYS L 3 247 ? 26.151  -0.576  248.548 1.00 66.69  ? 248 LYS D CG    1 
ATOM   9123 C CD    . LYS L 3 247 ? 24.780  -1.189  248.252 1.00 70.40  ? 248 LYS D CD    1 
ATOM   9124 C CE    . LYS L 3 247 ? 24.617  -2.649  248.734 1.00 69.46  ? 248 LYS D CE    1 
ATOM   9125 N NZ    . LYS L 3 247 ? 25.572  -3.658  248.140 1.00 54.57  ? 248 LYS D NZ    1 
ATOM   9126 N N     . PHE L 3 248 ? 28.922  2.227   246.564 1.00 96.26  ? 249 PHE D N     1 
ATOM   9127 C CA    . PHE L 3 248 ? 30.037  2.052   245.626 1.00 91.67  ? 249 PHE D CA    1 
ATOM   9128 C C     . PHE L 3 248 ? 30.929  3.307   245.549 1.00 91.69  ? 249 PHE D C     1 
ATOM   9129 O O     . PHE L 3 248 ? 32.159  3.202   245.499 1.00 87.78  ? 249 PHE D O     1 
ATOM   9130 C CB    . PHE L 3 248 ? 29.495  1.735   244.220 1.00 83.66  ? 249 PHE D CB    1 
ATOM   9131 C CG    . PHE L 3 248 ? 28.354  0.741   244.210 1.00 74.73  ? 249 PHE D CG    1 
ATOM   9132 C CD1   . PHE L 3 248 ? 28.558  -0.589  244.575 1.00 64.98  ? 249 PHE D CD1   1 
ATOM   9133 C CD2   . PHE L 3 248 ? 27.068  1.146   243.862 1.00 72.51  ? 249 PHE D CD2   1 
ATOM   9134 C CE1   . PHE L 3 248 ? 27.501  -1.496  244.604 1.00 57.33  ? 249 PHE D CE1   1 
ATOM   9135 C CE2   . PHE L 3 248 ? 26.003  0.244   243.888 1.00 66.29  ? 249 PHE D CE2   1 
ATOM   9136 C CZ    . PHE L 3 248 ? 26.223  -1.080  244.260 1.00 63.42  ? 249 PHE D CZ    1 
ATOM   9137 N N     . VAL L 3 249 ? 30.288  4.481   245.540 1.00 94.47  ? 250 VAL D N     1 
ATOM   9138 C CA    . VAL L 3 249 ? 30.956  5.792   245.454 1.00 93.28  ? 250 VAL D CA    1 
ATOM   9139 C C     . VAL L 3 249 ? 31.708  6.222   246.717 1.00 96.28  ? 250 VAL D C     1 
ATOM   9140 O O     . VAL L 3 249 ? 32.915  5.993   246.854 1.00 97.72  ? 250 VAL D O     1 
ATOM   9141 C CB    . VAL L 3 249 ? 29.936  6.921   245.132 1.00 92.08  ? 250 VAL D CB    1 
ATOM   9142 C CG1   . VAL L 3 249 ? 30.640  8.267   245.083 1.00 91.80  ? 250 VAL D CG1   1 
ATOM   9143 C CG2   . VAL L 3 249 ? 29.248  6.648   243.815 1.00 95.94  ? 250 VAL D CG2   1 
ATOM   9144 N N     . LYS L 3 250 ? 30.976  6.865   247.625 1.00 92.90  ? 251 LYS D N     1 
ATOM   9145 C CA    . LYS L 3 250 ? 31.526  7.355   248.884 1.00 85.78  ? 251 LYS D CA    1 
ATOM   9146 C C     . LYS L 3 250 ? 32.507  6.388   249.549 1.00 84.63  ? 251 LYS D C     1 
ATOM   9147 O O     . LYS L 3 250 ? 33.637  6.758   249.848 1.00 83.44  ? 251 LYS D O     1 
ATOM   9148 C CB    . LYS L 3 250 ? 30.387  7.682   249.855 1.00 77.15  ? 251 LYS D CB    1 
ATOM   9149 N N     . PRO L 3 251 ? 32.089  5.130   249.777 1.00 85.77  ? 252 PRO D N     1 
ATOM   9150 C CA    . PRO L 3 251 ? 32.947  4.124   250.414 1.00 82.95  ? 252 PRO D CA    1 
ATOM   9151 C C     . PRO L 3 251 ? 34.351  4.017   249.856 1.00 84.93  ? 252 PRO D C     1 
ATOM   9152 O O     . PRO L 3 251 ? 35.292  3.782   250.600 1.00 86.52  ? 252 PRO D O     1 
ATOM   9153 C CB    . PRO L 3 251 ? 32.175  2.831   250.211 1.00 84.02  ? 252 PRO D CB    1 
ATOM   9154 C CG    . PRO L 3 251 ? 30.761  3.287   250.242 1.00 91.70  ? 252 PRO D CG    1 
ATOM   9155 C CD    . PRO L 3 251 ? 30.789  4.542   249.406 1.00 84.68  ? 252 PRO D CD    1 
ATOM   9156 N N     . PHE L 3 252 ? 34.499  4.175   248.547 1.00 88.75  ? 253 PHE D N     1 
ATOM   9157 C CA    . PHE L 3 252 ? 35.818  4.060   247.942 1.00 90.86  ? 253 PHE D CA    1 
ATOM   9158 C C     . PHE L 3 252 ? 36.481  5.406   247.667 1.00 93.95  ? 253 PHE D C     1 
ATOM   9159 O O     . PHE L 3 252 ? 37.671  5.459   247.348 1.00 90.77  ? 253 PHE D O     1 
ATOM   9160 C CB    . PHE L 3 252 ? 35.742  3.257   246.637 1.00 87.09  ? 253 PHE D CB    1 
ATOM   9161 C CG    . PHE L 3 252 ? 35.329  1.827   246.819 1.00 71.69  ? 253 PHE D CG    1 
ATOM   9162 C CD1   . PHE L 3 252 ? 34.004  1.500   247.059 1.00 69.07  ? 253 PHE D CD1   1 
ATOM   9163 C CD2   . PHE L 3 252 ? 36.270  0.804   246.741 1.00 71.83  ? 253 PHE D CD2   1 
ATOM   9164 C CE1   . PHE L 3 252 ? 33.614  0.169   247.220 1.00 73.22  ? 253 PHE D CE1   1 
ATOM   9165 C CE2   . PHE L 3 252 ? 35.893  -0.538  246.901 1.00 71.52  ? 253 PHE D CE2   1 
ATOM   9166 C CZ    . PHE L 3 252 ? 34.563  -0.853  247.142 1.00 73.15  ? 253 PHE D CZ    1 
ATOM   9167 N N     . LYS L 3 253 ? 35.713  6.488   247.800 1.00 97.97  ? 254 LYS D N     1 
ATOM   9168 C CA    . LYS L 3 253 ? 36.215  7.847   247.549 1.00 103.30 ? 254 LYS D CA    1 
ATOM   9169 C C     . LYS L 3 253 ? 37.424  8.203   248.428 1.00 108.10 ? 254 LYS D C     1 
ATOM   9170 O O     . LYS L 3 253 ? 37.978  9.307   248.332 1.00 109.24 ? 254 LYS D O     1 
ATOM   9171 C CB    . LYS L 3 253 ? 35.086  8.866   247.772 1.00 99.41  ? 254 LYS D CB    1 
ATOM   9172 C CG    . LYS L 3 253 ? 35.282  10.205  247.069 1.00 99.39  ? 254 LYS D CG    1 
ATOM   9173 C CD    . LYS L 3 253 ? 34.087  11.135  247.290 1.00 100.80 ? 254 LYS D CD    1 
ATOM   9174 C CE    . LYS L 3 253 ? 33.985  12.228  246.212 1.00 102.46 ? 254 LYS D CE    1 
ATOM   9175 N NZ    . LYS L 3 253 ? 35.150  13.158  246.147 1.00 97.97  ? 254 LYS D NZ    1 
ATOM   9176 N N     . LYS L 3 254 ? 37.823  7.255   249.278 1.00 108.99 ? 255 LYS D N     1 
ATOM   9177 C CA    . LYS L 3 254 ? 38.952  7.414   250.192 1.00 106.08 ? 255 LYS D CA    1 
ATOM   9178 C C     . LYS L 3 254 ? 40.282  7.389   249.441 1.00 109.37 ? 255 LYS D C     1 
ATOM   9179 O O     . LYS L 3 254 ? 41.243  8.052   249.838 1.00 111.39 ? 255 LYS D O     1 
ATOM   9180 C CB    . LYS L 3 254 ? 38.933  6.291   251.234 1.00 99.51  ? 255 LYS D CB    1 
ATOM   9181 N N     . TYR L 3 255 ? 40.324  6.616   248.356 1.00 111.45 ? 256 TYR D N     1 
ATOM   9182 C CA    . TYR L 3 255 ? 41.525  6.469   247.530 1.00 107.32 ? 256 TYR D CA    1 
ATOM   9183 C C     . TYR L 3 255 ? 41.763  7.672   246.626 1.00 103.89 ? 256 TYR D C     1 
ATOM   9184 O O     . TYR L 3 255 ? 42.837  7.811   246.046 1.00 101.36 ? 256 TYR D O     1 
ATOM   9185 C CB    . TYR L 3 255 ? 41.416  5.200   246.682 1.00 107.56 ? 256 TYR D CB    1 
ATOM   9186 C CG    . TYR L 3 255 ? 41.311  3.926   247.495 1.00 109.90 ? 256 TYR D CG    1 
ATOM   9187 C CD1   . TYR L 3 255 ? 42.453  3.206   247.862 1.00 111.52 ? 256 TYR D CD1   1 
ATOM   9188 C CD2   . TYR L 3 255 ? 40.069  3.442   247.907 1.00 110.86 ? 256 TYR D CD2   1 
ATOM   9189 C CE1   . TYR L 3 255 ? 42.355  2.031   248.616 1.00 107.07 ? 256 TYR D CE1   1 
ATOM   9190 C CE2   . TYR L 3 255 ? 39.964  2.276   248.663 1.00 108.48 ? 256 TYR D CE2   1 
ATOM   9191 C CZ    . TYR L 3 255 ? 41.104  1.578   249.010 1.00 104.47 ? 256 TYR D CZ    1 
ATOM   9192 O OH    . TYR L 3 255 ? 40.981  0.429   249.745 1.00 100.01 ? 256 TYR D OH    1 
ATOM   9193 N N     . ILE L 3 256 ? 40.756  8.534   246.505 1.00 103.29 ? 257 ILE D N     1 
ATOM   9194 C CA    . ILE L 3 256 ? 40.865  9.731   245.676 1.00 103.41 ? 257 ILE D CA    1 
ATOM   9195 C C     . ILE L 3 256 ? 40.514  10.987  246.472 1.00 98.94  ? 257 ILE D C     1 
ATOM   9196 C CB    . ILE L 3 256 ? 39.933  9.654   244.442 1.00 102.49 ? 257 ILE D CB    1 
ATOM   9197 C CG1   . ILE L 3 256 ? 38.469  9.629   244.876 1.00 101.50 ? 257 ILE D CG1   1 
ATOM   9198 C CG2   . ILE L 3 256 ? 40.232  8.401   243.646 1.00 103.53 ? 257 ILE D CG2   1 
ATOM   9199 C CD1   . ILE L 3 256 ? 37.499  9.794   243.722 1.00 96.20  ? 257 ILE D CD1   1 
HETATM 9200 O O     . HOH M 4 .   ? 37.641  16.344  199.919 1.00 51.77  ? 8   HOH E O     1 
HETATM 9201 O O     . HOH M 4 .   ? 16.847  8.514   216.644 1.00 88.39  ? 9   HOH E O     1 
HETATM 9202 O O     . HOH M 4 .   ? 20.481  11.524  211.669 1.00 42.95  ? 10  HOH E O     1 
HETATM 9203 O O     . HOH M 4 .   ? 24.715  16.725  210.943 1.00 31.04  ? 11  HOH E O     1 
HETATM 9204 O O     . HOH M 4 .   ? 18.523  5.822   213.286 1.00 91.97  ? 12  HOH E O     1 
HETATM 9205 O O     . HOH M 4 .   ? 13.903  4.259   221.474 1.00 57.37  ? 13  HOH E O     1 
HETATM 9206 O O     . HOH M 4 .   ? 14.359  7.938   215.372 1.00 69.88  ? 14  HOH E O     1 
HETATM 9207 O O     . HOH M 4 .   ? 18.864  11.440  217.094 1.00 41.79  ? 15  HOH E O     1 
HETATM 9208 O O     . HOH M 4 .   ? 19.797  12.060  215.144 1.00 26.15  ? 16  HOH E O     1 
HETATM 9209 O O     . HOH M 4 .   ? 13.030  4.052   216.344 1.00 58.97  ? 17  HOH E O     1 
HETATM 9210 O O     . HOH M 4 .   ? 12.438  9.765   216.528 1.00 80.34  ? 18  HOH E O     1 
HETATM 9211 O O     . HOH M 4 .   ? 30.852  14.465  204.175 1.00 46.07  ? 19  HOH E O     1 
HETATM 9212 O O     . HOH M 4 .   ? 13.263  7.973   222.492 1.00 58.97  ? 20  HOH E O     1 
HETATM 9213 O O     . HOH N 4 .   ? 23.010  44.173  201.293 1.00 35.02  ? 44  HOH F O     1 
HETATM 9214 O O     . HOH N 4 .   ? 22.299  38.827  196.616 1.00 47.26  ? 45  HOH F O     1 
HETATM 9215 O O     . HOH N 4 .   ? 37.642  13.980  197.365 1.00 56.36  ? 98  HOH F O     1 
HETATM 9216 O O     . HOH N 4 .   ? 33.347  26.953  193.418 1.00 58.32  ? 103 HOH F O     1 
HETATM 9217 O O     . HOH N 4 .   ? 27.012  38.271  210.995 1.00 35.64  ? 156 HOH F O     1 
HETATM 9218 O O     . HOH N 4 .   ? 19.001  43.652  208.580 1.00 50.10  ? 203 HOH F O     1 
HETATM 9219 O O     . HOH N 4 .   ? 16.532  46.289  209.706 1.00 55.18  ? 204 HOH F O     1 
HETATM 9220 O O     . HOH N 4 .   ? 17.993  49.105  210.430 1.00 59.16  ? 205 HOH F O     1 
HETATM 9221 O O     . HOH N 4 .   ? 27.596  42.112  195.532 1.00 71.77  ? 278 HOH F O     1 
HETATM 9222 O O     . HOH N 4 .   ? 36.343  21.540  200.934 1.00 54.73  ? 452 HOH F O     1 
HETATM 9223 O O     . HOH N 4 .   ? 30.490  41.468  201.056 1.00 40.63  ? 453 HOH F O     1 
HETATM 9224 O O     . HOH O 4 .   ? 23.277  35.321  206.814 1.00 40.53  ? 29  HOH G O     1 
HETATM 9225 O O     . HOH O 4 .   ? 37.746  41.258  204.564 1.00 32.78  ? 30  HOH G O     1 
HETATM 9226 O O     . HOH O 4 .   ? 16.289  25.467  203.422 1.00 44.99  ? 50  HOH G O     1 
HETATM 9227 O O     . HOH O 4 .   ? 37.560  37.945  205.941 1.00 33.62  ? 118 HOH G O     1 
HETATM 9228 O O     . HOH O 4 .   ? 28.011  33.506  216.863 1.00 40.68  ? 119 HOH G O     1 
HETATM 9229 O O     . HOH O 4 .   ? 26.529  36.182  208.874 1.00 41.49  ? 157 HOH G O     1 
HETATM 9230 O O     . HOH O 4 .   ? 35.102  47.879  202.908 1.00 60.09  ? 275 HOH G O     1 
HETATM 9231 O O     . HOH O 4 .   ? 26.804  33.262  202.238 1.00 27.43  ? 279 HOH G O     1 
HETATM 9232 O O     . HOH O 4 .   ? 38.871  35.713  217.357 1.00 37.29  ? 287 HOH G O     1 
HETATM 9233 O O     . HOH O 4 .   ? 28.966  36.506  216.779 1.00 55.64  ? 289 HOH G O     1 
HETATM 9234 O O     . HOH O 4 .   ? 34.588  41.510  219.541 1.00 74.92  ? 291 HOH G O     1 
HETATM 9235 O O     . HOH O 4 .   ? 25.366  28.318  201.243 1.00 62.79  ? 401 HOH G O     1 
HETATM 9236 O O     . HOH O 4 .   ? 24.610  35.244  212.204 1.00 50.68  ? 531 HOH G O     1 
HETATM 9237 O O     . HOH O 4 .   ? 40.869  40.549  203.627 1.00 36.92  ? 543 HOH G O     1 
HETATM 9238 O O     . HOH P 4 .   ? 26.971  10.958  207.495 1.00 38.95  ? 55  HOH H O     1 
HETATM 9239 O O     . HOH P 4 .   ? 29.151  9.546   206.474 1.00 30.39  ? 56  HOH H O     1 
HETATM 9240 O O     . HOH P 4 .   ? 38.718  6.514   214.423 1.00 46.46  ? 86  HOH H O     1 
HETATM 9241 O O     . HOH P 4 .   ? 41.352  6.444   215.274 1.00 46.59  ? 87  HOH H O     1 
HETATM 9242 O O     . HOH P 4 .   ? 39.026  8.802   216.845 1.00 57.76  ? 88  HOH H O     1 
HETATM 9243 O O     . HOH P 4 .   ? 33.541  2.990   202.538 1.00 40.14  ? 96  HOH H O     1 
HETATM 9244 O O     . HOH P 4 .   ? 18.018  27.128  196.784 1.00 36.44  ? 158 HOH H O     1 
HETATM 9245 O O     . HOH P 4 .   ? 24.908  1.872   208.942 1.00 31.93  ? 159 HOH H O     1 
HETATM 9246 O O     . HOH P 4 .   ? 27.318  1.570   207.668 1.00 46.87  ? 195 HOH H O     1 
HETATM 9247 O O     . HOH P 4 .   ? 33.722  4.303   205.566 1.00 44.71  ? 265 HOH H O     1 
HETATM 9248 O O     . HOH P 4 .   ? 28.713  3.372   201.781 1.00 60.22  ? 373 HOH H O     1 
HETATM 9249 O O     . HOH P 4 .   ? 18.462  20.131  198.149 1.00 61.66  ? 381 HOH H O     1 
HETATM 9250 O O     . HOH P 4 .   ? 31.076  4.241   202.464 1.00 41.37  ? 442 HOH H O     1 
HETATM 9251 O O     . HOH P 4 .   ? 29.963  9.350   200.073 1.00 48.34  ? 443 HOH H O     1 
HETATM 9252 O O     . HOH P 4 .   ? 28.510  9.614   217.053 1.00 40.83  ? 530 HOH H O     1 
HETATM 9253 O O     . HOH Q 4 .   ? 13.599  -2.393  225.740 1.00 69.22  ? 22  HOH I O     1 
HETATM 9254 O O     . HOH Q 4 .   ? 37.174  2.985   218.438 1.00 41.30  ? 31  HOH I O     1 
HETATM 9255 O O     . HOH Q 4 .   ? 31.364  11.178  211.973 1.00 28.34  ? 91  HOH I O     1 
HETATM 9256 O O     . HOH Q 4 .   ? 15.007  -0.327  224.928 1.00 52.11  ? 148 HOH I O     1 
HETATM 9257 O O     . HOH Q 4 .   ? 35.197  2.772   220.837 1.00 39.45  ? 160 HOH I O     1 
HETATM 9258 O O     . HOH Q 4 .   ? 35.361  7.675   226.032 1.00 41.19  ? 161 HOH I O     1 
HETATM 9259 O O     . HOH Q 4 .   ? 31.491  6.968   229.578 1.00 54.23  ? 162 HOH I O     1 
HETATM 9260 O O     . HOH Q 4 .   ? 29.128  8.150   226.674 1.00 58.18  ? 163 HOH I O     1 
HETATM 9261 O O     . HOH Q 4 .   ? 12.561  -3.559  223.863 1.00 65.94  ? 164 HOH I O     1 
HETATM 9262 O O     . HOH Q 4 .   ? 32.681  7.997   226.718 1.00 59.18  ? 363 HOH I O     1 
HETATM 9263 O O     . HOH Q 4 .   ? 21.191  -0.383  224.909 1.00 45.66  ? 504 HOH I O     1 
HETATM 9264 O O     . HOH Q 4 .   ? 12.259  -16.137 229.660 1.00 59.01  ? 508 HOH I O     1 
HETATM 9265 O O     . HOH Q 4 .   ? 11.023  -11.996 229.941 1.00 59.68  ? 509 HOH I O     1 
HETATM 9266 O O     . HOH Q 4 .   ? 29.880  11.461  216.072 1.00 49.46  ? 529 HOH I O     1 
HETATM 9267 O O     . HOH Q 4 .   ? 35.391  10.104  227.148 1.00 52.12  ? 533 HOH I O     1 
HETATM 9268 O O     . HOH R 4 .   ? 21.270  -16.560 244.793 1.00 37.39  ? 169 HOH J O     1 
HETATM 9269 O O     . HOH R 4 .   ? 19.461  -18.975 252.748 1.00 53.37  ? 347 HOH J O     1 
HETATM 9270 O O     . HOH S 4 .   ? 33.020  -18.497 235.777 1.00 74.43  ? 8   HOH K O     1 
HETATM 9271 O O     . HOH S 4 .   ? 22.506  -9.980  246.919 1.00 56.10  ? 9   HOH K O     1 
HETATM 9272 O O     . HOH S 4 .   ? 11.459  -7.877  249.273 1.00 51.34  ? 10  HOH K O     1 
HETATM 9273 O O     . HOH S 4 .   ? 20.765  -1.122  248.711 1.00 80.58  ? 11  HOH K O     1 
HETATM 9274 O O     . HOH S 4 .   ? 14.365  -17.618 255.594 1.00 46.58  ? 12  HOH K O     1 
HETATM 9275 O O     . HOH S 4 .   ? 13.503  -9.133  257.883 1.00 36.47  ? 13  HOH K O     1 
HETATM 9276 O O     . HOH S 4 .   ? 7.755   -10.792 248.872 1.00 63.13  ? 14  HOH K O     1 
HETATM 9277 O O     . HOH S 4 .   ? 14.037  -11.235 246.948 1.00 50.30  ? 15  HOH K O     1 
HETATM 9278 O O     . HOH S 4 .   ? 12.582  -12.532 250.161 1.00 55.25  ? 16  HOH K O     1 
HETATM 9279 O O     . HOH T 4 .   ? 33.036  -18.467 232.456 1.00 48.63  ? 3   HOH L O     1 
HETATM 9280 O O     . HOH T 4 .   ? 20.662  -10.999 225.686 1.00 48.16  ? 32  HOH L O     1 
HETATM 9281 O O     . HOH T 4 .   ? 27.490  -18.128 229.796 1.00 34.70  ? 34  HOH L O     1 
HETATM 9282 O O     . HOH T 4 .   ? 10.449  7.045   212.578 1.00 39.19  ? 70  HOH L O     1 
HETATM 9283 O O     . HOH T 4 .   ? 25.922  -17.188 221.970 1.00 40.87  ? 132 HOH L O     1 
HETATM 9284 O O     . HOH T 4 .   ? 20.414  -8.502  221.254 1.00 47.38  ? 165 HOH L O     1 
HETATM 9285 O O     . HOH T 4 .   ? 12.551  5.392   212.337 1.00 51.92  ? 224 HOH L O     1 
HETATM 9286 O O     . HOH T 4 .   ? 16.732  -7.609  215.983 1.00 35.89  ? 517 HOH L O     1 
HETATM 9287 O O     . HOH T 4 .   ? 18.190  0.705   213.870 1.00 37.59  ? 527 HOH L O     1 
HETATM 9288 O O     . HOH U 4 .   ? 1.384   25.475  178.623 1.00 47.43  ? 259 HOH A O     1 
HETATM 9289 O O     . HOH U 4 .   ? 17.055  55.708  194.098 1.00 48.49  ? 260 HOH A O     1 
HETATM 9290 O O     . HOH U 4 .   ? -5.435  14.830  190.885 1.00 57.57  ? 261 HOH A O     1 
HETATM 9291 O O     . HOH U 4 .   ? -3.204  19.626  187.427 1.00 31.92  ? 262 HOH A O     1 
HETATM 9292 O O     . HOH U 4 .   ? 3.009   36.984  195.892 1.00 26.77  ? 263 HOH A O     1 
HETATM 9293 O O     . HOH U 4 .   ? 4.415   37.922  189.894 1.00 48.40  ? 264 HOH A O     1 
HETATM 9294 O O     . HOH U 4 .   ? 16.652  51.738  193.317 1.00 35.72  ? 265 HOH A O     1 
HETATM 9295 O O     . HOH U 4 .   ? 8.087   44.134  205.684 1.00 35.07  ? 266 HOH A O     1 
HETATM 9296 O O     . HOH U 4 .   ? 9.795   42.422  212.235 1.00 31.23  ? 267 HOH A O     1 
HETATM 9297 O O     . HOH U 4 .   ? 19.755  53.286  194.289 1.00 39.73  ? 268 HOH A O     1 
HETATM 9298 O O     . HOH U 4 .   ? 15.471  49.951  188.555 1.00 55.00  ? 269 HOH A O     1 
HETATM 9299 O O     . HOH U 4 .   ? 14.292  48.503  186.291 1.00 25.05  ? 270 HOH A O     1 
HETATM 9300 O O     . HOH U 4 .   ? -3.090  38.680  198.037 1.00 27.32  ? 271 HOH A O     1 
HETATM 9301 O O     . HOH U 4 .   ? 17.069  21.753  199.213 1.00 28.27  ? 272 HOH A O     1 
HETATM 9302 O O     . HOH U 4 .   ? 19.793  6.747   203.090 1.00 59.03  ? 273 HOH A O     1 
HETATM 9303 O O     . HOH U 4 .   ? 23.682  4.506   192.636 1.00 32.80  ? 274 HOH A O     1 
HETATM 9304 O O     . HOH U 4 .   ? 22.914  1.372   192.018 1.00 35.71  ? 275 HOH A O     1 
HETATM 9305 O O     . HOH U 4 .   ? 3.496   29.351  209.308 1.00 47.24  ? 276 HOH A O     1 
HETATM 9306 O O     . HOH U 4 .   ? 3.972   22.846  207.378 1.00 27.62  ? 277 HOH A O     1 
HETATM 9307 O O     . HOH U 4 .   ? 8.085   6.255   199.637 1.00 29.50  ? 278 HOH A O     1 
HETATM 9308 O O     . HOH U 4 .   ? 4.507   10.735  201.148 1.00 29.21  ? 279 HOH A O     1 
HETATM 9309 O O     . HOH U 4 .   ? 1.238   12.216  201.240 1.00 39.88  ? 280 HOH A O     1 
HETATM 9310 O O     . HOH U 4 .   ? 9.106   14.346  223.374 1.00 65.64  ? 281 HOH A O     1 
HETATM 9311 O O     . HOH U 4 .   ? 25.906  18.897  215.749 1.00 33.72  ? 282 HOH A O     1 
HETATM 9312 O O     . HOH U 4 .   ? 24.331  18.735  218.631 1.00 18.43  ? 283 HOH A O     1 
HETATM 9313 O O     . HOH U 4 .   ? 27.912  17.838  220.431 1.00 32.07  ? 284 HOH A O     1 
HETATM 9314 O O     . HOH U 4 .   ? 18.040  3.583   202.470 1.00 29.83  ? 285 HOH A O     1 
HETATM 9315 O O     . HOH U 4 .   ? 7.203   6.559   210.207 1.00 42.39  ? 286 HOH A O     1 
HETATM 9316 O O     . HOH U 4 .   ? 5.459   8.773   208.207 1.00 35.70  ? 287 HOH A O     1 
HETATM 9317 O O     . HOH U 4 .   ? -3.184  30.394  214.283 1.00 35.29  ? 288 HOH A O     1 
HETATM 9318 O O     . HOH U 4 .   ? -0.694  35.651  219.677 1.00 70.26  ? 289 HOH A O     1 
HETATM 9319 O O     . HOH U 4 .   ? 16.067  16.528  220.472 1.00 22.09  ? 290 HOH A O     1 
HETATM 9320 O O     . HOH U 4 .   ? 29.860  4.686   198.744 1.00 26.36  ? 291 HOH A O     1 
