data_1XK4
# 
_entry.id   1XK4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XK4         
RCSB  RCSB030446   
WWPDB D_1000030446 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1mr8 'S100A8 (MRP8)'  unspecified 
PDB 1irj 'S100A9 (MRP14)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XK4 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Korndoerfer, I.P.' 1 
'Brueckner, F.'     2 
'Skerra, A.'        3 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of the human (S100A8/S100A9)2 heterotetramer, calprotectin, illustrates how conformational changes of interacting alpha-helices can determine specific association of two EF-hand proteins
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            370 
_citation.page_first                887 
_citation.page_last                 898 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17553524 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.04.065 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Korndoerfer, I.P.' 1 
primary 'Brueckner, F.'     2 
primary 'Skerra, A.'        3 
# 
_cell.entry_id           1XK4 
_cell.length_a           48.509 
_cell.length_b           78.697 
_cell.length_c           177.411 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.94 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1XK4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Calgranulin A' 10837.463 6    ? C42S ? ? 
2 polymer     man 'Calgranulin B' 13116.759 6    ? C3S  ? ? 
3 non-polymer syn 'CALCIUM ION'   40.078    24   ? ?    ? ? 
4 non-polymer syn 'CHLORIDE ION'  35.453    4    ? ?    ? ? 
5 non-polymer syn 'CITRATE ANION' 189.100   1    ? ?    ? ? 
6 water       nat water           18.015    1059 ? ?    ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;S100 calcium-binding protein a8, s100a8, migration inhibitory factor-related protein 8, MRP-8, P8, cystic fibrosis antigen, cfag, leukocyte L1 complex light chain, calprotectin L1L
;
2 
;S100 calcium-binding protein A9, S100A9, migration inhibitory factor-related protein 14, MRP-14, P14, leucocyte L1 complex heavy chain, calprotectin L1H subunit
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGV
AAHKKSHEESHKE
;
;MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGV
AAHKKSHEESHKE
;
A,B,E,F,I,J ? 
2 'polypeptide(L)' no no 
;TSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIM
LMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
;
;TSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIM
LMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
;
C,D,G,H,K,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   THR n 
1 4   GLU n 
1 5   LEU n 
1 6   GLU n 
1 7   LYS n 
1 8   ALA n 
1 9   LEU n 
1 10  ASN n 
1 11  SER n 
1 12  ILE n 
1 13  ILE n 
1 14  ASP n 
1 15  VAL n 
1 16  TYR n 
1 17  HIS n 
1 18  LYS n 
1 19  TYR n 
1 20  SER n 
1 21  LEU n 
1 22  ILE n 
1 23  LYS n 
1 24  GLY n 
1 25  ASN n 
1 26  PHE n 
1 27  HIS n 
1 28  ALA n 
1 29  VAL n 
1 30  TYR n 
1 31  ARG n 
1 32  ASP n 
1 33  ASP n 
1 34  LEU n 
1 35  LYS n 
1 36  LYS n 
1 37  LEU n 
1 38  LEU n 
1 39  GLU n 
1 40  THR n 
1 41  GLU n 
1 42  SER n 
1 43  PRO n 
1 44  GLN n 
1 45  TYR n 
1 46  ILE n 
1 47  ARG n 
1 48  LYS n 
1 49  LYS n 
1 50  GLY n 
1 51  ALA n 
1 52  ASP n 
1 53  VAL n 
1 54  TRP n 
1 55  PHE n 
1 56  LYS n 
1 57  GLU n 
1 58  LEU n 
1 59  ASP n 
1 60  ILE n 
1 61  ASN n 
1 62  THR n 
1 63  ASP n 
1 64  GLY n 
1 65  ALA n 
1 66  VAL n 
1 67  ASN n 
1 68  PHE n 
1 69  GLN n 
1 70  GLU n 
1 71  PHE n 
1 72  LEU n 
1 73  ILE n 
1 74  LEU n 
1 75  VAL n 
1 76  ILE n 
1 77  LYS n 
1 78  MET n 
1 79  GLY n 
1 80  VAL n 
1 81  ALA n 
1 82  ALA n 
1 83  HIS n 
1 84  LYS n 
1 85  LYS n 
1 86  SER n 
1 87  HIS n 
1 88  GLU n 
1 89  GLU n 
1 90  SER n 
1 91  HIS n 
1 92  LYS n 
1 93  GLU n 
2 1   THR n 
2 2   SER n 
2 3   LYS n 
2 4   MET n 
2 5   SER n 
2 6   GLN n 
2 7   LEU n 
2 8   GLU n 
2 9   ARG n 
2 10  ASN n 
2 11  ILE n 
2 12  GLU n 
2 13  THR n 
2 14  ILE n 
2 15  ILE n 
2 16  ASN n 
2 17  THR n 
2 18  PHE n 
2 19  HIS n 
2 20  GLN n 
2 21  TYR n 
2 22  SER n 
2 23  VAL n 
2 24  LYS n 
2 25  LEU n 
2 26  GLY n 
2 27  HIS n 
2 28  PRO n 
2 29  ASP n 
2 30  THR n 
2 31  LEU n 
2 32  ASN n 
2 33  GLN n 
2 34  GLY n 
2 35  GLU n 
2 36  PHE n 
2 37  LYS n 
2 38  GLU n 
2 39  LEU n 
2 40  VAL n 
2 41  ARG n 
2 42  LYS n 
2 43  ASP n 
2 44  LEU n 
2 45  GLN n 
2 46  ASN n 
2 47  PHE n 
2 48  LEU n 
2 49  LYS n 
2 50  LYS n 
2 51  GLU n 
2 52  ASN n 
2 53  LYS n 
2 54  ASN n 
2 55  GLU n 
2 56  LYS n 
2 57  VAL n 
2 58  ILE n 
2 59  GLU n 
2 60  HIS n 
2 61  ILE n 
2 62  MET n 
2 63  GLU n 
2 64  ASP n 
2 65  LEU n 
2 66  ASP n 
2 67  THR n 
2 68  ASN n 
2 69  ALA n 
2 70  ASP n 
2 71  LYS n 
2 72  GLN n 
2 73  LEU n 
2 74  SER n 
2 75  PHE n 
2 76  GLU n 
2 77  GLU n 
2 78  PHE n 
2 79  ILE n 
2 80  MET n 
2 81  LEU n 
2 82  MET n 
2 83  ALA n 
2 84  ARG n 
2 85  LEU n 
2 86  THR n 
2 87  TRP n 
2 88  ALA n 
2 89  SER n 
2 90  HIS n 
2 91  GLU n 
2 92  LYS n 
2 93  MET n 
2 94  HIS n 
2 95  GLU n 
2 96  GLY n 
2 97  ASP n 
2 98  GLU n 
2 99  GLY n 
2 100 PRO n 
2 101 GLY n 
2 102 HIS n 
2 103 HIS n 
2 104 HIS n 
2 105 LYS n 
2 106 PRO n 
2 107 GLY n 
2 108 LEU n 
2 109 GLY n 
2 110 GLU n 
2 111 GLY n 
2 112 THR n 
2 113 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo S100A8 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? 'PET-36B(+)-MRP8C42S' ? ? 
2 1 sample ? ? ? human Homo S100A9 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? 'PET-36B(+)-MRP14C3S' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP S10A8_HUMAN P05109 1 
;MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGV
AAHKKSHEESHKE
;
1 ? 
2 UNP S10A9_HUMAN P06702 2 
;TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIM
LMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
;
2 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1XK4 A 1 ? 93  ? P05109 1 ? 93  ? 1 93  
2  1 1XK4 B 1 ? 93  ? P05109 1 ? 93  ? 1 93  
3  1 1XK4 E 1 ? 93  ? P05109 1 ? 93  ? 1 93  
4  1 1XK4 F 1 ? 93  ? P05109 1 ? 93  ? 1 93  
5  1 1XK4 I 1 ? 93  ? P05109 1 ? 93  ? 1 93  
6  1 1XK4 J 1 ? 93  ? P05109 1 ? 93  ? 1 93  
7  2 1XK4 C 1 ? 113 ? P06702 2 ? 114 ? 2 114 
8  2 1XK4 D 1 ? 113 ? P06702 2 ? 114 ? 2 114 
9  2 1XK4 G 1 ? 113 ? P06702 2 ? 114 ? 2 114 
10 2 1XK4 H 1 ? 113 ? P06702 2 ? 114 ? 2 114 
11 2 1XK4 K 1 ? 113 ? P06702 2 ? 114 ? 2 114 
12 2 1XK4 L 1 ? 113 ? P06702 2 ? 114 ? 2 114 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  1XK4 SER A 42 ? UNP P05109 CYS 42 'ENGINEERED MUTATION' 42 1  
2  1XK4 SER B 42 ? UNP P05109 CYS 42 'ENGINEERED MUTATION' 42 2  
3  1XK4 SER E 42 ? UNP P05109 CYS 42 'ENGINEERED MUTATION' 42 3  
4  1XK4 SER F 42 ? UNP P05109 CYS 42 'ENGINEERED MUTATION' 42 4  
5  1XK4 SER I 42 ? UNP P05109 CYS 42 'ENGINEERED MUTATION' 42 5  
6  1XK4 SER J 42 ? UNP P05109 CYS 42 'ENGINEERED MUTATION' 42 6  
7  1XK4 SER C 2  ? UNP P06702 CYS 3  'ENGINEERED MUTATION' 3  7  
8  1XK4 SER D 2  ? UNP P06702 CYS 3  'ENGINEERED MUTATION' 3  8  
9  1XK4 SER G 2  ? UNP P06702 CYS 3  'ENGINEERED MUTATION' 3  9  
10 1XK4 SER H 2  ? UNP P06702 CYS 3  'ENGINEERED MUTATION' 3  10 
11 1XK4 SER K 2  ? UNP P06702 CYS 3  'ENGINEERED MUTATION' 3  11 
12 1XK4 SER L 2  ? UNP P06702 CYS 3  'ENGINEERED MUTATION' 3  12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FLC non-polymer         . 'CITRATE ANION' ? 'C6 H5 O7 -3'    189.100 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XK4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   47.3 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            285 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pdbx_details    
'32% MPD, 0.1M Citrate (pH= 4.2), 20mM Tris (pH= 8.0), 2mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 285K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD           MARRESEARCH 2003-11-15 ? 
2 'IMAGE PLATE' MARRESEARCH 2004-07-28 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97960 1.0 
2 0.92000 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'SLS BEAMLINE X06SA'  SLS   X06SA ? 0.97960 
2 SYNCHROTRON 'BESSY BEAMLINE 14.2' BESSY 14.2  ? 0.92000 
# 
_reflns.entry_id                     1XK4 
_reflns.observed_criterion_sigma_F   6.0 
_reflns.observed_criterion_sigma_I   6.0 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             30.00 
_reflns.number_all                   102635 
_reflns.number_obs                   99507 
_reflns.percent_possible_obs         81.03 
_reflns.pdbx_Rmerge_I_obs            0.119 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        3.8005 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.20 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.9 
_reflns_shell.percent_possible_all   69.88 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.44 
_reflns_shell.pdbx_redundancy        6.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      12460 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1XK4 
_refine.ls_number_reflns_obs                     94798 
_refine.ls_number_reflns_all                     99802 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          -3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    81.02 
_refine.ls_R_factor_obs                          0.1602 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.15781 
_refine.ls_R_factor_R_free                       0.20475 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5004 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.942 
_refine.B_iso_mean                               27.208 
_refine.aniso_B[1][1]                            2.25 
_refine.aniso_B[2][2]                            -1.59 
_refine.aniso_B[3][3]                            -0.84 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.05 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      '1MR8 and 1IRJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.132 
_refine.pdbx_overall_ESU_R_Free                  0.130 
_refine.overall_SU_ML                            0.076 
_refine.overall_SU_B                             4.525 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8880 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             1059 
_refine_hist.number_atoms_total               9980 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.022  ? 9050  'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.458  1.945  ? 12133 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.481  5.000  ? 1060  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   35.494 25.459 ? 458   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   16.050 15.000 ? 1827  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   14.033 15.000 ? 30    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.115  0.200  ? 1337  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.007  0.020  ? 6620  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.225  0.300  ? 4878  'X-RAY DIFFRACTION' ? 
r_nbd_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.315  0.500  ? 6299  'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.255  0.500  ? 1270  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.118  0.500  ? 92    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.372  0.300  ? 133   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.254  0.500  ? 79    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.050  2.000  ? 5495  'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.930  3.000  ? 8598  'X-RAY DIFFRACTION' ? 
r_scbond_it              2.494  2.000  ? 3970  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.808  3.000  ? 3535  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'tight positional'  A 143 0.06 0.05  1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 'tight positional'  B 143 0.05 0.05  1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 'tight positional'  E 143 0.05 0.05  1 'X-RAY DIFFRACTION' 3  ? ? ? 
4 'tight positional'  F 143 0.05 0.05  1 'X-RAY DIFFRACTION' 4  ? ? ? 
5 'tight positional'  I 143 0.04 0.05  1 'X-RAY DIFFRACTION' 5  ? ? ? 
6 'tight positional'  J 143 0.04 0.05  1 'X-RAY DIFFRACTION' 6  ? ? ? 
1 'tight positional'  C 155 0.05 0.05  2 'X-RAY DIFFRACTION' 7  ? ? ? 
2 'tight positional'  D 155 0.06 0.05  2 'X-RAY DIFFRACTION' 8  ? ? ? 
3 'tight positional'  G 155 0.05 0.05  2 'X-RAY DIFFRACTION' 9  ? ? ? 
4 'tight positional'  H 155 0.05 0.05  2 'X-RAY DIFFRACTION' 10 ? ? ? 
5 'tight positional'  K 155 0.04 0.05  2 'X-RAY DIFFRACTION' 11 ? ? ? 
6 'tight positional'  L 155 0.04 0.05  2 'X-RAY DIFFRACTION' 12 ? ? ? 
1 'medium positional' A 291 0.17 0.50  1 'X-RAY DIFFRACTION' 13 ? ? ? 
2 'medium positional' B 291 0.34 0.50  1 'X-RAY DIFFRACTION' 14 ? ? ? 
3 'medium positional' E 291 0.17 0.50  1 'X-RAY DIFFRACTION' 15 ? ? ? 
4 'medium positional' F 291 0.14 0.50  1 'X-RAY DIFFRACTION' 16 ? ? ? 
5 'medium positional' I 291 0.15 0.50  1 'X-RAY DIFFRACTION' 17 ? ? ? 
6 'medium positional' J 291 0.21 0.50  1 'X-RAY DIFFRACTION' 18 ? ? ? 
1 'medium positional' C 337 0.25 0.50  2 'X-RAY DIFFRACTION' 19 ? ? ? 
2 'medium positional' D 337 0.41 0.50  2 'X-RAY DIFFRACTION' 20 ? ? ? 
3 'medium positional' G 337 0.36 0.50  2 'X-RAY DIFFRACTION' 21 ? ? ? 
4 'medium positional' H 337 0.28 0.50  2 'X-RAY DIFFRACTION' 22 ? ? ? 
5 'medium positional' K 337 0.21 0.50  2 'X-RAY DIFFRACTION' 23 ? ? ? 
6 'medium positional' L 337 0.20 0.50  2 'X-RAY DIFFRACTION' 24 ? ? ? 
1 'loose positional'  A 235 0.30 5.00  1 'X-RAY DIFFRACTION' 25 ? ? ? 
2 'loose positional'  B 235 0.32 5.00  1 'X-RAY DIFFRACTION' 26 ? ? ? 
3 'loose positional'  E 235 0.36 5.00  1 'X-RAY DIFFRACTION' 27 ? ? ? 
4 'loose positional'  F 235 0.31 5.00  1 'X-RAY DIFFRACTION' 28 ? ? ? 
5 'loose positional'  I 235 0.30 5.00  1 'X-RAY DIFFRACTION' 29 ? ? ? 
6 'loose positional'  J 235 0.26 5.00  1 'X-RAY DIFFRACTION' 30 ? ? ? 
1 'loose positional'  C 227 0.39 5.00  2 'X-RAY DIFFRACTION' 31 ? ? ? 
2 'loose positional'  D 227 0.49 5.00  2 'X-RAY DIFFRACTION' 32 ? ? ? 
3 'loose positional'  G 227 0.71 5.00  2 'X-RAY DIFFRACTION' 33 ? ? ? 
4 'loose positional'  H 227 0.40 5.00  2 'X-RAY DIFFRACTION' 34 ? ? ? 
5 'loose positional'  K 227 0.33 5.00  2 'X-RAY DIFFRACTION' 35 ? ? ? 
6 'loose positional'  L 227 0.28 5.00  2 'X-RAY DIFFRACTION' 36 ? ? ? 
1 'tight thermal'     A 143 0.19 0.50  1 'X-RAY DIFFRACTION' 37 ? ? ? 
2 'tight thermal'     B 143 0.17 0.50  1 'X-RAY DIFFRACTION' 38 ? ? ? 
3 'tight thermal'     E 143 0.19 0.50  1 'X-RAY DIFFRACTION' 39 ? ? ? 
4 'tight thermal'     F 143 0.16 0.50  1 'X-RAY DIFFRACTION' 40 ? ? ? 
5 'tight thermal'     I 143 0.16 0.50  1 'X-RAY DIFFRACTION' 41 ? ? ? 
6 'tight thermal'     J 143 0.15 0.50  1 'X-RAY DIFFRACTION' 42 ? ? ? 
1 'tight thermal'     C 155 0.17 0.50  2 'X-RAY DIFFRACTION' 43 ? ? ? 
2 'tight thermal'     D 155 0.17 0.50  2 'X-RAY DIFFRACTION' 44 ? ? ? 
3 'tight thermal'     G 155 0.14 0.50  2 'X-RAY DIFFRACTION' 45 ? ? ? 
4 'tight thermal'     H 155 0.17 0.50  2 'X-RAY DIFFRACTION' 46 ? ? ? 
5 'tight thermal'     K 155 0.14 0.50  2 'X-RAY DIFFRACTION' 47 ? ? ? 
6 'tight thermal'     L 155 0.15 0.50  2 'X-RAY DIFFRACTION' 48 ? ? ? 
1 'medium thermal'    A 291 1.32 2.00  1 'X-RAY DIFFRACTION' 49 ? ? ? 
2 'medium thermal'    B 291 1.17 2.00  1 'X-RAY DIFFRACTION' 50 ? ? ? 
3 'medium thermal'    E 291 1.59 2.00  1 'X-RAY DIFFRACTION' 51 ? ? ? 
4 'medium thermal'    F 291 1.02 2.00  1 'X-RAY DIFFRACTION' 52 ? ? ? 
5 'medium thermal'    I 291 1.04 2.00  1 'X-RAY DIFFRACTION' 53 ? ? ? 
6 'medium thermal'    J 291 1.15 2.00  1 'X-RAY DIFFRACTION' 54 ? ? ? 
1 'medium thermal'    C 337 1.42 2.00  2 'X-RAY DIFFRACTION' 55 ? ? ? 
2 'medium thermal'    D 337 1.16 2.00  2 'X-RAY DIFFRACTION' 56 ? ? ? 
3 'medium thermal'    G 337 1.45 2.00  2 'X-RAY DIFFRACTION' 57 ? ? ? 
4 'medium thermal'    H 337 1.20 2.00  2 'X-RAY DIFFRACTION' 58 ? ? ? 
5 'medium thermal'    K 337 1.12 2.00  2 'X-RAY DIFFRACTION' 59 ? ? ? 
6 'medium thermal'    L 337 1.05 2.00  2 'X-RAY DIFFRACTION' 60 ? ? ? 
1 'loose thermal'     A 235 2.53 10.00 1 'X-RAY DIFFRACTION' 61 ? ? ? 
2 'loose thermal'     B 235 1.82 10.00 1 'X-RAY DIFFRACTION' 62 ? ? ? 
3 'loose thermal'     E 235 2.27 10.00 1 'X-RAY DIFFRACTION' 63 ? ? ? 
4 'loose thermal'     F 235 2.22 10.00 1 'X-RAY DIFFRACTION' 64 ? ? ? 
5 'loose thermal'     I 235 1.72 10.00 1 'X-RAY DIFFRACTION' 65 ? ? ? 
6 'loose thermal'     J 235 1.62 10.00 1 'X-RAY DIFFRACTION' 66 ? ? ? 
1 'loose thermal'     C 227 2.08 10.00 2 'X-RAY DIFFRACTION' 67 ? ? ? 
2 'loose thermal'     D 227 1.83 10.00 2 'X-RAY DIFFRACTION' 68 ? ? ? 
3 'loose thermal'     G 227 2.16 10.00 2 'X-RAY DIFFRACTION' 69 ? ? ? 
4 'loose thermal'     H 227 1.69 10.00 2 'X-RAY DIFFRACTION' 70 ? ? ? 
5 'loose thermal'     K 227 1.70 10.00 2 'X-RAY DIFFRACTION' 71 ? ? ? 
6 'loose thermal'     L 227 1.47 10.00 2 'X-RAY DIFFRACTION' 72 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_R_work             5982 
_refine_ls_shell.R_factor_R_work                  0.186 
_refine_ls_shell.percent_reflns_obs               69.93 
_refine_ls_shell.R_factor_R_free                  0.249 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             303 
_refine_ls_shell.number_reflns_obs                8987 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1   A 
1 2   B 
1 3   E 
1 4   F 
1 5   I 
1 6   J 
1 7   A 
1 8   B 
1 9   E 
1 10  F 
1 11  I 
1 12  J 
1 13  A 
1 14  B 
1 15  E 
1 16  F 
1 17  I 
1 18  J 
1 19  A 
1 20  B 
1 21  E 
1 22  F 
1 23  I 
1 24  J 
1 25  A 
1 26  B 
1 27  E 
1 28  F 
1 29  I 
1 30  J 
1 31  A 
1 32  B 
1 33  E 
1 34  F 
1 35  I 
1 36  J 
1 37  A 
1 38  B 
1 39  E 
1 40  F 
1 41  I 
1 42  J 
1 43  A 
1 44  B 
1 45  E 
1 46  F 
1 47  I 
1 48  J 
1 49  A 
1 50  B 
1 51  E 
1 52  F 
1 53  I 
1 54  J 
1 55  A 
1 56  B 
1 57  E 
1 58  F 
1 59  I 
1 60  J 
1 61  A 
1 62  B 
1 63  E 
1 64  F 
1 65  I 
1 66  J 
1 67  A 
1 68  B 
1 69  E 
1 70  F 
1 71  I 
1 72  J 
1 73  A 
1 74  B 
1 75  E 
1 76  F 
1 77  I 
1 78  J 
1 79  A 
1 80  B 
1 81  E 
1 82  F 
1 83  I 
1 84  J 
1 85  A 
1 86  B 
1 87  E 
1 88  F 
1 89  I 
1 90  J 
1 91  A 
1 92  B 
1 93  E 
1 94  F 
1 95  I 
1 96  J 
1 97  A 
1 98  B 
1 99  E 
1 100 F 
1 101 I 
1 102 J 
1 103 A 
1 104 B 
1 105 E 
1 106 F 
1 107 I 
1 108 J 
1 109 A 
1 110 B 
1 111 E 
1 112 F 
1 113 I 
1 114 J 
1 115 A 
1 116 B 
1 117 E 
1 118 F 
1 119 I 
1 120 J 
1 121 A 
1 122 B 
1 123 E 
1 124 F 
1 125 I 
1 126 J 
1 127 A 
1 128 B 
1 129 E 
1 130 F 
1 131 I 
1 132 J 
1 133 A 
1 134 B 
1 135 E 
1 136 F 
1 137 I 
1 138 J 
1 139 A 
1 140 B 
1 141 E 
1 142 F 
1 143 I 
1 144 J 
1 145 A 
1 146 B 
1 147 E 
1 148 F 
1 149 I 
1 150 J 
1 151 A 
1 152 B 
1 153 E 
1 154 F 
1 155 I 
1 156 J 
1 157 A 
1 158 B 
1 159 E 
1 160 F 
1 161 I 
1 162 J 
1 163 A 
1 164 B 
1 165 E 
1 166 F 
1 167 I 
1 168 J 
1 169 A 
1 170 B 
1 171 E 
1 172 F 
1 173 I 
1 174 J 
1 175 A 
1 176 B 
1 177 E 
1 178 F 
1 179 I 
1 180 J 
1 181 A 
1 182 B 
1 183 E 
1 184 F 
1 185 I 
1 186 J 
1 187 A 
1 188 B 
1 189 E 
1 190 F 
1 191 I 
1 192 J 
1 193 A 
1 194 B 
1 195 E 
1 196 F 
1 197 I 
1 198 J 
2 1   C 
2 2   D 
2 3   G 
2 4   H 
2 5   K 
2 6   L 
2 7   C 
2 8   D 
2 9   G 
2 10  H 
2 11  K 
2 12  L 
2 13  C 
2 14  D 
2 15  G 
2 16  H 
2 17  K 
2 18  L 
2 19  C 
2 20  D 
2 21  G 
2 22  H 
2 23  K 
2 24  L 
2 25  C 
2 26  D 
2 27  G 
2 28  H 
2 29  K 
2 30  L 
2 31  C 
2 32  D 
2 33  G 
2 34  H 
2 35  K 
2 36  L 
2 37  C 
2 38  D 
2 39  G 
2 40  H 
2 41  K 
2 42  L 
2 43  C 
2 44  D 
2 45  G 
2 46  H 
2 47  K 
2 48  L 
2 49  C 
2 50  D 
2 51  G 
2 52  H 
2 53  K 
2 54  L 
2 55  C 
2 56  D 
2 57  G 
2 58  H 
2 59  K 
2 60  L 
2 61  C 
2 62  D 
2 63  G 
2 64  H 
2 65  K 
2 66  L 
2 67  C 
2 68  D 
2 69  G 
2 70  H 
2 71  K 
2 72  L 
2 73  C 
2 74  D 
2 75  G 
2 76  H 
2 77  K 
2 78  L 
2 79  C 
2 80  D 
2 81  G 
2 82  H 
2 83  K 
2 84  L 
2 85  C 
2 86  D 
2 87  G 
2 88  H 
2 89  K 
2 90  L 
2 91  C 
2 92  D 
2 93  G 
2 94  H 
2 95  K 
2 96  L 
2 97  C 
2 98  D 
2 99  G 
2 100 H 
2 101 K 
2 102 L 
2 103 C 
2 104 D 
2 105 G 
2 106 H 
2 107 K 
2 108 L 
2 109 C 
2 110 D 
2 111 G 
2 112 H 
2 113 K 
2 114 L 
2 115 C 
2 116 D 
2 117 G 
2 118 H 
2 119 K 
2 120 L 
2 121 C 
2 122 D 
2 123 G 
2 124 H 
2 125 K 
2 126 L 
2 127 C 
2 128 D 
2 129 G 
2 130 H 
2 131 K 
2 132 L 
2 133 C 
2 134 D 
2 135 G 
2 136 H 
2 137 K 
2 138 L 
2 139 C 
2 140 D 
2 141 G 
2 142 H 
2 143 K 
2 144 L 
2 145 C 
2 146 D 
2 147 G 
2 148 H 
2 149 K 
2 150 L 
2 151 C 
2 152 D 
2 153 G 
2 154 H 
2 155 K 
2 156 L 
2 157 C 
2 158 D 
2 159 G 
2 160 H 
2 161 K 
2 162 L 
2 163 C 
2 164 D 
2 165 G 
2 166 H 
2 167 K 
2 168 L 
2 169 C 
2 170 D 
2 171 G 
2 172 H 
2 173 K 
2 174 L 
2 175 C 
2 176 D 
2 177 G 
2 178 H 
2 179 K 
2 180 L 
2 181 C 
2 182 D 
2 183 G 
2 184 H 
2 185 K 
2 186 L 
2 187 C 
2 188 D 
2 189 G 
2 190 H 
2 191 K 
2 192 L 
2 193 C 
2 194 D 
2 195 G 
2 196 H 
2 197 K 
2 198 L 
2 199 C 
2 200 D 
2 201 G 
2 202 H 
2 203 K 
2 204 L 
2 205 C 
2 206 D 
2 207 G 
2 208 H 
2 209 K 
2 210 L 
2 211 C 
2 212 D 
2 213 G 
2 214 H 
2 215 K 
2 216 L 
2 217 C 
2 218 D 
2 219 G 
2 220 H 
2 221 K 
2 222 L 
2 223 C 
2 224 D 
2 225 G 
2 226 H 
2 227 K 
2 228 L 
2 229 C 
2 230 D 
2 231 G 
2 232 H 
2 233 K 
2 234 L 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1   1  1 A 1    A 1    A  MET 1  . A  MET 1  . 1 ? 
2   1  1 B 1    B 1    B  MET 1  . B  MET 1  . 1 ? 
3   1  1 E 1    E 1    E  MET 1  . E  MET 1  . 1 ? 
4   1  1 F 1    F 1    F  MET 1  . F  MET 1  . 1 ? 
5   1  1 I 1    I 1    I  MET 1  . I  MET 1  . 1 ? 
6   1  1 J 1    J 1    J  MET 1  . J  MET 1  . 1 ? 
7   2  4 A 2    A 2    A  LEU 2  . A  LEU 2  . 1 ? 
8   2  4 B 2    B 2    B  LEU 2  . B  LEU 2  . 1 ? 
9   2  4 E 2    E 2    E  LEU 2  . E  LEU 2  . 1 ? 
10  2  4 F 2    F 2    F  LEU 2  . F  LEU 2  . 1 ? 
11  2  4 I 2    I 2    I  LEU 2  . I  LEU 2  . 1 ? 
12  2  4 J 2    J 2    J  LEU 2  . J  LEU 2  . 1 ? 
13  3  5 A 3    A 3    A  THR 3  . A  THR 3  . 1 ? 
14  3  5 B 3    B 3    B  THR 3  . B  THR 3  . 1 ? 
15  3  5 E 3    E 3    E  THR 3  . E  THR 3  . 1 ? 
16  3  5 F 3    F 3    F  THR 3  . F  THR 3  . 1 ? 
17  3  5 I 3    I 3    I  THR 3  . I  THR 3  . 1 ? 
18  3  5 J 3    J 3    J  THR 3  . J  THR 3  . 1 ? 
19  4  4 A 4    A 4    A  GLU 4  . A  GLU 4  . 1 ? 
20  4  4 B 4    B 4    B  GLU 4  . B  GLU 4  . 1 ? 
21  4  4 E 4    E 4    E  GLU 4  . E  GLU 4  . 1 ? 
22  4  4 F 4    F 4    F  GLU 4  . F  GLU 4  . 1 ? 
23  4  4 I 4    I 4    I  GLU 4  . I  GLU 4  . 1 ? 
24  4  4 J 4    J 4    J  GLU 4  . J  GLU 4  . 1 ? 
25  5  5 A 5    A 6    A  LEU 5  . A  GLU 6  . 1 ? 
26  5  5 B 5    B 6    B  LEU 5  . B  GLU 6  . 1 ? 
27  5  5 E 5    E 6    E  LEU 5  . E  GLU 6  . 1 ? 
28  5  5 F 5    F 6    F  LEU 5  . F  GLU 6  . 1 ? 
29  5  5 I 5    I 6    I  LEU 5  . I  GLU 6  . 1 ? 
30  5  5 J 5    J 6    J  LEU 5  . J  GLU 6  . 1 ? 
31  6  1 A 7    A 7    A  LYS 7  . A  LYS 7  . 1 ? 
32  6  1 B 7    B 7    B  LYS 7  . B  LYS 7  . 1 ? 
33  6  1 E 7    E 7    E  LYS 7  . E  LYS 7  . 1 ? 
34  6  1 F 7    F 7    F  LYS 7  . F  LYS 7  . 1 ? 
35  6  1 I 7    I 7    I  LYS 7  . I  LYS 7  . 1 ? 
36  6  1 J 7    J 7    J  LYS 7  . J  LYS 7  . 1 ? 
37  7  5 A 8    A 8    A  ALA 8  . A  ALA 8  . 1 ? 
38  7  5 B 8    B 8    B  ALA 8  . B  ALA 8  . 1 ? 
39  7  5 E 8    E 8    E  ALA 8  . E  ALA 8  . 1 ? 
40  7  5 F 8    F 8    F  ALA 8  . F  ALA 8  . 1 ? 
41  7  5 I 8    I 8    I  ALA 8  . I  ALA 8  . 1 ? 
42  7  5 J 8    J 8    J  ALA 8  . J  ALA 8  . 1 ? 
43  8  4 A 9    A 9    A  LEU 9  . A  LEU 9  . 1 ? 
44  8  4 B 9    B 9    B  LEU 9  . B  LEU 9  . 1 ? 
45  8  4 E 9    E 9    E  LEU 9  . E  LEU 9  . 1 ? 
46  8  4 F 9    F 9    F  LEU 9  . F  LEU 9  . 1 ? 
47  8  4 I 9    I 9    I  LEU 9  . I  LEU 9  . 1 ? 
48  8  4 J 9    J 9    J  LEU 9  . J  LEU 9  . 1 ? 
49  9  5 A 10   A 13   A  ASN 10 . A  ILE 13 . 1 ? 
50  9  5 B 10   B 13   B  ASN 10 . B  ILE 13 . 1 ? 
51  9  5 E 10   E 13   E  ASN 10 . E  ILE 13 . 1 ? 
52  9  5 F 10   F 13   F  ASN 10 . F  ILE 13 . 1 ? 
53  9  5 I 10   I 13   I  ASN 10 . I  ILE 13 . 1 ? 
54  9  5 J 10   J 13   J  ASN 10 . J  ILE 13 . 1 ? 
55  10 5 A 15   A 17   A  VAL 15 . A  HIS 17 . 1 ? 
56  10 5 B 15   B 17   B  VAL 15 . B  HIS 17 . 1 ? 
57  10 5 E 15   E 17   E  VAL 15 . E  HIS 17 . 1 ? 
58  10 5 F 15   F 17   F  VAL 15 . F  HIS 17 . 1 ? 
59  10 5 I 15   I 17   I  VAL 15 . I  HIS 17 . 1 ? 
60  10 5 J 15   J 17   J  VAL 15 . J  HIS 17 . 1 ? 
61  11 1 A 18   A 18   A  LYS 18 . A  LYS 18 . 1 ? 
62  11 1 B 18   B 18   B  LYS 18 . B  LYS 18 . 1 ? 
63  11 1 E 18   E 18   E  LYS 18 . E  LYS 18 . 1 ? 
64  11 1 F 18   F 18   F  LYS 18 . F  LYS 18 . 1 ? 
65  11 1 I 18   I 18   I  LYS 18 . I  LYS 18 . 1 ? 
66  11 1 J 18   J 18   J  LYS 18 . J  LYS 18 . 1 ? 
67  12 5 A 19   A 20   A  TYR 19 . A  SER 20 . 1 ? 
68  12 5 B 19   B 20   B  TYR 19 . B  SER 20 . 1 ? 
69  12 5 E 19   E 20   E  TYR 19 . E  SER 20 . 1 ? 
70  12 5 F 19   F 20   F  TYR 19 . F  SER 20 . 1 ? 
71  12 5 I 19   I 20   I  TYR 19 . I  SER 20 . 1 ? 
72  12 5 J 19   J 20   J  TYR 19 . J  SER 20 . 1 ? 
73  13 5 A 24   A 30   A  GLY 24 . A  TYR 30 . 1 ? 
74  13 5 B 24   B 30   B  GLY 24 . B  TYR 30 . 1 ? 
75  13 5 E 24   E 30   E  GLY 24 . E  TYR 30 . 1 ? 
76  13 5 F 24   F 30   F  GLY 24 . F  TYR 30 . 1 ? 
77  13 5 I 24   I 30   I  GLY 24 . I  TYR 30 . 1 ? 
78  13 5 J 24   J 30   J  GLY 24 . J  TYR 30 . 1 ? 
79  14 5 A 33   A 34   A  ASP 33 . A  LEU 34 . 1 ? 
80  14 5 B 33   B 34   B  ASP 33 . B  LEU 34 . 1 ? 
81  14 5 E 33   E 34   E  ASP 33 . E  LEU 34 . 1 ? 
82  14 5 F 33   F 34   F  ASP 33 . F  LEU 34 . 1 ? 
83  14 5 I 33   I 34   I  ASP 33 . I  LEU 34 . 1 ? 
84  14 5 J 33   J 34   J  ASP 33 . J  LEU 34 . 1 ? 
85  15 1 A 35   A 36   A  LYS 35 . A  LYS 36 . 1 ? 
86  15 1 B 35   B 36   B  LYS 35 . B  LYS 36 . 1 ? 
87  15 1 E 35   E 36   E  LYS 35 . E  LYS 36 . 1 ? 
88  15 1 F 35   F 36   F  LYS 35 . F  LYS 36 . 1 ? 
89  15 1 I 35   I 36   I  LYS 35 . I  LYS 36 . 1 ? 
90  15 1 J 35   J 36   J  LYS 35 . J  LYS 36 . 1 ? 
91  16 5 A 37   A 38   A  LEU 37 . A  LEU 38 . 1 ? 
92  16 5 B 37   B 38   B  LEU 37 . B  LEU 38 . 1 ? 
93  16 5 E 37   E 38   E  LEU 37 . E  LEU 38 . 1 ? 
94  16 5 F 37   F 38   F  LEU 37 . F  LEU 38 . 1 ? 
95  16 5 I 37   I 38   I  LEU 37 . I  LEU 38 . 1 ? 
96  16 5 J 37   J 38   J  LEU 37 . J  LEU 38 . 1 ? 
97  17 4 A 44   A 44   A  GLN 44 . A  GLN 44 . 1 ? 
98  17 4 B 44   B 44   B  GLN 44 . B  GLN 44 . 1 ? 
99  17 4 E 44   E 44   E  GLN 44 . E  GLN 44 . 1 ? 
100 17 4 F 44   F 44   F  GLN 44 . F  GLN 44 . 1 ? 
101 17 4 I 44   I 44   I  GLN 44 . I  GLN 44 . 1 ? 
102 17 4 J 44   J 44   J  GLN 44 . J  GLN 44 . 1 ? 
103 18 5 A 45   A 46   A  TYR 45 . A  ILE 46 . 1 ? 
104 18 5 B 45   B 46   B  TYR 45 . B  ILE 46 . 1 ? 
105 18 5 E 45   E 46   E  TYR 45 . E  ILE 46 . 1 ? 
106 18 5 F 45   F 46   F  TYR 45 . F  ILE 46 . 1 ? 
107 18 5 I 45   I 46   I  TYR 45 . I  ILE 46 . 1 ? 
108 18 5 J 45   J 46   J  TYR 45 . J  ILE 46 . 1 ? 
109 19 1 A 47   A 49   A  ARG 47 . A  LYS 49 . 1 ? 
110 19 1 B 47   B 49   B  ARG 47 . B  LYS 49 . 1 ? 
111 19 1 E 47   E 49   E  ARG 47 . E  LYS 49 . 1 ? 
112 19 1 F 47   F 49   F  ARG 47 . F  LYS 49 . 1 ? 
113 19 1 I 47   I 49   I  ARG 47 . I  LYS 49 . 1 ? 
114 19 1 J 47   J 49   J  ARG 47 . J  LYS 49 . 1 ? 
115 20 5 A 50   A 55   A  GLY 50 . A  PHE 55 . 1 ? 
116 20 5 B 50   B 55   B  GLY 50 . B  PHE 55 . 1 ? 
117 20 5 E 50   E 55   E  GLY 50 . E  PHE 55 . 1 ? 
118 20 5 F 50   F 55   F  GLY 50 . F  PHE 55 . 1 ? 
119 20 5 I 50   I 55   I  GLY 50 . I  PHE 55 . 1 ? 
120 20 5 J 50   J 55   J  GLY 50 . J  PHE 55 . 1 ? 
121 21 1 A 56   A 57   A  LYS 56 . A  GLU 57 . 1 ? 
122 21 1 B 56   B 57   B  LYS 56 . B  GLU 57 . 1 ? 
123 21 1 E 56   E 57   E  LYS 56 . E  GLU 57 . 1 ? 
124 21 1 F 56   F 57   F  LYS 56 . F  GLU 57 . 1 ? 
125 21 1 I 56   I 57   I  LYS 56 . I  GLU 57 . 1 ? 
126 21 1 J 56   J 57   J  LYS 56 . J  GLU 57 . 1 ? 
127 22 5 A 58   A 68   A  LEU 58 . A  PHE 68 . 1 ? 
128 22 5 B 58   B 68   B  LEU 58 . B  PHE 68 . 1 ? 
129 22 5 E 58   E 68   E  LEU 58 . E  PHE 68 . 1 ? 
130 22 5 F 58   F 68   F  LEU 58 . F  PHE 68 . 1 ? 
131 22 5 I 58   I 68   I  LEU 58 . I  PHE 68 . 1 ? 
132 22 5 J 58   J 68   J  LEU 58 . J  PHE 68 . 1 ? 
133 23 1 A 69   A 69   A  GLN 69 . A  GLN 69 . 1 ? 
134 23 1 B 69   B 69   B  GLN 69 . B  GLN 69 . 1 ? 
135 23 1 E 69   E 69   E  GLN 69 . E  GLN 69 . 1 ? 
136 23 1 F 69   F 69   F  GLN 69 . F  GLN 69 . 1 ? 
137 23 1 I 69   I 69   I  GLN 69 . I  GLN 69 . 1 ? 
138 23 1 J 69   J 69   J  GLN 69 . J  GLN 69 . 1 ? 
139 24 5 A 70   A 76   A  GLU 70 . A  ILE 76 . 1 ? 
140 24 5 B 70   B 76   B  GLU 70 . B  ILE 76 . 1 ? 
141 24 5 E 70   E 76   E  GLU 70 . E  ILE 76 . 1 ? 
142 24 5 F 70   F 76   F  GLU 70 . F  ILE 76 . 1 ? 
143 24 5 I 70   I 76   I  GLU 70 . I  ILE 76 . 1 ? 
144 24 5 J 70   J 76   J  GLU 70 . J  ILE 76 . 1 ? 
145 25 5 A 78   A 83   A  MET 78 . A  HIS 83 . 1 ? 
146 25 5 B 78   B 83   B  MET 78 . B  HIS 83 . 1 ? 
147 25 5 E 78   E 83   E  MET 78 . E  HIS 83 . 1 ? 
148 25 5 F 78   F 83   F  MET 78 . F  HIS 83 . 1 ? 
149 25 5 I 78   I 83   I  MET 78 . I  HIS 83 . 1 ? 
150 25 5 J 78   J 83   J  MET 78 . J  HIS 83 . 1 ? 
151 26 1 A 84   A 87   A  LYS 84 . A  HIS 87 . 1 ? 
152 26 1 B 84   B 88   B  LYS 84 . B  GLU 88 . 1 ? 
153 26 1 E 84   E 88   E  LYS 84 . E  GLU 88 . 1 ? 
154 26 1 F 84   F 87   F  LYS 84 . F  HIS 87 . 1 ? 
155 26 1 I 84   I 87   I  LYS 84 . I  HIS 87 . 1 ? 
156 26 1 J 84   J 88   J  LYS 84 . J  GLU 88 . 1 ? 
157 27 5 A 22   A 22   A  ILE 22 . A  ILE 22 . 1 ? 
158 27 5 B 22   B 22   B  ILE 22 . B  ILE 22 . 1 ? 
159 27 5 E 22   E 22   E  ILE 22 . E  ILE 22 . 1 ? 
160 27 5 F 22   F 22   F  ILE 22 . F  ILE 22 . 1 ? 
161 27 5 I 22   I 22   I  ILE 22 . I  ILE 22 . 1 ? 
162 27 5 J 22   J 22   J  ILE 22 . J  ILE 22 . 1 ? 
163 28 1 A 39   A 39   A  GLU 39 . A  GLU 39 . 1 ? 
164 28 1 B 39   B 39   B  GLU 39 . B  GLU 39 . 1 ? 
165 28 1 E 39   E 39   E  GLU 39 . E  GLU 39 . 1 ? 
166 28 1 F 39   F 39   F  GLU 39 . F  GLU 39 . 1 ? 
167 28 1 I 39   I 39   I  GLU 39 . I  GLU 39 . 1 ? 
168 28 1 J 39   J 39   J  GLU 39 . J  GLU 39 . 1 ? 
169 29 5 A 40   A 41   A  THR 40 . A  GLU 41 . 1 ? 
170 29 5 B 40   B 41   B  THR 40 . B  GLU 41 . 1 ? 
171 29 5 E 40   E 41   E  THR 40 . E  GLU 41 . 1 ? 
172 29 5 F 40   F 41   F  THR 40 . F  GLU 41 . 1 ? 
173 29 5 I 40   I 41   I  THR 40 . I  GLU 41 . 1 ? 
174 29 5 J 40   J 41   J  THR 40 . J  GLU 41 . 1 ? 
175 30 4 A 77   A 77   A  LYS 77 . A  LYS 77 . 1 ? 
176 30 4 B 77   B 77   B  LYS 77 . B  LYS 77 . 1 ? 
177 30 4 E 77   E 77   E  LYS 77 . E  LYS 77 . 1 ? 
178 30 4 F 77   F 77   F  LYS 77 . F  LYS 77 . 1 ? 
179 30 4 I 77   I 77   I  LYS 77 . I  LYS 77 . 1 ? 
180 30 4 J 77   J 77   J  LYS 77 . J  LYS 77 . 1 ? 
181 31 4 A 42   A 42   A  SER 42 . A  SER 42 . 1 ? 
182 31 4 B 42   B 42   B  SER 42 . B  SER 42 . 1 ? 
183 31 4 E 42   E 42   E  SER 42 . E  SER 42 . 1 ? 
184 31 4 F 42   F 42   F  SER 42 . F  SER 42 . 1 ? 
185 31 4 I 42   I 42   I  SER 42 . I  SER 42 . 1 ? 
186 31 4 J 42   J 42   J  SER 42 . J  SER 42 . 1 ? 
187 32 5 A 43   A 43   A  PRO 43 . A  PRO 43 . 1 ? 
188 32 5 B 43   B 43   B  PRO 43 . B  PRO 43 . 1 ? 
189 32 5 E 43   E 43   E  PRO 43 . E  PRO 43 . 1 ? 
190 32 5 F 43   F 43   F  PRO 43 . F  PRO 43 . 1 ? 
191 32 5 I 43   I 43   I  PRO 43 . I  PRO 43 . 1 ? 
192 32 5 J 43   J 43   J  PRO 43 . J  PRO 43 . 1 ? 
193 33 4 A 1501 A 1502 M  CA  1  . N  CA  1  . 1 ? 
194 33 4 B 2501 B 2502 O  CA  1  . P  CA  1  . 1 ? 
195 33 4 E 1511 E 1512 U  CA  1  . V  CA  1  . 1 ? 
196 33 4 F 2511 F 2512 W  CA  1  . X  CA  1  . 1 ? 
197 33 4 I 1521 I 1522 CA CA  1  . DA CA  1  . 1 ? 
198 33 4 J 2521 J 2522 EA CA  1  . FA CA  1  . 1 ? 
1   1  1 C 4    C 5    C  LYS 3  . C  MET 4  . 2 ? 
2   1  1 D 4    D 5    D  LYS 3  . D  MET 4  . 2 ? 
3   1  1 G 4    G 5    G  LYS 3  . G  MET 4  . 2 ? 
4   1  1 H 4    H 5    H  LYS 3  . H  MET 4  . 2 ? 
5   1  1 K 4    K 5    K  LYS 3  . K  MET 4  . 2 ? 
6   1  1 L 4    L 5    L  LYS 3  . L  MET 4  . 2 ? 
7   2  4 C 6    C 7    C  SER 5  . C  GLN 6  . 2 ? 
8   2  4 D 6    D 7    D  SER 5  . D  GLN 6  . 2 ? 
9   2  4 G 6    G 7    G  SER 5  . G  GLN 6  . 2 ? 
10  2  4 H 6    H 7    H  SER 5  . H  GLN 6  . 2 ? 
11  2  4 K 6    K 7    K  SER 5  . K  GLN 6  . 2 ? 
12  2  4 L 6    L 7    L  SER 5  . L  GLN 6  . 2 ? 
13  3  5 C 8    C 9    C  LEU 7  . C  GLU 8  . 2 ? 
14  3  5 D 8    D 9    D  LEU 7  . D  GLU 8  . 2 ? 
15  3  5 G 8    G 9    G  LEU 7  . G  GLU 8  . 2 ? 
16  3  5 H 8    H 9    H  LEU 7  . H  GLU 8  . 2 ? 
17  3  5 K 8    K 9    K  LEU 7  . K  GLU 8  . 2 ? 
18  3  5 L 8    L 9    L  LEU 7  . L  GLU 8  . 2 ? 
19  4  5 C 11   C 16   C  ASN 10 . C  ILE 15 . 2 ? 
20  4  5 D 11   D 16   D  ASN 10 . D  ILE 15 . 2 ? 
21  4  5 G 11   G 16   G  ASN 10 . G  ILE 15 . 2 ? 
22  4  5 H 11   H 16   H  ASN 10 . H  ILE 15 . 2 ? 
23  4  5 K 11   K 16   K  ASN 10 . K  ILE 15 . 2 ? 
24  4  5 L 11   L 16   L  ASN 10 . L  ILE 15 . 2 ? 
25  5  5 C 18   C 19   C  THR 17 . C  PHE 18 . 2 ? 
26  5  5 D 18   D 19   D  THR 17 . D  PHE 18 . 2 ? 
27  5  5 G 18   G 19   G  THR 17 . G  PHE 18 . 2 ? 
28  5  5 H 18   H 19   H  THR 17 . H  PHE 18 . 2 ? 
29  5  5 K 18   K 19   K  THR 17 . K  PHE 18 . 2 ? 
30  5  5 L 18   L 19   L  THR 17 . L  PHE 18 . 2 ? 
31  6  4 C 20   C 20   C  HIS 19 . C  HIS 19 . 2 ? 
32  6  4 D 20   D 20   D  HIS 19 . D  HIS 19 . 2 ? 
33  6  4 G 20   G 20   G  HIS 19 . G  HIS 19 . 2 ? 
34  6  4 H 20   H 20   H  HIS 19 . H  HIS 19 . 2 ? 
35  6  4 K 20   K 20   K  HIS 19 . K  HIS 19 . 2 ? 
36  6  4 L 20   L 20   L  HIS 19 . L  HIS 19 . 2 ? 
37  7  5 C 22   C 24   C  TYR 21 . C  VAL 23 . 2 ? 
38  7  5 D 22   D 24   D  TYR 21 . D  VAL 23 . 2 ? 
39  7  5 G 22   G 24   G  TYR 21 . G  VAL 23 . 2 ? 
40  7  5 H 22   H 24   H  TYR 21 . H  VAL 23 . 2 ? 
41  7  5 K 22   K 24   K  TYR 21 . K  VAL 23 . 2 ? 
42  7  5 L 22   L 24   L  TYR 21 . L  VAL 23 . 2 ? 
43  8  4 C 27   C 28   C  GLY 26 . C  HIS 27 . 2 ? 
44  8  4 D 27   D 28   D  GLY 26 . D  HIS 27 . 2 ? 
45  8  4 G 27   G 28   G  GLY 26 . G  HIS 27 . 2 ? 
46  8  4 H 27   H 28   H  GLY 26 . H  HIS 27 . 2 ? 
47  8  4 K 27   K 28   K  GLY 26 . K  HIS 27 . 2 ? 
48  8  4 L 27   L 28   L  GLY 26 . L  HIS 27 . 2 ? 
49  9  5 C 29   C 29   C  PRO 28 . C  PRO 28 . 2 ? 
50  9  5 D 29   D 29   D  PRO 28 . D  PRO 28 . 2 ? 
51  9  5 G 29   G 29   G  PRO 28 . G  PRO 28 . 2 ? 
52  9  5 H 29   H 29   H  PRO 28 . H  PRO 28 . 2 ? 
53  9  5 K 29   K 29   K  PRO 28 . K  PRO 28 . 2 ? 
54  9  5 L 29   L 29   L  PRO 28 . L  PRO 28 . 2 ? 
55  10 4 C 30   C 30   C  ASP 29 . C  ASP 29 . 2 ? 
56  10 4 D 30   D 30   D  ASP 29 . D  ASP 29 . 2 ? 
57  10 4 G 30   G 30   G  ASP 29 . G  ASP 29 . 2 ? 
58  10 4 H 30   H 30   H  ASP 29 . H  ASP 29 . 2 ? 
59  10 4 K 30   K 30   K  ASP 29 . K  ASP 29 . 2 ? 
60  10 4 L 30   L 30   L  ASP 29 . L  ASP 29 . 2 ? 
61  11 5 C 31   C 33   C  THR 30 . C  ASN 32 . 2 ? 
62  11 5 D 31   D 33   D  THR 30 . D  ASN 32 . 2 ? 
63  11 5 G 31   G 33   G  THR 30 . G  ASN 32 . 2 ? 
64  11 5 H 31   H 33   H  THR 30 . H  ASN 32 . 2 ? 
65  11 5 K 31   K 33   K  THR 30 . K  ASN 32 . 2 ? 
66  11 5 L 31   L 33   L  THR 30 . L  ASN 32 . 2 ? 
67  12 1 C 34   C 34   C  GLN 33 . C  GLN 33 . 2 ? 
68  12 1 D 34   D 34   D  GLN 33 . D  GLN 33 . 2 ? 
69  12 1 G 34   G 34   G  GLN 33 . G  GLN 33 . 2 ? 
70  12 1 H 34   H 34   H  GLN 33 . H  GLN 33 . 2 ? 
71  12 1 K 34   K 34   K  GLN 33 . K  GLN 33 . 2 ? 
72  12 1 L 34   L 34   L  GLN 33 . L  GLN 33 . 2 ? 
73  13 5 C 35   C 37   C  GLY 34 . C  PHE 36 . 2 ? 
74  13 5 D 35   D 37   D  GLY 34 . D  PHE 36 . 2 ? 
75  13 5 G 35   G 37   G  GLY 34 . G  PHE 36 . 2 ? 
76  13 5 H 35   H 37   H  GLY 34 . H  PHE 36 . 2 ? 
77  13 5 K 35   K 37   K  GLY 34 . K  PHE 36 . 2 ? 
78  13 5 L 35   L 37   L  GLY 34 . L  PHE 36 . 2 ? 
79  14 1 C 38   C 39   C  LYS 37 . C  GLU 38 . 2 ? 
80  14 1 D 38   D 39   D  LYS 37 . D  GLU 38 . 2 ? 
81  14 1 G 38   G 39   G  LYS 37 . G  GLU 38 . 2 ? 
82  14 1 H 38   H 39   H  LYS 37 . H  GLU 38 . 2 ? 
83  14 1 K 38   K 39   K  LYS 37 . K  GLU 38 . 2 ? 
84  14 1 L 38   L 39   L  LYS 37 . L  GLU 38 . 2 ? 
85  15 5 C 40   C 42   C  LEU 39 . C  ARG 41 . 2 ? 
86  15 5 D 40   D 42   D  LEU 39 . D  ARG 41 . 2 ? 
87  15 5 G 40   G 42   G  LEU 39 . G  ARG 41 . 2 ? 
88  15 5 H 40   H 42   H  LEU 39 . H  ARG 41 . 2 ? 
89  15 5 K 40   K 42   K  LEU 39 . K  ARG 41 . 2 ? 
90  15 5 L 40   L 42   L  LEU 39 . L  ARG 41 . 2 ? 
91  16 4 C 46   C 46   C  GLN 45 . C  GLN 45 . 2 ? 
92  16 4 D 46   D 46   D  GLN 45 . D  GLN 45 . 2 ? 
93  16 4 G 46   G 46   G  GLN 45 . G  GLN 45 . 2 ? 
94  16 4 H 46   H 46   H  GLN 45 . H  GLN 45 . 2 ? 
95  16 4 K 46   K 46   K  GLN 45 . K  GLN 45 . 2 ? 
96  16 4 L 46   L 46   L  GLN 45 . L  GLN 45 . 2 ? 
97  17 5 C 47   C 49   C  ASN 46 . C  LEU 48 . 2 ? 
98  17 5 D 47   D 49   D  ASN 46 . D  LEU 48 . 2 ? 
99  17 5 G 47   G 49   G  ASN 46 . G  LEU 48 . 2 ? 
100 17 5 H 47   H 49   H  ASN 46 . H  LEU 48 . 2 ? 
101 17 5 K 47   K 49   K  ASN 46 . K  LEU 48 . 2 ? 
102 17 5 L 47   L 49   L  ASN 46 . L  LEU 48 . 2 ? 
103 18 4 C 61   C 61   C  HIS 60 . C  HIS 60 . 2 ? 
104 18 4 D 61   D 61   D  HIS 60 . D  HIS 60 . 2 ? 
105 18 4 G 61   G 61   G  HIS 60 . G  HIS 60 . 2 ? 
106 18 4 H 61   H 61   H  HIS 60 . H  HIS 60 . 2 ? 
107 18 4 K 61   K 61   K  HIS 60 . K  HIS 60 . 2 ? 
108 18 4 L 61   L 61   L  HIS 60 . L  HIS 60 . 2 ? 
109 19 5 C 62   C 63   C  ILE 61 . C  MET 62 . 2 ? 
110 19 5 D 62   D 63   D  ILE 61 . D  MET 62 . 2 ? 
111 19 5 G 62   G 63   G  ILE 61 . G  MET 62 . 2 ? 
112 19 5 H 62   H 63   H  ILE 61 . H  MET 62 . 2 ? 
113 19 5 K 62   K 63   K  ILE 61 . K  MET 62 . 2 ? 
114 19 5 L 62   L 63   L  ILE 61 . L  MET 62 . 2 ? 
115 20 4 C 68   C 68   C  THR 67 . C  THR 67 . 2 ? 
116 20 4 D 68   D 68   D  THR 67 . D  THR 67 . 2 ? 
117 20 4 G 68   G 68   G  THR 67 . G  THR 67 . 2 ? 
118 20 4 H 68   H 68   H  THR 67 . H  THR 67 . 2 ? 
119 20 4 K 68   K 68   K  THR 67 . K  THR 67 . 2 ? 
120 20 4 L 68   L 68   L  THR 67 . L  THR 67 . 2 ? 
121 21 5 C 69   C 71   C  ASN 68 . C  ASP 70 . 2 ? 
122 21 5 D 69   D 71   D  ASN 68 . D  ASP 70 . 2 ? 
123 21 5 G 69   G 71   G  ASN 68 . G  ASP 70 . 2 ? 
124 21 5 H 69   H 71   H  ASN 68 . H  ASP 70 . 2 ? 
125 21 5 K 69   K 71   K  ASN 68 . K  ASP 70 . 2 ? 
126 21 5 L 69   L 71   L  ASN 68 . L  ASP 70 . 2 ? 
127 22 5 C 74   C 84   C  LEU 73 . C  ALA 83 . 2 ? 
128 22 5 D 74   D 84   D  LEU 73 . D  ALA 83 . 2 ? 
129 22 5 G 74   G 84   G  LEU 73 . G  ALA 83 . 2 ? 
130 22 5 H 74   H 84   H  LEU 73 . H  ALA 83 . 2 ? 
131 22 5 K 74   K 84   K  LEU 73 . K  ALA 83 . 2 ? 
132 22 5 L 74   L 84   L  LEU 73 . L  ALA 83 . 2 ? 
133 23 5 C 86   C 87   C  LEU 85 . C  THR 86 . 2 ? 
134 23 5 D 86   D 87   D  LEU 85 . D  THR 86 . 2 ? 
135 23 5 G 86   G 87   G  LEU 85 . G  THR 86 . 2 ? 
136 23 5 H 86   H 87   H  LEU 85 . H  THR 86 . 2 ? 
137 23 5 K 86   K 87   K  LEU 85 . K  THR 86 . 2 ? 
138 23 5 L 86   L 87   L  LEU 85 . L  THR 86 . 2 ? 
139 24 2 C 88   C 92   C  TRP 87 . C  GLU 91 . 2 ? 
140 24 2 D 88   D 95   D  TRP 87 . D  HIS 94 . 2 ? 
141 24 2 G 88   G 95   G  TRP 87 . G  HIS 94 . 2 ? 
142 24 2 H 88   H 92   H  TRP 87 . H  GLU 91 . 2 ? 
143 24 2 K 88   K 95   K  TRP 87 . K  HIS 94 . 2 ? 
144 24 2 L 88   L 95   L  TRP 87 . L  HIS 94 . 2 ? 
145 25 4 C 21   C 21   C  GLN 20 . C  GLN 20 . 2 ? 
146 25 4 D 21   D 21   D  GLN 20 . D  GLN 20 . 2 ? 
147 25 4 G 21   G 21   G  GLN 20 . G  GLN 20 . 2 ? 
148 25 4 H 21   H 21   H  GLN 20 . H  GLN 20 . 2 ? 
149 25 4 K 21   K 21   K  GLN 20 . K  GLN 20 . 2 ? 
150 25 4 L 21   L 21   L  GLN 20 . L  GLN 20 . 2 ? 
151 26 4 C 25   C 25   C  LYS 24 . C  LYS 24 . 2 ? 
152 26 4 D 25   D 25   D  LYS 24 . D  LYS 24 . 2 ? 
153 26 4 G 25   G 25   G  LYS 24 . G  LYS 24 . 2 ? 
154 26 4 H 25   H 25   H  LYS 24 . H  LYS 24 . 2 ? 
155 26 4 K 25   K 25   K  LYS 24 . K  LYS 24 . 2 ? 
156 26 4 L 25   L 25   L  LYS 24 . L  LYS 24 . 2 ? 
157 27 4 C 3501 C 3502 Q  CA  1  . R  CA  1  . 2 ? 
158 27 4 D 4501 D 4502 S  CA  1  . T  CA  1  . 2 ? 
159 27 4 G 3511 G 3512 Y  CA  1  . Z  CA  1  . 2 ? 
160 27 4 H 4511 H 4512 AA CA  1  . BA CA  1  . 2 ? 
161 27 4 K 3521 K 3522 GA CA  1  . HA CA  1  . 2 ? 
162 27 4 L 4521 L 4522 IA CA  1  . JA CA  1  . 2 ? 
163 28 1 C 43   C 43   C  LYS 42 . C  LYS 42 . 2 ? 
164 28 1 D 43   D 43   D  LYS 42 . D  LYS 42 . 2 ? 
165 28 1 G 43   G 43   G  LYS 42 . G  LYS 42 . 2 ? 
166 28 1 H 43   H 43   H  LYS 42 . H  LYS 42 . 2 ? 
167 28 1 K 43   K 43   K  LYS 42 . K  LYS 42 . 2 ? 
168 28 1 L 43   L 43   L  LYS 42 . L  LYS 42 . 2 ? 
169 29 5 C 44   C 45   C  ASP 43 . C  LEU 44 . 2 ? 
170 29 5 D 44   D 45   D  ASP 43 . D  LEU 44 . 2 ? 
171 29 5 G 44   G 45   G  ASP 43 . G  LEU 44 . 2 ? 
172 29 5 H 44   H 45   H  ASP 43 . H  LEU 44 . 2 ? 
173 29 5 K 44   K 45   K  ASP 43 . K  LEU 44 . 2 ? 
174 29 5 L 44   L 45   L  ASP 43 . L  LEU 44 . 2 ? 
175 30 1 C 50   C 51   C  LYS 49 . C  LYS 50 . 2 ? 
176 30 1 D 50   D 51   D  LYS 49 . D  LYS 50 . 2 ? 
177 30 1 G 50   G 51   G  LYS 49 . G  LYS 50 . 2 ? 
178 30 1 H 50   H 51   H  LYS 49 . H  LYS 50 . 2 ? 
179 30 1 K 50   K 51   K  LYS 49 . K  LYS 50 . 2 ? 
180 30 1 L 50   L 51   L  LYS 49 . L  LYS 50 . 2 ? 
181 31 5 C 52   C 53   C  GLU 51 . C  ASN 52 . 2 ? 
182 31 5 D 52   D 53   D  GLU 51 . D  ASN 52 . 2 ? 
183 31 5 G 52   G 53   G  GLU 51 . G  ASN 52 . 2 ? 
184 31 5 H 52   H 53   H  GLU 51 . H  ASN 52 . 2 ? 
185 31 5 K 52   K 53   K  GLU 51 . K  ASN 52 . 2 ? 
186 31 5 L 52   L 53   L  GLU 51 . L  ASN 52 . 2 ? 
187 32 1 C 54   C 55   C  LYS 53 . C  ASN 54 . 2 ? 
188 32 1 D 54   D 55   D  LYS 53 . D  ASN 54 . 2 ? 
189 32 1 G 54   G 55   G  LYS 53 . G  ASN 54 . 2 ? 
190 32 1 H 54   H 55   H  LYS 53 . H  ASN 54 . 2 ? 
191 32 1 K 54   K 55   K  LYS 53 . K  ASN 54 . 2 ? 
192 32 1 L 54   L 55   L  LYS 53 . L  ASN 54 . 2 ? 
193 33 1 C 56   C 57   C  GLU 55 . C  LYS 56 . 2 ? 
194 33 1 D 56   D 57   D  GLU 55 . D  LYS 56 . 2 ? 
195 33 1 G 56   G 57   G  GLU 55 . G  LYS 56 . 2 ? 
196 33 1 H 56   H 57   H  GLU 55 . H  LYS 56 . 2 ? 
197 33 1 K 56   K 57   K  GLU 55 . K  LYS 56 . 2 ? 
198 33 1 L 56   L 57   L  GLU 55 . L  LYS 56 . 2 ? 
199 34 5 C 58   C 60   C  VAL 57 . C  GLU 59 . 2 ? 
200 34 5 D 58   D 60   D  VAL 57 . D  GLU 59 . 2 ? 
201 34 5 G 58   G 60   G  VAL 57 . G  GLU 59 . 2 ? 
202 34 5 H 58   H 60   H  VAL 57 . H  GLU 59 . 2 ? 
203 34 5 K 58   K 60   K  VAL 57 . K  GLU 59 . 2 ? 
204 34 5 L 58   L 60   L  VAL 57 . L  GLU 59 . 2 ? 
205 35 1 C 64   C 64   C  GLU 63 . C  GLU 63 . 2 ? 
206 35 1 D 64   D 64   D  GLU 63 . D  GLU 63 . 2 ? 
207 35 1 G 64   G 64   G  GLU 63 . G  GLU 63 . 2 ? 
208 35 1 H 64   H 64   H  GLU 63 . H  GLU 63 . 2 ? 
209 35 1 K 64   K 64   K  GLU 63 . K  GLU 63 . 2 ? 
210 35 1 L 64   L 64   L  GLU 63 . L  GLU 63 . 2 ? 
211 36 5 C 65   C 67   C  ASP 64 . C  ASP 66 . 2 ? 
212 36 5 D 65   D 67   D  ASP 64 . D  ASP 66 . 2 ? 
213 36 5 G 65   G 67   G  ASP 64 . G  ASP 66 . 2 ? 
214 36 5 H 65   H 67   H  ASP 64 . H  ASP 66 . 2 ? 
215 36 5 K 65   K 67   K  ASP 64 . K  ASP 66 . 2 ? 
216 36 5 L 65   L 67   L  ASP 64 . L  ASP 66 . 2 ? 
217 37 1 C 72   C 72   C  LYS 71 . C  LYS 71 . 2 ? 
218 37 1 D 72   D 72   D  LYS 71 . D  LYS 71 . 2 ? 
219 37 1 G 72   G 72   G  LYS 71 . G  LYS 71 . 2 ? 
220 37 1 H 72   H 72   H  LYS 71 . H  LYS 71 . 2 ? 
221 37 1 K 72   K 72   K  LYS 71 . K  LYS 71 . 2 ? 
222 37 1 L 72   L 72   L  LYS 71 . L  LYS 71 . 2 ? 
223 38 1 C 85   C 85   C  ARG 84 . C  ARG 84 . 2 ? 
224 38 1 D 85   D 85   D  ARG 84 . D  ARG 84 . 2 ? 
225 38 1 G 85   G 85   G  ARG 84 . G  ARG 84 . 2 ? 
226 38 1 H 85   H 85   H  ARG 84 . H  ARG 84 . 2 ? 
227 38 1 K 85   K 85   K  ARG 84 . K  ARG 84 . 2 ? 
228 38 1 L 85   L 85   L  ARG 84 . L  ARG 84 . 2 ? 
229 39 5 C 26   C 26   C  LEU 25 . C  LEU 25 . 2 ? 
230 39 5 D 26   D 26   D  LEU 25 . D  LEU 25 . 2 ? 
231 39 5 G 26   G 26   G  LEU 25 . G  LEU 25 . 2 ? 
232 39 5 H 26   H 26   H  LEU 25 . H  LEU 25 . 2 ? 
233 39 5 K 26   K 26   K  LEU 25 . K  LEU 25 . 2 ? 
234 39 5 L 26   L 26   L  LEU 25 . L  LEU 25 . 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  1XK4 
_struct.title                     'Crystal structure of human calprotectin(S100A8/S100A9)' 
_struct.pdbx_descriptor           'Calgranulin A/Calgranulin B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XK4 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'S100 family, heterotetramer, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 4 ? 
LA N N 3 ? 
MA N N 3 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 6 ? 
QA N N 6 ? 
RA N N 6 ? 
SA N N 6 ? 
TA N N 6 ? 
UA N N 6 ? 
VA N N 6 ? 
WA N N 6 ? 
XA N N 6 ? 
YA N N 6 ? 
ZA N N 6 ? 
AB N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is a tetramer composed of A,B,C,D or E,F,G,H or I,J,K,L.' ? 
2 ?                                                                                  ? 
3 ?                                                                                  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 3  ? LEU A 21 ? THR A 3  LEU A 21 1 ? 19 
HELX_P HELX_P2  2  TYR A 30 ? SER A 42 ? TYR A 30 SER A 42 1 ? 13 
HELX_P HELX_P3  3  PRO A 43 ? LYS A 48 ? PRO A 43 LYS A 48 1 ? 6  
HELX_P HELX_P4  4  GLY A 50 ? ASP A 59 ? GLY A 50 ASP A 59 1 ? 10 
HELX_P HELX_P5  5  ASN A 67 ? HIS A 87 ? ASN A 67 HIS A 87 1 ? 21 
HELX_P HELX_P6  6  THR B 3  ? LEU B 21 ? THR B 3  LEU B 21 1 ? 19 
HELX_P HELX_P7  7  TYR B 30 ? SER B 42 ? TYR B 30 SER B 42 1 ? 13 
HELX_P HELX_P8  8  PRO B 43 ? LYS B 48 ? PRO B 43 LYS B 48 1 ? 6  
HELX_P HELX_P9  9  GLY B 50 ? ASP B 59 ? GLY B 50 ASP B 59 1 ? 10 
HELX_P HELX_P10 10 ASN B 67 ? HIS B 87 ? ASN B 67 HIS B 87 1 ? 21 
HELX_P HELX_P11 11 SER C 5  ? VAL C 23 ? SER C 6  VAL C 24 1 ? 19 
HELX_P HELX_P12 12 ASN C 32 ? LEU C 44 ? ASN C 33 LEU C 45 1 ? 13 
HELX_P HELX_P13 13 LYS C 50 ? LYS C 53 ? LYS C 51 LYS C 54 5 ? 4  
HELX_P HELX_P14 14 ASN C 54 ? ASP C 66 ? ASN C 55 ASP C 67 1 ? 13 
HELX_P HELX_P15 15 SER C 74 ? GLU C 91 ? SER C 75 GLU C 92 1 ? 18 
HELX_P HELX_P16 16 SER D 5  ? VAL D 23 ? SER D 6  VAL D 24 1 ? 19 
HELX_P HELX_P17 17 GLN D 33 ? LEU D 44 ? GLN D 34 LEU D 45 1 ? 12 
HELX_P HELX_P18 18 LEU D 48 ? LYS D 53 ? LEU D 49 LYS D 54 1 ? 6  
HELX_P HELX_P19 19 ASN D 54 ? ASP D 66 ? ASN D 55 ASP D 67 1 ? 13 
HELX_P HELX_P20 20 SER D 74 ? MET D 93 ? SER D 75 MET D 94 1 ? 20 
HELX_P HELX_P21 21 THR E 3  ? LEU E 21 ? THR E 3  LEU E 21 1 ? 19 
HELX_P HELX_P22 22 TYR E 30 ? SER E 42 ? TYR E 30 SER E 42 1 ? 13 
HELX_P HELX_P23 23 PRO E 43 ? LYS E 48 ? PRO E 43 LYS E 48 1 ? 6  
HELX_P HELX_P24 24 GLY E 50 ? ASP E 59 ? GLY E 50 ASP E 59 1 ? 10 
HELX_P HELX_P25 25 ASN E 67 ? HIS E 87 ? ASN E 67 HIS E 87 1 ? 21 
HELX_P HELX_P26 26 THR F 3  ? LEU F 21 ? THR F 3  LEU F 21 1 ? 19 
HELX_P HELX_P27 27 TYR F 30 ? SER F 42 ? TYR F 30 SER F 42 1 ? 13 
HELX_P HELX_P28 28 PRO F 43 ? LYS F 48 ? PRO F 43 LYS F 48 1 ? 6  
HELX_P HELX_P29 29 GLY F 50 ? ASP F 59 ? GLY F 50 ASP F 59 1 ? 10 
HELX_P HELX_P30 30 ASN F 67 ? HIS F 87 ? ASN F 67 HIS F 87 1 ? 21 
HELX_P HELX_P31 31 SER G 5  ? VAL G 23 ? SER G 6  VAL G 24 1 ? 19 
HELX_P HELX_P32 32 ASN G 32 ? LEU G 44 ? ASN G 33 LEU G 45 1 ? 13 
HELX_P HELX_P33 33 LYS G 50 ? LYS G 53 ? LYS G 51 LYS G 54 5 ? 4  
HELX_P HELX_P34 34 ASN G 54 ? ASP G 66 ? ASN G 55 ASP G 67 1 ? 13 
HELX_P HELX_P35 35 PHE G 75 ? HIS G 94 ? PHE G 76 HIS G 95 1 ? 20 
HELX_P HELX_P36 36 SER H 5  ? VAL H 23 ? SER H 6  VAL H 24 1 ? 19 
HELX_P HELX_P37 37 ASN H 32 ? LEU H 44 ? ASN H 33 LEU H 45 1 ? 13 
HELX_P HELX_P38 38 LYS H 50 ? LYS H 53 ? LYS H 51 LYS H 54 5 ? 4  
HELX_P HELX_P39 39 ASN H 54 ? ASP H 66 ? ASN H 55 ASP H 67 1 ? 13 
HELX_P HELX_P40 40 PHE H 75 ? GLU H 91 ? PHE H 76 GLU H 92 1 ? 17 
HELX_P HELX_P41 41 THR I 3  ? LEU I 21 ? THR I 3  LEU I 21 1 ? 19 
HELX_P HELX_P42 42 TYR I 30 ? SER I 42 ? TYR I 30 SER I 42 1 ? 13 
HELX_P HELX_P43 43 PRO I 43 ? LYS I 48 ? PRO I 43 LYS I 48 1 ? 6  
HELX_P HELX_P44 44 GLY I 50 ? ASP I 59 ? GLY I 50 ASP I 59 1 ? 10 
HELX_P HELX_P45 45 ASN I 67 ? HIS I 87 ? ASN I 67 HIS I 87 1 ? 21 
HELX_P HELX_P46 46 THR J 3  ? LEU J 21 ? THR J 3  LEU J 21 1 ? 19 
HELX_P HELX_P47 47 TYR J 30 ? SER J 42 ? TYR J 30 SER J 42 1 ? 13 
HELX_P HELX_P48 48 PRO J 43 ? LYS J 48 ? PRO J 43 LYS J 48 1 ? 6  
HELX_P HELX_P49 49 GLY J 50 ? ASP J 59 ? GLY J 50 ASP J 59 1 ? 10 
HELX_P HELX_P50 50 ASN J 67 ? HIS J 87 ? ASN J 67 HIS J 87 1 ? 21 
HELX_P HELX_P51 51 SER K 5  ? VAL K 23 ? SER K 6  VAL K 24 1 ? 19 
HELX_P HELX_P52 52 ASN K 32 ? LEU K 44 ? ASN K 33 LEU K 45 1 ? 13 
HELX_P HELX_P53 53 LEU K 48 ? LYS K 53 ? LEU K 49 LYS K 54 1 ? 6  
HELX_P HELX_P54 54 ASN K 54 ? ASP K 66 ? ASN K 55 ASP K 67 1 ? 13 
HELX_P HELX_P55 55 SER K 74 ? HIS K 94 ? SER K 75 HIS K 95 1 ? 21 
HELX_P HELX_P56 56 SER L 5  ? VAL L 23 ? SER L 6  VAL L 24 1 ? 19 
HELX_P HELX_P57 57 ASN L 32 ? LEU L 44 ? ASN L 33 LEU L 45 1 ? 13 
HELX_P HELX_P58 58 LEU L 48 ? LYS L 53 ? LEU L 49 LYS L 54 1 ? 6  
HELX_P HELX_P59 59 ASN L 54 ? ASP L 66 ? ASN L 55 ASP L 67 1 ? 13 
HELX_P HELX_P60 60 SER L 74 ? HIS L 94 ? SER L 75 HIS L 95 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? M  CA . CA ? ? ? 1_555 A  ASN 61 OD1 ? ? A CA 1501 A ASN 61   1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc2   metalc ? ? M  CA . CA ? ? ? 1_555 A  GLU 70 OE1 ? ? A CA 1501 A GLU 70   1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc3   metalc ? ? M  CA . CA ? ? ? 1_555 A  GLU 70 OE2 ? ? A CA 1501 A GLU 70   1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc4   metalc ? ? M  CA . CA ? ? ? 1_555 A  ASP 59 OD1 ? ? A CA 1501 A ASP 59   1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc5   metalc ? ? M  CA . CA ? ? ? 1_555 A  ASP 63 OD1 ? ? A CA 1501 A ASP 63   1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc6   metalc ? ? M  CA . CA ? ? ? 1_555 A  ALA 65 O   ? ? A CA 1501 A ALA 65   1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc7   metalc ? ? M  CA . CA ? ? ? 1_555 PA HOH .  O   ? ? A CA 1501 A HOH 2076 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc8   metalc ? ? N  CA . CA ? ? ? 1_555 A  ALA 28 O   ? ? A CA 1502 A ALA 28   1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc9   metalc ? ? N  CA . CA ? ? ? 1_555 PA HOH .  O   ? ? A CA 1502 A HOH 2087 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc10  metalc ? ? N  CA . CA ? ? ? 1_555 A  SER 20 O   ? ? A CA 1502 A SER 20   1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc11  metalc ? ? N  CA . CA ? ? ? 1_555 A  ASN 25 O   ? ? A CA 1502 A ASN 25   1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc12  metalc ? ? N  CA . CA ? ? ? 1_555 A  LYS 23 O   ? ? A CA 1502 A LYS 23   1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc13  metalc ? ? P  CA . CA ? ? ? 1_555 B  ASP 63 OD1 ? ? B CA 2501 B ASP 63   1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc14  metalc ? ? P  CA . CA ? ? ? 1_555 B  ALA 65 O   ? ? B CA 2501 B ALA 65   1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc15  metalc ? ? P  CA . CA ? ? ? 1_555 QA HOH .  O   ? ? B CA 2501 B HOH 2565 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc16  metalc ? ? P  CA . CA ? ? ? 1_555 B  ASP 59 OD1 ? ? B CA 2501 B ASP 59   1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc17  metalc ? ? P  CA . CA ? ? ? 1_555 B  GLU 70 OE1 ? ? B CA 2501 B GLU 70   1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc18  metalc ? ? P  CA . CA ? ? ? 1_555 B  GLU 70 OE2 ? ? B CA 2501 B GLU 70   1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc19  metalc ? ? P  CA . CA ? ? ? 1_555 B  ASN 61 OD1 ? ? B CA 2501 B ASN 61   1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc20  metalc ? ? Q  CA . CA ? ? ? 1_555 B  LYS 23 O   ? ? B CA 2502 B LYS 23   1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc21  metalc ? ? Q  CA . CA ? ? ? 1_555 QA HOH .  O   ? ? B CA 2502 B HOH 2580 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc22  metalc ? ? Q  CA . CA ? ? ? 1_555 B  SER 20 O   ? ? B CA 2502 B SER 20   1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc23  metalc ? ? Q  CA . CA ? ? ? 1_555 B  ASN 25 O   ? ? B CA 2502 B ASN 25   1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc24  metalc ? ? Q  CA . CA ? ? ? 1_555 B  ALA 28 O   ? ? B CA 2502 B ALA 28   1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc25  metalc ? ? S  CA . CA ? ? ? 1_555 RA HOH .  O   ? ? C CA 3501 C HOH 3615 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc26  metalc ? ? S  CA . CA ? ? ? 1_555 C  ASN 68 OD1 ? ? C CA 3501 C ASN 69   1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc27  metalc ? ? S  CA . CA ? ? ? 1_555 C  ASP 66 OD1 ? ? C CA 3501 C ASP 67   1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc28  metalc ? ? S  CA . CA ? ? ? 1_555 C  ASP 70 OD1 ? ? C CA 3501 C ASP 71   1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc29  metalc ? ? S  CA . CA ? ? ? 1_555 C  GLN 72 O   ? ? C CA 3501 C GLN 73   1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc30  metalc ? ? S  CA . CA ? ? ? 1_555 C  GLU 77 OE1 ? ? C CA 3501 C GLU 78   1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc31  metalc ? ? S  CA . CA ? ? ? 1_555 C  GLU 77 OE2 ? ? C CA 3501 C GLU 78   1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc32  metalc ? ? T  CA . CA ? ? ? 1_555 C  HIS 27 O   ? ? C CA 3502 C HIS 28   1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc33  metalc ? ? T  CA . CA ? ? ? 1_555 C  THR 30 O   ? ? C CA 3502 C THR 31   1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc34  metalc ? ? T  CA . CA ? ? ? 1_555 RA HOH .  O   ? ? C CA 3502 C HOH 3614 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc35  metalc ? ? T  CA . CA ? ? ? 1_555 C  LEU 25 O   ? ? C CA 3502 C LEU 26   1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc36  metalc ? ? T  CA . CA ? ? ? 1_555 C  SER 22 O   ? ? C CA 3502 C SER 23   1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc37  metalc ? ? T  CA . CA ? ? ? 1_555 C  GLU 35 OE1 ? ? C CA 3502 C GLU 36   1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc38  metalc ? ? U  CA . CA ? ? ? 1_555 D  ASN 68 OD1 ? ? D CA 4501 D ASN 69   1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc39  metalc ? ? U  CA . CA ? ? ? 1_555 D  GLU 77 OE1 ? ? D CA 4501 D GLU 78   1_555 ? ? ? ? ? ? ? 2.533 ? 
metalc40  metalc ? ? U  CA . CA ? ? ? 1_555 D  GLU 77 OE2 ? ? D CA 4501 D GLU 78   1_555 ? ? ? ? ? ? ? 2.468 ? 
metalc41  metalc ? ? U  CA . CA ? ? ? 1_555 SA HOH .  O   ? ? D CA 4501 D HOH 4579 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc42  metalc ? ? U  CA . CA ? ? ? 1_555 D  ASP 66 OD1 ? ? D CA 4501 D ASP 67   1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc43  metalc ? ? U  CA . CA ? ? ? 1_555 D  ASP 70 OD1 ? ? D CA 4501 D ASP 71   1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc44  metalc ? ? U  CA . CA ? ? ? 1_555 D  GLN 72 O   ? ? D CA 4501 D GLN 73   1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc45  metalc ? ? V  CA . CA ? ? ? 1_555 D  HIS 27 O   ? ? D CA 4502 D HIS 28   1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc46  metalc ? ? V  CA . CA ? ? ? 1_555 D  THR 30 O   ? ? D CA 4502 D THR 31   1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc47  metalc ? ? V  CA . CA ? ? ? 1_555 SA HOH .  O   ? ? D CA 4502 D HOH 4568 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc48  metalc ? ? V  CA . CA ? ? ? 1_555 D  SER 22 O   ? ? D CA 4502 D SER 23   1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc49  metalc ? ? V  CA . CA ? ? ? 1_555 D  LEU 25 O   ? ? D CA 4502 D LEU 26   1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc50  metalc ? ? V  CA . CA ? ? ? 1_555 D  GLU 35 OE1 ? ? D CA 4502 D GLU 36   1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc51  metalc ? ? W  CA . CA ? ? ? 1_555 E  ASN 61 OD1 ? ? E CA 1511 E ASN 61   1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc52  metalc ? ? W  CA . CA ? ? ? 1_555 E  GLU 70 OE2 ? ? E CA 1511 E GLU 70   1_555 ? ? ? ? ? ? ? 2.524 ? 
metalc53  metalc ? ? W  CA . CA ? ? ? 1_555 E  ASP 59 OD1 ? ? E CA 1511 E ASP 59   1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc54  metalc ? ? W  CA . CA ? ? ? 1_555 E  ASP 63 OD1 ? ? E CA 1511 E ASP 63   1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc55  metalc ? ? W  CA . CA ? ? ? 1_555 E  ALA 65 O   ? ? E CA 1511 E ALA 65   1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc56  metalc ? ? W  CA . CA ? ? ? 1_555 E  GLU 70 OE1 ? ? E CA 1511 E GLU 70   1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc57  metalc ? ? W  CA . CA ? ? ? 1_555 TA HOH .  O   ? ? E CA 1511 E HOH 1605 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc58  metalc ? ? X  CA . CA ? ? ? 1_555 E  ALA 28 O   ? ? E CA 1512 E ALA 28   1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc59  metalc ? ? X  CA . CA ? ? ? 1_555 TA HOH .  O   ? ? E CA 1512 E HOH 1604 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc60  metalc ? ? X  CA . CA ? ? ? 1_555 E  LYS 23 O   ? ? E CA 1512 E LYS 23   1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc61  metalc ? ? X  CA . CA ? ? ? 1_555 E  SER 20 O   ? ? E CA 1512 E SER 20   1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc62  metalc ? ? X  CA . CA ? ? ? 1_555 E  ASN 25 O   ? ? E CA 1512 E ASN 25   1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc63  metalc ? ? Y  CA . CA ? ? ? 1_555 F  ASP 59 OD1 ? ? F CA 2511 F ASP 59   1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc64  metalc ? ? Y  CA . CA ? ? ? 1_555 F  ASP 63 OD1 ? ? F CA 2511 F ASP 63   1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc65  metalc ? ? Y  CA . CA ? ? ? 1_555 F  ALA 65 O   ? ? F CA 2511 F ALA 65   1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc66  metalc ? ? Y  CA . CA ? ? ? 1_555 F  GLU 70 OE1 ? ? F CA 2511 F GLU 70   1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc67  metalc ? ? Y  CA . CA ? ? ? 1_555 F  GLU 70 OE2 ? ? F CA 2511 F GLU 70   1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc68  metalc ? ? Y  CA . CA ? ? ? 1_555 F  ASN 61 OD1 ? ? F CA 2511 F ASN 61   1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc69  metalc ? ? Y  CA . CA ? ? ? 1_555 UA HOH .  O   ? ? F CA 2511 F HOH 2578 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc70  metalc ? ? Z  CA . CA ? ? ? 1_555 UA HOH .  O   ? ? F CA 2512 F HOH 2597 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc71  metalc ? ? Z  CA . CA ? ? ? 1_555 F  LYS 23 O   ? ? F CA 2512 F LYS 23   1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc72  metalc ? ? Z  CA . CA ? ? ? 1_555 F  ASN 25 O   ? ? F CA 2512 F ASN 25   1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc73  metalc ? ? Z  CA . CA ? ? ? 1_555 F  SER 20 O   ? ? F CA 2512 F SER 20   1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc74  metalc ? ? Z  CA . CA ? ? ? 1_555 F  ALA 28 O   ? ? F CA 2512 F ALA 28   1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc75  metalc ? ? CA CA . CA ? ? ? 1_555 G  GLN 72 O   ? ? G CA 3511 G GLN 73   1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc76  metalc ? ? CA CA . CA ? ? ? 1_555 G  ASP 70 OD1 ? ? G CA 3511 G ASP 71   1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc77  metalc ? ? CA CA . CA ? ? ? 1_555 VA HOH .  O   ? ? G CA 3511 G HOH 3574 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc78  metalc ? ? CA CA . CA ? ? ? 1_555 G  ASP 66 OD1 ? ? G CA 3511 G ASP 67   1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc79  metalc ? ? CA CA . CA ? ? ? 1_555 G  GLU 77 OE1 ? ? G CA 3511 G GLU 78   1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc80  metalc ? ? CA CA . CA ? ? ? 1_555 G  GLU 77 OE2 ? ? G CA 3511 G GLU 78   1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc81  metalc ? ? CA CA . CA ? ? ? 1_555 G  ASN 68 OD1 ? ? G CA 3511 G ASN 69   1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc82  metalc ? ? DA CA . CA ? ? ? 1_555 G  GLU 35 OE1 ? ? G CA 3512 G GLU 36   1_555 ? ? ? ? ? ? ? 2.790 ? 
metalc83  metalc ? ? DA CA . CA ? ? ? 1_555 VA HOH .  O   ? ? G CA 3512 G HOH 3549 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc84  metalc ? ? DA CA . CA ? ? ? 1_555 G  LEU 25 O   ? ? G CA 3512 G LEU 26   1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc85  metalc ? ? DA CA . CA ? ? ? 1_555 G  SER 22 O   ? ? G CA 3512 G SER 23   1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc86  metalc ? ? DA CA . CA ? ? ? 1_555 G  HIS 27 O   ? ? G CA 3512 G HIS 28   1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc87  metalc ? ? DA CA . CA ? ? ? 1_555 G  THR 30 O   ? ? G CA 3512 G THR 31   1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc88  metalc ? ? EA CA . CA ? ? ? 1_555 H  GLN 72 O   ? ? H CA 4511 H GLN 73   1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc89  metalc ? ? EA CA . CA ? ? ? 1_555 H  GLU 77 OE1 ? ? H CA 4511 H GLU 78   1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc90  metalc ? ? EA CA . CA ? ? ? 1_555 H  GLU 77 OE2 ? ? H CA 4511 H GLU 78   1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc91  metalc ? ? EA CA . CA ? ? ? 1_555 WA HOH .  O   ? ? H CA 4511 H HOH 4569 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc92  metalc ? ? EA CA . CA ? ? ? 1_555 H  ASP 70 OD1 ? ? H CA 4511 H ASP 71   1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc93  metalc ? ? EA CA . CA ? ? ? 1_555 H  ASN 68 OD1 ? ? H CA 4511 H ASN 69   1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc94  metalc ? ? EA CA . CA ? ? ? 1_555 H  ASP 66 OD1 ? ? H CA 4511 H ASP 67   1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc95  metalc ? ? FA CA . CA ? ? ? 1_555 H  SER 22 O   ? ? H CA 4512 H SER 23   1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc96  metalc ? ? FA CA . CA ? ? ? 1_555 H  LEU 25 O   ? ? H CA 4512 H LEU 26   1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc97  metalc ? ? FA CA . CA ? ? ? 1_555 H  THR 30 O   ? ? H CA 4512 H THR 31   1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc98  metalc ? ? FA CA . CA ? ? ? 1_555 H  GLU 35 OE1 ? ? H CA 4512 H GLU 36   1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc99  metalc ? ? FA CA . CA ? ? ? 1_555 WA HOH .  O   ? ? H CA 4512 H HOH 4592 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc100 metalc ? ? FA CA . CA ? ? ? 1_555 H  HIS 27 O   ? ? H CA 4512 H HIS 28   1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc101 metalc ? ? GA CA . CA ? ? ? 1_555 I  ASP 59 OD1 ? ? I CA 1521 I ASP 59   1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc102 metalc ? ? GA CA . CA ? ? ? 1_555 I  ASP 63 OD1 ? ? I CA 1521 I ASP 63   1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc103 metalc ? ? GA CA . CA ? ? ? 1_555 I  GLU 70 OE1 ? ? I CA 1521 I GLU 70   1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc104 metalc ? ? GA CA . CA ? ? ? 1_555 I  ASN 61 OD1 ? ? I CA 1521 I ASN 61   1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc105 metalc ? ? GA CA . CA ? ? ? 1_555 XA HOH .  O   ? ? I CA 1521 I HOH 1598 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc106 metalc ? ? GA CA . CA ? ? ? 1_555 I  GLU 70 OE2 ? ? I CA 1521 I GLU 70   1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc107 metalc ? ? GA CA . CA ? ? ? 1_555 I  ALA 65 O   ? ? I CA 1521 I ALA 65   1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc108 metalc ? ? HA CA . CA ? ? ? 1_555 I  LYS 23 O   ? ? I CA 1522 I LYS 23   1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc109 metalc ? ? HA CA . CA ? ? ? 1_555 I  ASN 25 O   ? ? I CA 1522 I ASN 25   1_555 ? ? ? ? ? ? ? 2.495 ? 
metalc110 metalc ? ? HA CA . CA ? ? ? 1_555 XA HOH .  O   ? ? I CA 1522 I HOH 1596 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc111 metalc ? ? HA CA . CA ? ? ? 1_555 I  ALA 28 O   ? ? I CA 1522 I ALA 28   1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc112 metalc ? ? HA CA . CA ? ? ? 1_555 I  SER 20 O   ? ? I CA 1522 I SER 20   1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc113 metalc ? ? IA CA . CA ? ? ? 1_555 J  ASN 61 OD1 ? ? J CA 2521 J ASN 61   1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc114 metalc ? ? IA CA . CA ? ? ? 1_555 J  GLU 70 OE1 ? ? J CA 2521 J GLU 70   1_555 ? ? ? ? ? ? ? 2.455 ? 
metalc115 metalc ? ? IA CA . CA ? ? ? 1_555 J  GLU 70 OE2 ? ? J CA 2521 J GLU 70   1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc116 metalc ? ? IA CA . CA ? ? ? 1_555 J  ASP 63 OD1 ? ? J CA 2521 J ASP 63   1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc117 metalc ? ? IA CA . CA ? ? ? 1_555 J  ALA 65 O   ? ? J CA 2521 J ALA 65   1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc118 metalc ? ? IA CA . CA ? ? ? 1_555 YA HOH .  O   ? ? J CA 2521 J HOH 2607 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc119 metalc ? ? IA CA . CA ? ? ? 1_555 J  ASP 59 OD1 ? ? J CA 2521 J ASP 59   1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc120 metalc ? ? JA CA . CA ? ? ? 1_555 J  LYS 23 O   ? ? J CA 2522 J LYS 23   1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc121 metalc ? ? JA CA . CA ? ? ? 1_555 J  ASN 25 O   ? ? J CA 2522 J ASN 25   1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc122 metalc ? ? JA CA . CA ? ? ? 1_555 J  ALA 28 O   ? ? J CA 2522 J ALA 28   1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc123 metalc ? ? JA CA . CA ? ? ? 1_555 YA HOH .  O   ? ? J CA 2522 J HOH 2610 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc124 metalc ? ? JA CA . CA ? ? ? 1_555 J  SER 20 O   ? ? J CA 2522 J SER 20   1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc125 metalc ? ? LA CA . CA ? ? ? 1_555 K  ASN 68 OD1 ? ? K CA 3521 K ASN 69   1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc126 metalc ? ? LA CA . CA ? ? ? 1_555 K  ASP 70 OD1 ? ? K CA 3521 K ASP 71   1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc127 metalc ? ? LA CA . CA ? ? ? 1_555 K  GLN 72 O   ? ? K CA 3521 K GLN 73   1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc128 metalc ? ? LA CA . CA ? ? ? 1_555 K  GLU 77 OE1 ? ? K CA 3521 K GLU 78   1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc129 metalc ? ? LA CA . CA ? ? ? 1_555 K  GLU 77 OE2 ? ? K CA 3521 K GLU 78   1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc130 metalc ? ? LA CA . CA ? ? ? 1_555 ZA HOH .  O   ? ? K CA 3521 K HOH 3595 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc131 metalc ? ? LA CA . CA ? ? ? 1_555 K  ASP 66 OD1 ? ? K CA 3521 K ASP 67   1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc132 metalc ? ? MA CA . CA ? ? ? 1_555 K  THR 30 O   ? ? K CA 3522 K THR 31   1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc133 metalc ? ? MA CA . CA ? ? ? 1_555 K  SER 22 O   ? ? K CA 3522 K SER 23   1_555 ? ? ? ? ? ? ? 2.494 ? 
metalc134 metalc ? ? MA CA . CA ? ? ? 1_555 K  LEU 25 O   ? ? K CA 3522 K LEU 26   1_555 ? ? ? ? ? ? ? 2.576 ? 
metalc135 metalc ? ? MA CA . CA ? ? ? 1_555 K  GLU 35 OE1 ? ? K CA 3522 K GLU 36   1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc136 metalc ? ? MA CA . CA ? ? ? 1_555 ZA HOH .  O   ? ? K CA 3522 K HOH 3596 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc137 metalc ? ? MA CA . CA ? ? ? 1_555 K  HIS 27 O   ? ? K CA 3522 K HIS 28   1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc138 metalc ? ? NA CA . CA ? ? ? 1_555 L  ASP 66 OD1 ? ? L CA 4521 L ASP 67   1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc139 metalc ? ? NA CA . CA ? ? ? 1_555 L  ASN 68 OD1 ? ? L CA 4521 L ASN 69   1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc140 metalc ? ? NA CA . CA ? ? ? 1_555 L  ASP 70 OD1 ? ? L CA 4521 L ASP 71   1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc141 metalc ? ? NA CA . CA ? ? ? 1_555 L  GLN 72 O   ? ? L CA 4521 L GLN 73   1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc142 metalc ? ? NA CA . CA ? ? ? 1_555 L  GLU 77 OE1 ? ? L CA 4521 L GLU 78   1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc143 metalc ? ? NA CA . CA ? ? ? 1_555 L  GLU 77 OE2 ? ? L CA 4521 L GLU 78   1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc144 metalc ? ? NA CA . CA ? ? ? 1_555 AB HOH .  O   ? ? L CA 4521 L HOH 4599 1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc145 metalc ? ? OA CA . CA ? ? ? 1_555 L  THR 30 O   ? ? L CA 4522 L THR 31   1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc146 metalc ? ? OA CA . CA ? ? ? 1_555 L  SER 22 O   ? ? L CA 4522 L SER 23   1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc147 metalc ? ? OA CA . CA ? ? ? 1_555 L  LEU 25 O   ? ? L CA 4522 L LEU 26   1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc148 metalc ? ? OA CA . CA ? ? ? 1_555 L  HIS 27 O   ? ? L CA 4522 L HIS 28   1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc149 metalc ? ? OA CA . CA ? ? ? 1_555 L  GLU 35 OE1 ? ? L CA 4522 L GLU 36   1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc150 metalc ? ? OA CA . CA ? ? ? 1_555 AB HOH .  O   ? ? L CA 4522 L HOH 4595 1_555 ? ? ? ? ? ? ? 2.463 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU D 31 ? ASN D 32 ? LEU D 32 ASN D 33 
A 2 GLN D 72 ? LEU D 73 ? GLN D 73 LEU D 74 
B 1 THR G 30 ? LEU G 31 ? THR G 31 LEU G 32 
B 2 LEU G 73 ? SER G 74 ? LEU G 74 SER G 75 
C 1 THR H 30 ? LEU H 31 ? THR H 31 LEU H 32 
C 2 LEU H 73 ? SER H 74 ? LEU H 74 SER H 75 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU D 31 ? N LEU D 32 O LEU D 73 ? O LEU D 74 
B 1 2 N LEU G 31 ? N LEU G 32 O LEU G 73 ? O LEU G 74 
C 1 2 N LEU H 31 ? N LEU H 32 O LEU H 73 ? O LEU H 74 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1501'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1502'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 2501'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 2502'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 3501'  
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 3502'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 4501'  
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 4502'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 1511'  
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 1512'  
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 2511'  
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 2512'  
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA G 3511'  
BC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA G 3512'  
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA H 4511'  
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA H 4512'  
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA I 1521'  
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA I 1522'  
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA J 2521'  
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA J 2522'  
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA K 3521'  
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA K 3522'  
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA L 4521'  
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA L 4522'  
CC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL J 2007'  
CC8 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE FLC F 2008' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ASP A  59 ? ASP A 59   . ? 1_555 ? 