HETATM 9321 O O     . HOH U 4 .   ? 21.384  39.435  216.804 1.00 57.08  ? 292 HOH A O     1 
HETATM 9322 O O     . HOH U 4 .   ? 18.273  38.908  215.242 1.00 35.11  ? 293 HOH A O     1 
HETATM 9323 O O     . HOH U 4 .   ? -2.726  25.638  201.234 1.00 25.54  ? 294 HOH A O     1 
HETATM 9324 O O     . HOH U 4 .   ? -4.363  16.797  185.537 1.00 72.68  ? 295 HOH A O     1 
HETATM 9325 O O     . HOH U 4 .   ? 5.937   6.946   197.368 1.00 40.42  ? 296 HOH A O     1 
HETATM 9326 O O     . HOH U 4 .   ? 4.464   4.534   197.371 1.00 80.24  ? 297 HOH A O     1 
HETATM 9327 O O     . HOH U 4 .   ? 15.316  -0.767  195.462 1.00 42.05  ? 298 HOH A O     1 
HETATM 9328 O O     . HOH U 4 .   ? 13.985  -0.150  193.209 1.00 44.92  ? 299 HOH A O     1 
HETATM 9329 O O     . HOH U 4 .   ? 6.617   3.699   199.748 1.00 32.78  ? 300 HOH A O     1 
HETATM 9330 O O     . HOH U 4 .   ? 8.697   2.522   196.700 1.00 39.21  ? 301 HOH A O     1 
HETATM 9331 O O     . HOH U 4 .   ? 16.213  16.236  184.433 1.00 74.15  ? 302 HOH A O     1 
HETATM 9332 O O     . HOH U 4 .   ? 18.421  33.932  199.740 1.00 39.71  ? 303 HOH A O     1 
HETATM 9333 O O     . HOH U 4 .   ? 20.803  49.202  189.062 1.00 37.53  ? 304 HOH A O     1 
HETATM 9334 O O     . HOH U 4 .   ? 14.593  51.691  184.226 1.00 49.45  ? 305 HOH A O     1 
HETATM 9335 O O     . HOH U 4 .   ? 15.201  52.398  187.180 1.00 34.12  ? 306 HOH A O     1 
HETATM 9336 O O     . HOH U 4 .   ? 26.930  41.328  184.834 1.00 43.51  ? 307 HOH A O     1 
HETATM 9337 O O     . HOH U 4 .   ? 26.713  44.973  183.650 1.00 63.18  ? 308 HOH A O     1 
HETATM 9338 O O     . HOH U 4 .   ? 24.621  47.502  187.964 1.00 35.10  ? 309 HOH A O     1 
HETATM 9339 O O     . HOH U 4 .   ? 1.360   36.425  193.426 1.00 46.71  ? 310 HOH A O     1 
HETATM 9340 O O     . HOH U 4 .   ? 3.384   39.647  187.432 1.00 46.17  ? 311 HOH A O     1 
HETATM 9341 O O     . HOH U 4 .   ? 4.038   38.134  192.571 1.00 38.64  ? 312 HOH A O     1 
HETATM 9342 O O     . HOH U 4 .   ? -5.848  37.733  198.671 1.00 40.98  ? 313 HOH A O     1 
HETATM 9343 O O     . HOH U 4 .   ? -7.344  29.421  200.633 1.00 50.28  ? 314 HOH A O     1 
HETATM 9344 O O     . HOH U 4 .   ? -8.600  33.946  203.027 1.00 50.07  ? 315 HOH A O     1 
HETATM 9345 O O     . HOH U 4 .   ? 21.331  8.248   200.215 1.00 30.90  ? 316 HOH A O     1 
HETATM 9346 O O     . HOH U 4 .   ? 13.134  4.287   205.627 1.00 31.30  ? 317 HOH A O     1 
HETATM 9347 O O     . HOH U 4 .   ? 22.557  2.926   208.669 1.00 43.14  ? 318 HOH A O     1 
HETATM 9348 O O     . HOH U 4 .   ? 22.172  43.302  214.802 1.00 46.65  ? 319 HOH A O     1 
HETATM 9349 O O     . HOH U 4 .   ? 11.078  44.982  211.422 1.00 50.65  ? 320 HOH A O     1 
HETATM 9350 O O     . HOH U 4 .   ? 11.830  48.685  212.485 1.00 43.66  ? 321 HOH A O     1 
HETATM 9351 O O     . HOH U 4 .   ? 10.827  50.901  209.829 1.00 27.11  ? 322 HOH A O     1 
HETATM 9352 O O     . HOH U 4 .   ? 2.898   42.529  211.091 1.00 68.30  ? 323 HOH A O     1 
HETATM 9353 O O     . HOH U 4 .   ? 0.758   38.634  206.912 1.00 40.10  ? 324 HOH A O     1 
HETATM 9354 O O     . HOH U 4 .   ? 0.896   38.831  203.889 1.00 35.27  ? 325 HOH A O     1 
HETATM 9355 O O     . HOH U 4 .   ? -1.871  41.344  207.918 1.00 44.15  ? 326 HOH A O     1 
HETATM 9356 O O     . HOH U 4 .   ? -1.800  35.326  197.146 1.00 41.45  ? 327 HOH A O     1 
HETATM 9357 O O     . HOH U 4 .   ? -3.698  27.505  207.069 1.00 47.45  ? 328 HOH A O     1 
HETATM 9358 O O     . HOH U 4 .   ? -3.144  25.354  210.315 1.00 45.07  ? 329 HOH A O     1 
HETATM 9359 O O     . HOH U 4 .   ? 0.328   23.599  212.580 1.00 57.21  ? 330 HOH A O     1 
HETATM 9360 O O     . HOH U 4 .   ? 21.224  0.044   194.710 1.00 55.30  ? 331 HOH A O     1 
HETATM 9361 O O     . HOH U 4 .   ? 3.006   12.235  204.349 1.00 55.62  ? 332 HOH A O     1 
HETATM 9362 O O     . HOH U 4 .   ? 0.439   10.357  203.072 1.00 60.60  ? 333 HOH A O     1 
HETATM 9363 O O     . HOH U 4 .   ? -2.119  10.558  203.646 1.00 45.65  ? 334 HOH A O     1 
HETATM 9364 O O     . HOH U 4 .   ? 6.456   13.931  222.102 1.00 52.89  ? 335 HOH A O     1 
HETATM 9365 O O     . HOH U 4 .   ? 4.922   8.866   212.648 1.00 40.15  ? 336 HOH A O     1 
HETATM 9366 O O     . HOH U 4 .   ? 5.414   7.347   217.287 1.00 72.58  ? 337 HOH A O     1 
HETATM 9367 O O     . HOH U 4 .   ? -2.598  11.280  218.611 1.00 90.65  ? 338 HOH A O     1 
HETATM 9368 O O     . HOH U 4 .   ? -1.526  35.253  222.813 1.00 44.27  ? 339 HOH A O     1 
HETATM 9369 O O     . HOH U 4 .   ? -7.076  35.052  220.996 1.00 51.66  ? 340 HOH A O     1 
HETATM 9370 O O     . HOH U 4 .   ? -2.713  29.417  223.887 1.00 29.57  ? 341 HOH A O     1 
HETATM 9371 O O     . HOH U 4 .   ? 25.210  18.473  221.210 1.00 39.98  ? 342 HOH A O     1 
HETATM 9372 O O     . HOH U 4 .   ? 23.131  18.488  230.781 1.00 45.37  ? 343 HOH A O     1 
HETATM 9373 O O     . HOH U 4 .   ? 28.767  16.737  227.015 1.00 73.94  ? 344 HOH A O     1 
HETATM 9374 O O     . HOH U 4 .   ? 26.812  12.993  226.555 1.00 61.45  ? 345 HOH A O     1 
HETATM 9375 O O     . HOH U 4 .   ? 23.099  15.518  229.855 1.00 80.36  ? 346 HOH A O     1 
HETATM 9376 O O     . HOH U 4 .   ? 23.341  12.597  227.670 1.00 43.78  ? 347 HOH A O     1 
HETATM 9377 O O     . HOH U 4 .   ? 32.236  10.166  191.214 1.00 107.77 ? 348 HOH A O     1 
HETATM 9378 O O     . HOH U 4 .   ? 30.080  28.307  232.904 1.00 20.01  ? 349 HOH A O     1 
HETATM 9379 O O     . HOH U 4 .   ? 32.162  25.764  231.675 1.00 49.60  ? 350 HOH A O     1 
HETATM 9380 O O     . HOH U 4 .   ? 29.735  27.104  229.421 1.00 34.14  ? 351 HOH A O     1 
HETATM 9381 O O     . HOH U 4 .   ? 25.933  25.696  235.534 1.00 56.61  ? 352 HOH A O     1 
HETATM 9382 O O     . HOH U 4 .   ? 26.462  23.817  233.826 1.00 79.38  ? 353 HOH A O     1 
HETATM 9383 O O     . HOH U 4 .   ? 30.664  19.409  237.345 1.00 45.49  ? 354 HOH A O     1 
HETATM 9384 O O     . HOH U 4 .   ? 43.055  13.314  232.269 1.00 66.00  ? 355 HOH A O     1 
HETATM 9385 O O     . HOH U 4 .   ? 49.075  29.395  244.416 1.00 53.04  ? 356 HOH A O     1 
HETATM 9386 O O     . HOH U 4 .   ? 51.067  23.321  248.125 1.00 40.58  ? 357 HOH A O     1 
HETATM 9387 O O     . HOH U 4 .   ? -2.096  13.579  196.126 1.00 70.81  ? 358 HOH A O     1 
HETATM 9388 O O     . HOH U 4 .   ? 18.154  11.738  180.427 1.00 51.81  ? 359 HOH A O     1 
HETATM 9389 O O     . HOH U 4 .   ? 21.875  17.601  195.066 1.00 56.21  ? 360 HOH A O     1 
HETATM 9390 O O     . HOH U 4 .   ? 17.177  20.603  196.008 1.00 39.80  ? 361 HOH A O     1 
HETATM 9391 O O     . HOH U 4 .   ? 5.780   22.810  181.976 1.00 69.10  ? 362 HOH A O     1 
HETATM 9392 O O     . HOH U 4 .   ? -1.960  16.804  187.213 1.00 42.47  ? 363 HOH A O     1 
HETATM 9393 O O     . HOH U 4 .   ? 4.062   32.176  187.065 1.00 35.83  ? 364 HOH A O     1 
HETATM 9394 O O     . HOH U 4 .   ? 18.926  32.803  186.128 1.00 39.37  ? 365 HOH A O     1 
HETATM 9395 O O     . HOH U 4 .   ? 16.101  52.617  190.443 1.00 48.41  ? 366 HOH A O     1 
HETATM 9396 O O     . HOH U 4 .   ? 16.911  54.161  187.368 1.00 44.15  ? 367 HOH A O     1 
HETATM 9397 O O     . HOH U 4 .   ? 16.642  55.136  196.549 1.00 48.62  ? 368 HOH A O     1 
HETATM 9398 O O     . HOH U 4 .   ? 12.084  47.827  209.607 1.00 47.51  ? 369 HOH A O     1 
HETATM 9399 O O     . HOH U 4 .   ? 9.533   47.911  211.946 1.00 38.46  ? 370 HOH A O     1 
HETATM 9400 O O     . HOH U 4 .   ? 13.345  51.072  210.798 1.00 58.09  ? 371 HOH A O     1 
HETATM 9401 O O     . HOH U 4 .   ? 12.892  44.554  213.337 1.00 69.51  ? 372 HOH A O     1 
HETATM 9402 O O     . HOH U 4 .   ? 19.923  44.313  217.524 1.00 75.52  ? 373 HOH A O     1 
HETATM 9403 O O     . HOH U 4 .   ? 23.098  42.782  199.139 1.00 40.05  ? 374 HOH A O     1 
HETATM 9404 O O     . HOH U 4 .   ? 25.065  42.261  182.158 1.00 70.48  ? 375 HOH A O     1 
HETATM 9405 O O     . HOH U 4 .   ? 18.309  34.508  179.634 1.00 46.87  ? 376 HOH A O     1 
HETATM 9406 O O     . HOH U 4 .   ? 16.037  35.279  178.025 1.00 59.59  ? 377 HOH A O     1 
HETATM 9407 O O     . HOH U 4 .   ? 15.434  23.222  203.093 1.00 52.88  ? 378 HOH A O     1 
HETATM 9408 O O     . HOH U 4 .   ? -7.581  34.377  200.282 1.00 58.61  ? 379 HOH A O     1 
HETATM 9409 O O     . HOH U 4 .   ? -5.272  32.868  203.593 1.00 74.56  ? 380 HOH A O     1 
HETATM 9410 O O     . HOH U 4 .   ? -3.304  26.144  204.419 1.00 53.41  ? 381 HOH A O     1 
HETATM 9411 O O     . HOH U 4 .   ? 9.151   2.599   199.931 1.00 59.21  ? 382 HOH A O     1 
HETATM 9412 O O     . HOH U 4 .   ? 25.922  21.282  207.086 1.00 47.60  ? 383 HOH A O     1 
HETATM 9413 O O     . HOH U 4 .   ? 5.911   7.624   200.587 1.00 52.54  ? 384 HOH A O     1 
HETATM 9414 O O     . HOH U 4 .   ? 6.591   8.268   204.451 1.00 56.43  ? 385 HOH A O     1 
HETATM 9415 O O     . HOH U 4 .   ? -1.798  11.837  214.874 1.00 61.81  ? 386 HOH A O     1 
HETATM 9416 O O     . HOH U 4 .   ? -7.486  12.864  218.412 1.00 61.05  ? 387 HOH A O     1 
HETATM 9417 O O     . HOH U 4 .   ? -6.425  20.162  214.828 1.00 40.16  ? 388 HOH A O     1 
HETATM 9418 O O     . HOH U 4 .   ? -6.830  20.905  210.539 1.00 91.24  ? 389 HOH A O     1 
HETATM 9419 O O     . HOH U 4 .   ? -0.975  22.179  221.304 1.00 50.38  ? 390 HOH A O     1 
HETATM 9420 O O     . HOH U 4 .   ? -7.461  35.437  224.356 1.00 60.25  ? 391 HOH A O     1 
HETATM 9421 O O     . HOH U 4 .   ? 29.718  24.676  232.620 1.00 53.59  ? 392 HOH A O     1 
HETATM 9422 O O     . HOH U 4 .   ? 32.895  18.959  231.879 1.00 70.23  ? 393 HOH A O     1 
HETATM 9423 O O     . HOH U 4 .   ? 37.121  19.722  234.401 1.00 46.67  ? 394 HOH A O     1 
HETATM 9424 O O     . HOH U 4 .   ? 32.543  30.649  234.681 1.00 33.90  ? 395 HOH A O     1 
HETATM 9425 O O     . HOH U 4 .   ? 46.437  27.225  239.314 1.00 51.70  ? 396 HOH A O     1 
HETATM 9426 O O     . HOH U 4 .   ? 50.613  27.441  238.041 1.00 61.97  ? 397 HOH A O     1 
HETATM 9427 O O     . HOH U 4 .   ? 47.587  23.080  231.440 1.00 56.22  ? 398 HOH A O     1 
HETATM 9428 O O     . HOH U 4 .   ? 24.885  45.553  201.139 1.00 46.13  ? 399 HOH A O     1 
HETATM 9429 O O     . HOH U 4 .   ? 18.629  54.019  190.918 1.00 43.41  ? 400 HOH A O     1 
HETATM 9430 O O     . HOH U 4 .   ? 49.266  24.910  225.985 1.00 53.81  ? 401 HOH A O     1 
HETATM 9431 O O     . HOH U 4 .   ? -0.328  27.855  179.532 1.00 97.99  ? 402 HOH A O     1 
HETATM 9432 O O     . HOH U 4 .   ? 7.057   10.800  223.851 1.00 60.17  ? 403 HOH A O     1 
HETATM 9433 O O     . HOH U 4 .   ? 43.714  24.819  233.606 1.00 79.42  ? 404 HOH A O     1 
HETATM 9434 O O     . HOH V 4 .   ? 51.935  14.504  199.630 1.00 68.89  ? 259 HOH B O     1 
HETATM 9435 O O     . HOH V 4 .   ? 38.406  18.859  181.156 1.00 32.95  ? 260 HOH B O     1 
HETATM 9436 O O     . HOH V 4 .   ? 32.638  29.495  178.881 1.00 56.37  ? 261 HOH B O     1 
HETATM 9437 O O     . HOH V 4 .   ? 47.410  32.976  210.134 1.00 30.14  ? 262 HOH B O     1 
HETATM 9438 O O     . HOH V 4 .   ? 39.489  27.892  205.094 1.00 44.31  ? 263 HOH B O     1 
HETATM 9439 O O     . HOH V 4 .   ? 35.430  11.225  222.815 1.00 75.40  ? 264 HOH B O     1 
HETATM 9440 O O     . HOH V 4 .   ? 54.779  21.116  203.180 1.00 36.46  ? 265 HOH B O     1 
HETATM 9441 O O     . HOH V 4 .   ? 58.509  23.101  200.472 1.00 24.06  ? 266 HOH B O     1 
HETATM 9442 O O     . HOH V 4 .   ? 57.773  17.117  201.345 1.00 30.15  ? 267 HOH B O     1 
HETATM 9443 O O     . HOH V 4 .   ? 61.869  23.527  201.888 1.00 36.45  ? 268 HOH B O     1 
HETATM 9444 O O     . HOH V 4 .   ? 41.377  19.622  180.363 1.00 64.76  ? 269 HOH B O     1 
HETATM 9445 O O     . HOH V 4 .   ? 55.874  19.655  183.275 1.00 24.97  ? 270 HOH B O     1 
HETATM 9446 O O     . HOH V 4 .   ? 59.551  23.390  181.485 1.00 77.99  ? 271 HOH B O     1 
HETATM 9447 O O     . HOH V 4 .   ? 55.317  7.186   213.191 1.00 24.34  ? 272 HOH B O     1 
HETATM 9448 O O     . HOH V 4 .   ? 55.333  5.259   215.043 1.00 76.17  ? 273 HOH B O     1 
HETATM 9449 O O     . HOH V 4 .   ? 41.426  13.091  221.831 1.00 33.05  ? 274 HOH B O     1 
HETATM 9450 O O     . HOH V 4 .   ? 36.453  12.696  213.737 1.00 32.75  ? 275 HOH B O     1 
HETATM 9451 O O     . HOH V 4 .   ? 41.040  1.401   206.332 1.00 32.55  ? 276 HOH B O     1 
HETATM 9452 O O     . HOH V 4 .   ? 30.856  0.163   197.475 1.00 34.35  ? 277 HOH B O     1 
HETATM 9453 O O     . HOH V 4 .   ? 36.724  13.124  207.639 1.00 43.19  ? 278 HOH B O     1 
HETATM 9454 O O     . HOH V 4 .   ? 43.929  18.206  203.703 1.00 39.41  ? 279 HOH B O     1 
HETATM 9455 O O     . HOH V 4 .   ? 38.283  20.429  198.843 1.00 15.24  ? 280 HOH B O     1 
HETATM 9456 O O     . HOH V 4 .   ? 35.845  24.381  201.138 1.00 45.94  ? 281 HOH B O     1 
HETATM 9457 O O     . HOH V 4 .   ? 29.726  34.102  200.747 1.00 38.65  ? 282 HOH B O     1 
HETATM 9458 O O     . HOH V 4 .   ? 42.928  10.938  220.972 1.00 38.12  ? 283 HOH B O     1 
HETATM 9459 O O     . HOH V 4 .   ? 57.886  18.888  211.117 1.00 29.04  ? 284 HOH B O     1 
HETATM 9460 O O     . HOH V 4 .   ? 57.190  13.003  213.393 1.00 53.19  ? 285 HOH B O     1 
HETATM 9461 O O     . HOH V 4 .   ? 52.404  18.080  209.749 1.00 42.67  ? 286 HOH B O     1 
HETATM 9462 O O     . HOH V 4 .   ? 51.038  22.726  205.827 1.00 35.51  ? 287 HOH B O     1 
HETATM 9463 O O     . HOH V 4 .   ? 41.891  37.060  190.505 1.00 48.77  ? 288 HOH B O     1 
HETATM 9464 O O     . HOH V 4 .   ? 45.571  36.504  192.758 1.00 30.22  ? 289 HOH B O     1 
HETATM 9465 O O     . HOH V 4 .   ? 43.944  33.800  209.955 1.00 36.38  ? 290 HOH B O     1 
HETATM 9466 O O     . HOH V 4 .   ? 41.697  34.722  209.111 1.00 23.28  ? 291 HOH B O     1 
HETATM 9467 O O     . HOH V 4 .   ? 40.839  35.567  212.511 1.00 51.81  ? 292 HOH B O     1 
HETATM 9468 O O     . HOH V 4 .   ? 41.453  34.844  205.312 1.00 33.39  ? 293 HOH B O     1 
HETATM 9469 O O     . HOH V 4 .   ? 38.490  34.486  207.278 1.00 43.71  ? 294 HOH B O     1 
HETATM 9470 O O     . HOH V 4 .   ? 35.812  33.745  207.278 1.00 38.45  ? 295 HOH B O     1 
HETATM 9471 O O     . HOH V 4 .   ? 42.369  39.790  201.094 1.00 32.70  ? 296 HOH B O     1 
HETATM 9472 O O     . HOH V 4 .   ? 58.462  20.140  214.986 1.00 40.21  ? 297 HOH B O     1 
HETATM 9473 O O     . HOH V 4 .   ? 60.898  26.348  222.411 1.00 37.73  ? 298 HOH B O     1 
HETATM 9474 O O     . HOH V 4 .   ? 24.311  38.232  219.252 1.00 47.95  ? 299 HOH B O     1 
HETATM 9475 O O     . HOH V 4 .   ? 24.669  39.585  216.087 1.00 45.18  ? 300 HOH B O     1 
HETATM 9476 O O     . HOH V 4 .   ? 14.125  37.198  226.560 1.00 48.10  ? 301 HOH B O     1 
HETATM 9477 O O     . HOH V 4 .   ? 35.681  20.654  174.772 1.00 25.78  ? 302 HOH B O     1 
HETATM 9478 O O     . HOH V 4 .   ? 15.129  38.023  218.229 1.00 51.75  ? 303 HOH B O     1 
HETATM 9479 O O     . HOH V 4 .   ? 18.543  40.490  217.054 1.00 46.36  ? 304 HOH B O     1 
HETATM 9480 O O     . HOH V 4 .   ? 24.530  43.117  216.695 1.00 51.97  ? 305 HOH B O     1 
HETATM 9481 O O     . HOH V 4 .   ? 62.184  20.531  200.952 1.00 65.73  ? 306 HOH B O     1 
HETATM 9482 O O     . HOH V 4 .   ? 61.075  15.605  201.898 1.00 35.09  ? 307 HOH B O     1 
HETATM 9483 O O     . HOH V 4 .   ? 61.337  14.290  204.792 1.00 27.91  ? 308 HOH B O     1 
HETATM 9484 O O     . HOH V 4 .   ? 61.925  26.204  192.791 1.00 50.47  ? 309 HOH B O     1 
HETATM 9485 O O     . HOH V 4 .   ? 61.035  26.508  195.731 1.00 53.58  ? 310 HOH B O     1 
HETATM 9486 O O     . HOH V 4 .   ? 40.769  22.042  178.799 1.00 53.63  ? 311 HOH B O     1 
HETATM 9487 O O     . HOH V 4 .   ? 37.420  16.455  179.993 1.00 71.49  ? 312 HOH B O     1 
HETATM 9488 O O     . HOH V 4 .   ? 37.560  19.169  178.679 1.00 62.27  ? 313 HOH B O     1 
HETATM 9489 O O     . HOH V 4 .   ? 31.269  22.936  188.725 1.00 35.54  ? 314 HOH B O     1 
HETATM 9490 O O     . HOH V 4 .   ? 56.360  10.895  186.814 1.00 69.24  ? 315 HOH B O     1 
HETATM 9491 O O     . HOH V 4 .   ? 57.419  7.091   187.472 1.00 50.98  ? 316 HOH B O     1 
HETATM 9492 O O     . HOH V 4 .   ? 56.260  11.973  183.373 1.00 32.70  ? 317 HOH B O     1 
HETATM 9493 O O     . HOH V 4 .   ? 53.126  4.899   189.236 1.00 54.65  ? 318 HOH B O     1 
HETATM 9494 O O     . HOH V 4 .   ? 53.086  -2.604  202.562 1.00 45.53  ? 319 HOH B O     1 
HETATM 9495 O O     . HOH V 4 .   ? 49.350  2.112   212.484 1.00 36.07  ? 320 HOH B O     1 
HETATM 9496 O O     . HOH V 4 .   ? 53.879  3.288   215.045 1.00 91.34  ? 321 HOH B O     1 
HETATM 9497 O O     . HOH V 4 .   ? 40.565  12.280  219.355 1.00 41.11  ? 322 HOH B O     1 
HETATM 9498 O O     . HOH V 4 .   ? 34.453  11.345  215.235 1.00 65.00  ? 323 HOH B O     1 
HETATM 9499 O O     . HOH V 4 .   ? 35.294  12.399  218.071 1.00 39.84  ? 324 HOH B O     1 
HETATM 9500 O O     . HOH V 4 .   ? 37.266  11.610  220.621 1.00 51.41  ? 325 HOH B O     1 
HETATM 9501 O O     . HOH V 4 .   ? 38.148  10.100  207.787 1.00 80.34  ? 326 HOH B O     1 
HETATM 9502 O O     . HOH V 4 .   ? 37.134  9.403   205.196 1.00 50.45  ? 327 HOH B O     1 
HETATM 9503 O O     . HOH V 4 .   ? 39.768  16.490  200.971 1.00 37.72  ? 328 HOH B O     1 
HETATM 9504 O O     . HOH V 4 .   ? 38.149  20.023  202.399 1.00 31.11  ? 329 HOH B O     1 
HETATM 9505 O O     . HOH V 4 .   ? 35.169  -9.216  197.943 1.00 45.80  ? 330 HOH B O     1 
HETATM 9506 O O     . HOH V 4 .   ? 41.494  3.226   193.520 1.00 59.04  ? 331 HOH B O     1 
HETATM 9507 O O     . HOH V 4 .   ? 31.264  9.589   193.912 1.00 47.03  ? 332 HOH B O     1 
HETATM 9508 O O     . HOH V 4 .   ? 33.077  5.211   191.635 1.00 40.36  ? 333 HOH B O     1 
HETATM 9509 O O     . HOH V 4 .   ? 54.052  4.552   205.824 1.00 52.82  ? 334 HOH B O     1 
HETATM 9510 O O     . HOH V 4 .   ? 33.887  33.416  195.288 1.00 31.48  ? 335 HOH B O     1 
HETATM 9511 O O     . HOH V 4 .   ? 37.151  38.521  194.582 1.00 50.17  ? 336 HOH B O     1 
HETATM 9512 O O     . HOH V 4 .   ? 41.203  37.267  199.073 1.00 43.21  ? 337 HOH B O     1 
HETATM 9513 O O     . HOH V 4 .   ? 28.839  32.673  189.194 1.00 36.71  ? 338 HOH B O     1 
HETATM 9514 O O     . HOH V 4 .   ? 30.488  40.773  195.664 1.00 80.89  ? 339 HOH B O     1 
HETATM 9515 O O     . HOH V 4 .   ? 53.162  17.286  229.003 1.00 64.49  ? 340 HOH B O     1 
HETATM 9516 O O     . HOH V 4 .   ? 58.559  13.860  227.215 1.00 45.30  ? 341 HOH B O     1 
HETATM 9517 O O     . HOH V 4 .   ? 59.822  13.401  212.809 1.00 61.75  ? 342 HOH B O     1 
HETATM 9518 O O     . HOH V 4 .   ? 27.397  33.170  180.189 1.00 53.32  ? 343 HOH B O     1 
HETATM 9519 O O     . HOH V 4 .   ? 38.547  31.009  177.148 1.00 42.25  ? 344 HOH B O     1 
HETATM 9520 O O     . HOH V 4 .   ? 58.053  23.233  208.118 1.00 47.05  ? 345 HOH B O     1 
HETATM 9521 O O     . HOH V 4 .   ? 43.550  32.889  220.253 1.00 28.14  ? 346 HOH B O     1 
HETATM 9522 O O     . HOH V 4 .   ? 41.120  31.324  209.534 1.00 59.96  ? 347 HOH B O     1 
HETATM 9523 O O     . HOH V 4 .   ? 28.871  37.705  222.035 1.00 47.60  ? 348 HOH B O     1 
HETATM 9524 O O     . HOH V 4 .   ? 29.529  42.346  223.287 1.00 57.98  ? 349 HOH B O     1 
HETATM 9525 O O     . HOH V 4 .   ? 32.019  40.543  221.299 1.00 44.46  ? 350 HOH B O     1 
HETATM 9526 O O     . HOH V 4 .   ? 40.671  43.259  228.071 1.00 67.16  ? 351 HOH B O     1 
HETATM 9527 O O     . HOH V 4 .   ? 45.754  40.608  228.031 1.00 44.62  ? 352 HOH B O     1 
HETATM 9528 O O     . HOH V 4 .   ? 19.327  42.869  229.531 1.00 36.69  ? 353 HOH B O     1 
HETATM 9529 O O     . HOH V 4 .   ? 19.280  42.134  237.613 1.00 50.11  ? 354 HOH B O     1 
HETATM 9530 O O     . HOH V 4 .   ? 17.099  43.915  236.511 1.00 73.47  ? 355 HOH B O     1 
HETATM 9531 O O     . HOH V 4 .   ? 10.999  45.368  236.413 1.00 40.46  ? 356 HOH B O     1 
HETATM 9532 O O     . HOH V 4 .   ? 10.704  42.200  235.877 1.00 67.15  ? 357 HOH B O     1 
HETATM 9533 O O     . HOH V 4 .   ? 9.244   44.963  233.569 1.00 63.15  ? 358 HOH B O     1 
HETATM 9534 O O     . HOH V 4 .   ? 56.635  21.267  224.460 1.00 39.30  ? 359 HOH B O     1 
HETATM 9535 O O     . HOH V 4 .   ? 38.692  27.154  231.147 1.00 38.42  ? 360 HOH B O     1 
HETATM 9536 O O     . HOH V 4 .   ? 32.789  28.765  232.677 1.00 37.31  ? 361 HOH B O     1 
HETATM 9537 O O     . HOH V 4 .   ? 28.568  36.660  230.191 1.00 40.77  ? 362 HOH B O     1 
HETATM 9538 O O     . HOH V 4 .   ? 31.845  37.813  232.917 1.00 44.88  ? 363 HOH B O     1 
HETATM 9539 O O     . HOH V 4 .   ? 38.019  39.712  229.626 1.00 49.92  ? 364 HOH B O     1 
HETATM 9540 O O     . HOH V 4 .   ? 38.632  44.399  226.721 1.00 76.94  ? 365 HOH B O     1 
HETATM 9541 O O     . HOH V 4 .   ? 42.876  41.271  227.635 1.00 44.08  ? 366 HOH B O     1 
HETATM 9542 O O     . HOH V 4 .   ? 46.706  38.141  229.368 1.00 52.26  ? 367 HOH B O     1 
HETATM 9543 O O     . HOH V 4 .   ? 45.707  45.382  230.719 1.00 50.64  ? 368 HOH B O     1 
HETATM 9544 O O     . HOH V 4 .   ? 44.448  37.508  236.528 1.00 50.76  ? 369 HOH B O     1 
HETATM 9545 O O     . HOH V 4 .   ? 43.758  33.803  238.153 1.00 64.13  ? 370 HOH B O     1 
HETATM 9546 O O     . HOH V 4 .   ? 40.394  30.485  237.381 1.00 48.18  ? 371 HOH B O     1 
HETATM 9547 O O     . HOH V 4 .   ? 42.248  31.442  233.935 1.00 53.03  ? 372 HOH B O     1 
HETATM 9548 O O     . HOH V 4 .   ? 44.875  28.476  236.685 1.00 72.63  ? 373 HOH B O     1 
HETATM 9549 O O     . HOH V 4 .   ? 45.257  24.892  237.029 1.00 53.85  ? 374 HOH B O     1 
HETATM 9550 O O     . HOH V 4 .   ? 9.039   32.949  229.525 1.00 73.10  ? 375 HOH B O     1 
HETATM 9551 O O     . HOH V 4 .   ? 31.193  -12.246 208.858 1.00 46.96  ? 376 HOH B O     1 
HETATM 9552 O O     . HOH V 4 .   ? 35.819  22.625  177.781 1.00 44.97  ? 377 HOH B O     1 
HETATM 9553 O O     . HOH V 4 .   ? 32.026  5.435   199.725 1.00 49.04  ? 378 HOH B O     1 
HETATM 9554 O O     . HOH V 4 .   ? 26.566  44.313  220.720 1.00 60.34  ? 379 HOH B O     1 
HETATM 9555 O O     . HOH V 4 .   ? 26.440  36.306  182.734 1.00 83.10  ? 380 HOH B O     1 
HETATM 9556 O O     . HOH V 4 .   ? 25.212  39.362  177.509 1.00 58.00  ? 381 HOH B O     1 
HETATM 9557 O O     . HOH V 4 .   ? 30.447  28.080  235.670 1.00 49.27  ? 382 HOH B O     1 
HETATM 9558 O O     . HOH V 4 .   ? 37.149  34.622  235.528 1.00 61.33  ? 383 HOH B O     1 
HETATM 9559 O O     . HOH V 4 .   ? 37.889  30.844  231.782 1.00 52.69  ? 384 HOH B O     1 
HETATM 9560 O O     . HOH V 4 .   ? 59.348  17.377  204.046 1.00 40.79  ? 385 HOH B O     1 
HETATM 9561 O O     . HOH V 4 .   ? 54.334  28.809  181.005 1.00 71.08  ? 386 HOH B O     1 
HETATM 9562 O O     . HOH V 4 .   ? 33.839  22.616  175.381 1.00 44.13  ? 387 HOH B O     1 
HETATM 9563 O O     . HOH V 4 .   ? 37.940  14.133  181.215 1.00 72.47  ? 388 HOH B O     1 
HETATM 9564 O O     . HOH V 4 .   ? 34.914  20.302  178.028 1.00 62.90  ? 389 HOH B O     1 
HETATM 9565 O O     . HOH V 4 .   ? 21.692  26.874  182.208 1.00 40.56  ? 390 HOH B O     1 
HETATM 9566 O O     . HOH V 4 .   ? 19.079  31.290  178.540 1.00 69.18  ? 391 HOH B O     1 
HETATM 9567 O O     . HOH V 4 .   ? 24.756  29.177  190.732 1.00 58.17  ? 392 HOH B O     1 
HETATM 9568 O O     . HOH V 4 .   ? 37.819  20.197  196.124 1.00 29.12  ? 393 HOH B O     1 
HETATM 9569 O O     . HOH V 4 .   ? 55.937  19.347  179.330 1.00 42.67  ? 394 HOH B O     1 
HETATM 9570 O O     . HOH V 4 .   ? 58.245  20.986  180.408 1.00 67.84  ? 395 HOH B O     1 
HETATM 9571 O O     . HOH V 4 .   ? 59.780  3.758   189.383 1.00 60.90  ? 396 HOH B O     1 
HETATM 9572 O O     . HOH V 4 .   ? 57.515  -0.192  191.426 1.00 65.42  ? 397 HOH B O     1 
HETATM 9573 O O     . HOH V 4 .   ? 32.970  -5.424  211.191 1.00 34.63  ? 398 HOH B O     1 
HETATM 9574 O O     . HOH V 4 .   ? 49.774  -6.104  210.069 1.00 48.55  ? 399 HOH B O     1 
HETATM 9575 O O     . HOH V 4 .   ? 31.827  -8.769  210.051 1.00 41.47  ? 400 HOH B O     1 
HETATM 9576 O O     . HOH V 4 .   ? 39.233  -10.913 196.410 1.00 52.07  ? 401 HOH B O     1 
HETATM 9577 O O     . HOH V 4 .   ? 32.711  -2.867  193.486 1.00 35.25  ? 402 HOH B O     1 
HETATM 9578 O O     . HOH V 4 .   ? 32.399  -5.292  195.331 1.00 79.52  ? 403 HOH B O     1 
HETATM 9579 O O     . HOH V 4 .   ? 32.737  -0.144  195.096 1.00 71.38  ? 404 HOH B O     1 
HETATM 9580 O O     . HOH V 4 .   ? 29.546  24.105  206.747 1.00 28.68  ? 405 HOH B O     1 
HETATM 9581 O O     . HOH V 4 .   ? 59.864  11.613  207.040 1.00 66.78  ? 406 HOH B O     1 
HETATM 9582 O O     . HOH V 4 .   ? 29.194  33.501  203.369 1.00 27.60  ? 407 HOH B O     1 
HETATM 9583 O O     . HOH V 4 .   ? 59.061  19.596  224.501 1.00 47.20  ? 408 HOH B O     1 
HETATM 9584 O O     . HOH V 4 .   ? 59.427  16.372  225.893 1.00 41.94  ? 409 HOH B O     1 
HETATM 9585 O O     . HOH V 4 .   ? 57.039  10.010  212.844 1.00 53.09  ? 410 HOH B O     1 
HETATM 9586 O O     . HOH V 4 .   ? 60.152  16.088  206.653 1.00 41.46  ? 411 HOH B O     1 
HETATM 9587 O O     . HOH V 4 .   ? 60.031  17.960  213.919 1.00 51.81  ? 412 HOH B O     1 
HETATM 9588 O O     . HOH V 4 .   ? 40.917  34.973  180.622 1.00 61.77  ? 413 HOH B O     1 
HETATM 9589 O O     . HOH V 4 .   ? 26.217  36.599  179.426 1.00 63.16  ? 414 HOH B O     1 
HETATM 9590 O O     . HOH V 4 .   ? 43.754  36.814  210.359 1.00 53.76  ? 415 HOH B O     1 
HETATM 9591 O O     . HOH V 4 .   ? 46.364  34.221  207.733 1.00 38.93  ? 416 HOH B O     1 
HETATM 9592 O O     . HOH V 4 .   ? 44.703  34.093  195.094 1.00 65.15  ? 417 HOH B O     1 
HETATM 9593 O O     . HOH V 4 .   ? 59.819  33.725  210.599 1.00 79.97  ? 418 HOH B O     1 
HETATM 9594 O O     . HOH V 4 .   ? 55.665  23.924  212.248 1.00 44.25  ? 419 HOH B O     1 
HETATM 9595 O O     . HOH V 4 .   ? 58.745  23.823  226.552 1.00 60.15  ? 420 HOH B O     1 
HETATM 9596 O O     . HOH V 4 .   ? 40.769  28.549  228.177 1.00 76.34  ? 421 HOH B O     1 
HETATM 9597 O O     . HOH V 4 .   ? 14.085  38.192  230.865 1.00 56.27  ? 422 HOH B O     1 
HETATM 9598 O O     . HOH V 4 .   ? 19.304  38.146  231.463 1.00 97.83  ? 423 HOH B O     1 
HETATM 9599 O O     . HOH V 4 .   ? 21.280  36.388  234.700 1.00 58.04  ? 424 HOH B O     1 
HETATM 9600 O O     . HOH V 4 .   ? 12.246  41.745  237.970 1.00 52.73  ? 425 HOH B O     1 
HETATM 9601 O O     . HOH V 4 .   ? 20.620  45.676  238.852 1.00 57.96  ? 426 HOH B O     1 
HETATM 9602 O O     . HOH V 4 .   ? 26.809  45.914  243.318 1.00 117.76 ? 427 HOH B O     1 
HETATM 9603 O O     . HOH V 4 .   ? 32.139  47.157  240.581 1.00 44.41  ? 428 HOH B O     1 
HETATM 9604 O O     . HOH V 4 .   ? 26.093  44.357  241.702 1.00 48.44  ? 429 HOH B O     1 
HETATM 9605 O O     . HOH V 4 .   ? 29.222  43.061  242.650 1.00 75.07  ? 430 HOH B O     1 
HETATM 9606 O O     . HOH V 4 .   ? 26.764  41.341  243.569 1.00 55.97  ? 431 HOH B O     1 
HETATM 9607 O O     . HOH V 4 .   ? 26.113  38.906  244.888 1.00 64.91  ? 432 HOH B O     1 
HETATM 9608 O O     . HOH V 4 .   ? 29.743  37.476  243.594 1.00 88.65  ? 433 HOH B O     1 
HETATM 9609 O O     . HOH V 4 .   ? 28.796  38.267  239.086 1.00 72.65  ? 434 HOH B O     1 
HETATM 9610 O O     . HOH V 4 .   ? 27.697  38.984  236.262 1.00 67.97  ? 435 HOH B O     1 
HETATM 9611 O O     . HOH V 4 .   ? 32.696  41.101  241.662 1.00 59.35  ? 436 HOH B O     1 
HETATM 9612 O O     . HOH V 4 .   ? 29.339  46.223  243.695 1.00 70.24  ? 437 HOH B O     1 
HETATM 9613 O O     . HOH V 4 .   ? 28.265  42.429  240.448 1.00 71.30  ? 438 HOH B O     1 
HETATM 9614 O O     . HOH V 4 .   ? 25.251  41.221  241.868 1.00 52.02  ? 439 HOH B O     1 
HETATM 9615 O O     . HOH V 4 .   ? 28.152  38.679  246.563 1.00 93.42  ? 440 HOH B O     1 
HETATM 9616 O O     . HOH V 4 .   ? 48.233  42.204  245.107 1.00 60.27  ? 441 HOH B O     1 
HETATM 9617 O O     . HOH V 4 .   ? 44.426  43.764  240.366 1.00 59.44  ? 442 HOH B O     1 
HETATM 9618 O O     . HOH V 4 .   ? 42.968  41.941  230.809 1.00 40.24  ? 443 HOH B O     1 
HETATM 9619 O O     . HOH V 4 .   ? 8.030   34.916  227.512 1.00 91.41  ? 444 HOH B O     1 
HETATM 9620 O O     . HOH V 4 .   ? 36.557  9.248   214.621 1.00 60.76  ? 445 HOH B O     1 
HETATM 9621 O O     . HOH V 4 .   ? 44.947  38.678  200.160 1.00 30.85  ? 446 HOH B O     1 
HETATM 9622 O O     . HOH V 4 .   ? 60.863  18.850  211.637 1.00 65.55  ? 447 HOH B O     1 
HETATM 9623 O O     . HOH V 4 .   ? 61.358  11.876  216.673 1.00 69.70  ? 448 HOH B O     1 
HETATM 9624 O O     . HOH V 4 .   ? 26.943  28.580  235.371 1.00 88.10  ? 449 HOH B O     1 
HETATM 9625 O O     . HOH V 4 .   ? 46.852  37.796  232.068 1.00 68.94  ? 450 HOH B O     1 
HETATM 9626 O O     . HOH W 4 .   ? 28.843  -20.696 261.917 1.00 43.26  ? 259 HOH C O     1 
HETATM 9627 O O     . HOH W 4 .   ? 34.612  -21.768 251.065 1.00 58.16  ? 260 HOH C O     1 
HETATM 9628 O O     . HOH W 4 .   ? 51.979  0.992   239.358 1.00 50.54  ? 261 HOH C O     1 
HETATM 9629 O O     . HOH W 4 .   ? 9.497   13.975  243.191 1.00 55.57  ? 262 HOH C O     1 
HETATM 9630 O O     . HOH W 4 .   ? 5.951   15.700  233.890 1.00 54.81  ? 263 HOH C O     1 
HETATM 9631 O O     . HOH W 4 .   ? 30.085  -4.963  212.702 1.00 45.47  ? 264 HOH C O     1 
HETATM 9632 O O     . HOH W 4 .   ? 28.886  -1.995  209.698 1.00 53.37  ? 265 HOH C O     1 
HETATM 9633 O O     . HOH W 4 .   ? 49.442  -13.218 233.732 1.00 35.19  ? 266 HOH C O     1 
HETATM 9634 O O     . HOH W 4 .   ? 18.942  -23.437 218.944 1.00 45.93  ? 267 HOH C O     1 
HETATM 9635 O O     . HOH W 4 .   ? 20.477  -20.364 218.842 1.00 58.54  ? 268 HOH C O     1 
HETATM 9636 O O     . HOH W 4 .   ? 28.819  -19.201 223.615 1.00 42.09  ? 269 HOH C O     1 
HETATM 9637 O O     . HOH W 4 .   ? 31.461  -22.854 262.153 1.00 40.96  ? 270 HOH C O     1 
HETATM 9638 O O     . HOH W 4 .   ? 26.506  -20.839 261.181 1.00 48.10  ? 271 HOH C O     1 
HETATM 9639 O O     . HOH W 4 .   ? 34.662  -13.584 238.485 1.00 49.29  ? 272 HOH C O     1 
HETATM 9640 O O     . HOH W 4 .   ? 33.460  -14.523 235.484 1.00 69.52  ? 273 HOH C O     1 
HETATM 9641 O O     . HOH W 4 .   ? 32.109  -15.850 232.633 1.00 57.20  ? 274 HOH C O     1 
HETATM 9642 O O     . HOH W 4 .   ? 22.955  -15.945 213.202 1.00 41.59  ? 275 HOH C O     1 
HETATM 9643 O O     . HOH W 4 .   ? 43.027  -16.678 216.770 1.00 51.70  ? 276 HOH C O     1 
HETATM 9644 O O     . HOH W 4 .   ? 44.923  -10.324 233.877 1.00 63.01  ? 277 HOH C O     1 
HETATM 9645 O O     . HOH W 4 .   ? 46.470  2.349   225.079 1.00 50.20  ? 278 HOH C O     1 
HETATM 9646 O O     . HOH W 4 .   ? 36.763  14.408  239.552 1.00 56.75  ? 279 HOH C O     1 
HETATM 9647 O O     . HOH W 4 .   ? 43.349  14.260  238.845 1.00 64.18  ? 280 HOH C O     1 
HETATM 9648 O O     . HOH W 4 .   ? 21.098  -21.107 238.217 1.00 39.31  ? 281 HOH C O     1 
HETATM 9649 O O     . HOH W 4 .   ? 25.468  -3.725  211.461 1.00 69.10  ? 282 HOH C O     1 
HETATM 9650 O O     . HOH W 4 .   ? 25.996  -7.814  211.182 1.00 53.84  ? 283 HOH C O     1 
HETATM 9651 O O     . HOH W 4 .   ? 28.276  9.954   229.686 1.00 54.68  ? 284 HOH C O     1 
HETATM 9652 O O     . HOH W 4 .   ? 44.459  -10.034 213.523 1.00 66.39  ? 285 HOH C O     1 
HETATM 9653 O O     . HOH W 4 .   ? 37.461  14.841  235.960 1.00 48.62  ? 286 HOH C O     1 
HETATM 9654 O O     . HOH W 4 .   ? 51.654  6.802   237.324 1.00 59.56  ? 287 HOH C O     1 
HETATM 9655 O O     . HOH W 4 .   ? 56.479  5.429   238.393 1.00 46.51  ? 288 HOH C O     1 
HETATM 9656 O O     . HOH W 4 .   ? 58.486  3.151   240.081 1.00 50.04  ? 289 HOH C O     1 
HETATM 9657 O O     . HOH W 4 .   ? 50.873  4.127   242.709 1.00 86.24  ? 290 HOH C O     1 
HETATM 9658 O O     . HOH W 4 .   ? 51.047  -14.856 224.120 1.00 67.97  ? 291 HOH C O     1 
HETATM 9659 O O     . HOH W 4 .   ? 51.336  -17.522 223.365 1.00 37.16  ? 292 HOH C O     1 
HETATM 9660 O O     . HOH W 4 .   ? 45.849  -14.909 221.311 1.00 48.01  ? 293 HOH C O     1 
HETATM 9661 O O     . HOH W 4 .   ? 48.208  -14.611 223.968 1.00 56.06  ? 294 HOH C O     1 
HETATM 9662 O O     . HOH W 4 .   ? 14.529  -27.413 219.928 1.00 49.32  ? 295 HOH C O     1 
HETATM 9663 O O     . HOH W 4 .   ? 15.653  -27.745 216.940 1.00 43.94  ? 296 HOH C O     1 
HETATM 9664 O O     . HOH W 4 .   ? 43.578  -28.053 259.803 1.00 49.48  ? 297 HOH C O     1 
HETATM 9665 O O     . HOH W 4 .   ? 35.855  -25.323 258.986 1.00 45.53  ? 298 HOH C O     1 
HETATM 9666 O O     . HOH W 4 .   ? 39.991  -18.275 260.638 1.00 45.97  ? 299 HOH C O     1 
HETATM 9667 O O     . HOH W 4 .   ? 43.104  -11.459 257.041 1.00 58.43  ? 300 HOH C O     1 
HETATM 9668 O O     . HOH W 4 .   ? 27.360  -26.870 249.349 1.00 32.84  ? 301 HOH C O     1 
HETATM 9669 O O     . HOH W 4 .   ? 26.950  -17.357 247.097 1.00 64.72  ? 302 HOH C O     1 
HETATM 9670 O O     . HOH W 4 .   ? 38.270  -18.520 211.177 1.00 52.53  ? 303 HOH C O     1 
HETATM 9671 O O     . HOH W 4 .   ? 25.126  -14.654 206.059 1.00 65.98  ? 304 HOH C O     1 
HETATM 9672 O O     . HOH W 4 .   ? 34.336  -2.267  224.635 1.00 41.38  ? 305 HOH C O     1 
HETATM 9673 O O     . HOH W 4 .   ? 54.120  -5.553  249.527 1.00 59.55  ? 306 HOH C O     1 
HETATM 9674 O O     . HOH W 4 .   ? 47.697  -10.490 234.530 1.00 54.35  ? 307 HOH C O     1 
HETATM 9675 O O     . HOH W 4 .   ? 37.995  6.842   226.851 1.00 40.13  ? 308 HOH C O     1 
HETATM 9676 O O     . HOH W 4 .   ? 50.561  3.574   232.238 1.00 59.42  ? 309 HOH C O     1 
HETATM 9677 O O     . HOH W 4 .   ? 56.498  1.590   235.471 1.00 63.72  ? 310 HOH C O     1 
HETATM 9678 O O     . HOH W 4 .   ? 38.790  12.973  241.231 1.00 44.59  ? 311 HOH C O     1 
HETATM 9679 O O     . HOH W 4 .   ? 28.948  14.339  233.580 1.00 80.21  ? 312 HOH C O     1 
HETATM 9680 O O     . HOH W 4 .   ? 7.397   16.167  230.821 1.00 63.68  ? 313 HOH C O     1 
HETATM 9681 O O     . HOH W 4 .   ? 37.359  -14.018 217.900 1.00 28.47  ? 314 HOH C O     1 
HETATM 9682 O O     . HOH W 4 .   ? 38.087  -12.241 211.331 1.00 55.13  ? 315 HOH C O     1 
HETATM 9683 O O     . HOH W 4 .   ? 51.931  -17.188 220.649 1.00 41.10  ? 316 HOH C O     1 
HETATM 9684 O O     . HOH W 4 .   ? 50.227  -11.967 222.610 1.00 47.98  ? 317 HOH C O     1 
HETATM 9685 O O     . HOH W 4 .   ? 51.941  -13.972 220.639 1.00 44.88  ? 318 HOH C O     1 
HETATM 9686 O O     . HOH W 4 .   ? 16.718  -31.438 217.720 1.00 49.07  ? 319 HOH C O     1 
HETATM 9687 O O     . HOH W 4 .   ? 14.107  -31.448 212.672 1.00 49.85  ? 320 HOH C O     1 
HETATM 9688 O O     . HOH W 4 .   ? 39.877  -29.055 239.468 1.00 75.53  ? 321 HOH C O     1 
HETATM 9689 O O     . HOH W 4 .   ? 47.433  -26.053 248.558 1.00 74.80  ? 322 HOH C O     1 
HETATM 9690 O O     . HOH W 4 .   ? 36.532  -18.662 243.617 1.00 51.15  ? 323 HOH C O     1 
HETATM 9691 O O     . HOH W 4 .   ? 33.645  0.367   221.191 1.00 72.42  ? 324 HOH C O     1 
HETATM 9692 O O     . HOH W 4 .   ? 7.557   18.849  233.169 1.00 48.52  ? 325 HOH C O     1 
HETATM 9693 O O     . HOH W 4 .   ? 22.239  -1.896  210.908 1.00 53.94  ? 326 HOH C O     1 
HETATM 9694 O O     . HOH W 4 .   ? 26.653  -22.295 243.401 1.00 75.18  ? 327 HOH C O     1 
HETATM 9695 O O     . HOH W 4 .   ? 29.602  -13.188 230.232 1.00 72.08  ? 328 HOH C O     1 
HETATM 9696 O O     . HOH W 4 .   ? 24.486  -16.465 225.599 1.00 52.16  ? 329 HOH C O     1 
HETATM 9697 O O     . HOH W 4 .   ? 36.599  4.250   223.948 1.00 76.87  ? 330 HOH C O     1 
HETATM 9698 O O     . HOH W 4 .   ? 36.208  9.023   230.843 1.00 42.07  ? 331 HOH C O     1 
HETATM 9699 O O     . HOH X 4 .   ? 12.294  -20.363 230.875 1.00 87.68  ? 259 HOH D O     1 
HETATM 9700 O O     . HOH X 4 .   ? -11.502 -24.930 234.993 1.00 38.98  ? 260 HOH D O     1 
HETATM 9701 O O     . HOH X 4 .   ? 14.272  -40.817 237.872 1.00 48.51  ? 261 HOH D O     1 
HETATM 9702 O O     . HOH X 4 .   ? 16.114  -40.550 231.027 1.00 52.14  ? 262 HOH D O     1 
HETATM 9703 O O     . HOH X 4 .   ? 4.646   -30.316 227.706 1.00 48.57  ? 263 HOH D O     1 
HETATM 9704 O O     . HOH X 4 .   ? -2.769  -32.399 219.035 1.00 49.03  ? 264 HOH D O     1 
HETATM 9705 O O     . HOH X 4 .   ? -1.143  -28.231 240.891 1.00 33.49  ? 265 HOH D O     1 
HETATM 9706 O O     . HOH X 4 .   ? 20.153  -24.591 238.691 1.00 63.56  ? 266 HOH D O     1 
HETATM 9707 O O     . HOH X 4 .   ? 17.725  -5.446  221.276 1.00 38.43  ? 267 HOH D O     1 
HETATM 9708 O O     . HOH X 4 .   ? 11.762  -5.750  215.216 1.00 19.79  ? 268 HOH D O     1 
HETATM 9709 O O     . HOH X 4 .   ? 16.010  3.998   210.924 1.00 42.93  ? 269 HOH D O     1 
HETATM 9710 O O     . HOH X 4 .   ? 1.114   2.917   215.474 1.00 79.84  ? 270 HOH D O     1 
HETATM 9711 O O     . HOH X 4 .   ? 10.704  -9.680  222.273 1.00 37.07  ? 271 HOH D O     1 
HETATM 9712 O O     . HOH X 4 .   ? 8.561   -12.416 232.765 1.00 29.42  ? 272 HOH D O     1 
HETATM 9713 O O     . HOH X 4 .   ? -8.363  0.410   225.136 1.00 80.48  ? 273 HOH D O     1 
HETATM 9714 O O     . HOH X 4 .   ? -6.187  -7.813  237.215 1.00 57.74  ? 274 HOH D O     1 
HETATM 9715 O O     . HOH X 4 .   ? 10.450  -18.789 240.815 1.00 37.19  ? 275 HOH D O     1 
HETATM 9716 O O     . HOH X 4 .   ? 21.779  -0.654  246.225 1.00 41.80  ? 276 HOH D O     1 