2   AC1 6  ASN A  61 ? ASN A 61   . ? 1_555 ? 
3   AC1 6  ASP A  63 ? ASP A 63   . ? 1_555 ? 
4   AC1 6  ALA A  65 ? ALA A 65   . ? 1_555 ? 
5   AC1 6  GLU A  70 ? GLU A 70   . ? 1_555 ? 
6   AC1 6  HOH PA .  ? HOH A 2076 . ? 1_555 ? 
7   AC2 6  SER A  20 ? SER A 20   . ? 1_555 ? 
8   AC2 6  LYS A  23 ? LYS A 23   . ? 1_555 ? 
9   AC2 6  ASN A  25 ? ASN A 25   . ? 1_555 ? 
10  AC2 6  ALA A  28 ? ALA A 28   . ? 1_555 ? 
11  AC2 6  TYR A  30 ? TYR A 30   . ? 1_555 ? 
12  AC2 6  HOH PA .  ? HOH A 2087 . ? 1_555 ? 
13  AC3 6  ASP B  59 ? ASP B 59   . ? 1_555 ? 
14  AC3 6  ASN B  61 ? ASN B 61   . ? 1_555 ? 
15  AC3 6  ASP B  63 ? ASP B 63   . ? 1_555 ? 
16  AC3 6  ALA B  65 ? ALA B 65   . ? 1_555 ? 
17  AC3 6  GLU B  70 ? GLU B 70   . ? 1_555 ? 
18  AC3 6  HOH QA .  ? HOH B 2565 . ? 1_555 ? 
19  AC4 6  SER B  20 ? SER B 20   . ? 1_555 ? 
20  AC4 6  LYS B  23 ? LYS B 23   . ? 1_555 ? 
21  AC4 6  ASN B  25 ? ASN B 25   . ? 1_555 ? 
22  AC4 6  ALA B  28 ? ALA B 28   . ? 1_555 ? 
23  AC4 6  TYR B  30 ? TYR B 30   . ? 1_555 ? 
24  AC4 6  HOH QA .  ? HOH B 2580 . ? 1_555 ? 
25  AC5 6  ASP C  66 ? ASP C 67   . ? 1_555 ? 
26  AC5 6  ASN C  68 ? ASN C 69   . ? 1_555 ? 
27  AC5 6  ASP C  70 ? ASP C 71   . ? 1_555 ? 
28  AC5 6  GLN C  72 ? GLN C 73   . ? 1_555 ? 
29  AC5 6  GLU C  77 ? GLU C 78   . ? 1_555 ? 
30  AC5 6  HOH RA .  ? HOH C 3615 . ? 1_555 ? 
31  AC6 6  SER C  22 ? SER C 23   . ? 1_555 ? 
32  AC6 6  LEU C  25 ? LEU C 26   . ? 1_555 ? 
33  AC6 6  HIS C  27 ? HIS C 28   . ? 1_555 ? 
34  AC6 6  THR C  30 ? THR C 31   . ? 1_555 ? 
35  AC6 6  GLU C  35 ? GLU C 36   . ? 1_555 ? 
36  AC6 6  HOH RA .  ? HOH C 3614 . ? 1_555 ? 
37  AC7 6  ASP D  66 ? ASP D 67   . ? 1_555 ? 
38  AC7 6  ASN D  68 ? ASN D 69   . ? 1_555 ? 
39  AC7 6  ASP D  70 ? ASP D 71   . ? 1_555 ? 
40  AC7 6  GLN D  72 ? GLN D 73   . ? 1_555 ? 
41  AC7 6  GLU D  77 ? GLU D 78   . ? 1_555 ? 
42  AC7 6  HOH SA .  ? HOH D 4579 . ? 1_555 ? 
43  AC8 6  SER D  22 ? SER D 23   . ? 1_555 ? 
44  AC8 6  LEU D  25 ? LEU D 26   . ? 1_555 ? 
45  AC8 6  HIS D  27 ? HIS D 28   . ? 1_555 ? 
46  AC8 6  THR D  30 ? THR D 31   . ? 1_555 ? 
47  AC8 6  GLU D  35 ? GLU D 36   . ? 1_555 ? 
48  AC8 6  HOH SA .  ? HOH D 4568 . ? 1_555 ? 
49  AC9 6  ASP E  59 ? ASP E 59   . ? 1_555 ? 
50  AC9 6  ASN E  61 ? ASN E 61   . ? 1_555 ? 
51  AC9 6  ASP E  63 ? ASP E 63   . ? 1_555 ? 
52  AC9 6  ALA E  65 ? ALA E 65   . ? 1_555 ? 
53  AC9 6  GLU E  70 ? GLU E 70   . ? 1_555 ? 
54  AC9 6  HOH TA .  ? HOH E 1605 . ? 1_555 ? 
55  BC1 6  SER E  20 ? SER E 20   . ? 1_555 ? 
56  BC1 6  LYS E  23 ? LYS E 23   . ? 1_555 ? 
57  BC1 6  ASN E  25 ? ASN E 25   . ? 1_555 ? 
58  BC1 6  ALA E  28 ? ALA E 28   . ? 1_555 ? 
59  BC1 6  TYR E  30 ? TYR E 30   . ? 1_555 ? 
60  BC1 6  HOH TA .  ? HOH E 1604 . ? 1_555 ? 
61  BC2 6  ASP F  59 ? ASP F 59   . ? 1_555 ? 
62  BC2 6  ASN F  61 ? ASN F 61   . ? 1_555 ? 
63  BC2 6  ASP F  63 ? ASP F 63   . ? 1_555 ? 
64  BC2 6  ALA F  65 ? ALA F 65   . ? 1_555 ? 
65  BC2 6  GLU F  70 ? GLU F 70   . ? 1_555 ? 
66  BC2 6  HOH UA .  ? HOH F 2578 . ? 1_555 ? 
67  BC3 6  SER F  20 ? SER F 20   . ? 1_555 ? 
68  BC3 6  LYS F  23 ? LYS F 23   . ? 1_555 ? 
69  BC3 6  ASN F  25 ? ASN F 25   . ? 1_555 ? 
70  BC3 6  ALA F  28 ? ALA F 28   . ? 1_555 ? 
71  BC3 6  TYR F  30 ? TYR F 30   . ? 1_555 ? 
72  BC3 6  HOH UA .  ? HOH F 2597 . ? 1_555 ? 
73  BC4 6  ASP G  66 ? ASP G 67   . ? 1_555 ? 
74  BC4 6  ASN G  68 ? ASN G 69   . ? 1_555 ? 
75  BC4 6  ASP G  70 ? ASP G 71   . ? 1_555 ? 
76  BC4 6  GLN G  72 ? GLN G 73   . ? 1_555 ? 
77  BC4 6  GLU G  77 ? GLU G 78   . ? 1_555 ? 
78  BC4 6  HOH VA .  ? HOH G 3574 . ? 1_555 ? 
79  BC5 6  SER G  22 ? SER G 23   . ? 1_555 ? 
80  BC5 6  LEU G  25 ? LEU G 26   . ? 1_555 ? 
81  BC5 6  HIS G  27 ? HIS G 28   . ? 1_555 ? 
82  BC5 6  THR G  30 ? THR G 31   . ? 1_555 ? 
83  BC5 6  GLU G  35 ? GLU G 36   . ? 1_555 ? 
84  BC5 6  HOH VA .  ? HOH G 3549 . ? 1_555 ? 
85  BC6 6  ASP H  66 ? ASP H 67   . ? 1_555 ? 
86  BC6 6  ASN H  68 ? ASN H 69   . ? 1_555 ? 
87  BC6 6  ASP H  70 ? ASP H 71   . ? 1_555 ? 
88  BC6 6  GLN H  72 ? GLN H 73   . ? 1_555 ? 
89  BC6 6  GLU H  77 ? GLU H 78   . ? 1_555 ? 
90  BC6 6  HOH WA .  ? HOH H 4569 . ? 1_555 ? 
91  BC7 6  SER H  22 ? SER H 23   . ? 1_555 ? 
92  BC7 6  LEU H  25 ? LEU H 26   . ? 1_555 ? 
93  BC7 6  HIS H  27 ? HIS H 28   . ? 1_555 ? 
94  BC7 6  THR H  30 ? THR H 31   . ? 1_555 ? 
95  BC7 6  GLU H  35 ? GLU H 36   . ? 1_555 ? 
96  BC7 6  HOH WA .  ? HOH H 4592 . ? 1_555 ? 
97  BC8 6  ASP I  59 ? ASP I 59   . ? 1_555 ? 
98  BC8 6  ASN I  61 ? ASN I 61   . ? 1_555 ? 
99  BC8 6  ASP I  63 ? ASP I 63   . ? 1_555 ? 
100 BC8 6  ALA I  65 ? ALA I 65   . ? 1_555 ? 
101 BC8 6  GLU I  70 ? GLU I 70   . ? 1_555 ? 
102 BC8 6  HOH XA .  ? HOH I 1598 . ? 1_555 ? 
103 BC9 6  SER I  20 ? SER I 20   . ? 1_555 ? 
104 BC9 6  LYS I  23 ? LYS I 23   . ? 1_555 ? 
105 BC9 6  ASN I  25 ? ASN I 25   . ? 1_555 ? 
106 BC9 6  ALA I  28 ? ALA I 28   . ? 1_555 ? 
107 BC9 6  TYR I  30 ? TYR I 30   . ? 1_555 ? 
108 BC9 6  HOH XA .  ? HOH I 1596 . ? 1_555 ? 
109 CC1 6  ASP J  59 ? ASP J 59   . ? 1_555 ? 
110 CC1 6  ASN J  61 ? ASN J 61   . ? 1_555 ? 
111 CC1 6  ASP J  63 ? ASP J 63   . ? 1_555 ? 
112 CC1 6  ALA J  65 ? ALA J 65   . ? 1_555 ? 
113 CC1 6  GLU J  70 ? GLU J 70   . ? 1_555 ? 
114 CC1 6  HOH YA .  ? HOH J 2607 . ? 1_555 ? 
115 CC2 6  SER J  20 ? SER J 20   . ? 1_555 ? 
116 CC2 6  LYS J  23 ? LYS J 23   . ? 1_555 ? 
117 CC2 6  ASN J  25 ? ASN J 25   . ? 1_555 ? 
118 CC2 6  ALA J  28 ? ALA J 28   . ? 1_555 ? 
119 CC2 6  TYR J  30 ? TYR J 30   . ? 1_555 ? 
120 CC2 6  HOH YA .  ? HOH J 2610 . ? 1_555 ? 
121 CC3 6  ASP K  66 ? ASP K 67   . ? 1_555 ? 
122 CC3 6  ASN K  68 ? ASN K 69   . ? 1_555 ? 
123 CC3 6  ASP K  70 ? ASP K 71   . ? 1_555 ? 
124 CC3 6  GLN K  72 ? GLN K 73   . ? 1_555 ? 
125 CC3 6  GLU K  77 ? GLU K 78   . ? 1_555 ? 
126 CC3 6  HOH ZA .  ? HOH K 3595 . ? 1_555 ? 
127 CC4 6  SER K  22 ? SER K 23   . ? 1_555 ? 
128 CC4 6  LEU K  25 ? LEU K 26   . ? 1_555 ? 
129 CC4 6  HIS K  27 ? HIS K 28   . ? 1_555 ? 
130 CC4 6  THR K  30 ? THR K 31   . ? 1_555 ? 
131 CC4 6  GLU K  35 ? GLU K 36   . ? 1_555 ? 
132 CC4 6  HOH ZA .  ? HOH K 3596 . ? 1_555 ? 
133 CC5 6  ASP L  66 ? ASP L 67   . ? 1_555 ? 
134 CC5 6  ASN L  68 ? ASN L 69   . ? 1_555 ? 
135 CC5 6  ASP L  70 ? ASP L 71   . ? 1_555 ? 
136 CC5 6  GLN L  72 ? GLN L 73   . ? 1_555 ? 
137 CC5 6  GLU L  77 ? GLU L 78   . ? 1_555 ? 
138 CC5 6  HOH AB .  ? HOH L 4599 . ? 1_555 ? 
139 CC6 6  SER L  22 ? SER L 23   . ? 1_555 ? 
140 CC6 6  LEU L  25 ? LEU L 26   . ? 1_555 ? 
141 CC6 6  HIS L  27 ? HIS L 28   . ? 1_555 ? 
142 CC6 6  THR L  30 ? THR L 31   . ? 1_555 ? 
143 CC6 6  GLU L  35 ? GLU L 36   . ? 1_555 ? 
144 CC6 6  HOH AB .  ? HOH L 4595 . ? 1_555 ? 
145 CC7 1  HOH YA .  ? HOH J 2528 . ? 1_555 ? 
146 CC8 11 THR F  3  ? THR F 3    . ? 1_555 ? 
147 CC8 11 GLU F  4  ? GLU F 4    . ? 1_555 ? 
148 CC8 11 HOH UA .  ? HOH F 2593 . ? 1_555 ? 
149 CC8 11 TYR H  21 ? TYR H 22   . ? 1_555 ? 
150 CC8 11 ASP H  43 ? ASP H 44   . ? 1_555 ? 
151 CC8 11 HOH WA .  ? HOH H 4558 . ? 1_555 ? 
152 CC8 11 THR J  3  ? THR J 3    . ? 1_555 ? 
153 CC8 11 GLU J  4  ? GLU J 4    . ? 1_555 ? 
154 CC8 11 LYS L  42 ? LYS L 43   . ? 1_555 ? 
155 CC8 11 ASP L  43 ? ASP L 44   . ? 1_555 ? 
156 CC8 11 HOH AB .  ? HOH L 4605 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XK4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XK4 
_atom_sites.fract_transf_matrix[1][1]   0.020615 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001782 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012707 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005658 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A  1 1  ? 33.642  67.954  153.748 1.00 44.63 ? 1    MET A N   1 
ATOM   2    C  CA  . MET A  1 1  ? 32.170  68.114  153.904 1.00 44.24 ? 1    MET A CA  1 
ATOM   3    C  C   . MET A  1 1  ? 31.461  66.772  153.894 1.00 37.87 ? 1    MET A C   1 
ATOM   4    O  O   . MET A  1 1  ? 31.348  66.153  152.836 1.00 38.19 ? 1    MET A O   1 
ATOM   5    C  CB  . MET A  1 1  ? 31.594  68.931  152.754 1.00 46.43 ? 1    MET A CB  1 
ATOM   6    C  CG  . MET A  1 1  ? 31.261  70.357  153.110 1.00 50.21 ? 1    MET A CG  1 
ATOM   7    S  SD  . MET A  1 1  ? 29.985  71.043  152.035 1.00 52.93 ? 1    MET A SD  1 
ATOM   8    C  CE  . MET A  1 1  ? 30.527  70.611  150.372 1.00 52.35 ? 1    MET A CE  1 
ATOM   9    N  N   . LEU A  1 2  ? 30.974  66.343  155.051 1.00 30.48 ? 2    LEU A N   1 
ATOM   10   C  CA  . LEU A  1 2  ? 30.083  65.191  155.132 1.00 26.28 ? 2    LEU A CA  1 
ATOM   11   C  C   . LEU A  1 2  ? 28.748  65.520  154.465 1.00 23.07 ? 2    LEU A C   1 
ATOM   12   O  O   . LEU A  1 2  ? 28.295  66.663  154.520 1.00 21.32 ? 2    LEU A O   1 
ATOM   13   C  CB  . LEU A  1 2  ? 29.869  64.782  156.595 1.00 25.96 ? 2    LEU A CB  1 
ATOM   14   C  CG  . LEU A  1 2  ? 30.712  63.639  157.178 1.00 26.87 ? 2    LEU A CG  1 
ATOM   15   C  CD1 . LEU A  1 2  ? 32.035  63.402  156.479 1.00 27.02 ? 2    LEU A CD1 1 
ATOM   16   C  CD2 . LEU A  1 2  ? 30.848  63.689  158.707 1.00 26.44 ? 2    LEU A CD2 1 
ATOM   17   N  N   . THR A  1 3  ? 28.123  64.537  153.814 1.00 19.10 ? 3    THR A N   1 
ATOM   18   C  CA  . THR A  1 3  ? 26.821  64.759  153.230 1.00 18.49 ? 3    THR A CA  1 
ATOM   19   C  C   . THR A  1 3  ? 25.827  64.804  154.371 1.00 17.23 ? 3    THR A C   1 
ATOM   20   O  O   . THR A  1 3  ? 26.130  64.419  155.520 1.00 16.08 ? 3    THR A O   1 
ATOM   21   C  CB  . THR A  1 3  ? 26.396  63.624  152.260 1.00 18.38 ? 3    THR A CB  1 
ATOM   22   O  OG1 . THR A  1 3  ? 26.232  62.382  152.996 1.00 16.13 ? 3    THR A OG1 1 
ATOM   23   C  CG2 . THR A  1 3  ? 27.522  63.324  151.274 1.00 19.32 ? 3    THR A CG2 1 
ATOM   24   N  N   . GLU A  1 4  ? 24.604  65.180  154.035 1.00 17.06 ? 4    GLU A N   1 
ATOM   25   C  CA  . GLU A  1 4  ? 23.558  65.217  155.056 1.00 17.53 ? 4    GLU A CA  1 
ATOM   26   C  C   . GLU A  1 4  ? 23.175  63.818  155.595 1.00 15.62 ? 4    GLU A C   1 
ATOM   27   O  O   . GLU A  1 4  ? 22.880  63.646  156.786 1.00 15.93 ? 4    GLU A O   1 
ATOM   28   C  CB  . GLU A  1 4  ? 22.316  65.909  154.504 1.00 20.67 ? 4    GLU A CB  1 
ATOM   29   C  CG  . GLU A  1 4  ? 22.483  67.409  154.380 1.00 22.18 ? 4    GLU A CG  1 
ATOM   30   C  CD  . GLU A  1 4  ? 22.841  68.077  155.684 1.00 24.50 ? 4    GLU A CD  1 
ATOM   31   O  OE1 . GLU A  1 4  ? 23.965  68.611  155.761 1.00 26.57 ? 4    GLU A OE1 1 
ATOM   32   O  OE2 . GLU A  1 4  ? 22.026  68.066  156.639 1.00 24.26 ? 4    GLU A OE2 1 
ATOM   33   N  N   . LEU A  1 5  ? 23.152  62.826  154.711 1.00 15.42 ? 5    LEU A N   1 
ATOM   34   C  CA  . LEU A  1 5  ? 22.961  61.420  155.122 1.00 16.66 ? 5    LEU A CA  1 
ATOM   35   C  C   . LEU A  1 5  ? 24.064  60.946  156.099 1.00 16.64 ? 5    LEU A C   1 
ATOM   36   O  O   . LEU A  1 5  ? 23.796  60.315  157.132 1.00 15.72 ? 5    LEU A O   1 
ATOM   37   C  CB  . LEU A  1 5  ? 23.027  60.530  153.882 1.00 17.52 ? 5    LEU A CB  1 
ATOM   38   C  CG  . LEU A  1 5  ? 22.223  59.220  153.833 1.00 23.12 ? 5    LEU A CG  1 
ATOM   39   C  CD1 . LEU A  1 5  ? 22.801  58.072  152.942 1.00 17.53 ? 5    LEU A CD1 1 
ATOM   40   C  CD2 . LEU A  1 5  ? 21.691  58.786  155.116 1.00 18.77 ? 5    LEU A CD2 1 
ATOM   41   N  N   . GLU A  1 6  ? 25.316  61.210  155.737 1.00 17.05 ? 6    GLU A N   1 
ATOM   42   C  CA  . GLU A  1 6  ? 26.446  60.885  156.629 1.00 17.08 ? 6    GLU A CA  1 
ATOM   43   C  C   . GLU A  1 6  ? 26.356  61.559  158.006 1.00 17.98 ? 6    GLU A C   1 
ATOM   44   O  O   . GLU A  1 6  ? 26.560  60.903  159.019 1.00 18.26 ? 6    GLU A O   1 
ATOM   45   C  CB  . GLU A  1 6  ? 27.777  61.206  155.942 1.00 17.18 ? 6    GLU A CB  1 
ATOM   46   C  CG  . GLU A  1 6  ? 28.061  60.209  154.820 1.00 17.58 ? 6    GLU A CG  1 
ATOM   47   C  CD  . GLU A  1 6  ? 29.124  60.675  153.850 1.00 21.06 ? 6    GLU A CD  1 
ATOM   48   O  OE1 . GLU A  1 6  ? 29.562  59.833  153.031 1.00 22.90 ? 6    GLU A OE1 1 
ATOM   49   O  OE2 . GLU A  1 6  ? 29.538  61.868  153.906 1.00 22.14 ? 6    GLU A OE2 1 
ATOM   50   N  N   . LYS A  1 7  ? 26.015  62.845  158.049 1.00 18.18 ? 7    LYS A N   1 
ATOM   51   C  CA  . LYS A  1 7  ? 25.791  63.561  159.319 1.00 19.04 ? 7    LYS A CA  1 
ATOM   52   C  C   . LYS A  1 7  ? 24.645  62.965  160.127 1.00 17.79 ? 7    LYS A C   1 
ATOM   53   O  O   . LYS A  1 7  ? 24.720  62.875  161.350 1.00 17.12 ? 7    LYS A O   1 
ATOM   54   C  CB  . LYS A  1 7  ? 25.536  65.050  159.017 1.00 20.95 ? 7    LYS A CB  1 
ATOM   55   C  CG  . LYS A  1 7  ? 26.833  65.764  158.616 1.00 24.50 ? 7    LYS A CG  1 
ATOM   56   C  CD  . LYS A  1 7  ? 26.628  67.126  157.974 1.00 29.60 ? 7    LYS A CD  1 
ATOM   57   C  CE  . LYS A  1 7  ? 25.754  68.031  158.791 1.00 33.15 ? 7    LYS A CE  1 
ATOM   58   N  NZ  . LYS A  1 7  ? 25.598  69.370  158.110 1.00 37.83 ? 7    LYS A NZ  1 
ATOM   59   N  N   . ALA A  1 8  ? 23.619  62.487  159.430 1.00 13.40 ? 8    ALA A N   1 
ATOM   60   C  CA  . ALA A  1 8  ? 22.501  61.819  160.091 1.00 13.96 ? 8    ALA A CA  1 
ATOM   61   C  C   . ALA A  1 8  ? 23.003  60.539  160.779 1.00 17.38 ? 8    ALA A C   1 
ATOM   62   O  O   . ALA A  1 8  ? 22.677  60.300  161.939 1.00 17.38 ? 8    ALA A O   1 
ATOM   63   C  CB  . ALA A  1 8  ? 21.402  61.518  159.070 1.00 13.48 ? 8    ALA A CB  1 
ATOM   64   N  N   . LEU A  1 9  ? 23.808  59.728  160.088 1.00 16.87 ? 9    LEU A N   1 
ATOM   65   C  CA  . LEU A  1 9  ? 24.371  58.536  160.711 1.00 17.05 ? 9    LEU A CA  1 
ATOM   66   C  C   . LEU A  1 9  ? 25.264  58.856  161.916 1.00 17.64 ? 9    LEU A C   1 
ATOM   67   O  O   . LEU A  1 9  ? 25.143  58.222  162.954 1.00 17.59 ? 9    LEU A O   1 
ATOM   68   C  CB  . LEU A  1 9  ? 25.127  57.673  159.684 1.00 16.10 ? 9    LEU A CB  1 
ATOM   69   C  CG  . LEU A  1 9  ? 24.250  57.259  158.481 1.00 18.56 ? 9    LEU A CG  1 
ATOM   70   C  CD1 . LEU A  1 9  ? 25.092  56.430  157.519 1.00 19.93 ? 9    LEU A CD1 1 
ATOM   71   C  CD2 . LEU A  1 9  ? 23.026  56.524  159.019 1.00 18.82 ? 9    LEU A CD2 1 
ATOM   72   N  N   . ASN A  1 10 ? 26.151  59.844  161.798 1.00 18.28 ? 10   ASN A N   1 
ATOM   73   C  CA  . ASN A  1 10 ? 26.952  60.259  162.963 1.00 18.41 ? 10   ASN A CA  1 
ATOM   74   C  C   . ASN A  1 10 ? 26.099  60.756  164.134 1.00 20.03 ? 10   ASN A C   1 
ATOM   75   O  O   . ASN A  1 10 ? 26.411  60.503  165.302 1.00 19.79 ? 10   ASN A O   1 
ATOM   76   C  CB  . ASN A  1 10 ? 27.962  61.334  162.552 1.00 20.90 ? 10   ASN A CB  1 
ATOM   77   C  CG  . ASN A  1 10 ? 29.151  60.776  161.774 1.00 22.47 ? 10   ASN A CG  1 
ATOM   78   O  OD1 . ASN A  1 10 ? 29.409  59.563  161.743 1.00 24.25 ? 10   ASN A OD1 1 
ATOM   79   N  ND2 . ASN A  1 10 ? 29.870  61.670  161.113 1.00 23.04 ? 10   ASN A ND2 1 
ATOM   80   N  N   . SER A  1 11 ? 25.000  61.429  163.824 1.00 16.23 ? 11   SER A N   1 
ATOM   81   C  CA  . SER A  1 11 ? 24.118  61.976  164.850 1.00 16.25 ? 11   SER A CA  1 
ATOM   82   C  C   . SER A  1 11 ? 23.485  60.832  165.629 1.00 16.16 ? 11   SER A C   1 
ATOM   83   O  O   . SER A  1 11 ? 23.198  60.992  166.817 1.00 16.46 ? 11   SER A O   1 
ATOM   84   C  CB  . SER A  1 11 ? 23.040  62.862  164.212 1.00 17.48 ? 11   SER A CB  1 
ATOM   85   O  OG  . SER A  1 11 ? 22.083  63.309  165.173 1.00 15.58 ? 11   SER A OG  1 
ATOM   86   N  N   . ILE A  1 12 ? 23.254  59.697  164.980 1.00 15.16 ? 12   ILE A N   1 
ATOM   87   C  CA  . ILE A  1 12 ? 22.700  58.533  165.721 1.00 15.30 ? 12   ILE A CA  1 
ATOM   88   C  C   . ILE A  1 12 ? 23.648  58.130  166.859 1.00 16.07 ? 12   ILE A C   1 
ATOM   89   O  O   . ILE A  1 12 ? 23.202  57.748  167.938 1.00 16.19 ? 12   ILE A O   1 
ATOM   90   C  CB  . ILE A  1 12 ? 22.353  57.341  164.799 1.00 17.92 ? 12   ILE A CB  1 
ATOM   91   C  CG1 . ILE A  1 12 ? 21.160  57.740  163.913 1.00 16.97 ? 12   ILE A CG1 1 
ATOM   92   C  CG2 . ILE A  1 12 ? 22.049  56.063  165.659 1.00 17.88 ? 12   ILE A CG2 1 
ATOM   93   C  CD1 . ILE A  1 12 ? 20.987  56.995  162.576 1.00 20.17 ? 12   ILE A CD1 1 
ATOM   94   N  N   . ILE A  1 13 ? 24.953  58.214  166.619 1.00 16.71 ? 13   ILE A N   1 
ATOM   95   C  CA  . ILE A  1 13 ? 25.925  57.945  167.665 1.00 17.13 ? 13   ILE A CA  1 
ATOM   96   C  C   . ILE A  1 13 ? 25.825  58.969  168.772 1.00 17.31 ? 13   ILE A C   1 
ATOM   97   O  O   . ILE A  1 13 ? 25.873  58.607  169.942 1.00 14.41 ? 13   ILE A O   1 
ATOM   98   C  CB  . ILE A  1 13 ? 27.378  57.920  167.100 1.00 15.83 ? 13   ILE A CB  1 
ATOM   99   C  CG1 . ILE A  1 13 ? 27.540  56.883  165.985 1.00 19.43 ? 13   ILE A CG1 1 
ATOM   100  C  CG2 . ILE A  1 13 ? 28.354  57.633  168.239 1.00 18.34 ? 13   ILE A CG2 1 
ATOM   101  C  CD1 . ILE A  1 13 ? 28.800  57.111  165.141 1.00 19.66 ? 13   ILE A CD1 1 
ATOM   102  N  N   . ASP A  1 14 ? 25.739  60.253  168.426 1.00 16.36 ? 14   ASP A N   1 
ATOM   103  C  CA  . ASP A  1 14 ? 25.527  61.301  169.438 1.00 16.47 ? 14   ASP A CA  1 
ATOM   104  C  C   . ASP A  1 14 ? 24.300  61.070  170.327 1.00 16.92 ? 14   ASP A C   1 
ATOM   105  O  O   . ASP A  1 14 ? 24.320  61.345  171.538 1.00 15.26 ? 14   ASP A O   1 
ATOM   106  C  CB  . ASP A  1 14 ? 25.357  62.661  168.766 1.00 18.09 ? 14   ASP A CB  1 
ATOM   107  C  CG  . ASP A  1 14 ? 26.608  63.121  168.078 1.00 24.10 ? 14   ASP A CG  1 
ATOM   108  O  OD1 . ASP A  1 14 ? 27.701  62.544  168.346 1.00 24.40 ? 14   ASP A OD1 1 
ATOM   109  O  OD2 . ASP A  1 14 ? 26.603  64.069  167.270 1.00 27.44 ? 14   ASP A OD2 1 
ATOM   110  N  N   . VAL A  1 15 ? 23.209  60.624  169.727 1.00 16.72 ? 15   VAL A N   1 
ATOM   111  C  CA  . VAL A  1 15 ? 22.003  60.350  170.505 1.00 17.81 ? 15   VAL A CA  1 
ATOM   112  C  C   . VAL A  1 15 ? 22.265  59.244  171.529 1.00 17.77 ? 15   VAL A C   1 
ATOM   113  O  O   . VAL A  1 15 ? 21.886  59.381  172.679 1.00 18.49 ? 15   VAL A O   1 
ATOM   114  C  CB  . VAL A  1 15 ? 20.814  59.948  169.636 1.00 19.06 ? 15   VAL A CB  1 
ATOM   115  C  CG1 . VAL A  1 15 ? 19.701  59.352  170.505 1.00 19.10 ? 15   VAL A CG1 1 
ATOM   116  C  CG2 . VAL A  1 15 ? 20.282  61.175  168.854 1.00 18.39 ? 15   VAL A CG2 1 
ATOM   117  N  N   . TYR A  1 16 ? 22.932  58.172  171.120 1.00 15.14 ? 16   TYR A N   1 
ATOM   118  C  CA  . TYR A  1 16 ? 23.283  57.129  172.083 1.00 14.70 ? 16   TYR A CA  1 
ATOM   119  C  C   . TYR A  1 16 ? 24.102  57.748  173.244 1.00 16.75 ? 16   TYR A C   1 
ATOM   120  O  O   . TYR A  1 16 ? 23.858  57.470  174.411 1.00 14.26 ? 16   TYR A O   1 
ATOM   121  C  CB  . TYR A  1 16 ? 24.097  56.021  171.387 1.00 15.21 ? 16   TYR A CB  1 
ATOM   122  C  CG  . TYR A  1 16 ? 24.505  54.934  172.374 1.00 13.79 ? 16   TYR A CG  1 
ATOM   123  C  CD1 . TYR A  1 16 ? 23.565  54.033  172.861 1.00 15.11 ? 16   TYR A CD1 1 
ATOM   124  C  CD2 . TYR A  1 16 ? 25.825  54.795  172.809 1.00 15.98 ? 16   TYR A CD2 1 
ATOM   125  C  CE1 . TYR A  1 16 ? 23.936  53.007  173.763 1.00 15.34 ? 16   TYR A CE1 1 
ATOM   126  C  CE2 . TYR A  1 16 ? 26.195  53.817  173.724 1.00 15.20 ? 16   TYR A CE2 1 
ATOM   127  C  CZ  . TYR A  1 16 ? 25.249  52.932  174.192 1.00 16.26 ? 16   TYR A CZ  1 
ATOM   128  O  OH  . TYR A  1 16 ? 25.616  51.982  175.129 1.00 15.43 ? 16   TYR A OH  1 
ATOM   129  N  N   . HIS A  1 17 ? 25.093  58.578  172.907 1.00 15.07 ? 17   HIS A N   1 
ATOM   130  C  CA  . HIS A  1 17 ? 26.035  59.084  173.923 1.00 17.94 ? 17   HIS A CA  1 
ATOM   131  C  C   . HIS A  1 17 ? 25.384  60.035  174.893 1.00 17.89 ? 17   HIS A C   1 
ATOM   132  O  O   . HIS A  1 17 ? 25.846  60.179  176.037 1.00 17.43 ? 17   HIS A O   1 
ATOM   133  C  CB  . HIS A  1 17 ? 27.211  59.795  173.275 1.00 18.49 ? 17   HIS A CB  1 
ATOM   134  C  CG  . HIS A  1 17 ? 28.218  58.853  172.696 1.00 20.28 ? 17   HIS A CG  1 
ATOM   135  N  ND1 . HIS A  1 17 ? 29.049  59.191  171.647 1.00 20.55 ? 17   HIS A ND1 1 
ATOM   136  C  CD2 . HIS A  1 17 ? 28.502  57.566  173.003 1.00 23.59 ? 17   HIS A CD2 1 
ATOM   137  C  CE1 . HIS A  1 17 ? 29.825  58.160  171.354 1.00 22.41 ? 17   HIS A CE1 1 
ATOM   138  N  NE2 . HIS A  1 17 ? 29.506  57.157  172.157 1.00 25.68 ? 17   HIS A NE2 1 
ATOM   139  N  N   . LYS A  1 18 ? 24.352  60.725  174.439 1.00 20.26 ? 18   LYS A N   1 
ATOM   140  C  CA  . LYS A  1 18 ? 23.610  61.590  175.363 1.00 23.92 ? 18   LYS A CA  1 
ATOM   141  C  C   . LYS A  1 18 ? 23.144  60.792  176.566 1.00 21.71 ? 18   LYS A C   1 
ATOM   142  O  O   . LYS A  1 18 ? 23.076  61.304  177.682 1.00 22.22 ? 18   LYS A O   1 
ATOM   143  C  CB  . LYS A  1 18 ? 22.363  62.189  174.722 1.00 27.04 ? 18   LYS A CB  1 
ATOM   144  C  CG  . LYS A  1 18 ? 22.593  63.283  173.711 1.00 34.79 ? 18   LYS A CG  1 
ATOM   145  C  CD  . LYS A  1 18 ? 21.282  64.081  173.479 1.00 34.51 ? 18   LYS A CD  1 
ATOM   146  C  CE  . LYS A  1 18 ? 20.546  63.582  172.256 1.00 38.62 ? 18   LYS A CE  1 
ATOM   147  N  NZ  . LYS A  1 18 ? 19.385  64.439  171.814 1.00 37.79 ? 18   LYS A NZ  1 
ATOM   148  N  N   . TYR A  1 19 ? 22.749  59.550  176.329 1.00 17.65 ? 19   TYR A N   1 
ATOM   149  C  CA  . TYR A  1 19 ? 22.260  58.659  177.395 1.00 18.93 ? 19   TYR A CA  1 
ATOM   150  C  C   . TYR A  1 19 ? 23.312  57.747  178.032 1.00 15.88 ? 19   TYR A C   1 
ATOM   151  O  O   . TYR A  1 19 ? 23.185  57.413  179.225 1.00 17.51 ? 19   TYR A O   1 
ATOM   152  C  CB  . TYR A  1 19 ? 21.041  57.840  176.901 1.00 19.58 ? 19   TYR A CB  1 
ATOM   153  C  CG  . TYR A  1 19 ? 19.968  58.783  176.434 1.00 20.25 ? 19   TYR A CG  1 
ATOM   154  C  CD1 . TYR A  1 19 ? 19.108  59.372  177.342 1.00 20.51 ? 19   TYR A CD1 1 
ATOM   155  C  CD2 . TYR A  1 19 ? 19.903  59.188  175.105 1.00 20.47 ? 19   TYR A CD2 1 
ATOM   156  C  CE1 . TYR A  1 19 ? 18.169  60.302  176.943 1.00 20.82 ? 19   TYR A CE1 1 
ATOM   157  C  CE2 . TYR A  1 19 ? 18.954  60.115  174.695 1.00 20.08 ? 19   TYR A CE2 1 
ATOM   158  C  CZ  . TYR A  1 19 ? 18.103  60.670  175.625 1.00 20.66 ? 19   TYR A CZ  1 
ATOM   159  O  OH  . TYR A  1 19 ? 17.153  61.589  175.249 1.00 24.27 ? 19   TYR A OH  1 
ATOM   160  N  N   . SER A  1 20 ? 24.303  57.302  177.256 1.00 15.71 ? 20   SER A N   1 
ATOM   161  C  CA  . SER A  1 20 ? 25.294  56.358  177.777 1.00 15.37 ? 20   SER A CA  1 
ATOM   162  C  C   . SER A  1 20 ? 26.252  57.092  178.724 1.00 16.33 ? 20   SER A C   1 
ATOM   163  O  O   . SER A  1 20 ? 26.924  56.479  179.549 1.00 14.51 ? 20   SER A O   1 
ATOM   164  C  CB  . SER A  1 20 ? 26.043  55.635  176.645 1.00 16.19 ? 20   SER A CB  1 
ATOM   165  O  OG  . SER A  1 20 ? 26.986  56.516  176.074 1.00 13.97 ? 20   SER A OG  1 
ATOM   166  N  N   . LEU A  1 21 ? 26.280  58.422  178.625 1.00 16.71 ? 21   LEU A N   1 
ATOM   167  C  CA  . LEU A  1 21 ? 27.144  59.234  179.497 1.00 18.84 ? 21   LEU A CA  1 
ATOM   168  C  C   . LEU A  1 21 ? 26.497  59.687  180.795 1.00 17.88 ? 21   LEU A C   1 
ATOM   169  O  O   . LEU A  1 21 ? 27.147  60.317  181.619 1.00 17.81 ? 21   LEU A O   1 
ATOM   170  C  CB  . LEU A  1 21 ? 27.765  60.431  178.744 1.00 18.63 ? 21   LEU A CB  1 
ATOM   171  C  CG  . LEU A  1 21 ? 29.164  60.234  178.126 1.00 21.33 ? 21   LEU A CG  1 
ATOM   172  C  CD1 . LEU A  1 21 ? 29.228  59.180  176.991 1.00 18.23 ? 21   LEU A CD1 1 
ATOM   173  C  CD2 . LEU A  1 21 ? 29.720  61.582  177.637 1.00 21.74 ? 21   LEU A CD2 1 
ATOM   174  N  N   . ILE A  1 22 ? 25.241  59.331  181.017 1.00 17.75 ? 22   ILE A N   1 
ATOM   175  C  CA  . ILE A  1 22 ? 24.564  59.735  182.229 1.00 17.56 ? 22   ILE A CA  1 
ATOM   176  C  C   . ILE A  1 22 ? 25.236  59.168  183.484 1.00 19.26 ? 22   ILE A C   1 
ATOM   177  O  O   . ILE A  1 22 ? 25.426  59.899  184.453 1.00 16.23 ? 22   ILE A O   1 
ATOM   178  C  CB  . ILE A  1 22 ? 23.059  59.360  182.170 1.00 18.78 ? 22   ILE A CB  1 
ATOM   179  C  CG1 . ILE A  1 22 ? 22.338  60.214  181.119 1.00 19.73 ? 22   ILE A CG1 1 
ATOM   180  C  CG2 . ILE A  1 22 ? 22.411  59.445  183.573 1.00 20.89 ? 22   ILE A CG2 1 
ATOM   181  C  CD1 . ILE A  1 22 ? 20.968  59.666  180.773 1.00 19.02 ? 22   ILE A CD1 1 
ATOM   182  N  N   . LYS A  1 23 ? 25.567  57.875  183.486 1.00 16.19 ? 23   LYS A N   1 
ATOM   183  C  CA  . LYS A  1 23 ? 26.208  57.296  184.651 1.00 15.54 ? 23   LYS A CA  1 
ATOM   184  C  C   . LYS A  1 23 ? 26.967  56.009  184.339 1.00 16.51 ? 23   LYS A C   1 
ATOM   185  O  O   . LYS A  1 23 ? 26.833  55.419  183.273 1.00 14.48 ? 23   LYS A O   1 
ATOM   186  C  CB  . LYS A  1 23 ? 25.179  57.040  185.736 1.00 19.62 ? 23   LYS A CB  1 
ATOM   187  C  CG  . LYS A  1 23 ? 24.094  56.052  185.372 1.00 18.98 ? 23   LYS A CG  1 
ATOM   188  C  CD  . LYS A  1 23 ? 23.305  55.728  186.654 1.00 23.18 ? 23   LYS A CD  1 
ATOM   189  C  CE  . LYS A  1 23 ? 22.111  54.840  186.361 1.00 25.75 ? 23   LYS A CE  1 
ATOM   190  N  NZ  . LYS A  1 23 ? 21.100  55.576  185.547 1.00 28.42 ? 23   LYS A NZ  1 
ATOM   191  N  N   . GLY A  1 24 ? 27.799  55.584  185.278 1.00 16.08 ? 24   GLY A N   1 
ATOM   192  C  CA  . GLY A  1 24 ? 28.415  54.280  185.159 1.00 18.43 ? 24   GLY A CA  1 
ATOM   193  C  C   . GLY A  1 24 ? 29.322  54.160  183.955 1.00 17.76 ? 24   GLY A C   1 
ATOM   194  O  O   . GLY A  1 24 ? 30.039  55.104  183.582 1.00 19.47 ? 24   GLY A O   1 
ATOM   195  N  N   . ASN A  1 25 ? 29.256  53.012  183.295 1.00 16.59 ? 25   ASN A N   1 
ATOM   196  C  CA  . ASN A  1 25 ? 30.062  52.786  182.090 1.00 17.11 ? 25   ASN A CA  1 
ATOM   197  C  C   . ASN A  1 25 ? 29.580  53.700  180.952 1.00 17.22 ? 25   ASN A C   1 
ATOM   198  O  O   . ASN A  1 25 ? 28.387  53.725  180.638 1.00 15.34 ? 25   ASN A O   1 
ATOM   199  C  CB  . ASN A  1 25 ? 29.916  51.299  181.675 1.00 18.62 ? 25   ASN A CB  1 
ATOM   200  C  CG  . ASN A  1 25 ? 30.875  50.879  180.564 1.00 22.34 ? 25   ASN A CG  1 
ATOM   201  O  OD1 . ASN A  1 25 ? 31.047  51.584  179.561 1.00 22.59 ? 25   ASN A OD1 1 
ATOM   202  N  ND2 . ASN A  1 25 ? 31.479  49.701  180.723 1.00 21.70 ? 25   ASN A ND2 1 
ATOM   203  N  N   . PHE A  1 26 ? 30.503  54.418  180.310 1.00 16.57 ? 26   PHE A N   1 
ATOM   204  C  CA  . PHE A  1 26 ? 30.123  55.326  179.221 1.00 17.45 ? 26   PHE A CA  1 
ATOM   205  C  C   . PHE A  1 26 ? 29.751  54.600  177.908 1.00 20.79 ? 26   PHE A C   1 
ATOM   206  O  O   . PHE A  1 26 ? 29.312  55.250  176.935 1.00 20.42 ? 26   PHE A O   1 
ATOM   207  C  CB  . PHE A  1 26 ? 31.245  56.347  178.967 1.00 18.08 ? 26   PHE A CB  1 
ATOM   208  C  CG  . PHE A  1 26 ? 31.287  57.505  179.965 1.00 18.75 ? 26   PHE A CG  1 
ATOM   209  C  CD1 . PHE A  1 26 ? 30.344  57.631  180.965 1.00 17.28 ? 26   PHE A CD1 1 
ATOM   210  C  CD2 . PHE A  1 26 ? 32.262  58.484  179.853 1.00 19.52 ? 26   PHE A CD2 1 
ATOM   211  C  CE1 . PHE A  1 26 ? 30.368  58.693  181.843 1.00 17.65 ? 26   PHE A CE1 1 
ATOM   212  C  CE2 . PHE A  1 26 ? 32.292  59.571  180.721 1.00 18.60 ? 26   PHE A CE2 1 
ATOM   213  C  CZ  . PHE A  1 26 ? 31.346  59.667  181.728 1.00 18.62 ? 26   PHE A CZ  1 
ATOM   214  N  N   . HIS A  1 27 ? 29.946  53.280  177.871 1.00 18.83 ? 27   HIS A N   1 
ATOM   215  C  CA  . HIS A  1 27 ? 29.480  52.433  176.768 1.00 20.70 ? 27   HIS A CA  1 
ATOM   216  C  C   . HIS A  1 27 ? 28.250  51.622  177.164 1.00 19.35 ? 27   HIS A C   1 
ATOM   217  O  O   . HIS A  1 27 ? 27.982  50.584  176.549 1.00 20.42 ? 27   HIS A O   1 
ATOM   218  C  CB  . HIS A  1 27 ? 30.603  51.508  176.324 1.00 22.28 ? 27   HIS A CB  1 
ATOM   219  C  CG  . HIS A  1 27 ? 31.854  52.241  175.963 1.00 24.31 ? 27   HIS A CG  1 
ATOM   220  N  ND1 . HIS A  1 27 ? 32.198  52.537  174.664 1.00 28.61 ? 27   HIS A ND1 1 
ATOM   221  C  CD2 . HIS A  1 27 ? 32.819  52.784  176.738 1.00 27.19 ? 27   HIS A CD2 1 
ATOM   222  C  CE1 . HIS A  1 27 ? 33.322  53.231  174.651 1.00 27.61 ? 27   HIS A CE1 1 
ATOM   223  N  NE2 . HIS A  1 27 ? 33.719  53.394  175.899 1.00 29.06 ? 27   HIS A NE2 1 
ATOM   224  N  N   . ALA A  1 28 ? 27.506  52.088  178.174 1.00 16.47 ? 28   ALA A N   1 
ATOM   225  C  CA  . ALA A  1 28 ? 26.322  51.393  178.624 1.00 15.45 ? 28   ALA A CA  1 
ATOM   226  C  C   . ALA A  1 28 ? 25.162  52.330  178.884 1.00 17.94 ? 28   ALA A C   1 
ATOM   227  O  O   . ALA A  1 28 ? 25.328  53.345  179.556 1.00 15.02 ? 28   ALA A O   1 
ATOM   228  C  CB  . ALA A  1 28 ? 26.614  50.624  179.906 1.00 16.64 ? 28   ALA A CB  1 
ATOM   229  N  N   . VAL A  1 29 ? 23.981  51.927  178.441 1.00 14.50 ? 29   VAL A N   1 
ATOM   230  C  CA  . VAL A  1 29 ? 22.723  52.613  178.756 1.00 15.67 ? 29   VAL A CA  1 
ATOM   231  C  C   . VAL A  1 29 ? 21.941  51.660  179.665 1.00 16.75 ? 29   VAL A C   1 
ATOM   232  O  O   . VAL A  1 29 ? 21.629  50.538  179.264 1.00 16.39 ? 29   VAL A O   1 
ATOM   233  C  CB  . VAL A  1 29 ? 21.973  52.997  177.431 1.00 16.42 ? 29   VAL A CB  1 
ATOM   234  C  CG1 . VAL A  1 29 ? 20.531  53.328  177.639 1.00 16.30 ? 29   VAL A CG1 1 
ATOM   235  C  CG2 . VAL A  1 29 ? 22.681  54.165  176.746 1.00 16.51 ? 29   VAL A CG2 1 
ATOM   236  N  N   . TYR A  1 30 ? 21.680  52.085  180.905 1.00 16.46 ? 30   TYR A N   1 
ATOM   237  C  CA  . TYR A  1 30 ? 20.991  51.202  181.856 1.00 16.82 ? 30   TYR A CA  1 
ATOM   238  C  C   . TYR A  1 30 ? 19.485  51.347  181.736 1.00 18.40 ? 30   TYR A C   1 
ATOM   239  O  O   . TYR A  1 30 ? 18.973  52.155  180.950 1.00 17.42 ? 30   TYR A O   1 
ATOM   240  C  CB  . TYR A  1 30 ? 21.508  51.459  183.283 1.00 18.37 ? 30   TYR A CB  1 
ATOM   241  C  CG  . TYR A  1 30 ? 23.010  51.323  183.347 1.00 19.05 ? 30   TYR A CG  1 
ATOM   242  C  CD1 . TYR A  1 30 ? 23.614  50.056  183.343 1.00 16.28 ? 30   TYR A CD1 1 
ATOM   243  C  CD2 . TYR A  1 30 ? 23.824  52.450  183.382 1.00 19.60 ? 30   TYR A CD2 1 
ATOM   244  C  CE1 . TYR A  1 30 ? 25.007  49.923  183.413 1.00 19.59 ? 30   TYR A CE1 1 
ATOM   245  C  CE2 . TYR A  1 30 ? 25.210  52.325  183.446 1.00 19.83 ? 30   TYR A CE2 1 
ATOM   246  C  CZ  . TYR A  1 30 ? 25.799  51.065  183.470 1.00 20.78 ? 30   TYR A CZ  1 
ATOM   247  O  OH  . TYR A  1 30 ? 27.186  50.969  183.547 1.00 18.87 ? 30   TYR A OH  1 
ATOM   248  N  N   . ARG A  1 31 ? 18.745  50.542  182.486 1.00 22.05 ? 31   ARG A N   1 
ATOM   249  C  CA  . ARG A  1 31 ? 17.314  50.478  182.232 1.00 25.16 ? 31   ARG A CA  1 
ATOM   250  C  C   . ARG A  1 31 ? 16.610  51.832  182.404 1.00 23.23 ? 31   ARG A C   1 
ATOM   251  O  O   . ARG A  1 31 ? 15.773  52.197  181.578 1.00 22.90 ? 31   ARG A O   1 
ATOM   252  C  CB  . ARG A  1 31 ? 16.659  49.396  183.079 1.00 28.69 ? 31   ARG A CB  1 
ATOM   253  C  CG  . ARG A  1 31 ? 15.145  49.324  182.908 1.00 32.44 ? 31   ARG A CG  1 
ATOM   254  C  CD  . ARG A  1 31 ? 14.453  48.342  183.875 1.00 33.93 ? 31   ARG A CD  1 
ATOM   255  N  NE  . ARG A  1 31 ? 14.554  46.958  183.408 1.00 40.13 ? 31   ARG A NE  1 
ATOM   256  C  CZ  . ARG A  1 31 ? 15.590  46.151  183.641 1.00 40.43 ? 31   ARG A CZ  1 
ATOM   257  N  NH1 . ARG A  1 31 ? 16.644  46.586  184.331 1.00 40.62 ? 31   ARG A NH1 1 
ATOM   258  N  NH2 . ARG A  1 31 ? 15.568  44.906  183.167 1.00 39.86 ? 31   ARG A NH2 1 
ATOM   259  N  N   . ASP A  1 32 ? 16.963  52.577  183.451 1.00 20.25 ? 32   ASP A N   1 
ATOM   260  C  CA  . ASP A  1 32 ? 16.410  53.919  183.648 1.00 21.24 ? 32   ASP A CA  1 
ATOM   261  C  C   . ASP A  1 32 ? 16.872  54.914  182.581 1.00 22.34 ? 32   ASP A C   1 
ATOM   262  O  O   . ASP A  1 32 ? 16.062  55.723  182.125 1.00 22.02 ? 32   ASP A O   1 
ATOM   263  C  CB  . ASP A  1 32 ? 16.626  54.454  185.072 1.00 24.42 ? 32   ASP A CB  1 
ATOM   264  C  CG  . ASP A  1 32 ? 18.084  54.490  185.499 1.00 28.58 ? 32   ASP A CG  1 
ATOM   265  O  OD1 . ASP A  1 32 ? 18.936  53.744  184.957 1.00 27.13 ? 32   ASP A OD1 1 
ATOM   266  O  OD2 . ASP A  1 32 ? 18.465  55.221  186.446 1.00 30.81 ? 32   ASP A OD2 1 
ATOM   267  N  N   . ASP A  1 33 ? 18.137  54.832  182.163 1.00 19.42 ? 33   ASP A N   1 
ATOM   268  C  CA  . ASP A  1 33 ? 18.579  55.637  181.019 1.00 19.39 ? 33   ASP A CA  1 
ATOM   269  C  C   . ASP A  1 33 ? 17.794  55.320  179.750 1.00 18.90 ? 33   ASP A C   1 
ATOM   270  O  O   . ASP A  1 33 ? 17.529  56.215  178.971 1.00 18.82 ? 33   ASP A O   1 
ATOM   271  C  CB  . ASP A  1 33 ? 20.057  55.473  180.711 1.00 20.58 ? 33   ASP A CB  1 
ATOM   272  C  CG  . ASP A  1 33 ? 20.914  55.582  181.933 1.00 23.17 ? 33   ASP A CG  1 
ATOM   273  O  OD1 . ASP A  1 33 ? 20.621  56.473  182.776 1.00 21.57 ? 33   ASP A OD1 1 
ATOM   274  O  OD2 . ASP A  1 33 ? 21.889  54.803  182.120 1.00 21.97 ? 33   ASP A OD2 1 
ATOM   275  N  N   . LEU A  1 34 ? 17.460  54.049  179.517 1.00 17.80 ? 34   LEU A N   1 
ATOM   276  C  CA  . LEU A  1 34 ? 16.763  53.695  178.286 1.00 17.55 ? 34   LEU A CA  1 
ATOM   277  C  C   . LEU A  1 34 ? 15.344  54.246  178.312 1.00 18.81 ? 34   LEU A C   1 
ATOM   278  O  O   . LEU A  1 34 ? 14.820  54.669  177.281 1.00 19.35 ? 34   LEU A O   1 
ATOM   279  C  CB  . LEU A  1 34 ? 16.760  52.172  178.057 1.00 16.96 ? 34   LEU A CB  1 
ATOM   280  C  CG  . LEU A  1 34 ? 16.014  51.785  176.767 1.00 18.55 ? 34   LEU A CG  1 
ATOM   281  C  CD1 . LEU A  1 34 ? 16.841  52.229  175.550 1.00 18.92 ? 34   LEU A CD1 1 
ATOM   282  C  CD2 . LEU A  1 34 ? 15.641  50.280  176.712 1.00 18.77 ? 34   LEU A CD2 1 
ATOM   283  N  N   . LYS A  1 35 ? 14.741  54.284  179.498 1.00 18.15 ? 35   LYS A N   1 
ATOM   284  C  CA  . LYS A  1 35 ? 13.409  54.877  179.651 1.00 21.59 ? 35   LYS A CA  1 
ATOM   285  C  C   . LYS A  1 35 ? 13.395  56.364  179.240 1.00 20.40 ? 35   LYS A C   1 
ATOM   286  O  O   . LYS A  1 35 ? 12.506  56.795  178.502 1.00 20.87 ? 35   LYS A O   1 
ATOM   287  C  CB  . LYS A  1 35 ? 12.908  54.683  181.077 1.00 23.26 ? 35   LYS A CB  1 
ATOM   288  C  CG  . LYS A  1 35 ? 11.510  55.255  181.331 1.00 27.36 ? 35   LYS A CG  1 
ATOM   289  C  CD  . LYS A  1 35 ? 11.002  54.696  182.663 1.00 30.62 ? 35   LYS A CD  1 
ATOM   290  C  CE  . LYS A  1 35 ? 9.974   55.598  183.308 1.00 33.72 ? 35   LYS A CE  1 
ATOM   291  N  NZ  . LYS A  1 35 ? 8.681   55.415  182.624 1.00 36.61 ? 35   LYS A NZ  1 
ATOM   292  N  N   . LYS A  1 36 ? 14.417  57.105  179.673 1.00 20.57 ? 36   LYS A N   1 
ATOM   293  C  CA  . LYS A  1 36 ? 14.573  58.524  179.324 1.00 22.21 ? 36   LYS A CA  1 
ATOM   294  C  C   . LYS A  1 36 ? 14.790  58.685  177.840 1.00 20.67 ? 36   LYS A C   1 
ATOM   295  O  O   . LYS A  1 36 ? 14.228  59.575  177.210 1.00 19.02 ? 36   LYS A O   1 
ATOM   296  C  CB  . LYS A  1 36 ? 15.751  59.161  180.076 1.00 23.42 ? 36   LYS A CB  1 
ATOM   297  C  CG  . LYS A  1 36 ? 15.462  59.392  181.528 1.00 28.91 ? 36   LYS A CG  1 
ATOM   298  C  CD  . LYS A  1 36 ? 16.628  60.112  182.212 1.00 30.82 ? 36   LYS A CD  1 
ATOM   299  C  CE  . LYS A  1 36 ? 16.145  60.796  183.493 1.00 35.56 ? 36   LYS A CE  1 
ATOM   300  N  NZ  . LYS A  1 36 ? 15.488  59.802  184.407 1.00 37.38 ? 36   LYS A NZ  1 
ATOM   301  N  N   . LEU A  1 37 ? 15.613  57.803  177.279 1.00 20.21 ? 37   LEU A N   1 
ATOM   302  C  CA  . LEU A  1 37 ? 15.807  57.772  175.825 1.00 19.15 ? 37   LEU A CA  1 
ATOM   303  C  C   . LEU A  1 37 ? 14.489  57.596  175.060 1.00 18.74 ? 37   LEU A C   1 
ATOM   304  O  O   . LEU A  1 37 ? 14.196  58.346  174.129 1.00 17.57 ? 37   LEU A O   1 
ATOM   305  C  CB  . LEU A  1 37 ? 16.817  56.683  175.435 1.00 17.76 ? 37   LEU A CB  1 
ATOM   306  C  CG  . LEU A  1 37 ? 17.402  56.660  174.003 1.00 19.61 ? 37   LEU A CG  1 
ATOM   307  C  CD1 . LEU A  1 37 ? 18.715  55.860  174.017 1.00 21.41 ? 37   LEU A CD1 1 
ATOM   308  C  CD2 . LEU A  1 37 ? 16.414  56.002  173.030 1.00 19.34 ? 37   LEU A CD2 1 
ATOM   309  N  N   . LEU A  1 38 ? 13.698  56.590  175.421 1.00 16.80 ? 38   LEU A N   1 
ATOM   310  C  CA  . LEU A  1 38 ? 12.461  56.363  174.680 1.00 18.53 ? 38   LEU A CA  1 
ATOM   311  C  C   . LEU A  1 38 ? 11.535  57.564  174.819 1.00 19.17 ? 38   LEU A C   1 
ATOM   312  O  O   . LEU A  1 38 ? 10.948  58.007  173.848 1.00 18.10 ? 38   LEU A O   1 
ATOM   313  C  CB  . LEU A  1 38 ? 11.786  55.080  175.157 1.00 17.53 ? 38   LEU A CB  1 
ATOM   314  C  CG  . LEU A  1 38 ? 12.543  53.791  174.819 1.00 15.77 ? 38   LEU A CG  1 
ATOM   315  C  CD1 . LEU A  1 38 ? 12.161  52.592  175.737 1.00 21.26 ? 38   LEU A CD1 1 
ATOM   316  C  CD2 . LEU A  1 38 ? 12.441  53.439  173.318 1.00 17.26 ? 38   LEU A CD2 1 
ATOM   317  N  N   . GLU A  1 39 ? 11.433  58.103  176.038 1.00 21.39 ? 39   GLU A N   1 
ATOM   318  C  CA  . GLU A  1 39 ? 10.542  59.228  176.290 1.00 25.39 ? 39   GLU A CA  1 
ATOM   319  C  C   . GLU A  1 39 ? 10.960  60.459  175.487 1.00 23.65 ? 39   GLU A C   1 
ATOM   320  O  O   . GLU A  1 39 ? 10.120  61.211  175.000 1.00 24.39 ? 39   GLU A O   1 
ATOM   321  C  CB  . GLU A  1 39 ? 10.516  59.558  177.782 1.00 27.60 ? 39   GLU A CB  1 
ATOM   322  C  CG  . GLU A  1 39 ? 9.765   58.542  178.635 1.00 33.90 ? 39   GLU A CG  1 
ATOM   323  C  CD  . GLU A  1 39 ? 9.711   58.927  180.122 1.00 36.66 ? 39   GLU A CD  1 
ATOM   324  O  OE1 . GLU A  1 39 ? 9.741   60.144  180.444 1.00 43.31 ? 39   GLU A OE1 1 
ATOM   325  O  OE2 . GLU A  1 39 ? 9.634   58.029  180.995 1.00 40.62 ? 39   GLU A OE2 1 
ATOM   326  N  N   . THR A  1 40 ? 12.263  60.668  175.343 1.00 21.49 ? 40   THR A N   1 
ATOM   327  C  CA  . THR A  1 40 ? 12.754  61.879  174.711 1.00 22.84 ? 40   THR A CA  1 
ATOM   328  C  C   . THR A  1 40 ? 12.890  61.748  173.214 1.00 21.64 ? 40   THR A C   1 
ATOM   329  O  O   . THR A  1 40 ? 12.574  62.671  172.480 1.00 21.92 ? 40   THR A O   1 
ATOM   330  C  CB  . THR A  1 40 ? 14.094  62.268  175.344 1.00 23.13 ? 40   THR A CB  1 
ATOM   331  O  OG1 . THR A  1 40 ? 13.831  62.588  176.711 1.00 25.38 ? 40   THR A OG1 1 
ATOM   332  C  CG2 . THR A  1 40 ? 14.612  63.582  174.823 1.00 25.11 ? 40   THR A CG2 1 
ATOM   333  N  N   . GLU A  1 41 ? 13.328  60.579  172.756 1.00 19.85 ? 41   GLU A N   1 
ATOM   334  C  CA  . GLU A  1 41 ? 13.769  60.465  171.390 1.00 20.70 ? 41   GLU A CA  1 
ATOM   335  C  C   . GLU A  1 41 ? 12.796  59.764  170.453 1.00 23.40 ? 41   GLU A C   1 
ATOM   336  O  O   . GLU A  1 41 ? 12.929  59.915  169.244 1.00 23.56 ? 41   GLU A O   1 
ATOM   337  C  CB  . GLU A  1 41 ? 15.114  59.739  171.323 1.00 20.11 ? 41   GLU A CB  1 
ATOM   338  C  CG  . GLU A  1 41 ? 16.221  60.367  172.147 1.00 22.13 ? 41   GLU A CG  1 
ATOM   339  C  CD  . GLU A  1 41 ? 16.802  61.636  171.538 1.00 23.63 ? 41   GLU A CD  1 
ATOM   340  O  OE1 . GLU A  1 41 ? 16.597  61.883  170.335 1.00 24.14 ? 41   GLU A OE1 1 
ATOM   341  O  OE2 . GLU A  1 41 ? 17.489  62.375  172.273 1.00 23.67 ? 41   GLU A OE2 1 
ATOM   342  N  N   . SER A  1 42 ? 11.866  58.972  170.982 1.00 20.95 ? 42   SER A N   1 
ATOM   343  C  CA  . SER A  1 42 ? 11.065  58.098  170.118 1.00 22.48 ? 42   SER A CA  1 
ATOM   344  C  C   . SER A  1 42 ? 9.587   58.481  170.107 1.00 23.36 ? 42   SER A C   1 
ATOM   345  O  O   . SER A  1 42 ? 9.101   58.989  171.092 1.00 21.95 ? 42   SER A O   1 
ATOM   346  C  CB  . SER A  1 42 ? 11.225  56.624  170.524 1.00 24.66 ? 42   SER A CB  1 
ATOM   347  O  OG  . SER A  1 42 ? 10.424  56.295  171.637 1.00 27.43 ? 42   SER A OG  1 
ATOM   348  N  N   . PRO A  1 43 ? 8.881   58.224  169.003 1.00 23.38 ? 43   PRO A N   1 
ATOM   349  C  CA  . PRO A  1 43 ? 7.463   58.574  168.889 1.00 25.56 ? 43   PRO A CA  1 
ATOM   350  C  C   . PRO A  1 43 ? 6.594   57.622  169.706 1.00 28.56 ? 43   PRO A C   1 
ATOM   351  O  O   . PRO A  1 43 ? 7.097   56.597  170.204 1.00 27.39 ? 43   PRO A O   1 
ATOM   352  C  CB  . PRO A  1 43 ? 7.184   58.398  167.400 1.00 25.04 ? 43   PRO A CB  1 
ATOM   353  C  CG  . PRO A  1 43 ? 8.091   57.326  167.029 1.00 23.81 ? 43   PRO A CG  1 
ATOM   354  C  CD  . PRO A  1 43 ? 9.383   57.581  167.782 1.00 23.27 ? 43   PRO A CD  1 
ATOM   355  N  N   . GLN A  1 44 ? 5.318   57.982  169.859 1.00 29.83 ? 44   GLN A N   1 
ATOM   356  C  CA  . GLN A  1 44 ? 4.378   57.224  170.680 1.00 32.84 ? 44   GLN A CA  1 
ATOM   357  C  C   . GLN A  1 44 ? 4.245   55.777  170.241 1.00 31.30 ? 44   GLN A C   1 
ATOM   358  O  O   . GLN A  1 44 ? 4.051   54.891  171.066 1.00 32.57 ? 44   GLN A O   1 
ATOM   359  C  CB  . GLN A  1 44 ? 2.985   57.861  170.678 1.00 36.82 ? 44   GLN A CB  1 
ATOM   360  C  CG  . GLN A  1 44 ? 2.022   57.219  171.686 1.00 41.83 ? 44   GLN A CG  1 
ATOM   361  C  CD  . GLN A  1 44 ? 2.417   57.494  173.144 1.00 45.88 ? 44   GLN A CD  1 
ATOM   362  O  OE1 . GLN A  1 44 ? 2.924   58.583  173.460 1.00 48.42 ? 44   GLN A OE1 1 
ATOM   363  N  NE2 . GLN A  1 44 ? 2.188   56.514  174.033 1.00 46.86 ? 44   GLN A NE2 1 
ATOM   364  N  N   . TYR A  1 45 ? 4.344   55.517  168.945 1.00 29.96 ? 45   TYR A N   1 
ATOM   365  C  CA  . TYR A  1 45 ? 4.154   54.149  168.490 1.00 28.88 ? 45   TYR A CA  1 
ATOM   366  C  C   . TYR A  1 45 ? 5.359   53.266  168.830 1.00 29.71 ? 45   TYR A C   1 
ATOM   367  O  O   . TYR A  1 45 ? 5.255   52.036  168.816 1.00 29.22 ? 45   TYR A O   1 
ATOM   368  C  CB  . TYR A  1 45 ? 3.751   54.083  167.009 1.00 28.97 ? 45   TYR A CB  1 
ATOM   369  C  CG  . TYR A  1 45 ? 4.757   54.659  166.071 1.00 28.25 ? 45   TYR A CG  1 
ATOM   370  C  CD1 . TYR A  1 45 ? 5.848   53.910  165.666 1.00 27.49 ? 45   TYR A CD1 1 
ATOM   371  C  CD2 . TYR A  1 45 ? 4.620   55.949  165.583 1.00 26.83 ? 45   TYR A CD2 1 
ATOM   372  C  CE1 . TYR A  1 45 ? 6.769   54.422  164.820 1.00 27.41 ? 45   TYR A CE1 1 
ATOM   373  C  CE2 . TYR A  1 45 ? 5.548   56.478  164.702 1.00 28.10 ? 45   TYR A CE2 1 
ATOM   374  C  CZ  . TYR A  1 45 ? 6.615   55.690  164.322 1.00 27.52 ? 45   TYR A CZ  1 
ATOM   375  O  OH  . TYR A  1 45 ? 7.575   56.176  163.476 1.00 29.37 ? 45   TYR A OH  1 
ATOM   376  N  N   . ILE A  1 46 ? 6.493   53.883  169.164 1.00 27.45 ? 46   ILE A N   1 
ATOM   377  C  CA  . ILE A  1 46 ? 7.628   53.134  169.721 1.00 25.99 ? 46   ILE A CA  1 
ATOM   378  C  C   . ILE A  1 46 ? 7.575   53.092  171.269 1.00 27.18 ? 46   ILE A C   1 
ATOM   379  O  O   . ILE A  1 46 ? 7.799   52.043  171.892 1.00 25.89 ? 46   ILE A O   1 
ATOM   380  C  CB  . ILE A  1 46 ? 8.957   53.757  169.240 1.00 25.86 ? 46   ILE A CB  1 
ATOM   381  C  CG1 . ILE A  1 46 ? 9.051   53.730  167.712 1.00 26.56 ? 46   ILE A CG1 1 
ATOM   382  C  CG2 . ILE A  1 46 ? 10.152  53.014  169.833 1.00 22.85 ? 46   ILE A CG2 1 
ATOM   383  C  CD1 . ILE A  1 46 ? 8.971   52.343  167.105 1.00 27.48 ? 46   ILE A CD1 1 
ATOM   384  N  N   . ARG A  1 47 ? 7.236   54.223  171.889 1.00 27.82 ? 47   ARG A N   1 
ATOM   385  C  CA  . ARG A  1 47 ? 7.205   54.316  173.349 1.00 31.20 ? 47   ARG A CA  1 
ATOM   386  C  C   . ARG A  1 47 ? 6.188   53.389  173.991 1.00 31.90 ? 47   ARG A C   1 
ATOM   387  O  O   . ARG A  1 47 ? 6.419   52.889  175.090 1.00 30.84 ? 47   ARG A O   1 
ATOM   388  C  CB  . ARG A  1 47 ? 6.846   55.734  173.772 1.00 33.44 ? 47   ARG A CB  1 
ATOM   389  C  CG  . ARG A  1 47 ? 7.988   56.680  173.685 1.00 37.51 ? 47   ARG A CG  1 
ATOM   390  C  CD  . ARG A  1 47 ? 7.740   57.980  174.418 1.00 40.81 ? 47   ARG A CD  1 
ATOM   391  N  NE  . ARG A  1 47 ? 7.383   59.020  173.474 1.00 44.06 ? 47   ARG A NE  1 
ATOM   392  C  CZ  . ARG A  1 47 ? 6.149   59.433  173.247 1.00 45.67 ? 47   ARG A CZ  1 
ATOM   393  N  NH1 . ARG A  1 47 ? 5.143   58.908  173.929 1.00 47.19 ? 47   ARG A NH1 1 
ATOM   394  N  NH2 . ARG A  1 47 ? 5.925   60.387  172.358 1.00 46.50 ? 47   ARG A NH2 1 
ATOM   395  N  N   . LYS A  1 48 ? 5.067   53.178  173.313 1.00 33.64 ? 48   LYS A N   1 
ATOM   396  C  CA  . LYS A  1 48 ? 3.936   52.451  173.897 1.00 36.63 ? 48   LYS A CA  1 
ATOM   397  C  C   . LYS A  1 48 ? 4.245   50.988  174.247 1.00 35.79 ? 48   LYS A C   1 
ATOM   398  O  O   . LYS A  1 48 ? 3.522   50.356  175.008 1.00 35.36 ? 48   LYS A O   1 
ATOM   399  C  CB  . LYS A  1 48 ? 2.701   52.544  172.984 1.00 38.19 ? 48   LYS A CB  1 
ATOM   400  C  CG  . LYS A  1 48 ? 2.797   51.742  171.690 1.00 41.16 ? 48   LYS A CG  1 
ATOM   401  C  CD  . LYS A  1 48 ? 1.480   51.784  170.938 1.00 43.99 ? 48   LYS A CD  1 
ATOM   402  C  CE  . LYS A  1 48 ? 1.635   51.385  169.474 1.00 46.25 ? 48   LYS A CE  1 
ATOM   403  N  NZ  . LYS A  1 48 ? 0.496   51.949  168.663 1.00 48.32 ? 48   LYS A NZ  1 
ATOM   404  N  N   . LYS A  1 49 ? 5.320   50.448  173.686 1.00 34.84 ? 49   LYS A N   1 
ATOM   405  C  CA  . LYS A  1 49 ? 5.734   49.099  174.007 1.00 34.10 ? 49   LYS A CA  1 
ATOM   406  C  C   . LYS A  1 49 ? 6.189   49.036  175.469 1.00 32.24 ? 49   LYS A C   1 
ATOM   407  O  O   . LYS A  1 49 ? 5.958   48.052  176.160 1.00 33.18 ? 49   LYS A O   1 
ATOM   408  C  CB  . LYS A  1 49 ? 6.823   48.657  173.027 1.00 35.96 ? 49   LYS A CB  1 
ATOM   409  C  CG  . LYS A  1 49 ? 7.432   47.334  173.352 1.00 38.69 ? 49   LYS A CG  1 
ATOM   410  C  CD  . LYS A  1 49 ? 7.585   46.487  172.105 1.00 41.23 ? 49   LYS A CD  1 
ATOM   411  C  CE  . LYS A  1 49 ? 8.901   46.740  171.453 1.00 41.19 ? 49   LYS A CE  1 
ATOM   412  N  NZ  . LYS A  1 49 ? 9.028   45.888  170.257 1.00 41.54 ? 49   LYS A NZ  1 
ATOM   413  N  N   . GLY A  1 50 ? 6.802   50.113  175.963 1.00 28.53 ? 50   GLY A N   1 
ATOM   414  C  CA  . GLY A  1 50 ? 7.170   50.220  177.380 1.00 27.55 ? 50   GLY A CA  1 
ATOM   415  C  C   . GLY A  1 50 ? 8.669   50.012  177.528 1.00 25.84 ? 50   GLY A C   1 
ATOM   416  O  O   . GLY A  1 50 ? 9.260   49.189  176.840 1.00 24.73 ? 50   GLY A O   1 
ATOM   417  N  N   . ALA A  1 51 ? 9.298   50.748  178.431 1.00 26.04 ? 51   ALA A N   1 
ATOM   418  C  CA  . ALA A  1 51 ? 10.748  50.689  178.552 1.00 24.95 ? 51   ALA A CA  1 
ATOM   419  C  C   . ALA A  1 51 ? 11.224  49.303  179.029 1.00 25.13 ? 51   ALA A C   1 
ATOM   420  O  O   . ALA A  1 51 ? 12.261  48.813  178.602 1.00 23.64 ? 51   ALA A O   1 
ATOM   421  C  CB  . ALA A  1 51 ? 11.254  51.790  179.457 1.00 27.40 ? 51   ALA A CB  1 
ATOM   422  N  N   . ASP A  1 52 ? 10.459  48.628  179.874 1.00 24.15 ? 52   ASP A N   1 
ATOM   423  C  CA  . ASP A  1 52 ? 10.875  47.309  180.317 1.00 25.49 ? 52   ASP A CA  1 
ATOM   424  C  C   . ASP A  1 52 ? 10.861  46.240  179.223 1.00 24.54 ? 52   ASP A C   1 
ATOM   425  O  O   . ASP A  1 52 ? 11.797  45.444  179.104 1.00 23.66 ? 52   ASP A O   1 
ATOM   426  C  CB  . ASP A  1 52 ? 10.081  46.899  181.563 1.00 29.87 ? 52   ASP A CB  1 
ATOM   427  C  CG  . ASP A  1 52 ? 10.581  47.620  182.815 1.00 33.75 ? 52   ASP A CG  1 
ATOM   428  O  OD1 . ASP A  1 52 ? 11.615  48.330  182.724 1.00 36.61 ? 52   ASP A OD1 1 
ATOM   429  O  OD2 . ASP A  1 52 ? 10.030  47.545  183.938 1.00 36.47 ? 52   ASP A OD2 1 
ATOM   430  N  N   . VAL A  1 53 ? 9.804   46.224  178.418 1.00 23.63 ? 53   VAL A N   1 
ATOM   431  C  CA  . VAL A  1 53 ? 9.759   45.360  177.241 1.00 22.73 ? 53   VAL A CA  1 
ATOM   432  C  C   . VAL A  1 53 ? 10.913  45.691  176.274 1.00 22.48 ? 53   VAL A C   1 
ATOM   433  O  O   . VAL A  1 53 ? 11.646  44.797  175.861 1.00 22.99 ? 53   VAL A O   1 
ATOM   434  C  CB  . VAL A  1 53 ? 8.372   45.450  176.550 1.00 23.69 ? 53   VAL A CB  1 
ATOM   435  C  CG1 . VAL A  1 53 ? 8.389   44.833  175.157 1.00 21.97 ? 53   VAL A CG1 1 
ATOM   436  C  CG2 . VAL A  1 53 ? 7.310   44.809  177.444 1.00 22.63 ? 53   VAL A CG2 1 
ATOM   437  N  N   . TRP A  1 54 ? 11.099  46.967  175.946 1.00 20.09 ? 54   TRP A N   1 
ATOM   438  C  CA  . TRP A  1 54 ? 12.200  47.337  175.059 1.00 19.76 ? 54   TRP A CA  1 
ATOM   439  C  C   . TRP A  1 54 ? 13.552  46.928  175.655 1.00 19.70 ? 54   TRP A C   1 
ATOM   440  O  O   . TRP A  1 54 ? 14.415  46.434  174.948 1.00 18.73 ? 54   TRP A O   1 
ATOM   441  C  CB  . TRP A  1 54 ? 12.202  48.838  174.800 1.00 18.87 ? 54   TRP A CB  1 
ATOM   442  C  CG  . TRP A  1 54 ? 11.398  49.204  173.595 1.00 19.99 ? 54   TRP A CG  1 
ATOM   443  C  CD1 . TRP A  1 54 ? 10.280  49.971  173.552 1.00 19.77 ? 54   TRP A CD1 1 
ATOM   444  C  CD2 . TRP A  1 54 ? 11.695  48.839  172.240 1.00 20.12 ? 54   TRP A CD2 1 
ATOM   445  N  NE1 . TRP A  1 54 ? 9.849   50.113  172.254 1.00 19.26 ? 54   TRP A NE1 1 
ATOM   446  C  CE2 . TRP A  1 54 ? 10.701  49.428  171.424 1.00 20.87 ? 54   TRP A CE2 1 
ATOM   447  C  CE3 . TRP A  1 54 ? 12.711  48.087  171.626 1.00 20.06 ? 54   TRP A CE3 1 
ATOM   448  C  CZ2 . TRP A  1 54 ? 10.685  49.279  170.031 1.00 21.61 ? 54   TRP A CZ2 1 
ATOM   449  C  CZ3 . TRP A  1 54 ? 12.680  47.919  170.242 1.00 19.98 ? 54   TRP A CZ3 1 
ATOM   450  C  CH2 . TRP A  1 54 ? 11.665  48.501  169.461 1.00 21.36 ? 54   TRP A CH2 1 
ATOM   451  N  N   . PHE A  1 55 ? 13.754  47.172  176.945 1.00 18.32 ? 55   PHE A N   1 
ATOM   452  C  CA  . PHE A  1 55 ? 15.050  46.814  177.530 1.00 17.88 ? 55   PHE A CA  1 
ATOM   453  C  C   . PHE A  1 55 ? 15.313  45.309  177.408 1.00 19.09 ? 55   PHE A C   1 
ATOM   454  O  O   . PHE A  1 55 ? 16.407  44.866  177.006 1.00 19.30 ? 55   PHE A O   1 
ATOM   455  C  CB  . PHE A  1 55 ? 15.170  47.312  178.985 1.00 19.65 ? 55   PHE A CB  1 
ATOM   456  C  CG  . PHE A  1 55 ? 16.555  47.192  179.555 1.00 20.70 ? 55   PHE A CG  1 
ATOM   457  C  CD1 . PHE A  1 55 ? 17.452  48.235  179.448 1.00 22.90 ? 55   PHE A CD1 1 
ATOM   458  C  CD2 . PHE A  1 55 ? 16.952  46.032  180.192 1.00 23.22 ? 55   PHE A CD2 1 
ATOM   459  C  CE1 . PHE A  1 55 ? 18.747  48.125  179.952 1.00 23.56 ? 55   PHE A CE1 1 
ATOM   460  C  CE2 . PHE A  1 55 ? 18.233  45.922  180.713 1.00 24.29 ? 55   PHE A CE2 1 
ATOM   461  C  CZ  . PHE A  1 55 ? 19.122  46.968  180.589 1.00 22.15 ? 55   PHE A CZ  1 
ATOM   462  N  N   . LYS A  1 56 ? 14.313  44.492  177.728 1.00 20.43 ? 56   LYS A N   1 
ATOM   463  C  CA  . LYS A  1 56 ? 14.511  43.061  177.598 1.00 24.14 ? 56   LYS A CA  1 
ATOM   464  C  C   . LYS A  1 56 ? 14.795  42.633  176.155 1.00 23.89 ? 56   LYS A C   1 
ATOM   465  O  O   . LYS A  1 56 ? 15.603  41.737  175.900 1.00 22.68 ? 56   LYS A O   1 
ATOM   466  C  CB  . LYS A  1 56 ? 13.284  42.326  178.135 1.00 27.42 ? 56   LYS A CB  1 
ATOM   467  C  CG  . LYS A  1 56 ? 13.453  40.824  178.121 1.00 31.94 ? 56   LYS A CG  1 
ATOM   468  C  CD  . LYS A  1 56 ? 12.222  40.147  178.679 1.00 35.16 ? 56   LYS A CD  1 
ATOM   469  C  CE  . LYS A  1 56 ? 12.536  38.713  179.045 1.00 38.49 ? 56   LYS A CE  1 
ATOM   470  N  NZ  . LYS A  1 56 ? 11.270  37.916  179.147 1.00 41.66 ? 56   LYS A NZ  1 
ATOM   471  N  N   . GLU A  1 57 ? 14.127  43.273  175.202 1.00 21.11 ? 57   GLU A N   1 
ATOM   472  C  CA  . GLU A  1 57 ? 14.361  42.977  173.801 1.00 24.19 ? 57   GLU A CA  1 
ATOM   473  C  C   . GLU A  1 57 ? 15.762  43.413  173.324 1.00 21.67 ? 57   GLU A C   1 
ATOM   474  O  O   . GLU A  1 57 ? 16.379  42.741  172.486 1.00 21.08 ? 57   GLU A O   1 
ATOM   475  C  CB  . GLU A  1 57 ? 13.227  43.617  172.993 1.00 26.40 ? 57   GLU A CB  1 
ATOM   476  C  CG  . GLU A  1 57 ? 13.337  43.494  171.493 1.00 33.05 ? 57   GLU A CG  1 
ATOM   477  C  CD  . GLU A  1 57 ? 12.154  44.128  170.774 1.00 33.77 ? 57   GLU A CD  1 
ATOM   478  O  OE1 . GLU A  1 57 ? 11.085  44.371  171.407 1.00 34.29 ? 57   GLU A OE1 1 
ATOM   479  O  OE2 . GLU A  1 57 ? 12.301  44.369  169.567 1.00 36.79 ? 57   GLU A OE2 1 
ATOM   480  N  N   . LEU A  1 58 ? 16.298  44.514  173.863 1.00 17.19 ? 58   LEU A N   1 
ATOM   481  C  CA  . LEU A  1 58 ? 17.585  45.045  173.351 1.00 17.18 ? 58   LEU A CA  1 
ATOM   482  C  C   . LEU A  1 58 ? 18.806  44.450  174.063 1.00 18.85 ? 58   LEU A C   1 
ATOM   483  O  O   . LEU A  1 58 ? 19.913  44.409  173.499 1.00 17.18 ? 58   LEU A O   1 
ATOM   484  C  CB  . LEU A  1 58 ? 17.646  46.562  173.502 1.00 16.65 ? 58   LEU A CB  1 
ATOM   485  C  CG  . LEU A  1 58 ? 16.548  47.331  172.733 1.00 14.09 ? 58   LEU A CG  1 
ATOM   486  C  CD1 . LEU A  1 58 ? 16.618  48.812  173.141 1.00 17.26 ? 58   LEU A CD1 1 
ATOM   487  C  CD2 . LEU A  1 58 ? 16.697  47.174  171.224 1.00 15.71 ? 58   LEU A CD2 1 
ATOM   488  N  N   . ASP A  1 59 ? 18.593  43.993  175.301 1.00 17.43 ? 59   ASP A N   1 
ATOM   489  C  CA  . ASP A  1 59 ? 19.702  43.472  176.088 1.00 17.05 ? 59   ASP A CA  1 
ATOM   490  C  C   . ASP A  1 59 ? 19.969  42.006  175.737 1.00 13.96 ? 59   ASP A C   1 
ATOM   491  O  O   . ASP A  1 59 ? 19.647  41.093  176.500 1.00 16.24 ? 59   ASP A O   1 
ATOM   492  C  CB  . ASP A  1 59 ? 19.437  43.681  177.584 1.00 16.27 ? 59   ASP A CB  1 
ATOM   493  C  CG  . ASP A  1 59 ? 20.636  43.293  178.430 1.00 16.18 ? 59   ASP A CG  1 
ATOM   494  O  OD1 . ASP A  1 59 ? 21.744  43.141  177.859 1.00 16.11 ? 59   ASP A OD1 1 
ATOM   495  O  OD2 . ASP A  1 59 ? 20.539  43.104  179.648 1.00 17.55 ? 59   ASP A OD2 1 
ATOM   496  N  N   . ILE A  1 60 ? 20.569  41.790  174.567 1.00 14.96 ? 60   ILE A N   1 
ATOM   497  C  CA  . ILE A  1 60 ? 20.795  40.491  173.968 1.00 17.21 ? 60   ILE A CA  1 
ATOM   498  C  C   . ILE A  1 60 ? 21.672  39.601  174.852 1.00 15.88 ? 60   ILE A C   1 
ATOM   499  O  O   . ILE A  1 60 ? 21.421  38.384  174.948 1.00 15.73 ? 60   ILE A O   1 
ATOM   500  C  CB  . ILE A  1 60 ? 21.492  40.691  172.577 1.00 16.09 ? 60   ILE A CB  1 
ATOM   501  C  CG1 . ILE A  1 60 ? 20.590  41.455  171.605 1.00 19.82 ? 60   ILE A CG1 1 
ATOM   502  C  CG2 . ILE A  1 60 ? 21.985  39.396  171.984 1.00 23.03 ? 60   ILE A CG2 1 
ATOM   503  C  CD1 . ILE A  1 60 ? 19.186  40.979  171.652 1.00 23.52 ? 60   ILE A CD1 1 
ATOM   504  N  N   . ASN A  1 61 ? 22.715  40.177  175.455 1.00 15.00 ? 61   ASN A N   1 
ATOM   505  C  CA  . ASN A  1 61 ? 23.617  39.352  176.292 1.00 15.43 ? 61   ASN A CA  1 
ATOM   506  C  C   . ASN A  1 61 ? 23.190  39.293  177.772 1.00 18.54 ? 61   ASN A C   1 
ATOM   507  O  O   . ASN A  1 61 ? 23.889  38.702  178.601 1.00 19.35 ? 61   ASN A O   1 
ATOM   508  C  CB  . ASN A  1 61 ? 25.103  39.769  176.162 1.00 15.68 ? 61   ASN A CB  1 
ATOM   509  C  CG  . ASN A  1 61 ? 25.361  41.159  176.726 1.00 15.57 ? 61   ASN A CG  1 
ATOM   510  O  OD1 . ASN A  1 61 ? 24.459  41.955  176.744 1.00 19.22 ? 61   ASN A OD1 1 
ATOM   511  N  ND2 . ASN A  1 61 ? 26.584  41.441  177.188 1.00 18.23 ? 61   ASN A ND2 1 
ATOM   512  N  N   . THR A  1 62 ? 22.035  39.870  178.094 1.00 18.15 ? 62   THR A N   1 
ATOM   513  C  CA  . THR A  1 62 ? 21.514  39.918  179.477 1.00 19.60 ? 62   THR A CA  1 
ATOM   514  C  C   . THR A  1 62 ? 22.533  40.363  180.521 1.00 19.49 ? 62   THR A C   1 
ATOM   515  O  O   . THR A  1 62 ? 22.660  39.737  181.593 1.00 18.83 ? 62   THR A O   1 
ATOM   516  C  CB  . THR A  1 62 ? 20.819  38.575  179.853 1.00 23.04 ? 62   THR A CB  1 
ATOM   517  O  OG1 . THR A  1 62 ? 21.690  37.464  179.580 1.00 22.04 ? 62   THR A OG1 1 
ATOM   518  C  CG2 . THR A  1 62 ? 19.682  38.307  178.877 1.00 21.75 ? 62   THR A CG2 1 
ATOM   519  N  N   . ASP A  1 63 ? 23.260  41.442  180.219 1.00 16.45 ? 63   ASP A N   1 
ATOM   520  C  CA  . ASP A  1 63 ? 24.206  41.964  181.190 1.00 15.99 ? 63   ASP A CA  1 
ATOM   521  C  C   . ASP A  1 63 ? 23.679  43.219  181.887 1.00 16.98 ? 63   ASP A C   1 
ATOM   522  O  O   . ASP A  1 63 ? 24.424  43.865  182.626 1.00 18.73 ? 63   ASP A O   1 
ATOM   523  C  CB  . ASP A  1 63 ? 25.576  42.203  180.550 1.00 17.85 ? 63   ASP A CB  1 
ATOM   524  C  CG  . ASP A  1 63 ? 25.576  43.335  179.536 1.00 19.20 ? 63   ASP A CG  1 
ATOM   525  O  OD1 . ASP A  1 63 ? 24.485  43.873  179.135 1.00 14.27 ? 63   ASP A OD1 1 
ATOM   526  O  OD2 . ASP A  1 63 ? 26.670  43.727  179.051 1.00 19.84 ? 63   ASP A OD2 1 
ATOM   527  N  N   . GLY A  1 64 ? 22.404  43.559  181.685 1.00 15.31 ? 64   GLY A N   1 
ATOM   528  C  CA  . GLY A  1 64 ? 21.823  44.686  182.423 1.00 16.35 ? 64   GLY A CA  1 
ATOM   529  C  C   . GLY A  1 64 ? 22.120  46.058  181.829 1.00 19.37 ? 64   GLY A C   1 
ATOM   530  O  O   . GLY A  1 64 ? 21.895  47.091  182.492 1.00 17.96 ? 64   GLY A O   1 
ATOM   531  N  N   . ALA A  1 65 ? 22.613  46.069  180.591 1.00 17.11 ? 65   ALA A N   1 
ATOM   532  C  CA  . ALA A  1 65 ? 22.844  47.317  179.862 1.00 18.46 ? 65   ALA A CA  1 
ATOM   533  C  C   . ALA A  1 65 ? 22.584  47.151  178.372 1.00 15.82 ? 65   ALA A C   1 
ATOM   534  O  O   . ALA A  1 65 ? 22.648  46.041  177.848 1.00 15.65 ? 65   ALA A O   1 
ATOM   535  C  CB  . ALA A  1 65 ? 24.259  47.800  180.060 1.00 18.70 ? 65   ALA A CB  1 
ATOM   536  N  N   . VAL A  1 66 ? 22.347  48.282  177.706 1.00 15.72 ? 66   VAL A N   1 
ATOM   537  C  CA  . VAL A  1 66 ? 22.218  48.319  176.260 1.00 16.34 ? 66   VAL A CA  1 
ATOM   538  C  C   . VAL A  1 66 ? 23.454  49.017  175.718 1.00 14.58 ? 66   VAL A C   1 
ATOM   539  O  O   . VAL A  1 66 ? 23.671  50.202  175.993 1.00 16.01 ? 66   VAL A O   1 
ATOM   540  C  CB  . VAL A  1 66 ? 20.953  49.097  175.892 1.00 14.42 ? 66   VAL A CB  1 
ATOM   541  C  CG1 . VAL A  1 66 ? 20.892  49.418  174.370 1.00 17.24 ? 66   VAL A CG1 1 
ATOM   542  C  CG2 . VAL A  1 66 ? 19.675  48.351  176.374 1.00 17.17 ? 66   VAL A CG2 1 
ATOM   543  N  N   . ASN A  1 67 ? 24.272  48.292  174.975 1.00 14.47 ? 67   ASN A N   1 
ATOM   544  C  CA  . ASN A  1 67 ? 25.484  48.846  174.359 1.00 16.32 ? 67   ASN A CA  1 
ATOM   545  C  C   . ASN A  1 67 ? 25.152  49.455  172.982 1.00 15.72 ? 67   ASN A C   1 
ATOM   546  O  O   . ASN A  1 67 ? 23.994  49.433  172.569 1.00 16.49 ? 67   ASN A O   1 
ATOM   547  C  CB  . ASN A  1 67 ? 26.637  47.804  174.339 1.00 15.55 ? 67   ASN A CB  1 
ATOM   548  C  CG  . ASN A  1 67 ? 26.421  46.651  173.347 1.00 16.82 ? 67   ASN A CG  1 
ATOM   549  O  OD1 . ASN A  1 67 ? 25.631  46.750  172.415 1.00 15.99 ? 67   ASN A OD1 1 
ATOM   550  N  ND2 . ASN A  1 67 ? 27.171  45.541  173.542 1.00 18.05 ? 67   ASN A ND2 1 
ATOM   551  N  N   . PHE A  1 68 ? 26.119  50.016  172.273 1.00 16.27 ? 68   PHE A N   1 
ATOM   552  C  CA  . PHE A  1 68 ? 25.752  50.726  171.041 1.00 16.83 ? 68   PHE A CA  1 
ATOM   553  C  C   . PHE A  1 68 ? 25.198  49.785  169.958 1.00 17.13 ? 68   PHE A C   1 
ATOM   554  O  O   . PHE A  1 68 ? 24.188  50.101  169.314 1.00 18.00 ? 68   PHE A O   1 
ATOM   555  C  CB  . PHE A  1 68 ? 26.898  51.578  170.503 1.00 16.88 ? 68   PHE A CB  1 
ATOM   556  C  CG  . PHE A  1 68 ? 26.545  52.320  169.252 1.00 18.08 ? 68   PHE A CG  1 
ATOM   557  C  CD1 . PHE A  1 68 ? 25.667  53.377  169.286 1.00 19.09 ? 68   PHE A CD1 1 
ATOM   558  C  CD2 . PHE A  1 68 ? 27.066  51.922  168.016 1.00 20.73 ? 68   PHE A CD2 1 
ATOM   559  C  CE1 . PHE A  1 68 ? 25.327  54.060  168.118 1.00 19.33 ? 68   PHE A CE1 1 
ATOM   560  C  CE2 . PHE A  1 68 ? 26.733  52.616  166.858 1.00 21.07 ? 68   PHE A CE2 1 
ATOM   561  C  CZ  . PHE A  1 68 ? 25.858  53.658  166.909 1.00 20.31 ? 68   PHE A CZ  1 
ATOM   562  N  N   . GLN A  1 69 ? 25.771  48.586  169.837 1.00 17.95 ? 69   GLN A N   1 
ATOM   563  C  CA  . GLN A  1 69 ? 25.242  47.646  168.845 1.00 21.47 ? 69   GLN A CA  1 
ATOM   564  C  C   . GLN A  1 69 ? 23.829  47.167  169.170 1.00 19.46 ? 69   GLN A C   1 
ATOM   565  O  O   . GLN A  1 69 ? 22.988  46.977  168.281 1.00 16.74 ? 69   GLN A O   1 
ATOM   566  C  CB  . GLN A  1 69 ? 26.222  46.509  168.578 1.00 24.70 ? 69   GLN A CB  1 
ATOM   567  C  CG  . GLN A  1 69 ? 26.544  45.688  169.786 1.00 31.69 ? 69   GLN A CG  1 
ATOM   568  C  CD  . GLN A  1 69 ? 27.823  44.897  169.622 1.00 37.04 ? 69   GLN A CD  1 
ATOM   569  O  OE1 . GLN A  1 69 ? 28.827  45.179  170.293 1.00 38.75 ? 69   GLN A OE1 1 
ATOM   570  N  NE2 . GLN A  1 69 ? 27.788  43.888  168.736 1.00 38.45 ? 69   GLN A NE2 1 
ATOM   571  N  N   . GLU A  1 70 ? 23.538  47.004  170.453 1.00 16.53 ? 70   GLU A N   1 
ATOM   572  C  CA  . GLU A  1 70 ? 22.181  46.692  170.893 1.00 16.97 ? 70   GLU A CA  1 
ATOM   573  C  C   . GLU A  1 70 ? 21.210  47.847  170.628 1.00 17.24 ? 70   GLU A C   1 
ATOM   574  O  O   . GLU A  1 70 ? 20.098  47.611  170.158 1.00 17.24 ? 70   GLU A O   1 
ATOM   575  C  CB  . GLU A  1 70 ? 22.174  46.298  172.369 1.00 15.50 ? 70   GLU A CB  1 
ATOM   576  C  CG  . GLU A  1 70 ? 22.880  44.971  172.626 1.00 17.04 ? 70   GLU A CG  1 
ATOM   577  C  CD  . GLU A  1 70 ? 23.189  44.688  174.100 1.00 15.29 ? 70   GLU A CD  1 
ATOM   578  O  OE1 . GLU A  1 70 ? 23.494  45.613  174.902 1.00 15.90 ? 70   GLU A OE1 1 
ATOM   579  O  OE2 . GLU A  1 70 ? 23.099  43.517  174.505 1.00 15.96 ? 70   GLU A OE2 1 
ATOM   580  N  N   . PHE A  1 71 ? 21.633  49.080  170.896 1.00 17.44 ? 71   PHE A N   1 
ATOM   581  C  CA  . PHE A  1 71 ? 20.833  50.267  170.576 1.00 15.07 ? 71   PHE A CA  1 
ATOM   582  C  C   . PHE A  1 71 ? 20.471  50.310  169.071 1.00 17.04 ? 71   PHE A C   1 
ATOM   583  O  O   . PHE A  1 71 ? 19.401  50.771  168.684 1.00 16.41 ? 71   PHE A O   1 
ATOM   584  C  CB  . PHE A  1 71 ? 21.646  51.505  170.972 1.00 15.91 ? 71   PHE A CB  1 
ATOM   585  C  CG  . PHE A  1 71 ? 21.096  52.817  170.470 1.00 16.02 ? 71   PHE A CG  1 
ATOM   586  C  CD1 . PHE A  1 71 ? 19.899  53.318  170.940 1.00 18.57 ? 71   PHE A CD1 1 
ATOM   587  C  CD2 . PHE A  1 71 ? 21.810  53.553  169.559 1.00 18.31 ? 71   PHE A CD2 1 
ATOM   588  C  CE1 . PHE A  1 71 ? 19.438  54.548  170.499 1.00 19.09 ? 71   PHE A CE1 1 
ATOM   589  C  CE2 . PHE A  1 71 ? 21.337  54.787  169.093 1.00 20.58 ? 71   PHE A CE2 1 
ATOM   590  C  CZ  . PHE A  1 71 ? 20.174  55.282  169.575 1.00 17.53 ? 71   PHE A CZ  1 
ATOM   591  N  N   . LEU A  1 72 ? 21.356  49.817  168.214 1.00 16.87 ? 72   LEU A N   1 
ATOM   592  C  CA  . LEU A  1 72 ? 21.068  49.816  166.766 1.00 18.48 ? 72   LEU A CA  1 
ATOM   593  C  C   . LEU A  1 72 ? 19.873  48.939  166.409 1.00 17.49 ? 72   LEU A C   1 
ATOM   594  O  O   . LEU A  1 72 ? 19.238  49.145  165.380 1.00 15.94 ? 72   LEU A O   1 
ATOM   595  C  CB  . LEU A  1 72 ? 22.294  49.430  165.933 1.00 18.28 ? 72   LEU A CB  1 
ATOM   596  C  CG  . LEU A  1 72 ? 23.400  50.516  165.876 1.00 20.08 ? 72   LEU A CG  1 
ATOM   597  C  CD1 . LEU A  1 72 ? 24.585  49.971  165.117 1.00 20.66 ? 72   LEU A CD1 1 
ATOM   598  C  CD2 . LEU A  1 72 ? 22.952  51.831  165.212 1.00 23.16 ? 72   LEU A CD2 1 
ATOM   599  N  N   . ILE A  1 73 ? 19.542  47.954  167.244 1.00 16.31 ? 73   ILE A N   1 
ATOM   600  C  CA  . ILE A  1 73 ? 18.304  47.237  167.014 1.00 16.82 ? 73   ILE A CA  1 
ATOM   601  C  C   . ILE A  1 73 ? 17.074  48.158  167.099 1.00 17.10 ? 73   ILE A C   1 
ATOM   602  O  O   . ILE A  1 73 ? 16.175  48.102  166.264 1.00 17.08 ? 73   ILE A O   1 
ATOM   603  C  CB  . ILE A  1 73 ? 18.171  46.095  168.039 1.00 17.01 ? 73   ILE A CB  1 
ATOM   604  C  CG1 . ILE A  1 73 ? 19.261  45.045  167.812 1.00 18.69 ? 73   ILE A CG1 1 
ATOM   605  C  CG2 . ILE A  1 73 ? 16.755  45.486  168.025 1.00 18.85 ? 73   ILE A CG2 1 
ATOM   606  C  CD1 . ILE A  1 73 ? 19.235  43.949  168.883 1.00 17.82 ? 73   ILE A CD1 1 
ATOM   607  N  N   . LEU A  1 74 ? 17.053  48.999  168.123 1.00 16.11 ? 74   LEU A N   1 
ATOM   608  C  CA  . LEU A  1 74 ? 15.997  49.989  168.308 1.00 14.65 ? 74   LEU A CA  1 
ATOM   609  C  C   . LEU A  1 74 ? 16.010  50.924  167.113 1.00 16.37 ? 74   LEU A C   1 
ATOM   610  O  O   . LEU A  1 74 ? 14.951  51.269  166.616 1.00 16.87 ? 74   LEU A O   1 
ATOM   611  C  CB  . LEU A  1 74 ? 16.316  50.806  169.589 1.00 13.75 ? 74   LEU A CB  1 
ATOM   612  C  CG  . LEU A  1 74 ? 15.344  51.955  169.824 1.00 17.88 ? 74   LEU A CG  1 
ATOM   613  C  CD1 . LEU A  1 74 ? 13.930  51.377  169.892 1.00 18.66 ? 74   LEU A CD1 1 
ATOM   614  C  CD2 . LEU A  1 74 ? 15.772  52.647  171.132 1.00 18.27 ? 74   LEU A CD2 1 
ATOM   615  N  N   . VAL A  1 75 ? 17.186  51.390  166.677 1.00 16.47 ? 75   VAL A N   1 
ATOM   616  C  CA  . VAL A  1 75 ? 17.232  52.347  165.538 1.00 15.52 ? 75   VAL A CA  1 
ATOM   617  C  C   . VAL A  1 75 ? 16.646  51.720  164.274 1.00 14.23 ? 75   VAL A C   1 
ATOM   618  O  O   . VAL A  1 75 ? 15.855  52.356  163.558 1.00 14.15 ? 75   VAL A O   1 
ATOM   619  C  CB  . VAL A  1 75 ? 18.670  52.823  165.335 1.00 13.48 ? 75   VAL A CB  1 
ATOM   620  C  CG1 . VAL A  1 75 ? 18.817  53.675  164.067 1.00 15.74 ? 75   VAL A CG1 1 
ATOM   621  C  CG2 . VAL A  1 75 ? 19.087  53.631  166.575 1.00 12.59 ? 75   VAL A CG2 1 
ATOM   622  N  N   . ILE A  1 76 ? 17.046  50.477  163.989 1.00 15.58 ? 76   ILE A N   1 
ATOM   623  C  CA  . ILE A  1 76 ? 16.500  49.729  162.835 1.00 14.58 ? 76   ILE A CA  1 
ATOM   624  C  C   . ILE A  1 76 ? 14.973  49.618  162.920 1.00 16.07 ? 76   ILE A C   1 
ATOM   625  O  O   . ILE A  1 76 ? 14.284  49.949  161.960 1.00 17.12 ? 76   ILE A O   1 
ATOM   626  C  CB  . ILE A  1 76 ? 17.209  48.352  162.661 1.00 15.13 ? 76   ILE A CB  1 
ATOM   627  C  CG1 . ILE A  1 76 ? 18.682  48.564  162.294 1.00 16.75 ? 76   ILE A CG1 1 
ATOM   628  C  CG2 . ILE A  1 76 ? 16.514  47.463  161.609 1.00 13.00 ? 76   ILE A CG2 1 
ATOM   629  C  CD1 . ILE A  1 76 ? 19.541  47.249  162.379 1.00 16.85 ? 76   ILE A CD1 1 
ATOM   630  N  N   . LYS A  1 77 ? 14.440  49.165  164.062 1.00 14.07 ? 77   LYS A N   1 
ATOM   631  C  CA  . LYS A  1 77 ? 13.000  49.018  164.212 1.00 17.90 ? 77   LYS A CA  1 
ATOM   632  C  C   . LYS A  1 77 ? 12.270  50.352  164.067 1.00 17.99 ? 77   LYS A C   1 
ATOM   633  O  O   . LYS A  1 77 ? 11.174  50.379  163.521 1.00 16.79 ? 77   LYS A O   1 
ATOM   634  C  CB  . LYS A  1 77 ? 12.652  48.382  165.565 1.00 18.13 ? 77   LYS A CB  1 
ATOM   635  C  CG  . LYS A  1 77 ? 13.142  46.929  165.697 1.00 22.70 ? 77   LYS A CG  1 
ATOM   636  C  CD  . LYS A  1 77 ? 12.273  46.000  164.930 1.00 26.41 ? 77   LYS A CD  1 
ATOM   637  C  CE  . LYS A  1 77 ? 12.610  44.529  165.260 1.00 29.78 ? 77   LYS A CE  1 
ATOM   638  N  NZ  . LYS A  1 77 ? 13.165  44.466  166.632 1.00 31.23 ? 77   LYS A NZ  1 
ATOM   639  N  N   . MET A  1 78 ? 12.866  51.436  164.578 1.00 18.60 ? 78   MET A N   1 
ATOM   640  C  CA  . MET A  1 78 ? 12.242  52.754  164.513 1.00 18.95 ? 78   MET A CA  1 
ATOM   641  C  C   . MET A  1 78 ? 12.257  53.242  163.067 1.00 18.89 ? 78   MET A C   1 
ATOM   642  O  O   . MET A  1 78 ? 11.280  53.863  162.610 1.00 19.83 ? 78   MET A O   1 
ATOM   643  C  CB  . MET A  1 78 ? 12.965  53.784  165.409 1.00 20.09 ? 78   MET A CB  1 
ATOM   644  C  CG  . MET A  1 78 ? 12.653  53.642  166.897 1.00 20.20 ? 78   MET A CG  1 
ATOM   645  S  SD  . MET A  1 78 ? 13.552  54.934  167.838 1.00 25.61 ? 78   MET A SD  1 
ATOM   646  C  CE  . MET A  1 78 ? 13.145  56.348  166.820 1.00 16.08 ? 78   MET A CE  1 
ATOM   647  N  N   . GLY A  1 79 ? 13.343  52.961  162.347 1.00 18.59 ? 79   GLY A N   1 
ATOM   648  C  CA  . GLY A  1 79 ? 13.427  53.360  160.936 1.00 15.55 ? 79   GLY A CA  1 
ATOM   649  C  C   . GLY A  1 79 ? 12.424  52.622  160.061 1.00 18.07 ? 79   GLY A C   1 
ATOM   650  O  O   . GLY A  1 79 ? 11.753  53.227  159.197 1.00 17.24 ? 79   GLY A O   1 
ATOM   651  N  N   . VAL A  1 80 ? 12.306  51.310  160.276 1.00 17.52 ? 80   VAL A N   1 
ATOM   652  C  CA  . VAL A  1 80 ? 11.369  50.470  159.507 1.00 17.14 ? 80   VAL A CA  1 
ATOM   653  C  C   . VAL A  1 80 ? 9.929   50.932  159.779 1.00 17.66 ? 80   VAL A C   1 
ATOM   654  O  O   . VAL A  1 80 ? 9.133   51.081  158.852 1.00 17.92 ? 80   VAL A O   1 
ATOM   655  C  CB  . VAL A  1 80 ? 11.538  48.964  159.833 1.00 17.06 ? 80   VAL A CB  1 
ATOM   656  C  CG1 . VAL A  1 80 ? 10.339  48.142  159.292 1.00 16.30 ? 80   VAL A CG1 1 
ATOM   657  C  CG2 . VAL A  1 80 ? 12.883  48.436  159.242 1.00 17.22 ? 80   VAL A CG2 1 
ATOM   658  N  N   . ALA A  1 81 ? 9.613   51.204  161.048 1.00 17.94 ? 81   ALA A N   1 
ATOM   659  C  CA  . ALA A  1 81 ? 8.269   51.641  161.439 1.00 17.56 ? 81   ALA A CA  1 
ATOM   660  C  C   . ALA A  1 81 ? 7.948   53.031  160.908 1.00 18.01 ? 81   ALA A C   1 
ATOM   661  O  O   . ALA A  1 81 ? 6.845   53.270  160.402 1.00 20.55 ? 81   ALA A O   1 
ATOM   662  C  CB  . ALA A  1 81 ? 8.135   51.641  162.928 1.00 17.42 ? 81   ALA A CB  1 
ATOM   663  N  N   . ALA A  1 82 ? 8.901   53.945  161.056 1.00 19.08 ? 82   ALA A N   1 
ATOM   664  C  CA  . ALA A  1 82 ? 8.779   55.305  160.498 1.00 19.80 ? 82   ALA A CA  1 
ATOM   665  C  C   . ALA A  1 82 ? 8.592   55.245  159.000 1.00 20.68 ? 82   ALA A C   1 
ATOM   666  O  O   . ALA A  1 82 ? 7.746   55.978  158.424 1.00 22.62 ? 82   ALA A O   1 
ATOM   667  C  CB  . ALA A  1 82 ? 10.040  56.153  160.831 1.00 21.29 ? 82   ALA A CB  1 
ATOM   668  N  N   . HIS A  1 83 ? 9.370   54.400  158.332 1.00 18.58 ? 83   HIS A N   1 
ATOM   669  C  CA  . HIS A  1 83 ? 9.188   54.283  156.877 1.00 20.32 ? 83   HIS A CA  1 
ATOM   670  C  C   . HIS A  1 83 ? 7.782   53.808  156.444 1.00 22.61 ? 83   HIS A C   1 
ATOM   671  O  O   . HIS A  1 83 ? 7.199   54.339  155.503 1.00 19.52 ? 83   HIS A O   1 
ATOM   672  C  CB  . HIS A  1 83 ? 10.265  53.440  156.220 1.00 19.40 ? 83   HIS A CB  1 
ATOM   673  C  CG  . HIS A  1 83 ? 9.966   53.138  154.780 1.00 19.37 ? 83   HIS A CG  1 
ATOM   674  N  ND1 . HIS A  1 83 ? 9.390   51.954  154.374 1.00 19.76 ? 83   HIS A ND1 1 
ATOM   675  C  CD2 . HIS A  1 83 ? 10.135  53.880  153.663 1.00 19.03 ? 83   HIS A CD2 1 
ATOM   676  C  CE1 . HIS A  1 83 ? 9.219   51.981  153.061 1.00 20.71 ? 83   HIS A CE1 1 
ATOM   677  N  NE2 . HIS A  1 83 ? 9.670   53.136  152.604 1.00 18.05 ? 83   HIS A NE2 1 
ATOM   678  N  N   . LYS A  1 84 ? 7.259   52.818  157.150 1.00 23.71 ? 84   LYS A N   1 
ATOM   679  C  CA  . LYS A  1 84 ? 5.886   52.368  157.005 1.00 29.05 ? 84   LYS A CA  1 
ATOM   680  C  C   . LYS A  1 84 ? 4.899   53.519  157.146 1.00 30.77 ? 84   LYS A C   1 
ATOM   681  O  O   . LYS A  1 84 ? 4.032   53.693  156.289 1.00 29.85 ? 84   LYS A O   1 
ATOM   682  C  CB  . LYS A  1 84 ? 5.564   51.312  158.064 1.00 32.15 ? 84   LYS A CB  1 
ATOM   683  C  CG  . LYS A  1 84 ? 5.388   49.918  157.544 1.00 37.83 ? 84   LYS A CG  1 
ATOM   684  C  CD  . LYS A  1 84 ? 5.140   48.946  158.698 1.00 41.64 ? 84   LYS A CD  1 
ATOM   685  C  CE  . LYS A  1 84 ? 4.174   47.826  158.302 1.00 44.99 ? 84   LYS A CE  1 
ATOM   686  N  NZ  . LYS A  1 84 ? 4.304   46.591  159.167 1.00 46.62 ? 84   LYS A NZ  1 
ATOM   687  N  N   . LYS A  1 85 ? 5.021   54.288  158.225 1.00 32.45 ? 85   LYS A N   1 
ATOM   688  C  CA  . LYS A  1 85 ? 4.128   55.416  158.491 1.00 36.02 ? 85   LYS A CA  1 
ATOM   689  C  C   . LYS A  1 85 ? 4.179   56.449  157.368 1.00 37.51 ? 85   LYS A C   1 
ATOM   690  O  O   . LYS A  1 85 ? 3.140   56.949  156.932 1.00 37.73 ? 85   LYS A O   1 
ATOM   691  C  CB  . LYS A  1 85 ? 4.486   56.116  159.814 1.00 37.74 ? 85   LYS A CB  1 
ATOM   692  C  CG  . LYS A  1 85 ? 4.413   55.258  161.060 1.00 41.34 ? 85   LYS A CG  1 
ATOM   693  C  CD  . LYS A  1 85 ? 3.011   55.165  161.621 1.00 43.90 ? 85   LYS A CD  1 
ATOM   694  C  CE  . LYS A  1 85 ? 2.951   54.141  162.741 1.00 45.33 ? 85   LYS A CE  1 
ATOM   695  N  NZ  . LYS A  1 85 ? 1.557   54.021  163.243 1.00 47.59 ? 85   LYS A NZ  1 
ATOM   696  N  N   . SER A  1 86 ? 5.378   56.782  156.899 1.00 38.93 ? 86   SER A N   1 
ATOM   697  C  CA  . SER A  1 86 ? 5.495   57.865  155.930 1.00 43.22 ? 86   SER A CA  1 
ATOM   698  C  C   . SER A  1 86 ? 4.802   57.544  154.604 1.00 46.82 ? 86   SER A C   1 
ATOM   699  O  O   . SER A  1 86 ? 4.599   58.427  153.767 1.00 45.55 ? 86   SER A O   1 
ATOM   700  C  CB  . SER A  1 86 ? 6.941   58.312  155.724 1.00 44.34 ? 86   SER A CB  1 
ATOM   701  O  OG  . SER A  1 86 ? 7.591   57.513  154.758 1.00 47.35 ? 86   SER A OG  1 
ATOM   702  N  N   . HIS A  1 87 ? 4.408   56.291  154.406 1.00 50.65 ? 87   HIS A N   1 
ATOM   703  C  CA  . HIS A  1 87 ? 3.382   56.048  153.392 1.00 55.04 ? 87   HIS A CA  1 
ATOM   704  C  C   . HIS A  1 87 ? 2.287   55.087  153.853 1.00 56.54 ? 87   HIS A C   1 
ATOM   705  O  O   . HIS A  1 87 ? 2.090   54.016  153.290 1.00 58.01 ? 87   HIS A O   1 
ATOM   706  C  CB  . HIS A  1 87 ? 3.980   55.715  152.020 1.00 56.63 ? 87   HIS A CB  1 
ATOM   707  C  CG  . HIS A  1 87 ? 4.483   54.313  151.883 1.00 58.12 ? 87   HIS A CG  1 
ATOM   708  N  ND1 . HIS A  1 87 ? 5.320   53.730  152.805 1.00 58.18 ? 87   HIS A ND1 1 
ATOM   709  C  CD2 . HIS A  1 87 ? 4.294   53.394  150.906 1.00 58.59 ? 87   HIS A CD2 1 
ATOM   710  C  CE1 . HIS A  1 87 ? 5.606   52.499  152.415 1.00 59.34 ? 87   HIS A CE1 1 
ATOM   711  N  NE2 . HIS A  1 87 ? 4.996   52.270  151.265 1.00 59.04 ? 87   HIS A NE2 1 
ATOM   712  N  N   . MET B  1 1  ? 49.492  29.395  163.221 1.00 44.72 ? 1    MET B N   1 
ATOM   713  C  CA  . MET B  1 1  ? 48.625  28.539  164.070 1.00 44.13 ? 1    MET B CA  1 
ATOM   714  C  C   . MET B  1 1  ? 47.584  29.370  164.814 1.00 38.02 ? 1    MET B C   1 
ATOM   715  O  O   . MET B  1 1  ? 47.926  30.089  165.755 1.00 38.12 ? 1    MET B O   1 
ATOM   716  C  CB  . MET B  1 1  ? 49.479  27.790  165.088 1.00 46.52 ? 1    MET B CB  1 
ATOM   717  C  CG  . MET B  1 1  ? 49.750  26.330  164.759 1.00 50.19 ? 1    MET B CG  1 
ATOM   718  S  SD  . MET B  1 1  ? 50.017  25.347  166.263 1.00 52.95 ? 1    MET B SD  1 
ATOM   719  C  CE  . MET B  1 1  ? 51.271  26.306  167.151 1.00 52.45 ? 1    MET B CE  1 
ATOM   720  N  N   . LEU B  1 2  ? 46.323  29.293  164.392 1.00 31.89 ? 2    LEU B N   1 
ATOM   721  C  CA  . LEU B  1 2  ? 45.223  29.831  165.195 1.00 27.18 ? 2    LEU B CA  1 
ATOM   722  C  C   . LEU B  1 2  ? 45.108  29.001  166.472 1.00 24.84 ? 2    LEU B C   1 
ATOM   723  O  O   . LEU B  1 2  ? 45.371  27.786  166.462 1.00 24.39 ? 2    LEU B O   1 
ATOM   724  C  CB  . LEU B  1 2  ? 43.903  29.802  164.419 1.00 26.05 ? 2    LEU B CB  1 
ATOM   725  C  CG  . LEU B  1 2  ? 43.361  31.064  163.734 1.00 27.47 ? 2    LEU B CG  1 
ATOM   726  C  CD1 . LEU B  1 2  ? 44.458  32.034  163.291 1.00 27.02 ? 2    LEU B CD1 1 
ATOM   727  C  CD2 . LEU B  1 2  ? 42.455  30.676  162.581 1.00 24.54 ? 2    LEU B CD2 1 
ATOM   728  N  N   . THR B  1 3  ? 44.710  29.651  167.564 1.00 21.84 ? 3    THR B N   1 
ATOM   729  C  CA  . THR B  1 3  ? 44.426  28.933  168.802 1.00 20.75 ? 3    THR B CA  1 
ATOM   730  C  C   . THR B  1 3  ? 43.099  28.187  168.708 1.00 20.15 ? 3    THR B C   1 
ATOM   731  O  O   . THR B  1 3  ? 42.283  28.406  167.806 1.00 19.66 ? 3    THR B O   1 
ATOM   732  C  CB  . THR B  1 3  ? 44.336  29.893  169.976 1.00 21.29 ? 3    THR B CB  1 
ATOM   733  O  OG1 . THR B  1 3  ? 43.091  30.602  169.869 1.00 21.32 ? 3    THR B OG1 1 
ATOM   734  C  CG2 . THR B  1 3  ? 45.386  31.002  169.864 1.00 20.55 ? 3    THR B CG2 1 
ATOM   735  N  N   . GLU B  1 4  ? 42.863  27.313  169.675 1.00 20.04 ? 4    GLU B N   1 
ATOM   736  C  CA  . GLU B  1 4  ? 41.597  26.596  169.719 1.00 20.67 ? 4    GLU B CA  1 
ATOM   737  C  C   . GLU B  1 4  ? 40.388  27.543  169.864 1.00 17.24 ? 4    GLU B C   1 
ATOM   738  O  O   . GLU B  1 4  ? 39.364  27.320  169.264 1.00 17.48 ? 4    GLU B O   1 
ATOM   739  C  CB  . GLU B  1 4  ? 41.597  25.565  170.840 1.00 22.72 ? 4    GLU B CB  1 
ATOM   740  C  CG  . GLU B  1 4  ? 42.713  24.520  170.803 1.00 26.46 ? 4    GLU B CG  1 
ATOM   741  C  CD  . GLU B  1 4  ? 43.019  23.972  169.426 1.00 29.46 ? 4    GLU B CD  1 
ATOM   742  O  OE1 . GLU B  1 4  ? 42.084  23.625  168.648 1.00 30.13 ? 4    GLU B OE1 1 
ATOM   743  O  OE2 . GLU B  1 4  ? 44.240  23.875  169.130 1.00 32.67 ? 4    GLU B OE2 1 
ATOM   744  N  N   . LEU B  1 5  ? 40.508  28.594  170.662 1.00 18.98 ? 5    LEU B N   1 
ATOM   745  C  CA  . LEU B  1 5  ? 39.444  29.580  170.785 1.00 19.19 ? 5    LEU B CA  1 
ATOM   746  C  C   . LEU B  1 5  ? 39.168  30.295  169.453 1.00 18.92 ? 5    LEU B C   1 
ATOM   747  O  O   . LEU B  1 5  ? 38.016  30.476  169.040 1.00 19.16 ? 5    LEU B O   1 
ATOM   748  C  CB  . LEU B  1 5  ? 39.894  30.623  171.800 1.00 21.32 ? 5    LEU B CB  1 
ATOM   749  C  CG  . LEU B  1 5  ? 38.823  31.353  172.610 1.00 24.19 ? 5    LEU B CG  1 
ATOM   750  C  CD1 . LEU B  1 5  ? 39.222  32.783  172.980 1.00 22.69 ? 5    LEU B CD1 1 
ATOM   751  C  CD2 . LEU B  1 5  ? 37.440  31.302  172.063 1.00 23.00 ? 5    LEU B CD2 1 
ATOM   752  N  N   . GLU B  1 6  ? 40.230  30.722  168.768 1.00 19.00 ? 6    GLU B N   1 
ATOM   753  C  CA  . GLU B  1 6  ? 40.067  31.372  167.461 1.00 19.25 ? 6    GLU B CA  1 
ATOM   754  C  C   . GLU B  1 6  ? 39.425  30.466  166.395 1.00 19.36 ? 6    GLU B C   1 
ATOM   755  O  O   . GLU B  1 6  ? 38.544  30.882  165.616 1.00 19.14 ? 6    GLU B O   1 
ATOM   756  C  CB  . GLU B  1 6  ? 41.430  31.908  166.998 1.00 19.70 ? 6    GLU B CB  1 
ATOM   757  C  CG  . GLU B  1 6  ? 41.920  33.055  167.887 1.00 20.48 ? 6    GLU B CG  1 
ATOM   758  C  CD  . GLU B  1 6  ? 43.395  33.387  167.702 1.00 22.92 ? 6    GLU B CD  1 
ATOM   759  O  OE1 . GLU B  1 6  ? 43.782  34.489  168.110 1.00 22.26 ? 6    GLU B OE1 1 
ATOM   760  O  OE2 . GLU B  1 6  ? 44.174  32.564  167.163 1.00 22.25 ? 6    GLU B OE2 1 
ATOM   761  N  N   . LYS B  1 7  ? 39.818  29.201  166.409 1.00 18.23 ? 7    LYS B N   1 
ATOM   762  C  CA  . LYS B  1 7  ? 39.250  28.227  165.515 1.00 19.15 ? 7    LYS B CA  1 
ATOM   763  C  C   . LYS B  1 7  ? 37.777  27.980  165.827 1.00 17.78 ? 7    LYS B C   1 
ATOM   764  O  O   . LYS B  1 7  ? 37.006  27.824  164.894 1.00 17.76 ? 7    LYS B O   1 
ATOM   765  C  CB  . LYS B  1 7  ? 40.066  26.926  165.582 1.00 21.57 ? 7    LYS B CB  1 
ATOM   766  C  CG  . LYS B  1 7  ? 41.386  27.036  164.831 1.00 24.68 ? 7    LYS B CG  1 
ATOM   767  C  CD  . LYS B  1 7  ? 42.368  25.944  165.220 1.00 29.94 ? 7    LYS B CD  1 
ATOM   768  C  CE  . LYS B  1 7  ? 41.788  24.561  165.043 1.00 33.56 ? 7    LYS B CE  1 
ATOM   769  N  NZ  . LYS B  1 7  ? 42.800  23.517  165.409 1.00 37.32 ? 7    LYS B NZ  1 
ATOM   770  N  N   . ALA B  1 8  ? 37.394  27.991  167.109 1.00 18.10 ? 8    ALA B N   1 
ATOM   771  C  CA  . ALA B  1 8  ? 35.976  27.917  167.508 1.00 14.48 ? 8    ALA B CA  1 
ATOM   772  C  C   . ALA B  1 8  ? 35.185  29.108  166.970 1.00 15.52 ? 8    ALA B C   1 
ATOM   773  O  O   . ALA B  1 8  ? 34.108  28.919  166.437 1.00 16.41 ? 8    ALA B O   1 
ATOM   774  C  CB  . ALA B  1 8  ? 35.802  27.828  169.042 1.00 17.03 ? 8    ALA B CB  1 
ATOM   775  N  N   . LEU B  1 9  ? 35.721  30.320  167.075 1.00 18.02 ? 9    LEU B N   1 
ATOM   776  C  CA  . LEU B  1 9  ? 35.058  31.509  166.475 1.00 18.41 ? 9    LEU B CA  1 
ATOM   777  C  C   . LEU B  1 9  ? 34.913  31.394  164.953 1.00 18.68 ? 9    LEU B C   1 
ATOM   778  O  O   . LEU B  1 9  ? 33.840  31.673  164.411 1.00 19.66 ? 9    LEU B O   1 
ATOM   779  C  CB  . LEU B  1 9  ? 35.807  32.800  166.832 1.00 17.69 ? 9    LEU B CB  1 
ATOM   780  C  CG  . LEU B  1 9  ? 35.932  33.074  168.344 1.00 18.22 ? 9    LEU B CG  1 
ATOM   781  C  CD1 . LEU B  1 9  ? 36.408  34.506  168.551 1.00 18.20 ? 9    LEU B CD1 1 
ATOM   782  C  CD2 . LEU B  1 9  ? 34.623  32.824  169.079 1.00 19.04 ? 9    LEU B CD2 1 
ATOM   783  N  N   . ASN B  1 10 ? 35.940  30.907  164.265 1.00 18.15 ? 10   ASN B N   1 
ATOM   784  C  CA  . ASN B  1 10 ? 35.845  30.758  162.812 1.00 19.08 ? 10   ASN B CA  1 
ATOM   785  C  C   . ASN B  1 10 ? 34.865  29.660  162.427 1.00 19.19 ? 10   ASN B C   1 
ATOM   786  O  O   . ASN B  1 10 ? 34.210  29.738  161.390 1.00 20.84 ? 10   ASN B O   1 
ATOM   787  C  CB  . ASN B  1 10 ? 37.217  30.523  162.186 1.00 20.60 ? 10   ASN B CB  1 
ATOM   788  C  CG  . ASN B  1 10 ? 37.984  31.814  162.001 1.00 21.11 ? 10   ASN B CG  1 
ATOM   789  O  OD1 . ASN B  1 10 ? 37.431  32.901  162.128 1.00 21.77 ? 10   ASN B OD1 1 
ATOM   790  N  ND2 . ASN B  1 10 ? 39.271  31.700  161.700 1.00 23.16 ? 10   ASN B ND2 1 
ATOM   791  N  N   . SER B  1 11 ? 34.714  28.682  163.317 1.00 18.11 ? 11   SER B N   1 
ATOM   792  C  CA  . SER B  1 11 ? 33.847  27.557  163.072 1.00 18.29 ? 11   SER B CA  1 
ATOM   793  C  C   . SER B  1 11 ? 32.402  28.007  163.152 1.00 18.73 ? 11   SER B C   1 
ATOM   794  O  O   . SER B  1 11 ? 31.519  27.477  162.442 1.00 19.20 ? 11   SER B O   1 
ATOM   795  C  CB  . SER B  1 11 ? 34.105  26.474  164.113 1.00 19.94 ? 11   SER B CB  1 
ATOM   796  O  OG  . SER B  1 11 ? 33.305  25.378  163.756 1.00 19.42 ? 11   SER B OG  1 
ATOM   797  N  N   . ILE B  1 12 ? 32.164  29.018  163.992 1.00 17.73 ? 12   ILE B N   1 
ATOM   798  C  CA  . ILE B  1 12 ? 30.840  29.607  164.086 1.00 17.57 ? 12   ILE B CA  1 
ATOM   799  C  C   . ILE B  1 12 ? 30.429  30.226  162.746 1.00 18.27 ? 12   ILE B C   1 
ATOM   800  O  O   . ILE B  1 12 ? 29.297  30.040  162.294 1.00 18.34 ? 12   ILE B O   1 
ATOM   801  C  CB  . ILE B  1 12 ? 30.785  30.593  165.250 1.00 17.63 ? 12   ILE B CB  1 
ATOM   802  C  CG1 . ILE B  1 12 ? 30.915  29.799  166.574 1.00 19.46 ? 12   ILE B CG1 1 
ATOM   803  C  CG2 . ILE B  1 12 ? 29.509  31.419  165.168 1.00 20.45 ? 12   ILE B CG2 1 
ATOM   804  C  CD1 . ILE B  1 12 ? 31.100  30.678  167.840 1.00 19.11 ? 12   ILE B CD1 1 
ATOM   805  N  N   . ILE B  1 13 ? 31.361  30.896  162.089 1.00 20.06 ? 13   ILE B N   1 
ATOM   806  C  CA  . ILE B  1 13 ? 31.117  31.433  160.736 1.00 18.98 ? 13   ILE B CA  1 
ATOM   807  C  C   . ILE B  1 13 ? 30.766  30.306  159.756 1.00 19.96 ? 13   ILE B C   1 
ATOM   808  O  O   . ILE B  1 13 ? 29.836  30.432  158.943 1.00 19.23 ? 13   ILE B O   1 
ATOM   809  C  CB  . ILE B  1 13 ? 32.350  32.217  160.232 1.00 20.09 ? 13   ILE B CB  1 
ATOM   810  C  CG1 . ILE B  1 13 ? 32.586  33.424  161.129 1.00 18.14 ? 13   ILE B CG1 1 
ATOM   811  C  CG2 . ILE B  1 13 ? 32.136  32.667  158.746 1.00 20.45 ? 13   ILE B CG2 1 
ATOM   812  C  CD1 . ILE B  1 13 ? 33.961  34.060  161.101 1.00 20.46 ? 13   ILE B CD1 1 
ATOM   813  N  N   . ASP B  1 14 ? 31.475  29.187  159.866 1.00 19.04 ? 14   ASP B N   1 
ATOM   814  C  CA  . ASP B  1 14 ? 31.256  28.015  159.001 1.00 20.17 ? 14   ASP B CA  1 
ATOM   815  C  C   . ASP B  1 14 ? 29.871  27.371  159.191 1.00 20.54 ? 14   ASP B C   1 
ATOM   816  O  O   . ASP B  1 14 ? 29.216  26.958  158.227 1.00 20.85 ? 14   ASP B O   1 
ATOM   817  C  CB  . ASP B  1 14 ? 32.402  27.006  159.215 1.00 24.75 ? 14   ASP B CB  1 
ATOM   818  C  CG  . ASP B  1 14 ? 32.229  25.758  158.381 1.00 28.67 ? 14   ASP B CG  1 
ATOM   819  O  OD1 . ASP B  1 14 ? 32.086  25.904  157.149 1.00 31.95 ? 14   ASP B OD1 1 
ATOM   820  O  OD2 . ASP B  1 14 ? 32.168  24.599  158.865 1.00 31.57 ? 14   ASP B OD2 1 
ATOM   821  N  N   . VAL B  1 15 ? 29.430  27.271  160.437 1.00 18.88 ? 15   VAL B N   1 
ATOM   822  C  CA  . VAL B  1 15 ? 28.079  26.814  160.738 1.00 20.25 ? 15   VAL B CA  1 
ATOM   823  C  C   . VAL B  1 15 ? 27.072  27.695  159.994 1.00 19.67 ? 15   VAL B C   1 
ATOM   824  O  O   . VAL B  1 15 ? 26.227  27.179  159.285 1.00 19.16 ? 15   VAL B O   1 
ATOM   825  C  CB  . VAL B  1 15 ? 27.779  26.810  162.271 1.00 19.34 ? 15   VAL B CB  1 
ATOM   826  C  CG1 . VAL B  1 15 ? 26.298  26.469  162.543 1.00 21.11 ? 15   VAL B CG1 1 
ATOM   827  C  CG2 . VAL B  1 15 ? 28.670  25.796  162.992 1.00 19.33 ? 15   VAL B CG2 1 
ATOM   828  N  N   . TYR B  1 16 ? 27.160  29.011  160.144 1.00 18.15 ? 16   TYR B N   1 
ATOM   829  C  CA  . TYR B  1 16 ? 26.226  29.906  159.435 1.00 17.99 ? 16   TYR B CA  1 
ATOM   830  C  C   . TYR B  1 16 ? 26.234  29.671  157.908 1.00 18.22 ? 16   TYR B C   1 
ATOM   831  O  O   . TYR B  1 16 ? 25.179  29.552  157.265 1.00 17.63 ? 16   TYR B O   1 
ATOM   832  C  CB  . TYR B  1 16 ? 26.512  31.378  159.798 1.00 18.19 ? 16   TYR B CB  1 
ATOM   833  C  CG  . TYR B  1 16 ? 25.600  32.294  159.039 1.00 17.29 ? 16   TYR B CG  1 
ATOM   834  C  CD1 . TYR B  1 16 ? 24.313  32.488  159.467 1.00 17.60 ? 16   TYR B CD1 1 
ATOM   835  C  CD2 . TYR B  1 16 ? 25.992  32.873  157.840 1.00 17.75 ? 16   TYR B CD2 1 
ATOM   836  C  CE1 . TYR B  1 16 ? 23.449  33.321  158.772 1.00 18.34 ? 16   TYR B CE1 1 
ATOM   837  C  CE2 . TYR B  1 16 ? 25.120  33.697  157.119 1.00 19.52 ? 16   TYR B CE2 1 
ATOM   838  C  CZ  . TYR B  1 16 ? 23.850  33.899  157.615 1.00 17.43 ? 16   TYR B CZ  1 
ATOM   839  O  OH  . TYR B  1 16 ? 22.934  34.656  156.943 1.00 20.13 ? 16   TYR B OH  1 
ATOM   840  N  N   . HIS B  1 17 ? 27.432  29.620  157.334 1.00 17.62 ? 17   HIS B N   1 
ATOM   841  C  CA  . HIS B  1 17 ? 27.638  29.347  155.901 1.00 21.60 ? 17   HIS B CA  1 
ATOM   842  C  C   . HIS B  1 17 ? 26.967  28.025  155.428 1.00 22.91 ? 17   HIS B C   1 
ATOM   843  O  O   . HIS B  1 17 ? 26.451  27.961  154.298 1.00 23.34 ? 17   HIS B O   1 
ATOM   844  C  CB  . HIS B  1 17 ? 29.148  29.338  155.697 1.00 26.28 ? 17   HIS B CB  1 
ATOM   845  C  CG  . HIS B  1 17 ? 29.611  29.385  154.270 1.00 32.37 ? 17   HIS B CG  1 
ATOM   846  N  ND1 . HIS B  1 17 ? 29.335  30.437  153.420 1.00 34.45 ? 17   HIS B ND1 1 
ATOM   847  C  CD2 . HIS B  1 17 ? 30.406  28.537  153.570 1.00 34.80 ? 17   HIS B CD2 1 
ATOM   848  C  CE1 . HIS B  1 17 ? 29.914  30.221  152.248 1.00 35.89 ? 17   HIS B CE1 1 
ATOM   849  N  NE2 . HIS B  1 17 ? 30.570  29.075  152.314 1.00 36.04 ? 17   HIS B NE2 1 
ATOM   850  N  N   . LYS B  1 18 ? 26.926  26.997  156.288 1.00 21.26 ? 18   LYS B N   1 
ATOM   851  C  CA  . LYS B  1 18 ? 26.301  25.699  155.978 1.00 24.78 ? 18   LYS B CA  1 
ATOM   852  C  C   . LYS B  1 18 ? 24.846  25.915  155.605 1.00 22.34 ? 18   LYS B C   1 
ATOM   853  O  O   . LYS B  1 18 ? 24.336  25.271  154.685 1.00 22.98 ? 18   LYS B O   1 
ATOM   854  C  CB  . LYS B  1 18 ? 26.322  24.709  157.165 1.00 27.21 ? 18   LYS B CB  1 
ATOM   855  C  CG  . LYS B  1 18 ? 27.620  23.946  157.408 1.00 34.90 ? 18   LYS B CG  1 
ATOM   856  C  CD  . LYS B  1 18 ? 27.425  22.734  158.369 1.00 34.05 ? 18   LYS B CD  1 
ATOM   857  C  CE  . LYS B  1 18 ? 27.579  23.114  159.868 1.00 38.79 ? 18   LYS B CE  1 
ATOM   858  N  NZ  . LYS B  1 18 ? 27.625  21.959  160.872 1.00 37.90 ? 18   LYS B NZ  1 
ATOM   859  N  N   . TYR B  1 19 ? 24.190  26.816  156.325 1.00 17.49 ? 19   TYR B N   1 
ATOM   860  C  CA  . TYR B  1 19 ? 22.765  27.045  156.178 1.00 18.26 ? 19   TYR B CA  1 
ATOM   861  C  C   . TYR B  1 19 ? 22.419  28.187  155.233 1.00 18.54 ? 19   TYR B C   1 
ATOM   862  O  O   . TYR B  1 19 ? 21.362  28.152  154.578 1.00 16.51 ? 19   TYR B O   1 
ATOM   863  C  CB  . TYR B  1 19 ? 22.108  27.251  157.554 1.00 21.06 ? 19   TYR B CB  1 
ATOM   864  C  CG  . TYR B  1 19 ? 22.186  25.947  158.302 1.00 22.53 ? 19   TYR B CG  1 
ATOM   865  C  CD1 . TYR B  1 19 ? 21.205  24.982  158.117 1.00 23.95 ? 19   TYR B CD1 1 
ATOM   866  C  CD2 . TYR B  1 19 ? 23.284  25.639  159.090 1.00 22.92 ? 19   TYR B CD2 1 
ATOM   867  C  CE1 . TYR B  1 19 ? 21.269  23.751  158.745 1.00 23.29 ? 19   TYR B CE1 1 
ATOM   868  C  CE2 . TYR B  1 19 ? 23.357  24.391  159.751 1.00 24.29 ? 19   TYR B CE2 1 
ATOM   869  C  CZ  . TYR B  1 19 ? 22.349  23.466  159.558 1.00 25.60 ? 19   TYR B CZ  1 
ATOM   870  O  OH  . TYR B  1 19 ? 22.380  22.230  160.184 1.00 26.78 ? 19   TYR B OH  1 
ATOM   871  N  N   . SER B  1 20 ? 23.295  29.189  155.137 1.00 19.27 ? 20   SER B N   1 
ATOM   872  C  CA  . SER B  1 20 ? 22.974  30.307  154.236 1.00 18.14 ? 20   SER B CA  1 
ATOM   873  C  C   . SER B  1 20 ? 23.127  29.880  152.765 1.00 19.49 ? 20   SER B C   1 
ATOM   874  O  O   . SER B  1 20 ? 22.559  30.500  151.851 1.00 19.96 ? 20   SER B O   1 
ATOM   875  C  CB  . SER B  1 20 ? 23.815  31.535  154.585 1.00 19.58 ? 20   SER B CB  1 
ATOM   876  O  OG  . SER B  1 20 ? 25.159  31.312  154.251 1.00 16.35 ? 20   SER B OG  1 
ATOM   877  N  N   . LEU B  1 21 ? 23.942  28.849  152.546 1.00 20.95 ? 21   LEU B N   1 
ATOM   878  C  CA  . LEU B  1 21 ? 24.149  28.284  151.204 1.00 23.38 ? 21   LEU B CA  1 
ATOM   879  C  C   . LEU B  1 21 ? 23.032  27.418  150.657 1.00 21.25 ? 21   LEU B C   1 
ATOM   880  O  O   . LEU B  1 21 ? 23.028  27.076  149.456 1.00 21.53 ? 21   LEU B O   1 
ATOM   881  C  CB  . LEU B  1 21 ? 25.454  27.504  151.143 1.00 25.37 ? 21   LEU B CB  1 
ATOM   882  C  CG  . LEU B  1 21 ? 26.730  28.335  151.054 1.00 28.68 ? 21   LEU B CG  1 
ATOM   883  C  CD1 . LEU B  1 21 ? 27.938  27.442  151.348 1.00 31.62 ? 21   LEU B CD1 1 
ATOM   884  C  CD2 . LEU B  1 21 ? 26.857  28.964  149.676 1.00 29.67 ? 21   LEU B CD2 1 
ATOM   885  N  N   . ILE B  1 22 ? 22.091  27.026  151.507 1.00 21.15 ? 22   ILE B N   1 
ATOM   886  C  CA  . ILE B  1 22 ? 20.991  26.155  151.037 1.00 19.77 ? 22   ILE B CA  1 
ATOM   887  C  C   . ILE B  1 22 ? 20.227  26.729  149.839 1.00 20.28 ? 22   ILE B C   1 
ATOM   888  O  O   . ILE B  1 22 ? 20.072  26.060  148.769 1.00 16.87 ? 22   ILE B O   1 
ATOM   889  C  CB  . ILE B  1 22 ? 20.021  25.882  152.194 1.00 20.02 ? 22   ILE B CB  1 
ATOM   890  C  CG1 . ILE B  1 22 ? 20.711  25.012  153.239 1.00 20.25 ? 22   ILE B CG1 1 
ATOM   891  C  CG2 . ILE B  1 22 ? 18.717  25.280  151.650 1.00 20.59 ? 22   ILE B CG2 1 
ATOM   892  C  CD1 . ILE B  1 22 ? 19.929  24.803  154.527 1.00 18.41 ? 22   ILE B CD1 1 
ATOM   893  N  N   . LYS B  1 23 ? 19.774  27.981  149.964 1.00 17.04 ? 23   LYS B N   1 
ATOM   894  C  CA  . LYS B  1 23 ? 18.999  28.568  148.881 1.00 19.54 ? 23   LYS B CA  1 
ATOM   895  C  C   . LYS B  1 23 ? 19.107  30.093  148.839 1.00 19.83 ? 23   LYS B C   1 
ATOM   896  O  O   . LYS B  1 23 ? 19.562  30.728  149.789 1.00 17.27 ? 23   LYS B O   1 
ATOM   897  C  CB  . LYS B  1 23 ? 17.523  28.173  148.999 1.00 17.24 ? 23   LYS B CB  1 
ATOM   898  C  CG  . LYS B  1 23 ? 16.783  28.755  150.220 1.00 20.44 ? 23   LYS B CG  1 
ATOM   899  C  CD  . LYS B  1 23 ? 15.393  28.125  150.371 1.00 20.58 ? 23   LYS B CD  1 
ATOM   900  C  CE  . LYS B  1 23 ? 14.852  28.358  151.764 1.00 22.79 ? 23   LYS B CE  1 
ATOM   901  N  NZ  . LYS B  1 23 ? 13.747  27.421  152.051 1.00 25.44 ? 23   LYS B NZ  1 
ATOM   902  N  N   . GLY B  1 24 ? 18.649  30.662  147.734 1.00 17.72 ? 24   GLY B N   1 
ATOM   903  C  CA  . GLY B  1 24 ? 18.455  32.105  147.652 1.00 18.60 ? 24   GLY B CA  1 
ATOM   904  C  C   . GLY B  1 24 ? 19.747  32.875  147.769 1.00 20.32 ? 24   GLY B C   1 
ATOM   905  O  O   . GLY B  1 24 ? 20.778  32.459  147.241 1.00 18.65 ? 24   GLY B O   1 
ATOM   906  N  N   . ASN B  1 25 ? 19.690  33.994  148.490 1.00 17.04 ? 25   ASN B N   1 
ATOM   907  C  CA  . ASN B  1 25 ? 20.870  34.808  148.747 1.00 18.21 ? 25   ASN B CA  1 
ATOM   908  C  C   . ASN B  1 25 ? 21.801  34.043  149.683 1.00 18.17 ? 25   ASN B C   1 
ATOM   909  O  O   . ASN B  1 25 ? 21.375  33.531  150.722 1.00 16.14 ? 25   ASN B O   1 
ATOM   910  C  CB  . ASN B  1 25 ? 20.437  36.163  149.356 1.00 19.20 ? 25   ASN B CB  1 
ATOM   911  C  CG  . ASN B  1 25 ? 21.586  37.165  149.480 1.00 22.71 ? 25   ASN B CG  1 
ATOM   912  O  OD1 . ASN B  1 25 ? 22.675  36.836  149.939 1.00 23.87 ? 25   ASN B OD1 1 
ATOM   913  N  ND2 . ASN B  1 25 ? 21.329  38.409  149.081 1.00 22.15 ? 25   ASN B ND2 1 
ATOM   914  N  N   . PHE B  1 26 ? 23.078  33.957  149.327 1.00 19.68 ? 26   PHE B N   1 
ATOM   915  C  CA  . PHE B  1 26 ? 24.000  33.158  150.128 1.00 22.45 ? 26   PHE B CA  1 
ATOM   916  C  C   . PHE B  1 26 ? 24.476  33.836  151.417 1.00 23.08 ? 26   PHE B C   1 
ATOM   917  O  O   . PHE B  1 26 ? 25.210  33.248  152.223 1.00 23.63 ? 26   PHE B O   1 
ATOM   918  C  CB  . PHE B  1 26 ? 25.162  32.657  149.275 1.00 28.17 ? 26   PHE B CB  1 
ATOM   919  C  CG  . PHE B  1 26 ? 24.754  31.603  148.270 1.00 30.54 ? 26   PHE B CG  1 
ATOM   920  C  CD1 . PHE B  1 26 ? 23.547  30.912  148.409 1.00 30.35 ? 26   PHE B CD1 1 
ATOM   921  C  CD2 . PHE B  1 26 ? 25.576  31.286  147.201 1.00 33.09 ? 26   PHE B CD2 1 
ATOM   922  C  CE1 . PHE B  1 26 ? 23.165  29.930  147.502 1.00 32.41 ? 26   PHE B CE1 1 
ATOM   923  C  CE2 . PHE B  1 26 ? 25.199  30.306  146.275 1.00 33.04 ? 26   PHE B CE2 1 
ATOM   924  C  CZ  . PHE B  1 26 ? 23.990  29.625  146.434 1.00 32.53 ? 26   PHE B CZ  1 
ATOM   925  N  N   . HIS B  1 27 ? 24.012  35.061  151.630 1.00 21.54 ? 27   HIS B N   1 
ATOM   926  C  CA  . HIS B  1 27 ? 24.180  35.783  152.892 1.00 21.29 ? 27   HIS B CA  1 
ATOM   927  C  C   . HIS B  1 27 ? 22.855  35.888  153.649 1.00 20.78 ? 27   HIS B C   1 
ATOM   928  O  O   . HIS B  1 27 ? 22.642  36.790  154.459 1.00 21.75 ? 27   HIS B O   1 
ATOM   929  C  CB  . HIS B  1 27 ? 24.754  37.182  152.622 1.00 24.46 ? 27   HIS B CB  1 
ATOM   930  C  CG  . HIS B  1 27 ? 25.897  37.181  151.657 1.00 28.21 ? 27   HIS B CG  1 
ATOM   931  N  ND1 . HIS B  1 27 ? 27.213  37.195  152.059 1.00 31.55 ? 27   HIS B ND1 1 
ATOM   932  C  CD2 . HIS B  1 27 ? 25.920  37.196  150.305 1.00 31.33 ? 27   HIS B CD2 1 
ATOM   933  C  CE1 . HIS B  1 27 ? 28.001  37.181  151.001 1.00 31.53 ? 27   HIS B CE1 1 
ATOM   934  N  NE2 . HIS B  1 27 ? 27.242  37.181  149.924 1.00 33.11 ? 27   HIS B NE2 1 
ATOM   935  N  N   . ALA B  1 28 ? 21.948  34.951  153.411 1.00 18.80 ? 28   ALA B N   1 
ATOM   936  C  CA  . ALA B  1 28 ? 20.702  34.959  154.144 1.00 16.91 ? 28   ALA B CA  1 
ATOM   937  C  C   . ALA B  1 28 ? 20.286  33.548  154.532 1.00 16.36 ? 28   ALA B C   1 
ATOM   938  O  O   . ALA B  1 28 ? 20.428  32.617  153.750 1.00 16.31 ? 28   ALA B O   1 
ATOM   939  C  CB  . ALA B  1 28 ? 19.600  35.610  153.291 1.00 18.26 ? 28   ALA B CB  1 
ATOM   940  N  N   . VAL B  1 29 ? 19.761  33.395  155.738 1.00 16.74 ? 29   VAL B N   1 
ATOM   941  C  CA  . VAL B  1 29 ? 19.122  32.138  156.173 1.00 17.53 ? 29   VAL B CA  1 
ATOM   942  C  C   . VAL B  1 29 ? 17.627  32.457  156.234 1.00 17.76 ? 29   VAL B C   1 
ATOM   943  O  O   . VAL B  1 29 ? 17.228  33.437  156.846 1.00 17.68 ? 29   VAL B O   1 
ATOM   944  C  CB  . VAL B  1 29 ? 19.708  31.746  157.557 1.00 20.09 ? 29   VAL B CB  1 
ATOM   945  C  CG1 . VAL B  1 29 ? 18.809  30.789  158.355 1.00 18.74 ? 29   VAL B CG1 1 
ATOM   946  C  CG2 . VAL B  1 29 ? 21.077  31.165  157.374 1.00 19.79 ? 29   VAL B CG2 1 
ATOM   947  N  N   . TYR B  1 30 ? 16.799  31.650  155.580 1.00 15.77 ? 30   TYR B N   1 
ATOM   948  C  CA  . TYR B  1 30 ? 15.364  31.886  155.515 1.00 16.78 ? 30   TYR B CA  1 
ATOM   949  C  C   . TYR B  1 30 ? 14.678  31.024  156.573 1.00 17.44 ? 30   TYR B C   1 
ATOM   950  O  O   . TYR B  1 30 ? 15.363  30.276  157.278 1.00 18.45 ? 30   TYR B O   1 
ATOM   951  C  CB  . TYR B  1 30 ? 14.861  31.612  154.094 1.00 16.97 ? 30   TYR B CB  1 
ATOM   952  C  CG  . TYR B  1 30 ? 15.577  32.471  153.058 1.00 19.16 ? 30   TYR B CG  1 
ATOM   953  C  CD1 . TYR B  1 30 ? 15.265  33.825  152.898 1.00 17.82 ? 30   TYR B CD1 1 
ATOM   954  C  CD2 . TYR B  1 30 ? 16.635  31.947  152.305 1.00 16.30 ? 30   TYR B CD2 1 
ATOM   955  C  CE1 . TYR B  1 30 ? 15.949  34.602  151.981 1.00 17.62 ? 30   TYR B CE1 1 
ATOM   956  C  CE2 . TYR B  1 30 ? 17.315  32.731  151.365 1.00 17.34 ? 30   TYR B CE2 1 
ATOM   957  C  CZ  . TYR B  1 30 ? 16.966  34.051  151.220 1.00 17.57 ? 30   TYR B CZ  1 
ATOM   958  O  OH  . TYR B  1 30 ? 17.633  34.832  150.309 1.00 17.81 ? 30   TYR B OH  1 
ATOM   959  N  N   . ARG B  1 31 ? 13.351  31.102  156.694 1.00 18.38 ? 31   ARG B N   1 
ATOM   960  C  CA  . ARG B  1 31 ? 12.638  30.456  157.803 1.00 22.10 ? 31   ARG B CA  1 
ATOM   961  C  C   . ARG B  1 31 ? 12.945  28.970  157.910 1.00 19.79 ? 31   ARG B C   1 
ATOM   962  O  O   . ARG B  1 31 ? 13.164  28.464  159.008 1.00 19.19 ? 31   ARG B O   1 
ATOM   963  C  CB  . ARG B  1 31 ? 11.116  30.630  157.690 1.00 24.77 ? 31   ARG B CB  1 
ATOM   964  C  CG  . ARG B  1 31 ? 10.595  31.980  158.153 1.00 31.93 ? 31   ARG B CG  1 
ATOM   965  C  CD  . ARG B  1 31 ? 9.064   32.088  158.296 1.00 33.94 ? 31   ARG B CD  1 
ATOM   966  N  NE  . ARG B  1 31 ? 8.726   33.094  159.307 1.00 41.27 ? 31   ARG B NE  1 
ATOM   967  C  CZ  . ARG B  1 31 ? 8.688   34.403  159.071 1.00 44.38 ? 31   ARG B CZ  1 
ATOM   968  N  NH1 . ARG B  1 31 ? 8.962   34.870  157.854 1.00 44.99 ? 31   ARG B NH1 1 
ATOM   969  N  NH2 . ARG B  1 31 ? 8.388   35.248  160.054 1.00 46.36 ? 31   ARG B NH2 1 
ATOM   970  N  N   . ASP B  1 32 ? 12.848  28.254  156.789 1.00 17.26 ? 32   ASP B N   1 
ATOM   971  C  CA  . ASP B  1 32 ? 13.086  26.818  156.855 1.00 19.16 ? 32   ASP B CA  1 
ATOM   972  C  C   . ASP B  1 32 ? 14.537  26.458  157.132 1.00 17.63 ? 32   ASP B C   1 
ATOM   973  O  O   . ASP B  1 32 ? 14.816  25.437  157.809 1.00 16.96 ? 32   ASP B O   1 
ATOM   974  C  CB  . ASP B  1 32 ? 12.645  26.084  155.588 1.00 18.86 ? 32   ASP B CB  1 
ATOM   975  C  CG  . ASP B  1 32 ? 12.696  24.591  155.797 1.00 20.85 ? 32   ASP B CG  1 
ATOM   976  O  OD1 . ASP B  1 32 ? 11.882  24.090  156.603 1.00 21.13 ? 32   ASP B OD1 1 
ATOM   977  O  OD2 . ASP B  1 32 ? 13.566  23.860  155.286 1.00 23.62 ? 32   ASP B OD2 1 
ATOM   978  N  N   . ASP B  1 33 ? 15.456  27.290  156.626 1.00 16.64 ? 33   ASP B N   1 
ATOM   979  C  CA  . ASP B  1 33 ? 16.883  27.093  156.877 1.00 18.14 ? 33   ASP B CA  1 
ATOM   980  C  C   . ASP B  1 33 ? 17.172  27.213  158.385 1.00 18.13 ? 33   ASP B C   1 
ATOM   981  O  O   . ASP B  1 33 ? 17.913  26.424  158.994 1.00 18.78 ? 33   ASP B O   1 
ATOM   982  C  CB  . ASP B  1 33 ? 17.723  28.148  156.140 1.00 20.98 ? 33   ASP B CB  1 
ATOM   983  C  CG  . ASP B  1 33 ? 17.474  28.218  154.638 1.00 23.81 ? 33   ASP B CG  1 
ATOM   984  O  OD1 . ASP B  1 33 ? 17.215  27.176  153.953 1.00 24.51 ? 33   ASP B OD1 1 
ATOM   985  O  OD2 . ASP B  1 33 ? 17.591  29.312  154.034 1.00 22.39 ? 33   ASP B OD2 1 
ATOM   986  N  N   . LEU B  1 34 ? 16.621  28.248  159.003 1.00 16.22 ? 34   LEU B N   1 
ATOM   987  C  CA  . LEU B  1 34 ? 16.798  28.380  160.441 1.00 18.92 ? 34   LEU B CA  1 
ATOM   988  C  C   . LEU B  1 34 ? 16.196  27.216  161.232 1.00 18.97 ? 34   LEU B C   1 
ATOM   989  O  O   . LEU B  1 34 ? 16.787  26.768  162.222 1.00 17.65 ? 34   LEU B O   1 
ATOM   990  C  CB  . LEU B  1 34 ? 16.199  29.697  160.925 1.00 17.81 ? 34   LEU B CB  1 
ATOM   991  C  CG  . LEU B  1 34 ? 16.482  29.994  162.415 1.00 19.30 ? 34   LEU B CG  1 
ATOM   992  C  CD1 . LEU B  1 34 ? 17.962  30.428  162.640 1.00 19.09 ? 34   LEU B CD1 1 
ATOM   993  C  CD2 . LEU B  1 34 ? 15.486  31.072  162.912 1.00 19.07 ? 34   LEU B CD2 1 
ATOM   994  N  N   . LYS B  1 35 ? 15.013  26.749  160.831 1.00 18.40 ? 35   LYS B N   1 
ATOM   995  C  CA  . LYS B  1 35 ? 14.409  25.582  161.452 1.00 21.22 ? 35   LYS B CA  1 
ATOM   996  C  C   . LYS B  1 35 ? 15.381  24.420  161.400 1.00 20.32 ? 35   LYS B C   1 
ATOM   997  O  O   . LYS B  1 35 ? 15.593  23.738  162.415 1.00 20.95 ? 35   LYS B O   1 
ATOM   998  C  CB  . LYS B  1 35 ? 13.088  25.215  160.747 1.00 22.85 ? 35   LYS B CB  1 
ATOM   999  C  CG  . LYS B  1 35 ? 12.385  24.007  161.335 1.00 27.08 ? 35   LYS B CG  1 
ATOM   1000 C  CD  . LYS B  1 35 ? 10.942  23.964  160.824 1.00 30.45 ? 35   LYS B CD  1 
ATOM   1001 C  CE  . LYS B  1 35 ? 10.321  22.586  160.944 1.00 33.60 ? 35   LYS B CE  1 
ATOM   1002 N  NZ  . LYS B  1 35 ? 10.031  22.205  162.358 1.00 36.18 ? 35   LYS B NZ  1 
ATOM   1003 N  N   . LYS B  1 36 ? 15.994  24.196  160.238 1.00 20.47 ? 36   LYS B N   1 
ATOM   1004 C  CA  . LYS B  1 36 ? 16.993  23.134  160.082 1.00 22.61 ? 36   LYS B CA  1 
ATOM   1005 C  C   . LYS B  1 36 ? 18.236  23.397  160.933 1.00 20.37 ? 36   LYS B C   1 
ATOM   1006 O  O   . LYS B  1 36 ? 18.809  22.468  161.492 1.00 19.38 ? 36   LYS B O   1 
ATOM   1007 C  CB  . LYS B  1 36 ? 17.409  22.970  158.615 1.00 23.50 ? 36   LYS B CB  1 
ATOM   1008 C  CG  . LYS B  1 36 ? 16.348  22.325  157.714 1.00 28.18 ? 36   LYS B CG  1 
ATOM   1009 C  CD  . LYS B  1 36 ? 16.907  22.102  156.318 1.00 30.00 ? 36   LYS B CD  1 
ATOM   1010 C  CE  . LYS B  1 36 ? 16.071  21.067  155.526 1.00 34.99 ? 36   LYS B CE  1 
ATOM   1011 N  NZ  . LYS B  1 36 ? 14.614  21.312  155.598 1.00 36.42 ? 36   LYS B NZ  1 
ATOM   1012 N  N   . LEU B  1 37 ? 18.672  24.646  161.018 1.00 18.92 ? 37   LEU B N   1 
ATOM   1013 C  CA  . LEU B  1 37 ? 19.816  24.964  161.896 1.00 18.63 ? 37   LEU B CA  1 
ATOM   1014 C  C   . LEU B  1 37 ? 19.480  24.665  163.369 1.00 18.90 ? 37   LEU B C   1 
ATOM   1015 O  O   . LEU B  1 37 ? 20.272  24.044  164.097 1.00 19.12 ? 37   LEU B O   1 
ATOM   1016 C  CB  . LEU B  1 37 ? 20.225  26.435  161.675 1.00 18.23 ? 37   LEU B CB  1 
ATOM   1017 C  CG  . LEU B  1 37 ? 21.489  26.944  162.378 1.00 18.35 ? 37   LEU B CG  1 
ATOM   1018 C  CD1 . LEU B  1 37 ? 21.922  28.194  161.625 1.00 21.25 ? 37   LEU B CD1 1 
ATOM   1019 C  CD2 . LEU B  1 37 ? 21.204  27.256  163.840 1.00 18.35 ? 37   LEU B CD2 1 
ATOM   1020 N  N   . LEU B  1 38 ? 18.313  25.092  163.836 1.00 17.29 ? 38   LEU B N   1 
ATOM   1021 C  CA  . LEU B  1 38 ? 17.976  24.894  165.242 1.00 20.78 ? 38   LEU B CA  1 
ATOM   1022 C  C   . LEU B  1 38 ? 17.862  23.401  165.547 1.00 20.75 ? 38   LEU B C   1 
ATOM   1023 O  O   . LEU B  1 38 ? 18.296  22.926  166.600 1.00 20.90 ? 38   LEU B O   1 
ATOM   1024 C  CB  . LEU B  1 38 ? 16.664  25.597  165.582 1.00 21.65 ? 38   LEU B CB  1 
ATOM   1025 C  CG  . LEU B  1 38 ? 16.760  27.131  165.616 1.00 22.57 ? 38   LEU B CG  1 
ATOM   1026 C  CD1 . LEU B  1 38 ? 15.375  27.742  165.496 1.00 22.36 ? 38   LEU B CD1 1 
ATOM   1027 C  CD2 . LEU B  1 38 ? 17.469  27.591  166.914 1.00 22.08 ? 38   LEU B CD2 1 
ATOM   1028 N  N   . GLU B  1 39 ? 17.308  22.659  164.607 1.00 21.69 ? 39   GLU B N   1 
ATOM   1029 C  CA  . GLU B  1 39 ? 17.137  21.220  164.787 1.00 25.55 ? 39   GLU B CA  1 
ATOM   1030 C  C   . GLU B  1 39 ? 18.458  20.471  164.823 1.00 23.43 ? 39   GLU B C   1 
ATOM   1031 O  O   . GLU B  1 39 ? 18.593  19.519  165.574 1.00 23.99 ? 39   GLU B O   1 
ATOM   1032 C  CB  . GLU B  1 39 ? 16.257  20.641  163.665 1.00 27.59 ? 39   GLU B CB  1 
ATOM   1033 C  CG  . GLU B  1 39 ? 14.783  20.987  163.796 1.00 34.04 ? 39   GLU B CG  1 
ATOM   1034 C  CD  . GLU B  1 39 ? 13.943  20.340  162.698 1.00 36.44 ? 39   GLU B CD  1 
ATOM   1035 O  OE1 . GLU B  1 39 ? 14.327  19.244  162.229 1.00 43.30 ? 39   GLU B OE1 1 
ATOM   1036 O  OE2 . GLU B  1 39 ? 12.907  20.902  162.292 1.00 40.93 ? 39   GLU B OE2 1 
ATOM   1037 N  N   . THR B  1 40 ? 19.434  20.889  164.030 1.00 20.77 ? 40   THR B N   1 
ATOM   1038 C  CA  . THR B  1 40 ? 20.697  20.153  163.942 1.00 23.82 ? 40   THR B CA  1 
ATOM   1039 C  C   . THR B  1 40 ? 21.769  20.669  164.909 1.00 24.72 ? 40   THR B C   1 
ATOM   1040 O  O   . THR B  1 40 ? 22.599  19.905  165.397 1.00 25.58 ? 40   THR B O   1 
ATOM   1041 C  CB  . THR B  1 40 ? 21.242  20.265  162.501 1.00 25.11 ? 40   THR B CB  1 
ATOM   1042 O  OG1 . THR B  1 40 ? 20.274  19.724  161.594 1.00 27.52 ? 40   THR B OG1 1 
ATOM   1043 C  CG2 . THR B  1 40 ? 22.434  19.369  162.292 1.00 26.22 ? 40   THR B CG2 1 
ATOM   1044 N  N   . GLU B  1 41 ? 21.763  21.973  165.174 1.00 21.89 ? 41   GLU B N   1 
ATOM   1045 C  CA  . GLU B  1 41 ? 22.906  22.616  165.810 1.00 23.77 ? 41   GLU B CA  1 
ATOM   1046 C  C   . GLU B  1 41 ? 22.659  23.037  167.266 1.00 22.51 ? 41   GLU B C   1 
ATOM   1047 O  O   . GLU B  1 41 ? 23.598  23.400  167.981 1.00 23.59 ? 41   GLU B O   1 
ATOM   1048 C  CB  . GLU B  1 41 ? 23.333  23.843  164.964 1.00 21.13 ? 41   GLU B CB  1 
ATOM   1049 C  CG  . GLU B  1 41 ? 23.755  23.550  163.527 1.00 23.69 ? 41   GLU B CG  1 
ATOM   1050 C  CD  . GLU B  1 41 ? 25.139  22.935  163.379 1.00 26.45 ? 41   GLU B CD  1 
ATOM   1051 O  OE1 . GLU B  1 41 ? 25.886  22.831  164.380 1.00 25.29 ? 41   GLU B OE1 1 
ATOM   1052 O  OE2 . GLU B  1 41 ? 25.498  22.542  162.239 1.00 27.21 ? 41   GLU B OE2 1 
ATOM   1053 N  N   . SER B  1 42 ? 21.407  23.056  167.708 1.00 21.23 ? 42   SER B N   1 
ATOM   1054 C  CA  . SER B  1 42 ? 21.082  23.677  168.989 1.00 23.70 ? 42   SER B CA  1 
ATOM   1055 C  C   . SER B  1 42 ? 20.465  22.639  169.925 1.00 22.81 ? 42   SER B C   1 
ATOM   1056 O  O   . SER B  1 42 ? 19.825  21.688  169.446 1.00 21.84 ? 42   SER B O   1 
ATOM   1057 C  CB  . SER B  1 42 ? 20.118  24.856  168.781 1.00 25.39 ? 42   SER B CB  1 
ATOM   1058 O  OG  . SER B  1 42 ? 18.791  24.407  168.559 1.00 26.70 ? 42   SER B OG  1 
ATOM   1059 N  N   . PRO B  1 43 ? 20.648  22.804  171.237 1.00 23.55 ? 43   PRO B N   1 
ATOM   1060 C  CA  . PRO B  1 43 ? 20.043  21.878  172.186 1.00 23.44 ? 43   PRO B CA  1 
ATOM   1061 C  C   . PRO B  1 43 ? 18.537  22.084  172.368 1.00 27.09 ? 43   PRO B C   1 
ATOM   1062 O  O   . PRO B  1 43 ? 17.984  23.127  172.009 1.00 25.43 ? 43   PRO B O   1 
ATOM   1063 C  CB  . PRO B  1 43 ? 20.790  22.147  173.506 1.00 23.40 ? 43   PRO B CB  1 
ATOM   1064 C  CG  . PRO B  1 43 ? 21.487  23.463  173.355 1.00 23.22 ? 43   PRO B CG  1 
ATOM   1065 C  CD  . PRO B  1 43 ? 21.425  23.868  171.905 1.00 20.10 ? 43   PRO B CD  1 
ATOM   1066 N  N   . GLN B  1 44 ? 17.884  21.083  172.951 1.00 26.85 ? 44   GLN B N   1 
ATOM   1067 C  CA  . GLN B  1 44 ? 16.447  21.102  173.110 1.00 30.12 ? 44   GLN B CA  1 
ATOM   1068 C  C   . GLN B  1 44 ? 15.946  22.339  173.846 1.00 28.09 ? 44   GLN B C   1 
ATOM   1069 O  O   . GLN B  1 44 ? 14.905  22.854  173.489 1.00 31.02 ? 44   GLN B O   1 
ATOM   1070 C  CB  . GLN B  1 44 ? 15.975  19.825  173.828 1.00 33.99 ? 44   GLN B CB  1 
ATOM   1071 C  CG  . GLN B  1 44 ? 14.456  19.647  173.841 1.00 39.54 ? 44   GLN B CG  1 
ATOM   1072 C  CD  . GLN B  1 44 ? 13.777  20.315  175.033 1.00 42.79 ? 44   GLN B CD  1 
ATOM   1073 O  OE1 . GLN B  1 44 ? 14.444  20.932  175.865 1.00 45.97 ? 44   GLN B OE1 1 
ATOM   1074 N  NE2 . GLN B  1 44 ? 12.452  20.180  175.127 1.00 45.10 ? 44   GLN B NE2 1 
ATOM   1075 N  N   . TYR B  1 45 ? 16.659  22.823  174.859 1.00 26.51 ? 45   TYR B N   1 
ATOM   1076 C  CA  . TYR B  1 45 ? 16.175  23.985  175.599 1.00 27.18 ? 45   TYR B CA  1 
ATOM   1077 C  C   . TYR B  1 45 ? 16.177  25.257  174.752 1.00 28.79 ? 45   TYR B C   1 
ATOM   1078 O  O   . TYR B  1 45 ? 15.466  26.211  175.086 1.00 29.75 ? 45   TYR B O   1 
ATOM   1079 C  CB  . TYR B  1 45 ? 16.909  24.199  176.937 1.00 28.08 ? 45   TYR B CB  1 
ATOM   1080 C  CG  . TYR B  1 45 ? 18.403  24.404  176.836 1.00 28.59 ? 45   TYR B CG  1 
ATOM   1081 C  CD1 . TYR B  1 45 ? 18.943  25.668  176.585 1.00 27.48 ? 45   TYR B CD1 1 
ATOM   1082 C  CD2 . TYR B  1 45 ? 19.280  23.341  177.013 1.00 28.04 ? 45   TYR B CD2 1 
ATOM   1083 C  CE1 . TYR B  1 45 ? 20.310  25.844  176.481 1.00 27.77 ? 45   TYR B CE1 1 
ATOM   1084 C  CE2 . TYR B  1 45 ? 20.644  23.509  176.927 1.00 27.03 ? 45   TYR B CE2 1 
ATOM   1085 C  CZ  . TYR B  1 45 ? 21.153  24.769  176.673 1.00 28.23 ? 45   TYR B CZ  1 