HETATM 9717 O O     . HOH X 4 .   ? 0.113   7.947   220.883 1.00 63.83  ? 277 HOH D O     1 
HETATM 9718 O O     . HOH X 4 .   ? 1.834   6.761   215.113 1.00 78.61  ? 278 HOH D O     1 
HETATM 9719 O O     . HOH X 4 .   ? 1.899   -0.137  214.730 1.00 60.55  ? 279 HOH D O     1 
HETATM 9720 O O     . HOH X 4 .   ? 12.965  -24.321 219.313 1.00 54.95  ? 280 HOH D O     1 
HETATM 9721 O O     . HOH X 4 .   ? 9.661   -27.440 214.723 1.00 61.37  ? 281 HOH D O     1 
HETATM 9722 O O     . HOH X 4 .   ? 4.703   -25.190 214.014 1.00 49.73  ? 282 HOH D O     1 
HETATM 9723 O O     . HOH X 4 .   ? 5.635   -28.861 218.637 1.00 45.08  ? 283 HOH D O     1 
HETATM 9724 O O     . HOH X 4 .   ? 17.887  -22.543 254.330 1.00 50.34  ? 284 HOH D O     1 
HETATM 9725 O O     . HOH X 4 .   ? 11.599  -25.334 255.430 1.00 72.13  ? 285 HOH D O     1 
HETATM 9726 O O     . HOH X 4 .   ? 2.865   -10.789 249.006 1.00 59.79  ? 286 HOH D O     1 
HETATM 9727 O O     . HOH X 4 .   ? 28.727  -31.439 237.490 1.00 48.87  ? 287 HOH D O     1 
HETATM 9728 O O     . HOH X 4 .   ? 28.532  -34.332 237.453 1.00 41.31  ? 288 HOH D O     1 
HETATM 9729 O O     . HOH X 4 .   ? 29.870  18.619  248.206 1.00 43.93  ? 289 HOH D O     1 
HETATM 9730 O O     . HOH X 4 .   ? 35.440  14.526  256.699 1.00 48.04  ? 290 HOH D O     1 
HETATM 9731 O O     . HOH X 4 .   ? 30.928  9.916   259.601 1.00 56.14  ? 291 HOH D O     1 
HETATM 9732 O O     . HOH X 4 .   ? 36.253  7.406   261.656 1.00 63.21  ? 292 HOH D O     1 
HETATM 9733 O O     . HOH X 4 .   ? 13.239  -28.942 210.696 1.00 56.05  ? 293 HOH D O     1 
HETATM 9734 O O     . HOH X 4 .   ? 24.050  -30.690 234.060 1.00 84.20  ? 294 HOH D O     1 
HETATM 9735 O O     . HOH X 4 .   ? 14.046  -20.325 240.027 1.00 49.44  ? 295 HOH D O     1 
HETATM 9736 O O     . HOH X 4 .   ? 3.620   -35.655 225.224 1.00 45.62  ? 296 HOH D O     1 
HETATM 9737 O O     . HOH X 4 .   ? 3.020   -33.501 227.939 1.00 45.25  ? 297 HOH D O     1 
HETATM 9738 O O     . HOH X 4 .   ? 2.549   -37.134 228.922 1.00 46.38  ? 298 HOH D O     1 
HETATM 9739 O O     . HOH X 4 .   ? -3.496  -21.075 213.146 1.00 55.21  ? 299 HOH D O     1 
HETATM 9740 O O     . HOH X 4 .   ? -1.262  -22.843 214.312 1.00 68.16  ? 300 HOH D O     1 
HETATM 9741 O O     . HOH X 4 .   ? -0.649  -10.021 201.918 1.00 50.02  ? 301 HOH D O     1 
HETATM 9742 O O     . HOH X 4 .   ? 17.136  -5.899  213.611 1.00 51.71  ? 302 HOH D O     1 
HETATM 9743 O O     . HOH X 4 .   ? -11.726 -10.421 220.747 1.00 65.84  ? 303 HOH D O     1 
HETATM 9744 O O     . HOH X 4 .   ? -1.987  -3.619  231.361 1.00 67.80  ? 304 HOH D O     1 
HETATM 9745 O O     . HOH X 4 .   ? 8.919   -5.512  248.147 1.00 41.96  ? 305 HOH D O     1 
HETATM 9746 O O     . HOH X 4 .   ? 8.717   -8.407  243.478 1.00 52.55  ? 306 HOH D O     1 
HETATM 9747 O O     . HOH X 4 .   ? 8.031   -11.017 245.401 1.00 51.32  ? 307 HOH D O     1 
HETATM 9748 O O     . HOH X 4 .   ? 16.312  -23.081 232.197 1.00 45.95  ? 308 HOH D O     1 
HETATM 9749 O O     . HOH X 4 .   ? 25.885  -25.982 237.386 1.00 56.92  ? 309 HOH D O     1 
HETATM 9750 O O     . HOH X 4 .   ? 7.668   -1.005  252.476 1.00 43.36  ? 310 HOH D O     1 
HETATM 9751 O O     . HOH X 4 .   ? 6.730   1.090   249.704 1.00 49.31  ? 311 HOH D O     1 
HETATM 9752 O O     . HOH X 4 .   ? 11.500  -6.591  222.789 1.00 48.26  ? 312 HOH D O     1 
HETATM 9753 O O     . HOH X 4 .   ? -13.729 -7.607  219.682 1.00 57.54  ? 313 HOH D O     1 
HETATM 9754 O O     . HOH X 4 .   ? -8.091  -2.587  233.517 1.00 51.62  ? 314 HOH D O     1 
HETATM 9755 O O     . HOH X 4 .   ? -2.976  -4.871  228.606 1.00 52.36  ? 315 HOH D O     1 
HETATM 9756 O O     . HOH X 4 .   ? 31.858  15.070  245.922 1.00 82.74  ? 316 HOH D O     1 
HETATM 9757 O O     . HOH X 4 .   ? 32.302  14.700  248.986 1.00 58.46  ? 317 HOH D O     1 
HETATM 9758 O O     . HOH X 4 .   ? 37.216  2.081   261.605 1.00 55.66  ? 318 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  GUA E . n 
A 1 2   DC  2   2   2   DC  CYT E . n 
A 1 3   DC  3   3   3   DC  CYT E . n 
A 1 4   DG  4   4   4   DG  GUA E . n 
A 1 5   DG  5   5   5   DG  GUA E . n 
A 1 6   DT  6   6   6   DT  THY E . n 
A 1 7   DC  7   7   7   DC  CYT E . n 
B 2 1   DG  1   8   8   DG  GUA F . n 
B 2 2   DA  2   9   9   DA  ADE F . n 
B 2 3   DC  3   10  10  DC  CYT F . n 
B 2 4   DC  4   11  11  DC  CYT F . n 
B 2 5   DG  5   12  12  DG  GUA F . n 
B 2 6   DG  6   13  13  DG  GUA F . n 
C 1 1   DG  1   1   1   DG  GUA G . n 
C 1 2   DC  2   2   2   DC  CYT G . n 
C 1 3   DC  3   3   3   DC  CYT G . n 
C 1 4   DG  4   4   4   DG  GUA G . n 
C 1 5   DG  5   5   5   DG  GUA G . n 
C 1 6   DT  6   6   6   DT  THY G . n 
C 1 7   DC  7   7   7   DC  CYT G . n 
D 2 1   DG  1   8   8   DG  GUA H . n 
D 2 2   DA  2   9   9   DA  ADE H . n 
D 2 3   DC  3   10  10  DC  CYT H . n 
D 2 4   DC  4   11  11  DC  CYT H . n 
D 2 5   DG  5   12  12  DG  GUA H . n 
D 2 6   DG  6   13  13  DG  GUA H . n 
E 1 1   DG  1   1   1   DG  GUA I . n 
E 1 2   DC  2   2   2   DC  CYT I . n 
E 1 3   DC  3   3   3   DC  CYT I . n 
E 1 4   DG  4   4   4   DG  GUA I . n 
E 1 5   DG  5   5   5   DG  GUA I . n 
E 1 6   DT  6   6   6   DT  THY I . n 
E 1 7   DC  7   7   7   DC  CYT I . n 
F 2 1   DG  1   8   8   DG  GUA J . n 
F 2 2   DA  2   9   9   DA  ADE J . n 
F 2 3   DC  3   10  10  DC  CYT J . n 
F 2 4   DC  4   11  11  DC  CYT J . n 
F 2 5   DG  5   12  12  DG  GUA J . n 
F 2 6   DG  6   13  13  DG  GUA J . n 
G 1 1   DG  1   1   1   DG  GUA K . n 
G 1 2   DC  2   2   2   DC  CYT K . n 
G 1 3   DC  3   3   3   DC  CYT K . n 
G 1 4   DG  4   4   4   DG  GUA K . n 
G 1 5   DG  5   5   5   DG  GUA K . n 
G 1 6   DT  6   6   6   DT  THY K . n 
G 1 7   DC  7   7   7   DC  CYT K . n 
H 2 1   DG  1   8   8   DG  GUA L . n 
H 2 2   DA  2   9   9   DA  ADE L . n 
H 2 3   DC  3   10  10  DC  CYT L . n 
H 2 4   DC  4   11  11  DC  CYT L . n 
H 2 5   DG  5   12  12  DG  GUA L . n 
H 2 6   DG  6   13  13  DG  GUA L . n 
I 3 1   SER 1   2   2   SER SER A . n 
I 3 2   PHE 2   3   3   PHE PHE A . n 
I 3 3   ILE 3   4   4   ILE ILE A . n 
I 3 4   LYS 4   5   5   LYS LYS A . n 
I 3 5   PRO 5   6   6   PRO PRO A . n 
I 3 6   ILE 6   7   7   ILE ILE A . n 
I 3 7   TYR 7   8   8   TYR TYR A . n 
I 3 8   GLN 8   9   9   GLN GLN A . n 
I 3 9   ASP 9   10  10  ASP ASP A . n 
I 3 10  ILE 10  11  11  ILE ILE A . n 
I 3 11  ASN 11  12  12  ASN ASN A . n 
I 3 12  SER 12  13  13  SER SER A . n 
I 3 13  ILE 13  14  14  ILE ILE A . n 
I 3 14  LEU 14  15  15  LEU LEU A . n 
I 3 15  ILE 15  16  16  ILE ILE A . n 
I 3 16  GLY 16  17  17  GLY GLY A . n 
I 3 17  GLN 17  18  18  GLN GLN A . n 
I 3 18  LYS 18  19  19  LYS LYS A . n 
I 3 19  VAL 19  20  20  VAL VAL A . n 
I 3 20  LYS 20  21  21  LYS LYS A . n 
I 3 21  ARG 21  22  22  ARG ARG A . n 
I 3 22  PRO 22  23  23  PRO PRO A . n 
I 3 23  LYS 23  24  24  LYS LYS A . n 
I 3 24  SER 24  25  25  SER SER A . n 
I 3 25  GLY 25  26  26  GLY GLY A . n 
I 3 26  THR 26  27  27  THR THR A . n 
I 3 27  LEU 27  28  28  LEU LEU A . n 
I 3 28  SER 28  29  29  SER SER A . n 
I 3 29  GLY 29  30  30  GLY GLY A . n 
I 3 30  HIS 30  31  31  HIS HIS A . n 
I 3 31  ALA 31  32  32  ALA ALA A . n 
I 3 32  ALA 32  33  33  ALA ALA A . n 
I 3 33  GLY 33  34  34  GLY GLY A . n 
I 3 34  GLU 34  35  35  GLU GLU A . n 
I 3 35  PRO 35  36  36  PRO PRO A . n 
I 3 36  PHE 36  37  37  PHE PHE A . n 
I 3 37  GLU 37  38  38  GLU GLU A . n 
I 3 38  LYS 38  39  39  LYS LYS A . n 
I 3 39  LEU 39  40  40  LEU LEU A . n 
I 3 40  VAL 40  41  41  VAL VAL A . n 
I 3 41  TYR 41  42  42  TYR TYR A . n 
I 3 42  LYS 42  43  43  LYS LYS A . n 
I 3 43  PHE 43  44  44  PHE PHE A . n 
I 3 44  LEU 44  45  45  LEU LEU A . n 
I 3 45  LYS 45  46  46  LYS LYS A . n 
I 3 46  GLU 46  47  47  GLU GLU A . n 
I 3 47  ASN 47  48  48  ASN ASN A . n 
I 3 48  LEU 48  49  49  LEU LEU A . n 
I 3 49  SER 49  50  50  SER SER A . n 
I 3 50  ASP 50  51  51  ASP ASP A . n 
I 3 51  LEU 51  52  52  LEU LEU A . n 
I 3 52  THR 52  53  53  THR THR A . n 
I 3 53  PHE 53  54  54  PHE PHE A . n 
I 3 54  LYS 54  55  55  LYS LYS A . n 
I 3 55  GLN 55  56  56  GLN GLN A . n 
I 3 56  TYR 56  57  57  TYR TYR A . n 
I 3 57  GLU 57  58  58  GLU GLU A . n 
I 3 58  TYR 58  59  59  TYR TYR A . n 
I 3 59  LEU 59  60  60  LEU LEU A . n 
I 3 60  ASN 60  61  61  ASN ASN A . n 
I 3 61  ASP 61  62  62  ASP ASP A . n 
I 3 62  LEU 62  63  63  LEU LEU A . n 
I 3 63  PHE 63  64  64  PHE PHE A . n 
I 3 64  MET 64  65  65  MET MET A . n 
I 3 65  LYS 65  66  66  LYS LYS A . n 
I 3 66  ASN 66  67  67  ASN ASN A . n 
I 3 67  PRO 67  68  68  PRO PRO A . n 
I 3 68  ALA 68  69  69  ALA ALA A . n 
I 3 69  ILE 69  70  70  ILE ILE A . n 
I 3 70  ILE 70  71  71  ILE ILE A . n 
I 3 71  GLY 71  72  72  GLY GLY A . n 
I 3 72  HIS 72  73  73  HIS HIS A . n 
I 3 73  GLU 73  74  74  GLU GLU A . n 
I 3 74  ALA 74  75  75  ALA ALA A . n 
I 3 75  ARG 75  76  76  ARG ARG A . n 
I 3 76  TYR 76  77  77  TYR TYR A . n 
I 3 77  LYS 77  78  78  LYS LYS A . n 
I 3 78  LEU 78  79  79  LEU LEU A . n 
I 3 79  PHE 79  80  80  PHE PHE A . n 
I 3 80  ASN 80  81  81  ASN ASN A . n 
I 3 81  SER 81  82  82  SER SER A . n 
I 3 82  PRO 82  83  83  PRO PRO A . n 
I 3 83  THR 83  84  84  THR THR A . n 
I 3 84  LEU 84  85  85  LEU LEU A . n 
I 3 85  LEU 85  86  86  LEU LEU A . n 
I 3 86  PHE 86  87  87  PHE PHE A . n 
I 3 87  LEU 87  88  88  LEU LEU A . n 
I 3 88  LEU 88  89  89  LEU LEU A . n 
I 3 89  SER 89  90  90  SER SER A . n 
I 3 90  ARG 90  91  91  ARG ARG A . n 
I 3 91  GLY 91  92  92  GLY GLY A . n 
I 3 92  LYS 92  93  93  LYS LYS A . n 
I 3 93  ALA 93  94  94  ALA ALA A . n 
I 3 94  ALA 94  95  95  ALA ALA A . n 
I 3 95  THR 95  96  96  THR THR A . n 
I 3 96  GLU 96  97  97  GLU GLU A . n 
I 3 97  ASN 97  98  98  ASN ASN A . n 
I 3 98  TRP 98  99  99  TRP TRP A . n 
I 3 99  SER 99  100 100 SER SER A . n 
I 3 100 ILE 100 101 101 ILE ILE A . n 
I 3 101 GLU 101 102 102 GLU GLU A . n 
I 3 102 ASN 102 103 103 ASN ASN A . n 
I 3 103 LEU 103 104 104 LEU LEU A . n 
I 3 104 PHE 104 105 105 PHE PHE A . n 
I 3 105 GLU 105 106 106 GLU GLU A . n 
I 3 106 GLU 106 107 107 GLU GLU A . n 
I 3 107 LYS 107 108 108 LYS LYS A . n 
I 3 108 GLN 108 109 109 GLN GLN A . n 
I 3 109 ASN 109 110 110 ASN ASN A . n 
I 3 110 ASP 110 111 111 ASP ASP A . n 
I 3 111 THR 111 112 112 THR THR A . n 
I 3 112 ALA 112 113 113 ALA ALA A . n 
I 3 113 ASP 113 114 114 ASP ASP A . n 
I 3 114 ILE 114 115 115 ILE ILE A . n 
I 3 115 LEU 115 116 116 LEU LEU A . n 
I 3 116 LEU 116 117 117 LEU LEU A . n 
I 3 117 VAL 117 118 118 VAL VAL A . n 
I 3 118 LYS 118 119 119 LYS LYS A . n 
I 3 119 ASP 119 120 120 ASP ASP A . n 
I 3 120 GLN 120 121 121 GLN GLN A . n 
I 3 121 PHE 121 122 122 PHE PHE A . n 
I 3 122 TYR 122 123 123 TYR TYR A . n 
I 3 123 GLU 123 124 124 GLU GLU A . n 
I 3 124 LEU 124 125 125 LEU LEU A . n 
I 3 125 LEU 125 126 126 LEU LEU A . n 
I 3 126 ASP 126 127 127 ASP ASP A . n 
I 3 127 VAL 127 128 128 VAL VAL A . n 
I 3 128 LYS 128 129 129 LYS LYS A . n 
I 3 129 THR 129 130 130 THR THR A . n 
I 3 130 ARG 130 131 131 ARG ARG A . n 
I 3 131 ASN 131 132 132 ASN ASN A . n 
I 3 132 ILE 132 133 133 ILE ILE A . n 
I 3 133 SER 133 134 134 SER SER A . n 
I 3 134 LYS 134 135 135 LYS LYS A . n 
I 3 135 SER 135 136 136 SER SER A . n 
I 3 136 ALA 136 137 137 ALA ALA A . n 
I 3 137 GLN 137 138 138 GLN GLN A . n 
I 3 138 ALA 138 139 139 ALA ALA A . n 
I 3 139 PRO 139 140 140 PRO PRO A . n 
I 3 140 ASN 140 141 141 ASN ASN A . n 
I 3 141 ILE 141 142 142 ILE ILE A . n 
I 3 142 ILE 142 143 143 ILE ILE A . n 
I 3 143 SER 143 144 144 SER SER A . n 
I 3 144 ALA 144 145 145 ALA ALA A . n 
I 3 145 TYR 145 146 146 TYR TYR A . n 
I 3 146 LYS 146 147 147 LYS LYS A . n 
I 3 147 LEU 147 148 148 LEU LEU A . n 
I 3 148 ALA 148 149 149 ALA ALA A . n 
I 3 149 GLN 149 150 150 GLN GLN A . n 
I 3 150 THR 150 151 151 THR THR A . n 
I 3 151 CYS 151 152 152 CYS CYS A . n 
I 3 152 ALA 152 153 153 ALA ALA A . n 
I 3 153 LYS 153 154 154 LYS LYS A . n 
I 3 154 MET 154 155 155 MET MET A . n 
I 3 155 ILE 155 156 156 ILE ILE A . n 
I 3 156 ASP 156 157 157 ASP ASP A . n 
I 3 157 ASN 157 158 158 ASN ASN A . n 
I 3 158 LYS 158 159 159 LYS LYS A . n 
I 3 159 GLU 159 160 160 GLU GLU A . n 
I 3 160 PHE 160 161 161 PHE PHE A . n 
I 3 161 ASP 161 162 162 ASP ASP A . n 
I 3 162 LEU 162 163 163 LEU LEU A . n 
I 3 163 PHE 163 164 164 PHE PHE A . n 
I 3 164 ASP 164 165 165 ASP ASP A . n 
I 3 165 ILE 165 166 166 ILE ILE A . n 
I 3 166 ASN 166 167 167 ASN ASN A . n 
I 3 167 TYR 167 168 168 TYR TYR A . n 
I 3 168 LEU 168 169 169 LEU LEU A . n 
I 3 169 GLU 169 170 170 GLU GLU A . n 
I 3 170 VAL 170 171 171 VAL VAL A . n 
I 3 171 ASP 171 172 172 ASP ASP A . n 
I 3 172 TRP 172 173 173 TRP TRP A . n 
I 3 173 GLU 173 174 174 GLU GLU A . n 
I 3 174 LEU 174 175 175 LEU LEU A . n 
I 3 175 ASN 175 176 176 ASN ASN A . n 
I 3 176 GLY 176 177 177 GLY GLY A . n 
I 3 177 GLU 177 178 178 GLU GLU A . n 
I 3 178 ASP 178 179 179 ASP ASP A . n 
I 3 179 LEU 179 180 180 LEU LEU A . n 
I 3 180 VAL 180 181 181 VAL VAL A . n 
I 3 181 CYS 181 182 182 CYS CYS A . n 
I 3 182 VAL 182 183 183 VAL VAL A . n 
I 3 183 SER 183 184 184 SER SER A . n 
I 3 184 THR 184 185 185 THR THR A . n 
I 3 185 SER 185 186 186 SER SER A . n 
I 3 186 PHE 186 187 187 PHE PHE A . n 
I 3 187 ALA 187 188 188 ALA ALA A . n 
I 3 188 GLU 188 189 189 GLU GLU A . n 
I 3 189 LEU 189 190 190 LEU LEU A . n 
I 3 190 PHE 190 191 191 PHE PHE A . n 
I 3 191 LYS 191 192 192 LYS LYS A . n 
I 3 192 SER 192 193 193 SER SER A . n 
I 3 193 GLU 193 194 194 GLU GLU A . n 
I 3 194 PRO 194 195 195 PRO PRO A . n 
I 3 195 SER 195 196 196 SER SER A . n 
I 3 196 GLU 196 197 197 GLU GLU A . n 
I 3 197 LEU 197 198 198 LEU LEU A . n 
I 3 198 TYR 198 199 199 TYR TYR A . n 
I 3 199 ILE 199 200 200 ILE ILE A . n 
I 3 200 ASN 200 201 201 ASN ASN A . n 
I 3 201 TRP 201 202 202 TRP TRP A . n 
I 3 202 ALA 202 203 203 ALA ALA A . n 
I 3 203 ALA 203 204 204 ALA ALA A . n 
I 3 204 ALA 204 205 205 ALA ALA A . n 
I 3 205 MET 205 206 206 MET MET A . n 
I 3 206 GLN 206 207 207 GLN GLN A . n 
I 3 207 ILE 207 208 208 ILE ILE A . n 
I 3 208 GLN 208 209 209 GLN GLN A . n 
I 3 209 PHE 209 210 210 PHE PHE A . n 
I 3 210 HIS 210 211 211 HIS HIS A . n 
I 3 211 VAL 211 212 212 VAL VAL A . n 
I 3 212 ARG 212 213 213 ARG ARG A . n 
I 3 213 ASP 213 214 214 ASP ASP A . n 
I 3 214 LEU 214 215 215 LEU LEU A . n 
I 3 215 ASP 215 216 216 ASP ASP A . n 
I 3 216 GLN 216 217 217 GLN GLN A . n 
I 3 217 GLY 217 218 218 GLY GLY A . n 
I 3 218 PHE 218 219 219 PHE PHE A . n 
I 3 219 ASN 219 220 220 ASN ASN A . n 
I 3 220 GLY 220 221 221 GLY GLY A . n 
I 3 221 THR 221 222 222 THR THR A . n 
I 3 222 ARG 222 223 223 ARG ARG A . n 
I 3 223 GLU 223 224 224 GLU GLU A . n 
I 3 224 GLU 224 225 225 GLU GLU A . n 
I 3 225 TRP 225 226 226 TRP TRP A . n 
I 3 226 ALA 226 227 227 ALA ALA A . n 
I 3 227 LYS 227 228 228 LYS LYS A . n 
I 3 228 SER 228 229 229 SER SER A . n 
I 3 229 TYR 229 230 230 TYR TYR A . n 
I 3 230 LEU 230 231 231 LEU LEU A . n 
I 3 231 LYS 231 232 232 LYS LYS A . n 
I 3 232 HIS 232 233 233 HIS HIS A . n 
I 3 233 PHE 233 234 234 PHE PHE A . n 
I 3 234 VAL 234 235 235 VAL VAL A . n 
I 3 235 THR 235 236 236 THR THR A . n 
I 3 236 GLN 236 237 237 GLN GLN A . n 
I 3 237 ALA 237 238 238 ALA ALA A . n 
I 3 238 GLU 238 239 239 GLU GLU A . n 
I 3 239 GLN 239 240 240 GLN GLN A . n 
I 3 240 ARG 240 241 241 ARG ARG A . n 
I 3 241 ALA 241 242 242 ALA ALA A . n 
I 3 242 ILE 242 243 243 ILE ILE A . n 
I 3 243 SER 243 244 244 SER SER A . n 
I 3 244 MET 244 245 245 MET MET A . n 
I 3 245 ILE 245 246 246 ILE ILE A . n 
I 3 246 ASP 246 247 247 ASP ASP A . n 
I 3 247 LYS 247 248 248 LYS LYS A . n 
I 3 248 PHE 248 249 249 PHE PHE A . n 
I 3 249 VAL 249 250 250 VAL VAL A . n 
I 3 250 LYS 250 251 251 LYS LYS A . n 
I 3 251 PRO 251 252 252 PRO PRO A . n 
I 3 252 PHE 252 253 253 PHE PHE A . n 
I 3 253 LYS 253 254 254 LYS LYS A . n 
I 3 254 LYS 254 255 255 LYS LYS A . n 
I 3 255 TYR 255 256 256 TYR TYR A . n 
I 3 256 ILE 256 257 257 ILE ILE A . n 
I 3 257 LEU 257 258 258 LEU LEU A . n 
J 3 1   SER 1   2   2   SER SER B . n 
J 3 2   PHE 2   3   3   PHE PHE B . n 
J 3 3   ILE 3   4   4   ILE ILE B . n 
J 3 4   LYS 4   5   5   LYS LYS B . n 
J 3 5   PRO 5   6   6   PRO PRO B . n 
J 3 6   ILE 6   7   7   ILE ILE B . n 
J 3 7   TYR 7   8   8   TYR TYR B . n 
J 3 8   GLN 8   9   9   GLN GLN B . n 
J 3 9   ASP 9   10  10  ASP ASP B . n 
J 3 10  ILE 10  11  11  ILE ILE B . n 
J 3 11  ASN 11  12  12  ASN ASN B . n 
J 3 12  SER 12  13  13  SER SER B . n 
J 3 13  ILE 13  14  14  ILE ILE B . n 
J 3 14  LEU 14  15  15  LEU LEU B . n 
J 3 15  ILE 15  16  16  ILE ILE B . n 
J 3 16  GLY 16  17  17  GLY GLY B . n 
J 3 17  GLN 17  18  18  GLN GLN B . n 
J 3 18  LYS 18  19  19  LYS LYS B . n 
J 3 19  VAL 19  20  20  VAL VAL B . n 
J 3 20  LYS 20  21  21  LYS LYS B . n 
J 3 21  ARG 21  22  22  ARG ARG B . n 
J 3 22  PRO 22  23  23  PRO PRO B . n 
J 3 23  LYS 23  24  24  LYS LYS B . n 
J 3 24  SER 24  25  25  SER SER B . n 
J 3 25  GLY 25  26  26  GLY GLY B . n 
J 3 26  THR 26  27  27  THR THR B . n 
J 3 27  LEU 27  28  28  LEU LEU B . n 
J 3 28  SER 28  29  29  SER SER B . n 
J 3 29  GLY 29  30  30  GLY GLY B . n 
J 3 30  HIS 30  31  31  HIS HIS B . n 
J 3 31  ALA 31  32  32  ALA ALA B . n 
J 3 32  ALA 32  33  33  ALA ALA B . n 
J 3 33  GLY 33  34  34  GLY GLY B . n 
J 3 34  GLU 34  35  35  GLU GLU B . n 
J 3 35  PRO 35  36  36  PRO PRO B . n 
J 3 36  PHE 36  37  37  PHE PHE B . n 
J 3 37  GLU 37  38  38  GLU GLU B . n 
J 3 38  LYS 38  39  39  LYS LYS B . n 
J 3 39  LEU 39  40  40  LEU LEU B . n 
J 3 40  VAL 40  41  41  VAL VAL B . n 
J 3 41  TYR 41  42  42  TYR TYR B . n 
J 3 42  LYS 42  43  43  LYS LYS B . n 
J 3 43  PHE 43  44  44  PHE PHE B . n 
J 3 44  LEU 44  45  45  LEU LEU B . n 
J 3 45  LYS 45  46  46  LYS LYS B . n 
J 3 46  GLU 46  47  47  GLU GLU B . n 
J 3 47  ASN 47  48  48  ASN ASN B . n 
J 3 48  LEU 48  49  49  LEU LEU B . n 
J 3 49  SER 49  50  50  SER SER B . n 
J 3 50  ASP 50  51  51  ASP ASP B . n 
J 3 51  LEU 51  52  52  LEU LEU B . n 
J 3 52  THR 52  53  53  THR THR B . n 
J 3 53  PHE 53  54  54  PHE PHE B . n 
J 3 54  LYS 54  55  55  LYS LYS B . n 
J 3 55  GLN 55  56  56  GLN GLN B . n 
J 3 56  TYR 56  57  57  TYR TYR B . n 
J 3 57  GLU 57  58  58  GLU GLU B . n 
J 3 58  TYR 58  59  59  TYR TYR B . n 
J 3 59  LEU 59  60  60  LEU LEU B . n 
J 3 60  ASN 60  61  61  ASN ASN B . n 
J 3 61  ASP 61  62  62  ASP ASP B . n 
J 3 62  LEU 62  63  63  LEU LEU B . n 
J 3 63  PHE 63  64  64  PHE PHE B . n 
J 3 64  MET 64  65  65  MET MET B . n 