ATOM   1086 O  OH  . TYR B  1 45 ? 22.514  24.924  176.579 1.00 29.07 ? 45   TYR B OH  1 
ATOM   1087 N  N   . ILE B  1 46 ? 16.983  25.260  173.690 1.00 24.81 ? 46   ILE B N   1 
ATOM   1088 C  CA  . ILE B  1 46 ? 16.964  26.334  172.692 1.00 25.74 ? 46   ILE B CA  1 
ATOM   1089 C  C   . ILE B  1 46 ? 15.859  26.071  171.653 1.00 26.29 ? 46   ILE B C   1 
ATOM   1090 O  O   . ILE B  1 46 ? 15.050  26.951  171.340 1.00 24.85 ? 46   ILE B O   1 
ATOM   1091 C  CB  . ILE B  1 46 ? 18.357  26.455  172.008 1.00 22.62 ? 46   ILE B CB  1 
ATOM   1092 C  CG1 . ILE B  1 46 ? 19.461  26.845  173.005 1.00 23.84 ? 46   ILE B CG1 1 
ATOM   1093 C  CG2 . ILE B  1 46 ? 18.328  27.485  170.847 1.00 24.31 ? 46   ILE B CG2 1 
ATOM   1094 C  CD1 . ILE B  1 46 ? 19.295  28.232  173.595 1.00 22.75 ? 46   ILE B CD1 1 
ATOM   1095 N  N   . ARG B  1 47 ? 15.815  24.850  171.130 1.00 27.80 ? 47   ARG B N   1 
ATOM   1096 C  CA  . ARG B  1 47 ? 14.835  24.485  170.108 1.00 30.91 ? 47   ARG B CA  1 
ATOM   1097 C  C   . ARG B  1 47 ? 13.399  24.692  170.569 1.00 32.02 ? 47   ARG B C   1 
ATOM   1098 O  O   . ARG B  1 47 ? 12.533  25.050  169.783 1.00 30.93 ? 47   ARG B O   1 
ATOM   1099 C  CB  . ARG B  1 47 ? 15.007  23.023  169.713 1.00 33.42 ? 47   ARG B CB  1 
ATOM   1100 C  CG  . ARG B  1 47 ? 16.165  22.769  168.801 1.00 37.45 ? 47   ARG B CG  1 
ATOM   1101 C  CD  . ARG B  1 47 ? 16.175  21.366  168.234 1.00 40.77 ? 47   ARG B CD  1 
ATOM   1102 N  NE  . ARG B  1 47 ? 17.137  20.527  168.925 1.00 43.98 ? 47   ARG B NE  1 
ATOM   1103 C  CZ  . ARG B  1 47 ? 16.813  19.622  169.829 1.00 45.77 ? 47   ARG B CZ  1 
ATOM   1104 N  NH1 . ARG B  1 47 ? 15.537  19.432  170.141 1.00 47.18 ? 47   ARG B NH1 1 
ATOM   1105 N  NH2 . ARG B  1 47 ? 17.762  18.901  170.419 1.00 46.68 ? 47   ARG B NH2 1 
ATOM   1106 N  N   . LYS B  1 48 ? 13.148  24.475  171.857 1.00 33.80 ? 48   LYS B N   1 
ATOM   1107 C  CA  . LYS B  1 48 ? 11.777  24.424  172.363 1.00 36.34 ? 48   LYS B CA  1 
ATOM   1108 C  C   . LYS B  1 48 ? 11.045  25.752  172.227 1.00 35.80 ? 48   LYS B C   1 
ATOM   1109 O  O   . LYS B  1 48 ? 9.816   25.787  172.241 1.00 35.52 ? 48   LYS B O   1 
ATOM   1110 C  CB  . LYS B  1 48 ? 11.746  23.968  173.819 1.00 38.19 ? 48   LYS B CB  1 
ATOM   1111 C  CG  . LYS B  1 48 ? 12.314  24.960  174.807 1.00 40.86 ? 48   LYS B CG  1 
ATOM   1112 C  CD  . LYS B  1 48 ? 12.067  24.463  176.228 1.00 44.18 ? 48   LYS B CD  1 
ATOM   1113 C  CE  . LYS B  1 48 ? 12.968  25.157  177.227 1.00 46.19 ? 48   LYS B CE  1 
ATOM   1114 N  NZ  . LYS B  1 48 ? 13.144  24.290  178.448 1.00 48.51 ? 48   LYS B NZ  1 
ATOM   1115 N  N   . LYS B  1 49 ? 11.795  26.838  172.080 1.00 35.07 ? 49   LYS B N   1 
ATOM   1116 C  CA  . LYS B  1 49 ? 11.186  28.140  171.808 1.00 34.40 ? 49   LYS B CA  1 
ATOM   1117 C  C   . LYS B  1 49 ? 10.342  28.145  170.513 1.00 32.00 ? 49   LYS B C   1 
ATOM   1118 O  O   . LYS B  1 49 ? 9.323   28.828  170.435 1.00 32.91 ? 49   LYS B O   1 
ATOM   1119 C  CB  . LYS B  1 49 ? 12.252  29.225  171.787 1.00 35.68 ? 49   LYS B CB  1 
ATOM   1120 C  CG  . LYS B  1 49 ? 11.715  30.548  171.343 1.00 38.82 ? 49   LYS B CG  1 
ATOM   1121 C  CD  . LYS B  1 49 ? 12.224  31.673  172.214 1.00 41.30 ? 49   LYS B CD  1 
ATOM   1122 C  CE  . LYS B  1 49 ? 13.530  32.196  171.725 1.00 41.31 ? 49   LYS B CE  1 
ATOM   1123 N  NZ  . LYS B  1 49 ? 14.077  33.176  172.695 1.00 41.59 ? 49   LYS B NZ  1 
ATOM   1124 N  N   . GLY B  1 50 ? 10.748  27.365  169.518 1.00 24.98 ? 50   GLY B N   1 
ATOM   1125 C  CA  . GLY B  1 50 ? 10.029  27.278  168.253 1.00 25.70 ? 50   GLY B CA  1 
ATOM   1126 C  C   . GLY B  1 50 ? 10.787  28.052  167.191 1.00 23.65 ? 50   GLY B C   1 
ATOM   1127 O  O   . GLY B  1 50 ? 11.254  29.176  167.455 1.00 23.26 ? 50   GLY B O   1 
ATOM   1128 N  N   . ALA B  1 51 ? 10.926  27.463  166.002 1.00 23.47 ? 51   ALA B N   1 
ATOM   1129 C  CA  . ALA B  1 51 ? 11.726  28.069  164.943 1.00 24.18 ? 51   ALA B CA  1 
ATOM   1130 C  C   . ALA B  1 51 ? 11.093  29.389  164.495 1.00 23.26 ? 51   ALA B C   1 
ATOM   1131 O  O   . ALA B  1 51 ? 11.788  30.361  164.302 1.00 21.05 ? 51   ALA B O   1 
ATOM   1132 C  CB  . ALA B  1 51 ? 11.915  27.098  163.750 1.00 23.90 ? 51   ALA B CB  1 
ATOM   1133 N  N   . ASP B  1 52 ? 9.770   29.455  164.395 1.00 24.91 ? 52   ASP B N   1 
ATOM   1134 C  CA  . ASP B  1 52 ? 9.132   30.714  164.021 1.00 27.04 ? 52   ASP B CA  1 
ATOM   1135 C  C   . ASP B  1 52 ? 9.314   31.816  165.073 1.00 25.62 ? 52   ASP B C   1 
ATOM   1136 O  O   . ASP B  1 52 ? 9.497   32.979  164.717 1.00 23.46 ? 52   ASP B O   1 
ATOM   1137 C  CB  . ASP B  1 52 ? 7.646   30.498  163.723 1.00 32.05 ? 52   ASP B CB  1 
ATOM   1138 C  CG  . ASP B  1 52 ? 7.418   29.807  162.386 1.00 38.32 ? 52   ASP B CG  1 
ATOM   1139 O  OD1 . ASP B  1 52 ? 8.384   29.690  161.579 1.00 40.66 ? 52   ASP B OD1 1 
ATOM   1140 O  OD2 . ASP B  1 52 ? 6.292   29.364  162.052 1.00 41.91 ? 52   ASP B OD2 1 
ATOM   1141 N  N   . VAL B  1 53 ? 9.202   31.470  166.354 1.00 23.07 ? 53   VAL B N   1 
ATOM   1142 C  CA  . VAL B  1 53 ? 9.512   32.418  167.425 1.00 24.06 ? 53   VAL B CA  1 
ATOM   1143 C  C   . VAL B  1 53 ? 10.962  32.932  167.345 1.00 22.69 ? 53   VAL B C   1 
ATOM   1144 O  O   . VAL B  1 53 ? 11.201  34.138  167.462 1.00 24.31 ? 53   VAL B O   1 
ATOM   1145 C  CB  . VAL B  1 53 ? 9.194   31.840  168.841 1.00 24.81 ? 53   VAL B CB  1 
ATOM   1146 C  CG1 . VAL B  1 53 ? 9.776   32.719  169.935 1.00 25.86 ? 53   VAL B CG1 1 
ATOM   1147 C  CG2 . VAL B  1 53 ? 7.716   31.728  169.020 1.00 29.14 ? 53   VAL B CG2 1 
ATOM   1148 N  N   . TRP B  1 54 ? 11.931  32.033  167.156 1.00 20.66 ? 54   TRP B N   1 
ATOM   1149 C  CA  . TRP B  1 54 ? 13.319  32.450  166.970 1.00 18.20 ? 54   TRP B CA  1 
ATOM   1150 C  C   . TRP B  1 54 ? 13.468  33.341  165.728 1.00 19.53 ? 54   TRP B C   1 
ATOM   1151 O  O   . TRP B  1 54 ? 14.137  34.380  165.765 1.00 17.43 ? 54   TRP B O   1 
ATOM   1152 C  CB  . TRP B  1 54 ? 14.217  31.220  166.859 1.00 15.98 ? 54   TRP B CB  1 
ATOM   1153 C  CG  . TRP B  1 54 ? 14.757  30.754  168.180 1.00 17.41 ? 54   TRP B CG  1 
ATOM   1154 C  CD1 . TRP B  1 54 ? 14.502  29.569  168.817 1.00 18.15 ? 54   TRP B CD1 1 
ATOM   1155 C  CD2 . TRP B  1 54 ? 15.647  31.477  169.023 1.00 16.56 ? 54   TRP B CD2 1 
ATOM   1156 N  NE1 . TRP B  1 54 ? 15.193  29.503  170.008 1.00 16.73 ? 54   TRP B NE1 1 
ATOM   1157 C  CE2 . TRP B  1 54 ? 15.925  30.657  170.149 1.00 17.30 ? 54   TRP B CE2 1 
ATOM   1158 C  CE3 . TRP B  1 54 ? 16.252  32.747  168.939 1.00 16.95 ? 54   TRP B CE3 1 
ATOM   1159 C  CZ2 . TRP B  1 54 ? 16.747  31.079  171.203 1.00 17.85 ? 54   TRP B CZ2 1 
ATOM   1160 C  CZ3 . TRP B  1 54 ? 17.086  33.147  169.956 1.00 16.80 ? 54   TRP B CZ3 1 
ATOM   1161 C  CH2 . TRP B  1 54 ? 17.321  32.327  171.079 1.00 19.09 ? 54   TRP B CH2 1 
ATOM   1162 N  N   . PHE B  1 55 ? 12.827  32.958  164.627 1.00 17.83 ? 55   PHE B N   1 
ATOM   1163 C  CA  . PHE B  1 55 ? 12.982  33.737  163.402 1.00 19.23 ? 55   PHE B CA  1 
ATOM   1164 C  C   . PHE B  1 55 ? 12.509  35.175  163.622 1.00 19.17 ? 55   PHE B C   1 
ATOM   1165 O  O   . PHE B  1 55 ? 13.175  36.119  163.170 1.00 19.44 ? 55   PHE B O   1 
ATOM   1166 C  CB  . PHE B  1 55 ? 12.249  33.075  162.216 1.00 20.05 ? 55   PHE B CB  1 
ATOM   1167 C  CG  . PHE B  1 55 ? 12.706  33.586  160.875 1.00 19.48 ? 55   PHE B CG  1 
ATOM   1168 C  CD1 . PHE B  1 55 ? 13.823  33.032  160.253 1.00 20.23 ? 55   PHE B CD1 1 
ATOM   1169 C  CD2 . PHE B  1 55 ? 12.102  34.692  160.290 1.00 23.41 ? 55   PHE B CD2 1 
ATOM   1170 C  CE1 . PHE B  1 55 ? 14.281  33.525  159.054 1.00 21.25 ? 55   PHE B CE1 1 
ATOM   1171 C  CE2 . PHE B  1 55 ? 12.558  35.188  159.069 1.00 22.38 ? 55   PHE B CE2 1 
ATOM   1172 C  CZ  . PHE B  1 55 ? 13.649  34.607  158.463 1.00 23.10 ? 55   PHE B CZ  1 
ATOM   1173 N  N   . LYS B  1 56 ? 11.372  35.344  164.295 1.00 20.02 ? 56   LYS B N   1 
ATOM   1174 C  CA  . LYS B  1 56 ? 10.821  36.674  164.514 1.00 24.36 ? 56   LYS B CA  1 
ATOM   1175 C  C   . LYS B  1 56 ? 11.733  37.501  165.402 1.00 24.03 ? 56   LYS B C   1 
ATOM   1176 O  O   . LYS B  1 56 ? 11.876  38.701  165.209 1.00 23.30 ? 56   LYS B O   1 
ATOM   1177 C  CB  . LYS B  1 56 ? 9.441   36.613  165.160 1.00 27.39 ? 56   LYS B CB  1 
ATOM   1178 C  CG  . LYS B  1 56 ? 8.787   37.972  165.249 1.00 32.26 ? 56   LYS B CG  1 
ATOM   1179 C  CD  . LYS B  1 56 ? 7.400   37.888  165.873 1.00 35.11 ? 56   LYS B CD  1 
ATOM   1180 C  CE  . LYS B  1 56 ? 6.649   39.195  165.664 1.00 38.42 ? 56   LYS B CE  1 
ATOM   1181 N  NZ  . LYS B  1 56 ? 5.471   39.252  166.580 1.00 41.75 ? 56   LYS B NZ  1 
ATOM   1182 N  N   . GLU B  1 57 ? 12.325  36.845  166.391 1.00 21.56 ? 57   GLU B N   1 
ATOM   1183 C  CA  . GLU B  1 57 ? 13.262  37.476  167.295 1.00 23.93 ? 57   GLU B CA  1 
ATOM   1184 C  C   . GLU B  1 57 ? 14.555  37.902  166.581 1.00 21.62 ? 57   GLU B C   1 
ATOM   1185 O  O   . GLU B  1 57 ? 15.082  38.968  166.872 1.00 21.09 ? 57   GLU B O   1 
ATOM   1186 C  CB  . GLU B  1 57 ? 13.575  36.502  168.422 1.00 26.35 ? 57   GLU B CB  1 
ATOM   1187 C  CG  . GLU B  1 57 ? 14.452  37.085  169.503 1.00 33.32 ? 57   GLU B CG  1 
ATOM   1188 C  CD  . GLU B  1 57 ? 14.593  36.144  170.685 1.00 34.45 ? 57   GLU B CD  1 
ATOM   1189 O  OE1 . GLU B  1 57 ? 13.646  35.350  170.939 1.00 34.93 ? 57   GLU B OE1 1 
ATOM   1190 O  OE2 . GLU B  1 57 ? 15.650  36.231  171.346 1.00 37.20 ? 57   GLU B OE2 1 
ATOM   1191 N  N   . LEU B  1 58 ? 15.070  37.074  165.676 1.00 16.97 ? 58   LEU B N   1 
ATOM   1192 C  CA  . LEU B  1 58 ? 16.353  37.309  164.990 1.00 15.16 ? 58   LEU B CA  1 
ATOM   1193 C  C   . LEU B  1 58 ? 16.252  38.239  163.773 1.00 17.14 ? 58   LEU B C   1 
ATOM   1194 O  O   . LEU B  1 58 ? 17.207  38.929  163.430 1.00 18.55 ? 58   LEU B O   1 
ATOM   1195 C  CB  . LEU B  1 58 ? 16.987  35.987  164.526 1.00 16.14 ? 58   LEU B CB  1 
ATOM   1196 C  CG  . LEU B  1 58 ? 17.351  35.008  165.659 1.00 16.10 ? 58   LEU B CG  1 
ATOM   1197 C  CD1 . LEU B  1 58 ? 17.970  33.745  165.057 1.00 19.90 ? 58   LEU B CD1 1 
ATOM   1198 C  CD2 . LEU B  1 58 ? 18.323  35.624  166.671 1.00 16.59 ? 58   LEU B CD2 1 
ATOM   1199 N  N   . ASP B  1 59 ? 15.104  38.260  163.127 1.00 14.80 ? 59   ASP B N   1 
ATOM   1200 C  CA  . ASP B  1 59 ? 14.988  39.117  161.944 1.00 16.64 ? 59   ASP B CA  1 
ATOM   1201 C  C   . ASP B  1 59 ? 14.733  40.590  162.288 1.00 16.25 ? 59   ASP B C   1 
ATOM   1202 O  O   . ASP B  1 59 ? 13.591  41.079  162.206 1.00 16.99 ? 59   ASP B O   1 
ATOM   1203 C  CB  . ASP B  1 59 ? 13.920  38.556  161.011 1.00 14.98 ? 59   ASP B CB  1 
ATOM   1204 C  CG  . ASP B  1 59 ? 13.881  39.304  159.695 1.00 15.23 ? 59   ASP B CG  1 
ATOM   1205 O  OD1 . ASP B  1 59 ? 14.842  40.083  159.353 1.00 14.61 ? 59   ASP B OD1 1 
ATOM   1206 O  OD2 . ASP B  1 59 ? 12.878  39.139  158.955 1.00 17.84 ? 59   ASP B OD2 1 
ATOM   1207 N  N   . ILE B  1 60 ? 15.788  41.304  162.678 1.00 14.38 ? 60   ILE B N   1 
ATOM   1208 C  CA  . ILE B  1 60 ? 15.664  42.653  163.227 1.00 16.43 ? 60   ILE B CA  1 
ATOM   1209 C  C   . ILE B  1 60 ? 15.040  43.637  162.222 1.00 17.12 ? 60   ILE B C   1 
ATOM   1210 O  O   . ILE B  1 60 ? 14.186  44.470  162.584 1.00 17.29 ? 60   ILE B O   1 
ATOM   1211 C  CB  . ILE B  1 60 ? 17.041  43.158  163.660 1.00 14.13 ? 60   ILE B CB  1 
ATOM   1212 C  CG1 . ILE B  1 60 ? 17.656  42.207  164.704 1.00 19.87 ? 60   ILE B CG1 1 
ATOM   1213 C  CG2 . ILE B  1 60 ? 16.968  44.601  164.146 1.00 18.82 ? 60   ILE B CG2 1 
ATOM   1214 C  CD1 . ILE B  1 60 ? 16.788  42.021  165.908 1.00 18.10 ? 60   ILE B CD1 1 
ATOM   1215 N  N   . ASN B  1 61 ? 15.446  43.531  160.963 1.00 15.09 ? 61   ASN B N   1 
ATOM   1216 C  CA  . ASN B  1 61 ? 14.954  44.500  159.987 1.00 15.31 ? 61   ASN B CA  1 
ATOM   1217 C  C   . ASN B  1 61 ? 13.676  44.007  159.289 1.00 16.50 ? 61   ASN B C   1 
ATOM   1218 O  O   . ASN B  1 61 ? 13.189  44.661  158.391 1.00 18.16 ? 61   ASN B O   1 
ATOM   1219 C  CB  . ASN B  1 61 ? 16.014  44.871  158.945 1.00 13.33 ? 61   ASN B CB  1 
ATOM   1220 C  CG  . ASN B  1 61 ? 16.494  43.700  158.123 1.00 16.65 ? 61   ASN B CG  1 
ATOM   1221 O  OD1 . ASN B  1 61 ? 16.449  42.585  158.553 1.00 19.90 ? 61   ASN B OD1 1 
ATOM   1222 N  ND2 . ASN B  1 61 ? 16.977  43.972  156.930 1.00 13.85 ? 61   ASN B ND2 1 
ATOM   1223 N  N   . THR B  1 62 ? 13.141  42.865  159.720 1.00 16.95 ? 62   THR B N   1 
ATOM   1224 C  CA  . THR B  1 62 ? 11.948  42.260  159.094 1.00 19.88 ? 62   THR B CA  1 
ATOM   1225 C  C   . THR B  1 62 ? 12.007  42.207  157.560 1.00 20.11 ? 62   THR B C   1 
ATOM   1226 O  O   . THR B  1 62 ? 11.060  42.632  156.888 1.00 20.96 ? 62   THR B O   1 
ATOM   1227 C  CB  . THR B  1 62 ? 10.641  42.994  159.500 1.00 20.34 ? 62   THR B CB  1 
ATOM   1228 O  OG1 . THR B  1 62 ? 10.843  44.408  159.374 1.00 24.64 ? 62   THR B OG1 1 
ATOM   1229 C  CG2 . THR B  1 62 ? 10.299  42.827  160.986 1.00 24.70 ? 62   THR B CG2 1 
ATOM   1230 N  N   . ASP B  1 63 ? 13.112  41.736  156.982 1.00 18.72 ? 63   ASP B N   1 
ATOM   1231 C  CA  . ASP B  1 63 ? 13.188  41.529  155.553 1.00 16.72 ? 63   ASP B CA  1 
ATOM   1232 C  C   . ASP B  1 63 ? 12.973  40.068  155.145 1.00 18.26 ? 63   ASP B C   1 
ATOM   1233 O  O   . ASP B  1 63 ? 13.237  39.706  153.993 1.00 20.10 ? 63   ASP B O   1 
ATOM   1234 C  CB  . ASP B  1 63 ? 14.518  42.050  155.045 1.00 17.41 ? 63   ASP B CB  1 
ATOM   1235 C  CG  . ASP B  1 63 ? 15.703  41.252  155.528 1.00 18.73 ? 63   ASP B CG  1 
ATOM   1236 O  OD1 . ASP B  1 63 ? 15.618  40.426  156.478 1.00 16.57 ? 63   ASP B OD1 1 
ATOM   1237 O  OD2 . ASP B  1 63 ? 16.835  41.475  155.041 1.00 21.17 ? 63   ASP B OD2 1 
ATOM   1238 N  N   . GLY B  1 64 ? 12.537  39.235  156.096 1.00 17.05 ? 64   GLY B N   1 
ATOM   1239 C  CA  . GLY B  1 64 ? 12.323  37.790  155.889 1.00 16.24 ? 64   GLY B CA  1 
ATOM   1240 C  C   . GLY B  1 64 ? 13.574  36.912  155.773 1.00 19.41 ? 64   GLY B C   1 
ATOM   1241 O  O   . GLY B  1 64 ? 13.509  35.791  155.251 1.00 17.19 ? 64   GLY B O   1 
ATOM   1242 N  N   . ALA B  1 65 ? 14.707  37.390  156.279 1.00 18.21 ? 65   ALA B N   1 
ATOM   1243 C  CA  . ALA B  1 65 ? 15.931  36.589  156.251 1.00 18.32 ? 65   ALA B CA  1 
ATOM   1244 C  C   . ALA B  1 65 ? 16.672  36.847  157.549 1.00 17.72 ? 65   ALA B C   1 
ATOM   1245 O  O   . ALA B  1 65 ? 16.422  37.869  158.198 1.00 17.98 ? 65   ALA B O   1 
ATOM   1246 C  CB  . ALA B  1 65 ? 16.785  37.013  155.078 1.00 19.68 ? 65   ALA B CB  1 
ATOM   1247 N  N   . VAL B  1 66 ? 17.565  35.925  157.929 1.00 15.03 ? 66   VAL B N   1 
ATOM   1248 C  CA  . VAL B  1 66 ? 18.446  36.156  159.067 1.00 16.44 ? 66   VAL B CA  1 
ATOM   1249 C  C   . VAL B  1 66 ? 19.854  36.253  158.480 1.00 16.00 ? 66   VAL B C   1 
ATOM   1250 O  O   . VAL B  1 66 ? 20.307  35.294  157.861 1.00 18.56 ? 66   VAL B O   1 
ATOM   1251 C  CB  . VAL B  1 66 ? 18.320  34.986  160.081 1.00 16.44 ? 66   VAL B CB  1 
ATOM   1252 C  CG1 . VAL B  1 66 ? 19.440  35.029  161.112 1.00 15.41 ? 66   VAL B CG1 1 
ATOM   1253 C  CG2 . VAL B  1 66 ? 16.977  35.107  160.785 1.00 17.25 ? 66   VAL B CG2 1 
ATOM   1254 N  N   . ASN B  1 67 ? 20.480  37.424  158.579 1.00 15.16 ? 67   ASN B N   1 
ATOM   1255 C  CA  . ASN B  1 67 ? 21.853  37.632  158.075 1.00 14.75 ? 67   ASN B CA  1 
ATOM   1256 C  C   . ASN B  1 67 ? 22.906  37.237  159.127 1.00 15.99 ? 67   ASN B C   1 
ATOM   1257 O  O   . ASN B  1 67 ? 22.518  36.782  160.193 1.00 14.99 ? 67   ASN B O   1 
ATOM   1258 C  CB  . ASN B  1 67 ? 22.053  39.042  157.473 1.00 17.85 ? 67   ASN B CB  1 
ATOM   1259 C  CG  . ASN B  1 67 ? 22.125  40.158  158.520 1.00 19.77 ? 67   ASN B CG  1 
ATOM   1260 O  OD1 . ASN B  1 67 ? 22.339  39.918  159.711 1.00 18.35 ? 67   ASN B OD1 1 
ATOM   1261 N  ND2 . ASN B  1 67 ? 21.919  41.392  158.068 1.00 19.81 ? 67   ASN B ND2 1 
ATOM   1262 N  N   . PHE B  1 68 ? 24.208  37.313  158.826 1.00 17.43 ? 68   PHE B N   1 
ATOM   1263 C  CA  . PHE B  1 68 ? 25.207  36.812  159.797 1.00 18.43 ? 68   PHE B CA  1 
ATOM   1264 C  C   . PHE B  1 68 ? 25.168  37.574  161.140 1.00 19.29 ? 68   PHE B C   1 
ATOM   1265 O  O   . PHE B  1 68 ? 25.301  36.975  162.220 1.00 17.64 ? 68   PHE B O   1 
ATOM   1266 C  CB  . PHE B  1 68 ? 26.620  36.824  159.209 1.00 21.01 ? 68   PHE B CB  1 
ATOM   1267 C  CG  . PHE B  1 68 ? 27.633  36.192  160.122 1.00 22.13 ? 68   PHE B CG  1 
ATOM   1268 C  CD1 . PHE B  1 68 ? 27.537  34.836  160.452 1.00 22.00 ? 68   PHE B CD1 1 
ATOM   1269 C  CD2 . PHE B  1 68 ? 28.621  36.961  160.714 1.00 23.32 ? 68   PHE B CD2 1 
ATOM   1270 C  CE1 . PHE B  1 68 ? 28.444  34.237  161.302 1.00 24.15 ? 68   PHE B CE1 1 
ATOM   1271 C  CE2 . PHE B  1 68 ? 29.534  36.371  161.611 1.00 23.43 ? 68   PHE B CE2 1 
ATOM   1272 C  CZ  . PHE B  1 68 ? 29.443  35.010  161.890 1.00 22.27 ? 68   PHE B CZ  1 
ATOM   1273 N  N   . GLN B  1 69 ? 25.002  38.893  161.072 1.00 18.05 ? 69   GLN B N   1 
ATOM   1274 C  CA  . GLN B  1 69 ? 24.975  39.676  162.326 1.00 21.85 ? 69   GLN B CA  1 
ATOM   1275 C  C   . GLN B  1 69 ? 23.734  39.388  163.177 1.00 19.60 ? 69   GLN B C   1 
ATOM   1276 O  O   . GLN B  1 69 ? 23.802  39.359  164.421 1.00 17.17 ? 69   GLN B O   1 
ATOM   1277 C  CB  . GLN B  1 69 ? 25.193  41.171  162.066 1.00 24.47 ? 69   GLN B CB  1 
ATOM   1278 C  CG  . GLN B  1 69 ? 24.094  41.811  161.244 1.00 31.72 ? 69   GLN B CG  1 
ATOM   1279 C  CD  . GLN B  1 69 ? 24.531  43.138  160.633 1.00 36.69 ? 69   GLN B CD  1 
ATOM   1280 O  OE1 . GLN B  1 69 ? 24.866  43.206  159.452 1.00 38.75 ? 69   GLN B OE1 1 
ATOM   1281 N  NE2 . GLN B  1 69 ? 24.548  44.182  161.443 1.00 38.23 ? 69   GLN B NE2 1 
ATOM   1282 N  N   . GLU B  1 70 ? 22.614  39.113  162.514 1.00 16.49 ? 70   GLU B N   1 
ATOM   1283 C  CA  . GLU B  1 70 ? 21.400  38.646  163.209 1.00 16.01 ? 70   GLU B CA  1 
ATOM   1284 C  C   . GLU B  1 70 ? 21.575  37.244  163.815 1.00 18.36 ? 70   GLU B C   1 
ATOM   1285 O  O   . GLU B  1 70 ? 21.156  36.998  164.947 1.00 19.89 ? 70   GLU B O   1 
ATOM   1286 C  CB  . GLU B  1 70 ? 20.173  38.692  162.271 1.00 16.26 ? 70   GLU B CB  1 
ATOM   1287 C  CG  . GLU B  1 70 ? 19.760  40.111  161.874 1.00 15.01 ? 70   GLU B CG  1 
ATOM   1288 C  CD  . GLU B  1 70 ? 18.738  40.155  160.732 1.00 16.77 ? 70   GLU B CD  1 
ATOM   1289 O  OE1 . GLU B  1 70 ? 18.821  39.340  159.794 1.00 19.11 ? 70   GLU B OE1 1 
ATOM   1290 O  OE2 . GLU B  1 70 ? 17.819  40.988  160.772 1.00 15.38 ? 70   GLU B OE2 1 
ATOM   1291 N  N   . PHE B  1 71 ? 22.225  36.346  163.082 1.00 18.72 ? 71   PHE B N   1 
ATOM   1292 C  CA  . PHE B  1 71 ? 22.573  35.015  163.599 1.00 17.20 ? 71   PHE B CA  1 
ATOM   1293 C  C   . PHE B  1 71 ? 23.388  35.125  164.908 1.00 19.69 ? 71   PHE B C   1 
ATOM   1294 O  O   . PHE B  1 71 ? 23.186  34.317  165.827 1.00 17.49 ? 71   PHE B O   1 
ATOM   1295 C  CB  . PHE B  1 71 ? 23.387  34.271  162.524 1.00 16.96 ? 71   PHE B CB  1 
ATOM   1296 C  CG  . PHE B  1 71 ? 23.990  32.944  162.992 1.00 17.69 ? 71   PHE B CG  1 
ATOM   1297 C  CD1 . PHE B  1 71 ? 23.168  31.870  163.299 1.00 19.00 ? 71   PHE B CD1 1 
ATOM   1298 C  CD2 . PHE B  1 71 ? 25.363  32.780  163.093 1.00 18.68 ? 71   PHE B CD2 1 
ATOM   1299 C  CE1 . PHE B  1 71 ? 23.683  30.655  163.711 1.00 19.19 ? 71   PHE B CE1 1 
ATOM   1300 C  CE2 . PHE B  1 71 ? 25.901  31.543  163.517 1.00 16.59 ? 71   PHE B CE2 1 
ATOM   1301 C  CZ  . PHE B  1 71 ? 25.051  30.493  163.820 1.00 20.05 ? 71   PHE B CZ  1 
ATOM   1302 N  N   . LEU B  1 72 ? 24.355  36.052  164.949 1.00 17.39 ? 72   LEU B N   1 
ATOM   1303 C  CA  . LEU B  1 72 ? 25.129  36.292  166.193 1.00 18.28 ? 72   LEU B CA  1 
ATOM   1304 C  C   . LEU B  1 72 ? 24.287  36.526  167.478 1.00 18.69 ? 72   LEU B C   1 
ATOM   1305 O  O   . LEU B  1 72 ? 24.748  36.202  168.584 1.00 17.64 ? 72   LEU B O   1 
ATOM   1306 C  CB  . LEU B  1 72 ? 26.177  37.386  165.973 1.00 20.38 ? 72   LEU B CB  1 
ATOM   1307 C  CG  . LEU B  1 72 ? 27.344  37.004  165.046 1.00 19.33 ? 72   LEU B CG  1 
ATOM   1308 C  CD1 . LEU B  1 72 ? 28.363  38.154  164.820 1.00 21.54 ? 72   LEU B CD1 1 
ATOM   1309 C  CD2 . LEU B  1 72 ? 28.051  35.779  165.607 1.00 21.46 ? 72   LEU B CD2 1 
ATOM   1310 N  N   . ILE B  1 73 ? 23.065  37.058  167.358 1.00 15.82 ? 73   ILE B N   1 
ATOM   1311 C  CA  . ILE B  1 73 ? 22.166  37.170  168.492 1.00 19.20 ? 73   ILE B CA  1 
ATOM   1312 C  C   . ILE B  1 73 ? 21.847  35.780  169.037 1.00 17.63 ? 73   ILE B C   1 
ATOM   1313 O  O   . ILE B  1 73 ? 21.795  35.588  170.271 1.00 16.79 ? 73   ILE B O   1 
ATOM   1314 C  CB  . ILE B  1 73 ? 20.828  37.843  168.057 1.00 17.29 ? 73   ILE B CB  1 
ATOM   1315 C  CG1 . ILE B  1 73 ? 21.077  39.284  167.622 1.00 17.77 ? 73   ILE B CG1 1 
ATOM   1316 C  CG2 . ILE B  1 73 ? 19.786  37.784  169.191 1.00 21.33 ? 73   ILE B CG2 1 
ATOM   1317 C  CD1 . ILE B  1 73 ? 19.902  39.956  166.953 1.00 19.33 ? 73   ILE B CD1 1 
ATOM   1318 N  N   . LEU B  1 74 ? 21.548  34.845  168.127 1.00 16.54 ? 74   LEU B N   1 
ATOM   1319 C  CA  . LEU B  1 74 ? 21.274  33.464  168.553 1.00 15.24 ? 74   LEU B CA  1 
ATOM   1320 C  C   . LEU B  1 74 ? 22.516  32.868  169.198 1.00 17.53 ? 74   LEU B C   1 
ATOM   1321 O  O   . LEU B  1 74 ? 22.472  32.206  170.241 1.00 16.19 ? 74   LEU B O   1 
ATOM   1322 C  CB  . LEU B  1 74 ? 20.837  32.625  167.337 1.00 15.34 ? 74   LEU B CB  1 
ATOM   1323 C  CG  . LEU B  1 74 ? 20.785  31.103  167.538 1.00 19.81 ? 74   LEU B CG  1 
ATOM   1324 C  CD1 . LEU B  1 74 ? 19.749  30.742  168.580 1.00 19.66 ? 74   LEU B CD1 1 
ATOM   1325 C  CD2 . LEU B  1 74 ? 20.531  30.402  166.188 1.00 17.33 ? 74   LEU B CD2 1 
ATOM   1326 N  N   . VAL B  1 75 ? 23.669  33.095  168.592 1.00 16.60 ? 75   VAL B N   1 
ATOM   1327 C  CA  . VAL B  1 75 ? 24.873  32.560  169.185 1.00 16.01 ? 75   VAL B CA  1 
ATOM   1328 C  C   . VAL B  1 75 ? 25.167  33.094  170.593 1.00 17.89 ? 75   VAL B C   1 
ATOM   1329 O  O   . VAL B  1 75 ? 25.604  32.340  171.464 1.00 16.51 ? 75   VAL B O   1 
ATOM   1330 C  CB  . VAL B  1 75 ? 26.098  32.857  168.280 1.00 18.23 ? 75   VAL B CB  1 
ATOM   1331 C  CG1 . VAL B  1 75 ? 27.377  32.407  168.988 1.00 18.86 ? 75   VAL B CG1 1 
ATOM   1332 C  CG2 . VAL B  1 75 ? 25.920  32.194  166.907 1.00 18.53 ? 75   VAL B CG2 1 
ATOM   1333 N  N   . ILE B  1 76 ? 24.927  34.387  170.806 1.00 17.20 ? 76   ILE B N   1 
ATOM   1334 C  CA  . ILE B  1 76 ? 25.087  34.992  172.129 1.00 16.16 ? 76   ILE B CA  1 
ATOM   1335 C  C   . ILE B  1 76 ? 24.106  34.338  173.111 1.00 17.69 ? 76   ILE B C   1 
ATOM   1336 O  O   . ILE B  1 76 ? 24.485  33.973  174.236 1.00 16.77 ? 76   ILE B O   1 
ATOM   1337 C  CB  . ILE B  1 76 ? 24.896  36.540  172.051 1.00 15.50 ? 76   ILE B CB  1 
ATOM   1338 C  CG1 . ILE B  1 76 ? 26.088  37.191  171.319 1.00 18.31 ? 76   ILE B CG1 1 
ATOM   1339 C  CG2 . ILE B  1 76 ? 24.703  37.132  173.462 1.00 15.84 ? 76   ILE B CG2 1 
ATOM   1340 C  CD1 . ILE B  1 76 ? 25.800  38.599  170.789 1.00 18.17 ? 76   ILE B CD1 1 
ATOM   1341 N  N   . LYS B  1 77 ? 22.841  34.222  172.727 1.00 16.71 ? 77   LYS B N   1 
ATOM   1342 C  CA  . LYS B  1 77 ? 21.836  33.674  173.646 1.00 18.80 ? 77   LYS B CA  1 
ATOM   1343 C  C   . LYS B  1 77 ? 22.111  32.201  173.977 1.00 18.82 ? 77   LYS B C   1 
ATOM   1344 O  O   . LYS B  1 77 ? 21.958  31.774  175.120 1.00 19.26 ? 77   LYS B O   1 
ATOM   1345 C  CB  . LYS B  1 77 ? 20.439  33.898  173.046 1.00 18.76 ? 77   LYS B CB  1 
ATOM   1346 C  CG  . LYS B  1 77 ? 20.096  35.383  173.095 1.00 22.41 ? 77   LYS B CG  1 
ATOM   1347 C  CD  . LYS B  1 77 ? 18.671  35.737  172.760 1.00 25.90 ? 77   LYS B CD  1 
ATOM   1348 C  CE  . LYS B  1 77 ? 18.332  37.012  173.529 1.00 28.34 ? 77   LYS B CE  1 
ATOM   1349 N  NZ  . LYS B  1 77 ? 17.037  37.597  173.119 1.00 29.34 ? 77   LYS B NZ  1 
ATOM   1350 N  N   . MET B  1 78 ? 22.532  31.439  172.979 1.00 17.50 ? 78   MET B N   1 
ATOM   1351 C  CA  . MET B  1 78 ? 22.951  30.049  173.200 1.00 17.16 ? 78   MET B CA  1 
ATOM   1352 C  C   . MET B  1 78 ? 24.143  29.920  174.156 1.00 18.08 ? 78   MET B C   1 
ATOM   1353 O  O   . MET B  1 78 ? 24.196  28.997  174.983 1.00 16.22 ? 78   MET B O   1 
ATOM   1354 C  CB  . MET B  1 78 ? 23.311  29.401  171.868 1.00 15.47 ? 78   MET B CB  1 
ATOM   1355 C  CG  . MET B  1 78 ? 22.028  29.120  171.043 1.00 18.38 ? 78   MET B CG  1 
ATOM   1356 S  SD  . MET B  1 78 ? 22.421  28.199  169.536 1.00 23.71 ? 78   MET B SD  1 
ATOM   1357 C  CE  . MET B  1 78 ? 23.351  26.807  170.201 1.00 19.54 ? 78   MET B CE  1 
ATOM   1358 N  N   . GLY B  1 79 ? 25.113  30.810  173.966 1.00 16.47 ? 79   GLY B N   1 
ATOM   1359 C  CA  . GLY B  1 79 ? 26.290  30.858  174.810 1.00 15.34 ? 79   GLY B CA  1 
ATOM   1360 C  C   . GLY B  1 79 ? 25.937  31.174  176.249 1.00 17.52 ? 79   GLY B C   1 
ATOM   1361 O  O   . GLY B  1 79 ? 26.359  30.468  177.200 1.00 17.94 ? 79   GLY B O   1 
ATOM   1362 N  N   . VAL B  1 80 ? 25.122  32.209  176.422 1.00 15.57 ? 80   VAL B N   1 
ATOM   1363 C  CA  . VAL B  1 80 ? 24.725  32.598  177.768 1.00 17.84 ? 80   VAL B CA  1 
ATOM   1364 C  C   . VAL B  1 80 ? 23.957  31.452  178.456 1.00 16.91 ? 80   VAL B C   1 
ATOM   1365 O  O   . VAL B  1 80 ? 24.232  31.084  179.605 1.00 17.16 ? 80   VAL B O   1 
ATOM   1366 C  CB  . VAL B  1 80 ? 23.938  33.921  177.732 1.00 16.66 ? 80   VAL B CB  1 
ATOM   1367 C  CG1 . VAL B  1 80 ? 23.265  34.201  179.083 1.00 19.43 ? 80   VAL B CG1 1 
ATOM   1368 C  CG2 . VAL B  1 80 ? 24.904  35.097  177.324 1.00 16.81 ? 80   VAL B CG2 1 
ATOM   1369 N  N   . ALA B  1 81 ? 23.042  30.823  177.720 1.00 18.93 ? 81   ALA B N   1 
ATOM   1370 C  CA  . ALA B  1 81 ? 22.264  29.713  178.268 1.00 18.11 ? 81   ALA B CA  1 
ATOM   1371 C  C   . ALA B  1 81 ? 23.141  28.502  178.570 1.00 18.53 ? 81   ALA B C   1 
ATOM   1372 O  O   . ALA B  1 81 ? 22.973  27.878  179.613 1.00 21.03 ? 81   ALA B O   1 
ATOM   1373 C  CB  . ALA B  1 81 ? 21.161  29.307  177.297 1.00 18.40 ? 81   ALA B CB  1 
ATOM   1374 N  N   . ALA B  1 82 ? 24.053  28.136  177.675 1.00 17.38 ? 82   ALA B N   1 
ATOM   1375 C  CA  . ALA B  1 82 ? 24.905  26.981  177.959 1.00 19.21 ? 82   ALA B CA  1 
ATOM   1376 C  C   . ALA B  1 82 ? 25.797  27.251  179.174 1.00 19.82 ? 82   ALA B C   1 
ATOM   1377 O  O   . ALA B  1 82 ? 26.077  26.349  179.982 1.00 19.70 ? 82   ALA B O   1 
ATOM   1378 C  CB  . ALA B  1 82 ? 25.749  26.603  176.753 1.00 19.94 ? 82   ALA B CB  1 
ATOM   1379 N  N   . HIS B  1 83 ? 26.318  28.468  179.281 1.00 19.73 ? 83   HIS B N   1 
ATOM   1380 C  CA  . HIS B  1 83 ? 27.152  28.797  180.440 1.00 18.20 ? 83   HIS B CA  1 
ATOM   1381 C  C   . HIS B  1 83 ? 26.363  28.639  181.745 1.00 21.22 ? 83   HIS B C   1 
ATOM   1382 O  O   . HIS B  1 83 ? 26.836  28.061  182.728 1.00 21.08 ? 83   HIS B O   1 
ATOM   1383 C  CB  . HIS B  1 83 ? 27.762  30.201  180.326 1.00 15.18 ? 83   HIS B CB  1 
ATOM   1384 C  CG  . HIS B  1 83 ? 28.414  30.672  181.596 1.00 16.41 ? 83   HIS B CG  1 
ATOM   1385 N  ND1 . HIS B  1 83 ? 27.760  31.447  182.539 1.00 14.09 ? 83   HIS B ND1 1 
ATOM   1386 C  CD2 . HIS B  1 83 ? 29.646  30.426  182.104 1.00 16.22 ? 83   HIS B CD2 1 
ATOM   1387 C  CE1 . HIS B  1 83 ? 28.573  31.674  183.561 1.00 17.46 ? 83   HIS B CE1 1 
ATOM   1388 N  NE2 . HIS B  1 83 ? 29.729  31.080  183.309 1.00 15.22 ? 83   HIS B NE2 1 
ATOM   1389 N  N   . LYS B  1 84 ? 25.139  29.141  181.770 1.00 24.03 ? 84   LYS B N   1 
ATOM   1390 C  CA  . LYS B  1 84 ? 24.288  28.938  182.926 1.00 28.90 ? 84   LYS B CA  1 
ATOM   1391 C  C   . LYS B  1 84 ? 24.155  27.451  183.279 1.00 30.58 ? 84   LYS B C   1 
ATOM   1392 O  O   . LYS B  1 84 ? 24.288  27.079  184.446 1.00 29.58 ? 84   LYS B O   1 
ATOM   1393 C  CB  . LYS B  1 84 ? 22.890  29.467  182.645 1.00 32.35 ? 84   LYS B CB  1 
ATOM   1394 C  CG  . LYS B  1 84 ? 22.521  30.727  183.378 1.00 37.76 ? 84   LYS B CG  1 
ATOM   1395 C  CD  . LYS B  1 84 ? 21.116  31.165  182.950 1.00 41.78 ? 84   LYS B CD  1 
ATOM   1396 C  CE  . LYS B  1 84 ? 20.309  31.735  184.118 1.00 44.88 ? 84   LYS B CE  1 
ATOM   1397 N  NZ  . LYS B  1 84 ? 19.220  32.667  183.661 1.00 46.56 ? 84   LYS B NZ  1 
ATOM   1398 N  N   . LYS B  1 85 ? 23.875  26.623  182.275 1.00 32.60 ? 85   LYS B N   1 
ATOM   1399 C  CA  . LYS B  1 85 ? 23.743  25.174  182.461 1.00 35.94 ? 85   LYS B CA  1 
ATOM   1400 C  C   . LYS B  1 85 ? 25.012  24.526  182.989 1.00 37.32 ? 85   LYS B C   1 
ATOM   1401 O  O   . LYS B  1 85 ? 24.938  23.630  183.826 1.00 37.32 ? 85   LYS B O   1 
ATOM   1402 C  CB  . LYS B  1 85 ? 23.382  24.466  181.153 1.00 37.79 ? 85   LYS B CB  1 
ATOM   1403 C  CG  . LYS B  1 85 ? 22.092  24.921  180.500 1.00 41.46 ? 85   LYS B CG  1 
ATOM   1404 C  CD  . LYS B  1 85 ? 20.900  24.208  181.075 1.00 43.93 ? 85   LYS B CD  1 
ATOM   1405 C  CE  . LYS B  1 85 ? 19.619  24.825  180.553 1.00 45.37 ? 85   LYS B CE  1 
ATOM   1406 N  NZ  . LYS B  1 85 ? 18.440  24.127  181.141 1.00 47.42 ? 85   LYS B NZ  1 
ATOM   1407 N  N   . SER B  1 86 ? 26.174  24.939  182.486 1.00 39.08 ? 86   SER B N   1 
ATOM   1408 C  CA  . SER B  1 86 ? 27.405  24.249  182.838 1.00 43.16 ? 86   SER B CA  1 
ATOM   1409 C  C   . SER B  1 86 ? 27.762  24.443  184.303 1.00 46.69 ? 86   SER B C   1 
ATOM   1410 O  O   . SER B  1 86 ? 28.618  23.732  184.828 1.00 45.52 ? 86   SER B O   1 
ATOM   1411 C  CB  . SER B  1 86 ? 28.569  24.626  181.930 1.00 44.27 ? 86   SER B CB  1 
ATOM   1412 O  OG  . SER B  1 86 ? 29.156  25.838  182.349 1.00 47.16 ? 86   SER B OG  1 
ATOM   1413 N  N   . HIS B  1 87 ? 27.116  25.390  184.975 1.00 50.49 ? 87   HIS B N   1 
ATOM   1414 C  CA  . HIS B  1 87 ? 27.156  25.349  186.434 1.00 55.13 ? 87   HIS B CA  1 
ATOM   1415 C  C   . HIS B  1 87 ? 25.793  25.495  187.083 1.00 56.88 ? 87   HIS B C   1 
ATOM   1416 O  O   . HIS B  1 87 ? 25.469  26.496  187.723 1.00 58.10 ? 87   HIS B O   1 
ATOM   1417 C  CB  . HIS B  1 87 ? 28.251  26.233  187.045 1.00 56.70 ? 87   HIS B CB  1 
ATOM   1418 C  CG  . HIS B  1 87 ? 27.933  27.696  187.083 1.00 58.25 ? 87   HIS B CG  1 
ATOM   1419 N  ND1 . HIS B  1 87 ? 27.452  28.387  185.992 1.00 58.13 ? 87   HIS B ND1 1 
ATOM   1420 C  CD2 . HIS B  1 87 ? 28.075  28.609  188.076 1.00 58.66 ? 87   HIS B CD2 1 
ATOM   1421 C  CE1 . HIS B  1 87 ? 27.286  29.657  186.319 1.00 59.24 ? 87   HIS B CE1 1 
ATOM   1422 N  NE2 . HIS B  1 87 ? 27.656  29.818  187.578 1.00 58.95 ? 87   HIS B NE2 1 
ATOM   1423 N  N   . GLU B  1 88 ? 25.035  24.416  186.923 1.00 60.33 ? 88   GLU B N   1 
ATOM   1424 C  CA  . GLU B  1 88 ? 23.695  24.262  187.446 1.00 62.98 ? 88   GLU B CA  1 
ATOM   1425 C  C   . GLU B  1 88 ? 23.438  22.759  187.532 1.00 63.86 ? 88   GLU B C   1 
ATOM   1426 O  O   . GLU B  1 88 ? 24.360  21.955  187.348 1.00 64.13 ? 88   GLU B O   1 
ATOM   1427 C  CB  . GLU B  1 88 ? 22.688  24.937  186.511 1.00 63.57 ? 88   GLU B CB  1 
ATOM   1428 C  CG  . GLU B  1 88 ? 21.451  24.109  186.200 1.00 64.64 ? 88   GLU B CG  1 
ATOM   1429 C  CD  . GLU B  1 88 ? 20.565  24.748  185.140 1.00 64.73 ? 88   GLU B CD  1 
ATOM   1430 O  OE1 . GLU B  1 88 ? 19.844  24.004  184.435 1.00 65.57 ? 88   GLU B OE1 1 
ATOM   1431 O  OE2 . GLU B  1 88 ? 20.587  25.994  185.006 1.00 64.74 ? 88   GLU B OE2 1 
ATOM   1432 N  N   . LYS C  2 3  ? 9.892   70.055  167.750 1.00 50.82 ? 4    LYS C N   1 
ATOM   1433 C  CA  . LYS C  2 3  ? 9.141   68.965  168.427 1.00 49.76 ? 4    LYS C CA  1 
ATOM   1434 C  C   . LYS C  2 3  ? 9.606   67.576  167.983 1.00 46.94 ? 4    LYS C C   1 
ATOM   1435 O  O   . LYS C  2 3  ? 9.618   66.663  168.802 1.00 47.29 ? 4    LYS C O   1 
ATOM   1436 C  CB  . LYS C  2 3  ? 7.633   69.126  168.233 1.00 52.31 ? 4    LYS C CB  1 
ATOM   1437 C  CG  . LYS C  2 3  ? 6.828   68.951  169.529 1.00 55.23 ? 4    LYS C CG  1 
ATOM   1438 C  CD  . LYS C  2 3  ? 6.593   67.481  169.892 1.00 57.32 ? 4    LYS C CD  1 
ATOM   1439 C  CE  . LYS C  2 3  ? 5.546   66.827  168.987 1.00 58.26 ? 4    LYS C CE  1 
ATOM   1440 N  NZ  . LYS C  2 3  ? 4.243   67.558  169.034 1.00 59.00 ? 4    LYS C NZ  1 
ATOM   1441 N  N   . MET C  2 4  ? 9.979   67.410  166.713 1.00 41.53 ? 5    MET C N   1 
ATOM   1442 C  CA  . MET C  2 4  ? 10.721  66.213  166.303 1.00 37.93 ? 5    MET C CA  1 
ATOM   1443 C  C   . MET C  2 4  ? 12.026  66.102  167.102 1.00 30.87 ? 5    MET C C   1 
ATOM   1444 O  O   . MET C  2 4  ? 12.789  67.058  167.202 1.00 27.73 ? 5    MET C O   1 
ATOM   1445 C  CB  . MET C  2 4  ? 11.036  66.213  164.800 1.00 39.53 ? 5    MET C CB  1 
ATOM   1446 C  CG  . MET C  2 4  ? 10.309  65.137  164.000 1.00 42.99 ? 5    MET C CG  1 
ATOM   1447 S  SD  . MET C  2 4  ? 11.049  64.820  162.370 1.00 46.25 ? 5    MET C SD  1 
ATOM   1448 C  CE  . MET C  2 4  ? 10.925  66.508  161.697 1.00 45.06 ? 5    MET C CE  1 
ATOM   1449 N  N   . SER C  2 5  ? 12.264  64.928  167.681 1.00 25.30 ? 6    SER C N   1 
ATOM   1450 C  CA  . SER C  2 5  ? 13.518  64.642  168.379 1.00 20.60 ? 6    SER C CA  1 
ATOM   1451 C  C   . SER C  2 5  ? 14.706  64.544  167.419 1.00 19.06 ? 6    SER C C   1 
ATOM   1452 O  O   . SER C  2 5  ? 14.529  64.392  166.198 1.00 17.34 ? 6    SER C O   1 
ATOM   1453 C  CB  . SER C  2 5  ? 13.363  63.314  169.132 1.00 17.47 ? 6    SER C CB  1 
ATOM   1454 O  OG  . SER C  2 5  ? 13.535  62.220  168.232 1.00 16.07 ? 6    SER C OG  1 
ATOM   1455 N  N   . GLN C  2 6  ? 15.923  64.578  167.966 1.00 15.63 ? 7    GLN C N   1 
ATOM   1456 C  CA  . GLN C  2 6  ? 17.117  64.441  167.133 1.00 17.23 ? 7    GLN C CA  1 
ATOM   1457 C  C   . GLN C  2 6  ? 17.118  63.105  166.402 1.00 15.80 ? 7    GLN C C   1 
ATOM   1458 O  O   . GLN C  2 6  ? 17.403  63.035  165.203 1.00 14.84 ? 7    GLN C O   1 
ATOM   1459 C  CB  . GLN C  2 6  ? 18.382  64.542  168.007 1.00 20.30 ? 7    GLN C CB  1 
ATOM   1460 C  CG  . GLN C  2 6  ? 19.690  64.503  167.241 1.00 19.25 ? 7    GLN C CG  1 
ATOM   1461 C  CD  . GLN C  2 6  ? 20.851  64.768  168.198 1.00 25.21 ? 7    GLN C CD  1 
ATOM   1462 O  OE1 . GLN C  2 6  ? 20.623  65.128  169.361 1.00 29.28 ? 7    GLN C OE1 1 
ATOM   1463 N  NE2 . GLN C  2 6  ? 22.085  64.607  167.719 1.00 25.93 ? 7    GLN C NE2 1 
ATOM   1464 N  N   . LEU C  2 7  ? 16.758  62.040  167.131 1.00 17.07 ? 8    LEU C N   1 
ATOM   1465 C  CA  . LEU C  2 7  ? 16.752  60.692  166.552 1.00 16.70 ? 8    LEU C CA  1 
ATOM   1466 C  C   . LEU C  2 7  ? 15.725  60.624  165.418 1.00 15.84 ? 8    LEU C C   1 
ATOM   1467 O  O   . LEU C  2 7  ? 15.985  60.029  164.377 1.00 15.85 ? 8    LEU C O   1 
ATOM   1468 C  CB  . LEU C  2 7  ? 16.446  59.648  167.650 1.00 16.58 ? 8    LEU C CB  1 
ATOM   1469 C  CG  . LEU C  2 7  ? 16.591  58.193  167.180 1.00 19.08 ? 8    LEU C CG  1 
ATOM   1470 C  CD1 . LEU C  2 7  ? 17.925  57.939  166.494 1.00 13.82 ? 8    LEU C CD1 1 
ATOM   1471 C  CD2 . LEU C  2 7  ? 16.432  57.227  168.330 1.00 17.62 ? 8    LEU C CD2 1 
ATOM   1472 N  N   . GLU C  2 8  ? 14.545  61.208  165.649 1.00 18.20 ? 9    GLU C N   1 
ATOM   1473 C  CA  . GLU C  2 8  ? 13.498  61.268  164.626 1.00 19.88 ? 9    GLU C CA  1 
ATOM   1474 C  C   . GLU C  2 8  ? 13.974  62.039  163.374 1.00 20.70 ? 9    GLU C C   1 
ATOM   1475 O  O   . GLU C  2 8  ? 13.734  61.591  162.256 1.00 20.48 ? 9    GLU C O   1 
ATOM   1476 C  CB  . GLU C  2 8  ? 12.204  61.861  165.228 1.00 21.71 ? 9    GLU C CB  1 
ATOM   1477 C  CG  . GLU C  2 8  ? 11.484  60.901  166.164 1.00 23.15 ? 9    GLU C CG  1 
ATOM   1478 C  CD  . GLU C  2 8  ? 10.413  61.541  167.052 1.00 23.66 ? 9    GLU C CD  1 
ATOM   1479 O  OE1 . GLU C  2 8  ? 10.353  62.774  167.203 1.00 23.01 ? 9    GLU C OE1 1 
ATOM   1480 O  OE2 . GLU C  2 8  ? 9.616   60.795  167.664 1.00 30.29 ? 9    GLU C OE2 1 
ATOM   1481 N  N   . ARG C  2 9  ? 14.689  63.147  163.560 1.00 14.32 ? 10   ARG C N   1 
ATOM   1482 C  CA  . ARG C  2 9  ? 15.187  63.926  162.422 1.00 17.29 ? 10   ARG C CA  1 
ATOM   1483 C  C   . ARG C  2 9  ? 16.154  63.079  161.624 1.00 15.51 ? 10   ARG C C   1 
ATOM   1484 O  O   . ARG C  2 9  ? 16.131  63.098  160.375 1.00 19.07 ? 10   ARG C O   1 
ATOM   1485 C  CB  . ARG C  2 9  ? 15.901  65.184  162.886 1.00 19.63 ? 10   ARG C CB  1 
ATOM   1486 C  CG  . ARG C  2 9  ? 15.019  66.330  163.294 1.00 22.45 ? 10   ARG C CG  1 
ATOM   1487 C  CD  . ARG C  2 9  ? 15.824  67.642  163.304 1.00 25.98 ? 10   ARG C CD  1 
ATOM   1488 N  NE  . ARG C  2 9  ? 16.999  67.625  164.188 1.00 28.31 ? 10   ARG C NE  1 
ATOM   1489 C  CZ  . ARG C  2 9  ? 16.961  67.835  165.511 1.00 30.82 ? 10   ARG C CZ  1 
ATOM   1490 N  NH1 . ARG C  2 9  ? 15.810  68.024  166.138 1.00 33.39 ? 10   ARG C NH1 1 
ATOM   1491 N  NH2 . ARG C  2 9  ? 18.073  67.816  166.233 1.00 31.11 ? 10   ARG C NH2 1 
ATOM   1492 N  N   . ASN C  2 10 ? 17.005  62.324  162.313 1.00 16.27 ? 11   ASN C N   1 
ATOM   1493 C  CA  . ASN C  2 10 ? 18.020  61.495  161.618 1.00 15.12 ? 11   ASN C CA  1 
ATOM   1494 C  C   . ASN C  2 10 ? 17.353  60.368  160.845 1.00 16.29 ? 11   ASN C C   1 
ATOM   1495 O  O   . ASN C  2 10 ? 17.700  60.085  159.710 1.00 16.89 ? 11   ASN C O   1 
ATOM   1496 C  CB  . ASN C  2 10 ? 18.996  60.883  162.624 1.00 17.15 ? 11   ASN C CB  1 
ATOM   1497 C  CG  . ASN C  2 10 ? 19.786  61.936  163.382 1.00 18.94 ? 11   ASN C CG  1 
ATOM   1498 O  OD1 . ASN C  2 10 ? 20.031  63.042  162.881 1.00 22.08 ? 11   ASN C OD1 1 
ATOM   1499 N  ND2 . ASN C  2 10 ? 20.203  61.598  164.579 1.00 17.78 ? 11   ASN C ND2 1 
ATOM   1500 N  N   . ILE C  2 11 ? 16.357  59.738  161.465 1.00 15.93 ? 12   ILE C N   1 
ATOM   1501 C  CA  . ILE C  2 11 ? 15.594  58.731  160.737 1.00 16.78 ? 12   ILE C CA  1 
ATOM   1502 C  C   . ILE C  2 11 ? 14.850  59.320  159.552 1.00 18.27 ? 12   ILE C C   1 
ATOM   1503 O  O   . ILE C  2 11 ? 14.876  58.732  158.472 1.00 17.92 ? 12   ILE C O   1 
ATOM   1504 C  CB  . ILE C  2 11 ? 14.660  57.976  161.705 1.00 18.38 ? 12   ILE C CB  1 
ATOM   1505 C  CG1 . ILE C  2 11 ? 15.509  56.977  162.508 1.00 18.00 ? 12   ILE C CG1 1 
ATOM   1506 C  CG2 . ILE C  2 11 ? 13.567  57.238  160.902 1.00 18.17 ? 12   ILE C CG2 1 
ATOM   1507 C  CD1 . ILE C  2 11 ? 14.862  56.559  163.746 1.00 21.68 ? 12   ILE C CD1 1 
ATOM   1508 N  N   . GLU C  2 12 ? 14.268  60.501  159.700 1.00 18.69 ? 13   GLU C N   1 
ATOM   1509 C  CA  . GLU C  2 12 ? 13.619  61.199  158.552 1.00 19.08 ? 13   GLU C CA  1 
ATOM   1510 C  C   . GLU C  2 12 ? 14.603  61.480  157.437 1.00 19.81 ? 13   GLU C C   1 
ATOM   1511 O  O   . GLU C  2 12 ? 14.292  61.288  156.251 1.00 19.28 ? 13   GLU C O   1 
ATOM   1512 C  CB  . GLU C  2 12 ? 12.982  62.503  159.024 1.00 22.53 ? 13   GLU C CB  1 
ATOM   1513 C  CG  . GLU C  2 12 ? 12.263  63.289  157.932 1.00 25.35 ? 13   GLU C CG  1 
ATOM   1514 C  CD  . GLU C  2 12 ? 11.637  64.535  158.523 1.00 26.91 ? 13   GLU C CD  1 
ATOM   1515 O  OE1 . GLU C  2 12 ? 10.399  64.717  158.395 1.00 30.79 ? 13   GLU C OE1 1 
ATOM   1516 O  OE2 . GLU C  2 12 ? 12.388  65.305  159.160 1.00 28.34 ? 13   GLU C OE2 1 
ATOM   1517 N  N   . THR C  2 13 ? 15.814  61.894  157.797 1.00 17.60 ? 14   THR C N   1 
ATOM   1518 C  CA  . THR C  2 13 ? 16.823  62.129  156.768 1.00 17.94 ? 14   THR C CA  1 
ATOM   1519 C  C   . THR C  2 13 ? 17.069  60.839  155.970 1.00 18.86 ? 14   THR C C   1 
ATOM   1520 O  O   . THR C  2 13 ? 17.118  60.850  154.733 1.00 18.31 ? 14   THR C O   1 
ATOM   1521 C  CB  . THR C  2 13 ? 18.136  62.602  157.413 1.00 19.49 ? 14   THR C CB  1 
ATOM   1522 O  OG1 . THR C  2 13 ? 17.956  63.913  157.977 1.00 18.77 ? 14   THR C OG1 1 
ATOM   1523 C  CG2 . THR C  2 13 ? 19.188  62.808  156.359 1.00 20.52 ? 14   THR C CG2 1 
ATOM   1524 N  N   . ILE C  2 14 ? 17.239  59.723  156.679 1.00 15.58 ? 15   ILE C N   1 
ATOM   1525 C  CA  . ILE C  2 14 ? 17.398  58.414  156.011 1.00 15.37 ? 15   ILE C CA  1 
ATOM   1526 C  C   . ILE C  2 14 ? 16.214  58.068  155.092 1.00 16.18 ? 15   ILE C C   1 
ATOM   1527 O  O   . ILE C  2 14 ? 16.418  57.663  153.922 1.00 19.48 ? 15   ILE C O   1 
ATOM   1528 C  CB  . ILE C  2 14 ? 17.652  57.301  157.052 1.00 15.93 ? 15   ILE C CB  1 
ATOM   1529 C  CG1 . ILE C  2 14 ? 18.989  57.594  157.756 1.00 15.05 ? 15   ILE C CG1 1 
ATOM   1530 C  CG2 . ILE C  2 14 ? 17.574  55.924  156.333 1.00 16.25 ? 15   ILE C CG2 1 
ATOM   1531 C  CD1 . ILE C  2 14 ? 19.205  56.841  159.105 1.00 17.62 ? 15   ILE C CD1 1 
ATOM   1532 N  N   . ILE C  2 15 ? 14.993  58.264  155.584 1.00 15.61 ? 16   ILE C N   1 
ATOM   1533 C  CA  . ILE C  2 15 ? 13.823  57.892  154.780 1.00 17.73 ? 16   ILE C CA  1 
ATOM   1534 C  C   . ILE C  2 15 ? 13.708  58.771  153.517 1.00 19.05 ? 16   ILE C C   1 
ATOM   1535 O  O   . ILE C  2 15 ? 13.419  58.314  152.402 1.00 18.02 ? 16   ILE C O   1 
ATOM   1536 C  CB  . ILE C  2 15 ? 12.569  58.009  155.652 1.00 19.35 ? 16   ILE C CB  1 
ATOM   1537 C  CG1 . ILE C  2 15 ? 12.576  56.851  156.652 1.00 19.25 ? 16   ILE C CG1 1 
ATOM   1538 C  CG2 . ILE C  2 15 ? 11.266  57.855  154.848 1.00 20.16 ? 16   ILE C CG2 1 
ATOM   1539 C  CD1 . ILE C  2 15 ? 11.630  57.093  157.808 1.00 18.64 ? 16   ILE C CD1 1 
ATOM   1540 N  N   . ASN C  2 16 ? 13.933  60.049  153.720 1.00 18.42 ? 17   ASN C N   1 
ATOM   1541 C  CA  . ASN C  2 16 ? 13.782  60.989  152.622 1.00 20.33 ? 17   ASN C CA  1 
ATOM   1542 C  C   . ASN C  2 16 ? 14.873  60.828  151.594 1.00 20.03 ? 17   ASN C C   1 
ATOM   1543 O  O   . ASN C  2 16 ? 14.634  61.100  150.425 1.00 19.45 ? 17   ASN C O   1 
ATOM   1544 C  CB  . ASN C  2 16 ? 13.671  62.429  153.143 1.00 17.92 ? 17   ASN C CB  1 
ATOM   1545 C  CG  . ASN C  2 16 ? 12.345  62.686  153.814 1.00 21.86 ? 17   ASN C CG  1 
ATOM   1546 O  OD1 . ASN C  2 16 ? 11.463  61.822  153.804 1.00 25.23 ? 17   ASN C OD1 1 
ATOM   1547 N  ND2 . ASN C  2 16 ? 12.187  63.861  154.406 1.00 22.68 ? 17   ASN C ND2 1 
ATOM   1548 N  N   . THR C  2 17 ? 16.065  60.414  152.018 1.00 19.10 ? 18   THR C N   1 
ATOM   1549 C  CA  . THR C  2 17 ? 17.164  60.155  151.092 1.00 17.75 ? 18   THR C CA  1 
ATOM   1550 C  C   . THR C  2 17 ? 16.855  58.924  150.237 1.00 17.40 ? 18   THR C C   1 
ATOM   1551 O  O   . THR C  2 17 ? 16.972  58.968  149.013 1.00 17.08 ? 18   THR C O   1 
ATOM   1552 C  CB  . THR C  2 17 ? 18.512  59.984  151.843 1.00 20.23 ? 18   THR C CB  1 
ATOM   1553 O  OG1 . THR C  2 17 ? 18.851  61.207  152.544 1.00 19.17 ? 18   THR C OG1 1 
ATOM   1554 C  CG2 . THR C  2 17 ? 19.628  59.795  150.843 1.00 17.45 ? 18   THR C CG2 1 
ATOM   1555 N  N   . PHE C  2 18 ? 16.465  57.829  150.880 1.00 17.98 ? 19   PHE C N   1 
ATOM   1556 C  CA  . PHE C  2 18 ? 15.959  56.622  150.198 1.00 17.33 ? 19   PHE C CA  1 
ATOM   1557 C  C   . PHE C  2 18 ? 14.913  56.990  149.160 1.00 18.87 ? 19   PHE C C   1 
ATOM   1558 O  O   . PHE C  2 18 ? 14.968  56.576  148.008 1.00 18.25 ? 19   PHE C O   1 
ATOM   1559 C  CB  . PHE C  2 18 ? 15.377  55.647  151.244 1.00 18.11 ? 19   PHE C CB  1 
ATOM   1560 C  CG  . PHE C  2 18 ? 14.836  54.368  150.662 1.00 19.54 ? 19   PHE C CG  1 
ATOM   1561 C  CD1 . PHE C  2 18 ? 15.663  53.293  150.451 1.00 19.25 ? 19   PHE C CD1 1 
ATOM   1562 C  CD2 . PHE C  2 18 ? 13.488  54.253  150.325 1.00 19.77 ? 19   PHE C CD2 1 
ATOM   1563 C  CE1 . PHE C  2 18 ? 15.156  52.087  149.959 1.00 21.14 ? 19   PHE C CE1 1 
ATOM   1564 C  CE2 . PHE C  2 18 ? 12.982  53.079  149.793 1.00 19.62 ? 19   PHE C CE2 1 
ATOM   1565 C  CZ  . PHE C  2 18 ? 13.818  51.995  149.609 1.00 18.75 ? 19   PHE C CZ  1 
ATOM   1566 N  N   . HIS C  2 19 ? 13.946  57.795  149.568 1.00 19.20 ? 20   HIS C N   1 
ATOM   1567 C  CA  . HIS C  2 19 ? 12.818  58.088  148.684 1.00 19.07 ? 20   HIS C CA  1 
ATOM   1568 C  C   . HIS C  2 19 ? 13.192  58.925  147.472 1.00 19.20 ? 20   HIS C C   1 
ATOM   1569 O  O   . HIS C  2 19 ? 12.586  58.782  146.403 1.00 18.36 ? 20   HIS C O   1 
ATOM   1570 C  CB  . HIS C  2 19 ? 11.737  58.817  149.484 1.00 18.82 ? 20   HIS C CB  1 
ATOM   1571 C  CG  . HIS C  2 19 ? 10.585  59.268  148.651 1.00 22.97 ? 20   HIS C CG  1 
ATOM   1572 N  ND1 . HIS C  2 19 ? 9.561   58.425  148.278 1.00 24.60 ? 20   HIS C ND1 1 
ATOM   1573 C  CD2 . HIS C  2 19 ? 10.295  60.483  148.117 1.00 22.59 ? 20   HIS C CD2 1 
ATOM   1574 C  CE1 . HIS C  2 19 ? 8.690   59.098  147.538 1.00 24.91 ? 20   HIS C CE1 1 
ATOM   1575 N  NE2 . HIS C  2 19 ? 9.114   60.348  147.426 1.00 25.44 ? 20   HIS C NE2 1 
ATOM   1576 N  N   . GLN C  2 20 ? 14.123  59.858  147.667 1.00 18.34 ? 21   GLN C N   1 
ATOM   1577 C  CA  . GLN C  2 20 ? 14.597  60.752  146.605 1.00 18.70 ? 21   GLN C CA  1 
ATOM   1578 C  C   . GLN C  2 20 ? 14.997  59.908  145.391 1.00 20.08 ? 21   GLN C C   1 
ATOM   1579 O  O   . GLN C  2 20 ? 14.700  60.256  144.247 1.00 18.58 ? 21   GLN C O   1 
ATOM   1580 C  CB  . GLN C  2 20 ? 15.780  61.560  147.109 1.00 17.96 ? 21   GLN C CB  1 
ATOM   1581 C  CG  . GLN C  2 20 ? 16.558  62.377  146.047 1.00 18.45 ? 21   GLN C CG  1 
ATOM   1582 C  CD  . GLN C  2 20 ? 15.730  63.367  145.213 1.00 19.11 ? 21   GLN C CD  1 
ATOM   1583 O  OE1 . GLN C  2 20 ? 14.719  63.895  145.665 1.00 20.19 ? 21   GLN C OE1 1 
ATOM   1584 N  NE2 . GLN C  2 20 ? 16.192  63.645  144.014 1.00 18.29 ? 21   GLN C NE2 1 
ATOM   1585 N  N   . TYR C  2 21 ? 15.633  58.772  145.684 1.00 18.51 ? 22   TYR C N   1 
ATOM   1586 C  CA  . TYR C  2 21 ? 16.074  57.866  144.623 1.00 20.22 ? 22   TYR C CA  1 
ATOM   1587 C  C   . TYR C  2 21 ? 15.058  56.803  144.229 1.00 18.08 ? 22   TYR C C   1 
ATOM   1588 O  O   . TYR C  2 21 ? 14.866  56.553  143.022 1.00 20.54 ? 22   TYR C O   1 
ATOM   1589 C  CB  . TYR C  2 21 ? 17.453  57.277  144.945 1.00 19.47 ? 22   TYR C CB  1 
ATOM   1590 C  CG  . TYR C  2 21 ? 18.524  58.348  145.081 1.00 18.60 ? 22   TYR C CG  1 
ATOM   1591 C  CD1 . TYR C  2 21 ? 18.783  58.966  146.319 1.00 18.57 ? 22   TYR C CD1 1 
ATOM   1592 C  CD2 . TYR C  2 21 ? 19.269  58.751  143.981 1.00 20.90 ? 22   TYR C CD2 1 
ATOM   1593 C  CE1 . TYR C  2 21 ? 19.760  59.964  146.461 1.00 19.50 ? 22   TYR C CE1 1 
ATOM   1594 C  CE2 . TYR C  2 21 ? 20.268  59.755  144.106 1.00 19.91 ? 22   TYR C CE2 1 
ATOM   1595 C  CZ  . TYR C  2 21 ? 20.507  60.354  145.343 1.00 20.73 ? 22   TYR C CZ  1 
ATOM   1596 O  OH  . TYR C  2 21 ? 21.501  61.324  145.481 1.00 22.22 ? 22   TYR C OH  1 
ATOM   1597 N  N   . SER C  2 22 ? 14.387  56.200  145.209 1.00 19.43 ? 23   SER C N   1 
ATOM   1598 C  CA  . SER C  2 22 ? 13.475  55.091  144.922 1.00 18.91 ? 23   SER C CA  1 
ATOM   1599 C  C   . SER C  2 22 ? 12.351  55.490  143.971 1.00 19.56 ? 23   SER C C   1 
ATOM   1600 O  O   . SER C  2 22 ? 11.919  54.701  143.121 1.00 19.09 ? 23   SER C O   1 
ATOM   1601 C  CB  . SER C  2 22 ? 12.902  54.520  146.234 1.00 18.92 ? 23   SER C CB  1 
ATOM   1602 O  OG  . SER C  2 22 ? 12.000  55.426  146.808 1.00 20.63 ? 23   SER C OG  1 
ATOM   1603 N  N   . VAL C  2 23 ? 11.923  56.743  144.082 1.00 19.63 ? 24   VAL C N   1 
ATOM   1604 C  CA  . VAL C  2 23 ? 10.747  57.197  143.348 1.00 19.60 ? 24   VAL C CA  1 
ATOM   1605 C  C   . VAL C  2 23 ? 10.980  57.528  141.877 1.00 20.58 ? 24   VAL C C   1 
ATOM   1606 O  O   . VAL C  2 23 ? 10.018  57.700  141.106 1.00 18.90 ? 24   VAL C O   1 
ATOM   1607 C  CB  . VAL C  2 23 ? 10.061  58.358  144.102 1.00 20.89 ? 24   VAL C CB  1 
ATOM   1608 C  CG1 . VAL C  2 23 ? 10.852  59.649  143.958 1.00 20.20 ? 24   VAL C CG1 1 
ATOM   1609 C  CG2 . VAL C  2 23 ? 8.620   58.518  143.627 1.00 23.33 ? 24   VAL C CG2 1 
ATOM   1610 N  N   . LYS C  2 24 ? 12.247  57.660  141.493 1.00 19.59 ? 25   LYS C N   1 
ATOM   1611 C  CA  . LYS C  2 24 ? 12.602  58.134  140.156 1.00 20.12 ? 25   LYS C CA  1 
ATOM   1612 C  C   . LYS C  2 24 ? 12.181  57.174  139.061 1.00 20.26 ? 25   LYS C C   1 
ATOM   1613 O  O   . LYS C  2 24 ? 11.859  57.605  137.961 1.00 18.11 ? 25   LYS C O   1 
ATOM   1614 C  CB  . LYS C  2 24 ? 14.109  58.296  140.056 1.00 22.70 ? 25   LYS C CB  1 
ATOM   1615 C  CG  . LYS C  2 24 ? 14.686  59.449  140.881 1.00 26.28 ? 25   LYS C CG  1 
ATOM   1616 C  CD  . LYS C  2 24 ? 16.193  59.443  140.834 1.00 28.08 ? 25   LYS C CD  1 
ATOM   1617 C  CE  . LYS C  2 24 ? 16.704  60.698  141.531 1.00 30.41 ? 25   LYS C CE  1 
ATOM   1618 N  NZ  . LYS C  2 24 ? 17.952  61.187  140.902 1.00 33.05 ? 25   LYS C NZ  1 
ATOM   1619 N  N   . LEU C  2 25 ? 12.173  55.873  139.354 1.00 20.07 ? 26   LEU C N   1 
ATOM   1620 C  CA  . LEU C  2 25 ? 11.967  54.878  138.287 1.00 23.07 ? 26   LEU C CA  1 
ATOM   1621 C  C   . LEU C  2 25 ? 11.558  53.540  138.899 1.00 23.21 ? 26   LEU C C   1 
ATOM   1622 O  O   . LEU C  2 25 ? 11.951  53.246  140.035 1.00 20.82 ? 26   LEU C O   1 
ATOM   1623 C  CB  . LEU C  2 25 ? 13.283  54.741  137.502 1.00 25.44 ? 26   LEU C CB  1 
ATOM   1624 C  CG  . LEU C  2 25 ? 13.456  54.463  135.995 1.00 29.56 ? 26   LEU C CG  1 
ATOM   1625 C  CD1 . LEU C  2 25 ? 13.069  53.050  135.708 1.00 31.55 ? 26   LEU C CD1 1 
ATOM   1626 C  CD2 . LEU C  2 25 ? 12.684  55.438  135.081 1.00 31.08 ? 26   LEU C CD2 1 
ATOM   1627 N  N   . GLY C  2 26 ? 10.816  52.713  138.151 1.00 22.55 ? 27   GLY C N   1 
ATOM   1628 C  CA  . GLY C  2 26 ? 10.458  51.383  138.654 1.00 23.53 ? 27   GLY C CA  1 
ATOM   1629 C  C   . GLY C  2 26 ? 9.513   51.420  139.838 1.00 22.28 ? 27   GLY C C   1 
ATOM   1630 O  O   . GLY C  2 26 ? 8.684   52.310  139.931 1.00 24.76 ? 27   GLY C O   1 
ATOM   1631 N  N   . HIS C  2 27 ? 9.606   50.453  140.748 1.00 22.68 ? 28   HIS C N   1 
ATOM   1632 C  CA  . HIS C  2 27 ? 8.779   50.484  141.947 1.00 23.33 ? 28   HIS C CA  1 
ATOM   1633 C  C   . HIS C  2 27 ? 9.189   51.713  142.763 1.00 20.61 ? 28   HIS C C   1 
ATOM   1634 O  O   . HIS C  2 27 ? 10.387  51.925  142.977 1.00 19.41 ? 28   HIS C O   1 
ATOM   1635 C  CB  . HIS C  2 27 ? 8.938   49.187  142.743 1.00 25.83 ? 28   HIS C CB  1 
ATOM   1636 C  CG  . HIS C  2 27 ? 8.571   47.964  141.961 1.00 30.72 ? 28   HIS C CG  1 
ATOM   1637 N  ND1 . HIS C  2 27 ? 7.317   47.394  142.017 1.00 34.21 ? 28   HIS C ND1 1 
ATOM   1638 C  CD2 . HIS C  2 27 ? 9.286   47.214  141.089 1.00 32.82 ? 28   HIS C CD2 1 
ATOM   1639 C  CE1 . HIS C  2 27 ? 7.272   46.345  141.213 1.00 34.22 ? 28   HIS C CE1 1 
ATOM   1640 N  NE2 . HIS C  2 27 ? 8.455   46.211  140.637 1.00 34.28 ? 28   HIS C NE2 1 
ATOM   1641 N  N   . PRO C  2 28 ? 8.219   52.569  143.099 1.00 21.05 ? 29   PRO C N   1 
ATOM   1642 C  CA  . PRO C  2 28 ? 8.523   53.870  143.712 1.00 21.48 ? 29   PRO C CA  1 
ATOM   1643 C  C   . PRO C  2 28 ? 9.066   53.791  145.130 1.00 23.64 ? 29   PRO C C   1 
ATOM   1644 O  O   . PRO C  2 28 ? 9.644   54.765  145.591 1.00 22.21 ? 29   PRO C O   1 
ATOM   1645 C  CB  . PRO C  2 28 ? 7.179   54.630  143.711 1.00 23.43 ? 29   PRO C CB  1 
ATOM   1646 C  CG  . PRO C  2 28 ? 6.108   53.593  143.443 1.00 23.61 ? 29   PRO C CG  1 
ATOM   1647 C  CD  . PRO C  2 28 ? 6.788   52.415  142.780 1.00 22.09 ? 29   PRO C CD  1 
ATOM   1648 N  N   . ASP C  2 29 ? 8.882   52.646  145.788 1.00 23.76 ? 30   ASP C N   1 
ATOM   1649 C  CA  . ASP C  2 29 ? 9.389   52.449  147.166 1.00 23.58 ? 30   ASP C CA  1 
ATOM   1650 C  C   . ASP C  2 29 ? 10.513  51.411  147.285 1.00 23.16 ? 30   ASP C C   1 
ATOM   1651 O  O   . ASP C  2 29 ? 10.811  50.911  148.385 1.00 20.92 ? 30   ASP C O   1 
ATOM   1652 C  CB  . ASP C  2 29 ? 8.223   52.079  148.075 1.00 24.89 ? 30   ASP C CB  1 
ATOM   1653 C  CG  . ASP C  2 29 ? 8.530   52.329  149.547 1.00 28.62 ? 30   ASP C CG  1 
ATOM   1654 O  OD1 . ASP C  2 29 ? 8.037   51.527  150.373 1.00 28.10 ? 30   ASP C OD1 1 
ATOM   1655 O  OD2 . ASP C  2 29 ? 9.255   53.280  149.953 1.00 27.49 ? 30   ASP C OD2 1 
ATOM   1656 N  N   . THR C  2 30 ? 11.172  51.092  146.175 1.00 20.38 ? 31   THR C N   1 
ATOM   1657 C  CA  . THR C  2 30 ? 12.419  50.329  146.248 1.00 19.62 ? 31   THR C CA  1 
ATOM   1658 C  C   . THR C  2 30 ? 13.481  50.991  145.399 1.00 20.24 ? 31   THR C C   1 
ATOM   1659 O  O   . THR C  2 30 ? 13.152  51.718  144.467 1.00 17.76 ? 31   THR C O   1 
ATOM   1660 C  CB  . THR C  2 30 ? 12.255  48.859  145.774 1.00 22.40 ? 31   THR C CB  1 
ATOM   1661 O  OG1 . THR C  2 30 ? 11.846  48.848  144.414 1.00 20.78 ? 31   THR C OG1 1 
ATOM   1662 C  CG2 . THR C  2 30 ? 11.127  48.100  146.502 1.00 22.46 ? 31   THR C CG2 1 
ATOM   1663 N  N   . LEU C  2 31 ? 14.750  50.751  145.706 1.00 17.77 ? 32   LEU C N   1 
ATOM   1664 C  CA  . LEU C  2 31 ? 15.871  51.191  144.881 1.00 18.40 ? 32   LEU C CA  1 
ATOM   1665 C  C   . LEU C  2 31 ? 16.256  50.102  143.879 1.00 19.72 ? 32   LEU C C   1 
ATOM   1666 O  O   . LEU C  2 31 ? 16.653  49.005  144.277 1.00 20.94 ? 32   LEU C O   1 
ATOM   1667 C  CB  . LEU C  2 31 ? 17.108  51.410  145.761 1.00 17.42 ? 32   LEU C CB  1 
ATOM   1668 C  CG  . LEU C  2 31 ? 17.009  52.490  146.838 1.00 17.81 ? 32   LEU C CG  1 
ATOM   1669 C  CD1 . LEU C  2 31 ? 18.207  52.476  147.808 1.00 18.70 ? 32   LEU C CD1 1 
ATOM   1670 C  CD2 . LEU C  2 31 ? 16.954  53.832  146.124 1.00 15.76 ? 32   LEU C CD2 1 
ATOM   1671 N  N   . ASN C  2 32 ? 16.156  50.397  142.591 1.00 19.82 ? 33   ASN C N   1 
ATOM   1672 C  CA  . ASN C  2 32 ? 16.769  49.501  141.627 1.00 20.44 ? 33   ASN C CA  1 
ATOM   1673 C  C   . ASN C  2 32 ? 18.291  49.701  141.649 1.00 20.56 ? 33   ASN C C   1 
ATOM   1674 O  O   . ASN C  2 32 ? 18.779  50.510  142.432 1.00 20.16 ? 33   ASN C O   1 
ATOM   1675 C  CB  . ASN C  2 32 ? 16.120  49.647  140.247 1.00 20.34 ? 33   ASN C CB  1 
ATOM   1676 C  CG  . ASN C  2 32 ? 16.253  51.023  139.670 1.00 21.79 ? 33   ASN C CG  1 
ATOM   1677 O  OD1 . ASN C  2 32 ? 17.217  51.741  139.946 1.00 23.39 ? 33   ASN C OD1 1 
ATOM   1678 N  ND2 . ASN C  2 32 ? 15.302  51.392  138.812 1.00 23.07 ? 33   ASN C ND2 1 
ATOM   1679 N  N   . GLN C  2 33 ? 19.043  48.965  140.828 1.00 22.70 ? 34   GLN C N   1 
ATOM   1680 C  CA  . GLN C  2 33 ? 20.506  49.038  140.842 1.00 25.83 ? 34   GLN C CA  1 
ATOM   1681 C  C   . GLN C  2 33 ? 21.054  50.441  140.536 1.00 23.55 ? 34   GLN C C   1 
ATOM   1682 O  O   . GLN C  2 33 ? 21.988  50.896  141.189 1.00 21.41 ? 34   GLN C O   1 
ATOM   1683 C  CB  . GLN C  2 33 ? 21.135  47.988  139.899 1.00 29.55 ? 34   GLN C CB  1 
ATOM   1684 C  CG  . GLN C  2 33 ? 22.659  47.908  140.032 1.00 34.24 ? 34   GLN C CG  1 
ATOM   1685 C  CD  . GLN C  2 33 ? 23.296  46.877  139.108 1.00 35.84 ? 34   GLN C CD  1 
ATOM   1686 O  OE1 . GLN C  2 33 ? 23.894  47.233  138.091 1.00 38.92 ? 34   GLN C OE1 1 
ATOM   1687 N  NE2 . GLN C  2 33 ? 23.170  45.601  139.458 1.00 38.81 ? 34   GLN C NE2 1 
ATOM   1688 N  N   . GLY C  2 34 ? 20.458  51.129  139.560 1.00 21.94 ? 35   GLY C N   1 
ATOM   1689 C  CA  . GLY C  2 34 ? 20.929  52.458  139.158 1.00 22.65 ? 35   GLY C CA  1 
ATOM   1690 C  C   . GLY C  2 34 ? 20.672  53.471  140.267 1.00 21.66 ? 35   GLY C C   1 
ATOM   1691 O  O   . GLY C  2 34 ? 21.478  54.365  140.496 1.00 23.21 ? 35   GLY C O   1 
ATOM   1692 N  N   . GLU C  2 35 ? 19.531  53.325  140.928 1.00 19.34 ? 36   GLU C N   1 
ATOM   1693 C  CA  . GLU C  2 35 ? 19.142  54.188  142.057 1.00 21.38 ? 36   GLU C CA  1 
ATOM   1694 C  C   . GLU C  2 35 ? 20.056  54.014  143.257 1.00 20.50 ? 36   GLU C C   1 
ATOM   1695 O  O   . GLU C  2 35 ? 20.515  54.993  143.853 1.00 22.18 ? 36   GLU C O   1 
ATOM   1696 C  CB  . GLU C  2 35 ? 17.660  53.957  142.391 1.00 20.33 ? 36   GLU C CB  1 
ATOM   1697 C  CG  . GLU C  2 35 ? 16.785  54.550  141.284 1.00 20.53 ? 36   GLU C CG  1 
ATOM   1698 C  CD  . GLU C  2 35 ? 15.357  54.034  141.248 1.00 21.72 ? 36   GLU C CD  1 
ATOM   1699 O  OE1 . GLU C  2 35 ? 15.000  53.143  142.054 1.00 18.99 ? 36   GLU C OE1 1 
ATOM   1700 O  OE2 . GLU C  2 35 ? 14.594  54.529  140.376 1.00 20.79 ? 36   GLU C OE2 1 
ATOM   1701 N  N   . PHE C  2 36 ? 20.322  52.763  143.625 1.00 20.17 ? 37   PHE C N   1 
ATOM   1702 C  CA  . PHE C  2 36 ? 21.278  52.475  144.693 1.00 19.88 ? 37   PHE C CA  1 
ATOM   1703 C  C   . PHE C  2 36 ? 22.652  53.045  144.378 1.00 20.47 ? 37   PHE C C   1 
ATOM   1704 O  O   . PHE C  2 36 ? 23.271  53.647  145.231 1.00 19.79 ? 37   PHE C O   1 
ATOM   1705 C  CB  . PHE C  2 36 ? 21.373  50.968  144.918 1.00 19.97 ? 37   PHE C CB  1 
ATOM   1706 C  CG  . PHE C  2 36 ? 22.279  50.589  146.035 1.00 20.75 ? 37   PHE C CG  1 
ATOM   1707 C  CD1 . PHE C  2 36 ? 21.916  50.848  147.353 1.00 18.02 ? 37   PHE C CD1 1 
ATOM   1708 C  CD2 . PHE C  2 36 ? 23.482  49.948  145.776 1.00 19.19 ? 37   PHE C CD2 1 
ATOM   1709 C  CE1 . PHE C  2 36 ? 22.751  50.501  148.398 1.00 18.07 ? 37   PHE C CE1 1 
ATOM   1710 C  CE2 . PHE C  2 36 ? 24.314  49.585  146.821 1.00 21.53 ? 37   PHE C CE2 1 
ATOM   1711 C  CZ  . PHE C  2 36 ? 23.928  49.840  148.124 1.00 20.42 ? 37   PHE C CZ  1 
ATOM   1712 N  N   . LYS C  2 37 ? 23.138  52.834  143.155 1.00 21.23 ? 38   LYS C N   1 
ATOM   1713 C  CA  . LYS C  2 37 ? 24.428  53.378  142.756 1.00 23.11 ? 38   LYS C CA  1 
ATOM   1714 C  C   . LYS C  2 37 ? 24.502  54.893  142.898 1.00 23.85 ? 38   LYS C C   1 
ATOM   1715 O  O   . LYS C  2 37 ? 25.519  55.424  143.362 1.00 23.22 ? 38   LYS C O   1 
ATOM   1716 C  CB  . LYS C  2 37 ? 24.786  52.945  141.336 1.00 24.28 ? 38   LYS C CB  1 
ATOM   1717 C  CG  . LYS C  2 37 ? 25.047  51.461  141.247 1.00 27.18 ? 38   LYS C CG  1 
ATOM   1718 C  CD  . LYS C  2 37 ? 25.444  51.078  139.830 1.00 30.03 ? 38   LYS C CD  1 
ATOM   1719 C  CE  . LYS C  2 37 ? 26.021  49.688  139.790 1.00 32.10 ? 38   LYS C CE  1 
ATOM   1720 N  NZ  . LYS C  2 37 ? 26.235  49.256  138.357 1.00 33.99 ? 38   LYS C NZ  1 
ATOM   1721 N  N   . GLU C  2 38 ? 23.435  55.575  142.492 1.00 23.70 ? 39   GLU C N   1 
ATOM   1722 C  CA  . GLU C  2 38 ? 23.390  57.032  142.533 1.00 24.89 ? 39   GLU C CA  1 
ATOM   1723 C  C   . GLU C  2 38 ? 23.438  57.510  143.981 1.00 23.91 ? 39   GLU C C   1 
ATOM   1724 O  O   . GLU C  2 38 ? 24.233  58.382  144.335 1.00 22.19 ? 39   GLU C O   1 
ATOM   1725 C  CB  . GLU C  2 38 ? 22.110  57.515  141.853 1.00 30.38 ? 39   GLU C CB  1 
ATOM   1726 C  CG  . GLU C  2 38 ? 22.269  58.752  141.001 1.00 36.87 ? 39   GLU C CG  1 
ATOM   1727 C  CD  . GLU C  2 38 ? 21.066  58.958  140.094 1.00 40.36 ? 39   GLU C CD  1 
ATOM   1728 O  OE1 . GLU C  2 38 ? 21.264  59.261  138.888 1.00 42.19 ? 39   GLU C OE1 1 
ATOM   1729 O  OE2 . GLU C  2 38 ? 19.909  58.803  140.575 1.00 41.35 ? 39   GLU C OE2 1 
ATOM   1730 N  N   . LEU C  2 39 ? 22.634  56.882  144.834 1.00 22.24 ? 40   LEU C N   1 
ATOM   1731 C  CA  . LEU C  2 39 ? 22.569  57.274  146.230 1.00 21.29 ? 40   LEU C CA  1 
ATOM   1732 C  C   . LEU C  2 39 ? 23.959  57.086  146.861 1.00 21.48 ? 40   LEU C C   1 
ATOM   1733 O  O   . LEU C  2 39 ? 24.442  57.955  147.569 1.00 20.65 ? 40   LEU C O   1 
ATOM   1734 C  CB  . LEU C  2 39 ? 21.504  56.452  146.962 1.00 20.90 ? 40   LEU C CB  1 
ATOM   1735 C  CG  . LEU C  2 39 ? 21.194  56.721  148.451 1.00 20.86 ? 40   LEU C CG  1 
ATOM   1736 C  CD1 . LEU C  2 39 ? 19.892  55.985  148.843 1.00 21.69 ? 40   LEU C CD1 1 
ATOM   1737 C  CD2 . LEU C  2 39 ? 22.354  56.234  149.344 1.00 18.02 ? 40   LEU C CD2 1 
ATOM   1738 N  N   . VAL C  2 40 ? 24.594  55.947  146.613 1.00 19.91 ? 41   VAL C N   1 
ATOM   1739 C  CA  . VAL C  2 40 ? 25.865  55.646  147.263 1.00 21.45 ? 41   VAL C CA  1 
ATOM   1740 C  C   . VAL C  2 40 ? 26.953  56.606  146.791 1.00 21.80 ? 41   VAL C C   1 
ATOM   1741 O  O   . VAL C  2 40 ? 27.767  57.087  147.572 1.00 21.75 ? 41   VAL C O   1 
ATOM   1742 C  CB  . VAL C  2 40 ? 26.272  54.164  147.051 1.00 23.35 ? 41   VAL C CB  1 
ATOM   1743 C  CG1 . VAL C  2 40 ? 27.703  53.929  147.539 1.00 24.64 ? 41   VAL C CG1 1 
ATOM   1744 C  CG2 . VAL C  2 40 ? 25.283  53.240  147.822 1.00 20.95 ? 41   VAL C CG2 1 
ATOM   1745 N  N   . ARG C  2 41 ? 26.943  56.860  145.491 1.00 21.51 ? 42   ARG C N   1 
ATOM   1746 C  CA  . ARG C  2 41 ? 27.876  57.764  144.839 1.00 23.57 ? 42   ARG C CA  1 
ATOM   1747 C  C   . ARG C  2 41 ? 27.816  59.182  145.404 1.00 24.05 ? 42   ARG C C   1 
ATOM   1748 O  O   . ARG C  2 41 ? 28.857  59.810  145.634 1.00 23.93 ? 42   ARG C O   1 
ATOM   1749 C  CB  . ARG C  2 41 ? 27.553  57.777  143.362 1.00 23.70 ? 42   ARG C CB  1 
ATOM   1750 C  CG  . ARG C  2 41 ? 28.352  58.758  142.539 1.00 29.01 ? 42   ARG C CG  1 
ATOM   1751 C  CD  . ARG C  2 41 ? 28.083  58.561  141.057 1.00 33.60 ? 42   ARG C CD  1 
ATOM   1752 N  NE  . ARG C  2 41 ? 28.729  59.570  140.232 1.00 39.93 ? 42   ARG C NE  1 
ATOM   1753 C  CZ  . ARG C  2 41 ? 28.126  60.642  139.703 1.00 42.90 ? 42   ARG C CZ  1 
ATOM   1754 N  NH1 . ARG C  2 41 ? 28.833  61.484  138.955 1.00 42.80 ? 42   ARG C NH1 1 
ATOM   1755 N  NH2 . ARG C  2 41 ? 26.833  60.883  139.908 1.00 43.27 ? 42   ARG C NH2 1 
ATOM   1756 N  N   . LYS C  2 42 ? 26.608  59.690  145.597 1.00 23.35 ? 43   LYS C N   1 
ATOM   1757 C  CA  . LYS C  2 42 ? 26.418  61.067  146.053 1.00 25.69 ? 43   LYS C CA  1 
ATOM   1758 C  C   . LYS C  2 42 ? 26.342  61.190  147.572 1.00 24.49 ? 43   LYS C C   1 
ATOM   1759 O  O   . LYS C  2 42 ? 27.099  61.947  148.172 1.00 25.60 ? 43   LYS C O   1 
ATOM   1760 C  CB  . LYS C  2 42 ? 25.167  61.694  145.425 1.00 28.22 ? 43   LYS C CB  1 
ATOM   1761 C  CG  . LYS C  2 42 ? 25.174  61.731  143.911 1.00 33.38 ? 43   LYS C CG  1 
ATOM   1762 C  CD  . LYS C  2 42 ? 24.351  62.924  143.416 1.00 37.88 ? 43   LYS C CD  1 
ATOM   1763 C  CE  . LYS C  2 42 ? 23.471  62.517  142.254 1.00 41.15 ? 43   LYS C CE  1 
ATOM   1764 N  NZ  . LYS C  2 42 ? 22.881  63.732  141.615 1.00 42.66 ? 43   LYS C NZ  1 
ATOM   1765 N  N   . ASP C  2 43 ? 25.438  60.428  148.187 1.00 22.31 ? 44   ASP C N   1 
ATOM   1766 C  CA  . ASP C  2 43 ? 25.114  60.639  149.579 1.00 22.22 ? 44   ASP C CA  1 
ATOM   1767 C  C   . ASP C  2 43 ? 26.012  59.876  150.559 1.00 22.03 ? 44   ASP C C   1 
ATOM   1768 O  O   . ASP C  2 43 ? 25.955  60.127  151.754 1.00 22.66 ? 44   ASP C O   1 
ATOM   1769 C  CB  . ASP C  2 43 ? 23.648  60.295  149.818 1.00 23.23 ? 44   ASP C CB  1 
ATOM   1770 C  CG  . ASP C  2 43 ? 22.750  61.212  149.052 1.00 24.32 ? 44   ASP C CG  1 
ATOM   1771 O  OD1 . ASP C  2 43 ? 22.804  62.432  149.301 1.00 25.57 ? 44   ASP C OD1 1 
ATOM   1772 O  OD2 . ASP C  2 43 ? 22.049  60.803  148.119 1.00 28.10 ? 44   ASP C OD2 1 
ATOM   1773 N  N   . LEU C  2 44 ? 26.833  58.966  150.038 1.00 20.96 ? 45   LEU C N   1 
ATOM   1774 C  CA  . LEU C  2 44 ? 27.785  58.216  150.856 1.00 21.68 ? 45   LEU C CA  1 
ATOM   1775 C  C   . LEU C  2 44 ? 29.157  58.380  150.222 1.00 22.45 ? 45   LEU C C   1 
ATOM   1776 O  O   . LEU C  2 44 ? 30.007  57.510  150.299 1.00 22.04 ? 45   LEU C O   1 
ATOM   1777 C  CB  . LEU C  2 44 ? 27.362  56.739  150.977 1.00 21.26 ? 45   LEU C CB  1 
ATOM   1778 C  CG  . LEU C  2 44 ? 26.049  56.499  151.755 1.00 21.33 ? 45   LEU C CG  1 
ATOM   1779 C  CD1 . LEU C  2 44 ? 25.665  55.013  151.741 1.00 20.71 ? 45   LEU C CD1 1 
ATOM   1780 C  CD2 . LEU C  2 44 ? 26.122  56.965  153.205 1.00 21.96 ? 45   LEU C CD2 1 
ATOM   1781 N  N   . GLN C  2 45 ? 29.376  59.533  149.603 1.00 20.85 ? 46   GLN C N   1 
ATOM   1782 C  CA  . GLN C  2 45 ? 30.647  59.763  148.921 1.00 25.07 ? 46   GLN C CA  1 
ATOM   1783 C  C   . GLN C  2 45 ? 31.877  59.722  149.823 1.00 24.28 ? 46   GLN C C   1 
ATOM   1784 O  O   . GLN C  2 45 ? 32.979  59.421  149.364 1.00 26.39 ? 46   GLN C O   1 
ATOM   1785 C  CB  . GLN C  2 45 ? 30.605  61.067  148.142 1.00 23.48 ? 46   GLN C CB  1 
ATOM   1786 C  CG  . GLN C  2 45 ? 30.334  62.304  148.963 1.00 25.28 ? 46   GLN C CG  1 
ATOM   1787 C  CD  . GLN C  2 45 ? 30.266  63.537  148.072 1.00 28.57 ? 46   GLN C CD  1 
ATOM   1788 O  OE1 . GLN C  2 45 ? 31.300  64.125  147.779 1.00 28.68 ? 46   GLN C OE1 1 
ATOM   1789 N  NE2 . GLN C  2 45 ? 29.066  63.900  147.607 1.00 26.18 ? 46   GLN C NE2 1 
ATOM   1790 N  N   . ASN C  2 46 ? 31.697  60.044  151.099 1.00 25.73 ? 47   ASN C N   1 
ATOM   1791 C  CA  . ASN C  2 46 ? 32.806  59.919  152.044 1.00 25.60 ? 47   ASN C CA  1 
ATOM   1792 C  C   . ASN C  2 46 ? 32.867  58.546  152.727 1.00 25.35 ? 47   ASN C C   1 
ATOM   1793 O  O   . ASN C  2 46 ? 33.923  57.913  152.725 1.00 27.00 ? 47   ASN C O   1 
ATOM   1794 C  CB  . ASN C  2 46 ? 32.730  61.040  153.076 1.00 24.52 ? 47   ASN C CB  1 
ATOM   1795 C  CG  . ASN C  2 46 ? 32.723  62.417  152.431 1.00 25.37 ? 47   ASN C CG  1 
ATOM   1796 O  OD1 . ASN C  2 46 ? 33.761  62.903  151.960 1.00 26.29 ? 47   ASN C OD1 1 
ATOM   1797 N  ND2 . ASN C  2 46 ? 31.550  63.030  152.359 1.00 24.50 ? 47   ASN C ND2 1 
ATOM   1798 N  N   . PHE C  2 47 ? 31.754  58.097  153.305 1.00 24.90 ? 48   PHE C N   1 
ATOM   1799 C  CA  . PHE C  2 47 ? 31.694  56.830  154.038 1.00 23.17 ? 48   PHE C CA  1 
ATOM   1800 C  C   . PHE C  2 47 ? 32.087  55.667  153.137 1.00 26.51 ? 48   PHE C C   1 
ATOM   1801 O  O   . PHE C  2 47 ? 32.759  54.732  153.577 1.00 27.25 ? 48   PHE C O   1 
ATOM   1802 C  CB  . PHE C  2 47 ? 30.306  56.589  154.664 1.00 23.59 ? 48   PHE C CB  1 
ATOM   1803 C  CG  . PHE C  2 47 ? 30.040  57.414  155.902 1.00 22.36 ? 48   PHE C CG  1 
ATOM   1804 C  CD1 . PHE C  2 47 ? 28.941  57.142  156.721 1.00 23.09 ? 48   PHE C CD1 1 
ATOM   1805 C  CD2 . PHE C  2 47 ? 30.904  58.450  156.264 1.00 21.56 ? 48   PHE C CD2 1 
ATOM   1806 C  CE1 . PHE C  2 47 ? 28.688  57.927  157.848 1.00 21.25 ? 48   PHE C CE1 1 
ATOM   1807 C  CE2 . PHE C  2 47 ? 30.663  59.218  157.397 1.00 21.34 ? 48   PHE C CE2 1 
ATOM   1808 C  CZ  . PHE C  2 47 ? 29.556  58.947  158.193 1.00 21.74 ? 48   PHE C CZ  1 
ATOM   1809 N  N   . LEU C  2 48 ? 31.686  55.722  151.872 1.00 24.05 ? 49   LEU C N   1 
ATOM   1810 C  CA  . LEU C  2 48 ? 31.992  54.625  150.958 1.00 25.78 ? 49   LEU C CA  1 
ATOM   1811 C  C   . LEU C  2 48 ? 32.933  55.070  149.842 1.00 25.25 ? 49   LEU C C   1 
ATOM   1812 O  O   . LEU C  2 48 ? 32.791  54.665  148.699 1.00 26.66 ? 49   LEU C O   1 
ATOM   1813 C  CB  . LEU C  2 48 ? 30.708  53.987  150.422 1.00 24.13 ? 49   LEU C CB  1 
ATOM   1814 C  CG  . LEU C  2 48 ? 29.864  53.167  151.414 1.00 25.02 ? 49   LEU C CG  1 
ATOM   1815 C  CD1 . LEU C  2 48 ? 28.633  52.637  150.732 1.00 25.69 ? 49   LEU C CD1 1 
ATOM   1816 C  CD2 . LEU C  2 48 ? 30.671  51.996  152.004 1.00 27.35 ? 49   LEU C CD2 1 
ATOM   1817 N  N   . LYS C  2 49 ? 33.891  55.917  150.198 1.00 28.40 ? 50   LYS C N   1 
ATOM   1818 C  CA  . LYS C  2 49 ? 34.827  56.533  149.252 1.00 32.04 ? 50   LYS C CA  1 
ATOM   1819 C  C   . LYS C  2 49 ? 35.644  55.504  148.474 1.00 32.31 ? 50   LYS C C   1 
ATOM   1820 O  O   . LYS C  2 49 ? 35.747  55.575  147.251 1.00 32.54 ? 50   LYS C O   1 
ATOM   1821 C  CB  . LYS C  2 49 ? 35.759  57.477  150.012 1.00 34.36 ? 50   LYS C CB  1 
ATOM   1822 C  CG  . LYS C  2 49 ? 36.794  58.188  149.170 1.00 38.28 ? 50   LYS C CG  1 
ATOM   1823 C  CD  . LYS C  2 49 ? 37.619  59.116  150.047 1.00 41.95 ? 50   LYS C CD  1 
ATOM   1824 C  CE  . LYS C  2 49 ? 38.890  59.622  149.341 1.00 45.00 ? 50   LYS C CE  1 
ATOM   1825 N  NZ  . LYS C  2 49 ? 39.071  59.136  147.926 1.00 46.79 ? 50   LYS C NZ  1 
ATOM   1826 N  N   . LYS C  2 50 ? 36.219  54.540  149.184 1.00 33.09 ? 51   LYS C N   1 
ATOM   1827 C  CA  . LYS C  2 50 ? 37.021  53.507  148.543 1.00 35.50 ? 51   LYS C CA  1 
ATOM   1828 C  C   . LYS C  2 50 ? 36.184  52.612  147.612 1.00 33.29 ? 51   LYS C C   1 
ATOM   1829 O  O   . LYS C  2 50 ? 36.559  52.365  146.464 1.00 32.40 ? 51   LYS C O   1 
ATOM   1830 C  CB  . LYS C  2 50 ? 37.759  52.672  149.600 1.00 37.84 ? 51   LYS C CB  1 
ATOM   1831 C  CG  . LYS C  2 50 ? 38.580  51.548  148.994 1.00 41.66 ? 51   LYS C CG  1 
ATOM   1832 C  CD  . LYS C  2 50 ? 39.188  50.630  150.038 1.00 42.92 ? 51   LYS C CD  1 
ATOM   1833 C  CE  . LYS C  2 50 ? 40.025  49.556  149.351 1.00 46.20 ? 51   LYS C CE  1 
ATOM   1834 N  NZ  . LYS C  2 50 ? 40.865  48.757  150.302 1.00 47.84 ? 51   LYS C NZ  1 
ATOM   1835 N  N   . GLU C  2 51 ? 35.055  52.135  148.127 1.00 32.00 ? 52   GLU C N   1 
ATOM   1836 C  CA  . GLU C  2 51 ? 34.112  51.272  147.416 1.00 31.18 ? 52   GLU C CA  1 
ATOM   1837 C  C   . GLU C  2 51 ? 33.563  51.932  146.150 1.00 29.33 ? 52   GLU C C   1 
ATOM   1838 O  O   . GLU C  2 51 ? 33.417  51.275  145.111 1.00 28.37 ? 52   GLU C O   1 
ATOM   1839 C  CB  . GLU C  2 51 ? 32.965  50.854  148.353 1.00 30.87 ? 52   GLU C CB  1 
ATOM   1840 C  CG  . GLU C  2 51 ? 33.347  49.907  149.499 1.00 30.58 ? 52   GLU C CG  1 
ATOM   1841 C  CD  . GLU C  2 51 ? 33.961  50.602  150.707 1.00 33.12 ? 52   GLU C CD  1 
ATOM   1842 O  OE1 . GLU C  2 51 ? 33.806  51.828  150.895 1.00 34.90 ? 52   GLU C OE1 1 
ATOM   1843 O  OE2 . GLU C  2 51 ? 34.611  49.914  151.506 1.00 34.80 ? 52   GLU C OE2 1 
ATOM   1844 N  N   . ASN C  2 52 ? 33.267  53.230  146.232 1.00 27.90 ? 53   ASN C N   1 
ATOM   1845 C  CA  . ASN C  2 52 ? 32.747  53.969  145.076 1.00 29.24 ? 53   ASN C CA  1 
ATOM   1846 C  C   . ASN C  2 52 ? 33.693  54.005  143.879 1.00 31.47 ? 53   ASN C C   1 
ATOM   1847 O  O   . ASN C  2 52 ? 33.289  54.356  142.765 1.00 30.67 ? 53   ASN C O   1 
ATOM   1848 C  CB  . ASN C  2 52 ? 32.319  55.398  145.451 1.00 27.97 ? 53   ASN C CB  1 
ATOM   1849 C  CG  . ASN C  2 52 ? 30.875  55.469  145.924 1.00 28.01 ? 53   ASN C CG  1 
ATOM   1850 O  OD1 . ASN C  2 52 ? 29.988  54.948  145.271 1.00 28.77 ? 53   ASN C OD1 1 
ATOM   1851 N  ND2 . ASN C  2 52 ? 30.642  56.113  147.065 1.00 25.82 ? 53   ASN C ND2 1 
ATOM   1852 N  N   . LYS C  2 53 ? 34.953  53.652  144.104 1.00 33.12 ? 54   LYS C N   1 
ATOM   1853 C  CA  . LYS C  2 53 ? 35.924  53.657  143.015 1.00 35.93 ? 54   LYS C CA  1 
ATOM   1854 C  C   . LYS C  2 53 ? 35.756  52.438  142.114 1.00 36.20 ? 54   LYS C C   1 
ATOM   1855 O  O   . LYS C  2 53 ? 36.297  52.393  141.017 1.00 36.93 ? 54   LYS C O   1 
ATOM   1856 C  CB  . LYS C  2 53 ? 37.348  53.736  143.565 1.00 37.33 ? 54   LYS C CB  1 
ATOM   1857 C  CG  . LYS C  2 53 ? 37.651  55.087  144.160 1.00 40.10 ? 54   LYS C CG  1 
ATOM   1858 C  CD  . LYS C  2 53 ? 39.061  55.172  144.703 1.00 42.66 ? 54   LYS C CD  1 
ATOM   1859 C  CE  . LYS C  2 53 ? 39.345  56.587  145.192 1.00 44.49 ? 54   LYS C CE  1 
ATOM   1860 N  NZ  . LYS C  2 53 ? 40.653  56.683  145.901 1.00 46.44 ? 54   LYS C NZ  1 
ATOM   1861 N  N   . ASN C  2 54 ? 35.000  51.455  142.583 1.00 36.37 ? 55   ASN C N   1 
ATOM   1862 C  CA  . ASN C  2 54 ? 34.763  50.244  141.819 1.00 36.82 ? 55   ASN C CA  1 
ATOM   1863 C  C   . ASN C  2 54 ? 33.276  49.908  141.766 1.00 36.63 ? 55   ASN C C   1 
ATOM   1864 O  O   . ASN C  2 54 ? 32.678  49.472  142.751 1.00 34.60 ? 55   ASN C O   1 
ATOM   1865 C  CB  . ASN C  2 54 ? 35.565  49.083  142.407 1.00 38.13 ? 55   ASN C CB  1 
ATOM   1866 C  CG  . ASN C  2 54 ? 35.515  47.839  141.540 1.00 39.50 ? 55   ASN C CG  1 
ATOM   1867 O  OD1 . ASN C  2 54 ? 34.766  47.757  140.564 1.00 39.79 ? 55   ASN C OD1 1 
ATOM   1868 N  ND2 . ASN C  2 54 ? 36.311  46.853  141.906 1.00 40.39 ? 55   ASN C ND2 1 
ATOM   1869 N  N   . GLU C  2 55 ? 32.685  50.124  140.597 1.00 37.07 ? 56   GLU C N   1 
ATOM   1870 C  CA  . GLU C  2 55 ? 31.272  49.845  140.368 1.00 38.84 ? 56   GLU C CA  1 
ATOM   1871 C  C   . GLU C  2 55 ? 30.874  48.414  140.738 1.00 37.18 ? 56   GLU C C   1 
ATOM   1872 O  O   . GLU C  2 55 ? 29.775  48.182  141.233 1.00 35.55 ? 56   GLU C O   1 
ATOM   1873 C  CB  . GLU C  2 55 ? 30.925  50.124  138.907 1.00 43.34 ? 56   GLU C CB  1 
ATOM   1874 C  CG  . GLU C  2 55 ? 29.461  49.925  138.579 1.00 48.22 ? 56   GLU C CG  1 
ATOM   1875 C  CD  . GLU C  2 55 ? 29.046  50.658  137.317 1.00 51.68 ? 56   GLU C CD  1 
ATOM   1876 O  OE1 . GLU C  2 55 ? 29.924  50.907  136.454 1.00 53.26 ? 56   GLU C OE1 1 
ATOM   1877 O  OE2 . GLU C  2 55 ? 27.841  50.979  137.194 1.00 52.86 ? 56   GLU C OE2 1 
ATOM   1878 N  N   . LYS C  2 56 ? 31.768  47.454  140.503 1.00 35.55 ? 57   LYS C N   1 
ATOM   1879 C  CA  . LYS C  2 56 ? 31.463  46.064  140.840 1.00 35.69 ? 57   LYS C CA  1 
ATOM   1880 C  C   . LYS C  2 56 ? 31.400  45.821  142.347 1.00 31.97 ? 57   LYS C C   1 
ATOM   1881 O  O   . LYS C  2 56 ? 30.655  44.967  142.806 1.00 30.43 ? 57   LYS C O   1 
ATOM   1882 C  CB  . LYS C  2 56 ? 32.448  45.092  140.182 1.00 37.96 ? 57   LYS C CB  1 
ATOM   1883 C  CG  . LYS C  2 56 ? 32.259  44.984  138.675 1.00 40.22 ? 57   LYS C CG  1 
ATOM   1884 C  CD  . LYS C  2 56 ? 33.350  44.151  138.006 1.00 42.12 ? 57   LYS C CD  1 
ATOM   1885 C  CE  . LYS C  2 56 ? 33.359  44.409  136.499 1.00 44.28 ? 57   LYS C CE  1 
ATOM   1886 N  NZ  . LYS C  2 56 ? 34.351  43.552  135.782 1.00 45.56 ? 57   LYS C NZ  1 
ATOM   1887 N  N   . VAL C  2 57 ? 32.203  46.556  143.107 1.00 30.42 ? 58   VAL C N   1 
ATOM   1888 C  CA  . VAL C  2 57 ? 32.149  46.480  144.562 1.00 30.07 ? 58   VAL C CA  1 
ATOM   1889 C  C   . VAL C  2 57 ? 30.786  46.957  145.037 1.00 27.07 ? 58   VAL C C   1 
ATOM   1890 O  O   . VAL C  2 57 ? 30.186  46.371  145.937 1.00 27.69 ? 58   VAL C O   1 
ATOM   1891 C  CB  . VAL C  2 57 ? 33.257  47.319  145.225 1.00 30.48 ? 58   VAL C CB  1 
ATOM   1892 C  CG1 . VAL C  2 57 ? 32.967  47.498  146.718 1.00 28.61 ? 58   VAL C CG1 1 
ATOM   1893 C  CG2 . VAL C  2 57 ? 34.607  46.650  145.005 1.00 30.05 ? 58   VAL C CG2 1 
ATOM   1894 N  N   . ILE C  2 58 ? 30.283  48.018  144.420 1.00 26.50 ? 59   ILE C N   1 
ATOM   1895 C  CA  . ILE C  2 58 ? 28.984  48.574  144.830 1.00 25.05 ? 59   ILE C CA  1 
ATOM   1896 C  C   . ILE C  2 58 ? 27.838  47.612  144.483 1.00 26.05 ? 59   ILE C C   1 
ATOM   1897 O  O   . ILE C  2 58 ? 26.875  47.431  145.246 1.00 24.58 ? 59   ILE C O   1 
ATOM   1898 C  CB  . ILE C  2 58 ? 28.750  49.935  144.148 1.00 25.44 ? 59   ILE C CB  1 
ATOM   1899 C  CG1 . ILE C  2 58 ? 29.863  50.928  144.509 1.00 22.82 ? 59   ILE C CG1 1 
ATOM   1900 C  CG2 . ILE C  2 58 ? 27.369  50.455  144.497 1.00 23.80 ? 59   ILE C CG2 1 
ATOM   1901 C  CD1 . ILE C  2 58 ? 29.920  51.229  146.004 1.00 26.10 ? 59   ILE C CD1 1 
ATOM   1902 N  N   . GLU C  2 59 ? 27.927  47.025  143.297 1.00 27.50 ? 60   GLU C N   1 
ATOM   1903 C  CA  . GLU C  2 59 ? 26.973  45.992  142.890 1.00 27.16 ? 60   GLU C CA  1 
ATOM   1904 C  C   . GLU C  2 59 ? 26.960  44.841  143.867 1.00 25.65 ? 60   GLU C C   1 
ATOM   1905 O  O   . GLU C  2 59 ? 25.889  44.322  144.186 1.00 26.53 ? 60   GLU C O   1 
ATOM   1906 C  CB  . GLU C  2 59 ? 27.298  45.455  141.493 1.00 28.82 ? 60   GLU C CB  1 
ATOM   1907 C  CG  . GLU C  2 59 ? 26.881  46.420  140.395 1.00 32.77 ? 60   GLU C CG  1 
ATOM   1908 C  CD  . GLU C  2 59 ? 27.517  46.099  139.053 1.00 34.99 ? 60   GLU C CD  1 
ATOM   1909 O  OE1 . GLU C  2 59 ? 28.023  44.969  138.866 1.00 37.17 ? 60   GLU C OE1 1 
ATOM   1910 O  OE2 . GLU C  2 59 ? 27.509  46.983  138.178 1.00 36.47 ? 60   GLU C OE2 1 
ATOM   1911 N  N   . HIS C  2 60 ? 28.131  44.433  144.344 1.00 24.81 ? 61   HIS C N   1 
ATOM   1912 C  CA  . HIS C  2 60 ? 28.194  43.304  145.273 1.00 27.59 ? 61   HIS C CA  1 
ATOM   1913 C  C   . HIS C  2 60 ? 27.576  43.666  146.619 1.00 25.73 ? 61   HIS C C   1 
ATOM   1914 O  O   . HIS C  2 60 ? 26.871  42.858  147.216 1.00 23.89 ? 61   HIS C O   1 
ATOM   1915 C  CB  . HIS C  2 60 ? 29.637  42.837  145.490 1.00 32.62 ? 61   HIS C CB  1 
ATOM   1916 C  CG  . HIS C  2 60 ? 29.759  41.599  146.334 1.00 37.99 ? 61   HIS C CG  1 
ATOM   1917 N  ND1 . HIS C  2 60 ? 29.856  40.332  145.793 1.00 40.71 ? 61   HIS C ND1 1 
ATOM   1918 C  CD2 . HIS C  2 60 ? 29.810  41.435  147.678 1.00 40.14 ? 61   HIS C CD2 1 
ATOM   1919 C  CE1 . HIS C  2 60 ? 29.956  39.443  146.767 1.00 40.92 ? 61   HIS C CE1 1 
ATOM   1920 N  NE2 . HIS C  2 60 ? 29.931  40.086  147.922 1.00 41.85 ? 61   HIS C NE2 1 
ATOM   1921 N  N   . ILE C  2 61 ? 27.858  44.877  147.098 1.00 25.73 ? 62   ILE C N   1 
ATOM   1922 C  CA  . ILE C  2 61 ? 27.188  45.398  148.298 1.00 24.02 ? 62   ILE C CA  1 
ATOM   1923 C  C   . ILE C  2 61 ? 25.670  45.282  148.160 1.00 23.78 ? 62   ILE C C   1 
ATOM   1924 O  O   . ILE C  2 61 ? 24.994  44.755  149.052 1.00 22.09 ? 62   ILE C O   1 
ATOM   1925 C  CB  . ILE C  2 61 ? 27.610  46.862  148.570 1.00 25.19 ? 62   ILE C CB  1 
ATOM   1926 C  CG1 . ILE C  2 61 ? 29.112  46.911  148.868 1.00 23.84 ? 62   ILE C CG1 1 
ATOM   1927 C  CG2 . ILE C  2 61 ? 26.780  47.482  149.725 1.00 24.53 ? 62   ILE C CG2 1 
ATOM   1928 C  CD1 . ILE C  2 61 ? 29.615  48.305  149.213 1.00 22.56 ? 62   ILE C CD1 1 
ATOM   1929 N  N   . MET C  2 62 ? 25.112  45.769  147.052 1.00 23.13 ? 63   MET C N   1 
ATOM   1930 C  CA  . MET C  2 62 ? 23.665  45.667  146.865 1.00 24.67 ? 63   MET C CA  1 
ATOM   1931 C  C   . MET C  2 62 ? 23.148  44.228  146.875 1.00 23.82 ? 63   MET C C   1 
ATOM   1932 O  O   . MET C  2 62 ? 22.117  43.940  147.491 1.00 21.77 ? 63   MET C O   1 
ATOM   1933 C  CB  . MET C  2 62 ? 23.232  46.311  145.549 1.00 25.67 ? 63   MET C CB  1 
ATOM   1934 C  CG  . MET C  2 62 ? 21.747  46.466  145.493 1.00 26.32 ? 63   MET C CG  1 
ATOM   1935 S  SD  . MET C  2 62 ? 21.297  47.119  143.883 1.00 29.37 ? 63   MET C SD  1 
ATOM   1936 C  CE  . MET C  2 62 ? 19.517  46.907  143.873 1.00 28.85 ? 63   MET C CE  1 
ATOM   1937 N  N   . GLU C  2 63 ? 23.831  43.357  146.138 1.00 23.09 ? 64   GLU C N   1 
ATOM   1938 C  CA  . GLU C  2 63 ? 23.492  41.935  146.032 1.00 26.13 ? 64   GLU C CA  1 
ATOM   1939 C  C   . GLU C  2 63 ? 23.452  41.278  147.404 1.00 23.80 ? 64   GLU C C   1 
ATOM   1940 O  O   . GLU C  2 63 ? 22.537  40.501  147.675 1.00 22.85 ? 64   GLU C O   1 
ATOM   1941 C  CB  . GLU C  2 63 ? 24.488  41.190  145.135 1.00 29.06 ? 64   GLU C CB  1 
ATOM   1942 C  CG  . GLU C  2 63 ? 24.395  41.584  143.665 1.00 35.22 ? 64   GLU C CG  1 
ATOM   1943 C  CD  . GLU C  2 63 ? 25.594  41.127  142.837 1.00 38.58 ? 64   GLU C CD  1 
ATOM   1944 O  OE1 . GLU C  2 63 ? 25.778  41.679  141.733 1.00 42.10 ? 64   GLU C OE1 1 
ATOM   1945 O  OE2 . GLU C  2 63 ? 26.359  40.237  143.277 1.00 41.42 ? 64   GLU C OE2 1 
ATOM   1946 N  N   . ASP C  2 64 ? 24.453  41.570  148.249 1.00 22.25 ? 65   ASP C N   1 
ATOM   1947 C  CA  . ASP C  2 64 ? 24.456  41.090  149.632 1.00 24.07 ? 65   ASP C CA  1 
ATOM   1948 C  C   . ASP C  2 64 ? 23.223  41.534  150.423 1.00 21.45 ? 65   ASP C C   1 
ATOM   1949 O  O   . ASP C  2 64 ? 22.666  40.743  151.176 1.00 22.39 ? 65   ASP C O   1 
ATOM   1950 C  CB  . ASP C  2 64 ? 25.737  41.495  150.360 1.00 26.90 ? 65   ASP C CB  1 
ATOM   1951 C  CG  . ASP C  2 64 ? 26.967  40.782  149.801 1.00 33.69 ? 65   ASP C CG  1 
ATOM   1952 O  OD1 . ASP C  2 64 ? 28.098  41.028  150.297 1.00 37.83 ? 65   ASP C OD1 1 
ATOM   1953 O  OD2 . ASP C  2 64 ? 26.896  39.962  148.848 1.00 37.28 ? 65   ASP C OD2 1 
ATOM   1954 N  N   . LEU C  2 65 ? 22.811  42.787  150.253 1.00 21.98 ? 66   LEU C N   1 
ATOM   1955 C  CA  . LEU C  2 65 ? 21.690  43.388  150.983 1.00 21.36 ? 66   LEU C CA  1 
ATOM   1956 C  C   . LEU C  2 65 ? 20.345  42.913  150.468 1.00 20.30 ? 66   LEU C C   1 
ATOM   1957 O  O   . LEU C  2 65 ? 19.350  42.932  151.192 1.00 17.92 ? 66   LEU C O   1 
ATOM   1958 C  CB  . LEU C  2 65 ? 21.723  44.924  150.852 1.00 22.51 ? 66   LEU C CB  1 
ATOM   1959 C  CG  . LEU C  2 65 ? 22.870  45.650  151.567 1.00 23.97 ? 66   LEU C CG  1 
ATOM   1960 C  CD1 . LEU C  2 65 ? 22.972  47.135  151.106 1.00 24.18 ? 66   LEU C CD1 1 
ATOM   1961 C  CD2 . LEU C  2 65 ? 22.671  45.504  153.068 1.00 25.55 ? 66   LEU C CD2 1 
ATOM   1962 N  N   . ASP C  2 66 ? 20.322  42.520  149.202 1.00 19.40 ? 67   ASP C N   1 
ATOM   1963 C  CA  . ASP C  2 66 ? 19.103  42.081  148.539 1.00 20.99 ? 67   ASP C CA  1 
ATOM   1964 C  C   . ASP C  2 66 ? 18.706  40.646  148.936 1.00 21.00 ? 67   ASP C C   1 
ATOM   1965 O  O   . ASP C  2 66 ? 18.921  39.688  148.185 1.00 19.49 ? 67   ASP C O   1 
ATOM   1966 C  CB  . ASP C  2 66 ? 19.342  42.165  147.025 1.00 19.44 ? 67   ASP C CB  1 
ATOM   1967 C  CG  . ASP C  2 66 ? 18.101  41.843  146.213 1.00 20.76 ? 67   ASP C CG  1 
ATOM   1968 O  OD1 . ASP C  2 66 ? 16.975  41.930  146.750 1.00 18.27 ? 67   ASP C OD1 1 
ATOM   1969 O  OD2 . ASP C  2 66 ? 18.177  41.555  144.999 1.00 23.35 ? 67   ASP C OD2 1 
ATOM   1970 N  N   . THR C  2 67 ? 18.084  40.507  150.098 1.00 20.75 ? 68   THR C N   1 
ATOM   1971 C  CA  . THR C  2 67 ? 17.912  39.191  150.701 1.00 22.04 ? 68   THR C CA  1 
ATOM   1972 C  C   . THR C  2 67 ? 16.775  38.394  150.095 1.00 22.70 ? 68   THR C C   1 
ATOM   1973 O  O   . THR C  2 67 ? 16.804  37.185  150.164 1.00 21.01 ? 68   THR C O   1 
ATOM   1974 C  CB  . THR C  2 67 ? 17.713  39.275  152.199 1.00 23.71 ? 68   THR C CB  1 
ATOM   1975 O  OG1 . THR C  2 67 ? 16.607  40.142  152.451 1.00 24.60 ? 68   THR C OG1 1 
ATOM   1976 C  CG2 . THR C  2 67 ? 18.918  39.936  152.859 1.00 24.43 ? 68   THR C CG2 1 
ATOM   1977 N  N   . ASN C  2 68 ? 15.787  39.056  149.493 1.00 21.45 ? 69   ASN C N   1 
ATOM   1978 C  CA  . ASN C  2 68 ? 14.788  38.329  148.707 1.00 22.97 ? 69   ASN C CA  1 
ATOM   1979 C  C   . ASN C  2 68 ? 15.134  38.170  147.223 1.00 22.83 ? 69   ASN C C   1 
ATOM   1980 O  O   . ASN C  2 68 ? 14.307  37.721  146.437 1.00 23.44 ? 69   ASN C O   1 
ATOM   1981 C  CB  . ASN C  2 68 ? 13.381  38.911  148.886 1.00 22.35 ? 69   ASN C CB  1 
ATOM   1982 C  CG  . ASN C  2 68 ? 13.189  40.211  148.146 1.00 23.87 ? 69   ASN C CG  1 
ATOM   1983 O  OD1 . ASN C  2 68 ? 14.152  40.880  147.786 1.00 22.92 ? 69   ASN C OD1 1 
ATOM   1984 N  ND2 . ASN C  2 68 ? 11.935  40.562  147.890 1.00 24.08 ? 69   ASN C ND2 1 
ATOM   1985 N  N   . ALA C  2 69 ? 16.359  38.535  146.851 1.00 22.10 ? 70   ALA C N   1 
ATOM   1986 C  CA  . ALA C  2 69 ? 16.877  38.306  145.511 1.00 22.37 ? 70   ALA C CA  1 
ATOM   1987 C  C   . ALA C  2 69 ? 15.958  38.822  144.396 1.00 24.65 ? 70   ALA C C   1 
ATOM   1988 O  O   . ALA C  2 69 ? 15.709  38.125  143.403 1.00 27.50 ? 70   ALA C O   1 
ATOM   1989 C  CB  . ALA C  2 69 ? 17.207  36.821  145.336 1.00 21.35 ? 70   ALA C CB  1 
ATOM   1990 N  N   . ASP C  2 70 ? 15.457  40.048  144.526 1.00 23.04 ? 71   ASP C N   1 
ATOM   1991 C  CA  . ASP C  2 70 ? 14.595  40.610  143.479 1.00 23.54 ? 71   ASP C CA  1 
ATOM   1992 C  C   . ASP C  2 70 ? 15.203  41.762  142.696 1.00 22.82 ? 71   ASP C C   1 
ATOM   1993 O  O   . ASP C  2 70 ? 14.544  42.430  141.879 1.00 22.21 ? 71   ASP C O   1 
ATOM   1994 C  CB  . ASP C  2 70 ? 13.185  40.902  143.996 1.00 24.39 ? 71   ASP C CB  1 
ATOM   1995 C  CG  . ASP C  2 70 ? 13.144  42.050  144.966 1.00 25.35 ? 71   ASP C CG  1 
ATOM   1996 O  OD1 . ASP C  2 70 ? 14.233  42.568  145.294 1.00 21.98 ? 71   ASP C OD1 1 
ATOM   1997 O  OD2 . ASP C  2 70 ? 12.070  42.481  145.449 1.00 25.96 ? 71   ASP C OD2 1 
ATOM   1998 N  N   . LYS C  2 71 ? 16.497  41.964  142.896 1.00 22.44 ? 72   LYS C N   1 
ATOM   1999 C  CA  . LYS C  2 71 ? 17.232  43.004  142.190 1.00 25.17 ? 72   LYS C CA  1 
ATOM   2000 C  C   . LYS C  2 71 ? 16.809  44.428  142.572 1.00 25.22 ? 72   LYS C C   1 
ATOM   2001 O  O   . LYS C  2 71 ? 16.966  45.363  141.796 1.00 25.50 ? 72   LYS C O   1 
ATOM   2002 C  CB  . LYS C  2 71 ? 17.154  42.767  140.673 1.00 28.15 ? 72   LYS C CB  1 
ATOM   2003 C  CG  . LYS C  2 71 ? 17.620  41.363  140.318 1.00 30.70 ? 72   LYS C CG  1 
ATOM   2004 C  CD  . LYS C  2 71 ? 17.671  41.102  138.827 1.00 35.21 ? 72   LYS C CD  1 
ATOM   2005 C  CE  . LYS C  2 71 ? 18.446  39.800  138.548 1.00 38.91 ? 72   LYS C CE  1 
ATOM   2006 N  NZ  . LYS C  2 71 ? 18.322  39.307  137.134 1.00 42.13 ? 72   LYS C NZ  1 
ATOM   2007 N  N   . GLN C  2 72 ? 16.260  44.584  143.765 1.00 23.76 ? 73   GLN C N   1 
ATOM   2008 C  CA  . GLN C  2 72 ? 15.818  45.877  144.280 1.00 22.61 ? 73   GLN C CA  1 
ATOM   2009 C  C   . GLN C  2 72 ? 16.097  45.828  145.763 1.00 21.75 ? 73   GLN C C   1 
ATOM   2010 O  O   . GLN C  2 72 ? 16.012  44.741  146.334 1.00 20.75 ? 73   GLN C O   1 
ATOM   2011 C  CB  . GLN C  2 72 ? 14.302  45.989  144.201 1.00 24.87 ? 73   GLN C CB  1 
ATOM   2012 C  CG  . GLN C  2 72 ? 13.703  46.032  142.820 1.00 28.73 ? 73   GLN C CG  1 
ATOM   2013 C  CD  . GLN C  2 72 ? 12.226  45.716  142.872 1.00 29.90 ? 73   GLN C CD  1 
ATOM   2014 O  OE1 . GLN C  2 72 ? 11.429  46.473  143.440 1.00 30.46 ? 73   GLN C OE1 1 
ATOM   2015 N  NE2 . GLN C  2 72 ? 11.854  44.577  142.286 1.00 32.57 ? 73   GLN C NE2 1 
ATOM   2016 N  N   . LEU C  2 73 ? 16.348  46.985  146.383 1.00 19.14 ? 74   LEU C N   1 
ATOM   2017 C  CA  . LEU C  2 73 ? 16.419  47.081  147.848 1.00 20.32 ? 74   LEU C CA  1 
ATOM   2018 C  C   . LEU C  2 73 ? 15.160  47.789  148.365 1.00 18.97 ? 74   LEU C C   1 
ATOM   2019 O  O   . LEU C  2 73 ? 14.898  48.946  148.003 1.00 19.77 ? 74   LEU C O   1 
ATOM   2020 C  CB  . LEU C  2 73 ? 17.654  47.844  148.345 1.00 21.46 ? 74   LEU C CB  1 
ATOM   2021 C  CG  . LEU C  2 73 ? 19.043  47.326  147.972 1.00 21.95 ? 74   LEU C CG  1 
ATOM   2022 C  CD1 . LEU C  2 73 ? 20.129  48.068  148.744 1.00 24.25 ? 74   LEU C CD1 1 
ATOM   2023 C  CD2 . LEU C  2 73 ? 19.057  45.877  148.414 1.00 21.38 ? 74   LEU C CD2 1 
ATOM   2024 N  N   . SER C  2 74 ? 14.399  47.070  149.192 1.00 17.85 ? 75   SER C N   1 
ATOM   2025 C  CA  . SER C  2 74 ? 13.348  47.646  150.005 1.00 16.98 ? 75   SER C CA  1 
ATOM   2026 C  C   . SER C  2 74 ? 13.959  48.511  151.103 1.00 17.40 ? 75   SER C C   1 
ATOM   2027 O  O   . SER C  2 74 ? 15.161  48.428  151.403 1.00 17.83 ? 75   SER C O   1 
ATOM   2028 C  CB  . SER C  2 74 ? 12.563  46.525  150.701 1.00 18.63 ? 75   SER C CB  1 
ATOM   2029 O  OG  . SER C  2 74 ? 13.417  45.818  151.594 1.00 17.10 ? 75   SER C OG  1 
ATOM   2030 N  N   . PHE C  2 75 ? 13.121  49.281  151.788 1.00 15.92 ? 76   PHE C N   1 
ATOM   2031 C  CA  . PHE C  2 75 ? 13.689  50.044  152.879 1.00 16.61 ? 76   PHE C CA  1 
ATOM   2032 C  C   . PHE C  2 75 ? 14.260  49.104  153.960 1.00 17.26 ? 76   PHE C C   1 
ATOM   2033 O  O   . PHE C  2 75 ? 15.313  49.398  154.536 1.00 16.96 ? 76   PHE C O   1 
ATOM   2034 C  CB  . PHE C  2 75 ? 12.691  51.017  153.484 1.00 18.92 ? 76   PHE C CB  1 
ATOM   2035 C  CG  . PHE C  2 75 ? 13.324  51.954  154.474 1.00 18.80 ? 76   PHE C CG  1 
ATOM   2036 C  CD1 . PHE C  2 75 ? 14.045  53.075  154.025 1.00 20.36 ? 76   PHE C CD1 1 
ATOM   2037 C  CD2 . PHE C  2 75 ? 13.274  51.670  155.820 1.00 19.97 ? 76   PHE C CD2 1 
ATOM   2038 C  CE1 . PHE C  2 75 ? 14.665  53.952  154.935 1.00 19.15 ? 76   PHE C CE1 1 
ATOM   2039 C  CE2 . PHE C  2 75 ? 13.924  52.540  156.743 1.00 20.20 ? 76   PHE C CE2 1 
ATOM   2040 C  CZ  . PHE C  2 75 ? 14.605  53.672  156.284 1.00 20.39 ? 76   PHE C CZ  1 
ATOM   2041 N  N   . GLU C  2 76 ? 13.529  48.029  154.259 1.00 18.95 ? 77   GLU C N   1 
ATOM   2042 C  CA  . GLU C  2 76 ? 13.987  47.028  155.236 1.00 19.00 ? 77   GLU C CA  1 
ATOM   2043 C  C   . GLU C  2 76 ? 15.385  46.537  154.937 1.00 19.07 ? 77   GLU C C   1 
ATOM   2044 O  O   . GLU C  2 76 ? 16.204  46.458  155.840 1.00 18.02 ? 77   GLU C O   1 
ATOM   2045 C  CB  . GLU C  2 76 ? 13.026  45.855  155.326 1.00 21.45 ? 77   GLU C CB  1 
ATOM   2046 C  CG  . GLU C  2 76 ? 11.742  46.247  156.010 1.00 23.19 ? 77   GLU C CG  1 
ATOM   2047 C  CD  . GLU C  2 76 ? 10.713  46.967  155.129 1.00 27.52 ? 77   GLU C CD  1 
ATOM   2048 O  OE1 . GLU C  2 76 ? 10.952  47.293  153.930 1.00 25.87 ? 77   GLU C OE1 1 
ATOM   2049 O  OE2 . GLU C  2 76 ? 9.607   47.212  155.681 1.00 29.49 ? 77   GLU C OE2 1 
ATOM   2050 N  N   . GLU C  2 77 ? 15.658  46.250  153.665 1.00 20.24 ? 78   GLU C N   1 
ATOM   2051 C  CA  . GLU C  2 77 ? 16.961  45.769  153.254 1.00 18.72 ? 78   GLU C CA  1 
ATOM   2052 C  C   . GLU C  2 77 ? 18.021  46.856  153.363 1.00 21.07 ? 78   GLU C C   1 
ATOM   2053 O  O   . GLU C  2 77 ? 19.145  46.608  153.812 1.00 19.27 ? 78   GLU C O   1 
ATOM   2054 C  CB  . GLU C  2 77 ? 16.890  45.197  151.843 1.00 18.90 ? 78   GLU C CB  1 
ATOM   2055 C  CG  . GLU C  2 77 ? 16.011  43.961  151.715 1.00 16.87 ? 78   GLU C CG  1 
ATOM   2056 C  CD  . GLU C  2 77 ? 15.791  43.542  150.244 1.00 17.67 ? 78   GLU C CD  1 
ATOM   2057 O  OE1 . GLU C  2 77 ? 15.774  44.392  149.325 1.00 17.84 ? 78   GLU C OE1 1 
ATOM   2058 O  OE2 . GLU C  2 77 ? 15.651  42.328  149.979 1.00 19.15 ? 78   GLU C OE2 1 
ATOM   2059 N  N   . PHE C  2 78 ? 17.654  48.059  152.932 1.00 20.29 ? 79   PHE C N   1 
ATOM   2060 C  CA  . PHE C  2 78 ? 18.568  49.200  152.906 1.00 20.00 ? 79   PHE C CA  1 
ATOM   2061 C  C   . PHE C  2 78 ? 18.980  49.647  154.308 1.00 21.65 ? 79   PHE C C   1 
ATOM   2062 O  O   . PHE C  2 78 ? 20.130  50.044  154.549 1.00 18.95 ? 79   PHE C O   1 
ATOM   2063 C  CB  . PHE C  2 78 ? 17.853  50.351  152.185 1.00 21.21 ? 79   PHE C CB  1 
ATOM   2064 C  CG  . PHE C  2 78 ? 18.627  51.628  152.123 1.00 22.33 ? 79   PHE C CG  1 
ATOM   2065 C  CD1 . PHE C  2 78 ? 19.642  51.797  151.195 1.00 22.55 ? 79   PHE C CD1 1 
ATOM   2066 C  CD2 . PHE C  2 78 ? 18.302  52.692  152.977 1.00 22.91 ? 79   PHE C CD2 1 
ATOM   2067 C  CE1 . PHE C  2 78 ? 20.343  53.021  151.143 1.00 22.17 ? 79   PHE C CE1 1 
ATOM   2068 C  CE2 . PHE C  2 78 ? 18.991  53.904  152.930 1.00 22.60 ? 79   PHE C CE2 1 
ATOM   2069 C  CZ  . PHE C  2 78 ? 20.008  54.063  151.998 1.00 19.88 ? 79   PHE C CZ  1 
ATOM   2070 N  N   . ILE C  2 79 ? 18.051  49.576  155.263 1.00 19.68 ? 80   ILE C N   1 
ATOM   2071 C  CA  . ILE C  2 79 ? 18.388  50.103  156.590 1.00 20.51 ? 80   ILE C CA  1 
ATOM   2072 C  C   . ILE C  2 79 ? 19.499  49.312  157.285 1.00 20.26 ? 80   ILE C C   1 
ATOM   2073 O  O   . ILE C  2 79 ? 20.160  49.824  158.195 1.00 18.28 ? 80   ILE C O   1 
ATOM   2074 C  CB  . ILE C  2 79 ? 17.167  50.191  157.503 1.00 20.52 ? 80   ILE C CB  1 
ATOM   2075 C  CG1 . ILE C  2 79 ? 17.543  50.993  158.751 1.00 22.05 ? 80   ILE C CG1 1 
ATOM   2076 C  CG2 . ILE C  2 79 ? 16.703  48.806  157.917 1.00 19.99 ? 80   ILE C CG2 1 
ATOM   2077 C  CD1 . ILE C  2 79 ? 16.641  52.115  159.060 1.00 25.07 ? 80   ILE C CD1 1 
ATOM   2078 N  N   . MET C  2 80 ? 19.715  48.080  156.828 1.00 16.47 ? 81   MET C N   1 
ATOM   2079 C  CA  . MET C  2 80 ? 20.740  47.226  157.389 1.00 19.80 ? 81   MET C CA  1 
ATOM   2080 C  C   . MET C  2 80 ? 22.120  47.832  157.002 1.00 18.64 ? 81   MET C C   1 
ATOM   2081 O  O   . MET C  2 80 ? 23.045  47.871  157.844 1.00 21.13 ? 81   MET C O   1 
ATOM   2082 C  CB  . MET C  2 80 ? 20.485  45.794  156.872 1.00 20.52 ? 81   MET C CB  1 
ATOM   2083 C  CG  . MET C  2 80 ? 21.272  44.688  157.531 1.00 24.77 ? 81   MET C CG  1 
ATOM   2084 S  SD  . MET C  2 80 ? 21.295  44.565  159.330 1.00 24.84 ? 81   MET C SD  1 
ATOM   2085 C  CE  . MET C  2 80 ? 19.583  44.069  159.592 1.00 25.50 ? 81   MET C CE  1 
ATOM   2086 N  N   . LEU C  2 81 ? 22.206  48.418  155.807 1.00 19.69 ? 82   LEU C N   1 
ATOM   2087 C  CA  . LEU C  2 81 ? 23.381  49.175  155.398 1.00 19.86 ? 82   LEU C CA  1 
ATOM   2088 C  C   . LEU C  2 81 ? 23.609  50.423  156.262 1.00 20.22 ? 82   LEU C C   1 
ATOM   2089 O  O   . LEU C  2 81 ? 24.727  50.728  156.646 1.00 19.36 ? 82   LEU C O   1 
ATOM   2090 C  CB  . LEU C  2 81 ? 23.241  49.655  153.945 1.00 21.78 ? 82   LEU C CB  1 
ATOM   2091 C  CG  . LEU C  2 81 ? 24.437  50.416  153.378 1.00 21.03 ? 82   LEU C CG  1 
ATOM   2092 C  CD1 . LEU C  2 81 ? 25.746  49.636  153.483 1.00 22.44 ? 82   LEU C CD1 1 
ATOM   2093 C  CD2 . LEU C  2 81 ? 24.137  50.844  151.929 1.00 20.40 ? 82   LEU C CD2 1 
ATOM   2094 N  N   . MET C  2 82 ? 22.551  51.194  156.485 1.00 19.90 ? 83   MET C N   1 
ATOM   2095 C  CA  . MET C  2 82 ? 22.688  52.363  157.346 1.00 20.19 ? 83   MET C CA  1 
ATOM   2096 C  C   . MET C  2 82 ? 23.193  51.952  158.735 1.00 19.72 ? 83   MET C C   1 
ATOM   2097 O  O   . MET C  2 82 ? 24.037  52.623  159.305 1.00 17.90 ? 83   MET C O   1 
ATOM   2098 C  CB  . MET C  2 82 ? 21.353  53.083  157.439 1.00 18.44 ? 83   MET C CB  1 
ATOM   2099 C  CG  . MET C  2 82 ? 20.837  53.521  156.105 1.00 19.44 ? 83   MET C CG  1 
ATOM   2100 S  SD  . MET C  2 82 ? 21.770  54.833  155.287 1.00 20.88 ? 83   MET C SD  1 
ATOM   2101 C  CE  . MET C  2 82 ? 22.848  53.894  154.162 1.00 21.33 ? 83   MET C CE  1 
ATOM   2102 N  N   . ALA C  2 83 ? 22.691  50.855  159.288 1.00 18.22 ? 84   ALA C N   1 
ATOM   2103 C  CA  . ALA C  2 83 ? 23.181  50.468  160.615 1.00 17.68 ? 84   ALA C CA  1 
ATOM   2104 C  C   . ALA C  2 83 ? 24.647  50.022  160.581 1.00 18.34 ? 84   ALA C C   1 
ATOM   2105 O  O   . ALA C  2 83 ? 25.394  50.335  161.511 1.00 21.95 ? 84   ALA C O   1 
ATOM   2106 C  CB  . ALA C  2 83 ? 22.311  49.393  161.212 1.00 17.14 ? 84   ALA C CB  1 
ATOM   2107 N  N   . ARG C  2 84 ? 25.047  49.290  159.545 1.00 20.45 ? 85   ARG C N   1 
ATOM   2108 C  CA  . ARG C  2 84 ? 26.425  48.856  159.376 1.00 24.19 ? 85   ARG C CA  1 
ATOM   2109 C  C   . ARG C  2 84 ? 27.357  50.060  159.288 1.00 22.33 ? 85   ARG C C   1 
ATOM   2110 O  O   . ARG C  2 84 ? 28.466  50.019  159.821 1.00 21.04 ? 85   ARG C O   1 
ATOM   2111 C  CB  . ARG C  2 84 ? 26.600  47.980  158.127 1.00 25.72 ? 85   ARG C CB  1 
ATOM   2112 C  CG  . ARG C  2 84 ? 26.034  46.571  158.293 1.00 32.06 ? 85   ARG C CG  1 
ATOM   2113 C  CD  . ARG C  2 84 ? 26.129  45.711  157.033 1.00 34.00 ? 85   ARG C CD  1 
ATOM   2114 N  NE  . ARG C  2 84 ? 25.341  44.489  157.159 1.00 40.42 ? 85   ARG C NE  1 
ATOM   2115 C  CZ  . ARG C  2 84 ? 25.003  43.713  156.131 1.00 42.92 ? 85   ARG C CZ  1 
ATOM   2116 N  NH1 . ARG C  2 84 ? 24.275  42.615  156.333 1.00 45.13 ? 85   ARG C NH1 1 
ATOM   2117 N  NH2 . ARG C  2 84 ? 25.390  44.036  154.901 1.00 42.85 ? 85   ARG C NH2 1 
ATOM   2118 N  N   . LEU C  2 85 ? 26.896  51.117  158.627 1.00 20.24 ? 86   LEU C N   1 
ATOM   2119 C  CA  . LEU C  2 85 ? 27.728  52.283  158.357 1.00 22.43 ? 86   LEU C CA  1 
ATOM   2120 C  C   . LEU C  2 85 ? 27.904  53.135  159.617 1.00 23.10 ? 86   LEU C C   1 
ATOM   2121 O  O   . LEU C  2 85 ? 28.970  53.718  159.832 1.00 21.63 ? 86   LEU C O   1 
ATOM   2122 C  CB  . LEU C  2 85 ? 27.143  53.122  157.207 1.00 22.09 ? 86   LEU C CB  1 
ATOM   2123 C  CG  . LEU C  2 85 ? 27.852  53.065  155.841 1.00 26.56 ? 86   LEU C CG  1 
ATOM   2124 C  CD1 . LEU C  2 85 ? 28.491  51.764  155.533 1.00 28.20 ? 86   LEU C CD1 1 
ATOM   2125 C  CD2 . LEU C  2 85 ? 26.938  53.527  154.679 1.00 24.02 ? 86   LEU C CD2 1 
ATOM   2126 N  N   . THR C  2 86 ? 26.863  53.153  160.447 1.00 22.38 ? 87   THR C N   1 
ATOM   2127 C  CA  . THR C  2 86 ? 26.872  53.902  161.694 1.00 22.87 ? 87   THR C CA  1 
ATOM   2128 C  C   . THR C  2 86 ? 27.855  53.191  162.595 1.00 25.51 ? 87   THR C C   1 
ATOM   2129 O  O   . THR C  2 86 ? 28.692  53.830  163.225 1.00 25.75 ? 87   THR C O   1 
ATOM   2130 C  CB  . THR C  2 86 ? 25.481  53.863  162.333 1.00 26.40 ? 87   THR C CB  1 
ATOM   2131 O  OG1 . THR C  2 86 ? 24.513  54.465  161.459 1.00 28.00 ? 87   THR C OG1 1 
ATOM   2132 C  CG2 . THR C  2 86 ? 25.429  54.728  163.543 1.00 28.02 ? 87   THR C CG2 1 
ATOM   2133 N  N   . TRP C  2 87 ? 27.736  51.864  162.634 1.00 24.42 ? 88   TRP C N   1 
ATOM   2134 C  CA  . TRP C  2 87 ? 28.643  51.050  163.415 1.00 26.57 ? 88   TRP C CA  1 
ATOM   2135 C  C   . TRP C  2 87 ? 30.096  51.305  162.973 1.00 25.59 ? 88   TRP C C   1 
ATOM   2136 O  O   . TRP C  2 87 ? 30.948  51.576  163.819 1.00 26.37 ? 88   TRP C O   1 
ATOM   2137 C  CB  . TRP C  2 87 ? 28.248  49.559  163.370 1.00 28.79 ? 88   TRP C CB  1 
ATOM   2138 C  CG  . TRP C  2 87 ? 29.280  48.719  164.024 1.00 29.51 ? 88   TRP C CG  1 
ATOM   2139 C  CD1 . TRP C  2 87 ? 30.299  48.036  163.410 1.00 30.52 ? 88   TRP C CD1 1 
ATOM   2140 C  CD2 . TRP C  2 87 ? 29.432  48.491  165.429 1.00 29.75 ? 88   TRP C CD2 1 
ATOM   2141 N  NE1 . TRP C  2 87 ? 31.057  47.378  164.349 1.00 30.26 ? 88   TRP C NE1 1 
ATOM   2142 C  CE2 . TRP C  2 87 ? 30.556  47.652  165.598 1.00 30.01 ? 88   TRP C CE2 1 
ATOM   2143 C  CE3 . TRP C  2 87 ? 28.723  48.904  166.576 1.00 30.42 ? 88   TRP C CE3 1 
ATOM   2144 C  CZ2 . TRP C  2 87 ? 30.994  47.227  166.864 1.00 31.05 ? 88   TRP C CZ2 1 
ATOM   2145 C  CZ3 . TRP C  2 87 ? 29.151  48.473  167.833 1.00 30.15 ? 88   TRP C CZ3 1 
ATOM   2146 C  CH2 . TRP C  2 87 ? 30.282  47.646  167.963 1.00 30.82 ? 88   TRP C CH2 1 
ATOM   2147 N  N   . ALA C  2 88 ? 30.361  51.232  161.668 1.00 24.47 ? 89   ALA C N   1 
ATOM   2148 C  CA  . ALA C  2 88 ? 31.701  51.487  161.122 1.00 25.21 ? 89   ALA C CA  1 
ATOM   2149 C  C   . ALA C  2 88 ? 32.227  52.875  161.473 1.00 26.65 ? 89   ALA C C   1 
ATOM   2150 O  O   . ALA C  2 88 ? 33.405  53.029  161.805 1.00 28.31 ? 89   ALA C O   1 
ATOM   2151 C  CB  . ALA C  2 88 ? 31.708  51.301  159.642 1.00 26.76 ? 89   ALA C CB  1 
ATOM   2152 N  N   . SER C  2 89 ? 31.364  53.888  161.401 1.00 27.00 ? 90   SER C N   1 
ATOM   2153 C  CA  . SER C  2 89 ? 31.727  55.250  161.820 1.00 27.69 ? 90   SER C CA  1 
ATOM   2154 C  C   . SER C  2 89 ? 32.067  55.310  163.315 1.00 27.94 ? 90   SER C C   1 
ATOM   2155 O  O   . SER C  2 89 ? 33.091  55.866  163.713 1.00 28.94 ? 90   SER C O   1 
ATOM   2156 C  CB  . SER C  2 89 ? 30.606  56.244  161.456 1.00 29.42 ? 90   SER C CB  1 
ATOM   2157 O  OG  . SER C  2 89 ? 31.017  57.571  161.743 1.00 31.17 ? 90   SER C OG  1 
ATOM   2158 N  N   . HIS C  2 90 ? 31.227  54.682  164.133 1.00 27.33 ? 91   HIS C N   1 
ATOM   2159 C  CA  . HIS C  2 90 ? 31.432  54.566  165.579 1.00 29.33 ? 91   HIS C CA  1 
ATOM   2160 C  C   . HIS C  2 90 ? 32.780  53.919  165.907 1.00 31.33 ? 91   HIS C C   1 
ATOM   2161 O  O   . HIS C  2 90 ? 33.520  54.368  166.801 1.00 30.79 ? 91   HIS C O   1 
ATOM   2162 C  CB  . HIS C  2 90 ? 30.302  53.708  166.167 1.00 31.19 ? 91   HIS C CB  1 
ATOM   2163 C  CG  . HIS C  2 90 ? 30.512  53.330  167.600 1.00 33.19 ? 91   HIS C CG  1 
ATOM   2164 N  ND1 . HIS C  2 90 ? 30.975  52.090  167.986 1.00 35.14 ? 91   HIS C ND1 1 
ATOM   2165 C  CD2 . HIS C  2 90 ? 30.346  54.040  168.737 1.00 34.06 ? 91   HIS C CD2 1 
ATOM   2166 C  CE1 . HIS C  2 90 ? 31.079  52.052  169.301 1.00 35.17 ? 91   HIS C CE1 1 
ATOM   2167 N  NE2 . HIS C  2 90 ? 30.695  53.220  169.782 1.00 35.44 ? 91   HIS C NE2 1 
ATOM   2168 N  N   . GLU C  2 91 ? 33.098  52.839  165.198 1.00 33.43 ? 92   GLU C N   1 
ATOM   2169 C  CA  . GLU C  2 91 ? 34.363  52.152  165.409 1.00 37.00 ? 92   GLU C CA  1 
ATOM   2170 C  C   . GLU C  2 91 ? 35.534  52.980  164.896 1.00 38.37 ? 92   GLU C C   1 
ATOM   2171 O  O   . GLU C  2 91 ? 36.601  52.963  165.505 1.00 39.12 ? 92   GLU C O   1 
ATOM   2172 C  CB  . GLU C  2 91 ? 34.355  50.758  164.770 1.00 39.31 ? 92   GLU C CB  1 
ATOM   2173 C  CG  . GLU C  2 91 ? 33.426  49.769  165.467 1.00 42.41 ? 92   GLU C CG  1 
ATOM   2174 C  CD  . GLU C  2 91 ? 33.783  49.554  166.930 1.00 44.92 ? 92   GLU C CD  1 
ATOM   2175 O  OE1 . GLU C  2 91 ? 34.739  48.784  167.199 1.00 45.60 ? 92   GLU C OE1 1 
ATOM   2176 O  OE2 . GLU C  2 91 ? 33.105  50.143  167.813 1.00 45.73 ? 92   GLU C OE2 1 
ATOM   2177 N  N   . LYS D  2 3  ? 27.709  13.383  168.943 1.00 50.98 ? 4    LYS D N   1 
ATOM   2178 C  CA  . LYS D  2 3  ? 26.308  13.839  169.175 1.00 49.73 ? 4    LYS D CA  1 
ATOM   2179 C  C   . LYS D  2 3  ? 26.235  15.339  169.447 1.00 47.13 ? 4    LYS D C   1 
ATOM   2180 O  O   . LYS D  2 3  ? 25.246  15.970  169.064 1.00 47.01 ? 4    LYS D O   1 
ATOM   2181 C  CB  . LYS D  2 3  ? 25.657  13.067  170.318 1.00 52.47 ? 4    LYS D CB  1 
ATOM   2182 C  CG  . LYS D  2 3  ? 24.258  12.538  170.003 1.00 55.32 ? 4    LYS D CG  1 
ATOM   2183 C  CD  . LYS D  2 3  ? 23.178  13.574  170.290 1.00 57.33 ? 4    LYS D CD  1 
ATOM   2184 C  CE  . LYS D  2 3  ? 22.959  13.773  171.787 1.00 58.27 ? 4    LYS D CE  1 
ATOM   2185 N  NZ  . LYS D  2 3  ? 22.546  12.510  172.464 1.00 58.84 ? 4    LYS D NZ  1 
ATOM   2186 N  N   . MET D  2 4  ? 27.258  15.902  170.105 1.00 41.57 ? 5    MET D N   1 
ATOM   2187 C  CA  . MET D  2 4  ? 27.373  17.349  170.245 1.00 37.95 ? 5    MET D CA  1 
ATOM   2188 C  C   . MET D  2 4  ? 27.558  17.953  168.855 1.00 30.75 ? 5    MET D C   1 
ATOM   2189 O  O   . MET D  2 4  ? 28.402  17.498  168.084 1.00 27.98 ? 5    MET D O   1 
ATOM   2190 C  CB  . MET D  2 4  ? 28.567  17.744  171.126 1.00 39.69 ? 5    MET D CB  1 
ATOM   2191 C  CG  . MET D  2 4  ? 28.212  18.682  172.278 1.00 42.98 ? 5    MET D CG  1 
ATOM   2192 S  SD  . MET D  2 4  ? 29.645  19.456  173.093 1.00 45.89 ? 5    MET D SD  1 
ATOM   2193 C  CE  . MET D  2 4  ? 30.730  18.054  173.319 1.00 45.19 ? 5    MET D CE  1 
ATOM   2194 N  N   . SER D  2 5  ? 26.790  18.990  168.539 1.00 26.18 ? 6    SER D N   1 
ATOM   2195 C  CA  . SER D  2 5  ? 26.891  19.607  167.220 1.00 23.26 ? 6    SER D CA  1 
ATOM   2196 C  C   . SER D  2 5  ? 28.162  20.432  167.048 1.00 22.53 ? 6    SER D C   1 
ATOM   2197 O  O   . SER D  2 5  ? 28.836  20.772  168.022 1.00 20.92 ? 6    SER D O   1 
ATOM   2198 C  CB  . SER D  2 5  ? 25.676  20.507  166.958 1.00 21.58 ? 6    SER D CB  1 
ATOM   2199 O  OG  . SER D  2 5  ? 25.701  21.608  167.863 1.00 19.63 ? 6    SER D OG  1 
ATOM   2200 N  N   . GLN D  2 6  ? 28.470  20.803  165.814 1.00 21.64 ? 7    GLN D N   1 
ATOM   2201 C  CA  . GLN D  2 6  ? 29.573  21.757  165.575 1.00 21.76 ? 7    GLN D CA  1 
ATOM   2202 C  C   . GLN D  2 6  ? 29.401  23.034  166.403 1.00 18.98 ? 7    GLN D C   1 
ATOM   2203 O  O   . GLN D  2 6  ? 30.296  23.423  167.154 1.00 18.32 ? 7    GLN D O   1 
ATOM   2204 C  CB  . GLN D  2 6  ? 29.665  22.105  164.083 1.00 21.36 ? 7    GLN D CB  1 
ATOM   2205 C  CG  . GLN D  2 6  ? 30.872  22.974  163.646 1.00 21.77 ? 7    GLN D CG  1 
ATOM   2206 C  CD  . GLN D  2 6  ? 30.949  23.201  162.137 1.00 26.05 ? 7    GLN D CD  1 
ATOM   2207 O  OE1 . GLN D  2 6  ? 30.191  22.602  161.359 1.00 28.67 ? 7    GLN D OE1 1 
ATOM   2208 N  NE2 . GLN D  2 6  ? 31.859  24.077  161.717 1.00 27.20 ? 7    GLN D NE2 1 
ATOM   2209 N  N   . LEU D  2 7  ? 28.257  23.691  166.286 1.00 19.09 ? 8    LEU D N   1 
ATOM   2210 C  CA  . LEU D  2 7  ? 27.996  24.912  167.071 1.00 18.27 ? 8    LEU D CA  1 
ATOM   2211 C  C   . LEU D  2 7  ? 28.117  24.673  168.584 1.00 18.93 ? 8    LEU D C   1 
ATOM   2212 O  O   . LEU D  2 7  ? 28.715  25.493  169.299 1.00 17.64 ? 8    LEU D O   1 
ATOM   2213 C  CB  . LEU D  2 7  ? 26.598  25.452  166.704 1.00 17.81 ? 8    LEU D CB  1 
ATOM   2214 C  CG  . LEU D  2 7  ? 26.162  26.783  167.306 1.00 19.26 ? 8    LEU D CG  1 
ATOM   2215 C  CD1 . LEU D  2 7  ? 27.226  27.860  167.059 1.00 18.14 ? 8    LEU D CD1 1 
ATOM   2216 C  CD2 . LEU D  2 7  ? 24.823  27.144  166.641 1.00 19.12 ? 8    LEU D CD2 1 
ATOM   2217 N  N   . GLU D  2 8  ? 27.538  23.571  169.086 1.00 18.86 ? 9    GLU D N   1 
ATOM   2218 C  CA  . GLU D  2 8  ? 27.626  23.291  170.538 1.00 20.24 ? 9    GLU D CA  1 
ATOM   2219 C  C   . GLU D  2 8  ? 29.053  23.099  171.024 1.00 20.38 ? 9    GLU D C   1 
ATOM   2220 O  O   . GLU D  2 8  ? 29.392  23.510  172.145 1.00 18.42 ? 9    GLU D O   1 
ATOM   2221 C  CB  . GLU D  2 8  ? 26.777  22.073  170.928 1.00 22.93 ? 9    GLU D CB  1 
ATOM   2222 C  CG  . GLU D  2 8  ? 25.290  22.391  170.951 1.00 24.36 ? 9    GLU D CG  1 
ATOM   2223 C  CD  . GLU D  2 8  ? 24.419  21.141  170.817 1.00 31.12 ? 9    GLU D CD  1 
ATOM   2224 O  OE1 . GLU D  2 8  ? 24.929  20.058  170.403 1.00 32.82 ? 9    GLU D OE1 1 
ATOM   2225 O  OE2 . GLU D  2 8  ? 23.199  21.239  171.088 1.00 32.27 ? 9    GLU D OE2 1 
ATOM   2226 N  N   . ARG D  2 9  ? 29.873  22.461  170.196 1.00 18.72 ? 10   ARG D N   1 
ATOM   2227 C  CA  . ARG D  2 9  ? 31.311  22.309  170.510 1.00 21.06 ? 10   ARG D CA  1 
ATOM   2228 C  C   . ARG D  2 9  ? 32.022  23.633  170.533 1.00 21.64 ? 10   ARG D C   1 
ATOM   2229 O  O   . ARG D  2 9  ? 32.891  23.859  171.372 1.00 19.35 ? 10   ARG D O   1 
ATOM   2230 C  CB  . ARG D  2 9  ? 32.018  21.417  169.491 1.00 18.42 ? 10   ARG D CB  1 
ATOM   2231 C  CG  . ARG D  2 9  ? 31.677  19.939  169.613 1.00 22.98 ? 10   ARG D CG  1 
ATOM   2232 C  CD  . ARG D  2 9  ? 32.133  19.143  168.377 1.00 24.04 ? 10   ARG D CD  1 
ATOM   2233 N  NE  . ARG D  2 9  ? 33.589  19.092  168.216 1.00 23.90 ? 10   ARG D NE  1 
ATOM   2234 C  CZ  . ARG D  2 9  ? 34.366  18.171  168.786 1.00 23.66 ? 10   ARG D CZ  1 
ATOM   2235 N  NH1 . ARG D  2 9  ? 33.842  17.251  169.585 1.00 23.33 ? 10   ARG D NH1 1 
ATOM   2236 N  NH2 . ARG D  2 9  ? 35.669  18.179  168.577 1.00 23.39 ? 10   ARG D NH2 1 
ATOM   2237 N  N   . ASN D  2 10 ? 31.648  24.535  169.625 1.00 20.01 ? 11   ASN D N   1 
ATOM   2238 C  CA  . ASN D  2 10 ? 32.312  25.836  169.594 1.00 19.61 ? 11   ASN D CA  1 
ATOM   2239 C  C   . ASN D  2 10 ? 31.980  26.658  170.830 1.00 17.78 ? 11   ASN D C   1 
ATOM   2240 O  O   . ASN D  2 10 ? 32.848  27.321  171.377 1.00 19.48 ? 11   ASN D O   1 
ATOM   2241 C  CB  . ASN D  2 10 ? 31.938  26.606  168.327 1.00 18.48 ? 11   ASN D CB  1 
ATOM   2242 C  CG  . ASN D  2 10 ? 32.338  25.869  167.073 1.00 19.26 ? 11   ASN D CG  1 
ATOM   2243 O  OD1 . ASN D  2 10 ? 33.324  25.113  167.035 1.00 23.03 ? 11   ASN D OD1 1 
ATOM   2244 N  ND2 . ASN D  2 10 ? 31.588  26.095  166.029 1.00 18.57 ? 11   ASN D ND2 1 
ATOM   2245 N  N   . ILE D  2 11 ? 30.729  26.563  171.260 1.00 17.66 ? 12   ILE D N   1 
ATOM   2246 C  CA  . ILE D  2 11 ? 30.247  27.238  172.470 1.00 19.84 ? 12   ILE D CA  1 
ATOM   2247 C  C   . ILE D  2 11 ? 30.914  26.625  173.710 1.00 18.72 ? 12   ILE D C   1 
ATOM   2248 O  O   . ILE D  2 11 ? 31.416  27.350  174.570 1.00 20.49 ? 12   ILE D O   1 
ATOM   2249 C  CB  . ILE D  2 11 ? 28.700  27.188  172.524 1.00 19.25 ? 12   ILE D CB  1 
ATOM   2250 C  CG1 . ILE D  2 11 ? 28.137  28.158  171.470 1.00 22.68 ? 12   ILE D CG1 1 
ATOM   2251 C  CG2 . ILE D  2 11 ? 28.199  27.592  173.936 1.00 21.18 ? 12   ILE D CG2 1 
ATOM   2252 C  CD1 . ILE D  2 11 ? 26.651  28.018  171.321 1.00 23.77 ? 12   ILE D CD1 1 
ATOM   2253 N  N   . GLU D  2 12 ? 30.998  25.308  173.754 1.00 20.08 ? 13   GLU D N   1 
ATOM   2254 C  CA  . GLU D  2 12 ? 31.704  24.661  174.863 1.00 21.09 ? 13   GLU D CA  1 
ATOM   2255 C  C   . GLU D  2 12 ? 33.176  25.113  174.909 1.00 19.02 ? 13   GLU D C   1 
ATOM   2256 O  O   . GLU D  2 12 ? 33.731  25.359  175.984 1.00 20.18 ? 13   GLU D O   1 
ATOM   2257 C  CB  . GLU D  2 12 ? 31.613  23.127  174.752 1.00 24.38 ? 13   GLU D CB  1 
ATOM   2258 C  CG  . GLU D  2 12 ? 32.378  22.466  175.897 1.00 30.79 ? 13   GLU D CG  1 
ATOM   2259 C  CD  . GLU D  2 12 ? 31.995  23.058  177.254 1.00 36.82 ? 13   GLU D CD  1 
ATOM   2260 O  OE1 . GLU D  2 12 ? 30.775  23.279  177.476 1.00 38.57 ? 13   GLU D OE1 1 
ATOM   2261 O  OE2 . GLU D  2 12 ? 32.890  23.306  178.113 1.00 39.28 ? 13   GLU D OE2 1 
ATOM   2262 N  N   . THR D  2 13 ? 33.815  25.261  173.759 1.00 17.55 ? 14   THR D N   1 
ATOM   2263 C  CA  . THR D  2 13 ? 35.186  25.769  173.756 1.00 18.96 ? 14   THR D CA  1 
ATOM   2264 C  C   . THR D  2 13 ? 35.274  27.164  174.389 1.00 19.77 ? 14   THR D C   1 
ATOM   2265 O  O   . THR D  2 13 ? 36.207  27.452  175.170 1.00 18.83 ? 14   THR D O   1 
ATOM   2266 C  CB  . THR D  2 13 ? 35.715  25.776  172.340 1.00 20.22 ? 14   THR D CB  1 
ATOM   2267 O  OG1 . THR D  2 13 ? 35.889  24.416  171.912 1.00 20.58 ? 14   THR D OG1 1 
ATOM   2268 C  CG2 . THR D  2 13 ? 37.120  26.397  172.279 1.00 21.14 ? 14   THR D CG2 1 
ATOM   2269 N  N   . ILE D  2 14 ? 34.301  28.019  174.067 1.00 20.68 ? 15   ILE D N   1 
ATOM   2270 C  CA  . ILE D  2 14 ? 34.275  29.378  174.626 1.00 20.06 ? 15   ILE D CA  1 
ATOM   2271 C  C   . ILE D  2 14 ? 34.135  29.333  176.127 1.00 19.12 ? 15   ILE D C   1 
ATOM   2272 O  O   . ILE D  2 14 ? 34.893  29.972  176.862 1.00 19.56 ? 15   ILE D O   1 
ATOM   2273 C  CB  . ILE D  2 14 ? 33.156  30.230  173.976 1.00 19.73 ? 15   ILE D CB  1 
ATOM   2274 C  CG1 . ILE D  2 14 ? 33.453  30.375  172.472 1.00 19.96 ? 15   ILE D CG1 1 
ATOM   2275 C  CG2 . ILE D  2 14 ? 33.052  31.610  174.683 1.00 19.79 ? 15   ILE D CG2 1 
ATOM   2276 C  CD1 . ILE D  2 14 ? 32.286  30.958  171.649 1.00 21.29 ? 15   ILE D CD1 1 
ATOM   2277 N  N   . ILE D  2 15 ? 33.155  28.569  176.597 1.00 19.74 ? 16   ILE D N   1 
ATOM   2278 C  CA  . ILE D  2 15 ? 32.868  28.453  178.026 1.00 18.78 ? 16   ILE D CA  1 
ATOM   2279 C  C   . ILE D  2 15 ? 34.058  27.891  178.794 1.00 20.21 ? 16   ILE D C   1 
ATOM   2280 O  O   . ILE D  2 15 ? 34.410  28.430  179.849 1.00 18.85 ? 16   ILE D O   1 
ATOM   2281 C  CB  . ILE D  2 15 ? 31.595  27.593  178.211 1.00 18.06 ? 16   ILE D CB  1 
ATOM   2282 C  CG1 . ILE D  2 15 ? 30.376  28.324  177.612 1.00 17.76 ? 16   ILE D CG1 1 
ATOM   2283 C  CG2 . ILE D  2 15 ? 31.388  27.223  179.712 1.00 21.06 ? 16   ILE D CG2 1 
ATOM   2284 C  CD1 . ILE D  2 15 ? 29.110  27.387  177.653 1.00 18.01 ? 16   ILE D CD1 1 
ATOM   2285 N  N   . ASN D  2 16 ? 34.672  26.827  178.278 1.00 18.00 ? 17   ASN D N   1 
ATOM   2286 C  CA  . ASN D  2 16 ? 35.794  26.197  178.968 1.00 18.84 ? 17   ASN D CA  1 
ATOM   2287 C  C   . ASN D  2 16 ? 36.994  27.141  179.059 1.00 19.79 ? 17   ASN D C   1 
ATOM   2288 O  O   . ASN D  2 16 ? 37.725  27.144  180.051 1.00 18.17 ? 17   ASN D O   1 
ATOM   2289 C  CB  . ASN D  2 16 ? 36.246  24.913  178.268 1.00 18.41 ? 17   ASN D CB  1 
ATOM   2290 C  CG  . ASN D  2 16 ? 37.219  24.119  179.120 1.00 20.67 ? 17   ASN D CG  1 
ATOM   2291 O  OD1 . ASN D  2 16 ? 36.836  23.585  180.156 1.00 22.83 ? 17   ASN D OD1 1 
ATOM   2292 N  ND2 . ASN D  2 16 ? 38.493  24.143  178.755 1.00 19.66 ? 17   ASN D ND2 1 
ATOM   2293 N  N   . THR D  2 17 ? 37.233  27.880  177.989 1.00 17.84 ? 18   THR D N   1 
ATOM   2294 C  CA  . THR D  2 17 ? 38.321  28.864  178.002 1.00 19.07 ? 18   THR D CA  1 
ATOM   2295 C  C   . THR D  2 17 ? 38.072  29.996  179.013 1.00 20.00 ? 18   THR D C   1 
ATOM   2296 O  O   . THR D  2 17 ? 38.983  30.352  179.773 1.00 19.01 ? 18   THR D O   1 
ATOM   2297 C  CB  . THR D  2 17 ? 38.518  29.431  176.586 1.00 22.38 ? 18   THR D CB  1 
ATOM   2298 O  OG1 . THR D  2 17 ? 38.834  28.364  175.695 1.00 24.56 ? 18   THR D OG1 1 
ATOM   2299 C  CG2 . THR D  2 17 ? 39.738  30.351  176.491 1.00 21.80 ? 18   THR D CG2 1 
ATOM   2300 N  N   . PHE D  2 18 ? 36.851  30.523  179.054 1.00 18.84 ? 19   PHE D N   1 
ATOM   2301 C  CA  . PHE D  2 18 ? 36.495  31.502  180.093 1.00 17.87 ? 19   PHE D CA  1 
ATOM   2302 C  C   . PHE D  2 18 ? 36.746  30.928  181.498 1.00 19.08 ? 19   PHE D C   1 
ATOM   2303 O  O   . PHE D  2 18 ? 37.395  31.583  182.318 1.00 18.81 ? 19   PHE D O   1 
ATOM   2304 C  CB  . PHE D  2 18 ? 35.025  31.845  179.946 1.00 18.85 ? 19   PHE D CB  1 
ATOM   2305 C  CG  . PHE D  2 18 ? 34.532  32.859  180.937 1.00 18.39 ? 19   PHE D CG  1 
ATOM   2306 C  CD1 . PHE D  2 18 ? 34.650  34.215  180.686 1.00 19.13 ? 19   PHE D CD1 1 
ATOM   2307 C  CD2 . PHE D  2 18 ? 33.950  32.440  182.110 1.00 16.90 ? 19   PHE D CD2 1 
ATOM   2308 C  CE1 . PHE D  2 18 ? 34.159  35.163  181.604 1.00 18.59 ? 19   PHE D CE1 1 
ATOM   2309 C  CE2 . PHE D  2 18 ? 33.443  33.379  183.040 1.00 19.01 ? 19   PHE D CE2 1 
ATOM   2310 C  CZ  . PHE D  2 18 ? 33.568  34.730  182.793 1.00 18.56 ? 19   PHE D CZ  1 
ATOM   2311 N  N   . HIS D  2 19 ? 36.265  29.700  181.743 1.00 20.26 ? 20   HIS D N   1 
ATOM   2312 C  CA  . HIS D  2 19 ? 36.406  29.021  183.045 1.00 19.26 ? 20   HIS D CA  1 
ATOM   2313 C  C   . HIS D  2 19 ? 37.878  28.802  183.410 1.00 19.00 ? 20   HIS D C   1 
ATOM   2314 O  O   . HIS D  2 19 ? 38.299  28.989  184.550 1.00 19.31 ? 20   HIS D O   1 
ATOM   2315 C  CB  . HIS D  2 19 ? 35.638  27.688  183.034 1.00 19.76 ? 20   HIS D CB  1 
ATOM   2316 C  CG  . HIS D  2 19 ? 35.841  26.856  184.268 1.00 23.64 ? 20   HIS D CG  1 
ATOM   2317 N  ND1 . HIS D  2 19 ? 35.126  27.053  185.433 1.00 24.37 ? 20   HIS D ND1 1 
ATOM   2318 C  CD2 . HIS D  2 19 ? 36.684  25.823  184.517 1.00 22.27 ? 20   HIS D CD2 1 
ATOM   2319 C  CE1 . HIS D  2 19 ? 35.517  26.180  186.345 1.00 23.53 ? 20   HIS D CE1 1 
ATOM   2320 N  NE2 . HIS D  2 19 ? 36.459  25.419  185.816 1.00 23.22 ? 20   HIS D NE2 1 
ATOM   2321 N  N   . GLN D  2 20 ? 38.669  28.425  182.428 1.00 20.34 ? 21   GLN D N   1 
ATOM   2322 C  CA  . GLN D  2 20 ? 40.078  28.170  182.678 1.00 20.03 ? 21   GLN D CA  1 
ATOM   2323 C  C   . GLN D  2 20 ? 40.735  29.318  183.450 1.00 19.31 ? 21   GLN D C   1 
ATOM   2324 O  O   . GLN D  2 20 ? 41.477  29.089  184.397 1.00 18.44 ? 21   GLN D O   1 
ATOM   2325 C  CB  . GLN D  2 20 ? 40.802  27.966  181.363 1.00 21.34 ? 21   GLN D CB  1 
ATOM   2326 C  CG  . GLN D  2 20 ? 42.211  27.510  181.591 1.00 25.00 ? 21   GLN D CG  1 
ATOM   2327 C  CD  . GLN D  2 20 ? 42.843  27.173  180.292 1.00 29.42 ? 21   GLN D CD  1 
ATOM   2328 O  OE1 . GLN D  2 20 ? 42.274  26.381  179.509 1.00 32.76 ? 21   GLN D OE1 1 
ATOM   2329 N  NE2 . GLN D  2 20 ? 44.006  27.775  180.022 1.00 31.33 ? 21   GLN D NE2 1 
ATOM   2330 N  N   . TYR D  2 21 ? 40.452  30.551  183.035 1.00 19.13 ? 22   TYR D N   1 
ATOM   2331 C  CA  . TYR D  2 21 ? 41.046  31.728  183.653 1.00 19.59 ? 22   TYR D CA  1 
ATOM   2332 C  C   . TYR D  2 21 ? 40.234  32.276  184.817 1.00 20.49 ? 22   TYR D C   1 
ATOM   2333 O  O   . TYR D  2 21 ? 40.813  32.697  185.817 1.00 21.27 ? 22   TYR D O   1 
ATOM   2334 C  CB  . TYR D  2 21 ? 41.251  32.802  182.576 1.00 21.48 ? 22   TYR D CB  1 
ATOM   2335 C  CG  . TYR D  2 21 ? 42.228  32.338  181.532 1.00 22.20 ? 22   TYR D CG  1 
ATOM   2336 C  CD1 . TYR D  2 21 ? 41.786  31.752  180.339 1.00 23.65 ? 22   TYR D CD1 1 
ATOM   2337 C  CD2 . TYR D  2 21 ? 43.597  32.409  181.772 1.00 23.78 ? 22   TYR D CD2 1 
ATOM   2338 C  CE1 . TYR D  2 21 ? 42.669  31.304  179.408 1.00 22.29 ? 22   TYR D CE1 1 
ATOM   2339 C  CE2 . TYR D  2 21 ? 44.504  31.953  180.839 1.00 24.40 ? 22   TYR D CE2 1 
ATOM   2340 C  CZ  . TYR D  2 21 ? 44.033  31.418  179.663 1.00 23.92 ? 22   TYR D CZ  1 
ATOM   2341 O  OH  . TYR D  2 21 ? 44.935  30.975  178.729 1.00 24.76 ? 22   TYR D OH  1 
ATOM   2342 N  N   . SER D  2 22 ? 38.901  32.265  184.718 1.00 18.63 ? 23   SER D N   1 
ATOM   2343 C  CA  . SER D  2 22 ? 38.078  32.874  185.765 1.00 19.91 ? 23   SER D CA  1 
ATOM   2344 C  C   . SER D  2 22 ? 38.318  32.205  187.117 1.00 20.75 ? 23   SER D C   1 
ATOM   2345 O  O   . SER D  2 22 ? 38.297  32.855  188.165 1.00 18.97 ? 23   SER D O   1 
ATOM   2346 C  CB  . SER D  2 22 ? 36.593  32.818  185.365 1.00 22.44 ? 23   SER D CB  1 
ATOM   2347 O  OG  . SER D  2 22 ? 36.102  31.483  185.414 1.00 25.09 ? 23   SER D OG  1 
ATOM   2348 N  N   . VAL D  2 23 ? 38.578  30.901  187.090 1.00 18.04 ? 24   VAL D N   1 
ATOM   2349 C  CA  . VAL D  2 23 ? 38.735  30.156  188.335 1.00 21.17 ? 24   VAL D CA  1 
ATOM   2350 C  C   . VAL D  2 23 ? 40.095  30.342  189.032 1.00 19.41 ? 24   VAL D C   1 
ATOM   2351 O  O   . VAL D  2 23 ? 40.278  29.861  190.146 1.00 23.60 ? 24   VAL D O   1 
ATOM   2352 C  CB  . VAL D  2 23 ? 38.442  28.654  188.105 1.00 21.43 ? 24   VAL D CB  1 
ATOM   2353 C  CG1 . VAL D  2 23 ? 39.638  27.966  187.442 1.00 21.25 ? 24   VAL D CG1 1 
ATOM   2354 C  CG2 . VAL D  2 23 ? 38.080  27.989  189.405 1.00 23.95 ? 24   VAL D CG2 1 
ATOM   2355 N  N   . LYS D  2 24 ? 41.045  31.028  188.404 1.00 20.96 ? 25   LYS D N   1 
ATOM   2356 C  CA  . LYS D  2 24 ? 42.408  31.114  188.946 1.00 23.67 ? 25   LYS D CA  1 
ATOM   2357 C  C   . LYS D  2 24 ? 42.472  31.884  190.264 1.00 23.34 ? 25   LYS D C   1 
ATOM   2358 O  O   . LYS D  2 24 ? 43.300  31.589  191.135 1.00 23.02 ? 25   LYS D O   1 
ATOM   2359 C  CB  . LYS D  2 24 ? 43.363  31.747  187.922 1.00 24.90 ? 25   LYS D CB  1 
ATOM   2360 C  CG  . LYS D  2 24 ? 43.677  30.869  186.719 1.00 27.17 ? 25   LYS D CG  1 
ATOM   2361 C  CD  . LYS D  2 24 ? 44.634  31.557  185.762 1.00 28.43 ? 25   LYS D CD  1 
ATOM   2362 C  CE  . LYS D  2 24 ? 45.195  30.581  184.717 1.00 32.76 ? 25   LYS D CE  1 
ATOM   2363 N  NZ  . LYS D  2 24 ? 46.356  29.773  185.207 1.00 35.26 ? 25   LYS D NZ  1 
ATOM   2364 N  N   . LEU D  2 25 ? 41.590  32.865  190.399 1.00 21.55 ? 26   LEU D N   1 
ATOM   2365 C  CA  . LEU D  2 25 ? 41.617  33.835  191.494 1.00 21.68 ? 26   LEU D CA  1 
ATOM   2366 C  C   . LEU D  2 25 ? 40.328  34.643  191.530 1.00 22.16 ? 26   LEU D C   1 
ATOM   2367 O  O   . LEU D  2 25 ? 39.724  34.931  190.481 1.00 20.18 ? 26   LEU D O   1 
ATOM   2368 C  CB  . LEU D  2 25 ? 42.781  34.808  191.283 1.00 22.51 ? 26   LEU D CB  1 
ATOM   2369 C  CG  . LEU D  2 25 ? 43.221  35.760  192.401 1.00 23.83 ? 26   LEU D CG  1 
ATOM   2370 C  CD1 . LEU D  2 25 ? 43.849  35.014  193.553 1.00 22.68 ? 26   LEU D CD1 1 
ATOM   2371 C  CD2 . LEU D  2 25 ? 44.210  36.783  191.849 1.00 23.13 ? 26   LEU D CD2 1 
ATOM   2372 N  N   . GLY D  2 26 ? 39.921  35.029  192.730 1.00 20.37 ? 27   GLY D N   1 
ATOM   2373 C  CA  . GLY D  2 26 ? 38.775  35.923  192.888 1.00 22.63 ? 27   GLY D CA  1 
ATOM   2374 C  C   . GLY D  2 26 ? 37.503  35.114  192.735 1.00 21.93 ? 27   GLY D C   1 
ATOM   2375 O  O   . GLY D  2 26 ? 37.505  33.910  192.960 1.00 23.23 ? 27   GLY D O   1 
ATOM   2376 N  N   . HIS D  2 27 ? 36.417  35.756  192.346 1.00 22.18 ? 28   HIS D N   1 
ATOM   2377 C  CA  . HIS D  2 27 ? 35.188  35.031  192.053 1.00 23.93 ? 28   HIS D CA  1 
ATOM   2378 C  C   . HIS D  2 27 ? 35.456  34.011  190.956 1.00 22.66 ? 28   HIS D C   1 
ATOM   2379 O  O   . HIS D  2 27 ? 36.027  34.358  189.938 1.00 19.88 ? 28   HIS D O   1 
ATOM   2380 C  CB  . HIS D  2 27 ? 34.100  36.006  191.594 1.00 27.68 ? 28   HIS D CB  1 
ATOM   2381 C  CG  . HIS D  2 27 ? 33.692  36.980  192.652 1.00 32.18 ? 28   HIS D CG  1 
ATOM   2382 N  ND1 . HIS D  2 27 ? 33.073  36.591  193.820 1.00 34.81 ? 28   HIS D ND1 1 
ATOM   2383 C  CD2 . HIS D  2 27 ? 33.870  38.317  192.748 1.00 33.72 ? 28   HIS D CD2 1 
ATOM   2384 C  CE1 . HIS D  2 27 ? 32.846  37.653  194.571 1.00 35.86 ? 28   HIS D CE1 1 
ATOM   2385 N  NE2 . HIS D  2 27 ? 33.329  38.711  193.947 1.00 36.20 ? 28   HIS D NE2 1 
ATOM   2386 N  N   . PRO D  2 28 ? 35.061  32.762  191.171 1.00 22.51 ? 29   PRO D N   1 
ATOM   2387 C  CA  . PRO D  2 28 ? 35.416  31.689  190.235 1.00 21.44 ? 29   PRO D CA  1 
ATOM   2388 C  C   . PRO D  2 28 ? 34.675  31.757  188.908 1.00 22.24 ? 29   PRO D C   1 
ATOM   2389 O  O   . PRO D  2 28 ? 35.107  31.110  187.967 1.00 22.51 ? 29   PRO D O   1 
ATOM   2390 C  CB  . PRO D  2 28 ? 35.037  30.407  190.979 1.00 23.35 ? 29   PRO D CB  1 
ATOM   2391 C  CG  . PRO D  2 28 ? 34.065  30.826  192.037 1.00 23.78 ? 29   PRO D CG  1 
ATOM   2392 C  CD  . PRO D  2 28 ? 34.332  32.268  192.353 1.00 22.28 ? 29   PRO D CD  1 
ATOM   2393 N  N   . ASP D  2 29 ? 33.585  32.510  188.818 1.00 20.03 ? 30   ASP D N   1 
ATOM   2394 C  CA  . ASP D  2 29 ? 32.873  32.621  187.522 1.00 21.06 ? 30   ASP D CA  1 
ATOM   2395 C  C   . ASP D  2 29 ? 33.012  33.998  186.862 1.00 20.66 ? 30   ASP D C   1 
ATOM   2396 O  O   . ASP D  2 29 ? 32.274  34.325  185.937 1.00 20.77 ? 30   ASP D O   1 
ATOM   2397 C  CB  . ASP D  2 29 ? 31.409  32.249  187.745 1.00 22.50 ? 30   ASP D CB  1 
ATOM   2398 C  CG  . ASP D  2 29 ? 30.671  31.824  186.459 1.00 26.51 ? 30   ASP D CG  1 
ATOM   2399 O  OD1 . ASP D  2 29 ? 31.275  31.257  185.494 1.00 25.71 ? 30   ASP D OD1 1 
ATOM   2400 O  OD2 . ASP D  2 29 ? 29.435  32.049  186.392 1.00 26.21 ? 30   ASP D OD2 1 
ATOM   2401 N  N   . THR D  2 30 ? 33.936  34.842  187.310 1.00 19.98 ? 31   THR D N   1 
ATOM   2402 C  CA  . THR D  2 30 ? 34.232  36.065  186.520 1.00 20.45 ? 31   THR D CA  1 
ATOM   2403 C  C   . THR D  2 30 ? 35.731  36.213  186.275 1.00 19.86 ? 31   THR D C   1 
ATOM   2404 O  O   . THR D  2 30 ? 36.552  35.629  186.994 1.00 16.56 ? 31   THR D O   1 
ATOM   2405 C  CB  . THR D  2 30 ? 33.758  37.389  187.221 1.00 20.18 ? 31   THR D CB  1 
ATOM   2406 O  OG1 . THR D  2 30 ? 34.465  37.572  188.454 1.00 22.39 ? 31   THR D OG1 1 
ATOM   2407 C  CG2 . THR D  2 30 ? 32.315  37.355  187.613 1.00 21.50 ? 31   THR D CG2 1 
ATOM   2408 N  N   . LEU D  2 31 ? 36.070  37.004  185.269 1.00 19.93 ? 32   LEU D N   1 
ATOM   2409 C  CA  . LEU D  2 31 ? 37.456  37.311  184.938 1.00 19.49 ? 32   LEU D CA  1 
ATOM   2410 C  C   . LEU D  2 31 ? 37.842  38.641  185.593 1.00 22.08 ? 32   LEU D C   1 
ATOM   2411 O  O   . LEU D  2 31 ? 37.210  39.664  185.355 1.00 21.04 ? 32   LEU D O   1 
ATOM   2412 C  CB  . LEU D  2 31 ? 37.601  37.483  183.422 1.00 21.28 ? 32   LEU D CB  1 
ATOM   2413 C  CG  . LEU D  2 31 ? 37.431  36.254  182.524 1.00 19.92 ? 32   LEU D CG  1 
ATOM   2414 C  CD1 . LEU D  2 31 ? 37.569  36.699  181.027 1.00 19.18 ? 32   LEU D CD1 1 
ATOM   2415 C  CD2 . LEU D  2 31 ? 38.431  35.177  182.876 1.00 18.81 ? 32   LEU D CD2 1 
ATOM   2416 N  N   . ASN D  2 32 ? 38.912  38.648  186.373 1.00 19.04 ? 33   ASN D N   1 
ATOM   2417 C  CA  . ASN D  2 32 ? 39.418  39.926  186.813 1.00 19.85 ? 33   ASN D CA  1 
ATOM   2418 C  C   . ASN D  2 32 ? 40.403  40.417  185.735 1.00 19.71 ? 33   ASN D C   1 
ATOM   2419 O  O   . ASN D  2 32 ? 40.633  39.744  184.715 1.00 19.93 ? 33   ASN D O   1 
ATOM   2420 C  CB  . ASN D  2 32 ? 39.977  39.819  188.235 1.00 22.76 ? 33   ASN D CB  1 
ATOM   2421 C  CG  . ASN D  2 32 ? 41.196  38.925  188.324 1.00 24.48 ? 33   ASN D CG  1 
ATOM   2422 O  OD1 . ASN D  2 32 ? 41.809  38.599  187.307 1.00 24.07 ? 33   ASN D OD1 1 
ATOM   2423 N  ND2 . ASN D  2 32 ? 41.556  38.523  189.550 1.00 24.89 ? 33   ASN D ND2 1 
ATOM   2424 N  N   . GLN D  2 33 ? 40.971  41.599  185.928 1.00 22.47 ? 34   GLN D N   1 
ATOM   2425 C  CA  . GLN D  2 33 ? 41.798  42.188  184.888 1.00 25.63 ? 34   GLN D CA  1 
ATOM   2426 C  C   . GLN D  2 33 ? 42.972  41.293  184.476 1.00 23.86 ? 34   GLN D C   1 
ATOM   2427 O  O   . GLN D  2 33 ? 43.231  41.108  183.293 1.00 21.62 ? 34   GLN D O   1 
ATOM   2428 C  CB  . GLN D  2 33 ? 42.275  43.584  185.319 1.00 29.27 ? 34   GLN D CB  1 
ATOM   2429 C  CG  . GLN D  2 33 ? 43.034  44.296  184.228 1.00 34.09 ? 34   GLN D CG  1 
ATOM   2430 C  CD  . GLN D  2 33 ? 43.518  45.684  184.647 1.00 35.86 ? 34   GLN D CD  1 
ATOM   2431 O  OE1 . GLN D  2 33 ? 44.701  45.873  184.938 1.00 38.72 ? 34   GLN D OE1 1 
ATOM   2432 N  NE2 . GLN D  2 33 ? 42.599  46.645  184.694 1.00 38.75 ? 34   GLN D NE2 1 
ATOM   2433 N  N   . GLY D  2 34 ? 43.680  40.731  185.448 1.00 20.87 ? 35   GLY D N   1 
ATOM   2434 C  CA  . GLY D  2 34 ? 44.842  39.881  185.142 1.00 21.56 ? 35   GLY D CA  1 
ATOM   2435 C  C   . GLY D  2 34 ? 44.484  38.600  184.400 1.00 19.92 ? 35   GLY D C   1 
ATOM   2436 O  O   . GLY D  2 34 ? 45.217  38.146  183.506 1.00 21.62 ? 35   GLY D O   1 
ATOM   2437 N  N   . GLU D  2 35 ? 43.379  37.987  184.805 1.00 19.30 ? 36   GLU D N   1 
ATOM   2438 C  CA  . GLU D  2 35 ? 42.841  36.825  184.097 1.00 19.08 ? 36   GLU D CA  1 
ATOM   2439 C  C   . GLU D  2 35 ? 42.438  37.150  182.657 1.00 21.54 ? 36   GLU D C   1 
ATOM   2440 O  O   . GLU D  2 35 ? 42.758  36.405  181.725 1.00 20.40 ? 36   GLU D O   1 
ATOM   2441 C  CB  . GLU D  2 35 ? 41.660  36.256  184.893 1.00 19.33 ? 36   GLU D CB  1 
ATOM   2442 C  CG  . GLU D  2 35 ? 42.135  35.551  186.149 1.00 20.00 ? 36   GLU D CG  1 
ATOM   2443 C  CD  . GLU D  2 35 ? 41.109  35.427  187.252 1.00 20.13 ? 36   GLU D CD  1 
ATOM   2444 O  OE1 . GLU D  2 35 ? 39.958  35.850  187.061 1.00 19.80 ? 36   GLU D OE1 1 
ATOM   2445 O  OE2 . GLU D  2 35 ? 41.471  34.900  188.346 1.00 20.60 ? 36   GLU D OE2 1 
ATOM   2446 N  N   . PHE D  2 36 ? 41.754  38.279  182.469 1.00 19.84 ? 37   PHE D N   1 
ATOM   2447 C  CA  . PHE D  2 36 ? 41.392  38.704  181.117 1.00 21.54 ? 37   PHE D CA  1 
ATOM   2448 C  C   . PHE D  2 36 ? 42.644  38.927  180.286 1.00 21.20 ? 37   PHE D C   1 
ATOM   2449 O  O   . PHE D  2 36 ? 42.732  38.495  179.142 1.00 19.53 ? 37   PHE D O   1 
ATOM   2450 C  CB  . PHE D  2 36 ? 40.586  39.981  181.141 1.00 20.12 ? 37   PHE D CB  1 
ATOM   2451 C  CG  . PHE D  2 36 ? 40.146  40.453  179.764 1.00 19.98 ? 37   PHE D CG  1 
ATOM   2452 C  CD1 . PHE D  2 36 ? 39.266  39.704  178.998 1.00 21.24 ? 37   PHE D CD1 1 
ATOM   2453 C  CD2 . PHE D  2 36 ? 40.650  41.644  179.244 1.00 20.34 ? 37   PHE D CD2 1 
ATOM   2454 C  CE1 . PHE D  2 36 ? 38.859  40.143  177.729 1.00 21.82 ? 37   PHE D CE1 1 
ATOM   2455 C  CE2 . PHE D  2 36 ? 40.273  42.086  177.991 1.00 20.40 ? 37   PHE D CE2 1 
ATOM   2456 C  CZ  . PHE D  2 36 ? 39.372  41.348  177.234 1.00 21.33 ? 37   PHE D CZ  1 
ATOM   2457 N  N   . LYS D  2 37 ? 43.638  39.588  180.866 1.00 21.28 ? 38   LYS D N   1 
ATOM   2458 C  CA  . LYS D  2 37 ? 44.861  39.846  180.111 1.00 23.10 ? 38   LYS D CA  1 
ATOM   2459 C  C   . LYS D  2 37 ? 45.528  38.553  179.670 1.00 23.32 ? 38   LYS D C   1 
ATOM   2460 O  O   . LYS D  2 37 ? 46.055  38.468  178.569 1.00 22.92 ? 38   LYS D O   1 
ATOM   2461 C  CB  . LYS D  2 37 ? 45.833  40.691  180.940 1.00 24.06 ? 38   LYS D CB  1 
ATOM   2462 C  CG  . LYS D  2 37 ? 45.365  42.135  181.072 1.00 27.08 ? 38   LYS D CG  1 
ATOM   2463 C  CD  . LYS D  2 37 ? 46.326  42.932  181.939 1.00 29.88 ? 38   LYS D CD  1 
ATOM   2464 C  CE  . LYS D  2 37 ? 45.968  44.406  181.870 1.00 32.10 ? 38   LYS D CE  1 
ATOM   2465 N  NZ  . LYS D  2 37 ? 46.844  45.192  182.797 1.00 33.92 ? 38   LYS D NZ  1 
ATOM   2466 N  N   . GLU D  2 38 ? 45.508  37.548  180.547 1.00 23.87 ? 39   GLU D N   1 
ATOM   2467 C  CA  . GLU D  2 38 ? 46.146  36.279  180.259 1.00 24.70 ? 39   GLU D CA  1 
ATOM   2468 C  C   . GLU D  2 38 ? 45.415  35.558  179.123 1.00 23.78 ? 39   GLU D C   1 
ATOM   2469 O  O   . GLU D  2 38 ? 46.027  35.028  178.203 1.00 21.84 ? 39   GLU D O   1 
ATOM   2470 C  CB  . GLU D  2 38 ? 46.086  35.397  181.495 1.00 29.99 ? 39   GLU D CB  1 
ATOM   2471 C  CG  . GLU D  2 38 ? 47.365  34.640  181.743 1.00 36.83 ? 39   GLU D CG  1 
ATOM   2472 C  CD  . GLU D  2 38 ? 47.424  34.089  183.157 1.00 40.06 ? 39   GLU D CD  1 
ATOM   2473 O  OE1 . GLU D  2 38 ? 48.453  34.306  183.844 1.00 41.66 ? 39   GLU D OE1 1 
ATOM   2474 O  OE2 . GLU D  2 38 ? 46.428  33.468  183.583 1.00 40.71 ? 39   GLU D OE2 1 
ATOM   2475 N  N   . LEU D  2 39 ? 44.094  35.527  179.232 1.00 19.66 ? 40   LEU D N   1 
ATOM   2476 C  CA  . LEU D  2 39 ? 43.279  34.916  178.193 1.00 20.44 ? 40   LEU D CA  1 
ATOM   2477 C  C   . LEU D  2 39 ? 43.491  35.570  176.821 1.00 21.27 ? 40   LEU D C   1 
ATOM   2478 O  O   . LEU D  2 39 ? 43.639  34.879  175.822 1.00 21.12 ? 40   LEU D O   1 
ATOM   2479 C  CB  . LEU D  2 39 ? 41.796  34.994  178.576 1.00 20.48 ? 40   LEU D CB  1 
ATOM   2480 C  CG  . LEU D  2 39 ? 40.814  34.260  177.648 1.00 18.84 ? 40   LEU D CG  1 
ATOM   2481 C  CD1 . LEU D  2 39 ? 39.538  34.079  178.460 1.00 21.49 ? 40   LEU D CD1 1 
ATOM   2482 C  CD2 . LEU D  2 39 ? 40.518  35.046  176.363 1.00 20.24 ? 40   LEU D CD2 1 
ATOM   2483 N  N   . VAL D  2 40 ? 43.470  36.894  176.763 1.00 21.80 ? 41   VAL D N   1 
ATOM   2484 C  CA  . VAL D  2 40 ? 43.697  37.588  175.488 1.00 23.40 ? 41   VAL D CA  1 
ATOM   2485 C  C   . VAL D  2 40 ? 45.101  37.310  174.931 1.00 24.71 ? 41   VAL D C   1 
ATOM   2486 O  O   . VAL D  2 40 ? 45.281  37.083  173.732 1.00 23.63 ? 41   VAL D O   1 
ATOM   2487 C  CB  . VAL D  2 40 ? 43.439  39.101  175.635 1.00 24.05 ? 41   VAL D CB  1 
ATOM   2488 C  CG1 . VAL D  2 40 ? 43.876  39.862  174.388 1.00 26.94 ? 41   VAL D CG1 1 
ATOM   2489 C  CG2 . VAL D  2 40 ? 41.954  39.339  175.896 1.00 22.31 ? 41   VAL D CG2 1 
ATOM   2490 N  N   . ARG D  2 41 ? 46.101  37.321  175.799 1.00 24.10 ? 42   ARG D N   1 
ATOM   2491 C  CA  . ARG D  2 41 ? 47.482  37.187  175.324 1.00 27.12 ? 42   ARG D CA  1 
ATOM   2492 C  C   . ARG D  2 41 ? 47.742  35.819  174.720 1.00 25.42 ? 42   ARG D C   1 
ATOM   2493 O  O   . ARG D  2 41 ? 48.458  35.669  173.732 1.00 26.21 ? 42   ARG D O   1 
ATOM   2494 C  CB  . ARG D  2 41 ? 48.475  37.410  176.469 1.00 29.74 ? 42   ARG D CB  1 
ATOM   2495 C  CG  . ARG D  2 41 ? 49.930  37.389  176.029 1.00 34.20 ? 42   ARG D CG  1 
ATOM   2496 C  CD  . ARG D  2 41 ? 50.938  37.042  177.138 1.00 35.86 ? 42   ARG D CD  1 
ATOM   2497 N  NE  . ARG D  2 41 ? 50.518  37.508  178.462 1.00 40.65 ? 42   ARG D NE  1 
ATOM   2498 C  CZ  . ARG D  2 41 ? 50.128  36.704  179.454 1.00 43.32 ? 42   ARG D CZ  1 
ATOM   2499 N  NH1 . ARG D  2 41 ? 50.090  35.385  179.275 1.00 45.45 ? 42   ARG D NH1 1 
ATOM   2500 N  NH2 . ARG D  2 41 ? 49.772  37.216  180.629 1.00 44.57 ? 42   ARG D NH2 1 
ATOM   2501 N  N   . LYS D  2 42 ? 47.155  34.808  175.337 1.00 24.04 ? 43   LYS D N   1 
ATOM   2502 C  CA  . LYS D  2 42 ? 47.359  33.449  174.901 1.00 25.84 ? 43   LYS D CA  1 
ATOM   2503 C  C   . LYS D  2 42 ? 46.309  32.979  173.906 1.00 24.85 ? 43   LYS D C   1 
ATOM   2504 O  O   . LYS D  2 42 ? 46.652  32.555  172.822 1.00 26.65 ? 43   LYS D O   1 
ATOM   2505 C  CB  . LYS D  2 42 ? 47.336  32.518  176.113 1.00 28.49 ? 43   LYS D CB  1 
ATOM   2506 C  CG  . LYS D  2 42 ? 48.402  32.847  177.129 1.00 33.78 ? 43   LYS D CG  1 
ATOM   2507 C  CD  . LYS D  2 42 ? 48.915  31.583  177.778 1.00 38.05 ? 43   LYS D CD  1 
ATOM   2508 C  CE  . LYS D  2 42 ? 49.012  31.764  179.285 1.00 40.87 ? 43   LYS D CE  1 
ATOM   2509 N  NZ  . LYS D  2 42 ? 49.712  30.617  179.937 1.00 42.76 ? 43   LYS D NZ  1 
ATOM   2510 N  N   . ASP D  2 43 ? 45.026  33.041  174.275 1.00 23.23 ? 44   ASP D N   1 
ATOM   2511 C  CA  . ASP D  2 43 ? 43.996  32.488  173.417 1.00 23.83 ? 44   ASP D CA  1 
ATOM   2512 C  C   . ASP D  2 43 ? 43.491  33.386  172.288 1.00 24.49 ? 44   ASP D C   1 
ATOM   2513 O  O   . ASP D  2 43 ? 42.772  32.919  171.412 1.00 24.31 ? 44   ASP D O   1 
ATOM   2514 C  CB  . ASP D  2 43 ? 42.812  32.000  174.245 1.00 26.30 ? 44   ASP D CB  1 
ATOM   2515 C  CG  . ASP D  2 43 ? 43.216  30.983  175.290 1.00 27.23 ? 44   ASP D CG  1 
ATOM   2516 O  OD1 . ASP D  2 43 ? 43.679  29.887  174.949 1.00 28.73 ? 44   ASP D OD1 1 
ATOM   2517 O  OD2 . ASP D  2 43 ? 43.105  31.201  176.501 1.00 32.54 ? 44   ASP D OD2 1 
ATOM   2518 N  N   . LEU D  2 44 ? 43.905  34.650  172.272 1.00 23.74 ? 45   LEU D N   1 
ATOM   2519 C  CA  . LEU D  2 44 ? 43.508  35.545  171.191 1.00 23.50 ? 45   LEU D CA  1 
ATOM   2520 C  C   . LEU D  2 44 ? 44.742  36.240  170.652 1.00 23.99 ? 45   LEU D C   1 
ATOM   2521 O  O   . LEU D  2 44 ? 44.697  37.409  170.249 1.00 22.80 ? 45   LEU D O   1 
ATOM   2522 C  CB  . LEU D  2 44 ? 42.485  36.569  171.692 1.00 23.30 ? 45   LEU D CB  1 
ATOM   2523 C  CG  . LEU D  2 44 ? 41.134  35.996  172.117 1.00 21.66 ? 45   LEU D CG  1 
ATOM   2524 C  CD1 . LEU D  2 44 ? 40.291  37.088  172.768 1.00 22.56 ? 45   LEU D CD1 1 
ATOM   2525 C  CD2 . LEU D  2 44 ? 40.441  35.411  170.873 1.00 23.23 ? 45   LEU D CD2 1 
ATOM   2526 N  N   . GLN D  2 45 ? 45.846  35.501  170.642 1.00 23.33 ? 46   GLN D N   1 
ATOM   2527 C  CA  . GLN D  2 45 ? 47.125  36.069  170.238 1.00 25.46 ? 46   GLN D CA  1 
ATOM   2528 C  C   . GLN D  2 45 ? 47.138  36.449  168.762 1.00 25.48 ? 46   GLN D C   1 
ATOM   2529 O  O   . GLN D  2 45 ? 47.952  37.280  168.372 1.00 25.78 ? 46   GLN D O   1 
ATOM   2530 C  CB  . GLN D  2 45 ? 48.282  35.126  170.563 1.00 24.97 ? 46   GLN D CB  1 
ATOM   2531 C  CG  . GLN D  2 45 ? 48.162  33.796  169.847 1.00 27.33 ? 46   GLN D CG  1 
ATOM   2532 C  CD  . GLN D  2 45 ? 49.309  32.848  170.154 1.00 29.58 ? 46   GLN D CD  1 
ATOM   2533 O  OE1 . GLN D  2 45 ? 50.247  32.727  169.362 1.00 30.63 ? 46   GLN D OE1 1 
ATOM   2534 N  NE2 . GLN D  2 45 ? 49.231  32.168  171.289 1.00 27.90 ? 46   GLN D NE2 1 
ATOM   2535 N  N   . ASN D  2 46 ? 46.237  35.882  167.955 1.00 25.64 ? 47   ASN D N   1 
ATOM   2536 C  CA  . ASN D  2 46 ? 46.158  36.216  166.534 1.00 26.32 ? 47   ASN D CA  1 
ATOM   2537 C  C   . ASN D  2 46 ? 45.090  37.268  166.233 1.00 26.81 ? 47   ASN D C   1 
ATOM   2538 O  O   . ASN D  2 46 ? 45.368  38.252  165.549 1.00 25.30 ? 47   ASN D O   1 
ATOM   2539 C  CB  . ASN D  2 46 ? 45.969  34.974  165.643 1.00 27.38 ? 47   ASN D CB  1 
ATOM   2540 C  CG  . ASN D  2 46 ? 47.075  33.955  165.826 1.00 28.37 ? 47   ASN D CG  1 
ATOM   2541 O  OD1 . ASN D  2 46 ? 48.179  34.128  165.308 1.00 29.26 ? 47   ASN D OD1 1 
ATOM   2542 N  ND2 . ASN D  2 46 ? 46.793  32.892  166.576 1.00 29.54 ? 47   ASN D ND2 1 
ATOM   2543 N  N   . PHE D  2 47 ? 43.886  37.057  166.766 1.00 26.26 ? 48   PHE D N   1 
ATOM   2544 C  CA  . PHE D  2 47 ? 42.723  37.913  166.515 1.00 26.70 ? 48   PHE D CA  1 
ATOM   2545 C  C   . PHE D  2 47 ? 42.915  39.288  167.163 1.00 28.24 ? 48   PHE D C   1 
ATOM   2546 O  O   . PHE D  2 47 ? 42.397  40.303  166.676 1.00 25.74 ? 48   PHE D O   1 
ATOM   2547 C  CB  . PHE D  2 47 ? 41.451  37.252  167.075 1.00 27.28 ? 48   PHE D CB  1 
ATOM   2548 C  CG  . PHE D  2 47 ? 40.833  36.191  166.177 1.00 25.69 ? 48   PHE D CG  1 
ATOM   2549 C  CD1 . PHE D  2 47 ? 39.508  35.815  166.349 1.00 25.69 ? 48   PHE D CD1 1 
ATOM   2550 C  CD2 . PHE D  2 47 ? 41.561  35.576  165.162 1.00 25.11 ? 48   PHE D CD2 1 
ATOM   2551 C  CE1 . PHE D  2 47 ? 38.923  34.828  165.534 1.00 26.03 ? 48   PHE D CE1 1 
ATOM   2552 C  CE2 . PHE D  2 47 ? 40.984  34.597  164.334 1.00 25.87 ? 48   PHE D CE2 1 
ATOM   2553 C  CZ  . PHE D  2 47 ? 39.661  34.233  164.510 1.00 26.04 ? 48   PHE D CZ  1 
ATOM   2554 N  N   . LEU D  2 48 ? 43.659  39.321  168.270 1.00 26.92 ? 49   LEU D N   1 
ATOM   2555 C  CA  . LEU D  2 48 ? 44.000  40.580  168.916 1.00 27.25 ? 49   LEU D CA  1 
ATOM   2556 C  C   . LEU D  2 48 ? 45.516  40.863  168.908 1.00 27.61 ? 49   LEU D C   1 
ATOM   2557 O  O   . LEU D  2 48 ? 46.053  41.401  169.862 1.00 26.79 ? 49   LEU D O   1 
ATOM   2558 C  CB  . LEU D  2 48 ? 43.441  40.610  170.335 1.00 28.29 ? 49   LEU D CB  1 
ATOM   2559 C  CG  . LEU D  2 48 ? 41.909  40.707  170.387 1.00 29.18 ? 49   LEU D CG  1 
ATOM   2560 C  CD1 . LEU D  2 48 ? 41.350  40.646  171.814 1.00 27.91 ? 49   LEU D CD1 1 
ATOM   2561 C  CD2 . LEU D  2 48 ? 41.447  41.995  169.707 1.00 29.17 ? 49   LEU D CD2 1 
ATOM   2562 N  N   . LYS D  2 49 ? 46.194  40.518  167.817 1.00 28.52 ? 50   LYS D N   1 
ATOM   2563 C  CA  . LYS D  2 49 ? 47.651  40.658  167.727 1.00 32.43 ? 50   LYS D CA  1 
ATOM   2564 C  C   . LYS D  2 49 ? 48.130  42.103  167.929 1.00 32.14 ? 50   LYS D C   1 
ATOM   2565 O  O   . LYS D  2 49 ? 49.052  42.363  168.700 1.00 32.78 ? 50   LYS D O   1 
ATOM   2566 C  CB  . LYS D  2 49 ? 48.130  40.097  166.380 1.00 34.20 ? 50   LYS D CB  1 
ATOM   2567 C  CG  . LYS D  2 49 ? 49.614  40.203  166.124 1.00 38.54 ? 50   LYS D CG  1 
ATOM   2568 C  CD  . LYS D  2 49 ? 49.928  39.693  164.721 1.00 41.81 ? 50   LYS D CD  1 
ATOM   2569 C  CE  . LYS D  2 49 ? 51.415  39.865  164.356 1.00 44.95 ? 50   LYS D CE  1 
ATOM   2570 N  NZ  . LYS D  2 49 ? 52.161  40.849  165.209 1.00 46.62 ? 50   LYS D NZ  1 
ATOM   2571 N  N   . LYS D  2 50 ? 47.489  43.045  167.252 1.00 33.13 ? 51   LYS D N   1 
ATOM   2572 C  CA  . LYS D  2 50 ? 47.889  44.448  167.360 1.00 35.30 ? 51   LYS D CA  1 
ATOM   2573 C  C   . LYS D  2 50 ? 47.579  45.006  168.755 1.00 33.30 ? 51   LYS D C   1 
ATOM   2574 O  O   . LYS D  2 50 ? 48.414  45.677  169.383 1.00 32.29 ? 51   LYS D O   1 
ATOM   2575 C  CB  . LYS D  2 50 ? 47.197  45.293  166.285 1.00 37.83 ? 51   LYS D CB  1 
ATOM   2576 C  CG  . LYS D  2 50 ? 47.565  46.771  166.372 1.00 41.66 ? 51   LYS D CG  1 
ATOM   2577 C  CD  . LYS D  2 50 ? 46.758  47.636  165.427 1.00 43.14 ? 51   LYS D CD  1 
ATOM   2578 C  CE  . LYS D  2 50 ? 47.215  49.090  165.556 1.00 46.27 ? 51   LYS D CE  1 
ATOM   2579 N  NZ  . LYS D  2 50 ? 46.691  49.980  164.475 1.00 47.76 ? 51   LYS D NZ  1 
ATOM   2580 N  N   . GLU D  2 51 ? 46.364  44.702  169.212 1.00 30.08 ? 52   GLU D N   1 
ATOM   2581 C  CA  . GLU D  2 51 ? 45.852  45.161  170.498 1.00 30.44 ? 52   GLU D CA  1 
ATOM   2582 C  C   . GLU D  2 51 ? 46.689  44.659  171.673 1.00 29.45 ? 52   GLU D C   1 
ATOM   2583 O  O   . GLU D  2 51 ? 46.849  45.359  172.680 1.00 29.73 ? 52   GLU D O   1 
ATOM   2584 C  CB  . GLU D  2 51 ? 44.397  44.704  170.694 1.00 31.03 ? 52   GLU D CB  1 
ATOM   2585 C  CG  . GLU D  2 51 ? 43.380  45.397  169.806 1.00 33.59 ? 52   GLU D CG  1 
ATOM   2586 C  CD  . GLU D  2 51 ? 43.326  44.825  168.404 1.00 35.49 ? 52   GLU D CD  1 
ATOM   2587 O  OE1 . GLU D  2 51 ? 44.048  43.848  168.103 1.00 36.12 ? 52   GLU D OE1 1 
ATOM   2588 O  OE2 . GLU D  2 51 ? 42.543  45.354  167.588 1.00 38.29 ? 52   GLU D OE2 1 
ATOM   2589 N  N   . ASN D  2 52 ? 47.208  43.440  171.546 1.00 29.12 ? 53   ASN D N   1 
ATOM   2590 C  CA  . ASN D  2 52 ? 48.008  42.824  172.602 1.00 30.03 ? 53   ASN D CA  1 
ATOM   2591 C  C   . ASN D  2 52 ? 49.331  43.565  172.871 1.00 31.78 ? 53   ASN D C   1 
ATOM   2592 O  O   . ASN D  2 52 ? 49.864  43.505  173.978 1.00 30.48 ? 53   ASN D O   1 
ATOM   2593 C  CB  . ASN D  2 52 ? 48.265  41.339  172.294 1.00 29.44 ? 53   ASN D CB  1 
ATOM   2594 C  CG  . ASN D  2 52 ? 47.276  40.403  173.002 1.00 32.03 ? 53   ASN D CG  1 
ATOM   2595 O  OD1 . ASN D  2 52 ? 47.085  40.499  174.206 1.00 34.51 ? 53   ASN D OD1 1 
ATOM   2596 N  ND2 . ASN D  2 52 ? 46.672  39.490  172.259 1.00 29.58 ? 53   ASN D ND2 1 
ATOM   2597 N  N   . LYS D  2 53 ? 49.840  44.279  171.865 1.00 33.45 ? 54   LYS D N   1 
ATOM   2598 C  CA  . LYS D  2 53 ? 51.113  45.002  171.969 1.00 35.99 ? 54   LYS D CA  1 
ATOM   2599 C  C   . LYS D  2 53 ? 51.054  46.179  172.927 1.00 36.25 ? 54   LYS D C   1 
ATOM   2600 O  O   . LYS D  2 53 ? 52.090  46.713  173.337 1.00 37.11 ? 54   LYS D O   1 
ATOM   2601 C  CB  . LYS D  2 53 ? 51.570  45.480  170.594 1.00 37.37 ? 54   LYS D CB  1 
ATOM   2602 C  CG  . LYS D  2 53 ? 52.045  44.348  169.708 1.00 40.13 ? 54   LYS D CG  1 
ATOM   2603 C  CD  . LYS D  2 53 ? 52.455  44.839  168.329 1.00 42.71 ? 54   LYS D CD  1 
ATOM   2604 C  CE  . LYS D  2 53 ? 53.006  43.687  167.499 1.00 44.53 ? 54   LYS D CE  1 
ATOM   2605 N  NZ  . LYS D  2 53 ? 53.384  44.114  166.125 1.00 46.50 ? 54   LYS D NZ  1 
ATOM   2606 N  N   . ASN D  2 54 ? 49.842  46.574  173.288 1.00 36.24 ? 55   ASN D N   1 
ATOM   2607 C  CA  . ASN D  2 54 ? 49.656  47.643  174.251 1.00 36.87 ? 55   ASN D CA  1 
ATOM   2608 C  C   . ASN D  2 54 ? 48.731  47.226  175.388 1.00 36.89 ? 55   ASN D C   1 
ATOM   2609 O  O   . ASN D  2 54 ? 47.514  47.105  175.186 1.00 34.71 ? 55   ASN D O   1 
ATOM   2610 C  CB  . ASN D  2 54 ? 49.093  48.875  173.550 1.00 38.10 ? 55   ASN D CB  1 
ATOM   2611 C  CG  . ASN D  2 54 ? 49.052  50.101  174.454 1.00 39.74 ? 55   ASN D CG  1 
ATOM   2612 O  OD1 . ASN D  2 54 ? 49.298  50.014  175.662 1.00 40.11 ? 55   ASN D OD1 1 
ATOM   2613 N  ND2 . ASN D  2 54 ? 48.751  51.260  173.863 1.00 40.50 ? 55   ASN D ND2 1 
ATOM   2614 N  N   . GLU D  2 55 ? 49.313  47.021  176.568 1.00 37.07 ? 56   GLU D N   1 
ATOM   2615 C  CA  . GLU D  2 55 ? 48.564  46.659  177.765 1.00 38.94 ? 56   GLU D CA  1 
ATOM   2616 C  C   . GLU D  2 55 ? 47.386  47.594  178.048 1.00 37.13 ? 56   GLU D C   1 
ATOM   2617 O  O   . GLU D  2 55 ? 46.328  47.158  178.503 1.00 35.91 ? 56   GLU D O   1 
ATOM   2618 C  CB  . GLU D  2 55 ? 49.496  46.587  178.983 1.00 43.27 ? 56   GLU D CB  1 
ATOM   2619 C  CG  . GLU D  2 55 ? 48.812  46.089  180.251 1.00 48.18 ? 56   GLU D CG  1 
ATOM   2620 C  CD  . GLU D  2 55 ? 49.779  45.557  181.296 1.00 51.63 ? 56   GLU D CD  1 
ATOM   2621 O  OE1 . GLU D  2 55 ? 50.959  45.970  181.288 1.00 53.30 ? 56   GLU D OE1 1 
ATOM   2622 O  OE2 . GLU D  2 55 ? 49.358  44.723  182.133 1.00 52.84 ? 56   GLU D OE2 1 
ATOM   2623 N  N   . LYS D  2 56 ? 47.551  48.877  177.762 1.00 35.50 ? 57   LYS D N   1 
ATOM   2624 C  CA  . LYS D  2 56 ? 46.488  49.835  178.024 1.00 35.44 ? 57   LYS D CA  1 
ATOM   2625 C  C   . LYS D  2 56 ? 45.282  49.654  177.077 1.00 32.13 ? 57   LYS D C   1 
ATOM   2626 O  O   . LYS D  2 56 ? 44.142  49.942  177.450 1.00 30.07 ? 57   LYS D O   1 
ATOM   2627 C  CB  . LYS D  2 56 ? 47.030  51.273  178.036 1.00 38.25 ? 57   LYS D CB  1 
ATOM   2628 C  CG  . LYS D  2 56 ? 47.966  51.564  179.217 1.00 40.24 ? 57   LYS D CG  1 
ATOM   2629 C  CD  . LYS D  2 56 ? 48.593  52.957  179.155 1.00 42.22 ? 57   LYS D CD  1 
ATOM   2630 C  CE  . LYS D  2 56 ? 49.750  53.111  180.167 1.00 44.04 ? 57   LYS D CE  1 
ATOM   2631 N  NZ  . LYS D  2 56 ? 50.386  54.484  180.161 1.00 45.28 ? 57   LYS D NZ  1 
ATOM   2632 N  N   . VAL D  2 57 ? 45.518  49.150  175.868 1.00 29.62 ? 58   VAL D N   1 
ATOM   2633 C  CA  . VAL D  2 57 ? 44.403  48.866  174.936 1.00 28.36 ? 58   VAL D CA  1 
ATOM   2634 C  C   . VAL D  2 57 ? 43.576  47.686  175.462 1.00 26.41 ? 58   VAL D C   1 
ATOM   2635 O  O   . VAL D  2 57 ? 42.360  47.778  175.554 1.00 26.89 ? 58   VAL D O   1 
ATOM   2636 C  CB  . VAL D  2 57 ? 44.906  48.600  173.509 1.00 28.61 ? 58   VAL D CB  1 
ATOM   2637 C  CG1 . VAL D  2 57 ? 43.772  48.150  172.589 1.00 28.59 ? 58   VAL D CG1 1 
ATOM   2638 C  CG2 . VAL D  2 57 ? 45.554  49.853  172.950 1.00 29.76 ? 58   VAL D CG2 1 
ATOM   2639 N  N   . ILE D  2 58 ? 44.246  46.600  175.831 1.00 25.25 ? 59   ILE D N   1 
ATOM   2640 C  CA  . ILE D  2 58 ? 43.592  45.455  176.462 1.00 25.27 ? 59   ILE D CA  1 
ATOM   2641 C  C   . ILE D  2 58 ? 42.782  45.873  177.692 1.00 25.11 ? 59   ILE D C   1 
ATOM   2642 O  O   . ILE D  2 58 ? 41.640  45.422  177.873 1.00 25.03 ? 59   ILE D O   1 
ATOM   2643 C  CB  . ILE D  2 58 ? 44.636  44.395  176.844 1.00 24.79 ? 59   ILE D CB  1 
ATOM   2644 C  CG1 . ILE D  2 58 ? 45.388  43.905  175.604 1.00 24.65 ? 59   ILE D CG1 1 
ATOM   2645 C  CG2 . ILE D  2 58 ? 43.972  43.226  177.590 1.00 24.61 ? 59   ILE D CG2 1 
ATOM   2646 C  CD1 . ILE D  2 58 ? 44.490  43.627  174.377 1.00 26.12 ? 59   ILE D CD1 1 
ATOM   2647 N  N   . GLU D  2 59 ? 43.373  46.732  178.532 1.00 27.13 ? 60   GLU D N   1 
ATOM   2648 C  CA  . GLU D  2 59 ? 42.668  47.342  179.667 1.00 27.02 ? 60   GLU D CA  1 
ATOM   2649 C  C   . GLU D  2 59 ? 41.398  48.100  179.280 1.00 26.36 ? 60   GLU D C   1 
ATOM   2650 O  O   . GLU D  2 59 ? 40.397  47.990  179.973 1.00 24.93 ? 60   GLU D O   1 
ATOM   2651 C  CB  . GLU D  2 59 ? 43.599  48.273  180.471 1.00 27.00 ? 60   GLU D CB  1 
ATOM   2652 C  CG  . GLU D  2 59 ? 44.546  47.495  181.370 1.00 27.47 ? 60   GLU D CG  1 
ATOM   2653 C  CD  . GLU D  2 59 ? 45.716  48.314  181.909 1.00 28.96 ? 60   GLU D CD  1 
ATOM   2654 O  OE1 . GLU D  2 59 ? 45.650  49.563  181.913 1.00 27.49 ? 60   GLU D OE1 1 
ATOM   2655 O  OE2 . GLU D  2 59 ? 46.709  47.683  182.335 1.00 29.74 ? 60   GLU D OE2 1 
ATOM   2656 N  N   . HIS D  2 60 ? 41.453  48.906  178.220 1.00 26.46 ? 61   HIS D N   1 
ATOM   2657 C  CA  . HIS D  2 60 ? 40.296  49.670  177.789 1.00 27.07 ? 61   HIS D CA  1 
ATOM   2658 C  C   . HIS D  2 60 ? 39.202  48.748  177.247 1.00 25.42 ? 61   HIS D C   1 
ATOM   2659 O  O   . HIS D  2 60 ? 38.015  49.006  177.441 1.00 25.20 ? 61   HIS D O   1 
ATOM   2660 C  CB  . HIS D  2 60 ? 40.641  50.618  176.653 1.00 31.16 ? 61   HIS D CB  1 
ATOM   2661 C  CG  . HIS D  2 60 ? 41.591  51.702  177.029 1.00 37.02 ? 61   HIS D CG  1 
ATOM   2662 N  ND1 . HIS D  2 60 ? 41.692  52.194  178.313 1.00 38.84 ? 61   HIS D ND1 1 
ATOM   2663 C  CD2 . HIS D  2 60 ? 42.467  52.409  176.281 1.00 38.71 ? 61   HIS D CD2 1 
ATOM   2664 C  CE1 . HIS D  2 60 ? 42.606  53.148  178.344 1.00 39.66 ? 61   HIS D CE1 1 
ATOM   2665 N  NE2 . HIS D  2 60 ? 43.092  53.296  177.124 1.00 40.41 ? 61   HIS D NE2 1 
ATOM   2666 N  N   . ILE D  2 61 ? 39.596  47.692  176.548 1.00 24.22 ? 62   ILE D N   1 
ATOM   2667 C  CA  . ILE D  2 61 ? 38.605  46.725  176.043 1.00 25.03 ? 62   ILE D CA  1 
ATOM   2668 C  C   . ILE D  2 61 ? 37.846  46.073  177.195 1.00 24.64 ? 62   ILE D C   1 
ATOM   2669 O  O   . ILE D  2 61 ? 36.613  45.937  177.156 1.00 23.40 ? 62   ILE D O   1 
ATOM   2670 C  CB  . ILE D  2 61 ? 39.306  45.645  175.206 1.00 24.62 ? 62   ILE D CB  1 
ATOM   2671 C  CG1 . ILE D  2 61 ? 39.822  46.271  173.906 1.00 24.74 ? 62   ILE D CG1 1 
ATOM   2672 C  CG2 . ILE D  2 61 ? 38.390  44.443  174.992 1.00 24.06 ? 62   ILE D CG2 1 
ATOM   2673 C  CD1 . ILE D  2 61 ? 40.812  45.397  173.174 1.00 26.11 ? 62   ILE D CD1 1 
ATOM   2674 N  N   . MET D  2 62 ? 38.573  45.670  178.233 1.00 23.12 ? 63   MET D N   1 
ATOM   2675 C  CA  . MET D  2 62 ? 37.871  45.140  179.383 1.00 25.97 ? 63   MET D CA  1 
ATOM   2676 C  C   . MET D  2 62 ? 36.966  46.167  180.071 1.00 24.95 ? 63   MET D C   1 
ATOM   2677 O  O   . MET D  2 62 ? 35.842  45.825  180.462 1.00 22.25 ? 63   MET D O   1 
ATOM   2678 C  CB  . MET D  2 62 ? 38.817  44.553  180.409 1.00 29.17 ? 63   MET D CB  1 
ATOM   2679 C  CG  . MET D  2 62 ? 37.996  43.955  181.530 1.00 32.10 ? 63   MET D CG  1 
ATOM   2680 S  SD  . MET D  2 62 ? 39.045  43.133  182.703 1.00 34.37 ? 63   MET D SD  1 
ATOM   2681 C  CE  . MET D  2 62 ? 37.913  42.854  184.083 1.00 29.99 ? 63   MET D CE  1 
ATOM   2682 N  N   . GLU D  2 63 ? 37.424  47.418  180.184 1.00 22.94 ? 64   GLU D N   1 
ATOM   2683 C  CA  . GLU D  2 63 ? 36.607  48.485  180.783 1.00 25.56 ? 64   GLU D CA  1 
ATOM   2684 C  C   . GLU D  2 63 ? 35.300  48.706  180.001 1.00 23.83 ? 64   GLU D C   1 
ATOM   2685 O  O   . GLU D  2 63 ? 34.222  48.857  180.575 1.00 22.67 ? 64   GLU D O   1 
ATOM   2686 C  CB  . GLU D  2 63 ? 37.392  49.794  180.841 1.00 28.70 ? 64   GLU D CB  1 
ATOM   2687 C  CG  . GLU D  2 63 ? 38.545  49.742  181.828 1.00 35.35 ? 64   GLU D CG  1 
ATOM   2688 C  CD  . GLU D  2 63 ? 39.571  50.837  181.585 1.00 39.11 ? 64   GLU D CD  1 
ATOM   2689 O  OE1 . GLU D  2 63 ? 40.721  50.626  182.021 1.00 42.23 ? 64   GLU D OE1 1 
ATOM   2690 O  OE2 . GLU D  2 63 ? 39.236  51.899  180.981 1.00 41.52 ? 64   GLU D OE2 1 
ATOM   2691 N  N   . ASP D  2 64 ? 35.418  48.740  178.685 1.00 22.80 ? 65   ASP D N   1 
ATOM   2692 C  CA  . ASP D  2 64 ? 34.265  48.886  177.824 1.00 23.68 ? 65   ASP D CA  1 
ATOM   2693 C  C   . ASP D  2 64 ? 33.306  47.695  177.963 1.00 21.43 ? 65   ASP D C   1 
ATOM   2694 O  O   . ASP D  2 64 ? 32.089  47.897  177.914 1.00 20.23 ? 65   ASP D O   1 
ATOM   2695 C  CB  . ASP D  2 64 ? 34.721  49.060  176.374 1.00 27.43 ? 65   ASP D CB  1 
ATOM   2696 C  CG  . ASP D  2 64 ? 35.539  50.340  176.170 1.00 32.93 ? 65   ASP D CG  1 
ATOM   2697 O  OD1 . ASP D  2 64 ? 36.230  50.442  175.129 1.00 35.60 ? 65   ASP D OD1 1 
ATOM   2698 O  OD2 . ASP D  2 64 ? 35.557  51.295  176.993 1.00 33.43 ? 65   ASP D OD2 1 
ATOM   2699 N  N   . LEU D  2 65 ? 33.846  46.479  178.117 1.00 20.63 ? 66   LEU D N   1 
ATOM   2700 C  CA  . LEU D  2 65 ? 33.000  45.264  178.259 1.00 21.55 ? 66   LEU D CA  1 
ATOM   2701 C  C   . LEU D  2 65 ? 32.345  45.195  179.629 1.00 21.32 ? 66   LEU D C   1 
ATOM   2702 O  O   . LEU D  2 65 ? 31.314  44.533  179.801 1.00 20.17 ? 66   LEU D O   1 
ATOM   2703 C  CB  . LEU D  2 65 ? 33.811  43.973  178.048 1.00 19.42 ? 66   LEU D CB  1 
ATOM   2704 C  CG  . LEU D  2 65 ? 34.308  43.765  176.598 1.00 21.06 ? 66   LEU D CG  1 
ATOM   2705 C  CD1 . LEU D  2 65 ? 35.371  42.649  176.494 1.00 21.13 ? 66   LEU D CD1 1 
ATOM   2706 C  CD2 . LEU D  2 65 ? 33.175  43.517  175.609 1.00 20.79 ? 66   LEU D CD2 1 
ATOM   2707 N  N   . ASP D  2 66 ? 32.941  45.875  180.610 1.00 18.19 ? 67   ASP D N   1 
ATOM   2708 C  CA  . ASP D  2 66 ? 32.521  45.707  182.011 1.00 20.25 ? 67   ASP D CA  1 
ATOM   2709 C  C   . ASP D  2 66 ? 31.339  46.637  182.269 1.00 19.91 ? 67   ASP D C   1 
ATOM   2710 O  O   . ASP D  2 66 ? 31.481  47.697  182.868 1.00 17.71 ? 67   ASP D O   1 
ATOM   2711 C  CB  . ASP D  2 66 ? 33.714  45.944  182.953 1.00 18.76 ? 67   ASP D CB  1 
ATOM   2712 C  CG  . ASP D  2 66 ? 33.344  45.926  184.438 1.00 22.24 ? 67   ASP D CG  1 
ATOM   2713 O  OD1 . ASP D  2 66 ? 32.268  45.426  184.824 1.00 19.81 ? 67   ASP D OD1 1 
ATOM   2714 O  OD2 . ASP D  2 66 ? 34.089  46.434  185.307 1.00 22.88 ? 67   ASP D OD2 1 
ATOM   2715 N  N   . THR D  2 67 ? 30.151  46.245  181.803 1.00 20.13 ? 68   THR D N   1 
ATOM   2716 C  CA  . THR D  2 67 ? 29.058  47.204  181.784 1.00 20.94 ? 68   THR D CA  1 
ATOM   2717 C  C   . THR D  2 67 ? 28.504  47.517  183.172 1.00 22.80 ? 68   THR D C   1 
ATOM   2718 O  O   . THR D  2 67 ? 27.943  48.584  183.361 1.00 22.12 ? 68   THR D O   1 
ATOM   2719 C  CB  . THR D  2 67 ? 27.915  46.804  180.828 1.00 25.76 ? 68   THR D CB  1 
ATOM   2720 O  OG1 . THR D  2 67 ? 27.532  45.480  181.154 1.00 24.93 ? 68   THR D OG1 1 
ATOM   2721 C  CG2 . THR D  2 67 ? 28.387  46.693  179.361 1.00 25.82 ? 68   THR D CG2 1 
ATOM   2722 N  N   . ASN D  2 68 ? 28.652  46.644  184.170 1.00 21.16 ? 69   ASN D N   1 
ATOM   2723 C  CA  . ASN D  2 68 ? 28.191  47.042  185.511 1.00 21.16 ? 69   ASN D CA  1 
ATOM   2724 C  C   . ASN D  2 68 ? 29.320  47.646  186.335 1.00 22.81 ? 69   ASN D C   1 
ATOM   2725 O  O   . ASN D  2 68 ? 29.150  47.878  187.521 1.00 24.31 ? 69   ASN D O   1 
ATOM   2726 C  CB  . ASN D  2 68 ? 27.501  45.888  186.262 1.00 22.39 ? 69   ASN D CB  1 
ATOM   2727 C  CG  . ASN D  2 68 ? 28.474  44.795  186.710 1.00 20.29 ? 69   ASN D CG  1 
ATOM   2728 O  OD1 . ASN D  2 68 ? 29.566  44.646  186.171 1.00 22.63 ? 69   ASN D OD1 1 
ATOM   2729 N  ND2 . ASN D  2 68 ? 28.068  44.023  187.713 1.00 22.63 ? 69   ASN D ND2 1 
ATOM   2730 N  N   . ALA D  2 69 ? 30.483  47.848  185.712 1.00 22.27 ? 70   ALA D N   1 
ATOM   2731 C  CA  . ALA D  2 69 ? 31.600  48.565  186.327 1.00 23.32 ? 70   ALA D CA  1 
ATOM   2732 C  C   . ALA D  2 69 ? 32.043  48.005  187.675 1.00 22.05 ? 70   ALA D C   1 
ATOM   2733 O  O   . ALA D  2 69 ? 32.345  48.776  188.598 1.00 24.36 ? 70   ALA D O   1 
ATOM   2734 C  CB  . ALA D  2 69 ? 31.264  50.101  186.448 1.00 22.84 ? 70   ALA D CB  1 
ATOM   2735 N  N   . ASP D  2 70 ? 32.077  46.681  187.810 1.00 23.09 ? 71   ASP D N   1 
ATOM   2736 C  CA  . ASP D  2 70 ? 32.584  46.049  189.032 1.00 22.50 ? 71   ASP D CA  1 
ATOM   2737 C  C   . ASP D  2 70 ? 33.989  45.460  188.920 1.00 22.54 ? 71   ASP D C   1 
ATOM   2738 O  O   . ASP D  2 70 ? 34.387  44.701  189.811 1.00 22.81 ? 71   ASP D O   1 
ATOM   2739 C  CB  . ASP D  2 70 ? 31.615  44.994  189.560 1.00 23.43 ? 71   ASP D CB  1 
ATOM   2740 C  CG  . ASP D  2 70 ? 31.442  43.825  188.612 1.00 24.41 ? 71   ASP D CG  1 
ATOM   2741 O  OD1 . ASP D  2 70 ? 32.131  43.762  187.542 1.00 21.33 ? 71   ASP D OD1 1 
ATOM   2742 O  OD2 . ASP D  2 70 ? 30.651  42.897  188.895 1.00 25.45 ? 71   ASP D OD2 1 
ATOM   2743 N  N   . LYS D  2 71 ? 34.719  45.820  187.862 1.00 21.73 ? 72   LYS D N   1 
ATOM   2744 C  CA  . LYS D  2 71 ? 36.118  45.446  187.626 1.00 24.67 ? 72   LYS D CA  1 
ATOM   2745 C  C   . LYS D  2 71 ? 36.340  43.960  187.375 1.00 25.47 ? 72   LYS D C   1 
ATOM   2746 O  O   . LYS D  2 71 ? 37.438  43.408  187.571 1.00 25.22 ? 72   LYS D O   1 
ATOM   2747 C  CB  . LYS D  2 71 ? 37.026  45.949  188.747 1.00 27.74 ? 72   LYS D CB  1 
ATOM   2748 C  CG  . LYS D  2 71 ? 36.896  47.458  188.890 1.00 30.83 ? 72   LYS D CG  1 
ATOM   2749 C  CD  . LYS D  2 71 ? 37.774  47.997  189.990 1.00 35.23 ? 72   LYS D CD  1 
ATOM   2750 C  CE  . LYS D  2 71 ? 37.809  49.524  189.884 1.00 38.99 ? 72   LYS D CE  1 
ATOM   2751 N  NZ  . LYS D  2 71 ? 38.513  50.125  191.065 1.00 42.21 ? 72   LYS D NZ  1 
ATOM   2752 N  N   . GLN D  2 72 ? 35.275  43.314  186.935 1.00 22.88 ? 73   GLN D N   1 
ATOM   2753 C  CA  . GLN D  2 72 ? 35.422  41.955  186.432 1.00 21.30 ? 73   GLN D CA  1 
ATOM   2754 C  C   . GLN D  2 72 ? 34.430  41.730  185.318 1.00 21.45 ? 73   GLN D C   1 
ATOM   2755 O  O   . GLN D  2 72 ? 33.424  42.441  185.216 1.00 23.51 ? 73   GLN D O   1 
ATOM   2756 C  CB  . GLN D  2 72 ? 35.182  40.952  187.533 1.00 25.14 ? 73   GLN D CB  1 
ATOM   2757 C  CG  . GLN D  2 72 ? 33.813  41.050  188.173 1.00 25.08 ? 73   GLN D CG  1 
ATOM   2758 C  CD  . GLN D  2 72 ? 33.908  40.729  189.671 1.00 27.18 ? 73   GLN D CD  1 
ATOM   2759 O  OE1 . GLN D  2 72 ? 33.896  39.568  190.054 1.00 27.35 ? 73   GLN D OE1 1 
ATOM   2760 N  NE2 . GLN D  2 72 ? 33.988  41.753  190.502 1.00 28.29 ? 73   GLN D NE2 1 
ATOM   2761 N  N   . LEU D  2 73 ? 34.721  40.724  184.500 1.00 19.21 ? 74   LEU D N   1 
ATOM   2762 C  CA  . LEU D  2 73 ? 33.844  40.380  183.381 1.00 19.94 ? 74   LEU D CA  1 
ATOM   2763 C  C   . LEU D  2 73 ? 33.116  39.102  183.692 1.00 20.47 ? 74   LEU D C   1 
ATOM   2764 O  O   . LEU D  2 73 ? 33.743  38.054  183.883 1.00 20.55 ? 74   LEU D O   1 
ATOM   2765 C  CB  . LEU D  2 73 ? 34.631  40.164  182.103 1.00 18.71 ? 74   LEU D CB  1 
ATOM   2766 C  CG  . LEU D  2 73 ? 35.393  41.367  181.588 1.00 20.76 ? 74   LEU D CG  1 
ATOM   2767 C  CD1 . LEU D  2 73 ? 35.998  40.995  180.230 1.00 21.37 ? 74   LEU D CD1 1 
ATOM   2768 C  CD2 . LEU D  2 73 ? 34.453  42.577  181.470 1.00 23.49 ? 74   LEU D CD2 1 
ATOM   2769 N  N   . SER D  2 74 ? 31.797  39.212  183.791 1.00 19.03 ? 75   SER D N   1 
ATOM   2770 C  CA  . SER D  2 74 ? 30.961  38.037  183.794 1.00 18.78 ? 75   SER D CA  1 
ATOM   2771 C  C   . SER D  2 74 ? 30.997  37.373  182.406 1.00 16.86 ? 75   SER D C   1 
ATOM   2772 O  O   . SER D  2 74 ? 31.448  37.963  181.390 1.00 18.92 ? 75   SER D O   1 
ATOM   2773 C  CB  . SER D  2 74 ? 29.510  38.401  184.164 1.00 16.96 ? 75   SER D CB  1 
ATOM   2774 O  OG  . SER D  2 74 ? 28.930  39.213  183.144 1.00 18.39 ? 75   SER D OG  1 
ATOM   2775 N  N   . PHE D  2 75 ? 30.478  36.156  182.343 1.00 16.02 ? 76   PHE D N   1 
ATOM   2776 C  CA  . PHE D  2 75 ? 30.377  35.514  181.057 1.00 17.77 ? 76   PHE D CA  1 
ATOM   2777 C  C   . PHE D  2 75 ? 29.470  36.307  180.114 1.00 16.33 ? 76   PHE D C   1 
ATOM   2778 O  O   . PHE D  2 75 ? 29.768  36.434  178.940 1.00 17.16 ? 76   PHE D O   1 
ATOM   2779 C  CB  . PHE D  2 75 ? 29.860  34.090  181.165 1.00 19.01 ? 76   PHE D CB  1 
ATOM   2780 C  CG  . PHE D  2 75 ? 29.936  33.348  179.859 1.00 17.69 ? 76   PHE D CG  1 
ATOM   2781 C  CD1 . PHE D  2 75 ? 31.153  32.845  179.416 1.00 19.67 ? 76   PHE D CD1 1 
ATOM   2782 C  CD2 . PHE D  2 75 ? 28.799  33.247  179.031 1.00 16.25 ? 76   PHE D CD2 1 
ATOM   2783 C  CE1 . PHE D  2 75 ? 31.246  32.186  178.191 1.00 19.13 ? 76   PHE D CE1 1 
ATOM   2784 C  CE2 . PHE D  2 75 ? 28.873  32.572  177.811 1.00 18.06 ? 76   PHE D CE2 1 
ATOM   2785 C  CZ  . PHE D  2 75 ? 30.106  32.041  177.391 1.00 18.33 ? 76   PHE D CZ  1 
ATOM   2786 N  N   . GLU D  2 76 ? 28.378  36.861  180.633 1.00 17.83 ? 77   GLU D N   1 
ATOM   2787 C  CA  . GLU D  2 76 ? 27.486  37.644  179.784 1.00 17.84 ? 77   GLU D CA  1 
ATOM   2788 C  C   . GLU D  2 76 ? 28.251  38.817  179.152 1.00 18.54 ? 77   GLU D C   1 
ATOM   2789 O  O   . GLU D  2 76 ? 28.099  39.095  177.953 1.00 17.47 ? 77   GLU D O   1 
ATOM   2790 C  CB  . GLU D  2 76 ? 26.310  38.190  180.612 1.00 19.71 ? 77   GLU D CB  1 
ATOM   2791 C  CG  . GLU D  2 76 ? 25.262  37.146  180.997 1.00 22.29 ? 77   GLU D CG  1 
ATOM   2792 C  CD  . GLU D  2 76 ? 25.637  36.238  182.178 1.00 26.04 ? 77   GLU D CD  1 
ATOM   2793 O  OE1 . GLU D  2 76 ? 26.696  36.384  182.845 1.00 24.61 ? 77   GLU D OE1 1 
ATOM   2794 O  OE2 . GLU D  2 76 ? 24.820  35.331  182.457 1.00 26.70 ? 77   GLU D OE2 1 
ATOM   2795 N  N   . GLU D  2 77 ? 29.042  39.512  179.964 1.00 19.45 ? 78   GLU D N   1 
ATOM   2796 C  CA  . GLU D  2 77 ? 29.859  40.625  179.464 1.00 20.44 ? 78   GLU D CA  1 
ATOM   2797 C  C   . GLU D  2 77 ? 30.896  40.155  178.418 1.00 19.61 ? 78   GLU D C   1 
ATOM   2798 O  O   . GLU D  2 77 ? 31.047  40.748  177.350 1.00 20.66 ? 78   GLU D O   1 
ATOM   2799 C  CB  . GLU D  2 77 ? 30.520  41.366  180.645 1.00 17.39 ? 78   GLU D CB  1 
ATOM   2800 C  CG  . GLU D  2 77 ? 29.515  42.108  181.524 1.00 17.89 ? 78   GLU D CG  1 
ATOM   2801 C  CD  . GLU D  2 77 ? 30.143  42.564  182.824 1.00 20.15 ? 78   GLU D CD  1 
ATOM   2802 O  OE1 . GLU D  2 77 ? 31.198  42.003  183.185 1.00 20.37 ? 78   GLU D OE1 1 
ATOM   2803 O  OE2 . GLU D  2 77 ? 29.622  43.491  183.474 1.00 19.41 ? 78   GLU D OE2 1 
ATOM   2804 N  N   . PHE D  2 78 ? 31.565  39.047  178.710 1.00 20.13 ? 79   PHE D N   1 
ATOM   2805 C  CA  . PHE D  2 78 ? 32.646  38.497  177.891 1.00 18.50 ? 79   PHE D CA  1 
ATOM   2806 C  C   . PHE D  2 78 ? 32.154  38.028  176.531 1.00 19.18 ? 79   PHE D C   1 
ATOM   2807 O  O   . PHE D  2 78 ? 32.857  38.185  175.521 1.00 21.65 ? 79   PHE D O   1 
ATOM   2808 C  CB  . PHE D  2 78 ? 33.285  37.303  178.622 1.00 18.67 ? 79   PHE D CB  1 
ATOM   2809 C  CG  . PHE D  2 78 ? 34.368  36.619  177.842 1.00 20.40 ? 79   PHE D CG  1 
ATOM   2810 C  CD1 . PHE D  2 78 ? 35.626  37.197  177.740 1.00 20.26 ? 79   PHE D CD1 1 
ATOM   2811 C  CD2 . PHE D  2 78 ? 34.153  35.379  177.266 1.00 20.06 ? 79   PHE D CD2 1 
ATOM   2812 C  CE1 . PHE D  2 78 ? 36.662  36.545  177.043 1.00 21.35 ? 79   PHE D CE1 1 
ATOM   2813 C  CE2 . PHE D  2 78 ? 35.172  34.716  176.570 1.00 21.70 ? 79   PHE D CE2 1 
ATOM   2814 C  CZ  . PHE D  2 78 ? 36.421  35.315  176.462 1.00 21.23 ? 79   PHE D CZ  1 
ATOM   2815 N  N   . ILE D  2 79 ? 30.984  37.405  176.489 1.00 17.59 ? 80   ILE D N   1 
ATOM   2816 C  CA  . ILE D  2 79 ? 30.520  36.837  175.211 1.00 18.02 ? 80   ILE D CA  1 
ATOM   2817 C  C   . ILE D  2 79 ? 30.382  37.910  174.111 1.00 18.80 ? 80   ILE D C   1 
ATOM   2818 O  O   . ILE D  2 79 ? 30.472  37.604  172.916 1.00 17.84 ? 80   ILE D O   1 
ATOM   2819 C  CB  . ILE D  2 79 ? 29.241  36.015  175.350 1.00 19.18 ? 80   ILE D CB  1 
ATOM   2820 C  CG1 . ILE D  2 79 ? 29.002  35.211  174.054 1.00 20.30 ? 80   ILE D CG1 1 
ATOM   2821 C  CG2 . ILE D  2 79 ? 28.006  36.905  175.608 1.00 17.94 ? 80   ILE D CG2 1 
ATOM   2822 C  CD1 . ILE D  2 79 ? 28.758  33.787  174.236 1.00 22.73 ? 80   ILE D CD1 1 
ATOM   2823 N  N   . MET D  2 80 ? 30.139  39.158  174.511 1.00 18.91 ? 81   MET D N   1 
ATOM   2824 C  CA  . MET D  2 80 ? 30.029  40.266  173.527 1.00 20.99 ? 81   MET D CA  1 
ATOM   2825 C  C   . MET D  2 80 ? 31.356  40.460  172.764 1.00 21.80 ? 81   MET D C   1 
ATOM   2826 O  O   . MET D  2 80 ? 31.346  40.781  171.567 1.00 22.58 ? 81   MET D O   1 
ATOM   2827 C  CB  . MET D  2 80 ? 29.591  41.573  174.202 1.00 22.63 ? 81   MET D CB  1 
ATOM   2828 C  CG  . MET D  2 80 ? 28.077  41.767  174.462 1.00 28.46 ? 81   MET D CG  1 
ATOM   2829 S  SD  . MET D  2 80 ? 27.057  42.114  172.977 1.00 35.37 ? 81   MET D SD  1 
ATOM   2830 C  CE  . MET D  2 80 ? 28.337  42.548  171.874 1.00 27.73 ? 81   MET D CE  1 
ATOM   2831 N  N   . LEU D  2 81 ? 32.486  40.291  173.444 1.00 20.44 ? 82   LEU D N   1 
ATOM   2832 C  CA  . LEU D  2 81 ? 33.800  40.280  172.769 1.00 20.21 ? 82   LEU D CA  1 
ATOM   2833 C  C   . LEU D  2 81 ? 33.862  39.150  171.741 1.00 19.86 ? 82   LEU D C   1 
ATOM   2834 O  O   . LEU D  2 81 ? 34.369  39.357  170.635 1.00 21.12 ? 82   LEU D O   1 
ATOM   2835 C  CB  . LEU D  2 81 ? 34.982  40.157  173.759 1.00 20.06 ? 82   LEU D CB  1 
ATOM   2836 C  CG  . LEU D  2 81 ? 36.382  40.116  173.124 1.00 21.91 ? 82   LEU D CG  1 
ATOM   2837 C  CD1 . LEU D  2 81 ? 36.750  41.458  172.445 1.00 23.24 ? 82   LEU D CD1 1 
ATOM   2838 C  CD2 . LEU D  2 81 ? 37.512  39.659  174.096 1.00 22.32 ? 82   LEU D CD2 1 
ATOM   2839 N  N   . MET D  2 82 ? 33.378  37.963  172.128 1.00 19.38 ? 83   MET D N   1 
ATOM   2840 C  CA  . MET D  2 82 ? 33.381  36.792  171.263 1.00 18.83 ? 83   MET D CA  1 
ATOM   2841 C  C   . MET D  2 82 ? 32.575  37.100  170.010 1.00 19.76 ? 83   MET D C   1 
ATOM   2842 O  O   . MET D  2 82 ? 33.045  36.848  168.905 1.00 21.05 ? 83   MET D O   1 
ATOM   2843 C  CB  . MET D  2 82 ? 32.806  35.558  171.994 1.00 16.11 ? 83   MET D CB  1 
ATOM   2844 C  CG  . MET D  2 82 ? 33.636  35.089  173.206 1.00 17.98 ? 83   MET D CG  1 
ATOM   2845 S  SD  . MET D  2 82 ? 35.389  34.655  172.850 1.00 22.07 ? 83   MET D SD  1 
ATOM   2846 C  CE  . MET D  2 82 ? 36.314  36.159  173.016 1.00 22.28 ? 83   MET D CE  1 
ATOM   2847 N  N   . ALA D  2 83 ? 31.373  37.660  170.158 1.00 20.54 ? 84   ALA D N   1 
ATOM   2848 C  CA  . ALA D  2 83 ? 30.576  37.968  168.969 1.00 20.59 ? 84   ALA D CA  1 
ATOM   2849 C  C   . ALA D  2 83 ? 31.283  39.027  168.084 1.00 21.68 ? 84   ALA D C   1 
ATOM   2850 O  O   . ALA D  2 83 ? 31.375  38.880  166.854 1.00 21.74 ? 84   ALA D O   1 
ATOM   2851 C  CB  . ALA D  2 83 ? 29.187  38.419  169.365 1.00 22.68 ? 84   ALA D CB  1 
ATOM   2852 N  N   . ARG D  2 84 ? 31.857  40.051  168.714 1.00 20.99 ? 85   ARG D N   1 
ATOM   2853 C  CA  . ARG D  2 84 ? 32.537  41.113  167.969 1.00 24.02 ? 85   ARG D CA  1 
ATOM   2854 C  C   . ARG D  2 84 ? 33.726  40.587  167.170 1.00 22.16 ? 85   ARG D C   1 
ATOM   2855 O  O   . ARG D  2 84 ? 33.948  40.988  166.050 1.00 21.27 ? 85   ARG D O   1 
ATOM   2856 C  CB  . ARG D  2 84 ? 33.031  42.213  168.902 1.00 25.42 ? 85   ARG D CB  1 
ATOM   2857 C  CG  . ARG D  2 84 ? 31.913  43.102  169.409 1.00 32.17 ? 85   ARG D CG  1 
ATOM   2858 C  CD  . ARG D  2 84 ? 32.373  44.195  170.376 1.00 34.32 ? 85   ARG D CD  1 
ATOM   2859 N  NE  . ARG D  2 84 ? 31.257  44.809  171.086 1.00 40.27 ? 85   ARG D NE  1 
ATOM   2860 C  CZ  . ARG D  2 84 ? 31.402  45.505  172.204 1.00 42.94 ? 85   ARG D CZ  1 
ATOM   2861 N  NH1 . ARG D  2 84 ? 30.342  46.028  172.805 1.00 45.30 ? 85   ARG D NH1 1 
ATOM   2862 N  NH2 . ARG D  2 84 ? 32.611  45.680  172.726 1.00 43.20 ? 85   ARG D NH2 1 
ATOM   2863 N  N   . LEU D  2 85 ? 34.511  39.702  167.782 1.00 21.24 ? 86   LEU D N   1 
ATOM   2864 C  CA  . LEU D  2 85 ? 35.632  39.075  167.120 1.00 22.74 ? 86   LEU D CA  1 
ATOM   2865 C  C   . LEU D  2 85 ? 35.213  38.109  166.022 1.00 23.09 ? 86   LEU D C   1 
ATOM   2866 O  O   . LEU D  2 85 ? 35.865  38.010  164.990 1.00 22.42 ? 86   LEU D O   1 
ATOM   2867 C  CB  . LEU D  2 85 ? 36.465  38.330  168.160 1.00 23.51 ? 86   LEU D CB  1 
ATOM   2868 C  CG  . LEU D  2 85 ? 37.743  38.968  168.710 1.00 25.48 ? 86   LEU D CG  1 
ATOM   2869 C  CD1 . LEU D  2 85 ? 37.818  40.462  168.502 1.00 25.43 ? 86   LEU D CD1 1 
ATOM   2870 C  CD2 . LEU D  2 85 ? 37.972  38.498  170.135 1.00 24.84 ? 86   LEU D CD2 1 
ATOM   2871 N  N   . THR D  2 86 ? 34.114  37.390  166.226 1.00 22.82 ? 87   THR D N   1 
ATOM   2872 C  CA  . THR D  2 86 ? 33.611  36.524  165.152 1.00 21.59 ? 87   THR D CA  1 
ATOM   2873 C  C   . THR D  2 86 ? 33.186  37.395  163.953 1.00 24.42 ? 87   THR D C   1 
ATOM   2874 O  O   . THR D  2 86 ? 33.518  37.097  162.806 1.00 22.54 ? 87   THR D O   1 
ATOM   2875 C  CB  . THR D  2 86 ? 32.449  35.667  165.691 1.00 20.85 ? 87   THR D CB  1 
ATOM   2876 O  OG1 . THR D  2 86 ? 32.932  34.863  166.800 1.00 19.56 ? 87   THR D OG1 1 
ATOM   2877 C  CG2 . THR D  2 86 ? 31.958  34.681  164.647 1.00 20.12 ? 87   THR D CG2 1 
ATOM   2878 N  N   . TRP D  2 87 ? 32.459  38.478  164.220 1.00 23.95 ? 88   TRP D N   1 
ATOM   2879 C  CA  . TRP D  2 87 ? 32.086  39.415  163.150 1.00 25.78 ? 88   TRP D CA  1 
ATOM   2880 C  C   . TRP D  2 87 ? 33.314  39.959  162.428 1.00 25.40 ? 88   TRP D C   1 
ATOM   2881 O  O   . TRP D  2 87 ? 33.353  39.996  161.199 1.00 26.37 ? 88   TRP D O   1 
ATOM   2882 C  CB  . TRP D  2 87 ? 31.292  40.582  163.717 1.00 27.35 ? 88   TRP D CB  1 
ATOM   2883 C  CG  . TRP D  2 87 ? 31.060  41.660  162.703 1.00 29.09 ? 88   TRP D CG  1 
ATOM   2884 C  CD1 . TRP D  2 87 ? 31.712  42.869  162.604 1.00 30.15 ? 88   TRP D CD1 1 
ATOM   2885 C  CD2 . TRP D  2 87 ? 30.116  41.629  161.633 1.00 29.82 ? 88   TRP D CD2 1 
ATOM   2886 N  NE1 . TRP D  2 87 ? 31.209  43.592  161.544 1.00 30.67 ? 88   TRP D NE1 1 
ATOM   2887 C  CE2 . TRP D  2 87 ? 30.235  42.851  160.925 1.00 31.07 ? 88   TRP D CE2 1 
ATOM   2888 C  CE3 . TRP D  2 87 ? 29.171  40.692  161.198 1.00 31.25 ? 88   TRP D CE3 1 
ATOM   2889 C  CZ2 . TRP D  2 87 ? 29.446  43.155  159.806 1.00 31.43 ? 88   TRP D CZ2 1 
ATOM   2890 C  CZ3 . TRP D  2 87 ? 28.396  40.992  160.076 1.00 30.94 ? 88   TRP D CZ3 1 
ATOM   2891 C  CH2 . TRP D  2 87 ? 28.551  42.206  159.391 1.00 31.07 ? 88   TRP D CH2 1 
ATOM   2892 N  N   . ALA D  2 88 ? 34.307  40.417  163.183 1.00 24.26 ? 89   ALA D N   1 
ATOM   2893 C  CA  . ALA D  2 88 ? 35.533  40.960  162.585 1.00 25.02 ? 89   ALA D CA  1 
ATOM   2894 C  C   . ALA D  2 88 ? 36.201  39.937  161.668 1.00 26.51 ? 89   ALA D C   1 
ATOM   2895 O  O   . ALA D  2 88 ? 36.684  40.288  160.586 1.00 27.32 ? 89   ALA D O   1 
ATOM   2896 C  CB  . ALA D  2 88 ? 36.521  41.433  163.658 1.00 23.53 ? 89   ALA D CB  1 
ATOM   2897 N  N   . SER D  2 89 ? 36.225  38.676  162.093 1.00 26.17 ? 90   SER D N   1 
ATOM   2898 C  CA  . SER D  2 89 ? 36.874  37.642  161.287 1.00 27.25 ? 90   SER D CA  1 
ATOM   2899 C  C   . SER D  2 89 ? 36.066  37.393  160.011 1.00 27.53 ? 90   SER D C   1 
ATOM   2900 O  O   . SER D  2 89 ? 36.637  37.304  158.927 1.00 28.68 ? 90   SER D O   1 
ATOM   2901 C  CB  . SER D  2 89 ? 37.073  36.366  162.115 1.00 27.57 ? 90   SER D CB  1 
ATOM   2902 O  OG  . SER D  2 89 ? 37.776  35.387  161.380 1.00 27.55 ? 90   SER D OG  1 
ATOM   2903 N  N   . HIS D  2 90 ? 34.745  37.306  160.142 1.00 27.02 ? 91   HIS D N   1 
ATOM   2904 C  CA  . HIS D  2 90 ? 33.834  37.205  158.990 1.00 28.88 ? 91   HIS D CA  1 
ATOM   2905 C  C   . HIS D  2 90 ? 34.088  38.339  158.005 1.00 31.03 ? 91   HIS D C   1 
ATOM   2906 O  O   . HIS D  2 90 ? 34.140  38.114  156.797 1.00 30.11 ? 91   HIS D O   1 
ATOM   2907 C  CB  . HIS D  2 90 ? 32.382  37.201  159.476 1.00 29.35 ? 91   HIS D CB  1 
ATOM   2908 C  CG  . HIS D  2 90 ? 31.352  37.344  158.391 1.00 32.31 ? 91   HIS D CG  1 
ATOM   2909 N  ND1 . HIS D  2 90 ? 30.894  38.568  157.952 1.00 34.28 ? 91   HIS D ND1 1 
ATOM   2910 C  CD2 . HIS D  2 90 ? 30.667  36.412  157.687 1.00 34.14 ? 91   HIS D CD2 1 
ATOM   2911 C  CE1 . HIS D  2 90 ? 29.988  38.384  157.007 1.00 34.90 ? 91   HIS D CE1 1 
ATOM   2912 N  NE2 . HIS D  2 90 ? 29.828  37.084  156.830 1.00 35.10 ? 91   HIS D NE2 1 
ATOM   2913 N  N   . GLU D  2 91 ? 34.235  39.559  158.517 1.00 32.98 ? 92   GLU D N   1 
ATOM   2914 C  CA  . GLU D  2 91 ? 34.446  40.718  157.649 1.00 36.92 ? 92   GLU D CA  1 
ATOM   2915 C  C   . GLU D  2 91 ? 35.771  40.684  156.885 1.00 38.39 ? 92   GLU D C   1 
ATOM   2916 O  O   . GLU D  2 91 ? 35.821  41.100  155.730 1.00 38.71 ? 92   GLU D O   1 
ATOM   2917 C  CB  . GLU D  2 91 ? 34.332  42.016  158.449 1.00 38.67 ? 92   GLU D CB  1 
ATOM   2918 C  CG  . GLU D  2 91 ? 32.924  42.257  158.954 1.00 41.58 ? 92   GLU D CG  1 
ATOM   2919 C  CD  . GLU D  2 91 ? 31.914  42.331  157.819 1.00 45.08 ? 92   GLU D CD  1 
ATOM   2920 O  OE1 . GLU D  2 91 ? 31.535  43.464  157.450 1.00 45.72 ? 92   GLU D OE1 1 
ATOM   2921 O  OE2 . GLU D  2 91 ? 31.492  41.270  157.293 1.00 46.72 ? 92   GLU D OE2 1 
ATOM   2922 N  N   . LYS D  2 92 ? 36.846  40.214  157.504 1.00 39.09 ? 93   LYS D N   1 
ATOM   2923 C  CA  . LYS D  2 92 ? 38.118  40.221  156.811 1.00 45.13 ? 93   LYS D CA  1 
ATOM   2924 C  C   . LYS D  2 92 ? 38.291  39.033  155.865 1.00 47.85 ? 93   LYS D C   1 
ATOM   2925 O  O   . LYS D  2 92 ? 39.226  39.009  155.060 1.00 50.38 ? 93   LYS D O   1 
ATOM   2926 C  CB  . LYS D  2 92 ? 39.303  40.381  157.769 1.00 45.34 ? 93   LYS D CB  1 
ATOM   2927 C  CG  . LYS D  2 92 ? 39.663  39.164  158.561 1.00 49.24 ? 93   LYS D CG  1 
ATOM   2928 C  CD  . LYS D  2 92 ? 41.136  39.206  158.979 1.00 52.11 ? 93   LYS D CD  1 
ATOM   2929 C  CE  . LYS D  2 92 ? 42.056  39.207  157.755 1.00 54.14 ? 93   LYS D CE  1 
ATOM   2930 N  NZ  . LYS D  2 92 ? 43.437  38.716  158.049 1.00 55.16 ? 93   LYS D NZ  1 
ATOM   2931 N  N   . MET D  2 93 ? 37.395  38.055  155.937 1.00 49.86 ? 94   MET D N   1 
ATOM   2932 C  CA  . MET D  2 93 ? 37.382  37.010  154.915 1.00 53.08 ? 94   MET D CA  1 
ATOM   2933 C  C   . MET D  2 93 ? 36.526  37.437  153.714 1.00 56.04 ? 94   MET D C   1 
ATOM   2934 O  O   . MET D  2 93 ? 36.012  36.612  152.956 1.00 55.42 ? 94   MET D O   1 
ATOM   2935 C  CB  . MET D  2 93 ? 37.060  35.600  155.461 1.00 52.95 ? 94   MET D CB  1 
ATOM   2936 C  CG  . MET D  2 93 ? 36.047  35.497  156.595 1.00 52.94 ? 94   MET D CG  1 
ATOM   2937 S  SD  . MET D  2 93 ? 35.885  33.827  157.299 1.00 51.66 ? 94   MET D SD  1 
ATOM   2938 C  CE  . MET D  2 93 ? 35.149  32.960  155.905 1.00 53.39 ? 94   MET D CE  1 
ATOM   2939 N  N   . HIS D  2 94 ? 36.402  38.754  153.559 1.00 59.60 ? 95   HIS D N   1 
ATOM   2940 C  CA  . HIS D  2 94 ? 35.932  39.377  152.325 1.00 61.72 ? 95   HIS D CA  1 
ATOM   2941 C  C   . HIS D  2 94 ? 37.115  40.024  151.609 1.00 63.17 ? 95   HIS D C   1 
ATOM   2942 O  O   . HIS D  2 94 ? 37.794  40.884  152.180 1.00 63.61 ? 95   HIS D O   1 
ATOM   2943 C  CB  . HIS D  2 94 ? 34.898  40.460  152.616 1.00 62.65 ? 95   HIS D CB  1 
ATOM   2944 C  CG  . HIS D  2 94 ? 33.567  39.927  153.040 1.00 64.05 ? 95   HIS D CG  1 
ATOM   2945 N  ND1 . HIS D  2 94 ? 33.278  38.580  153.061 1.00 64.11 ? 95   HIS D ND1 1 
ATOM   2946 C  CD2 . HIS D  2 94 ? 32.435  40.563  153.427 1.00 64.78 ? 95   HIS D CD2 1 
ATOM   2947 C  CE1 . HIS D  2 94 ? 32.031  38.408  153.462 1.00 64.88 ? 95   HIS D CE1 1 
ATOM   2948 N  NE2 . HIS D  2 94 ? 31.497  39.595  153.688 1.00 64.98 ? 95   HIS D NE2 1 
ATOM   2949 N  N   . MET E  1 1  ? 36.721  64.707  95.115  1.00 44.67 ? 1    MET E N   1 
ATOM   2950 C  CA  . MET E  1 1  ? 35.641  65.606  94.627  1.00 44.15 ? 1    MET E CA  1 
ATOM   2951 C  C   . MET E  1 1  ? 34.377  64.827  94.325  1.00 37.99 ? 1    MET E C   1 
ATOM   2952 O  O   . MET E  1 1  ? 34.321  64.094  93.328  1.00 38.03 ? 1    MET E O   1 
ATOM   2953 C  CB  . MET E  1 1  ? 36.075  66.314  93.347  1.00 46.55 ? 1    MET E CB  1 
ATOM   2954 C  CG  . MET E  1 1  ? 36.465  67.770  93.525  1.00 50.24 ? 1    MET E CG  1 
ATOM   2955 S  SD  . MET E  1 1  ? 36.162  68.716  92.007  1.00 52.81 ? 1    MET E SD  1 
ATOM   2956 C  CE  . MET E  1 1  ? 37.032  67.769  90.748  1.00 52.47 ? 1    MET E CE  1 
ATOM   2957 N  N   . LEU E  1 2  ? 33.371  64.991  95.178  1.00 30.78 ? 2    LEU E N   1 
ATOM   2958 C  CA  . LEU E  1 2  ? 32.044  64.493  94.844  1.00 27.38 ? 2    LEU E CA  1 
ATOM   2959 C  C   . LEU E  1 2  ? 31.431  65.322  93.721  1.00 23.92 ? 2    LEU E C   1 
ATOM   2960 O  O   . LEU E  1 2  ? 31.656  66.528  93.660  1.00 23.58 ? 2    LEU E O   1 
ATOM   2961 C  CB  . LEU E  1 2  ? 31.127  64.475  96.059  1.00 26.98 ? 2    LEU E CB  1 
ATOM   2962 C  CG  . LEU E  1 2  ? 31.036  63.120  96.772  1.00 29.30 ? 2    LEU E CG  1 
ATOM   2963 C  CD1 . LEU E  1 2  ? 32.344  62.345  96.662  1.00 27.04 ? 2    LEU E CD1 1 
ATOM   2964 C  CD2 . LEU E  1 2  ? 30.612  63.335  98.194  1.00 27.69 ? 2    LEU E CD2 1 
ATOM   2965 N  N   . THR E  1 3  ? 30.681  64.674  92.834  1.00 21.65 ? 3    THR E N   1 
ATOM   2966 C  CA  . THR E  1 3  ? 30.078  65.363  91.691  1.00 20.56 ? 3    THR E CA  1 
ATOM   2967 C  C   . THR E  1 3  ? 28.843  66.086  92.232  1.00 21.74 ? 3    THR E C   1 
ATOM   2968 O  O   . THR E  1 3  ? 28.441  65.849  93.361  1.00 18.86 ? 3    THR E O   1 
ATOM   2969 C  CB  . THR E  1 3  ? 29.596  64.334  90.653  1.00 19.09 ? 3    THR E CB  1 
ATOM   2970 O  OG1 . THR E  1 3  ? 28.516  63.603  91.254  1.00 18.83 ? 3    THR E OG1 1 
ATOM   2971 C  CG2 . THR E  1 3  ? 30.651  63.262  90.360  1.00 16.62 ? 3    THR E CG2 1 
ATOM   2972 N  N   . GLU E  1 4  ? 28.222  66.954  91.440  1.00 21.81 ? 4    GLU E N   1 
ATOM   2973 C  CA  . GLU E  1 4  ? 27.046  67.664  91.937  1.00 21.07 ? 4    GLU E CA  1 
ATOM   2974 C  C   . GLU E  1 4  ? 25.842  66.759  92.221  1.00 19.89 ? 4    GLU E C   1 
ATOM   2975 O  O   . GLU E  1 4  ? 25.088  67.014  93.144  1.00 18.63 ? 4    GLU E O   1 
ATOM   2976 C  CB  . GLU E  1 4  ? 26.650  68.825  91.010  1.00 24.62 ? 4    GLU E CB  1 
ATOM   2977 C  CG  . GLU E  1 4  ? 27.607  70.012  91.018  1.00 26.44 ? 4    GLU E CG  1 
ATOM   2978 C  CD  . GLU E  1 4  ? 27.765  70.639  92.404  1.00 29.11 ? 4    GLU E CD  1 
ATOM   2979 O  OE1 . GLU E  1 4  ? 28.921  70.948  92.803  1.00 32.39 ? 4    GLU E OE1 1 
ATOM   2980 O  OE2 . GLU E  1 4  ? 26.746  70.820  93.121  1.00 31.66 ? 4    GLU E OE2 1 
ATOM   2981 N  N   . LEU E  1 5  ? 25.654  65.717  91.413  1.00 19.49 ? 5    LEU E N   1 
ATOM   2982 C  CA  . LEU E  1 5  ? 24.644  64.708  91.667  1.00 20.27 ? 5    LEU E CA  1 
ATOM   2983 C  C   . LEU E  1 5  ? 24.890  63.977  92.985  1.00 19.24 ? 5    LEU E C   1 
ATOM   2984 O  O   . LEU E  1 5  ? 23.991  63.816  93.789  1.00 18.62 ? 5    LEU E O   1 
ATOM   2985 C  CB  . LEU E  1 5  ? 24.654  63.656  90.548  1.00 20.59 ? 5    LEU E CB  1 
ATOM   2986 C  CG  . LEU E  1 5  ? 23.332  62.953  90.182  1.00 22.48 ? 5    LEU E CG  1 
ATOM   2987 C  CD1 . LEU E  1 5  ? 23.473  61.490  89.629  1.00 18.05 ? 5    LEU E CD1 1 
ATOM   2988 C  CD2 . LEU E  1 5  ? 22.125  63.126  91.029  1.00 21.66 ? 5    LEU E CD2 1 
ATOM   2989 N  N   . GLU E  1 6  ? 26.123  63.551  93.225  1.00 18.42 ? 6    GLU E N   1 
ATOM   2990 C  CA  . GLU E  1 6  ? 26.447  62.881  94.495  1.00 18.03 ? 6    GLU E CA  1 
ATOM   2991 C  C   . GLU E  1 6  ? 26.232  63.784  95.710  1.00 19.00 ? 6    GLU E C   1 
ATOM   2992 O  O   . GLU E  1 6  ? 25.696  63.372  96.752  1.00 18.64 ? 6    GLU E O   1 
ATOM   2993 C  CB  . GLU E  1 6  ? 27.907  62.442  94.430  1.00 21.73 ? 6    GLU E CB  1 
ATOM   2994 C  CG  . GLU E  1 6  ? 28.064  61.304  93.436  1.00 21.49 ? 6    GLU E CG  1 
ATOM   2995 C  CD  . GLU E  1 6  ? 29.499  60.937  93.126  1.00 24.83 ? 6    GLU E CD  1 
ATOM   2996 O  OE1 . GLU E  1 6  ? 29.684  59.837  92.579  1.00 25.49 ? 6    GLU E OE1 1 
ATOM   2997 O  OE2 . GLU E  1 6  ? 30.429  61.741  93.369  1.00 25.51 ? 6    GLU E OE2 1 
ATOM   2998 N  N   . LYS E  1 7  ? 26.647  65.037  95.580  1.00 18.12 ? 7    LYS E N   1 
ATOM   2999 C  CA  . LYS E  1 7  ? 26.384  66.034  96.630  1.00 19.12 ? 7    LYS E CA  1 
ATOM   3000 C  C   . LYS E  1 7  ? 24.899  66.302  96.878  1.00 18.09 ? 7    LYS E C   1 
ATOM   3001 O  O   . LYS E  1 7  ? 24.497  66.469  98.024  1.00 17.63 ? 7    LYS E O   1 
ATOM   3002 C  CB  . LYS E  1 7  ? 27.110  67.337  96.291  1.00 21.61 ? 7    LYS E CB  1 
ATOM   3003 C  CG  . LYS E  1 7  ? 28.616  67.194  96.446  1.00 24.41 ? 7    LYS E CG  1 
ATOM   3004 C  CD  . LYS E  1 7  ? 29.393  68.279  95.730  1.00 29.82 ? 7    LYS E CD  1 
ATOM   3005 C  CE  . LYS E  1 7  ? 28.904  69.640  96.097  1.00 33.54 ? 7    LYS E CE  1 
ATOM   3006 N  NZ  . LYS E  1 7  ? 29.783  70.649  95.415  1.00 37.41 ? 7    LYS E NZ  1 
ATOM   3007 N  N   . ALA E  1 8  ? 24.087  66.269  95.824  1.00 18.34 ? 8    ALA E N   1 
ATOM   3008 C  CA  . ALA E  1 8  ? 22.633  66.392  95.976  1.00 16.85 ? 8    ALA E CA  1 
ATOM   3009 C  C   . ALA E  1 8  ? 22.034  65.212  96.785  1.00 18.53 ? 8    ALA E C   1 
ATOM   3010 O  O   . ALA E  1 8  ? 21.163  65.417  97.637  1.00 19.29 ? 8    ALA E O   1 
ATOM   3011 C  CB  . ALA E  1 8  ? 21.980  66.501  94.578  1.00 17.12 ? 8    ALA E CB  1 
ATOM   3012 N  N   . LEU E  1 9  ? 22.482  63.987  96.494  1.00 19.43 ? 9    LEU E N   1 
ATOM   3013 C  CA  . LEU E  1 9  ? 22.098  62.786  97.246  1.00 20.69 ? 9    LEU E CA  1 
ATOM   3014 C  C   . LEU E  1 9  ? 22.472  62.894  98.740  1.00 20.43 ? 9    LEU E C   1 
ATOM   3015 O  O   . LEU E  1 9  ? 21.648  62.680  99.634  1.00 20.95 ? 9    LEU E O   1 
ATOM   3016 C  CB  . LEU E  1 9  ? 22.683  61.515  96.600  1.00 17.43 ? 9    LEU E CB  1 
ATOM   3017 C  CG  . LEU E  1 9  ? 22.190  61.292  95.151  1.00 19.27 ? 9    LEU E CG  1 
ATOM   3018 C  CD1 . LEU E  1 9  ? 22.605  59.923  94.541  1.00 20.84 ? 9    LEU E CD1 1 
ATOM   3019 C  CD2 . LEU E  1 9  ? 20.699  61.461  95.032  1.00 21.28 ? 9    LEU E CD2 1 
ATOM   3020 N  N   . ASN E  1 10 ? 23.710  63.305  98.999  1.00 20.72 ? 10   ASN E N   1 
ATOM   3021 C  CA  . ASN E  1 10 ? 24.159  63.473  100.380 1.00 20.58 ? 10   ASN E CA  1 
ATOM   3022 C  C   . ASN E  1 10 ? 23.377  64.573  101.091 1.00 19.29 ? 10   ASN E C   1 
ATOM   3023 O  O   . ASN E  1 10 ? 23.173  64.486  102.301 1.00 21.52 ? 10   ASN E O   1 
ATOM   3024 C  CB  . ASN E  1 10 ? 25.662  63.755  100.413 1.00 20.13 ? 10   ASN E CB  1 
ATOM   3025 C  CG  . ASN E  1 10 ? 26.512  62.488  100.295 1.00 23.04 ? 10   ASN E CG  1 
ATOM   3026 O  OD1 . ASN E  1 10 ? 26.027  61.357  100.389 1.00 21.31 ? 10   ASN E OD1 1 
ATOM   3027 N  ND2 . ASN E  1 10 ? 27.809  62.687  100.129 1.00 20.34 ? 10   ASN E ND2 1 
ATOM   3028 N  N   . SER E  1 11 ? 22.909  65.585  100.358 1.00 17.83 ? 11   SER E N   1 
ATOM   3029 C  CA  . SER E  1 11 ? 22.169  66.707  100.947 1.00 17.18 ? 11   SER E CA  1 
ATOM   3030 C  C   . SER E  1 11 ? 20.781  66.245  101.353 1.00 18.14 ? 11   SER E C   1 
ATOM   3031 O  O   . SER E  1 11 ? 20.239  66.713  102.338 1.00 19.86 ? 11   SER E O   1 
ATOM   3032 C  CB  . SER E  1 11 ? 22.068  67.874  99.948  1.00 19.46 ? 11   SER E CB  1 
ATOM   3033 O  OG  . SER E  1 11 ? 21.177  68.877  100.421 1.00 20.49 ? 11   SER E OG  1 
ATOM   3034 N  N   . ILE E  1 12 ? 20.220  65.282  100.624 1.00 18.97 ? 12   ILE E N   1 
ATOM   3035 C  CA  . ILE E  1 12 ? 18.931  64.709  101.007 1.00 19.86 ? 12   ILE E CA  1 
ATOM   3036 C  C   . ILE E  1 12 ? 18.998  64.077  102.409 1.00 19.71 ? 12   ILE E C   1 
ATOM   3037 O  O   . ILE E  1 12 ? 18.079  64.246  103.251 1.00 20.54 ? 12   ILE E O   1 
ATOM   3038 C  CB  . ILE E  1 12 ? 18.453  63.696  99.923  1.00 21.29 ? 12   ILE E CB  1 
ATOM   3039 C  CG1 . ILE E  1 12 ? 18.034  64.464  98.648  1.00 19.21 ? 12   ILE E CG1 1 
ATOM   3040 C  CG2 . ILE E  1 12 ? 17.289  62.824  100.481 1.00 24.48 ? 12   ILE E CG2 1 
ATOM   3041 C  CD1 . ILE E  1 12 ? 17.743  63.551  97.393  1.00 21.05 ? 12   ILE E CD1 1 
ATOM   3042 N  N   . ILE E  1 13 ? 20.111  63.408  102.684 1.00 19.16 ? 13   ILE E N   1 
ATOM   3043 C  CA  . ILE E  1 13 ? 20.382  62.875  104.019 1.00 19.95 ? 13   ILE E CA  1 
ATOM   3044 C  C   . ILE E  1 13 ? 20.468  63.990  105.062 1.00 21.35 ? 13   ILE E C   1 
ATOM   3045 O  O   . ILE E  1 13 ? 19.834  63.903  106.107 1.00 20.48 ? 13   ILE E O   1 
ATOM   3046 C  CB  . ILE E  1 13 ? 21.691  62.076  104.023 1.00 19.50 ? 13   ILE E CB  1 
ATOM   3047 C  CG1 . ILE E  1 13 ? 21.580  60.916  103.042 1.00 22.25 ? 13   ILE E CG1 1 
ATOM   3048 C  CG2 . ILE E  1 13 ? 22.068  61.570  105.458 1.00 22.70 ? 13   ILE E CG2 1 
ATOM   3049 C  CD1 . ILE E  1 13 ? 22.897  60.263  102.821 1.00 24.38 ? 13   ILE E CD1 1 
ATOM   3050 N  N   . ASP E  1 14 ? 21.226  65.042  104.744 1.00 21.64 ? 14   ASP E N   1 
ATOM   3051 C  CA  . ASP E  1 14 ? 21.290  66.231  105.594 1.00 23.16 ? 14   ASP E CA  1 
ATOM   3052 C  C   . ASP E  1 14 ? 19.903  66.826  105.873 1.00 22.19 ? 14   ASP E C   1 
ATOM   3053 O  O   . ASP E  1 14 ? 19.598  67.170  107.007 1.00 22.99 ? 14   ASP E O   1 
ATOM   3054 C  CB  . ASP E  1 14 ? 22.264  67.241  104.984 1.00 24.26 ? 14   ASP E CB  1 
ATOM   3055 C  CG  . ASP E  1 14 ? 22.385  68.493  105.811 1.00 28.07 ? 14   ASP E CG  1 
ATOM   3056 O  OD1 . ASP E  1 14 ? 22.913  68.431  106.955 1.00 28.69 ? 14   ASP E OD1 1 
ATOM   3057 O  OD2 . ASP E  1 14 ? 21.986  69.596  105.386 1.00 30.60 ? 14   ASP E OD2 1 
ATOM   3058 N  N   . VAL E  1 15 ? 19.036  66.904  104.871 1.00 20.09 ? 15   VAL E N   1 
ATOM   3059 C  CA  . VAL E  1 15 ? 17.668  67.390  105.094 1.00 18.56 ? 15   VAL E CA  1 
ATOM   3060 C  C   . VAL E  1 15 ? 16.925  66.560  106.150 1.00 20.18 ? 15   VAL E C   1 
ATOM   3061 O  O   . VAL E  1 15 ? 16.283  67.108  107.053 1.00 19.54 ? 15   VAL E O   1 
ATOM   3062 C  CB  . VAL E  1 15 ? 16.819  67.436  103.803 1.00 19.82 ? 15   VAL E CB  1 
ATOM   3063 C  CG1 . VAL E  1 15 ? 15.358  67.714  104.140 1.00 20.00 ? 15   VAL E CG1 1 
ATOM   3064 C  CG2 . VAL E  1 15 ? 17.370  68.545  102.855 1.00 18.16 ? 15   VAL E CG2 1 
ATOM   3065 N  N   . TYR E  1 16 ? 16.990  65.245  106.013 1.00 19.34 ? 16   TYR E N   1 
ATOM   3066 C  CA  . TYR E  1 16 ? 16.364  64.381  107.005 1.00 18.80 ? 16   TYR E CA  1 
ATOM   3067 C  C   . TYR E  1 16 ? 16.952  64.643  108.397 1.00 19.12 ? 16   TYR E C   1 
ATOM   3068 O  O   . TYR E  1 16 ? 16.212  64.746  109.373 1.00 19.38 ? 16   TYR E O   1 
ATOM   3069 C  CB  . TYR E  1 16 ? 16.494  62.903  106.599 1.00 19.66 ? 16   TYR E CB  1 
ATOM   3070 C  CG  . TYR E  1 16 ? 15.846  61.995  107.624 1.00 19.11 ? 16   TYR E CG  1 
ATOM   3071 C  CD1 . TYR E  1 16 ? 14.457  61.864  107.677 1.00 17.59 ? 16   TYR E CD1 1 
ATOM   3072 C  CD2 . TYR E  1 16 ? 16.613  61.337  108.587 1.00 18.61 ? 16   TYR E CD2 1 
ATOM   3073 C  CE1 . TYR E  1 16 ? 13.869  61.041  108.651 1.00 21.71 ? 16   TYR E CE1 1 
ATOM   3074 C  CE2 . TYR E  1 16 ? 16.037  60.544  109.565 1.00 19.14 ? 16   TYR E CE2 1 
ATOM   3075 C  CZ  . TYR E  1 16 ? 14.671  60.390  109.581 1.00 20.56 ? 16   TYR E CZ  1 
ATOM   3076 O  OH  . TYR E  1 16 ? 14.094  59.603  110.552 1.00 18.58 ? 16   TYR E OH  1 
ATOM   3077 N  N   . HIS E  1 17 ? 18.276  64.709  108.493 1.00 18.94 ? 17   HIS E N   1 
ATOM   3078 C  CA  . HIS E  1 17 ? 19.018  64.926  109.753 1.00 22.94 ? 17   HIS E CA  1 
ATOM   3079 C  C   . HIS E  1 17 ? 18.519  66.231  110.440 1.00 23.19 ? 17   HIS E C   1 
ATOM   3080 O  O   . HIS E  1 17 ? 18.347  66.249  111.678 1.00 26.42 ? 17   HIS E O   1 
ATOM   3081 C  CB  . HIS E  1 17 ? 20.518  64.902  109.367 1.00 25.88 ? 17   HIS E CB  1 
ATOM   3082 C  CG  . HIS E  1 17 ? 21.493  65.195  110.470 1.00 33.00 ? 17   HIS E CG  1 
ATOM   3083 N  ND1 . HIS E  1 17 ? 21.929  64.235  111.361 1.00 35.61 ? 17   HIS E ND1 1 
ATOM   3084 C  CD2 . HIS E  1 17 ? 22.185  66.323  110.771 1.00 34.98 ? 17   HIS E CD2 1 
ATOM   3085 C  CE1 . HIS E  1 17 ? 22.810  64.769  112.190 1.00 35.53 ? 17   HIS E CE1 1 
ATOM   3086 N  NE2 . HIS E  1 17 ? 22.985  66.035  111.852 1.00 36.35 ? 17   HIS E NE2 1 
ATOM   3087 N  N   . LYS E  1 18 ? 18.177  67.271  109.657 1.00 21.23 ? 18   LYS E N   1 
ATOM   3088 C  CA  . LYS E  1 18 ? 17.705  68.581  110.176 1.00 24.60 ? 18   LYS E CA  1 
ATOM   3089 C  C   . LYS E  1 18 ? 16.469  68.402  111.035 1.00 22.53 ? 18   LYS E C   1 
ATOM   3090 O  O   . LYS E  1 18 ? 16.279  69.099  112.039 1.00 23.20 ? 18   LYS E O   1 
ATOM   3091 C  CB  . LYS E  1 18 ? 17.313  69.559  109.044 1.00 27.12 ? 18   LYS E CB  1 
ATOM   3092 C  CG  . LYS E  1 18 ? 18.442  70.330  108.366 1.00 34.72 ? 18   LYS E CG  1 
ATOM   3093 C  CD  . LYS E  1 18 ? 17.909  71.547  107.532 1.00 34.26 ? 18   LYS E CD  1 
ATOM   3094 C  CE  . LYS E  1 18 ? 17.516  71.184  106.079 1.00 38.80 ? 18   LYS E CE  1 
ATOM   3095 N  NZ  . LYS E  1 18 ? 17.244  72.348  105.111 1.00 37.72 ? 18   LYS E NZ  1 
ATOM   3096 N  N   . TYR E  1 19 ? 15.622  67.478  110.622 1.00 18.47 ? 19   TYR E N   1 
ATOM   3097 C  CA  . TYR E  1 19 ? 14.329  67.303  111.250 1.00 18.44 ? 19   TYR E CA  1 
ATOM   3098 C  C   . TYR E  1 19 ? 14.376  66.169  112.270 1.00 18.52 ? 19   TYR E C   1 
ATOM   3099 O  O   . TYR E  1 19 ? 13.703  66.229  113.311 1.00 18.53 ? 19   TYR E O   1 
ATOM   3100 C  CB  . TYR E  1 19 ? 13.251  67.060  110.190 1.00 20.70 ? 19   TYR E CB  1 
ATOM   3101 C  CG  . TYR E  1 19 ? 13.021  68.333  109.423 1.00 22.98 ? 19   TYR E CG  1 
ATOM   3102 C  CD1 . TYR E  1 19 ? 12.264  69.344  109.979 1.00 22.52 ? 19   TYR E CD1 1 
ATOM   3103 C  CD2 . TYR E  1 19 ? 13.678  68.582  108.229 1.00 20.92 ? 19   TYR E CD2 1 
ATOM   3104 C  CE1 . TYR E  1 19 ? 12.068  70.552  109.331 1.00 23.78 ? 19   TYR E CE1 1 
ATOM   3105 C  CE2 . TYR E  1 19 ? 13.507  69.810  107.561 1.00 24.21 ? 19   TYR E CE2 1 
ATOM   3106 C  CZ  . TYR E  1 19 ? 12.699  70.774  108.127 1.00 23.89 ? 19   TYR E CZ  1 
ATOM   3107 O  OH  . TYR E  1 19 ? 12.494  71.981  107.498 1.00 27.10 ? 19   TYR E OH  1 
ATOM   3108 N  N   . SER E  1 20 ? 15.178  65.148  111.990 1.00 18.06 ? 20   SER E N   1 
ATOM   3109 C  CA  . SER E  1 20 ? 15.216  64.001  112.937 1.00 20.76 ? 20   SER E CA  1 
ATOM   3110 C  C   . SER E  1 20 ? 15.870  64.405  114.284 1.00 20.09 ? 20   SER E C   1 
ATOM   3111 O  O   . SER E  1 20 ? 15.686  63.763  115.327 1.00 20.15 ? 20   SER E O   1 
ATOM   3112 C  CB  . SER E  1 20 ? 15.897  62.795  112.270 1.00 19.38 ? 20   SER E CB  1 
ATOM   3113 O  OG  . SER E  1 20 ? 17.305  62.958  112.207 1.00 21.96 ? 20   SER E OG  1 
ATOM   3114 N  N   . LEU E  1 21 ? 16.665  65.473  114.247 1.00 21.08 ? 21   LEU E N   1 
ATOM   3115 C  CA  . LEU E  1 21 ? 17.359  65.997  115.430 1.00 21.17 ? 21   LEU E CA  1 
ATOM   3116 C  C   . LEU E  1 21 ? 16.500  66.889  116.330 1.00 21.62 ? 21   LEU E C   1 
ATOM   3117 O  O   . LEU E  1 21 ? 16.910  67.287  117.441 1.00 22.06 ? 21   LEU E O   1 
ATOM   3118 C  CB  . LEU E  1 21 ? 18.605  66.754  114.988 1.00 24.52 ? 21   LEU E CB  1 
ATOM   3119 C  CG  . LEU E  1 21 ? 19.880  65.945  114.741 1.00 27.43 ? 21   LEU E CG  1 
ATOM   3120 C  CD1 . LEU E  1 21 ? 20.910  66.744  113.900 1.00 29.42 ? 21   LEU E CD1 1 
ATOM   3121 C  CD2 . LEU E  1 21 ? 20.505  65.534  116.060 1.00 30.82 ? 21   LEU E CD2 1 
ATOM   3122 N  N   . ILE E  1 22 ? 15.285  67.198  115.899 1.00 19.70 ? 22   ILE E N   1 
ATOM   3123 C  CA  . ILE E  1 22 ? 14.477  68.096  116.726 1.00 19.97 ? 22   ILE E CA  1 
ATOM   3124 C  C   . ILE E  1 22 ? 14.198  67.542  118.125 1.00 20.77 ? 22   ILE E C   1 
ATOM   3125 O  O   . ILE E  1 22 ? 14.303  68.253  119.163 1.00 20.08 ? 22   ILE E O   1 
ATOM   3126 C  CB  . ILE E  1 22 ? 13.157  68.458  116.011 1.00 19.95 ? 22   ILE E CB  1 
ATOM   3127 C  CG1 . ILE E  1 22 ? 13.457  69.303  114.782 1.00 21.72 ? 22   ILE E CG1 1 
ATOM   3128 C  CG2 . ILE E  1 22 ? 12.198  69.198  116.995 1.00 20.47 ? 22   ILE E CG2 1 
ATOM   3129 C  CD1 . ILE E  1 22 ? 12.253  69.478  113.840 1.00 22.63 ? 22   ILE E CD1 1 
ATOM   3130 N  N   . LYS E  1 23 ? 13.807  66.275  118.190 1.00 19.73 ? 23   LYS E N   1 
ATOM   3131 C  CA  . LYS E  1 23 ? 13.401  65.718  119.486 1.00 20.34 ? 23   LYS E CA  1 
ATOM   3132 C  C   . LYS E  1 23 ? 13.435  64.194  119.492 1.00 23.58 ? 23   LYS E C   1 
ATOM   3133 O  O   . LYS E  1 23 ? 13.596  63.560  118.436 1.00 17.74 ? 23   LYS E O   1 
ATOM   3134 C  CB  . LYS E  1 23 ? 12.007  66.225  119.868 1.00 20.08 ? 23   LYS E CB  1 
ATOM   3135 C  CG  . LYS E  1 23 ? 10.905  65.764  118.942 1.00 20.23 ? 23   LYS E CG  1 
ATOM   3136 C  CD  . LYS E  1 23 ? 9.584   66.441  119.254 1.00 22.84 ? 23   LYS E CD  1 
ATOM   3137 C  CE  . LYS E  1 23 ? 8.526   66.017  118.248 1.00 22.26 ? 23   LYS E CE  1 
ATOM   3138 N  NZ  . LYS E  1 23 ? 7.309   66.861  118.398 1.00 26.68 ? 23   LYS E NZ  1 
ATOM   3139 N  N   . GLY E  1 24 ? 13.319  63.614  120.688 1.00 20.08 ? 24   GLY E N   1 
ATOM   3140 C  CA  . GLY E  1 24 ? 13.255  62.169  120.800 1.00 20.52 ? 24   GLY E CA  1 
ATOM   3141 C  C   . GLY E  1 24 ? 14.446  61.468  120.199 1.00 20.44 ? 24   GLY E C   1 
ATOM   3142 O  O   . GLY E  1 24 ? 15.587  61.934  120.304 1.00 20.92 ? 24   GLY E O   1 
ATOM   3143 N  N   . ASN E  1 25 ? 14.169  60.343  119.553 1.00 18.74 ? 25   ASN E N   1 
ATOM   3144 C  CA  . ASN E  1 25 ? 15.194  59.549  118.874 1.00 19.37 ? 25   ASN E CA  1 
ATOM   3145 C  C   . ASN E  1 25 ? 15.701  60.321  117.669 1.00 18.63 ? 25   ASN E C   1 
ATOM   3146 O  O   . ASN E  1 25 ? 14.899  60.795  116.880 1.00 18.18 ? 25   ASN E O   1 
ATOM   3147 C  CB  . ASN E  1 25 ? 14.544  58.222  118.438 1.00 22.15 ? 25   ASN E CB  1 
ATOM   3148 C  CG  . ASN E  1 25 ? 15.533  57.232  117.829 1.00 24.29 ? 25   ASN E CG  1 
ATOM   3149 O  OD1 . ASN E  1 25 ? 16.345  57.568  116.966 1.00 25.89 ? 25   ASN E OD1 1 
ATOM   3150 N  ND2 . ASN E  1 25 ? 15.453  55.993  118.276 1.00 23.76 ? 25   ASN E ND2 1 
ATOM   3151 N  N   . PHE E  1 26 ? 17.016  60.415  117.501 1.00 20.26 ? 26   PHE E N   1 
ATOM   3152 C  CA  . PHE E  1 26 ? 17.600  61.219  116.440 1.00 22.75 ? 26   PHE E CA  1 
ATOM   3153 C  C   . PHE E  1 26 ? 17.602  60.475  115.091 1.00 24.97 ? 26   PHE E C   1 
ATOM   3154 O  O   . PHE E  1 26 ? 18.038  60.994  114.060 1.00 25.80 ? 26   PHE E O   1 
ATOM   3155 C  CB  . PHE E  1 26 ? 19.006  61.694  116.829 1.00 27.27 ? 26   PHE E CB  1 
ATOM   3156 C  CG  . PHE E  1 26 ? 19.026  62.676  117.969 1.00 29.47 ? 26   PHE E CG  1 
ATOM   3157 C  CD1 . PHE E  1 26 ? 17.900  63.422  118.286 1.00 30.41 ? 26   PHE E CD1 1 
ATOM   3158 C  CD2 . PHE E  1 26 ? 20.188  62.870  118.710 1.00 32.28 ? 26   PHE E CD2 1 
ATOM   3159 C  CE1 . PHE E  1 26 ? 17.911  64.328  119.340 1.00 32.64 ? 26   PHE E CE1 1 
ATOM   3160 C  CE2 . PHE E  1 26 ? 20.220  63.771  119.773 1.00 33.32 ? 26   PHE E CE2 1 
ATOM   3161 C  CZ  . PHE E  1 26 ? 19.079  64.511  120.089 1.00 33.42 ? 26   PHE E CZ  1 
ATOM   3162 N  N   . HIS E  1 27 ? 17.069  59.261  115.101 1.00 24.07 ? 27   HIS E N   1 
ATOM   3163 C  CA  . HIS E  1 27 ? 16.804  58.541  113.857 1.00 22.22 ? 27   HIS E CA  1 
ATOM   3164 C  C   . HIS E  1 27 ? 15.306  58.459  113.579 1.00 21.66 ? 27   HIS E C   1 
ATOM   3165 O  O   . HIS E  1 27 ? 14.842  57.577  112.840 1.00 23.16 ? 27   HIS E O   1 
ATOM   3166 C  CB  . HIS E  1 27 ? 17.404  57.132  113.921 1.00 27.64 ? 27   HIS E CB  1 
ATOM   3167 C  CG  . HIS E  1 27 ? 18.833  57.101  114.375 1.00 31.55 ? 27   HIS E CG  1 
ATOM   3168 N  ND1 . HIS E  1 27 ? 19.897  56.998  113.511 1.00 35.39 ? 27   HIS E ND1 1 
ATOM   3169 C  CD2 . HIS E  1 27 ? 19.369  57.139  115.619 1.00 34.27 ? 27   HIS E CD2 1 
ATOM   3170 C  CE1 . HIS E  1 27 ? 21.028  56.996  114.193 1.00 33.39 ? 27   HIS E CE1 1 
ATOM   3171 N  NE2 . HIS E  1 27 ? 20.734  57.079  115.476 1.00 35.52 ? 27   HIS E NE2 1 
ATOM   3172 N  N   . ALA E  1 28 ? 14.534  59.386  114.140 1.00 18.37 ? 28   ALA E N   1 
ATOM   3173 C  CA  . ALA E  1 28 ? 13.087  59.382  113.916 1.00 19.42 ? 28   ALA E CA  1 
ATOM   3174 C  C   . ALA E  1 28 ? 12.541  60.798  113.706 1.00 17.95 ? 28   ALA E C   1 
ATOM   3175 O  O   . ALA E  1 28 ? 13.005  61.740  114.347 1.00 16.81 ? 28   ALA E O   1 
ATOM   3176 C  CB  . ALA E  1 28 ? 12.394  58.755  115.102 1.00 17.07 ? 28   ALA E CB  1 
ATOM   3177 N  N   . VAL E  1 29 ? 11.537  60.923  112.837 1.00 17.43 ? 29   VAL E N   1 
ATOM   3178 C  CA  . VAL E  1 29 ? 10.860  62.193  112.579 1.00 19.92 ? 29   VAL E CA  1 
ATOM   3179 C  C   . VAL E  1 29 ? 9.442   61.934  113.045 1.00 18.96 ? 29   VAL E C   1 
ATOM   3180 O  O   . VAL E  1 29 ? 8.806   60.984  112.597 1.00 19.46 ? 29   VAL E O   1 
ATOM   3181 C  CB  . VAL E  1 29 ? 10.935  62.541  111.061 1.00 22.14 ? 29   VAL E CB  1 
ATOM   3182 C  CG1 . VAL E  1 29 ? 9.801   63.470  110.598 1.00 22.64 ? 29   VAL E CG1 1 
ATOM   3183 C  CG2 . VAL E  1 29 ? 12.276  63.174  110.773 1.00 19.79 ? 29   VAL E CG2 1 
ATOM   3184 N  N   . TYR E  1 30 ? 8.951   62.738  113.973 1.00 18.09 ? 30   TYR E N   1 
ATOM   3185 C  CA  . TYR E  1 30 ? 7.614   62.494  114.496 1.00 17.06 ? 30   TYR E CA  1 
ATOM   3186 C  C   . TYR E  1 30 ? 6.571   63.350  113.764 1.00 18.25 ? 30   TYR E C   1 
ATOM   3187 O  O   . TYR E  1 30 ? 6.892   64.062  112.830 1.00 17.90 ? 30   TYR E O   1 
ATOM   3188 C  CB  . TYR E  1 30 ? 7.612   62.753  116.010 1.00 20.34 ? 30   TYR E CB  1 
ATOM   3189 C  CG  . TYR E  1 30 ? 8.639   61.906  116.728 1.00 21.07 ? 30   TYR E CG  1 
ATOM   3190 C  CD1 . TYR E  1 30 ? 8.393   60.545  116.988 1.00 21.75 ? 30   TYR E CD1 1 
ATOM   3191 C  CD2 . TYR E  1 30 ? 9.882   62.446  117.097 1.00 17.08 ? 30   TYR E CD2 1 
ATOM   3192 C  CE1 . TYR E  1 30 ? 9.341   59.762  117.636 1.00 18.87 ? 30   TYR E CE1 1 
ATOM   3193 C  CE2 . TYR E  1 30 ? 10.822  61.673  117.755 1.00 19.27 ? 30   TYR E CE2 1 
ATOM   3194 C  CZ  . TYR E  1 30 ? 10.553  60.338  118.012 1.00 20.37 ? 30   TYR E CZ  1 
ATOM   3195 O  OH  . TYR E  1 30 ? 11.506  59.593  118.668 1.00 19.87 ? 30   TYR E OH  1 
ATOM   3196 N  N   . ARG E  1 31 ? 5.319   63.337  114.200 1.00 19.29 ? 31   ARG E N   1 
ATOM   3197 C  CA  . ARG E  1 31 ? 4.259   63.950  113.401 1.00 21.51 ? 31   ARG E CA  1 
ATOM   3198 C  C   . ARG E  1 31 ? 4.439   65.444  113.166 1.00 22.01 ? 31   ARG E C   1 
ATOM   3199 O  O   . ARG E  1 31 ? 4.215   65.961  112.058 1.00 21.22 ? 31   ARG E O   1 
ATOM   3200 C  CB  . ARG E  1 31 ? 2.935   63.757  114.135 1.00 25.19 ? 31   ARG E CB  1 
ATOM   3201 C  CG  . ARG E  1 31 ? 1.709   63.565  113.249 1.00 32.01 ? 31   ARG E CG  1 
ATOM   3202 C  CD  . ARG E  1 31 ? 0.490   62.995  114.043 1.00 33.18 ? 31   ARG E CD  1 
ATOM   3203 N  NE  . ARG E  1 31 ? -0.011  61.687  113.604 1.00 39.97 ? 31   ARG E NE  1 
ATOM   3204 C  CZ  . ARG E  1 31 ? 0.346   60.521  114.146 1.00 42.21 ? 31   ARG E CZ  1 
ATOM   3205 N  NH1 . ARG E  1 31 ? 1.231   60.492  115.140 1.00 43.47 ? 31   ARG E NH1 1 
ATOM   3206 N  NH2 . ARG E  1 31 ? -0.183  59.380  113.700 1.00 42.06 ? 31   ARG E NH2 1 
ATOM   3207 N  N   . ASP E  1 32 ? 4.784   66.168  114.228 1.00 19.09 ? 32   ASP E N   1 
ATOM   3208 C  CA  . ASP E  1 32 ? 4.986   67.601  114.069 1.00 19.74 ? 32   ASP E CA  1 
ATOM   3209 C  C   . ASP E  1 32 ? 6.256   67.961  113.316 1.00 20.64 ? 32   ASP E C   1 
ATOM   3210 O  O   . ASP E  1 32 ? 6.291   68.998  112.602 1.00 20.66 ? 32   ASP E O   1 
ATOM   3211 C  CB  . ASP E  1 32 ? 5.006   68.312  115.412 1.00 19.32 ? 32   ASP E CB  1 
ATOM   3212 C  CG  . ASP E  1 32 ? 4.998   69.804  115.223 1.00 24.38 ? 32   ASP E CG  1 
ATOM   3213 O  OD1 . ASP E  1 32 ? 3.967   70.336  114.754 1.00 24.08 ? 32   ASP E OD1 1 
ATOM   3214 O  OD2 . ASP E  1 32 ? 5.992   70.509  115.488 1.00 26.79 ? 32   ASP E OD2 1 
ATOM   3215 N  N   . ASP E  1 33 ? 7.284   67.124  113.461 1.00 20.28 ? 33   ASP E N   1 
ATOM   3216 C  CA  . ASP E  1 33 ? 8.533   67.305  112.713 1.00 21.20 ? 33   ASP E CA  1 
ATOM   3217 C  C   . ASP E  1 33 ? 8.269   67.140  111.215 1.00 19.29 ? 33   ASP E C   1 
ATOM   3218 O  O   . ASP E  1 33 ? 8.817   67.861  110.382 1.00 18.52 ? 33   ASP E O   1 
ATOM   3219 C  CB  . ASP E  1 33 ? 9.529   66.197  113.071 1.00 23.74 ? 33   ASP E CB  1 
ATOM   3220 C  CG  . ASP E  1 33 ? 9.937   66.184  114.535 1.00 24.57 ? 33   ASP E CG  1 
ATOM   3221 O  OD1 . ASP E  1 33 ? 9.824   67.238  115.226 1.00 25.59 ? 33   ASP E OD1 1 
ATOM   3222 O  OD2 . ASP E  1 33 ? 10.413  65.138  115.062 1.00 23.56 ? 33   ASP E OD2 1 
ATOM   3223 N  N   . LEU E  1 34 ? 7.466   66.140  110.863 1.00 18.41 ? 34   LEU E N   1 
ATOM   3224 C  CA  . LEU E  1 34 ? 7.108   65.955  109.432 1.00 20.05 ? 34   LEU E CA  1 
ATOM   3225 C  C   . LEU E  1 34 ? 6.303   67.143  108.886 1.00 19.81 ? 34   LEU E C   1 
ATOM   3226 O  O   . LEU E  1 34 ? 6.538   67.612  107.764 1.00 19.76 ? 34   LEU E O   1 
ATOM   3227 C  CB  . LEU E  1 34 ? 6.353   64.636  109.243 1.00 17.32 ? 34   LEU E CB  1 
ATOM   3228 C  CG  . LEU E  1 34 ? 6.047   64.311  107.769 1.00 21.17 ? 34   LEU E CG  1 
ATOM   3229 C  CD1 . LEU E  1 34 ? 7.357   63.901  107.058 1.00 22.86 ? 34   LEU E CD1 1 
ATOM   3230 C  CD2 . LEU E  1 34 ? 5.030   63.178  107.664 1.00 21.19 ? 34   LEU E CD2 1 
ATOM   3231 N  N   . LYS E  1 35 ? 5.377   67.658  109.698 1.00 18.18 ? 35   LYS E N   1 
ATOM   3232 C  CA  . LYS E  1 35 ? 4.640   68.874  109.350 1.00 21.47 ? 35   LYS E CA  1 
ATOM   3233 C  C   . LYS E  1 35 ? 5.603   70.010  109.004 1.00 21.11 ? 35   LYS E C   1 
ATOM   3234 O  O   . LYS E  1 35 ? 5.460   70.656  107.955 1.00 20.28 ? 35   LYS E O   1 
ATOM   3235 C  CB  . LYS E  1 35 ? 3.695   69.288  110.477 1.00 22.96 ? 35   LYS E CB  1 
ATOM   3236 C  CG  . LYS E  1 35 ? 2.755   70.433  110.144 1.00 27.10 ? 35   LYS E CG  1 
ATOM   3237 C  CD  . LYS E  1 35 ? 1.683   70.531  111.229 1.00 30.38 ? 35   LYS E CD  1 
ATOM   3238 C  CE  . LYS E  1 35 ? 1.064   71.902  111.302 1.00 33.42 ? 35   LYS E CE  1 
ATOM   3239 N  NZ  . LYS E  1 35 ? 0.250   72.188  110.107 1.00 36.07 ? 35   LYS E NZ  1 
ATOM   3240 N  N   . LYS E  1 36 ? 6.584   70.229  109.872 1.00 20.91 ? 36   LYS E N   1 
ATOM   3241 C  CA  . LYS E  1 36 ? 7.575   71.279  109.662 1.00 22.72 ? 36   LYS E CA  1 
ATOM   3242 C  C   . LYS E  1 36 ? 8.401   71.010  108.420 1.00 20.48 ? 36   LYS E C   1 
ATOM   3243 O  O   . LYS E  1 36 ? 8.739   71.934  107.702 1.00 19.18 ? 36   LYS E O   1 
ATOM   3244 C  CB  . LYS E  1 36 ? 8.504   71.409  110.883 1.00 23.63 ? 36   LYS E CB  1 
ATOM   3245 C  CG  . LYS E  1 36 ? 7.841   72.098  112.100 1.00 28.21 ? 36   LYS E CG  1 
ATOM   3246 C  CD  . LYS E  1 36 ? 8.831   72.281  113.233 1.00 30.10 ? 36   LYS E CD  1 
ATOM   3247 C  CE  . LYS E  1 36 ? 8.338   73.322  114.260 1.00 34.94 ? 36   LYS E CE  1 
ATOM   3248 N  NZ  . LYS E  1 36 ? 6.938   73.100  114.715 1.00 36.24 ? 36   LYS E NZ  1 
ATOM   3249 N  N   . LEU E  1 37 ? 8.764   69.758  108.192 1.00 19.65 ? 37   LEU E N   1 
ATOM   3250 C  CA  . LEU E  1 37 ? 9.537   69.393  106.994 1.00 18.71 ? 37   LEU E CA  1 
ATOM   3251 C  C   . LEU E  1 37 ? 8.711   69.706  105.734 1.00 20.01 ? 37   LEU E C   1 
ATOM   3252 O  O   . LEU E  1 37 ? 9.192   70.350  104.798 1.00 22.18 ? 37   LEU E O   1 
ATOM   3253 C  CB  . LEU E  1 37 ? 9.935   67.902  107.062 1.00 20.65 ? 37   LEU E CB  1 
ATOM   3254 C  CG  . LEU E  1 37 ? 10.871  67.323  105.995 1.00 20.48 ? 37   LEU E CG  1 
ATOM   3255 C  CD1 . LEU E  1 37 ? 11.520  65.998  106.474 1.00 20.71 ? 37   LEU E CD1 1 
ATOM   3256 C  CD2 . LEU E  1 37 ? 10.101  67.082  104.695 1.00 22.63 ? 37   LEU E CD2 1 
ATOM   3257 N  N   . LEU E  1 38 ? 7.454   69.296  105.706 1.00 20.63 ? 38   LEU E N   1 
ATOM   3258 C  CA  . LEU E  1 38 ? 6.651   69.519  104.488 1.00 21.83 ? 38   LEU E CA  1 
ATOM   3259 C  C   . LEU E  1 38 ? 6.492   71.011  104.229 1.00 22.92 ? 38   LEU E C   1 
ATOM   3260 O  O   . LEU E  1 38 ? 6.626   71.468  103.089 1.00 21.43 ? 38   LEU E O   1 
ATOM   3261 C  CB  . LEU E  1 38 ? 5.273   68.865  104.643 1.00 22.05 ? 38   LEU E CB  1 
ATOM   3262 C  CG  . LEU E  1 38 ? 5.327   67.326  104.599 1.00 22.60 ? 38   LEU E CG  1 
ATOM   3263 C  CD1 . LEU E  1 38 ? 4.073   66.728  105.185 1.00 22.57 ? 38   LEU E CD1 1 
ATOM   3264 C  CD2 . LEU E  1 38 ? 5.518   66.866  103.143 1.00 22.54 ? 38   LEU E CD2 1 
ATOM   3265 N  N   . GLU E  1 39 ? 6.190   71.758  105.295 1.00 21.51 ? 39   GLU E N   1 
ATOM   3266 C  CA  . GLU E  1 39 ? 6.012   73.209  105.218 1.00 25.75 ? 39   GLU E CA  1 
ATOM   3267 C  C   . GLU E  1 39 ? 7.263   73.895  104.688 1.00 23.71 ? 39   GLU E C   1 
ATOM   3268 O  O   . GLU E  1 39 ? 7.173   74.840  103.897 1.00 24.41 ? 39   GLU E O   1 
ATOM   3269 C  CB  . GLU E  1 39 ? 5.623   73.791  106.593 1.00 27.55 ? 39   GLU E CB  1 
ATOM   3270 C  CG  . GLU E  1 39 ? 4.194   73.480  107.031 1.00 33.93 ? 39   GLU E CG  1 
ATOM   3271 C  CD  . GLU E  1 39 ? 3.811   74.132  108.363 1.00 36.59 ? 39   GLU E CD  1 
ATOM   3272 O  OE1 . GLU E  1 39 ? 4.374   75.197  108.690 1.00 43.40 ? 39   GLU E OE1 1 
ATOM   3273 O  OE2 . GLU E  1 39 ? 2.949   73.615  109.111 1.00 40.96 ? 39   GLU E OE2 1 
ATOM   3274 N  N   . THR E  1 40 ? 8.432   73.423  105.090 1.00 22.01 ? 40   THR E N   1 
ATOM   3275 C  CA  . THR E  1 40 ? 9.673   74.128  104.751 1.00 23.62 ? 40   THR E CA  1 
ATOM   3276 C  C   . THR E  1 40 ? 10.342  73.625  103.473 1.00 25.34 ? 40   THR E C   1 
ATOM   3277 O  O   . THR E  1 40 ? 10.970  74.386  102.720 1.00 25.29 ? 40   THR E O   1 
ATOM   3278 C  CB  . THR E  1 40 ? 10.636  73.994  105.948 1.00 26.11 ? 40   THR E CB  1 
ATOM   3279 O  OG1 . THR E  1 40 ? 9.986   74.522  107.119 1.00 29.48 ? 40   THR E OG1 1 
ATOM   3280 C  CG2 . THR E  1 40 ? 11.828  74.908  105.806 1.00 26.69 ? 40   THR E CG2 1 
ATOM   3281 N  N   . GLU E  1 41 ? 10.220  72.332  103.223 1.00 24.18 ? 41   GLU E N   1 
ATOM   3282 C  CA  . GLU E  1 41 ? 11.016  71.695  102.179 1.00 24.16 ? 41   GLU E CA  1 
ATOM   3283 C  C   . GLU E  1 41 ? 10.230  71.317  100.928 1.00 24.02 ? 41   GLU E C   1 
ATOM   3284 O  O   . GLU E  1 41 ? 10.829  70.973  99.913  1.00 24.65 ? 41   GLU E O   1 
ATOM   3285 C  CB  . GLU E  1 41 ? 11.665  70.415  102.737 1.00 24.95 ? 41   GLU E CB  1 
ATOM   3286 C  CG  . GLU E  1 41 ? 12.577  70.592  103.945 1.00 28.54 ? 41   GLU E CG  1 
ATOM   3287 C  CD  . GLU E  1 41 ? 13.885  71.311  103.622 1.00 29.64 ? 41   GLU E CD  1 
ATOM   3288 O  OE1 . GLU E  1 41 ? 14.233  71.458  102.440 1.00 28.94 ? 41   GLU E OE1 1 
ATOM   3289 O  OE2 . GLU E  1 41 ? 14.581  71.747  104.565 1.00 32.33 ? 41   GLU E OE2 1 
ATOM   3290 N  N   . SER E  1 42 ? 8.907   71.325  100.987 1.00 21.90 ? 42   SER E N   1 
ATOM   3291 C  CA  . SER E  1 42 ? 8.124   70.781  99.879  1.00 22.93 ? 42   SER E CA  1 
ATOM   3292 C  C   . SER E  1 42 ? 7.210   71.810  99.236  1.00 22.64 ? 42   SER E C   1 
ATOM   3293 O  O   . SER E  1 42 ? 6.746   72.764  99.911  1.00 23.97 ? 42   SER E O   1 
ATOM   3294 C  CB  . SER E  1 42 ? 7.309   69.564  100.352 1.00 23.88 ? 42   SER E CB  1 
ATOM   3295 O  OG  . SER E  1 42 ? 6.101   69.985  100.961 1.00 26.91 ? 42   SER E OG  1 
ATOM   3296 N  N   . PRO E  1 43 ? 6.896   71.601  97.959  1.00 22.74 ? 43   PRO E N   1 
ATOM   3297 C  CA  . PRO E  1 43 ? 5.979   72.484  97.236  1.00 24.38 ? 43   PRO E CA  1 
ATOM   3298 C  C   . PRO E  1 43 ? 4.510   72.359  97.675  1.00 26.09 ? 43   PRO E C   1 
ATOM   3299 O  O   . PRO E  1 43 ? 4.115   71.366  98.267  1.00 23.27 ? 43   PRO E O   1 
ATOM   3300 C  CB  . PRO E  1 43 ? 6.136   72.055  95.770  1.00 23.05 ? 43   PRO E CB  1 
ATOM   3301 C  CG  . PRO E  1 43 ? 6.729   70.696  95.803  1.00 25.00 ? 43   PRO E CG  1 
ATOM   3302 C  CD  . PRO E  1 43 ? 7.439   70.513  97.103  1.00 22.54 ? 43   PRO E CD  1 
ATOM   3303 N  N   . GLN E  1 44 ? 3.694   73.351  97.348  1.00 28.46 ? 44   GLN E N   1 
ATOM   3304 C  CA  . GLN E  1 44 ? 2.292   73.346  97.752  1.00 30.95 ? 44   GLN E CA  1 
ATOM   3305 C  C   . GLN E  1 44 ? 1.533   72.142  97.216  1.00 29.69 ? 44   GLN E C   1 
ATOM   3306 O  O   . GLN E  1 44 ? 0.609   71.653  97.866  1.00 29.66 ? 44   GLN E O   1 
ATOM   3307 C  CB  . GLN E  1 44 ? 1.579   74.624  97.291  1.00 35.53 ? 44   GLN E CB  1 
ATOM   3308 C  CG  . GLN E  1 44 ? 0.126   74.701  97.768  1.00 40.27 ? 44   GLN E CG  1 
ATOM   3309 C  CD  . GLN E  1 44 ? 0.009   74.767  99.303  1.00 45.17 ? 44   GLN E CD  1 
ATOM   3310 O  OE1 . GLN E  1 44 ? 0.762   75.506  99.959  1.00 47.69 ? 44   GLN E OE1 1 
ATOM   3311 N  NE2 . GLN E  1 44 ? -0.932  74.002  99.875  1.00 45.90 ? 44   GLN E NE2 1 
ATOM   3312 N  N   . TYR E  1 45 ? 1.913   71.653  96.040  1.00 26.99 ? 45   TYR E N   1 
ATOM   3313 C  CA  . TYR E  1 45 ? 1.215   70.507  95.473  1.00 25.81 ? 45   TYR E CA  1 
ATOM   3314 C  C   . TYR E  1 45 ? 1.537   69.210  96.257  1.00 27.21 ? 45   TYR E C   1 
ATOM   3315 O  O   . TYR E  1 45 ? 0.794   68.227  96.212  1.00 28.53 ? 45   TYR E O   1 
ATOM   3316 C  CB  . TYR E  1 45 ? 1.478   70.390  93.958  1.00 27.51 ? 45   TYR E CB  1 
ATOM   3317 C  CG  . TYR E  1 45 ? 2.919   70.145  93.546  1.00 29.31 ? 45   TYR E CG  1 
ATOM   3318 C  CD1 . TYR E  1 45 ? 3.463   68.869  93.608  1.00 28.89 ? 45   TYR E CD1 1 
ATOM   3319 C  CD2 . TYR E  1 45 ? 3.720   71.173  93.054  1.00 28.06 ? 45   TYR E CD2 1 
ATOM   3320 C  CE1 . TYR E  1 45 ? 4.748   68.636  93.224  1.00 27.88 ? 45   TYR E CE1 1 
ATOM   3321 C  CE2 . TYR E  1 45 ? 5.024   70.944  92.657  1.00 28.50 ? 45   TYR E CE2 1 
ATOM   3322 C  CZ  . TYR E  1 45 ? 5.529   69.661  92.742  1.00 27.18 ? 45   TYR E CZ  1 
ATOM   3323 O  OH  . TYR E  1 45 ? 6.816   69.388  92.374  1.00 29.01 ? 45   TYR E OH  1 
ATOM   3324 N  N   . ILE E  1 46 ? 2.633   69.227  97.005  1.00 24.47 ? 46   ILE E N   1 
ATOM   3325 C  CA  . ILE E  1 46 ? 2.937   68.117  97.913  1.00 25.47 ? 46   ILE E CA  1 
ATOM   3326 C  C   . ILE E  1 46 ? 2.294   68.382  99.269  1.00 26.23 ? 46   ILE E C   1 
ATOM   3327 O  O   . ILE E  1 46 ? 1.603   67.517  99.820  1.00 27.82 ? 46   ILE E O   1 
ATOM   3328 C  CB  . ILE E  1 46 ? 4.458   67.949  98.050  1.00 24.03 ? 46   ILE E CB  1 
ATOM   3329 C  CG1 . ILE E  1 46 ? 5.060   67.440  96.729  1.00 24.57 ? 46   ILE E CG1 1 
ATOM   3330 C  CG2 . ILE E  1 46 ? 4.775   66.966  99.205  1.00 24.71 ? 46   ILE E CG2 1 
ATOM   3331 C  CD1 . ILE E  1 46 ? 4.506   66.117  96.290  1.00 22.70 ? 46   ILE E CD1 1 
ATOM   3332 N  N   . ARG E  1 47 ? 2.532   69.573  99.815  1.00 28.00 ? 47   ARG E N   1 
ATOM   3333 C  CA  . ARG E  1 47 ? 1.978   69.963  101.102 1.00 30.99 ? 47   ARG E CA  1 
ATOM   3334 C  C   . ARG E  1 47 ? 0.469   69.781  101.184 1.00 32.09 ? 47   ARG E C   1 
ATOM   3335 O  O   . ARG E  1 47 ? -0.048  69.438  102.235 1.00 31.14 ? 47   ARG E O   1 
ATOM   3336 C  CB  . ARG E  1 47 ? 2.283   71.422  101.398 1.00 33.23 ? 47   ARG E CB  1 
ATOM   3337 C  CG  . ARG E  1 47 ? 3.690   71.655  101.791 1.00 37.38 ? 47   ARG E CG  1 
ATOM   3338 C  CD  . ARG E  1 47 ? 3.913   73.039  102.342 1.00 40.85 ? 47   ARG E CD  1 
ATOM   3339 N  NE  . ARG E  1 47 ? 4.587   73.883  101.374 1.00 44.04 ? 47   ARG E NE  1 
ATOM   3340 C  CZ  . ARG E  1 47 ? 3.972   74.820  100.675 1.00 45.89 ? 47   ARG E CZ  1 
ATOM   3341 N  NH1 . ARG E  1 47 ? 2.670   75.016  100.855 1.00 47.03 ? 47   ARG E NH1 1 
ATOM   3342 N  NH2 . ARG E  1 47 ? 4.657   75.563  99.812  1.00 46.72 ? 47   ARG E NH2 1 
ATOM   3343 N  N   . LYS E  1 48 ? -0.230  70.017  100.077 1.00 33.86 ? 48   LYS E N   1 
ATOM   3344 C  CA  . LYS E  1 48 ? -1.692  70.072  100.101 1.00 36.42 ? 48   LYS E CA  1 
ATOM   3345 C  C   . LYS E  1 48 ? -2.358  68.757  100.491 1.00 35.66 ? 48   LYS E C   1 
ATOM   3346 O  O   . LYS E  1 48 ? -3.530  68.737  100.862 1.00 35.18 ? 48   LYS E O   1 
ATOM   3347 C  CB  . LYS E  1 48 ? -2.240  70.553  98.757  1.00 38.13 ? 48   LYS E CB  1 
ATOM   3348 C  CG  . LYS E  1 48 ? -2.126  69.550  97.644  1.00 40.99 ? 48   LYS E CG  1 
ATOM   3349 C  CD  . LYS E  1 48 ? -2.833  70.056  96.395  1.00 44.31 ? 48   LYS E CD  1 
ATOM   3350 C  CE  . LYS E  1 48 ? -2.303  69.369  95.149  1.00 46.10 ? 48   LYS E CE  1 
ATOM   3351 N  NZ  . LYS E  1 48 ? -2.579  70.220  93.942  1.00 48.49 ? 48   LYS E NZ  1 
ATOM   3352 N  N   . LYS E  1 49 ? -1.613  67.661  100.388 1.00 35.23 ? 49   LYS E N   1 
ATOM   3353 C  CA  . LYS E  1 49 ? -2.117  66.365  100.827 1.00 34.66 ? 49   LYS E CA  1 
ATOM   3354 C  C   . LYS E  1 49 ? -2.463  66.364  102.329 1.00 32.04 ? 49   LYS E C   1 
ATOM   3355 O  O   . LYS E  1 49 ? -3.390  65.678  102.768 1.00 33.09 ? 49   LYS E O   1 
ATOM   3356 C  CB  . LYS E  1 49 ? -1.125  65.261  100.476 1.00 35.88 ? 49   LYS E CB  1 
ATOM   3357 C  CG  . LYS E  1 49 ? -1.512  63.934  101.072 1.00 38.73 ? 49   LYS E CG  1 
ATOM   3358 C  CD  . LYS E  1 49 ? -1.380  62.824  100.060 1.00 41.28 ? 49   LYS E CD  1 
ATOM   3359 C  CE  . LYS E  1 49 ? 0.014   62.270  100.035 1.00 41.50 ? 49   LYS E CE  1 
ATOM   3360 N  NZ  . LYS E  1 49 ? 0.168   61.335  98.875  1.00 41.69 ? 49   LYS E NZ  1 
ATOM   3361 N  N   . GLY E  1 50 ? -1.739  67.173  103.094 1.00 28.85 ? 50   GLY E N   1 
ATOM   3362 C  CA  . GLY E  1 50 ? -1.968  67.323  104.523 1.00 27.19 ? 50   GLY E CA  1 
ATOM   3363 C  C   . GLY E  1 50 ? -0.907  66.515  105.249 1.00 25.59 ? 50   GLY E C   1 
ATOM   3364 O  O   . GLY E  1 50 ? -0.549  65.416  104.811 1.00 24.91 ? 50   GLY E O   1 
ATOM   3365 N  N   . ALA E  1 51 ? -0.385  67.051  106.344 1.00 25.24 ? 51   ALA E N   1 
ATOM   3366 C  CA  . ALA E  1 51 ? 0.726   66.406  107.029 1.00 26.05 ? 51   ALA E CA  1 
ATOM   3367 C  C   . ALA E  1 51 ? 0.326   65.085  107.709 1.00 25.80 ? 51   ALA E C   1 
ATOM   3368 O  O   . ALA E  1 51 ? 1.114   64.144  107.729 1.00 26.22 ? 51   ALA E O   1 
ATOM   3369 C  CB  . ALA E  1 51 ? 1.382   67.366  108.011 1.00 25.96 ? 51   ALA E CB  1 
ATOM   3370 N  N   . ASP E  1 52 ? -0.888  65.000  108.251 1.00 25.54 ? 52   ASP E N   1 
ATOM   3371 C  CA  . ASP E  1 52 ? -1.348  63.746  108.853 1.00 27.23 ? 52   ASP E CA  1 
ATOM   3372 C  C   . ASP E  1 52 ? -1.513  62.643  107.796 1.00 26.27 ? 52   ASP E C   1 
ATOM   3373 O  O   . ASP E  1 52 ? -1.148  61.478  108.029 1.00 24.49 ? 52   ASP E O   1 
ATOM   3374 C  CB  . ASP E  1 52 ? -2.685  63.929  109.591 1.00 32.23 ? 52   ASP E CB  1 
ATOM   3375 C  CG  . ASP E  1 52 ? -2.590  64.864  110.778 1.00 37.75 ? 52   ASP E CG  1 
ATOM   3376 O  OD1 . ASP E  1 52 ? -1.480  65.003  111.354 1.00 39.65 ? 52   ASP E OD1 1 
ATOM   3377 O  OD2 . ASP E  1 52 ? -3.606  65.461  111.231 1.00 39.79 ? 52   ASP E OD2 1 
ATOM   3378 N  N   . VAL E  1 53 ? -2.058  63.005  106.634 1.00 24.46 ? 53   VAL E N   1 
ATOM   3379 C  CA  . VAL E  1 53 ? -2.220  62.027  105.565 1.00 25.33 ? 53   VAL E CA  1 
ATOM   3380 C  C   . VAL E  1 53 ? -0.854  61.511  105.094 1.00 22.77 ? 53   VAL E C   1 
ATOM   3381 O  O   . VAL E  1 53 ? -0.680  60.300  104.884 1.00 22.78 ? 53   VAL E O   1 
ATOM   3382 C  CB  . VAL E  1 53 ? -3.015  62.613  104.367 1.00 27.33 ? 53   VAL E CB  1 
ATOM   3383 C  CG1 . VAL E  1 53 ? -3.066  61.644  103.208 1.00 26.37 ? 53   VAL E CG1 1 
ATOM   3384 C  CG2 . VAL E  1 53 ? -4.407  62.982  104.799 1.00 27.61 ? 53   VAL E CG2 1 
ATOM   3385 N  N   . TRP E  1 54 ? 0.113   62.419  104.937 1.00 21.46 ? 54   TRP E N   1 
ATOM   3386 C  CA  . TRP E  1 54 ? 1.472   62.001  104.591 1.00 18.68 ? 54   TRP E CA  1 
ATOM   3387 C  C   . TRP E  1 54 ? 2.051   61.110  105.683 1.00 20.56 ? 54   TRP E C   1 
ATOM   3388 O  O   . TRP E  1 54 ? 2.635   60.073  105.396 1.00 20.94 ? 54   TRP E O   1 
ATOM   3389 C  CB  . TRP E  1 54 ? 2.419   63.196  104.370 1.00 18.50 ? 54   TRP E CB  1 
ATOM   3390 C  CG  . TRP E  1 54 ? 2.480   63.662  102.932 1.00 19.13 ? 54   TRP E CG  1 
ATOM   3391 C  CD1 . TRP E  1 54 ? 2.045   64.864  102.429 1.00 20.24 ? 54   TRP E CD1 1 
ATOM   3392 C  CD2 . TRP E  1 54 ? 3.001   62.930  101.822 1.00 19.91 ? 54   TRP E CD2 1 
ATOM   3393 N  NE1 . TRP E  1 54 ? 2.244   64.907  101.065 1.00 20.87 ? 54   TRP E NE1 1 
ATOM   3394 C  CE2 . TRP E  1 54 ? 2.840   63.736  100.669 1.00 20.31 ? 54   TRP E CE2 1 
ATOM   3395 C  CE3 . TRP E  1 54 ? 3.567   61.654  101.677 1.00 20.72 ? 54   TRP E CE3 1 
ATOM   3396 C  CZ2 . TRP E  1 54 ? 3.249   63.312  99.395  1.00 21.21 ? 54   TRP E CZ2 1 
ATOM   3397 C  CZ3 . TRP E  1 54 ? 3.972   61.234  100.421 1.00 20.49 ? 54   TRP E CZ3 1 
ATOM   3398 C  CH2 . TRP E  1 54 ? 3.806   62.058  99.301  1.00 21.23 ? 54   TRP E CH2 1 
ATOM   3399 N  N   . PHE E  1 55 ? 1.888   61.512  106.944 1.00 20.11 ? 55   PHE E N   1 
ATOM   3400 C  CA  . PHE E  1 55 ? 2.455   60.733  108.041 1.00 20.84 ? 55   PHE E CA  1 
ATOM   3401 C  C   . PHE E  1 55 ? 1.960   59.272  108.047 1.00 20.39 ? 55   PHE E C   1 
ATOM   3402 O  O   . PHE E  1 55 ? 2.731   58.324  108.245 1.00 22.90 ? 55   PHE E O   1 
ATOM   3403 C  CB  . PHE E  1 55 ? 2.194   61.391  109.401 1.00 20.83 ? 55   PHE E CB  1 
ATOM   3404 C  CG  . PHE E  1 55 ? 3.123   60.889  110.478 1.00 22.34 ? 55   PHE E CG  1 
ATOM   3405 C  CD1 . PHE E  1 55 ? 4.419   61.390  110.595 1.00 22.30 ? 55   PHE E CD1 1 
ATOM   3406 C  CD2 . PHE E  1 55 ? 2.752   59.825  111.281 1.00 24.34 ? 55   PHE E CD2 1 
ATOM   3407 C  CE1 . PHE E  1 55 ? 5.298   60.882  111.533 1.00 21.37 ? 55   PHE E CE1 1 
ATOM   3408 C  CE2 . PHE E  1 55 ? 3.615   59.316  112.249 1.00 22.24 ? 55   PHE E CE2 1 
ATOM   3409 C  CZ  . PHE E  1 55 ? 4.879   59.850  112.387 1.00 24.05 ? 55   PHE E CZ  1 
ATOM   3410 N  N   . LYS E  1 56 ? 0.672   59.089  107.832 1.00 21.10 ? 56   LYS E N   1 
ATOM   3411 C  CA  . LYS E  1 56 ? 0.086   57.760  107.795 1.00 24.48 ? 56   LYS E CA  1 
ATOM   3412 C  C   . LYS E  1 56 ? 0.638   56.947  106.621 1.00 23.82 ? 56   LYS E C   1 
ATOM   3413 O  O   . LYS E  1 56 ? 0.893   55.746  106.727 1.00 22.75 ? 56   LYS E O   1 
ATOM   3414 C  CB  . LYS E  1 56 ? -1.433  57.873  107.716 1.00 27.17 ? 56   LYS E CB  1 
ATOM   3415 C  CG  . LYS E  1 56 ? -2.110  56.520  107.820 1.00 32.24 ? 56   LYS E CG  1 
ATOM   3416 C  CD  . LYS E  1 56 ? -3.605  56.637  107.737 1.00 35.01 ? 56   LYS E CD  1 
ATOM   3417 C  CE  . LYS E  1 56 ? -4.249  55.370  108.241 1.00 38.60 ? 56   LYS E CE  1 
ATOM   3418 N  NZ  . LYS E  1 56 ? -5.690  55.355  107.889 1.00 41.84 ? 56   LYS E NZ  1 
ATOM   3419 N  N   . GLU E  1 57 ? 0.813   57.605  105.487 1.00 21.70 ? 57   GLU E N   1 
ATOM   3420 C  CA  . GLU E  1 57 ? 1.353   56.955  104.317 1.00 23.95 ? 57   GLU E CA  1 
ATOM   3421 C  C   . GLU E  1 57 ? 2.816   56.523  104.500 1.00 22.00 ? 57   GLU E C   1 
ATOM   3422 O  O   . GLU E  1 57 ? 3.240   55.468  103.987 1.00 21.31 ? 57   GLU E O   1 
ATOM   3423 C  CB  . GLU E  1 57 ? 1.214   57.916  103.120 1.00 26.64 ? 57   GLU E CB  1 
ATOM   3424 C  CG  . GLU E  1 57 ? 1.670   57.362  101.806 1.00 33.13 ? 57   GLU E CG  1 
ATOM   3425 C  CD  . GLU E  1 57 ? 1.371   58.306  100.666 1.00 34.47 ? 57   GLU E CD  1 
ATOM   3426 O  OE1 . GLU E  1 57 ? 0.375   59.084  100.769 1.00 34.80 ? 57   GLU E OE1 1 