J 3 65  LYS 65  66  66  LYS LYS B . n 
J 3 66  ASN 66  67  67  ASN ASN B . n 
J 3 67  PRO 67  68  68  PRO PRO B . n 
J 3 68  ALA 68  69  69  ALA ALA B . n 
J 3 69  ILE 69  70  70  ILE ILE B . n 
J 3 70  ILE 70  71  71  ILE ILE B . n 
J 3 71  GLY 71  72  72  GLY GLY B . n 
J 3 72  HIS 72  73  73  HIS HIS B . n 
J 3 73  GLU 73  74  74  GLU GLU B . n 
J 3 74  ALA 74  75  75  ALA ALA B . n 
J 3 75  ARG 75  76  76  ARG ARG B . n 
J 3 76  TYR 76  77  77  TYR TYR B . n 
J 3 77  LYS 77  78  78  LYS LYS B . n 
J 3 78  LEU 78  79  79  LEU LEU B . n 
J 3 79  PHE 79  80  80  PHE PHE B . n 
J 3 80  ASN 80  81  81  ASN ASN B . n 
J 3 81  SER 81  82  82  SER SER B . n 
J 3 82  PRO 82  83  83  PRO PRO B . n 
J 3 83  THR 83  84  84  THR THR B . n 
J 3 84  LEU 84  85  85  LEU LEU B . n 
J 3 85  LEU 85  86  86  LEU LEU B . n 
J 3 86  PHE 86  87  87  PHE PHE B . n 
J 3 87  LEU 87  88  88  LEU LEU B . n 
J 3 88  LEU 88  89  89  LEU LEU B . n 
J 3 89  SER 89  90  90  SER SER B . n 
J 3 90  ARG 90  91  91  ARG ARG B . n 
J 3 91  GLY 91  92  92  GLY GLY B . n 
J 3 92  LYS 92  93  93  LYS LYS B . n 
J 3 93  ALA 93  94  94  ALA ALA B . n 
J 3 94  ALA 94  95  95  ALA ALA B . n 
J 3 95  THR 95  96  96  THR THR B . n 
J 3 96  GLU 96  97  97  GLU GLU B . n 
J 3 97  ASN 97  98  98  ASN ASN B . n 
J 3 98  TRP 98  99  99  TRP TRP B . n 
J 3 99  SER 99  100 100 SER SER B . n 
J 3 100 ILE 100 101 101 ILE ILE B . n 
J 3 101 GLU 101 102 102 GLU GLU B . n 
J 3 102 ASN 102 103 103 ASN ASN B . n 
J 3 103 LEU 103 104 104 LEU LEU B . n 
J 3 104 PHE 104 105 105 PHE PHE B . n 
J 3 105 GLU 105 106 106 GLU GLU B . n 
J 3 106 GLU 106 107 107 GLU GLU B . n 
J 3 107 LYS 107 108 108 LYS LYS B . n 
J 3 108 GLN 108 109 109 GLN GLN B . n 
J 3 109 ASN 109 110 110 ASN ASN B . n 
J 3 110 ASP 110 111 111 ASP ASP B . n 
J 3 111 THR 111 112 112 THR THR B . n 
J 3 112 ALA 112 113 113 ALA ALA B . n 
J 3 113 ASP 113 114 114 ASP ASP B . n 
J 3 114 ILE 114 115 115 ILE ILE B . n 
J 3 115 LEU 115 116 116 LEU LEU B . n 
J 3 116 LEU 116 117 117 LEU LEU B . n 
J 3 117 VAL 117 118 118 VAL VAL B . n 
J 3 118 LYS 118 119 119 LYS LYS B . n 
J 3 119 ASP 119 120 120 ASP ASP B . n 
J 3 120 GLN 120 121 121 GLN GLN B . n 
J 3 121 PHE 121 122 122 PHE PHE B . n 
J 3 122 TYR 122 123 123 TYR TYR B . n 
J 3 123 GLU 123 124 124 GLU GLU B . n 
J 3 124 LEU 124 125 125 LEU LEU B . n 
J 3 125 LEU 125 126 126 LEU LEU B . n 
J 3 126 ASP 126 127 127 ASP ASP B . n 
J 3 127 VAL 127 128 128 VAL VAL B . n 
J 3 128 LYS 128 129 129 LYS LYS B . n 
J 3 129 THR 129 130 130 THR THR B . n 
J 3 130 ARG 130 131 131 ARG ARG B . n 
J 3 131 ASN 131 132 132 ASN ASN B . n 
J 3 132 ILE 132 133 133 ILE ILE B . n 
J 3 133 SER 133 134 134 SER SER B . n 
J 3 134 LYS 134 135 135 LYS LYS B . n 
J 3 135 SER 135 136 136 SER SER B . n 
J 3 136 ALA 136 137 137 ALA ALA B . n 
J 3 137 GLN 137 138 138 GLN GLN B . n 
J 3 138 ALA 138 139 139 ALA ALA B . n 
J 3 139 PRO 139 140 140 PRO PRO B . n 
J 3 140 ASN 140 141 141 ASN ASN B . n 
J 3 141 ILE 141 142 142 ILE ILE B . n 
J 3 142 ILE 142 143 143 ILE ILE B . n 
J 3 143 SER 143 144 144 SER SER B . n 
J 3 144 ALA 144 145 145 ALA ALA B . n 
J 3 145 TYR 145 146 146 TYR TYR B . n 
J 3 146 LYS 146 147 147 LYS LYS B . n 
J 3 147 LEU 147 148 148 LEU LEU B . n 
J 3 148 ALA 148 149 149 ALA ALA B . n 
J 3 149 GLN 149 150 150 GLN GLN B . n 
J 3 150 THR 150 151 151 THR THR B . n 
J 3 151 CYS 151 152 152 CYS CYS B . n 
J 3 152 ALA 152 153 153 ALA ALA B . n 
J 3 153 LYS 153 154 154 LYS LYS B . n 
J 3 154 MET 154 155 155 MET MET B . n 
J 3 155 ILE 155 156 156 ILE ILE B . n 
J 3 156 ASP 156 157 157 ASP ASP B . n 
J 3 157 ASN 157 158 158 ASN ASN B . n 
J 3 158 LYS 158 159 159 LYS LYS B . n 
J 3 159 GLU 159 160 160 GLU GLU B . n 
J 3 160 PHE 160 161 161 PHE PHE B . n 
J 3 161 ASP 161 162 162 ASP ASP B . n 
J 3 162 LEU 162 163 163 LEU LEU B . n 
J 3 163 PHE 163 164 164 PHE PHE B . n 
J 3 164 ASP 164 165 165 ASP ASP B . n 
J 3 165 ILE 165 166 166 ILE ILE B . n 
J 3 166 ASN 166 167 167 ASN ASN B . n 
J 3 167 TYR 167 168 168 TYR TYR B . n 
J 3 168 LEU 168 169 169 LEU LEU B . n 
J 3 169 GLU 169 170 170 GLU GLU B . n 
J 3 170 VAL 170 171 171 VAL VAL B . n 
J 3 171 ASP 171 172 172 ASP ASP B . n 
J 3 172 TRP 172 173 173 TRP TRP B . n 
J 3 173 GLU 173 174 174 GLU GLU B . n 
J 3 174 LEU 174 175 175 LEU LEU B . n 
J 3 175 ASN 175 176 176 ASN ASN B . n 
J 3 176 GLY 176 177 177 GLY GLY B . n 
J 3 177 GLU 177 178 178 GLU GLU B . n 
J 3 178 ASP 178 179 179 ASP ASP B . n 
J 3 179 LEU 179 180 180 LEU LEU B . n 
J 3 180 VAL 180 181 181 VAL VAL B . n 
J 3 181 CYS 181 182 182 CYS CYS B . n 
J 3 182 VAL 182 183 183 VAL VAL B . n 
J 3 183 SER 183 184 184 SER SER B . n 
J 3 184 THR 184 185 185 THR THR B . n 
J 3 185 SER 185 186 186 SER SER B . n 
J 3 186 PHE 186 187 187 PHE PHE B . n 
J 3 187 ALA 187 188 188 ALA ALA B . n 
J 3 188 GLU 188 189 189 GLU GLU B . n 
J 3 189 LEU 189 190 190 LEU LEU B . n 
J 3 190 PHE 190 191 191 PHE PHE B . n 
J 3 191 LYS 191 192 192 LYS LYS B . n 
J 3 192 SER 192 193 193 SER SER B . n 
J 3 193 GLU 193 194 194 GLU GLU B . n 
J 3 194 PRO 194 195 195 PRO PRO B . n 
J 3 195 SER 195 196 196 SER SER B . n 
J 3 196 GLU 196 197 197 GLU GLU B . n 
J 3 197 LEU 197 198 198 LEU LEU B . n 
J 3 198 TYR 198 199 199 TYR TYR B . n 
J 3 199 ILE 199 200 200 ILE ILE B . n 
J 3 200 ASN 200 201 201 ASN ASN B . n 
J 3 201 TRP 201 202 202 TRP TRP B . n 
J 3 202 ALA 202 203 203 ALA ALA B . n 
J 3 203 ALA 203 204 204 ALA ALA B . n 
J 3 204 ALA 204 205 205 ALA ALA B . n 
J 3 205 MET 205 206 206 MET MET B . n 
J 3 206 GLN 206 207 207 GLN GLN B . n 
J 3 207 ILE 207 208 208 ILE ILE B . n 
J 3 208 GLN 208 209 209 GLN GLN B . n 
J 3 209 PHE 209 210 210 PHE PHE B . n 
J 3 210 HIS 210 211 211 HIS HIS B . n 
J 3 211 VAL 211 212 212 VAL VAL B . n 
J 3 212 ARG 212 213 213 ARG ARG B . n 
J 3 213 ASP 213 214 214 ASP ASP B . n 
J 3 214 LEU 214 215 215 LEU LEU B . n 
J 3 215 ASP 215 216 216 ASP ASP B . n 
J 3 216 GLN 216 217 217 GLN GLN B . n 
J 3 217 GLY 217 218 218 GLY GLY B . n 
J 3 218 PHE 218 219 219 PHE PHE B . n 
J 3 219 ASN 219 220 220 ASN ASN B . n 
J 3 220 GLY 220 221 221 GLY GLY B . n 
J 3 221 THR 221 222 222 THR THR B . n 
J 3 222 ARG 222 223 223 ARG ARG B . n 
J 3 223 GLU 223 224 224 GLU GLU B . n 
J 3 224 GLU 224 225 225 GLU GLU B . n 
J 3 225 TRP 225 226 226 TRP TRP B . n 
J 3 226 ALA 226 227 227 ALA ALA B . n 
J 3 227 LYS 227 228 228 LYS LYS B . n 
J 3 228 SER 228 229 229 SER SER B . n 
J 3 229 TYR 229 230 230 TYR TYR B . n 
J 3 230 LEU 230 231 231 LEU LEU B . n 
J 3 231 LYS 231 232 232 LYS LYS B . n 
J 3 232 HIS 232 233 233 HIS HIS B . n 
J 3 233 PHE 233 234 234 PHE PHE B . n 
J 3 234 VAL 234 235 235 VAL VAL B . n 
J 3 235 THR 235 236 236 THR THR B . n 
J 3 236 GLN 236 237 237 GLN GLN B . n 
J 3 237 ALA 237 238 238 ALA ALA B . n 
J 3 238 GLU 238 239 239 GLU GLU B . n 
J 3 239 GLN 239 240 240 GLN GLN B . n 
J 3 240 ARG 240 241 241 ARG ARG B . n 
J 3 241 ALA 241 242 242 ALA ALA B . n 
J 3 242 ILE 242 243 243 ILE ILE B . n 
J 3 243 SER 243 244 244 SER SER B . n 
J 3 244 MET 244 245 245 MET MET B . n 
J 3 245 ILE 245 246 246 ILE ILE B . n 
J 3 246 ASP 246 247 247 ASP ASP B . n 
J 3 247 LYS 247 248 248 LYS LYS B . n 
J 3 248 PHE 248 249 249 PHE PHE B . n 
J 3 249 VAL 249 250 250 VAL VAL B . n 
J 3 250 LYS 250 251 251 LYS LYS B . n 
J 3 251 PRO 251 252 252 PRO PRO B . n 
J 3 252 PHE 252 253 253 PHE PHE B . n 
J 3 253 LYS 253 254 254 LYS LYS B . n 
J 3 254 LYS 254 255 255 LYS LYS B . n 
J 3 255 TYR 255 256 256 TYR TYR B . n 
J 3 256 ILE 256 257 257 ILE ILE B . n 
J 3 257 LEU 257 258 ?   ?   ?   B . n 
K 3 1   SER 1   2   2   SER SER C . n 
K 3 2   PHE 2   3   3   PHE PHE C . n 
K 3 3   ILE 3   4   4   ILE ILE C . n 
K 3 4   LYS 4   5   5   LYS LYS C . n 
K 3 5   PRO 5   6   6   PRO PRO C . n 
K 3 6   ILE 6   7   7   ILE ILE C . n 
K 3 7   TYR 7   8   8   TYR TYR C . n 
K 3 8   GLN 8   9   9   GLN GLN C . n 
K 3 9   ASP 9   10  10  ASP ASP C . n 
K 3 10  ILE 10  11  11  ILE ILE C . n 
K 3 11  ASN 11  12  12  ASN ASN C . n 
K 3 12  SER 12  13  13  SER SER C . n 
K 3 13  ILE 13  14  14  ILE ILE C . n 
K 3 14  LEU 14  15  15  LEU LEU C . n 
K 3 15  ILE 15  16  16  ILE ILE C . n 
K 3 16  GLY 16  17  17  GLY GLY C . n 
K 3 17  GLN 17  18  18  GLN GLN C . n 
K 3 18  LYS 18  19  19  LYS LYS C . n 
K 3 19  VAL 19  20  20  VAL VAL C . n 
K 3 20  LYS 20  21  21  LYS LYS C . n 
K 3 21  ARG 21  22  22  ARG ARG C . n 
K 3 22  PRO 22  23  23  PRO PRO C . n 
K 3 23  LYS 23  24  24  LYS LYS C . n 
K 3 24  SER 24  25  25  SER SER C . n 
K 3 25  GLY 25  26  26  GLY GLY C . n 
K 3 26  THR 26  27  27  THR THR C . n 
K 3 27  LEU 27  28  28  LEU LEU C . n 
K 3 28  SER 28  29  29  SER SER C . n 
K 3 29  GLY 29  30  30  GLY GLY C . n 
K 3 30  HIS 30  31  31  HIS HIS C . n 
K 3 31  ALA 31  32  32  ALA ALA C . n 
K 3 32  ALA 32  33  33  ALA ALA C . n 
K 3 33  GLY 33  34  34  GLY GLY C . n 
K 3 34  GLU 34  35  35  GLU GLU C . n 
K 3 35  PRO 35  36  36  PRO PRO C . n 
K 3 36  PHE 36  37  37  PHE PHE C . n 
K 3 37  GLU 37  38  38  GLU GLU C . n 
K 3 38  LYS 38  39  39  LYS LYS C . n 
K 3 39  LEU 39  40  40  LEU LEU C . n 
K 3 40  VAL 40  41  41  VAL VAL C . n 
K 3 41  TYR 41  42  42  TYR TYR C . n 
K 3 42  LYS 42  43  43  LYS LYS C . n 
K 3 43  PHE 43  44  44  PHE PHE C . n 
K 3 44  LEU 44  45  45  LEU LEU C . n 
K 3 45  LYS 45  46  46  LYS LYS C . n 
K 3 46  GLU 46  47  47  GLU GLU C . n 
K 3 47  ASN 47  48  48  ASN ASN C . n 
K 3 48  LEU 48  49  49  LEU LEU C . n 
K 3 49  SER 49  50  50  SER SER C . n 
K 3 50  ASP 50  51  51  ASP ASP C . n 
K 3 51  LEU 51  52  52  LEU LEU C . n 
K 3 52  THR 52  53  53  THR THR C . n 
K 3 53  PHE 53  54  54  PHE PHE C . n 
K 3 54  LYS 54  55  55  LYS LYS C . n 
K 3 55  GLN 55  56  56  GLN GLN C . n 
K 3 56  TYR 56  57  57  TYR TYR C . n 
K 3 57  GLU 57  58  58  GLU GLU C . n 
K 3 58  TYR 58  59  59  TYR TYR C . n 
K 3 59  LEU 59  60  60  LEU LEU C . n 
K 3 60  ASN 60  61  61  ASN ASN C . n 
K 3 61  ASP 61  62  62  ASP ASP C . n 
K 3 62  LEU 62  63  63  LEU LEU C . n 
K 3 63  PHE 63  64  64  PHE PHE C . n 
K 3 64  MET 64  65  65  MET MET C . n 
K 3 65  LYS 65  66  66  LYS LYS C . n 
K 3 66  ASN 66  67  67  ASN ASN C . n 
K 3 67  PRO 67  68  68  PRO PRO C . n 
K 3 68  ALA 68  69  69  ALA ALA C . n 
K 3 69  ILE 69  70  70  ILE ILE C . n 
K 3 70  ILE 70  71  71  ILE ILE C . n 
K 3 71  GLY 71  72  72  GLY GLY C . n 
K 3 72  HIS 72  73  73  HIS HIS C . n 
K 3 73  GLU 73  74  74  GLU GLU C . n 
K 3 74  ALA 74  75  75  ALA ALA C . n 
K 3 75  ARG 75  76  76  ARG ARG C . n 
K 3 76  TYR 76  77  77  TYR TYR C . n 
K 3 77  LYS 77  78  78  LYS LYS C . n 
K 3 78  LEU 78  79  79  LEU LEU C . n 
K 3 79  PHE 79  80  80  PHE PHE C . n 
K 3 80  ASN 80  81  81  ASN ASN C . n 
K 3 81  SER 81  82  82  SER SER C . n 
K 3 82  PRO 82  83  83  PRO PRO C . n 
K 3 83  THR 83  84  84  THR THR C . n 
K 3 84  LEU 84  85  85  LEU LEU C . n 
K 3 85  LEU 85  86  86  LEU LEU C . n 
K 3 86  PHE 86  87  87  PHE PHE C . n 
K 3 87  LEU 87  88  88  LEU LEU C . n 
K 3 88  LEU 88  89  89  LEU LEU C . n 
K 3 89  SER 89  90  90  SER SER C . n 
K 3 90  ARG 90  91  91  ARG ARG C . n 
K 3 91  GLY 91  92  92  GLY GLY C . n 
K 3 92  LYS 92  93  93  LYS LYS C . n 
K 3 93  ALA 93  94  94  ALA ALA C . n 
K 3 94  ALA 94  95  95  ALA ALA C . n 
K 3 95  THR 95  96  96  THR THR C . n 
K 3 96  GLU 96  97  97  GLU GLU C . n 
K 3 97  ASN 97  98  98  ASN ASN C . n 
K 3 98  TRP 98  99  99  TRP TRP C . n 
K 3 99  SER 99  100 100 SER SER C . n 
K 3 100 ILE 100 101 101 ILE ILE C . n 
K 3 101 GLU 101 102 ?   ?   ?   C . n 
K 3 102 ASN 102 103 ?   ?   ?   C . n 
K 3 103 LEU 103 104 ?   ?   ?   C . n 
K 3 104 PHE 104 105 105 PHE PHE C . n 
K 3 105 GLU 105 106 106 GLU GLU C . n 
K 3 106 GLU 106 107 107 GLU GLU C . n 
K 3 107 LYS 107 108 108 LYS LYS C . n 
K 3 108 GLN 108 109 109 GLN GLN C . n 
K 3 109 ASN 109 110 110 ASN ASN C . n 
K 3 110 ASP 110 111 111 ASP ASP C . n 
K 3 111 THR 111 112 112 THR THR C . n 
K 3 112 ALA 112 113 113 ALA ALA C . n 
K 3 113 ASP 113 114 114 ASP ASP C . n 
K 3 114 ILE 114 115 115 ILE ILE C . n 
K 3 115 LEU 115 116 116 LEU LEU C . n 
K 3 116 LEU 116 117 117 LEU LEU C . n 
K 3 117 VAL 117 118 118 VAL VAL C . n 
K 3 118 LYS 118 119 119 LYS LYS C . n 
K 3 119 ASP 119 120 120 ASP ASP C . n 
K 3 120 GLN 120 121 121 GLN GLN C . n 
K 3 121 PHE 121 122 122 PHE PHE C . n 
K 3 122 TYR 122 123 123 TYR TYR C . n 
K 3 123 GLU 123 124 124 GLU GLU C . n 
K 3 124 LEU 124 125 125 LEU LEU C . n 
K 3 125 LEU 125 126 126 LEU LEU C . n 
K 3 126 ASP 126 127 127 ASP ASP C . n 
K 3 127 VAL 127 128 128 VAL VAL C . n 
K 3 128 LYS 128 129 129 LYS LYS C . n 
K 3 129 THR 129 130 130 THR THR C . n 
K 3 130 ARG 130 131 131 ARG ARG C . n 
K 3 131 ASN 131 132 132 ASN ASN C . n 
K 3 132 ILE 132 133 133 ILE ILE C . n 
K 3 133 SER 133 134 134 SER SER C . n 
K 3 134 LYS 134 135 135 LYS LYS C . n 
K 3 135 SER 135 136 136 SER SER C . n 
K 3 136 ALA 136 137 137 ALA ALA C . n 
K 3 137 GLN 137 138 138 GLN GLN C . n 
K 3 138 ALA 138 139 139 ALA ALA C . n 
K 3 139 PRO 139 140 140 PRO PRO C . n 
K 3 140 ASN 140 141 141 ASN ASN C . n 
K 3 141 ILE 141 142 142 ILE ILE C . n 
K 3 142 ILE 142 143 143 ILE ILE C . n 
K 3 143 SER 143 144 144 SER SER C . n 
K 3 144 ALA 144 145 145 ALA ALA C . n 
K 3 145 TYR 145 146 146 TYR TYR C . n 
K 3 146 LYS 146 147 147 LYS LYS C . n 
K 3 147 LEU 147 148 148 LEU LEU C . n 
K 3 148 ALA 148 149 149 ALA ALA C . n 
K 3 149 GLN 149 150 150 GLN GLN C . n 
K 3 150 THR 150 151 151 THR THR C . n 
K 3 151 CYS 151 152 152 CYS CYS C . n 
K 3 152 ALA 152 153 153 ALA ALA C . n 
K 3 153 LYS 153 154 154 LYS LYS C . n 
K 3 154 MET 154 155 155 MET MET C . n 
K 3 155 ILE 155 156 156 ILE ILE C . n 
K 3 156 ASP 156 157 157 ASP ASP C . n 
K 3 157 ASN 157 158 158 ASN ASN C . n 
K 3 158 LYS 158 159 159 LYS LYS C . n 
K 3 159 GLU 159 160 160 GLU GLU C . n 
K 3 160 PHE 160 161 161 PHE PHE C . n 
K 3 161 ASP 161 162 162 ASP ASP C . n 
K 3 162 LEU 162 163 163 LEU LEU C . n 
K 3 163 PHE 163 164 164 PHE PHE C . n 
K 3 164 ASP 164 165 165 ASP ASP C . n 
K 3 165 ILE 165 166 166 ILE ILE C . n 
K 3 166 ASN 166 167 167 ASN ASN C . n 
K 3 167 TYR 167 168 168 TYR TYR C . n 
K 3 168 LEU 168 169 169 LEU LEU C . n 
K 3 169 GLU 169 170 170 GLU GLU C . n 
K 3 170 VAL 170 171 171 VAL VAL C . n 
K 3 171 ASP 171 172 172 ASP ASP C . n 
K 3 172 TRP 172 173 173 TRP TRP C . n 
K 3 173 GLU 173 174 174 GLU GLU C . n 
K 3 174 LEU 174 175 175 LEU LEU C . n 
K 3 175 ASN 175 176 176 ASN ASN C . n 
K 3 176 GLY 176 177 177 GLY GLY C . n 
K 3 177 GLU 177 178 178 GLU GLU C . n 
K 3 178 ASP 178 179 179 ASP ASP C . n 
K 3 179 LEU 179 180 180 LEU LEU C . n 
K 3 180 VAL 180 181 181 VAL VAL C . n 
K 3 181 CYS 181 182 182 CYS CYS C . n 
K 3 182 VAL 182 183 183 VAL VAL C . n 
K 3 183 SER 183 184 184 SER SER C . n 
K 3 184 THR 184 185 185 THR THR C . n 
K 3 185 SER 185 186 186 SER SER C . n 
K 3 186 PHE 186 187 187 PHE PHE C . n 
K 3 187 ALA 187 188 188 ALA ALA C . n 
K 3 188 GLU 188 189 189 GLU GLU C . n 
K 3 189 LEU 189 190 190 LEU LEU C . n 
K 3 190 PHE 190 191 191 PHE PHE C . n 
K 3 191 LYS 191 192 192 LYS LYS C . n 
K 3 192 SER 192 193 193 SER SER C . n 
K 3 193 GLU 193 194 194 GLU GLU C . n 
K 3 194 PRO 194 195 195 PRO PRO C . n 
K 3 195 SER 195 196 196 SER SER C . n 
K 3 196 GLU 196 197 197 GLU GLU C . n 
K 3 197 LEU 197 198 198 LEU LEU C . n 
K 3 198 TYR 198 199 199 TYR TYR C . n 
K 3 199 ILE 199 200 200 ILE ILE C . n 
K 3 200 ASN 200 201 201 ASN ASN C . n 
K 3 201 TRP 201 202 202 TRP TRP C . n 
K 3 202 ALA 202 203 203 ALA ALA C . n 
K 3 203 ALA 203 204 204 ALA ALA C . n 
K 3 204 ALA 204 205 205 ALA ALA C . n 
K 3 205 MET 205 206 206 MET MET C . n 
K 3 206 GLN 206 207 207 GLN GLN C . n 
K 3 207 ILE 207 208 208 ILE ILE C . n 
K 3 208 GLN 208 209 209 GLN GLN C . n 
K 3 209 PHE 209 210 210 PHE PHE C . n 
K 3 210 HIS 210 211 211 HIS HIS C . n 
K 3 211 VAL 211 212 212 VAL VAL C . n 
K 3 212 ARG 212 213 213 ARG ARG C . n 
K 3 213 ASP 213 214 214 ASP ASP C . n 
K 3 214 LEU 214 215 215 LEU LEU C . n 
K 3 215 ASP 215 216 216 ASP ASP C . n 
K 3 216 GLN 216 217 217 GLN GLN C . n 
K 3 217 GLY 217 218 218 GLY GLY C . n 
K 3 218 PHE 218 219 219 PHE PHE C . n 
K 3 219 ASN 219 220 220 ASN ASN C . n 
K 3 220 GLY 220 221 221 GLY GLY C . n 
K 3 221 THR 221 222 222 THR THR C . n 
K 3 222 ARG 222 223 223 ARG ARG C . n 
K 3 223 GLU 223 224 224 GLU GLU C . n 
K 3 224 GLU 224 225 225 GLU GLU C . n 
K 3 225 TRP 225 226 226 TRP TRP C . n 
K 3 226 ALA 226 227 227 ALA ALA C . n 
K 3 227 LYS 227 228 228 LYS LYS C . n 
K 3 228 SER 228 229 229 SER SER C . n 
K 3 229 TYR 229 230 230 TYR TYR C . n 
K 3 230 LEU 230 231 231 LEU LEU C . n 
K 3 231 LYS 231 232 232 LYS LYS C . n 
K 3 232 HIS 232 233 233 HIS HIS C . n 
K 3 233 PHE 233 234 234 PHE PHE C . n 
K 3 234 VAL 234 235 235 VAL VAL C . n 
K 3 235 THR 235 236 236 THR THR C . n 
K 3 236 GLN 236 237 237 GLN GLN C . n 
K 3 237 ALA 237 238 238 ALA ALA C . n 
K 3 238 GLU 238 239 239 GLU GLU C . n 
K 3 239 GLN 239 240 240 GLN GLN C . n 
K 3 240 ARG 240 241 241 ARG ARG C . n 
K 3 241 ALA 241 242 242 ALA ALA C . n 
K 3 242 ILE 242 243 243 ILE ILE C . n 
K 3 243 SER 243 244 244 SER SER C . n 
K 3 244 MET 244 245 245 MET MET C . n 
K 3 245 ILE 245 246 246 ILE ILE C . n 
K 3 246 ASP 246 247 247 ASP ASP C . n 
K 3 247 LYS 247 248 248 LYS LYS C . n 
K 3 248 PHE 248 249 249 PHE PHE C . n 
K 3 249 VAL 249 250 250 VAL VAL C . n 
K 3 250 LYS 250 251 251 LYS LYS C . n 
K 3 251 PRO 251 252 252 PRO PRO C . n 
K 3 252 PHE 252 253 253 PHE PHE C . n 
K 3 253 LYS 253 254 254 LYS LYS C . n 
K 3 254 LYS 254 255 255 LYS LYS C . n 
K 3 255 TYR 255 256 256 TYR TYR C . n 
K 3 256 ILE 256 257 257 ILE ILE C . n 
K 3 257 LEU 257 258 258 LEU LEU C . n 
L 3 1   SER 1   2   2   SER SER D . n 
L 3 2   PHE 2   3   3   PHE PHE D . n 
L 3 3   ILE 3   4   4   ILE ILE D . n 
L 3 4   LYS 4   5   5   LYS LYS D . n 
L 3 5   PRO 5   6   6   PRO PRO D . n 
L 3 6   ILE 6   7   7   ILE ILE D . n 
L 3 7   TYR 7   8   8   TYR TYR D . n 
L 3 8   GLN 8   9   9   GLN GLN D . n 
L 3 9   ASP 9   10  10  ASP ASP D . n 
L 3 10  ILE 10  11  11  ILE ILE D . n 
L 3 11  ASN 11  12  12  ASN ASN D . n 
L 3 12  SER 12  13  13  SER SER D . n 
L 3 13  ILE 13  14  14  ILE ILE D . n 
L 3 14  LEU 14  15  15  LEU LEU D . n 
L 3 15  ILE 15  16  16  ILE ILE D . n 
L 3 16  GLY 16  17  17  GLY GLY D . n 
L 3 17  GLN 17  18  18  GLN GLN D . n 
L 3 18  LYS 18  19  19  LYS LYS D . n 
L 3 19  VAL 19  20  20  VAL VAL D . n 
L 3 20  LYS 20  21  21  LYS LYS D . n 
L 3 21  ARG 21  22  22  ARG ARG D . n 
L 3 22  PRO 22  23  23  PRO PRO D . n 
L 3 23  LYS 23  24  24  LYS LYS D . n 