ATOM   3427 O  OE2 . GLU E  1 57 ? 2.159   58.246  99.695  1.00 37.51 ? 57   GLU E OE2 1 
ATOM   3428 N  N   . LEU E  1 58 ? 3.588   57.317  105.232 1.00 18.36 ? 58   LEU E N   1 
ATOM   3429 C  CA  . LEU E  1 58 ? 5.029   57.105  105.374 1.00 17.71 ? 58   LEU E CA  1 
ATOM   3430 C  C   . LEU E  1 58 ? 5.408   56.178  106.513 1.00 18.37 ? 58   LEU E C   1 
ATOM   3431 O  O   . LEU E  1 58 ? 6.391   55.473  106.423 1.00 18.77 ? 58   LEU E O   1 
ATOM   3432 C  CB  . LEU E  1 58 ? 5.783   58.420  105.578 1.00 18.06 ? 58   LEU E CB  1 
ATOM   3433 C  CG  . LEU E  1 58 ? 5.845   59.407  104.369 1.00 16.72 ? 58   LEU E CG  1 
ATOM   3434 C  CD1 . LEU E  1 58 ? 6.523   60.727  104.749 1.00 19.13 ? 58   LEU E CD1 1 
ATOM   3435 C  CD2 . LEU E  1 58 ? 6.458   58.837  103.045 1.00 17.17 ? 58   LEU E CD2 1 
ATOM   3436 N  N   . ASP E  1 59 ? 4.637   56.206  107.592 1.00 16.94 ? 59   ASP E N   1 
ATOM   3437 C  CA  . ASP E  1 59 ? 4.896   55.330  108.723 1.00 18.06 ? 59   ASP E CA  1 
ATOM   3438 C  C   . ASP E  1 59 ? 4.446   53.878  108.455 1.00 19.64 ? 59   ASP E C   1 
ATOM   3439 O  O   . ASP E  1 59 ? 3.391   53.404  108.898 1.00 16.97 ? 59   ASP E O   1 
ATOM   3440 C  CB  . ASP E  1 59 ? 4.234   55.891  109.965 1.00 17.74 ? 59   ASP E CB  1 
ATOM   3441 C  CG  . ASP E  1 59 ? 4.622   55.121  111.194 1.00 19.76 ? 59   ASP E CG  1 
ATOM   3442 O  OD1 . ASP E  1 59 ? 5.602   54.306  111.118 1.00 14.59 ? 59   ASP E OD1 1 
ATOM   3443 O  OD2 . ASP E  1 59 ? 3.968   55.279  112.253 1.00 20.77 ? 59   ASP E OD2 1 
ATOM   3444 N  N   . ILE E  1 60 ? 5.276   53.158  107.720 1.00 16.44 ? 60   ILE E N   1 
ATOM   3445 C  CA  . ILE E  1 60 ? 4.933   51.818  107.253 1.00 19.14 ? 60   ILE E CA  1 
ATOM   3446 C  C   . ILE E  1 60 ? 4.739   50.807  108.394 1.00 19.18 ? 60   ILE E C   1 
ATOM   3447 O  O   . ILE E  1 60 ? 3.810   49.982  108.335 1.00 19.32 ? 60   ILE E O   1 
ATOM   3448 C  CB  . ILE E  1 60 ? 6.060   51.357  106.331 1.00 14.97 ? 60   ILE E CB  1 
ATOM   3449 C  CG1 . ILE E  1 60 ? 6.111   52.253  105.081 1.00 20.17 ? 60   ILE E CG1 1 
ATOM   3450 C  CG2 . ILE E  1 60 ? 5.903   49.884  105.935 1.00 19.81 ? 60   ILE E CG2 1 
ATOM   3451 C  CD1 . ILE E  1 60 ? 4.830   52.291  104.355 1.00 20.39 ? 60   ILE E CD1 1 
ATOM   3452 N  N   . ASN E  1 61 ? 5.603   50.865  109.414 1.00 17.64 ? 61   ASN E N   1 
ATOM   3453 C  CA  . ASN E  1 61 ? 5.499   49.880  110.507 1.00 15.44 ? 61   ASN E CA  1 
ATOM   3454 C  C   . ASN E  1 61 ? 4.588   50.352  111.641 1.00 17.69 ? 61   ASN E C   1 
ATOM   3455 O  O   . ASN E  1 61 ? 4.512   49.671  112.659 1.00 20.73 ? 61   ASN E O   1 
ATOM   3456 C  CB  . ASN E  1 61 ? 6.861   49.488  111.104 1.00 15.10 ? 61   ASN E CB  1 
ATOM   3457 C  CG  . ASN E  1 61 ? 7.580   50.663  111.718 1.00 17.20 ? 61   ASN E CG  1 
ATOM   3458 O  OD1 . ASN E  1 61 ? 7.297   51.778  111.343 1.00 19.11 ? 61   ASN E OD1 1 
ATOM   3459 N  ND2 . ASN E  1 61 ? 8.494   50.418  112.662 1.00 16.83 ? 61   ASN E ND2 1 
ATOM   3460 N  N   . THR E  1 62 ? 3.907   51.480  111.447 1.00 18.34 ? 62   THR E N   1 
ATOM   3461 C  CA  . THR E  1 62 ? 2.960   52.045  112.412 1.00 20.33 ? 62   THR E CA  1 
ATOM   3462 C  C   . THR E  1 62 ? 3.527   52.150  113.841 1.00 20.92 ? 62   THR E C   1 
ATOM   3463 O  O   . THR E  1 62 ? 2.860   51.753  114.814 1.00 21.70 ? 62   THR E O   1 
ATOM   3464 C  CB  . THR E  1 62 ? 1.593   51.314  112.366 1.00 23.54 ? 62   THR E CB  1 
ATOM   3465 O  OG1 . THR E  1 62 ? 1.762   49.899  112.616 1.00 24.81 ? 62   THR E OG1 1 
ATOM   3466 C  CG2 . THR E  1 62 ? 1.040   51.360  110.942 1.00 23.32 ? 62   THR E CG2 1 
ATOM   3467 N  N   . ASP E  1 63 ? 4.755   52.677  113.946 1.00 20.89 ? 63   ASP E N   1 
ATOM   3468 C  CA  . ASP E  1 63 ? 5.444   52.867  115.230 1.00 19.35 ? 63   ASP E CA  1 
ATOM   3469 C  C   . ASP E  1 63 ? 5.462   54.323  115.676 1.00 20.00 ? 63   ASP E C   1 
ATOM   3470 O  O   . ASP E  1 63 ? 6.044   54.654  116.720 1.00 20.68 ? 63   ASP E O   1 
ATOM   3471 C  CB  . ASP E  1 63 ? 6.858   52.260  115.242 1.00 17.57 ? 63   ASP E CB  1 
ATOM   3472 C  CG  . ASP E  1 63 ? 7.854   53.068  114.427 1.00 20.13 ? 63   ASP E CG  1 
ATOM   3473 O  OD1 . ASP E  1 63 ? 7.450   53.906  113.600 1.00 17.53 ? 63   ASP E OD1 1 
ATOM   3474 O  OD2 . ASP E  1 63 ? 9.081   52.898  114.540 1.00 23.65 ? 63   ASP E OD2 1 
ATOM   3475 N  N   . GLY E  1 64 ? 4.858   55.196  114.874 1.00 20.18 ? 64   GLY E N   1 
ATOM   3476 C  CA  . GLY E  1 64 ? 4.644   56.599  115.280 1.00 21.66 ? 64   GLY E CA  1 
ATOM   3477 C  C   . GLY E  1 64 ? 5.790   57.526  114.930 1.00 20.76 ? 64   GLY E C   1 
ATOM   3478 O  O   . GLY E  1 64 ? 5.870   58.630  115.472 1.00 20.22 ? 64   GLY E O   1 
ATOM   3479 N  N   . ALA E  1 65 ? 6.664   57.086  114.024 1.00 17.71 ? 65   ALA E N   1 
ATOM   3480 C  CA  . ALA E  1 65 ? 7.829   57.856  113.592 1.00 20.16 ? 65   ALA E CA  1 
ATOM   3481 C  C   . ALA E  1 65 ? 8.041   57.555  112.132 1.00 17.64 ? 65   ALA E C   1 
ATOM   3482 O  O   . ALA E  1 65 ? 7.692   56.458  111.675 1.00 18.22 ? 65   ALA E O   1 
ATOM   3483 C  CB  . ALA E  1 65 ? 9.088   57.428  114.337 1.00 20.46 ? 65   ALA E CB  1 
ATOM   3484 N  N   . VAL E  1 66 ? 8.682   58.485  111.426 1.00 18.79 ? 66   VAL E N   1 
ATOM   3485 C  CA  . VAL E  1 66 ? 9.182   58.233  110.092 1.00 19.42 ? 66   VAL E CA  1 
ATOM   3486 C  C   . VAL E  1 66 ? 10.722  58.107  110.156 1.00 17.86 ? 66   VAL E C   1 
ATOM   3487 O  O   . VAL E  1 66 ? 11.397  59.062  110.551 1.00 18.81 ? 66   VAL E O   1 
ATOM   3488 C  CB  . VAL E  1 66 ? 8.799   59.391  109.182 1.00 18.23 ? 66   VAL E CB  1 
ATOM   3489 C  CG1 . VAL E  1 66 ? 9.538   59.299  107.883 1.00 19.09 ? 66   VAL E CG1 1 
ATOM   3490 C  CG2 . VAL E  1 66 ? 7.307   59.418  108.986 1.00 19.96 ? 66   VAL E CG2 1 
ATOM   3491 N  N   . ASN E  1 67 ? 11.254  56.937  109.808 1.00 15.77 ? 67   ASN E N   1 
ATOM   3492 C  CA  . ASN E  1 67 ? 12.705  56.714  109.814 1.00 17.93 ? 67   ASN E CA  1 
ATOM   3493 C  C   . ASN E  1 67 ? 13.254  57.083  108.426 1.00 18.64 ? 67   ASN E C   1 
ATOM   3494 O  O   . ASN E  1 67 ? 12.479  57.534  107.584 1.00 17.64 ? 67   ASN E O   1 
ATOM   3495 C  CB  . ASN E  1 67 ? 13.065  55.294  110.348 1.00 19.29 ? 67   ASN E CB  1 
ATOM   3496 C  CG  . ASN E  1 67 ? 12.744  54.165  109.351 1.00 21.23 ? 67   ASN E CG  1 
ATOM   3497 O  OD1 . ASN E  1 67 ? 12.524  54.407  108.152 1.00 20.13 ? 67   ASN E OD1 1 
ATOM   3498 N  ND2 . ASN E  1 67 ? 12.757  52.914  109.842 1.00 21.01 ? 67   ASN E ND2 1 
ATOM   3499 N  N   . PHE E  1 68 ? 14.564  57.005  108.219 1.00 16.89 ? 68   PHE E N   1 
ATOM   3500 C  CA  . PHE E  1 68 ? 15.175  57.496  106.979 1.00 20.04 ? 68   PHE E CA  1 
ATOM   3501 C  C   . PHE E  1 68 ? 14.642  56.726  105.779 1.00 17.60 ? 68   PHE E C   1 
ATOM   3502 O  O   . PHE E  1 68 ? 14.325  57.308  104.736 1.00 17.20 ? 68   PHE E O   1 
ATOM   3503 C  CB  . PHE E  1 68 ? 16.705  57.404  107.017 1.00 19.99 ? 68   PHE E CB  1 
ATOM   3504 C  CG  . PHE E  1 68 ? 17.354  58.029  105.815 1.00 20.85 ? 68   PHE E CG  1 
ATOM   3505 C  CD1 . PHE E  1 68 ? 17.139  59.368  105.522 1.00 21.34 ? 68   PHE E CD1 1 
ATOM   3506 C  CD2 . PHE E  1 68 ? 18.103  57.273  104.935 1.00 23.28 ? 68   PHE E CD2 1 
ATOM   3507 C  CE1 . PHE E  1 68 ? 17.726  59.978  104.393 1.00 22.84 ? 68   PHE E CE1 1 
ATOM   3508 C  CE2 . PHE E  1 68 ? 18.677  57.858  103.796 1.00 20.99 ? 68   PHE E CE2 1 
ATOM   3509 C  CZ  . PHE E  1 68 ? 18.490  59.211  103.536 1.00 20.62 ? 68   PHE E CZ  1 
ATOM   3510 N  N   . GLN E  1 69 ? 14.456  55.421  105.939 1.00 17.93 ? 69   GLN E N   1 
ATOM   3511 C  CA  . GLN E  1 69 ? 14.003  54.657  104.770 1.00 21.35 ? 69   GLN E CA  1 
ATOM   3512 C  C   . GLN E  1 69 ? 12.556  54.983  104.405 1.00 19.49 ? 69   GLN E C   1 
ATOM   3513 O  O   . GLN E  1 69 ? 12.188  54.993  103.223 1.00 17.98 ? 69   GLN E O   1 
ATOM   3514 C  CB  . GLN E  1 69 ? 14.282  53.167  104.916 1.00 24.73 ? 69   GLN E CB  1 
ATOM   3515 C  CG  . GLN E  1 69 ? 13.542  52.504  106.050 1.00 31.68 ? 69   GLN E CG  1 
ATOM   3516 C  CD  . GLN E  1 69 ? 14.199  51.194  106.452 1.00 36.82 ? 69   GLN E CD  1 
ATOM   3517 O  OE1 . GLN E  1 69 ? 14.927  51.136  107.441 1.00 39.00 ? 69   GLN E OE1 1 
ATOM   3518 N  NE2 . GLN E  1 69 ? 13.964  50.144  105.668 1.00 38.24 ? 69   GLN E NE2 1 
ATOM   3519 N  N   . GLU E  1 70 ? 11.734  55.273  105.413 1.00 16.95 ? 70   GLU E N   1 
ATOM   3520 C  CA  . GLU E  1 70 ? 10.379  55.730  105.178 1.00 17.04 ? 70   GLU E CA  1 
ATOM   3521 C  C   . GLU E  1 70 ? 10.410  57.130  104.544 1.00 20.08 ? 70   GLU E C   1 
ATOM   3522 O  O   . GLU E  1 70 ? 9.610   57.428  103.656 1.00 18.30 ? 70   GLU E O   1 
ATOM   3523 C  CB  . GLU E  1 70 ? 9.568   55.727  106.512 1.00 14.75 ? 70   GLU E CB  1 
ATOM   3524 C  CG  . GLU E  1 70 ? 9.384   54.297  107.036 1.00 14.07 ? 70   GLU E CG  1 
ATOM   3525 C  CD  . GLU E  1 70 ? 8.766   54.228  108.428 1.00 15.19 ? 70   GLU E CD  1 
ATOM   3526 O  OE1 . GLU E  1 70 ? 9.136   55.064  109.270 1.00 16.45 ? 70   GLU E OE1 1 
ATOM   3527 O  OE2 . GLU E  1 70 ? 7.957   53.331  108.734 1.00 18.15 ? 70   GLU E OE2 1 
ATOM   3528 N  N   . PHE E  1 71 ? 11.337  57.975  104.982 1.00 18.45 ? 71   PHE E N   1 
ATOM   3529 C  CA  . PHE E  1 71 ? 11.481  59.313  104.389 1.00 17.61 ? 71   PHE E CA  1 
ATOM   3530 C  C   . PHE E  1 71 ? 11.771  59.220  102.881 1.00 18.83 ? 71   PHE E C   1 
ATOM   3531 O  O   . PHE E  1 71 ? 11.373  60.067  102.052 1.00 17.29 ? 71   PHE E O   1 
ATOM   3532 C  CB  . PHE E  1 71 ? 12.601  60.051  105.148 1.00 18.19 ? 71   PHE E CB  1 
ATOM   3533 C  CG  . PHE E  1 71 ? 13.010  61.355  104.491 1.00 19.84 ? 71   PHE E CG  1 
ATOM   3534 C  CD1 . PHE E  1 71 ? 12.130  62.420  104.468 1.00 17.65 ? 71   PHE E CD1 1 
ATOM   3535 C  CD2 . PHE E  1 71 ? 14.265  61.495  103.942 1.00 19.28 ? 71   PHE E CD2 1 
ATOM   3536 C  CE1 . PHE E  1 71 ? 12.488  63.651  103.897 1.00 21.47 ? 71   PHE E CE1 1 
ATOM   3537 C  CE2 . PHE E  1 71 ? 14.644  62.716  103.339 1.00 19.93 ? 71   PHE E CE2 1 
ATOM   3538 C  CZ  . PHE E  1 71 ? 13.748  63.786  103.339 1.00 18.60 ? 71   PHE E CZ  1 
ATOM   3539 N  N   . LEU E  1 72 ? 12.506  58.191  102.500 1.00 18.01 ? 72   LEU E N   1 
ATOM   3540 C  CA  . LEU E  1 72 ? 12.864  58.069  101.089 1.00 19.03 ? 72   LEU E CA  1 
ATOM   3541 C  C   . LEU E  1 72 ? 11.626  57.839  100.207 1.00 19.82 ? 72   LEU E C   1 
ATOM   3542 O  O   . LEU E  1 72 ? 11.598  58.180  99.019  1.00 19.45 ? 72   LEU E O   1 
ATOM   3543 C  CB  . LEU E  1 72 ? 13.927  56.997  100.913 1.00 21.12 ? 72   LEU E CB  1 
ATOM   3544 C  CG  . LEU E  1 72 ? 15.331  57.409  101.340 1.00 22.21 ? 72   LEU E CG  1 
ATOM   3545 C  CD1 . LEU E  1 72 ? 16.294  56.246  101.213 1.00 23.32 ? 72   LEU E CD1 1 
ATOM   3546 C  CD2 . LEU E  1 72 ? 15.798  58.609  100.484 1.00 22.50 ? 72   LEU E CD2 1 
ATOM   3547 N  N   . ILE E  1 73 ? 10.562  57.299  100.781 1.00 17.37 ? 73   ILE E N   1 
ATOM   3548 C  CA  . ILE E  1 73 ? 9.320   57.202  100.031 1.00 18.21 ? 73   ILE E CA  1 
ATOM   3549 C  C   . ILE E  1 73 ? 8.806   58.593  99.661  1.00 17.17 ? 73   ILE E C   1 
ATOM   3550 O  O   . ILE E  1 73 ? 8.348   58.794  98.535  1.00 19.19 ? 73   ILE E O   1 
ATOM   3551 C  CB  . ILE E  1 73 ? 8.246   56.496  100.877 1.00 20.11 ? 73   ILE E CB  1 
ATOM   3552 C  CG1 . ILE E  1 73 ? 8.672   55.064  101.240 1.00 20.21 ? 73   ILE E CG1 1 
ATOM   3553 C  CG2 . ILE E  1 73 ? 6.900   56.554  100.178 1.00 20.29 ? 73   ILE E CG2 1 
ATOM   3554 C  CD1 . ILE E  1 73 ? 7.640   54.337  102.109 1.00 22.41 ? 73   ILE E CD1 1 
ATOM   3555 N  N   . LEU E  1 74 ? 8.770   59.525  100.624 1.00 16.58 ? 74   LEU E N   1 
ATOM   3556 C  CA  . LEU E  1 74 ? 8.386   60.893  100.280 1.00 16.50 ? 74   LEU E CA  1 
ATOM   3557 C  C   . LEU E  1 74 ? 9.309   61.481  99.225  1.00 19.76 ? 74   LEU E C   1 
ATOM   3558 O  O   . LEU E  1 74 ? 8.873   62.151  98.294  1.00 19.92 ? 74   LEU E O   1 
ATOM   3559 C  CB  . LEU E  1 74 ? 8.429   61.788  101.540 1.00 17.19 ? 74   LEU E CB  1 
ATOM   3560 C  CG  . LEU E  1 74 ? 8.281   63.296  101.310 1.00 17.46 ? 74   LEU E CG  1 
ATOM   3561 C  CD1 . LEU E  1 74 ? 6.944   63.578  100.667 1.00 19.62 ? 74   LEU E CD1 1 
ATOM   3562 C  CD2 . LEU E  1 74 ? 8.464   64.064  102.661 1.00 17.71 ? 74   LEU E CD2 1 
ATOM   3563 N  N   . VAL E  1 75 ? 10.598  61.232  99.353  1.00 18.06 ? 75   VAL E N   1 
ATOM   3564 C  CA  . VAL E  1 75 ? 11.534  61.784  98.388  1.00 18.86 ? 75   VAL E CA  1 
ATOM   3565 C  C   . VAL E  1 75 ? 11.314  61.258  96.965  1.00 19.19 ? 75   VAL E C   1 
ATOM   3566 O  O   . VAL E  1 75 ? 11.444  62.005  95.984  1.00 20.99 ? 75   VAL E O   1 
ATOM   3567 C  CB  . VAL E  1 75 ? 12.960  61.481  98.830  1.00 21.21 ? 75   VAL E CB  1 
ATOM   3568 C  CG1 . VAL E  1 75 ? 13.959  61.904  97.757  1.00 21.13 ? 75   VAL E CG1 1 
ATOM   3569 C  CG2 . VAL E  1 75 ? 13.235  62.179  100.196 1.00 19.34 ? 75   VAL E CG2 1 
ATOM   3570 N  N   . ILE E  1 76 ? 11.063  59.957  96.867  1.00 17.92 ? 76   ILE E N   1 
ATOM   3571 C  CA  . ILE E  1 76 ? 10.684  59.338  95.607  1.00 16.67 ? 76   ILE E CA  1 
ATOM   3572 C  C   . ILE E  1 76 ? 9.421   59.992  95.042  1.00 17.54 ? 76   ILE E C   1 
ATOM   3573 O  O   . ILE E  1 76 ? 9.361   60.371  93.859  1.00 18.72 ? 76   ILE E O   1 
ATOM   3574 C  CB  . ILE E  1 76 ? 10.539  57.795  95.757  1.00 17.17 ? 76   ILE E CB  1 
ATOM   3575 C  CG1 . ILE E  1 76 ? 11.911  57.161  95.962  1.00 21.17 ? 76   ILE E CG1 1 
ATOM   3576 C  CG2 . ILE E  1 76 ? 9.855   57.183  94.517  1.00 16.43 ? 76   ILE E CG2 1 
ATOM   3577 C  CD1 . ILE E  1 76 ? 11.812  55.682  96.467  1.00 21.30 ? 76   ILE E CD1 1 
ATOM   3578 N  N   . LYS E  1 77 ? 8.398   60.122  95.859  1.00 17.46 ? 77   LYS E N   1 
ATOM   3579 C  CA  . LYS E  1 77 ? 7.167   60.687  95.340  1.00 17.37 ? 77   LYS E CA  1 
ATOM   3580 C  C   . LYS E  1 77 ? 7.335   62.146  94.920  1.00 18.66 ? 77   LYS E C   1 
ATOM   3581 O  O   . LYS E  1 77 ? 6.723   62.574  93.933  1.00 18.98 ? 77   LYS E O   1 
ATOM   3582 C  CB  . LYS E  1 77 ? 6.048   60.499  96.370  1.00 19.77 ? 77   LYS E CB  1 
ATOM   3583 C  CG  . LYS E  1 77 ? 5.631   59.034  96.367  1.00 22.29 ? 77   LYS E CG  1 
ATOM   3584 C  CD  . LYS E  1 77 ? 4.434   58.758  97.249  1.00 24.53 ? 77   LYS E CD  1 
ATOM   3585 C  CE  . LYS E  1 77 ? 3.913   57.353  96.874  1.00 25.76 ? 77   LYS E CE  1 
ATOM   3586 N  NZ  . LYS E  1 77 ? 3.301   56.791  98.111  1.00 28.35 ? 77   LYS E NZ  1 
ATOM   3587 N  N   . MET E  1 78 ? 8.121   62.905  95.676  1.00 17.30 ? 78   MET E N   1 
ATOM   3588 C  CA  . MET E  1 78 ? 8.344   64.327  95.373  1.00 19.37 ? 78   MET E CA  1 
ATOM   3589 C  C   . MET E  1 78 ? 9.091   64.461  94.049  1.00 21.15 ? 78   MET E C   1 
ATOM   3590 O  O   . MET E  1 78 ? 8.776   65.350  93.242  1.00 19.97 ? 78   MET E O   1 
ATOM   3591 C  CB  . MET E  1 78 ? 9.172   64.986  96.469  1.00 20.62 ? 78   MET E CB  1 
ATOM   3592 C  CG  . MET E  1 78 ? 8.354   65.283  97.716  1.00 22.29 ? 78   MET E CG  1 
ATOM   3593 S  SD  . MET E  1 78 ? 9.307   66.185  98.967  1.00 24.92 ? 78   MET E SD  1 
ATOM   3594 C  CE  . MET E  1 78 ? 9.733   67.623  97.990  1.00 22.41 ? 78   MET E CE  1 
ATOM   3595 N  N   . GLY E  1 79 ? 10.104  63.614  93.873  1.00 19.49 ? 79   GLY E N   1 
ATOM   3596 C  CA  . GLY E  1 79 ? 10.909  63.575  92.628  1.00 18.41 ? 79   GLY E CA  1 
ATOM   3597 C  C   . GLY E  1 79 ? 10.094  63.252  91.382  1.00 19.91 ? 79   GLY E C   1 
ATOM   3598 O  O   . GLY E  1 79 ? 10.190  63.926  90.319  1.00 17.83 ? 79   GLY E O   1 
ATOM   3599 N  N   . VAL E  1 80 ? 9.295   62.199  91.496  1.00 17.26 ? 80   VAL E N   1 
ATOM   3600 C  CA  . VAL E  1 80 ? 8.371   61.822  90.414  1.00 20.49 ? 80   VAL E CA  1 
ATOM   3601 C  C   . VAL E  1 80 ? 7.384   62.974  90.110  1.00 18.23 ? 80   VAL E C   1 
ATOM   3602 O  O   . VAL E  1 80 ? 7.106   63.262  88.949  1.00 19.69 ? 80   VAL E O   1 
ATOM   3603 C  CB  . VAL E  1 80 ? 7.641   60.479  90.751  1.00 21.73 ? 80   VAL E CB  1 
ATOM   3604 C  CG1 . VAL E  1 80 ? 6.513   60.175  89.752  1.00 23.69 ? 80   VAL E CG1 1 
ATOM   3605 C  CG2 . VAL E  1 80 ? 8.671   59.315  90.821  1.00 18.34 ? 80   VAL E CG2 1 
ATOM   3606 N  N   . ALA E  1 81 ? 6.851   63.635  91.136  1.00 20.08 ? 81   ALA E N   1 
ATOM   3607 C  CA  . ALA E  1 81 ? 5.910   64.728  90.870  1.00 18.19 ? 81   ALA E CA  1 
ATOM   3608 C  C   . ALA E  1 81 ? 6.622   65.938  90.254  1.00 19.12 ? 81   ALA E C   1 
ATOM   3609 O  O   . ALA E  1 81 ? 6.121   66.546  89.310  1.00 21.11 ? 81   ALA E O   1 
ATOM   3610 C  CB  . ALA E  1 81 ? 5.114   65.124  92.169  1.00 16.68 ? 81   ALA E CB  1 
ATOM   3611 N  N   . ALA E  1 82 ? 7.797   66.286  90.768  1.00 18.17 ? 82   ALA E N   1 
ATOM   3612 C  CA  . ALA E  1 82 ? 8.518   67.427  90.211  1.00 17.77 ? 82   ALA E CA  1 
ATOM   3613 C  C   . ALA E  1 82 ? 8.947   67.154  88.763  1.00 19.49 ? 82   ALA E C   1 
ATOM   3614 O  O   . ALA E  1 82 ? 9.072   68.073  87.919  1.00 19.23 ? 82   ALA E O   1 
ATOM   3615 C  CB  . ALA E  1 82 ? 9.717   67.717  91.088  1.00 21.06 ? 82   ALA E CB  1 
ATOM   3616 N  N   . HIS E  1 83 ? 9.177   65.892  88.440  1.00 18.73 ? 83   HIS E N   1 
ATOM   3617 C  CA  . HIS E  1 83 ? 9.634   65.563  87.090  1.00 20.20 ? 83   HIS E CA  1 
ATOM   3618 C  C   . HIS E  1 83 ? 8.485   65.740  86.113  1.00 21.39 ? 83   HIS E C   1 
ATOM   3619 O  O   . HIS E  1 83 ? 8.651   66.272  85.012  1.00 21.42 ? 83   HIS E O   1 
ATOM   3620 C  CB  . HIS E  1 83 ? 10.169  64.136  86.983  1.00 17.21 ? 83   HIS E CB  1 
ATOM   3621 C  CG  . HIS E  1 83 ? 10.402  63.705  85.554  1.00 17.68 ? 83   HIS E CG  1 
ATOM   3622 N  ND1 . HIS E  1 83 ? 9.521   62.892  84.878  1.00 19.42 ? 83   HIS E ND1 1 
ATOM   3623 C  CD2 . HIS E  1 83 ? 11.388  64.005  84.675  1.00 18.71 ? 83   HIS E CD2 1 
ATOM   3624 C  CE1 . HIS E  1 83 ? 9.953   62.709  83.639  1.00 18.91 ? 83   HIS E CE1 1 
ATOM   3625 N  NE2 . HIS E  1 83 ? 11.105  63.347  83.501  1.00 17.94 ? 83   HIS E NE2 1 
ATOM   3626 N  N   . LYS E  1 84 ? 7.317   65.271  86.541  1.00 24.08 ? 84   LYS E N   1 
ATOM   3627 C  CA  . LYS E  1 84 ? 6.095   65.474  85.791  1.00 29.02 ? 84   LYS E CA  1 
ATOM   3628 C  C   . LYS E  1 84 ? 5.844   66.951  85.504  1.00 30.68 ? 84   LYS E C   1 
ATOM   3629 O  O   . LYS E  1 84 ? 5.553   67.315  84.363  1.00 29.84 ? 84   LYS E O   1 
ATOM   3630 C  CB  . LYS E  1 84 ? 4.916   64.940  86.589  1.00 32.06 ? 84   LYS E CB  1 
ATOM   3631 C  CG  . LYS E  1 84 ? 4.233   63.751  85.987  1.00 37.59 ? 84   LYS E CG  1 
ATOM   3632 C  CD  . LYS E  1 84 ? 3.111   63.294  86.891  1.00 41.69 ? 84   LYS E CD  1 
ATOM   3633 C  CE  . LYS E  1 84 ? 1.948   62.727  86.087  1.00 44.96 ? 84   LYS E CE  1 
ATOM   3634 N  NZ  . LYS E  1 84 ? 1.074   61.825  86.908  1.00 46.50 ? 84   LYS E NZ  1 
ATOM   3635 N  N   . LYS E  1 85 ? 5.933   67.788  86.539  1.00 32.72 ? 85   LYS E N   1 
ATOM   3636 C  CA  . LYS E  1 85 ? 5.797   69.241  86.386  1.00 36.10 ? 85   LYS E CA  1 
ATOM   3637 C  C   . LYS E  1 85 ? 6.809   69.849  85.430  1.00 37.38 ? 85   LYS E C   1 
ATOM   3638 O  O   . LYS E  1 85 ? 6.451   70.706  84.620  1.00 37.66 ? 85   LYS E O   1 
ATOM   3639 C  CB  . LYS E  1 85 ? 5.936   69.967  87.730  1.00 37.80 ? 85   LYS E CB  1 
ATOM   3640 C  CG  . LYS E  1 85 ? 4.965   69.518  88.808  1.00 41.46 ? 85   LYS E CG  1 
ATOM   3641 C  CD  . LYS E  1 85 ? 3.655   70.278  88.744  1.00 43.86 ? 85   LYS E CD  1 
ATOM   3642 C  CE  . LYS E  1 85 ? 2.637   69.633  89.668  1.00 45.37 ? 85   LYS E CE  1 
ATOM   3643 N  NZ  . LYS E  1 85 ? 1.299   70.281  89.572  1.00 47.31 ? 85   LYS E NZ  1 
ATOM   3644 N  N   . SER E  1 86 ? 8.069   69.434  85.513  1.00 38.98 ? 86   SER E N   1 
ATOM   3645 C  CA  . SER E  1 86 ? 9.098   70.107  84.730  1.00 43.25 ? 86   SER E CA  1 
ATOM   3646 C  C   . SER E  1 86 ? 8.885   69.917  83.227  1.00 46.64 ? 86   SER E C   1 
ATOM   3647 O  O   . SER E  1 86 ? 9.469   70.628  82.411  1.00 45.41 ? 86   SER E O   1 
ATOM   3648 C  CB  . SER E  1 86 ? 10.510  69.728  85.176  1.00 44.27 ? 86   SER E CB  1 
ATOM   3649 O  OG  . SER E  1 86 ? 10.941  68.556  84.524  1.00 47.26 ? 86   SER E OG  1 
ATOM   3650 N  N   . HIS E  1 87 ? 8.032   68.970  82.857  1.00 50.47 ? 87   HIS E N   1 
ATOM   3651 C  CA  . HIS E  1 87 ? 7.514   68.998  81.494  1.00 55.27 ? 87   HIS E CA  1 
ATOM   3652 C  C   . HIS E  1 87 ? 6.015   68.738  81.394  1.00 56.98 ? 87   HIS E C   1 
ATOM   3653 O  O   . HIS E  1 87 ? 5.575   67.835  80.700  1.00 58.08 ? 87   HIS E O   1 
ATOM   3654 C  CB  . HIS E  1 87 ? 8.339   68.148  80.513  1.00 56.65 ? 87   HIS E CB  1 
ATOM   3655 C  CG  . HIS E  1 87 ? 8.041   66.683  80.570  1.00 58.26 ? 87   HIS E CG  1 
ATOM   3656 N  ND1 . HIS E  1 87 ? 7.994   65.982  81.754  1.00 58.06 ? 87   HIS E ND1 1 
ATOM   3657 C  CD2 . HIS E  1 87 ? 7.787   65.786  79.586  1.00 58.61 ? 87   HIS E CD2 1 
ATOM   3658 C  CE1 . HIS E  1 87 ? 7.706   64.718  81.498  1.00 59.21 ? 87   HIS E CE1 1 
ATOM   3659 N  NE2 . HIS E  1 87 ? 7.577   64.572  80.192  1.00 58.92 ? 87   HIS E NE2 1 
ATOM   3660 N  N   . GLU E  1 88 ? 5.216   69.508  82.113  1.00 62.08 ? 88   GLU E N   1 
ATOM   3661 C  CA  . GLU E  1 88 ? 3.871   69.737  81.630  1.00 65.95 ? 88   GLU E CA  1 
ATOM   3662 C  C   . GLU E  1 88 ? 4.096   70.960  80.759  1.00 68.37 ? 88   GLU E C   1 
ATOM   3663 O  O   . GLU E  1 88 ? 3.182   71.729  80.467  1.00 69.05 ? 88   GLU E O   1 
ATOM   3664 C  CB  . GLU E  1 88 ? 2.908   69.989  82.783  1.00 67.01 ? 88   GLU E CB  1 
ATOM   3665 C  CG  . GLU E  1 88 ? 2.411   68.688  83.391  1.00 68.12 ? 88   GLU E CG  1 
ATOM   3666 C  CD  . GLU E  1 88 ? 1.812   68.879  84.764  1.00 69.03 ? 88   GLU E CD  1 
ATOM   3667 O  OE1 . GLU E  1 88 ? 1.680   70.045  85.200  1.00 69.80 ? 88   GLU E OE1 1 
ATOM   3668 O  OE2 . GLU E  1 88 ? 1.477   67.857  85.404  1.00 69.46 ? 88   GLU E OE2 1 
ATOM   3669 N  N   . GLU E  1 89 ? 5.358   71.080  80.341  1.00 70.77 ? 89   GLU E N   1 
ATOM   3670 C  CA  . GLU E  1 89 ? 5.928   72.251  79.681  1.00 72.38 ? 89   GLU E CA  1 
ATOM   3671 C  C   . GLU E  1 89 ? 6.974   71.812  78.652  1.00 72.42 ? 89   GLU E C   1 
ATOM   3672 O  O   . GLU E  1 89 ? 7.991   71.200  78.996  1.00 71.60 ? 89   GLU E O   1 
ATOM   3673 C  CB  . GLU E  1 89 ? 6.597   73.156  80.719  1.00 73.17 ? 89   GLU E CB  1 
ATOM   3674 C  CG  . GLU E  1 89 ? 5.871   73.207  82.054  1.00 74.15 ? 89   GLU E CG  1 
ATOM   3675 C  CD  . GLU E  1 89 ? 6.731   73.775  83.165  1.00 74.89 ? 89   GLU E CD  1 
ATOM   3676 O  OE1 . GLU E  1 89 ? 7.974   73.710  83.051  1.00 75.31 ? 89   GLU E OE1 1 
ATOM   3677 O  OE2 . GLU E  1 89 ? 6.162   74.288  84.152  1.00 75.65 ? 89   GLU E OE2 1 
ATOM   3678 N  N   . MET F  1 1  ? 24.993  26.316  109.657 1.00 44.72 ? 1    MET F N   1 
ATOM   3679 C  CA  . MET F  1 1  ? 23.561  26.167  110.035 1.00 44.29 ? 1    MET F CA  1 
ATOM   3680 C  C   . MET F  1 1  ? 22.955  27.541  110.265 1.00 37.93 ? 1    MET F C   1 
ATOM   3681 O  O   . MET F  1 1  ? 23.246  28.172  111.274 1.00 38.22 ? 1    MET F O   1 
ATOM   3682 C  CB  . MET F  1 1  ? 23.420  25.358  111.323 1.00 46.44 ? 1    MET F CB  1 
ATOM   3683 C  CG  . MET F  1 1  ? 22.993  23.909  111.128 1.00 50.25 ? 1    MET F CG  1 
ATOM   3684 S  SD  . MET F  1 1  ? 22.153  23.253  112.588 1.00 52.96 ? 1    MET F SD  1 
ATOM   3685 C  CE  . MET F  1 1  ? 23.271  23.652  113.939 1.00 52.37 ? 1    MET F CE  1 
ATOM   3686 N  N   . LEU F  1 2  ? 22.119  28.001  109.342 1.00 31.28 ? 2    LEU F N   1 
ATOM   3687 C  CA  . LEU F  1 2  ? 21.274  29.162  109.624 1.00 26.68 ? 2    LEU F CA  1 
ATOM   3688 C  C   . LEU F  1 2  ? 20.269  28.794  110.702 1.00 23.44 ? 2    LEU F C   1 
ATOM   3689 O  O   . LEU F  1 2  ? 19.873  27.642  110.807 1.00 20.66 ? 2    LEU F O   1 
ATOM   3690 C  CB  . LEU F  1 2  ? 20.519  29.580  108.374 1.00 27.11 ? 2    LEU F CB  1 
ATOM   3691 C  CG  . LEU F  1 2  ? 21.033  30.741  107.516 1.00 29.34 ? 2    LEU F CG  1 
ATOM   3692 C  CD1 . LEU F  1 2  ? 22.508  31.068  107.637 1.00 27.98 ? 2    LEU F CD1 1 
ATOM   3693 C  CD2 . LEU F  1 2  ? 20.571  30.619  106.066 1.00 27.23 ? 2    LEU F CD2 1 
ATOM   3694 N  N   . THR F  1 3  ? 19.839  29.774  111.490 1.00 21.65 ? 3    THR F N   1 
ATOM   3695 C  CA  . THR F  1 3  ? 18.816  29.556  112.499 1.00 20.14 ? 3    THR F CA  1 
ATOM   3696 C  C   . THR F  1 3  ? 17.428  29.526  111.863 1.00 18.68 ? 3    THR F C   1 
ATOM   3697 O  O   . THR F  1 3  ? 17.250  29.924  110.711 1.00 19.10 ? 3    THR F O   1 
ATOM   3698 C  CB  . THR F  1 3  ? 18.868  30.694  113.554 1.00 21.80 ? 3    THR F CB  1 
ATOM   3699 O  OG1 . THR F  1 3  ? 18.436  31.929  112.931 1.00 19.41 ? 3    THR F OG1 1 
ATOM   3700 C  CG2 . THR F  1 3  ? 20.325  30.942  113.991 1.00 22.23 ? 3    THR F CG2 1 
ATOM   3701 N  N   . GLU F  1 4  ? 16.413  29.112  112.613 1.00 17.92 ? 4    GLU F N   1 
ATOM   3702 C  CA  . GLU F  1 4  ? 15.052  29.126  112.060 1.00 18.24 ? 4    GLU F CA  1 
ATOM   3703 C  C   . GLU F  1 4  ? 14.580  30.541  111.698 1.00 17.18 ? 4    GLU F C   1 
ATOM   3704 O  O   . GLU F  1 4  ? 13.823  30.742  110.733 1.00 16.51 ? 4    GLU F O   1 
ATOM   3705 C  CB  . GLU F  1 4  ? 14.096  28.429  113.032 1.00 19.84 ? 4    GLU F CB  1 
ATOM   3706 C  CG  . GLU F  1 4  ? 14.325  26.926  113.047 1.00 22.50 ? 4    GLU F CG  1 
ATOM   3707 C  CD  . GLU F  1 4  ? 14.329  26.304  111.652 1.00 25.06 ? 4    GLU F CD  1 
ATOM   3708 O  OE1 . GLU F  1 4  ? 15.402  25.787  111.242 1.00 26.06 ? 4    GLU F OE1 1 
ATOM   3709 O  OE2 . GLU F  1 4  ? 13.297  26.342  110.943 1.00 25.26 ? 4    GLU F OE2 1 
ATOM   3710 N  N   . LEU F  1 5  ? 15.026  31.532  112.467 1.00 15.54 ? 5    LEU F N   1 
ATOM   3711 C  CA  . LEU F  1 5  ? 14.668  32.933  112.170 1.00 19.22 ? 5    LEU F CA  1 
ATOM   3712 C  C   . LEU F  1 5  ? 15.305  33.399  110.871 1.00 18.00 ? 5    LEU F C   1 
ATOM   3713 O  O   . LEU F  1 5  ? 14.644  33.993  110.036 1.00 16.39 ? 5    LEU F O   1 
ATOM   3714 C  CB  . LEU F  1 5  ? 15.186  33.878  113.261 1.00 18.52 ? 5    LEU F CB  1 
ATOM   3715 C  CG  . LEU F  1 5  ? 14.464  35.198  113.615 1.00 22.90 ? 5    LEU F CG  1 
ATOM   3716 C  CD1 . LEU F  1 5  ? 15.360  36.295  114.183 1.00 19.22 ? 5    LEU F CD1 1 
ATOM   3717 C  CD2 . LEU F  1 5  ? 13.509  35.713  112.675 1.00 16.88 ? 5    LEU F CD2 1 
ATOM   3718 N  N   . GLU F  1 6  ? 16.601  33.142  110.735 1.00 19.03 ? 6    GLU F N   1 
ATOM   3719 C  CA  . GLU F  1 6  ? 17.322  33.486  109.524 1.00 18.92 ? 6    GLU F CA  1 
ATOM   3720 C  C   . GLU F  1 6  ? 16.733  32.836  108.268 1.00 19.68 ? 6    GLU F C   1 
ATOM   3721 O  O   . GLU F  1 6  ? 16.696  33.464  107.194 1.00 17.72 ? 6    GLU F O   1 
ATOM   3722 C  CB  . GLU F  1 6  ? 18.821  33.160  109.686 1.00 19.87 ? 6    GLU F CB  1 
ATOM   3723 C  CG  . GLU F  1 6  ? 19.482  34.128  110.660 1.00 19.98 ? 6    GLU F CG  1 
ATOM   3724 C  CD  . GLU F  1 6  ? 20.847  33.672  111.164 1.00 21.95 ? 6    GLU F CD  1 
ATOM   3725 O  OE1 . GLU F  1 6  ? 21.551  34.517  111.755 1.00 22.44 ? 6    GLU F OE1 1 
ATOM   3726 O  OE2 . GLU F  1 6  ? 21.211  32.475  111.029 1.00 20.15 ? 6    GLU F OE2 1 
ATOM   3727 N  N   . LYS F  1 7  ? 16.338  31.572  108.399 1.00 18.45 ? 7    LYS F N   1 
ATOM   3728 C  CA  . LYS F  1 7  ? 15.731  30.815  107.304 1.00 19.28 ? 7    LYS F CA  1 
ATOM   3729 C  C   . LYS F  1 7  ? 14.383  31.409  106.960 1.00 17.46 ? 7    LYS F C   1 
ATOM   3730 O  O   . LYS F  1 7  ? 14.010  31.437  105.808 1.00 17.65 ? 7    LYS F O   1 
ATOM   3731 C  CB  . LYS F  1 7  ? 15.641  29.318  107.654 1.00 20.75 ? 7    LYS F CB  1 
ATOM   3732 C  CG  . LYS F  1 7  ? 16.975  28.587  107.523 1.00 24.74 ? 7    LYS F CG  1 
ATOM   3733 C  CD  . LYS F  1 7  ? 17.011  27.211  108.185 1.00 29.51 ? 7    LYS F CD  1 
ATOM   3734 C  CE  . LYS F  1 7  ? 15.827  26.342  107.843 1.00 33.54 ? 7    LYS F CE  1 
ATOM   3735 N  NZ  . LYS F  1 7  ? 15.923  25.028  108.596 1.00 37.66 ? 7    LYS F NZ  1 
ATOM   3736 N  N   . ALA F  1 8  ? 13.654  31.938  107.942 1.00 16.44 ? 8    ALA F N   1 
ATOM   3737 C  CA  . ALA F  1 8  ? 12.366  32.558  107.653 1.00 15.51 ? 8    ALA F CA  1 
ATOM   3738 C  C   . ALA F  1 8  ? 12.549  33.849  106.850 1.00 18.78 ? 8    ALA F C   1 
ATOM   3739 O  O   . ALA F  1 8  ? 11.770  34.128  105.936 1.00 17.35 ? 8    ALA F O   1 
ATOM   3740 C  CB  . ALA F  1 8  ? 11.550  32.831  108.986 1.00 15.30 ? 8    ALA F CB  1 
ATOM   3741 N  N   . LEU F  1 9  ? 13.578  34.620  107.204 1.00 17.67 ? 9    LEU F N   1 
ATOM   3742 C  CA  . LEU F  1 9  ? 13.963  35.843  106.484 1.00 19.59 ? 9    LEU F CA  1 
ATOM   3743 C  C   . LEU F  1 9  ? 14.359  35.511  105.048 1.00 18.48 ? 9    LEU F C   1 
ATOM   3744 O  O   . LEU F  1 9  ? 13.866  36.141  104.097 1.00 18.26 ? 9    LEU F O   1 
ATOM   3745 C  CB  . LEU F  1 9  ? 15.099  36.590  107.210 1.00 16.03 ? 9    LEU F CB  1 
ATOM   3746 C  CG  . LEU F  1 9  ? 14.709  37.071  108.627 1.00 19.14 ? 9    LEU F CG  1 
ATOM   3747 C  CD1 . LEU F  1 9  ? 15.816  37.933  109.181 1.00 21.90 ? 9    LEU F CD1 1 
ATOM   3748 C  CD2 . LEU F  1 9  ? 13.369  37.821  108.644 1.00 19.79 ? 9    LEU F CD2 1 
ATOM   3749 N  N   . ASN F  1 10 ? 15.172  34.471  104.867 1.00 18.89 ? 10   ASN F N   1 
ATOM   3750 C  CA  . ASN F  1 10 ? 15.531  34.101  103.494 1.00 19.30 ? 10   ASN F CA  1 
ATOM   3751 C  C   . ASN F  1 10 ? 14.330  33.642  102.656 1.00 19.48 ? 10   ASN F C   1 
ATOM   3752 O  O   . ASN F  1 10 ? 14.240  33.898  101.437 1.00 19.53 ? 10   ASN F O   1 
ATOM   3753 C  CB  . ASN F  1 10 ? 16.629  33.045  103.480 1.00 21.86 ? 10   ASN F CB  1 
ATOM   3754 C  CG  . ASN F  1 10 ? 18.002  33.646  103.678 1.00 24.51 ? 10   ASN F CG  1 
ATOM   3755 O  OD1 . ASN F  1 10 ? 18.185  34.856  103.533 1.00 28.32 ? 10   ASN F OD1 1 
ATOM   3756 N  ND2 . ASN F  1 10 ? 18.966  32.815  104.071 1.00 25.98 ? 10   ASN F ND2 1 
ATOM   3757 N  N   . SER F  1 11 ? 13.391  32.984  103.329 1.00 19.44 ? 11   SER F N   1 
ATOM   3758 C  CA  . SER F  1 11 ? 12.227  32.415  102.666 1.00 18.32 ? 11   SER F CA  1 
ATOM   3759 C  C   . SER F  1 11 ? 11.296  33.520  102.189 1.00 18.70 ? 11   SER F C   1 
ATOM   3760 O  O   . SER F  1 11 ? 10.623  33.337  101.190 1.00 18.02 ? 11   SER F O   1 
ATOM   3761 C  CB  . SER F  1 11 ? 11.513  31.445  103.619 1.00 19.84 ? 11   SER F CB  1 
ATOM   3762 O  OG  . SER F  1 11 ? 10.239  31.047  103.121 1.00 21.84 ? 11   SER F OG  1 
ATOM   3763 N  N   . ILE F  1 12 ? 11.234  34.653  102.904 1.00 18.30 ? 12   ILE F N   1 
ATOM   3764 C  CA  . ILE F  1 12 ? 10.527  35.837  102.369 1.00 17.85 ? 12   ILE F CA  1 
ATOM   3765 C  C   . ILE F  1 12 ? 11.016  36.251  100.967 1.00 17.85 ? 12   ILE F C   1 
ATOM   3766 O  O   . ILE F  1 12 ? 10.241  36.662  100.097 1.00 18.33 ? 12   ILE F O   1 
ATOM   3767 C  CB  . ILE F  1 12 ? 10.612  36.990  103.387 1.00 18.48 ? 12   ILE F CB  1 
ATOM   3768 C  CG1 . ILE F  1 12 ? 9.730   36.597  104.576 1.00 18.69 ? 12   ILE F CG1 1 
ATOM   3769 C  CG2 . ILE F  1 12 ? 10.168  38.346  102.770 1.00 18.60 ? 12   ILE F CG2 1 
ATOM   3770 C  CD1 . ILE F  1 12 ? 9.945   37.441  105.865 1.00 20.22 ? 12   ILE F CD1 1 
ATOM   3771 N  N   . ILE F  1 13 ? 12.320  36.180  100.769 1.00 17.42 ? 13   ILE F N   1 
ATOM   3772 C  CA  . ILE F  1 13 ? 12.890  36.466  99.455  1.00 18.02 ? 13   ILE F CA  1 
ATOM   3773 C  C   . ILE F  1 13 ? 12.359  35.439  98.432  1.00 20.30 ? 13   ILE F C   1 
ATOM   3774 O  O   . ILE F  1 13 ? 11.969  35.817  97.323  1.00 19.69 ? 13   ILE F O   1 
ATOM   3775 C  CB  . ILE F  1 13 ? 14.439  36.432  99.506  1.00 19.30 ? 13   ILE F CB  1 
ATOM   3776 C  CG1 . ILE F  1 13 ? 14.977  37.457  100.517 1.00 20.93 ? 13   ILE F CG1 1 
ATOM   3777 C  CG2 . ILE F  1 13 ? 15.010  36.669  98.120  1.00 19.57 ? 13   ILE F CG2 1 
ATOM   3778 C  CD1 . ILE F  1 13 ? 16.513  37.391  100.674 1.00 21.92 ? 13   ILE F CD1 1 
ATOM   3779 N  N   . ASP F  1 14 ? 12.263  34.158  98.819  1.00 18.71 ? 14   ASP F N   1 
ATOM   3780 C  CA  . ASP F  1 14 ? 11.809  33.085  97.909  1.00 18.92 ? 14   ASP F CA  1 
ATOM   3781 C  C   . ASP F  1 14 ? 10.345  33.283  97.539  1.00 18.96 ? 14   ASP F C   1 
ATOM   3782 O  O   . ASP F  1 14 ? 9.935   33.006  96.415  1.00 18.28 ? 14   ASP F O   1 
ATOM   3783 C  CB  . ASP F  1 14 ? 11.877  31.691  98.574  1.00 21.60 ? 14   ASP F CB  1 
ATOM   3784 C  CG  . ASP F  1 14 ? 13.301  31.195  98.774  1.00 24.59 ? 14   ASP F CG  1 
ATOM   3785 O  OD1 . ASP F  1 14 ? 14.238  31.696  98.103  1.00 25.63 ? 14   ASP F OD1 1 
ATOM   3786 O  OD2 . ASP F  1 14 ? 13.557  30.264  99.570  1.00 27.68 ? 14   ASP F OD2 1 
ATOM   3787 N  N   . VAL F  1 15 ? 9.545   33.725  98.503  1.00 17.00 ? 15   VAL F N   1 
ATOM   3788 C  CA  . VAL F  1 15 ? 8.169   34.053  98.186  1.00 16.82 ? 15   VAL F CA  1 
ATOM   3789 C  C   . VAL F  1 15 ? 8.102   35.131  97.100  1.00 17.15 ? 15   VAL F C   1 
ATOM   3790 O  O   . VAL F  1 15 ? 7.369   34.987  96.134  1.00 17.48 ? 15   VAL F O   1 
ATOM   3791 C  CB  . VAL F  1 15 ? 7.421   34.529  99.432  1.00 17.93 ? 15   VAL F CB  1 
ATOM   3792 C  CG1 . VAL F  1 15 ? 6.008   34.992  99.107  1.00 20.04 ? 15   VAL F CG1 1 
ATOM   3793 C  CG2 . VAL F  1 15 ? 7.308   33.336  100.409 1.00 19.39 ? 15   VAL F CG2 1 
ATOM   3794 N  N   . TYR F  1 16 ? 8.829   36.213  97.292  1.00 14.87 ? 16   TYR F N   1 
ATOM   3795 C  CA  . TYR F  1 16 ? 8.881   37.232  96.242  1.00 16.46 ? 16   TYR F CA  1 
ATOM   3796 C  C   . TYR F  1 16 ? 9.275   36.606  94.872  1.00 17.78 ? 16   TYR F C   1 
ATOM   3797 O  O   . TYR F  1 16 ? 8.614   36.861  93.862  1.00 16.65 ? 16   TYR F O   1 
ATOM   3798 C  CB  . TYR F  1 16 ? 9.807   38.388  96.654  1.00 17.72 ? 16   TYR F CB  1 
ATOM   3799 C  CG  . TYR F  1 16 ? 9.874   39.477  95.562  1.00 17.81 ? 16   TYR F CG  1 
ATOM   3800 C  CD1 . TYR F  1 16 ? 8.853   40.417  95.431  1.00 18.43 ? 16   TYR F CD1 1 
ATOM   3801 C  CD2 . TYR F  1 16 ? 10.942  39.557  94.698  1.00 17.30 ? 16   TYR F CD2 1 
ATOM   3802 C  CE1 . TYR F  1 16 ? 8.905   41.416  94.423  1.00 18.15 ? 16   TYR F CE1 1 
ATOM   3803 C  CE2 . TYR F  1 16 ? 10.994  40.498  93.690  1.00 19.19 ? 16   TYR F CE2 1 
ATOM   3804 C  CZ  . TYR F  1 16 ? 9.993   41.428  93.556  1.00 18.92 ? 16   TYR F CZ  1 
ATOM   3805 O  OH  . TYR F  1 16 ? 10.094  42.356  92.521  1.00 19.21 ? 16   TYR F OH  1 
ATOM   3806 N  N   . HIS F  1 17 ? 10.358  35.836  94.824  1.00 18.41 ? 17   HIS F N   1 
ATOM   3807 C  CA  . HIS F  1 17 ? 10.812  35.254  93.556  1.00 18.71 ? 17   HIS F CA  1 
ATOM   3808 C  C   . HIS F  1 17 ? 9.839   34.330  92.844  1.00 20.88 ? 17   HIS F C   1 
ATOM   3809 O  O   . HIS F  1 17 ? 9.870   34.197  91.594  1.00 18.57 ? 17   HIS F O   1 
ATOM   3810 C  CB  . HIS F  1 17 ? 12.160  34.566  93.692  1.00 20.44 ? 17   HIS F CB  1 
ATOM   3811 C  CG  . HIS F  1 17 ? 13.284  35.528  93.869  1.00 21.81 ? 17   HIS F CG  1 
ATOM   3812 N  ND1 . HIS F  1 17 ? 14.405  35.233  94.610  1.00 22.83 ? 17   HIS F ND1 1 
ATOM   3813 C  CD2 . HIS F  1 17 ? 13.431  36.808  93.453  1.00 25.95 ? 17   HIS F CD2 1 
ATOM   3814 C  CE1 . HIS F  1 17 ? 15.217  36.276  94.610  1.00 25.51 ? 17   HIS F CE1 1 
ATOM   3815 N  NE2 . HIS F  1 17 ? 14.645  37.251  93.925  1.00 25.61 ? 17   HIS F NE2 1 
ATOM   3816 N  N   . LYS F  1 18 ? 9.041   33.631  93.632  1.00 20.65 ? 18   LYS F N   1 
ATOM   3817 C  CA  . LYS F  1 18 ? 7.977   32.821  93.049  1.00 24.19 ? 18   LYS F CA  1 
ATOM   3818 C  C   . LYS F  1 18 ? 7.094   33.618  92.107  1.00 22.30 ? 18   LYS F C   1 
ATOM   3819 O  O   . LYS F  1 18 ? 6.571   33.073  91.116  1.00 22.72 ? 18   LYS F O   1 
ATOM   3820 C  CB  . LYS F  1 18 ? 7.054   32.235  94.103  1.00 27.39 ? 18   LYS F CB  1 
ATOM   3821 C  CG  . LYS F  1 18 ? 7.597   31.052  94.872  1.00 34.79 ? 18   LYS F CG  1 
ATOM   3822 C  CD  . LYS F  1 18 ? 6.461   30.319  95.619  1.00 34.49 ? 18   LYS F CD  1 
ATOM   3823 C  CE  . LYS F  1 18 ? 6.224   30.849  97.019  1.00 38.53 ? 18   LYS F CE  1 
ATOM   3824 N  NZ  . LYS F  1 18 ? 5.286   30.008  97.862  1.00 37.67 ? 18   LYS F NZ  1 
ATOM   3825 N  N   . TYR F  1 19 ? 6.918   34.896  92.405  1.00 18.95 ? 19   TYR F N   1 
ATOM   3826 C  CA  . TYR F  1 19 ? 6.009   35.755  91.637  1.00 18.98 ? 19   TYR F CA  1 
ATOM   3827 C  C   . TYR F  1 19 ? 6.730   36.675  90.691  1.00 16.46 ? 19   TYR F C   1 
ATOM   3828 O  O   . TYR F  1 19 ? 6.175   36.985  89.631  1.00 17.80 ? 19   TYR F O   1 
ATOM   3829 C  CB  . TYR F  1 19 ? 5.059   36.575  92.547  1.00 19.42 ? 19   TYR F CB  1 
ATOM   3830 C  CG  . TYR F  1 19 ? 4.220   35.624  93.360  1.00 22.28 ? 19   TYR F CG  1 
ATOM   3831 C  CD1 . TYR F  1 19 ? 3.071   35.047  92.830  1.00 19.47 ? 19   TYR F CD1 1 
ATOM   3832 C  CD2 . TYR F  1 19 ? 4.621   35.249  94.643  1.00 22.43 ? 19   TYR F CD2 1 
ATOM   3833 C  CE1 . TYR F  1 19 ? 2.353   34.107  93.539  1.00 22.63 ? 19   TYR F CE1 1 
ATOM   3834 C  CE2 . TYR F  1 19 ? 3.895   34.340  95.370  1.00 23.01 ? 19   TYR F CE2 1 
ATOM   3835 C  CZ  . TYR F  1 19 ? 2.768   33.774  94.819  1.00 23.33 ? 19   TYR F CZ  1 
ATOM   3836 O  OH  . TYR F  1 19 ? 2.097   32.862  95.586  1.00 23.66 ? 19   TYR F OH  1 
ATOM   3837 N  N   . SER F  1 20 ? 7.933   37.117  91.064  1.00 14.84 ? 20   SER F N   1 
ATOM   3838 C  CA  . SER F  1 20 ? 8.716   37.990  90.179  1.00 17.86 ? 20   SER F CA  1 
ATOM   3839 C  C   . SER F  1 20 ? 9.283   37.239  88.969  1.00 18.49 ? 20   SER F C   1 
ATOM   3840 O  O   . SER F  1 20 ? 9.619   37.842  87.945  1.00 16.03 ? 20   SER F O   1 
ATOM   3841 C  CB  . SER F  1 20 ? 9.808   38.686  90.974  1.00 16.57 ? 20   SER F CB  1 
ATOM   3842 O  OG  . SER F  1 20 ? 10.895  37.816  91.190  1.00 19.09 ? 20   SER F OG  1 
ATOM   3843 N  N   . LEU F  1 21 ? 9.429   35.921  89.089  1.00 19.69 ? 21   LEU F N   1 
ATOM   3844 C  CA  . LEU F  1 21 ? 9.887   35.114  87.937  1.00 20.80 ? 21   LEU F CA  1 
ATOM   3845 C  C   . LEU F  1 21 ? 8.764   34.694  86.963  1.00 19.34 ? 21   LEU F C   1 
ATOM   3846 O  O   . LEU F  1 21 ? 9.014   34.093  85.910  1.00 17.41 ? 21   LEU F O   1 
ATOM   3847 C  CB  . LEU F  1 21 ? 10.720  33.911  88.426  1.00 20.46 ? 21   LEU F CB  1 
ATOM   3848 C  CG  . LEU F  1 21 ? 12.243  34.133  88.502  1.00 20.80 ? 21   LEU F CG  1 
ATOM   3849 C  CD1 . LEU F  1 21 ? 12.618  35.203  89.509  1.00 18.32 ? 21   LEU F CD1 1 
ATOM   3850 C  CD2 . LEU F  1 21 ? 13.030  32.894  88.864  1.00 21.80 ? 21   LEU F CD2 1 
ATOM   3851 N  N   . ILE F  1 22 ? 7.516   35.022  87.273  1.00 17.84 ? 22   ILE F N   1 
ATOM   3852 C  CA  . ILE F  1 22 ? 6.436   34.683  86.348  1.00 16.97 ? 22   ILE F CA  1 
ATOM   3853 C  C   . ILE F  1 22 ? 6.640   35.223  84.931  1.00 19.00 ? 22   ILE F C   1 
ATOM   3854 O  O   . ILE F  1 22 ? 6.502   34.493  83.941  1.00 20.30 ? 22   ILE F O   1 
ATOM   3855 C  CB  . ILE F  1 22 ? 5.072   35.115  86.908  1.00 18.19 ? 22   ILE F CB  1 
ATOM   3856 C  CG1 . ILE F  1 22 ? 4.702   34.233  88.092  1.00 18.17 ? 22   ILE F CG1 1 
ATOM   3857 C  CG2 . ILE F  1 22 ? 3.990   35.007  85.839  1.00 20.25 ? 22   ILE F CG2 1 
ATOM   3858 C  CD1 . ILE F  1 22 ? 3.453   34.744  88.879  1.00 19.56 ? 22   ILE F CD1 1 
ATOM   3859 N  N   . LYS F  1 23 ? 6.937   36.505  84.818  1.00 18.06 ? 23   LYS F N   1 
ATOM   3860 C  CA  . LYS F  1 23 ? 7.157   37.064  83.488  1.00 20.30 ? 23   LYS F CA  1 
ATOM   3861 C  C   . LYS F  1 23 ? 7.984   38.328  83.539  1.00 19.11 ? 23   LYS F C   1 
ATOM   3862 O  O   . LYS F  1 23 ? 8.173   38.904  84.616  1.00 16.84 ? 23   LYS F O   1 
ATOM   3863 C  CB  . LYS F  1 23 ? 5.814   37.355  82.815  1.00 21.08 ? 23   LYS F CB  1 
ATOM   3864 C  CG  . LYS F  1 23 ? 4.985   38.447  83.467  1.00 24.17 ? 23   LYS F CG  1 
ATOM   3865 C  CD  . LYS F  1 23 ? 3.690   38.634  82.667  1.00 28.18 ? 23   LYS F CD  1 
ATOM   3866 C  CE  . LYS F  1 23 ? 2.686   39.526  83.389  1.00 28.60 ? 23   LYS F CE  1 
ATOM   3867 N  NZ  . LYS F  1 23 ? 2.054   38.875  84.576  1.00 29.30 ? 23   LYS F NZ  1 
ATOM   3868 N  N   . GLY F  1 24 ? 8.419   38.772  82.353  1.00 18.70 ? 24   GLY F N   1 
ATOM   3869 C  CA  . GLY F  1 24 ? 9.145   40.046  82.165  1.00 19.43 ? 24   GLY F CA  1 
ATOM   3870 C  C   . GLY F  1 24 ? 10.404  40.162  83.010  1.00 19.95 ? 24   GLY F C   1 
ATOM   3871 O  O   . GLY F  1 24 ? 11.182  39.225  83.063  1.00 20.30 ? 24   GLY F O   1 
ATOM   3872 N  N   . ASN F  1 25 ? 10.592  41.312  83.680  1.00 18.85 ? 25   ASN F N   1 
ATOM   3873 C  CA  . ASN F  1 25 ? 11.748  41.560  84.540  1.00 17.39 ? 25   ASN F CA  1 
ATOM   3874 C  C   . ASN F  1 25 ? 11.681  40.671  85.795  1.00 17.58 ? 25   ASN F C   1 
ATOM   3875 O  O   . ASN F  1 25 ? 10.647  40.632  86.494  1.00 16.02 ? 25   ASN F O   1 
ATOM   3876 C  CB  . ASN F  1 25 ? 11.828  43.062  84.919  1.00 17.63 ? 25   ASN F CB  1 
ATOM   3877 C  CG  . ASN F  1 25 ? 13.160  43.442  85.566  1.00 21.79 ? 25   ASN F CG  1 
ATOM   3878 O  OD1 . ASN F  1 25 ? 13.654  42.754  86.469  1.00 21.03 ? 25   ASN F OD1 1 
ATOM   3879 N  ND2 . ASN F  1 25 ? 13.742  44.554  85.117  1.00 25.04 ? 25   ASN F ND2 1 
ATOM   3880 N  N   . PHE F  1 26 ? 12.759  39.941  86.067  1.00 16.91 ? 26   PHE F N   1 
ATOM   3881 C  CA  . PHE F  1 26 ? 12.770  38.976  87.171  1.00 18.92 ? 26   PHE F CA  1 
ATOM   3882 C  C   . PHE F  1 26 ? 12.779  39.712  88.521  1.00 23.58 ? 26   PHE F C   1 
ATOM   3883 O  O   . PHE F  1 26 ? 12.583  39.118  89.589  1.00 22.17 ? 26   PHE F O   1 
ATOM   3884 C  CB  . PHE F  1 26 ? 13.929  37.967  87.007  1.00 19.86 ? 26   PHE F CB  1 
ATOM   3885 C  CG  . PHE F  1 26 ? 13.596  36.829  86.065  1.00 20.46 ? 26   PHE F CG  1 
ATOM   3886 C  CD1 . PHE F  1 26 ? 12.326  36.724  85.500  1.00 18.99 ? 26   PHE F CD1 1 
ATOM   3887 C  CD2 . PHE F  1 26 ? 14.515  35.829  85.781  1.00 18.89 ? 26   PHE F CD2 1 
ATOM   3888 C  CE1 . PHE F  1 26 ? 12.014  35.687  84.645  1.00 20.32 ? 26   PHE F CE1 1 
ATOM   3889 C  CE2 . PHE F  1 26 ? 14.170  34.760  84.966  1.00 18.91 ? 26   PHE F CE2 1 
ATOM   3890 C  CZ  . PHE F  1 26 ? 12.932  34.700  84.387  1.00 18.13 ? 26   PHE F CZ  1 
ATOM   3891 N  N   . HIS F  1 27 ? 13.003  41.025  88.459  1.00 22.37 ? 27   HIS F N   1 
ATOM   3892 C  CA  . HIS F  1 27 ? 13.017  41.844  89.673  1.00 22.72 ? 27   HIS F CA  1 
ATOM   3893 C  C   . HIS F  1 27 ? 11.761  42.688  89.782  1.00 20.35 ? 27   HIS F C   1 
ATOM   3894 O  O   . HIS F  1 27 ? 11.766  43.704  90.477  1.00 21.00 ? 27   HIS F O   1 
ATOM   3895 C  CB  . HIS F  1 27 ? 14.221  42.774  89.669  1.00 25.85 ? 27   HIS F CB  1 
ATOM   3896 C  CG  . HIS F  1 27 ? 15.527  42.063  89.505  1.00 30.46 ? 27   HIS F CG  1 
ATOM   3897 N  ND1 . HIS F  1 27 ? 16.340  41.752  90.568  1.00 33.84 ? 27   HIS F ND1 1 
ATOM   3898 C  CD2 . HIS F  1 27 ? 16.168  41.616  88.398  1.00 33.83 ? 27   HIS F CD2 1 
ATOM   3899 C  CE1 . HIS F  1 27 ? 17.425  41.135  90.130  1.00 34.75 ? 27   HIS F CE1 1 
ATOM   3900 N  NE2 . HIS F  1 27 ? 17.351  41.054  88.815  1.00 36.58 ? 27   HIS F NE2 1 
ATOM   3901 N  N   . ALA F  1 28 ? 10.711  42.278  89.080  1.00 17.96 ? 28   ALA F N   1 
ATOM   3902 C  CA  . ALA F  1 28 ? 9.456   42.999  89.052  1.00 18.73 ? 28   ALA F CA  1 
ATOM   3903 C  C   . ALA F  1 28 ? 8.255   42.089  89.257  1.00 17.39 ? 28   ALA F C   1 
ATOM   3904 O  O   . ALA F  1 28 ? 8.119   41.035  88.609  1.00 16.99 ? 28   ALA F O   1 
ATOM   3905 C  CB  . ALA F  1 28 ? 9.309   43.748  87.714  1.00 18.44 ? 28   ALA F CB  1 
ATOM   3906 N  N   . VAL F  1 29 ? 7.335   42.527  90.099  1.00 17.38 ? 29   VAL F N   1 
ATOM   3907 C  CA  . VAL F  1 29 ? 6.062   41.858  90.232  1.00 16.95 ? 29   VAL F CA  1 
ATOM   3908 C  C   . VAL F  1 29 ? 4.997   42.804  89.683  1.00 18.46 ? 29   VAL F C   1 
ATOM   3909 O  O   . VAL F  1 29 ? 4.792   43.909  90.200  1.00 17.38 ? 29   VAL F O   1 
ATOM   3910 C  CB  . VAL F  1 29 ? 5.810   41.462  91.714  1.00 18.74 ? 29   VAL F CB  1 
ATOM   3911 C  CG1 . VAL F  1 29 ? 4.349   41.096  91.973  1.00 18.18 ? 29   VAL F CG1 1 
ATOM   3912 C  CG2 . VAL F  1 29 ? 6.723   40.293  92.074  1.00 17.55 ? 29   VAL F CG2 1 
ATOM   3913 N  N   . TYR F  1 30 ? 4.362   42.385  88.592  1.00 17.93 ? 30   TYR F N   1 
ATOM   3914 C  CA  . TYR F  1 30 ? 3.351   43.204  87.935  1.00 18.00 ? 30   TYR F CA  1 
ATOM   3915 C  C   . TYR F  1 30 ? 1.998   43.059  88.597  1.00 18.69 ? 30   TYR F C   1 
ATOM   3916 O  O   . TYR F  1 30 ? 1.808   42.235  89.495  1.00 18.60 ? 30   TYR F O   1 
ATOM   3917 C  CB  . TYR F  1 30 ? 3.302   42.872  86.447  1.00 17.89 ? 30   TYR F CB  1 
ATOM   3918 C  CG  . TYR F  1 30 ? 4.670   43.011  85.848  1.00 16.63 ? 30   TYR F CG  1 
ATOM   3919 C  CD1 . TYR F  1 30 ? 5.225   44.275  85.613  1.00 15.96 ? 30   TYR F CD1 1 
ATOM   3920 C  CD2 . TYR F  1 30 ? 5.425   41.885  85.537  1.00 15.57 ? 30   TYR F CD2 1 
ATOM   3921 C  CE1 . TYR F  1 30 ? 6.500   44.407  85.052  1.00 17.85 ? 30   TYR F CE1 1 
ATOM   3922 C  CE2 . TYR F  1 30 ? 6.710   42.006  84.978  1.00 17.95 ? 30   TYR F CE2 1 
ATOM   3923 C  CZ  . TYR F  1 30 ? 7.234   43.269  84.743  1.00 18.16 ? 30   TYR F CZ  1 
ATOM   3924 O  OH  . TYR F  1 30 ? 8.485   43.416  84.178  1.00 17.19 ? 30   TYR F OH  1 
ATOM   3925 N  N   . ARG F  1 31 ? 1.061   43.886  88.157  1.00 20.80 ? 31   ARG F N   1 
ATOM   3926 C  CA  . ARG F  1 31 ? -0.210  44.006  88.846  1.00 22.19 ? 31   ARG F CA  1 
ATOM   3927 C  C   . ARG F  1 31 ? -0.930  42.661  88.931  1.00 21.16 ? 31   ARG F C   1 
ATOM   3928 O  O   . ARG F  1 31 ? -1.366  42.276  89.995  1.00 21.52 ? 31   ARG F O   1 
ATOM   3929 C  CB  . ARG F  1 31 ? -1.078  45.059  88.163  1.00 27.47 ? 31   ARG F CB  1 
ATOM   3930 C  CG  . ARG F  1 31 ? -2.432  45.265  88.821  1.00 32.01 ? 31   ARG F CG  1 
ATOM   3931 C  CD  . ARG F  1 31 ? -3.417  46.017  87.929  1.00 37.74 ? 31   ARG F CD  1 
ATOM   3932 N  NE  . ARG F  1 31 ? -3.491  47.403  88.364  1.00 42.80 ? 31   ARG F NE  1 
ATOM   3933 C  CZ  . ARG F  1 31 ? -2.499  48.264  88.218  1.00 44.93 ? 31   ARG F CZ  1 
ATOM   3934 N  NH1 . ARG F  1 31 ? -1.380  47.858  87.632  1.00 46.03 ? 31   ARG F NH1 1 
ATOM   3935 N  NH2 . ARG F  1 31 ? -2.623  49.517  88.652  1.00 45.16 ? 31   ARG F NH2 1 
ATOM   3936 N  N   . ASP F  1 32 ? -1.042  41.930  87.824  1.00 22.10 ? 32   ASP F N   1 
ATOM   3937 C  CA  . ASP F  1 32 ? -1.673  40.620  87.903  1.00 22.55 ? 32   ASP F CA  1 
ATOM   3938 C  C   . ASP F  1 32 ? -0.874  39.617  88.742  1.00 23.18 ? 32   ASP F C   1 
ATOM   3939 O  O   . ASP F  1 32 ? -1.473  38.777  89.417  1.00 22.32 ? 32   ASP F O   1 
ATOM   3940 C  CB  . ASP F  1 32 ? -2.006  40.066  86.512  1.00 25.72 ? 32   ASP F CB  1 
ATOM   3941 C  CG  . ASP F  1 32 ? -0.811  40.053  85.557  1.00 28.51 ? 32   ASP F CG  1 
ATOM   3942 O  OD1 . ASP F  1 32 ? 0.253   40.676  85.816  1.00 28.33 ? 32   ASP F OD1 1 
ATOM   3943 O  OD2 . ASP F  1 32 ? -0.864  39.447  84.463  1.00 31.86 ? 32   ASP F OD2 1 
ATOM   3944 N  N   . ASP F  1 33 ? 0.460   39.675  88.685  1.00 20.57 ? 33   ASP F N   1 
ATOM   3945 C  CA  . ASP F  1 33 ? 1.287   38.847  89.560  1.00 20.54 ? 33   ASP F CA  1 
ATOM   3946 C  C   . ASP F  1 33 ? 1.020   39.134  91.045  1.00 21.02 ? 33   ASP F C   1 
ATOM   3947 O  O   . ASP F  1 33 ? 1.105   38.237  91.872  1.00 20.32 ? 33   ASP F O   1 
ATOM   3948 C  CB  . ASP F  1 33 ? 2.775   39.087  89.337  1.00 23.06 ? 33   ASP F CB  1 
ATOM   3949 C  CG  . ASP F  1 33 ? 3.209   38.870  87.926  1.00 26.12 ? 33   ASP F CG  1 
ATOM   3950 O  OD1 . ASP F  1 33 ? 2.623   37.964  87.270  1.00 26.99 ? 33   ASP F OD1 1 
ATOM   3951 O  OD2 . ASP F  1 33 ? 4.175   39.511  87.417  1.00 24.50 ? 33   ASP F OD2 1 
ATOM   3952 N  N   . LEU F  1 34 ? 0.775   40.391  91.403  1.00 19.69 ? 34   LEU F N   1 
ATOM   3953 C  CA  . LEU F  1 34 ? 0.571   40.740  92.819  1.00 20.79 ? 34   LEU F CA  1 
ATOM   3954 C  C   . LEU F  1 34 ? -0.771  40.153  93.285  1.00 19.79 ? 34   LEU F C   1 
ATOM   3955 O  O   . LEU F  1 34 ? -0.923  39.689  94.424  1.00 18.92 ? 34   LEU F O   1 
ATOM   3956 C  CB  . LEU F  1 34 ? 0.577   42.266  93.017  1.00 19.00 ? 34   LEU F CB  1 
ATOM   3957 C  CG  . LEU F  1 34 ? 0.420   42.634  94.500  1.00 22.44 ? 34   LEU F CG  1 
ATOM   3958 C  CD1 . LEU F  1 34 ? 1.731   42.384  95.246  1.00 20.25 ? 34   LEU F CD1 1 
ATOM   3959 C  CD2 . LEU F  1 34 ? -0.084  44.074  94.667  1.00 20.75 ? 34   LEU F CD2 1 
ATOM   3960 N  N   . LYS F  1 35 ? -1.760  40.183  92.403  1.00 18.74 ? 35   LYS F N   1 
ATOM   3961 C  CA  . LYS F  1 35 ? -3.061  39.609  92.726  1.00 21.68 ? 35   LYS F CA  1 
ATOM   3962 C  C   . LYS F  1 35 ? -2.943  38.131  93.094  1.00 20.30 ? 35   LYS F C   1 
ATOM   3963 O  O   . LYS F  1 35 ? -3.521  37.683  94.090  1.00 21.55 ? 35   LYS F O   1 
ATOM   3964 C  CB  . LYS F  1 35 ? -4.002  39.791  91.543  1.00 23.36 ? 35   LYS F CB  1 
ATOM   3965 C  CG  . LYS F  1 35 ? -5.422  39.334  91.834  1.00 27.52 ? 35   LYS F CG  1 
ATOM   3966 C  CD  . LYS F  1 35 ? -6.326  39.825  90.708  1.00 30.68 ? 35   LYS F CD  1 
ATOM   3967 C  CE  . LYS F  1 35 ? -7.539  38.928  90.509  1.00 33.56 ? 35   LYS F CE  1 
ATOM   3968 N  NZ  . LYS F  1 35 ? -8.475  39.159  91.623  1.00 36.47 ? 35   LYS F NZ  1 
ATOM   3969 N  N   . LYS F  1 36 ? -2.167  37.395  92.307  1.00 20.88 ? 36   LYS F N   1 
ATOM   3970 C  CA  . LYS F  1 36 ? -1.848  35.989  92.574  1.00 22.39 ? 36   LYS F CA  1 
ATOM   3971 C  C   . LYS F  1 36 ? -1.081  35.815  93.882  1.00 20.78 ? 36   LYS F C   1 
ATOM   3972 O  O   . LYS F  1 36 ? -1.358  34.899  94.641  1.00 19.13 ? 36   LYS F O   1 
ATOM   3973 C  CB  . LYS F  1 36 ? -1.018  35.386  91.435  1.00 23.60 ? 36   LYS F CB  1 
ATOM   3974 C  CG  . LYS F  1 36 ? -1.823  35.102  90.183  1.00 28.87 ? 36   LYS F CG  1 
ATOM   3975 C  CD  . LYS F  1 36 ? -0.992  34.354  89.140  1.00 30.78 ? 36   LYS F CD  1 
ATOM   3976 C  CE  . LYS F  1 36 ? -1.889  33.694  88.072  1.00 35.51 ? 36   LYS F CE  1 
ATOM   3977 N  NZ  . LYS F  1 36 ? -2.783  34.685  87.379  1.00 37.52 ? 36   LYS F NZ  1 
ATOM   3978 N  N   . LEU F  1 37 ? -0.091  36.672  94.113  1.00 21.49 ? 37   LEU F N   1 
ATOM   3979 C  CA  . LEU F  1 37 ? 0.639   36.645  95.396  1.00 20.78 ? 37   LEU F CA  1 
ATOM   3980 C  C   . LEU F  1 37 ? -0.313  36.849  96.581  1.00 20.68 ? 37   LEU F C   1 
ATOM   3981 O  O   . LEU F  1 37 ? -0.317  36.056  97.529  1.00 21.06 ? 37   LEU F O   1 
ATOM   3982 C  CB  . LEU F  1 37 ? 1.794   37.657  95.369  1.00 20.62 ? 37   LEU F CB  1 
ATOM   3983 C  CG  . LEU F  1 37 ? 2.708   37.781  96.595  1.00 21.02 ? 37   LEU F CG  1 
ATOM   3984 C  CD1 . LEU F  1 37 ? 3.881   38.708  96.212  1.00 21.77 ? 37   LEU F CD1 1 
ATOM   3985 C  CD2 . LEU F  1 37 ? 1.938   38.349  97.834  1.00 18.13 ? 37   LEU F CD2 1 
ATOM   3986 N  N   . LEU F  1 38 ? -1.168  37.864  96.517  1.00 20.13 ? 38   LEU F N   1 
ATOM   3987 C  CA  . LEU F  1 38 ? -2.071  38.142  97.639  1.00 20.70 ? 38   LEU F CA  1 
ATOM   3988 C  C   . LEU F  1 38 ? -3.065  37.002  97.847  1.00 21.36 ? 38   LEU F C   1 
ATOM   3989 O  O   . LEU F  1 38 ? -3.338  36.613  98.972  1.00 23.59 ? 38   LEU F O   1 
ATOM   3990 C  CB  . LEU F  1 38 ? -2.790  39.478  97.440  1.00 21.80 ? 38   LEU F CB  1 
ATOM   3991 C  CG  . LEU F  1 38 ? -1.937  40.746  97.500  1.00 19.76 ? 38   LEU F CG  1 
ATOM   3992 C  CD1 . LEU F  1 38 ? -2.660  41.889  96.798  1.00 22.58 ? 38   LEU F CD1 1 
ATOM   3993 C  CD2 . LEU F  1 38 ? -1.655  41.129  98.945  1.00 20.00 ? 38   LEU F CD2 1 
ATOM   3994 N  N   . GLU F  1 39 ? -3.603  36.452  96.758  1.00 21.68 ? 39   GLU F N   1 
ATOM   3995 C  CA  . GLU F  1 39 ? -4.515  35.301  96.826  1.00 25.63 ? 39   GLU F CA  1 
ATOM   3996 C  C   . GLU F  1 39 ? -3.862  34.043  97.388  1.00 23.42 ? 39   GLU F C   1 
ATOM   3997 O  O   . GLU F  1 39 ? -4.491  33.271  98.112  1.00 24.96 ? 39   GLU F O   1 
ATOM   3998 C  CB  . GLU F  1 39 ? -5.088  34.985  95.440  1.00 27.57 ? 39   GLU F CB  1 
ATOM   3999 C  CG  . GLU F  1 39 ? -6.096  35.996  94.930  1.00 33.99 ? 39   GLU F CG  1 
ATOM   4000 C  CD  . GLU F  1 39 ? -6.650  35.617  93.562  1.00 36.51 ? 39   GLU F CD  1 
ATOM   4001 O  OE1 . GLU F  1 39 ? -6.702  34.406  93.246  1.00 43.21 ? 39   GLU F OE1 1 
ATOM   4002 O  OE2 . GLU F  1 39 ? -7.048  36.513  92.790  1.00 40.69 ? 39   GLU F OE2 1 
ATOM   4003 N  N   . THR F  1 40 ? -2.602  33.824  97.041  1.00 23.66 ? 40   THR F N   1 
ATOM   4004 C  CA  . THR F  1 40 ? -1.905  32.606  97.446  1.00 23.73 ? 40   THR F CA  1 
ATOM   4005 C  C   . THR F  1 40 ? -1.254  32.724  98.818  1.00 24.56 ? 40   THR F C   1 
ATOM   4006 O  O   . THR F  1 40 ? -1.234  31.747  99.567  1.00 26.19 ? 40   THR F O   1 
ATOM   4007 C  CB  . THR F  1 40 ? -0.837  32.242  96.390  1.00 25.04 ? 40   THR F CB  1 
ATOM   4008 O  OG1 . THR F  1 40 ? -1.490  32.007  95.138  1.00 24.70 ? 40   THR F OG1 1 
ATOM   4009 C  CG2 . THR F  1 40 ? -0.203  30.923  96.710  1.00 24.72 ? 40   THR F CG2 1 
ATOM   4010 N  N   . GLU F  1 41 ? -0.744  33.912  99.142  1.00 22.46 ? 41   GLU F N   1 
ATOM   4011 C  CA  . GLU F  1 41 ? 0.156   34.097  100.281 1.00 22.61 ? 41   GLU F CA  1 
ATOM   4012 C  C   . GLU F  1 41 ? -0.425  34.824  101.485 1.00 23.11 ? 41   GLU F C   1 
ATOM   4013 O  O   . GLU F  1 41 ? 0.138   34.721  102.580 1.00 24.31 ? 41   GLU F O   1 
ATOM   4014 C  CB  . GLU F  1 41 ? 1.418   34.858  99.863  1.00 21.53 ? 41   GLU F CB  1 
ATOM   4015 C  CG  . GLU F  1 41 ? 2.216   34.226  98.722  1.00 22.57 ? 41   GLU F CG  1 
ATOM   4016 C  CD  . GLU F  1 41 ? 2.871   32.907  99.092  1.00 23.69 ? 41   GLU F CD  1 
ATOM   4017 O  OE1 . GLU F  1 41 ? 2.942   32.543  100.296 1.00 24.53 ? 41   GLU F OE1 1 
ATOM   4018 O  OE2 . GLU F  1 41 ? 3.363   32.220  98.158  1.00 25.73 ? 41   GLU F OE2 1 
ATOM   4019 N  N   . SER F  1 42 ? -1.507  35.564  101.314 1.00 21.06 ? 42   SER F N   1 
ATOM   4020 C  CA  . SER F  1 42 ? -1.947  36.463  102.384 1.00 22.24 ? 42   SER F CA  1 
ATOM   4021 C  C   . SER F  1 42 ? -3.346  36.097  102.921 1.00 22.81 ? 42   SER F C   1 
ATOM   4022 O  O   . SER F  1 42 ? -4.191  35.593  102.172 1.00 22.35 ? 42   SER F O   1 
ATOM   4023 C  CB  . SER F  1 42 ? -1.905  37.914  101.870 1.00 24.09 ? 42   SER F CB  1 
ATOM   4024 O  OG  . SER F  1 42 ? -3.183  38.282  101.372 1.00 27.20 ? 42   SER F OG  1 
ATOM   4025 N  N   . PRO F  1 43 ? -3.590  36.313  104.217 1.00 23.39 ? 43   PRO F N   1 
ATOM   4026 C  CA  . PRO F  1 43 ? -4.887  35.961  104.810 1.00 25.12 ? 43   PRO F CA  1 
ATOM   4027 C  C   . PRO F  1 43 ? -6.013  36.876  104.300 1.00 27.42 ? 43   PRO F C   1 
ATOM   4028 O  O   . PRO F  1 43 ? -5.749  37.879  103.639 1.00 26.85 ? 43   PRO F O   1 
ATOM   4029 C  CB  . PRO F  1 43 ? -4.655  36.150  106.314 1.00 23.86 ? 43   PRO F CB  1 
ATOM   4030 C  CG  . PRO F  1 43 ? -3.529  37.125  106.437 1.00 23.82 ? 43   PRO F CG  1 
ATOM   4031 C  CD  . PRO F  1 43 ? -2.651  36.878  105.208 1.00 23.43 ? 43   PRO F CD  1 
ATOM   4032 N  N   . GLN F  1 44 ? -7.259  36.530  104.602 1.00 29.39 ? 44   GLN F N   1 
ATOM   4033 C  CA  . GLN F  1 44 ? -8.405  37.261  104.052 1.00 32.48 ? 44   GLN F CA  1 
ATOM   4034 C  C   . GLN F  1 44 ? -8.434  38.716  104.515 1.00 30.62 ? 44   GLN F C   1 
ATOM   4035 O  O   . GLN F  1 44 ? -8.870  39.598  103.776 1.00 31.19 ? 44   GLN F O   1 
ATOM   4036 C  CB  . GLN F  1 44 ? -9.727  36.545  104.391 1.00 36.26 ? 44   GLN F CB  1 
ATOM   4037 C  CG  . GLN F  1 44 ? -11.025 37.269  103.999 1.00 40.84 ? 44   GLN F CG  1 
ATOM   4038 C  CD  . GLN F  1 44 ? -11.133 37.618  102.515 1.00 45.10 ? 44   GLN F CD  1 
ATOM   4039 O  OE1 . GLN F  1 44 ? -11.153 36.735  101.644 1.00 47.30 ? 44   GLN F OE1 1 
ATOM   4040 N  NE2 . GLN F  1 44 ? -11.222 38.916  102.225 1.00 46.92 ? 44   GLN F NE2 1 
ATOM   4041 N  N   . TYR F  1 45 ? -7.955  38.975  105.723 1.00 28.84 ? 45   TYR F N   1 
ATOM   4042 C  CA  . TYR F  1 45 ? -8.004  40.341  106.237 1.00 29.50 ? 45   TYR F CA  1 
ATOM   4043 C  C   . TYR F  1 45 ? -6.978  41.253  105.543 1.00 28.92 ? 45   TYR F C   1 
ATOM   4044 O  O   . TYR F  1 45 ? -7.090  42.475  105.638 1.00 29.69 ? 45   TYR F O   1 
ATOM   4045 C  CB  . TYR F  1 45 ? -7.885  40.399  107.769 1.00 28.78 ? 45   TYR F CB  1 
ATOM   4046 C  CG  . TYR F  1 45 ? -6.593  39.841  108.330 1.00 29.27 ? 45   TYR F CG  1 
ATOM   4047 C  CD1 . TYR F  1 45 ? -5.440  40.621  108.376 1.00 29.01 ? 45   TYR F CD1 1 
ATOM   4048 C  CD2 . TYR F  1 45 ? -6.526  38.544  108.821 1.00 27.28 ? 45   TYR F CD2 1 
ATOM   4049 C  CE1 . TYR F  1 45 ? -4.252  40.125  108.889 1.00 28.28 ? 45   TYR F CE1 1 
ATOM   4050 C  CE2 . TYR F  1 45 ? -5.339  38.041  109.333 1.00 27.81 ? 45   TYR F CE2 1 
ATOM   4051 C  CZ  . TYR F  1 45 ? -4.215  38.841  109.373 1.00 27.51 ? 45   TYR F CZ  1 
ATOM   4052 O  OH  . TYR F  1 45 ? -3.026  38.350  109.856 1.00 28.92 ? 45   TYR F OH  1 
ATOM   4053 N  N   . ILE F  1 46 ? -5.977  40.659  104.888 1.00 25.23 ? 46   ILE F N   1 
ATOM   4054 C  CA  . ILE F  1 46 ? -5.061  41.402  104.010 1.00 26.91 ? 46   ILE F CA  1 
ATOM   4055 C  C   . ILE F  1 46 ? -5.654  41.464  102.587 1.00 28.69 ? 46   ILE F C   1 
ATOM   4056 O  O   . ILE F  1 46 ? -5.790  42.552  101.987 1.00 29.28 ? 46   ILE F O   1 
ATOM   4057 C  CB  . ILE F  1 46 ? -3.673  40.709  103.986 1.00 25.81 ? 46   ILE F CB  1 
ATOM   4058 C  CG1 . ILE F  1 46 ? -3.034  40.720  105.374 1.00 27.13 ? 46   ILE F CG1 1 
ATOM   4059 C  CG2 . ILE F  1 46 ? -2.712  41.366  102.973 1.00 26.25 ? 46   ILE F CG2 1 
ATOM   4060 C  CD1 . ILE F  1 46 ? -2.540  42.102  105.830 1.00 27.67 ? 46   ILE F CD1 1 
ATOM   4061 N  N   . ARG F  1 47 ? -6.023  40.301  102.051 1.00 28.05 ? 47   ARG F N   1 
ATOM   4062 C  CA  . ARG F  1 47 ? -6.623  40.231  100.726 1.00 31.05 ? 47   ARG F CA  1 
ATOM   4063 C  C   . ARG F  1 47 ? -7.806  41.172  100.551 1.00 32.17 ? 47   ARG F C   1 
ATOM   4064 O  O   . ARG F  1 47 ? -8.001  41.723  99.475  1.00 31.21 ? 47   ARG F O   1 
ATOM   4065 C  CB  . ARG F  1 47 ? -7.106  38.822  100.421 1.00 33.40 ? 47   ARG F CB  1 
ATOM   4066 C  CG  . ARG F  1 47 ? -6.018  37.864  100.099 1.00 37.37 ? 47   ARG F CG  1 
ATOM   4067 C  CD  . ARG F  1 47 ? -6.533  36.553  99.558  1.00 40.77 ? 47   ARG F CD  1 
ATOM   4068 N  NE  . ARG F  1 47 ? -6.508  35.506  100.570 1.00 43.96 ? 47   ARG F NE  1 
ATOM   4069 C  CZ  . ARG F  1 47 ? -7.578  35.067  101.207 1.00 45.65 ? 47   ARG F CZ  1 
ATOM   4070 N  NH1 . ARG F  1 47 ? -8.761  35.592  100.937 1.00 46.97 ? 47   ARG F NH1 1 
ATOM   4071 N  NH2 . ARG F  1 47 ? -7.463  34.108  102.117 1.00 46.57 ? 47   ARG F NH2 1 
ATOM   4072 N  N   . LYS F  1 48 ? -8.608  41.347  101.595 1.00 33.90 ? 48   LYS F N   1 
ATOM   4073 C  CA  . LYS F  1 48 ? -9.862  42.088  101.457 1.00 36.40 ? 48   LYS F CA  1 
ATOM   4074 C  C   . LYS F  1 48 ? -9.662  43.542  101.045 1.00 35.90 ? 48   LYS F C   1 
ATOM   4075 O  O   . LYS F  1 48 ? -10.595 44.189  100.581 1.00 35.72 ? 48   LYS F O   1 
ATOM   4076 C  CB  . LYS F  1 48 ? -10.700 42.031  102.739 1.00 38.26 ? 48   LYS F CB  1 
ATOM   4077 C  CG  . LYS F  1 48 ? -10.128 42.806  103.906 1.00 41.09 ? 48   LYS F CG  1 
ATOM   4078 C  CD  . LYS F  1 48 ? -11.103 42.767  105.075 1.00 44.31 ? 48   LYS F CD  1 
ATOM   4079 C  CE  . LYS F  1 48 ? -10.424 43.152  106.386 1.00 46.16 ? 48   LYS F CE  1 
ATOM   4080 N  NZ  . LYS F  1 48 ? -11.202 42.620  107.548 1.00 48.40 ? 48   LYS F NZ  1 
ATOM   4081 N  N   . LYS F  1 49 ? -8.449  44.054  101.200 1.00 35.17 ? 49   LYS F N   1 
ATOM   4082 C  CA  . LYS F  1 49 ? -8.166  45.418  100.774 1.00 34.57 ? 49   LYS F CA  1 
ATOM   4083 C  C   . LYS F  1 49 ? -8.306  45.578  99.255  1.00 32.36 ? 49   LYS F C   1 
ATOM   4084 O  O   . LYS F  1 49 ? -8.661  46.652  98.769  1.00 33.50 ? 49   LYS F O   1 
ATOM   4085 C  CB  . LYS F  1 49 ? -6.792  45.863  101.288 1.00 35.99 ? 49   LYS F CB  1 
ATOM   4086 C  CG  . LYS F  1 49 ? -6.288  47.149  100.679 1.00 38.69 ? 49   LYS F CG  1 
ATOM   4087 C  CD  . LYS F  1 49 ? -5.691  48.052  101.742 1.00 41.30 ? 49   LYS F CD  1 
ATOM   4088 C  CE  . LYS F  1 49 ? -4.221  47.798  101.919 1.00 41.35 ? 49   LYS F CE  1 
ATOM   4089 N  NZ  . LYS F  1 49 ? -3.682  48.555  103.080 1.00 41.55 ? 49   LYS F NZ  1 
ATOM   4090 N  N   . GLY F  1 50 ? -8.032  44.518  98.500  1.00 30.10 ? 50   GLY F N   1 
ATOM   4091 C  CA  . GLY F  1 50 ? -8.099  44.579  97.045  1.00 27.48 ? 50   GLY F CA  1 
ATOM   4092 C  C   . GLY F  1 50 ? -6.711  44.660  96.431  1.00 26.11 ? 50   GLY F C   1 
ATOM   4093 O  O   . GLY F  1 50 ? -5.842  45.374  96.936  1.00 24.44 ? 50   GLY F O   1 
ATOM   4094 N  N   . ALA F  1 51 ? -6.489  43.929  95.346  1.00 25.61 ? 51   ALA F N   1 
ATOM   4095 C  CA  . ALA F  1 51 ? -5.164  43.903  94.756  1.00 26.17 ? 51   ALA F CA  1 
ATOM   4096 C  C   . ALA F  1 51 ? -4.821  45.255  94.108  1.00 25.39 ? 51   ALA F C   1 
ATOM   4097 O  O   . ALA F  1 51 ? -3.661  45.681  94.178  1.00 25.27 ? 51   ALA F O   1 
ATOM   4098 C  CB  . ALA F  1 51 ? -5.017  42.751  93.795  1.00 25.97 ? 51   ALA F CB  1 
ATOM   4099 N  N   . ASP F  1 52 ? -5.808  45.954  93.534  1.00 24.15 ? 52   ASP F N   1 
ATOM   4100 C  CA  . ASP F  1 52 ? -5.535  47.263  92.922  1.00 26.20 ? 52   ASP F CA  1 
ATOM   4101 C  C   . ASP F  1 52 ? -5.139  48.310  93.964  1.00 25.69 ? 52   ASP F C   1 
ATOM   4102 O  O   . ASP F  1 52 ? -4.318  49.197  93.720  1.00 26.21 ? 52   ASP F O   1 
ATOM   4103 C  CB  . ASP F  1 52 ? -6.754  47.785  92.149  1.00 28.70 ? 52   ASP F CB  1 
ATOM   4104 C  CG  . ASP F  1 52 ? -6.983  47.040  90.856  1.00 31.96 ? 52   ASP F CG  1 
ATOM   4105 O  OD1 . ASP F  1 52 ? -6.107  46.228  90.478  1.00 33.94 ? 52   ASP F OD1 1 
ATOM   4106 O  OD2 . ASP F  1 52 ? -8.007  47.205  90.143  1.00 34.80 ? 52   ASP F OD2 1 
ATOM   4107 N  N   . VAL F  1 53 ? -5.774  48.228  95.125  1.00 24.45 ? 53   VAL F N   1 
ATOM   4108 C  CA  . VAL F  1 53 ? -5.459  49.108  96.229  1.00 24.91 ? 53   VAL F CA  1 
ATOM   4109 C  C   . VAL F  1 53 ? -4.060  48.811  96.782  1.00 22.38 ? 53   VAL F C   1 
ATOM   4110 O  O   . VAL F  1 53 ? -3.265  49.738  96.968  1.00 23.31 ? 53   VAL F O   1 
ATOM   4111 C  CB  . VAL F  1 53 ? -6.510  48.970  97.340  1.00 26.19 ? 53   VAL F CB  1 
ATOM   4112 C  CG1 . VAL F  1 53 ? -6.143  49.841  98.541  1.00 28.54 ? 53   VAL F CG1 1 
ATOM   4113 C  CG2 . VAL F  1 53 ? -7.895  49.363  96.803  1.00 28.40 ? 53   VAL F CG2 1 
ATOM   4114 N  N   . TRP F  1 54 ? -3.756  47.530  97.007  1.00 20.20 ? 54   TRP F N   1 
ATOM   4115 C  CA  . TRP F  1 54 ? -2.425  47.128  97.463  1.00 20.19 ? 54   TRP F CA  1 
ATOM   4116 C  C   . TRP F  1 54 ? -1.385  47.534  96.423  1.00 19.70 ? 54   TRP F C   1 
ATOM   4117 O  O   . TRP F  1 54 ? -0.337  48.039  96.767  1.00 21.42 ? 54   TRP F O   1 
ATOM   4118 C  CB  . TRP F  1 54 ? -2.334  45.616  97.710  1.00 20.83 ? 54   TRP F CB  1 
ATOM   4119 C  CG  . TRP F  1 54 ? -2.680  45.244  99.117  1.00 21.01 ? 54   TRP F CG  1 
ATOM   4120 C  CD1 . TRP F  1 54 ? -3.722  44.465  99.538  1.00 21.14 ? 54   TRP F CD1 1 
ATOM   4121 C  CD2 . TRP F  1 54 ? -1.961  45.626  100.292 1.00 21.82 ? 54   TRP F CD2 1 
ATOM   4122 N  NE1 . TRP F  1 54 ? -3.717  44.361  100.912 1.00 20.89 ? 54   TRP F NE1 1 
ATOM   4123 C  CE2 . TRP F  1 54 ? -2.642  45.062  101.404 1.00 22.89 ? 54   TRP F CE2 1 
ATOM   4124 C  CE3 . TRP F  1 54 ? -0.814  46.410  100.524 1.00 22.21 ? 54   TRP F CE3 1 
ATOM   4125 C  CZ2 . TRP F  1 54 ? -2.204  45.241  102.725 1.00 23.39 ? 54   TRP F CZ2 1 
ATOM   4126 C  CZ3 . TRP F  1 54 ? -0.399  46.620  101.843 1.00 22.05 ? 54   TRP F CZ3 1 
ATOM   4127 C  CH2 . TRP F  1 54 ? -1.093  46.040  102.922 1.00 22.50 ? 54   TRP F CH2 1 
ATOM   4128 N  N   . PHE F  1 55 ? -1.642  47.274  95.145  1.00 19.77 ? 55   PHE F N   1 
ATOM   4129 C  CA  . PHE F  1 55 ? -0.672  47.643  94.129  1.00 21.14 ? 55   PHE F CA  1 
ATOM   4130 C  C   . PHE F  1 55 ? -0.335  49.142  94.168  1.00 20.10 ? 55   PHE F C   1 
ATOM   4131 O  O   . PHE F  1 55 ? 0.833   49.529  94.123  1.00 20.84 ? 55   PHE F O   1 
ATOM   4132 C  CB  . PHE F  1 55 ? -1.156  47.270  92.707  1.00 22.41 ? 55   PHE F CB  1 
ATOM   4133 C  CG  . PHE F  1 55 ? -0.079  47.355  91.665  1.00 23.71 ? 55   PHE F CG  1 
ATOM   4134 C  CD1 . PHE F  1 55 ? 0.808   46.304  91.491  1.00 23.63 ? 55   PHE F CD1 1 
ATOM   4135 C  CD2 . PHE F  1 55 ? 0.056   48.491  90.868  1.00 24.08 ? 55   PHE F CD2 1 
ATOM   4136 C  CE1 . PHE F  1 55 ? 1.815   46.380  90.519  1.00 24.36 ? 55   PHE F CE1 1 
ATOM   4137 C  CE2 . PHE F  1 55 ? 1.044   48.582  89.914  1.00 26.31 ? 55   PHE F CE2 1 
ATOM   4138 C  CZ  . PHE F  1 55 ? 1.934   47.519  89.745  1.00 24.74 ? 55   PHE F CZ  1 
ATOM   4139 N  N   . LYS F  1 56 ? -1.358  49.985  94.202  1.00 20.71 ? 56   LYS F N   1 
ATOM   4140 C  CA  . LYS F  1 56 ? -1.150  51.429  94.262  1.00 24.20 ? 56   LYS F CA  1 
ATOM   4141 C  C   . LYS F  1 56 ? -0.356  51.811  95.520  1.00 24.26 ? 56   LYS F C   1 
ATOM   4142 O  O   . LYS F  1 56 ? 0.569   52.643  95.482  1.00 22.81 ? 56   LYS F O   1 
ATOM   4143 C  CB  . LYS F  1 56 ? -2.501  52.150  94.254  1.00 27.10 ? 56   LYS F CB  1 
ATOM   4144 C  CG  . LYS F  1 56 ? -2.339  53.647  94.154  1.00 32.02 ? 56   LYS F CG  1 
ATOM   4145 C  CD  . LYS F  1 56 ? -3.675  54.360  94.046  1.00 35.26 ? 56   LYS F CD  1 
ATOM   4146 C  CE  . LYS F  1 56 ? -3.482  55.794  93.603  1.00 38.27 ? 56   LYS F CE  1 
ATOM   4147 N  NZ  . LYS F  1 56 ? -4.695  56.588  93.924  1.00 41.86 ? 56   LYS F NZ  1 
ATOM   4148 N  N   . GLU F  1 57 ? -0.719  51.213  96.650  1.00 21.34 ? 57   GLU F N   1 
ATOM   4149 C  CA  . GLU F  1 57 ? 0.039   51.442  97.869  1.00 23.84 ? 57   GLU F CA  1 
ATOM   4150 C  C   . GLU F  1 57 ? 1.526   51.047  97.779  1.00 21.95 ? 57   GLU F C   1 
ATOM   4151 O  O   . GLU F  1 57 ? 2.381   51.747  98.321  1.00 21.12 ? 57   GLU F O   1 
ATOM   4152 C  CB  . GLU F  1 57 ? -0.666  50.744  99.027  1.00 26.50 ? 57   GLU F CB  1 
ATOM   4153 C  CG  . GLU F  1 57 ? -0.049  50.955  100.376 1.00 33.03 ? 57   GLU F CG  1 
ATOM   4154 C  CD  . GLU F  1 57 ? -0.892  50.332  101.468 1.00 34.32 ? 57   GLU F CD  1 
ATOM   4155 O  OE1 . GLU F  1 57 ? -2.113  50.125  101.253 1.00 34.87 ? 57   GLU F OE1 1 
ATOM   4156 O  OE2 . GLU F  1 57 ? -0.315  50.058  102.538 1.00 37.36 ? 57   GLU F OE2 1 
ATOM   4157 N  N   . LEU F  1 58 ? 1.850   49.951  97.088  1.00 19.15 ? 58   LEU F N   1 
ATOM   4158 C  CA  . LEU F  1 58 ? 3.220   49.416  97.098  1.00 16.58 ? 58   LEU F CA  1 
ATOM   4159 C  C   . LEU F  1 58 ? 4.091   50.015  95.987  1.00 18.20 ? 58   LEU F C   1 
ATOM   4160 O  O   . LEU F  1 58 ? 5.314   50.058  96.118  1.00 18.97 ? 58   LEU F O   1 
ATOM   4161 C  CB  . LEU F  1 58 ? 3.224   47.889  96.920  1.00 18.44 ? 58   LEU F CB  1 
ATOM   4162 C  CG  . LEU F  1 58 ? 2.468   47.126  98.015  1.00 17.34 ? 58   LEU F CG  1 
ATOM   4163 C  CD1 . LEU F  1 58 ? 2.461   45.637  97.687  1.00 21.04 ? 58   LEU F CD1 1 
ATOM   4164 C  CD2 . LEU F  1 58 ? 3.042   47.423  99.439  1.00 18.13 ? 58   LEU F CD2 1 
ATOM   4165 N  N   . ASP F  1 59 ? 3.470   50.442  94.889  1.00 17.79 ? 59   ASP F N   1 
ATOM   4166 C  CA  . ASP F  1 59 ? 4.259   50.883  93.733  1.00 16.60 ? 59   ASP F CA  1 
ATOM   4167 C  C   . ASP F  1 59 ? 4.678   52.343  93.980  1.00 15.86 ? 59   ASP F C   1 
ATOM   4168 O  O   . ASP F  1 59 ? 4.096   53.282  93.418  1.00 17.98 ? 59   ASP F O   1 
ATOM   4169 C  CB  . ASP F  1 59 ? 3.475   50.745  92.434  1.00 15.39 ? 59   ASP F CB  1 
ATOM   4170 C  CG  . ASP F  1 59 ? 4.335   51.074  91.233  1.00 16.67 ? 59   ASP F CG  1 
ATOM   4171 O  OD1 . ASP F  1 59 ? 5.580   51.188  91.400  1.00 17.32 ? 59   ASP F OD1 1 
ATOM   4172 O  OD2 . ASP F  1 59 ? 3.820   51.276  90.127  1.00 18.33 ? 59   ASP F OD2 1 
ATOM   4173 N  N   . ILE F  1 60 ? 5.685   52.494  94.838  1.00 17.54 ? 60   ILE F N   1 
ATOM   4174 C  CA  . ILE F  1 60 ? 6.146   53.778  95.362  1.00 18.78 ? 60   ILE F CA  1 
ATOM   4175 C  C   . ILE F  1 60 ? 6.587   54.701  94.245  1.00 17.16 ? 60   ILE F C   1 
ATOM   4176 O  O   . ILE F  1 60 ? 6.254   55.871  94.279  1.00 17.56 ? 60   ILE F O   1 
ATOM   4177 C  CB  . ILE F  1 60 ? 7.349   53.545  96.322  1.00 17.28 ? 60   ILE F CB  1 
ATOM   4178 C  CG1 . ILE F  1 60 ? 6.860   52.803  97.567  1.00 21.94 ? 60   ILE F CG1 1 
ATOM   4179 C  CG2 . ILE F  1 60 ? 8.086   54.814  96.649  1.00 24.61 ? 60   ILE F CG2 1 
ATOM   4180 C  CD1 . ILE F  1 60 ? 5.527   53.347  98.025  1.00 19.85 ? 60   ILE F CD1 1 
ATOM   4181 N  N   . ASN F  1 61 ? 7.378   54.189  93.294  1.00 16.09 ? 61   ASN F N   1 
ATOM   4182 C  CA  . ASN F  1 61 ? 7.899   55.057  92.213  1.00 17.11 ? 61   ASN F CA  1 
ATOM   4183 C  C   . ASN F  1 61 ? 6.979   55.098  90.981  1.00 18.21 ? 61   ASN F C   1 
ATOM   4184 O  O   . ASN F  1 61 ? 7.354   55.653  89.943  1.00 19.41 ? 61   ASN F O   1 
ATOM   4185 C  CB  . ASN F  1 61 ? 9.317   54.644  91.802  1.00 16.12 ? 61   ASN F CB  1 
ATOM   4186 C  CG  . ASN F  1 61 ? 9.357   53.253  91.190  1.00 19.55 ? 61   ASN F CG  1 
ATOM   4187 O  OD1 . ASN F  1 61 ? 8.471   52.444  91.449  1.00 19.72 ? 61   ASN F OD1 1 
ATOM   4188 N  ND2 . ASN F  1 61 ? 10.380  52.970  90.356  1.00 18.07 ? 61   ASN F ND2 1 
ATOM   4189 N  N   . THR F  1 62 ? 5.773   54.550  91.116  1.00 17.62 ? 62   THR F N   1 
ATOM   4190 C  CA  . THR F  1 62 ? 4.783   54.432  90.035  1.00 21.24 ? 62   THR F CA  1 
ATOM   4191 C  C   . THR F  1 62 ? 5.332   53.986  88.684  1.00 21.36 ? 62   THR F C   1 
ATOM   4192 O  O   . THR F  1 62 ? 5.055   54.630  87.657  1.00 22.19 ? 62   THR F O   1 
ATOM   4193 C  CB  . THR F  1 62 ? 3.972   55.726  89.878  1.00 23.51 ? 62   THR F CB  1 
ATOM   4194 O  OG1 . THR F  1 62 ? 4.867   56.845  89.777  1.00 24.20 ? 62   THR F OG1 1 
ATOM   4195 C  CG2 . THR F  1 62 ? 3.249   56.018  91.183  1.00 23.02 ? 62   THR F CG2 1 
ATOM   4196 N  N   . ASP F  1 63 ? 6.119   52.909  88.685  1.00 19.03 ? 63   ASP F N   1 
ATOM   4197 C  CA  . ASP F  1 63 ? 6.667   52.359  87.437  1.00 17.46 ? 63   ASP F CA  1 
ATOM   4198 C  C   . ASP F  1 63 ? 5.917   51.135  86.925  1.00 18.71 ? 63   ASP F C   1 
ATOM   4199 O  O   . ASP F  1 63 ? 6.356   50.457  85.990  1.00 18.40 ? 63   ASP F O   1 
ATOM   4200 C  CB  . ASP F  1 63 ? 8.206   52.157  87.501  1.00 19.27 ? 63   ASP F CB  1 
ATOM   4201 C  CG  . ASP F  1 63 ? 8.637   51.029  88.442  1.00 22.37 ? 63   ASP F CG  1 
ATOM   4202 O  OD1 . ASP F  1 63 ? 7.803   50.521  89.207  1.00 16.14 ? 63   ASP F OD1 1 
ATOM   4203 O  OD2 . ASP F  1 63 ? 9.827   50.597  88.493  1.00 25.68 ? 63   ASP F OD2 1 
ATOM   4204 N  N   . GLY F  1 64 ? 4.789   50.811  87.562  1.00 16.27 ? 64   GLY F N   1 
ATOM   4205 C  CA  . GLY F  1 64 ? 4.001   49.684  87.076  1.00 17.71 ? 64   GLY F CA  1 
ATOM   4206 C  C   . GLY F  1 64 ? 4.468   48.326  87.574  1.00 17.88 ? 64   GLY F C   1 
ATOM   4207 O  O   . GLY F  1 64 ? 4.100   47.321  86.991  1.00 18.42 ? 64   GLY F O   1 
ATOM   4208 N  N   . ALA F  1 65 ? 5.356   48.288  88.563  1.00 18.44 ? 65   ALA F N   1 
ATOM   4209 C  CA  . ALA F  1 65 ? 5.783   47.005  89.153  1.00 18.20 ? 65   ALA F CA  1 
ATOM   4210 C  C   . ALA F  1 65 ? 6.097   47.190  90.626  1.00 17.95 ? 65   ALA F C   1 
ATOM   4211 O  O   . ALA F  1 65 ? 6.236   48.310  91.109  1.00 17.90 ? 65   ALA F O   1 
ATOM   4212 C  CB  . ALA F  1 65 ? 6.992   46.440  88.447  1.00 18.96 ? 65   ALA F CB  1 
ATOM   4213 N  N   . VAL F  1 66 ? 6.185   46.065  91.337  1.00 15.53 ? 66   VAL F N   1 
ATOM   4214 C  CA  . VAL F  1 66 ? 6.533   46.069  92.746  1.00 15.92 ? 66   VAL F CA  1 
ATOM   4215 C  C   . VAL F  1 66 ? 7.874   45.378  92.785  1.00 17.13 ? 66   VAL F C   1 
ATOM   4216 O  O   . VAL F  1 66 ? 7.986   44.194  92.400  1.00 19.33 ? 66   VAL F O   1 
ATOM   4217 C  CB  . VAL F  1 66 ? 5.496   45.269  93.538  1.00 15.28 ? 66   VAL F CB  1 
ATOM   4218 C  CG1 . VAL F  1 66 ? 5.998   44.980  94.962  1.00 15.06 ? 66   VAL F CG1 1 
ATOM   4219 C  CG2 . VAL F  1 66 ? 4.149   46.033  93.594  1.00 18.36 ? 66   VAL F CG2 1 
ATOM   4220 N  N   . ASN F  1 67 ? 8.901   46.123  93.176  1.00 15.32 ? 67   ASN F N   1 
ATOM   4221 C  CA  . ASN F  1 67 ? 10.227  45.528  93.369  1.00 15.67 ? 67   ASN F CA  1 
ATOM   4222 C  C   . ASN F  1 67 ? 10.397  44.918  94.760  1.00 16.30 ? 67   ASN F C   1 
ATOM   4223 O  O   . ASN F  1 67 ? 9.446   44.948  95.562  1.00 17.09 ? 67   ASN F O   1 
ATOM   4224 C  CB  . ASN F  1 67 ? 11.371  46.506  93.006  1.00 17.60 ? 67   ASN F CB  1 
ATOM   4225 C  CG  . ASN F  1 67 ? 11.529  47.669  93.974  1.00 18.07 ? 67   ASN F CG  1 
ATOM   4226 O  OD1 . ASN F  1 67 ? 11.208  47.595  95.163  1.00 19.73 ? 67   ASN F OD1 1 
ATOM   4227 N  ND2 . ASN F  1 67 ? 12.044  48.791  93.438  1.00 18.58 ? 67   ASN F ND2 1 
ATOM   4228 N  N   . PHE F  1 68 ? 11.570  44.401  95.091  1.00 15.27 ? 68   PHE F N   1 
ATOM   4229 C  CA  . PHE F  1 68 ? 11.649  43.656  96.362  1.00 15.72 ? 68   PHE F CA  1 
ATOM   4230 C  C   . PHE F  1 68 ? 11.442  44.576  97.569  1.00 18.42 ? 68   PHE F C   1 
ATOM   4231 O  O   . PHE F  1 68 ? 10.672  44.240  98.525  1.00 18.69 ? 68   PHE F O   1 
ATOM   4232 C  CB  . PHE F  1 68 ? 12.954  42.860  96.490  1.00 19.60 ? 68   PHE F CB  1 
ATOM   4233 C  CG  . PHE F  1 68 ? 13.000  42.057  97.768  1.00 21.35 ? 68   PHE F CG  1 
ATOM   4234 C  CD1 . PHE F  1 68 ? 12.092  41.004  97.968  1.00 19.94 ? 68   PHE F CD1 1 
ATOM   4235 C  CD2 . PHE F  1 68 ? 13.890  42.387  98.781  1.00 21.31 ? 68   PHE F CD2 1 
ATOM   4236 C  CE1 . PHE F  1 68 ? 12.104  40.281  99.174  1.00 22.47 ? 68   PHE F CE1 1 
ATOM   4237 C  CE2 . PHE F  1 68 ? 13.912  41.662  99.974  1.00 23.22 ? 68   PHE F CE2 1 
ATOM   4238 C  CZ  . PHE F  1 68 ? 13.012  40.614  100.162 1.00 21.04 ? 68   PHE F CZ  1 
ATOM   4239 N  N   . GLN F  1 69 ? 12.054  45.767  97.495  1.00 17.62 ? 69   GLN F N   1 
ATOM   4240 C  CA  . GLN F  1 69 ? 11.957  46.699  98.612  1.00 21.72 ? 69   GLN F CA  1 
ATOM   4241 C  C   . GLN F  1 69 ? 10.528  47.196  98.811  1.00 19.78 ? 69   GLN F C   1 
ATOM   4242 O  O   . GLN F  1 69 ? 10.085  47.370  99.933  1.00 17.39 ? 69   GLN F O   1 
ATOM   4243 C  CB  . GLN F  1 69 ? 12.962  47.843  98.504  1.00 24.70 ? 69   GLN F CB  1 
ATOM   4244 C  CG  . GLN F  1 69 ? 12.806  48.733  97.281  1.00 31.77 ? 69   GLN F CG  1 
ATOM   4245 C  CD  . GLN F  1 69 ? 14.103  49.486  96.964  1.00 37.14 ? 69   GLN F CD  1 
ATOM   4246 O  OE1 . GLN F  1 69 ? 14.825  49.141  96.005  1.00 38.79 ? 69   GLN F OE1 1 
ATOM   4247 N  NE2 . GLN F  1 69 ? 14.417  50.493  97.793  1.00 38.32 ? 69   GLN F NE2 1 
ATOM   4248 N  N   . GLU F  1 70 ? 9.808   47.411  97.720  1.00 19.44 ? 70   GLU F N   1 
ATOM   4249 C  CA  . GLU F  1 70 ? 8.377   47.697  97.758  1.00 18.88 ? 70   GLU F CA  1 
ATOM   4250 C  C   . GLU F  1 70 ? 7.579   46.527  98.309  1.00 19.37 ? 70   GLU F C   1 
ATOM   4251 O  O   . GLU F  1 70 ? 6.679   46.750  99.098  1.00 19.87 ? 70   GLU F O   1 
ATOM   4252 C  CB  . GLU F  1 70 ? 7.869   48.064  96.356  1.00 17.73 ? 70   GLU F CB  1 
ATOM   4253 C  CG  . GLU F  1 70 ? 8.461   49.376  95.842  1.00 15.73 ? 70   GLU F CG  1 
ATOM   4254 C  CD  . GLU F  1 70 ? 8.090   49.687  94.401  1.00 16.50 ? 70   GLU F CD  1 
ATOM   4255 O  OE1 . GLU F  1 70 ? 8.035   48.767  93.559  1.00 15.91 ? 70   GLU F OE1 1 
ATOM   4256 O  OE2 . GLU F  1 70 ? 7.910   50.882  94.056  1.00 15.25 ? 70   GLU F OE2 1 
ATOM   4257 N  N   . PHE F  1 71 ? 7.921   45.303  97.924  1.00 19.61 ? 71   PHE F N   1 
ATOM   4258 C  CA  . PHE F  1 71 ? 7.277   44.125  98.515  1.00 20.18 ? 71   PHE F CA  1 
ATOM   4259 C  C   . PHE F  1 71 ? 7.451   44.071  100.050 1.00 20.40 ? 71   PHE F C   1 
ATOM   4260 O  O   . PHE F  1 71 ? 6.511   43.709  100.793 1.00 17.95 ? 71   PHE F O   1 
ATOM   4261 C  CB  . PHE F  1 71 ? 7.813   42.858  97.837  1.00 20.79 ? 71   PHE F CB  1 
ATOM   4262 C  CG  . PHE F  1 71 ? 7.446   41.553  98.537  1.00 20.53 ? 71   PHE F CG  1 
ATOM   4263 C  CD1 . PHE F  1 71 ? 6.145   41.111  98.581  1.00 20.01 ? 71   PHE F CD1 1 
ATOM   4264 C  CD2 . PHE F  1 71 ? 8.434   40.770  99.107  1.00 19.22 ? 71   PHE F CD2 1 
ATOM   4265 C  CE1 . PHE F  1 71 ? 5.826   39.885  99.156  1.00 22.27 ? 71   PHE F CE1 1 
ATOM   4266 C  CE2 . PHE F  1 71 ? 8.131   39.537  99.709  1.00 21.96 ? 71   PHE F CE2 1 
ATOM   4267 C  CZ  . PHE F  1 71 ? 6.809   39.111  99.761  1.00 19.94 ? 71   PHE F CZ  1 
ATOM   4268 N  N   . LEU F  1 72 ? 8.613   44.482  100.554 1.00 18.03 ? 72   LEU F N   1 
ATOM   4269 C  CA  . LEU F  1 72 ? 8.773   44.552  102.016 1.00 20.55 ? 72   LEU F CA  1 
ATOM   4270 C  C   . LEU F  1 72 ? 7.738   45.415  102.776 1.00 20.07 ? 72   LEU F C   1 
ATOM   4271 O  O   . LEU F  1 72 ? 7.503   45.198  103.969 1.00 18.30 ? 72   LEU F O   1 
ATOM   4272 C  CB  . LEU F  1 72 ? 10.219  44.905  102.378 1.00 22.18 ? 72   LEU F CB  1 
ATOM   4273 C  CG  . LEU F  1 72 ? 11.247  43.817  102.042 1.00 22.58 ? 72   LEU F CG  1 
ATOM   4274 C  CD1 . LEU F  1 72 ? 12.692  44.336  102.227 1.00 24.12 ? 72   LEU F CD1 1 
ATOM   4275 C  CD2 . LEU F  1 72 ? 11.013  42.510  102.844 1.00 21.26 ? 72   LEU F CD2 1 
ATOM   4276 N  N   . ILE F  1 73 ? 7.079   46.358  102.104 1.00 15.95 ? 73   ILE F N   1 
ATOM   4277 C  CA  . ILE F  1 73 ? 6.021   47.139  102.772 1.00 17.78 ? 73   ILE F CA  1 
ATOM   4278 C  C   . ILE F  1 73 ? 4.865   46.228  103.156 1.00 15.76 ? 73   ILE F C   1 
ATOM   4279 O  O   . ILE F  1 73 ? 4.342   46.297  104.262 1.00 18.02 ? 73   ILE F O   1 
ATOM   4280 C  CB  . ILE F  1 73 ? 5.504   48.253  101.849 1.00 19.17 ? 73   ILE F CB  1 
ATOM   4281 C  CG1 . ILE F  1 73 ? 6.566   49.335  101.737 1.00 18.34 ? 73   ILE F CG1 1 
ATOM   4282 C  CG2 . ILE F  1 73 ? 4.227   48.881  102.435 1.00 16.55 ? 73   ILE F CG2 1 
ATOM   4283 C  CD1 . ILE F  1 73 ? 6.209   50.386  100.644 1.00 19.33 ? 73   ILE F CD1 1 
ATOM   4284 N  N   . LEU F  1 74 ? 4.430   45.414  102.206 1.00 17.25 ? 74   LEU F N   1 
ATOM   4285 C  CA  . LEU F  1 74 ? 3.375   44.429  102.413 1.00 16.35 ? 74   LEU F CA  1 
ATOM   4286 C  C   . LEU F  1 74 ? 3.804   43.470  103.517 1.00 17.88 ? 74   LEU F C   1 
ATOM   4287 O  O   . LEU F  1 74 ? 2.973   43.102  104.323 1.00 19.87 ? 74   LEU F O   1 
ATOM   4288 C  CB  . LEU F  1 74 ? 3.205   43.580  101.108 1.00 18.89 ? 74   LEU F CB  1 
ATOM   4289 C  CG  . LEU F  1 74 ? 2.181   42.430  101.208 1.00 22.12 ? 74   LEU F CG  1 
ATOM   4290 C  CD1 . LEU F  1 74 ? 0.789   42.923  101.669 1.00 22.38 ? 74   LEU F CD1 1 
ATOM   4291 C  CD2 . LEU F  1 74 ? 2.083   41.658  99.879  1.00 20.66 ? 74   LEU F CD2 1 
ATOM   4292 N  N   . VAL F  1 75 ? 5.055   42.992  103.479 1.00 17.50 ? 75   VAL F N   1 
ATOM   4293 C  CA  . VAL F  1 75 ? 5.528   42.061  104.522 1.00 17.00 ? 75   VAL F CA  1 
ATOM   4294 C  C   . VAL F  1 75 ? 5.461   42.687  105.913 1.00 17.03 ? 75   VAL F C   1 
ATOM   4295 O  O   . VAL F  1 75 ? 4.977   42.058  106.862 1.00 17.82 ? 75   VAL F O   1 
ATOM   4296 C  CB  . VAL F  1 75 ? 6.960   41.570  104.233 1.00 17.39 ? 75   VAL F CB  1 
ATOM   4297 C  CG1 . VAL F  1 75 ? 7.441   40.718  105.400 1.00 18.05 ? 75   VAL F CG1 1 
ATOM   4298 C  CG2 . VAL F  1 75 ? 6.995   40.757  102.892 1.00 17.69 ? 75   VAL F CG2 1 
ATOM   4299 N  N   . ILE F  1 76 ? 5.962   43.914  106.039 1.00 17.58 ? 76   ILE F N   1 
ATOM   4300 C  CA  . ILE F  1 76 ? 5.868   44.646  107.332 1.00 17.11 ? 76   ILE F CA  1 
ATOM   4301 C  C   . ILE F  1 76 ? 4.417   44.763  107.756 1.00 18.23 ? 76   ILE F C   1 
ATOM   4302 O  O   . ILE F  1 76 ? 4.055   44.461  108.890 1.00 19.14 ? 76   ILE F O   1 
ATOM   4303 C  CB  . ILE F  1 76 ? 6.505   46.045  107.213 1.00 16.56 ? 76   ILE F CB  1 
ATOM   4304 C  CG1 . ILE F  1 76 ? 8.043   45.917  107.100 1.00 17.79 ? 76   ILE F CG1 1 
ATOM   4305 C  CG2 . ILE F  1 76 ? 6.136   46.951  108.418 1.00 16.02 ? 76   ILE F CG2 1 
ATOM   4306 C  CD1 . ILE F  1 76 ? 8.765   47.205  106.671 1.00 20.21 ? 76   ILE F CD1 1 
ATOM   4307 N  N   . LYS F  1 77 ? 3.555   45.204  106.842 1.00 17.78 ? 77   LYS F N   1 
ATOM   4308 C  CA  . LYS F  1 77 ? 2.155   45.372  107.217 1.00 19.12 ? 77   LYS F CA  1 
ATOM   4309 C  C   . LYS F  1 77 ? 1.459   44.068  107.614 1.00 19.19 ? 77   LYS F C   1 
ATOM   4310 O  O   . LYS F  1 77 ? 0.652   44.074  108.546 1.00 17.49 ? 77   LYS F O   1 
ATOM   4311 C  CB  . LYS F  1 77 ? 1.385   46.158  106.141 1.00 20.43 ? 77   LYS F CB  1 
ATOM   4312 C  CG  . LYS F  1 77 ? 1.677   47.653  106.295 1.00 21.71 ? 77   LYS F CG  1 
ATOM   4313 C  CD  . LYS F  1 77 ? 1.360   48.479  105.079 1.00 26.52 ? 77   LYS F CD  1 
ATOM   4314 C  CE  . LYS F  1 77 ? 1.605   49.938  105.464 1.00 27.36 ? 77   LYS F CE  1 
ATOM   4315 N  NZ  . LYS F  1 77 ? 0.985   50.856  104.470 1.00 31.77 ? 77   LYS F NZ  1 
ATOM   4316 N  N   . MET F  1 78 ? 1.719   42.977  106.882 1.00 19.24 ? 78   MET F N   1 
ATOM   4317 C  CA  . MET F  1 78 ? 1.209   41.658  107.228 1.00 17.89 ? 78   MET F CA  1 
ATOM   4318 C  C   . MET F  1 78 ? 1.697   41.173  108.587 1.00 18.91 ? 78   MET F C   1 
ATOM   4319 O  O   . MET F  1 78 ? 0.919   40.582  109.363 1.00 17.27 ? 78   MET F O   1 
ATOM   4320 C  CB  . MET F  1 78 ? 1.620   40.617  106.165 1.00 18.50 ? 78   MET F CB  1 
ATOM   4321 C  CG  . MET F  1 78 ? 0.884   40.789  104.861 1.00 19.23 ? 78   MET F CG  1 
ATOM   4322 S  SD  . MET F  1 78 ? 1.320   39.504  103.653 1.00 23.51 ? 78   MET F SD  1 
ATOM   4323 C  CE  . MET F  1 78 ? 1.101   38.047  104.688 1.00 15.01 ? 78   MET F CE  1 
ATOM   4324 N  N   . GLY F  1 79 ? 2.976   41.396  108.862 1.00 15.90 ? 79   GLY F N   1 
ATOM   4325 C  CA  . GLY F  1 79 ? 3.570   41.029  110.150 1.00 15.40 ? 79   GLY F CA  1 
ATOM   4326 C  C   . GLY F  1 79 ? 2.967   41.766  111.348 1.00 17.24 ? 79   GLY F C   1 
ATOM   4327 O  O   . GLY F  1 79 ? 2.584   41.140  112.358 1.00 15.95 ? 79   GLY F O   1 
ATOM   4328 N  N   . VAL F  1 80 ? 2.811   43.080  111.210 1.00 17.40 ? 80   VAL F N   1 
ATOM   4329 C  CA  . VAL F  1 80 ? 2.153   43.901  112.229 1.00 17.47 ? 80   VAL F CA  1 
ATOM   4330 C  C   . VAL F  1 80 ? 0.720   43.432  112.444 1.00 18.68 ? 80   VAL F C   1 
ATOM   4331 O  O   . VAL F  1 80 ? 0.291   43.315  113.583 1.00 18.67 ? 80   VAL F O   1 
ATOM   4332 C  CB  . VAL F  1 80 ? 2.201   45.402  111.883 1.00 18.17 ? 80   VAL F CB  1 
ATOM   4333 C  CG1 . VAL F  1 80 ? 1.342   46.241  112.826 1.00 18.36 ? 80   VAL F CG1 1 
ATOM   4334 C  CG2 . VAL F  1 80 ? 3.659   45.849  111.965 1.00 18.32 ? 80   VAL F CG2 1 
ATOM   4335 N  N   . ALA F  1 81 ? -0.037  43.219  111.369 1.00 17.36 ? 81   ALA F N   1 
ATOM   4336 C  CA  . ALA F  1 81 ? -1.429  42.768  111.567 1.00 18.47 ? 81   ALA F CA  1 
ATOM   4337 C  C   . ALA F  1 81 ? -1.493  41.368  112.174 1.00 19.08 ? 81   ALA F C   1 
ATOM   4338 O  O   . ALA F  1 81 ? -2.322  41.106  113.043 1.00 19.89 ? 81   ALA F O   1 
ATOM   4339 C  CB  . ALA F  1 81 ? -2.248  42.826  110.267 1.00 17.72 ? 81   ALA F CB  1 
ATOM   4340 N  N   . ALA F  1 82 ? -0.658  40.459  111.694 1.00 18.77 ? 82   ALA F N   1 
ATOM   4341 C  CA  . ALA F  1 82 ? -0.661  39.094  112.263 1.00 20.10 ? 82   ALA F CA  1 
ATOM   4342 C  C   . ALA F  1 82 ? -0.256  39.118  113.734 1.00 21.13 ? 82   ALA F C   1 
ATOM   4343 O  O   . ALA F  1 82 ? -0.836  38.393  114.575 1.00 19.30 ? 82   ALA F O   1 
ATOM   4344 C  CB  . ALA F  1 82 ? 0.281   38.173  111.436 1.00 18.75 ? 82   ALA F CB  1 
ATOM   4345 N  N   . HIS F  1 83 ? 0.735   39.948  114.069 1.00 19.73 ? 83   HIS F N   1 
ATOM   4346 C  CA  . HIS F  1 83 ? 1.087   40.082  115.498 1.00 22.17 ? 83   HIS F CA  1 
ATOM   4347 C  C   . HIS F  1 83 ? -0.071  40.587  116.370 1.00 23.74 ? 83   HIS F C   1 
ATOM   4348 O  O   . HIS F  1 83 ? -0.318  40.069  117.477 1.00 23.98 ? 83   HIS F O   1 
ATOM   4349 C  CB  . HIS F  1 83 ? 2.335   40.939  115.693 1.00 20.25 ? 83   HIS F CB  1 
ATOM   4350 C  CG  . HIS F  1 83 ? 2.642   41.201  117.134 1.00 18.75 ? 83   HIS F CG  1 
ATOM   4351 N  ND1 . HIS F  1 83 ? 2.291   42.370  117.762 1.00 17.59 ? 83   HIS F ND1 1 
ATOM   4352 C  CD2 . HIS F  1 83 ? 3.232   40.426  118.075 1.00 19.87 ? 83   HIS F CD2 1 
ATOM   4353 C  CE1 . HIS F  1 83 ? 2.668   42.315  119.033 1.00 21.76 ? 83   HIS F CE1 1 
ATOM   4354 N  NE2 . HIS F  1 83 ? 3.249   41.145  119.245 1.00 18.89 ? 83   HIS F NE2 1 
ATOM   4355 N  N   . LYS F  1 84 ? -0.784  41.592  115.882 1.00 24.34 ? 84   LYS F N   1 
ATOM   4356 C  CA  . LYS F  1 84 ? -2.001  42.065  116.529 1.00 29.09 ? 84   LYS F CA  1 
ATOM   4357 C  C   . LYS F  1 84 ? -3.002  40.925  116.749 1.00 30.63 ? 84   LYS F C   1 
ATOM   4358 O  O   . LYS F  1 84 ? -3.534  40.764  117.852 1.00 29.85 ? 84   LYS F O   1 
ATOM   4359 C  CB  . LYS F  1 84 ? -2.667  43.144  115.672 1.00 32.19 ? 84   LYS F CB  1 
ATOM   4360 C  CG  . LYS F  1 84 ? -2.636  44.538  116.229 1.00 37.71 ? 84   LYS F CG  1 
ATOM   4361 C  CD  . LYS F  1 84 ? -3.243  45.515  115.229 1.00 41.55 ? 84   LYS F CD  1 
ATOM   4362 C  CE  . LYS F  1 84 ? -4.014  46.627  115.948 1.00 44.95 ? 84   LYS F CE  1 
ATOM   4363 N  NZ  . LYS F  1 84 ? -4.250  47.850  115.096 1.00 46.51 ? 84   LYS F NZ  1 
ATOM   4364 N  N   . LYS F  1 85 ? -3.250  40.135  115.708 1.00 32.71 ? 85   LYS F N   1 
ATOM   4365 C  CA  . LYS F  1 85 ? -4.194  39.017  115.778 1.00 36.06 ? 85   LYS F CA  1 
ATOM   4366 C  C   . LYS F  1 85 ? -3.746  37.967  116.789 1.00 37.45 ? 85   LYS F C   1 
ATOM   4367 O  O   . LYS F  1 85 ? -4.559  37.455  117.550 1.00 37.49 ? 85   LYS F O   1 
ATOM   4368 C  CB  . LYS F  1 85 ? -4.363  38.325  114.417 1.00 37.85 ? 85   LYS F CB  1 
ATOM   4369 C  CG  . LYS F  1 85 ? -4.866  39.207  113.293 1.00 41.42 ? 85   LYS F CG  1 
ATOM   4370 C  CD  . LYS F  1 85 ? -6.375  39.263  113.241 1.00 43.86 ? 85   LYS F CD  1 
ATOM   4371 C  CE  . LYS F  1 85 ? -6.830  40.315  112.242 1.00 45.42 ? 85   LYS F CE  1 
ATOM   4372 N  NZ  . LYS F  1 85 ? -8.311  40.452  112.251 1.00 47.41 ? 85   LYS F NZ  1 
ATOM   4373 N  N   . SER F  1 86 ? -2.462  37.633  116.806 1.00 39.06 ? 86   SER F N   1 
ATOM   4374 C  CA  . SER F  1 86 ? -2.015  36.560  117.680 1.00 43.18 ? 86   SER F CA  1 
ATOM   4375 C  C   . SER F  1 86 ? -2.174  36.894  119.165 1.00 46.83 ? 86   SER F C   1 
ATOM   4376 O  O   . SER F  1 86 ? -2.023  36.022  120.029 1.00 45.47 ? 86   SER F O   1 
ATOM   4377 C  CB  . SER F  1 86 ? -0.595  36.113  117.365 1.00 44.39 ? 86   SER F CB  1 
ATOM   4378 O  OG  . SER F  1 86 ? 0.334   36.963  117.997 1.00 47.26 ? 86   SER F OG  1 
ATOM   4379 N  N   . HIS F  1 87 ? -2.492  38.143  119.480 1.00 50.54 ? 87   HIS F N   1 
ATOM   4380 C  CA  . HIS F  1 87 ? -3.069  38.389  120.800 1.00 55.06 ? 87   HIS F CA  1 
ATOM   4381 C  C   . HIS F  1 87 ? -4.258  39.353  120.773 1.00 56.50 ? 87   HIS F C   1 
ATOM   4382 O  O   . HIS F  1 87 ? -4.230  40.433  121.353 1.00 57.91 ? 87   HIS F O   1 
ATOM   4383 C  CB  . HIS F  1 87 ? -1.993  38.702  121.855 1.00 56.67 ? 87   HIS F CB  1 
ATOM   4384 C  CG  . HIS F  1 87 ? -1.460  40.098  121.805 1.00 58.16 ? 87   HIS F CG  1 
ATOM   4385 N  ND1 . HIS F  1 87 ? -1.000  40.679  120.645 1.00 58.13 ? 87   HIS F ND1 1 
ATOM   4386 C  CD2 . HIS F  1 87 ? -1.300  41.024  122.783 1.00 58.62 ? 87   HIS F CD2 1 
ATOM   4387 C  CE1 . HIS F  1 87 ? -0.602  41.913  120.905 1.00 59.29 ? 87   HIS F CE1 1 
ATOM   4388 N  NE2 . HIS F  1 87 ? -0.769  42.146  122.196 1.00 58.99 ? 87   HIS F NE2 1 
ATOM   4389 N  N   . LYS G  2 3  ? 14.247  80.863  97.688  1.00 50.94 ? 4    LYS G N   1 
ATOM   4390 C  CA  . LYS G  2 3  ? 12.855  80.418  97.972  1.00 49.74 ? 4    LYS G CA  1 
ATOM   4391 C  C   . LYS G  2 3  ? 12.698  78.918  97.734  1.00 47.16 ? 4    LYS G C   1 
ATOM   4392 O  O   . LYS G  2 3  ? 11.954  78.270  98.476  1.00 47.06 ? 4    LYS G O   1 
ATOM   4393 C  CB  . LYS G  2 3  ? 11.834  81.197  97.142  1.00 52.48 ? 4    LYS G CB  1 
ATOM   4394 C  CG  . LYS G  2 3  ? 10.642  81.710  97.947  1.00 55.28 ? 4    LYS G CG  1 
ATOM   4395 C  CD  . LYS G  2 3  ? 9.541   80.654  98.067  1.00 57.30 ? 4    LYS G CD  1 
ATOM   4396 C  CE  . LYS G  2 3  ? 8.800   80.453  96.739  1.00 58.33 ? 4    LYS G CE  1 
ATOM   4397 N  NZ  . LYS G  2 3  ? 8.128   81.708  96.266  1.00 58.93 ? 4    LYS G NZ  1 
ATOM   4398 N  N   . MET G  2 4  ? 13.382  78.374  96.720  1.00 41.56 ? 5    MET G N   1 
ATOM   4399 C  CA  . MET G  2 4  ? 13.489  76.920  96.562  1.00 37.89 ? 5    MET G CA  1 
ATOM   4400 C  C   . MET G  2 4  ? 14.200  76.331  97.780  1.00 30.89 ? 5    MET G C   1 
ATOM   4401 O  O   . MET G  2 4  ? 15.237  76.813  98.201  1.00 28.07 ? 5    MET G O   1 
ATOM   4402 C  CB  . MET G  2 4  ? 14.279  76.546  95.303  1.00 39.74 ? 5    MET G CB  1 
ATOM   4403 C  CG  . MET G  2 4  ? 13.539  75.610  94.359  1.00 43.08 ? 5    MET G CG  1 
ATOM   4404 S  SD  . MET G  2 4  ? 14.593  74.840  93.096  1.00 46.09 ? 5    MET G SD  1 
ATOM   4405 C  CE  . MET G  2 4  ? 15.536  76.241  92.510  1.00 45.17 ? 5    MET G CE  1 
ATOM   4406 N  N   . SER G  2 5  ? 13.666  75.274  98.366  1.00 27.54 ? 6    SER G N   1 
ATOM   4407 C  CA  . SER G  2 5  ? 14.302  74.755  99.566  1.00 23.32 ? 6    SER G CA  1 
ATOM   4408 C  C   . SER G  2 5  ? 15.498  73.885  99.243  1.00 22.82 ? 6    SER G C   1 
ATOM   4409 O  O   . SER G  2 5  ? 15.799  73.574  98.077  1.00 20.50 ? 6    SER G O   1 
ATOM   4410 C  CB  . SER G  2 5  ? 13.334  73.855  100.295 1.00 21.90 ? 6    SER G CB  1 
ATOM   4411 O  OG  . SER G  2 5  ? 13.135  72.795  99.385  1.00 22.37 ? 6    SER G OG  1 
ATOM   4412 N  N   . GLN G  2 6  ? 16.149  73.416  100.299 1.00 22.18 ? 7    GLN G N   1 
ATOM   4413 C  CA  . GLN G  2 6  ? 17.255  72.470  100.121 1.00 23.34 ? 7    GLN G CA  1 
ATOM   4414 C  C   . GLN G  2 6  ? 16.802  71.219  99.371  1.00 20.13 ? 7    GLN G C   1 
ATOM   4415 O  O   . GLN G  2 6  ? 17.440  70.776  98.397  1.00 19.82 ? 7    GLN G O   1 
ATOM   4416 C  CB  . GLN G  2 6  ? 17.797  72.031  101.487 1.00 23.36 ? 7    GLN G CB  1 
ATOM   4417 C  CG  . GLN G  2 6  ? 19.112  71.244  101.391 1.00 25.75 ? 7    GLN G CG  1 
ATOM   4418 C  CD  . GLN G  2 6  ? 19.753  70.999  102.756 1.00 27.00 ? 7    GLN G CD  1 
ATOM   4419 O  OE1 . GLN G  2 6  ? 19.333  71.587  103.776 1.00 30.20 ? 7    GLN G OE1 1 
ATOM   4420 N  NE2 . GLN G  2 6  ? 20.758  70.121  102.794 1.00 29.08 ? 7    GLN G NE2 1 
ATOM   4421 N  N   . LEU G  2 7  ? 15.700  70.644  99.829  1.00 18.15 ? 8    LEU G N   1 
ATOM   4422 C  CA  . LEU G  2 7  ? 15.237  69.386  99.250  1.00 17.77 ? 8    LEU G CA  1 
ATOM   4423 C  C   . LEU G  2 7  ? 14.827  69.611  97.806  1.00 20.85 ? 8    LEU G C   1 
ATOM   4424 O  O   . LEU G  2 7  ? 15.126  68.777  96.952  1.00 20.10 ? 8    LEU G O   1 
ATOM   4425 C  CB  . LEU G  2 7  ? 14.065  68.828  100.057 1.00 18.62 ? 8    LEU G CB  1 
ATOM   4426 C  CG  . LEU G  2 7  ? 13.528  67.466  99.674  1.00 20.40 ? 8    LEU G CG  1 
ATOM   4427 C  CD1 . LEU G  2 7  ? 14.677  66.433  99.491  1.00 22.25 ? 8    LEU G CD1 1 
ATOM   4428 C  CD2 . LEU G  2 7  ? 12.519  67.046  100.741 1.00 20.92 ? 8    LEU G CD2 1 
ATOM   4429 N  N   . GLU G  2 8  ? 14.122  70.714  97.538  1.00 19.69 ? 9    GLU G N   1 
ATOM   4430 C  CA  . GLU G  2 8  ? 13.710  71.046  96.162  1.00 22.31 ? 9    GLU G CA  1 
ATOM   4431 C  C   . GLU G  2 8  ? 14.914  71.241  95.232  1.00 21.59 ? 9    GLU G C   1 
ATOM   4432 O  O   . GLU G  2 8  ? 14.936  70.792  94.069  1.00 21.49 ? 9    GLU G O   1 
ATOM   4433 C  CB  . GLU G  2 8  ? 12.824  72.291  96.142  1.00 24.11 ? 9    GLU G CB  1 
ATOM   4434 C  CG  . GLU G  2 8  ? 11.416  72.047  96.669  1.00 28.40 ? 9    GLU G CG  1 
ATOM   4435 C  CD  . GLU G  2 8  ? 10.683  73.316  97.075  1.00 31.64 ? 9    GLU G CD  1 
ATOM   4436 O  OE1 . GLU G  2 8  ? 11.304  74.406  97.216  1.00 34.74 ? 9    GLU G OE1 1 
ATOM   4437 O  OE2 . GLU G  2 8  ? 9.465   73.222  97.320  1.00 33.69 ? 9    GLU G OE2 1 
ATOM   4438 N  N   . ARG G  2 9  ? 15.954  71.886  95.729  1.00 21.70 ? 10   ARG G N   1 
ATOM   4439 C  CA  . ARG G  2 9  ? 17.172  72.030  94.909  1.00 19.57 ? 10   ARG G CA  1 
ATOM   4440 C  C   . ARG G  2 9  ? 17.818  70.685  94.602  1.00 20.81 ? 10   ARG G C   1 
ATOM   4441 O  O   . ARG G  2 9  ? 18.273  70.470  93.498  1.00 19.22 ? 10   ARG G O   1 
ATOM   4442 C  CB  . ARG G  2 9  ? 18.183  72.893  95.662  1.00 18.14 ? 10   ARG G CB  1 
ATOM   4443 C  CG  . ARG G  2 9  ? 17.891  74.388  95.581  1.00 20.26 ? 10   ARG G CG  1 
ATOM   4444 C  CD  . ARG G  2 9  ? 18.777  75.214  96.522  1.00 22.54 ? 10   ARG G CD  1 
ATOM   4445 N  NE  . ARG G  2 9  ? 20.188  75.239  96.120  1.00 24.16 ? 10   ARG G NE  1 
ATOM   4446 C  CZ  . ARG G  2 9  ? 20.728  76.224  95.401  1.00 24.72 ? 10   ARG G CZ  1 
ATOM   4447 N  NH1 . ARG G  2 9  ? 19.963  77.231  95.016  1.00 25.69 ? 10   ARG G NH1 1 
ATOM   4448 N  NH2 . ARG G  2 9  ? 22.012  76.208  95.052  1.00 23.77 ? 10   ARG G NH2 1 
ATOM   4449 N  N   . ASN G  2 10 ? 17.831  69.753  95.560  1.00 19.74 ? 11   ASN G N   1 
ATOM   4450 C  CA  . ASN G  2 10 ? 18.471  68.452  95.329  1.00 18.96 ? 11   ASN G CA  1 
ATOM   4451 C  C   . ASN G  2 10 ? 17.716  67.655  94.291  1.00 16.67 ? 11   ASN G C   1 
ATOM   4452 O  O   . ASN G  2 10 ? 18.296  66.991  93.432  1.00 18.30 ? 11   ASN G O   1 
ATOM   4453 C  CB  . ASN G  2 10 ? 18.531  67.671  96.650  1.00 19.80 ? 11   ASN G CB  1 
ATOM   4454 C  CG  . ASN G  2 10 ? 19.338  68.404  97.692  1.00 21.55 ? 11   ASN G CG  1 
ATOM   4455 O  OD1 . ASN G  2 10 ? 20.243  69.194  97.377  1.00 24.18 ? 11   ASN G OD1 1 
ATOM   4456 N  ND2 . ASN G  2 10 ? 18.991  68.182  98.936  1.00 20.89 ? 11   ASN G ND2 1 
ATOM   4457 N  N   . ILE G  2 11 ? 16.395  67.748  94.367  1.00 19.26 ? 12   ILE G N   1 
ATOM   4458 C  CA  . ILE G  2 11 ? 15.531  67.064  93.411  1.00 19.32 ? 12   ILE G CA  1 
ATOM   4459 C  C   . ILE G  2 11 ? 15.714  67.669  92.013  1.00 19.75 ? 12   ILE G C   1 
ATOM   4460 O  O   . ILE G  2 11 ? 15.847  66.930  91.027  1.00 19.90 ? 12   ILE G O   1 
ATOM   4461 C  CB  . ILE G  2 11 ? 14.090  67.133  93.945  1.00 21.74 ? 12   ILE G CB  1 
ATOM   4462 C  CG1 . ILE G  2 11 ? 13.937  66.044  95.010  1.00 19.90 ? 12   ILE G CG1 1 
ATOM   4463 C  CG2 . ILE G  2 11 ? 13.071  66.875  92.809  1.00 24.40 ? 12   ILE G CG2 1 
ATOM   4464 C  CD1 . ILE G  2 11 ? 12.685  66.266  95.826  1.00 19.42 ? 12   ILE G CD1 1 
ATOM   4465 N  N   . GLU G  2 12 ? 15.784  68.990  91.956  1.00 19.25 ? 13   GLU G N   1 
ATOM   4466 C  CA  . GLU G  2 12 ? 16.005  69.696  90.680  1.00 21.97 ? 13   GLU G CA  1 
ATOM   4467 C  C   . GLU G  2 12 ? 17.333  69.241  90.081  1.00 20.63 ? 13   GLU G C   1 
ATOM   4468 O  O   . GLU G  2 12 ? 17.482  69.097  88.842  1.00 20.74 ? 13   GLU G O   1 
ATOM   4469 C  CB  . GLU G  2 12 ? 15.963  71.226  90.868  1.00 22.44 ? 13   GLU G CB  1 
ATOM   4470 C  CG  . GLU G  2 12 ? 16.334  71.984  89.572  1.00 29.84 ? 13   GLU G CG  1 
ATOM   4471 C  CD  . GLU G  2 12 ? 15.968  73.471  89.632  1.00 32.60 ? 13   GLU G CD  1 
ATOM   4472 O  OE1 . GLU G  2 12 ? 15.917  74.140  88.564  1.00 40.52 ? 13   GLU G OE1 1 
ATOM   4473 O  OE2 . GLU G  2 12 ? 15.725  73.987  90.753  1.00 40.39 ? 13   GLU G OE2 1 
ATOM   4474 N  N   . THR G  2 13 ? 18.331  69.043  90.934  1.00 18.16 ? 14   THR G N   1 
ATOM   4475 C  CA  . THR G  2 13 ? 19.621  68.516  90.417  1.00 17.73 ? 14   THR G CA  1 
ATOM   4476 C  C   . THR G  2 13 ? 19.502  67.097  89.817  1.00 19.97 ? 14   THR G C   1 
ATOM   4477 O  O   . THR G  2 13 ? 20.096  66.769  88.760  1.00 20.02 ? 14   THR G O   1 
ATOM   4478 C  CB  . THR G  2 13 ? 20.674  68.509  91.551  1.00 20.08 ? 14   THR G CB  1 
ATOM   4479 O  OG1 . THR G  2 13 ? 20.998  69.851  91.938  1.00 20.22 ? 14   THR G OG1 1 
ATOM   4480 C  CG2 . THR G  2 13 ? 22.021  67.916  91.073  1.00 21.12 ? 14   THR G CG2 1 
ATOM   4481 N  N   . ILE G  2 14 ? 18.716  66.244  90.462  1.00 19.82 ? 15   ILE G N   1 
ATOM   4482 C  CA  . ILE G  2 14 ? 18.487  64.913  89.908  1.00 20.27 ? 15   ILE G CA  1 
ATOM   4483 C  C   . ILE G  2 14 ? 17.729  65.004  88.593  1.00 20.73 ? 15   ILE G C   1 
ATOM   4484 O  O   . ILE G  2 14 ? 18.036  64.302  87.630  1.00 21.07 ? 15   ILE G O   1 
ATOM   4485 C  CB  . ILE G  2 14 ? 17.671  64.049  90.931  1.00 17.98 ? 15   ILE G CB  1 
ATOM   4486 C  CG1 . ILE G  2 14 ? 18.429  63.896  92.244  1.00 20.37 ? 15   ILE G CG1 1 
ATOM   4487 C  CG2 . ILE G  2 14 ? 17.366  62.661  90.312  1.00 21.38 ? 15   ILE G CG2 1 
ATOM   4488 C  CD1 . ILE G  2 14 ? 17.596  63.294  93.425  1.00 19.01 ? 15   ILE G CD1 1 
ATOM   4489 N  N   . ILE G  2 15 ? 16.649  65.779  88.572  1.00 21.12 ? 16   ILE G N   1 
ATOM   4490 C  CA  . ILE G  2 15 ? 15.861  65.914  87.330  1.00 21.21 ? 16   ILE G CA  1 
ATOM   4491 C  C   . ILE G  2 15 ? 16.693  66.499  86.209  1.00 20.51 ? 16   ILE G C   1 
ATOM   4492 O  O   . ILE G  2 15 ? 16.628  66.034  85.082  1.00 19.91 ? 16   ILE G O   1 
ATOM   4493 C  CB  . ILE G  2 15 ? 14.649  66.799  87.578  1.00 21.65 ? 16   ILE G CB  1 
ATOM   4494 C  CG1 . ILE G  2 15 ? 13.681  66.026  88.477  1.00 21.08 ? 16   ILE G CG1 1 
ATOM   4495 C  CG2 . ILE G  2 15 ? 13.986  67.158  86.262  1.00 22.07 ? 16   ILE G CG2 1 
ATOM   4496 C  CD1 . ILE G  2 15 ? 12.536  66.887  88.981  1.00 23.42 ? 16   ILE G CD1 1 
ATOM   4497 N  N   . ASN G  2 16 ? 17.469  67.529  86.504  1.00 19.85 ? 17   ASN G N   1 
ATOM   4498 C  CA  . ASN G  2 16 ? 18.279  68.130  85.430  1.00 20.00 ? 17   ASN G CA  1 
ATOM   4499 C  C   . ASN G  2 16 ? 19.388  67.217  84.883  1.00 21.23 ? 17   ASN G C   1 
ATOM   4500 O  O   . ASN G  2 16 ? 19.618  67.185  83.675  1.00 19.61 ? 17   ASN G O   1 
ATOM   4501 C  CB  . ASN G  2 16 ? 18.866  69.464  85.872  1.00 19.65 ? 17   ASN G CB  1 
ATOM   4502 C  CG  . ASN G  2 16 ? 19.532  70.200  84.735  1.00 23.02 ? 17   ASN G CG  1 
ATOM   4503 O  OD1 . ASN G  2 16 ? 18.861  70.791  83.905  1.00 24.47 ? 17   ASN G OD1 1 
ATOM   4504 N  ND2 . ASN G  2 16 ? 20.848  70.165  84.695  1.00 21.97 ? 17   ASN G ND2 1 
ATOM   4505 N  N   . THR G  2 17 ? 20.059  66.482  85.775  1.00 20.91 ? 18   THR G N   1 
ATOM   4506 C  CA  . THR G  2 17 ? 21.010  65.458  85.399  1.00 21.16 ? 18   THR G CA  1 
ATOM   4507 C  C   . THR G  2 17 ? 20.457  64.345  84.498  1.00 19.33 ? 18   THR G C   1 
ATOM   4508 O  O   . THR G  2 17 ? 21.091  63.984  83.491  1.00 17.77 ? 18   THR G O   1 
ATOM   4509 C  CB  . THR G  2 17 ? 21.646  64.827  86.634  1.00 23.83 ? 18   THR G CB  1 
ATOM   4510 O  OG1 . THR G  2 17 ? 22.364  65.839  87.355  1.00 27.48 ? 18   THR G OG1 1 
ATOM   4511 C  CG2 . THR G  2 17 ? 22.698  63.845  86.189  1.00 26.39 ? 18   THR G CG2 1 
ATOM   4512 N  N   . PHE G  2 18 ? 19.297  63.812  84.852  1.00 20.39 ? 19   PHE G N   1 
ATOM   4513 C  CA  . PHE G  2 18 ? 18.580  62.839  84.021  1.00 19.01 ? 19   PHE G CA  1 
ATOM   4514 C  C   . PHE G  2 18 ? 18.263  63.387  82.643  1.00 19.53 ? 19   PHE G C   1 
ATOM   4515 O  O   . PHE G  2 18 ? 18.487  62.711  81.636  1.00 21.50 ? 19   PHE G O   1 
ATOM   4516 C  CB  . PHE G  2 18 ? 17.249  62.520  84.706  1.00 19.54 ? 19   PHE G CB  1 
ATOM   4517 C  CG  . PHE G  2 18 ? 16.395  61.540  83.940  1.00 18.32 ? 19   PHE G CG  1 
ATOM   4518 C  CD1 . PHE G  2 18 ? 16.488  60.182  84.176  1.00 20.82 ? 19   PHE G CD1 1 
ATOM   4519 C  CD2 . PHE G  2 18 ? 15.481  61.986  83.007  1.00 19.88 ? 19   PHE G CD2 1 
ATOM   4520 C  CE1 . PHE G  2 18 ? 15.719  59.261  83.445  1.00 19.98 ? 19   PHE G CE1 1 
ATOM   4521 C  CE2 . PHE G  2 18 ? 14.686  61.074  82.267  1.00 20.00 ? 19   PHE G CE2 1 
ATOM   4522 C  CZ  . PHE G  2 18 ? 14.805  59.705  82.503  1.00 18.33 ? 19   PHE G CZ  1 
ATOM   4523 N  N   . HIS G  2 19 ? 17.795  64.633  82.606  1.00 19.82 ? 20   HIS G N   1 
ATOM   4524 C  CA  . HIS G  2 19 ? 17.466  65.328  81.342  1.00 17.53 ? 20   HIS G CA  1 
ATOM   4525 C  C   . HIS G  2 19 ? 18.656  65.554  80.443  1.00 20.10 ? 20   HIS G C   1 
ATOM   4526 O  O   . HIS G  2 19 ? 18.562  65.381  79.235  1.00 21.12 ? 20   HIS G O   1 
ATOM   4527 C  CB  . HIS G  2 19 ? 16.815  66.664  81.657  1.00 17.89 ? 20   HIS G CB  1 
ATOM   4528 C  CG  . HIS G  2 19 ? 16.501  67.486  80.442  1.00 25.05 ? 20   HIS G CG  1 
ATOM   4529 N  ND1 . HIS G  2 19 ? 15.454  67.201  79.593  1.00 26.79 ? 20   HIS G ND1 1 
ATOM   4530 C  CD2 . HIS G  2 19 ? 17.105  68.583  79.932  1.00 24.47 ? 20   HIS G CD2 1 
ATOM   4531 C  CE1 . HIS G  2 19 ? 15.425  68.085  78.611  1.00 25.62 ? 20   HIS G CE1 1 
ATOM   4532 N  NE2 . HIS G  2 19 ? 16.402  68.949  78.808  1.00 26.20 ? 20   HIS G NE2 1 
ATOM   4533 N  N   . GLN G  2 20 ? 19.763  65.945  81.062  1.00 19.76 ? 21   GLN G N   1 
ATOM   4534 C  CA  . GLN G  2 20 ? 20.997  66.227  80.363  1.00 20.34 ? 21   GLN G CA  1 
ATOM   4535 C  C   . GLN G  2 20 ? 21.358  65.070  79.431  1.00 20.91 ? 21   GLN G C   1 
ATOM   4536 O  O   . GLN G  2 20 ? 21.839  65.300  78.316  1.00 20.82 ? 21   GLN G O   1 
ATOM   4537 C  CB  . GLN G  2 20 ? 22.116  66.474  81.380  1.00 22.01 ? 21   GLN G CB  1 
ATOM   4538 C  CG  . GLN G  2 20 ? 23.536  66.308  80.856  1.00 26.99 ? 21   GLN G CG  1 
ATOM   4539 C  CD  . GLN G  2 20 ? 23.980  67.438  79.989  1.00 29.98 ? 21   GLN G CD  1 
ATOM   4540 O  OE1 . GLN G  2 20 ? 23.552  68.591  80.176  1.00 34.24 ? 21   GLN G OE1 1 
ATOM   4541 N  NE2 . GLN G  2 20 ? 24.837  67.123  78.996  1.00 31.51 ? 21   GLN G NE2 1 
ATOM   4542 N  N   . TYR G  2 21 ? 21.174  63.841  79.916  1.00 20.24 ? 22   TYR G N   1 
ATOM   4543 C  CA  . TYR G  2 21 ? 21.539  62.637  79.134  1.00 22.41 ? 22   TYR G CA  1 
ATOM   4544 C  C   . TYR G  2 21 ? 20.395  62.062  78.321  1.00 21.96 ? 22   TYR G C   1 
ATOM   4545 O  O   . TYR G  2 21 ? 20.610  61.600  77.202  1.00 22.25 ? 22   TYR G O   1 
ATOM   4546 C  CB  . TYR G  2 21 ? 22.172  61.554  80.021  1.00 25.75 ? 22   TYR G CB  1 
ATOM   4547 C  CG  . TYR G  2 21 ? 23.460  62.041  80.628  1.00 25.48 ? 22   TYR G CG  1 
ATOM   4548 C  CD1 . TYR G  2 21 ? 23.464  62.658  81.877  1.00 28.31 ? 22   TYR G CD1 1 
ATOM   4549 C  CD2 . TYR G  2 21 ? 24.660  61.917  79.950  1.00 27.36 ? 22   TYR G CD2 1 
ATOM   4550 C  CE1 . TYR G  2 21 ? 24.621  63.144  82.424  1.00 27.27 ? 22   TYR G CE1 1 
ATOM   4551 C  CE2 . TYR G  2 21 ? 25.832  62.396  80.501  1.00 27.63 ? 22   TYR G CE2 1 
ATOM   4552 C  CZ  . TYR G  2 21 ? 25.799  63.010  81.745  1.00 28.24 ? 22   TYR G CZ  1 
ATOM   4553 O  OH  . TYR G  2 21 ? 26.960  63.510  82.310  1.00 28.24 ? 22   TYR G OH  1 
ATOM   4554 N  N   . SER G  2 22 ? 19.179  62.119  78.838  1.00 20.19 ? 23   SER G N   1 
ATOM   4555 C  CA  . SER G  2 22 ? 18.038  61.502  78.142  1.00 22.27 ? 23   SER G CA  1 
ATOM   4556 C  C   . SER G  2 22 ? 17.693  62.160  76.830  1.00 22.37 ? 23   SER G C   1 
ATOM   4557 O  O   . SER G  2 22 ? 17.222  61.488  75.908  1.00 20.18 ? 23   SER G O   1 
ATOM   4558 C  CB  . SER G  2 22 ? 16.781  61.503  79.023  1.00 22.35 ? 23   SER G CB  1 
ATOM   4559 O  OG  . SER G  2 22 ? 16.247  62.820  79.192  1.00 26.07 ? 23   SER G OG  1 
ATOM   4560 N  N   . VAL G  2 23 ? 17.943  63.468  76.714  1.00 19.35 ? 24   VAL G N   1 
ATOM   4561 C  CA  . VAL G  2 23 ? 17.556  64.218  75.514  1.00 20.76 ? 24   VAL G CA  1 
ATOM   4562 C  C   . VAL G  2 23 ? 18.573  64.094  74.356  1.00 20.59 ? 24   VAL G C   1 
ATOM   4563 O  O   . VAL G  2 23 ? 18.319  64.525  73.239  1.00 22.45 ? 24   VAL G O   1 
ATOM   4564 C  CB  . VAL G  2 23 ? 17.331  65.671  75.923  1.00 21.73 ? 24   VAL G CB  1 
ATOM   4565 C  CG1 . VAL G  2 23 ? 18.677  66.347  76.144  1.00 23.64 ? 24   VAL G CG1 1 
ATOM   4566 C  CG2 . VAL G  2 23 ? 16.446  66.384  74.908  1.00 27.70 ? 24   VAL G CG2 1 
ATOM   4567 N  N   . LYS G  2 24 ? 19.702  63.446  74.611  1.00 22.17 ? 25   LYS G N   1 
ATOM   4568 C  CA  . LYS G  2 24 ? 20.760  63.329  73.613  1.00 24.21 ? 25   LYS G CA  1 
ATOM   4569 C  C   . LYS G  2 24 ? 20.339  62.519  72.386  1.00 24.43 ? 25   LYS G C   1 
ATOM   4570 O  O   . LYS G  2 24 ? 20.750  62.818  71.273  1.00 26.89 ? 25   LYS G O   1 
ATOM   4571 C  CB  . LYS G  2 24 ? 21.967  62.663  74.241  1.00 25.71 ? 25   LYS G CB  1 
ATOM   4572 C  CG  . LYS G  2 24 ? 22.697  63.528  75.230  1.00 29.04 ? 25   LYS G CG  1 
ATOM   4573 C  CD  . LYS G  2 24 ? 23.756  62.690  75.904  1.00 32.10 ? 25   LYS G CD  1 
ATOM   4574 C  CE  . LYS G  2 24 ? 25.138  63.289  75.771  1.00 32.38 ? 25   LYS G CE  1 
ATOM   4575 N  NZ  . LYS G  2 24 ? 25.828  62.661  74.607  1.00 35.66 ? 25   LYS G NZ  1 
ATOM   4576 N  N   . LEU G  2 25 ? 19.512  61.495  72.607  1.00 23.36 ? 26   LEU G N   1 
ATOM   4577 C  CA  . LEU G  2 25 ? 19.220  60.509  71.559  1.00 23.06 ? 26   LEU G CA  1 
ATOM   4578 C  C   . LEU G  2 25 ? 17.997  59.701  71.976  1.00 21.91 ? 26   LEU G C   1 
ATOM   4579 O  O   . LEU G  2 25 ? 17.810  59.477  73.159  1.00 20.91 ? 26   LEU G O   1 
ATOM   4580 C  CB  . LEU G  2 25 ? 20.434  59.574  71.402  1.00 23.50 ? 26   LEU G CB  1 
ATOM   4581 C  CG  . LEU G  2 25 ? 20.745  58.674  70.203  1.00 24.89 ? 26   LEU G CG  1 
ATOM   4582 C  CD1 . LEU G  2 25 ? 19.785  57.528  70.151  1.00 30.66 ? 26   LEU G CD1 1 
ATOM   4583 C  CD2 . LEU G  2 25 ? 20.718  59.473  68.912  1.00 25.19 ? 26   LEU G CD2 1 
ATOM   4584 N  N   . GLY G  2 26 ? 17.143  59.299  71.033  1.00 21.44 ? 27   GLY G N   1 
ATOM   4585 C  CA  . GLY G  2 26 ? 15.963  58.472  71.359  1.00 24.30 ? 27   GLY G CA  1 
ATOM   4586 C  C   . GLY G  2 26 ? 14.789  59.256  71.928  1.00 22.90 ? 27   GLY G C   1 
ATOM   4587 O  O   . GLY G  2 26 ? 14.603  60.432  71.619  1.00 22.34 ? 27   GLY G O   1 
ATOM   4588 N  N   . HIS G  2 27 ? 13.970  58.621  72.758  1.00 23.89 ? 28   HIS G N   1 
ATOM   4589 C  CA  . HIS G  2 27 ? 12.903  59.359  73.438  1.00 23.53 ? 28   HIS G CA  1 
ATOM   4590 C  C   . HIS G  2 27 ? 13.604  60.344  74.352  1.00 22.75 ? 28   HIS G C   1 
ATOM   4591 O  O   . HIS G  2 27 ? 14.528  59.972  75.080  1.00 22.07 ? 28   HIS G O   1 
ATOM   4592 C  CB  . HIS G  2 27 ? 11.969  58.435  74.242  1.00 26.99 ? 28   HIS G CB  1 
ATOM   4593 C  CG  . HIS G  2 27 ? 11.348  57.370  73.396  1.00 33.64 ? 28   HIS G CG  1 
ATOM   4594 N  ND1 . HIS G  2 27 ? 10.092  57.499  72.838  1.00 36.07 ? 28   HIS G ND1 1 
ATOM   4595 C  CD2 . HIS G  2 27 ? 11.853  56.207  72.917  1.00 35.04 ? 28   HIS G CD2 1 
ATOM   4596 C  CE1 . HIS G  2 27 ? 9.829   56.437  72.097  1.00 35.99 ? 28   HIS G CE1 1 
ATOM   4597 N  NE2 . HIS G  2 27 ? 10.885  55.641  72.120  1.00 36.89 ? 28   HIS G NE2 1 
ATOM   4598 N  N   . PRO G  2 28 ? 13.170  61.597  74.321  1.00 22.65 ? 29   PRO G N   1 
ATOM   4599 C  CA  . PRO G  2 28 ? 13.854  62.634  75.076  1.00 23.81 ? 29   PRO G CA  1 
ATOM   4600 C  C   . PRO G  2 28 ? 13.621  62.614  76.568  1.00 23.09 ? 29   PRO G C   1 
ATOM   4601 O  O   . PRO G  2 28 ? 14.326  63.298  77.292  1.00 24.95 ? 29   PRO G O   1 
ATOM   4602 C  CB  . PRO G  2 28 ? 13.307  63.949  74.480  1.00 25.83 ? 29   PRO G CB  1 
ATOM   4603 C  CG  . PRO G  2 28 ? 11.976  63.581  73.895  1.00 25.76 ? 29   PRO G CG  1 
ATOM   4604 C  CD  . PRO G  2 28 ? 12.080  62.128  73.479  1.00 22.66 ? 29   PRO G CD  1 
ATOM   4605 N  N   . ASP G  2 29 ? 12.665  61.819  77.030  1.00 22.77 ? 30   ASP G N   1 
ATOM   4606 C  CA  . ASP G  2 29 ? 12.431  61.707  78.473  1.00 22.05 ? 30   ASP G CA  1 
ATOM   4607 C  C   . ASP G  2 29 ? 12.762  60.316  79.027  1.00 22.92 ? 30   ASP G C   1 
ATOM   4608 O  O   . ASP G  2 29 ? 12.313  59.986  80.108  1.00 20.97 ? 30   ASP G O   1 
ATOM   4609 C  CB  . ASP G  2 29 ? 10.989  62.150  78.766  1.00 23.86 ? 30   ASP G CB  1 
ATOM   4610 C  CG  . ASP G  2 29 ? 10.748  62.535  80.239  1.00 26.15 ? 30   ASP G CG  1 
ATOM   4611 O  OD1 . ASP G  2 29 ? 11.653  63.122  80.903  1.00 25.72 ? 30   ASP G OD1 1 
ATOM   4612 O  OD2 . ASP G  2 29 ? 9.649   62.280  80.806  1.00 28.10 ? 30   ASP G OD2 1 
ATOM   4613 N  N   . THR G  2 30 ? 13.535  59.496  78.313  1.00 21.87 ? 31   THR G N   1 
ATOM   4614 C  CA  . THR G  2 30 ? 14.065  58.235  78.882  1.00 22.33 ? 31   THR G CA  1 
ATOM   4615 C  C   . THR G  2 30 ? 15.557  58.082  78.587  1.00 22.08 ? 31   THR G C   1 
ATOM   4616 O  O   . THR G  2 30 ? 16.037  58.688  77.637  1.00 20.69 ? 31   THR G O   1 
ATOM   4617 C  CB  . THR G  2 30 ? 13.354  56.970  78.345  1.00 23.63 ? 31   THR G CB  1 
ATOM   4618 O  OG1 . THR G  2 30 ? 13.622  56.770  76.962  1.00 24.78 ? 31   THR G OG1 1 
ATOM   4619 C  CG2 . THR G  2 30 ? 11.851  57.041  78.445  1.00 24.37 ? 31   THR G CG2 1 
ATOM   4620 N  N   . LEU G  2 31 ? 16.255  57.261  79.376  1.00 19.05 ? 32   LEU G N   1 
ATOM   4621 C  CA  . LEU G  2 31 ? 17.687  57.014  79.197  1.00 20.06 ? 32   LEU G CA  1 
ATOM   4622 C  C   . LEU G  2 31 ? 17.812  55.680  78.459  1.00 22.63 ? 32   LEU G C   1 
ATOM   4623 O  O   . LEU G  2 31 ? 17.314  54.661  78.937  1.00 22.88 ? 32   LEU G O   1 
ATOM   4624 C  CB  . LEU G  2 31 ? 18.369  56.835  80.554  1.00 20.69 ? 32   LEU G CB  1 
ATOM   4625 C  CG  . LEU G  2 31 ? 18.511  58.087  81.420  1.00 17.04 ? 32   LEU G CG  1 
ATOM   4626 C  CD1 . LEU G  2 31 ? 19.119  57.658  82.737  1.00 19.89 ? 32   LEU G CD1 1 
ATOM   4627 C  CD2 . LEU G  2 31 ? 19.433  59.089  80.794  1.00 19.53 ? 32   LEU G CD2 1 
ATOM   4628 N  N   . ASN G  2 32 ? 18.468  55.702  77.315  1.00 20.21 ? 33   ASN G N   1 
ATOM   4629 C  CA  . ASN G  2 32 ? 18.877  54.461  76.669  1.00 21.32 ? 33   ASN G CA  1 
ATOM   4630 C  C   . ASN G  2 32 ? 20.182  53.970  77.319  1.00 19.76 ? 33   ASN G C   1 
ATOM   4631 O  O   . ASN G  2 32 ? 20.730  54.588  78.258  1.00 19.39 ? 33   ASN G O   1 
ATOM   4632 C  CB  . ASN G  2 32 ? 18.922  54.610  75.139  1.00 23.25 ? 33   ASN G CB  1 
ATOM   4633 C  CG  . ASN G  2 32 ? 20.098  55.453  74.653  1.00 24.31 ? 33   ASN G CG  1 
ATOM   4634 O  OD1 . ASN G  2 32 ? 21.012  55.760  75.407  1.00 25.91 ? 33   ASN G OD1 1 
ATOM   4635 N  ND2 . ASN G  2 32 ? 20.088  55.802  73.376  1.00 26.06 ? 33   ASN G ND2 1 
ATOM   4636 N  N   . GLN G  2 33 ? 20.644  52.801  76.913  1.00 22.72 ? 34   GLN G N   1 
ATOM   4637 C  CA  . GLN G  2 33 ? 21.742  52.184  77.638  1.00 25.67 ? 34   GLN G CA  1 
ATOM   4638 C  C   . GLN G  2 33 ? 22.981  53.047  77.587  1.00 23.85 ? 34   GLN G C   1 
ATOM   4639 O  O   . GLN G  2 33 ? 23.698  53.183  78.585  1.00 22.04 ? 34   GLN G O   1 
ATOM   4640 C  CB  . GLN G  2 33 ? 22.047  50.797  77.053  1.00 29.22 ? 34   GLN G CB  1 
ATOM   4641 C  CG  . GLN G  2 33 ? 23.212  50.120  77.746  1.00 34.05 ? 34   GLN G CG  1 
ATOM   4642 C  CD  . GLN G  2 33 ? 23.475  48.709  77.233  1.00 35.66 ? 34   GLN G CD  1 
ATOM   4643 O  OE1 . GLN G  2 33 ? 24.471  48.460  76.528  1.00 38.61 ? 34   GLN G OE1 1 
ATOM   4644 N  NE2 . GLN G  2 33 ? 22.578  47.778  77.584  1.00 38.49 ? 34   GLN G NE2 1 
ATOM   4645 N  N   . GLY G  2 34 ? 23.222  53.632  76.420  1.00 20.07 ? 35   GLY G N   1 
ATOM   4646 C  CA  . GLY G  2 34 ? 24.400  54.495  76.218  1.00 21.05 ? 35   GLY G CA  1 
ATOM   4647 C  C   . GLY G  2 34 ? 24.326  55.775  77.041  1.00 18.94 ? 35   GLY G C   1 
ATOM   4648 O  O   . GLY G  2 34 ? 25.315  56.242  77.619  1.00 19.87 ? 35   GLY G O   1 
ATOM   4649 N  N   . GLU G  2 35 ? 23.131  56.343  77.147  1.00 21.09 ? 36   GLU G N   1 
ATOM   4650 C  CA  . GLU G  2 35 ? 22.948  57.526  78.009  1.00 19.86 ? 36   GLU G CA  1 
ATOM   4651 C  C   . GLU G  2 35 ? 23.053  57.196  79.497  1.00 22.56 ? 36   GLU G C   1 
ATOM   4652 O  O   . GLU G  2 35 ? 23.607  57.977  80.281  1.00 23.20 ? 36   GLU G O   1 
ATOM   4653 C  CB  . GLU G  2 35 ? 21.616  58.167  77.700  1.00 21.83 ? 36   GLU G CB  1 
ATOM   4654 C  CG  . GLU G  2 35 ? 21.609  58.776  76.314  1.00 16.97 ? 36   GLU G CG  1 
ATOM   4655 C  CD  . GLU G  2 35 ? 20.236  58.940  75.691  1.00 20.49 ? 36   GLU G CD  1 
ATOM   4656 O  OE1 . GLU G  2 35 ? 19.222  58.553  76.309  1.00 19.63 ? 36   GLU G OE1 1 
ATOM   4657 O  OE2 . GLU G  2 35 ? 20.156  59.478  74.560  1.00 21.59 ? 36   GLU G OE2 1 
ATOM   4658 N  N   . PHE G  2 36 ? 22.523  56.039  79.888  1.00 22.22 ? 37   PHE G N   1 
ATOM   4659 C  CA  . PHE G  2 36 ? 22.669  55.601  81.277  1.00 21.63 ? 37   PHE G CA  1 
ATOM   4660 C  C   . PHE G  2 36 ? 24.144  55.365  81.633  1.00 21.51 ? 37   PHE G C   1 
ATOM   4661 O  O   . PHE G  2 36 ? 24.602  55.777  82.687  1.00 21.24 ? 37   PHE G O   1 
ATOM   4662 C  CB  . PHE G  2 36 ? 21.799  54.385  81.555  1.00 21.56 ? 37   PHE G CB  1 
ATOM   4663 C  CG  . PHE G  2 36 ? 21.933  53.861  82.962  1.00 21.13 ? 37   PHE G CG  1 
ATOM   4664 C  CD1 . PHE G  2 36 ? 21.277  54.490  84.024  1.00 23.83 ? 37   PHE G CD1 1 
ATOM   4665 C  CD2 . PHE G  2 36 ? 22.691  52.721  83.210  1.00 21.64 ? 37   PHE G CD2 1 
ATOM   4666 C  CE1 . PHE G  2 36 ? 21.409  53.991  85.326  1.00 24.72 ? 37   PHE G CE1 1 
ATOM   4667 C  CE2 . PHE G  2 36 ? 22.828  52.221  84.493  1.00 22.43 ? 37   PHE G CE2 1 
ATOM   4668 C  CZ  . PHE G  2 36 ? 22.187  52.843  85.543  1.00 21.26 ? 37   PHE G CZ  1 
ATOM   4669 N  N   . LYS G  2 37 ? 24.910  54.763  80.724  1.00 21.11 ? 38   LYS G N   1 
ATOM   4670 C  CA  . LYS G  2 37 ? 26.322  54.548  80.993  1.00 22.98 ? 38   LYS G CA  1 
ATOM   4671 C  C   . LYS G  2 37 ? 27.112  55.851  81.143  1.00 23.91 ? 38   LYS G C   1 
ATOM   4672 O  O   . LYS G  2 37 ? 28.024  55.961  81.967  1.00 23.34 ? 38   LYS G O   1 
ATOM   4673 C  CB  . LYS G  2 37 ? 26.928  53.707  79.869  1.00 23.96 ? 38   LYS G CB  1 
ATOM   4674 C  CG  . LYS G  2 37 ? 26.473  52.274  79.885  1.00 27.03 ? 38   LYS G CG  1 
ATOM   4675 C  CD  . LYS G  2 37 ? 27.068  51.504  78.707  1.00 29.76 ? 38   LYS G CD  1 
ATOM   4676 C  CE  . LYS G  2 37 ? 26.841  50.022  78.902  1.00 32.27 ? 38   LYS G CE  1 
ATOM   4677 N  NZ  . LYS G  2 37 ? 27.267  49.240  77.697  1.00 33.91 ? 38   LYS G NZ  1 
ATOM   4678 N  N   . GLU G  2 38 ? 26.792  56.830  80.304  1.00 23.74 ? 39   GLU G N   1 
ATOM   4679 C  CA  . GLU G  2 38 ? 27.466  58.107  80.346  1.00 24.81 ? 39   GLU G CA  1 
ATOM   4680 C  C   . GLU G  2 38 ? 27.201  58.802  81.664  1.00 23.52 ? 39   GLU G C   1 
ATOM   4681 O  O   . GLU G  2 38 ? 28.109  59.325  82.305  1.00 22.37 ? 39   GLU G O   1 
ATOM   4682 C  CB  . GLU G  2 38 ? 26.936  58.990  79.236  1.00 30.40 ? 39   GLU G CB  1 
ATOM   4683 C  CG  . GLU G  2 38 ? 28.053  59.745  78.559  1.00 36.91 ? 39   GLU G CG  1 
ATOM   4684 C  CD  . GLU G  2 38 ? 27.632  60.287  77.208  1.00 40.11 ? 39   GLU G CD  1 
ATOM   4685 O  OE1 . GLU G  2 38 ? 28.375  60.064  76.221  1.00 41.89 ? 39   GLU G OE1 1 
ATOM   4686 O  OE2 . GLU G  2 38 ? 26.558  60.919  77.139  1.00 40.95 ? 39   GLU G OE2 1 
ATOM   4687 N  N   . LEU G  2 39 ? 25.943  58.771  82.084  1.00 20.56 ? 40   LEU G N   1 
ATOM   4688 C  CA  . LEU G  2 39 ? 25.579  59.434  83.325  1.00 22.00 ? 40   LEU G CA  1 
ATOM   4689 C  C   . LEU G  2 39 ? 26.256  58.768  84.534  1.00 23.79 ? 40   LEU G C   1 
ATOM   4690 O  O   . LEU G  2 39 ? 26.823  59.449  85.405  1.00 23.74 ? 40   LEU G O   1 
ATOM   4691 C  CB  . LEU G  2 39 ? 24.060  59.400  83.475  1.00 18.23 ? 40   LEU G CB  1 
ATOM   4692 C  CG  . LEU G  2 39 ? 23.456  60.091  84.724  1.00 20.92 ? 40   LEU G CG  1 
ATOM   4693 C  CD1 . LEU G  2 39 ? 21.976  60.232  84.409  1.00 22.35 ? 40   LEU G CD1 1 
ATOM   4694 C  CD2 . LEU G  2 39 ? 23.640  59.267  85.956  1.00 22.54 ? 40   LEU G CD2 1 
ATOM   4695 N  N   . VAL G  2 40 ? 26.217  57.438  84.594  1.00 23.62 ? 41   VAL G N   1 
ATOM   4696 C  CA  . VAL G  2 40 ? 26.904  56.752  85.677  1.00 24.50 ? 41   VAL G CA  1 
ATOM   4697 C  C   . VAL G  2 40 ? 28.431  57.003  85.639  1.00 25.73 ? 41   VAL G C   1 
ATOM   4698 O  O   . VAL G  2 40 ? 29.046  57.240  86.677  1.00 26.16 ? 41   VAL G O   1 
ATOM   4699 C  CB  . VAL G  2 40 ? 26.558  55.257  85.637  1.00 26.01 ? 41   VAL G CB  1 
ATOM   4700 C  CG1 . VAL G  2 40 ? 27.351  54.454  86.680  1.00 28.76 ? 41   VAL G CG1 1 
ATOM   4701 C  CG2 . VAL G  2 40 ? 25.046  55.088  85.852  1.00 25.01 ? 41   VAL G CG2 1 
ATOM   4702 N  N   . ARG G  2 41 ? 29.039  56.984  84.456  1.00 25.43 ? 42   ARG G N   1 
ATOM   4703 C  CA  . ARG G  2 41 ? 30.487  57.194  84.382  1.00 27.10 ? 42   ARG G CA  1 
ATOM   4704 C  C   . ARG G  2 41 ? 30.894  58.533  84.957  1.00 27.05 ? 42   ARG G C   1 
ATOM   4705 O  O   . ARG G  2 41 ? 31.927  58.639  85.628  1.00 26.30 ? 42   ARG G O   1 
ATOM   4706 C  CB  . ARG G  2 41 ? 31.011  57.188  82.943  1.00 31.62 ? 42   ARG G CB  1 
ATOM   4707 C  CG  . ARG G  2 41 ? 31.007  55.849  82.274  1.00 38.67 ? 42   ARG G CG  1 
ATOM   4708 C  CD  . ARG G  2 41 ? 31.991  54.852  82.858  1.00 41.61 ? 42   ARG G CD  1 
ATOM   4709 N  NE  . ARG G  2 41 ? 32.047  53.629  82.067  1.00 44.38 ? 42   ARG G NE  1 
ATOM   4710 C  CZ  . ARG G  2 41 ? 32.682  52.541  82.460  1.00 45.58 ? 42   ARG G CZ  1 
ATOM   4711 N  NH1 . ARG G  2 41 ? 32.705  51.454  81.691  1.00 45.91 ? 42   ARG G NH1 1 
ATOM   4712 N  NH2 . ARG G  2 41 ? 33.299  52.551  83.636  1.00 45.42 ? 42   ARG G NH2 1 
ATOM   4713 N  N   . LYS G  2 42 ? 30.102  59.559  84.650  1.00 23.94 ? 43   LYS G N   1 
ATOM   4714 C  CA  . LYS G  2 42 ? 30.505  60.919  84.963  1.00 26.12 ? 43   LYS G CA  1 
ATOM   4715 C  C   . LYS G  2 42 ? 29.895  61.398  86.264  1.00 24.65 ? 43   LYS G C   1 
ATOM   4716 O  O   . LYS G  2 42 ? 30.589  61.861  87.148  1.00 26.56 ? 43   LYS G O   1 
ATOM   4717 C  CB  . LYS G  2 42 ? 30.114  61.889  83.848  1.00 28.40 ? 43   LYS G CB  1 
ATOM   4718 C  CG  . LYS G  2 42 ? 30.693  61.547  82.480  1.00 33.64 ? 43   LYS G CG  1 
ATOM   4719 C  CD  . LYS G  2 42 ? 30.864  62.830  81.689  1.00 37.87 ? 43   LYS G CD  1 
ATOM   4720 C  CE  . LYS G  2 42 ? 30.441  62.648  80.245  1.00 40.86 ? 43   LYS G CE  1 
ATOM   4721 N  NZ  . LYS G  2 42 ? 30.792  63.837  79.400  1.00 42.76 ? 43   LYS G NZ  1 
ATOM   4722 N  N   . ASP G  2 43 ? 28.584  61.314  86.372  1.00 23.76 ? 44   ASP G N   1 
ATOM   4723 C  CA  . ASP G  2 43 ? 27.942  61.855  87.554  1.00 23.01 ? 44   ASP G CA  1 
ATOM   4724 C  C   . ASP G  2 43 ? 27.944  60.967  88.777  1.00 23.76 ? 44   ASP G C   1 
ATOM   4725 O  O   . ASP G  2 43 ? 27.704  61.449  89.880  1.00 23.21 ? 44   ASP G O   1 
ATOM   4726 C  CB  . ASP G  2 43 ? 26.570  62.426  87.215  1.00 23.43 ? 44   ASP G CB  1 
ATOM   4727 C  CG  . ASP G  2 43 ? 26.670  63.404  86.060  1.00 27.04 ? 44   ASP G CG  1 
ATOM   4728 O  OD1 . ASP G  2 43 ? 27.206  64.512  86.241  1.00 26.31 ? 44   ASP G OD1 1 
ATOM   4729 O  OD2 . ASP G  2 43 ? 26.346  63.104  84.895  1.00 32.12 ? 44   ASP G OD2 1 
ATOM   4730 N  N   . LEU G  2 44 ? 28.229  59.682  88.591  1.00 21.45 ? 45   LEU G N   1 
ATOM   4731 C  CA  . LEU G  2 44 ? 28.316  58.775  89.732  1.00 22.31 ? 45   LEU G CA  1 
ATOM   4732 C  C   . LEU G  2 44 ? 29.713  58.159  89.804  1.00 24.86 ? 45   LEU G C   1 
ATOM   4733 O  O   . LEU G  2 44 ? 29.877  57.013  90.207  1.00 26.44 ? 45   LEU G O   1 
ATOM   4734 C  CB  . LEU G  2 44 ? 27.210  57.707  89.633  1.00 20.57 ? 45   LEU G CB  1 
ATOM   4735 C  CG  . LEU G  2 44 ? 25.790  58.276  89.842  1.00 22.17 ? 45   LEU G CG  1 
ATOM   4736 C  CD1 . LEU G  2 44 ? 24.706  57.249  89.506  1.00 22.02 ? 45   LEU G CD1 1 
ATOM   4737 C  CD2 . LEU G  2 44 ? 25.547  58.874  91.238  1.00 24.76 ? 45   LEU G CD2 1 
ATOM   4738 N  N   . GLN G  2 45 ? 30.728  58.909  89.379  1.00 24.78 ? 46   GLN G N   1 
ATOM   4739 C  CA  . GLN G  2 45 ? 32.080  58.355  89.323  1.00 26.07 ? 46   GLN G CA  1 
ATOM   4740 C  C   . GLN G  2 45 ? 32.632  57.879  90.677  1.00 26.28 ? 46   GLN G C   1 
ATOM   4741 O  O   . GLN G  2 45 ? 33.466  56.976  90.707  1.00 26.02 ? 46   GLN G O   1 
ATOM   4742 C  CB  . GLN G  2 45 ? 33.060  59.313  88.637  1.00 25.84 ? 46   GLN G CB  1 
ATOM   4743 C  CG  . GLN G  2 45 ? 33.341  60.604  89.381  1.00 28.12 ? 46   GLN G CG  1 
ATOM   4744 C  CD  . GLN G  2 45 ? 34.228  61.530  88.575  1.00 29.54 ? 46   GLN G CD  1 
ATOM   4745 O  OE1 . GLN G  2 45 ? 35.457  61.372  88.566  1.00 32.98 ? 46   GLN G OE1 1 
ATOM   4746 N  NE2 . GLN G  2 45 ? 33.617  62.471  87.867  1.00 29.25 ? 46   GLN G NE2 1 
ATOM   4747 N  N   . ASN G  2 46 ? 32.151  58.449  91.777  1.00 26.45 ? 47   ASN G N   1 
ATOM   4748 C  CA  . ASN G  2 46 ? 32.608  58.062  93.108  1.00 25.86 ? 47   ASN G CA  1 
ATOM   4749 C  C   . ASN G  2 46 ? 31.677  57.013  93.711  1.00 26.64 ? 47   ASN G C   1 
ATOM   4750 O  O   . ASN G  2 46 ? 32.127  55.962  94.174  1.00 28.11 ? 47   ASN G O   1 
ATOM   4751 C  CB  . ASN G  2 46 ? 32.684  59.279  94.032  1.00 27.74 ? 47   ASN G CB  1 
ATOM   4752 C  CG  . ASN G  2 46 ? 33.496  60.407  93.451  1.00 29.59 ? 47   ASN G CG  1 
ATOM   4753 O  OD1 . ASN G  2 46 ? 34.718  60.315  93.339  1.00 30.26 ? 47   ASN G OD1 1 
ATOM   4754 N  ND2 . ASN G  2 46 ? 32.822  61.476  93.051  1.00 30.34 ? 47   ASN G ND2 1 
ATOM   4755 N  N   . PHE G  2 47 ? 30.376  57.283  93.690  1.00 24.22 ? 48   PHE G N   1 
ATOM   4756 C  CA  . PHE G  2 47 ? 29.400  56.382  94.303  1.00 25.83 ? 48   PHE G CA  1 
ATOM   4757 C  C   . PHE G  2 47 ? 29.402  54.997  93.645  1.00 27.13 ? 48   PHE G C   1 
ATOM   4758 O  O   . PHE G  2 47 ? 29.238  53.985  94.330  1.00 26.65 ? 48   PHE G O   1 
ATOM   4759 C  CB  . PHE G  2 47 ? 27.997  57.000  94.263  1.00 25.36 ? 48   PHE G CB  1 
ATOM   4760 C  CG  . PHE G  2 47 ? 27.743  58.004  95.361  1.00 24.93 ? 48   PHE G CG  1 
ATOM   4761 C  CD1 . PHE G  2 47 ? 26.448  58.365  95.708  1.00 26.60 ? 48   PHE G CD1 1 
ATOM   4762 C  CD2 . PHE G  2 47 ? 28.791  58.617  96.023  1.00 24.71 ? 48   PHE G CD2 1 
ATOM   4763 C  CE1 . PHE G  2 47 ? 26.208  59.297  96.702  1.00 27.46 ? 48   PHE G CE1 1 
ATOM   4764 C  CE2 . PHE G  2 47 ? 28.555  59.542  97.046  1.00 26.83 ? 48   PHE G CE2 1 
ATOM   4765 C  CZ  . PHE G  2 47 ? 27.252  59.877  97.392  1.00 26.28 ? 48   PHE G CZ  1 
ATOM   4766 N  N   . LEU G  2 48 ? 29.569  54.964  92.324  1.00 26.12 ? 49   LEU G N   1 
ATOM   4767 C  CA  . LEU G  2 48 ? 29.652  53.720  91.571  1.00 26.59 ? 49   LEU G CA  1 
ATOM   4768 C  C   . LEU G  2 48 ? 31.055  53.443  91.065  1.00 27.35 ? 49   LEU G C   1 
ATOM   4769 O  O   . LEU G  2 48 ? 31.229  52.849  90.001  1.00 28.12 ? 49   LEU G O   1 
ATOM   4770 C  CB  . LEU G  2 48 ? 28.663  53.715  90.413  1.00 24.98 ? 49   LEU G CB  1 
ATOM   4771 C  CG  . LEU G  2 48 ? 27.211  53.629  90.905  1.00 25.45 ? 49   LEU G CG  1 
ATOM   4772 C  CD1 . LEU G  2 48 ? 26.216  53.721  89.763  1.00 23.46 ? 49   LEU G CD1 1 
ATOM   4773 C  CD2 . LEU G  2 48 ? 26.986  52.340  91.653  1.00 28.70 ? 49   LEU G CD2 1 
ATOM   4774 N  N   . LYS G  2 49 ? 32.050  53.866  91.841  1.00 28.71 ? 50   LYS G N   1 
ATOM   4775 C  CA  . LYS G  2 49 ? 33.450  53.733  91.444  1.00 32.16 ? 50   LYS G CA  1 
ATOM   4776 C  C   . LYS G  2 49 ? 33.828  52.295  91.091  1.00 32.30 ? 50   LYS G C   1 
ATOM   4777 O  O   . LYS G  2 49 ? 34.361  52.053  90.019  1.00 32.94 ? 50   LYS G O   1 
ATOM   4778 C  CB  . LYS G  2 49 ? 34.360  54.290  92.535  1.00 34.24 ? 50   LYS G CB  1 
ATOM   4779 C  CG  . LYS G  2 49 ? 35.843  54.130  92.270  1.00 38.42 ? 50   LYS G CG  1 
ATOM   4780 C  CD  . LYS G  2 49 ? 36.635  54.775  93.402  1.00 41.89 ? 50   LYS G CD  1 
ATOM   4781 C  CE  . LYS G  2 49 ? 38.121  54.421  93.350  1.00 44.93 ? 50   LYS G CE  1 
ATOM   4782 N  NZ  . LYS G  2 49 ? 38.515  53.633  92.149  1.00 46.70 ? 50   LYS G NZ  1 
ATOM   4783 N  N   . LYS G  2 50 ? 33.517  51.349  91.971  1.00 33.19 ? 51   LYS G N   1 
ATOM   4784 C  CA  . LYS G  2 50 ? 33.815  49.944  91.709  1.00 35.22 ? 51   LYS G CA  1 
ATOM   4785 C  C   . LYS G  2 50 ? 33.046  49.403  90.497  1.00 33.29 ? 51   LYS G C   1 
ATOM   4786 O  O   . LYS G  2 50 ? 33.627  48.757  89.615  1.00 32.28 ? 51   LYS G O   1 
ATOM   4787 C  CB  . LYS G  2 50 ? 33.538  49.093  92.952  1.00 37.94 ? 51   LYS G CB  1 
ATOM   4788 C  CG  . LYS G  2 50 ? 33.854  47.626  92.743  1.00 41.69 ? 51   LYS G CG  1 
ATOM   4789 C  CD  . LYS G  2 50 ? 33.456  46.762  93.931  1.00 43.22 ? 51   LYS G CD  1 
ATOM   4790 C  CE  . LYS G  2 50 ? 33.798  45.302  93.635  1.00 46.17 ? 51   LYS G CE  1 
ATOM   4791 N  NZ  . LYS G  2 50 ? 33.736  44.428  94.848  1.00 47.81 ? 51   LYS G NZ  1 
ATOM   4792 N  N   . GLU G  2 51 ? 31.748  49.701  90.446  1.00 31.92 ? 52   GLU G N   1 
ATOM   4793 C  CA  . GLU G  2 51 ? 30.873  49.210  89.368  1.00 30.42 ? 52   GLU G CA  1 
ATOM   4794 C  C   . GLU G  2 51 ? 31.218  49.756  87.981  1.00 29.84 ? 52   GLU G C   1 
ATOM   4795 O  O   . GLU G  2 51 ? 31.101  49.036  86.981  1.00 27.26 ? 52   GLU G O   1 
ATOM   4796 C  CB  . GLU G  2 51 ? 29.400  49.482  89.688  1.00 33.12 ? 52   GLU G CB  1 
ATOM   4797 C  CG  . GLU G  2 51 ? 28.884  48.788  90.942  1.00 33.70 ? 52   GLU G CG  1 
ATOM   4798 C  CD  . GLU G  2 51 ? 29.364  49.395  92.253  1.00 34.76 ? 52   GLU G CD  1 
ATOM   4799 O  OE1 . GLU G  2 51 ? 30.106  50.407  92.279  1.00 33.24 ? 52   GLU G OE1 1 
ATOM   4800 O  OE2 . GLU G  2 51 ? 28.995  48.822  93.295  1.00 37.04 ? 52   GLU G OE2 1 
ATOM   4801 N  N   . ASN G  2 52 ? 31.626  51.023  87.924  1.00 28.29 ? 53   ASN G N   1 
ATOM   4802 C  CA  . ASN G  2 52 ? 32.087  51.650  86.675  1.00 30.24 ? 53   ASN G CA  1 
ATOM   4803 C  C   . ASN G  2 52 ? 33.279  50.927  86.026  1.00 31.24 ? 53   ASN G C   1 
ATOM   4804 O  O   . ASN G  2 52 ? 33.536  51.090  84.830  1.00 30.58 ? 53   ASN G O   1 
ATOM   4805 C  CB  . ASN G  2 52 ? 32.403  53.141  86.907  1.00 29.74 ? 53   ASN G CB  1 
ATOM   4806 C  CG  . ASN G  2 52 ? 31.205  54.056  86.627  1.00 28.88 ? 53   ASN G CG  1 
ATOM   4807 O  OD1 . ASN G  2 52 ? 30.686  54.079  85.511  1.00 30.06 ? 53   ASN G OD1 1 
ATOM   4808 N  ND2 . ASN G  2 52 ? 30.782  54.822  87.622  1.00 28.53 ? 53   ASN G ND2 1 
ATOM   4809 N  N   . LYS G  2 53 ? 34.016  50.128  86.793  1.00 33.04 ? 54   LYS G N   1 
ATOM   4810 C  CA  . LYS G  2 53 ? 35.167  49.417  86.231  1.00 36.00 ? 54   LYS G CA  1 
ATOM   4811 C  C   . LYS G  2 53 ? 34.760  48.252  85.336  1.00 36.21 ? 54   LYS G C   1 
ATOM   4812 O  O   . LYS G  2 53 ? 35.578  47.717  84.602  1.00 36.90 ? 54   LYS G O   1 
ATOM   4813 C  CB  . LYS G  2 53 ? 36.108  48.926  87.333  1.00 37.56 ? 54   LYS G CB  1 
ATOM   4814 C  CG  . LYS G  2 53 ? 36.832  50.064  88.026  1.00 40.20 ? 54   LYS G CG  1 
ATOM   4815 C  CD  . LYS G  2 53 ? 37.740  49.560  89.134  1.00 42.74 ? 54   LYS G CD  1 
ATOM   4816 C  CE  . LYS G  2 53 ? 38.505  50.726  89.752  1.00 44.61 ? 54   LYS G CE  1 
ATOM   4817 N  NZ  . LYS G  2 53 ? 39.349  50.294  90.898  1.00 46.44 ? 54   LYS G NZ  1 
ATOM   4818 N  N   . ASN G  2 54 ? 33.496  47.857  85.410  1.00 36.23 ? 55   ASN G N   1 
ATOM   4819 C  CA  . ASN G  2 54 ? 32.990  46.774  84.590  1.00 36.74 ? 55   ASN G CA  1 
ATOM   4820 C  C   . ASN G  2 54 ? 31.698  47.181  83.891  1.00 36.61 ? 55   ASN G C   1 
ATOM   4821 O  O   . ASN G  2 54 ? 30.649  47.313  84.527  1.00 34.83 ? 55   ASN G O   1 
ATOM   4822 C  CB  . ASN G  2 54 ? 32.765  45.531  85.451  1.00 38.13 ? 55   ASN G CB  1 
ATOM   4823 C  CG  . ASN G  2 54 ? 32.403  44.308  84.633  1.00 39.58 ? 55   ASN G CG  1 
ATOM   4824 O  OD1 . ASN G  2 54 ? 32.165  44.398  83.429  1.00 40.07 ? 55   ASN G OD1 1 
ATOM   4825 N  ND2 . ASN G  2 54 ? 32.368  43.151  85.284  1.00 40.39 ? 55   ASN G ND2 1 
ATOM   4826 N  N   . GLU G  2 55 ? 31.793  47.376  82.580  1.00 37.14 ? 56   GLU G N   1 
ATOM   4827 C  CA  . GLU G  2 55 ? 30.663  47.778  81.755  1.00 38.92 ? 56   GLU G CA  1 
ATOM   4828 C  C   . GLU G  2 55 ? 29.455  46.846  81.883  1.00 37.11 ? 56   GLU G C   1 
ATOM   4829 O  O   . GLU G  2 55 ? 28.311  47.294  81.823  1.00 35.58 ? 56   GLU G O   1 
ATOM   4830 C  CB  . GLU G  2 55 ? 31.100  47.903  80.292  1.00 43.35 ? 56   GLU G CB  1 
ATOM   4831 C  CG  . GLU G  2 55 ? 29.992  48.363  79.358  1.00 48.15 ? 56   GLU G CG  1 
ATOM   4832 C  CD  . GLU G  2 55 ? 30.504  48.887  78.028  1.00 51.77 ? 56   GLU G CD  1 
ATOM   4833 O  OE1 . GLU G  2 55 ? 31.600  48.460  77.581  1.00 53.25 ? 56   GLU G OE1 1 
ATOM   4834 O  OE2 . GLU G  2 55 ? 29.794  49.725  77.420  1.00 52.91 ? 56   GLU G OE2 1 
ATOM   4835 N  N   . LYS G  2 56 ? 29.707  45.557  82.071  1.00 35.65 ? 57   LYS G N   1 
ATOM   4836 C  CA  . LYS G  2 56 ? 28.631  44.582  82.221  1.00 35.48 ? 57   LYS G CA  1 
ATOM   4837 C  C   . LYS G  2 56 ? 27.864  44.736  83.543  1.00 32.06 ? 57   LYS G C   1 
ATOM   4838 O  O   . LYS G  2 56 ? 26.657  44.497  83.582  1.00 30.03 ? 57   LYS G O   1 
ATOM   4839 C  CB  . LYS G  2 56 ? 29.152  43.148  82.025  1.00 37.92 ? 57   LYS G CB  1 
ATOM   4840 C  CG  . LYS G  2 56 ? 29.570  42.848  80.587  1.00 40.04 ? 57   LYS G CG  1 
ATOM   4841 C  CD  . LYS G  2 56 ? 30.227  41.473  80.432  1.00 42.15 ? 57   LYS G CD  1 
ATOM   4842 C  CE  . LYS G  2 56 ? 30.917  41.337  79.060  1.00 44.25 ? 57   LYS G CE  1 
ATOM   4843 N  NZ  . LYS G  2 56 ? 31.509  39.978  78.827  1.00 45.59 ? 57   LYS G NZ  1 
ATOM   4844 N  N   . VAL G  2 57 ? 28.552  45.131  84.613  1.00 29.69 ? 58   VAL G N   1 
ATOM   4845 C  CA  . VAL G  2 57 ? 27.895  45.452  85.890  1.00 28.26 ? 58   VAL G CA  1 
ATOM   4846 C  C   . VAL G  2 57 ? 26.915  46.619  85.732  1.00 26.43 ? 58   VAL G C   1 
ATOM   4847 O  O   . VAL G  2 57 ? 25.771  46.549  86.211  1.00 24.97 ? 58   VAL G O   1 
ATOM   4848 C  CB  . VAL G  2 57 ? 28.942  45.782  86.984  1.00 27.37 ? 58   VAL G CB  1 
ATOM   4849 C  CG1 . VAL G  2 57 ? 28.279  46.151  88.307  1.00 25.75 ? 58   VAL G CG1 1 
ATOM   4850 C  CG2 . VAL G  2 57 ? 29.875  44.605  87.165  1.00 27.91 ? 58   VAL G CG2 1 
ATOM   4851 N  N   . ILE G  2 58 ? 27.374  47.681  85.068  1.00 24.01 ? 59   ILE G N   1 
ATOM   4852 C  CA  . ILE G  2 58 ? 26.531  48.830  84.745  1.00 26.09 ? 59   ILE G CA  1 
ATOM   4853 C  C   . ILE G  2 58 ? 25.298  48.408  83.940  1.00 25.18 ? 59   ILE G C   1 
ATOM   4854 O  O   . ILE G  2 58 ? 24.159  48.803  84.248  1.00 23.16 ? 59   ILE G O   1 
ATOM   4855 C  CB  . ILE G  2 58 ? 27.355  49.911  84.001  1.00 27.07 ? 59   ILE G CB  1 
ATOM   4856 C  CG1 . ILE G  2 58 ? 28.565  50.311  84.864  1.00 26.23 ? 59   ILE G CG1 1 
ATOM   4857 C  CG2 . ILE G  2 58 ? 26.477  51.132  83.701  1.00 28.16 ? 59   ILE G CG2 1 
ATOM   4858 C  CD1 . ILE G  2 58 ? 28.176  50.778  86.296  1.00 26.78 ? 59   ILE G CD1 1 
ATOM   4859 N  N   . GLU G  2 59 ? 25.529  47.582  82.921  1.00 25.58 ? 60   GLU G N   1 
ATOM   4860 C  CA  . GLU G  2 59 ? 24.442  47.009  82.134  1.00 26.43 ? 60   GLU G CA  1 
ATOM   4861 C  C   . GLU G  2 59 ? 23.426  46.242  82.978  1.00 25.48 ? 60   GLU G C   1 
ATOM   4862 O  O   . GLU G  2 59 ? 22.223  46.354  82.732  1.00 24.23 ? 60   GLU G O   1 
ATOM   4863 C  CB  . GLU G  2 59 ? 24.984  46.108  81.019  1.00 27.44 ? 60   GLU G CB  1 
ATOM   4864 C  CG  . GLU G  2 59 ? 25.736  46.882  79.943  1.00 28.85 ? 60   GLU G CG  1 
ATOM   4865 C  CD  . GLU G  2 59 ? 26.475  45.984  78.959  1.00 30.03 ? 60   GLU G CD  1 
ATOM   4866 O  OE1 . GLU G  2 59 ? 26.203  44.765  78.923  1.00 30.82 ? 60   GLU G OE1 1 
ATOM   4867 O  OE2 . GLU G  2 59 ? 27.340  46.507  78.204  1.00 32.15 ? 60   GLU G OE2 1 
ATOM   4868 N  N   . HIS G  2 60 ? 23.896  45.438  83.932  1.00 26.58 ? 61   HIS G N   1 
ATOM   4869 C  CA  . HIS G  2 60 ? 22.990  44.660  84.782  1.00 28.17 ? 61   HIS G CA  1 
ATOM   4870 C  C   . HIS G  2 60 ? 22.160  45.571  85.698  1.00 26.05 ? 61   HIS G C   1 
ATOM   4871 O  O   . HIS G  2 60 ? 21.000  45.271  85.999  1.00 27.11 ? 61   HIS G O   1 
ATOM   4872 C  CB  . HIS G  2 60 ? 23.761  43.689  85.677  1.00 31.28 ? 61   HIS G CB  1 
ATOM   4873 C  CG  . HIS G  2 60 ? 24.455  42.600  84.927  1.00 37.12 ? 61   HIS G CG  1 
ATOM   4874 N  ND1 . HIS G  2 60 ? 23.930  42.034  83.785  1.00 38.71 ? 61   HIS G ND1 1 
ATOM   4875 C  CD2 . HIS G  2 60 ? 25.624  41.960  85.164  1.00 38.68 ? 61   HIS G CD2 1 
ATOM   4876 C  CE1 . HIS G  2 60 ? 24.748  41.089  83.351  1.00 40.61 ? 61   HIS G CE1 1 
ATOM   4877 N  NE2 . HIS G  2 60 ? 25.785  41.029  84.167  1.00 40.04 ? 61   HIS G NE2 1 
ATOM   4878 N  N   . ILE G  2 61 ? 22.782  46.646  86.163  1.00 25.45 ? 62   ILE G N   1 
ATOM   4879 C  CA  . ILE G  2 61 ? 22.113  47.630  87.015  1.00 26.14 ? 62   ILE G CA  1 
ATOM   4880 C  C   . ILE G  2 61 ? 20.955  48.227  86.221  1.00 25.86 ? 62   ILE G C   1 
ATOM   4881 O  O   . ILE G  2 61 ? 19.823  48.284  86.706  1.00 26.42 ? 62   ILE G O   1 
ATOM   4882 C  CB  . ILE G  2 61 ? 23.099  48.734  87.457  1.00 27.02 ? 62   ILE G CB  1 
ATOM   4883 C  CG1 . ILE G  2 61 ? 24.128  48.134  88.438  1.00 27.81 ? 62   ILE G CG1 1 
ATOM   4884 C  CG2 . ILE G  2 61 ? 22.338  49.888  88.103  1.00 26.06 ? 62   ILE G CG2 1 
ATOM   4885 C  CD1 . ILE G  2 61 ? 25.287  49.054  88.794  1.00 26.97 ? 62   ILE G CD1 1 
ATOM   4886 N  N   . MET G  2 62 ? 21.236  48.649  84.988  1.00 24.33 ? 63   MET G N   1 
ATOM   4887 C  CA  . MET G  2 62 ? 20.162  49.158  84.155  1.00 27.08 ? 63   MET G CA  1 
ATOM   4888 C  C   . MET G  2 62 ? 19.059  48.134  83.889  1.00 23.77 ? 63   MET G C   1 
ATOM   4889 O  O   . MET G  2 62 ? 17.890  48.487  83.928  1.00 24.37 ? 63   MET G O   1 
ATOM   4890 C  CB  . MET G  2 62 ? 20.665  49.658  82.806  1.00 31.01 ? 63   MET G CB  1 
ATOM   4891 C  CG  . MET G  2 62 ? 19.467  49.995  81.919  1.00 33.22 ? 63   MET G CG  1 
ATOM   4892 S  SD  . MET G  2 62 ? 19.939  51.189  80.693  1.00 36.90 ? 63   MET G SD  1 
ATOM   4893 C  CE  . MET G  2 62 ? 18.354  51.471  79.877  1.00 33.82 ? 63   MET G CE  1 
ATOM   4894 N  N   . GLU G  2 63 ? 19.425  46.880  83.612  1.00 23.21 ? 64   GLU G N   1 
ATOM   4895 C  CA  . GLU G  2 63 ? 18.436  45.848  83.295  1.00 25.38 ? 64   GLU G CA  1 
ATOM   4896 C  C   . GLU G  2 63 ? 17.524  45.634  84.505  1.00 23.95 ? 64   GLU G C   1 
ATOM   4897 O  O   . GLU G  2 63 ? 16.311  45.472  84.366  1.00 23.00 ? 64   GLU G O   1 
ATOM   4898 C  CB  . GLU G  2 63 ? 19.134  44.534  82.945  1.00 29.18 ? 64   GLU G CB  1 
ATOM   4899 C  CG  . GLU G  2 63 ? 19.868  44.621  81.623  1.00 35.35 ? 64   GLU G CG  1 
ATOM   4900 C  CD  . GLU G  2 63 ? 20.907  43.527  81.433  1.00 39.27 ? 64   GLU G CD  1 
ATOM   4901 O  OE1 . GLU G  2 63 ? 21.780  43.736  80.553  1.00 42.37 ? 64   GLU G OE1 1 
ATOM   4902 O  OE2 . GLU G  2 63 ? 20.839  42.470  82.121  1.00 41.49 ? 64   GLU G OE2 1 
ATOM   4903 N  N   . ASP G  2 64 ? 18.124  45.658  85.683  1.00 22.14 ? 65   ASP G N   1 
ATOM   4904 C  CA  . ASP G  2 64 ? 17.372  45.502  86.924  1.00 23.16 ? 65   ASP G CA  1 
ATOM   4905 C  C   . ASP G  2 64 ? 16.413  46.666  87.157  1.00 22.40 ? 65   ASP G C   1 
ATOM   4906 O  O   . ASP G  2 64 ? 15.284  46.444  87.627  1.00 21.53 ? 65   ASP G O   1 
ATOM   4907 C  CB  . ASP G  2 64 ? 18.335  45.295  88.107  1.00 26.34 ? 65   ASP G CB  1 
ATOM   4908 C  CG  . ASP G  2 64 ? 19.176  43.985  87.964  1.00 31.64 ? 65   ASP G CG  1 
ATOM   4909 O  OD1 . ASP G  2 64 ? 20.203  43.869  88.666  1.00 35.85 ? 65   ASP G OD1 1 
ATOM   4910 O  OD2 . ASP G  2 64 ? 18.937  43.037  87.162  1.00 31.58 ? 65   ASP G OD2 1 
ATOM   4911 N  N   . LEU G  2 65 ? 16.836  47.891  86.804  1.00 21.40 ? 66   LEU G N   1 
ATOM   4912 C  CA  . LEU G  2 65 ? 15.977  49.068  86.989  1.00 23.57 ? 66   LEU G CA  1 
ATOM   4913 C  C   . LEU G  2 65 ? 14.874  49.123  85.943  1.00 22.56 ? 66   LEU G C   1 
ATOM   4914 O  O   . LEU G  2 65 ? 13.848  49.757  86.181  1.00 22.18 ? 66   LEU G O   1 
ATOM   4915 C  CB  . LEU G  2 65 ? 16.761  50.391  86.988  1.00 21.39 ? 66   LEU G CB  1 
ATOM   4916 C  CG  . LEU G  2 65 ? 17.755  50.636  88.135  1.00 22.10 ? 66   LEU G CG  1 
ATOM   4917 C  CD1 . LEU G  2 65 ? 18.837  51.668  87.762  1.00 20.73 ? 66   LEU G CD1 1 
ATOM   4918 C  CD2 . LEU G  2 65 ? 17.029  51.010  89.392  1.00 23.41 ? 66   LEU G CD2 1 
ATOM   4919 N  N   . ASP G  2 66 ? 15.075  48.425  84.817  1.00 17.01 ? 67   ASP G N   1 
ATOM   4920 C  CA  . ASP G  2 66 ? 14.218  48.603  83.655  1.00 19.39 ? 67   ASP G CA  1 
ATOM   4921 C  C   . ASP G  2 66 ? 12.996  47.692  83.850  1.00 20.82 ? 67   ASP G C   1 
ATOM   4922 O  O   . ASP G  2 66 ? 12.867  46.614  83.237  1.00 20.60 ? 67   ASP G O   1 
ATOM   4923 C  CB  . ASP G  2 66 ? 15.012  48.298  82.384  1.00 20.01 ? 67   ASP G CB  1 
ATOM   4924 C  CG  . ASP G  2 66 ? 14.181  48.411  81.124  1.00 20.97 ? 67   ASP G CG  1 
ATOM   4925 O  OD1 . ASP G  2 66 ? 13.032  48.906  81.166  1.00 23.17 ? 67   ASP G OD1 1 
ATOM   4926 O  OD2 . ASP G  2 66 ? 14.584  47.941  80.051  1.00 23.40 ? 67   ASP G OD2 1 
ATOM   4927 N  N   . THR G  2 67 ? 12.087  48.125  84.726  1.00 20.51 ? 68   THR G N   1 
ATOM   4928 C  CA  . THR G  2 67 ? 11.009  47.230  85.191  1.00 23.49 ? 68   THR G CA  1 
ATOM   4929 C  C   . THR G  2 67 ? 9.955   46.879  84.132  1.00 24.31 ? 68   THR G C   1 
ATOM   4930 O  O   . THR G  2 67 ? 9.339   45.830  84.227  1.00 23.55 ? 68   THR G O   1 
ATOM   4931 C  CB  . THR G  2 67 ? 10.334  47.701  86.480  1.00 26.63 ? 68   THR G CB  1 
ATOM   4932 O  OG1 . THR G  2 67 ? 9.882   49.034  86.287  1.00 27.47 ? 68   THR G OG1 1 
ATOM   4933 C  CG2 . THR G  2 67 ? 11.360  47.833  87.657  1.00 27.49 ? 68   THR G CG2 1 
ATOM   4934 N  N   . ASN G  2 68 ? 9.754   47.700  83.103  1.00 22.87 ? 69   ASN G N   1 
ATOM   4935 C  CA  . ASN G  2 68 ? 8.862   47.267  82.012  1.00 23.12 ? 69   ASN G CA  1 
ATOM   4936 C  C   . ASN G  2 68 ? 9.609   46.691  80.812  1.00 23.46 ? 69   ASN G C   1 
ATOM   4937 O  O   . ASN G  2 68 ? 9.008   46.517  79.757  1.00 22.80 ? 69   ASN G O   1 
ATOM   4938 C  CB  . ASN G  2 68 ? 7.900   48.373  81.537  1.00 22.22 ? 69   ASN G CB  1 
ATOM   4939 C  CG  . ASN G  2 68 ? 8.623   49.480  80.787  1.00 21.87 ? 69   ASN G CG  1 
ATOM   4940 O  OD1 . ASN G  2 68 ? 9.849   49.594  80.870  1.00 24.18 ? 69   ASN G OD1 1 
ATOM   4941 N  ND2 . ASN G  2 68 ? 7.877   50.265  79.998  1.00 23.98 ? 69   ASN G ND2 1 
ATOM   4942 N  N   . ALA G  2 69 ? 10.917  46.461  80.971  1.00 22.09 ? 70   ALA G N   1 
ATOM   4943 C  CA  . ALA G  2 69 ? 11.714  45.696  80.022  1.00 23.16 ? 70   ALA G CA  1 
ATOM   4944 C  C   . ALA G  2 69 ? 11.715  46.296  78.632  1.00 23.87 ? 70   ALA G C   1 
ATOM   4945 O  O   . ALA G  2 69 ? 11.665  45.544  77.652  1.00 23.71 ? 70   ALA G O   1 
ATOM   4946 C  CB  . ALA G  2 69 ? 11.208  44.219  79.958  1.00 21.12 ? 70   ALA G CB  1 
ATOM   4947 N  N   . ASP G  2 70 ? 11.723  47.618  78.518  1.00 22.81 ? 71   ASP G N   1 
ATOM   4948 C  CA  . ASP G  2 70 ? 11.743  48.238  77.179  1.00 24.13 ? 71   ASP G CA  1 
ATOM   4949 C  C   . ASP G  2 70 ? 13.082  48.818  76.736  1.00 22.19 ? 71   ASP G C   1 
ATOM   4950 O  O   . ASP G  2 70 ? 13.135  49.527  75.726  1.00 24.08 ? 71   ASP G O   1 
ATOM   4951 C  CB  . ASP G  2 70 ? 10.626  49.272  77.020  1.00 24.00 ? 71   ASP G CB  1 
ATOM   4952 C  CG  . ASP G  2 70 ? 10.808  50.478  77.920  1.00 24.92 ? 71   ASP G CG  1 
ATOM   4953 O  OD1 . ASP G  2 70 ? 11.820  50.548  78.663  1.00 22.71 ? 71   ASP G OD1 1 
ATOM   4954 O  OD2 . ASP G  2 70 ? 9.963   51.399  77.967  1.00 26.39 ? 71   ASP G OD2 1 
ATOM   4955 N  N   . LYS G  2 71 ? 14.152  48.510  77.463  1.00 22.09 ? 72   LYS G N   1 
ATOM   4956 C  CA  . LYS G  2 71 ? 15.527  48.922  77.129  1.00 24.99 ? 72   LYS G CA  1 
ATOM   4957 C  C   . LYS G  2 71 ? 15.808  50.417  77.319  1.00 25.49 ? 72   LYS G C   1 
ATOM   4958 O  O   . LYS G  2 71 ? 16.721  50.975  76.736  1.00 25.83 ? 72   LYS G O   1 
ATOM   4959 C  CB  . LYS G  2 71 ? 15.957  48.432  75.747  1.00 28.05 ? 72   LYS G CB  1 
ATOM   4960 C  CG  . LYS G  2 71 ? 15.778  46.929  75.625  1.00 30.88 ? 72   LYS G CG  1 
ATOM   4961 C  CD  . LYS G  2 71 ? 16.255  46.394  74.296  1.00 35.20 ? 72   LYS G CD  1 
ATOM   4962 C  CE  . LYS G  2 71 ? 16.297  44.846  74.354  1.00 38.96 ? 72   LYS G CE  1 
ATOM   4963 N  NZ  . LYS G  2 71 ? 16.504  44.189  73.024  1.00 42.30 ? 72   LYS G NZ  1 
ATOM   4964 N  N   . GLN G  2 72 ? 14.996  51.063  78.146  1.00 24.66 ? 73   GLN G N   1 
ATOM   4965 C  CA  . GLN G  2 72 ? 15.201  52.481  78.436  1.00 22.67 ? 73   GLN G CA  1 
ATOM   4966 C  C   . GLN G  2 72 ? 14.765  52.660  79.859  1.00 21.86 ? 73   GLN G C   1 
ATOM   4967 O  O   . GLN G  2 72 ? 13.871  51.942  80.320  1.00 22.98 ? 73   GLN G O   1 
ATOM   4968 C  CB  . GLN G  2 72 ? 14.250  53.358  77.619  1.00 23.46 ? 73   GLN G CB  1 
ATOM   4969 C  CG  . GLN G  2 72 ? 14.230  53.137  76.151  1.00 30.96 ? 73   GLN G CG  1 
ATOM   4970 C  CD  . GLN G  2 72 ? 12.906  53.591  75.597  1.00 32.98 ? 73   GLN G CD  1 
ATOM   4971 O  OE1 . GLN G  2 72 ? 12.531  54.757  75.741  1.00 31.11 ? 73   GLN G OE1 1 
ATOM   4972 N  NE2 . GLN G  2 72 ? 12.183  52.664  74.971  1.00 34.32 ? 73   GLN G NE2 1 
ATOM   4973 N  N   . LEU G  2 73 ? 15.348  53.652  80.536  1.00 18.72 ? 74   LEU G N   1 
ATOM   4974 C  CA  . LEU G  2 73 ? 14.923  53.964  81.905  1.00 21.92 ? 74   LEU G CA  1 
ATOM   4975 C  C   . LEU G  2 73 ? 14.086  55.239  81.893  1.00 20.79 ? 74   LEU G C   1 
ATOM   4976 O  O   . LEU G  2 73 ? 14.543  56.286  81.411  1.00 20.99 ? 74   LEU G O   1 
ATOM   4977 C  CB  . LEU G  2 73 ? 16.147  54.226  82.772  1.00 23.40 ? 74   LEU G CB  1 
ATOM   4978 C  CG  . LEU G  2 73 ? 16.997  53.014  83.118  1.00 25.17 ? 74   LEU G CG  1 
ATOM   4979 C  CD1 . LEU G  2 73 ? 17.946  53.378  84.227  1.00 25.29 ? 74   LEU G CD1 1 
ATOM   4980 C  CD2 . LEU G  2 73 ? 16.102  51.801  83.500  1.00 23.57 ? 74   LEU G CD2 1 
ATOM   4981 N  N   . SER G  2 74 ? 12.843  55.149  82.352  1.00 21.27 ? 75   SER G N   1 
ATOM   4982 C  CA  . SER G  2 74 ? 12.022  56.324  82.531  1.00 20.29 ? 75   SER G CA  1 
ATOM   4983 C  C   . SER G  2 74 ? 12.584  56.996  83.772  1.00 20.61 ? 75   SER G C   1 
ATOM   4984 O  O   . SER G  2 74 ? 13.372  56.404  84.531  1.00 21.72 ? 75   SER G O   1 
ATOM   4985 C  CB  . SER G  2 74 ? 10.572  55.917  82.806  1.00 21.16 ? 75   SER G CB  1 
ATOM   4986 O  OG  . SER G  2 74 ? 10.521  55.085  83.969  1.00 19.57 ? 75   SER G OG  1 
ATOM   4987 N  N   . PHE G  2 75 ? 12.133  58.219  84.034  1.00 19.45 ? 76   PHE G N   1 
ATOM   4988 C  CA  . PHE G  2 75 ? 12.477  58.831  85.299  1.00 17.88 ? 76   PHE G CA  1 
ATOM   4989 C  C   . PHE G  2 75 ? 12.003  58.039  86.516  1.00 17.85 ? 76   PHE G C   1 
ATOM   4990 O  O   . PHE G  2 75 ? 12.747  57.938  87.500  1.00 17.89 ? 76   PHE G O   1 
ATOM   4991 C  CB  . PHE G  2 75 ? 12.019  60.282  85.369  1.00 19.18 ? 76   PHE G CB  1 
ATOM   4992 C  CG  . PHE G  2 75 ? 12.518  60.990  86.600  1.00 21.61 ? 76   PHE G CG  1 
ATOM   4993 C  CD1 . PHE G  2 75 ? 13.793  61.503  86.634  1.00 21.85 ? 76   PHE G CD1 1 
ATOM   4994 C  CD2 . PHE G  2 75 ? 11.718  61.098  87.745  1.00 20.99 ? 76   PHE G CD2 1 
ATOM   4995 C  CE1 . PHE G  2 75 ? 14.282  62.169  87.768  1.00 21.28 ? 76   PHE G CE1 1 
ATOM   4996 C  CE2 . PHE G  2 75 ? 12.214  61.742  88.901  1.00 23.51 ? 76   PHE G CE2 1 
ATOM   4997 C  CZ  . PHE G  2 75 ? 13.492  62.279  88.910  1.00 19.53 ? 76   PHE G CZ  1 
ATOM   4998 N  N   . GLU G  2 76 ? 10.783  57.501  86.445  1.00 19.23 ? 77   GLU G N   1 
ATOM   4999 C  CA  . GLU G  2 76 ? 10.241  56.702  87.527  1.00 20.51 ? 77   GLU G CA  1 
ATOM   5000 C  C   . GLU G  2 76 ? 11.180  55.539  87.846  1.00 19.82 ? 77   GLU G C   1 
ATOM   5001 O  O   . GLU G  2 76 ? 11.390  55.208  89.019  1.00 20.38 ? 77   GLU G O   1 
ATOM   5002 C  CB  . GLU G  2 76 ? 8.814   56.185  87.211  1.00 23.18 ? 77   GLU G CB  1 
ATOM   5003 C  CG  . GLU G  2 76 ? 7.687   57.224  87.209  1.00 25.30 ? 77   GLU G CG  1 
ATOM   5004 C  CD  . GLU G  2 76 ? 7.625   58.139  85.978  1.00 27.82 ? 77   GLU G CD  1 
ATOM   5005 O  OE1 . GLU G  2 76 ? 8.392   58.002  84.969  1.00 27.26 ? 77   GLU G OE1 1 
ATOM   5006 O  OE2 . GLU G  2 76 ? 6.760   59.036  86.022  1.00 30.34 ? 77   GLU G OE2 1 
ATOM   5007 N  N   . GLU G  2 77 ? 11.691  54.855  86.815  1.00 20.24 ? 78   GLU G N   1 
ATOM   5008 C  CA  . GLU G  2 77 ? 12.547  53.698  87.061  1.00 19.45 ? 78   GLU G CA  1 
ATOM   5009 C  C   . GLU G  2 77 ? 13.899  54.183  87.622  1.00 21.51 ? 78   GLU G C   1 
ATOM   5010 O  O   . GLU G  2 77 ? 14.471  53.581  88.531  1.00 21.94 ? 78   GLU G O   1 
ATOM   5011 C  CB  . GLU G  2 77 ? 12.779  52.936  85.736  1.00 18.88 ? 78   GLU G CB  1 
ATOM   5012 C  CG  . GLU G  2 77 ? 11.533  52.259  85.206  1.00 19.07 ? 78   GLU G CG  1 
ATOM   5013 C  CD  . GLU G  2 77 ? 11.698  51.765  83.764  1.00 18.09 ? 78   GLU G CD  1 
ATOM   5014 O  OE1 . GLU G  2 77 ? 12.522  52.350  83.010  1.00 20.86 ? 78   GLU G OE1 1 
ATOM   5015 O  OE2 . GLU G  2 77 ? 10.993  50.796  83.385  1.00 18.97 ? 78   GLU G OE2 1 
ATOM   5016 N  N   . PHE G  2 78 ? 14.433  55.263  87.048  1.00 24.22 ? 79   PHE G N   1 
ATOM   5017 C  CA  . PHE G  2 78 ? 15.745  55.802  87.425  1.00 21.09 ? 79   PHE G CA  1 
ATOM   5018 C  C   . PHE G  2 78 ? 15.818  56.297  88.868  1.00 23.84 ? 79   PHE G C   1 
ATOM   5019 O  O   . PHE G  2 78 ? 16.861  56.179  89.547  1.00 24.64 ? 79   PHE G O   1 
ATOM   5020 C  CB  . PHE G  2 78 ? 16.057  56.972  86.496  1.00 23.36 ? 79   PHE G CB  1 
ATOM   5021 C  CG  . PHE G  2 78 ? 17.314  57.708  86.835  1.00 22.24 ? 79   PHE G CG  1 
ATOM   5022 C  CD1 . PHE G  2 78 ? 18.562  57.188  86.495  1.00 23.72 ? 79   PHE G CD1 1 
ATOM   5023 C  CD2 . PHE G  2 78 ? 17.243  58.957  87.444  1.00 23.18 ? 79   PHE G CD2 1 
ATOM   5024 C  CE1 . PHE G  2 78 ? 19.719  57.905  86.786  1.00 22.70 ? 79   PHE G CE1 1 
ATOM   5025 C  CE2 . PHE G  2 78 ? 18.382  59.676  87.728  1.00 22.74 ? 79   PHE G CE2 1 
ATOM   5026 C  CZ  . PHE G  2 78 ? 19.625  59.159  87.370  1.00 23.21 ? 79   PHE G CZ  1 
ATOM   5027 N  N   . ILE G  2 79 ? 14.723  56.846  89.368  1.00 20.75 ? 80   ILE G N   1 
ATOM   5028 C  CA  . ILE G  2 79 ? 14.810  57.468  90.688  1.00 21.30 ? 80   ILE G CA  1 
ATOM   5029 C  C   . ILE G  2 79 ? 14.924  56.417  91.816  1.00 20.26 ? 80   ILE G C   1 
ATOM   5030 O  O   . ILE G  2 79 ? 15.348  56.730  92.940  1.00 21.12 ? 80   ILE G O   1 
ATOM   5031 C  CB  . ILE G  2 79 ? 13.670  58.433  90.918  1.00 22.66 ? 80   ILE G CB  1 
ATOM   5032 C  CG1 . ILE G  2 79 ? 14.077  59.428  92.048  1.00 23.51 ? 80   ILE G CG1 1 
ATOM   5033 C  CG2 . ILE G  2 79 ? 12.372  57.631  91.215  1.00 18.17 ? 80   ILE G CG2 1 
ATOM   5034 C  CD1 . ILE G  2 79 ? 12.976  60.324  92.522  1.00 26.33 ? 80   ILE G CD1 1 
ATOM   5035 N  N   . MET G  2 80 ? 14.556  55.168  91.508  1.00 19.62 ? 81   MET G N   1 
ATOM   5036 C  CA  . MET G  2 80 ? 14.869  54.053  92.422  1.00 22.08 ? 81   MET G CA  1 
ATOM   5037 C  C   . MET G  2 80 ? 16.358  53.893  92.679  1.00 21.71 ? 81   MET G C   1 
ATOM   5038 O  O   . MET G  2 80 ? 16.756  53.608  93.814  1.00 20.82 ? 81   MET G O   1 
ATOM   5039 C  CB  . MET G  2 80 ? 14.317  52.726  91.913  1.00 26.04 ? 81   MET G CB  1 
ATOM   5040 C  CG  . MET G  2 80 ? 12.944  52.367  92.442  1.00 31.88 ? 81   MET G CG  1 
ATOM   5041 S  SD  . MET G  2 80 ? 12.773  52.140  94.238  1.00 35.41 ? 81   MET G SD  1 
ATOM   5042 C  CE  . MET G  2 80 ? 10.984  52.030  94.303  1.00 31.75 ? 81   MET G CE  1 
ATOM   5043 N  N   . LEU G  2 81 ? 17.172  54.042  91.639  1.00 20.26 ? 82   LEU G N   1 
ATOM   5044 C  CA  . LEU G  2 81 ? 18.617  54.076  91.820  1.00 21.66 ? 82   LEU G CA  1 
ATOM   5045 C  C   . LEU G  2 81 ? 19.041  55.230  92.736  1.00 23.77 ? 82   LEU G C   1 
ATOM   5046 O  O   . LEU G  2 81 ? 19.979  55.057  93.524  1.00 22.77 ? 82   LEU G O   1 
ATOM   5047 C  CB  . LEU G  2 81 ? 19.354  54.200  90.483  1.00 22.77 ? 82   LEU G CB  1 
ATOM   5048 C  CG  . LEU G  2 81 ? 20.904  54.269  90.476  1.00 20.98 ? 82   LEU G CG  1 
ATOM   5049 C  CD1 . LEU G  2 81 ? 21.538  52.970  90.994  1.00 22.20 ? 82   LEU G CD1 1 
ATOM   5050 C  CD2 . LEU G  2 81 ? 21.473  54.548  89.087  1.00 24.07 ? 82   LEU G CD2 1 
ATOM   5051 N  N   . MET G  2 82 ? 18.396  56.403  92.603  1.00 22.14 ? 83   MET G N   1 
ATOM   5052 C  CA  . MET G  2 82 ? 18.842  57.597  93.357  1.00 21.31 ? 83   MET G CA  1 
ATOM   5053 C  C   . MET G  2 82 ? 18.567  57.299  94.819  1.00 23.03 ? 83   MET G C   1 
ATOM   5054 O  O   . MET G  2 82 ? 19.382  57.592  95.713  1.00 23.41 ? 83   MET G O   1 
ATOM   5055 C  CB  . MET G  2 82 ? 18.114  58.874  92.902  1.00 21.56 ? 83   MET G CB  1 
ATOM   5056 C  CG  . MET G  2 82 ? 18.447  59.374  91.465  1.00 19.81 ? 83   MET G CG  1 
ATOM   5057 S  SD  . MET G  2 82 ? 20.214  59.702  91.162  1.00 23.83 ? 83   MET G SD  1 
ATOM   5058 C  CE  . MET G  2 82 ? 20.901  58.212  90.470  1.00 22.99 ? 83   MET G CE  1 
ATOM   5059 N  N   . ALA G  2 83 ? 17.430  56.651  95.057  1.00 20.69 ? 84   ALA G N   1 
ATOM   5060 C  CA  . ALA G  2 83 ? 17.035  56.346  96.429  1.00 21.49 ? 84   ALA G CA  1 
ATOM   5061 C  C   . ALA G  2 83 ? 17.949  55.276  97.056  1.00 22.28 ? 84   ALA G C   1 
ATOM   5062 O  O   . ALA G  2 83 ? 18.322  55.388  98.220  1.00 22.02 ? 84   ALA G O   1 
ATOM   5063 C  CB  . ALA G  2 83 ? 15.577  55.905  96.461  1.00 24.85 ? 84   ALA G CB  1 
ATOM   5064 N  N   . ARG G  2 84 ? 18.348  54.275  96.272  1.00 20.92 ? 85   ARG G N   1 
ATOM   5065 C  CA  . ARG G  2 84 ? 19.207  53.207  96.760  1.00 24.33 ? 85   ARG G CA  1 
ATOM   5066 C  C   . ARG G  2 84 ? 20.607  53.721  97.055  1.00 22.44 ? 85   ARG G C   1 
ATOM   5067 O  O   . ARG G  2 84 ? 21.201  53.314  98.039  1.00 21.26 ? 85   ARG G O   1 
ATOM   5068 C  CB  . ARG G  2 84 ? 19.324  52.090  95.722  1.00 25.64 ? 85   ARG G CB  1 
ATOM   5069 C  CG  . ARG G  2 84 ? 18.105  51.221  95.630  1.00 32.22 ? 85   ARG G CG  1 
ATOM   5070 C  CD  . ARG G  2 84 ? 18.197  50.154  94.529  1.00 34.02 ? 85   ARG G CD  1 
ATOM   5071 N  NE  . ARG G  2 84 ? 16.908  49.515  94.269  1.00 40.29 ? 85   ARG G NE  1 
ATOM   5072 C  CZ  . ARG G  2 84 ? 16.643  48.811  93.176  1.00 42.76 ? 85   ARG G CZ  1 
ATOM   5073 N  NH1 . ARG G  2 84 ? 15.449  48.257  93.015  1.00 45.21 ? 85   ARG G NH1 1 
ATOM   5074 N  NH2 . ARG G  2 84 ? 17.568  48.663  92.240  1.00 43.07 ? 85   ARG G NH2 1 
ATOM   5075 N  N   . LEU G  2 85 ? 21.151  54.557  96.163  1.00 21.91 ? 86   LEU G N   1 
ATOM   5076 C  CA  . LEU G  2 85 ? 22.438  55.220  96.412  1.00 22.38 ? 86   LEU G CA  1 
ATOM   5077 C  C   . LEU G  2 85 ? 22.437  56.157  97.629  1.00 22.87 ? 86   LEU G C   1 
ATOM   5078 O  O   . LEU G  2 85 ? 23.381  56.154  98.428  1.00 23.40 ? 86   LEU G O   1 
ATOM   5079 C  CB  . LEU G  2 85 ? 22.870  56.008  95.167  1.00 23.76 ? 86   LEU G CB  1 
ATOM   5080 C  CG  . LEU G  2 85 ? 23.866  55.431  94.142  1.00 27.47 ? 86   LEU G CG  1 
ATOM   5081 C  CD1 . LEU G  2 85 ? 23.881  53.962  94.133  1.00 28.00 ? 86   LEU G CD1 1 
ATOM   5082 C  CD2 . LEU G  2 85 ? 23.675  56.038  92.756  1.00 26.28 ? 86   LEU G CD2 1 
ATOM   5083 N  N   . THR G  2 86 ? 21.380  56.950  97.780  1.00 22.10 ? 87   THR G N   1 
ATOM   5084 C  CA  . THR G  2 86 ? 21.204  57.749  99.007  1.00 23.22 ? 87   THR G CA  1 
ATOM   5085 C  C   . THR G  2 86 ? 21.241  56.882  100.265 1.00 24.75 ? 87   THR G C   1 
ATOM   5086 O  O   . THR G  2 86 ? 21.917  57.216  101.231 1.00 24.13 ? 87   THR G O   1 
ATOM   5087 C  CB  . THR G  2 86 ? 19.903  58.563  98.933  1.00 22.53 ? 87   THR G CB  1 
ATOM   5088 O  OG1 . THR G  2 86 ? 19.900  59.305  97.689  1.00 25.44 ? 87   THR G OG1 1 
ATOM   5089 C  CG2 . THR G  2 86 ? 19.849  59.621  100.054 1.00 19.24 ? 87   THR G CG2 1 
ATOM   5090 N  N   . TRP G  2 87 ? 20.512  55.775  100.246 1.00 23.59 ? 88   TRP G N   1 
ATOM   5091 C  CA  . TRP G  2 87 ? 20.490  54.875  101.404 1.00 26.09 ? 88   TRP G CA  1 
ATOM   5092 C  C   . TRP G  2 87 ? 21.881  54.328  101.655 1.00 25.23 ? 88   TRP G C   1 
ATOM   5093 O  O   . TRP G  2 87 ? 22.318  54.301  102.796 1.00 26.02 ? 88   TRP G O   1 
ATOM   5094 C  CB  . TRP G  2 87 ? 19.506  53.735  101.173 1.00 28.19 ? 88   TRP G CB  1 
ATOM   5095 C  CG  . TRP G  2 87 ? 19.617  52.632  102.165 1.00 29.09 ? 88   TRP G CG  1 
ATOM   5096 C  CD1 . TRP G  2 87 ? 20.227  51.412  101.998 1.00 29.04 ? 88   TRP G CD1 1 
ATOM   5097 C  CD2 . TRP G  2 87 ? 19.073  52.638  103.483 1.00 30.37 ? 88   TRP G CD2 1 
ATOM   5098 N  NE1 . TRP G  2 87 ? 20.090  50.657  103.144 1.00 30.69 ? 88   TRP G NE1 1 
ATOM   5099 C  CE2 . TRP G  2 87 ? 19.400  51.391  104.080 1.00 30.19 ? 88   TRP G CE2 1 
ATOM   5100 C  CE3 . TRP G  2 87 ? 18.362  53.581  104.233 1.00 29.86 ? 88   TRP G CE3 1 
ATOM   5101 C  CZ2 . TRP G  2 87 ? 19.024  51.064  105.386 1.00 31.84 ? 88   TRP G CZ2 1 
ATOM   5102 C  CZ3 . TRP G  2 87 ? 17.989  53.255  105.543 1.00 31.05 ? 88   TRP G CZ3 1 
ATOM   5103 C  CH2 . TRP G  2 87 ? 18.325  52.005  106.102 1.00 31.41 ? 88   TRP G CH2 1 
ATOM   5104 N  N   . ALA G  2 88 ? 22.561  53.876  100.599 1.00 24.10 ? 89   ALA G N   1 
ATOM   5105 C  CA  . ALA G  2 88 ? 23.911  53.336  100.705 1.00 25.25 ? 89   ALA G CA  1 
ATOM   5106 C  C   . ALA G  2 88 ? 24.894  54.345  101.290 1.00 26.38 ? 89   ALA G C   1 
ATOM   5107 O  O   . ALA G  2 88 ? 25.732  54.009  102.136 1.00 27.57 ? 89   ALA G O   1 
ATOM   5108 C  CB  . ALA G  2 88 ? 24.406  52.826  99.335  1.00 24.47 ? 89   ALA G CB  1 
ATOM   5109 N  N   . SER G  2 89 ? 24.795  55.587  100.854 1.00 26.32 ? 90   SER G N   1 
ATOM   5110 C  CA  . SER G  2 89 ? 25.645  56.633  101.410 1.00 27.59 ? 90   SER G CA  1 
ATOM   5111 C  C   . SER G  2 89 ? 25.356  56.860  102.893 1.00 27.73 ? 90   SER G C   1 
ATOM   5112 O  O   . SER G  2 89 ? 26.283  56.959  103.707 1.00 29.18 ? 90   SER G O   1 
ATOM   5113 C  CB  . SER G  2 89 ? 25.444  57.928  100.621 1.00 28.75 ? 90   SER G CB  1 
ATOM   5114 O  OG  . SER G  2 89 ? 26.375  58.891  101.052 1.00 29.01 ? 90   SER G OG  1 
ATOM   5115 N  N   . HIS G  2 90 ? 24.076  56.932  103.241 1.00 26.75 ? 91   HIS G N   1 
ATOM   5116 C  CA  . HIS G  2 90 ? 23.649  57.062  104.647 1.00 29.18 ? 91   HIS G CA  1 
ATOM   5117 C  C   . HIS G  2 90 ? 24.206  55.921  105.489 1.00 31.02 ? 91   HIS G C   1 
ATOM   5118 O  O   . HIS G  2 90 ? 24.678  56.144  106.608 1.00 29.98 ? 91   HIS G O   1 
ATOM   5119 C  CB  . HIS G  2 90 ? 22.119  57.120  104.735 1.00 30.45 ? 91   HIS G CB  1 
ATOM   5120 C  CG  . HIS G  2 90 ? 21.562  56.987  106.124 1.00 32.55 ? 91   HIS G CG  1 
ATOM   5121 N  ND1 . HIS G  2 90 ? 21.144  55.781  106.644 1.00 34.29 ? 91   HIS G ND1 1 
ATOM   5122 C  CD2 . HIS G  2 90 ? 21.287  57.917  107.067 1.00 34.14 ? 91   HIS G CD2 1 
ATOM   5123 C  CE1 . HIS G  2 90 ? 20.675  55.967  107.866 1.00 35.14 ? 91   HIS G CE1 1 
ATOM   5124 N  NE2 . HIS G  2 90 ? 20.748  57.254  108.145 1.00 35.91 ? 91   HIS G NE2 1 
ATOM   5125 N  N   . GLU G  2 91 ? 24.165  54.702  104.958 1.00 33.10 ? 92   GLU G N   1 
ATOM   5126 C  CA  . GLU G  2 91 ? 24.678  53.547  105.709 1.00 36.98 ? 92   GLU G CA  1 
ATOM   5127 C  C   . GLU G  2 91 ? 26.195  53.612  105.879 1.00 38.40 ? 92   GLU G C   1 
ATOM   5128 O  O   . GLU G  2 91 ? 26.738  53.186  106.904 1.00 38.72 ? 92   GLU G O   1 
ATOM   5129 C  CB  . GLU G  2 91 ? 24.259  52.219  105.060 1.00 38.72 ? 92   GLU G CB  1 
ATOM   5130 C  CG  . GLU G  2 91 ? 22.776  51.891  105.172 1.00 41.59 ? 92   GLU G CG  1 
ATOM   5131 C  CD  . GLU G  2 91 ? 22.252  51.954  106.598 1.00 45.24 ? 92   GLU G CD  1 
ATOM   5132 O  OE1 . GLU G  2 91 ? 22.118  50.880  107.235 1.00 45.65 ? 92   GLU G OE1 1 
ATOM   5133 O  OE2 . GLU G  2 91 ? 21.982  53.074  107.097 1.00 46.50 ? 92   GLU G OE2 1 
ATOM   5134 N  N   . LYS G  2 92 ? 26.878  54.164  104.886 1.00 42.24 ? 93   LYS G N   1 
ATOM   5135 C  CA  . LYS G  2 92 ? 28.321  54.260  104.951 1.00 46.50 ? 93   LYS G CA  1 
ATOM   5136 C  C   . LYS G  2 92 ? 28.756  55.283  105.999 1.00 48.19 ? 93   LYS G C   1 
ATOM   5137 O  O   . LYS G  2 92 ? 29.834  55.167  106.582 1.00 49.69 ? 93   LYS G O   1 
ATOM   5138 C  CB  . LYS G  2 92 ? 28.902  54.607  103.587 1.00 48.07 ? 93   LYS G CB  1 
ATOM   5139 C  CG  . LYS G  2 92 ? 30.194  53.877  103.281 1.00 51.09 ? 93   LYS G CG  1 
ATOM   5140 C  CD  . LYS G  2 92 ? 31.010  54.633  102.251 1.00 53.23 ? 93   LYS G CD  1 
ATOM   5141 C  CE  . LYS G  2 92 ? 32.079  53.744  101.618 1.00 55.32 ? 93   LYS G CE  1 
ATOM   5142 N  NZ  . LYS G  2 92 ? 32.733  54.406  100.436 1.00 54.77 ? 93   LYS G NZ  1 
ATOM   5143 N  N   . MET G  2 93 ? 27.906  56.269  106.262 1.00 49.65 ? 94   MET G N   1 
ATOM   5144 C  CA  . MET G  2 93 ? 28.224  57.292  107.251 1.00 51.43 ? 94   MET G CA  1 
ATOM   5145 C  C   . MET G  2 93 ? 28.022  56.752  108.659 1.00 54.14 ? 94   MET G C   1 
ATOM   5146 O  O   . MET G  2 93 ? 28.650  57.214  109.606 1.00 55.11 ? 94   MET G O   1 
ATOM   5147 C  CB  . MET G  2 93 ? 27.380  58.545  107.041 1.00 49.78 ? 94   MET G CB  1 
ATOM   5148 C  CG  . MET G  2 93 ? 27.520  59.188  105.670 1.00 49.91 ? 94   MET G CG  1 
ATOM   5149 S  SD  . MET G  2 93 ? 26.353  60.560  105.485 1.00 51.76 ? 94   MET G SD  1 
ATOM   5150 C  CE  . MET G  2 93 ? 25.059  60.056  106.629 1.00 51.92 ? 94   MET G CE  1 
ATOM   5151 N  N   . HIS G  2 94 ? 27.151  55.760  108.786 1.00 57.59 ? 95   HIS G N   1 
ATOM   5152 C  CA  . HIS G  2 94 ? 26.923  55.088  110.059 1.00 60.25 ? 95   HIS G CA  1 
ATOM   5153 C  C   . HIS G  2 94 ? 27.746  53.805  110.133 1.00 61.00 ? 95   HIS G C   1 
ATOM   5154 O  O   . HIS G  2 94 ? 28.861  53.734  109.604 1.00 61.16 ? 95   HIS G O   1 
ATOM   5155 C  CB  . HIS G  2 94 ? 25.433  54.783  110.217 1.00 62.27 ? 95   HIS G CB  1 
ATOM   5156 C  CG  . HIS G  2 94 ? 24.583  56.011  110.327 1.00 64.85 ? 95   HIS G CG  1 
ATOM   5157 N  ND1 . HIS G  2 94 ? 23.300  55.988  110.834 1.00 65.78 ? 95   HIS G ND1 1 
ATOM   5158 C  CD2 . HIS G  2 94 ? 24.842  57.305  110.017 1.00 65.37 ? 95   HIS G CD2 1 
ATOM   5159 C  CE1 . HIS G  2 94 ? 22.804  57.213  110.825 1.00 66.13 ? 95   HIS G CE1 1 
ATOM   5160 N  NE2 . HIS G  2 94 ? 23.720  58.032  110.337 1.00 66.13 ? 95   HIS G NE2 1 
ATOM   5161 N  N   . LYS H  2 3  ? -2.168  24.483  105.066 1.00 50.73 ? 4    LYS H N   1 
ATOM   5162 C  CA  . LYS H  2 3  ? -3.117  25.580  104.715 1.00 49.71 ? 4    LYS H CA  1 
ATOM   5163 C  C   . LYS H  2 3  ? -2.527  26.971  104.983 1.00 47.00 ? 4    LYS H C   1 
ATOM   5164 O  O   . LYS H  2 3  ? -2.793  27.902  104.227 1.00 47.45 ? 4    LYS H O   1 
ATOM   5165 C  CB  . LYS H  2 3  ? -4.461  25.413  105.429 1.00 52.31 ? 4    LYS H CB  1 
ATOM   5166 C  CG  . LYS H  2 3  ? -5.675  25.580  104.506 1.00 55.21 ? 4    LYS H CG  1 
ATOM   5167 C  CD  . LYS H  2 3  ? -6.054  27.037  104.268 1.00 57.26 ? 4    LYS H CD  1 
ATOM   5168 C  CE  . LYS H  2 3  ? -6.666  27.662  105.518 1.00 58.30 ? 4    LYS H CE  1 
ATOM   5169 N  NZ  . LYS H  2 3  ? -7.909  26.947  105.934 1.00 58.89 ? 4    LYS H NZ  1 
ATOM   5170 N  N   . MET H  2 4  ? -1.735  27.129  106.042 1.00 41.55 ? 5    MET H N   1 
ATOM   5171 C  CA  . MET H  2 4  ? -0.880  28.312  106.148 1.00 37.96 ? 5    MET H CA  1 
ATOM   5172 C  C   . MET H  2 4  ? 0.057   28.430  104.936 1.00 31.03 ? 5    MET H C   1 
ATOM   5173 O  O   . MET H  2 4  ? 0.740   27.475  104.560 1.00 27.59 ? 5    MET H O   1 
ATOM   5174 C  CB  . MET H  2 4  ? -0.060  28.299  107.440 1.00 39.71 ? 5    MET H CB  1 
ATOM   5175 C  CG  . MET H  2 4  ? -0.437  29.410  108.412 1.00 43.09 ? 5    MET H CG  1 
ATOM   5176 S  SD  . MET H  2 4  ? 0.773   29.731  109.720 1.00 46.58 ? 5    MET H SD  1 
ATOM   5177 C  CE  . MET H  2 4  ? 0.974   28.017  110.332 1.00 45.09 ? 5    MET H CE  1 
ATOM   5178 N  N   . SER H  2 5  ? 0.055   29.602  104.301 1.00 27.39 ? 6    SER H N   1 
ATOM   5179 C  CA  . SER H  2 5  ? 0.966   29.846  103.191 1.00 23.01 ? 6    SER H CA  1 
ATOM   5180 C  C   . SER H  2 5  ? 2.397   29.935  103.693 1.00 20.74 ? 6    SER H C   1 
ATOM   5181 O  O   . SER H  2 5  ? 2.641   30.129  104.894 1.00 20.67 ? 6    SER H O   1 
ATOM   5182 C  CB  . SER H  2 5  ? 0.629   31.174  102.512 1.00 19.71 ? 6    SER H CB  1 
ATOM   5183 O  OG  . SER H  2 5  ? 1.059   32.264  103.317 1.00 20.66 ? 6    SER H OG  1 
ATOM   5184 N  N   . GLN H  2 6  ? 3.345   29.836  102.768 1.00 18.93 ? 7    GLN H N   1 
ATOM   5185 C  CA  . GLN H  2 6  ? 4.758   29.984  103.124 1.00 18.55 ? 7    GLN H CA  1 
ATOM   5186 C  C   . GLN H  2 6  ? 5.062   31.343  103.767 1.00 16.91 ? 7    GLN H C   1 
ATOM   5187 O  O   . GLN H  2 6  ? 5.795   31.422  104.772 1.00 15.02 ? 7    GLN H O   1 
ATOM   5188 C  CB  . GLN H  2 6  ? 5.639   29.788  101.890 1.00 19.32 ? 7    GLN H CB  1 
ATOM   5189 C  CG  . GLN H  2 6  ? 7.156   29.957  102.109 1.00 22.19 ? 7    GLN H CG  1 
ATOM   5190 C  CD  . GLN H  2 6  ? 7.894   29.653  100.803 1.00 23.87 ? 7    GLN H CD  1 
ATOM   5191 O  OE1 . GLN H  2 6  ? 7.265   29.151  99.868  1.00 29.54 ? 7    GLN H OE1 1 
ATOM   5192 N  NE2 . GLN H  2 6  ? 9.187   29.985  100.703 1.00 25.71 ? 7    GLN H NE2 1 
ATOM   5193 N  N   . LEU H  2 7  ? 4.542   32.421  103.176 1.00 16.42 ? 8    LEU H N   1 
ATOM   5194 C  CA  . LEU H  2 7  ? 4.764   33.756  103.761 1.00 17.43 ? 8    LEU H CA  1 
ATOM   5195 C  C   . LEU H  2 7  ? 4.167   33.845  105.180 1.00 17.57 ? 8    LEU H C   1 
ATOM   5196 O  O   . LEU H  2 7  ? 4.788   34.408  106.097 1.00 17.19 ? 8    LEU H O   1 
ATOM   5197 C  CB  . LEU H  2 7  ? 4.162   34.827  102.838 1.00 19.91 ? 8    LEU H CB  1 
ATOM   5198 C  CG  . LEU H  2 7  ? 4.397   36.277  103.264 1.00 19.29 ? 8    LEU H CG  1 
ATOM   5199 C  CD1 . LEU H  2 7  ? 5.893   36.523  103.387 1.00 21.26 ? 8    LEU H CD1 1 
ATOM   5200 C  CD2 . LEU H  2 7  ? 3.795   37.220  102.234 1.00 19.08 ? 8    LEU H CD2 1 
ATOM   5201 N  N   . GLU H  2 8  ? 2.991   33.260  105.368 1.00 19.83 ? 9    GLU H N   1 
ATOM   5202 C  CA  . GLU H  2 8  ? 2.361   33.276  106.694 1.00 23.41 ? 9    GLU H CA  1 
ATOM   5203 C  C   . GLU H  2 8  ? 3.188   32.516  107.727 1.00 22.50 ? 9    GLU H C   1 
ATOM   5204 O  O   . GLU H  2 8  ? 3.210   32.894  108.901 1.00 22.74 ? 9    GLU H O   1 
ATOM   5205 C  CB  . GLU H  2 8  ? 0.932   32.706  106.643 1.00 25.87 ? 9    GLU H CB  1 
ATOM   5206 C  CG  . GLU H  2 8  ? -0.031  33.555  105.843 1.00 26.13 ? 9    GLU H CG  1 
ATOM   5207 C  CD  . GLU H  2 8  ? -1.390  32.901  105.618 1.00 29.48 ? 9    GLU H CD  1 
ATOM   5208 O  OE1 . GLU H  2 8  ? -1.493  31.660  105.569 1.00 29.71 ? 9    GLU H OE1 1 
ATOM   5209 O  OE2 . GLU H  2 8  ? -2.379  33.636  105.426 1.00 32.17 ? 9    GLU H OE2 1 
ATOM   5210 N  N   . ARG H  2 9  ? 3.816   31.420  107.299 1.00 20.92 ? 10   ARG H N   1 
ATOM   5211 C  CA  . ARG H  2 9  ? 4.648   30.589  108.190 1.00 23.45 ? 10   ARG H CA  1 
ATOM   5212 C  C   . ARG H  2 9  ? 5.881   31.365  108.593 1.00 20.51 ? 10   ARG H C   1 
ATOM   5213 O  O   . ARG H  2 9  ? 6.302   31.323  109.754 1.00 21.06 ? 10   ARG H O   1 
ATOM   5214 C  CB  . ARG H  2 9  ? 5.101   29.295  107.512 1.00 24.79 ? 10   ARG H CB  1 
ATOM   5215 C  CG  . ARG H  2 9  ? 4.114   28.164  107.602 1.00 28.43 ? 10   ARG H CG  1 
ATOM   5216 C  CD  . ARG H  2 9  ? 4.676   26.768  107.187 1.00 29.83 ? 10   ARG H CD  1 
ATOM   5217 N  NE  . ARG H  2 9  ? 5.612   26.722  106.057 1.00 35.22 ? 10   ARG H NE  1 
ATOM   5218 C  CZ  . ARG H  2 9  ? 5.270   26.544  104.778 1.00 37.54 ? 10   ARG H CZ  1 
ATOM   5219 N  NH1 . ARG H  2 9  ? 3.996   26.449  104.415 1.00 38.74 ? 10   ARG H NH1 1 
ATOM   5220 N  NH2 . ARG H  2 9  ? 6.207   26.490  103.841 1.00 38.78 ? 10   ARG H NH2 1 
ATOM   5221 N  N   . ASN H  2 10 ? 6.444   32.097  107.626 1.00 18.26 ? 11   ASN H N   1 
ATOM   5222 C  CA  . ASN H  2 10 ? 7.618   32.913  107.885 1.00 18.04 ? 11   ASN H CA  1 
ATOM   5223 C  C   . ASN H  2 10 ? 7.306   34.029  108.870 1.00 16.47 ? 11   ASN H C   1 
ATOM   5224 O  O   . ASN H  2 10 ? 8.034   34.252  109.853 1.00 17.83 ? 11   ASN H O   1 
ATOM   5225 C  CB  . ASN H  2 10 ? 8.143   33.514  106.577 1.00 17.69 ? 11   ASN H CB  1 
ATOM   5226 C  CG  . ASN H  2 10 ? 8.629   32.443  105.597 1.00 19.86 ? 11   ASN H CG  1 
ATOM   5227 O  OD1 . ASN H  2 10 ? 9.061   31.343  106.002 1.00 22.25 ? 11   ASN H OD1 1 
ATOM   5228 N  ND2 . ASN H  2 10 ? 8.531   32.739  104.323 1.00 16.67 ? 11   ASN H ND2 1 
ATOM   5229 N  N   . ILE H  2 11 ? 6.178   34.694  108.666 1.00 17.87 ? 12   ILE H N   1 
ATOM   5230 C  CA  . ILE H  2 11 ? 5.743   35.687  109.630 1.00 17.79 ? 12   ILE H CA  1 
ATOM   5231 C  C   . ILE H  2 11 ? 5.473   35.082  111.013 1.00 20.98 ? 12   ILE H C   1 
ATOM   5232 O  O   . ILE H  2 11 ? 5.874   35.643  112.042 1.00 19.64 ? 12   ILE H O   1 
ATOM   5233 C  CB  . ILE H  2 11 ? 4.502   36.409  109.104 1.00 22.57 ? 12   ILE H CB  1 
ATOM   5234 C  CG1 . ILE H  2 11 ? 4.908   37.367  107.985 1.00 22.34 ? 12   ILE H CG1 1 
ATOM   5235 C  CG2 . ILE H  2 11 ? 3.883   37.270  110.212 1.00 22.10 ? 12   ILE H CG2 1 
ATOM   5236 C  CD1 . ILE H  2 11 ? 3.709   37.872  107.164 1.00 27.94 ? 12   ILE H CD1 1 
ATOM   5237 N  N   . GLU H  2 12 ? 4.745   33.970  111.045 1.00 20.76 ? 13   GLU H N   1 
ATOM   5238 C  CA  . GLU H  2 12 ? 4.598   33.208  112.304 1.00 21.29 ? 13   GLU H CA  1 
ATOM   5239 C  C   . GLU H  2 12 ? 5.926   32.938  113.015 1.00 20.94 ? 13   GLU H C   1 
ATOM   5240 O  O   . GLU H  2 12 ? 6.020   33.088  114.226 1.00 20.68 ? 13   GLU H O   1 
ATOM   5241 C  CB  . GLU H  2 12 ? 3.875   31.890  112.037 1.00 24.16 ? 13   GLU H CB  1 
ATOM   5242 C  CG  . GLU H  2 12 ? 3.639   31.046  113.291 1.00 27.32 ? 13   GLU H CG  1 
ATOM   5243 C  CD  . GLU H  2 12 ? 2.921   29.758  112.931 1.00 32.15 ? 13   GLU H CD  1 
ATOM   5244 O  OE1 . GLU H  2 12 ? 1.895   29.461  113.583 1.00 34.27 ? 13   GLU H OE1 1 
ATOM   5245 O  OE2 . GLU H  2 12 ? 3.358   29.069  111.972 1.00 30.90 ? 13   GLU H OE2 1 
ATOM   5246 N  N   . THR H  2 13 ? 6.969   32.530  112.292 1.00 19.85 ? 14   THR H N   1 
ATOM   5247 C  CA  . THR H  2 13 ? 8.275   32.281  112.914 1.00 17.85 ? 14   THR H CA  1 
ATOM   5248 C  C   . THR H  2 13 ? 8.830   33.567  113.571 1.00 19.77 ? 14   THR H C   1 
ATOM   5249 O  O   . THR H  2 13 ? 9.296   33.547  114.706 1.00 19.27 ? 14   THR H O   1 
ATOM   5250 C  CB  . THR H  2 13 ? 9.287   31.771  111.860 1.00 17.16 ? 14   THR H CB  1 
ATOM   5251 O  OG1 . THR H  2 13 ? 8.952   30.450  111.407 1.00 17.68 ? 14   THR H OG1 1 
ATOM   5252 C  CG2 . THR H  2 13 ? 10.648  31.561  112.490 1.00 20.26 ? 14   THR H CG2 1 
ATOM   5253 N  N   . ILE H  2 14 ? 8.750   34.700  112.869 1.00 20.33 ? 15   ILE H N   1 
ATOM   5254 C  CA  . ILE H  2 14 ? 9.138   36.000  113.429 1.00 18.72 ? 15   ILE H CA  1 
ATOM   5255 C  C   . ILE H  2 14 ? 8.391   36.353  114.715 1.00 19.58 ? 15   ILE H C   1 
ATOM   5256 O  O   . ILE H  2 14 ? 8.974   36.745  115.736 1.00 18.84 ? 15   ILE H O   1 
ATOM   5257 C  CB  . ILE H  2 14 ? 8.947   37.124  112.351 1.00 20.46 ? 15   ILE H CB  1 
ATOM   5258 C  CG1 . ILE H  2 14 ? 9.786   36.767  111.118 1.00 18.16 ? 15   ILE H CG1 1 
ATOM   5259 C  CG2 . ILE H  2 14 ? 9.294   38.506  113.003 1.00 18.03 ? 15   ILE H CG2 1 
ATOM   5260 C  CD1 . ILE H  2 14 ? 9.557   37.625  109.806 1.00 19.09 ? 15   ILE H CD1 1 
ATOM   5261 N  N   . ILE H  2 15 ? 7.085   36.203  114.643 1.00 15.80 ? 16   ILE H N   1 
ATOM   5262 C  CA  . ILE H  2 15 ? 6.254   36.530  115.795 1.00 17.82 ? 16   ILE H CA  1 
ATOM   5263 C  C   . ILE H  2 15 ? 6.525   35.603  116.970 1.00 19.92 ? 16   ILE H C   1 
ATOM   5264 O  O   . ILE H  2 15 ? 6.561   36.040  118.108 1.00 18.69 ? 16   ILE H O   1 
ATOM   5265 C  CB  . ILE H  2 15 ? 4.823   36.388  115.381 1.00 17.93 ? 16   ILE H CB  1 
ATOM   5266 C  CG1 . ILE H  2 15 ? 4.451   37.560  114.496 1.00 18.53 ? 16   ILE H CG1 1 
ATOM   5267 C  CG2 . ILE H  2 15 ? 3.892   36.349  116.668 1.00 19.12 ? 16   ILE H CG2 1 
ATOM   5268 C  CD1 . ILE H  2 15 ? 3.166   37.246  113.805 1.00 21.32 ? 16   ILE H CD1 1 
ATOM   5269 N  N   . ASN H  2 16 ? 6.681   34.311  116.705 1.00 19.98 ? 17   ASN H N   1 
ATOM   5270 C  CA  . ASN H  2 16 ? 6.952   33.398  117.824 1.00 21.66 ? 17   ASN H CA  1 
ATOM   5271 C  C   . ASN H  2 16 ? 8.358   33.557  118.400 1.00 19.79 ? 17   ASN H C   1 
ATOM   5272 O  O   . ASN H  2 16 ? 8.552   33.296  119.592 1.00 19.65 ? 17   ASN H O   1 
ATOM   5273 C  CB  . ASN H  2 16 ? 6.656   31.954  117.434 1.00 21.92 ? 17   ASN H CB  1 
ATOM   5274 C  CG  . ASN H  2 16 ? 5.167   31.709  117.227 1.00 27.08 ? 17   ASN H CG  1 
ATOM   5275 O  OD1 . ASN H  2 16 ? 4.330   32.564  117.557 1.00 25.55 ? 17   ASN H OD1 1 
ATOM   5276 N  ND2 . ASN H  2 16 ? 4.828   30.545  116.696 1.00 26.41 ? 17   ASN H ND2 1 
ATOM   5277 N  N   . THR H  2 17 ? 9.326   33.932  117.552 1.00 19.88 ? 18   THR H N   1 
ATOM   5278 C  CA  . THR H  2 17 ? 10.679  34.236  118.022 1.00 19.67 ? 18   THR H CA  1 
ATOM   5279 C  C   . THR H  2 17 ? 10.640  35.475  118.930 1.00 21.64 ? 18   THR H C   1 
ATOM   5280 O  O   . THR H  2 17 ? 11.171  35.454  120.053 1.00 20.47 ? 18   THR H O   1 
ATOM   5281 C  CB  . THR H  2 17 ? 11.657  34.414  116.846 1.00 22.48 ? 18   THR H CB  1 
ATOM   5282 O  OG1 . THR H  2 17 ? 11.687  33.201  116.092 1.00 21.50 ? 18   THR H OG1 1 
ATOM   5283 C  CG2 . THR H  2 17 ? 13.127  34.553  117.311 1.00 21.25 ? 18   THR H CG2 1 
ATOM   5284 N  N   . PHE H  2 18 ? 10.005  36.537  118.450 1.00 20.23 ? 19   PHE H N   1 
ATOM   5285 C  CA  . PHE H  2 18 ? 9.840   37.756  119.261 1.00 18.84 ? 19   PHE H CA  1 
ATOM   5286 C  C   . PHE H  2 18 ? 9.246   37.375  120.606 1.00 20.81 ? 19   PHE H C   1 
ATOM   5287 O  O   . PHE H  2 18 ? 9.707   37.801  121.670 1.00 21.26 ? 19   PHE H O   1 
ATOM   5288 C  CB  . PHE H  2 18 ? 8.948   38.739  118.479 1.00 20.35 ? 19   PHE H CB  1 
ATOM   5289 C  CG  . PHE H  2 18 ? 8.601   40.005  119.233 1.00 22.08 ? 19   PHE H CG  1 
ATOM   5290 C  CD1 . PHE H  2 18 ? 9.446   41.102  119.161 1.00 21.75 ? 19   PHE H CD1 1 
ATOM   5291 C  CD2 . PHE H  2 18 ? 7.447   40.090  119.991 1.00 21.69 ? 19   PHE H CD2 1 
ATOM   5292 C  CE1 . PHE H  2 18 ? 9.144   42.299  119.799 1.00 20.13 ? 19   PHE H CE1 1 
ATOM   5293 C  CE2 . PHE H  2 18 ? 7.134   41.282  120.676 1.00 21.46 ? 19   PHE H CE2 1 
ATOM   5294 C  CZ  . PHE H  2 18 ? 7.972   42.393  120.565 1.00 22.19 ? 19   PHE H CZ  1 
ATOM   5295 N  N   . HIS H  2 19 ? 8.176   36.612  120.548 1.00 20.15 ? 20   HIS H N   1 
ATOM   5296 C  CA  . HIS H  2 19 ? 7.449   36.243  121.768 1.00 20.39 ? 20   HIS H CA  1 
ATOM   5297 C  C   . HIS H  2 19 ? 8.256   35.408  122.790 1.00 20.97 ? 20   HIS H C   1 
ATOM   5298 O  O   . HIS H  2 19 ? 8.140   35.584  124.022 1.00 20.14 ? 20   HIS H O   1 
ATOM   5299 C  CB  . HIS H  2 19 ? 6.121   35.581  121.399 1.00 21.02 ? 20   HIS H CB  1 
ATOM   5300 C  CG  . HIS H  2 19 ? 5.366   35.080  122.592 1.00 25.39 ? 20   HIS H CG  1 
ATOM   5301 N  ND1 . HIS H  2 19 ? 4.519   35.877  123.331 1.00 26.08 ? 20   HIS H ND1 1 
ATOM   5302 C  CD2 . HIS H  2 19 ? 5.343   33.859  123.179 1.00 25.32 ? 20   HIS H CD2 1 
ATOM   5303 C  CE1 . HIS H  2 19 ? 4.006   35.172  124.324 1.00 26.62 ? 20   HIS H CE1 1 
ATOM   5304 N  NE2 . HIS H  2 19 ? 4.499   33.944  124.261 1.00 26.62 ? 20   HIS H NE2 1 
ATOM   5305 N  N   . GLN H  2 20 ? 9.012   34.431  122.295 1.00 20.02 ? 21   GLN H N   1 
ATOM   5306 C  CA  . GLN H  2 20 ? 9.826   33.563  123.130 1.00 19.15 ? 21   GLN H CA  1 
ATOM   5307 C  C   . GLN H  2 20 ? 10.653  34.403  124.107 1.00 20.58 ? 21   GLN H C   1 
ATOM   5308 O  O   . GLN H  2 20 ? 10.784  34.039  125.297 1.00 19.29 ? 21   GLN H O   1 
ATOM   5309 C  CB  . GLN H  2 20 ? 10.747  32.718  122.230 1.00 19.12 ? 21   GLN H CB  1 
ATOM   5310 C  CG  . GLN H  2 20 ? 11.862  31.988  122.973 1.00 19.87 ? 21   GLN H CG  1 
ATOM   5311 C  CD  . GLN H  2 20 ? 11.381  30.975  124.046 1.00 20.95 ? 21   GLN H CD  1 
ATOM   5312 O  OE1 . GLN H  2 20 ? 12.155  30.650  124.949 1.00 24.20 ? 21   GLN H OE1 1 
ATOM   5313 N  NE2 . GLN H  2 20 ? 10.144  30.484  123.948 1.00 18.44 ? 21   GLN H NE2 1 
ATOM   5314 N  N   . TYR H  2 21 ? 11.162  35.546  123.617 1.00 19.74 ? 22   TYR H N   1 
ATOM   5315 C  CA  . TYR H  2 21 ? 11.982  36.429  124.461 1.00 21.94 ? 22   TYR H CA  1 
ATOM   5316 C  C   . TYR H  2 21 ? 11.151  37.495  125.168 1.00 21.65 ? 22   TYR H C   1 
ATOM   5317 O  O   . TYR H  2 21 ? 11.385  37.769  126.338 1.00 23.66 ? 22   TYR H O   1 
ATOM   5318 C  CB  . TYR H  2 21 ? 13.143  37.054  123.674 1.00 23.00 ? 22   TYR H CB  1 
ATOM   5319 C  CG  . TYR H  2 21 ? 14.110  36.022  123.152 1.00 22.94 ? 22   TYR H CG  1 
ATOM   5320 C  CD1 . TYR H  2 21 ? 13.933  35.442  121.891 1.00 23.87 ? 22   TYR H CD1 1 
ATOM   5321 C  CD2 . TYR H  2 21 ? 15.203  35.618  123.909 1.00 24.15 ? 22   TYR H CD2 1 
ATOM   5322 C  CE1 . TYR H  2 21 ? 14.796  34.469  121.411 1.00 22.34 ? 22   TYR H CE1 1 
ATOM   5323 C  CE2 . TYR H  2 21 ? 16.095  34.633  123.422 1.00 22.82 ? 22   TYR H CE2 1 
ATOM   5324 C  CZ  . TYR H  2 21 ? 15.872  34.058  122.191 1.00 23.61 ? 22   TYR H CZ  1 
ATOM   5325 O  OH  . TYR H  2 21 ? 16.752  33.128  121.671 1.00 25.53 ? 22   TYR H OH  1 
ATOM   5326 N  N   . SER H  2 22 ? 10.177  38.078  124.482 1.00 22.22 ? 23   SER H N   1 
ATOM   5327 C  CA  . SER H  2 22 ? 9.461   39.226  125.065 1.00 21.93 ? 23   SER H CA  1 
ATOM   5328 C  C   . SER H  2 22 ? 8.739   38.867  126.366 1.00 22.36 ? 23   SER H C   1 
ATOM   5329 O  O   . SER H  2 22 ? 8.661   39.677  127.310 1.00 20.76 ? 23   SER H O   1 
ATOM   5330 C  CB  . SER H  2 22 ? 8.511   39.838  124.033 1.00 21.98 ? 23   SER H CB  1 
ATOM   5331 O  OG  . SER H  2 22 ? 7.352   39.045  123.856 1.00 23.85 ? 23   SER H OG  1 
ATOM   5332 N  N   . VAL H  2 23 ? 8.261   37.624  126.435 1.00 22.22 ? 24   VAL H N   1 
ATOM   5333 C  CA  . VAL H  2 23 ? 7.433   37.189  127.564 1.00 21.89 ? 24   VAL H CA  1 
ATOM   5334 C  C   . VAL H  2 23 ? 8.204   36.830  128.854 1.00 21.80 ? 24   VAL H C   1 
ATOM   5335 O  O   . VAL H  2 23 ? 7.608   36.620  129.923 1.00 20.00 ? 24   VAL H O   1 
ATOM   5336 C  CB  . VAL H  2 23 ? 6.529   36.035  127.109 1.00 23.21 ? 24   VAL H CB  1 
ATOM   5337 C  CG1 . VAL H  2 23 ? 7.343   34.744  126.931 1.00 22.34 ? 24   VAL H CG1 1 
ATOM   5338 C  CG2 . VAL H  2 23 ? 5.343   35.860  128.024 1.00 23.73 ? 24   VAL H CG2 1 
ATOM   5339 N  N   . LYS H  2 24 ? 9.529   36.752  128.764 1.00 20.73 ? 25   LYS H N   1 
ATOM   5340 C  CA  . LYS H  2 24 ? 10.325  36.259  129.882 1.00 21.80 ? 25   LYS H CA  1 
ATOM   5341 C  C   . LYS H  2 24 ? 10.324  37.220  131.072 1.00 22.00 ? 25   LYS H C   1 
ATOM   5342 O  O   . LYS H  2 24 ? 10.464  36.815  132.204 1.00 21.46 ? 25   LYS H O   1 
ATOM   5343 C  CB  . LYS H  2 24 ? 11.764  36.078  129.453 1.00 23.01 ? 25   LYS H CB  1 
ATOM   5344 C  CG  . LYS H  2 24 ? 12.023  34.979  128.431 1.00 26.48 ? 25   LYS H CG  1 
ATOM   5345 C  CD  . LYS H  2 24 ? 13.471  35.072  127.990 1.00 28.70 ? 25   LYS H CD  1 
ATOM   5346 C  CE  . LYS H  2 24 ? 13.852  34.054  126.910 1.00 30.03 ? 25   LYS H CE  1 
ATOM   5347 N  NZ  . LYS H  2 24 ? 14.254  32.787  127.508 1.00 31.86 ? 25   LYS H NZ  1 
ATOM   5348 N  N   . LEU H  2 25 ? 10.218  38.511  130.795 1.00 23.03 ? 26   LEU H N   1 
ATOM   5349 C  CA  . LEU H  2 25 ? 10.343  39.506  131.858 1.00 24.11 ? 26   LEU H CA  1 
ATOM   5350 C  C   . LEU H  2 25 ? 9.766   40.838  131.416 1.00 23.10 ? 26   LEU H C   1 
ATOM   5351 O  O   . LEU H  2 25 ? 9.704   41.131  130.225 1.00 21.43 ? 26   LEU H O   1 
ATOM   5352 C  CB  . LEU H  2 25 ? 11.825  39.683  132.208 1.00 27.19 ? 26   LEU H CB  1 
ATOM   5353 C  CG  . LEU H  2 25 ? 12.108  40.295  133.580 1.00 31.51 ? 26   LEU H CG  1 
ATOM   5354 C  CD1 . LEU H  2 25 ? 11.438  39.500  134.703 1.00 33.35 ? 26   LEU H CD1 1 
ATOM   5355 C  CD2 . LEU H  2 25 ? 13.611  40.307  133.785 1.00 33.56 ? 26   LEU H CD2 1 
ATOM   5356 N  N   . GLY H  2 26 ? 9.373   41.660  132.377 1.00 21.75 ? 27   GLY H N   1 
ATOM   5357 C  CA  . GLY H  2 26 ? 8.902   43.001  132.052 1.00 24.61 ? 27   GLY H CA  1 
ATOM   5358 C  C   . GLY H  2 26 ? 7.587   42.989  131.301 1.00 22.81 ? 27   GLY H C   1 
ATOM   5359 O  O   . GLY H  2 26 ? 6.729   42.128  131.540 1.00 26.66 ? 27   GLY H O   1 
ATOM   5360 N  N   . HIS H  2 27 ? 7.397   43.958  130.414 1.00 23.15 ? 28   HIS H N   1 
ATOM   5361 C  CA  . HIS H  2 27 ? 6.225   43.939  129.544 1.00 22.98 ? 28   HIS H CA  1 
ATOM   5362 C  C   . HIS H  2 27 ? 6.278   42.667  128.658 1.00 20.35 ? 28   HIS H C   1 
ATOM   5363 O  O   . HIS H  2 27 ? 7.298   42.368  127.995 1.00 21.00 ? 28   HIS H O   1 
ATOM   5364 C  CB  . HIS H  2 27 ? 6.112   45.245  128.742 1.00 24.90 ? 28   HIS H CB  1 
ATOM   5365 C  CG  . HIS H  2 27 ? 5.981   46.466  129.604 1.00 31.35 ? 28   HIS H CG  1 
ATOM   5366 N  ND1 . HIS H  2 27 ? 4.766   46.918  130.073 1.00 34.63 ? 28   HIS H ND1 1 
ATOM   5367 C  CD2 . HIS H  2 27 ? 6.918   47.282  130.145 1.00 33.19 ? 28   HIS H CD2 1 
ATOM   5368 C  CE1 . HIS H  2 27 ? 4.954   47.981  130.838 1.00 34.87 ? 28   HIS H CE1 1 
ATOM   5369 N  NE2 . HIS H  2 27 ? 6.253   48.220  130.905 1.00 34.94 ? 28   HIS H NE2 1 
ATOM   5370 N  N   . PRO H  2 28 ? 5.221   41.867  128.713 1.00 21.13 ? 29   PRO H N   1 
ATOM   5371 C  CA  . PRO H  2 28 ? 5.196   40.565  128.030 1.00 22.35 ? 29   PRO H CA  1 
ATOM   5372 C  C   . PRO H  2 28 ? 5.241   40.602  126.493 1.00 22.48 ? 29   PRO H C   1 
ATOM   5373 O  O   . PRO H  2 28 ? 5.564   39.599  125.859 1.00 22.72 ? 29   PRO H O   1 
ATOM   5374 C  CB  . PRO H  2 28 ? 3.905   39.905  128.539 1.00 25.32 ? 29   PRO H CB  1 
ATOM   5375 C  CG  . PRO H  2 28 ? 3.080   41.041  129.088 1.00 24.04 ? 29   PRO H CG  1 
ATOM   5376 C  CD  . PRO H  2 28 ? 4.010   42.122  129.521 1.00 21.74 ? 29   PRO H CD  1 
ATOM   5377 N  N   . ASP H  2 29 ? 4.912   41.753  125.916 1.00 22.27 ? 30   ASP H N   1 
ATOM   5378 C  CA  . ASP H  2 29 ? 4.790   41.914  124.470 1.00 22.83 ? 30   ASP H CA  1 
ATOM   5379 C  C   . ASP H  2 29 ? 5.773   42.961  123.973 1.00 22.67 ? 30   ASP H C   1 
ATOM   5380 O  O   . ASP H  2 29 ? 5.622   43.460  122.850 1.00 25.14 ? 30   ASP H O   1 
ATOM   5381 C  CB  . ASP H  2 29 ? 3.372   42.368  124.128 1.00 25.02 ? 30   ASP H CB  1 
ATOM   5382 C  CG  . ASP H  2 29 ? 2.987   42.074  122.691 1.00 28.89 ? 30   ASP H CG  1 
ATOM   5383 O  OD1 . ASP H  2 29 ? 3.381   41.016  122.128 1.00 30.31 ? 30   ASP H OD1 1 
ATOM   5384 O  OD2 . ASP H  2 29 ? 2.265   42.867  122.036 1.00 28.77 ? 30   ASP H OD2 1 
ATOM   5385 N  N   . THR H  2 30 ? 6.792   43.285  124.767 1.00 20.48 ? 31   THR H N   1 
ATOM   5386 C  CA  . THR H  2 30 ? 7.941   44.042  124.239 1.00 22.74 ? 31   THR H CA  1 
ATOM   5387 C  C   . THR H  2 30 ? 9.252   43.393  124.629 1.00 21.12 ? 31   THR H C   1 
ATOM   5388 O  O   . THR H  2 30 ? 9.275   42.633  125.598 1.00 19.25 ? 31   THR H O   1 
ATOM   5389 C  CB  . THR H  2 30 ? 7.958   45.505  124.743 1.00 22.59 ? 31   THR H CB  1 
ATOM   5390 O  OG1 . THR H  2 30 ? 8.268   45.526  126.140 1.00 21.22 ? 31   THR H OG1 1 
ATOM   5391 C  CG2 . THR H  2 30 ? 6.586   46.186  124.632 1.00 25.95 ? 31   THR H CG2 1 
ATOM   5392 N  N   . LEU H  2 31 ? 10.329  43.692  123.906 1.00 18.76 ? 32   LEU H N   1 
ATOM   5393 C  CA  . LEU H  2 31 ? 11.677  43.224  124.251 1.00 20.59 ? 32   LEU H CA  1 
ATOM   5394 C  C   . LEU H  2 31 ? 12.413  44.313  125.032 1.00 21.87 ? 32   LEU H C   1 
ATOM   5395 O  O   . LEU H  2 31 ? 12.554  45.446  124.543 1.00 22.24 ? 32   LEU H O   1 
ATOM   5396 C  CB  . LEU H  2 31 ? 12.510  42.961  122.989 1.00 19.95 ? 32   LEU H CB  1 
ATOM   5397 C  CG  . LEU H  2 31 ? 12.089  41.879  122.004 1.00 19.25 ? 32   LEU H CG  1 
ATOM   5398 C  CD1 . LEU H  2 31 ? 12.809  41.878  120.624 1.00 20.48 ? 32   LEU H CD1 1 
ATOM   5399 C  CD2 . LEU H  2 31 ? 12.197  40.502  122.705 1.00 19.24 ? 32   LEU H CD2 1 
ATOM   5400 N  N   . ASN H  2 32 ? 12.911  43.977  126.215 1.00 22.40 ? 33   ASN H N   1 
ATOM   5401 C  CA  . ASN H  2 32 ? 13.768  44.904  126.941 1.00 22.31 ? 33   ASN H CA  1 
ATOM   5402 C  C   . ASN H  2 32 ? 15.197  44.694  126.418 1.00 23.35 ? 33   ASN H C   1 
ATOM   5403 O  O   . ASN H  2 32 ? 15.419  43.857  125.529 1.00 21.80 ? 33   ASN H O   1 
ATOM   5404 C  CB  . ASN H  2 32 ? 13.617  44.742  128.461 1.00 22.55 ? 33   ASN H CB  1 
ATOM   5405 C  CG  . ASN H  2 32 ? 14.024  43.357  128.955 1.00 24.01 ? 33   ASN H CG  1 
ATOM   5406 O  OD1 . ASN H  2 32 ? 14.819  42.674  128.310 1.00 25.33 ? 33   ASN H OD1 1 
ATOM   5407 N  ND2 . ASN H  2 32 ? 13.527  42.967  130.127 1.00 26.09 ? 33   ASN H ND2 1 
ATOM   5408 N  N   . GLN H  2 33 ? 16.167  45.432  126.940 1.00 22.53 ? 34   GLN H N   1 
ATOM   5409 C  CA  . GLN H  2 33 ? 17.508  45.363  126.375 1.00 26.05 ? 34   GLN H CA  1 
ATOM   5410 C  C   . GLN H  2 33 ? 18.117  43.958  126.435 1.00 23.94 ? 34   GLN H C   1 
ATOM   5411 O  O   . GLN H  2 33 ? 18.722  43.508  125.475 1.00 22.20 ? 34   GLN H O   1 
ATOM   5412 C  CB  . GLN H  2 33 ? 18.441  46.382  127.030 1.00 29.60 ? 34   GLN H CB  1 
ATOM   5413 C  CG  . GLN H  2 33 ? 19.837  46.414  126.388 1.00 34.20 ? 34   GLN H CG  1 
ATOM   5414 C  CD  . GLN H  2 33 ? 20.750  47.438  127.036 1.00 35.87 ? 34   GLN H CD  1 
ATOM   5415 O  OE1 . GLN H  2 33 ? 21.616  47.084  127.837 1.00 38.85 ? 34   GLN H OE1 1 
ATOM   5416 N  NE2 . GLN H  2 33 ? 20.549  48.716  126.703 1.00 38.89 ? 34   GLN H NE2 1 
ATOM   5417 N  N   . GLY H  2 34 ? 17.997  43.286  127.573 1.00 24.32 ? 35   GLY H N   1 
ATOM   5418 C  CA  . GLY H  2 34 ? 18.569  41.947  127.721 1.00 24.12 ? 35   GLY H CA  1 
ATOM   5419 C  C   . GLY H  2 34 ? 17.883  40.924  126.837 1.00 21.95 ? 35   GLY H C   1 
ATOM   5420 O  O   . GLY H  2 34 ? 18.535  40.020  126.294 1.00 25.20 ? 35   GLY H O   1 
ATOM   5421 N  N   . GLU H  2 35 ? 16.572  41.057  126.664 1.00 21.77 ? 36   GLU H N   1 
ATOM   5422 C  CA  . GLU H  2 35 ? 15.828  40.135  125.791 1.00 23.24 ? 36   GLU H CA  1 
ATOM   5423 C  C   . GLU H  2 35 ? 16.216  40.330  124.323 1.00 22.34 ? 36   GLU H C   1 
ATOM   5424 O  O   . GLU H  2 35 ? 16.361  39.361  123.569 1.00 24.15 ? 36   GLU H O   1 
ATOM   5425 C  CB  . GLU H  2 35 ? 14.313  40.302  125.986 1.00 23.18 ? 36   GLU H CB  1 
ATOM   5426 C  CG  . GLU H  2 35 ? 13.872  39.734  127.329 1.00 23.36 ? 36   GLU H CG  1 
ATOM   5427 C  CD  . GLU H  2 35 ? 12.537  40.287  127.821 1.00 23.04 ? 36   GLU H CD  1 
ATOM   5428 O  OE1 . GLU H  2 35 ? 11.941  41.190  127.188 1.00 20.08 ? 36   GLU H OE1 1 
ATOM   5429 O  OE2 . GLU H  2 35 ? 12.086  39.800  128.880 1.00 24.29 ? 36   GLU H OE2 1 
ATOM   5430 N  N   . PHE H  2 36 ? 16.364  41.581  123.903 1.00 22.94 ? 37   PHE H N   1 
ATOM   5431 C  CA  . PHE H  2 36 ? 16.802  41.860  122.536 1.00 21.67 ? 37   PHE H CA  1 
ATOM   5432 C  C   . PHE H  2 36 ? 18.215  41.327  122.302 1.00 22.45 ? 37   PHE H C   1 
ATOM   5433 O  O   . PHE H  2 36 ? 18.472  40.694  121.275 1.00 21.37 ? 37   PHE H O   1 
ATOM   5434 C  CB  . PHE H  2 36 ? 16.766  43.371  122.282 1.00 21.28 ? 37   PHE H CB  1 
ATOM   5435 C  CG  . PHE H  2 36 ? 17.236  43.757  120.917 1.00 20.90 ? 37   PHE H CG  1 
ATOM   5436 C  CD1 . PHE H  2 36 ? 16.461  43.476  119.803 1.00 20.66 ? 37   PHE H CD1 1 
ATOM   5437 C  CD2 . PHE H  2 36 ? 18.473  44.357  120.738 1.00 22.41 ? 37   PHE H CD2 1 
ATOM   5438 C  CE1 . PHE H  2 36 ? 16.879  43.846  118.534 1.00 22.34 ? 37   PHE H CE1 1 
ATOM   5439 C  CE2 . PHE H  2 36 ? 18.902  44.725  119.464 1.00 18.18 ? 37   PHE H CE2 1 
ATOM   5440 C  CZ  . PHE H  2 36 ? 18.092  44.461  118.362 1.00 20.21 ? 37   PHE H CZ  1 
ATOM   5441 N  N   . LYS H  2 37 ? 19.108  41.554  123.266 1.00 21.32 ? 38   LYS H N   1 
ATOM   5442 C  CA  . LYS H  2 37 ? 20.449  40.987  123.219 1.00 23.21 ? 38   LYS H CA  1 
ATOM   5443 C  C   . LYS H  2 37 ? 20.475  39.467  123.030 1.00 23.86 ? 38   LYS H C   1 
ATOM   5444 O  O   . LYS H  2 37 ? 21.256  38.957  122.202 1.00 23.07 ? 38   LYS H O   1 
ATOM   5445 C  CB  . LYS H  2 37 ? 21.256  41.403  124.459 1.00 24.32 ? 38   LYS H CB  1 
ATOM   5446 C  CG  . LYS H  2 37 ? 21.632  42.877  124.409 1.00 27.69 ? 38   LYS H CG  1 
ATOM   5447 C  CD  . LYS H  2 37 ? 22.467  43.269  125.607 1.00 29.92 ? 38   LYS H CD  1 
ATOM   5448 C  CE  . LYS H  2 37 ? 23.051  44.657  125.386 1.00 32.26 ? 38   LYS H CE  1 
ATOM   5449 N  NZ  . LYS H  2 37 ? 23.774  45.095  126.628 1.00 34.12 ? 38   LYS H NZ  1 
ATOM   5450 N  N   . GLU H  2 38 ? 19.625  38.765  123.782 1.00 23.89 ? 39   GLU H N   1 
ATOM   5451 C  CA  . GLU H  2 38 ? 19.569  37.320  123.749 1.00 24.87 ? 39   GLU H CA  1 
ATOM   5452 C  C   . GLU H  2 38 ? 19.073  36.840  122.387 1.00 24.00 ? 39   GLU H C   1 
ATOM   5453 O  O   . GLU H  2 38 ? 19.635  35.924  121.775 1.00 22.14 ? 39   GLU H O   1 
ATOM   5454 C  CB  . GLU H  2 38 ? 18.606  36.826  124.838 1.00 30.62 ? 39   GLU H CB  1 
ATOM   5455 C  CG  . GLU H  2 38 ? 19.082  35.629  125.613 1.00 36.74 ? 39   GLU H CG  1 
ATOM   5456 C  CD  . GLU H  2 38 ? 18.274  35.438  126.894 1.00 40.31 ? 39   GLU H CD  1 
ATOM   5457 O  OE1 . GLU H  2 38 ? 18.889  35.205  127.962 1.00 42.01 ? 39   GLU H OE1 1 
ATOM   5458 O  OE2 . GLU H  2 38 ? 17.020  35.543  126.846 1.00 41.37 ? 39   GLU H OE2 1 
ATOM   5459 N  N   . LEU H  2 39 ? 18.008  37.459  121.901 1.00 23.63 ? 40   LEU H N   1 
ATOM   5460 C  CA  . LEU H  2 39 ? 17.497  37.112  120.588 1.00 22.01 ? 40   LEU H CA  1 
ATOM   5461 C  C   . LEU H  2 39 ? 18.558  37.323  119.496 1.00 24.30 ? 40   LEU H C   1 
ATOM   5462 O  O   . LEU H  2 39 ? 18.810  36.447  118.660 1.00 22.70 ? 40   LEU H O   1 
ATOM   5463 C  CB  . LEU H  2 39 ? 16.229  37.909  120.314 1.00 22.75 ? 40   LEU H CB  1 
ATOM   5464 C  CG  . LEU H  2 39 ? 15.511  37.599  118.994 1.00 23.98 ? 40   LEU H CG  1 
ATOM   5465 C  CD1 . LEU H  2 39 ? 14.105  38.114  119.145 1.00 23.97 ? 40   LEU H CD1 1 
ATOM   5466 C  CD2 . LEU H  2 39 ? 16.178  38.286  117.809 1.00 20.06 ? 40   LEU H CD2 1 
ATOM   5467 N  N   . VAL H  2 40 ? 19.187  38.488  119.498 1.00 21.82 ? 41   VAL H N   1 
ATOM   5468 C  CA  . VAL H  2 40 ? 20.209  38.743  118.489 1.00 25.24 ? 41   VAL H CA  1 
ATOM   5469 C  C   . VAL H  2 40 ? 21.372  37.757  118.569 1.00 23.97 ? 41   VAL H C   1 
ATOM   5470 O  O   . VAL H  2 40 ? 21.840  37.264  117.554 1.00 22.99 ? 41   VAL H O   1 
ATOM   5471 C  CB  . VAL H  2 40 ? 20.690  40.209  118.519 1.00 25.95 ? 41   VAL H CB  1 
ATOM   5472 C  CG1 . VAL H  2 40 ? 21.800  40.428  117.521 1.00 28.77 ? 41   VAL H CG1 1 
ATOM   5473 C  CG2 . VAL H  2 40 ? 19.525  41.143  118.213 1.00 24.25 ? 41   VAL H CG2 1 
ATOM   5474 N  N   . ARG H  2 41 ? 21.858  37.497  119.773 1.00 23.52 ? 42   ARG H N   1 
ATOM   5475 C  CA  . ARG H  2 41 ? 22.970  36.592  119.965 1.00 25.81 ? 42   ARG H CA  1 
ATOM   5476 C  C   . ARG H  2 41 ? 22.650  35.181  119.472 1.00 24.78 ? 42   ARG H C   1 
ATOM   5477 O  O   . ARG H  2 41 ? 23.518  34.520  118.910 1.00 23.99 ? 42   ARG H O   1 
ATOM   5478 C  CB  . ARG H  2 41 ? 23.327  36.542  121.449 1.00 26.23 ? 42   ARG H CB  1 
ATOM   5479 C  CG  . ARG H  2 41 ? 24.534  35.702  121.808 1.00 31.50 ? 42   ARG H CG  1 
ATOM   5480 C  CD  . ARG H  2 41 ? 24.957  35.825  123.273 1.00 33.33 ? 42   ARG H CD  1 
ATOM   5481 N  NE  . ARG H  2 41 ? 24.029  35.122  124.154 1.00 40.91 ? 42   ARG H NE  1 
ATOM   5482 C  CZ  . ARG H  2 41 ? 24.319  33.994  124.802 1.00 44.44 ? 42   ARG H CZ  1 
ATOM   5483 N  NH1 . ARG H  2 41 ? 25.526  33.446  124.677 1.00 46.74 ? 42   ARG H NH1 1 
ATOM   5484 N  NH2 . ARG H  2 41 ? 23.415  33.416  125.592 1.00 45.32 ? 42   ARG H NH2 1 
ATOM   5485 N  N   . LYS H  2 42 ? 21.435  34.700  119.734 1.00 24.04 ? 43   LYS H N   1 
ATOM   5486 C  CA  . LYS H  2 42 ? 21.093  33.304  119.418 1.00 26.01 ? 43   LYS H CA  1 
ATOM   5487 C  C   . LYS H  2 42 ? 20.457  33.172  118.040 1.00 24.39 ? 43   LYS H C   1 
ATOM   5488 O  O   . LYS H  2 42 ? 20.890  32.354  117.237 1.00 26.39 ? 43   LYS H O   1 
ATOM   5489 C  CB  . LYS H  2 42 ? 20.147  32.716  120.471 1.00 28.23 ? 43   LYS H CB  1 
ATOM   5490 C  CG  . LYS H  2 42 ? 20.737  32.608  121.862 1.00 33.47 ? 43   LYS H CG  1 
ATOM   5491 C  CD  . LYS H  2 42 ? 20.113  31.438  122.612 1.00 37.71 ? 43   LYS H CD  1 
ATOM   5492 C  CE  . LYS H  2 42 ? 19.739  31.879  124.008 1.00 40.84 ? 43   LYS H CE  1 
ATOM   5493 N  NZ  . LYS H  2 42 ? 19.364  30.722  124.841 1.00 42.76 ? 43   LYS H NZ  1 
ATOM   5494 N  N   . ASP H  2 43 ? 19.438  33.978  117.760 1.00 20.77 ? 44   ASP H N   1 
ATOM   5495 C  CA  . ASP H  2 43 ? 18.626  33.786  116.565 1.00 20.64 ? 44   ASP H CA  1 
ATOM   5496 C  C   . ASP H  2 43 ? 19.153  34.487  115.319 1.00 21.55 ? 44   ASP H C   1 
ATOM   5497 O  O   . ASP H  2 43 ? 18.789  34.138  114.215 1.00 21.48 ? 44   ASP H O   1 
ATOM   5498 C  CB  . ASP H  2 43 ? 17.165  34.088  116.849 1.00 21.70 ? 44   ASP H CB  1 
ATOM   5499 C  CG  . ASP H  2 43 ? 16.658  33.229  117.987 1.00 24.98 ? 44   ASP H CG  1 
ATOM   5500 O  OD1 . ASP H  2 43 ? 16.547  32.009  117.776 1.00 26.12 ? 44   ASP H OD1 1 
ATOM   5501 O  OD2 . ASP H  2 43 ? 16.411  33.655  119.118 1.00 29.66 ? 44   ASP H OD2 1 
ATOM   5502 N  N   . LEU H  2 44 ? 20.079  35.406  115.518 1.00 20.80 ? 45   LEU H N   1 
ATOM   5503 C  CA  . LEU H  2 44 ? 20.702  36.090  114.390 1.00 22.00 ? 45   LEU H CA  1 
ATOM   5504 C  C   . LEU H  2 44 ? 22.201  35.930  114.527 1.00 23.90 ? 45   LEU H C   1 
ATOM   5505 O  O   . LEU H  2 44 ? 22.975  36.823  114.171 1.00 24.87 ? 45   LEU H O   1 
ATOM   5506 C  CB  . LEU H  2 44 ? 20.251  37.559  114.331 1.00 22.62 ? 45   LEU H CB  1 
ATOM   5507 C  CG  . LEU H  2 44 ? 18.739  37.788  114.181 1.00 23.62 ? 45   LEU H CG  1 
ATOM   5508 C  CD1 . LEU H  2 44 ? 18.389  39.246  114.535 1.00 24.84 ? 45   LEU H CD1 1 
ATOM   5509 C  CD2 . LEU H  2 44 ? 18.257  37.474  112.758 1.00 24.57 ? 45   LEU H CD2 1 
ATOM   5510 N  N   . GLN H  2 45 ? 22.619  34.765  115.011 1.00 21.88 ? 46   GLN H N   1 
ATOM   5511 C  CA  . GLN H  2 45 ? 24.050  34.577  115.240 1.00 24.89 ? 46   GLN H CA  1 
ATOM   5512 C  C   . GLN H  2 45 ? 24.856  34.615  113.943 1.00 23.69 ? 46   GLN H C   1 
ATOM   5513 O  O   . GLN H  2 45 ? 26.063  34.897  113.940 1.00 26.37 ? 46   GLN H O   1 
ATOM   5514 C  CB  . GLN H  2 45 ? 24.314  33.275  115.984 1.00 24.48 ? 46   GLN H CB  1 
ATOM   5515 C  CG  . GLN H  2 45 ? 23.770  32.036  115.256 1.00 27.33 ? 46   GLN H CG  1 
ATOM   5516 C  CD  . GLN H  2 45 ? 23.986  30.771  116.069 1.00 30.32 ? 46   GLN H CD  1 
ATOM   5517 O  OE1 . GLN H  2 45 ? 24.996  30.097  115.893 1.00 31.85 ? 46   GLN H OE1 1 
ATOM   5518 N  NE2 . GLN H  2 45 ? 23.076  30.477  116.985 1.00 27.55 ? 46   GLN H NE2 1 
ATOM   5519 N  N   . ASN H  2 46 ? 24.203  34.312  112.829 1.00 25.23 ? 47   ASN H N   1 
ATOM   5520 C  CA  . ASN H  2 46 ? 24.862  34.428  111.541 1.00 25.84 ? 47   ASN H CA  1 
ATOM   5521 C  C   . ASN H  2 46 ? 24.716  35.803  110.887 1.00 27.04 ? 47   ASN H C   1 
ATOM   5522 O  O   . ASN H  2 46 ? 25.713  36.388  110.453 1.00 24.70 ? 47   ASN H O   1 
ATOM   5523 C  CB  . ASN H  2 46 ? 24.342  33.366  110.574 1.00 26.62 ? 47   ASN H CB  1 
ATOM   5524 C  CG  . ASN H  2 46 ? 24.565  31.952  111.086 1.00 29.52 ? 47   ASN H CG  1 
ATOM   5525 O  OD1 . ASN H  2 46 ? 25.675  31.431  111.024 1.00 31.64 ? 47   ASN H OD1 1 
ATOM   5526 N  ND2 . ASN H  2 46 ? 23.513  31.323  111.569 1.00 27.14 ? 47   ASN H ND2 1 
ATOM   5527 N  N   . PHE H  2 47 ? 23.478  36.300  110.802 1.00 25.16 ? 48   PHE H N   1 
ATOM   5528 C  CA  . PHE H  2 47 ? 23.194  37.530  110.058 1.00 25.61 ? 48   PHE H CA  1 
ATOM   5529 C  C   . PHE H  2 47 ? 23.853  38.721  110.741 1.00 27.24 ? 48   PHE H C   1 
ATOM   5530 O  O   . PHE H  2 47 ? 24.129  39.726  110.098 1.00 27.13 ? 48   PHE H O   1 
ATOM   5531 C  CB  . PHE H  2 47 ? 21.676  37.783  109.929 1.00 24.51 ? 48   PHE H CB  1 
ATOM   5532 C  CG  . PHE H  2 47 ? 20.986  36.963  108.852 1.00 23.99 ? 48   PHE H CG  1 
ATOM   5533 C  CD1 . PHE H  2 47 ? 19.674  37.236  108.513 1.00 22.97 ? 48   PHE H CD1 1 
ATOM   5534 C  CD2 . PHE H  2 47 ? 21.647  35.925  108.188 1.00 24.57 ? 48   PHE H CD2 1 
ATOM   5535 C  CE1 . PHE H  2 47 ? 19.015  36.487  107.536 1.00 24.50 ? 48   PHE H CE1 1 
ATOM   5536 C  CE2 . PHE H  2 47 ? 21.005  35.156  107.224 1.00 22.62 ? 48   PHE H CE2 1 
ATOM   5537 C  CZ  . PHE H  2 47 ? 19.683  35.448  106.889 1.00 24.16 ? 48   PHE H CZ  1 
ATOM   5538 N  N   . LEU H  2 48 ? 24.050  38.638  112.053 1.00 25.39 ? 49   LEU H N   1 
ATOM   5539 C  CA  . LEU H  2 48 ? 24.668  39.732  112.806 1.00 27.55 ? 49   LEU H CA  1 
ATOM   5540 C  C   . LEU H  2 48 ? 25.903  39.239  113.536 1.00 26.64 ? 49   LEU H C   1 
ATOM   5541 O  O   . LEU H  2 48 ? 26.192  39.624  114.666 1.00 27.66 ? 49   LEU H O   1 
ATOM   5542 C  CB  . LEU H  2 48 ? 23.681  40.389  113.775 1.00 27.56 ? 49   LEU H CB  1 
ATOM   5543 C  CG  . LEU H  2 48 ? 22.650  41.306  113.116 1.00 29.95 ? 49   LEU H CG  1 
ATOM   5544 C  CD1 . LEU H  2 48 ? 21.561  41.638  114.128 1.00 30.28 ? 49   LEU H CD1 1 
ATOM   5545 C  CD2 . LEU H  2 48 ? 23.286  42.576  112.518 1.00 30.95 ? 49   LEU H CD2 1 
ATOM   5546 N  N   . LYS H  2 49 ? 26.638  38.378  112.850 1.00 28.65 ? 50   LYS H N   1 
ATOM   5547 C  CA  . LYS H  2 49 ? 27.840  37.760  113.384 1.00 32.32 ? 50   LYS H CA  1 
ATOM   5548 C  C   . LYS H  2 49 ? 28.875  38.793  113.812 1.00 32.30 ? 50   LYS H C   1 
ATOM   5549 O  O   . LYS H  2 49 ? 29.412  38.713  114.911 1.00 32.68 ? 50   LYS H O   1 
ATOM   5550 C  CB  . LYS H  2 49 ? 28.446  36.830  112.328 1.00 34.24 ? 50   LYS H CB  1 
ATOM   5551 C  CG  . LYS H  2 49 ? 29.684  36.099  112.765 1.00 38.27 ? 50   LYS H CG  1 
ATOM   5552 C  CD  . LYS H  2 49 ? 30.170  35.232  111.618 1.00 41.83 ? 50   LYS H CD  1 
ATOM   5553 C  CE  . LYS H  2 49 ? 31.514  34.572  111.918 1.00 44.97 ? 50   LYS H CE  1 
ATOM   5554 N  NZ  . LYS H  2 49 ? 32.272  35.208  113.046 1.00 46.81 ? 50   LYS H NZ  1 
ATOM   5555 N  N   . LYS H  2 50 ? 29.161  39.753  112.938 1.00 33.36 ? 51   LYS H N   1 
ATOM   5556 C  CA  . LYS H  2 50 ? 30.129  40.795  113.252 1.00 35.18 ? 51   LYS H CA  1 
ATOM   5557 C  C   . LYS H  2 50 ? 29.670  41.695  114.406 1.00 33.19 ? 51   LYS H C   1 
ATOM   5558 O  O   . LYS H  2 50 ? 30.414  41.940  115.357 1.00 32.52 ? 51   LYS H O   1 
ATOM   5559 C  CB  . LYS H  2 50 ? 30.433  41.628  112.005 1.00 37.84 ? 51   LYS H CB  1 
ATOM   5560 C  CG  . LYS H  2 50 ? 31.419  42.747  112.277 1.00 41.77 ? 51   LYS H CG  1 
ATOM   5561 C  CD  . LYS H  2 50 ? 31.634  43.657  111.080 1.00 43.26 ? 51   LYS H CD  1 
ATOM   5562 C  CE  . LYS H  2 50 ? 32.666  44.733  111.425 1.00 46.26 ? 51   LYS H CE  1 
ATOM   5563 N  NZ  . LYS H  2 50 ? 33.149  45.487  110.226 1.00 47.87 ? 51   LYS H NZ  1 
ATOM   5564 N  N   . GLU H  2 51 ? 28.442  42.191  114.316 1.00 31.72 ? 52   GLU H N   1 
ATOM   5565 C  CA  . GLU H  2 51 ? 27.859  43.085  115.319 1.00 30.98 ? 52   GLU H CA  1 
ATOM   5566 C  C   . GLU H  2 51 ? 27.740  42.438  116.705 1.00 30.56 ? 52   GLU H C   1 
ATOM   5567 O  O   . GLU H  2 51 ? 27.894  43.092  117.737 1.00 28.95 ? 52   GLU H O   1 
ATOM   5568 C  CB  . GLU H  2 51 ? 26.490  43.545  114.829 1.00 29.99 ? 52   GLU H CB  1 
ATOM   5569 C  CG  . GLU H  2 51 ? 26.517  44.444  113.599 1.00 31.80 ? 52   GLU H CG  1 
ATOM   5570 C  CD  . GLU H  2 51 ? 26.605  43.692  112.268 1.00 32.35 ? 52   GLU H CD  1 
ATOM   5571 O  OE1 . GLU H  2 51 ? 26.541  42.439  112.223 1.00 31.10 ? 52   GLU H OE1 1 
ATOM   5572 O  OE2 . GLU H  2 51 ? 26.716  44.373  111.229 1.00 33.48 ? 52   GLU H OE2 1 
ATOM   5573 N  N   . ASN H  2 52 ? 27.488  41.134  116.721 1.00 30.28 ? 53   ASN H N   1 
ATOM   5574 C  CA  . ASN H  2 52 ? 27.367  40.368  117.958 1.00 30.04 ? 53   ASN H CA  1 
ATOM   5575 C  C   . ASN H  2 52 ? 28.658  40.329  118.781 1.00 31.40 ? 53   ASN H C   1 
ATOM   5576 O  O   . ASN H  2 52 ? 28.636  39.970  119.959 1.00 32.56 ? 53   ASN H O   1 
ATOM   5577 C  CB  . ASN H  2 52 ? 26.927  38.939  117.629 1.00 29.78 ? 53   ASN H CB  1 
ATOM   5578 C  CG  . ASN H  2 52 ? 25.432  38.743  117.779 1.00 29.29 ? 53   ASN H CG  1 
ATOM   5579 O  OD1 . ASN H  2 52 ? 24.857  39.183  118.760 1.00 30.46 ? 53   ASN H OD1 1 
ATOM   5580 N  ND2 . ASN H  2 52 ? 24.808  38.051  116.835 1.00 28.16 ? 53   ASN H ND2 1 
ATOM   5581 N  N   . LYS H  2 53 ? 29.782  40.662  118.152 1.00 33.10 ? 54   LYS H N   1 
ATOM   5582 C  CA  . LYS H  2 53 ? 31.086  40.648  118.818 1.00 35.81 ? 54   LYS H CA  1 
ATOM   5583 C  C   . LYS H  2 53 ? 31.291  41.869  119.706 1.00 36.29 ? 54   LYS H C   1 
ATOM   5584 O  O   . LYS H  2 53 ? 32.234  41.919  120.495 1.00 36.55 ? 54   LYS H O   1 
ATOM   5585 C  CB  . LYS H  2 53 ? 32.214  40.561  117.794 1.00 37.33 ? 54   LYS H CB  1 
ATOM   5586 C  CG  . LYS H  2 53 ? 32.320  39.203  117.140 1.00 40.04 ? 54   LYS H CG  1 
ATOM   5587 C  CD  . LYS H  2 53 ? 33.437  39.138  116.117 1.00 42.67 ? 54   LYS H CD  1 
ATOM   5588 C  CE  . LYS H  2 53 ? 33.526  37.724  115.548 1.00 44.58 ? 54   LYS H CE  1 
ATOM   5589 N  NZ  . LYS H  2 53 ? 34.552  37.614  114.472 1.00 46.55 ? 54   LYS H NZ  1 
ATOM   5590 N  N   . ASN H  2 54 ? 30.402  42.851  119.569 1.00 36.35 ? 55   ASN H N   1 
ATOM   5591 C  CA  . ASN H  2 54 ? 30.481  44.071  120.356 1.00 36.72 ? 55   ASN H CA  1 
ATOM   5592 C  C   . ASN H  2 54 ? 29.127  44.435  120.953 1.00 36.62 ? 55   ASN H C   1 
ATOM   5593 O  O   . ASN H  2 54 ? 28.238  44.917  120.256 1.00 34.46 ? 55   ASN H O   1 
ATOM   5594 C  CB  . ASN H  2 54 ? 31.012  45.222  119.507 1.00 37.99 ? 55   ASN H CB  1 
ATOM   5595 C  CG  . ASN H  2 54 ? 31.288  46.473  120.330 1.00 39.54 ? 55   ASN H CG  1 
ATOM   5596 O  OD1 . ASN H  2 54 ? 30.912  46.568  121.497 1.00 39.77 ? 55   ASN H OD1 1 
ATOM   5597 N  ND2 . ASN H  2 54 ? 31.955  47.436  119.719 1.00 40.34 ? 55   ASN H ND2 1 
ATOM   5598 N  N   . GLU H  2 55 ? 28.987  44.202  122.252 1.00 37.04 ? 56   GLU H N   1 
ATOM   5599 C  CA  . GLU H  2 55 ? 27.748  44.474  122.967 1.00 38.70 ? 56   GLU H CA  1 
ATOM   5600 C  C   . GLU H  2 55 ? 27.232  45.905  122.756 1.00 37.14 ? 56   GLU H C   1 
ATOM   5601 O  O   . GLU H  2 55 ? 26.018  46.140  122.658 1.00 35.55 ? 56   GLU H O   1 
ATOM   5602 C  CB  . GLU H  2 55 ? 27.937  44.170  124.452 1.00 43.32 ? 56   GLU H CB  1 
ATOM   5603 C  CG  . GLU H  2 55 ? 26.681  44.358  125.281 1.00 48.18 ? 56   GLU H CG  1 
ATOM   5604 C  CD  . GLU H  2 55 ? 26.749  43.658  126.624 1.00 51.63 ? 56   GLU H CD  1 
ATOM   5605 O  OE1 . GLU H  2 55 ? 27.872  43.429  127.127 1.00 53.34 ? 56   GLU H OE1 1 
ATOM   5606 O  OE2 . GLU H  2 55 ? 25.675  43.346  127.183 1.00 52.81 ? 56   GLU H OE2 1 
ATOM   5607 N  N   . LYS H  2 56 ? 28.151  46.863  122.648 1.00 35.66 ? 57   LYS H N   1 
ATOM   5608 C  CA  . LYS H  2 56 ? 27.751  48.253  122.465 1.00 35.22 ? 57   LYS H CA  1 
ATOM   5609 C  C   . LYS H  2 56 ? 27.140  48.473  121.090 1.00 31.99 ? 57   LYS H C   1 
ATOM   5610 O  O   . LYS H  2 56 ? 26.284  49.336  120.917 1.00 30.37 ? 57   LYS H O   1 
ATOM   5611 C  CB  . LYS H  2 56 ? 28.925  49.205  122.715 1.00 37.92 ? 57   LYS H CB  1 
ATOM   5612 C  CG  . LYS H  2 56 ? 29.313  49.279  124.182 1.00 40.13 ? 57   LYS H CG  1 
ATOM   5613 C  CD  . LYS H  2 56 ? 30.576  50.096  124.413 1.00 42.54 ? 57   LYS H CD  1 
ATOM   5614 C  CE  . LYS H  2 56 ? 31.145  49.845  125.815 1.00 44.34 ? 57   LYS H CE  1 
ATOM   5615 N  NZ  . LYS H  2 56 ? 32.315  50.727  126.129 1.00 45.66 ? 57   LYS H NZ  1 
ATOM   5616 N  N   . VAL H  2 57 ? 27.564  47.681  120.107 1.00 30.41 ? 58   VAL H N   1 
ATOM   5617 C  CA  . VAL H  2 57 ? 26.992  47.812  118.763 1.00 29.30 ? 58   VAL H CA  1 
ATOM   5618 C  C   . VAL H  2 57 ? 25.536  47.339  118.799 1.00 28.21 ? 58   VAL H C   1 
ATOM   5619 O  O   . VAL H  2 57 ? 24.645  48.004  118.243 1.00 27.15 ? 58   VAL H O   1 
ATOM   5620 C  CB  . VAL H  2 57 ? 27.793  47.045  117.697 1.00 29.08 ? 58   VAL H CB  1 
ATOM   5621 C  CG1 . VAL H  2 57 ? 26.973  46.905  116.422 1.00 29.34 ? 58   VAL H CG1 1 
ATOM   5622 C  CG2 . VAL H  2 57 ? 29.115  47.740  117.426 1.00 29.26 ? 58   VAL H CG2 1 
ATOM   5623 N  N   . ILE H  2 58 ? 25.297  46.221  119.483 1.00 25.21 ? 59   ILE H N   1 
ATOM   5624 C  CA  . ILE H  2 58 ? 23.923  45.716  119.616 1.00 25.52 ? 59   ILE H CA  1 
ATOM   5625 C  C   . ILE H  2 58 ? 23.045  46.731  120.336 1.00 24.76 ? 59   ILE H C   1 
ATOM   5626 O  O   . ILE H  2 58 ? 21.887  46.946  119.941 1.00 23.98 ? 59   ILE H O   1 
ATOM   5627 C  CB  . ILE H  2 58 ? 23.886  44.379  120.361 1.00 24.85 ? 59   ILE H CB  1 
ATOM   5628 C  CG1 . ILE H  2 58 ? 24.709  43.318  119.635 1.00 24.12 ? 59   ILE H CG1 1 
ATOM   5629 C  CG2 . ILE H  2 58 ? 22.454  43.951  120.563 1.00 22.79 ? 59   ILE H CG2 1 
ATOM   5630 C  CD1 . ILE H  2 58 ? 24.451  43.193  118.090 1.00 24.01 ? 59   ILE H CD1 1 
ATOM   5631 N  N   . GLU H  2 59 ? 23.595  47.350  121.383 1.00 26.36 ? 60   GLU H N   1 
ATOM   5632 C  CA  . GLU H  2 59 ? 22.883  48.381  122.141 1.00 26.66 ? 60   GLU H CA  1 
ATOM   5633 C  C   . GLU H  2 59 ? 22.490  49.533  121.242 1.00 25.22 ? 60   GLU H C   1 
ATOM   5634 O  O   . GLU H  2 59 ? 21.376  50.027  121.319 1.00 25.94 ? 60   GLU H O   1 
ATOM   5635 C  CB  . GLU H  2 59 ? 23.710  48.888  123.321 1.00 27.48 ? 60   GLU H CB  1 
ATOM   5636 C  CG  . GLU H  2 59 ? 23.889  47.814  124.383 1.00 32.00 ? 60   GLU H CG  1 
ATOM   5637 C  CD  . GLU H  2 59 ? 24.691  48.287  125.591 1.00 34.29 ? 60   GLU H CD  1 
ATOM   5638 O  OE1 . GLU H  2 59 ? 25.044  49.482  125.651 1.00 35.94 ? 60   GLU H OE1 1 
ATOM   5639 O  OE2 . GLU H  2 59 ? 24.968  47.458  126.485 1.00 35.78 ? 60   GLU H OE2 1 
ATOM   5640 N  N   . HIS H  2 60 ? 23.400  49.954  120.376 1.00 25.20 ? 61   HIS H N   1 
ATOM   5641 C  CA  . HIS H  2 60 ? 23.095  51.034  119.439 1.00 27.61 ? 61   HIS H CA  1 
ATOM   5642 C  C   . HIS H  2 60 ? 21.988  50.676  118.431 1.00 26.48 ? 61   HIS H C   1 
ATOM   5643 O  O   . HIS H  2 60 ? 21.141  51.512  118.115 1.00 25.09 ? 61   HIS H O   1 
ATOM   5644 C  CB  . HIS H  2 60 ? 24.372  51.471  118.707 1.00 32.34 ? 61   HIS H CB  1 
ATOM   5645 C  CG  . HIS H  2 60 ? 24.173  52.595  117.730 1.00 37.74 ? 61   HIS H CG  1 
ATOM   5646 N  ND1 . HIS H  2 60 ? 23.645  53.819  118.089 1.00 40.62 ? 61   HIS H ND1 1 
ATOM   5647 C  CD2 . HIS H  2 60 ? 24.463  52.688  116.408 1.00 40.53 ? 61   HIS H CD2 1 
ATOM   5648 C  CE1 . HIS H  2 60 ? 23.609  54.612  117.032 1.00 41.74 ? 61   HIS H CE1 1 
ATOM   5649 N  NE2 . HIS H  2 60 ? 24.101  53.951  115.998 1.00 41.45 ? 61   HIS H NE2 1 
ATOM   5650 N  N   . ILE H  2 61 ? 22.020  49.452  117.899 1.00 26.40 ? 62   ILE H N   1 
ATOM   5651 C  CA  . ILE H  2 61 ? 20.970  48.965  116.990 1.00 25.08 ? 62   ILE H CA  1 
ATOM   5652 C  C   . ILE H  2 61 ? 19.608  49.032  117.705 1.00 24.34 ? 62   ILE H C   1 
ATOM   5653 O  O   . ILE H  2 61 ? 18.609  49.461  117.134 1.00 22.04 ? 62   ILE H O   1 
ATOM   5654 C  CB  . ILE H  2 61 ? 21.255  47.490  116.573 1.00 26.08 ? 62   ILE H CB  1 
ATOM   5655 C  CG1 . ILE H  2 61 ? 22.444  47.413  115.620 1.00 24.60 ? 62   ILE H CG1 1 
ATOM   5656 C  CG2 . ILE H  2 61 ? 20.053  46.864  115.886 1.00 23.19 ? 62   ILE H CG2 1 
ATOM   5657 C  CD1 . ILE H  2 61 ? 22.960  45.998  115.345 1.00 25.99 ? 62   ILE H CD1 1 
ATOM   5658 N  N   . MET H  2 62 ? 19.564  48.587  118.953 1.00 23.54 ? 63   MET H N   1 
ATOM   5659 C  CA  . MET H  2 62 ? 18.315  48.700  119.686 1.00 25.12 ? 63   MET H CA  1 
ATOM   5660 C  C   . MET H  2 62 ? 17.846  50.149  119.856 1.00 24.50 ? 63   MET H C   1 
ATOM   5661 O  O   . MET H  2 62 ? 16.654  50.459  119.676 1.00 24.54 ? 63   MET H O   1 
ATOM   5662 C  CB  . MET H  2 62 ? 18.397  48.028  121.065 1.00 26.92 ? 63   MET H CB  1 
ATOM   5663 C  CG  . MET H  2 62 ? 17.008  47.881  121.623 1.00 29.26 ? 63   MET H CG  1 
ATOM   5664 S  SD  . MET H  2 62 ? 17.027  47.207  123.281 1.00 30.91 ? 63   MET H SD  1 
ATOM   5665 C  CE  . MET H  2 62 ? 15.371  47.528  123.936 1.00 29.50 ? 63   MET H CE  1 
ATOM   5666 N  N   . GLU H  2 63 ? 18.775  51.010  120.268 1.00 22.99 ? 64   GLU H N   1 
ATOM   5667 C  CA  . GLU H  2 63 ? 18.496  52.440  120.478 1.00 26.06 ? 64   GLU H CA  1 
ATOM   5668 C  C   . GLU H  2 63 ? 17.962  53.068  119.199 1.00 23.96 ? 64   GLU H C   1 
ATOM   5669 O  O   . GLU H  2 63 ? 16.973  53.799  119.259 1.00 23.67 ? 64   GLU H O   1 
ATOM   5670 C  CB  . GLU H  2 63 ? 19.736  53.195  120.965 1.00 29.00 ? 64   GLU H CB  1 
ATOM   5671 C  CG  . GLU H  2 63 ? 20.230  52.766  122.342 1.00 35.24 ? 64   GLU H CG  1 
ATOM   5672 C  CD  . GLU H  2 63 ? 21.656  53.219  122.658 1.00 38.50 ? 64   GLU H CD  1 
ATOM   5673 O  OE1 . GLU H  2 63 ? 22.233  52.690  123.630 1.00 42.23 ? 64   GLU H OE1 1 
ATOM   5674 O  OE2 . GLU H  2 63 ? 22.227  54.086  121.953 1.00 41.56 ? 64   GLU H OE2 1 
ATOM   5675 N  N   . ASP H  2 64 ? 18.583  52.756  118.055 1.00 22.85 ? 65   ASP H N   1 
ATOM   5676 C  CA  . ASP H  2 64 ? 18.085  53.211  116.747 1.00 23.88 ? 65   ASP H CA  1 
ATOM   5677 C  C   . ASP H  2 64 ? 16.646  52.743  116.472 1.00 23.02 ? 65   ASP H C   1 
ATOM   5678 O  O   . ASP H  2 64 ? 15.831  53.535  116.018 1.00 23.43 ? 65   ASP H O   1 
ATOM   5679 C  CB  . ASP H  2 64 ? 19.061  52.837  115.633 1.00 27.70 ? 65   ASP H CB  1 
ATOM   5680 C  CG  . ASP H  2 64 ? 20.412  53.558  115.790 1.00 33.93 ? 65   ASP H CG  1 
ATOM   5681 O  OD1 . ASP H  2 64 ? 21.345  53.275  115.003 1.00 37.56 ? 65   ASP H OD1 1 
ATOM   5682 O  OD2 . ASP H  2 64 ? 20.640  54.422  116.682 1.00 37.16 ? 65   ASP H OD2 1 
ATOM   5683 N  N   . LEU H  2 65 ? 16.302  51.501  116.828 1.00 22.71 ? 66   LEU H N   1 
ATOM   5684 C  CA  . LEU H  2 65 ? 14.976  50.937  116.547 1.00 20.73 ? 66   LEU H CA  1 
ATOM   5685 C  C   . LEU H  2 65 ? 13.888  51.443  117.506 1.00 21.00 ? 66   LEU H C   1 
ATOM   5686 O  O   . LEU H  2 65 ? 12.689  51.448  117.181 1.00 18.71 ? 66   LEU H O   1 
ATOM   5687 C  CB  . LEU H  2 65 ? 15.033  49.397  116.634 1.00 22.20 ? 66   LEU H CB  1 
ATOM   5688 C  CG  . LEU H  2 65 ? 15.798  48.640  115.543 1.00 20.56 ? 66   LEU H CG  1 
ATOM   5689 C  CD1 . LEU H  2 65 ? 16.033  47.199  115.974 1.00 22.82 ? 66   LEU H CD1 1 
ATOM   5690 C  CD2 . LEU H  2 65 ? 14.966  48.703  114.248 1.00 24.53 ? 66   LEU H CD2 1 
ATOM   5691 N  N   . ASP H  2 66 ? 14.315  51.845  118.698 1.00 18.77 ? 67   ASP H N   1 
ATOM   5692 C  CA  . ASP H  2 66 ? 13.410  52.261  119.772 1.00 19.68 ? 67   ASP H CA  1 
ATOM   5693 C  C   . ASP H  2 66 ? 12.897  53.678  119.526 1.00 20.85 ? 67   ASP H C   1 
ATOM   5694 O  O   . ASP H  2 66 ? 13.370  54.661  120.127 1.00 22.06 ? 67   ASP H O   1 
ATOM   5695 C  CB  . ASP H  2 66 ? 14.173  52.173  121.106 1.00 18.76 ? 67   ASP H CB  1 
ATOM   5696 C  CG  . ASP H  2 66 ? 13.305  52.487  122.280 1.00 20.94 ? 67   ASP H CG  1 
ATOM   5697 O  OD1 . ASP H  2 66 ? 12.070  52.408  122.132 1.00 20.41 ? 67   ASP H OD1 1 
ATOM   5698 O  OD2 . ASP H  2 66 ? 13.779  52.818  123.387 1.00 23.45 ? 67   ASP H OD2 1 
ATOM   5699 N  N   . THR H  2 67 ? 11.926  53.811  118.629 1.00 20.69 ? 68   THR H N   1 
ATOM   5700 C  CA  . THR H  2 67 ? 11.615  55.142  118.112 1.00 23.17 ? 68   THR H CA  1 
ATOM   5701 C  C   . THR H  2 67 ? 10.777  55.931  119.083 1.00 23.66 ? 68   THR H C   1 
ATOM   5702 O  O   . THR H  2 67 ? 10.789  57.146  119.009 1.00 23.80 ? 68   THR H O   1 
ATOM   5703 C  CB  . THR H  2 67 ? 10.905  55.090  116.752 1.00 25.89 ? 68   THR H CB  1 
ATOM   5704 O  OG1 . THR H  2 67 ? 9.776   54.222  116.874 1.00 27.09 ? 68   THR H OG1 1 
ATOM   5705 C  CG2 . THR H  2 67 ? 11.783  54.415  115.712 1.00 27.52 ? 68   THR H CG2 1 
ATOM   5706 N  N   . ASN H  2 68 ? 10.085  55.269  120.012 1.00 22.16 ? 69   ASN H N   1 
ATOM   5707 C  CA  . ASN H  2 68 ? 9.401   56.026  121.074 1.00 22.29 ? 69   ASN H CA  1 
ATOM   5708 C  C   . ASN H  2 68 ? 10.220  56.214  122.356 1.00 22.24 ? 69   ASN H C   1 
ATOM   5709 O  O   . ASN H  2 68 ? 9.721   56.730  123.358 1.00 23.47 ? 69   ASN H O   1 
ATOM   5710 C  CB  . ASN H  2 68 ? 8.027   55.446  121.387 1.00 23.39 ? 69   ASN H CB  1 
ATOM   5711 C  CG  . ASN H  2 68 ? 8.113   54.142  122.148 1.00 25.10 ? 69   ASN H CG  1 
ATOM   5712 O  OD1 . ASN H  2 68 ? 9.176   53.530  122.221 1.00 27.60 ? 69   ASN H OD1 1 
ATOM   5713 N  ND2 . ASN H  2 68 ? 7.008   53.733  122.756 1.00 27.57 ? 69   ASN H ND2 1 
ATOM   5714 N  N   . ALA H  2 69 ? 11.485  55.821  122.309 1.00 21.83 ? 70   ALA H N   1 
ATOM   5715 C  CA  . ALA H  2 69 ? 12.488  56.091  123.346 1.00 22.39 ? 70   ALA H CA  1 
ATOM   5716 C  C   . ALA H  2 69 ? 12.079  55.583  124.711 1.00 25.94 ? 70   ALA H C   1 
ATOM   5717 O  O   . ALA H  2 69 ? 12.292  56.268  125.718 1.00 26.04 ? 70   ALA H O   1 
ATOM   5718 C  CB  . ALA H  2 69 ? 12.802  57.588  123.426 1.00 25.43 ? 70   ALA H CB  1 
ATOM   5719 N  N   . ASP H  2 70 ? 11.478  54.398  124.752 1.00 22.70 ? 71   ASP H N   1 
ATOM   5720 C  CA  . ASP H  2 70 ? 11.011  53.851  126.036 1.00 24.43 ? 71   ASP H CA  1 
ATOM   5721 C  C   . ASP H  2 70 ? 11.838  52.669  126.535 1.00 22.44 ? 71   ASP H C   1 
ATOM   5722 O  O   . ASP H  2 70 ? 11.483  51.991  127.512 1.00 23.79 ? 71   ASP H O   1 
ATOM   5723 C  CB  . ASP H  2 70 ? 9.500   53.581  126.011 1.00 23.42 ? 71   ASP H CB  1 
ATOM   5724 C  CG  . ASP H  2 70 ? 9.122   52.383  125.161 1.00 26.89 ? 71   ASP H CG  1 
ATOM   5725 O  OD1 . ASP H  2 70 ? 10.014  51.824  124.465 1.00 22.85 ? 71   ASP H OD1 1 
ATOM   5726 O  OD2 . ASP H  2 70 ? 7.948   51.929  125.142 1.00 27.37 ? 71   ASP H OD2 1 
ATOM   5727 N  N   . LYS H  2 71 ? 12.986  52.466  125.899 1.00 22.37 ? 72   LYS H N   1 
ATOM   5728 C  CA  . LYS H  2 71 ? 13.927  51.428  126.281 1.00 25.40 ? 72   LYS H CA  1 
ATOM   5729 C  C   . LYS H  2 71 ? 13.383  50.010  126.090 1.00 25.54 ? 72   LYS H C   1 
ATOM   5730 O  O   . LYS H  2 71 ? 13.835  49.066  126.735 1.00 25.74 ? 72   LYS H O   1 
ATOM   5731 C  CB  . LYS H  2 71 ? 14.456  51.661  127.707 1.00 27.97 ? 72   LYS H CB  1 
ATOM   5732 C  CG  . LYS H  2 71 ? 15.091  53.039  127.857 1.00 30.88 ? 72   LYS H CG  1 
ATOM   5733 C  CD  . LYS H  2 71 ? 15.624  53.317  129.244 1.00 34.93 ? 72   LYS H CD  1 
ATOM   5734 C  CE  . LYS H  2 71 ? 16.453  54.612  129.231 1.00 38.81 ? 72   LYS H CE  1 
ATOM   5735 N  NZ  . LYS H  2 71 ? 16.862  55.074  130.596 1.00 42.37 ? 72   LYS H NZ  1 
ATOM   5736 N  N   . GLN H  2 72 ? 12.413  49.857  125.192 1.00 25.39 ? 73   GLN H N   1 
ATOM   5737 C  CA  . GLN H  2 72 ? 11.866  48.544  124.860 1.00 22.77 ? 73   GLN H CA  1 
ATOM   5738 C  C   . GLN H  2 72 ? 11.489  48.529  123.401 1.00 22.94 ? 73   GLN H C   1 
ATOM   5739 O  O   . GLN H  2 72 ? 10.986  49.543  122.900 1.00 23.45 ? 73   GLN H O   1 
ATOM   5740 C  CB  . GLN H  2 72 ? 10.535  48.330  125.565 1.00 24.95 ? 73   GLN H CB  1 
ATOM   5741 C  CG  . GLN H  2 72 ? 10.531  48.427  127.036 1.00 28.50 ? 73   GLN H CG  1 
ATOM   5742 C  CD  . GLN H  2 72 ? 9.108   48.633  127.507 1.00 29.78 ? 73   GLN H CD  1 
ATOM   5743 O  OE1 . GLN H  2 72 ? 8.248   47.769  127.301 1.00 27.87 ? 73   GLN H OE1 1 
ATOM   5744 N  NE2 . GLN H  2 72 ? 8.850   49.778  128.132 1.00 30.87 ? 73   GLN H NE2 1 
ATOM   5745 N  N   . LEU H  2 73 ? 11.666  47.389  122.733 1.00 20.89 ? 74   LEU H N   1 
ATOM   5746 C  CA  . LEU H  2 73 ? 11.104  47.226  121.380 1.00 21.81 ? 74   LEU H CA  1 
ATOM   5747 C  C   . LEU H  2 73 ? 9.735   46.562  121.310 1.00 21.98 ? 74   LEU H C   1 
ATOM   5748 O  O   . LEU H  2 73 ? 9.536   45.415  121.788 1.00 21.45 ? 74   LEU H O   1 
ATOM   5749 C  CB  . LEU H  2 73 ? 12.061  46.432  120.489 1.00 22.46 ? 74   LEU H CB  1 
ATOM   5750 C  CG  . LEU H  2 73 ? 13.453  47.012  120.271 1.00 25.53 ? 74   LEU H CG  1 
ATOM   5751 C  CD1 . LEU H  2 73 ? 14.156  46.168  119.219 1.00 26.88 ? 74   LEU H CD1 1 
ATOM   5752 C  CD2 . LEU H  2 73 ? 13.417  48.492  119.792 1.00 25.46 ? 74   LEU H CD2 1 
ATOM   5753 N  N   . SER H  2 74 ? 8.780   47.296  120.748 1.00 21.75 ? 75   SER H N   1 
ATOM   5754 C  CA  . SER H  2 74 ? 7.483   46.748  120.400 1.00 19.65 ? 75   SER H CA  1 
ATOM   5755 C  C   . SER H  2 74 ? 7.699   45.857  119.172 1.00 20.25 ? 75   SER H C   1 
ATOM   5756 O  O   . SER H  2 74 ? 8.716   45.956  118.480 1.00 20.83 ? 75   SER H O   1 
ATOM   5757 C  CB  . SER H  2 74 ? 6.512   47.852  120.014 1.00 19.94 ? 75   SER H CB  1 
ATOM   5758 O  OG  . SER H  2 74 ? 7.027   48.654  118.939 1.00 17.91 ? 75   SER H OG  1 
ATOM   5759 N  N   . PHE H  2 75 ? 6.716   45.020  118.870 1.00 17.71 ? 76   PHE H N   1 
ATOM   5760 C  CA  . PHE H  2 75 ? 6.773   44.321  117.607 1.00 19.18 ? 76   PHE H CA  1 
ATOM   5761 C  C   . PHE H  2 75 ? 6.923   45.271  116.382 1.00 18.67 ? 76   PHE H C   1 
ATOM   5762 O  O   . PHE H  2 75 ? 7.681   44.989  115.447 1.00 22.27 ? 76   PHE H O   1 
ATOM   5763 C  CB  . PHE H  2 75 ? 5.579   43.436  117.410 1.00 20.94 ? 76   PHE H CB  1 
ATOM   5764 C  CG  . PHE H  2 75 ? 5.774   42.487  116.261 1.00 18.44 ? 76   PHE H CG  1 
ATOM   5765 C  CD1 . PHE H  2 75 ? 6.547   41.340  116.442 1.00 20.76 ? 76   PHE H CD1 1 
ATOM   5766 C  CD2 . PHE H  2 75 ? 5.211   42.750  115.027 1.00 18.35 ? 76   PHE H CD2 1 