L 3 24  SER 24  25  25  SER SER D . n 
L 3 25  GLY 25  26  26  GLY GLY D . n 
L 3 26  THR 26  27  27  THR THR D . n 
L 3 27  LEU 27  28  28  LEU LEU D . n 
L 3 28  SER 28  29  29  SER SER D . n 
L 3 29  GLY 29  30  30  GLY GLY D . n 
L 3 30  HIS 30  31  31  HIS HIS D . n 
L 3 31  ALA 31  32  32  ALA ALA D . n 
L 3 32  ALA 32  33  33  ALA ALA D . n 
L 3 33  GLY 33  34  34  GLY GLY D . n 
L 3 34  GLU 34  35  35  GLU GLU D . n 
L 3 35  PRO 35  36  36  PRO PRO D . n 
L 3 36  PHE 36  37  37  PHE PHE D . n 
L 3 37  GLU 37  38  38  GLU GLU D . n 
L 3 38  LYS 38  39  39  LYS LYS D . n 
L 3 39  LEU 39  40  40  LEU LEU D . n 
L 3 40  VAL 40  41  41  VAL VAL D . n 
L 3 41  TYR 41  42  42  TYR TYR D . n 
L 3 42  LYS 42  43  43  LYS LYS D . n 
L 3 43  PHE 43  44  44  PHE PHE D . n 
L 3 44  LEU 44  45  45  LEU LEU D . n 
L 3 45  LYS 45  46  46  LYS LYS D . n 
L 3 46  GLU 46  47  47  GLU GLU D . n 
L 3 47  ASN 47  48  48  ASN ASN D . n 
L 3 48  LEU 48  49  49  LEU LEU D . n 
L 3 49  SER 49  50  50  SER SER D . n 
L 3 50  ASP 50  51  51  ASP ASP D . n 
L 3 51  LEU 51  52  52  LEU LEU D . n 
L 3 52  THR 52  53  53  THR THR D . n 
L 3 53  PHE 53  54  54  PHE PHE D . n 
L 3 54  LYS 54  55  55  LYS LYS D . n 
L 3 55  GLN 55  56  56  GLN GLN D . n 
L 3 56  TYR 56  57  57  TYR TYR D . n 
L 3 57  GLU 57  58  58  GLU GLU D . n 
L 3 58  TYR 58  59  59  TYR TYR D . n 
L 3 59  LEU 59  60  60  LEU LEU D . n 
L 3 60  ASN 60  61  61  ASN ASN D . n 
L 3 61  ASP 61  62  62  ASP ASP D . n 
L 3 62  LEU 62  63  63  LEU LEU D . n 
L 3 63  PHE 63  64  64  PHE PHE D . n 
L 3 64  MET 64  65  65  MET MET D . n 
L 3 65  LYS 65  66  66  LYS LYS D . n 
L 3 66  ASN 66  67  67  ASN ASN D . n 
L 3 67  PRO 67  68  68  PRO PRO D . n 
L 3 68  ALA 68  69  69  ALA ALA D . n 
L 3 69  ILE 69  70  70  ILE ILE D . n 
L 3 70  ILE 70  71  71  ILE ILE D . n 
L 3 71  GLY 71  72  72  GLY GLY D . n 
L 3 72  HIS 72  73  73  HIS HIS D . n 
L 3 73  GLU 73  74  74  GLU GLU D . n 
L 3 74  ALA 74  75  75  ALA ALA D . n 
L 3 75  ARG 75  76  76  ARG ARG D . n 
L 3 76  TYR 76  77  77  TYR TYR D . n 
L 3 77  LYS 77  78  78  LYS LYS D . n 
L 3 78  LEU 78  79  79  LEU LEU D . n 
L 3 79  PHE 79  80  80  PHE PHE D . n 
L 3 80  ASN 80  81  81  ASN ASN D . n 
L 3 81  SER 81  82  82  SER SER D . n 
L 3 82  PRO 82  83  83  PRO PRO D . n 
L 3 83  THR 83  84  84  THR THR D . n 
L 3 84  LEU 84  85  85  LEU LEU D . n 
L 3 85  LEU 85  86  86  LEU LEU D . n 
L 3 86  PHE 86  87  87  PHE PHE D . n 
L 3 87  LEU 87  88  88  LEU LEU D . n 
L 3 88  LEU 88  89  89  LEU LEU D . n 
L 3 89  SER 89  90  90  SER SER D . n 
L 3 90  ARG 90  91  91  ARG ARG D . n 
L 3 91  GLY 91  92  92  GLY GLY D . n 
L 3 92  LYS 92  93  93  LYS LYS D . n 
L 3 93  ALA 93  94  94  ALA ALA D . n 
L 3 94  ALA 94  95  95  ALA ALA D . n 
L 3 95  THR 95  96  96  THR THR D . n 
L 3 96  GLU 96  97  97  GLU GLU D . n 
L 3 97  ASN 97  98  98  ASN ASN D . n 
L 3 98  TRP 98  99  99  TRP TRP D . n 
L 3 99  SER 99  100 100 SER SER D . n 
L 3 100 ILE 100 101 101 ILE ILE D . n 
L 3 101 GLU 101 102 102 GLU GLU D . n 
L 3 102 ASN 102 103 103 ASN ASN D . n 
L 3 103 LEU 103 104 104 LEU LEU D . n 
L 3 104 PHE 104 105 105 PHE PHE D . n 
L 3 105 GLU 105 106 106 GLU GLU D . n 
L 3 106 GLU 106 107 107 GLU GLU D . n 
L 3 107 LYS 107 108 108 LYS LYS D . n 
L 3 108 GLN 108 109 109 GLN GLN D . n 
L 3 109 ASN 109 110 110 ASN ASN D . n 
L 3 110 ASP 110 111 111 ASP ASP D . n 
L 3 111 THR 111 112 112 THR THR D . n 
L 3 112 ALA 112 113 113 ALA ALA D . n 
L 3 113 ASP 113 114 114 ASP ASP D . n 
L 3 114 ILE 114 115 115 ILE ILE D . n 
L 3 115 LEU 115 116 116 LEU LEU D . n 
L 3 116 LEU 116 117 117 LEU LEU D . n 
L 3 117 VAL 117 118 118 VAL VAL D . n 
L 3 118 LYS 118 119 119 LYS LYS D . n 
L 3 119 ASP 119 120 120 ASP ASP D . n 
L 3 120 GLN 120 121 121 GLN GLN D . n 
L 3 121 PHE 121 122 122 PHE PHE D . n 
L 3 122 TYR 122 123 123 TYR TYR D . n 
L 3 123 GLU 123 124 124 GLU GLU D . n 
L 3 124 LEU 124 125 125 LEU LEU D . n 
L 3 125 LEU 125 126 126 LEU LEU D . n 
L 3 126 ASP 126 127 127 ASP ASP D . n 
L 3 127 VAL 127 128 128 VAL VAL D . n 
L 3 128 LYS 128 129 129 LYS LYS D . n 
L 3 129 THR 129 130 130 THR THR D . n 
L 3 130 ARG 130 131 131 ARG ARG D . n 
L 3 131 ASN 131 132 132 ASN ASN D . n 
L 3 132 ILE 132 133 133 ILE ILE D . n 
L 3 133 SER 133 134 134 SER SER D . n 
L 3 134 LYS 134 135 135 LYS LYS D . n 
L 3 135 SER 135 136 136 SER SER D . n 
L 3 136 ALA 136 137 137 ALA ALA D . n 
L 3 137 GLN 137 138 138 GLN GLN D . n 
L 3 138 ALA 138 139 139 ALA ALA D . n 
L 3 139 PRO 139 140 140 PRO PRO D . n 
L 3 140 ASN 140 141 141 ASN ASN D . n 
L 3 141 ILE 141 142 142 ILE ILE D . n 
L 3 142 ILE 142 143 143 ILE ILE D . n 
L 3 143 SER 143 144 144 SER SER D . n 
L 3 144 ALA 144 145 145 ALA ALA D . n 
L 3 145 TYR 145 146 146 TYR TYR D . n 
L 3 146 LYS 146 147 147 LYS LYS D . n 
L 3 147 LEU 147 148 148 LEU LEU D . n 
L 3 148 ALA 148 149 149 ALA ALA D . n 
L 3 149 GLN 149 150 150 GLN GLN D . n 
L 3 150 THR 150 151 151 THR THR D . n 
L 3 151 CYS 151 152 152 CYS CYS D . n 
L 3 152 ALA 152 153 153 ALA ALA D . n 
L 3 153 LYS 153 154 154 LYS LYS D . n 
L 3 154 MET 154 155 155 MET MET D . n 
L 3 155 ILE 155 156 156 ILE ILE D . n 
L 3 156 ASP 156 157 157 ASP ASP D . n 
L 3 157 ASN 157 158 158 ASN ASN D . n 
L 3 158 LYS 158 159 159 LYS LYS D . n 
L 3 159 GLU 159 160 160 GLU GLU D . n 
L 3 160 PHE 160 161 161 PHE PHE D . n 
L 3 161 ASP 161 162 162 ASP ASP D . n 
L 3 162 LEU 162 163 163 LEU LEU D . n 
L 3 163 PHE 163 164 164 PHE PHE D . n 
L 3 164 ASP 164 165 165 ASP ASP D . n 
L 3 165 ILE 165 166 166 ILE ILE D . n 
L 3 166 ASN 166 167 167 ASN ASN D . n 
L 3 167 TYR 167 168 168 TYR TYR D . n 
L 3 168 LEU 168 169 169 LEU LEU D . n 
L 3 169 GLU 169 170 170 GLU GLU D . n 
L 3 170 VAL 170 171 171 VAL VAL D . n 
L 3 171 ASP 171 172 172 ASP ASP D . n 
L 3 172 TRP 172 173 173 TRP TRP D . n 
L 3 173 GLU 173 174 174 GLU GLU D . n 
L 3 174 LEU 174 175 175 LEU LEU D . n 
L 3 175 ASN 175 176 176 ASN ASN D . n 
L 3 176 GLY 176 177 177 GLY GLY D . n 
L 3 177 GLU 177 178 178 GLU GLU D . n 
L 3 178 ASP 178 179 179 ASP ASP D . n 
L 3 179 LEU 179 180 180 LEU LEU D . n 
L 3 180 VAL 180 181 181 VAL VAL D . n 
L 3 181 CYS 181 182 182 CYS CYS D . n 
L 3 182 VAL 182 183 183 VAL VAL D . n 
L 3 183 SER 183 184 184 SER SER D . n 
L 3 184 THR 184 185 185 THR THR D . n 
L 3 185 SER 185 186 186 SER SER D . n 
L 3 186 PHE 186 187 187 PHE PHE D . n 
L 3 187 ALA 187 188 188 ALA ALA D . n 
L 3 188 GLU 188 189 189 GLU GLU D . n 
L 3 189 LEU 189 190 190 LEU LEU D . n 
L 3 190 PHE 190 191 191 PHE PHE D . n 
L 3 191 LYS 191 192 192 LYS LYS D . n 
L 3 192 SER 192 193 193 SER SER D . n 
L 3 193 GLU 193 194 194 GLU GLU D . n 
L 3 194 PRO 194 195 195 PRO PRO D . n 
L 3 195 SER 195 196 196 SER SER D . n 
L 3 196 GLU 196 197 197 GLU GLU D . n 
L 3 197 LEU 197 198 198 LEU LEU D . n 
L 3 198 TYR 198 199 199 TYR TYR D . n 
L 3 199 ILE 199 200 200 ILE ILE D . n 
L 3 200 ASN 200 201 201 ASN ASN D . n 
L 3 201 TRP 201 202 202 TRP TRP D . n 
L 3 202 ALA 202 203 203 ALA ALA D . n 
L 3 203 ALA 203 204 204 ALA ALA D . n 
L 3 204 ALA 204 205 205 ALA ALA D . n 
L 3 205 MET 205 206 206 MET MET D . n 
L 3 206 GLN 206 207 207 GLN GLN D . n 
L 3 207 ILE 207 208 208 ILE ILE D . n 
L 3 208 GLN 208 209 209 GLN GLN D . n 
L 3 209 PHE 209 210 210 PHE PHE D . n 
L 3 210 HIS 210 211 211 HIS HIS D . n 
L 3 211 VAL 211 212 212 VAL VAL D . n 
L 3 212 ARG 212 213 213 ARG ARG D . n 
L 3 213 ASP 213 214 214 ASP ASP D . n 
L 3 214 LEU 214 215 215 LEU LEU D . n 
L 3 215 ASP 215 216 216 ASP ASP D . n 
L 3 216 GLN 216 217 217 GLN GLN D . n 
L 3 217 GLY 217 218 218 GLY GLY D . n 
L 3 218 PHE 218 219 219 PHE PHE D . n 
L 3 219 ASN 219 220 220 ASN ASN D . n 
L 3 220 GLY 220 221 221 GLY GLY D . n 
L 3 221 THR 221 222 222 THR THR D . n 
L 3 222 ARG 222 223 223 ARG ARG D . n 
L 3 223 GLU 223 224 224 GLU GLU D . n 
L 3 224 GLU 224 225 225 GLU GLU D . n 
L 3 225 TRP 225 226 226 TRP TRP D . n 
L 3 226 ALA 226 227 227 ALA ALA D . n 
L 3 227 LYS 227 228 228 LYS LYS D . n 
L 3 228 SER 228 229 229 SER SER D . n 
L 3 229 TYR 229 230 230 TYR TYR D . n 
L 3 230 LEU 230 231 231 LEU LEU D . n 
L 3 231 LYS 231 232 232 LYS LYS D . n 
L 3 232 HIS 232 233 233 HIS HIS D . n 
L 3 233 PHE 233 234 234 PHE PHE D . n 
L 3 234 VAL 234 235 235 VAL VAL D . n 
L 3 235 THR 235 236 236 THR THR D . n 
L 3 236 GLN 236 237 237 GLN GLN D . n 
L 3 237 ALA 237 238 238 ALA ALA D . n 
L 3 238 GLU 238 239 239 GLU GLU D . n 
L 3 239 GLN 239 240 240 GLN GLN D . n 
L 3 240 ARG 240 241 241 ARG ARG D . n 
L 3 241 ALA 241 242 242 ALA ALA D . n 
L 3 242 ILE 242 243 243 ILE ILE D . n 
L 3 243 SER 243 244 244 SER SER D . n 
L 3 244 MET 244 245 245 MET MET D . n 
L 3 245 ILE 245 246 246 ILE ILE D . n 
L 3 246 ASP 246 247 247 ASP ASP D . n 
L 3 247 LYS 247 248 248 LYS LYS D . n 
L 3 248 PHE 248 249 249 PHE PHE D . n 
L 3 249 VAL 249 250 250 VAL VAL D . n 
L 3 250 LYS 250 251 251 LYS LYS D . n 
L 3 251 PRO 251 252 252 PRO PRO D . n 
L 3 252 PHE 252 253 253 PHE PHE D . n 
L 3 253 LYS 253 254 254 LYS LYS D . n 
L 3 254 LYS 254 255 255 LYS LYS D . n 
L 3 255 TYR 255 256 256 TYR TYR D . n 
L 3 256 ILE 256 257 257 ILE ILE D . n 
L 3 257 LEU 257 258 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
M 4 HOH 1   8   1   HOH WAT E . 
M 4 HOH 2   9   27  HOH WAT E . 
M 4 HOH 3   10  57  HOH WAT E . 
M 4 HOH 4   11  64  HOH WAT E . 
M 4 HOH 5   12  73  HOH WAT E . 
M 4 HOH 6   13  153 HOH WAT E . 
M 4 HOH 7   14  154 HOH WAT E . 
M 4 HOH 8   15  155 HOH WAT E . 
M 4 HOH 9   16  198 HOH WAT E . 
M 4 HOH 10  17  225 HOH WAT E . 
M 4 HOH 11  18  407 HOH WAT E . 
M 4 HOH 12  19  449 HOH WAT E . 
M 4 HOH 13  20  546 HOH WAT E . 
N 4 HOH 1   44  44  HOH WAT F . 
N 4 HOH 2   45  45  HOH WAT F . 
N 4 HOH 3   98  98  HOH WAT F . 
N 4 HOH 4   103 103 HOH WAT F . 
N 4 HOH 5   156 156 HOH WAT F . 
N 4 HOH 6   203 203 HOH WAT F . 
N 4 HOH 7   204 204 HOH WAT F . 
N 4 HOH 8   205 205 HOH WAT F . 
N 4 HOH 9   278 278 HOH WAT F . 
N 4 HOH 10  452 452 HOH WAT F . 
N 4 HOH 11  453 453 HOH WAT F . 
O 4 HOH 1   29  29  HOH WAT G . 
O 4 HOH 2   30  30  HOH WAT G . 
O 4 HOH 3   50  50  HOH WAT G . 
O 4 HOH 4   118 118 HOH WAT G . 
O 4 HOH 5   119 119 HOH WAT G . 
O 4 HOH 6   157 157 HOH WAT G . 
O 4 HOH 7   275 275 HOH WAT G . 
O 4 HOH 8   279 279 HOH WAT G . 
O 4 HOH 9   287 287 HOH WAT G . 
O 4 HOH 10  289 289 HOH WAT G . 
O 4 HOH 11  291 291 HOH WAT G . 
O 4 HOH 12  401 401 HOH WAT G . 
O 4 HOH 13  531 531 HOH WAT G . 
O 4 HOH 14  543 543 HOH WAT G . 
P 4 HOH 1   55  55  HOH WAT H . 
P 4 HOH 2   56  56  HOH WAT H . 
P 4 HOH 3   86  86  HOH WAT H . 
P 4 HOH 4   87  87  HOH WAT H . 
P 4 HOH 5   88  88  HOH WAT H . 
P 4 HOH 6   96  96  HOH WAT H . 
P 4 HOH 7   158 158 HOH WAT H . 
P 4 HOH 8   159 159 HOH WAT H . 
P 4 HOH 9   195 195 HOH WAT H . 
P 4 HOH 10  265 265 HOH WAT H . 
P 4 HOH 11  373 373 HOH WAT H . 
P 4 HOH 12  381 381 HOH WAT H . 
P 4 HOH 13  442 442 HOH WAT H . 
P 4 HOH 14  443 443 HOH WAT H . 
P 4 HOH 15  530 530 HOH WAT H . 
Q 4 HOH 1   22  22  HOH WAT I . 
Q 4 HOH 2   31  31  HOH WAT I . 
Q 4 HOH 3   91  91  HOH WAT I . 
Q 4 HOH 4   148 148 HOH WAT I . 
Q 4 HOH 5   160 160 HOH WAT I . 
Q 4 HOH 6   161 161 HOH WAT I . 
Q 4 HOH 7   162 162 HOH WAT I . 
Q 4 HOH 8   163 163 HOH WAT I . 
Q 4 HOH 9   164 164 HOH WAT I . 
Q 4 HOH 10  363 363 HOH WAT I . 
Q 4 HOH 11  504 504 HOH WAT I . 
Q 4 HOH 12  508 508 HOH WAT I . 
Q 4 HOH 13  509 509 HOH WAT I . 
Q 4 HOH 14  529 529 HOH WAT I . 
Q 4 HOH 15  533 533 HOH WAT I . 
R 4 HOH 1   169 169 HOH WAT J . 
R 4 HOH 2   347 347 HOH WAT J . 
S 4 HOH 1   8   2   HOH WAT K . 
S 4 HOH 2   9   24  HOH WAT K . 
S 4 HOH 3   10  25  HOH WAT K . 
S 4 HOH 4   11  26  HOH WAT K . 
S 4 HOH 5   12  167 HOH WAT K . 
S 4 HOH 6   13  168 HOH WAT K . 
S 4 HOH 7   14  524 HOH WAT K . 
S 4 HOH 8   15  525 HOH WAT K . 
S 4 HOH 9   16  526 HOH WAT K . 
T 4 HOH 1   3   3   HOH WAT L . 
T 4 HOH 2   32  32  HOH WAT L . 
T 4 HOH 3   34  34  HOH WAT L . 
T 4 HOH 4   70  70  HOH WAT L . 
T 4 HOH 5   132 132 HOH WAT L . 
T 4 HOH 6   165 165 HOH WAT L . 
T 4 HOH 7   224 224 HOH WAT L . 
T 4 HOH 8   517 517 HOH WAT L . 
T 4 HOH 9   527 527 HOH WAT L . 
U 4 HOH 1   259 5   HOH WAT A . 
U 4 HOH 2   260 6   HOH WAT A . 
U 4 HOH 3   261 37  HOH WAT A . 
U 4 HOH 4   262 38  HOH WAT A . 
U 4 HOH 5   263 39  HOH WAT A . 
U 4 HOH 6   264 40  HOH WAT A . 
U 4 HOH 7   265 41  HOH WAT A . 
U 4 HOH 8   266 42  HOH WAT A . 
U 4 HOH 9   267 43  HOH WAT A . 
U 4 HOH 10  268 46  HOH WAT A . 
U 4 HOH 11  269 47  HOH WAT A . 
U 4 HOH 12  270 48  HOH WAT A . 
U 4 HOH 13  271 49  HOH WAT A . 
U 4 HOH 14  272 51  HOH WAT A . 
U 4 HOH 15  273 52  HOH WAT A . 
U 4 HOH 16  274 53  HOH WAT A . 
U 4 HOH 17  275 54  HOH WAT A . 
U 4 HOH 18  276 58  HOH WAT A . 
U 4 HOH 19  277 59  HOH WAT A . 
U 4 HOH 20  278 60  HOH WAT A . 
U 4 HOH 21  279 61  HOH WAT A . 
U 4 HOH 22  280 62  HOH WAT A . 
U 4 HOH 23  281 63  HOH WAT A . 
U 4 HOH 24  282 65  HOH WAT A . 
U 4 HOH 25  283 66  HOH WAT A . 
U 4 HOH 26  284 67  HOH WAT A . 
U 4 HOH 27  285 68  HOH WAT A . 
U 4 HOH 28  286 69  HOH WAT A . 
U 4 HOH 29  287 71  HOH WAT A . 
U 4 HOH 30  288 74  HOH WAT A . 
U 4 HOH 31  289 75  HOH WAT A . 
U 4 HOH 32  290 76  HOH WAT A . 
U 4 HOH 33  291 95  HOH WAT A . 
U 4 HOH 34  292 124 HOH WAT A . 
U 4 HOH 35  293 126 HOH WAT A . 
U 4 HOH 36  294 170 HOH WAT A . 
U 4 HOH 37  295 171 HOH WAT A . 
U 4 HOH 38  296 172 HOH WAT A . 
U 4 HOH 39  297 173 HOH WAT A . 
U 4 HOH 40  298 174 HOH WAT A . 
U 4 HOH 41  299 175 HOH WAT A . 
U 4 HOH 42  300 176 HOH WAT A . 
U 4 HOH 43  301 177 HOH WAT A . 
U 4 HOH 44  302 178 HOH WAT A . 
U 4 HOH 45  303 179 HOH WAT A . 
U 4 HOH 46  304 180 HOH WAT A . 
U 4 HOH 47  305 181 HOH WAT A . 
U 4 HOH 48  306 182 HOH WAT A . 
U 4 HOH 49  307 183 HOH WAT A . 
U 4 HOH 50  308 184 HOH WAT A . 
U 4 HOH 51  309 185 HOH WAT A . 
U 4 HOH 52  310 186 HOH WAT A . 
U 4 HOH 53  311 187 HOH WAT A . 
U 4 HOH 54  312 188 HOH WAT A . 
U 4 HOH 55  313 189 HOH WAT A . 
U 4 HOH 56  314 190 HOH WAT A . 
U 4 HOH 57  315 191 HOH WAT A . 
U 4 HOH 58  316 192 HOH WAT A . 
U 4 HOH 59  317 193 HOH WAT A . 
U 4 HOH 60  318 194 HOH WAT A . 
U 4 HOH 61  319 201 HOH WAT A . 
U 4 HOH 62  320 206 HOH WAT A . 
U 4 HOH 63  321 207 HOH WAT A . 
U 4 HOH 64  322 208 HOH WAT A . 
U 4 HOH 65  323 209 HOH WAT A . 
U 4 HOH 66  324 210 HOH WAT A . 
U 4 HOH 67  325 211 HOH WAT A . 
U 4 HOH 68  326 212 HOH WAT A . 
U 4 HOH 69  327 213 HOH WAT A . 
U 4 HOH 70  328 214 HOH WAT A . 
U 4 HOH 71  329 215 HOH WAT A . 
U 4 HOH 72  330 216 HOH WAT A . 
U 4 HOH 73  331 217 HOH WAT A . 
U 4 HOH 74  332 218 HOH WAT A . 
U 4 HOH 75  333 219 HOH WAT A . 
U 4 HOH 76  334 220 HOH WAT A . 
U 4 HOH 77  335 221 HOH WAT A . 
U 4 HOH 78  336 222 HOH WAT A . 
U 4 HOH 79  337 223 HOH WAT A . 
U 4 HOH 80  338 226 HOH WAT A . 
U 4 HOH 81  339 230 HOH WAT A . 
U 4 HOH 82  340 231 HOH WAT A . 
U 4 HOH 83  341 232 HOH WAT A . 
U 4 HOH 84  342 233 HOH WAT A . 
U 4 HOH 85  343 234 HOH WAT A . 
U 4 HOH 86  344 235 HOH WAT A . 
U 4 HOH 87  345 236 HOH WAT A . 
U 4 HOH 88  346 238 HOH WAT A . 
U 4 HOH 89  347 239 HOH WAT A . 
U 4 HOH 90  348 270 HOH WAT A . 
U 4 HOH 91  349 305 HOH WAT A . 
U 4 HOH 92  350 306 HOH WAT A . 
U 4 HOH 93  351 307 HOH WAT A . 
U 4 HOH 94  352 308 HOH WAT A . 
U 4 HOH 95  353 309 HOH WAT A . 
U 4 HOH 96  354 310 HOH WAT A . 
U 4 HOH 97  355 312 HOH WAT A . 
U 4 HOH 98  356 330 HOH WAT A . 
U 4 HOH 99  357 331 HOH WAT A . 
U 4 HOH 100 358 377 HOH WAT A . 
U 4 HOH 101 359 378 HOH WAT A . 
U 4 HOH 102 360 379 HOH WAT A . 
U 4 HOH 103 361 380 HOH WAT A . 
U 4 HOH 104 362 382 HOH WAT A . 
U 4 HOH 105 363 383 HOH WAT A . 
U 4 HOH 106 364 384 HOH WAT A . 
U 4 HOH 107 365 385 HOH WAT A . 
U 4 HOH 108 366 386 HOH WAT A . 
U 4 HOH 109 367 387 HOH WAT A . 
U 4 HOH 110 368 388 HOH WAT A . 
U 4 HOH 111 369 389 HOH WAT A . 
U 4 HOH 112 370 390 HOH WAT A . 
U 4 HOH 113 371 391 HOH WAT A . 
U 4 HOH 114 372 392 HOH WAT A . 
U 4 HOH 115 373 393 HOH WAT A . 
U 4 HOH 116 374 395 HOH WAT A . 
U 4 HOH 117 375 396 HOH WAT A . 
U 4 HOH 118 376 399 HOH WAT A . 
U 4 HOH 119 377 400 HOH WAT A . 
U 4 HOH 120 378 402 HOH WAT A . 
U 4 HOH 121 379 403 HOH WAT A . 
U 4 HOH 122 380 404 HOH WAT A . 
U 4 HOH 123 381 405 HOH WAT A . 
U 4 HOH 124 382 406 HOH WAT A . 
U 4 HOH 125 383 408 HOH WAT A . 
U 4 HOH 126 384 409 HOH WAT A . 
U 4 HOH 127 385 410 HOH WAT A . 
U 4 HOH 128 386 411 HOH WAT A . 
U 4 HOH 129 387 412 HOH WAT A . 
U 4 HOH 130 388 413 HOH WAT A . 
U 4 HOH 131 389 414 HOH WAT A . 
U 4 HOH 132 390 415 HOH WAT A . 
U 4 HOH 133 391 416 HOH WAT A . 
U 4 HOH 134 392 417 HOH WAT A . 
U 4 HOH 135 393 419 HOH WAT A . 
U 4 HOH 136 394 420 HOH WAT A . 
U 4 HOH 137 395 421 HOH WAT A . 
U 4 HOH 138 396 424 HOH WAT A . 
U 4 HOH 139 397 425 HOH WAT A . 
U 4 HOH 140 398 426 HOH WAT A . 
U 4 HOH 141 399 454 HOH WAT A . 
U 4 HOH 142 400 461 HOH WAT A . 
U 4 HOH 143 401 470 HOH WAT A . 
U 4 HOH 144 402 541 HOH WAT A . 
U 4 HOH 145 403 545 HOH WAT A . 
U 4 HOH 146 404 556 HOH WAT A . 
V 4 HOH 1   259 7   HOH WAT B . 
V 4 HOH 2   260 8   HOH WAT B . 
V 4 HOH 3   261 9   HOH WAT B . 
V 4 HOH 4   262 10  HOH WAT B . 
V 4 HOH 5   263 11  HOH WAT B . 
V 4 HOH 6   264 28  HOH WAT B . 
V 4 HOH 7   265 77  HOH WAT B . 
V 4 HOH 8   266 78  HOH WAT B . 
V 4 HOH 9   267 79  HOH WAT B . 
V 4 HOH 10  268 80  HOH WAT B . 
V 4 HOH 11  269 81  HOH WAT B . 
V 4 HOH 12  270 82  HOH WAT B . 
V 4 HOH 13  271 83  HOH WAT B . 
V 4 HOH 14  272 84  HOH WAT B . 
V 4 HOH 15  273 85  HOH WAT B . 
V 4 HOH 16  274 89  HOH WAT B . 
V 4 HOH 17  275 90  HOH WAT B . 
V 4 HOH 18  276 92  HOH WAT B . 
V 4 HOH 19  277 97  HOH WAT B . 
V 4 HOH 20  278 99  HOH WAT B . 
V 4 HOH 21  279 100 HOH WAT B . 
V 4 HOH 22  280 101 HOH WAT B . 
V 4 HOH 23  281 102 HOH WAT B . 
V 4 HOH 24  282 104 HOH WAT B . 
V 4 HOH 25  283 105 HOH WAT B . 
V 4 HOH 26  284 106 HOH WAT B . 
V 4 HOH 27  285 107 HOH WAT B . 
V 4 HOH 28  286 108 HOH WAT B . 
V 4 HOH 29  287 109 HOH WAT B . 
V 4 HOH 30  288 110 HOH WAT B . 
V 4 HOH 31  289 111 HOH WAT B . 
V 4 HOH 32  290 112 HOH WAT B . 
V 4 HOH 33  291 113 HOH WAT B . 
V 4 HOH 34  292 114 HOH WAT B . 
V 4 HOH 35  293 115 HOH WAT B . 
V 4 HOH 36  294 116 HOH WAT B . 
V 4 HOH 37  295 117 HOH WAT B . 
V 4 HOH 38  296 120 HOH WAT B . 
V 4 HOH 39  297 121 HOH WAT B . 
V 4 HOH 40  298 122 HOH WAT B . 
V 4 HOH 41  299 123 HOH WAT B . 
V 4 HOH 42  300 125 HOH WAT B . 
V 4 HOH 43  301 127 HOH WAT B . 
V 4 HOH 44  302 139 HOH WAT B . 
V 4 HOH 45  303 199 HOH WAT B . 
V 4 HOH 46  304 200 HOH WAT B . 
V 4 HOH 47  305 202 HOH WAT B . 
V 4 HOH 48  306 240 HOH WAT B . 