ATOM   5767 C  CE1 . PHE H  2 75 ? 6.786   40.459  115.379 1.00 21.43 ? 76   PHE H CE1 1 
ATOM   5768 C  CE2 . PHE H  2 75 ? 5.461   41.895  113.938 1.00 21.59 ? 76   PHE H CE2 1 
ATOM   5769 C  CZ  . PHE H  2 75 ? 6.236   40.727  114.124 1.00 20.67 ? 76   PHE H CZ  1 
ATOM   5770 N  N   . GLU H  2 76 ? 6.191   46.390  116.387 1.00 20.79 ? 77   GLU H N   1 
ATOM   5771 C  CA  . GLU H  2 76 ? 6.280   47.356  115.282 1.00 20.85 ? 77   GLU H CA  1 
ATOM   5772 C  C   . GLU H  2 76 ? 7.711   47.859  115.077 1.00 21.24 ? 77   GLU H C   1 
ATOM   5773 O  O   . GLU H  2 76 ? 8.179   47.965  113.938 1.00 19.96 ? 77   GLU H O   1 
ATOM   5774 C  CB  . GLU H  2 76 ? 5.312   48.524  115.494 1.00 22.55 ? 77   GLU H CB  1 
ATOM   5775 C  CG  . GLU H  2 76 ? 3.842   48.134  115.341 1.00 24.33 ? 77   GLU H CG  1 
ATOM   5776 C  CD  . GLU H  2 76 ? 3.220   47.446  116.551 1.00 29.41 ? 77   GLU H CD  1 
ATOM   5777 O  OE1 . GLU H  2 76 ? 3.902   47.129  117.559 1.00 28.57 ? 77   GLU H OE1 1 
ATOM   5778 O  OE2 . GLU H  2 76 ? 1.983   47.207  116.499 1.00 32.72 ? 77   GLU H OE2 1 
ATOM   5779 N  N   . GLU H  2 77 ? 8.401   48.199  116.169 1.00 20.48 ? 78   GLU H N   1 
ATOM   5780 C  CA  . GLU H  2 77 ? 9.780   48.686  116.050 1.00 21.04 ? 78   GLU H CA  1 
ATOM   5781 C  C   . GLU H  2 77 ? 10.704  47.546  115.564 1.00 21.50 ? 78   GLU H C   1 
ATOM   5782 O  O   . GLU H  2 77 ? 11.576  47.744  114.709 1.00 23.10 ? 78   GLU H O   1 
ATOM   5783 C  CB  . GLU H  2 77 ? 10.248  49.242  117.398 1.00 19.43 ? 78   GLU H CB  1 
ATOM   5784 C  CG  . GLU H  2 77 ? 9.519   50.513  117.865 1.00 19.24 ? 78   GLU H CG  1 
ATOM   5785 C  CD  . GLU H  2 77 ? 9.802   50.883  119.319 1.00 19.32 ? 78   GLU H CD  1 
ATOM   5786 O  OE1 . GLU H  2 77 ? 10.121  49.978  120.147 1.00 18.96 ? 78   GLU H OE1 1 
ATOM   5787 O  OE2 . GLU H  2 77 ? 9.706   52.096  119.634 1.00 21.74 ? 78   GLU H OE2 1 
ATOM   5788 N  N   . PHE H  2 78 ? 10.532  46.363  116.153 1.00 21.43 ? 79   PHE H N   1 
ATOM   5789 C  CA  . PHE H  2 78 ? 11.318  45.164  115.800 1.00 22.94 ? 79   PHE H CA  1 
ATOM   5790 C  C   . PHE H  2 78 ? 11.209  44.708  114.341 1.00 21.57 ? 79   PHE H C   1 
ATOM   5791 O  O   . PHE H  2 78 ? 12.230  44.320  113.696 1.00 21.50 ? 79   PHE H O   1 
ATOM   5792 C  CB  . PHE H  2 78 ? 10.867  44.028  116.742 1.00 23.65 ? 79   PHE H CB  1 
ATOM   5793 C  CG  . PHE H  2 78 ? 11.577  42.713  116.530 1.00 24.35 ? 79   PHE H CG  1 
ATOM   5794 C  CD1 . PHE H  2 78 ? 12.863  42.505  117.028 1.00 25.29 ? 79   PHE H CD1 1 
ATOM   5795 C  CD2 . PHE H  2 78 ? 10.948  41.676  115.871 1.00 22.81 ? 79   PHE H CD2 1 
ATOM   5796 C  CE1 . PHE H  2 78 ? 13.525  41.282  116.822 1.00 25.22 ? 79   PHE H CE1 1 
ATOM   5797 C  CE2 . PHE H  2 78 ? 11.598  40.461  115.669 1.00 23.88 ? 79   PHE H CE2 1 
ATOM   5798 C  CZ  . PHE H  2 78 ? 12.877  40.257  116.149 1.00 24.54 ? 79   PHE H CZ  1 
ATOM   5799 N  N   . ILE H  2 79 ? 9.983   44.716  113.811 1.00 20.13 ? 80   ILE H N   1 
ATOM   5800 C  CA  . ILE H  2 79 ? 9.763   44.212  112.449 1.00 20.18 ? 80   ILE H CA  1 
ATOM   5801 C  C   . ILE H  2 79 ? 10.563  45.026  111.398 1.00 21.03 ? 80   ILE H C   1 
ATOM   5802 O  O   . ILE H  2 79 ? 10.862  44.511  110.315 1.00 18.87 ? 80   ILE H O   1 
ATOM   5803 C  CB  . ILE H  2 79 ? 8.259   44.107  112.051 1.00 21.33 ? 80   ILE H CB  1 
ATOM   5804 C  CG1 . ILE H  2 79 ? 8.071   43.356  110.702 1.00 22.29 ? 80   ILE H CG1 1 
ATOM   5805 C  CG2 . ILE H  2 79 ? 7.676   45.465  111.774 1.00 19.51 ? 80   ILE H CG2 1 
ATOM   5806 C  CD1 . ILE H  2 79 ? 8.340   41.893  110.746 1.00 27.27 ? 80   ILE H CD1 1 
ATOM   5807 N  N   . MET H  2 80 ? 10.980  46.243  111.756 1.00 19.19 ? 81   MET H N   1 
ATOM   5808 C  CA  . MET H  2 80 ? 11.818  47.071  110.866 1.00 21.33 ? 81   MET H CA  1 
ATOM   5809 C  C   . MET H  2 80 ? 13.218  46.481  110.754 1.00 21.23 ? 81   MET H C   1 
ATOM   5810 O  O   . MET H  2 80 ? 13.803  46.493  109.661 1.00 21.60 ? 81   MET H O   1 
ATOM   5811 C  CB  . MET H  2 80 ? 11.934  48.515  111.396 1.00 21.89 ? 81   MET H CB  1 
ATOM   5812 C  CG  . MET H  2 80 ? 10.942  49.525  110.854 1.00 27.65 ? 81   MET H CG  1 
ATOM   5813 S  SD  . MET H  2 80 ? 10.939  49.896  109.066 1.00 29.50 ? 81   MET H SD  1 
ATOM   5814 C  CE  . MET H  2 80 ? 12.646  49.720  108.680 1.00 25.11 ? 81   MET H CE  1 
ATOM   5815 N  N   . LEU H  2 81 ? 13.720  45.889  111.844 1.00 21.46 ? 82   LEU H N   1 
ATOM   5816 C  CA  . LEU H  2 81 ? 14.992  45.163  111.798 1.00 20.48 ? 82   LEU H CA  1 
ATOM   5817 C  C   . LEU H  2 81 ? 14.911  43.932  110.884 1.00 22.99 ? 82   LEU H C   1 
ATOM   5818 O  O   . LEU H  2 81 ? 15.838  43.653  110.115 1.00 24.60 ? 82   LEU H O   1 
ATOM   5819 C  CB  . LEU H  2 81 ? 15.415  44.688  113.195 1.00 22.17 ? 82   LEU H CB  1 
ATOM   5820 C  CG  . LEU H  2 81 ? 16.723  43.907  113.262 1.00 22.01 ? 82   LEU H CG  1 
ATOM   5821 C  CD1 . LEU H  2 81 ? 17.857  44.781  112.704 1.00 24.31 ? 82   LEU H CD1 1 
ATOM   5822 C  CD2 . LEU H  2 81 ? 16.977  43.418  114.705 1.00 21.36 ? 82   LEU H CD2 1 
ATOM   5823 N  N   . MET H  2 82 ? 13.794  43.219  110.977 1.00 22.76 ? 83   MET H N   1 
ATOM   5824 C  CA  . MET H  2 82 ? 13.564  42.007  110.195 1.00 21.85 ? 83   MET H CA  1 
ATOM   5825 C  C   . MET H  2 82 ? 13.537  42.366  108.727 1.00 21.85 ? 83   MET H C   1 
ATOM   5826 O  O   . MET H  2 82 ? 14.199  41.718  107.904 1.00 21.44 ? 83   MET H O   1 
ATOM   5827 C  CB  . MET H  2 82 ? 12.232  41.362  110.623 1.00 21.38 ? 83   MET H CB  1 
ATOM   5828 C  CG  . MET H  2 82 ? 12.208  40.829  112.070 1.00 23.26 ? 83   MET H CG  1 
ATOM   5829 S  SD  . MET H  2 82 ? 13.479  39.573  112.431 1.00 23.73 ? 83   MET H SD  1 
ATOM   5830 C  CE  . MET H  2 82 ? 14.848  40.550  113.047 1.00 22.94 ? 83   MET H CE  1 
ATOM   5831 N  N   . ALA H  2 83 ? 12.850  43.459  108.401 1.00 20.38 ? 84   ALA H N   1 
ATOM   5832 C  CA  . ALA H  2 83 ? 12.844  43.939  107.010 1.00 20.42 ? 84   ALA H CA  1 
ATOM   5833 C  C   . ALA H  2 83 ? 14.232  44.340  106.499 1.00 20.00 ? 84   ALA H C   1 
ATOM   5834 O  O   . ALA H  2 83 ? 14.591  43.973  105.370 1.00 22.04 ? 84   ALA H O   1 
ATOM   5835 C  CB  . ALA H  2 83 ? 11.841  45.056  106.854 1.00 19.21 ? 84   ALA H CB  1 
ATOM   5836 N  N   . ARG H  2 84 ? 15.008  45.059  107.321 1.00 20.90 ? 85   ARG H N   1 
ATOM   5837 C  CA  . ARG H  2 84 ? 16.348  45.503  106.956 1.00 23.86 ? 85   ARG H CA  1 
ATOM   5838 C  C   . ARG H  2 84 ? 17.250  44.305  106.708 1.00 22.09 ? 85   ARG H C   1 
ATOM   5839 O  O   . ARG H  2 84 ? 18.068  44.338  105.797 1.00 21.81 ? 85   ARG H O   1 
ATOM   5840 C  CB  . ARG H  2 84 ? 16.991  46.398  108.025 1.00 25.85 ? 85   ARG H CB  1 
ATOM   5841 C  CG  . ARG H  2 84 ? 16.454  47.824  108.084 1.00 32.12 ? 85   ARG H CG  1 
ATOM   5842 C  CD  . ARG H  2 84 ? 16.992  48.661  109.260 1.00 33.91 ? 85   ARG H CD  1 
ATOM   5843 N  NE  . ARG H  2 84 ? 16.237  49.908  109.400 1.00 40.18 ? 85   ARG H NE  1 
ATOM   5844 C  CZ  . ARG H  2 84 ? 16.292  50.699  110.467 1.00 42.91 ? 85   ARG H CZ  1 
ATOM   5845 N  NH1 . ARG H  2 84 ? 15.543  51.796  110.524 1.00 45.23 ? 85   ARG H NH1 1 
ATOM   5846 N  NH2 . ARG H  2 84 ? 17.076  50.383  111.492 1.00 43.06 ? 85   ARG H NH2 1 
ATOM   5847 N  N   . LEU H  2 85 ? 17.154  43.286  107.561 1.00 21.31 ? 86   LEU H N   1 
ATOM   5848 C  CA  . LEU H  2 85 ? 17.973  42.096  107.447 1.00 21.19 ? 86   LEU H CA  1 
ATOM   5849 C  C   . LEU H  2 85 ? 17.617  41.254  106.232 1.00 22.60 ? 86   LEU H C   1 
ATOM   5850 O  O   . LEU H  2 85 ? 18.503  40.631  105.655 1.00 20.69 ? 86   LEU H O   1 
ATOM   5851 C  CB  . LEU H  2 85 ? 17.836  41.213  108.696 1.00 19.61 ? 86   LEU H CB  1 
ATOM   5852 C  CG  . LEU H  2 85 ? 18.876  41.325  109.819 1.00 26.85 ? 86   LEU H CG  1 
ATOM   5853 C  CD1 . LEU H  2 85 ? 19.635  42.617  109.905 1.00 24.93 ? 86   LEU H CD1 1 
ATOM   5854 C  CD2 . LEU H  2 85 ? 18.308  40.915  111.185 1.00 23.37 ? 86   LEU H CD2 1 
ATOM   5855 N  N   . THR H  2 86 ? 16.337  41.218  105.855 1.00 22.18 ? 87   THR H N   1 
ATOM   5856 C  CA  . THR H  2 86 ? 15.940  40.460  104.662 1.00 24.67 ? 87   THR H CA  1 
ATOM   5857 C  C   . THR H  2 86 ? 16.551  41.190  103.487 1.00 25.73 ? 87   THR H C   1 
ATOM   5858 O  O   . THR H  2 86 ? 17.146  40.582  102.594 1.00 25.16 ? 87   THR H O   1 
ATOM   5859 C  CB  . THR H  2 86 ? 14.407  40.425  104.519 1.00 25.41 ? 87   THR H CB  1 
ATOM   5860 O  OG1 . THR H  2 86 ? 13.841  39.909  105.718 1.00 29.74 ? 87   THR H OG1 1 
ATOM   5861 C  CG2 . THR H  2 86 ? 13.968  39.408  103.509 1.00 27.52 ? 87   THR H CG2 1 
ATOM   5862 N  N   . TRP H  2 87 ? 16.437  42.518  103.503 1.00 24.14 ? 88   TRP H N   1 
ATOM   5863 C  CA  . TRP H  2 87 ? 17.013  43.293  102.413 1.00 26.66 ? 88   TRP H CA  1 
ATOM   5864 C  C   . TRP H  2 87 ? 18.519  43.028  102.305 1.00 25.56 ? 88   TRP H C   1 
ATOM   5865 O  O   . TRP H  2 87 ? 19.043  42.837  101.213 1.00 26.05 ? 88   TRP H O   1 
ATOM   5866 C  CB  . TRP H  2 87 ? 16.713  44.791  102.590 1.00 28.25 ? 88   TRP H CB  1 
ATOM   5867 C  CG  . TRP H  2 87 ? 17.444  45.619  101.615 1.00 29.83 ? 88   TRP H CG  1 
ATOM   5868 C  CD1 . TRP H  2 87 ? 18.623  46.291  101.814 1.00 30.46 ? 88   TRP H CD1 1 
ATOM   5869 C  CD2 . TRP H  2 87 ? 17.050  45.883  100.270 1.00 30.69 ? 88   TRP H CD2 1 
ATOM   5870 N  NE1 . TRP H  2 87 ? 18.987  46.951  100.659 1.00 30.53 ? 88   TRP H NE1 1 
ATOM   5871 C  CE2 . TRP H  2 87 ? 18.040  46.709  99.694  1.00 30.77 ? 88   TRP H CE2 1 
ATOM   5872 C  CE3 . TRP H  2 87 ? 15.956  45.495  99.480  1.00 31.08 ? 88   TRP H CE3 1 
ATOM   5873 C  CZ2 . TRP H  2 87 ? 17.959  47.167  98.369  1.00 32.02 ? 88   TRP H CZ2 1 
ATOM   5874 C  CZ3 . TRP H  2 87 ? 15.878  45.948  98.169  1.00 30.20 ? 88   TRP H CZ3 1 
ATOM   5875 C  CH2 . TRP H  2 87 ? 16.875  46.767  97.625  1.00 31.57 ? 88   TRP H CH2 1 
ATOM   5876 N  N   . ALA H  2 88 ? 19.208  43.035  103.445 1.00 24.67 ? 89   ALA H N   1 
ATOM   5877 C  CA  . ALA H  2 88 ? 20.655  42.866  103.457 1.00 25.34 ? 89   ALA H CA  1 
ATOM   5878 C  C   . ALA H  2 88 ? 21.042  41.479  102.936 1.00 26.40 ? 89   ALA H C   1 
ATOM   5879 O  O   . ALA H  2 88 ? 22.010  41.327  102.203 1.00 28.15 ? 89   ALA H O   1 
ATOM   5880 C  CB  . ALA H  2 88 ? 21.158  43.075  104.857 1.00 25.85 ? 89   ALA H CB  1 
ATOM   5881 N  N   . SER H  2 89 ? 20.265  40.467  103.308 1.00 27.03 ? 90   SER H N   1 
ATOM   5882 C  CA  . SER H  2 89 ? 20.477  39.111  102.799 1.00 27.66 ? 90   SER H CA  1 
ATOM   5883 C  C   . SER H  2 89 ? 20.229  39.043  101.281 1.00 27.91 ? 90   SER H C   1 
ATOM   5884 O  O   . SER H  2 89 ? 21.036  38.472  100.544 1.00 29.14 ? 90   SER H O   1 
ATOM   5885 C  CB  . SER H  2 89 ? 19.596  38.120  103.590 1.00 29.36 ? 90   SER H CB  1 
ATOM   5886 O  OG  . SER H  2 89 ? 19.971  36.792  103.305 1.00 29.57 ? 90   SER H OG  1 
ATOM   5887 N  N   . HIS H  2 90 ? 19.138  39.659  100.822 1.00 27.49 ? 91   HIS H N   1 
ATOM   5888 C  CA  . HIS H  2 90 ? 18.804  39.758  99.396  1.00 29.29 ? 91   HIS H CA  1 
ATOM   5889 C  C   . HIS H  2 90 ? 19.935  40.424  98.620  1.00 31.22 ? 91   HIS H C   1 
ATOM   5890 O  O   . HIS H  2 90 ? 20.295  39.983  97.518  1.00 30.56 ? 91   HIS H O   1 
ATOM   5891 C  CB  . HIS H  2 90 ? 17.523  40.575  99.204  1.00 31.18 ? 91   HIS H CB  1 
ATOM   5892 C  CG  . HIS H  2 90 ? 17.243  40.929  97.778  1.00 33.43 ? 91   HIS H CG  1 
ATOM   5893 N  ND1 . HIS H  2 90 ? 17.566  42.156  97.235  1.00 35.42 ? 91   HIS H ND1 1 
ATOM   5894 C  CD2 . HIS H  2 90 ? 16.670  40.214  96.783  1.00 34.64 ? 91   HIS H CD2 1 
ATOM   5895 C  CE1 . HIS H  2 90 ? 17.221  42.176  95.960  1.00 35.30 ? 91   HIS H CE1 1 
ATOM   5896 N  NE2 . HIS H  2 90 ? 16.681  41.007  95.657  1.00 35.76 ? 91   HIS H NE2 1 
ATOM   5897 N  N   . GLU H  2 91 ? 20.490  41.499  99.178  1.00 33.28 ? 92   GLU H N   1 
ATOM   5898 C  CA  . GLU H  2 91 ? 21.586  42.193  98.507  1.00 37.04 ? 92   GLU H CA  1 
ATOM   5899 C  C   . GLU H  2 91 ? 22.867  41.369  98.519  1.00 38.23 ? 92   GLU H C   1 
ATOM   5900 O  O   . GLU H  2 91 ? 23.652  41.461  97.572  1.00 38.73 ? 92   GLU H O   1 
ATOM   5901 C  CB  . GLU H  2 91 ? 21.828  43.571  99.129  1.00 38.85 ? 92   GLU H CB  1 
ATOM   5902 C  CG  . GLU H  2 91 ? 20.657  44.532  98.982  1.00 41.64 ? 92   GLU H CG  1 
ATOM   5903 C  CD  . GLU H  2 91 ? 20.391  44.901  97.531  1.00 45.19 ? 92   GLU H CD  1 
ATOM   5904 O  OE1 . GLU H  2 91 ? 21.203  45.659  96.951  1.00 43.93 ? 92   GLU H OE1 1 
ATOM   5905 O  OE2 . GLU H  2 91 ? 19.371  44.428  96.976  1.00 46.95 ? 92   GLU H OE2 1 
ATOM   5906 N  N   . MET I  1 1  ? 29.491  -12.104 138.892 1.00 44.73 ? 1    MET I N   1 
ATOM   5907 C  CA  . MET I  1 1  ? 28.297  -12.664 139.576 1.00 44.15 ? 1    MET I CA  1 
ATOM   5908 C  C   . MET I  1 1  ? 27.369  -11.558 140.039 1.00 37.97 ? 1    MET I C   1 
ATOM   5909 O  O   . MET I  1 1  ? 27.676  -10.853 141.004 1.00 38.31 ? 1    MET I O   1 
ATOM   5910 C  CB  . MET I  1 1  ? 28.701  -13.483 140.802 1.00 46.40 ? 1    MET I CB  1 
ATOM   5911 C  CG  . MET I  1 1  ? 28.637  -14.984 140.615 1.00 50.29 ? 1    MET I CG  1 
ATOM   5912 S  SD  . MET I  1 1  ? 28.352  -15.933 142.140 1.00 52.56 ? 1    MET I SD  1 
ATOM   5913 C  CE  . MET I  1 1  ? 29.541  -15.212 143.273 1.00 52.27 ? 1    MET I CE  1 
ATOM   5914 N  N   . LEU I  1 2  ? 26.231  -11.417 139.374 1.00 31.56 ? 2    LEU I N   1 
ATOM   5915 C  CA  . LEU I  1 2  ? 25.154  -10.595 139.922 1.00 25.86 ? 2    LEU I CA  1 
ATOM   5916 C  C   . LEU I  1 2  ? 24.528  -11.273 141.138 1.00 23.95 ? 2    LEU I C   1 
ATOM   5917 O  O   . LEU I  1 2  ? 24.475  -12.514 141.239 1.00 22.66 ? 2    LEU I O   1 
ATOM   5918 C  CB  . LEU I  1 2  ? 24.081  -10.310 138.870 1.00 24.46 ? 2    LEU I CB  1 
ATOM   5919 C  CG  . LEU I  1 2  ? 24.129  -9.059  137.992 1.00 27.61 ? 2    LEU I CG  1 
ATOM   5920 C  CD1 . LEU I  1 2  ? 25.425  -8.206  138.014 1.00 25.87 ? 2    LEU I CD1 1 
ATOM   5921 C  CD2 . LEU I  1 2  ? 23.695  -9.424  136.578 1.00 27.49 ? 2    LEU I CD2 1 
ATOM   5922 N  N   . THR I  1 3  ? 24.067  -10.444 142.070 1.00 21.28 ? 3    THR I N   1 
ATOM   5923 C  CA  . THR I  1 3  ? 23.346  -10.936 143.238 1.00 20.67 ? 3    THR I CA  1 
ATOM   5924 C  C   . THR I  1 3  ? 21.936  -11.325 142.839 1.00 19.73 ? 3    THR I C   1 
ATOM   5925 O  O   . THR I  1 3  ? 21.469  -10.969 141.749 1.00 17.64 ? 3    THR I O   1 
ATOM   5926 C  CB  . THR I  1 3  ? 23.264  -9.848  144.321 1.00 21.94 ? 3    THR I CB  1 
ATOM   5927 O  OG1 . THR I  1 3  ? 22.477  -8.751  143.824 1.00 21.70 ? 3    THR I OG1 1 
ATOM   5928 C  CG2 . THR I  1 3  ? 24.642  -9.252  144.600 1.00 19.88 ? 3    THR I CG2 1 
ATOM   5929 N  N   . GLU I  1 4  ? 21.230  -12.022 143.728 1.00 16.70 ? 4    GLU I N   1 
ATOM   5930 C  CA  . GLU I  1 4  ? 19.842  -12.349 143.427 1.00 19.15 ? 4    GLU I CA  1 
ATOM   5931 C  C   . GLU I  1 4  ? 18.975  -11.091 143.280 1.00 17.89 ? 4    GLU I C   1 
ATOM   5932 O  O   . GLU I  1 4  ? 18.005  -11.073 142.495 1.00 16.57 ? 4    GLU I O   1 
ATOM   5933 C  CB  . GLU I  1 4  ? 19.261  -13.266 144.515 1.00 20.31 ? 4    GLU I CB  1 
ATOM   5934 C  CG  . GLU I  1 4  ? 19.803  -14.699 144.470 1.00 21.27 ? 4    GLU I CG  1 
ATOM   5935 C  CD  . GLU I  1 4  ? 19.554  -15.427 143.159 1.00 24.10 ? 4    GLU I CD  1 
ATOM   5936 O  OE1 . GLU I  1 4  ? 20.541  -15.689 142.441 1.00 24.17 ? 4    GLU I OE1 1 
ATOM   5937 O  OE2 . GLU I  1 4  ? 18.388  -15.698 142.806 1.00 23.88 ? 4    GLU I OE2 1 
ATOM   5938 N  N   . LEU I  1 5  ? 19.312  -10.038 144.029 1.00 16.78 ? 5    LEU I N   1 
ATOM   5939 C  CA  . LEU I  1 5  ? 18.505  -8.807  143.986 1.00 18.84 ? 5    LEU I CA  1 
ATOM   5940 C  C   . LEU I  1 5  ? 18.633  -8.168  142.604 1.00 18.27 ? 5    LEU I C   1 
ATOM   5941 O  O   . LEU I  1 5  ? 17.638  -7.815  141.961 1.00 16.84 ? 5    LEU I O   1 
ATOM   5942 C  CB  . LEU I  1 5  ? 19.038  -7.795  145.007 1.00 19.89 ? 5    LEU I CB  1 
ATOM   5943 C  CG  . LEU I  1 5  ? 18.050  -6.821  145.696 1.00 25.43 ? 5    LEU I CG  1 
ATOM   5944 C  CD1 . LEU I  1 5  ? 18.658  -5.503  146.167 1.00 20.65 ? 5    LEU I CD1 1 
ATOM   5945 C  CD2 . LEU I  1 5  ? 16.752  -6.582  145.023 1.00 20.59 ? 5    LEU I CD2 1 
ATOM   5946 N  N   . GLU I  1 6  ? 19.884  -8.080  142.149 1.00 18.46 ? 6    GLU I N   1 
ATOM   5947 C  CA  . GLU I  1 6  ? 20.254  -7.505  140.839 1.00 19.27 ? 6    GLU I CA  1 
ATOM   5948 C  C   . GLU I  1 6  ? 19.646  -8.306  139.679 1.00 20.24 ? 6    GLU I C   1 
ATOM   5949 O  O   . GLU I  1 6  ? 19.216  -7.737  138.667 1.00 19.17 ? 6    GLU I O   1 
ATOM   5950 C  CB  . GLU I  1 6  ? 21.775  -7.461  140.725 1.00 20.57 ? 6    GLU I CB  1 
ATOM   5951 C  CG  . GLU I  1 6  ? 22.381  -6.457  141.681 1.00 21.99 ? 6    GLU I CG  1 
ATOM   5952 C  CD  . GLU I  1 6  ? 23.884  -6.498  141.829 1.00 23.35 ? 6    GLU I CD  1 
ATOM   5953 O  OE1 . GLU I  1 6  ? 24.432  -5.474  142.316 1.00 23.90 ? 6    GLU I OE1 1 
ATOM   5954 O  OE2 . GLU I  1 6  ? 24.522  -7.525  141.497 1.00 23.73 ? 6    GLU I OE2 1 
ATOM   5955 N  N   . LYS I  1 7  ? 19.614  -9.627  139.842 1.00 18.36 ? 7    LYS I N   1 
ATOM   5956 C  CA  . LYS I  1 7  ? 19.013  -10.513 138.853 1.00 19.33 ? 7    LYS I CA  1 
ATOM   5957 C  C   . LYS I  1 7  ? 17.502  -10.323 138.812 1.00 17.52 ? 7    LYS I C   1 
ATOM   5958 O  O   . LYS I  1 7  ? 16.906  -10.408 137.729 1.00 18.35 ? 7    LYS I O   1 
ATOM   5959 C  CB  . LYS I  1 7  ? 19.384  -11.977 139.150 1.00 21.31 ? 7    LYS I CB  1 
ATOM   5960 C  CG  . LYS I  1 7  ? 20.829  -12.273 138.720 1.00 24.79 ? 7    LYS I CG  1 
ATOM   5961 C  CD  . LYS I  1 7  ? 21.389  -13.579 139.273 1.00 29.61 ? 7    LYS I CD  1 
ATOM   5962 C  CE  . LYS I  1 7  ? 20.522  -14.764 138.973 1.00 33.23 ? 7    LYS I CE  1 
ATOM   5963 N  NZ  . LYS I  1 7  ? 21.085  -16.028 139.577 1.00 37.44 ? 7    LYS I NZ  1 
ATOM   5964 N  N   . ALA I  1 8  ? 16.894  -10.030 139.961 1.00 17.11 ? 8    ALA I N   1 
ATOM   5965 C  CA  . ALA I  1 8  ? 15.440  -9.762  140.051 1.00 15.57 ? 8    ALA I CA  1 
ATOM   5966 C  C   . ALA I  1 8  ? 15.087  -8.475  139.309 1.00 17.40 ? 8    ALA I C   1 
ATOM   5967 O  O   . ALA I  1 8  ? 14.112  -8.422  138.538 1.00 16.53 ? 8    ALA I O   1 
ATOM   5968 C  CB  . ALA I  1 8  ? 15.028  -9.654  141.550 1.00 15.55 ? 8    ALA I CB  1 
ATOM   5969 N  N   . LEU I  1 9  ? 15.914  -7.455  139.477 1.00 17.29 ? 9    LEU I N   1 
ATOM   5970 C  CA  . LEU I  1 9  ? 15.697  -6.188  138.753 1.00 18.73 ? 9    LEU I CA  1 
ATOM   5971 C  C   . LEU I  1 9  ? 15.893  -6.379  137.233 1.00 19.16 ? 9    LEU I C   1 
ATOM   5972 O  O   . LEU I  1 9  ? 15.099  -5.910  136.417 1.00 17.29 ? 9    LEU I O   1 
ATOM   5973 C  CB  . LEU I  1 9  ? 16.627  -5.112  139.300 1.00 17.99 ? 9    LEU I CB  1 
ATOM   5974 C  CG  . LEU I  1 9  ? 16.470  -4.745  140.785 1.00 17.91 ? 9    LEU I CG  1 
ATOM   5975 C  CD1 . LEU I  1 9  ? 17.379  -3.578  141.129 1.00 20.68 ? 9    LEU I CD1 1 
ATOM   5976 C  CD2 . LEU I  1 9  ? 14.950  -4.513  141.185 1.00 19.76 ? 9    LEU I CD2 1 
ATOM   5977 N  N   . ASN I  1 10 ? 16.918  -7.123  136.826 1.00 19.18 ? 10   ASN I N   1 
ATOM   5978 C  CA  . ASN I  1 10 ? 17.045  -7.434  135.383 1.00 18.61 ? 10   ASN I CA  1 
ATOM   5979 C  C   . ASN I  1 10 ? 15.897  -8.275  134.828 1.00 19.16 ? 10   ASN I C   1 
ATOM   5980 O  O   . ASN I  1 10 ? 15.447  -8.131  133.685 1.00 20.21 ? 10   ASN I O   1 
ATOM   5981 C  CB  . ASN I  1 10 ? 18.398  -8.069  135.086 1.00 19.66 ? 10   ASN I CB  1 
ATOM   5982 C  CG  . ASN I  1 10 ? 19.534  -7.068  135.161 1.00 22.49 ? 10   ASN I CG  1 
ATOM   5983 O  OD1 . ASN I  1 10 ? 19.311  -5.852  135.132 1.00 23.66 ? 10   ASN I OD1 1 
ATOM   5984 N  ND2 . ASN I  1 10 ? 20.772  -7.572  135.206 1.00 22.72 ? 10   ASN I ND2 1 
ATOM   5985 N  N   . SER I  1 11 ? 15.372  -9.149  135.661 1.00 19.09 ? 11   SER I N   1 
ATOM   5986 C  CA  . SER I  1 11 ? 14.267  -9.987  135.266 1.00 18.85 ? 11   SER I CA  1 
ATOM   5987 C  C   . SER I  1 11 ? 13.003  -9.152  135.015 1.00 18.41 ? 11   SER I C   1 
ATOM   5988 O  O   . SER I  1 11 ? 12.226  -9.478  134.135 1.00 16.12 ? 11   SER I O   1 
ATOM   5989 C  CB  . SER I  1 11 ? 14.039  -11.070 136.326 1.00 18.36 ? 11   SER I CB  1 
ATOM   5990 O  OG  . SER I  1 11 ? 12.861  -11.800 136.027 1.00 18.53 ? 11   SER I OG  1 
ATOM   5991 N  N   . ILE I  1 12 ? 12.805  -8.067  135.771 1.00 17.79 ? 12   ILE I N   1 
ATOM   5992 C  CA  . ILE I  1 12 ? 11.673  -7.189  135.552 1.00 17.81 ? 12   ILE I CA  1 
ATOM   5993 C  C   . ILE I  1 12 ? 11.706  -6.539  134.151 1.00 17.72 ? 12   ILE I C   1 
ATOM   5994 O  O   . ILE I  1 12 ? 10.669  -6.371  133.495 1.00 17.57 ? 12   ILE I O   1 
ATOM   5995 C  CB  . ILE I  1 12 ? 11.613  -6.107  136.701 1.00 18.65 ? 12   ILE I CB  1 
ATOM   5996 C  CG1 . ILE I  1 12 ? 11.268  -6.790  138.035 1.00 17.99 ? 12   ILE I CG1 1 
ATOM   5997 C  CG2 . ILE I  1 12 ? 10.621  -4.982  136.332 1.00 18.18 ? 12   ILE I CG2 1 
ATOM   5998 C  CD1 . ILE I  1 12 ? 11.564  -5.867  139.254 1.00 18.42 ? 12   ILE I CD1 1 
ATOM   5999 N  N   . ILE I  1 13 ? 12.913  -6.235  133.684 1.00 16.28 ? 13   ILE I N   1 
ATOM   6000 C  CA  . ILE I  1 13 ? 13.127  -5.744  132.321 1.00 20.30 ? 13   ILE I CA  1 
ATOM   6001 C  C   . ILE I  1 13 ? 12.759  -6.823  131.311 1.00 20.93 ? 13   ILE I C   1 
ATOM   6002 O  O   . ILE I  1 13 ? 12.096  -6.565  130.299 1.00 20.81 ? 13   ILE I O   1 
ATOM   6003 C  CB  . ILE I  1 13 ? 14.605  -5.320  132.103 1.00 20.02 ? 13   ILE I CB  1 
ATOM   6004 C  CG1 . ILE I  1 13 ? 14.988  -4.190  133.047 1.00 19.96 ? 13   ILE I CG1 1 
ATOM   6005 C  CG2 . ILE I  1 13 ? 14.855  -4.819  130.635 1.00 19.82 ? 13   ILE I CG2 1 
ATOM   6006 C  CD1 . ILE I  1 13 ? 16.522  -3.954  133.089 1.00 21.74 ? 13   ILE I CD1 1 
ATOM   6007 N  N   . ASP I  1 14 ? 13.179  -8.053  131.592 1.00 20.66 ? 14   ASP I N   1 
ATOM   6008 C  CA  . ASP I  1 14 ? 12.834  -9.180  130.732 1.00 22.58 ? 14   ASP I CA  1 
ATOM   6009 C  C   . ASP I  1 14 ? 11.313  -9.415  130.690 1.00 19.69 ? 14   ASP I C   1 
ATOM   6010 O  O   . ASP I  1 14 ? 10.786  -9.735  129.635 1.00 20.13 ? 14   ASP I O   1 
ATOM   6011 C  CB  . ASP I  1 14 ? 13.585  -10.441 131.192 1.00 23.78 ? 14   ASP I CB  1 
ATOM   6012 C  CG  . ASP I  1 14 ? 13.248  -11.641 130.362 1.00 28.95 ? 14   ASP I CG  1 
ATOM   6013 O  OD1 . ASP I  1 14 ? 13.456  -11.566 129.131 1.00 32.42 ? 14   ASP I OD1 1 
ATOM   6014 O  OD2 . ASP I  1 14 ? 12.747  -12.685 130.838 1.00 30.08 ? 14   ASP I OD2 1 
ATOM   6015 N  N   . VAL I  1 15 ? 10.606  -9.273  131.805 1.00 18.06 ? 15   VAL I N   1 
ATOM   6016 C  CA  . VAL I  1 15 ? 9.128   -9.377  131.826 1.00 16.98 ? 15   VAL I CA  1 
ATOM   6017 C  C   . VAL I  1 15 ? 8.482   -8.366  130.857 1.00 19.04 ? 15   VAL I C   1 
ATOM   6018 O  O   . VAL I  1 15 ? 7.622   -8.714  130.037 1.00 16.14 ? 15   VAL I O   1 
ATOM   6019 C  CB  . VAL I  1 15 ? 8.548   -9.155  133.225 1.00 19.54 ? 15   VAL I CB  1 
ATOM   6020 C  CG1 . VAL I  1 15 ? 7.027   -9.088  133.169 1.00 19.00 ? 15   VAL I CG1 1 
ATOM   6021 C  CG2 . VAL I  1 15 ? 8.979   -10.319 134.153 1.00 19.72 ? 15   VAL I CG2 1 
ATOM   6022 N  N   . TYR I  1 16 ? 8.942   -7.119  130.927 1.00 17.41 ? 16   TYR I N   1 
ATOM   6023 C  CA  . TYR I  1 16 ? 8.445   -6.106  130.001 1.00 18.33 ? 16   TYR I CA  1 
ATOM   6024 C  C   . TYR I  1 16 ? 8.641   -6.517  128.545 1.00 19.45 ? 16   TYR I C   1 
ATOM   6025 O  O   . TYR I  1 16 ? 7.718   -6.456  127.724 1.00 15.55 ? 16   TYR I O   1 
ATOM   6026 C  CB  . TYR I  1 16 ? 9.120   -4.754  130.272 1.00 18.53 ? 16   TYR I CB  1 
ATOM   6027 C  CG  . TYR I  1 16 ? 8.593   -3.707  129.315 1.00 17.34 ? 16   TYR I CG  1 
ATOM   6028 C  CD1 . TYR I  1 16 ? 7.334   -3.125  129.505 1.00 16.84 ? 16   TYR I CD1 1 
ATOM   6029 C  CD2 . TYR I  1 16 ? 9.352   -3.337  128.199 1.00 16.80 ? 16   TYR I CD2 1 
ATOM   6030 C  CE1 . TYR I  1 16 ? 6.828   -2.145  128.607 1.00 14.92 ? 16   TYR I CE1 1 
ATOM   6031 C  CE2 . TYR I  1 16 ? 8.875   -2.379  127.319 1.00 19.21 ? 16   TYR I CE2 1 
ATOM   6032 C  CZ  . TYR I  1 16 ? 7.633   -1.810  127.524 1.00 15.73 ? 16   TYR I CZ  1 
ATOM   6033 O  OH  . TYR I  1 16 ? 7.169   -0.886  126.612 1.00 17.34 ? 16   TYR I OH  1 
ATOM   6034 N  N   . HIS I  1 17 ? 9.865   -6.914  128.228 1.00 18.00 ? 17   HIS I N   1 
ATOM   6035 C  CA  . HIS I  1 17 ? 10.198  -7.306  126.866 1.00 21.14 ? 17   HIS I CA  1 
ATOM   6036 C  C   . HIS I  1 17 ? 9.367   -8.472  126.348 1.00 21.35 ? 17   HIS I C   1 
ATOM   6037 O  O   . HIS I  1 17 ? 9.021   -8.519  125.171 1.00 20.34 ? 17   HIS I O   1 
ATOM   6038 C  CB  . HIS I  1 17 ? 11.691  -7.568  126.762 1.00 28.45 ? 17   HIS I CB  1 
ATOM   6039 C  CG  . HIS I  1 17 ? 12.514  -6.319  126.730 1.00 36.10 ? 17   HIS I CG  1 
ATOM   6040 N  ND1 . HIS I  1 17 ? 13.803  -6.260  127.219 1.00 39.59 ? 17   HIS I ND1 1 
ATOM   6041 C  CD2 . HIS I  1 17 ? 12.230  -5.075  126.270 1.00 40.24 ? 17   HIS I CD2 1 
ATOM   6042 C  CE1 . HIS I  1 17 ? 14.278  -5.034  127.063 1.00 40.38 ? 17   HIS I CE1 1 
ATOM   6043 N  NE2 . HIS I  1 17 ? 13.343  -4.295  126.490 1.00 41.39 ? 17   HIS I NE2 1 
ATOM   6044 N  N   . LYS I  1 18 ? 9.036   -9.431  127.205 1.00 20.60 ? 18   LYS I N   1 
ATOM   6045 C  CA  . LYS I  1 18 ? 8.147   -10.524 126.791 1.00 24.79 ? 18   LYS I CA  1 
ATOM   6046 C  C   . LYS I  1 18 ? 6.889   -9.990  126.117 1.00 22.34 ? 18   LYS I C   1 
ATOM   6047 O  O   . LYS I  1 18 ? 6.376   -10.592 125.167 1.00 22.76 ? 18   LYS I O   1 
ATOM   6048 C  CB  . LYS I  1 18 ? 7.697   -11.404 127.970 1.00 26.81 ? 18   LYS I CB  1 
ATOM   6049 C  CG  . LYS I  1 18 ? 8.685   -12.422 128.490 1.00 34.72 ? 18   LYS I CG  1 
ATOM   6050 C  CD  . LYS I  1 18 ? 7.991   -13.455 129.425 1.00 34.04 ? 18   LYS I CD  1 
ATOM   6051 C  CE  . LYS I  1 18 ? 7.840   -12.988 130.894 1.00 38.85 ? 18   LYS I CE  1 
ATOM   6052 N  NZ  . LYS I  1 18 ? 7.419   -14.043 131.921 1.00 37.73 ? 18   LYS I NZ  1 
ATOM   6053 N  N   . TYR I  1 19 ? 6.370   -8.867  126.607 1.00 18.12 ? 19   TYR I N   1 
ATOM   6054 C  CA  . TYR I  1 19 ? 5.093   -8.361  126.085 1.00 17.00 ? 19   TYR I CA  1 
ATOM   6055 C  C   . TYR I  1 19 ? 5.260   -7.254  125.019 1.00 17.24 ? 19   TYR I C   1 
ATOM   6056 O  O   . TYR I  1 19 ? 4.461   -7.146  124.093 1.00 16.02 ? 19   TYR I O   1 
ATOM   6057 C  CB  . TYR I  1 19 ? 4.223   -7.882  127.262 1.00 20.50 ? 19   TYR I CB  1 
ATOM   6058 C  CG  . TYR I  1 19 ? 3.921   -9.075  128.130 1.00 21.41 ? 19   TYR I CG  1 
ATOM   6059 C  CD1 . TYR I  1 19 ? 2.860   -9.905  127.837 1.00 21.28 ? 19   TYR I CD1 1 
ATOM   6060 C  CD2 . TYR I  1 19 ? 4.738   -9.399  129.205 1.00 21.36 ? 19   TYR I CD2 1 
ATOM   6061 C  CE1 . TYR I  1 19 ? 2.606   -11.032 128.605 1.00 22.20 ? 19   TYR I CE1 1 
ATOM   6062 C  CE2 . TYR I  1 19 ? 4.490   -10.516 129.986 1.00 22.21 ? 19   TYR I CE2 1 
ATOM   6063 C  CZ  . TYR I  1 19 ? 3.441   -11.339 129.664 1.00 23.19 ? 19   TYR I CZ  1 
ATOM   6064 O  OH  . TYR I  1 19 ? 3.211   -12.470 130.447 1.00 26.95 ? 19   TYR I OH  1 
ATOM   6065 N  N   . SER I  1 20 ? 6.317   -6.467  125.154 1.00 16.15 ? 20   SER I N   1 
ATOM   6066 C  CA  . SER I  1 20 ? 6.632   -5.410  124.187 1.00 15.16 ? 20   SER I CA  1 
ATOM   6067 C  C   . SER I  1 20 ? 7.078   -6.019  122.840 1.00 17.98 ? 20   SER I C   1 
ATOM   6068 O  O   . SER I  1 20 ? 6.953   -5.381  121.772 1.00 19.10 ? 20   SER I O   1 
ATOM   6069 C  CB  . SER I  1 20 ? 7.699   -4.495  124.801 1.00 16.22 ? 20   SER I CB  1 
ATOM   6070 O  OG  . SER I  1 20 ? 9.012   -4.976  124.580 1.00 17.32 ? 20   SER I OG  1 
ATOM   6071 N  N   . LEU I  1 21 ? 7.571   -7.253  122.882 1.00 18.02 ? 21   LEU I N   1 
ATOM   6072 C  CA  . LEU I  1 21 ? 7.969   -7.956  121.627 1.00 18.56 ? 21   LEU I CA  1 
ATOM   6073 C  C   . LEU I  1 21 ? 6.812   -8.626  120.903 1.00 19.40 ? 21   LEU I C   1 
ATOM   6074 O  O   . LEU I  1 21 ? 6.995   -9.207  119.817 1.00 18.15 ? 21   LEU I O   1 
ATOM   6075 C  CB  . LEU I  1 21 ? 9.072   -8.978  121.864 1.00 20.82 ? 21   LEU I CB  1 
ATOM   6076 C  CG  . LEU I  1 21 ? 10.530  -8.541  122.003 1.00 21.57 ? 21   LEU I CG  1 
ATOM   6077 C  CD1 . LEU I  1 21 ? 11.308  -9.630  122.786 1.00 22.65 ? 21   LEU I CD1 1 
ATOM   6078 C  CD2 . LEU I  1 21 ? 11.143  -8.247  120.653 1.00 25.10 ? 21   LEU I CD2 1 
ATOM   6079 N  N   . ILE I  1 22 ? 5.604   -8.565  121.457 1.00 17.08 ? 22   ILE I N   1 
ATOM   6080 C  CA  . ILE I  1 22 ? 4.487   -9.239  120.774 1.00 18.00 ? 22   ILE I CA  1 
ATOM   6081 C  C   . ILE I  1 22 ? 4.172   -8.665  119.395 1.00 17.99 ? 22   ILE I C   1 
ATOM   6082 O  O   . ILE I  1 22 ? 3.952   -9.412  118.426 1.00 16.36 ? 22   ILE I O   1 
ATOM   6083 C  CB  . ILE I  1 22 ? 3.209   -9.241  121.633 1.00 19.35 ? 22   ILE I CB  1 
ATOM   6084 C  CG1 . ILE I  1 22 ? 3.378   -10.118 122.877 1.00 20.62 ? 22   ILE I CG1 1 
ATOM   6085 C  CG2 . ILE I  1 22 ? 2.025   -9.698  120.791 1.00 19.65 ? 22   ILE I CG2 1 
ATOM   6086 C  CD1 . ILE I  1 22 ? 2.263   -9.908  123.896 1.00 18.88 ? 22   ILE I CD1 1 
ATOM   6087 N  N   . LYS I  1 23 ? 4.131   -7.336  119.297 1.00 18.02 ? 23   LYS I N   1 
ATOM   6088 C  CA  . LYS I  1 23 ? 3.844   -6.724  118.003 1.00 18.17 ? 23   LYS I CA  1 
ATOM   6089 C  C   . LYS I  1 23 ? 4.247   -5.252  117.950 1.00 17.49 ? 23   LYS I C   1 
ATOM   6090 O  O   . LYS I  1 23 ? 4.634   -4.665  118.958 1.00 17.33 ? 23   LYS I O   1 
ATOM   6091 C  CB  . LYS I  1 23 ? 2.359   -6.855  117.699 1.00 18.82 ? 23   LYS I CB  1 
ATOM   6092 C  CG  . LYS I  1 23 ? 1.488   -6.062  118.669 1.00 21.68 ? 23   LYS I CG  1 
ATOM   6093 C  CD  . LYS I  1 23 ? 0.069   -6.167  118.206 1.00 24.60 ? 23   LYS I CD  1 
ATOM   6094 C  CE  . LYS I  1 23 ? -0.917  -5.633  119.228 1.00 26.78 ? 23   LYS I CE  1 
ATOM   6095 N  NZ  . LYS I  1 23 ? -1.212  -6.722  120.192 1.00 31.30 ? 23   LYS I NZ  1 
ATOM   6096 N  N   . GLY I  1 24 ? 4.185   -4.662  116.758 1.00 18.78 ? 24   GLY I N   1 
ATOM   6097 C  CA  . GLY I  1 24 ? 4.371   -3.213  116.625 1.00 19.41 ? 24   GLY I CA  1 
ATOM   6098 C  C   . GLY I  1 24 ? 5.746   -2.751  117.036 1.00 19.71 ? 24   GLY I C   1 
ATOM   6099 O  O   . GLY I  1 24 ? 6.731   -3.426  116.802 1.00 16.48 ? 24   GLY I O   1 
ATOM   6100 N  N   . ASN I  1 25 ? 5.802   -1.613  117.718 1.00 16.83 ? 25   ASN I N   1 
ATOM   6101 C  CA  . ASN I  1 25 ? 7.052   -1.085  118.240 1.00 17.82 ? 25   ASN I CA  1 
ATOM   6102 C  C   . ASN I  1 25 ? 7.555   -1.935  119.407 1.00 17.56 ? 25   ASN I C   1 
ATOM   6103 O  O   . ASN I  1 25 ? 6.802   -2.258  120.322 1.00 17.88 ? 25   ASN I O   1 
ATOM   6104 C  CB  . ASN I  1 25 ? 6.807   0.383   118.611 1.00 18.64 ? 25   ASN I CB  1 
ATOM   6105 C  CG  . ASN I  1 25 ? 8.024   1.086   119.140 1.00 18.58 ? 25   ASN I CG  1 
ATOM   6106 O  OD1 . ASN I  1 25 ? 8.766   0.554   119.942 1.00 20.58 ? 25   ASN I OD1 1 
ATOM   6107 N  ND2 . ASN I  1 25 ? 8.187   2.353   118.746 1.00 24.29 ? 25   ASN I ND2 1 
ATOM   6108 N  N   . PHE I  1 26 ? 8.831   -2.306  119.392 1.00 17.03 ? 26   PHE I N   1 
ATOM   6109 C  CA  . PHE I  1 26 ? 9.338   -3.179  120.465 1.00 19.88 ? 26   PHE I CA  1 
ATOM   6110 C  C   . PHE I  1 26 ? 9.590   -2.469  121.803 1.00 22.65 ? 26   PHE I C   1 
ATOM   6111 O  O   . PHE I  1 26 ? 9.976   -3.089  122.807 1.00 22.73 ? 26   PHE I O   1 
ATOM   6112 C  CB  . PHE I  1 26 ? 10.579  -3.909  119.997 1.00 23.46 ? 26   PHE I CB  1 
ATOM   6113 C  CG  . PHE I  1 26 ? 10.308  -4.902  118.901 1.00 24.44 ? 26   PHE I CG  1 
ATOM   6114 C  CD1 . PHE I  1 26 ? 9.049   -5.478  118.743 1.00 25.05 ? 26   PHE I CD1 1 
ATOM   6115 C  CD2 . PHE I  1 26 ? 11.321  -5.279  118.043 1.00 27.29 ? 26   PHE I CD2 1 
ATOM   6116 C  CE1 . PHE I  1 26 ? 8.813   -6.414  117.751 1.00 27.99 ? 26   PHE I CE1 1 
ATOM   6117 C  CE2 . PHE I  1 26 ? 11.083  -6.213  117.044 1.00 28.19 ? 26   PHE I CE2 1 
ATOM   6118 C  CZ  . PHE I  1 26 ? 9.826   -6.789  116.907 1.00 27.72 ? 26   PHE I CZ  1 
ATOM   6119 N  N   . HIS I  1 27 ? 9.318   -1.161  121.824 1.00 21.78 ? 27   HIS I N   1 
ATOM   6120 C  CA  . HIS I  1 27 ? 9.460   -0.369  123.047 1.00 20.18 ? 27   HIS I CA  1 
ATOM   6121 C  C   . HIS I  1 27 ? 8.064   0.045   123.504 1.00 19.91 ? 27   HIS I C   1 
ATOM   6122 O  O   . HIS I  1 27 ? 7.867   1.012   124.274 1.00 23.07 ? 27   HIS I O   1 
ATOM   6123 C  CB  . HIS I  1 27 ? 10.383  0.826   122.725 1.00 20.76 ? 27   HIS I CB  1 
ATOM   6124 C  CG  . HIS I  1 27 ? 11.728  0.399   122.249 1.00 26.89 ? 27   HIS I CG  1 
ATOM   6125 N  ND1 . HIS I  1 27 ? 12.790  0.195   123.100 1.00 30.98 ? 27   HIS I ND1 1 
ATOM   6126 C  CD2 . HIS I  1 27 ? 12.169  0.068   121.014 1.00 29.54 ? 27   HIS I CD2 1 
ATOM   6127 C  CE1 . HIS I  1 27 ? 13.842  -0.204  122.407 1.00 32.41 ? 27   HIS I CE1 1 
ATOM   6128 N  NE2 . HIS I  1 27 ? 13.489  -0.299  121.139 1.00 31.88 ? 27   HIS I NE2 1 
ATOM   6129 N  N   . ALA I  1 28 ? 7.062   -0.711  123.058 1.00 16.44 ? 28   ALA I N   1 
ATOM   6130 C  CA  . ALA I  1 28 ? 5.658   -0.383  123.394 1.00 14.97 ? 28   ALA I CA  1 
ATOM   6131 C  C   . ALA I  1 28 ? 4.876   -1.662  123.732 1.00 15.72 ? 28   ALA I C   1 
ATOM   6132 O  O   . ALA I  1 28 ? 5.034   -2.687  123.048 1.00 15.79 ? 28   ALA I O   1 
ATOM   6133 C  CB  . ALA I  1 28 ? 4.968   0.309   122.198 1.00 15.00 ? 28   ALA I CB  1 
ATOM   6134 N  N   . VAL I  1 29 ? 4.008   -1.577  124.748 1.00 15.51 ? 29   VAL I N   1 
ATOM   6135 C  CA  . VAL I  1 29 ? 3.026   -2.584  125.099 1.00 17.85 ? 29   VAL I CA  1 
ATOM   6136 C  C   . VAL I  1 29 ? 1.649   -1.933  124.899 1.00 17.65 ? 29   VAL I C   1 
ATOM   6137 O  O   . VAL I  1 29 ? 1.359   -0.868  125.450 1.00 16.38 ? 29   VAL I O   1 
ATOM   6138 C  CB  . VAL I  1 29 ? 3.197   -2.967  126.600 1.00 18.56 ? 29   VAL I CB  1 
ATOM   6139 C  CG1 . VAL I  1 29 ? 1.998   -3.752  127.164 1.00 19.60 ? 29   VAL I CG1 1 
ATOM   6140 C  CG2 . VAL I  1 29 ? 4.486   -3.711  126.795 1.00 17.76 ? 29   VAL I CG2 1 
ATOM   6141 N  N   . TYR I  1 30 ? 0.829   -2.539  124.043 1.00 16.93 ? 30   TYR I N   1 
ATOM   6142 C  CA  . TYR I  1 30 ? -0.435  -1.953  123.618 1.00 19.18 ? 30   TYR I CA  1 
ATOM   6143 C  C   . TYR I  1 30 ? -1.536  -2.435  124.565 1.00 17.85 ? 30   TYR I C   1 
ATOM   6144 O  O   . TYR I  1 30 ? -1.302  -3.250  125.429 1.00 19.16 ? 30   TYR I O   1 
ATOM   6145 C  CB  . TYR I  1 30 ? -0.725  -2.297  122.131 1.00 17.19 ? 30   TYR I CB  1 
ATOM   6146 C  CG  . TYR I  1 30 ? 0.384   -1.767  121.228 1.00 18.49 ? 30   TYR I CG  1 
ATOM   6147 C  CD1 . TYR I  1 30 ? 0.452   -0.403  120.907 1.00 18.28 ? 30   TYR I CD1 1 
ATOM   6148 C  CD2 . TYR I  1 30 ? 1.402   -2.602  120.758 1.00 16.66 ? 30   TYR I CD2 1 
ATOM   6149 C  CE1 . TYR I  1 30 ? 1.493   0.116   120.149 1.00 17.82 ? 30   TYR I CE1 1 
ATOM   6150 C  CE2 . TYR I  1 30 ? 2.429   -2.084  119.969 1.00 16.95 ? 30   TYR I CE2 1 
ATOM   6151 C  CZ  . TYR I  1 30 ? 2.471   -0.731  119.672 1.00 17.67 ? 30   TYR I CZ  1 
ATOM   6152 O  OH  . TYR I  1 30 ? 3.520   -0.258  118.898 1.00 20.25 ? 30   TYR I OH  1 
ATOM   6153 N  N   . ARG I  1 31 ? -2.741  -1.913  124.412 1.00 20.40 ? 31   ARG I N   1 
ATOM   6154 C  CA  . ARG I  1 31 ? -3.793  -2.192  125.395 1.00 22.65 ? 31   ARG I CA  1 
ATOM   6155 C  C   . ARG I  1 31 ? -4.057  -3.701  125.551 1.00 22.47 ? 31   ARG I C   1 
ATOM   6156 O  O   . ARG I  1 31 ? -4.220  -4.212  126.672 1.00 23.00 ? 31   ARG I O   1 
ATOM   6157 C  CB  . ARG I  1 31 ? -5.030  -1.382  124.987 1.00 25.78 ? 31   ARG I CB  1 
ATOM   6158 C  CG  . ARG I  1 31 ? -6.285  -1.488  125.842 1.00 29.96 ? 31   ARG I CG  1 
ATOM   6159 C  CD  . ARG I  1 31 ? -7.437  -0.596  125.287 1.00 30.61 ? 31   ARG I CD  1 
ATOM   6160 N  NE  . ARG I  1 31 ? -7.279  0.805   125.688 1.00 37.04 ? 31   ARG I NE  1 
ATOM   6161 C  CZ  . ARG I  1 31 ? -6.683  1.753   124.948 1.00 38.86 ? 31   ARG I CZ  1 
ATOM   6162 N  NH1 . ARG I  1 31 ? -6.173  1.485   123.733 1.00 40.75 ? 31   ARG I NH1 1 
ATOM   6163 N  NH2 . ARG I  1 31 ? -6.611  2.992   125.421 1.00 38.40 ? 31   ARG I NH2 1 
ATOM   6164 N  N   . ASP I  1 32 ? -4.091  -4.433  124.439 1.00 21.12 ? 32   ASP I N   1 
ATOM   6165 C  CA  . ASP I  1 32 ? -4.275  -5.877  124.502 1.00 22.62 ? 32   ASP I CA  1 
ATOM   6166 C  C   . ASP I  1 32 ? -3.079  -6.652  125.081 1.00 22.18 ? 32   ASP I C   1 
ATOM   6167 O  O   . ASP I  1 32 ? -3.273  -7.616  125.827 1.00 21.70 ? 32   ASP I O   1 
ATOM   6168 C  CB  . ASP I  1 32 ? -4.712  -6.442  123.136 1.00 24.86 ? 32   ASP I CB  1 
ATOM   6169 C  CG  . ASP I  1 32 ? -3.759  -6.094  121.979 1.00 27.77 ? 32   ASP I CG  1 
ATOM   6170 O  OD1 . ASP I  1 32 ? -2.931  -5.152  122.059 1.00 27.85 ? 32   ASP I OD1 1 
ATOM   6171 O  OD2 . ASP I  1 32 ? -3.801  -6.714  120.889 1.00 30.43 ? 32   ASP I OD2 1 
ATOM   6172 N  N   . ASP I  1 33 ? -1.856  -6.252  124.725 1.00 21.40 ? 33   ASP I N   1 
ATOM   6173 C  CA  . ASP I  1 33 ? -0.667  -6.789  125.363 1.00 20.10 ? 33   ASP I CA  1 
ATOM   6174 C  C   . ASP I  1 33 ? -0.683  -6.567  126.877 1.00 17.72 ? 33   ASP I C   1 
ATOM   6175 O  O   . ASP I  1 33 ? -0.313  -7.453  127.640 1.00 18.70 ? 33   ASP I O   1 
ATOM   6176 C  CB  . ASP I  1 33 ? 0.593   -6.163  124.786 1.00 20.96 ? 33   ASP I CB  1 
ATOM   6177 C  CG  . ASP I  1 33 ? 0.634   -6.206  123.300 1.00 21.07 ? 33   ASP I CG  1 
ATOM   6178 O  OD1 . ASP I  1 33 ? 0.225   -7.244  122.728 1.00 19.19 ? 33   ASP I OD1 1 
ATOM   6179 O  OD2 . ASP I  1 33 ? 1.112   -5.266  122.648 1.00 19.74 ? 33   ASP I OD2 1 
ATOM   6180 N  N   . LEU I  1 34 ? -1.130  -5.399  127.322 1.00 17.25 ? 34   LEU I N   1 
ATOM   6181 C  CA  . LEU I  1 34 ? -1.205  -5.163  128.775 1.00 19.58 ? 34   LEU I CA  1 
ATOM   6182 C  C   . LEU I  1 34 ? -2.176  -6.118  129.477 1.00 19.01 ? 34   LEU I C   1 
ATOM   6183 O  O   . LEU I  1 34 ? -1.931  -6.589  130.579 1.00 17.86 ? 34   LEU I O   1 
ATOM   6184 C  CB  . LEU I  1 34 ? -1.552  -3.708  129.084 1.00 19.59 ? 34   LEU I CB  1 
ATOM   6185 C  CG  . LEU I  1 34 ? -1.494  -3.398  130.581 1.00 21.97 ? 34   LEU I CG  1 
ATOM   6186 C  CD1 . LEU I  1 34 ? -0.059  -3.467  131.063 1.00 22.34 ? 34   LEU I CD1 1 
ATOM   6187 C  CD2 . LEU I  1 34 ? -2.096  -2.028  130.846 1.00 22.55 ? 34   LEU I CD2 1 
ATOM   6188 N  N   . LYS I  1 35 ? -3.286  -6.417  128.824 1.00 18.83 ? 35   LYS I N   1 
ATOM   6189 C  CA  . LYS I  1 35 ? -4.255  -7.321  129.403 1.00 21.25 ? 35   LYS I CA  1 
ATOM   6190 C  C   . LYS I  1 35 ? -3.595  -8.681  129.608 1.00 20.34 ? 35   LYS I C   1 
ATOM   6191 O  O   . LYS I  1 35 ? -3.700  -9.290  130.670 1.00 20.32 ? 35   LYS I O   1 
ATOM   6192 C  CB  . LYS I  1 35 ? -5.458  -7.436  128.467 1.00 23.39 ? 35   LYS I CB  1 
ATOM   6193 C  CG  . LYS I  1 35 ? -6.599  -8.258  129.012 1.00 27.34 ? 35   LYS I CG  1 
ATOM   6194 C  CD  . LYS I  1 35 ? -7.811  -7.992  128.137 1.00 30.52 ? 35   LYS I CD  1 
ATOM   6195 C  CE  . LYS I  1 35 ? -8.790  -9.142  128.136 1.00 33.86 ? 35   LYS I CE  1 
ATOM   6196 N  NZ  . LYS I  1 35 ? -9.473  -9.258  129.445 1.00 36.42 ? 35   LYS I NZ  1 
ATOM   6197 N  N   . LYS I  1 36 ? -2.862  -9.132  128.600 1.00 20.78 ? 36   LYS I N   1 
ATOM   6198 C  CA  . LYS I  1 36 ? -2.178  -10.419 128.699 1.00 22.63 ? 36   LYS I CA  1 
ATOM   6199 C  C   . LYS I  1 36 ? -1.138  -10.371 129.809 1.00 20.80 ? 36   LYS I C   1 
ATOM   6200 O  O   . LYS I  1 36 ? -0.959  -11.328 130.572 1.00 18.69 ? 36   LYS I O   1 
ATOM   6201 C  CB  . LYS I  1 36 ? -1.483  -10.733 127.368 1.00 23.52 ? 36   LYS I CB  1 
ATOM   6202 C  CG  . LYS I  1 36 ? -2.432  -11.196 126.291 1.00 28.59 ? 36   LYS I CG  1 
ATOM   6203 C  CD  . LYS I  1 36 ? -1.664  -11.617 125.021 1.00 30.33 ? 36   LYS I CD  1 
ATOM   6204 C  CE  . LYS I  1 36 ? -2.542  -12.485 124.119 1.00 35.61 ? 36   LYS I CE  1 
ATOM   6205 N  NZ  . LYS I  1 36 ? -3.822  -11.743 123.840 1.00 37.44 ? 36   LYS I NZ  1 
ATOM   6206 N  N   . LEU I  1 37 ? -0.435  -9.248  129.882 1.00 19.89 ? 37   LEU I N   1 
ATOM   6207 C  CA  . LEU I  1 37 ? 0.601   -9.093  130.912 1.00 19.87 ? 37   LEU I CA  1 
ATOM   6208 C  C   . LEU I  1 37 ? 0.004   -9.248  132.297 1.00 19.23 ? 37   LEU I C   1 
ATOM   6209 O  O   . LEU I  1 37 ? 0.512   -10.004 133.153 1.00 20.29 ? 37   LEU I O   1 
ATOM   6210 C  CB  . LEU I  1 37 ? 1.283   -7.733  130.767 1.00 19.37 ? 37   LEU I CB  1 
ATOM   6211 C  CG  . LEU I  1 37 ? 2.452   -7.485  131.728 1.00 21.30 ? 37   LEU I CG  1 
ATOM   6212 C  CD1 . LEU I  1 37 ? 3.263   -6.387  131.094 1.00 21.15 ? 37   LEU I CD1 1 
ATOM   6213 C  CD2 . LEU I  1 37 ? 1.974   -7.051  133.132 1.00 18.94 ? 37   LEU I CD2 1 
ATOM   6214 N  N   . LEU I  1 38 ? -1.096  -8.537  132.533 1.00 19.47 ? 38   LEU I N   1 
ATOM   6215 C  CA  . LEU I  1 38 ? -1.737  -8.553  133.838 1.00 20.26 ? 38   LEU I CA  1 
ATOM   6216 C  C   . LEU I  1 38 ? -2.301  -9.939  134.171 1.00 20.68 ? 38   LEU I C   1 
ATOM   6217 O  O   . LEU I  1 38 ? -2.111  -10.443 135.291 1.00 20.07 ? 38   LEU I O   1 
ATOM   6218 C  CB  . LEU I  1 38 ? -2.842  -7.501  133.913 1.00 18.39 ? 38   LEU I CB  1 
ATOM   6219 C  CG  . LEU I  1 38 ? -2.397  -6.029  133.857 1.00 18.78 ? 38   LEU I CG  1 
ATOM   6220 C  CD1 . LEU I  1 38 ? -3.559  -5.107  133.531 1.00 20.28 ? 38   LEU I CD1 1 
ATOM   6221 C  CD2 . LEU I  1 38 ? -1.764  -5.599  135.210 1.00 18.82 ? 38   LEU I CD2 1 
ATOM   6222 N  N   . GLU I  1 39 ? -2.972  -10.558 133.203 1.00 21.28 ? 39   GLU I N   1 
ATOM   6223 C  CA  . GLU I  1 39 ? -3.460  -11.926 133.375 1.00 25.46 ? 39   GLU I CA  1 
ATOM   6224 C  C   . GLU I  1 39 ? -2.366  -12.946 133.729 1.00 23.77 ? 39   GLU I C   1 
ATOM   6225 O  O   . GLU I  1 39 ? -2.577  -13.836 134.547 1.00 24.62 ? 39   GLU I O   1 
ATOM   6226 C  CB  . GLU I  1 39 ? -4.239  -12.392 132.125 1.00 27.54 ? 39   GLU I CB  1 
ATOM   6227 C  CG  . GLU I  1 39 ? -5.545  -11.642 131.898 1.00 33.81 ? 39   GLU I CG  1 
ATOM   6228 C  CD  . GLU I  1 39 ? -6.270  -12.135 130.655 1.00 36.49 ? 39   GLU I CD  1 
ATOM   6229 O  OE1 . GLU I  1 39 ? -6.051  -13.303 130.275 1.00 43.25 ? 39   GLU I OE1 1 
ATOM   6230 O  OE2 . GLU I  1 39 ? -7.042  -11.371 130.047 1.00 40.71 ? 39   GLU I OE2 1 
ATOM   6231 N  N   . THR I  1 40 ? -1.181  -12.813 133.146 1.00 22.51 ? 40   THR I N   1 
ATOM   6232 C  CA  . THR I  1 40 ? -0.154  -13.840 133.275 1.00 22.88 ? 40   THR I CA  1 
ATOM   6233 C  C   . THR I  1 40 ? 0.836   -13.541 134.407 1.00 23.02 ? 40   THR I C   1 
ATOM   6234 O  O   . THR I  1 40 ? 1.370   -14.460 135.029 1.00 24.31 ? 40   THR I O   1 
ATOM   6235 C  CB  . THR I  1 40 ? 0.583   -13.932 131.927 1.00 26.61 ? 40   THR I CB  1 
ATOM   6236 O  OG1 . THR I  1 40 ? -0.374  -14.323 130.930 1.00 29.42 ? 40   THR I OG1 1 
ATOM   6237 C  CG2 . THR I  1 40 ? 1.645   -15.053 131.919 1.00 28.07 ? 40   THR I CG2 1 
ATOM   6238 N  N   . GLU I  1 41 ? 1.044   -12.259 134.679 1.00 20.55 ? 41   GLU I N   1 
ATOM   6239 C  CA  . GLU I  1 41 ? 2.091   -11.822 135.596 1.00 21.07 ? 41   GLU I CA  1 
ATOM   6240 C  C   . GLU I  1 41 ? 1.630   -11.268 136.942 1.00 22.81 ? 41   GLU I C   1 
ATOM   6241 O  O   . GLU I  1 41 ? 2.446   -11.200 137.879 1.00 21.93 ? 41   GLU I O   1 
ATOM   6242 C  CB  . GLU I  1 41 ? 2.983   -10.784 134.909 1.00 20.02 ? 41   GLU I CB  1 
ATOM   6243 C  CG  . GLU I  1 41 ? 3.582   -11.254 133.589 1.00 20.02 ? 41   GLU I CG  1 
ATOM   6244 C  CD  . GLU I  1 41 ? 4.761   -12.199 133.726 1.00 25.16 ? 41   GLU I CD  1 
ATOM   6245 O  OE1 . GLU I  1 41 ? 5.237   -12.423 134.874 1.00 23.50 ? 41   GLU I OE1 1 
ATOM   6246 O  OE2 . GLU I  1 41 ? 5.242   -12.698 132.668 1.00 25.39 ? 41   GLU I OE2 1 
ATOM   6247 N  N   . SER I  1 42 ? 0.370   -10.876 137.083 1.00 22.15 ? 42   SER I N   1 
ATOM   6248 C  CA  . SER I  1 42 ? -0.017  -10.261 138.346 1.00 22.75 ? 42   SER I CA  1 
ATOM   6249 C  C   . SER I  1 42 ? -1.125  -10.986 139.126 1.00 24.14 ? 42   SER I C   1 
ATOM   6250 O  O   . SER I  1 42 ? -1.963  -11.680 138.527 1.00 24.55 ? 42   SER I O   1 
ATOM   6251 C  CB  . SER I  1 42 ? -0.394  -8.800  138.118 1.00 24.67 ? 42   SER I CB  1 
ATOM   6252 O  OG  . SER I  1 42 ? -1.598  -8.719  137.413 1.00 27.38 ? 42   SER I OG  1 
ATOM   6253 N  N   . PRO I  1 43 ? -1.136  -10.821 140.449 1.00 24.06 ? 43   PRO I N   1 
ATOM   6254 C  CA  . PRO I  1 43 ? -2.100  -11.536 141.279 1.00 24.61 ? 43   PRO I CA  1 
ATOM   6255 C  C   . PRO I  1 43 ? -3.486  -10.922 141.150 1.00 27.58 ? 43   PRO I C   1 
ATOM   6256 O  O   . PRO I  1 43 ? -3.629  -9.836  140.587 1.00 23.91 ? 43   PRO I O   1 
ATOM   6257 C  CB  . PRO I  1 43 ? -1.540  -11.375 142.704 1.00 25.07 ? 43   PRO I CB  1 
ATOM   6258 C  CG  . PRO I  1 43 ? -0.842  -10.056 142.661 1.00 24.01 ? 43   PRO I CG  1 
ATOM   6259 C  CD  . PRO I  1 43 ? -0.245  -9.955  141.250 1.00 22.86 ? 43   PRO I CD  1 
ATOM   6260 N  N   . GLN I  1 44 ? -4.495  -11.608 141.683 1.00 29.84 ? 44   GLN I N   1 
ATOM   6261 C  CA  . GLN I  1 44 ? -5.886  -11.243 141.412 1.00 31.58 ? 44   GLN I CA  1 
ATOM   6262 C  C   . GLN I  1 44 ? -6.266  -9.878  141.988 1.00 30.60 ? 44   GLN I C   1 
ATOM   6263 O  O   . GLN I  1 44 ? -7.138  -9.195  141.449 1.00 31.78 ? 44   GLN I O   1 
ATOM   6264 C  CB  . GLN I  1 44 ? -6.847  -12.327 141.925 1.00 36.88 ? 44   GLN I CB  1 
ATOM   6265 C  CG  . GLN I  1 44 ? -8.300  -11.869 142.034 1.00 41.21 ? 44   GLN I CG  1 
ATOM   6266 C  CD  . GLN I  1 44 ? -8.972  -11.711 140.682 1.00 45.38 ? 44   GLN I CD  1 
ATOM   6267 O  OE1 . GLN I  1 44 ? -8.689  -12.476 139.749 1.00 48.36 ? 44   GLN I OE1 1 
ATOM   6268 N  NE2 . GLN I  1 44 ? -9.868  -10.724 140.563 1.00 47.20 ? 44   GLN I NE2 1 
ATOM   6269 N  N   . TYR I  1 45 ? -5.605  -9.486  143.069 1.00 28.92 ? 45   TYR I N   1 
ATOM   6270 C  CA  . TYR I  1 45 ? -5.879  -8.214  143.718 1.00 27.37 ? 45   TYR I CA  1 
ATOM   6271 C  C   . TYR I  1 45 ? -5.371  -7.045  142.880 1.00 27.89 ? 45   TYR I C   1 
ATOM   6272 O  O   . TYR I  1 45 ? -5.851  -5.930  143.062 1.00 28.57 ? 45   TYR I O   1 
ATOM   6273 C  CB  . TYR I  1 45 ? -5.383  -8.161  145.172 1.00 27.58 ? 45   TYR I CB  1 
ATOM   6274 C  CG  . TYR I  1 45 ? -3.881  -8.249  145.362 1.00 27.51 ? 45   TYR I CG  1 
ATOM   6275 C  CD1 . TYR I  1 45 ? -3.056  -7.151  145.150 1.00 27.33 ? 45   TYR I CD1 1 
ATOM   6276 C  CD2 . TYR I  1 45 ? -3.296  -9.440  145.746 1.00 27.43 ? 45   TYR I CD2 1 
ATOM   6277 C  CE1 . TYR I  1 45 ? -1.671  -7.243  145.322 1.00 25.56 ? 45   TYR I CE1 1 
ATOM   6278 C  CE2 . TYR I  1 45 ? -1.944  -9.543  145.903 1.00 27.26 ? 45   TYR I CE2 1 
ATOM   6279 C  CZ  . TYR I  1 45 ? -1.133  -8.439  145.718 1.00 26.72 ? 45   TYR I CZ  1 
ATOM   6280 O  OH  . TYR I  1 45 ? 0.215   -8.627  145.890 1.00 26.18 ? 45   TYR I OH  1 
ATOM   6281 N  N   . ILE I  1 46 ? -4.447  -7.314  141.949 1.00 24.26 ? 46   ILE I N   1 
ATOM   6282 C  CA  . ILE I  1 46 ? -3.972  -6.324  140.977 1.00 24.88 ? 46   ILE I CA  1 
ATOM   6283 C  C   . ILE I  1 46 ? -4.860  -6.366  139.731 1.00 25.99 ? 46   ILE I C   1 
ATOM   6284 O  O   . ILE I  1 46 ? -5.359  -5.332  139.266 1.00 26.70 ? 46   ILE I O   1 
ATOM   6285 C  CB  . ILE I  1 46 ? -2.478  -6.559  140.590 1.00 20.61 ? 46   ILE I CB  1 
ATOM   6286 C  CG1 . ILE I  1 46 ? -1.524  -6.271  141.759 1.00 23.61 ? 46   ILE I CG1 1 
ATOM   6287 C  CG2 . ILE I  1 46 ? -2.078  -5.744  139.333 1.00 22.32 ? 46   ILE I CG2 1 
ATOM   6288 C  CD1 . ILE I  1 46 ? -1.507  -4.823  142.286 1.00 23.08 ? 46   ILE I CD1 1 
ATOM   6289 N  N   . ARG I  1 47 ? -5.063  -7.566  139.191 1.00 27.75 ? 47   ARG I N   1 
ATOM   6290 C  CA  . ARG I  1 47 ? -5.904  -7.749  138.006 1.00 30.95 ? 47   ARG I CA  1 
ATOM   6291 C  C   . ARG I  1 47 ? -7.315  -7.180  138.133 1.00 32.07 ? 47   ARG I C   1 
ATOM   6292 O  O   . ARG I  1 47 ? -7.901  -6.735  137.144 1.00 31.29 ? 47   ARG I O   1 
ATOM   6293 C  CB  . ARG I  1 47 ? -6.034  -9.230  137.693 1.00 33.43 ? 47   ARG I CB  1 
ATOM   6294 C  CG  . ARG I  1 47 ? -4.791  -9.854  137.134 1.00 37.43 ? 47   ARG I CG  1 
ATOM   6295 C  CD  . ARG I  1 47 ? -5.044  -11.225 136.558 1.00 40.71 ? 47   ARG I CD  1 
ATOM   6296 N  NE  . ARG I  1 47 ? -4.507  -12.245 137.438 1.00 44.03 ? 47   ARG I NE  1 
ATOM   6297 C  CZ  . ARG I  1 47 ? -5.243  -12.992 138.242 1.00 45.88 ? 47   ARG I CZ  1 
ATOM   6298 N  NH1 . ARG I  1 47 ? -6.563  -12.841 138.257 1.00 47.15 ? 47   ARG I NH1 1 
ATOM   6299 N  NH2 . ARG I  1 47 ? -4.657  -13.895 139.018 1.00 46.64 ? 47   ARG I NH2 1 
ATOM   6300 N  N   . LYS I  1 48 ? -7.862  -7.184  139.341 1.00 33.95 ? 48   LYS I N   1 
ATOM   6301 C  CA  . LYS I  1 48 ? -9.288  -6.881  139.527 1.00 36.43 ? 48   LYS I CA  1 
ATOM   6302 C  C   . LYS I  1 48 ? -9.619  -5.422  139.242 1.00 35.89 ? 48   LYS I C   1 
ATOM   6303 O  O   . LYS I  1 48 ? -10.787 -5.064  139.078 1.00 35.25 ? 48   LYS I O   1 
ATOM   6304 C  CB  . LYS I  1 48 ? -9.749  -7.231  140.941 1.00 38.08 ? 48   LYS I CB  1 
ATOM   6305 C  CG  . LYS I  1 48 ? -9.209  -6.298  142.003 1.00 41.24 ? 48   LYS I CG  1 
ATOM   6306 C  CD  . LYS I  1 48 ? -9.814  -6.613  143.358 1.00 44.26 ? 48   LYS I CD  1 
ATOM   6307 C  CE  . LYS I  1 48 ? -8.976  -6.065  144.503 1.00 46.17 ? 48   LYS I CE  1 
ATOM   6308 N  NZ  . LYS I  1 48 ? -9.295  -6.798  145.777 1.00 48.47 ? 48   LYS I NZ  1 
ATOM   6309 N  N   . LYS I  1 49 ? -8.594  -4.575  139.205 1.00 35.37 ? 49   LYS I N   1 
ATOM   6310 C  CA  . LYS I  1 49 ? -8.794  -3.184  138.822 1.00 34.42 ? 49   LYS I CA  1 
ATOM   6311 C  C   . LYS I  1 49 ? -9.272  -3.104  137.373 1.00 32.20 ? 49   LYS I C   1 
ATOM   6312 O  O   . LYS I  1 49 ? -10.004 -2.188  136.997 1.00 33.39 ? 49   LYS I O   1 
ATOM   6313 C  CB  . LYS I  1 49 ? -7.507  -2.388  139.027 1.00 35.80 ? 49   LYS I CB  1 
ATOM   6314 C  CG  . LYS I  1 49 ? -7.557  -1.021  138.398 1.00 38.63 ? 49   LYS I CG  1 
ATOM   6315 C  CD  . LYS I  1 49 ? -6.993  0.027   139.327 1.00 41.41 ? 49   LYS I CD  1 
ATOM   6316 C  CE  . LYS I  1 49 ? -5.499  0.135   139.188 1.00 41.28 ? 49   LYS I CE  1 
ATOM   6317 N  NZ  . LYS I  1 49 ? -4.939  1.033   140.230 1.00 41.45 ? 49   LYS I NZ  1 
ATOM   6318 N  N   . GLY I  1 50 ? -8.862  -4.077  136.569 1.00 28.42 ? 50   GLY I N   1 
ATOM   6319 C  CA  . GLY I  1 50 ? -9.300  -4.150  135.187 1.00 28.21 ? 50   GLY I CA  1 
ATOM   6320 C  C   . GLY I  1 50 ? -8.239  -3.605  134.263 1.00 26.07 ? 50   GLY I C   1 
ATOM   6321 O  O   . GLY I  1 50 ? -7.638  -2.569  134.562 1.00 25.66 ? 50   GLY I O   1 
ATOM   6322 N  N   . ALA I  1 51 ? -7.982  -4.305  133.162 1.00 25.07 ? 51   ALA I N   1 
ATOM   6323 C  CA  . ALA I  1 51 ? -6.895  -3.929  132.253 1.00 26.39 ? 51   ALA I CA  1 
ATOM   6324 C  C   . ALA I  1 51 ? -7.048  -2.547  131.629 1.00 25.56 ? 51   ALA I C   1 
ATOM   6325 O  O   . ALA I  1 51 ? -6.066  -1.855  131.451 1.00 24.93 ? 51   ALA I O   1 
ATOM   6326 C  CB  . ALA I  1 51 ? -6.660  -4.995  131.143 1.00 25.10 ? 51   ALA I CB  1 
ATOM   6327 N  N   . ASP I  1 52 ? -8.269  -2.128  131.312 1.00 26.30 ? 52   ASP I N   1 
ATOM   6328 C  CA  . ASP I  1 52 ? -8.450  -0.819  130.707 1.00 27.66 ? 52   ASP I CA  1 
ATOM   6329 C  C   . ASP I  1 52 ? -8.157  0.302   131.684 1.00 26.02 ? 52   ASP I C   1 
ATOM   6330 O  O   . ASP I  1 52 ? -7.580  1.319   131.306 1.00 23.91 ? 52   ASP I O   1 
ATOM   6331 C  CB  . ASP I  1 52 ? -9.867  -0.671  130.182 1.00 30.90 ? 52   ASP I CB  1 
ATOM   6332 C  CG  . ASP I  1 52 ? -10.095 -1.471  128.929 1.00 35.07 ? 52   ASP I CG  1 
ATOM   6333 O  OD1 . ASP I  1 52 ? -9.104  -1.836  128.252 1.00 36.74 ? 52   ASP I OD1 1 
ATOM   6334 O  OD2 . ASP I  1 52 ? -11.235 -1.781  128.539 1.00 37.77 ? 52   ASP I OD2 1 
ATOM   6335 N  N   . VAL I  1 53 ? -8.622  0.130   132.920 1.00 24.90 ? 53   VAL I N   1 
ATOM   6336 C  CA  . VAL I  1 53 ? -8.311  1.061   133.996 1.00 24.97 ? 53   VAL I CA  1 
ATOM   6337 C  C   . VAL I  1 53 ? -6.804  1.160   134.236 1.00 24.09 ? 53   VAL I C   1 
ATOM   6338 O  O   . VAL I  1 53 ? -6.252  2.262   134.379 1.00 24.56 ? 53   VAL I O   1 
ATOM   6339 C  CB  . VAL I  1 53 ? -9.017  0.636   135.297 1.00 26.31 ? 53   VAL I CB  1 
ATOM   6340 C  CG1 . VAL I  1 53 ? -8.729  1.614   136.415 1.00 26.08 ? 53   VAL I CG1 1 
ATOM   6341 C  CG2 . VAL I  1 53 ? -10.517 0.509   135.063 1.00 29.41 ? 53   VAL I CG2 1 
ATOM   6342 N  N   . TRP I  1 54 ? -6.128  0.015   134.280 1.00 19.95 ? 54   TRP I N   1 
ATOM   6343 C  CA  . TRP I  1 54 ? -4.683  0.053   134.411 1.00 21.13 ? 54   TRP I CA  1 
ATOM   6344 C  C   . TRP I  1 54 ? -4.059  0.764   133.210 1.00 20.35 ? 54   TRP I C   1 
ATOM   6345 O  O   . TRP I  1 54 ? -3.114  1.541   133.362 1.00 17.65 ? 54   TRP I O   1 
ATOM   6346 C  CB  . TRP I  1 54 ? -4.107  -1.353  134.524 1.00 18.64 ? 54   TRP I CB  1 
ATOM   6347 C  CG  . TRP I  1 54 ? -3.973  -1.846  135.956 1.00 19.83 ? 54   TRP I CG  1 
ATOM   6348 C  CD1 . TRP I  1 54 ? -4.604  -2.918  136.510 1.00 18.89 ? 54   TRP I CD1 1 
ATOM   6349 C  CD2 . TRP I  1 54 ? -3.137  -1.298  136.991 1.00 19.15 ? 54   TRP I CD2 1 
ATOM   6350 N  NE1 . TRP I  1 54 ? -4.230  -3.067  137.822 1.00 19.05 ? 54   TRP I NE1 1 
ATOM   6351 C  CE2 . TRP I  1 54 ? -3.314  -2.098  138.143 1.00 19.63 ? 54   TRP I CE2 1 
ATOM   6352 C  CE3 . TRP I  1 54 ? -2.258  -0.215  137.060 1.00 19.69 ? 54   TRP I CE3 1 
ATOM   6353 C  CZ2 . TRP I  1 54 ? -2.645  -1.844  139.346 1.00 18.84 ? 54   TRP I CZ2 1 
ATOM   6354 C  CZ3 . TRP I  1 54 ? -1.582  0.032   138.256 1.00 18.51 ? 54   TRP I CZ3 1 
ATOM   6355 C  CH2 . TRP I  1 54 ? -1.792  -0.768  139.383 1.00 19.61 ? 54   TRP I CH2 1 
ATOM   6356 N  N   . PHE I  1 55 ? -4.583  0.498   132.016 1.00 17.91 ? 55   PHE I N   1 
ATOM   6357 C  CA  . PHE I  1 55 ? -3.988  1.087   130.807 1.00 20.70 ? 55   PHE I CA  1 
ATOM   6358 C  C   . PHE I  1 55 ? -4.096  2.609   130.838 1.00 19.81 ? 55   PHE I C   1 
ATOM   6359 O  O   . PHE I  1 55 ? -3.126  3.299   130.524 1.00 20.51 ? 55   PHE I O   1 
ATOM   6360 C  CB  . PHE I  1 55 ? -4.613  0.546   129.508 1.00 21.02 ? 55   PHE I CB  1 
ATOM   6361 C  CG  . PHE I  1 55 ? -3.830  0.931   128.265 1.00 20.69 ? 55   PHE I CG  1 
ATOM   6362 C  CD1 . PHE I  1 55 ? -2.767  0.159   127.833 1.00 21.83 ? 55   PHE I CD1 1 
ATOM   6363 C  CD2 . PHE I  1 55 ? -4.123  2.093   127.581 1.00 22.61 ? 55   PHE I CD2 1 
ATOM   6364 C  CE1 . PHE I  1 55 ? -2.017  0.515   126.710 1.00 21.50 ? 55   PHE I CE1 1 
ATOM   6365 C  CE2 . PHE I  1 55 ? -3.356  2.471   126.442 1.00 22.14 ? 55   PHE I CE2 1 
ATOM   6366 C  CZ  . PHE I  1 55 ? -2.318  1.671   126.029 1.00 23.58 ? 55   PHE I CZ  1 
ATOM   6367 N  N   . LYS I  1 56 ? -5.247  3.122   131.259 1.00 20.66 ? 56   LYS I N   1 
ATOM   6368 C  CA  . LYS I  1 56 ? -5.445  4.560   131.338 1.00 24.35 ? 56   LYS I CA  1 
ATOM   6369 C  C   . LYS I  1 56 ? -4.544  5.199   132.389 1.00 23.91 ? 56   LYS I C   1 
ATOM   6370 O  O   . LYS I  1 56 ? -3.966  6.262   132.164 1.00 22.71 ? 56   LYS I O   1 
ATOM   6371 C  CB  . LYS I  1 56 ? -6.902  4.894   131.632 1.00 27.59 ? 56   LYS I CB  1 
ATOM   6372 C  CG  . LYS I  1 56 ? -7.171  6.372   131.557 1.00 31.88 ? 56   LYS I CG  1 
ATOM   6373 C  CD  . LYS I  1 56 ? -8.624  6.680   131.852 1.00 35.14 ? 56   LYS I CD  1 
ATOM   6374 C  CE  . LYS I  1 56 ? -8.974  8.099   131.425 1.00 38.33 ? 56   LYS I CE  1 
ATOM   6375 N  NZ  . LYS I  1 56 ? -10.217 8.506   132.159 1.00 41.69 ? 56   LYS I NZ  1 
ATOM   6376 N  N   . GLU I  1 57 ? -4.389  4.516   133.519 1.00 21.48 ? 57   GLU I N   1 
ATOM   6377 C  CA  . GLU I  1 57 ? -3.504  4.991   134.585 1.00 23.83 ? 57   GLU I CA  1 
ATOM   6378 C  C   . GLU I  1 57 ? -2.023  5.012   134.135 1.00 21.75 ? 57   GLU I C   1 
ATOM   6379 O  O   . GLU I  1 57 ? -1.267  5.931   134.451 1.00 21.10 ? 57   GLU I O   1 
ATOM   6380 C  CB  . GLU I  1 57 ? -3.742  4.101   135.799 1.00 26.45 ? 57   GLU I CB  1 
ATOM   6381 C  CG  . GLU I  1 57 ? -2.866  4.427   136.977 1.00 33.22 ? 57   GLU I CG  1 
ATOM   6382 C  CD  . GLU I  1 57 ? -3.231  3.603   138.189 1.00 34.32 ? 57   GLU I CD  1 
ATOM   6383 O  OE1 . GLU I  1 57 ? -4.387  3.106   138.250 1.00 34.76 ? 57   GLU I OE1 1 
ATOM   6384 O  OE2 . GLU I  1 57 ? -2.347  3.488   139.063 1.00 37.20 ? 57   GLU I OE2 1 
ATOM   6385 N  N   . LEU I  1 58 ? -1.619  4.007   133.376 1.00 17.89 ? 58   LEU I N   1 
ATOM   6386 C  CA  . LEU I  1 58 ? -0.230  3.847   132.964 1.00 15.90 ? 58   LEU I CA  1 
ATOM   6387 C  C   . LEU I  1 58 ? 0.175   4.661   131.736 1.00 17.12 ? 58   LEU I C   1 
ATOM   6388 O  O   . LEU I  1 58 ? 1.365   5.019   131.604 1.00 16.79 ? 58   LEU I O   1 
ATOM   6389 C  CB  . LEU I  1 58 ? 0.146   2.378   132.722 1.00 15.92 ? 58   LEU I CB  1 
ATOM   6390 C  CG  . LEU I  1 58 ? -0.002  1.441   133.946 1.00 14.84 ? 58   LEU I CG  1 
ATOM   6391 C  CD1 . LEU I  1 58 ? 0.322   0.020   133.496 1.00 18.47 ? 58   LEU I CD1 1 
ATOM   6392 C  CD2 . LEU I  1 58 ? 0.880   1.879   135.107 1.00 13.91 ? 58   LEU I CD2 1 
ATOM   6393 N  N   . ASP I  1 59 ? -0.762  4.911   130.820 1.00 14.89 ? 59   ASP I N   1 
ATOM   6394 C  CA  . ASP I  1 59 ? -0.378  5.624   129.602 1.00 15.04 ? 59   ASP I CA  1 
ATOM   6395 C  C   . ASP I  1 59 ? -0.284  7.124   129.855 1.00 15.97 ? 59   ASP I C   1 
ATOM   6396 O  O   . ASP I  1 59 ? -1.178  7.888   129.489 1.00 16.93 ? 59   ASP I O   1 
ATOM   6397 C  CB  . ASP I  1 59 ? -1.338  5.278   128.478 1.00 15.07 ? 59   ASP I CB  1 
ATOM   6398 C  CG  . ASP I  1 59 ? -0.912  5.862   127.163 1.00 17.14 ? 59   ASP I CG  1 
ATOM   6399 O  OD1 . ASP I  1 59 ? 0.268   6.317   127.085 1.00 18.10 ? 59   ASP I OD1 1 
ATOM   6400 O  OD2 . ASP I  1 59 ? -1.684  5.846   126.176 1.00 16.55 ? 59   ASP I OD2 1 
ATOM   6401 N  N   . ILE I  1 60 ? 0.807   7.557   130.483 1.00 15.85 ? 60   ILE I N   1 
ATOM   6402 C  CA  . ILE I  1 60 ? 0.879   8.934   130.987 1.00 16.06 ? 60   ILE I CA  1 
ATOM   6403 C  C   . ILE I  1 60 ? 0.841   9.958   129.844 1.00 17.07 ? 60   ILE I C   1 
ATOM   6404 O  O   . ILE I  1 60 ? 0.282   11.031  129.993 1.00 15.78 ? 60   ILE I O   1 
ATOM   6405 C  CB  . ILE I  1 60 ? 2.186   9.105   131.800 1.00 15.82 ? 60   ILE I CB  1 
ATOM   6406 C  CG1 . ILE I  1 60 ? 2.122   8.215   133.072 1.00 18.89 ? 60   ILE I CG1 1 
ATOM   6407 C  CG2 . ILE I  1 60 ? 2.511   10.543  132.097 1.00 18.58 ? 60   ILE I CG2 1 
ATOM   6408 C  CD1 . ILE I  1 60 ? 0.836   8.366   133.919 1.00 20.00 ? 60   ILE I CD1 1 
ATOM   6409 N  N   . ASN I  1 61 ? 1.453   9.637   128.720 1.00 14.05 ? 61   ASN I N   1 
ATOM   6410 C  CA  . ASN I  1 61 ? 1.505   10.605  127.598 1.00 16.83 ? 61   ASN I CA  1 
ATOM   6411 C  C   . ASN I  1 61 ? 0.378   10.390  126.580 1.00 18.23 ? 61   ASN I C   1 
ATOM   6412 O  O   . ASN I  1 61 ? 0.366   11.039  125.534 1.00 19.54 ? 61   ASN I O   1 
ATOM   6413 C  CB  . ASN I  1 61 ? 2.866   10.577  126.872 1.00 14.36 ? 61   ASN I CB  1 
ATOM   6414 C  CG  . ASN I  1 61 ? 3.121   9.266   126.177 1.00 18.70 ? 61   ASN I CG  1 
ATOM   6415 O  OD1 . ASN I  1 61 ? 2.611   8.231   126.602 1.00 18.79 ? 61   ASN I OD1 1 
ATOM   6416 N  ND2 . ASN I  1 61 ? 3.882   9.303   125.095 1.00 15.67 ? 61   ASN I ND2 1 
ATOM   6417 N  N   . THR I  1 62 ? -0.611  9.560   126.931 1.00 19.31 ? 62   THR I N   1 
ATOM   6418 C  CA  . THR I  1 62 ? -1.745  9.195   126.063 1.00 18.67 ? 62   THR I CA  1 
ATOM   6419 C  C   . THR I  1 62 ? -1.407  8.978   124.585 1.00 20.34 ? 62   THR I C   1 
ATOM   6420 O  O   . THR I  1 62 ? -2.033  9.564   123.669 1.00 19.95 ? 62   THR I O   1 
ATOM   6421 C  CB  . THR I  1 62 ? -2.906  10.185  126.219 1.00 20.47 ? 62   THR I CB  1 
ATOM   6422 O  OG1 . THR I  1 62 ? -2.398  11.519  126.081 1.00 20.86 ? 62   THR I OG1 1 
ATOM   6423 C  CG2 . THR I  1 62 ? -3.422  10.135  127.627 1.00 21.05 ? 62   THR I CG2 1 
ATOM   6424 N  N   . ASP I  1 63 ? -0.387  8.160   124.350 1.00 17.38 ? 63   ASP I N   1 
ATOM   6425 C  CA  . ASP I  1 63 ? -0.027  7.784   123.003 1.00 16.76 ? 63   ASP I CA  1 
ATOM   6426 C  C   . ASP I  1 63 ? -0.500  6.377   122.609 1.00 18.90 ? 63   ASP I C   1 
ATOM   6427 O  O   . ASP I  1 63 ? -0.172  5.897   121.510 1.00 19.50 ? 63   ASP I O   1 
ATOM   6428 C  CB  . ASP I  1 63 ? 1.481   7.941   122.779 1.00 18.20 ? 63   ASP I CB  1 
ATOM   6429 C  CG  . ASP I  1 63 ? 2.302   6.918   123.533 1.00 18.98 ? 63   ASP I CG  1 
ATOM   6430 O  OD1 . ASP I  1 63 ? 1.765   6.215   124.415 1.00 13.82 ? 63   ASP I OD1 1 
ATOM   6431 O  OD2 . ASP I  1 63 ? 3.524   6.733   123.289 1.00 23.36 ? 63   ASP I OD2 1 
ATOM   6432 N  N   . GLY I  1 64 ? -1.301  5.735   123.466 1.00 16.34 ? 64   GLY I N   1 
ATOM   6433 C  CA  . GLY I  1 64 ? -1.867  4.423   123.178 1.00 17.24 ? 64   GLY I CA  1 
ATOM   6434 C  C   . GLY I  1 64 ? -0.907  3.245   123.354 1.00 18.50 ? 64   GLY I C   1 
ATOM   6435 O  O   . GLY I  1 64 ? -1.126  2.140   122.851 1.00 15.31 ? 64   GLY I O   1 
ATOM   6436 N  N   . ALA I  1 65 ? 0.146   3.451   124.126 1.00 18.59 ? 65   ALA I N   1 
ATOM   6437 C  CA  . ALA I  1 65 ? 0.943   2.324   124.565 1.00 18.61 ? 65   ALA I CA  1 
ATOM   6438 C  C   . ALA I  1 65 ? 1.530   2.606   125.929 1.00 18.17 ? 65   ALA I C   1 
ATOM   6439 O  O   . ALA I  1 65 ? 1.562   3.753   126.366 1.00 19.13 ? 65   ALA I O   1 
ATOM   6440 C  CB  . ALA I  1 65 ? 2.065   2.093   123.619 1.00 19.61 ? 65   ALA I CB  1 
ATOM   6441 N  N   . VAL I  1 66 ? 2.025   1.546   126.557 1.00 17.19 ? 66   VAL I N   1 
ATOM   6442 C  CA  . VAL I  1 66 ? 2.791   1.616   127.802 1.00 16.64 ? 66   VAL I CA  1 
ATOM   6443 C  C   . VAL I  1 66 ? 4.279   1.370   127.455 1.00 16.05 ? 66   VAL I C   1 
ATOM   6444 O  O   . VAL I  1 66 ? 4.628   0.297   126.970 1.00 16.97 ? 66   VAL I O   1 
ATOM   6445 C  CB  . VAL I  1 66 ? 2.272   0.543   128.760 1.00 13.67 ? 66   VAL I CB  1 
ATOM   6446 C  CG1 . VAL I  1 66 ? 3.142   0.426   130.012 1.00 13.27 ? 66   VAL I CG1 1 
ATOM   6447 C  CG2 . VAL I  1 66 ? 0.784   0.887   129.160 1.00 18.01 ? 66   VAL I CG2 1 
ATOM   6448 N  N   . ASN I  1 67 ? 5.136   2.377   127.643 1.00 14.79 ? 67   ASN I N   1 
ATOM   6449 C  CA  . ASN I  1 67 ? 6.583   2.173   127.484 1.00 16.40 ? 67   ASN I CA  1 
ATOM   6450 C  C   . ASN I  1 67 ? 7.185   1.663   128.796 1.00 16.93 ? 67   ASN I C   1 
ATOM   6451 O  O   . ASN I  1 67 ? 6.474   1.421   129.774 1.00 16.09 ? 67   ASN I O   1 
ATOM   6452 C  CB  . ASN I  1 67 ? 7.302   3.436   126.965 1.00 13.91 ? 67   ASN I CB  1 
ATOM   6453 C  CG  . ASN I  1 67 ? 7.273   4.601   127.959 1.00 16.35 ? 67   ASN I CG  1 
ATOM   6454 O  OD1 . ASN I  1 67 ? 7.061   4.424   129.172 1.00 17.82 ? 67   ASN I OD1 1 
ATOM   6455 N  ND2 . ASN I  1 67 ? 7.464   5.817   127.454 1.00 19.35 ? 67   ASN I ND2 1 
ATOM   6456 N  N   . PHE I  1 68 ? 8.489   1.440   128.822 1.00 16.70 ? 68   PHE I N   1 
ATOM   6457 C  CA  . PHE I  1 68 ? 9.038   0.792   130.008 1.00 17.73 ? 68   PHE I CA  1 
ATOM   6458 C  C   . PHE I  1 68 ? 8.953   1.668   131.242 1.00 17.47 ? 68   PHE I C   1 
ATOM   6459 O  O   . PHE I  1 68 ? 8.643   1.173   132.326 1.00 17.57 ? 68   PHE I O   1 
ATOM   6460 C  CB  . PHE I  1 68 ? 10.480  0.381   129.771 1.00 17.41 ? 68   PHE I CB  1 
ATOM   6461 C  CG  . PHE I  1 68 ? 11.083  -0.332  130.924 1.00 17.82 ? 68   PHE I CG  1 
ATOM   6462 C  CD1 . PHE I  1 68 ? 10.673  -1.624  131.254 1.00 14.84 ? 68   PHE I CD1 1 
ATOM   6463 C  CD2 . PHE I  1 68 ? 12.065  0.285   131.686 1.00 20.30 ? 68   PHE I CD2 1 
ATOM   6464 C  CE1 . PHE I  1 68 ? 11.220  -2.304  132.315 1.00 19.25 ? 68   PHE I CE1 1 
ATOM   6465 C  CE2 . PHE I  1 68 ? 12.606  -0.388  132.773 1.00 20.88 ? 68   PHE I CE2 1 
ATOM   6466 C  CZ  . PHE I  1 68 ? 12.185  -1.686  133.077 1.00 20.25 ? 68   PHE I CZ  1 
ATOM   6467 N  N   . GLN I  1 69 ? 9.252   2.957   131.104 1.00 17.81 ? 69   GLN I N   1 
ATOM   6468 C  CA  . GLN I  1 69 ? 9.142   3.813   132.296 1.00 21.26 ? 69   GLN I CA  1 
ATOM   6469 C  C   . GLN I  1 69 ? 7.705   3.878   132.839 1.00 19.99 ? 69   GLN I C   1 
ATOM   6470 O  O   . GLN I  1 69 ? 7.499   3.884   134.064 1.00 17.89 ? 69   GLN I O   1 
ATOM   6471 C  CB  . GLN I  1 69 ? 9.785   5.176   132.068 1.00 24.72 ? 69   GLN I CB  1 
ATOM   6472 C  CG  . GLN I  1 69 ? 9.079   6.008   131.005 1.00 31.61 ? 69   GLN I CG  1 
ATOM   6473 C  CD  . GLN I  1 69 ? 9.976   7.118   130.449 1.00 36.90 ? 69   GLN I CD  1 
ATOM   6474 O  OE1 . GLN I  1 69 ? 10.505  7.004   129.331 1.00 38.50 ? 69   GLN I OE1 1 
ATOM   6475 N  NE2 . GLN I  1 69 ? 10.159  8.182   131.237 1.00 38.16 ? 69   GLN I NE2 1 
ATOM   6476 N  N   . GLU I  1 70 ? 6.699   3.847   131.964 1.00 17.33 ? 70   GLU I N   1 
ATOM   6477 C  CA  . GLU I  1 70 ? 5.310   3.770   132.422 1.00 17.29 ? 70   GLU I CA  1 
ATOM   6478 C  C   . GLU I  1 70 ? 5.041   2.410   133.090 1.00 16.89 ? 70   GLU I C   1 
ATOM   6479 O  O   . GLU I  1 70 ? 4.358   2.346   134.093 1.00 17.27 ? 70   GLU I O   1 
ATOM   6480 C  CB  . GLU I  1 70 ? 4.366   3.936   131.238 1.00 15.59 ? 70   GLU I CB  1 
ATOM   6481 C  CG  . GLU I  1 70 ? 4.348   5.356   130.702 1.00 15.50 ? 70   GLU I CG  1 
ATOM   6482 C  CD  . GLU I  1 70 ? 3.690   5.514   129.319 1.00 17.14 ? 70   GLU I CD  1 
ATOM   6483 O  OE1 . GLU I  1 70 ? 3.766   4.612   128.453 1.00 17.33 ? 70   GLU I OE1 1 
ATOM   6484 O  OE2 . GLU I  1 70 ? 3.171   6.620   129.066 1.00 14.99 ? 70   GLU I OE2 1 
ATOM   6485 N  N   . PHE I  1 71 ? 5.533   1.321   132.503 1.00 14.38 ? 71   PHE I N   1 
ATOM   6486 C  CA  . PHE I  1 71 ? 5.485   -0.005  133.120 1.00 12.93 ? 71   PHE I CA  1 
ATOM   6487 C  C   . PHE I  1 71 ? 6.004   -0.012  134.553 1.00 14.99 ? 71   PHE I C   1 
ATOM   6488 O  O   . PHE I  1 71 ? 5.425   -0.682  135.414 1.00 16.25 ? 71   PHE I O   1 
ATOM   6489 C  CB  . PHE I  1 71 ? 6.275   -1.035  132.243 1.00 16.31 ? 71   PHE I CB  1 
ATOM   6490 C  CG  . PHE I  1 71 ? 6.444   -2.400  132.896 1.00 17.00 ? 71   PHE I CG  1 
ATOM   6491 C  CD1 . PHE I  1 71 ? 5.350   -3.229  133.091 1.00 16.72 ? 71   PHE I CD1 1 
ATOM   6492 C  CD2 . PHE I  1 71 ? 7.712   -2.878  133.233 1.00 18.89 ? 71   PHE I CD2 1 
ATOM   6493 C  CE1 . PHE I  1 71 ? 5.513   -4.543  133.667 1.00 18.69 ? 71   PHE I CE1 1 
ATOM   6494 C  CE2 . PHE I  1 71 ? 7.905   -4.182  133.778 1.00 18.12 ? 71   PHE I CE2 1 
ATOM   6495 C  CZ  . PHE I  1 71 ? 6.799   -5.000  134.009 1.00 18.20 ? 71   PHE I CZ  1 
ATOM   6496 N  N   . LEU I  1 72 ? 7.018   0.796   134.862 1.00 14.85 ? 72   LEU I N   1 
ATOM   6497 C  CA  . LEU I  1 72 ? 7.626   0.784   136.186 1.00 15.49 ? 72   LEU I CA  1 
ATOM   6498 C  C   . LEU I  1 72 ? 6.649   1.320   137.215 1.00 16.99 ? 72   LEU I C   1 
ATOM   6499 O  O   . LEU I  1 72 ? 6.776   1.046   138.397 1.00 16.95 ? 72   LEU I O   1 
ATOM   6500 C  CB  . LEU I  1 72 ? 8.876   1.630   136.237 1.00 17.10 ? 72   LEU I CB  1 
ATOM   6501 C  CG  . LEU I  1 72 ? 10.053  0.915   135.533 1.00 17.10 ? 72   LEU I CG  1 
ATOM   6502 C  CD1 . LEU I  1 72 ? 11.190  1.908   135.539 1.00 22.46 ? 72   LEU I CD1 1 
ATOM   6503 C  CD2 . LEU I  1 72 ? 10.513  -0.397  136.222 1.00 19.08 ? 72   LEU I CD2 1 
ATOM   6504 N  N   . ILE I  1 73 ? 5.671   2.089   136.763 1.00 16.81 ? 73   ILE I N   1 
ATOM   6505 C  CA  . ILE I  1 73 ? 4.622   2.522   137.677 1.00 17.05 ? 73   ILE I CA  1 
ATOM   6506 C  C   . ILE I  1 73 ? 3.838   1.306   138.214 1.00 15.41 ? 73   ILE I C   1 
ATOM   6507 O  O   . ILE I  1 73 ? 3.528   1.239   139.424 1.00 15.13 ? 73   ILE I O   1 
ATOM   6508 C  CB  . ILE I  1 73 ? 3.665   3.438   136.945 1.00 17.46 ? 73   ILE I CB  1 
ATOM   6509 C  CG1 . ILE I  1 73 ? 4.344   4.760   136.594 1.00 16.65 ? 73   ILE I CG1 1 
ATOM   6510 C  CG2 . ILE I  1 73 ? 2.457   3.726   137.793 1.00 15.97 ? 73   ILE I CG2 1 
ATOM   6511 C  CD1 . ILE I  1 73 ? 3.418   5.624   135.686 1.00 18.64 ? 73   ILE I CD1 1 
ATOM   6512 N  N   . LEU I  1 74 ? 3.424   0.435   137.281 1.00 13.46 ? 74   LEU I N   1 
ATOM   6513 C  CA  . LEU I  1 74 ? 2.817   -0.843  137.634 1.00 15.85 ? 74   LEU I CA  1 
ATOM   6514 C  C   . LEU I  1 74 ? 3.726   -1.640  138.588 1.00 17.66 ? 74   LEU I C   1 
ATOM   6515 O  O   . LEU I  1 74 ? 3.249   -2.177  139.582 1.00 16.05 ? 74   LEU I O   1 
ATOM   6516 C  CB  . LEU I  1 74 ? 2.431   -1.636  136.366 1.00 18.01 ? 74   LEU I CB  1 
ATOM   6517 C  CG  . LEU I  1 74 ? 1.853   -3.039  136.656 1.00 19.48 ? 74   LEU I CG  1 
ATOM   6518 C  CD1 . LEU I  1 74 ? 0.568   -2.952  137.434 1.00 18.27 ? 74   LEU I CD1 1 
ATOM   6519 C  CD2 . LEU I  1 74 ? 1.675   -3.840  135.337 1.00 17.93 ? 74   LEU I CD2 1 
ATOM   6520 N  N   . VAL I  1 75 ? 5.029   -1.714  138.303 1.00 16.62 ? 75   VAL I N   1 
ATOM   6521 C  CA  . VAL I  1 75 ? 5.952   -2.497  139.147 1.00 17.01 ? 75   VAL I CA  1 
ATOM   6522 C  C   . VAL I  1 75 ? 5.980   -1.940  140.588 1.00 18.07 ? 75   VAL I C   1 
ATOM   6523 O  O   . VAL I  1 75 ? 5.958   -2.690  141.585 1.00 16.13 ? 75   VAL I O   1 
ATOM   6524 C  CB  . VAL I  1 75 ? 7.371   -2.532  138.557 1.00 19.19 ? 75   VAL I CB  1 
ATOM   6525 C  CG1 . VAL I  1 75 ? 8.279   -3.342  139.487 1.00 20.01 ? 75   VAL I CG1 1 
ATOM   6526 C  CG2 . VAL I  1 75 ? 7.354   -3.153  137.138 1.00 18.08 ? 75   VAL I CG2 1 
ATOM   6527 N  N   . ILE I  1 76 ? 6.002   -0.616  140.692 1.00 16.84 ? 76   ILE I N   1 
ATOM   6528 C  CA  . ILE I  1 76 ? 6.040   0.016   142.006 1.00 15.50 ? 76   ILE I CA  1 
ATOM   6529 C  C   . ILE I  1 76 ? 4.774   -0.283  142.803 1.00 15.72 ? 76   ILE I C   1 
ATOM   6530 O  O   . ILE I  1 76 ? 4.854   -0.607  143.975 1.00 15.85 ? 76   ILE I O   1 
ATOM   6531 C  CB  . ILE I  1 76 ? 6.204   1.527   141.846 1.00 16.76 ? 76   ILE I CB  1 
ATOM   6532 C  CG1 . ILE I  1 76 ? 7.611   1.831   141.419 1.00 14.98 ? 76   ILE I CG1 1 
ATOM   6533 C  CG2 . ILE I  1 76 ? 5.951   2.281   143.151 1.00 16.00 ? 76   ILE I CG2 1 
ATOM   6534 C  CD1 . ILE I  1 76 ? 7.746   3.284   140.961 1.00 19.15 ? 76   ILE I CD1 1 
ATOM   6535 N  N   . LYS I  1 77 ? 3.627   -0.116  142.153 1.00 15.84 ? 77   LYS I N   1 
ATOM   6536 C  CA  . LYS I  1 77 ? 2.331   -0.297  142.781 1.00 19.69 ? 77   LYS I CA  1 
ATOM   6537 C  C   . LYS I  1 77 ? 2.168   -1.752  143.197 1.00 17.85 ? 77   LYS I C   1 
ATOM   6538 O  O   . LYS I  1 77 ? 1.659   -2.021  144.282 1.00 17.76 ? 77   LYS I O   1 
ATOM   6539 C  CB  . LYS I  1 77 ? 1.208   0.188   141.850 1.00 20.31 ? 77   LYS I CB  1 
ATOM   6540 C  CG  . LYS I  1 77 ? 1.129   1.754   141.919 1.00 21.13 ? 77   LYS I CG  1 
ATOM   6541 C  CD  . LYS I  1 77 ? -0.057  2.382   141.220 1.00 24.94 ? 77   LYS I CD  1 
ATOM   6542 C  CE  . LYS I  1 77 ? 0.059   3.925   141.219 1.00 26.00 ? 77   LYS I CE  1 
ATOM   6543 N  NZ  . LYS I  1 77 ? 0.113   4.503   142.597 1.00 32.23 ? 77   LYS I NZ  1 
ATOM   6544 N  N   . MET I  1 78 ? 2.589   -2.672  142.331 1.00 18.86 ? 78   MET I N   1 
ATOM   6545 C  CA  . MET I  1 78 ? 2.532   -4.096  142.672 1.00 18.86 ? 78   MET I CA  1 
ATOM   6546 C  C   . MET I  1 78 ? 3.402   -4.448  143.868 1.00 18.64 ? 78   MET I C   1 
ATOM   6547 O  O   . MET I  1 78 ? 2.976   -5.203  144.737 1.00 17.05 ? 78   MET I O   1 
ATOM   6548 C  CB  . MET I  1 78 ? 2.938   -4.958  141.468 1.00 18.54 ? 78   MET I CB  1 
ATOM   6549 C  CG  . MET I  1 78 ? 1.867   -5.005  140.387 1.00 19.95 ? 78   MET I CG  1 
ATOM   6550 S  SD  . MET I  1 78 ? 2.421   -6.081  139.045 1.00 25.01 ? 78   MET I SD  1 
ATOM   6551 C  CE  . MET I  1 78 ? 2.914   -7.575  139.933 1.00 15.87 ? 78   MET I CE  1 
ATOM   6552 N  N   . GLY I  1 79 ? 4.622   -3.915  143.879 1.00 18.02 ? 79   GLY I N   1 
ATOM   6553 C  CA  . GLY I  1 79 ? 5.586   -4.142  144.970 1.00 18.78 ? 79   GLY I CA  1 
ATOM   6554 C  C   . GLY I  1 79 ? 5.055   -3.592  146.285 1.00 17.58 ? 79   GLY I C   1 
ATOM   6555 O  O   . GLY I  1 79 ? 5.065   -4.264  147.313 1.00 17.55 ? 79   GLY I O   1 
ATOM   6556 N  N   . VAL I  1 80 ? 4.568   -2.363  146.259 1.00 17.09 ? 80   VAL I N   1 
ATOM   6557 C  CA  . VAL I  1 80 ? 3.968   -1.782  147.467 1.00 18.43 ? 80   VAL I CA  1 
ATOM   6558 C  C   . VAL I  1 80 ? 2.782   -2.623  147.964 1.00 17.40 ? 80   VAL I C   1 
ATOM   6559 O  O   . VAL I  1 80 ? 2.682   -2.945  149.154 1.00 17.70 ? 80   VAL I O   1 
ATOM   6560 C  CB  . VAL I  1 80 ? 3.565   -0.344  147.207 1.00 19.37 ? 80   VAL I CB  1 
ATOM   6561 C  CG1 . VAL I  1 80 ? 2.676   0.210   148.370 1.00 20.32 ? 80   VAL I CG1 1 
ATOM   6562 C  CG2 . VAL I  1 80 ? 4.833   0.508   147.002 1.00 16.35 ? 80   VAL I CG2 1 
ATOM   6563 N  N   . ALA I  1 81 ? 1.894   -3.016  147.056 1.00 18.19 ? 81   ALA I N   1 
ATOM   6564 C  CA  . ALA I  1 81 ? 0.772   -3.855  147.460 1.00 15.84 ? 81   ALA I CA  1 
ATOM   6565 C  C   . ALA I  1 81 ? 1.192   -5.234  148.046 1.00 17.76 ? 81   ALA I C   1 
ATOM   6566 O  O   . ALA I  1 81 ? 0.703   -5.661  149.094 1.00 17.64 ? 81   ALA I O   1 
ATOM   6567 C  CB  . ALA I  1 81 ? -0.206  -4.028  146.309 1.00 15.85 ? 81   ALA I CB  1 
ATOM   6568 N  N   . ALA I  1 82 ? 2.138   -5.893  147.393 1.00 17.32 ? 82   ALA I N   1 
ATOM   6569 C  CA  . ALA I  1 82 ? 2.656   -7.197  147.819 1.00 17.31 ? 82   ALA I CA  1 
ATOM   6570 C  C   . ALA I  1 82 ? 3.343   -7.103  149.188 1.00 18.99 ? 82   ALA I C   1 
ATOM   6571 O  O   . ALA I  1 82 ? 3.251   -8.027  150.001 1.00 20.51 ? 82   ALA I O   1 
ATOM   6572 C  CB  . ALA I  1 82 ? 3.624   -7.729  146.774 1.00 16.85 ? 82   ALA I CB  1 
ATOM   6573 N  N   . HIS I  1 83 ? 4.014   -5.982  149.446 1.00 16.56 ? 83   HIS I N   1 
ATOM   6574 C  CA  . HIS I  1 83 ? 4.711   -5.820  150.718 1.00 19.43 ? 83   HIS I CA  1 
ATOM   6575 C  C   . HIS I  1 83 ? 3.656   -5.686  151.799 1.00 21.38 ? 83   HIS I C   1 
ATOM   6576 O  O   . HIS I  1 83 ? 3.742   -6.340  152.830 1.00 22.36 ? 83   HIS I O   1 
ATOM   6577 C  CB  . HIS I  1 83 ? 5.620   -4.586  150.723 1.00 20.10 ? 83   HIS I CB  1 
ATOM   6578 C  CG  . HIS I  1 83 ? 6.107   -4.246  152.093 1.00 19.41 ? 83   HIS I CG  1 
ATOM   6579 N  ND1 . HIS I  1 83 ? 5.491   -3.294  152.877 1.00 18.36 ? 83   HIS I ND1 1 
ATOM   6580 C  CD2 . HIS I  1 83 ? 7.062   -4.821  152.865 1.00 19.84 ? 83   HIS I CD2 1 
ATOM   6581 C  CE1 . HIS I  1 83 ? 6.107   -3.236  154.046 1.00 18.38 ? 83   HIS I CE1 1 
ATOM   6582 N  NE2 . HIS I  1 83 ? 7.041   -4.174  154.079 1.00 18.25 ? 83   HIS I NE2 1 
ATOM   6583 N  N   . LYS I  1 84 ? 2.640   -4.867  151.554 1.00 24.00 ? 84   LYS I N   1 
ATOM   6584 C  CA  . LYS I  1 84 ? 1.498   -4.765  152.468 1.00 28.61 ? 84   LYS I CA  1 
ATOM   6585 C  C   . LYS I  1 84 ? 0.879   -6.125  152.812 1.00 30.52 ? 84   LYS I C   1 
ATOM   6586 O  O   . LYS I  1 84 ? 0.574   -6.395  153.988 1.00 29.52 ? 84   LYS I O   1 
ATOM   6587 C  CB  . LYS I  1 84 ? 0.397   -3.909  151.844 1.00 32.08 ? 84   LYS I CB  1 
ATOM   6588 C  CG  . LYS I  1 84 ? 0.155   -2.575  152.492 1.00 37.70 ? 84   LYS I CG  1 
ATOM   6589 C  CD  . LYS I  1 84 ? -0.939  -1.820  151.742 1.00 41.74 ? 84   LYS I CD  1 
ATOM   6590 C  CE  . LYS I  1 84 ? -1.795  -0.999  152.706 1.00 44.97 ? 84   LYS I CE  1 
ATOM   6591 N  NZ  . LYS I  1 84 ? -2.524  0.149   152.056 1.00 46.59 ? 84   LYS I NZ  1 
ATOM   6592 N  N   . LYS I  1 85 ? 0.641   -6.950  151.790 1.00 32.20 ? 85   LYS I N   1 
ATOM   6593 C  CA  . LYS I  1 85 ? 0.086   -8.301  151.984 1.00 35.95 ? 85   LYS I CA  1 
ATOM   6594 C  C   . LYS I  1 85 ? 1.007   -9.191  152.802 1.00 37.37 ? 85   LYS I C   1 
ATOM   6595 O  O   . LYS I  1 85 ? 0.545   -9.919  153.674 1.00 37.72 ? 85   LYS I O   1 
ATOM   6596 C  CB  . LYS I  1 85 ? -0.179  -9.014  150.658 1.00 37.85 ? 85   LYS I CB  1 
ATOM   6597 C  CG  . LYS I  1 85 ? -1.146  -8.317  149.733 1.00 41.30 ? 85   LYS I CG  1 
ATOM   6598 C  CD  . LYS I  1 85 ? -2.593  -8.676  150.017 1.00 43.82 ? 85   LYS I CD  1 
ATOM   6599 C  CE  . LYS I  1 85 ? -3.533  -7.795  149.193 1.00 45.28 ? 85   LYS I CE  1 
ATOM   6600 N  NZ  . LYS I  1 85 ? -4.960  -8.021  149.575 1.00 47.34 ? 85   LYS I NZ  1 
ATOM   6601 N  N   . SER I  1 86 ? 2.303   -9.154  152.525 1.00 39.07 ? 86   SER I N   1 
ATOM   6602 C  CA  . SER I  1 86 ? 3.227   -10.056 153.205 1.00 43.22 ? 86   SER I CA  1 
ATOM   6603 C  C   . SER I  1 86 ? 3.306   -9.810  154.715 1.00 46.73 ? 86   SER I C   1 
ATOM   6604 O  O   . SER I  1 86 ? 3.855   -10.625 155.456 1.00 45.33 ? 86   SER I O   1 
ATOM   6605 C  CB  . SER I  1 86 ? 4.610   -10.074 152.549 1.00 44.28 ? 86   SER I CB  1 
ATOM   6606 O  OG  . SER I  1 86 ? 5.444   -9.045  153.044 1.00 47.47 ? 86   SER I OG  1 
ATOM   6607 N  N   . HIS I  1 87 ? 2.759   -8.698  155.189 1.00 50.54 ? 87   HIS I N   1 
ATOM   6608 C  CA  . HIS I  1 87 ? 2.442   -8.647  156.614 1.00 55.02 ? 87   HIS I CA  1 
ATOM   6609 C  C   . HIS I  1 87 ? 1.058   -8.054  156.884 1.00 56.51 ? 87   HIS I C   1 
ATOM   6610 O  O   . HIS I  1 87 ? 0.912   -7.044  157.563 1.00 58.03 ? 87   HIS I O   1 
ATOM   6611 C  CB  . HIS I  1 87 ? 3.579   -8.044  157.461 1.00 56.71 ? 87   HIS I CB  1 
ATOM   6612 C  CG  . HIS I  1 87 ? 3.689   -6.553  157.392 1.00 58.18 ? 87   HIS I CG  1 
ATOM   6613 N  ND1 . HIS I  1 87 ? 3.672   -5.857  156.205 1.00 58.15 ? 87   HIS I ND1 1 
ATOM   6614 C  CD2 . HIS I  1 87 ? 3.849   -5.629  158.370 1.00 58.57 ? 87   HIS I CD2 1 
ATOM   6615 C  CE1 . HIS I  1 87 ? 3.787   -4.563  156.456 1.00 59.27 ? 87   HIS I CE1 1 
ATOM   6616 N  NE2 . HIS I  1 87 ? 3.903   -4.399  157.762 1.00 59.01 ? 87   HIS I NE2 1 
ATOM   6617 N  N   . MET J  1 1  ? 26.606  27.970  124.959 1.00 44.62 ? 1    MET J N   1 
ATOM   6618 C  CA  . MET J  1 1  ? 25.240  28.514  124.741 1.00 44.14 ? 1    MET J CA  1 
ATOM   6619 C  C   . MET J  1 1  ? 24.215  27.403  124.613 1.00 38.19 ? 1    MET J C   1 
ATOM   6620 O  O   . MET J  1 1  ? 24.172  26.692  123.599 1.00 38.18 ? 1    MET J O   1 
ATOM   6621 C  CB  . MET J  1 1  ? 25.191  29.342  123.459 1.00 46.47 ? 1    MET J CB  1 
ATOM   6622 C  CG  . MET J  1 1  ? 25.180  30.840  123.675 1.00 50.19 ? 1    MET J CG  1 
ATOM   6623 S  SD  . MET J  1 1  ? 24.308  31.721  122.349 1.00 52.70 ? 1    MET J SD  1 
ATOM   6624 C  CE  . MET J  1 1  ? 25.069  31.057  120.865 1.00 52.33 ? 1    MET J CE  1 
ATOM   6625 N  N   . LEU J  1 2  ? 23.382  27.259  125.629 1.00 31.88 ? 2    LEU J N   1 
ATOM   6626 C  CA  . LEU J  1 2  ? 22.223  26.394  125.502 1.00 27.43 ? 2    LEU J CA  1 
ATOM   6627 C  C   . LEU J  1 2  ? 21.155  27.081  124.662 1.00 24.09 ? 2    LEU J C   1 
ATOM   6628 O  O   . LEU J  1 2  ? 21.011  28.309  124.688 1.00 24.12 ? 2    LEU J O   1 
ATOM   6629 C  CB  . LEU J  1 2  ? 21.660  26.075  126.882 1.00 26.57 ? 2    LEU J CB  1 
ATOM   6630 C  CG  . LEU J  1 2  ? 22.524  25.293  127.870 1.00 27.55 ? 2    LEU J CG  1 
ATOM   6631 C  CD1 . LEU J  1 2  ? 21.673  25.073  129.102 1.00 27.45 ? 2    LEU J CD1 1 
ATOM   6632 C  CD2 . LEU J  1 2  ? 22.975  23.952  127.299 1.00 27.28 ? 2    LEU J CD2 1 
ATOM   6633 N  N   . THR J  1 3  ? 20.413  26.290  123.899 1.00 22.66 ? 3    THR J N   1 
ATOM   6634 C  CA  . THR J  1 3  ? 19.310  26.803  123.098 1.00 19.55 ? 3    THR J CA  1 
ATOM   6635 C  C   . THR J  1 3  ? 18.149  27.152  124.009 1.00 19.48 ? 3    THR J C   1 
ATOM   6636 O  O   . THR J  1 3  ? 18.189  26.810  125.191 1.00 19.27 ? 3    THR J O   1 
ATOM   6637 C  CB  . THR J  1 3  ? 18.864  25.713  122.099 1.00 20.29 ? 3    THR J CB  1 
ATOM   6638 O  OG1 . THR J  1 3  ? 18.322  24.588  122.803 1.00 19.78 ? 3    THR J OG1 1 
ATOM   6639 C  CG2 . THR J  1 3  ? 20.069  25.104  121.400 1.00 18.21 ? 3    THR J CG2 1 
ATOM   6640 N  N   . GLU J  1 4  ? 17.127  27.798  123.444 1.00 17.18 ? 4    GLU J N   1 
ATOM   6641 C  CA  . GLU J  1 4  ? 15.916  28.141  124.192 1.00 19.00 ? 4    GLU J CA  1 
ATOM   6642 C  C   . GLU J  1 4  ? 15.188  26.870  124.627 1.00 18.55 ? 4    GLU J C   1 
ATOM   6643 O  O   . GLU J  1 4  ? 14.589  26.843  125.707 1.00 15.32 ? 4    GLU J O   1 
ATOM   6644 C  CB  . GLU J  1 4  ? 15.007  29.064  123.369 1.00 20.48 ? 4    GLU J CB  1 
ATOM   6645 C  CG  . GLU J  1 4  ? 15.539  30.493  123.224 1.00 20.82 ? 4    GLU J CG  1 
ATOM   6646 C  CD  . GLU J  1 4  ? 15.824  31.173  124.562 1.00 24.69 ? 4    GLU J CD  1 
ATOM   6647 O  OE1 . GLU J  1 4  ? 17.007  31.475  124.856 1.00 23.24 ? 4    GLU J OE1 1 
ATOM   6648 O  OE2 . GLU J  1 4  ? 14.867  31.330  125.361 1.00 24.31 ? 4    GLU J OE2 1 
ATOM   6649 N  N   . LEU J  1 5  ? 15.210  25.835  123.785 1.00 15.05 ? 5    LEU J N   1 
ATOM   6650 C  CA  . LEU J  1 5  ? 14.593  24.560  124.180 1.00 17.64 ? 5    LEU J CA  1 
ATOM   6651 C  C   . LEU J  1 5  ? 15.258  23.949  125.401 1.00 16.46 ? 5    LEU J C   1 
ATOM   6652 O  O   . LEU J  1 5  ? 14.578  23.531  126.345 1.00 14.71 ? 5    LEU J O   1 
ATOM   6653 C  CB  . LEU J  1 5  ? 14.661  23.525  123.041 1.00 17.86 ? 5    LEU J CB  1 
ATOM   6654 C  CG  . LEU J  1 5  ? 13.465  22.571  122.825 1.00 21.63 ? 5    LEU J CG  1 
ATOM   6655 C  CD1 . LEU J  1 5  ? 13.761  21.201  122.147 1.00 17.32 ? 5    LEU J CD1 1 
ATOM   6656 C  CD2 . LEU J  1 5  ? 12.498  22.482  123.938 1.00 15.43 ? 5    LEU J CD2 1 
ATOM   6657 N  N   . GLU J  1 6  ? 16.582  23.858  125.363 1.00 14.80 ? 6    GLU J N   1 
ATOM   6658 C  CA  . GLU J  1 6  ? 17.377  23.262  126.445 1.00 17.50 ? 6    GLU J CA  1 
ATOM   6659 C  C   . GLU J  1 6  ? 17.201  24.060  127.734 1.00 18.85 ? 6    GLU J C   1 
ATOM   6660 O  O   . GLU J  1 6  ? 16.997  23.494  128.823 1.00 17.28 ? 6    GLU J O   1 
ATOM   6661 C  CB  . GLU J  1 6  ? 18.853  23.147  126.044 1.00 17.97 ? 6    GLU J CB  1 
ATOM   6662 C  CG  . GLU J  1 6  ? 19.123  22.133  124.940 1.00 19.72 ? 6    GLU J CG  1 
ATOM   6663 C  CD  . GLU J  1 6  ? 20.454  22.313  124.230 1.00 20.22 ? 6    GLU J CD  1 
ATOM   6664 O  OE1 . GLU J  1 6  ? 20.904  21.364  123.534 1.00 20.55 ? 6    GLU J OE1 1 
ATOM   6665 O  OE2 . GLU J  1 6  ? 21.052  23.406  124.337 1.00 21.89 ? 6    GLU J OE2 1 
ATOM   6666 N  N   . LYS J  1 7  ? 17.199  25.379  127.618 1.00 17.99 ? 7    LYS J N   1 
ATOM   6667 C  CA  . LYS J  1 7  ? 16.873  26.225  128.779 1.00 18.72 ? 7    LYS J CA  1 
ATOM   6668 C  C   . LYS J  1 7  ? 15.461  26.028  129.352 1.00 17.72 ? 7    LYS J C   1 
ATOM   6669 O  O   . LYS J  1 7  ? 15.299  26.117  130.573 1.00 17.64 ? 7    LYS J O   1 
ATOM   6670 C  CB  . LYS J  1 7  ? 17.133  27.702  128.456 1.00 21.19 ? 7    LYS J CB  1 
ATOM   6671 C  CG  . LYS J  1 7  ? 18.619  28.007  128.295 1.00 24.49 ? 7    LYS J CG  1 
ATOM   6672 C  CD  . LYS J  1 7  ? 18.879  29.304  127.520 1.00 29.96 ? 7    LYS J CD  1 
ATOM   6673 C  CE  . LYS J  1 7  ? 18.201  30.507  128.142 1.00 33.41 ? 7    LYS J CE  1 
ATOM   6674 N  NZ  . LYS J  1 7  ? 18.498  31.778  127.387 1.00 37.23 ? 7    LYS J NZ  1 
ATOM   6675 N  N   . ALA J  1 8  ? 14.461  25.771  128.510 1.00 17.79 ? 8    ALA J N   1 
ATOM   6676 C  CA  . ALA J  1 8  ? 13.083  25.517  128.981 1.00 17.53 ? 8    ALA J CA  1 
ATOM   6677 C  C   . ALA J  1 8  ? 13.078  24.205  129.758 1.00 17.97 ? 8    ALA J C   1 
ATOM   6678 O  O   . ALA J  1 8  ? 12.474  24.165  130.818 1.00 16.50 ? 8    ALA J O   1 
ATOM   6679 C  CB  . ALA J  1 8  ? 12.077  25.439  127.832 1.00 17.36 ? 8    ALA J CB  1 
ATOM   6680 N  N   . LEU J  1 9  ? 13.781  23.181  129.260 1.00 15.84 ? 9    LEU J N   1 
ATOM   6681 C  CA  . LEU J  1 9  ? 13.920  21.903  130.029 1.00 17.32 ? 9    LEU J CA  1 
ATOM   6682 C  C   . LEU J  1 9  ? 14.596  22.110  131.394 1.00 18.70 ? 9    LEU J C   1 
ATOM   6683 O  O   . LEU J  1 9  ? 14.095  21.662  132.440 1.00 19.18 ? 9    LEU J O   1 
ATOM   6684 C  CB  . LEU J  1 9  ? 14.664  20.837  129.219 1.00 18.17 ? 9    LEU J CB  1 
ATOM   6685 C  CG  . LEU J  1 9  ? 14.025  20.530  127.852 1.00 19.62 ? 9    LEU J CG  1 
ATOM   6686 C  CD1 . LEU J  1 9  ? 14.674  19.302  127.220 1.00 21.37 ? 9    LEU J CD1 1 
ATOM   6687 C  CD2 . LEU J  1 9  ? 12.492  20.362  128.040 1.00 18.16 ? 9    LEU J CD2 1 
ATOM   6688 N  N   . ASN J  1 10 ? 15.726  22.812  131.397 1.00 19.05 ? 10   ASN J N   1 
ATOM   6689 C  CA  . ASN J  1 10 ? 16.364  23.174  132.672 1.00 19.91 ? 10   ASN J CA  1 
ATOM   6690 C  C   . ASN J  1 10 ? 15.460  23.987  133.589 1.00 19.70 ? 10   ASN J C   1 
ATOM   6691 O  O   . ASN J  1 10 ? 15.445  23.749  134.797 1.00 20.62 ? 10   ASN J O   1 
ATOM   6692 C  CB  . ASN J  1 10 ? 17.712  23.870  132.476 1.00 21.10 ? 10   ASN J CB  1 
ATOM   6693 C  CG  . ASN J  1 10 ? 18.765  22.904  132.010 1.00 22.12 ? 10   ASN J CG  1 
ATOM   6694 O  OD1 . ASN J  1 10 ? 18.553  21.688  132.080 1.00 23.71 ? 10   ASN J OD1 1 
ATOM   6695 N  ND2 . ASN J  1 10 ? 19.891  23.410  131.536 1.00 22.29 ? 10   ASN J ND2 1 
ATOM   6696 N  N   . SER J  1 11 ? 14.678  24.897  133.014 1.00 18.54 ? 11   SER J N   1 
ATOM   6697 C  CA  . SER J  1 11 ? 13.757  25.724  133.817 1.00 17.28 ? 11   SER J CA  1 
ATOM   6698 C  C   . SER J  1 11 ? 12.662  24.866  134.507 1.00 17.72 ? 11   SER J C   1 
ATOM   6699 O  O   . SER J  1 11 ? 12.287  25.122  135.652 1.00 16.49 ? 11   SER J O   1 
ATOM   6700 C  CB  . SER J  1 11 ? 13.168  26.838  132.950 1.00 18.96 ? 11   SER J CB  1 
ATOM   6701 O  OG  . SER J  1 11 ? 12.225  27.593  133.676 1.00 17.99 ? 11   SER J OG  1 
ATOM   6702 N  N   . ILE J  1 12 ? 12.227  23.797  133.841 1.00 17.63 ? 12   ILE J N   1 
ATOM   6703 C  CA  . ILE J  1 12 ? 11.293  22.851  134.446 1.00 17.52 ? 12   ILE J CA  1 
ATOM   6704 C  C   . ILE J  1 12 ? 11.893  22.255  135.732 1.00 17.07 ? 12   ILE J C   1 
ATOM   6705 O  O   . ILE J  1 12 ? 11.190  22.074  136.703 1.00 17.82 ? 12   ILE J O   1 
ATOM   6706 C  CB  . ILE J  1 12 ? 10.858  21.756  133.416 1.00 16.21 ? 12   ILE J CB  1 
ATOM   6707 C  CG1 . ILE J  1 12 ? 10.014  22.422  132.303 1.00 15.55 ? 12   ILE J CG1 1 
ATOM   6708 C  CG2 . ILE J  1 12 ? 10.082  20.607  134.139 1.00 18.08 ? 12   ILE J CG2 1 
ATOM   6709 C  CD1 . ILE J  1 12 ? 9.715   21.566  131.069 1.00 14.76 ? 12   ILE J CD1 1 
ATOM   6710 N  N   . ILE J  1 13 ? 13.186  21.911  135.710 1.00 16.91 ? 13   ILE J N   1 
ATOM   6711 C  CA  . ILE J  1 13 ? 13.851  21.454  136.932 1.00 19.01 ? 13   ILE J CA  1 
ATOM   6712 C  C   . ILE J  1 13 ? 13.820  22.520  138.027 1.00 19.58 ? 13   ILE J C   1 
ATOM   6713 O  O   . ILE J  1 13 ? 13.540  22.240  139.184 1.00 18.17 ? 13   ILE J O   1 
ATOM   6714 C  CB  . ILE J  1 13 ? 15.300  21.047  136.609 1.00 19.98 ? 13   ILE J CB  1 
ATOM   6715 C  CG1 . ILE J  1 13 ? 15.251  19.919  135.572 1.00 17.91 ? 13   ILE J CG1 1 
ATOM   6716 C  CG2 . ILE J  1 13 ? 16.074  20.626  137.904 1.00 20.23 ? 13   ILE J CG2 1 
ATOM   6717 C  CD1 . ILE J  1 13 ? 16.573  19.662  134.829 1.00 23.34 ? 13   ILE J CD1 1 
ATOM   6718 N  N   . ASP J  1 14 ? 14.116  23.758  137.657 1.00 17.83 ? 14   ASP J N   1 
ATOM   6719 C  CA  . ASP J  1 14 ? 14.169  24.878  138.589 1.00 18.93 ? 14   ASP J CA  1 
ATOM   6720 C  C   . ASP J  1 14 ? 12.782  25.122  139.198 1.00 16.52 ? 14   ASP J C   1 
ATOM   6721 O  O   . ASP J  1 14 ? 12.648  25.471  140.374 1.00 20.02 ? 14   ASP J O   1 
ATOM   6722 C  CB  . ASP J  1 14 ? 14.647  26.132  137.825 1.00 22.19 ? 14   ASP J CB  1 
ATOM   6723 C  CG  . ASP J  1 14 ? 14.592  27.393  138.678 1.00 29.84 ? 14   ASP J CG  1 
ATOM   6724 O  OD1 . ASP J  1 14 ? 15.311  27.469  139.701 1.00 32.18 ? 14   ASP J OD1 1 
ATOM   6725 O  OD2 . ASP J  1 14 ? 13.862  28.372  138.415 1.00 33.82 ? 14   ASP J OD2 1 
ATOM   6726 N  N   . VAL J  1 15 ? 11.735  24.945  138.401 1.00 15.22 ? 15   VAL J N   1 
ATOM   6727 C  CA  . VAL J  1 15 ? 10.362  25.052  138.917 1.00 15.30 ? 15   VAL J CA  1 
ATOM   6728 C  C   . VAL J  1 15 ? 10.093  24.039  140.036 1.00 15.07 ? 15   VAL J C   1 
ATOM   6729 O  O   . VAL J  1 15 ? 9.572   24.406  141.104 1.00 15.22 ? 15   VAL J O   1 
ATOM   6730 C  CB  . VAL J  1 15 ? 9.300   24.881  137.808 1.00 18.32 ? 15   VAL J CB  1 
ATOM   6731 C  CG1 . VAL J  1 15 ? 7.879   24.746  138.398 1.00 17.81 ? 15   VAL J CG1 1 
ATOM   6732 C  CG2 . VAL J  1 15 ? 9.340   26.124  136.869 1.00 16.27 ? 15   VAL J CG2 1 
ATOM   6733 N  N   . TYR J  1 16 ? 10.430  22.785  139.801 1.00 14.62 ? 16   TYR J N   1 
ATOM   6734 C  CA  . TYR J  1 16 ? 10.309  21.783  140.864 1.00 16.28 ? 16   TYR J CA  1 
ATOM   6735 C  C   . TYR J  1 16 ? 11.051  22.214  142.133 1.00 18.08 ? 16   TYR J C   1 
ATOM   6736 O  O   . TYR J  1 16 ? 10.512  22.126  143.248 1.00 17.65 ? 16   TYR J O   1 
ATOM   6737 C  CB  . TYR J  1 16 ? 10.785  20.405  140.361 1.00 17.04 ? 16   TYR J CB  1 
ATOM   6738 C  CG  . TYR J  1 16 ? 10.678  19.348  141.443 1.00 15.63 ? 16   TYR J CG  1 
ATOM   6739 C  CD1 . TYR J  1 16 ? 9.431   18.807  141.776 1.00 15.70 ? 16   TYR J CD1 1 
ATOM   6740 C  CD2 . TYR J  1 16 ? 11.798  18.956  142.175 1.00 14.05 ? 16   TYR J CD2 1 
ATOM   6741 C  CE1 . TYR J  1 16 ? 9.282   17.798  142.774 1.00 15.50 ? 16   TYR J CE1 1 
ATOM   6742 C  CE2 . TYR J  1 16 ? 11.659  17.981  143.185 1.00 14.33 ? 16   TYR J CE2 1 
ATOM   6743 C  CZ  . TYR J  1 16 ? 10.401  17.435  143.480 1.00 18.00 ? 16   TYR J CZ  1 
ATOM   6744 O  OH  . TYR J  1 16 ? 10.273  16.504  144.488 1.00 16.07 ? 16   TYR J OH  1 
ATOM   6745 N  N   . HIS J  1 17 ? 12.313  22.586  141.966 1.00 16.62 ? 17   HIS J N   1 
ATOM   6746 C  CA  . HIS J  1 17 ? 13.208  23.006  143.067 1.00 20.22 ? 17   HIS J CA  1 
ATOM   6747 C  C   . HIS J  1 17 ? 12.566  24.156  143.885 1.00 23.19 ? 17   HIS J C   1 
ATOM   6748 O  O   . HIS J  1 17 ? 12.680  24.188  145.116 1.00 22.58 ? 17   HIS J O   1 
ATOM   6749 C  CB  . HIS J  1 17 ? 14.557  23.351  142.415 1.00 26.04 ? 17   HIS J CB  1 
ATOM   6750 C  CG  . HIS J  1 17 ? 15.753  23.370  143.325 1.00 33.34 ? 17   HIS J CG  1 
ATOM   6751 N  ND1 . HIS J  1 17 ? 16.218  22.254  143.995 1.00 36.73 ? 17   HIS J ND1 1 
ATOM   6752 C  CD2 . HIS J  1 17 ? 16.631  24.366  143.610 1.00 35.14 ? 17   HIS J CD2 1 
ATOM   6753 C  CE1 . HIS J  1 17 ? 17.302  22.574  144.687 1.00 37.16 ? 17   HIS J CE1 1 
ATOM   6754 N  NE2 . HIS J  1 17 ? 17.576  23.849  144.469 1.00 36.71 ? 17   HIS J NE2 1 
ATOM   6755 N  N   . LYS J  1 18 ? 11.853  25.089  143.244 1.00 21.29 ? 18   LYS J N   1 
ATOM   6756 C  CA  . LYS J  1 18 ? 11.194  26.207  143.977 1.00 24.48 ? 18   LYS J CA  1 
ATOM   6757 C  C   . LYS J  1 18 ? 10.263  25.676  145.067 1.00 21.96 ? 18   LYS J C   1 
ATOM   6758 O  O   . LYS J  1 18 ? 10.138  26.278  146.123 1.00 21.75 ? 18   LYS J O   1 
ATOM   6759 C  CB  . LYS J  1 18 ? 10.340  27.104  143.065 1.00 26.82 ? 18   LYS J CB  1 
ATOM   6760 C  CG  . LYS J  1 18 ? 11.056  28.087  142.168 1.00 34.77 ? 18   LYS J CG  1 
ATOM   6761 C  CD  . LYS J  1 18 ? 10.060  29.117  141.542 1.00 34.11 ? 18   LYS J CD  1 
ATOM   6762 C  CE  . LYS J  1 18 ? 9.320   28.652  140.268 1.00 38.85 ? 18   LYS J CE  1 
ATOM   6763 N  NZ  . LYS J  1 18 ? 8.547   29.731  139.497 1.00 37.66 ? 18   LYS J NZ  1 
ATOM   6764 N  N   . TYR J  1 19 ? 9.631   24.541  144.801 1.00 17.82 ? 19   TYR J N   1 
ATOM   6765 C  CA  . TYR J  1 19 ? 8.632   24.003  145.713 1.00 17.18 ? 19   TYR J CA  1 
ATOM   6766 C  C   . TYR J  1 19 ? 9.198   22.904  146.600 1.00 17.14 ? 19   TYR J C   1 
ATOM   6767 O  O   . TYR J  1 19 ? 8.785   22.783  147.752 1.00 15.31 ? 19   TYR J O   1 
ATOM   6768 C  CB  . TYR J  1 19 ? 7.391   23.529  144.942 1.00 19.03 ? 19   TYR J CB  1 
ATOM   6769 C  CG  . TYR J  1 19 ? 6.760   24.701  144.244 1.00 18.30 ? 19   TYR J CG  1 
ATOM   6770 C  CD1 . TYR J  1 19 ? 5.879   25.538  144.920 1.00 17.82 ? 19   TYR J CD1 1 
ATOM   6771 C  CD2 . TYR J  1 19 ? 7.114   25.026  142.945 1.00 20.62 ? 19   TYR J CD2 1 
ATOM   6772 C  CE1 . TYR J  1 19 ? 5.330   26.670  144.278 1.00 20.97 ? 19   TYR J CE1 1 
ATOM   6773 C  CE2 . TYR J  1 19 ? 6.567   26.143  142.308 1.00 22.21 ? 19   TYR J CE2 1 
ATOM   6774 C  CZ  . TYR J  1 19 ? 5.695   26.967  142.999 1.00 22.32 ? 19   TYR J CZ  1 
ATOM   6775 O  OH  . TYR J  1 19 ? 5.148   28.079  142.371 1.00 26.03 ? 19   TYR J OH  1 
ATOM   6776 N  N   . SER J  1 20 ? 10.168  22.142  146.092 1.00 15.88 ? 20   SER J N   1 
ATOM   6777 C  CA  . SER J  1 20 ? 10.771  21.084  146.934 1.00 16.65 ? 20   SER J CA  1 
ATOM   6778 C  C   . SER J  1 20 ? 11.675  21.674  148.037 1.00 18.03 ? 20   SER J C   1 
ATOM   6779 O  O   . SER J  1 20 ? 11.972  21.025  149.052 1.00 16.10 ? 20   SER J O   1 
ATOM   6780 C  CB  . SER J  1 20 ? 11.502  20.061  146.057 1.00 19.37 ? 20   SER J CB  1 
ATOM   6781 O  OG  . SER J  1 20 ? 12.768  20.555  145.630 1.00 16.68 ? 20   SER J OG  1 
ATOM   6782 N  N   . LEU J  1 21 ? 12.144  22.904  147.810 1.00 18.06 ? 21   LEU J N   1 
ATOM   6783 C  CA  . LEU J  1 21 ? 12.975  23.583  148.833 1.00 18.20 ? 21   LEU J CA  1 
ATOM   6784 C  C   . LEU J  1 21 ? 12.165  24.251  149.929 1.00 18.98 ? 21   LEU J C   1 
ATOM   6785 O  O   . LEU J  1 21 ? 12.749  24.842  150.854 1.00 18.71 ? 21   LEU J O   1 
ATOM   6786 C  CB  . LEU J  1 21 ? 13.882  24.648  148.213 1.00 18.99 ? 21   LEU J CB  1 
ATOM   6787 C  CG  . LEU J  1 21 ? 15.143  24.198  147.475 1.00 21.01 ? 21   LEU J CG  1 
ATOM   6788 C  CD1 . LEU J  1 21 ? 15.527  25.312  146.483 1.00 23.81 ? 21   LEU J CD1 1 
ATOM   6789 C  CD2 . LEU J  1 21 ? 16.304  23.940  148.399 1.00 22.77 ? 21   LEU J CD2 1 
ATOM   6790 N  N   . ILE J  1 22 ? 10.838  24.212  149.860 1.00 16.58 ? 22   ILE J N   1 
ATOM   6791 C  CA  . ILE J  1 22 ? 10.072  24.913  150.908 1.00 16.86 ? 22   ILE J CA  1 
ATOM   6792 C  C   . ILE J  1 22 ? 10.276  24.324  152.294 1.00 17.70 ? 22   ILE J C   1 
ATOM   6793 O  O   . ILE J  1 22 ? 10.433  25.043  153.282 1.00 16.66 ? 22   ILE J O   1 
ATOM   6794 C  CB  . ILE J  1 22 ? 8.582   24.906  150.555 1.00 17.24 ? 22   ILE J CB  1 
ATOM   6795 C  CG1 . ILE J  1 22 ? 8.356   25.725  149.278 1.00 15.58 ? 22   ILE J CG1 1 
ATOM   6796 C  CG2 . ILE J  1 22 ? 7.729   25.336  151.772 1.00 17.15 ? 22   ILE J CG2 1 
ATOM   6797 C  CD1 . ILE J  1 22 ? 6.893   25.740  148.789 1.00 16.14 ? 22   ILE J CD1 1 
ATOM   6798 N  N   . LYS J  1 23 ? 10.308  22.993  152.394 1.00 17.23 ? 23   LYS J N   1 
ATOM   6799 C  CA  . LYS J  1 23 ? 10.507  22.382  153.717 1.00 17.63 ? 23   LYS J CA  1 
ATOM   6800 C  C   . LYS J  1 23 ? 10.905  20.912  153.631 1.00 16.30 ? 23   LYS J C   1 
ATOM   6801 O  O   . LYS J  1 23 ? 10.864  20.309  152.550 1.00 15.54 ? 23   LYS J O   1 
ATOM   6802 C  CB  . LYS J  1 23 ? 9.230   22.494  154.546 1.00 19.52 ? 23   LYS J CB  1 
ATOM   6803 C  CG  . LYS J  1 23 ? 8.044   21.711  153.965 1.00 21.63 ? 23   LYS J CG  1 
ATOM   6804 C  CD  . LYS J  1 23 ? 6.862   21.745  154.890 1.00 23.10 ? 23   LYS J CD  1 
ATOM   6805 C  CE  . LYS J  1 23 ? 5.598   21.167  154.273 1.00 25.67 ? 23   LYS J CE  1 
ATOM   6806 N  NZ  . LYS J  1 23 ? 4.919   22.211  153.456 1.00 28.53 ? 23   LYS J NZ  1 
ATOM   6807 N  N   . GLY J  1 24 ? 11.279  20.330  154.768 1.00 15.41 ? 24   GLY J N   1 
ATOM   6808 C  CA  . GLY J  1 24 ? 11.544  18.879  154.843 1.00 16.32 ? 24   GLY J CA  1 
ATOM   6809 C  C   . GLY J  1 24 ? 12.630  18.428  153.910 1.00 18.09 ? 24   GLY J C   1 
ATOM   6810 O  O   . GLY J  1 24 ? 13.629  19.129  153.735 1.00 18.42 ? 24   GLY J O   1 
ATOM   6811 N  N   . ASN J  1 25 ? 12.396  17.284  153.254 1.00 17.68 ? 25   ASN J N   1 
ATOM   6812 C  CA  . ASN J  1 25 ? 13.352  16.742  152.286 1.00 17.07 ? 25   ASN J CA  1 
ATOM   6813 C  C   . ASN J  1 25 ? 13.356  17.599  151.017 1.00 18.92 ? 25   ASN J C   1 
ATOM   6814 O  O   . ASN J  1 25 ? 12.301  17.909  150.465 1.00 15.33 ? 25   ASN J O   1 
ATOM   6815 C  CB  . ASN J  1 25 ? 12.981  15.267  152.048 1.00 18.32 ? 25   ASN J CB  1 
ATOM   6816 C  CG  . ASN J  1 25 ? 13.947  14.521  151.163 1.00 22.27 ? 25   ASN J CG  1 
ATOM   6817 O  OD1 . ASN J  1 25 ? 14.502  15.057  150.201 1.00 19.40 ? 25   ASN J OD1 1 
ATOM   6818 N  ND2 . ASN J  1 25 ? 14.099  13.224  151.452 1.00 23.65 ? 25   ASN J ND2 1 
ATOM   6819 N  N   . PHE J  1 26 ? 14.539  18.017  150.577 1.00 15.21 ? 26   PHE J N   1 
ATOM   6820 C  CA  . PHE J  1 26 ? 14.641  18.902  149.402 1.00 19.29 ? 26   PHE J CA  1 
ATOM   6821 C  C   . PHE J  1 26 ? 14.456  18.162  148.066 1.00 22.53 ? 26   PHE J C   1 
ATOM   6822 O  O   . PHE J  1 26 ? 14.537  18.754  146.979 1.00 22.27 ? 26   PHE J O   1 
ATOM   6823 C  CB  . PHE J  1 26 ? 15.970  19.634  149.404 1.00 22.99 ? 26   PHE J CB  1 
ATOM   6824 C  CG  . PHE J  1 26 ? 16.117  20.643  150.525 1.00 24.21 ? 26   PHE J CG  1 
ATOM   6825 C  CD1 . PHE J  1 26 ? 15.008  21.260  151.100 1.00 25.86 ? 26   PHE J CD1 1 
ATOM   6826 C  CD2 . PHE J  1 26 ? 17.373  21.008  150.972 1.00 26.67 ? 26   PHE J CD2 1 
ATOM   6827 C  CE1 . PHE J  1 26 ? 15.155  22.201  152.119 1.00 27.07 ? 26   PHE J CE1 1 
ATOM   6828 C  CE2 . PHE J  1 26 ? 17.530  21.942  152.002 1.00 26.60 ? 26   PHE J CE2 1 
ATOM   6829 C  CZ  . PHE J  1 26 ? 16.416  22.547  152.567 1.00 26.88 ? 26   PHE J CZ  1 
ATOM   6830 N  N   . HIS J  1 27 ? 14.225  16.852  148.156 1.00 19.62 ? 27   HIS J N   1 
ATOM   6831 C  CA  . HIS J  1 27 ? 13.846  16.058  146.984 1.00 20.53 ? 27   HIS J CA  1 
ATOM   6832 C  C   . HIS J  1 27 ? 12.378  15.651  147.060 1.00 19.25 ? 27   HIS J C   1 
ATOM   6833 O  O   . HIS J  1 27 ? 11.960  14.666  146.454 1.00 18.96 ? 27   HIS J O   1 
ATOM   6834 C  CB  . HIS J  1 27 ? 14.775  14.835  146.899 1.00 22.59 ? 27   HIS J CB  1 
ATOM   6835 C  CG  . HIS J  1 27 ? 16.219  15.212  146.791 1.00 25.58 ? 27   HIS J CG  1 
ATOM   6836 N  ND1 . HIS J  1 27 ? 16.864  15.347  145.581 1.00 30.71 ? 27   HIS J ND1 1 
ATOM   6837 C  CD2 . HIS J  1 27 ? 17.121  15.568  147.735 1.00 28.49 ? 27   HIS J CD2 1 
ATOM   6838 C  CE1 . HIS J  1 27 ? 18.109  15.738  145.784 1.00 30.84 ? 27   HIS J CE1 1 
ATOM   6839 N  NE2 . HIS J  1 27 ? 18.289  15.887  147.083 1.00 31.17 ? 27   HIS J NE2 1 
ATOM   6840 N  N   . ALA J  1 28 ? 11.589  16.388  147.839 1.00 16.22 ? 28   ALA J N   1 
ATOM   6841 C  CA  . ALA J  1 28 ? 10.194  16.025  148.043 1.00 15.47 ? 28   ALA J CA  1 
ATOM   6842 C  C   . ALA J  1 28 ? 9.331   17.283  148.026 1.00 17.66 ? 28   ALA J C   1 
ATOM   6843 O  O   . ALA J  1 28 ? 9.733   18.301  148.596 1.00 15.28 ? 28   ALA J O   1 
ATOM   6844 C  CB  . ALA J  1 28 ? 10.024  15.297  149.381 1.00 18.80 ? 28   ALA J CB  1 
ATOM   6845 N  N   . VAL J  1 29 ? 8.176   17.190  147.359 1.00 15.34 ? 29   VAL J N   1 
ATOM   6846 C  CA  . VAL J  1 29 ? 7.118   18.178  147.383 1.00 16.22 ? 29   VAL J CA  1 
ATOM   6847 C  C   . VAL J  1 29 ? 5.937   17.527  148.119 1.00 18.08 ? 29   VAL J C   1 
ATOM   6848 O  O   . VAL J  1 29 ? 5.402   16.492  147.688 1.00 17.00 ? 29   VAL J O   1 
ATOM   6849 C  CB  . VAL J  1 29 ? 6.757   18.635  145.960 1.00 18.06 ? 29   VAL J CB  1 
ATOM   6850 C  CG1 . VAL J  1 29 ? 5.405   19.375  145.901 1.00 17.23 ? 29   VAL J CG1 1 
ATOM   6851 C  CG2 . VAL J  1 29 ? 7.893   19.492  145.402 1.00 16.11 ? 29   VAL J CG2 1 
ATOM   6852 N  N   . TYR J  1 30 ? 5.580   18.116  149.254 1.00 16.86 ? 30   TYR J N   1 
ATOM   6853 C  CA  . TYR J  1 30 ? 4.531   17.551  150.088 1.00 16.96 ? 30   TYR J CA  1 
ATOM   6854 C  C   . TYR J  1 30 ? 3.167   17.997  149.560 1.00 18.07 ? 30   TYR J C   1 
ATOM   6855 O  O   . TYR J  1 30 ? 3.064   18.758  148.603 1.00 18.14 ? 30   TYR J O   1 
ATOM   6856 C  CB  . TYR J  1 30 ? 4.776   17.905  151.560 1.00 16.85 ? 30   TYR J CB  1 
ATOM   6857 C  CG  . TYR J  1 30 ? 6.142   17.391  152.001 1.00 17.25 ? 30   TYR J CG  1 
ATOM   6858 C  CD1 . TYR J  1 30 ? 6.330   16.020  152.236 1.00 19.32 ? 30   TYR J CD1 1 
ATOM   6859 C  CD2 . TYR J  1 30 ? 7.270   18.234  152.028 1.00 14.53 ? 30   TYR J CD2 1 
ATOM   6860 C  CE1 . TYR J  1 30 ? 7.576   15.521  152.577 1.00 19.83 ? 30   TYR J CE1 1 
ATOM   6861 C  CE2 . TYR J  1 30 ? 8.517   17.753  152.384 1.00 14.86 ? 30   TYR J CE2 1 
ATOM   6862 C  CZ  . TYR J  1 30 ? 8.672   16.390  152.637 1.00 17.07 ? 30   TYR J CZ  1 
ATOM   6863 O  OH  . TYR J  1 30 ? 9.899   15.863  152.963 1.00 18.07 ? 30   TYR J OH  1 
ATOM   6864 N  N   . ARG J  1 31 ? 2.087   17.522  150.167 1.00 17.90 ? 31   ARG J N   1 
ATOM   6865 C  CA  . ARG J  1 31 ? 0.772   17.820  149.584 1.00 19.65 ? 31   ARG J CA  1 
ATOM   6866 C  C   . ARG J  1 31 ? 0.469   19.312  149.522 1.00 19.16 ? 31   ARG J C   1 
ATOM   6867 O  O   . ARG J  1 31 ? -0.052  19.828  148.512 1.00 21.11 ? 31   ARG J O   1 
ATOM   6868 C  CB  . ARG J  1 31 ? -0.298  17.061  150.387 1.00 21.97 ? 31   ARG J CB  1 
ATOM   6869 C  CG  . ARG J  1 31 ? -1.730  17.238  149.919 1.00 26.74 ? 31   ARG J CG  1 
ATOM   6870 C  CD  . ARG J  1 31 ? -2.751  16.649  150.912 1.00 28.50 ? 31   ARG J CD  1 
ATOM   6871 N  NE  . ARG J  1 31 ? -2.480  15.233  151.157 1.00 32.90 ? 31   ARG J NE  1 
ATOM   6872 C  CZ  . ARG J  1 31 ? -2.964  14.255  150.407 1.00 34.02 ? 31   ARG J CZ  1 
ATOM   6873 N  NH1 . ARG J  1 31 ? -3.753  14.556  149.384 1.00 34.68 ? 31   ARG J NH1 1 
ATOM   6874 N  NH2 . ARG J  1 31 ? -2.669  12.984  150.677 1.00 33.77 ? 31   ARG J NH2 1 
ATOM   6875 N  N   . ASP J  1 32 ? 0.739   20.009  150.626 1.00 16.32 ? 32   ASP J N   1 
ATOM   6876 C  CA  . ASP J  1 32 ? 0.511   21.451  150.641 1.00 20.41 ? 32   ASP J CA  1 
ATOM   6877 C  C   . ASP J  1 32 ? 1.397   22.216  149.667 1.00 21.09 ? 32   ASP J C   1 
ATOM   6878 O  O   . ASP J  1 32 ? 0.931   23.158  149.025 1.00 19.68 ? 32   ASP J O   1 
ATOM   6879 C  CB  . ASP J  1 32 ? 0.568   22.023  152.073 1.00 23.02 ? 32   ASP J CB  1 
ATOM   6880 C  CG  . ASP J  1 32 ? 1.844   21.655  152.834 1.00 26.40 ? 32   ASP J CG  1 
ATOM   6881 O  OD1 . ASP J  1 32 ? 2.642   20.799  152.390 1.00 24.82 ? 32   ASP J OD1 1 
ATOM   6882 O  OD2 . ASP J  1 32 ? 2.094   22.157  153.951 1.00 30.71 ? 32   ASP J OD2 1 
ATOM   6883 N  N   . ASP J  1 33 ? 2.648   21.782  149.503 1.00 19.75 ? 33   ASP J N   1 
ATOM   6884 C  CA  . ASP J  1 33 ? 3.529   22.429  148.535 1.00 19.60 ? 33   ASP J CA  1 
ATOM   6885 C  C   . ASP J  1 33 ? 2.978   22.170  147.125 1.00 18.89 ? 33   ASP J C   1 
ATOM   6886 O  O   . ASP J  1 33 ? 3.054   23.034  146.261 1.00 17.71 ? 33   ASP J O   1 
ATOM   6887 C  CB  . ASP J  1 33 ? 4.958   21.870  148.595 1.00 19.78 ? 33   ASP J CB  1 
ATOM   6888 C  CG  . ASP J  1 33 ? 5.537   21.816  149.999 1.00 20.67 ? 33   ASP J CG  1 
ATOM   6889 O  OD1 . ASP J  1 33 ? 5.330   22.783  150.768 1.00 20.29 ? 33   ASP J OD1 1 
ATOM   6890 O  OD2 . ASP J  1 33 ? 6.283   20.874  150.374 1.00 18.16 ? 33   ASP J OD2 1 
ATOM   6891 N  N   . LEU J  1 34 ? 2.464   20.971  146.859 1.00 17.78 ? 34   LEU J N   1 
ATOM   6892 C  CA  . LEU J  1 34 ? 1.878   20.729  145.522 1.00 17.97 ? 34   LEU J CA  1 
ATOM   6893 C  C   . LEU J  1 34 ? 0.700   21.646  145.223 1.00 19.08 ? 34   LEU J C   1 
ATOM   6894 O  O   . LEU J  1 34 ? 0.522   22.119  144.089 1.00 17.42 ? 34   LEU J O   1 
ATOM   6895 C  CB  . LEU J  1 34 ? 1.407   19.280  145.387 1.00 19.35 ? 34   LEU J CB  1 
ATOM   6896 C  CG  . LEU J  1 34 ? 0.909   18.917  143.979 1.00 20.31 ? 34   LEU J CG  1 
ATOM   6897 C  CD1 . LEU J  1 34 ? 2.050   19.009  142.951 1.00 22.08 ? 34   LEU J CD1 1 
ATOM   6898 C  CD2 . LEU J  1 34 ? 0.279   17.555  143.936 1.00 19.48 ? 34   LEU J CD2 1 
ATOM   6899 N  N   . LYS J  1 35 ? -0.131  21.890  146.235 1.00 18.43 ? 35   LYS J N   1 
ATOM   6900 C  CA  . LYS J  1 35 ? -1.268  22.784  146.076 1.00 21.15 ? 35   LYS J CA  1 
ATOM   6901 C  C   . LYS J  1 35 ? -0.778  24.183  145.651 1.00 20.24 ? 35   LYS J C   1 
ATOM   6902 O  O   . LYS J  1 35 ? -1.305  24.806  144.707 1.00 20.75 ? 35   LYS J O   1 
ATOM   6903 C  CB  . LYS J  1 35 ? -2.070  22.840  147.380 1.00 22.87 ? 35   LYS J CB  1 
ATOM   6904 C  CG  . LYS J  1 35 ? -3.318  23.701  147.300 1.00 27.18 ? 35   LYS J CG  1 
ATOM   6905 C  CD  . LYS J  1 35 ? -4.139  23.459  148.569 1.00 30.54 ? 35   LYS J CD  1 
ATOM   6906 C  CE  . LYS J  1 35 ? -5.068  24.630  148.875 1.00 33.71 ? 35   LYS J CE  1 
ATOM   6907 N  NZ  . LYS J  1 35 ? -6.125  24.697  147.841 1.00 36.40 ? 35   LYS J NZ  1 
ATOM   6908 N  N   . LYS J  1 36 ? 0.250   24.670  146.326 1.00 20.53 ? 36   LYS J N   1 
ATOM   6909 C  CA  . LYS J  1 36 ? 0.873   25.939  145.938 1.00 22.29 ? 36   LYS J CA  1 
ATOM   6910 C  C   . LYS J  1 36 ? 1.445   25.894  144.532 1.00 20.62 ? 36   LYS J C   1 
ATOM   6911 O  O   . LYS J  1 36 ? 1.281   26.853  143.753 1.00 19.53 ? 36   LYS J O   1 
ATOM   6912 C  CB  . LYS J  1 36 ? 1.994   26.334  146.915 1.00 23.54 ? 36   LYS J CB  1 
ATOM   6913 C  CG  . LYS J  1 36 ? 1.479   26.758  148.280 1.00 28.77 ? 36   LYS J CG  1 
ATOM   6914 C  CD  . LYS J  1 36 ? 2.625   27.272  149.151 1.00 30.61 ? 36   LYS J CD  1 
ATOM   6915 C  CE  . LYS J  1 36 ? 2.090   28.103  150.315 1.00 35.73 ? 36   LYS J CE  1 
ATOM   6916 N  NZ  . LYS J  1 36 ? 1.017   27.371  151.082 1.00 37.36 ? 36   LYS J NZ  1 
ATOM   6917 N  N   . LEU J  1 37 ? 2.146   24.804  144.210 1.00 18.41 ? 37   LEU J N   1 
ATOM   6918 C  CA  . LEU J  1 37 ? 2.706   24.671  142.866 1.00 18.73 ? 37   LEU J CA  1 
ATOM   6919 C  C   . LEU J  1 37 ? 1.618   24.830  141.800 1.00 20.26 ? 37   LEU J C   1 
ATOM   6920 O  O   . LEU J  1 37 ? 1.782   25.588  140.833 1.00 19.09 ? 37   LEU J O   1 
ATOM   6921 C  CB  . LEU J  1 37 ? 3.456   23.342  142.709 1.00 18.24 ? 37   LEU J CB  1 
ATOM   6922 C  CG  . LEU J  1 37 ? 4.200   23.147  141.383 1.00 22.82 ? 37   LEU J CG  1 
ATOM   6923 C  CD1 . LEU J  1 37 ? 5.409   22.207  141.619 1.00 23.17 ? 37   LEU J CD1 1 
ATOM   6924 C  CD2 . LEU J  1 37 ? 3.284   22.558  140.335 1.00 20.53 ? 37   LEU J CD2 1 
ATOM   6925 N  N   . LEU J  1 38 ? 0.507   24.132  141.986 1.00 16.86 ? 38   LEU J N   1 
ATOM   6926 C  CA  . LEU J  1 38 ? -0.557  24.074  140.990 1.00 19.39 ? 38   LEU J CA  1 
ATOM   6927 C  C   . LEU J  1 38 ? -1.285  25.420  140.933 1.00 19.65 ? 38   LEU J C   1 
ATOM   6928 O  O   . LEU J  1 38 ? -1.607  25.928  139.848 1.00 20.24 ? 38   LEU J O   1 
ATOM   6929 C  CB  . LEU J  1 38 ? -1.516  22.928  141.367 1.00 19.79 ? 38   LEU J CB  1 
ATOM   6930 C  CG  . LEU J  1 38 ? -1.139  21.441  141.198 1.00 21.29 ? 38   LEU J CG  1 
ATOM   6931 C  CD1 . LEU J  1 38 ? -2.132  20.579  142.008 1.00 21.68 ? 38   LEU J CD1 1 
ATOM   6932 C  CD2 . LEU J  1 38 ? -1.053  20.956  139.712 1.00 19.61 ? 38   LEU J CD2 1 
ATOM   6933 N  N   . GLU J  1 39 ? -1.504  26.037  142.093 1.00 21.26 ? 39   GLU J N   1 
ATOM   6934 C  CA  . GLU J  1 39 ? -2.089  27.392  142.106 1.00 25.15 ? 39   GLU J CA  1 
ATOM   6935 C  C   . GLU J  1 39 ? -1.235  28.416  141.372 1.00 23.39 ? 39   GLU J C   1 
ATOM   6936 O  O   . GLU J  1 39 ? -1.743  29.257  140.635 1.00 24.58 ? 39   GLU J O   1 
ATOM   6937 C  CB  . GLU J  1 39 ? -2.337  27.874  143.529 1.00 27.45 ? 39   GLU J CB  1 