V 4 HOH 49  307 241 HOH WAT B . 
V 4 HOH 50  308 242 HOH WAT B . 
V 4 HOH 51  309 243 HOH WAT B . 
V 4 HOH 52  310 244 HOH WAT B . 
V 4 HOH 53  311 245 HOH WAT B . 
V 4 HOH 54  312 246 HOH WAT B . 
V 4 HOH 55  313 247 HOH WAT B . 
V 4 HOH 56  314 248 HOH WAT B . 
V 4 HOH 57  315 249 HOH WAT B . 
V 4 HOH 58  316 250 HOH WAT B . 
V 4 HOH 59  317 251 HOH WAT B . 
V 4 HOH 60  318 252 HOH WAT B . 
V 4 HOH 61  319 253 HOH WAT B . 
V 4 HOH 62  320 255 HOH WAT B . 
V 4 HOH 63  321 256 HOH WAT B . 
V 4 HOH 64  322 257 HOH WAT B . 
V 4 HOH 65  323 258 HOH WAT B . 
V 4 HOH 66  324 259 HOH WAT B . 
V 4 HOH 67  325 260 HOH WAT B . 
V 4 HOH 68  326 261 HOH WAT B . 
V 4 HOH 69  327 262 HOH WAT B . 
V 4 HOH 70  328 263 HOH WAT B . 
V 4 HOH 71  329 264 HOH WAT B . 
V 4 HOH 72  330 266 HOH WAT B . 
V 4 HOH 73  331 267 HOH WAT B . 
V 4 HOH 74  332 268 HOH WAT B . 
V 4 HOH 75  333 269 HOH WAT B . 
V 4 HOH 76  334 271 HOH WAT B . 
V 4 HOH 77  335 272 HOH WAT B . 
V 4 HOH 78  336 273 HOH WAT B . 
V 4 HOH 79  337 274 HOH WAT B . 
V 4 HOH 80  338 276 HOH WAT B . 
V 4 HOH 81  339 277 HOH WAT B . 
V 4 HOH 82  340 280 HOH WAT B . 
V 4 HOH 83  341 281 HOH WAT B . 
V 4 HOH 84  342 282 HOH WAT B . 
V 4 HOH 85  343 283 HOH WAT B . 
V 4 HOH 86  344 284 HOH WAT B . 
V 4 HOH 87  345 285 HOH WAT B . 
V 4 HOH 88  346 286 HOH WAT B . 
V 4 HOH 89  347 288 HOH WAT B . 
V 4 HOH 90  348 290 HOH WAT B . 
V 4 HOH 91  349 292 HOH WAT B . 
V 4 HOH 92  350 293 HOH WAT B . 
V 4 HOH 93  351 294 HOH WAT B . 
V 4 HOH 94  352 295 HOH WAT B . 
V 4 HOH 95  353 296 HOH WAT B . 
V 4 HOH 96  354 297 HOH WAT B . 
V 4 HOH 97  355 298 HOH WAT B . 
V 4 HOH 98  356 299 HOH WAT B . 
V 4 HOH 99  357 300 HOH WAT B . 
V 4 HOH 100 358 301 HOH WAT B . 
V 4 HOH 101 359 302 HOH WAT B . 
V 4 HOH 102 360 303 HOH WAT B . 
V 4 HOH 103 361 304 HOH WAT B . 
V 4 HOH 104 362 317 HOH WAT B . 
V 4 HOH 105 363 318 HOH WAT B . 
V 4 HOH 106 364 319 HOH WAT B . 
V 4 HOH 107 365 320 HOH WAT B . 
V 4 HOH 108 366 321 HOH WAT B . 
V 4 HOH 109 367 322 HOH WAT B . 
V 4 HOH 110 368 323 HOH WAT B . 
V 4 HOH 111 369 324 HOH WAT B . 
V 4 HOH 112 370 325 HOH WAT B . 
V 4 HOH 113 371 326 HOH WAT B . 
V 4 HOH 114 372 327 HOH WAT B . 
V 4 HOH 115 373 328 HOH WAT B . 
V 4 HOH 116 374 329 HOH WAT B . 
V 4 HOH 117 375 332 HOH WAT B . 
V 4 HOH 118 376 355 HOH WAT B . 
V 4 HOH 119 377 357 HOH WAT B . 
V 4 HOH 120 378 374 HOH WAT B . 
V 4 HOH 121 379 394 HOH WAT B . 
V 4 HOH 122 380 397 HOH WAT B . 
V 4 HOH 123 381 398 HOH WAT B . 
V 4 HOH 124 382 418 HOH WAT B . 
V 4 HOH 125 383 422 HOH WAT B . 
V 4 HOH 126 384 423 HOH WAT B . 
V 4 HOH 127 385 427 HOH WAT B . 
V 4 HOH 128 386 428 HOH WAT B . 
V 4 HOH 129 387 429 HOH WAT B . 
V 4 HOH 130 388 430 HOH WAT B . 
V 4 HOH 131 389 431 HOH WAT B . 
V 4 HOH 132 390 432 HOH WAT B . 
V 4 HOH 133 391 433 HOH WAT B . 
V 4 HOH 134 392 434 HOH WAT B . 
V 4 HOH 135 393 435 HOH WAT B . 
V 4 HOH 136 394 436 HOH WAT B . 
V 4 HOH 137 395 437 HOH WAT B . 
V 4 HOH 138 396 438 HOH WAT B . 
V 4 HOH 139 397 439 HOH WAT B . 
V 4 HOH 140 398 440 HOH WAT B . 
V 4 HOH 141 399 441 HOH WAT B . 
V 4 HOH 142 400 444 HOH WAT B . 
V 4 HOH 143 401 445 HOH WAT B . 
V 4 HOH 144 402 446 HOH WAT B . 
V 4 HOH 145 403 447 HOH WAT B . 
V 4 HOH 146 404 448 HOH WAT B . 
V 4 HOH 147 405 450 HOH WAT B . 
V 4 HOH 148 406 451 HOH WAT B . 
V 4 HOH 149 407 455 HOH WAT B . 
V 4 HOH 150 408 456 HOH WAT B . 
V 4 HOH 151 409 457 HOH WAT B . 
V 4 HOH 152 410 458 HOH WAT B . 
V 4 HOH 153 411 459 HOH WAT B . 
V 4 HOH 154 412 460 HOH WAT B . 
V 4 HOH 155 413 462 HOH WAT B . 
V 4 HOH 156 414 463 HOH WAT B . 
V 4 HOH 157 415 464 HOH WAT B . 
V 4 HOH 158 416 465 HOH WAT B . 
V 4 HOH 159 417 466 HOH WAT B . 
V 4 HOH 160 418 467 HOH WAT B . 
V 4 HOH 161 419 468 HOH WAT B . 
V 4 HOH 162 420 469 HOH WAT B . 
V 4 HOH 163 421 471 HOH WAT B . 
V 4 HOH 164 422 472 HOH WAT B . 
V 4 HOH 165 423 473 HOH WAT B . 
V 4 HOH 166 424 474 HOH WAT B . 
V 4 HOH 167 425 475 HOH WAT B . 
V 4 HOH 168 426 476 HOH WAT B . 
V 4 HOH 169 427 477 HOH WAT B . 
V 4 HOH 170 428 478 HOH WAT B . 
V 4 HOH 171 429 479 HOH WAT B . 
V 4 HOH 172 430 480 HOH WAT B . 
V 4 HOH 173 431 481 HOH WAT B . 
V 4 HOH 174 432 482 HOH WAT B . 
V 4 HOH 175 433 483 HOH WAT B . 
V 4 HOH 176 434 484 HOH WAT B . 
V 4 HOH 177 435 485 HOH WAT B . 
V 4 HOH 178 436 486 HOH WAT B . 
V 4 HOH 179 437 487 HOH WAT B . 
V 4 HOH 180 438 488 HOH WAT B . 
V 4 HOH 181 439 489 HOH WAT B . 
V 4 HOH 182 440 490 HOH WAT B . 
V 4 HOH 183 441 491 HOH WAT B . 
V 4 HOH 184 442 492 HOH WAT B . 
V 4 HOH 185 443 493 HOH WAT B . 
V 4 HOH 186 444 494 HOH WAT B . 
V 4 HOH 187 445 532 HOH WAT B . 
V 4 HOH 188 446 542 HOH WAT B . 
V 4 HOH 189 447 547 HOH WAT B . 
V 4 HOH 190 448 553 HOH WAT B . 
V 4 HOH 191 449 554 HOH WAT B . 
V 4 HOH 192 450 555 HOH WAT B . 
W 4 HOH 1   259 12  HOH WAT C . 
W 4 HOH 2   260 13  HOH WAT C . 
W 4 HOH 3   261 14  HOH WAT C . 
W 4 HOH 4   262 15  HOH WAT C . 
W 4 HOH 5   263 16  HOH WAT C . 
W 4 HOH 6   264 93  HOH WAT C . 
W 4 HOH 7   265 94  HOH WAT C . 
W 4 HOH 8   266 128 HOH WAT C . 
W 4 HOH 9   267 129 HOH WAT C . 
W 4 HOH 10  268 130 HOH WAT C . 
W 4 HOH 11  269 131 HOH WAT C . 
W 4 HOH 12  270 133 HOH WAT C . 
W 4 HOH 13  271 134 HOH WAT C . 
W 4 HOH 14  272 135 HOH WAT C . 
W 4 HOH 15  273 136 HOH WAT C . 
W 4 HOH 16  274 137 HOH WAT C . 
W 4 HOH 17  275 138 HOH WAT C . 
W 4 HOH 18  276 140 HOH WAT C . 
W 4 HOH 19  277 141 HOH WAT C . 
W 4 HOH 20  278 142 HOH WAT C . 
W 4 HOH 21  279 143 HOH WAT C . 
W 4 HOH 22  280 144 HOH WAT C . 
W 4 HOH 23  281 166 HOH WAT C . 
W 4 HOH 24  282 196 HOH WAT C . 
W 4 HOH 25  283 197 HOH WAT C . 
W 4 HOH 26  284 237 HOH WAT C . 
W 4 HOH 27  285 254 HOH WAT C . 
W 4 HOH 28  286 311 HOH WAT C . 
W 4 HOH 29  287 313 HOH WAT C . 
W 4 HOH 30  288 314 HOH WAT C . 
W 4 HOH 31  289 315 HOH WAT C . 
W 4 HOH 32  290 316 HOH WAT C . 
W 4 HOH 33  291 333 HOH WAT C . 
W 4 HOH 34  292 334 HOH WAT C . 
W 4 HOH 35  293 335 HOH WAT C . 
W 4 HOH 36  294 336 HOH WAT C . 
W 4 HOH 37  295 337 HOH WAT C . 
W 4 HOH 38  296 339 HOH WAT C . 
W 4 HOH 39  297 343 HOH WAT C . 
W 4 HOH 40  298 344 HOH WAT C . 
W 4 HOH 41  299 345 HOH WAT C . 
W 4 HOH 42  300 346 HOH WAT C . 
W 4 HOH 43  301 351 HOH WAT C . 
W 4 HOH 44  302 354 HOH WAT C . 
W 4 HOH 45  303 356 HOH WAT C . 
W 4 HOH 46  304 358 HOH WAT C . 
W 4 HOH 47  305 359 HOH WAT C . 
W 4 HOH 48  306 360 HOH WAT C . 
W 4 HOH 49  307 361 HOH WAT C . 
W 4 HOH 50  308 362 HOH WAT C . 
W 4 HOH 51  309 364 HOH WAT C . 
W 4 HOH 52  310 365 HOH WAT C . 
W 4 HOH 53  311 366 HOH WAT C . 
W 4 HOH 54  312 371 HOH WAT C . 
W 4 HOH 55  313 372 HOH WAT C . 
W 4 HOH 56  314 375 HOH WAT C . 
W 4 HOH 57  315 376 HOH WAT C . 
W 4 HOH 58  316 495 HOH WAT C . 
W 4 HOH 59  317 496 HOH WAT C . 
W 4 HOH 60  318 497 HOH WAT C . 
W 4 HOH 61  319 498 HOH WAT C . 
W 4 HOH 62  320 499 HOH WAT C . 
W 4 HOH 63  321 501 HOH WAT C . 
W 4 HOH 64  322 502 HOH WAT C . 
W 4 HOH 65  323 503 HOH WAT C . 
W 4 HOH 66  324 505 HOH WAT C . 
W 4 HOH 67  325 506 HOH WAT C . 
W 4 HOH 68  326 528 HOH WAT C . 
W 4 HOH 69  327 535 HOH WAT C . 
W 4 HOH 70  328 539 HOH WAT C . 
W 4 HOH 71  329 540 HOH WAT C . 
W 4 HOH 72  330 551 HOH WAT C . 
W 4 HOH 73  331 552 HOH WAT C . 
X 4 HOH 1   259 4   HOH WAT D . 
X 4 HOH 2   260 17  HOH WAT D . 
X 4 HOH 3   261 18  HOH WAT D . 
X 4 HOH 4   262 19  HOH WAT D . 
X 4 HOH 5   263 20  HOH WAT D . 
X 4 HOH 6   264 21  HOH WAT D . 
X 4 HOH 7   265 23  HOH WAT D . 
X 4 HOH 8   266 33  HOH WAT D . 
X 4 HOH 9   267 35  HOH WAT D . 
X 4 HOH 10  268 36  HOH WAT D . 
X 4 HOH 11  269 72  HOH WAT D . 
X 4 HOH 12  270 145 HOH WAT D . 
X 4 HOH 13  271 146 HOH WAT D . 
X 4 HOH 14  272 147 HOH WAT D . 
X 4 HOH 15  273 149 HOH WAT D . 
X 4 HOH 16  274 150 HOH WAT D . 
X 4 HOH 17  275 151 HOH WAT D . 
X 4 HOH 18  276 152 HOH WAT D . 
X 4 HOH 19  277 227 HOH WAT D . 
X 4 HOH 20  278 228 HOH WAT D . 
X 4 HOH 21  279 229 HOH WAT D . 
X 4 HOH 22  280 338 HOH WAT D . 
X 4 HOH 23  281 340 HOH WAT D . 
X 4 HOH 24  282 341 HOH WAT D . 
X 4 HOH 25  283 342 HOH WAT D . 
X 4 HOH 26  284 348 HOH WAT D . 
X 4 HOH 27  285 349 HOH WAT D . 
X 4 HOH 28  286 350 HOH WAT D . 
X 4 HOH 29  287 352 HOH WAT D . 
X 4 HOH 30  288 353 HOH WAT D . 
X 4 HOH 31  289 367 HOH WAT D . 
X 4 HOH 32  290 368 HOH WAT D . 
X 4 HOH 33  291 369 HOH WAT D . 
X 4 HOH 34  292 370 HOH WAT D . 
X 4 HOH 35  293 500 HOH WAT D . 
X 4 HOH 36  294 507 HOH WAT D . 
X 4 HOH 37  295 510 HOH WAT D . 
X 4 HOH 38  296 511 HOH WAT D . 
X 4 HOH 39  297 512 HOH WAT D . 
X 4 HOH 40  298 513 HOH WAT D . 
X 4 HOH 41  299 514 HOH WAT D . 
X 4 HOH 42  300 515 HOH WAT D . 
X 4 HOH 43  301 516 HOH WAT D . 
X 4 HOH 44  302 518 HOH WAT D . 
X 4 HOH 45  303 519 HOH WAT D . 
X 4 HOH 46  304 520 HOH WAT D . 
X 4 HOH 47  305 521 HOH WAT D . 
X 4 HOH 48  306 522 HOH WAT D . 
X 4 HOH 49  307 523 HOH WAT D . 
X 4 HOH 50  308 534 HOH WAT D . 
X 4 HOH 51  309 536 HOH WAT D . 
X 4 HOH 52  310 537 HOH WAT D . 
X 4 HOH 53  311 538 HOH WAT D . 
X 4 HOH 54  312 544 HOH WAT D . 
X 4 HOH 55  313 548 HOH WAT D . 
X 4 HOH 56  314 549 HOH WAT D . 
X 4 HOH 57  315 550 HOH WAT D . 
X 4 HOH 58  316 557 HOH WAT D . 
X 4 HOH 59  317 558 HOH WAT D . 
X 4 HOH 60  318 559 HOH WAT D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? hexameric 6 
2 author_defined_assembly ? hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,I,J,M,N,O,P,U,V 
2 1 E,F,G,H,K,L,Q,R,S,T,W,X 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-09-28 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS   'data scaling'   .         ? 1 
SCALA 'data scaling'   .         ? 2 
CNS   refinement       .         ? 3 
XDS   'data reduction' .         ? 4 
CCP4  'data scaling'   '(SCALA)' ? 5 
CNS   phasing          .         ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 "O3'" L DG  8   ? ? O L HOH 34  ? ? 2.12 
2 1 N     D GLY 92  ? ? O D HOH 268 ? ? 2.16 
3 1 N     A GLN 121 ? ? O A HOH 327 ? ? 2.17 
4 1 OP1   G DG  5   ? ? O G HOH 119 ? ? 2.18 
5 1 OE1   B GLN 138 ? ? O B HOH 407 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     397 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     397 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_556 
_pdbx_validate_symm_contact.dist              1.21 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 P F DG 8 ? ? OP3 F DG 8 ? ? 1.521 1.607 -0.086 0.012 N 
2 1 P H DG 8 ? ? OP3 H DG 8 ? ? 1.529 1.607 -0.078 0.012 N 
3 1 P J DG 8 ? ? OP3 J DG 8 ? ? 1.521 1.607 -0.086 0.012 N 
4 1 P L DG 8 ? ? OP3 L DG 8 ? ? 1.522 1.607 -0.085 0.012 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" F DA 9 ? ? "C1'" F DA 9 ? ? N9 F DA 9 ? ? 111.54 108.30 3.24 0.30 N 
2 1 "O4'" H DA 9 ? ? "C1'" H DA 9 ? ? N9 H DA 9 ? ? 111.05 108.30 2.75 0.30 N 
3 1 "O4'" J DG 8 ? ? "C1'" J DG 8 ? ? N9 J DG 8 ? ? 110.12 108.30 1.82 0.30 N 
4 1 "O4'" L DG 8 ? ? "C1'" L DG 8 ? ? N9 L DG 8 ? ? 110.46 108.30 2.16 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ASP A 10  ? ? -37.14  -32.35  
2   1 PRO A 23  ? ? -56.99  89.62   
3   1 LYS A 24  ? ? 42.79   25.00   
4   1 LEU A 28  ? ? -69.40  36.95   
5   1 HIS A 31  ? ? -69.59  23.67   
6   1 ALA A 33  ? ? -43.72  -94.34  
7   1 ASN A 48  ? ? -81.64  -73.23  
8   1 LEU A 49  ? ? -82.19  46.23   
9   1 SER A 50  ? ? -39.50  -32.85  
10  1 GLN A 56  ? ? -9.48   -73.82  
11  1 TRP A 99  ? ? -40.72  152.23  
12  1 ASN A 103 ? ? -152.61 53.70   
13  1 GLN A 121 ? ? 43.13   20.94   
14  1 SER A 134 ? ? -69.93  30.35   
15  1 LYS A 135 ? ? 174.21  -173.11 
16  1 ILE A 156 ? ? -51.10  -70.82  
17  1 ASP A 157 ? ? -37.41  -87.16  
18  1 ASN A 158 ? ? -50.72  -6.02   
19  1 GLU A 160 ? ? -113.90 77.26   
20  1 LEU A 163 ? ? -121.35 -55.14  
21  1 PHE A 191 ? ? -68.76  9.25    
22  1 LEU A 198 ? ? -39.25  123.16  
23  1 ALA A 204 ? ? -61.80  52.48   
24  1 MET A 206 ? ? 46.20   20.49   
25  1 PHE A 210 ? ? -175.13 146.83  
26  1 VAL A 250 ? ? -123.76 -65.47  
27  1 ILE A 257 ? ? -66.91  53.17   
28  1 LYS B 5   ? ? -27.15  -65.47  
29  1 LYS B 24  ? ? 55.79   4.46    
30  1 SER B 25  ? ? 63.70   -1.39   
31  1 HIS B 31  ? ? -34.22  -70.59  
32  1 PRO B 36  ? ? -52.68  -9.97   
33  1 ASN B 67  ? ? -159.80 56.22   
34  1 GLU B 74  ? ? -45.43  -72.75  
35  1 SER B 82  ? ? -163.32 113.25  
36  1 SER B 90  ? ? -39.63  162.38  
37  1 ASN B 98  ? ? -78.18  39.36   
38  1 ASN B 103 ? ? -155.40 84.93   
39  1 GLU B 106 ? ? -124.65 -167.23 
40  1 GLN B 121 ? ? 62.78   -9.23   
41  1 SER B 136 ? ? -105.97 77.77   
42  1 ILE B 143 ? ? -175.21 148.59  
43  1 ILE B 156 ? ? -64.64  -75.68  
44  1 ASP B 157 ? ? -36.19  -39.40  
45  1 ASP B 162 ? ? -175.20 43.96   
46  1 ALA B 205 ? ? 45.95   22.82   
47  1 PHE B 210 ? ? 175.39  145.79  
48  1 GLN B 217 ? ? -154.94 25.43   
49  1 VAL B 250 ? ? -123.59 -73.56  
50  1 LYS B 255 ? ? -70.60  32.96   
51  1 ILE C 7   ? ? -67.99  5.36    
52  1 ILE C 11  ? ? -37.43  -37.87  
53  1 ILE C 16  ? ? -55.35  98.91   
54  1 PRO C 23  ? ? -53.08  82.88   
55  1 LYS C 24  ? ? 39.96   69.37   
56  1 SER C 25  ? ? 63.77   -4.78   
57  1 LEU C 28  ? ? -103.31 66.70   
58  1 HIS C 31  ? ? -57.03  -3.47   
59  1 ALA C 33  ? ? -105.83 -102.77 
60  1 ASN C 48  ? ? -168.62 -5.86   
61  1 LEU C 49  ? ? -159.27 48.15   
62  1 ASP C 51  ? ? -172.67 16.03   
63  1 LEU C 52  ? ? -167.02 1.12    
64  1 GLN C 56  ? ? 42.23   -87.73  
65  1 MET C 65  ? ? 66.63   -28.82  
66  1 ASN C 67  ? ? -170.62 71.22   
67  1 PRO C 68  ? ? -67.62  5.19    
68  1 ALA C 69  ? ? -64.82  -98.28  
69  1 ILE C 71  ? ? -135.70 -156.76 
70  1 SER C 82  ? ? 63.05   158.73  
71  1 THR C 84  ? ? -48.61  -73.26  
72  1 LEU C 89  ? ? -161.64 -38.96  
73  1 THR C 96  ? ? -71.70  27.73   
74  1 ASN C 98  ? ? -168.94 106.16  
75  1 SER C 100 ? ? -77.34  -98.23  
76  1 THR C 112 ? ? -44.53  -70.67  
77  1 ASP C 120 ? ? 77.20   -83.54  
78  1 ALA C 137 ? ? -127.04 -166.70 
79  1 ASN C 158 ? ? -178.49 17.78   
80  1 LYS C 159 ? ? 35.34   70.82   
81  1 PHE C 161 ? ? -73.02  38.13   
82  1 ASP C 162 ? ? -175.54 94.01   
83  1 LEU C 163 ? ? -170.39 -29.31  
84  1 LEU C 175 ? ? -68.39  77.46   
85  1 VAL C 183 ? ? -148.57 -10.03  
86  1 PHE C 210 ? ? 178.67  159.06  
87  1 ASP C 216 ? ? -63.99  79.81   
88  1 GLN C 217 ? ? -83.46  44.11   
89  1 VAL C 250 ? ? -94.67  -72.19  
90  1 LYS D 21  ? ? -39.26  114.65  
91  1 ARG D 22  ? ? -37.81  145.66  
92  1 PRO D 23  ? ? -46.68  109.91  
93  1 LEU D 28  ? ? -118.68 56.88   
94  1 ALA D 33  ? ? -141.96 -78.34  
95  1 LEU D 40  ? ? -102.20 -63.64  
96  1 VAL D 41  ? ? -37.93  -35.93  
97  1 LYS D 43  ? ? -62.18  -76.54  
98  1 GLN D 56  ? ? -27.08  -73.05  
99  1 TYR D 77  ? ? -47.34  -15.16  
100 1 ASN D 81  ? ? -69.34  44.75   
101 1 SER D 82  ? ? -164.83 107.15  
102 1 ASN D 98  ? ? -76.33  24.91   
103 1 GLU D 106 ? ? -117.53 -158.68 
104 1 ASP D 111 ? ? -24.87  113.27  
105 1 LYS D 119 ? ? -171.75 123.35  
106 1 GLN D 121 ? ? 67.53   -5.27   
107 1 ILE D 142 ? ? -119.62 -80.70  
108 1 THR D 151 ? ? -62.29  -76.93  
109 1 ASP D 162 ? ? 37.58   33.37   
110 1 PHE D 187 ? ? -175.62 148.75  
111 1 MET D 206 ? ? 39.04   32.48   
112 1 PHE D 210 ? ? 172.13  162.07  
113 1 ARG D 213 ? ? -69.65  10.65   
114 1 ASP D 214 ? ? -143.84 32.30   
115 1 PHE D 219 ? ? -167.32 92.22   
116 1 SER D 244 ? ? -72.67  24.95   
117 1 VAL D 250 ? ? -71.80  -87.13  
118 1 LYS D 254 ? ? -57.84  -0.60   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 DG  F 8   ? ? 0.059 'SIDE CHAIN' 
2  1 DA  F 9   ? ? 0.114 'SIDE CHAIN' 
3  1 DC  G 2   ? ? 0.076 'SIDE CHAIN' 
4  1 DG  H 8   ? ? 0.071 'SIDE CHAIN' 
5  1 DA  H 9   ? ? 0.132 'SIDE CHAIN' 
6  1 DC  H 10  ? ? 0.090 'SIDE CHAIN' 
7  1 DG  H 12  ? ? 0.069 'SIDE CHAIN' 
8  1 DG  J 8   ? ? 0.058 'SIDE CHAIN' 
9  1 DA  J 9   ? ? 0.075 'SIDE CHAIN' 
10 1 DG  L 8   ? ? 0.067 'SIDE CHAIN' 
11 1 DG  L 12  ? ? 0.053 'SIDE CHAIN' 
12 1 TYR A 168 ? ? 0.075 'SIDE CHAIN' 
13 1 TYR B 230 ? ? 0.065 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 22  ? CG  ? I ARG 21  CG  
2   1 Y 1 A ARG 22  ? CD  ? I ARG 21  CD  
3   1 Y 1 A ARG 22  ? NE  ? I ARG 21  NE  
4   1 Y 1 A ARG 22  ? CZ  ? I ARG 21  CZ  
5   1 Y 1 A ARG 22  ? NH1 ? I ARG 21  NH1 
6   1 Y 1 A ARG 22  ? NH2 ? I ARG 21  NH2 
7   1 Y 1 A LYS 24  ? CG  ? I LYS 23  CG  
8   1 Y 1 A LYS 24  ? CD  ? I LYS 23  CD  
9   1 Y 1 A LYS 24  ? CE  ? I LYS 23  CE  
10  1 Y 1 A LYS 24  ? NZ  ? I LYS 23  NZ  
11  1 Y 1 A SER 50  ? OG  ? I SER 49  OG  
12  1 Y 1 A LYS 159 ? CG  ? I LYS 158 CG  
13  1 Y 1 A LYS 159 ? CD  ? I LYS 158 CD  
14  1 Y 1 A LYS 159 ? CE  ? I LYS 158 CE  
15  1 Y 1 A LYS 159 ? NZ  ? I LYS 158 NZ  
16  1 Y 1 A LYS 228 ? CG  ? I LYS 227 CG  
17  1 Y 1 A LYS 228 ? CD  ? I LYS 227 CD  
18  1 Y 1 A LYS 228 ? CE  ? I LYS 227 CE  
19  1 Y 1 A LYS 228 ? NZ  ? I LYS 227 NZ  
20  1 Y 1 A LYS 251 ? CD  ? I LYS 250 CD  
21  1 Y 1 A LYS 251 ? CE  ? I LYS 250 CE  
22  1 Y 1 A LYS 251 ? NZ  ? I LYS 250 NZ  
23  1 Y 1 A LEU 258 ? O   ? I LEU 257 O   
24  1 Y 1 A LEU 258 ? CG  ? I LEU 257 CG  
25  1 Y 1 A LEU 258 ? CD1 ? I LEU 257 CD1 
26  1 Y 1 A LEU 258 ? CD2 ? I LEU 257 CD2 
27  1 Y 1 B GLN 9   ? CG  ? J GLN 8   CG  
28  1 Y 1 B GLN 9   ? CD  ? J GLN 8   CD  
29  1 Y 1 B GLN 9   ? OE1 ? J GLN 8   OE1 
30  1 Y 1 B GLN 9   ? NE2 ? J GLN 8   NE2 
31  1 Y 1 B LYS 21  ? CG  ? J LYS 20  CG  
32  1 Y 1 B LYS 21  ? CD  ? J LYS 20  CD  
33  1 Y 1 B LYS 21  ? CE  ? J LYS 20  CE  
34  1 Y 1 B LYS 21  ? NZ  ? J LYS 20  NZ  
35  1 Y 1 B LYS 24  ? CG  ? J LYS 23  CG  
36  1 Y 1 B LYS 24  ? CD  ? J LYS 23  CD  
37  1 Y 1 B LYS 24  ? CE  ? J LYS 23  CE  
38  1 Y 1 B LYS 24  ? NZ  ? J LYS 23  NZ  
39  1 Y 1 B GLU 74  ? CG  ? J GLU 73  CG  
40  1 Y 1 B GLU 74  ? CD  ? J GLU 73  CD  
41  1 Y 1 B GLU 74  ? OE1 ? J GLU 73  OE1 
42  1 Y 1 B GLU 74  ? OE2 ? J GLU 73  OE2 
43  1 Y 1 B LYS 78  ? CG  ? J LYS 77  CG  
44  1 Y 1 B LYS 78  ? CD  ? J LYS 77  CD  
45  1 Y 1 B LYS 78  ? CE  ? J LYS 77  CE  
46  1 Y 1 B LYS 78  ? NZ  ? J LYS 77  NZ  
47  1 Y 1 B LYS 93  ? CG  ? J LYS 92  CG  
48  1 Y 1 B LYS 93  ? CD  ? J LYS 92  CD  
49  1 Y 1 B LYS 93  ? CE  ? J LYS 92  CE  
50  1 Y 1 B LYS 93  ? NZ  ? J LYS 92  NZ  
51  1 Y 1 B GLN 121 ? CG  ? J GLN 120 CG  
52  1 Y 1 B GLN 121 ? CD  ? J GLN 120 CD  
53  1 Y 1 B GLN 121 ? OE1 ? J GLN 120 OE1 
54  1 Y 1 B GLN 121 ? NE2 ? J GLN 120 NE2 
55  1 Y 1 B GLN 240 ? CG  ? J GLN 239 CG  
56  1 Y 1 B GLN 240 ? CD  ? J GLN 239 CD  
57  1 Y 1 B GLN 240 ? OE1 ? J GLN 239 OE1 
58  1 Y 1 B GLN 240 ? NE2 ? J GLN 239 NE2 
59  1 Y 1 B ILE 257 ? O   ? J ILE 256 O   
60  1 Y 1 C GLN 9   ? CG  ? K GLN 8   CG  
61  1 Y 1 C GLN 9   ? CD  ? K GLN 8   CD  
62  1 Y 1 C GLN 9   ? OE1 ? K GLN 8   OE1 
63  1 Y 1 C GLN 9   ? NE2 ? K GLN 8   NE2 
64  1 Y 1 C ASP 10  ? CG  ? K ASP 9   CG  
65  1 Y 1 C ASP 10  ? OD1 ? K ASP 9   OD1 
66  1 Y 1 C ASP 10  ? OD2 ? K ASP 9   OD2 
67  1 Y 1 C LYS 21  ? CG  ? K LYS 20  CG  
68  1 Y 1 C LYS 21  ? CD  ? K LYS 20  CD  
69  1 Y 1 C LYS 21  ? CE  ? K LYS 20  CE  
70  1 Y 1 C LYS 21  ? NZ  ? K LYS 20  NZ  
71  1 Y 1 C LYS 24  ? CG  ? K LYS 23  CG  
72  1 Y 1 C LYS 24  ? CD  ? K LYS 23  CD  
73  1 Y 1 C LYS 24  ? CE  ? K LYS 23  CE  
74  1 Y 1 C LYS 24  ? NZ  ? K LYS 23  NZ  
75  1 Y 1 C LYS 39  ? CG  ? K LYS 38  CG  
76  1 Y 1 C LYS 39  ? CD  ? K LYS 38  CD  
77  1 Y 1 C LYS 39  ? CE  ? K LYS 38  CE  
78  1 Y 1 C LYS 39  ? NZ  ? K LYS 38  NZ  
79  1 Y 1 C LYS 43  ? CG  ? K LYS 42  CG  
80  1 Y 1 C LYS 43  ? CD  ? K LYS 42  CD  
81  1 Y 1 C LYS 43  ? CE  ? K LYS 42  CE  
82  1 Y 1 C LYS 43  ? NZ  ? K LYS 42  NZ  
83  1 Y 1 C PHE 44  ? CG  ? K PHE 43  CG  
84  1 Y 1 C PHE 44  ? CD1 ? K PHE 43  CD1 
85  1 Y 1 C PHE 44  ? CD2 ? K PHE 43  CD2 
86  1 Y 1 C PHE 44  ? CE1 ? K PHE 43  CE1 
87  1 Y 1 C PHE 44  ? CE2 ? K PHE 43  CE2 
88  1 Y 1 C PHE 44  ? CZ  ? K PHE 43  CZ  
89  1 Y 1 C LYS 46  ? CG  ? K LYS 45  CG  
90  1 Y 1 C LYS 46  ? CD  ? K LYS 45  CD  
91  1 Y 1 C LYS 46  ? CE  ? K LYS 45  CE  
92  1 Y 1 C LYS 46  ? NZ  ? K LYS 45  NZ  
93  1 Y 1 C GLU 47  ? CG  ? K GLU 46  CG  
94  1 Y 1 C GLU 47  ? CD  ? K GLU 46  CD  
95  1 Y 1 C GLU 47  ? OE1 ? K GLU 46  OE1 
96  1 Y 1 C GLU 47  ? OE2 ? K GLU 46  OE2 
97  1 Y 1 C ASN 48  ? CG  ? K ASN 47  CG  
98  1 Y 1 C ASN 48  ? OD1 ? K ASN 47  OD1 
99  1 Y 1 C ASN 48  ? ND2 ? K ASN 47  ND2 
100 1 Y 1 C SER 50  ? OG  ? K SER 49  OG  
101 1 Y 1 C ASP 51  ? CG  ? K ASP 50  CG  
102 1 Y 1 C ASP 51  ? OD1 ? K ASP 50  OD1 
103 1 Y 1 C ASP 51  ? OD2 ? K ASP 50  OD2 
104 1 Y 1 C LYS 55  ? CG  ? K LYS 54  CG  
105 1 Y 1 C LYS 55  ? CD  ? K LYS 54  CD  
106 1 Y 1 C LYS 55  ? CE  ? K LYS 54  CE  
107 1 Y 1 C LYS 55  ? NZ  ? K LYS 54  NZ  
108 1 Y 1 C GLU 58  ? CG  ? K GLU 57  CG  
109 1 Y 1 C GLU 58  ? CD  ? K GLU 57  CD  
110 1 Y 1 C GLU 58  ? OE1 ? K GLU 57  OE1 
111 1 Y 1 C GLU 58  ? OE2 ? K GLU 57  OE2 
112 1 Y 1 C ASN 61  ? CG  ? K ASN 60  CG  
113 1 Y 1 C ASN 61  ? OD1 ? K ASN 60  OD1 
114 1 Y 1 C ASN 61  ? ND2 ? K ASN 60  ND2 
115 1 Y 1 C GLU 74  ? CG  ? K GLU 73  CG  
116 1 Y 1 C GLU 74  ? CD  ? K GLU 73  CD  
117 1 Y 1 C GLU 74  ? OE1 ? K GLU 73  OE1 
118 1 Y 1 C GLU 74  ? OE2 ? K GLU 73  OE2 
119 1 Y 1 C ARG 76  ? CG  ? K ARG 75  CG  
120 1 Y 1 C ARG 76  ? CD  ? K ARG 75  CD  
121 1 Y 1 C ARG 76  ? NE  ? K ARG 75  NE  
122 1 Y 1 C ARG 76  ? CZ  ? K ARG 75  CZ  
123 1 Y 1 C ARG 76  ? NH1 ? K ARG 75  NH1 
124 1 Y 1 C ARG 76  ? NH2 ? K ARG 75  NH2 
125 1 Y 1 C LYS 78  ? CG  ? K LYS 77  CG  
126 1 Y 1 C LYS 78  ? CD  ? K LYS 77  CD  
127 1 Y 1 C LYS 78  ? CE  ? K LYS 77  CE  
128 1 Y 1 C LYS 78  ? NZ  ? K LYS 77  NZ  
129 1 Y 1 C LYS 93  ? CG  ? K LYS 92  CG  
130 1 Y 1 C LYS 93  ? CD  ? K LYS 92  CD  
131 1 Y 1 C LYS 93  ? CE  ? K LYS 92  CE  
132 1 Y 1 C LYS 93  ? NZ  ? K LYS 92  NZ  
133 1 Y 1 C GLU 97  ? CG  ? K GLU 96  CG  
134 1 Y 1 C GLU 97  ? CD  ? K GLU 96  CD  
135 1 Y 1 C GLU 97  ? OE1 ? K GLU 96  OE1 
136 1 Y 1 C GLU 97  ? OE2 ? K GLU 96  OE2 
137 1 Y 1 C SER 100 ? OG  ? K SER 99  OG  
138 1 Y 1 C ILE 101 ? O   ? K ILE 100 O   
139 1 Y 1 C GLU 107 ? CG  ? K GLU 106 CG  
140 1 Y 1 C GLU 107 ? CD  ? K GLU 106 CD  
141 1 Y 1 C GLU 107 ? OE1 ? K GLU 106 OE1 
142 1 Y 1 C GLU 107 ? OE2 ? K GLU 106 OE2 
143 1 Y 1 C LYS 119 ? CG  ? K LYS 118 CG  
144 1 Y 1 C LYS 119 ? CD  ? K LYS 118 CD  
145 1 Y 1 C LYS 119 ? CE  ? K LYS 118 CE  
146 1 Y 1 C LYS 119 ? NZ  ? K LYS 118 NZ  
147 1 Y 1 C LYS 154 ? CG  ? K LYS 153 CG  
148 1 Y 1 C LYS 154 ? CD  ? K LYS 153 CD  
149 1 Y 1 C LYS 154 ? CE  ? K LYS 153 CE  
150 1 Y 1 C LYS 154 ? NZ  ? K LYS 153 NZ  
151 1 Y 1 C ILE 156 ? CG1 ? K ILE 155 CG1 
152 1 Y 1 C ILE 156 ? CG2 ? K ILE 155 CG2 
153 1 Y 1 C LYS 159 ? CG  ? K LYS 158 CG  
154 1 Y 1 C LYS 159 ? CD  ? K LYS 158 CD  
155 1 Y 1 C LYS 159 ? CE  ? K LYS 158 CE  
156 1 Y 1 C LYS 159 ? NZ  ? K LYS 158 NZ  
157 1 Y 1 C GLU 160 ? CD  ? K GLU 159 CD  
158 1 Y 1 C GLU 160 ? OE1 ? K GLU 159 OE1 
159 1 Y 1 C GLU 160 ? OE2 ? K GLU 159 OE2 
160 1 Y 1 C GLU 194 ? CG  ? K GLU 193 CG  
161 1 Y 1 C GLU 194 ? CD  ? K GLU 193 CD  
162 1 Y 1 C GLU 194 ? OE1 ? K GLU 193 OE1 
163 1 Y 1 C GLU 194 ? OE2 ? K GLU 193 OE2 
164 1 Y 1 C GLU 224 ? CG  ? K GLU 223 CG  
165 1 Y 1 C GLU 224 ? CD  ? K GLU 223 CD  
166 1 Y 1 C GLU 224 ? OE1 ? K GLU 223 OE1 
167 1 Y 1 C GLU 224 ? OE2 ? K GLU 223 OE2 
168 1 Y 1 C LYS 251 ? CG  ? K LYS 250 CG  
169 1 Y 1 C LYS 251 ? CD  ? K LYS 250 CD  
170 1 Y 1 C LYS 251 ? CE  ? K LYS 250 CE  
171 1 Y 1 C LYS 251 ? NZ  ? K LYS 250 NZ  
172 1 Y 1 C LEU 258 ? O   ? K LEU 257 O   
173 1 Y 1 D LYS 5   ? CG  ? L LYS 4   CG  
174 1 Y 1 D LYS 5   ? CD  ? L LYS 4   CD  
175 1 Y 1 D LYS 5   ? CE  ? L LYS 4   CE  
176 1 Y 1 D LYS 5   ? NZ  ? L LYS 4   NZ  
177 1 Y 1 D ASN 12  ? CG  ? L ASN 11  CG  
178 1 Y 1 D ASN 12  ? OD1 ? L ASN 11  OD1 
179 1 Y 1 D ASN 12  ? ND2 ? L ASN 11  ND2 
180 1 Y 1 D LYS 19  ? CG  ? L LYS 18  CG  
181 1 Y 1 D LYS 19  ? CD  ? L LYS 18  CD  
182 1 Y 1 D LYS 19  ? CE  ? L LYS 18  CE  
183 1 Y 1 D LYS 19  ? NZ  ? L LYS 18  NZ  
184 1 Y 1 D LYS 21  ? CG  ? L LYS 20  CG  
185 1 Y 1 D LYS 21  ? CD  ? L LYS 20  CD  
186 1 Y 1 D LYS 21  ? CE  ? L LYS 20  CE  
187 1 Y 1 D LYS 21  ? NZ  ? L LYS 20  NZ  
188 1 Y 1 D LYS 24  ? CG  ? L LYS 23  CG  
189 1 Y 1 D LYS 24  ? CD  ? L LYS 23  CD  
190 1 Y 1 D LYS 24  ? CE  ? L LYS 23  CE  
191 1 Y 1 D LYS 24  ? NZ  ? L LYS 23  NZ  
192 1 Y 1 D LYS 39  ? CG  ? L LYS 38  CG  
193 1 Y 1 D LYS 39  ? CD  ? L LYS 38  CD  
194 1 Y 1 D LYS 39  ? CE  ? L LYS 38  CE  
195 1 Y 1 D LYS 39  ? NZ  ? L LYS 38  NZ  
196 1 Y 1 D LYS 43  ? CG  ? L LYS 42  CG  
197 1 Y 1 D LYS 43  ? CD  ? L LYS 42  CD  
198 1 Y 1 D LYS 43  ? CE  ? L LYS 42  CE  
199 1 Y 1 D LYS 43  ? NZ  ? L LYS 42  NZ  
200 1 Y 1 D LYS 46  ? CG  ? L LYS 45  CG  
201 1 Y 1 D LYS 46  ? CD  ? L LYS 45  CD  
202 1 Y 1 D LYS 46  ? CE  ? L LYS 45  CE  
203 1 Y 1 D LYS 46  ? NZ  ? L LYS 45  NZ  
204 1 Y 1 D SER 50  ? OG  ? L SER 49  OG  
205 1 Y 1 D LYS 55  ? CG  ? L LYS 54  CG  
206 1 Y 1 D LYS 55  ? CD  ? L LYS 54  CD  
207 1 Y 1 D LYS 55  ? CE  ? L LYS 54  CE  
208 1 Y 1 D LYS 55  ? NZ  ? L LYS 54  NZ  
209 1 Y 1 D GLU 74  ? CG  ? L GLU 73  CG  
210 1 Y 1 D GLU 74  ? CD  ? L GLU 73  CD  
211 1 Y 1 D GLU 74  ? OE1 ? L GLU 73  OE1 
212 1 Y 1 D GLU 74  ? OE2 ? L GLU 73  OE2 
213 1 Y 1 D SER 100 ? OG  ? L SER 99  OG  
214 1 Y 1 D LYS 159 ? CG  ? L LYS 158 CG  
215 1 Y 1 D LYS 159 ? CD  ? L LYS 158 CD  
216 1 Y 1 D LYS 159 ? CE  ? L LYS 158 CE  
217 1 Y 1 D LYS 159 ? NZ  ? L LYS 158 NZ  
218 1 Y 1 D ASP 162 ? CG  ? L ASP 161 CG  
219 1 Y 1 D ASP 162 ? OD1 ? L ASP 161 OD1 
220 1 Y 1 D ASP 162 ? OD2 ? L ASP 161 OD2 
221 1 Y 1 D ASN 220 ? CG  ? L ASN 219 CG  
222 1 Y 1 D ASN 220 ? OD1 ? L ASN 219 OD1 
223 1 Y 1 D ASN 220 ? ND2 ? L ASN 219 ND2 
224 1 Y 1 D GLU 224 ? CG  ? L GLU 223 CG  
225 1 Y 1 D GLU 224 ? CD  ? L GLU 223 CD  
226 1 Y 1 D GLU 224 ? OE1 ? L GLU 223 OE1 
227 1 Y 1 D GLU 224 ? OE2 ? L GLU 223 OE2 
228 1 Y 1 D GLU 225 ? CG  ? L GLU 224 CG  
229 1 Y 1 D GLU 225 ? CD  ? L GLU 224 CD  
230 1 Y 1 D GLU 225 ? OE1 ? L GLU 224 OE1 
231 1 Y 1 D GLU 225 ? OE2 ? L GLU 224 OE2 
232 1 Y 1 D GLN 240 ? CG  ? L GLN 239 CG  
233 1 Y 1 D GLN 240 ? CD  ? L GLN 239 CD  
234 1 Y 1 D GLN 240 ? OE1 ? L GLN 239 OE1 
235 1 Y 1 D GLN 240 ? NE2 ? L GLN 239 NE2 
236 1 Y 1 D LYS 251 ? CG  ? L LYS 250 CG  
237 1 Y 1 D LYS 251 ? CD  ? L LYS 250 CD  
238 1 Y 1 D LYS 251 ? CE  ? L LYS 250 CE  
239 1 Y 1 D LYS 251 ? NZ  ? L LYS 250 NZ  
240 1 Y 1 D LYS 255 ? CG  ? L LYS 254 CG  
241 1 Y 1 D LYS 255 ? CD  ? L LYS 254 CD  
242 1 Y 1 D LYS 255 ? CE  ? L LYS 254 CE  
243 1 Y 1 D LYS 255 ? NZ  ? L LYS 254 NZ  
244 1 Y 1 D ILE 257 ? O   ? L ILE 256 O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B LEU 258 ? J LEU 257 
2 1 Y 1 C GLU 102 ? K GLU 101 
3 1 Y 1 C ASN 103 ? K ASN 102 
4 1 Y 1 C LEU 104 ? K LEU 103 
5 1 Y 1 D LEU 258 ? L LEU 257 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1XHU 'double helix'        
1XHU 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DC 3 1_555 B DG 5 1_555 0.843  -0.375 0.123  1.334   -7.650  -1.974  1  G_DC3:DG12_F G 3  ? F 12 ? 19 1 
1 C DG 4 1_555 B DC 4 1_555 0.751  -0.348 -0.061 6.103   -12.990 2.999   2  G_DG4:DC11_F G 4  ? F 11 ? 19 1 
1 C DG 5 1_555 B DC 3 1_555 -0.583 -0.397 -0.056 -17.030 -10.971 -3.026  3  G_DG5:DC10_F G 5  ? F 10 ? 19 1 
1 C DT 6 1_555 B DA 2 1_555 0.198  -0.217 0.177  -11.673 -3.940  -6.120  4  G_DT6:DA9_F  G 6  ? F 9  ? 20 1 
1 C DC 7 1_555 B DG 1 1_555 0.282  -0.530 -0.166 6.791   -19.093 -5.284  5  G_DC7:DG8_F  G 7  ? F 8  ? 19 1 
1 D DG 1 1_555 A DC 7 1_555 -0.212 -0.312 -0.618 -12.842 -24.897 -0.625  6  H_DG8:DC7_E  H 8  ? E 7  ? 19 1 
1 D DA 2 1_555 A DT 6 1_555 0.518  -0.026 0.396  11.515  -5.416  -8.250  7  H_DA9:DT6_E  H 9  ? E 6  ? 20 1 
1 D DC 3 1_555 A DG 5 1_555 0.047  -0.201 -0.085 21.026  -11.484 -9.724  8  H_DC10:DG5_E H 10 ? E 5  ? 19 1 
1 D DC 4 1_555 A DG 4 1_555 -0.262 -0.347 -0.262 -8.485  -20.006 -4.270  9  H_DC11:DG4_E H 11 ? E 4  ? 19 1 
1 D DG 5 1_555 A DC 3 1_555 0.067  -0.026 0.306  12.245  -4.371  -7.363  10 H_DG12:DC3_E H 12 ? E 3  ? 19 1 
1 E DG 1 1_555 A DC 2 1_555 0.665  0.009  -0.574 -7.246  -25.012 -12.414 11 I_DG1:DC2_E  I 1  ? E 2  ? ?  ? 
1 E DC 2 1_555 A DG 1 1_555 -1.286 -0.172 -0.531 5.568   -11.258 -7.900  12 I_DC2:DG1_E  I 2  ? E 1  ? 19 1 
1 E DC 3 1_555 H DG 5 1_555 -0.011 -0.137 0.094  -15.091 -9.601  -6.598  13 I_DC3:DG12_L I 3  ? L 12 ? 19 1 
1 E DG 4 1_555 H DC 4 1_555 -0.342 -0.048 0.559  23.756  1.318   -6.623  14 I_DG4:DC11_L I 4  ? L 11 ? 19 1 
1 E DG 5 1_555 H DC 3 1_555 -0.847 -0.095 0.111  -21.858 -4.274  2.282   15 I_DG5:DC10_L I 5  ? L 10 ? 19 1 
1 E DT 6 1_555 H DA 2 1_555 -0.485 -0.007 0.613  -18.697 3.728   -9.492  16 I_DT6:DA9_L  I 6  ? L 9  ? 20 1 
1 E DC 7 1_555 H DG 1 1_555 0.050  -0.356 -0.988 8.907   -23.924 -8.213  17 I_DC7:DG8_L  I 7  ? L 8  ? 19 1 
1 F DG 1 1_555 G DC 7 1_555 0.345  0.155  -0.421 -6.822  -16.199 -9.565  18 J_DG8:DC7_K  J 8  ? K 7  ? ?  ? 
1 F DA 2 1_555 G DT 6 1_555 0.300  -0.078 0.008  6.719   1.724   8.035   19 J_DA9:DT6_K  J 9  ? K 6  ? 20 1 
1 F DC 3 1_555 G DG 5 1_555 0.108  -0.218 -0.021 24.148  -4.541  2.392   20 J_DC10:DG5_K J 10 ? K 5  ? 19 1 
1 F DC 4 1_555 G DG 4 1_555 -0.285 -0.490 -0.015 -5.243  -7.021  -5.248  21 J_DC11:DG4_K J 11 ? K 4  ? 19 1 
1 F DG 5 1_555 G DC 3 1_555 1.005  -0.285 -0.043 0.968   -10.144 -1.577  22 J_DG12:DC3_K J 12 ? K 3  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DC 3 1_555 B DG 5 1_555 C DG 4 1_555 B DC 4 1_555 0.212  0.213  3.151 4.450   12.563  32.127 -1.535 0.315  3.024 21.578  
-7.643  34.714 1  GG_DC3DG4:DC11DG12_FF G 3  ? F 12 ? G 4  ? F 11 ? 
1 C DG 4 1_555 B DC 4 1_555 C DG 5 1_555 B DC 3 1_555 -2.121 0.453  6.677 -25.609 -7.274  22.059 3.430  -5.798 5.777 -13.946 
49.097  34.446 2  GG_DG4DG5:DC10DC11_FF G 4  ? F 11 ? G 5  ? F 10 ? 
1 C DG 5 1_555 B DC 3 1_555 C DT 6 1_555 B DA 2 1_555 -0.735 -0.975 3.273 -1.490  -6.865  36.234 -0.581 0.954  3.421 -10.912 2.368 
36.886 3  GG_DG5DT6:DA9DC10_FF  G 5  ? F 10 ? G 6  ? F 9  ? 
1 C DT 6 1_555 B DA 2 1_555 C DC 7 1_555 B DG 1 1_555 -1.420 -0.371 3.200 -5.727  -6.778  24.531 1.111  1.515  3.417 -15.326 
12.950  26.064 4  GG_DT6DC7:DG8DA9_FF   G 6  ? F 9  ? G 7  ? F 8  ? 
1 C DC 7 1_555 B DG 1 1_555 D DG 1 1_555 A DC 7 1_555 0.393  -1.629 3.710 6.478   26.210  27.487 -5.657 0.188  1.657 43.976  
-10.869 38.346 5  GH_DC7DG8:DC7DG8_EF   G 7  ? F 8  ? H 8  ? E 7  ? 
1 D DG 1 1_555 A DC 7 1_555 D DA 2 1_555 A DT 6 1_555 1.123  -0.243 2.945 -0.950  -7.180  27.556 0.993  -2.480 2.876 -14.753 1.952 
28.474 6  HH_DG8DA9:DT6DC7_EE   H 8  ? E 7  ? H 9  ? E 6  ? 
1 D DA 2 1_555 A DT 6 1_555 D DC 3 1_555 A DG 5 1_555 0.576  -1.312 2.974 3.453   -3.950  30.989 -1.723 -0.452 3.157 -7.328  
-6.405  31.419 7  HH_DA9DC10:DG5DT6_EE  H 9  ? E 6  ? H 10 ? E 5  ? 
1 D DC 3 1_555 A DG 5 1_555 D DC 4 1_555 A DG 4 1_555 2.473  0.483  6.876 31.339  -9.118  26.475 3.056  4.708  6.131 -14.519 
-49.902 41.797 8  HH_DC10DC11:DG4DG5_EE H 10 ? E 5  ? H 11 ? E 4  ? 
1 D DC 4 1_555 A DG 4 1_555 D DG 5 1_555 A DC 3 1_555 -0.128 0.692  2.867 -4.098  8.451   31.559 -0.089 -0.409 2.943 15.124  7.335 
32.893 9  HH_DC11DG12:DC3DG4_EE H 11 ? E 4  ? H 12 ? E 3  ? 
1 D DG 5 1_555 A DC 3 1_555 E DG 1 1_555 A DC 2 1_555 -0.957 -0.052 4.003 1.197   2.870   44.098 -0.397 1.408  3.966 3.817   
-1.592  44.203 10 HI_DG12DG1:DC2DC3_EE  H 12 ? E 3  ? I 1  ? E 2  ? 
1 E DG 1 1_555 A DC 2 1_555 E DC 2 1_555 A DG 1 1_555 0.951  0.493  2.844 3.099   -4.969  20.744 3.060  -1.457 2.763 -13.457 
-8.392  21.546 11 II_DG1DC2:DG1DC2_EE   I 1  ? E 2  ? I 2  ? E 1  ? 
1 E DC 2 1_555 A DG 1 1_555 E DC 3 1_555 H DG 5 1_555 0.010  -0.371 3.905 -2.606  8.332   41.791 -1.503 -0.324 3.760 11.529  3.606 
42.653 12 II_DC2DC3:DG12DG1_LE  I 2  ? E 1  ? I 3  ? L 12 ? 
1 E DC 3 1_555 H DG 5 1_555 E DG 4 1_555 H DC 4 1_555 -0.042 0.039  2.416 -4.441  2.697   29.102 -0.347 -0.615 2.390 5.314   8.749 
29.553 13 II_DC3DG4:DC11DG12_LL I 3  ? L 12 ? I 4  ? L 11 ? 
1 E DG 4 1_555 H DC 4 1_555 E DG 5 1_555 H DC 3 1_555 -1.388 0.100  7.303 -23.679 -9.865  27.655 3.269  -5.316 6.255 -16.771 
40.255  37.549 14 II_DG4DG5:DC10DC11_LL I 4  ? L 11 ? I 5  ? L 10 ? 
1 E DG 5 1_555 H DC 3 1_555 E DT 6 1_555 H DA 2 1_555 -1.412 -1.382 3.284 -0.114  -7.884  34.117 -1.048 2.331  3.512 -13.220 0.190 
34.990 15 II_DG5DT6:DA9DC10_LL  I 5  ? L 10 ? I 6  ? L 9  ? 
1 E DT 6 1_555 H DA 2 1_555 E DC 7 1_555 H DG 1 1_555 -0.809 -0.516 2.875 3.718   -3.867  28.073 -0.279 2.378  2.791 -7.881  
-7.577  28.571 16 II_DT6DC7:DG8DA9_LL   I 6  ? L 9  ? I 7  ? L 8  ? 
1 E DC 7 1_555 H DG 1 1_555 F DG 1 1_555 G DC 7 1_555 -0.216 -1.162 3.806 -2.815  29.941  25.315 -5.430 -0.024 1.631 50.573  4.754 
39.121 17 IJ_DC7DG8:DC7DG8_KL   I 7  ? L 8  ? J 8  ? K 7  ? 
1 F DG 1 1_555 G DC 7 1_555 F DA 2 1_555 G DT 6 1_555 1.592  -0.047 3.284 0.559   -3.176  26.837 0.716  -3.262 3.299 -6.811  
-1.199  27.027 18 JJ_DG8DA9:DT6DC7_KK   J 8  ? K 7  ? J 9  ? K 6  ? 
1 F DA 2 1_555 G DT 6 1_555 F DC 3 1_555 G DG 5 1_555 0.516  -0.916 3.022 0.213   -6.252  29.776 -0.552 -0.942 3.147 -12.000 
-0.408  30.412 19 JJ_DA9DC10:DG5DT6_KK  J 9  ? K 6  ? J 10 ? K 5  ? 
1 F DC 3 1_555 G DG 5 1_555 F DC 4 1_555 G DG 4 1_555 1.594  0.687  6.881 24.456  -10.076 29.978 3.675  4.126  6.019 -16.098 
-39.073 39.777 20 JJ_DC10DC11:DG4DG5_KK J 10 ? K 5  ? J 11 ? K 4  ? 
1 F DC 4 1_555 G DG 4 1_555 F DG 5 1_555 G DC 3 1_555 -0.104 0.377  3.237 0.061   12.040  34.978 -1.049 0.173  3.190 19.337  
-0.098  36.931 21 JJ_DC11DG12:DC3DG4_KK J 11 ? K 4  ? J 12 ? K 3  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#