ATOM   6938 C  CG  . GLU J  1 39 ? -3.451  27.101  144.214 1.00 34.08 ? 39   GLU J CG  1 
ATOM   6939 C  CD  . GLU J  1 39 ? -3.707  27.615  145.621 1.00 36.94 ? 39   GLU J CD  1 
ATOM   6940 O  OE1 . GLU J  1 39 ? -3.403  28.798  145.887 1.00 43.40 ? 39   GLU J OE1 1 
ATOM   6941 O  OE2 . GLU J  1 39 ? -4.208  26.856  146.465 1.00 40.82 ? 39   GLU J OE2 1 
ATOM   6942 N  N   . THR J  1 40 ? 0.074   28.298  141.511 1.00 23.33 ? 40   THR J N   1 
ATOM   6943 C  CA  . THR J  1 40 ? 1.007   29.283  140.992 1.00 21.60 ? 40   THR J CA  1 
ATOM   6944 C  C   . THR J  1 40 ? 1.539   29.021  139.587 1.00 24.74 ? 40   THR J C   1 
ATOM   6945 O  O   . THR J  1 40 ? 1.776   29.966  138.833 1.00 23.73 ? 40   THR J O   1 
ATOM   6946 C  CB  . THR J  1 40 ? 2.191   29.361  141.983 1.00 26.02 ? 40   THR J CB  1 
ATOM   6947 O  OG1 . THR J  1 40 ? 1.736   29.914  143.229 1.00 28.07 ? 40   THR J OG1 1 
ATOM   6948 C  CG2 . THR J  1 40 ? 3.258   30.351  141.485 1.00 26.40 ? 40   THR J CG2 1 
ATOM   6949 N  N   . GLU J  1 41 ? 1.704   27.747  139.233 1.00 21.83 ? 41   GLU J N   1 
ATOM   6950 C  CA  . GLU J  1 41 ? 2.327   27.389  137.976 1.00 22.31 ? 41   GLU J CA  1 
ATOM   6951 C  C   . GLU J  1 41 ? 1.372   26.896  136.884 1.00 22.46 ? 41   GLU J C   1 
ATOM   6952 O  O   . GLU J  1 41 ? 1.768   26.874  135.723 1.00 22.20 ? 41   GLU J O   1 
ATOM   6953 C  CB  . GLU J  1 41 ? 3.387   26.309  138.216 1.00 21.75 ? 41   GLU J CB  1 
ATOM   6954 C  CG  . GLU J  1 41 ? 4.508   26.657  139.191 1.00 21.74 ? 41   GLU J CG  1 
ATOM   6955 C  CD  . GLU J  1 41 ? 5.427   27.751  138.698 1.00 23.97 ? 41   GLU J CD  1 
ATOM   6956 O  OE1 . GLU J  1 41 ? 5.432   28.065  137.484 1.00 21.88 ? 41   GLU J OE1 1 
ATOM   6957 O  OE2 . GLU J  1 41 ? 6.176   28.306  139.518 1.00 25.33 ? 41   GLU J OE2 1 
ATOM   6958 N  N   . SER J  1 42 ? 0.184   26.401  137.223 1.00 20.25 ? 42   SER J N   1 
ATOM   6959 C  CA  . SER J  1 42 ? -0.631  25.715  136.203 1.00 21.17 ? 42   SER J CA  1 
ATOM   6960 C  C   . SER J  1 42 ? -1.919  26.466  135.854 1.00 22.49 ? 42   SER J C   1 
ATOM   6961 O  O   . SER J  1 42 ? -2.432  27.209  136.685 1.00 20.46 ? 42   SER J O   1 
ATOM   6962 C  CB  . SER J  1 42 ? -0.921  24.267  136.609 1.00 24.11 ? 42   SER J CB  1 
ATOM   6963 O  OG  . SER J  1 42 ? -1.954  24.268  137.569 1.00 28.72 ? 42   SER J OG  1 
ATOM   6964 N  N   . PRO J  1 43 ? -2.449  26.291  134.636 1.00 23.45 ? 43   PRO J N   1 
ATOM   6965 C  CA  . PRO J  1 43 ? -3.685  27.021  134.246 1.00 24.38 ? 43   PRO J CA  1 
ATOM   6966 C  C   . PRO J  1 43 ? -4.937  26.401  134.885 1.00 26.29 ? 43   PRO J C   1 
ATOM   6967 O  O   . PRO J  1 43 ? -4.856  25.303  135.423 1.00 23.86 ? 43   PRO J O   1 
ATOM   6968 C  CB  . PRO J  1 43 ? -3.690  26.923  132.717 1.00 23.63 ? 43   PRO J CB  1 
ATOM   6969 C  CG  . PRO J  1 43 ? -2.792  25.753  132.354 1.00 23.78 ? 43   PRO J CG  1 
ATOM   6970 C  CD  . PRO J  1 43 ? -1.904  25.468  133.540 1.00 22.93 ? 43   PRO J CD  1 
ATOM   6971 N  N   . GLN J  1 44 ? -6.057  27.123  134.865 1.00 29.40 ? 44   GLN J N   1 
ATOM   6972 C  CA  . GLN J  1 44 ? -7.299  26.717  135.538 1.00 32.28 ? 44   GLN J CA  1 
ATOM   6973 C  C   . GLN J  1 44 ? -7.764  25.323  135.151 1.00 30.38 ? 44   GLN J C   1 
ATOM   6974 O  O   . GLN J  1 44 ? -8.289  24.591  135.986 1.00 30.61 ? 44   GLN J O   1 
ATOM   6975 C  CB  . GLN J  1 44 ? -8.421  27.746  135.272 1.00 36.86 ? 44   GLN J CB  1 
ATOM   6976 C  CG  . GLN J  1 44 ? -9.853  27.296  135.641 1.00 41.69 ? 44   GLN J CG  1 
ATOM   6977 C  CD  . GLN J  1 44 ? -10.056 27.115  137.136 1.00 45.41 ? 44   GLN J CD  1 
ATOM   6978 O  OE1 . GLN J  1 44 ? -9.258  27.614  137.947 1.00 47.89 ? 44   GLN J OE1 1 
ATOM   6979 N  NE2 . GLN J  1 44 ? -11.126 26.403  137.515 1.00 47.31 ? 44   GLN J NE2 1 
ATOM   6980 N  N   . TYR J  1 45 ? -7.548  24.951  133.893 1.00 28.58 ? 45   TYR J N   1 
ATOM   6981 C  CA  . TYR J  1 45 ? -8.043  23.666  133.413 1.00 27.52 ? 45   TYR J CA  1 
ATOM   6982 C  C   . TYR J  1 45 ? -7.220  22.495  133.950 1.00 28.03 ? 45   TYR J C   1 
ATOM   6983 O  O   . TYR J  1 45 ? -7.661  21.344  133.882 1.00 28.32 ? 45   TYR J O   1 
ATOM   6984 C  CB  . TYR J  1 45 ? -8.210  23.641  131.878 1.00 27.15 ? 45   TYR J CB  1 
ATOM   6985 C  CG  . TYR J  1 45 ? -6.924  23.775  131.121 1.00 26.58 ? 45   TYR J CG  1 
ATOM   6986 C  CD1 . TYR J  1 45 ? -6.067  22.688  130.974 1.00 27.18 ? 45   TYR J CD1 1 
ATOM   6987 C  CD2 . TYR J  1 45 ? -6.547  24.988  130.572 1.00 25.64 ? 45   TYR J CD2 1 
ATOM   6988 C  CE1 . TYR J  1 45 ? -4.862  22.804  130.306 1.00 25.38 ? 45   TYR J CE1 1 
ATOM   6989 C  CE2 . TYR J  1 45 ? -5.342  25.119  129.902 1.00 25.55 ? 45   TYR J CE2 1 
ATOM   6990 C  CZ  . TYR J  1 45 ? -4.504  24.018  129.770 1.00 26.51 ? 45   TYR J CZ  1 
ATOM   6991 O  OH  . TYR J  1 45 ? -3.308  24.154  129.085 1.00 24.82 ? 45   TYR J OH  1 
ATOM   6992 N  N   . ILE J  1 46 ? -6.034  22.784  134.488 1.00 24.74 ? 46   ILE J N   1 
ATOM   6993 C  CA  . ILE J  1 46 ? -5.228  21.761  135.170 1.00 25.14 ? 46   ILE J CA  1 
ATOM   6994 C  C   . ILE J  1 46 ? -5.590  21.811  136.658 1.00 27.84 ? 46   ILE J C   1 
ATOM   6995 O  O   . ILE J  1 46 ? -5.845  20.776  137.297 1.00 26.62 ? 46   ILE J O   1 
ATOM   6996 C  CB  . ILE J  1 46 ? -3.695  22.010  134.940 1.00 24.00 ? 46   ILE J CB  1 
ATOM   6997 C  CG1 . ILE J  1 46 ? -3.267  21.764  133.489 1.00 24.97 ? 46   ILE J CG1 1 
ATOM   6998 C  CG2 . ILE J  1 46 ? -2.820  21.188  135.916 1.00 21.68 ? 46   ILE J CG2 1 
ATOM   6999 C  CD1 . ILE J  1 46 ? -3.378  20.292  132.990 1.00 25.91 ? 46   ILE J CD1 1 
ATOM   7000 N  N   . ARG J  1 47 ? -5.619  23.018  137.215 1.00 27.69 ? 47   ARG J N   1 
ATOM   7001 C  CA  . ARG J  1 47 ? -5.980  23.207  138.622 1.00 31.09 ? 47   ARG J CA  1 
ATOM   7002 C  C   . ARG J  1 47 ? -7.334  22.620  139.019 1.00 32.23 ? 47   ARG J C   1 
ATOM   7003 O  O   . ARG J  1 47 ? -7.528  22.177  140.165 1.00 30.99 ? 47   ARG J O   1 
ATOM   7004 C  CB  . ARG J  1 47 ? -6.016  24.690  138.967 1.00 33.24 ? 47   ARG J CB  1 
ATOM   7005 C  CG  . ARG J  1 47 ? -4.661  25.335  139.063 1.00 37.50 ? 47   ARG J CG  1 
ATOM   7006 C  CD  . ARG J  1 47 ? -4.711  26.713  139.680 1.00 40.64 ? 47   ARG J CD  1 
ATOM   7007 N  NE  . ARG J  1 47 ? -4.526  27.737  138.666 1.00 44.14 ? 47   ARG J NE  1 
ATOM   7008 C  CZ  . ARG J  1 47 ? -5.507  28.469  138.161 1.00 45.75 ? 47   ARG J CZ  1 
ATOM   7009 N  NH1 . ARG J  1 47 ? -6.751  28.297  138.591 1.00 47.31 ? 47   ARG J NH1 1 
ATOM   7010 N  NH2 . ARG J  1 47 ? -5.244  29.378  137.232 1.00 46.65 ? 47   ARG J NH2 1 
ATOM   7011 N  N   . LYS J  1 48 ? -8.288  22.649  138.093 1.00 33.83 ? 48   LYS J N   1 
ATOM   7012 C  CA  . LYS J  1 48 ? -9.665  22.305  138.449 1.00 36.42 ? 48   LYS J CA  1 
ATOM   7013 C  C   . LYS J  1 48 ? -9.833  20.853  138.875 1.00 35.82 ? 48   LYS J C   1 
ATOM   7014 O  O   . LYS J  1 48 ? -10.823 20.506  139.520 1.00 35.20 ? 48   LYS J O   1 
ATOM   7015 C  CB  . LYS J  1 48 ? -10.640 22.622  137.316 1.00 38.18 ? 48   LYS J CB  1 
ATOM   7016 C  CG  . LYS J  1 48 ? -10.476 21.726  136.105 1.00 41.13 ? 48   LYS J CG  1 
ATOM   7017 C  CD  . LYS J  1 48 ? -11.558 22.022  135.083 1.00 44.25 ? 48   LYS J CD  1 
ATOM   7018 C  CE  . LYS J  1 48 ? -11.164 21.511  133.701 1.00 46.22 ? 48   LYS J CE  1 
ATOM   7019 N  NZ  . LYS J  1 48 ? -11.919 22.250  132.649 1.00 48.29 ? 48   LYS J NZ  1 
ATOM   7020 N  N   . LYS J  1 49 ? -8.864  20.009  138.524 1.00 35.03 ? 49   LYS J N   1 
ATOM   7021 C  CA  . LYS J  1 49 ? -8.896  18.623  138.966 1.00 34.45 ? 49   LYS J CA  1 
ATOM   7022 C  C   . LYS J  1 49 ? -8.830  18.525  140.491 1.00 32.31 ? 49   LYS J C   1 
ATOM   7023 O  O   . LYS J  1 49 ? -9.369  17.590  141.093 1.00 33.25 ? 49   LYS J O   1 
ATOM   7024 C  CB  . LYS J  1 49 ? -7.778  17.817  138.292 1.00 36.04 ? 49   LYS J CB  1 
ATOM   7025 C  CG  . LYS J  1 49 ? -7.584  16.451  138.908 1.00 38.73 ? 49   LYS J CG  1 
ATOM   7026 C  CD  . LYS J  1 49 ? -7.384  15.409  137.843 1.00 41.37 ? 49   LYS J CD  1 
ATOM   7027 C  CE  . LYS J  1 49 ? -5.948  15.339  137.402 1.00 41.40 ? 49   LYS J CE  1 
ATOM   7028 N  NZ  . LYS J  1 49 ? -5.797  14.421  136.230 1.00 41.65 ? 49   LYS J NZ  1 
ATOM   7029 N  N   . GLY J  1 50 ? -8.182  19.505  141.110 1.00 28.06 ? 50   GLY J N   1 
ATOM   7030 C  CA  . GLY J  1 50 ? -8.082  19.568  142.546 1.00 25.78 ? 50   GLY J CA  1 
ATOM   7031 C  C   . GLY J  1 50 ? -6.704  19.065  142.944 1.00 25.39 ? 50   GLY J C   1 
ATOM   7032 O  O   . GLY J  1 50 ? -6.230  18.097  142.364 1.00 21.86 ? 50   GLY J O   1 
ATOM   7033 N  N   . ALA J  1 51 ? -6.069  19.725  143.906 1.00 24.07 ? 51   ALA J N   1 
ATOM   7034 C  CA  . ALA J  1 51 ? -4.745  19.363  144.407 1.00 23.37 ? 51   ALA J CA  1 
ATOM   7035 C  C   . ALA J  1 51 ? -4.719  17.984  145.053 1.00 24.67 ? 51   ALA J C   1 
ATOM   7036 O  O   . ALA J  1 51 ? -3.756  17.247  144.874 1.00 24.93 ? 51   ALA J O   1 
ATOM   7037 C  CB  . ALA J  1 51 ? -4.255  20.412  145.428 1.00 22.47 ? 51   ALA J CB  1 
ATOM   7038 N  N   . ASP J  1 52 ? -5.753  17.621  145.816 1.00 21.98 ? 52   ASP J N   1 
ATOM   7039 C  CA  . ASP J  1 52 ? -5.735  16.280  146.405 1.00 26.32 ? 52   ASP J CA  1 
ATOM   7040 C  C   . ASP J  1 52 ? -5.756  15.182  145.347 1.00 23.81 ? 52   ASP J C   1 
ATOM   7041 O  O   . ASP J  1 52 ? -5.039  14.185  145.472 1.00 23.46 ? 52   ASP J O   1 
ATOM   7042 C  CB  . ASP J  1 52 ? -6.879  16.042  147.392 1.00 27.54 ? 52   ASP J CB  1 
ATOM   7043 C  CG  . ASP J  1 52 ? -6.705  16.795  148.702 1.00 33.56 ? 52   ASP J CG  1 
ATOM   7044 O  OD1 . ASP J  1 52 ? -5.595  17.301  149.006 1.00 33.53 ? 52   ASP J OD1 1 
ATOM   7045 O  OD2 . ASP J  1 52 ? -7.655  16.911  149.518 1.00 36.64 ? 52   ASP J OD2 1 
ATOM   7046 N  N   . VAL J  1 53 ? -6.610  15.339  144.338 1.00 21.98 ? 53   VAL J N   1 
ATOM   7047 C  CA  . VAL J  1 53 ? -6.683  14.361  143.259 1.00 22.57 ? 53   VAL J CA  1 
ATOM   7048 C  C   . VAL J  1 53 ? -5.360  14.306  142.472 1.00 20.72 ? 53   VAL J C   1 
ATOM   7049 O  O   . VAL J  1 53 ? -4.897  13.219  142.132 1.00 20.14 ? 53   VAL J O   1 
ATOM   7050 C  CB  . VAL J  1 53 ? -7.891  14.661  142.304 1.00 23.70 ? 53   VAL J CB  1 
ATOM   7051 C  CG1 . VAL J  1 53 ? -7.916  13.693  141.138 1.00 23.36 ? 53   VAL J CG1 1 
ATOM   7052 C  CG2 . VAL J  1 53 ? -9.218  14.619  143.084 1.00 25.86 ? 53   VAL J CG2 1 
ATOM   7053 N  N   . TRP J  1 54 ? -4.731  15.444  142.185 1.00 19.30 ? 54   TRP J N   1 
ATOM   7054 C  CA  . TRP J  1 54 ? -3.430  15.383  141.518 1.00 19.13 ? 54   TRP J CA  1 
ATOM   7055 C  C   . TRP J  1 54 ? -2.429  14.677  142.440 1.00 19.69 ? 54   TRP J C   1 
ATOM   7056 O  O   . TRP J  1 54 ? -1.659  13.849  141.982 1.00 17.18 ? 54   TRP J O   1 
ATOM   7057 C  CB  . TRP J  1 54 ? -2.866  16.765  141.155 1.00 18.11 ? 54   TRP J CB  1 
ATOM   7058 C  CG  . TRP J  1 54 ? -3.306  17.263  139.837 1.00 17.45 ? 54   TRP J CG  1 
ATOM   7059 C  CD1 . TRP J  1 54 ? -4.139  18.330  139.576 1.00 19.87 ? 54   TRP J CD1 1 
ATOM   7060 C  CD2 . TRP J  1 54 ? -2.890  16.766  138.573 1.00 19.99 ? 54   TRP J CD2 1 
ATOM   7061 N  NE1 . TRP J  1 54 ? -4.312  18.479  138.217 1.00 18.70 ? 54   TRP J NE1 1 
ATOM   7062 C  CE2 . TRP J  1 54 ? -3.525  17.557  137.574 1.00 21.37 ? 54   TRP J CE2 1 
ATOM   7063 C  CE3 . TRP J  1 54 ? -2.053  15.719  138.173 1.00 19.83 ? 54   TRP J CE3 1 
ATOM   7064 C  CZ2 . TRP J  1 54 ? -3.351  17.327  136.211 1.00 19.90 ? 54   TRP J CZ2 1 
ATOM   7065 C  CZ3 . TRP J  1 54 ? -1.864  15.505  136.794 1.00 19.45 ? 54   TRP J CZ3 1 
ATOM   7066 C  CH2 . TRP J  1 54 ? -2.524  16.295  135.844 1.00 19.24 ? 54   TRP J CH2 1 
ATOM   7067 N  N   . PHE J  1 55 ? -2.431  15.027  143.718 1.00 17.67 ? 55   PHE J N   1 
ATOM   7068 C  CA  . PHE J  1 55 ? -1.442  14.455  144.630 1.00 19.54 ? 55   PHE J CA  1 
ATOM   7069 C  C   . PHE J  1 55 ? -1.504  12.920  144.653 1.00 20.22 ? 55   PHE J C   1 
ATOM   7070 O  O   . PHE J  1 55 ? -0.476  12.225  144.627 1.00 20.99 ? 55   PHE J O   1 
ATOM   7071 C  CB  . PHE J  1 55 ? -1.595  14.997  146.051 1.00 20.58 ? 55   PHE J CB  1 
ATOM   7072 C  CG  . PHE J  1 55 ? -0.444  14.611  146.929 1.00 20.19 ? 55   PHE J CG  1 
ATOM   7073 C  CD1 . PHE J  1 55 ? 0.723   15.361  146.924 1.00 21.50 ? 55   PHE J CD1 1 
ATOM   7074 C  CD2 . PHE J  1 55 ? -0.491  13.440  147.641 1.00 20.48 ? 55   PHE J CD2 1 
ATOM   7075 C  CE1 . PHE J  1 55 ? 1.817   14.992  147.710 1.00 19.76 ? 55   PHE J CE1 1 
ATOM   7076 C  CE2 . PHE J  1 55 ? 0.601   13.057  148.432 1.00 22.68 ? 55   PHE J CE2 1 
ATOM   7077 C  CZ  . PHE J  1 55 ? 1.750   13.843  148.437 1.00 23.77 ? 55   PHE J CZ  1 
ATOM   7078 N  N   . LYS J  1 56 ? -2.716  12.388  144.693 1.00 20.58 ? 56   LYS J N   1 
ATOM   7079 C  CA  . LYS J  1 56 ? -2.915  10.943  144.700 1.00 24.44 ? 56   LYS J CA  1 
ATOM   7080 C  C   . LYS J  1 56 ? -2.472  10.324  143.371 1.00 23.89 ? 56   LYS J C   1 
ATOM   7081 O  O   . LYS J  1 56 ? -1.819  9.278   143.337 1.00 23.15 ? 56   LYS J O   1 
ATOM   7082 C  CB  . LYS J  1 56 ? -4.378  10.616  145.003 1.00 27.02 ? 56   LYS J CB  1 
ATOM   7083 C  CG  . LYS J  1 56 ? -4.619  9.125   145.188 1.00 32.11 ? 56   LYS J CG  1 
ATOM   7084 C  CD  . LYS J  1 56 ? -6.093  8.818   145.351 1.00 35.10 ? 56   LYS J CD  1 
ATOM   7085 C  CE  . LYS J  1 56 ? -6.285  7.408   145.906 1.00 38.48 ? 56   LYS J CE  1 
ATOM   7086 N  NZ  . LYS J  1 56 ? -7.696  6.958   145.710 1.00 41.72 ? 56   LYS J NZ  1 
ATOM   7087 N  N   . GLU J  1 57 ? -2.777  10.989  142.262 1.00 21.51 ? 57   GLU J N   1 
ATOM   7088 C  CA  . GLU J  1 57 ? -2.339  10.528  140.968 1.00 23.94 ? 57   GLU J CA  1 
ATOM   7089 C  C   . GLU J  1 57 ? -0.799  10.530  140.824 1.00 21.88 ? 57   GLU J C   1 
ATOM   7090 O  O   . GLU J  1 57 ? -0.249  9.614   140.235 1.00 21.07 ? 57   GLU J O   1 
ATOM   7091 C  CB  . GLU J  1 57 ? -3.015  11.385  139.891 1.00 26.54 ? 57   GLU J CB  1 
ATOM   7092 C  CG  . GLU J  1 57 ? -2.603  11.099  138.468 1.00 32.94 ? 57   GLU J CG  1 
ATOM   7093 C  CD  . GLU J  1 57 ? -3.416  11.915  137.487 1.00 34.22 ? 57   GLU J CD  1 
ATOM   7094 O  OE1 . GLU J  1 57 ? -4.472  12.460  137.895 1.00 34.39 ? 57   GLU J OE1 1 
ATOM   7095 O  OE2 . GLU J  1 57 ? -2.967  12.017  136.322 1.00 37.31 ? 57   GLU J OE2 1 
ATOM   7096 N  N   . LEU J  1 58 ? -0.119  11.534  141.380 1.00 16.91 ? 58   LEU J N   1 
ATOM   7097 C  CA  . LEU J  1 58 ? 1.334   11.712  141.247 1.00 16.40 ? 58   LEU J CA  1 
ATOM   7098 C  C   . LEU J  1 58 ? 2.203   10.914  142.240 1.00 17.01 ? 58   LEU J C   1 
ATOM   7099 O  O   . LEU J  1 58 ? 3.350   10.542  141.929 1.00 16.43 ? 58   LEU J O   1 
ATOM   7100 C  CB  . LEU J  1 58 ? 1.689   13.203  141.366 1.00 16.54 ? 58   LEU J CB  1 
ATOM   7101 C  CG  . LEU J  1 58 ? 1.044   14.106  140.286 1.00 14.93 ? 58   LEU J CG  1 
ATOM   7102 C  CD1 . LEU J  1 58 ? 1.361   15.547  140.545 1.00 14.86 ? 58   LEU J CD1 1 
ATOM   7103 C  CD2 . LEU J  1 58 ? 1.498   13.724  138.866 1.00 13.16 ? 58   LEU J CD2 1 
ATOM   7104 N  N   . ASP J  1 59 ? 1.661   10.638  143.421 1.00 14.11 ? 59   ASP J N   1 
ATOM   7105 C  CA  . ASP J  1 59 ? 2.451   9.949   144.451 1.00 14.09 ? 59   ASP J CA  1 
ATOM   7106 C  C   . ASP J  1 59 ? 2.440   8.438   144.202 1.00 13.02 ? 59   ASP J C   1 
ATOM   7107 O  O   . ASP J  1 59 ? 1.749   7.685   144.863 1.00 16.93 ? 59   ASP J O   1 
ATOM   7108 C  CB  . ASP J  1 59 ? 1.915   10.303  145.846 1.00 16.04 ? 59   ASP J CB  1 
ATOM   7109 C  CG  . ASP J  1 59 ? 2.797   9.746   146.943 1.00 16.27 ? 59   ASP J CG  1 
ATOM   7110 O  OD1 . ASP J  1 59 ? 3.931   9.295   146.611 1.00 15.66 ? 59   ASP J OD1 1 
ATOM   7111 O  OD2 . ASP J  1 59 ? 2.458   9.708   148.145 1.00 16.80 ? 59   ASP J OD2 1 
ATOM   7112 N  N   . ILE J  1 60 ? 3.228   7.993   143.232 1.00 16.89 ? 60   ILE J N   1 
ATOM   7113 C  CA  . ILE J  1 60 ? 3.162   6.627   142.718 1.00 16.56 ? 60   ILE J CA  1 
ATOM   7114 C  C   . ILE J  1 60 ? 3.512   5.587   143.785 1.00 16.97 ? 60   ILE J C   1 
ATOM   7115 O  O   . ILE J  1 60 ? 2.890   4.513   143.855 1.00 20.14 ? 60   ILE J O   1 
ATOM   7116 C  CB  . ILE J  1 60 ? 4.139   6.487   141.505 1.00 14.62 ? 60   ILE J CB  1 
ATOM   7117 C  CG1 . ILE J  1 60 ? 3.686   7.396   140.348 1.00 18.08 ? 60   ILE J CG1 1 
ATOM   7118 C  CG2 . ILE J  1 60 ? 4.242   5.064   141.045 1.00 18.06 ? 60   ILE J CG2 1 
ATOM   7119 C  CD1 . ILE J  1 60 ? 2.251   7.230   139.947 1.00 17.80 ? 60   ILE J CD1 1 
ATOM   7120 N  N   . ASN J  1 61 ? 4.518   5.905   144.590 1.00 16.07 ? 61   ASN J N   1 
ATOM   7121 C  CA  . ASN J  1 61 ? 4.958   4.978   145.642 1.00 16.84 ? 61   ASN J CA  1 
ATOM   7122 C  C   . ASN J  1 61 ? 4.243   5.151   147.001 1.00 18.58 ? 61   ASN J C   1 
ATOM   7123 O  O   . ASN J  1 61 ? 4.598   4.491   147.978 1.00 18.62 ? 61   ASN J O   1 
ATOM   7124 C  CB  . ASN J  1 61 ? 6.495   5.017   145.793 1.00 16.49 ? 61   ASN J CB  1 
ATOM   7125 C  CG  . ASN J  1 61 ? 6.993   6.341   146.349 1.00 17.61 ? 61   ASN J CG  1 
ATOM   7126 O  OD1 . ASN J  1 61 ? 6.396   7.376   146.107 1.00 20.26 ? 61   ASN J OD1 1 
ATOM   7127 N  ND2 . ASN J  1 61 ? 8.063   6.300   147.146 1.00 16.36 ? 61   ASN J ND2 1 
ATOM   7128 N  N   . THR J  1 62 ? 3.223   6.016   147.039 1.00 17.74 ? 62   THR J N   1 
ATOM   7129 C  CA  . THR J  1 62 ? 2.459   6.381   148.225 1.00 19.16 ? 62   THR J CA  1 
ATOM   7130 C  C   . THR J  1 62 ? 3.305   6.614   149.467 1.00 19.23 ? 62   THR J C   1 
ATOM   7131 O  O   . THR J  1 62 ? 3.054   6.023   150.513 1.00 18.08 ? 62   THR J O   1 
ATOM   7132 C  CB  . THR J  1 62 ? 1.327   5.371   148.516 1.00 21.80 ? 62   THR J CB  1 
ATOM   7133 O  OG1 . THR J  1 62 ? 1.832   4.030   148.447 1.00 24.34 ? 62   THR J OG1 1 
ATOM   7134 C  CG2 . THR J  1 62 ? 0.290   5.438   147.398 1.00 22.46 ? 62   THR J CG2 1 
ATOM   7135 N  N   . ASP J  1 63 ? 4.347   7.432   149.318 1.00 16.68 ? 63   ASP J N   1 
ATOM   7136 C  CA  . ASP J  1 63 ? 5.181   7.786   150.458 1.00 17.91 ? 63   ASP J CA  1 
ATOM   7137 C  C   . ASP J  1 63 ? 4.886   9.178   151.010 1.00 18.32 ? 63   ASP J C   1 
ATOM   7138 O  O   . ASP J  1 63 ? 5.579   9.640   151.937 1.00 18.61 ? 63   ASP J O   1 
ATOM   7139 C  CB  . ASP J  1 63 ? 6.653   7.650   150.129 1.00 15.94 ? 63   ASP J CB  1 
ATOM   7140 C  CG  . ASP J  1 63 ? 7.121   8.657   149.101 1.00 18.58 ? 63   ASP J CG  1 
ATOM   7141 O  OD1 . ASP J  1 63 ? 6.315   9.352   148.447 1.00 14.02 ? 63   ASP J OD1 1 
ATOM   7142 O  OD2 . ASP J  1 63 ? 8.335   8.860   148.899 1.00 23.69 ? 63   ASP J OD2 1 
ATOM   7143 N  N   . GLY J  1 64 ? 3.848   9.818   150.474 1.00 16.91 ? 64   GLY J N   1 
ATOM   7144 C  CA  . GLY J  1 64 ? 3.377   11.128  150.985 1.00 16.86 ? 64   GLY J CA  1 
ATOM   7145 C  C   . GLY J  1 64 ? 4.142   12.320  150.451 1.00 18.11 ? 64   GLY J C   1 
ATOM   7146 O  O   . GLY J  1 64 ? 4.073   13.437  150.983 1.00 15.92 ? 64   GLY J O   1 
ATOM   7147 N  N   . ALA J  1 65 ? 4.868   12.101  149.359 1.00 15.19 ? 65   ALA J N   1 
ATOM   7148 C  CA  . ALA J  1 65 ? 5.503   13.200  148.645 1.00 17.47 ? 65   ALA J CA  1 
ATOM   7149 C  C   . ALA J  1 65 ? 5.567   12.915  147.157 1.00 16.90 ? 65   ALA J C   1 
ATOM   7150 O  O   . ALA J  1 65 ? 5.441   11.756  146.725 1.00 16.33 ? 65   ALA J O   1 
ATOM   7151 C  CB  . ALA J  1 65 ? 6.892   13.406  149.163 1.00 17.19 ? 65   ALA J CB  1 
ATOM   7152 N  N   . VAL J  1 66 ? 5.790   13.993  146.393 1.00 17.07 ? 66   VAL J N   1 
ATOM   7153 C  CA  . VAL J  1 66 ? 5.950   13.941  144.959 1.00 15.63 ? 66   VAL J CA  1 
ATOM   7154 C  C   . VAL J  1 66 ? 7.433   14.222  144.720 1.00 14.56 ? 66   VAL J C   1 
ATOM   7155 O  O   . VAL J  1 66 ? 7.946   15.306  145.050 1.00 15.92 ? 66   VAL J O   1 
ATOM   7156 C  CB  . VAL J  1 66 ? 5.064   15.020  144.295 1.00 16.49 ? 66   VAL J CB  1 
ATOM   7157 C  CG1 . VAL J  1 66 ? 5.409   15.247  142.814 1.00 14.20 ? 66   VAL J CG1 1 
ATOM   7158 C  CG2 . VAL J  1 66 ? 3.581   14.638  144.415 1.00 18.05 ? 66   VAL J CG2 1 
ATOM   7159 N  N   . ASN J  1 67 ? 8.144   13.216  144.230 1.00 15.87 ? 67   ASN J N   1 
ATOM   7160 C  CA  . ASN J  1 67 ? 9.561   13.417  143.861 1.00 13.82 ? 67   ASN J CA  1 
ATOM   7161 C  C   . ASN J  1 67 ? 9.668   13.941  142.434 1.00 16.75 ? 67   ASN J C   1 
ATOM   7162 O  O   . ASN J  1 67 ? 8.670   14.205  141.773 1.00 17.49 ? 67   ASN J O   1 
ATOM   7163 C  CB  . ASN J  1 67 ? 10.413  12.154  144.127 1.00 15.75 ? 67   ASN J CB  1 
ATOM   7164 C  CG  . ASN J  1 67 ? 10.121  10.993  143.155 1.00 16.86 ? 67   ASN J CG  1 
ATOM   7165 O  OD1 . ASN J  1 67 ? 9.526   11.157  142.083 1.00 16.27 ? 67   ASN J OD1 1 
ATOM   7166 N  ND2 . ASN J  1 67 ? 10.501  9.781   143.567 1.00 18.59 ? 67   ASN J ND2 1 
ATOM   7167 N  N   . PHE J  1 68 ? 10.874  14.173  141.963 1.00 13.55 ? 68   PHE J N   1 
ATOM   7168 C  CA  . PHE J  1 68 ? 10.985  14.851  140.657 1.00 17.41 ? 68   PHE J CA  1 
ATOM   7169 C  C   . PHE J  1 68 ? 10.445  13.983  139.521 1.00 18.09 ? 68   PHE J C   1 
ATOM   7170 O  O   . PHE J  1 68 ? 9.767   14.486  138.645 1.00 17.12 ? 68   PHE J O   1 
ATOM   7171 C  CB  . PHE J  1 68 ? 12.417  15.244  140.348 1.00 17.78 ? 68   PHE J CB  1 
ATOM   7172 C  CG  . PHE J  1 68 ? 12.562  16.047  139.071 1.00 18.38 ? 68   PHE J CG  1 
ATOM   7173 C  CD1 . PHE J  1 68 ? 11.975  17.310  138.955 1.00 17.46 ? 68   PHE J CD1 1 
ATOM   7174 C  CD2 . PHE J  1 68 ? 13.232  15.534  137.987 1.00 21.44 ? 68   PHE J CD2 1 
ATOM   7175 C  CE1 . PHE J  1 68 ? 12.079  18.065  137.796 1.00 20.02 ? 68   PHE J CE1 1 
ATOM   7176 C  CE2 . PHE J  1 68 ? 13.353  16.301  136.777 1.00 20.95 ? 68   PHE J CE2 1 
ATOM   7177 C  CZ  . PHE J  1 68 ? 12.775  17.551  136.692 1.00 19.23 ? 68   PHE J CZ  1 
ATOM   7178 N  N   . GLN J  1 69 ? 10.773  12.690  139.514 1.00 17.74 ? 69   GLN J N   1 
ATOM   7179 C  CA  . GLN J  1 69 ? 10.280  11.849  138.416 1.00 21.70 ? 69   GLN J CA  1 
ATOM   7180 C  C   . GLN J  1 69 ? 8.752   11.756  138.461 1.00 19.66 ? 69   GLN J C   1 
ATOM   7181 O  O   . GLN J  1 69 ? 8.100   11.710  137.422 1.00 17.33 ? 69   GLN J O   1 
ATOM   7182 C  CB  . GLN J  1 69 ? 10.946  10.474  138.438 1.00 24.75 ? 69   GLN J CB  1 
ATOM   7183 C  CG  . GLN J  1 69 ? 10.686  9.670   139.693 1.00 31.65 ? 69   GLN J CG  1 
ATOM   7184 C  CD  . GLN J  1 69 ? 11.733  8.567   139.884 1.00 36.90 ? 69   GLN J CD  1 
ATOM   7185 O  OE1 . GLN J  1 69 ? 12.625  8.694   140.741 1.00 38.83 ? 69   GLN J OE1 1 
ATOM   7186 N  NE2 . GLN J  1 69 ? 11.634  7.499   139.082 1.00 37.92 ? 69   GLN J NE2 1 
ATOM   7187 N  N   . GLU J  1 70 ? 8.187   11.777  139.671 1.00 17.71 ? 70   GLU J N   1 
ATOM   7188 C  CA  . GLU J  1 70 ? 6.734   11.872  139.819 1.00 16.45 ? 70   GLU J CA  1 
ATOM   7189 C  C   . GLU J  1 70 ? 6.210   13.202  139.251 1.00 17.16 ? 70   GLU J C   1 
ATOM   7190 O  O   . GLU J  1 70 ? 5.189   13.225  138.552 1.00 16.91 ? 70   GLU J O   1 
ATOM   7191 C  CB  . GLU J  1 70 ? 6.334   11.655  141.272 1.00 14.66 ? 70   GLU J CB  1 
ATOM   7192 C  CG  . GLU J  1 70 ? 6.456   10.195  141.720 1.00 12.71 ? 70   GLU J CG  1 
ATOM   7193 C  CD  . GLU J  1 70 ? 6.358   9.998   143.235 1.00 11.48 ? 70   GLU J CD  1 
ATOM   7194 O  OE1 . GLU J  1 70 ? 6.679   10.938  144.009 1.00 15.31 ? 70   GLU J OE1 1 
ATOM   7195 O  OE2 . GLU J  1 70 ? 5.913   8.915   143.666 1.00 14.31 ? 70   GLU J OE2 1 
ATOM   7196 N  N   . PHE J  1 71 ? 6.898   14.304  139.551 1.00 15.97 ? 71   PHE J N   1 
ATOM   7197 C  CA  . PHE J  1 71 ? 6.522   15.636  139.035 1.00 15.87 ? 71   PHE J CA  1 
ATOM   7198 C  C   . PHE J  1 71 ? 6.451   15.656  137.515 1.00 17.32 ? 71   PHE J C   1 
ATOM   7199 O  O   . PHE J  1 71 ? 5.590   16.327  136.901 1.00 14.42 ? 71   PHE J O   1 
ATOM   7200 C  CB  . PHE J  1 71 ? 7.530   16.668  139.567 1.00 16.34 ? 71   PHE J CB  1 
ATOM   7201 C  CG  . PHE J  1 71 ? 7.418   18.021  138.907 1.00 17.93 ? 71   PHE J CG  1 
ATOM   7202 C  CD1 . PHE J  1 71 ? 6.282   18.792  139.097 1.00 16.25 ? 71   PHE J CD1 1 
ATOM   7203 C  CD2 . PHE J  1 71 ? 8.450   18.501  138.118 1.00 18.69 ? 71   PHE J CD2 1 
ATOM   7204 C  CE1 . PHE J  1 71 ? 6.161   20.057  138.493 1.00 18.34 ? 71   PHE J CE1 1 
ATOM   7205 C  CE2 . PHE J  1 71 ? 8.338   19.778  137.510 1.00 19.51 ? 71   PHE J CE2 1 
ATOM   7206 C  CZ  . PHE J  1 71 ? 7.183   20.539  137.720 1.00 18.44 ? 71   PHE J CZ  1 
ATOM   7207 N  N   . LEU J  1 72 ? 7.347   14.904  136.891 1.00 17.70 ? 72   LEU J N   1 
ATOM   7208 C  CA  . LEU J  1 72 ? 7.340   14.821  135.407 1.00 19.25 ? 72   LEU J CA  1 
ATOM   7209 C  C   . LEU J  1 72 ? 6.041   14.227  134.823 1.00 19.10 ? 72   LEU J C   1 
ATOM   7210 O  O   . LEU J  1 72 ? 5.674   14.515  133.683 1.00 18.09 ? 72   LEU J O   1 
ATOM   7211 C  CB  . LEU J  1 72 ? 8.585   14.078  134.911 1.00 19.30 ? 72   LEU J CB  1 
ATOM   7212 C  CG  . LEU J  1 72 ? 9.907   14.844  135.122 1.00 20.91 ? 72   LEU J CG  1 
ATOM   7213 C  CD1 . LEU J  1 72 ? 11.081  13.964  134.732 1.00 23.21 ? 72   LEU J CD1 1 
ATOM   7214 C  CD2 . LEU J  1 72 ? 9.974   16.143  134.298 1.00 22.56 ? 72   LEU J CD2 1 
ATOM   7215 N  N   . ILE J  1 73 ? 5.305   13.420  135.586 1.00 15.00 ? 73   ILE J N   1 
ATOM   7216 C  CA  . ILE J  1 73 ? 3.978   13.055  135.129 1.00 16.66 ? 73   ILE J CA  1 
ATOM   7217 C  C   . ILE J  1 73 ? 3.072   14.282  134.905 1.00 17.93 ? 73   ILE J C   1 
ATOM   7218 O  O   . ILE J  1 73 ? 2.350   14.362  133.894 1.00 16.72 ? 73   ILE J O   1 
ATOM   7219 C  CB  . ILE J  1 73 ? 3.319   12.066  136.113 1.00 16.36 ? 73   ILE J CB  1 
ATOM   7220 C  CG1 . ILE J  1 73 ? 4.134   10.772  136.219 1.00 17.39 ? 73   ILE J CG1 1 
ATOM   7221 C  CG2 . ILE J  1 73 ? 1.893   11.750  135.692 1.00 17.77 ? 73   ILE J CG2 1 
ATOM   7222 C  CD1 . ILE J  1 73 ? 3.754   9.941   137.461 1.00 17.01 ? 73   ILE J CD1 1 
ATOM   7223 N  N   . LEU J  1 74 ? 3.038   15.183  135.895 1.00 15.42 ? 74   LEU J N   1 
ATOM   7224 C  CA  . LEU J  1 74 ? 2.329   16.454  135.782 1.00 15.54 ? 74   LEU J CA  1 
ATOM   7225 C  C   . LEU J  1 74 ? 2.810   17.244  134.567 1.00 16.07 ? 74   LEU J C   1 
ATOM   7226 O  O   . LEU J  1 74 ? 1.999   17.722  133.793 1.00 17.89 ? 74   LEU J O   1 
ATOM   7227 C  CB  . LEU J  1 74 ? 2.500   17.293  137.064 1.00 14.45 ? 74   LEU J CB  1 
ATOM   7228 C  CG  . LEU J  1 74 ? 1.851   18.690  136.948 1.00 18.77 ? 74   LEU J CG  1 
ATOM   7229 C  CD1 . LEU J  1 74 ? 0.295   18.557  136.820 1.00 19.12 ? 74   LEU J CD1 1 
ATOM   7230 C  CD2 . LEU J  1 74 ? 2.275   19.494  138.193 1.00 17.24 ? 74   LEU J CD2 1 
ATOM   7231 N  N   . VAL J  1 75 ? 4.118   17.367  134.379 1.00 17.58 ? 75   VAL J N   1 
ATOM   7232 C  CA  . VAL J  1 75 ? 4.643   18.128  133.229 1.00 15.23 ? 75   VAL J CA  1 
ATOM   7233 C  C   . VAL J  1 75 ? 4.208   17.545  131.878 1.00 17.49 ? 75   VAL J C   1 
ATOM   7234 O  O   . VAL J  1 75 ? 3.789   18.289  130.952 1.00 18.16 ? 75   VAL J O   1 
ATOM   7235 C  CB  . VAL J  1 75 ? 6.163   18.219  133.268 1.00 17.20 ? 75   VAL J CB  1 
ATOM   7236 C  CG1 . VAL J  1 75 ? 6.675   18.985  132.064 1.00 17.56 ? 75   VAL J CG1 1 
ATOM   7237 C  CG2 . VAL J  1 75 ? 6.630   18.877  134.593 1.00 14.50 ? 75   VAL J CG2 1 
ATOM   7238 N  N   . ILE J  1 76 ? 4.268   16.217  131.766 1.00 17.85 ? 76   ILE J N   1 
ATOM   7239 C  CA  . ILE J  1 76 ? 3.791   15.559  130.539 1.00 17.30 ? 76   ILE J CA  1 
ATOM   7240 C  C   . ILE J  1 76 ? 2.319   15.869  130.305 1.00 17.08 ? 76   ILE J C   1 
ATOM   7241 O  O   . ILE J  1 76 ? 1.936   16.286  129.200 1.00 18.81 ? 76   ILE J O   1 
ATOM   7242 C  CB  . ILE J  1 76 ? 4.048   14.050  130.596 1.00 18.41 ? 76   ILE J CB  1 
ATOM   7243 C  CG1 . ILE J  1 76 ? 5.566   13.791  130.525 1.00 15.90 ? 76   ILE J CG1 1 
ATOM   7244 C  CG2 . ILE J  1 76 ? 3.276   13.308  129.462 1.00 16.12 ? 76   ILE J CG2 1 
ATOM   7245 C  CD1 . ILE J  1 76 ? 6.021   12.324  130.814 1.00 17.79 ? 76   ILE J CD1 1 
ATOM   7246 N  N   . LYS J  1 77 ? 1.485   15.676  131.324 1.00 15.04 ? 77   LYS J N   1 
ATOM   7247 C  CA  . LYS J  1 77 ? 0.048   15.882  131.133 1.00 17.87 ? 77   LYS J CA  1 
ATOM   7248 C  C   . LYS J  1 77 ? -0.261  17.341  130.826 1.00 17.18 ? 77   LYS J C   1 
ATOM   7249 O  O   . LYS J  1 77 ? -1.123  17.624  129.984 1.00 16.10 ? 77   LYS J O   1 
ATOM   7250 C  CB  . LYS J  1 77 ? -0.725  15.383  132.359 1.00 17.57 ? 77   LYS J CB  1 
ATOM   7251 C  CG  . LYS J  1 77 ? -0.637  13.845  132.426 1.00 21.00 ? 77   LYS J CG  1 
ATOM   7252 C  CD  . LYS J  1 77 ? -1.645  13.176  133.351 1.00 26.35 ? 77   LYS J CD  1 
ATOM   7253 C  CE  . LYS J  1 77 ? -1.709  11.691  133.006 1.00 26.78 ? 77   LYS J CE  1 
ATOM   7254 N  NZ  . LYS J  1 77 ? -2.345  10.891  134.059 1.00 30.73 ? 77   LYS J NZ  1 
ATOM   7255 N  N   . MET J  1 78 ? 0.419   18.258  131.515 1.00 17.01 ? 78   MET J N   1 
ATOM   7256 C  CA  . MET J  1 78 ? 0.301   19.687  131.199 1.00 18.05 ? 78   MET J CA  1 
ATOM   7257 C  C   . MET J  1 78 ? 0.727   20.000  129.771 1.00 17.55 ? 78   MET J C   1 
ATOM   7258 O  O   . MET J  1 78 ? 0.134   20.844  129.128 1.00 17.36 ? 78   MET J O   1 
ATOM   7259 C  CB  . MET J  1 78 ? 1.117   20.542  132.173 1.00 19.41 ? 78   MET J CB  1 
ATOM   7260 C  CG  . MET J  1 78 ? 0.418   20.677  133.527 1.00 20.98 ? 78   MET J CG  1 
ATOM   7261 S  SD  . MET J  1 78 ? 1.394   21.728  134.675 1.00 24.61 ? 78   MET J SD  1 
ATOM   7262 C  CE  . MET J  1 78 ? 1.499   23.189  133.651 1.00 18.79 ? 78   MET J CE  1 
ATOM   7263 N  N   . GLY J  1 79 ? 1.786   19.358  129.303 1.00 16.59 ? 79   GLY J N   1 
ATOM   7264 C  CA  . GLY J  1 79 ? 2.268   19.596  127.914 1.00 16.88 ? 79   GLY J CA  1 
ATOM   7265 C  C   . GLY J  1 79 ? 1.220   19.141  126.909 1.00 17.31 ? 79   GLY J C   1 
ATOM   7266 O  O   . GLY J  1 79 ? 0.818   19.881  126.001 1.00 15.71 ? 79   GLY J O   1 
ATOM   7267 N  N   . VAL J  1 80 ? 0.759   17.908  127.071 1.00 16.20 ? 80   VAL J N   1 
ATOM   7268 C  CA  . VAL J  1 80 ? -0.255  17.322  126.171 1.00 17.10 ? 80   VAL J CA  1 
ATOM   7269 C  C   . VAL J  1 80 ? -1.533  18.177  126.165 1.00 18.57 ? 80   VAL J C   1 
ATOM   7270 O  O   . VAL J  1 80 ? -2.069  18.470  125.074 1.00 18.65 ? 80   VAL J O   1 
ATOM   7271 C  CB  . VAL J  1 80 ? -0.551  15.849  126.558 1.00 19.07 ? 80   VAL J CB  1 
ATOM   7272 C  CG1 . VAL J  1 80 ? -1.714  15.267  125.750 1.00 21.10 ? 80   VAL J CG1 1 
ATOM   7273 C  CG2 . VAL J  1 80 ? 0.692   14.980  126.354 1.00 18.77 ? 80   VAL J CG2 1 
ATOM   7274 N  N   . ALA J  1 81 ? -2.022  18.590  127.346 1.00 18.81 ? 81   ALA J N   1 
ATOM   7275 C  CA  . ALA J  1 81 ? -3.219  19.460  127.418 1.00 17.98 ? 81   ALA J CA  1 
ATOM   7276 C  C   . ALA J  1 81 ? -2.997  20.811  126.733 1.00 18.39 ? 81   ALA J C   1 
ATOM   7277 O  O   . ALA J  1 81 ? -3.834  21.254  125.939 1.00 20.00 ? 81   ALA J O   1 
ATOM   7278 C  CB  . ALA J  1 81 ? -3.751  19.678  128.880 1.00 19.08 ? 81   ALA J CB  1 
ATOM   7279 N  N   . ALA J  1 82 ? -1.857  21.431  127.003 1.00 18.48 ? 82   ALA J N   1 
ATOM   7280 C  CA  . ALA J  1 82 ? -1.545  22.741  126.411 1.00 19.55 ? 82   ALA J CA  1 
ATOM   7281 C  C   . ALA J  1 82 ? -1.466  22.644  124.885 1.00 21.61 ? 82   ALA J C   1 
ATOM   7282 O  O   . ALA J  1 82 ? -1.939  23.545  124.154 1.00 22.89 ? 82   ALA J O   1 
ATOM   7283 C  CB  . ALA J  1 82 ? -0.242  23.272  126.987 1.00 18.32 ? 82   ALA J CB  1 
ATOM   7284 N  N   . HIS J  1 83 ? -0.853  21.564  124.398 1.00 17.87 ? 83   HIS J N   1 
ATOM   7285 C  CA  . HIS J  1 83 ? -0.754  21.333  122.950 1.00 19.50 ? 83   HIS J CA  1 
ATOM   7286 C  C   . HIS J  1 83 ? -2.141  21.208  122.341 1.00 20.08 ? 83   HIS J C   1 
ATOM   7287 O  O   . HIS J  1 83 ? -2.451  21.841  121.326 1.00 20.57 ? 83   HIS J O   1 
ATOM   7288 C  CB  . HIS J  1 83 ? 0.075   20.088  122.619 1.00 17.49 ? 83   HIS J CB  1 
ATOM   7289 C  CG  . HIS J  1 83 ? 0.054   19.742  121.150 1.00 15.92 ? 83   HIS J CG  1 
ATOM   7290 N  ND1 . HIS J  1 83 ? -0.765  18.759  120.634 1.00 17.53 ? 83   HIS J ND1 1 
ATOM   7291 C  CD2 . HIS J  1 83 ? 0.666   20.313  120.084 1.00 17.15 ? 83   HIS J CD2 1 
ATOM   7292 C  CE1 . HIS J  1 83 ? -0.627  18.712  119.316 1.00 17.64 ? 83   HIS J CE1 1 
ATOM   7293 N  NE2 . HIS J  1 83 ? 0.240   19.645  118.957 1.00 16.85 ? 83   HIS J NE2 1 
ATOM   7294 N  N   . LYS J  1 84 ? -2.998  20.412  122.965 1.00 24.02 ? 84   LYS J N   1 
ATOM   7295 C  CA  . LYS J  1 84 ? -4.373  20.292  122.495 1.00 28.83 ? 84   LYS J CA  1 
ATOM   7296 C  C   . LYS J  1 84 ? -5.044  21.657  122.381 1.00 30.68 ? 84   LYS J C   1 
ATOM   7297 O  O   . LYS J  1 84 ? -5.699  21.967  121.369 1.00 29.59 ? 84   LYS J O   1 
ATOM   7298 C  CB  . LYS J  1 84 ? -5.174  19.435  123.474 1.00 32.29 ? 84   LYS J CB  1 
ATOM   7299 C  CG  . LYS J  1 84 ? -5.578  18.091  122.959 1.00 37.74 ? 84   LYS J CG  1 
ATOM   7300 C  CD  . LYS J  1 84 ? -6.301  17.317  124.056 1.00 41.63 ? 84   LYS J CD  1 
ATOM   7301 C  CE  . LYS J  1 84 ? -7.435  16.456  123.494 1.00 44.99 ? 84   LYS J CE  1 
ATOM   7302 N  NZ  . LYS J  1 84 ? -7.807  15.328  124.430 1.00 46.44 ? 84   LYS J NZ  1 
ATOM   7303 N  N   . LYS J  1 85 ? -4.895  22.472  123.427 1.00 32.43 ? 85   LYS J N   1 
ATOM   7304 C  CA  . LYS J  1 85 ? -5.492  23.809  123.452 1.00 36.06 ? 85   LYS J CA  1 
ATOM   7305 C  C   . LYS J  1 85 ? -4.934  24.702  122.350 1.00 37.25 ? 85   LYS J C   1 
ATOM   7306 O  O   . LYS J  1 85 ? -5.692  25.413  121.698 1.00 37.36 ? 85   LYS J O   1 
ATOM   7307 C  CB  . LYS J  1 85 ? -5.251  24.510  124.791 1.00 37.90 ? 85   LYS J CB  1 
ATOM   7308 C  CG  . LYS J  1 85 ? -5.806  23.790  125.998 1.00 41.27 ? 85   LYS J CG  1 
ATOM   7309 C  CD  . LYS J  1 85 ? -7.250  24.142  126.257 1.00 43.81 ? 85   LYS J CD  1 
ATOM   7310 C  CE  . LYS J  1 85 ? -7.828  23.265  127.363 1.00 45.31 ? 85   LYS J CE  1 
ATOM   7311 N  NZ  . LYS J  1 85 ? -9.299  23.480  127.497 1.00 47.48 ? 85   LYS J NZ  1 
ATOM   7312 N  N   . SER J  1 86 ? -3.623  24.666  122.135 1.00 38.94 ? 86   SER J N   1 
ATOM   7313 C  CA  . SER J  1 86 ? -3.017  25.567  121.158 1.00 43.26 ? 86   SER J CA  1 
ATOM   7314 C  C   . SER J  1 86 ? -3.491  25.331  119.724 1.00 46.72 ? 86   SER J C   1 
ATOM   7315 O  O   . SER J  1 86 ? -3.280  26.170  118.846 1.00 45.21 ? 86   SER J O   1 
ATOM   7316 C  CB  . SER J  1 86 ? -1.489  25.619  121.258 1.00 44.28 ? 86   SER J CB  1 
ATOM   7317 O  OG  . SER J  1 86 ? -0.878  24.614  120.473 1.00 47.30 ? 86   SER J OG  1 
ATOM   7318 N  N   . HIS J  1 87 ? -4.133  24.195  119.476 1.00 50.61 ? 87   HIS J N   1 
ATOM   7319 C  CA  . HIS J  1 87 ? -4.960  24.112  118.272 1.00 55.15 ? 87   HIS J CA  1 
ATOM   7320 C  C   . HIS J  1 87 ? -6.324  23.482  118.533 1.00 56.77 ? 87   HIS J C   1 
ATOM   7321 O  O   . HIS J  1 87 ? -6.705  22.487  117.923 1.00 58.01 ? 87   HIS J O   1 
ATOM   7322 C  CB  . HIS J  1 87 ? -4.214  23.529  117.071 1.00 56.64 ? 87   HIS J CB  1 
ATOM   7323 C  CG  . HIS J  1 87 ? -4.076  22.041  117.092 1.00 58.20 ? 87   HIS J CG  1 
ATOM   7324 N  ND1 . HIS J  1 87 ? -3.644  21.350  118.201 1.00 58.10 ? 87   HIS J ND1 1 
ATOM   7325 C  CD2 . HIS J  1 87 ? -4.279  21.114  116.124 1.00 58.59 ? 87   HIS J CD2 1 
ATOM   7326 C  CE1 . HIS J  1 87 ? -3.608  20.059  117.923 1.00 59.29 ? 87   HIS J CE1 1 
ATOM   7327 N  NE2 . HIS J  1 87 ? -3.989  19.888  116.669 1.00 59.01 ? 87   HIS J NE2 1 
ATOM   7328 N  N   . GLU J  1 88 ? -7.030  24.076  119.492 1.00 59.16 ? 88   GLU J N   1 
ATOM   7329 C  CA  . GLU J  1 88 ? -8.442  23.807  119.762 1.00 60.23 ? 88   GLU J CA  1 
ATOM   7330 C  C   . GLU J  1 88 ? -8.746  22.319  119.940 1.00 61.10 ? 88   GLU J C   1 
ATOM   7331 O  O   . GLU J  1 88 ? -9.068  21.868  121.044 1.00 61.68 ? 88   GLU J O   1 
ATOM   7332 C  CB  . GLU J  1 88 ? -9.323  24.411  118.660 1.00 60.63 ? 88   GLU J CB  1 
ATOM   7333 C  CG  . GLU J  1 88 ? -8.605  25.289  117.633 1.00 60.24 ? 88   GLU J CG  1 
ATOM   7334 C  CD  . GLU J  1 88 ? -7.721  26.380  118.224 1.00 60.34 ? 88   GLU J CD  1 
ATOM   7335 O  OE1 . GLU J  1 88 ? -7.969  26.837  119.361 1.00 59.73 ? 88   GLU J OE1 1 
ATOM   7336 O  OE2 . GLU J  1 88 ? -6.763  26.796  117.533 1.00 60.89 ? 88   GLU J OE2 1 
ATOM   7337 N  N   . LYS K  2 3  ? 3.568   -21.715 139.886 1.00 50.88 ? 4    LYS K N   1 
ATOM   7338 C  CA  . LYS K  2 3  ? 2.309   -20.912 139.846 1.00 49.79 ? 4    LYS K CA  1 
ATOM   7339 C  C   . LYS K  2 3  ? 2.560   -19.414 140.078 1.00 47.13 ? 4    LYS K C   1 
ATOM   7340 O  O   . LYS K  2 3  ? 1.863   -18.585 139.488 1.00 47.27 ? 4    LYS K O   1 
ATOM   7341 C  CB  . LYS K  2 3  ? 1.272   -21.450 140.834 1.00 52.30 ? 4    LYS K CB  1 
ATOM   7342 C  CG  . LYS K  2 3  ? -0.120  -21.621 140.221 1.00 55.24 ? 4    LYS K CG  1 
ATOM   7343 C  CD  . LYS K  2 3  ? -0.911  -20.308 140.173 1.00 57.34 ? 4    LYS K CD  1 
ATOM   7344 C  CE  . LYS K  2 3  ? -1.406  -19.894 141.561 1.00 58.31 ? 4    LYS K CE  1 
ATOM   7345 N  NZ  . LYS K  2 3  ? -2.288  -20.942 142.167 1.00 58.99 ? 4    LYS K NZ  1 
ATOM   7346 N  N   . MET K  2 4  ? 3.529   -19.067 140.930 1.00 41.69 ? 5    MET K N   1 
ATOM   7347 C  CA  . MET K  2 4  ? 4.046   -17.692 140.950 1.00 37.86 ? 5    MET K CA  1 
ATOM   7348 C  C   . MET K  2 4  ? 4.642   -17.300 139.591 1.00 30.85 ? 5    MET K C   1 
ATOM   7349 O  O   . MET K  2 4  ? 5.466   -18.025 139.007 1.00 27.51 ? 5    MET K O   1 
ATOM   7350 C  CB  . MET K  2 4  ? 5.098   -17.497 142.042 1.00 39.56 ? 5    MET K CB  1 
ATOM   7351 C  CG  . MET K  2 4  ? 4.630   -16.600 143.169 1.00 43.07 ? 5    MET K CG  1 
ATOM   7352 S  SD  . MET K  2 4  ? 6.000   -16.034 144.191 1.00 46.26 ? 5    MET K SD  1 
ATOM   7353 C  CE  . MET K  2 4  ? 6.700   -17.595 144.656 1.00 44.95 ? 5    MET K CE  1 
ATOM   7354 N  N   . SER K  2 5  ? 4.216   -16.151 139.080 1.00 25.91 ? 6    SER K N   1 
ATOM   7355 C  CA  . SER K  2 5  ? 4.748   -15.631 137.820 1.00 22.71 ? 6    SER K CA  1 
ATOM   7356 C  C   . SER K  2 5  ? 6.182   -15.140 137.974 1.00 21.04 ? 6    SER K C   1 
ATOM   7357 O  O   . SER K  2 5  ? 6.668   -14.939 139.093 1.00 19.97 ? 6    SER K O   1 
ATOM   7358 C  CB  . SER K  2 5  ? 3.868   -14.484 137.311 1.00 20.52 ? 6    SER K CB  1 
ATOM   7359 O  OG  . SER K  2 5  ? 3.946   -13.387 138.214 1.00 18.51 ? 6    SER K OG  1 
ATOM   7360 N  N   . GLN K  2 6  ? 6.855   -14.933 136.846 1.00 20.95 ? 7    GLN K N   1 
ATOM   7361 C  CA  . GLN K  2 6  ? 8.196   -14.381 136.865 1.00 19.02 ? 7    GLN K CA  1 
ATOM   7362 C  C   . GLN K  2 6  ? 8.208   -13.039 137.592 1.00 19.30 ? 7    GLN K C   1 
ATOM   7363 O  O   . GLN K  2 6  ? 9.086   -12.811 138.428 1.00 18.24 ? 7    GLN K O   1 
ATOM   7364 C  CB  . GLN K  2 6  ? 8.737   -14.211 135.434 1.00 21.03 ? 7    GLN K CB  1 
ATOM   7365 C  CG  . GLN K  2 6  ? 10.118  -13.574 135.318 1.00 20.37 ? 7    GLN K CG  1 
ATOM   7366 C  CD  . GLN K  2 6  ? 10.579  -13.544 133.863 1.00 23.72 ? 7    GLN K CD  1 
ATOM   7367 O  OE1 . GLN K  2 6  ? 9.834   -14.001 132.971 1.00 24.95 ? 7    GLN K OE1 1 
ATOM   7368 N  NE2 . GLN K  2 6  ? 11.787  -13.031 133.609 1.00 23.43 ? 7    GLN K NE2 1 
ATOM   7369 N  N   . LEU K  2 7  ? 7.222   -12.175 137.304 1.00 18.50 ? 8    LEU K N   1 
ATOM   7370 C  CA  . LEU K  2 7  ? 7.180   -10.841 137.922 1.00 18.01 ? 8    LEU K CA  1 
ATOM   7371 C  C   . LEU K  2 7  ? 6.885   -10.937 139.435 1.00 19.13 ? 8    LEU K C   1 
ATOM   7372 O  O   . LEU K  2 7  ? 7.483   -10.223 140.252 1.00 18.95 ? 8    LEU K O   1 
ATOM   7373 C  CB  . LEU K  2 7  ? 6.108   -9.993  137.222 1.00 16.61 ? 8    LEU K CB  1 
ATOM   7374 C  CG  . LEU K  2 7  ? 6.007   -8.526  137.659 1.00 20.38 ? 8    LEU K CG  1 
ATOM   7375 C  CD1 . LEU K  2 7  ? 7.333   -7.761  137.537 1.00 19.78 ? 8    LEU K CD1 1 
ATOM   7376 C  CD2 . LEU K  2 7  ? 4.909   -7.808  136.892 1.00 21.14 ? 8    LEU K CD2 1 
ATOM   7377 N  N   . GLU K  2 8  ? 5.977   -11.828 139.807 1.00 18.39 ? 9    GLU K N   1 
ATOM   7378 C  CA  . GLU K  2 8  ? 5.695   -12.051 141.229 1.00 22.46 ? 9    GLU K CA  1 
ATOM   7379 C  C   . GLU K  2 8  ? 6.949   -12.544 141.966 1.00 20.59 ? 9    GLU K C   1 
ATOM   7380 O  O   . GLU K  2 8  ? 7.191   -12.125 143.106 1.00 20.58 ? 9    GLU K O   1 
ATOM   7381 C  CB  . GLU K  2 8  ? 4.534   -13.028 141.407 1.00 23.28 ? 9    GLU K CB  1 
ATOM   7382 C  CG  . GLU K  2 8  ? 3.161   -12.435 141.191 1.00 24.66 ? 9    GLU K CG  1 
ATOM   7383 C  CD  . GLU K  2 8  ? 2.057   -13.483 141.036 1.00 27.20 ? 9    GLU K CD  1 
ATOM   7384 O  OE1 . GLU K  2 8  ? 2.332   -14.699 140.828 1.00 28.16 ? 9    GLU K OE1 1 
ATOM   7385 O  OE2 . GLU K  2 8  ? 0.877   -13.065 141.076 1.00 28.78 ? 9    GLU K OE2 1 
ATOM   7386 N  N   . ARG K  2 9  ? 7.726   -13.439 141.361 1.00 19.12 ? 10   ARG K N   1 
ATOM   7387 C  CA  . ARG K  2 9  ? 8.961   -13.890 142.009 1.00 20.67 ? 10   ARG K CA  1 
ATOM   7388 C  C   . ARG K  2 9  ? 9.947   -12.741 142.187 1.00 19.23 ? 10   ARG K C   1 
ATOM   7389 O  O   . ARG K  2 9  ? 10.599  -12.636 143.230 1.00 19.69 ? 10   ARG K O   1 
ATOM   7390 C  CB  . ARG K  2 9  ? 9.681   -14.988 141.222 1.00 18.86 ? 10   ARG K CB  1 
ATOM   7391 C  CG  . ARG K  2 9  ? 9.042   -16.316 141.186 1.00 19.67 ? 10   ARG K CG  1 
ATOM   7392 C  CD  . ARG K  2 9  ? 9.941   -17.383 140.520 1.00 22.88 ? 10   ARG K CD  1 
ATOM   7393 N  NE  . ARG K  2 9  ? 10.416  -17.073 139.160 1.00 26.34 ? 10   ARG K NE  1 
ATOM   7394 C  CZ  . ARG K  2 9  ? 9.740   -17.380 138.062 1.00 29.65 ? 10   ARG K CZ  1 
ATOM   7395 N  NH1 . ARG K  2 9  ? 8.530   -17.921 138.177 1.00 30.10 ? 10   ARG K NH1 1 
ATOM   7396 N  NH2 . ARG K  2 9  ? 10.242  -17.113 136.859 1.00 30.48 ? 10   ARG K NH2 1 
ATOM   7397 N  N   . ASN K  2 10 ? 10.102  -11.916 141.153 1.00 17.48 ? 11   ASN K N   1 
ATOM   7398 C  CA  . ASN K  2 10 ? 11.020  -10.811 141.255 1.00 18.57 ? 11   ASN K CA  1 
ATOM   7399 C  C   . ASN K  2 10 ? 10.574  -9.857  142.346 1.00 18.35 ? 11   ASN K C   1 
ATOM   7400 O  O   . ASN K  2 10 ? 11.387  -9.375  143.110 1.00 18.37 ? 11   ASN K O   1 
ATOM   7401 C  CB  . ASN K  2 10 ? 11.151  -10.057 139.930 1.00 18.83 ? 11   ASN K CB  1 
ATOM   7402 C  CG  . ASN K  2 10 ? 11.665  -10.954 138.811 1.00 21.34 ? 11   ASN K CG  1 
ATOM   7403 O  OD1 . ASN K  2 10 ? 12.353  -11.957 139.067 1.00 23.23 ? 11   ASN K OD1 1 
ATOM   7404 N  ND2 . ASN K  2 10 ? 11.333  -10.617 137.585 1.00 16.94 ? 11   ASN K ND2 1 
ATOM   7405 N  N   . ILE K  2 11 ? 9.280   -9.549  142.408 1.00 18.66 ? 12   ILE K N   1 
ATOM   7406 C  CA  . ILE K  2 11 ? 8.827   -8.670  143.508 1.00 17.95 ? 12   ILE K CA  1 
ATOM   7407 C  C   . ILE K  2 11 ? 9.060   -9.299  144.889 1.00 19.65 ? 12   ILE K C   1 
ATOM   7408 O  O   . ILE K  2 11 ? 9.454   -8.588  145.818 1.00 17.91 ? 12   ILE K O   1 
ATOM   7409 C  CB  . ILE K  2 11 ? 7.386   -8.319  143.316 1.00 19.55 ? 12   ILE K CB  1 
ATOM   7410 C  CG1 . ILE K  2 11 ? 7.300   -7.328  142.138 1.00 20.16 ? 12   ILE K CG1 1 
ATOM   7411 C  CG2 . ILE K  2 11 ? 6.857   -7.692  144.578 1.00 19.55 ? 12   ILE K CG2 1 
ATOM   7412 C  CD1 . ILE K  2 11 ? 5.913   -7.115  141.664 1.00 22.63 ? 12   ILE K CD1 1 
ATOM   7413 N  N   . GLU K  2 12 ? 8.785   -10.596 145.016 1.00 18.96 ? 13   GLU K N   1 
ATOM   7414 C  CA  . GLU K  2 12 ? 9.059   -11.343 146.252 1.00 20.88 ? 13   GLU K CA  1 
ATOM   7415 C  C   . GLU K  2 12 ? 10.532  -11.262 146.672 1.00 20.55 ? 13   GLU K C   1 
ATOM   7416 O  O   . GLU K  2 12 ? 10.850  -11.070 147.863 1.00 20.01 ? 13   GLU K O   1 
ATOM   7417 C  CB  . GLU K  2 12 ? 8.603   -12.800 146.092 1.00 21.44 ? 13   GLU K CB  1 
ATOM   7418 C  CG  . GLU K  2 12 ? 8.848   -13.649 147.339 1.00 23.21 ? 13   GLU K CG  1 
ATOM   7419 C  CD  . GLU K  2 12 ? 8.426   -15.095 147.112 1.00 26.12 ? 13   GLU K CD  1 
ATOM   7420 O  OE1 . GLU K  2 12 ? 7.646   -15.567 147.957 1.00 30.56 ? 13   GLU K OE1 1 
ATOM   7421 O  OE2 . GLU K  2 12 ? 8.841   -15.733 146.097 1.00 28.03 ? 13   GLU K OE2 1 
ATOM   7422 N  N   . THR K  2 13 ? 11.434  -11.390 145.708 1.00 19.77 ? 14   THR K N   1 
ATOM   7423 C  CA  . THR K  2 13 ? 12.878  -11.255 145.978 1.00 19.10 ? 14   THR K CA  1 
ATOM   7424 C  C   . THR K  2 13 ? 13.246  -9.888  146.561 1.00 19.95 ? 14   THR K C   1 
ATOM   7425 O  O   . THR K  2 13 ? 14.030  -9.799  147.525 1.00 19.16 ? 14   THR K O   1 
ATOM   7426 C  CB  . THR K  2 13 ? 13.695  -11.512 144.696 1.00 17.83 ? 14   THR K CB  1 
ATOM   7427 O  OG1 . THR K  2 13 ? 13.473  -12.852 144.249 1.00 17.74 ? 14   THR K OG1 1 
ATOM   7428 C  CG2 . THR K  2 13 ? 15.164  -11.442 144.997 1.00 18.94 ? 14   THR K CG2 1 
ATOM   7429 N  N   . ILE K  2 14 ? 12.685  -8.822  145.984 1.00 18.10 ? 15   ILE K N   1 
ATOM   7430 C  CA  . ILE K  2 14 ? 12.838  -7.457  146.545 1.00 18.75 ? 15   ILE K CA  1 
ATOM   7431 C  C   . ILE K  2 14 ? 12.310  -7.357  147.968 1.00 17.77 ? 15   ILE K C   1 
ATOM   7432 O  O   . ILE K  2 14 ? 12.981  -6.861  148.883 1.00 20.22 ? 15   ILE K O   1 
ATOM   7433 C  CB  . ILE K  2 14 ? 12.110  -6.414  145.644 1.00 18.94 ? 15   ILE K CB  1 
ATOM   7434 C  CG1 . ILE K  2 14 ? 12.731  -6.490  144.252 1.00 17.18 ? 15   ILE K CG1 1 
ATOM   7435 C  CG2 . ILE K  2 14 ? 12.215  -4.988  146.278 1.00 18.74 ? 15   ILE K CG2 1 
ATOM   7436 C  CD1 . ILE K  2 14 ? 12.069  -5.633  143.130 1.00 17.35 ? 15   ILE K CD1 1 
ATOM   7437 N  N   . ILE K  2 15 ? 11.081  -7.787  148.170 1.00 17.34 ? 16   ILE K N   1 
ATOM   7438 C  CA  . ILE K  2 15 ? 10.501  -7.727  149.527 1.00 16.64 ? 16   ILE K CA  1 
ATOM   7439 C  C   . ILE K  2 15 ? 11.318  -8.511  150.545 1.00 19.88 ? 16   ILE K C   1 
ATOM   7440 O  O   . ILE K  2 15 ? 11.529  -8.044  151.675 1.00 19.11 ? 16   ILE K O   1 
ATOM   7441 C  CB  . ILE K  2 15 ? 9.065   -8.285  149.463 1.00 16.30 ? 16   ILE K CB  1 
ATOM   7442 C  CG1 . ILE K  2 15 ? 8.207   -7.284  148.677 1.00 17.87 ? 16   ILE K CG1 1 
ATOM   7443 C  CG2 . ILE K  2 15 ? 8.545   -8.615  150.885 1.00 19.66 ? 16   ILE K CG2 1 
ATOM   7444 C  CD1 . ILE K  2 15 ? 6.857   -7.851  148.276 1.00 19.87 ? 16   ILE K CD1 1 
ATOM   7445 N  N   . ASN K  2 16 ? 11.749  -9.710  150.166 1.00 18.34 ? 17   ASN K N   1 
ATOM   7446 C  CA  . ASN K  2 16 ? 12.424  -10.579 151.133 1.00 19.32 ? 17   ASN K CA  1 
ATOM   7447 C  C   . ASN K  2 16 ? 13.823  -10.122 151.432 1.00 17.33 ? 17   ASN K C   1 
ATOM   7448 O  O   . ASN K  2 16 ? 14.292  -10.341 152.543 1.00 17.32 ? 17   ASN K O   1 
ATOM   7449 C  CB  . ASN K  2 16 ? 12.411  -12.047 150.705 1.00 20.54 ? 17   ASN K CB  1 
ATOM   7450 C  CG  . ASN K  2 16 ? 11.046  -12.692 150.868 1.00 23.54 ? 17   ASN K CG  1 
ATOM   7451 O  OD1 . ASN K  2 16 ? 10.119  -12.084 151.410 1.00 24.03 ? 17   ASN K OD1 1 
ATOM   7452 N  ND2 . ASN K  2 16 ? 10.898  -13.909 150.350 1.00 23.67 ? 17   ASN K ND2 1 
ATOM   7453 N  N   . THR K  2 17 ? 14.466  -9.482  150.453 1.00 16.88 ? 18   THR K N   1 
ATOM   7454 C  CA  . THR K  2 17 ? 15.736  -8.809  150.685 1.00 17.66 ? 18   THR K CA  1 
ATOM   7455 C  C   . THR K  2 17 ? 15.583  -7.625  151.655 1.00 17.83 ? 18   THR K C   1 
ATOM   7456 O  O   . THR K  2 17 ? 16.314  -7.522  152.630 1.00 18.02 ? 18   THR K O   1 
ATOM   7457 C  CB  . THR K  2 17 ? 16.341  -8.342  149.346 1.00 18.74 ? 18   THR K CB  1 
ATOM   7458 O  OG1 . THR K  2 17 ? 16.474  -9.449  148.448 1.00 20.65 ? 18   THR K OG1 1 
ATOM   7459 C  CG2 . THR K  2 17 ? 17.759  -7.839  149.528 1.00 17.80 ? 18   THR K CG2 1 
ATOM   7460 N  N   . PHE K  2 18 ? 14.625  -6.739  151.405 1.00 18.61 ? 19   PHE K N   1 
ATOM   7461 C  CA  . PHE K  2 18 ? 14.330  -5.652  152.337 1.00 18.00 ? 19   PHE K CA  1 
ATOM   7462 C  C   . PHE K  2 18 ? 14.098  -6.215  153.742 1.00 17.55 ? 19   PHE K C   1 
ATOM   7463 O  O   . PHE K  2 18 ? 14.672  -5.727  154.726 1.00 17.48 ? 19   PHE K O   1 
ATOM   7464 C  CB  . PHE K  2 18 ? 13.092  -4.895  151.810 1.00 17.99 ? 19   PHE K CB  1 
ATOM   7465 C  CG  . PHE K  2 18 ? 12.613  -3.769  152.704 1.00 17.04 ? 19   PHE K CG  1 
ATOM   7466 C  CD1 . PHE K  2 18 ? 13.028  -2.457  152.481 1.00 17.03 ? 19   PHE K CD1 1 
ATOM   7467 C  CD2 . PHE K  2 18 ? 11.691  -4.008  153.728 1.00 18.10 ? 19   PHE K CD2 1 
ATOM   7468 C  CE1 . PHE K  2 18 ? 12.547  -1.406  153.275 1.00 18.18 ? 19   PHE K CE1 1 
ATOM   7469 C  CE2 . PHE K  2 18 ? 11.239  -2.957  154.547 1.00 18.42 ? 19   PHE K CE2 1 
ATOM   7470 C  CZ  . PHE K  2 18 ? 11.648  -1.677  154.314 1.00 18.78 ? 19   PHE K CZ  1 
ATOM   7471 N  N   . HIS K  2 19 ? 13.290  -7.263  153.831 1.00 18.65 ? 20   HIS K N   1 
ATOM   7472 C  CA  . HIS K  2 19 ? 13.004  -7.886  155.133 1.00 18.23 ? 20   HIS K CA  1 
ATOM   7473 C  C   . HIS K  2 19 ? 14.231  -8.481  155.851 1.00 19.30 ? 20   HIS K C   1 
ATOM   7474 O  O   . HIS K  2 19 ? 14.408  -8.295  157.080 1.00 19.91 ? 20   HIS K O   1 
ATOM   7475 C  CB  . HIS K  2 19 ? 11.867  -8.905  154.981 1.00 19.64 ? 20   HIS K CB  1 
ATOM   7476 C  CG  . HIS K  2 19 ? 11.450  -9.536  156.276 1.00 23.28 ? 20   HIS K CG  1 
ATOM   7477 N  ND1 . HIS K  2 19 ? 10.528  -8.963  157.129 1.00 23.28 ? 20   HIS K ND1 1 
ATOM   7478 C  CD2 . HIS K  2 19 ? 11.799  -10.719 156.835 1.00 22.08 ? 20   HIS K CD2 1 
ATOM   7479 C  CE1 . HIS K  2 19 ? 10.364  -9.747  158.183 1.00 22.66 ? 20   HIS K CE1 1 
ATOM   7480 N  NE2 . HIS K  2 19 ? 11.135  -10.812 158.036 1.00 24.26 ? 20   HIS K NE2 1 
ATOM   7481 N  N   . GLN K  2 20 ? 15.104  -9.144  155.107 1.00 19.03 ? 21   GLN K N   1 
ATOM   7482 C  CA  . GLN K  2 20 ? 16.308  -9.728  155.712 1.00 18.90 ? 21   GLN K CA  1 
ATOM   7483 C  C   . GLN K  2 20 ? 17.064  -8.711  156.586 1.00 18.69 ? 21   GLN K C   1 
ATOM   7484 O  O   . GLN K  2 20 ? 17.594  -9.030  157.669 1.00 17.86 ? 21   GLN K O   1 
ATOM   7485 C  CB  . GLN K  2 20 ? 17.229  -10.254 154.601 1.00 19.50 ? 21   GLN K CB  1 
ATOM   7486 C  CG  . GLN K  2 20 ? 18.607  -10.852 155.048 1.00 18.74 ? 21   GLN K CG  1 
ATOM   7487 C  CD  . GLN K  2 20 ? 18.557  -11.943 156.117 1.00 22.27 ? 21   GLN K CD  1 
ATOM   7488 O  OE1 . GLN K  2 20 ? 17.562  -12.645 156.259 1.00 20.47 ? 21   GLN K OE1 1 
ATOM   7489 N  NE2 . GLN K  2 20 ? 19.650  -12.083 156.884 1.00 21.14 ? 21   GLN K NE2 1 
ATOM   7490 N  N   . TYR K  2 21 ? 17.075  -7.468  156.116 1.00 18.77 ? 22   TYR K N   1 
ATOM   7491 C  CA  . TYR K  2 21 ? 17.806  -6.404  156.808 1.00 18.68 ? 22   TYR K CA  1 
ATOM   7492 C  C   . TYR K  2 21 ? 16.957  -5.593  157.765 1.00 18.47 ? 22   TYR K C   1 
ATOM   7493 O  O   . TYR K  2 21 ? 17.422  -5.221  158.832 1.00 18.82 ? 22   TYR K O   1 
ATOM   7494 C  CB  . TYR K  2 21 ? 18.473  -5.492  155.776 1.00 20.57 ? 22   TYR K CB  1 
ATOM   7495 C  CG  . TYR K  2 21 ? 19.513  -6.254  154.975 1.00 20.52 ? 22   TYR K CG  1 
ATOM   7496 C  CD1 . TYR K  2 21 ? 19.228  -6.752  153.723 1.00 19.82 ? 22   TYR K CD1 1 
ATOM   7497 C  CD2 . TYR K  2 21 ? 20.784  -6.479  155.504 1.00 24.02 ? 22   TYR K CD2 1 
ATOM   7498 C  CE1 . TYR K  2 21 ? 20.173  -7.483  153.018 1.00 21.34 ? 22   TYR K CE1 1 
ATOM   7499 C  CE2 . TYR K  2 21 ? 21.745  -7.161  154.782 1.00 21.83 ? 22   TYR K CE2 1 
ATOM   7500 C  CZ  . TYR K  2 21 ? 21.429  -7.658  153.542 1.00 22.03 ? 22   TYR K CZ  1 
ATOM   7501 O  OH  . TYR K  2 21 ? 22.407  -8.344  152.841 1.00 20.86 ? 22   TYR K OH  1 
ATOM   7502 N  N   . SER K  2 22 ? 15.733  -5.270  157.387 1.00 17.94 ? 23   SER K N   1 
ATOM   7503 C  CA  . SER K  2 22 ? 14.980  -4.325  158.210 1.00 18.98 ? 23   SER K CA  1 
ATOM   7504 C  C   . SER K  2 22 ? 14.752  -4.932  159.615 1.00 21.02 ? 23   SER K C   1 
ATOM   7505 O  O   . SER K  2 22 ? 14.711  -4.243  160.631 1.00 18.46 ? 23   SER K O   1 
ATOM   7506 C  CB  . SER K  2 22 ? 13.662  -3.992  157.503 1.00 19.59 ? 23   SER K CB  1 
ATOM   7507 O  OG  . SER K  2 22 ? 12.825  -5.127  157.556 1.00 20.02 ? 23   SER K OG  1 
ATOM   7508 N  N   . VAL K  2 23 ? 14.643  -6.248  159.686 1.00 19.75 ? 24   VAL K N   1 
ATOM   7509 C  CA  . VAL K  2 23 ? 14.281  -6.888  160.945 1.00 20.69 ? 24   VAL K CA  1 
ATOM   7510 C  C   . VAL K  2 23 ? 15.487  -7.075  161.893 1.00 20.61 ? 24   VAL K C   1 
ATOM   7511 O  O   . VAL K  2 23 ? 15.323  -7.484  163.042 1.00 21.20 ? 24   VAL K O   1 
ATOM   7512 C  CB  . VAL K  2 23 ? 13.596  -8.244  160.684 1.00 22.83 ? 24   VAL K CB  1 
ATOM   7513 C  CG1 . VAL K  2 23 ? 14.640  -9.283  160.244 1.00 20.15 ? 24   VAL K CG1 1 
ATOM   7514 C  CG2 . VAL K  2 23 ? 12.863  -8.684  161.928 1.00 26.11 ? 24   VAL K CG2 1 
ATOM   7515 N  N   . LYS K  2 24 ? 16.696  -6.736  161.444 1.00 20.35 ? 25   LYS K N   1 
ATOM   7516 C  CA  . LYS K  2 24 ? 17.879  -7.009  162.261 1.00 22.47 ? 25   LYS K CA  1 
ATOM   7517 C  C   . LYS K  2 24 ? 17.907  -6.173  163.537 1.00 23.07 ? 25   LYS K C   1 
ATOM   7518 O  O   . LYS K  2 24 ? 18.440  -6.612  164.585 1.00 22.62 ? 25   LYS K O   1 
ATOM   7519 C  CB  . LYS K  2 24 ? 19.140  -6.785  161.442 1.00 24.96 ? 25   LYS K CB  1 
ATOM   7520 C  CG  . LYS K  2 24 ? 19.334  -7.836  160.354 1.00 27.54 ? 25   LYS K CG  1 
ATOM   7521 C  CD  . LYS K  2 24 ? 20.646  -7.680  159.639 1.00 30.57 ? 25   LYS K CD  1 
ATOM   7522 C  CE  . LYS K  2 24 ? 21.256  -9.042  159.329 1.00 34.19 ? 25   LYS K CE  1 
ATOM   7523 N  NZ  . LYS K  2 24 ? 22.187  -8.841  158.184 1.00 35.78 ? 25   LYS K NZ  1 
ATOM   7524 N  N   . LEU K  2 25 ? 17.308  -4.983  163.459 1.00 20.41 ? 26   LEU K N   1 
ATOM   7525 C  CA  . LEU K  2 25 ? 17.449  -3.978  164.525 1.00 24.39 ? 26   LEU K CA  1 
ATOM   7526 C  C   . LEU K  2 25 ? 16.469  -2.836  164.304 1.00 23.45 ? 26   LEU K C   1 
ATOM   7527 O  O   . LEU K  2 25 ? 16.107  -2.520  163.164 1.00 20.83 ? 26   LEU K O   1 
ATOM   7528 C  CB  . LEU K  2 25 ? 18.845  -3.350  164.470 1.00 24.51 ? 26   LEU K CB  1 
ATOM   7529 C  CG  . LEU K  2 25 ? 19.993  -3.550  165.454 1.00 29.57 ? 26   LEU K CG  1 
ATOM   7530 C  CD1 . LEU K  2 25 ? 20.775  -2.254  165.504 1.00 27.92 ? 26   LEU K CD1 1 
ATOM   7531 C  CD2 . LEU K  2 25 ? 19.571  -3.978  166.864 1.00 27.87 ? 26   LEU K CD2 1 
ATOM   7532 N  N   . GLY K  2 26 ? 16.081  -2.174  165.382 1.00 22.85 ? 27   GLY K N   1 
ATOM   7533 C  CA  . GLY K  2 26 ? 15.215  -1.005  165.235 1.00 22.87 ? 27   GLY K CA  1 
ATOM   7534 C  C   . GLY K  2 26 ? 13.803  -1.410  164.857 1.00 22.57 ? 27   GLY K C   1 
ATOM   7535 O  O   . GLY K  2 26 ? 13.374  -2.524  165.147 1.00 20.75 ? 27   GLY K O   1 
ATOM   7536 N  N   . HIS K  2 27 ? 13.061  -0.504  164.225 1.00 21.79 ? 28   HIS K N   1 
ATOM   7537 C  CA  . HIS K  2 27 ? 11.757  -0.860  163.683 1.00 23.39 ? 28   HIS K CA  1 
ATOM   7538 C  C   . HIS K  2 27 ? 11.923  -1.997  162.683 1.00 22.22 ? 28   HIS K C   1 
ATOM   7539 O  O   . HIS K  2 27 ? 12.743  -1.925  161.759 1.00 19.16 ? 28   HIS K O   1 
ATOM   7540 C  CB  . HIS K  2 27 ? 11.099  0.344   162.994 1.00 26.60 ? 28   HIS K CB  1 
ATOM   7541 C  CG  . HIS K  2 27 ? 10.898  1.521   163.899 1.00 30.49 ? 28   HIS K CG  1 
ATOM   7542 N  ND1 . HIS K  2 27 ? 9.729   1.734   164.597 1.00 34.34 ? 28   HIS K ND1 1 
ATOM   7543 C  CD2 . HIS K  2 27 ? 11.743  2.511   164.273 1.00 31.80 ? 28   HIS K CD2 1 
ATOM   7544 C  CE1 . HIS K  2 27 ? 9.857   2.813   165.352 1.00 34.41 ? 28   HIS K CE1 1 
ATOM   7545 N  NE2 . HIS K  2 27 ? 11.066  3.310   165.165 1.00 34.25 ? 28   HIS K NE2 1 
ATOM   7546 N  N   . PRO K  2 28 ? 11.149  -3.054  162.861 1.00 21.64 ? 29   PRO K N   1 
ATOM   7547 C  CA  . PRO K  2 28 ? 11.374  -4.276  162.083 1.00 21.42 ? 29   PRO K CA  1 
ATOM   7548 C  C   . PRO K  2 28 ? 10.946  -4.179  160.619 1.00 21.33 ? 29   PRO K C   1 
ATOM   7549 O  O   . PRO K  2 28 ? 11.342  -5.033  159.812 1.00 20.46 ? 29   PRO K O   1 
ATOM   7550 C  CB  . PRO K  2 28 ? 10.522  -5.318  162.804 1.00 23.87 ? 29   PRO K CB  1 
ATOM   7551 C  CG  . PRO K  2 28 ? 9.490   -4.513  163.544 1.00 25.19 ? 29   PRO K CG  1 
ATOM   7552 C  CD  . PRO K  2 28 ? 10.081  -3.202  163.868 1.00 20.38 ? 29   PRO K CD  1 
ATOM   7553 N  N   . ASP K  2 29 ? 10.137  -3.184  160.280 1.00 18.36 ? 30   ASP K N   1 
ATOM   7554 C  CA  . ASP K  2 29 ? 9.677   -3.089  158.883 1.00 20.99 ? 30   ASP K CA  1 
ATOM   7555 C  C   . ASP K  2 29 ? 10.201  -1.846  158.171 1.00 20.05 ? 30   ASP K C   1 
ATOM   7556 O  O   . ASP K  2 29 ? 9.677   -1.456  157.120 1.00 18.68 ? 30   ASP K O   1 
ATOM   7557 C  CB  . ASP K  2 29 ? 8.159   -3.122  158.783 1.00 23.96 ? 30   ASP K CB  1 
ATOM   7558 C  CG  . ASP K  2 29 ? 7.669   -3.352  157.348 1.00 27.06 ? 30   ASP K CG  1 
ATOM   7559 O  OD1 . ASP K  2 29 ? 8.296   -4.116  156.563 1.00 25.34 ? 30   ASP K OD1 1 
ATOM   7560 O  OD2 . ASP K  2 29 ? 6.647   -2.776  156.934 1.00 27.87 ? 30   ASP K OD2 1 
ATOM   7561 N  N   . THR K  2 30 ? 11.222  -1.215  158.739 1.00 17.81 ? 31   THR K N   1 
ATOM   7562 C  CA  . THR K  2 30 ? 11.964  -0.170  157.992 1.00 19.32 ? 31   THR K CA  1 
ATOM   7563 C  C   . THR K  2 30 ? 13.456  -0.454  158.029 1.00 19.72 ? 31   THR K C   1 
ATOM   7564 O  O   . THR K  2 30 ? 13.935  -1.162  158.930 1.00 16.42 ? 31   THR K O   1 
ATOM   7565 C  CB  . THR K  2 30 ? 11.719  1.256   158.559 1.00 20.13 ? 31   THR K CB  1 
ATOM   7566 O  OG1 . THR K  2 30 ? 12.287  1.364   159.875 1.00 20.78 ? 31   THR K OG1 1 
ATOM   7567 C  CG2 . THR K  2 30 ? 10.218  1.511   158.788 1.00 23.42 ? 31   THR K CG2 1 
ATOM   7568 N  N   . LEU K  2 31 ? 14.190  0.115   157.076 1.00 18.39 ? 32   LEU K N   1 
ATOM   7569 C  CA  . LEU K  2 31 ? 15.661  0.075   157.104 1.00 18.11 ? 32   LEU K CA  1 
ATOM   7570 C  C   . LEU K  2 31 ? 16.186  1.327   157.795 1.00 20.13 ? 32   LEU K C   1 
ATOM   7571 O  O   . LEU K  2 31 ? 15.922  2.436   157.337 1.00 20.02 ? 32   LEU K O   1 
ATOM   7572 C  CB  . LEU K  2 31 ? 16.250  0.046   155.689 1.00 16.95 ? 32   LEU K CB  1 
ATOM   7573 C  CG  . LEU K  2 31 ? 15.872  -1.079  154.713 1.00 15.51 ? 32   LEU K CG  1 
ATOM   7574 C  CD1 . LEU K  2 31 ? 16.260  -0.754  153.277 1.00 17.51 ? 32   LEU K CD1 1 
ATOM   7575 C  CD2 . LEU K  2 31 ? 16.447  -2.448  155.207 1.00 17.22 ? 32   LEU K CD2 1 
ATOM   7576 N  N   . ASN K  2 32 ? 16.972  1.157   158.860 1.00 21.29 ? 33   ASN K N   1 
ATOM   7577 C  CA  . ASN K  2 32 ? 17.753  2.279   159.401 1.00 19.85 ? 33   ASN K CA  1 
ATOM   7578 C  C   . ASN K  2 32 ? 18.998  2.448   158.517 1.00 20.88 ? 33   ASN K C   1 
ATOM   7579 O  O   . ASN K  2 32 ? 19.167  1.712   157.539 1.00 18.62 ? 33   ASN K O   1 
ATOM   7580 C  CB  . ASN K  2 32 ? 18.064  2.087   160.902 1.00 19.00 ? 33   ASN K CB  1 
ATOM   7581 C  CG  . ASN K  2 32 ? 18.846  0.821   161.193 1.00 20.36 ? 33   ASN K CG  1 
ATOM   7582 O  OD1 . ASN K  2 32 ? 19.566  0.322   160.332 1.00 19.90 ? 33   ASN K OD1 1 
ATOM   7583 N  ND2 . ASN K  2 32 ? 18.762  0.334   162.442 1.00 21.47 ? 33   ASN K ND2 1 
ATOM   7584 N  N   . GLN K  2 33 ? 19.861  3.403   158.836 1.00 22.26 ? 34   GLN K N   1 
ATOM   7585 C  CA  . GLN K  2 33 ? 21.034  3.679   158.017 1.00 25.32 ? 34   GLN K CA  1 
ATOM   7586 C  C   . GLN K  2 33 ? 21.982  2.489   157.909 1.00 23.99 ? 34   GLN K C   1 
ATOM   7587 O  O   . GLN K  2 33 ? 22.473  2.166   156.824 1.00 21.49 ? 34   GLN K O   1 
ATOM   7588 C  CB  . GLN K  2 33 ? 21.787  4.898   158.558 1.00 29.22 ? 34   GLN K CB  1 
ATOM   7589 C  CG  . GLN K  2 33 ? 22.898  5.351   157.632 1.00 34.20 ? 34   GLN K CG  1 
ATOM   7590 C  CD  . GLN K  2 33 ? 23.599  6.604   158.134 1.00 36.20 ? 34   GLN K CD  1 
ATOM   7591 O  OE1 . GLN K  2 33 ? 24.682  6.531   158.722 1.00 38.83 ? 34   GLN K OE1 1 
ATOM   7592 N  NE2 . GLN K  2 33 ? 22.964  7.744   157.941 1.00 38.65 ? 34   GLN K NE2 1 
ATOM   7593 N  N   . GLY K  2 34 ? 22.256  1.839   159.039 1.00 20.64 ? 35   GLY K N   1 
ATOM   7594 C  CA  . GLY K  2 34 ? 23.111  0.649   159.030 1.00 20.40 ? 35   GLY K CA  1 
ATOM   7595 C  C   . GLY K  2 34 ? 22.592  -0.465  158.138 1.00 21.20 ? 35   GLY K C   1 
ATOM   7596 O  O   . GLY K  2 34 ? 23.362  -1.127  157.420 1.00 21.60 ? 35   GLY K O   1 
ATOM   7597 N  N   . GLU K  2 35 ? 21.275  -0.660  158.162 1.00 19.28 ? 36   GLU K N   1 
ATOM   7598 C  CA  . GLU K  2 35 ? 20.653  -1.755  157.409 1.00 20.47 ? 36   GLU K CA  1 
ATOM   7599 C  C   . GLU K  2 35 ? 20.611  -1.448  155.935 1.00 19.63 ? 36   GLU K C   1 
ATOM   7600 O  O   . GLU K  2 35 ? 20.843  -2.324  155.115 1.00 21.03 ? 36   GLU K O   1 
ATOM   7601 C  CB  . GLU K  2 35 ? 19.248  -2.037  157.940 1.00 18.66 ? 36   GLU K CB  1 
ATOM   7602 C  CG  . GLU K  2 35 ? 19.326  -2.676  159.326 1.00 19.15 ? 36   GLU K CG  1 
ATOM   7603 C  CD  . GLU K  2 35 ? 18.108  -2.473  160.214 1.00 20.15 ? 36   GLU K CD  1 
ATOM   7604 O  OE1 . GLU K  2 35 ? 17.139  -1.785  159.824 1.00 18.10 ? 36   GLU K OE1 1 
ATOM   7605 O  OE2 . GLU K  2 35 ? 18.103  -3.031  161.346 1.00 20.39 ? 36   GLU K OE2 1 
ATOM   7606 N  N   . PHE K  2 36 ? 20.360  -0.178  155.606 1.00 19.89 ? 37   PHE K N   1 
ATOM   7607 C  CA  . PHE K  2 36 ? 20.427  0.246   154.205 1.00 17.75 ? 37   PHE K CA  1 
ATOM   7608 C  C   . PHE K  2 36 ? 21.858  0.058   153.670 1.00 19.80 ? 37   PHE K C   1 
ATOM   7609 O  O   . PHE K  2 36 ? 22.047  -0.497  152.597 1.00 17.94 ? 37   PHE K O   1 
ATOM   7610 C  CB  . PHE K  2 36 ? 19.945  1.685   154.091 1.00 18.86 ? 37   PHE K CB  1 
ATOM   7611 C  CG  . PHE K  2 36 ? 19.972  2.228   152.695 1.00 18.08 ? 37   PHE K CG  1 
ATOM   7612 C  CD1 . PHE K  2 36 ? 19.063  1.752   151.747 1.00 20.34 ? 37   PHE K CD1 1 
ATOM   7613 C  CD2 . PHE K  2 36 ? 20.931  3.168   152.318 1.00 20.26 ? 37   PHE K CD2 1 
ATOM   7614 C  CE1 . PHE K  2 36 ? 19.075  2.244   150.422 1.00 21.09 ? 37   PHE K CE1 1 
ATOM   7615 C  CE2 . PHE K  2 36 ? 20.922  3.691   150.986 1.00 21.62 ? 37   PHE K CE2 1 
ATOM   7616 C  CZ  . PHE K  2 36 ? 20.007  3.210   150.041 1.00 19.99 ? 37   PHE K CZ  1 
ATOM   7617 N  N   . LYS K  2 37 ? 22.861  0.508   154.425 1.00 20.67 ? 38   LYS K N   1 
ATOM   7618 C  CA  . LYS K  2 37 ? 24.244  0.362   154.020 1.00 22.89 ? 38   LYS K CA  1 
ATOM   7619 C  C   . LYS K  2 37 ? 24.638  -1.090  153.786 1.00 23.57 ? 38   LYS K C   1 
ATOM   7620 O  O   . LYS K  2 37 ? 25.355  -1.381  152.836 1.00 23.30 ? 38   LYS K O   1 
ATOM   7621 C  CB  . LYS K  2 37 ? 25.184  0.963   155.079 1.00 24.00 ? 38   LYS K CB  1 
ATOM   7622 C  CG  . LYS K  2 37 ? 25.194  2.480   155.023 1.00 26.89 ? 38   LYS K CG  1 
ATOM   7623 C  CD  . LYS K  2 37 ? 26.101  3.050   156.093 1.00 29.96 ? 38   LYS K CD  1 
ATOM   7624 C  CE  . LYS K  2 37 ? 26.191  4.566   155.984 1.00 32.09 ? 38   LYS K CE  1 
ATOM   7625 N  NZ  . LYS K  2 37 ? 27.009  5.127   157.120 1.00 33.89 ? 38   LYS K NZ  1 
ATOM   7626 N  N   . GLU K  2 38 ? 24.183  -1.985  154.659 1.00 23.45 ? 39   GLU K N   1 
ATOM   7627 C  CA  . GLU K  2 38 ? 24.502  -3.405  154.526 1.00 25.00 ? 39   GLU K CA  1 
ATOM   7628 C  C   . GLU K  2 38 ? 23.874  -3.982  153.251 1.00 23.92 ? 39   GLU K C   1 
ATOM   7629 O  O   . GLU K  2 38 ? 24.530  -4.681  152.462 1.00 21.99 ? 39   GLU K O   1 
ATOM   7630 C  CB  . GLU K  2 38 ? 23.998  -4.156  155.760 1.00 30.46 ? 39   GLU K CB  1 
ATOM   7631 C  CG  . GLU K  2 38 ? 24.989  -5.179  156.271 1.00 36.82 ? 39   GLU K CG  1 
ATOM   7632 C  CD  . GLU K  2 38 ? 24.623  -5.703  157.632 1.00 39.97 ? 39   GLU K CD  1 
ATOM   7633 O  OE1 . GLU K  2 38 ? 25.519  -5.771  158.490 1.00 41.77 ? 39   GLU K OE1 1 
ATOM   7634 O  OE2 . GLU K  2 38 ? 23.433  -6.039  157.839 1.00 41.51 ? 39   GLU K OE2 1 
ATOM   7635 N  N   . LEU K  2 39 ? 22.579  -3.707  153.081 1.00 19.49 ? 40   LEU K N   1 
ATOM   7636 C  CA  . LEU K  2 39 ? 21.855  -4.131  151.870 1.00 20.98 ? 40   LEU K CA  1 
ATOM   7637 C  C   . LEU K  2 39 ? 22.513  -3.666  150.573 1.00 20.93 ? 40   LEU K C   1 
ATOM   7638 O  O   . LEU K  2 39 ? 22.761  -4.458  149.663 1.00 21.25 ? 40   LEU K O   1 
ATOM   7639 C  CB  . LEU K  2 39 ? 20.402  -3.686  151.927 1.00 20.55 ? 40   LEU K CB  1 
ATOM   7640 C  CG  . LEU K  2 39 ? 19.473  -4.210  150.822 1.00 20.45 ? 40   LEU K CG  1 
ATOM   7641 C  CD1 . LEU K  2 39 ? 18.083  -4.014  151.358 1.00 24.46 ? 40   LEU K CD1 1 
ATOM   7642 C  CD2 . LEU K  2 39 ? 19.719  -3.438  149.521 1.00 20.50 ? 40   LEU K CD2 1 
ATOM   7643 N  N   . VAL K  2 40 ? 22.813  -2.378  150.483 1.00 19.62 ? 41   VAL K N   1 
ATOM   7644 C  CA  . VAL K  2 40 ? 23.529  -1.884  149.294 1.00 22.41 ? 41   VAL K CA  1 
ATOM   7645 C  C   . VAL K  2 40 ? 24.919  -2.492  149.104 1.00 23.08 ? 41   VAL K C   1 
ATOM   7646 O  O   . VAL K  2 40 ? 25.327  -2.799  147.977 1.00 23.98 ? 41   VAL K O   1 
ATOM   7647 C  CB  . VAL K  2 40 ? 23.615  -0.358  149.356 1.00 23.68 ? 41   VAL K CB  1 
ATOM   7648 C  CG1 . VAL K  2 40 ? 24.394  0.218   148.164 1.00 26.72 ? 41   VAL K CG1 1 
ATOM   7649 C  CG2 . VAL K  2 40 ? 22.183  0.238   149.404 1.00 20.67 ? 41   VAL K CG2 1 
ATOM   7650 N  N   . ARG K  2 41 ? 25.660  -2.669  150.195 1.00 24.22 ? 42   ARG K N   1 
ATOM   7651 C  CA  . ARG K  2 41 ? 27.036  -3.154  150.076 1.00 27.52 ? 42   ARG K CA  1 
ATOM   7652 C  C   . ARG K  2 41 ? 27.057  -4.612  149.581 1.00 24.99 ? 42   ARG K C   1 
ATOM   7653 O  O   . ARG K  2 41 ? 27.932  -5.002  148.848 1.00 26.86 ? 42   ARG K O   1 
ATOM   7654 C  CB  . ARG K  2 41 ? 27.743  -3.001  151.432 1.00 28.84 ? 42   ARG K CB  1 
ATOM   7655 C  CG  . ARG K  2 41 ? 29.060  -3.741  151.593 1.00 33.98 ? 42   ARG K CG  1 
ATOM   7656 C  CD  . ARG K  2 41 ? 29.636  -3.672  153.015 1.00 35.52 ? 42   ARG K CD  1 
ATOM   7657 N  NE  . ARG K  2 41 ? 29.668  -2.297  153.524 1.00 41.92 ? 42   ARG K NE  1 
ATOM   7658 C  CZ  . ARG K  2 41 ? 29.009  -1.860  154.604 1.00 44.60 ? 42   ARG K CZ  1 
ATOM   7659 N  NH1 . ARG K  2 41 ? 28.250  -2.686  155.325 1.00 46.07 ? 42   ARG K NH1 1 
ATOM   7660 N  NH2 . ARG K  2 41 ? 29.120  -0.590  154.977 1.00 45.31 ? 42   ARG K NH2 1 
ATOM   7661 N  N   . LYS K  2 42 ? 26.086  -5.414  149.992 1.00 24.23 ? 43   LYS K N   1 
ATOM   7662 C  CA  . LYS K  2 42 ? 26.091  -6.831  149.653 1.00 25.71 ? 43   LYS K CA  1 
ATOM   7663 C  C   . LYS K  2 42 ? 25.211  -7.091  148.444 1.00 24.71 ? 43   LYS K C   1 
ATOM   7664 O  O   . LYS K  2 42 ? 25.663  -7.638  147.455 1.00 26.15 ? 43   LYS K O   1 
ATOM   7665 C  CB  . LYS K  2 42 ? 25.599  -7.670  150.837 1.00 28.42 ? 43   LYS K CB  1 
ATOM   7666 C  CG  . LYS K  2 42 ? 26.451  -7.562  152.098 1.00 33.44 ? 43   LYS K CG  1 
ATOM   7667 C  CD  . LYS K  2 42 ? 26.382  -8.886  152.871 1.00 37.93 ? 43   LYS K CD  1 
ATOM   7668 C  CE  . LYS K  2 42 ? 26.336  -8.605  154.353 1.00 40.93 ? 43   LYS K CE  1 
ATOM   7669 N  NZ  . LYS K  2 42 ? 26.521  -9.862  155.150 1.00 42.59 ? 43   LYS K NZ  1 
ATOM   7670 N  N   . ASP K  2 43 ? 23.946  -6.687  148.511 1.00 22.27 ? 44   ASP K N   1 
ATOM   7671 C  CA  . ASP K  2 43 ? 23.032  -7.087  147.449 1.00 23.57 ? 44   ASP K CA  1 
ATOM   7672 C  C   . ASP K  2 43 ? 22.999  -6.185  146.224 1.00 22.00 ? 44   ASP K C   1 
ATOM   7673 O  O   . ASP K  2 43 ? 22.335  -6.512  145.226 1.00 21.32 ? 44   ASP K O   1 
ATOM   7674 C  CB  . ASP K  2 43 ? 21.641  -7.309  148.005 1.00 21.60 ? 44   ASP K CB  1 
ATOM   7675 C  CG  . ASP K  2 43 ? 21.670  -8.265  149.194 1.00 24.89 ? 44   ASP K CG  1 
ATOM   7676 O  OD1 . ASP K  2 43 ? 21.989  -9.455  149.010 1.00 25.77 ? 44   ASP K OD1 1 
ATOM   7677 O  OD2 . ASP K  2 43 ? 21.505  -7.901  150.361 1.00 26.03 ? 44   ASP K OD2 1 
ATOM   7678 N  N   . LEU K  2 44 ? 23.710  -5.066  146.305 1.00 20.35 ? 45   LEU K N   1 
ATOM   7679 C  CA  . LEU K  2 44 ? 23.819  -4.161  145.164 1.00 21.83 ? 45   LEU K CA  1 
ATOM   7680 C  C   . LEU K  2 44 ? 25.290  -3.855  144.890 1.00 24.44 ? 45   LEU K C   1 
ATOM   7681 O  O   . LEU K  2 44 ? 25.633  -2.767  144.415 1.00 26.82 ? 45   LEU K O   1 
ATOM   7682 C  CB  . LEU K  2 44 ? 23.020  -2.874  145.417 1.00 22.58 ? 45   LEU K CB  1 
ATOM   7683 C  CG  . LEU K  2 44 ? 21.510  -3.083  145.423 1.00 24.01 ? 45   LEU K CG  1 
ATOM   7684 C  CD1 . LEU K  2 44 ? 20.799  -1.798  145.870 1.00 25.04 ? 45   LEU K CD1 1 
ATOM   7685 C  CD2 . LEU K  2 44 ? 21.024  -3.616  144.056 1.00 22.70 ? 45   LEU K CD2 1 
ATOM   7686 N  N   . GLN K  2 45 ? 26.146  -4.836  145.198 1.00 24.69 ? 46   GLN K N   1 
ATOM   7687 C  CA  . GLN K  2 45 ? 27.598  -4.716  145.090 1.00 25.04 ? 46   GLN K CA  1 
ATOM   7688 C  C   . GLN K  2 45 ? 28.076  -4.434  143.672 1.00 25.43 ? 46   GLN K C   1 
ATOM   7689 O  O   . GLN K  2 45 ? 29.108  -3.794  143.492 1.00 26.97 ? 46   GLN K O   1 
ATOM   7690 C  CB  . GLN K  2 45 ? 28.283  -5.963  145.663 1.00 23.63 ? 46   GLN K CB  1 
ATOM   7691 C  CG  . GLN K  2 45 ? 27.906  -7.230  144.954 1.00 27.06 ? 46   GLN K CG  1 
ATOM   7692 C  CD  . GLN K  2 45 ? 28.591  -8.462  145.534 1.00 29.26 ? 46   GLN K CD  1 
ATOM   7693 O  OE1 . GLN K  2 45 ? 29.565  -8.951  144.955 1.00 30.25 ? 46   GLN K OE1 1 
ATOM   7694 N  NE2 . GLN K  2 45 ? 28.092  -8.958  146.662 1.00 29.29 ? 46   GLN K NE2 1 
ATOM   7695 N  N   . ASN K  2 46 ? 27.327  -4.885  142.665 1.00 25.93 ? 47   ASN K N   1 
ATOM   7696 C  CA  . ASN K  2 46 ? 27.619  -4.515  141.274 1.00 27.32 ? 47   ASN K CA  1 
ATOM   7697 C  C   . ASN K  2 46 ? 26.887  -3.254  140.771 1.00 27.32 ? 47   ASN K C   1 
ATOM   7698 O  O   . ASN K  2 46 ? 27.512  -2.362  140.192 1.00 26.39 ? 47   ASN K O   1 
ATOM   7699 C  CB  . ASN K  2 46 ? 27.327  -5.695  140.338 1.00 28.71 ? 47   ASN K CB  1 
ATOM   7700 C  CG  . ASN K  2 46 ? 27.957  -6.989  140.829 1.00 31.20 ? 47   ASN K CG  1 
ATOM   7701 O  OD1 . ASN K  2 46 ? 29.177  -7.159  140.756 1.00 30.94 ? 47   ASN K OD1 1 
ATOM   7702 N  ND2 . ASN K  2 46 ? 27.133  -7.898  141.362 1.00 30.04 ? 47   ASN K ND2 1 
ATOM   7703 N  N   . PHE K  2 47 ? 25.570  -3.185  140.949 1.00 26.32 ? 48   PHE K N   1 
ATOM   7704 C  CA  . PHE K  2 47 ? 24.834  -2.029  140.436 1.00 25.74 ? 48   PHE K CA  1 
ATOM   7705 C  C   . PHE K  2 47 ? 25.291  -0.701  141.054 1.00 26.72 ? 48   PHE K C   1 
ATOM   7706 O  O   . PHE K  2 47 ? 25.235  0.360   140.411 1.00 26.49 ? 48   PHE K O   1 
ATOM   7707 C  CB  . PHE K  2 47 ? 23.342  -2.206  140.684 1.00 24.91 ? 48   PHE K CB  1 
ATOM   7708 C  CG  . PHE K  2 47 ? 22.652  -3.124  139.708 1.00 23.65 ? 48   PHE K CG  1 
ATOM   7709 C  CD1 . PHE K  2 47 ? 21.262  -3.131  139.635 1.00 23.22 ? 48   PHE K CD1 1 
ATOM   7710 C  CD2 . PHE K  2 47 ? 23.370  -3.992  138.888 1.00 23.64 ? 48   PHE K CD2 1 
ATOM   7711 C  CE1 . PHE K  2 47 ? 20.610  -3.962  138.756 1.00 23.92 ? 48   PHE K CE1 1 
ATOM   7712 C  CE2 . PHE K  2 47 ? 22.721  -4.822  137.985 1.00 22.59 ? 48   PHE K CE2 1 
ATOM   7713 C  CZ  . PHE K  2 47 ? 21.338  -4.807  137.918 1.00 23.65 ? 48   PHE K CZ  1 
ATOM   7714 N  N   . LEU K  2 48 ? 25.740  -0.755  142.303 1.00 25.70 ? 49   LEU K N   1 
ATOM   7715 C  CA  . LEU K  2 48 ? 26.164  0.446   143.010 1.00 25.54 ? 49   LEU K CA  1 
ATOM   7716 C  C   . LEU K  2 48 ? 27.638  0.331   143.390 1.00 27.03 ? 49   LEU K C   1 
ATOM   7717 O  O   . LEU K  2 48 ? 28.081  0.837   144.416 1.00 25.68 ? 49   LEU K O   1 
ATOM   7718 C  CB  . LEU K  2 48 ? 25.281  0.673   144.239 1.00 25.17 ? 49   LEU K CB  1 
ATOM   7719 C  CG  . LEU K  2 48 ? 23.917  1.278   143.908 1.00 23.33 ? 49   LEU K CG  1 
ATOM   7720 C  CD1 . LEU K  2 48 ? 23.051  1.416   145.141 1.00 25.10 ? 49   LEU K CD1 1 
ATOM   7721 C  CD2 . LEU K  2 48 ? 24.129  2.640   143.229 1.00 25.28 ? 49   LEU K CD2 1 
ATOM   7722 N  N   . LYS K  2 49 ? 28.395  -0.323  142.520 1.00 28.31 ? 50   LYS K N   1 
ATOM   7723 C  CA  . LYS K  2 49 ? 29.815  -0.547  142.729 1.00 32.24 ? 50   LYS K CA  1 
ATOM   7724 C  C   . LYS K  2 49 ? 30.581  0.751   143.004 1.00 32.21 ? 50   LYS K C   1 
ATOM   7725 O  O   . LYS K  2 49 ? 31.314  0.842   143.981 1.00 32.77 ? 50   LYS K O   1 
ATOM   7726 C  CB  . LYS K  2 49 ? 30.391  -1.274  141.514 1.00 34.17 ? 50   LYS K CB  1 
ATOM   7727 C  CG  . LYS K  2 49 ? 31.878  -1.547  141.567 1.00 38.45 ? 50   LYS K CG  1 
ATOM   7728 C  CD  . LYS K  2 49 ? 32.290  -2.315  140.314 1.00 41.92 ? 50   LYS K CD  1 
ATOM   7729 C  CE  . LYS K  2 49 ? 33.805  -2.392  140.143 1.00 44.93 ? 50   LYS K CE  1 
ATOM   7730 N  NZ  . LYS K  2 49 ? 34.564  -1.753  141.263 1.00 46.81 ? 50   LYS K NZ  1 
ATOM   7731 N  N   . LYS K  2 50 ? 30.400  1.757   142.158 1.00 33.38 ? 51   LYS K N   1 
ATOM   7732 C  CA  . LYS K  2 50 ? 31.120  3.013   142.320 1.00 35.39 ? 51   LYS K CA  1 
ATOM   7733 C  C   . LYS K  2 50 ? 30.718  3.718   143.616 1.00 33.20 ? 51   LYS K C   1 
ATOM   7734 O  O   . LYS K  2 50 ? 31.574  4.159   144.379 1.00 32.31 ? 51   LYS K O   1 
ATOM   7735 C  CB  . LYS K  2 50 ? 30.901  3.928   141.109 1.00 37.86 ? 51   LYS K CB  1 
ATOM   7736 C  CG  . LYS K  2 50 ? 31.583  5.279   141.257 1.00 41.70 ? 51   LYS K CG  1 
ATOM   7737 C  CD  . LYS K  2 50 ? 31.301  6.229   140.103 1.00 42.96 ? 51   LYS K CD  1 
ATOM   7738 C  CE  . LYS K  2 50 ? 32.086  7.525   140.293 1.00 46.15 ? 51   LYS K CE  1 
ATOM   7739 N  NZ  . LYS K  2 50 ? 31.959  8.439   139.117 1.00 47.78 ? 51   LYS K NZ  1 
ATOM   7740 N  N   . GLU K  2 51 ? 29.414  3.799   143.862 1.00 31.11 ? 52   GLU K N   1 
ATOM   7741 C  CA  . GLU K  2 51 ? 28.864  4.465   145.035 1.00 29.98 ? 52   GLU K CA  1 
ATOM   7742 C  C   . GLU K  2 51 ? 29.274  3.836   146.362 1.00 28.95 ? 52   GLU K C   1 
ATOM   7743 O  O   . GLU K  2 51 ? 29.456  4.542   147.355 1.00 26.67 ? 52   GLU K O   1 
ATOM   7744 C  CB  . GLU K  2 51 ? 27.327  4.520   144.927 1.00 31.70 ? 52   GLU K CB  1 
ATOM   7745 C  CG  . GLU K  2 51 ? 26.795  5.427   143.823 1.00 30.53 ? 52   GLU K CG  1 
ATOM   7746 C  CD  . GLU K  2 51 ? 26.882  4.809   142.431 1.00 34.69 ? 52   GLU K CD  1 
ATOM   7747 O  OE1 . GLU K  2 51 ? 27.235  3.614   142.289 1.00 33.80 ? 52   GLU K OE1 1 
ATOM   7748 O  OE2 . GLU K  2 51 ? 26.577  5.527   141.452 1.00 35.69 ? 52   GLU K OE2 1 
ATOM   7749 N  N   . ASN K  2 52 ? 29.387  2.509   146.375 1.00 28.65 ? 53   ASN K N   1 
ATOM   7750 C  CA  . ASN K  2 52 ? 29.773  1.737   147.560 1.00 30.40 ? 53   ASN K CA  1 
ATOM   7751 C  C   . ASN K  2 52 ? 31.185  2.091   148.034 1.00 30.85 ? 53   ASN K C   1 
ATOM   7752 O  O   . ASN K  2 52 ? 31.552  1.849   149.179 1.00 30.51 ? 53   ASN K O   1 
ATOM   7753 C  CB  . ASN K  2 52 ? 29.633  0.219   147.306 1.00 29.63 ? 53   ASN K CB  1 
ATOM   7754 C  CG  . ASN K  2 52 ? 28.262  -0.341  147.738 1.00 30.49 ? 53   ASN K CG  1 
ATOM   7755 O  OD1 . ASN K  2 52 ? 27.797  -0.103  148.858 1.00 29.52 ? 53   ASN K OD1 1 
ATOM   7756 N  ND2 . ASN K  2 52 ? 27.643  -1.130  146.869 1.00 30.05 ? 53   ASN K ND2 1 
ATOM   7757 N  N   . LYS K  2 53 ? 31.971  2.701   147.153 1.00 33.16 ? 54   LYS K N   1 
ATOM   7758 C  CA  . LYS K  2 53 ? 33.322  3.098   147.512 1.00 35.87 ? 54   LYS K CA  1 
ATOM   7759 C  C   . LYS K  2 53 ? 33.355  4.295   148.459 1.00 36.38 ? 54   LYS K C   1 
ATOM   7760 O  O   . LYS K  2 53 ? 34.376  4.571   149.082 1.00 36.79 ? 54   LYS K O   1 
ATOM   7761 C  CB  . LYS K  2 53 ? 34.155  3.367   146.258 1.00 37.33 ? 54   LYS K CB  1 
ATOM   7762 C  CG  . LYS K  2 53 ? 34.439  2.100   145.481 1.00 40.12 ? 54   LYS K CG  1 
ATOM   7763 C  CD  . LYS K  2 53 ? 35.333  2.334   144.285 1.00 42.67 ? 54   LYS K CD  1 
ATOM   7764 C  CE  . LYS K  2 53 ? 35.635  1.009   143.585 1.00 44.56 ? 54   LYS K CE  1 
ATOM   7765 N  NZ  . LYS K  2 53 ? 36.353  1.230   142.303 1.00 46.39 ? 54   LYS K NZ  1 
ATOM   7766 N  N   . ASN K  2 54 ? 32.234  4.997   148.574 1.00 36.45 ? 55   ASN K N   1 
ATOM   7767 C  CA  . ASN K  2 54 ? 32.166  6.180   149.416 1.00 36.74 ? 55   ASN K CA  1 
ATOM   7768 C  C   . ASN K  2 54 ? 30.930  6.135   150.296 1.00 36.52 ? 55   ASN K C   1 
ATOM   7769 O  O   . ASN K  2 54 ? 29.808  6.305   149.821 1.00 34.52 ? 55   ASN K O   1 
ATOM   7770 C  CB  . ASN K  2 54 ? 32.148  7.444   148.556 1.00 37.96 ? 55   ASN K CB  1 
ATOM   7771 C  CG  . ASN K  2 54 ? 32.250  8.712   149.390 1.00 39.66 ? 55   ASN K CG  1 
ATOM   7772 O  OD1 . ASN K  2 54 ? 32.149  8.675   150.622 1.00 39.79 ? 55   ASN K OD1 1 
ATOM   7773 N  ND2 . ASN K  2 54 ? 32.472  9.840   148.724 1.00 40.32 ? 55   ASN K ND2 1 
ATOM   7774 N  N   . GLU K  2 55 ? 31.156  5.900   151.580 1.00 36.96 ? 56   GLU K N   1 
ATOM   7775 C  CA  . GLU K  2 55 ? 30.083  5.771   152.557 1.00 38.96 ? 56   GLU K CA  1 
ATOM   7776 C  C   . GLU K  2 55 ? 29.160  6.990   152.593 1.00 37.02 ? 56   GLU K C   1 
ATOM   7777 O  O   . GLU K  2 55 ? 27.951  6.861   152.807 1.00 35.61 ? 56   GLU K O   1 
ATOM   7778 C  CB  . GLU K  2 55 ? 30.671  5.504   153.944 1.00 43.29 ? 56   GLU K CB  1 
ATOM   7779 C  CG  . GLU K  2 55 ? 29.630  5.330   155.028 1.00 48.10 ? 56   GLU K CG  1 
ATOM   7780 C  CD  . GLU K  2 55 ? 30.189  4.681   156.278 1.00 51.71 ? 56   GLU K CD  1 
ATOM   7781 O  OE1 . GLU K  2 55 ? 31.415  4.810   156.522 1.00 53.25 ? 56   GLU K OE1 1 
ATOM   7782 O  OE2 . GLU K  2 55 ? 29.399  4.050   157.018 1.00 52.96 ? 56   GLU K OE2 1 
ATOM   7783 N  N   . LYS K  2 56 ? 29.724  8.167   152.355 1.00 35.48 ? 57   LYS K N   1 
ATOM   7784 C  CA  . LYS K  2 56 ? 28.925  9.389   152.359 1.00 35.21 ? 57   LYS K CA  1 
ATOM   7785 C  C   . LYS K  2 56 ? 27.993  9.481   151.167 1.00 31.70 ? 57   LYS K C   1 
ATOM   7786 O  O   . LYS K  2 56 ? 26.937  10.093  151.257 1.00 30.22 ? 57   LYS K O   1 
ATOM   7787 C  CB  . LYS K  2 56 ? 29.809  10.634  152.445 1.00 37.88 ? 57   LYS K CB  1 
ATOM   7788 C  CG  . LYS K  2 56 ? 30.527  10.754  153.783 1.00 40.14 ? 57   LYS K CG  1 
ATOM   7789 C  CD  . LYS K  2 56 ? 31.472  11.952  153.824 1.00 42.54 ? 57   LYS K CD  1 
ATOM   7790 C  CE  . LYS K  2 56 ? 32.405  11.859  155.035 1.00 44.35 ? 57   LYS K CE  1 
ATOM   7791 N  NZ  . LYS K  2 56 ? 33.338  13.023  155.160 1.00 45.61 ? 57   LYS K NZ  1 
ATOM   7792 N  N   . VAL K  2 57 ? 28.391  8.881   150.056 1.00 28.66 ? 58   VAL K N   1 
ATOM   7793 C  CA  . VAL K  2 57 ? 27.505  8.770   148.903 1.00 27.12 ? 58   VAL K CA  1 
ATOM   7794 C  C   . VAL K  2 57 ? 26.290  7.908   149.206 1.00 26.44 ? 58   VAL K C   1 
ATOM   7795 O  O   . VAL K  2 57 ? 25.152  8.267   148.870 1.00 26.19 ? 58   VAL K O   1 
ATOM   7796 C  CB  . VAL K  2 57 ? 28.232  8.238   147.664 1.00 26.12 ? 58   VAL K CB  1 
ATOM   7797 C  CG1 . VAL K  2 57 ? 27.244  8.035   146.507 1.00 24.79 ? 58   VAL K CG1 1 
ATOM   7798 C  CG2 . VAL K  2 57 ? 29.312  9.241   147.234 1.00 28.16 ? 58   VAL K CG2 1 
ATOM   7799 N  N   . ILE K  2 58 ? 26.544  6.758   149.820 1.00 24.95 ? 59   ILE K N   1 
ATOM   7800 C  CA  . ILE K  2 58 ? 25.477  5.865   150.228 1.00 23.73 ? 59   ILE K CA  1 
ATOM   7801 C  C   . ILE K  2 58 ? 24.518  6.569   151.206 1.00 23.89 ? 59   ILE K C   1 
ATOM   7802 O  O   . ILE K  2 58 ? 23.302  6.521   151.003 1.00 24.29 ? 59   ILE K O   1 
ATOM   7803 C  CB  . ILE K  2 58 ? 26.064  4.521   150.774 1.00 24.16 ? 59   ILE K CB  1 
ATOM   7804 C  CG1 . ILE K  2 58 ? 26.953  3.841   149.714 1.00 22.74 ? 59   ILE K CG1 1 
ATOM   7805 C  CG2 . ILE K  2 58 ? 24.955  3.623   151.252 1.00 23.79 ? 59   ILE K CG2 1 
ATOM   7806 C  CD1 . ILE K  2 58 ? 26.296  3.586   148.339 1.00 23.52 ? 59   ILE K CD1 1 
ATOM   7807 N  N   . GLU K  2 59 ? 25.045  7.273   152.215 1.00 26.25 ? 60   GLU K N   1 
ATOM   7808 C  CA  . GLU K  2 59 ? 24.217  8.096   153.121 1.00 25.42 ? 60   GLU K CA  1 
ATOM   7809 C  C   . GLU K  2 59 ? 23.352  9.144   152.403 1.00 26.54 ? 60   GLU K C   1 
ATOM   7810 O  O   . GLU K  2 59 ? 22.193  9.344   152.758 1.00 26.24 ? 60   GLU K O   1 
ATOM   7811 C  CB  . GLU K  2 59 ? 25.081  8.810   154.167 1.00 28.25 ? 60   GLU K CB  1 
ATOM   7812 C  CG  . GLU K  2 59 ? 25.656  7.857   155.205 1.00 30.77 ? 60   GLU K CG  1 
ATOM   7813 C  CD  . GLU K  2 59 ? 26.827  8.447   155.975 1.00 33.10 ? 60   GLU K CD  1 
ATOM   7814 O  OE1 . GLU K  2 59 ? 27.056  9.681   155.886 1.00 34.83 ? 60   GLU K OE1 1 
ATOM   7815 O  OE2 . GLU K  2 59 ? 27.531  7.663   156.663 1.00 32.50 ? 60   GLU K OE2 1 
ATOM   7816 N  N   . HIS K  2 60 ? 23.913  9.813   151.404 1.00 24.64 ? 61   HIS K N   1 
ATOM   7817 C  CA  . HIS K  2 60 ? 23.137  10.818  150.684 1.00 26.44 ? 61   HIS K CA  1 
ATOM   7818 C  C   . HIS K  2 60 ? 22.001  10.192  149.879 1.00 24.56 ? 61   HIS K C   1 
ATOM   7819 O  O   . HIS K  2 60 ? 20.928  10.782  149.753 1.00 23.90 ? 61   HIS K O   1 
ATOM   7820 C  CB  . HIS K  2 60 ? 24.020  11.715  149.824 1.00 30.85 ? 61   HIS K CB  1 
ATOM   7821 C  CG  . HIS K  2 60 ? 23.289  12.900  149.262 1.00 37.63 ? 61   HIS K CG  1 
ATOM   7822 N  ND1 . HIS K  2 60 ? 22.886  13.965  150.042 1.00 40.02 ? 61   HIS K ND1 1 
ATOM   7823 C  CD2 . HIS K  2 60 ? 22.857  13.170  148.008 1.00 38.56 ? 61   HIS K CD2 1 
ATOM   7824 C  CE1 . HIS K  2 60 ? 22.245  14.842  149.290 1.00 40.23 ? 61   HIS K CE1 1 
ATOM   7825 N  NE2 . HIS K  2 60 ? 22.213  14.383  148.052 1.00 40.39 ? 61   HIS K NE2 1 
ATOM   7826 N  N   . ILE K  2 61 ? 22.244  9.011   149.324 1.00 24.44 ? 62   ILE K N   1 
ATOM   7827 C  CA  . ILE K  2 61 ? 21.208  8.276   148.598 1.00 24.37 ? 62   ILE K CA  1 
ATOM   7828 C  C   . ILE K  2 61 ? 20.033  7.932   149.518 1.00 22.72 ? 62   ILE K C   1 
ATOM   7829 O  O   . ILE K  2 61 ? 18.872  8.160   149.175 1.00 21.91 ? 62   ILE K O   1 
ATOM   7830 C  CB  . ILE K  2 61 ? 21.815  7.011   147.991 1.00 23.07 ? 62   ILE K CB  1 
ATOM   7831 C  CG1 . ILE K  2 61 ? 22.827  7.392   146.905 1.00 26.56 ? 62   ILE K CG1 1 
ATOM   7832 C  CG2 . ILE K  2 61 ? 20.714  6.081   147.437 1.00 25.65 ? 62   ILE K CG2 1 
ATOM   7833 C  CD1 . ILE K  2 61 ? 23.671  6.240   146.444 1.00 28.51 ? 62   ILE K CD1 1 
ATOM   7834 N  N   . MET K  2 62 ? 20.337  7.374   150.688 1.00 22.15 ? 63   MET K N   1 
ATOM   7835 C  CA  . MET K  2 62 ? 19.299  7.173   151.667 1.00 25.09 ? 63   MET K CA  1 
ATOM   7836 C  C   . MET K  2 62 ? 18.571  8.446   152.093 1.00 23.54 ? 63   MET K C   1 
ATOM   7837 O  O   . MET K  2 62 ? 17.351  8.442   152.233 1.00 23.11 ? 63   MET K O   1 
ATOM   7838 C  CB  . MET K  2 62 ? 19.849  6.499   152.914 1.00 25.54 ? 63   MET K CB  1 
ATOM   7839 C  CG  . MET K  2 62 ? 18.767  6.439   153.961 1.00 27.86 ? 63   MET K CG  1 
ATOM   7840 S  SD  . MET K  2 62 ? 19.238  5.219   155.176 1.00 30.61 ? 63   MET K SD  1 
ATOM   7841 C  CE  . MET K  2 62 ? 17.848  5.222   156.302 1.00 28.21 ? 63   MET K CE  1 
ATOM   7842 N  N   . GLU K  2 63 ? 19.304  9.524   152.327 1.00 23.06 ? 64   GLU K N   1 
ATOM   7843 C  CA  . GLU K  2 63 ? 18.677  10.792  152.714 1.00 25.57 ? 64   GLU K CA  1 
ATOM   7844 C  C   . GLU K  2 63 ? 17.682  11.289  151.669 1.00 23.71 ? 64   GLU K C   1 
ATOM   7845 O  O   . GLU K  2 63 ? 16.571  11.743  152.001 1.00 23.00 ? 64   GLU K O   1 
ATOM   7846 C  CB  . GLU K  2 63 ? 19.739  11.869  152.985 1.00 28.72 ? 64   GLU K CB  1 
ATOM   7847 C  CG  . GLU K  2 63 ? 20.574  11.587  154.220 1.00 35.09 ? 64   GLU K CG  1 
ATOM   7848 C  CD  . GLU K  2 63 ? 21.869  12.394  154.248 1.00 38.86 ? 64   GLU K CD  1 
ATOM   7849 O  OE1 . GLU K  2 63 ? 22.781  12.003  155.005 1.00 42.27 ? 64   GLU K OE1 1 
ATOM   7850 O  OE2 . GLU K  2 63 ? 21.980  13.408  153.534 1.00 41.36 ? 64   GLU K OE2 1 
ATOM   7851 N  N   . ASP K  2 64 ? 18.067  11.187  150.402 1.00 20.88 ? 65   ASP K N   1 
ATOM   7852 C  CA  . ASP K  2 64 ? 17.176  11.600  149.319 1.00 23.75 ? 65   ASP K CA  1 
ATOM   7853 C  C   . ASP K  2 64 ? 15.939  10.722  149.219 1.00 20.45 ? 65   ASP K C   1 
ATOM   7854 O  O   . ASP K  2 64 ? 14.864  11.213  148.861 1.00 21.46 ? 65   ASP K O   1 
ATOM   7855 C  CB  . ASP K  2 64 ? 17.941  11.576  148.006 1.00 24.30 ? 65   ASP K CB  1 
ATOM   7856 C  CG  . ASP K  2 64 ? 19.080  12.588  148.009 1.00 30.73 ? 65   ASP K CG  1 
ATOM   7857 O  OD1 . ASP K  2 64 ? 19.899  12.609  147.061 1.00 33.12 ? 65   ASP K OD1 1 
ATOM   7858 O  OD2 . ASP K  2 64 ? 19.240  13.403  148.946 1.00 33.02 ? 65   ASP K OD2 1 
ATOM   7859 N  N   . LEU K  2 65 ? 16.102  9.430   149.489 1.00 20.32 ? 66   LEU K N   1 
ATOM   7860 C  CA  . LEU K  2 65 ? 14.959  8.490   149.465 1.00 20.66 ? 66   LEU K CA  1 
ATOM   7861 C  C   . LEU K  2 65 ? 14.032  8.676   150.658 1.00 20.49 ? 66   LEU K C   1 
ATOM   7862 O  O   . LEU K  2 65 ? 12.878  8.263   150.610 1.00 19.82 ? 66   LEU K O   1 
ATOM   7863 C  CB  . LEU K  2 65 ? 15.397  7.022   149.399 1.00 20.55 ? 66   LEU K CB  1 
ATOM   7864 C  CG  . LEU K  2 65 ? 16.084  6.542   148.106 1.00 20.50 ? 66   LEU K CG  1 
ATOM   7865 C  CD1 . LEU K  2 65 ? 16.909  5.276   148.414 1.00 22.68 ? 66   LEU K CD1 1 
ATOM   7866 C  CD2 . LEU K  2 65 ? 15.070  6.294   147.000 1.00 21.58 ? 66   LEU K CD2 1 
ATOM   7867 N  N   . ASP K  2 66 ? 14.563  9.211   151.749 1.00 18.61 ? 67   ASP K N   1 
ATOM   7868 C  CA  . ASP K  2 66 ? 13.842  9.286   153.016 1.00 19.32 ? 67   ASP K CA  1 
ATOM   7869 C  C   . ASP K  2 66 ? 12.909  10.511  153.006 1.00 19.30 ? 67   ASP K C   1 
ATOM   7870 O  O   . ASP K  2 66 ? 13.178  11.540  153.624 1.00 19.00 ? 67   ASP K O   1 
ATOM   7871 C  CB  . ASP K  2 66 ? 14.883  9.352   154.156 1.00 19.76 ? 67   ASP K CB  1 
ATOM   7872 C  CG  . ASP K  2 66 ? 14.259  9.465   155.540 1.00 20.24 ? 67   ASP K CG  1 
ATOM   7873 O  OD1 . ASP K  2 66 ? 13.046  9.217   155.724 1.00 19.92 ? 67   ASP K OD1 1 
ATOM   7874 O  OD2 . ASP K  2 66 ? 14.957  9.848   156.516 1.00 23.90 ? 67   ASP K OD2 1 
ATOM   7875 N  N   . THR K  2 67 ? 11.781  10.398  152.317 1.00 20.55 ? 68   THR K N   1 
ATOM   7876 C  CA  . THR K  2 67 ? 10.983  11.587  152.058 1.00 22.12 ? 68   THR K CA  1 
ATOM   7877 C  C   . THR K  2 67 ? 10.275  12.141  153.263 1.00 22.09 ? 68   THR K C   1 
ATOM   7878 O  O   . THR K  2 67 ? 9.965   13.314  153.259 1.00 21.73 ? 68   THR K O   1 
ATOM   7879 C  CB  . THR K  2 67 ? 9.996   11.392  150.891 1.00 24.31 ? 68   THR K CB  1 
ATOM   7880 O  OG1 . THR K  2 67 ? 9.277   10.192  151.139 1.00 25.75 ? 68   THR K OG1 1 
ATOM   7881 C  CG2 . THR K  2 67 ? 10.773  11.100  149.573 1.00 27.46 ? 68   THR K CG2 1 
ATOM   7882 N  N   . ASN K  2 68 ? 10.030  11.338  154.300 1.00 21.09 ? 69   ASN K N   1 
ATOM   7883 C  CA  . ASN K  2 68 ? 9.430   11.897  155.517 1.00 21.12 ? 69   ASN K CA  1 
ATOM   7884 C  C   . ASN K  2 68 ? 10.485  12.267  156.553 1.00 23.49 ? 69   ASN K C   1 
ATOM   7885 O  O   . ASN K  2 68 ? 10.159  12.664  157.675 1.00 23.39 ? 69   ASN K O   1 
ATOM   7886 C  CB  . ASN K  2 68 ? 8.340   10.983  156.094 1.00 22.11 ? 69   ASN K CB  1 
ATOM   7887 C  CG  . ASN K  2 68 ? 8.906   9.747   156.767 1.00 22.62 ? 69   ASN K CG  1 
ATOM   7888 O  OD1 . ASN K  2 68 ? 10.042  9.373   156.527 1.00 22.40 ? 69   ASN K OD1 1 
ATOM   7889 N  ND2 . ASN K  2 68 ? 8.125   9.135   157.646 1.00 25.08 ? 69   ASN K ND2 1 
ATOM   7890 N  N   . ALA K  2 69 ? 11.757  12.159  156.166 1.00 23.22 ? 70   ALA K N   1 
ATOM   7891 C  CA  . ALA K  2 69 ? 12.865  12.601  157.015 1.00 23.06 ? 70   ALA K CA  1 
ATOM   7892 C  C   . ALA K  2 69 ? 12.891  12.019  158.438 1.00 24.36 ? 70   ALA K C   1 
ATOM   7893 O  O   . ALA K  2 69 ? 13.180  12.720  159.431 1.00 25.64 ? 70   ALA K O   1 
ATOM   7894 C  CB  . ALA K  2 69 ? 12.944  14.160  157.025 1.00 23.74 ? 70   ALA K CB  1 
ATOM   7895 N  N   . ASP K  2 70 ? 12.630  10.728  158.557 1.00 22.46 ? 71   ASP K N   1 
ATOM   7896 C  CA  . ASP K  2 70 ? 12.643  10.068  159.860 1.00 22.96 ? 71   ASP K CA  1 
ATOM   7897 C  C   . ASP K  2 70 ? 13.825  9.129   160.025 1.00 22.23 ? 71   ASP K C   1 
ATOM   7898 O  O   . ASP K  2 70 ? 13.896  8.334   160.968 1.00 23.31 ? 71   ASP K O   1 
ATOM   7899 C  CB  . ASP K  2 70 ? 11.317  9.340   160.117 1.00 21.69 ? 71   ASP K CB  1 
ATOM   7900 C  CG  . ASP K  2 70 ? 11.097  8.133   159.198 1.00 23.67 ? 71   ASP K CG  1 
ATOM   7901 O  OD1 . ASP K  2 70 ? 11.916  7.871   158.272 1.00 20.12 ? 71   ASP K OD1 1 
ATOM   7902 O  OD2 . ASP K  2 70 ? 10.100  7.394   159.327 1.00 26.09 ? 71   ASP K OD2 1 
ATOM   7903 N  N   . LYS K  2 71 ? 14.792  9.242   159.138 1.00 22.24 ? 72   LYS K N   1 
ATOM   7904 C  CA  . LYS K  2 71 ? 16.017  8.457   159.266 1.00 24.85 ? 72   LYS K CA  1 
ATOM   7905 C  C   . LYS K  2 71 ? 15.868  6.946   159.054 1.00 25.33 ? 72   LYS K C   1 
ATOM   7906 O  O   . LYS K  2 71 ? 16.734  6.164   159.461 1.00 25.42 ? 72   LYS K O   1 
ATOM   7907 C  CB  . LYS K  2 71 ? 16.728  8.801   160.584 1.00 27.90 ? 72   LYS K CB  1 
ATOM   7908 C  CG  . LYS K  2 71 ? 16.977  10.289  160.688 1.00 30.61 ? 72   LYS K CG  1 
ATOM   7909 C  CD  . LYS K  2 71 ? 17.744  10.684  161.938 1.00 35.22 ? 72   LYS K CD  1 
ATOM   7910 C  CE  . LYS K  2 71 ? 18.141  12.153  161.809 1.00 38.93 ? 72   LYS K CE  1 
ATOM   7911 N  NZ  . LYS K  2 71 ? 18.655  12.701  163.109 1.00 42.15 ? 72   LYS K NZ  1 
ATOM   7912 N  N   . GLN K  2 72 ? 14.766  6.534   158.422 1.00 22.47 ? 73   GLN K N   1 
ATOM   7913 C  CA  . GLN K  2 72 ? 14.474  5.121   158.152 1.00 22.17 ? 73   GLN K CA  1 
ATOM   7914 C  C   . GLN K  2 72 ? 13.916  5.079   156.731 1.00 20.66 ? 73   GLN K C   1 
ATOM   7915 O  O   . GLN K  2 72 ? 13.253  6.027   156.345 1.00 22.39 ? 73   GLN K O   1 
ATOM   7916 C  CB  . GLN K  2 72 ? 13.326  4.623   159.049 1.00 19.48 ? 73   GLN K CB  1 
ATOM   7917 C  CG  . GLN K  2 72 ? 13.614  4.524   160.528 1.00 25.68 ? 73   GLN K CG  1 
ATOM   7918 C  CD  . GLN K  2 72 ? 12.319  4.450   161.309 1.00 29.35 ? 73   GLN K CD  1 
ATOM   7919 O  OE1 . GLN K  2 72 ? 11.638  3.425   161.285 1.00 30.01 ? 73   GLN K OE1 1 
ATOM   7920 N  NE2 . GLN K  2 72 ? 11.974  5.535   162.001 1.00 29.20 ? 73   GLN K NE2 1 
ATOM   7921 N  N   . LEU K  2 73 ? 14.176  4.018   155.961 1.00 20.21 ? 74   LEU K N   1 
ATOM   7922 C  CA  . LEU K  2 73 ? 13.434  3.834   154.705 1.00 19.45 ? 74   LEU K CA  1 
ATOM   7923 C  C   . LEU K  2 73 ? 12.299  2.853   154.905 1.00 18.53 ? 74   LEU K C   1 
ATOM   7924 O  O   . LEU K  2 73 ? 12.540  1.694   155.288 1.00 20.69 ? 74   LEU K O   1 
ATOM   7925 C  CB  . LEU K  2 73 ? 14.341  3.323   153.580 1.00 19.55 ? 74   LEU K CB  1 
ATOM   7926 C  CG  . LEU K  2 73 ? 15.465  4.273   153.167 1.00 22.38 ? 74   LEU K CG  1 
ATOM   7927 C  CD1 . LEU K  2 73 ? 16.130  3.722   151.931 1.00 22.62 ? 74   LEU K CD1 1 
ATOM   7928 C  CD2 . LEU K  2 73 ? 14.945  5.654   152.886 1.00 21.26 ? 74   LEU K CD2 1 
ATOM   7929 N  N   . SER K  2 74 ? 11.061  3.308   154.682 1.00 20.27 ? 75   SER K N   1 
ATOM   7930 C  CA  . SER K  2 74 ? 9.939   2.389   154.538 1.00 19.55 ? 75   SER K CA  1 
ATOM   7931 C  C   . SER K  2 74 ? 10.091  1.620   153.236 1.00 18.83 ? 75   SER K C   1 
ATOM   7932 O  O   . SER K  2 74 ? 10.855  1.999   152.349 1.00 17.88 ? 75   SER K O   1 
ATOM   7933 C  CB  . SER K  2 74 ? 8.612   3.133   154.463 1.00 20.87 ? 75   SER K CB  1 
ATOM   7934 O  OG  . SER K  2 74 ? 8.682   4.055   153.377 1.00 18.76 ? 75   SER K OG  1 
ATOM   7935 N  N   . PHE K  2 75 ? 9.321   0.554   153.093 1.00 19.52 ? 76   PHE K N   1 
ATOM   7936 C  CA  . PHE K  2 75 ? 9.323   -0.136  151.830 1.00 16.18 ? 76   PHE K CA  1 
ATOM   7937 C  C   . PHE K  2 75 ? 8.931   0.807   150.677 1.00 17.72 ? 76   PHE K C   1 
ATOM   7938 O  O   . PHE K  2 75 ? 9.542   0.754   149.598 1.00 17.07 ? 76   PHE K O   1 
ATOM   7939 C  CB  . PHE K  2 75 ? 8.388   -1.348  151.826 1.00 17.29 ? 76   PHE K CB  1 
ATOM   7940 C  CG  . PHE K  2 75 ? 8.528   -2.163  150.568 1.00 17.51 ? 76   PHE K CG  1 
ATOM   7941 C  CD1 . PHE K  2 75 ? 9.636   -3.012  150.418 1.00 20.14 ? 76   PHE K CD1 1 
ATOM   7942 C  CD2 . PHE K  2 75 ? 7.615   -2.038  149.528 1.00 17.91 ? 76   PHE K CD2 1 
ATOM   7943 C  CE1 . PHE K  2 75 ? 9.836   -3.761  149.253 1.00 17.82 ? 76   PHE K CE1 1 
ATOM   7944 C  CE2 . PHE K  2 75 ? 7.806   -2.747  148.337 1.00 18.82 ? 76   PHE K CE2 1 
ATOM   7945 C  CZ  . PHE K  2 75 ? 8.916   -3.645  148.202 1.00 18.66 ? 76   PHE K CZ  1 
ATOM   7946 N  N   . GLU K  2 76 ? 7.907   1.637   150.901 1.00 18.34 ? 77   GLU K N   1 
ATOM   7947 C  CA  . GLU K  2 76 ? 7.435   2.638   149.919 1.00 17.56 ? 77   GLU K CA  1 
ATOM   7948 C  C   . GLU K  2 76 ? 8.524   3.594   149.424 1.00 17.23 ? 77   GLU K C   1 
ATOM   7949 O  O   . GLU K  2 76 ? 8.628   3.868   148.234 1.00 18.18 ? 77   GLU K O   1 
ATOM   7950 C  CB  . GLU K  2 76 ? 6.313   3.486   150.544 1.00 20.14 ? 77   GLU K CB  1 
ATOM   7951 C  CG  . GLU K  2 76 ? 4.974   2.768   150.583 1.00 22.38 ? 77   GLU K CG  1 
ATOM   7952 C  CD  . GLU K  2 76 ? 4.748   1.859   151.806 1.00 26.51 ? 77   GLU K CD  1 
ATOM   7953 O  OE1 . GLU K  2 76 ? 5.613   1.674   152.711 1.00 23.50 ? 77   GLU K OE1 1 
ATOM   7954 O  OE2 . GLU K  2 76 ? 3.639   1.281   151.833 1.00 27.61 ? 77   GLU K OE2 1 
ATOM   7955 N  N   . GLU K  2 77 ? 9.343   4.084   150.345 1.00 18.25 ? 78   GLU K N   1 
ATOM   7956 C  CA  . GLU K  2 77 ? 10.503  4.892   149.993 1.00 19.10 ? 78   GLU K CA  1 
ATOM   7957 C  C   . GLU K  2 77 ? 11.552  4.055   149.244 1.00 19.56 ? 78   GLU K C   1 
ATOM   7958 O  O   . GLU K  2 77 ? 12.086  4.482   148.220 1.00 21.36 ? 78   GLU K O   1 
ATOM   7959 C  CB  . GLU K  2 77 ? 11.101  5.527   151.263 1.00 16.96 ? 78   GLU K CB  1 
ATOM   7960 C  CG  . GLU K  2 77 ? 10.174  6.528   151.963 1.00 18.72 ? 78   GLU K CG  1 
ATOM   7961 C  CD  . GLU K  2 77 ? 10.669  6.957   153.341 1.00 17.35 ? 78   GLU K CD  1 
ATOM   7962 O  OE1 . GLU K  2 77 ? 11.383  6.178   154.011 1.00 19.04 ? 78   GLU K OE1 1 
ATOM   7963 O  OE2 . GLU K  2 77 ? 10.318  8.090   153.746 1.00 18.43 ? 78   GLU K OE2 1 
ATOM   7964 N  N   . PHE K  2 78 ? 11.828  2.851   149.740 1.00 20.36 ? 79   PHE K N   1 
ATOM   7965 C  CA  . PHE K  2 78 ? 12.860  1.970   149.179 1.00 20.47 ? 79   PHE K CA  1 
ATOM   7966 C  C   . PHE K  2 78 ? 12.570  1.492   147.755 1.00 20.80 ? 79   PHE K C   1 
ATOM   7967 O  O   . PHE K  2 78 ? 13.472  1.339   146.940 1.00 19.69 ? 79   PHE K O   1 
ATOM   7968 C  CB  . PHE K  2 78 ? 12.990  0.723   150.085 1.00 19.59 ? 79   PHE K CB  1 
ATOM   7969 C  CG  . PHE K  2 78 ? 14.001  -0.306  149.606 1.00 20.19 ? 79   PHE K CG  1 
ATOM   7970 C  CD1 . PHE K  2 78 ? 15.367  -0.071  149.756 1.00 20.06 ? 79   PHE K CD1 1 
ATOM   7971 C  CD2 . PHE K  2 78 ? 13.585  -1.501  149.025 1.00 19.24 ? 79   PHE K CD2 1 
ATOM   7972 C  CE1 . PHE K  2 78 ? 16.292  -1.029  149.355 1.00 18.82 ? 79   PHE K CE1 1 
ATOM   7973 C  CE2 . PHE K  2 78 ? 14.498  -2.451  148.584 1.00 20.20 ? 79   PHE K CE2 1 
ATOM   7974 C  CZ  . PHE K  2 78 ? 15.865  -2.204  148.773 1.00 20.53 ? 79   PHE K CZ  1 
ATOM   7975 N  N   . ILE K  2 79 ? 11.308  1.222   147.444 1.00 20.80 ? 80   ILE K N   1 
ATOM   7976 C  CA  . ILE K  2 79 ? 10.982  0.670   146.117 1.00 19.59 ? 80   ILE K CA  1 
ATOM   7977 C  C   . ILE K  2 79 ? 11.279  1.687   145.008 1.00 20.70 ? 80   ILE K C   1 
ATOM   7978 O  O   . ILE K  2 79 ? 11.501  1.326   143.854 1.00 19.49 ? 80   ILE K O   1 
ATOM   7979 C  CB  . ILE K  2 79 ? 9.488   0.212   146.078 1.00 20.15 ? 80   ILE K CB  1 
ATOM   7980 C  CG1 . ILE K  2 79 ? 9.151   -0.565  144.804 1.00 20.67 ? 80   ILE K CG1 1 
ATOM   7981 C  CG2 . ILE K  2 79 ? 8.524   1.390   146.186 1.00 21.04 ? 80   ILE K CG2 1 
ATOM   7982 C  CD1 . ILE K  2 79 ? 9.563   -1.949  144.783 1.00 22.94 ? 80   ILE K CD1 1 
ATOM   7983 N  N   . MET K  2 80 ? 11.322  2.968   145.359 1.00 18.97 ? 81   MET K N   1 
ATOM   7984 C  CA  . MET K  2 80 ? 11.767  3.972   144.379 1.00 21.08 ? 81   MET K CA  1 
ATOM   7985 C  C   . MET K  2 80 ? 13.212  3.750   143.910 1.00 20.72 ? 81   MET K C   1 
ATOM   7986 O  O   . MET K  2 80 ? 13.516  3.941   142.725 1.00 22.21 ? 81   MET K O   1 
ATOM   7987 C  CB  . MET K  2 80 ? 11.621  5.379   144.953 1.00 23.61 ? 81   MET K CB  1 
ATOM   7988 C  CG  . MET K  2 80 ? 10.381  6.080   144.605 1.00 27.68 ? 81   MET K CG  1 
ATOM   7989 S  SD  . MET K  2 80 ? 10.122  6.447   142.835 1.00 26.87 ? 81   MET K SD  1 
ATOM   7990 C  CE  . MET K  2 80 ? 8.459   7.141   142.962 1.00 30.73 ? 81   MET K CE  1 
ATOM   7991 N  N   . LEU K  2 81 ? 14.094  3.349   144.811 1.00 20.63 ? 82   LEU K N   1 
ATOM   7992 C  CA  . LEU K  2 81 ? 15.482  3.071   144.443 1.00 19.82 ? 82   LEU K CA  1 
ATOM   7993 C  C   . LEU K  2 81 ? 15.491  1.866   143.497 1.00 22.38 ? 82   LEU K C   1 
ATOM   7994 O  O   . LEU K  2 81 ? 16.291  1.813   142.570 1.00 21.66 ? 82   LEU K O   1 
ATOM   7995 C  CB  . LEU K  2 81 ? 16.348  2.708   145.650 1.00 20.47 ? 82   LEU K CB  1 
ATOM   7996 C  CG  . LEU K  2 81 ? 17.800  2.256   145.375 1.00 20.18 ? 82   LEU K CG  1 
ATOM   7997 C  CD1 . LEU K  2 81 ? 18.563  3.363   144.678 1.00 19.91 ? 82   LEU K CD1 1 
ATOM   7998 C  CD2 . LEU K  2 81 ? 18.543  1.786   146.607 1.00 21.34 ? 82   LEU K CD2 1 
ATOM   7999 N  N   . MET K  2 82 ? 14.656  0.875   143.779 1.00 19.70 ? 83   MET K N   1 
ATOM   8000 C  CA  . MET K  2 82 ? 14.651  -0.334  142.945 1.00 19.75 ? 83   MET K CA  1 
ATOM   8001 C  C   . MET K  2 82 ? 14.207  0.017   141.524 1.00 20.64 ? 83   MET K C   1 
ATOM   8002 O  O   . MET K  2 82 ? 14.804  -0.427  140.543 1.00 19.71 ? 83   MET K O   1 
ATOM   8003 C  CB  . MET K  2 82 ? 13.699  -1.391  143.536 1.00 19.48 ? 83   MET K CB  1 
ATOM   8004 C  CG  . MET K  2 82 ? 14.012  -1.871  144.957 1.00 18.72 ? 83   MET K CG  1 
ATOM   8005 S  SD  . MET K  2 82 ? 15.571  -2.794  144.955 1.00 24.38 ? 83   MET K SD  1 
ATOM   8006 C  CE  . MET K  2 82 ? 16.663  -1.485  145.400 1.00 21.45 ? 83   MET K CE  1 
ATOM   8007 N  N   . ALA K  2 83 ? 13.167  0.833   141.411 1.00 19.63 ? 84   ALA K N   1 
ATOM   8008 C  CA  . ALA K  2 83 ? 12.691  1.273   140.087 1.00 19.97 ? 84   ALA K CA  1 
ATOM   8009 C  C   . ALA K  2 83 ? 13.774  2.107   139.383 1.00 20.00 ? 84   ALA K C   1 
ATOM   8010 O  O   . ALA K  2 83 ? 14.025  1.914   138.188 1.00 24.09 ? 84   ALA K O   1 
ATOM   8011 C  CB  . ALA K  2 83 ? 11.421  2.097   140.209 1.00 19.83 ? 84   ALA K CB  1 
ATOM   8012 N  N   . ARG K  2 84 ? 14.466  2.978   140.122 1.00 20.61 ? 85   ARG K N   1 
ATOM   8013 C  CA  . ARG K  2 84 ? 15.544  3.753   139.511 1.00 24.26 ? 85   ARG K CA  1 
ATOM   8014 C  C   . ARG K  2 84 ? 16.677  2.872   138.998 1.00 22.46 ? 85   ARG K C   1 
ATOM   8015 O  O   . ARG K  2 84 ? 17.278  3.157   137.966 1.00 21.59 ? 85   ARG K O   1 
ATOM   8016 C  CB  . ARG K  2 84 ? 16.130  4.757   140.499 1.00 25.53 ? 85   ARG K CB  1 
ATOM   8017 C  CG  . ARG K  2 84 ? 15.239  5.972   140.699 1.00 31.96 ? 85   ARG K CG  1 
ATOM   8018 C  CD  . ARG K  2 84 ? 15.775  6.952   141.740 1.00 34.14 ? 85   ARG K CD  1 
ATOM   8019 N  NE  . ARG K  2 84 ? 14.738  7.885   142.184 1.00 40.33 ? 85   ARG K NE  1 
ATOM   8020 C  CZ  . ARG K  2 84 ? 14.805  8.591   143.310 1.00 42.91 ? 85   ARG K CZ  1 
ATOM   8021 N  NH1 . ARG K  2 84 ? 13.815  9.413   143.637 1.00 45.08 ? 85   ARG K NH1 1 
ATOM   8022 N  NH2 . ARG K  2 84 ? 15.862  8.482   144.101 1.00 42.92 ? 85   ARG K NH2 1 
ATOM   8023 N  N   . LEU K  2 85 ? 17.011  1.829   139.750 1.00 21.33 ? 86   LEU K N   1 
ATOM   8024 C  CA  . LEU K  2 85 ? 18.147  1.002   139.354 1.00 20.51 ? 86   LEU K CA  1 
ATOM   8025 C  C   . LEU K  2 85 ? 17.783  0.109   138.184 1.00 21.28 ? 86   LEU K C   1 
ATOM   8026 O  O   . LEU K  2 85 ? 18.616  -0.205  137.347 1.00 20.24 ? 86   LEU K O   1 
ATOM   8027 C  CB  . LEU K  2 85 ? 18.611  0.150   140.528 1.00 22.95 ? 86   LEU K CB  1 
ATOM   8028 C  CG  . LEU K  2 85 ? 19.894  0.503   141.318 1.00 24.52 ? 86   LEU K CG  1 
ATOM   8029 C  CD1 . LEU K  2 85 ? 20.436  1.905   141.241 1.00 25.20 ? 86   LEU K CD1 1 
ATOM   8030 C  CD2 . LEU K  2 85 ? 19.799  -0.050  142.748 1.00 23.22 ? 86   LEU K CD2 1 
ATOM   8031 N  N   . THR K  2 86 ? 16.524  -0.276  138.112 1.00 19.62 ? 87   THR K N   1 
ATOM   8032 C  CA  . THR K  2 86 ? 16.040  -1.097  137.015 1.00 20.58 ? 87   THR K CA  1 
ATOM   8033 C  C   . THR K  2 86 ? 16.061  -0.271  135.737 1.00 23.42 ? 87   THR K C   1 
ATOM   8034 O  O   . THR K  2 86 ? 16.501  -0.755  134.700 1.00 22.79 ? 87   THR K O   1 
ATOM   8035 C  CB  . THR K  2 86 ? 14.608  -1.549  137.321 1.00 20.56 ? 87   THR K CB  1 
ATOM   8036 O  OG1 . THR K  2 86 ? 14.562  -2.367  138.515 1.00 20.78 ? 87   THR K OG1 1 
ATOM   8037 C  CG2 . THR K  2 86 ? 14.063  -2.407  136.217 1.00 20.90 ? 87   THR K CG2 1 
ATOM   8038 N  N   . TRP K  2 87 ? 15.583  0.965   135.819 1.00 23.65 ? 88   TRP K N   1 
ATOM   8039 C  CA  . TRP K  2 87 ? 15.707  1.917   134.705 1.00 25.82 ? 88   TRP K CA  1 
ATOM   8040 C  C   . TRP K  2 87 ? 17.169  2.078   134.250 1.00 25.06 ? 88   TRP K C   1 
ATOM   8041 O  O   . TRP K  2 87 ? 17.464  2.007   133.054 1.00 26.10 ? 88   TRP K O   1 
ATOM   8042 C  CB  . TRP K  2 87 ? 15.102  3.273   135.090 1.00 26.83 ? 88   TRP K CB  1 
ATOM   8043 C  CG  . TRP K  2 87 ? 15.345  4.317   134.020 1.00 27.79 ? 88   TRP K CG  1 
ATOM   8044 C  CD1 . TRP K  2 87 ? 16.287  5.299   134.026 1.00 28.49 ? 88   TRP K CD1 1 
ATOM   8045 C  CD2 . TRP K  2 87 ? 14.681  4.405   132.758 1.00 29.44 ? 88   TRP K CD2 1 
ATOM   8046 N  NE1 . TRP K  2 87 ? 16.220  6.029   132.861 1.00 28.84 ? 88   TRP K NE1 1 
ATOM   8047 C  CE2 . TRP K  2 87 ? 15.234  5.506   132.066 1.00 28.25 ? 88   TRP K CE2 1 
ATOM   8048 C  CE3 . TRP K  2 87 ? 13.645  3.687   132.154 1.00 29.15 ? 88   TRP K CE3 1 
ATOM   8049 C  CZ2 . TRP K  2 87 ? 14.801  5.894   130.792 1.00 30.09 ? 88   TRP K CZ2 1 
ATOM   8050 C  CZ3 . TRP K  2 87 ? 13.205  4.087   130.897 1.00 29.97 ? 88   TRP K CZ3 1 
ATOM   8051 C  CH2 . TRP K  2 87 ? 13.792  5.171   130.222 1.00 29.59 ? 88   TRP K CH2 1 
ATOM   8052 N  N   . ALA K  2 88 ? 18.090  2.268   135.196 1.00 23.85 ? 89   ALA K N   1 
ATOM   8053 C  CA  . ALA K  2 88 ? 19.501  2.462   134.860 1.00 24.98 ? 89   ALA K CA  1 
ATOM   8054 C  C   . ALA K  2 88 ? 20.087  1.222   134.194 1.00 26.26 ? 89   ALA K C   1 
ATOM   8055 O  O   . ALA K  2 88 ? 20.883  1.335   133.275 1.00 27.96 ? 89   ALA K O   1 
ATOM   8056 C  CB  . ALA K  2 88 ? 20.344  2.885   136.074 1.00 22.75 ? 89   ALA K CB  1 
ATOM   8057 N  N   . SER K  2 89 ? 19.671  0.039   134.635 1.00 26.71 ? 90   SER K N   1 
ATOM   8058 C  CA  . SER K  2 89 ? 20.147  -1.193  134.013 1.00 27.26 ? 90   SER K CA  1 
ATOM   8059 C  C   . SER K  2 89 ? 19.596  -1.310  132.580 1.00 27.72 ? 90   SER K C   1 
ATOM   8060 O  O   . SER K  2 89 ? 20.318  -1.663  131.649 1.00 28.83 ? 90   SER K O   1 
ATOM   8061 C  CB  . SER K  2 89 ? 19.745  -2.390  134.878 1.00 25.64 ? 90   SER K CB  1 
ATOM   8062 O  OG  . SER K  2 89 ? 20.363  -3.571  134.415 1.00 27.91 ? 90   SER K OG  1 
ATOM   8063 N  N   . HIS K  2 90 ? 18.315  -1.009  132.410 1.00 27.10 ? 91   HIS K N   1 
ATOM   8064 C  CA  . HIS K  2 90 ? 17.662  -0.971  131.097 1.00 29.13 ? 91   HIS K CA  1 
ATOM   8065 C  C   . HIS K  2 90 ? 18.400  -0.001  130.169 1.00 30.97 ? 91   HIS K C   1 
ATOM   8066 O  O   . HIS K  2 90 ? 18.693  -0.324  129.019 1.00 29.83 ? 91   HIS K O   1 
ATOM   8067 C  CB  . HIS K  2 90 ? 16.204  -0.548  131.285 1.00 30.29 ? 91   HIS K CB  1 
ATOM   8068 C  CG  . HIS K  2 90 ? 15.442  -0.326  130.014 1.00 33.09 ? 91   HIS K CG  1 
ATOM   8069 N  ND1 . HIS K  2 90 ? 15.278  0.921   129.447 1.00 34.09 ? 91   HIS K ND1 1 
ATOM   8070 C  CD2 . HIS K  2 90 ? 14.760  -1.190  129.222 1.00 34.44 ? 91   HIS K CD2 1 
ATOM   8071 C  CE1 . HIS K  2 90 ? 14.547  0.815   128.350 1.00 35.17 ? 91   HIS K CE1 1 
ATOM   8072 N  NE2 . HIS K  2 90 ? 14.213  -0.456  128.196 1.00 35.73 ? 91   HIS K NE2 1 
ATOM   8073 N  N   . GLU K  2 91 ? 18.743  1.177   130.680 1.00 33.12 ? 92   GLU K N   1 
ATOM   8074 C  CA  . GLU K  2 91 ? 19.436  2.168   129.851 1.00 36.91 ? 92   GLU K CA  1 
ATOM   8075 C  C   . GLU K  2 91 ? 20.843  1.721   129.466 1.00 38.34 ? 92   GLU K C   1 
ATOM   8076 O  O   . GLU K  2 91 ? 21.321  2.004   128.365 1.00 38.77 ? 92   GLU K O   1 
ATOM   8077 C  CB  . GLU K  2 91 ? 19.478  3.533   130.541 1.00 38.78 ? 92   GLU K CB  1 
ATOM   8078 C  CG  . GLU K  2 91 ? 18.103  4.153   130.739 1.00 42.05 ? 92   GLU K CG  1 
ATOM   8079 C  CD  . GLU K  2 91 ? 17.362  4.384   129.430 1.00 44.74 ? 92   GLU K CD  1 
ATOM   8080 O  OE1 . GLU K  2 91 ? 17.611  5.437   128.787 1.00 45.65 ? 92   GLU K OE1 1 
ATOM   8081 O  OE2 . GLU K  2 91 ? 16.518  3.531   129.052 1.00 46.10 ? 92   GLU K OE2 1 
ATOM   8082 N  N   . LYS K  2 92 ? 21.509  1.012   130.365 1.00 40.07 ? 93   LYS K N   1 
ATOM   8083 C  CA  . LYS K  2 92 ? 22.841  0.533   130.062 1.00 43.62 ? 93   LYS K CA  1 
ATOM   8084 C  C   . LYS K  2 92 ? 22.809  -0.602  129.034 1.00 45.67 ? 93   LYS K C   1 
ATOM   8085 O  O   . LYS K  2 92 ? 23.775  -0.792  128.290 1.00 45.61 ? 93   LYS K O   1 
ATOM   8086 C  CB  . LYS K  2 92 ? 23.562  0.110   131.340 1.00 45.92 ? 93   LYS K CB  1 
ATOM   8087 C  CG  . LYS K  2 92 ? 24.748  -0.783  131.072 1.00 48.93 ? 93   LYS K CG  1 
ATOM   8088 C  CD  . LYS K  2 92 ? 25.851  -0.550  132.078 1.00 50.95 ? 93   LYS K CD  1 
ATOM   8089 C  CE  . LYS K  2 92 ? 27.159  -1.153  131.587 1.00 51.46 ? 93   LYS K CE  1 
ATOM   8090 N  NZ  . LYS K  2 92 ? 28.223  -1.053  132.634 1.00 52.41 ? 93   LYS K NZ  1 
ATOM   8091 N  N   . MET K  2 93 ? 21.708  -1.353  128.995 1.00 47.20 ? 94   MET K N   1 
ATOM   8092 C  CA  . MET K  2 93 ? 21.553  -2.465  128.054 1.00 49.44 ? 94   MET K CA  1 
ATOM   8093 C  C   . MET K  2 93 ? 21.374  -1.923  126.643 1.00 53.32 ? 94   MET K C   1 
ATOM   8094 O  O   . MET K  2 93 ? 21.936  -2.463  125.692 1.00 55.08 ? 94   MET K O   1 
ATOM   8095 C  CB  . MET K  2 93 ? 20.343  -3.344  128.408 1.00 47.44 ? 94   MET K CB  1 
ATOM   8096 C  CG  . MET K  2 93 ? 20.584  -4.354  129.526 1.00 47.30 ? 94   MET K CG  1 
ATOM   8097 S  SD  . MET K  2 93 ? 19.073  -5.166  130.131 1.00 46.09 ? 94   MET K SD  1 
ATOM   8098 C  CE  . MET K  2 93 ? 19.791  -6.122  131.471 1.00 46.20 ? 94   MET K CE  1 
ATOM   8099 N  N   . HIS K  2 94 ? 20.591  -0.856  126.511 1.00 57.29 ? 95   HIS K N   1 
ATOM   8100 C  CA  . HIS K  2 94 ? 20.296  -0.275  125.201 1.00 60.85 ? 95   HIS K CA  1 
ATOM   8101 C  C   . HIS K  2 94 ? 21.355  0.732   124.760 1.00 61.72 ? 95   HIS K C   1 
ATOM   8102 O  O   . HIS K  2 94 ? 22.550  0.419   124.705 1.00 62.45 ? 95   HIS K O   1 
ATOM   8103 C  CB  . HIS K  2 94 ? 18.897  0.354   125.183 1.00 62.87 ? 95   HIS K CB  1 
ATOM   8104 C  CG  . HIS K  2 94 ? 17.785  -0.648  125.082 1.00 65.47 ? 95   HIS K CG  1 
ATOM   8105 N  ND1 . HIS K  2 94 ? 16.561  -0.469  125.692 1.00 65.93 ? 95   HIS K ND1 1 
ATOM   8106 C  CD2 . HIS K  2 94 ? 17.717  -1.845  124.449 1.00 66.26 ? 95   HIS K CD2 1 
ATOM   8107 C  CE1 . HIS K  2 94 ? 15.785  -1.509  125.435 1.00 66.35 ? 95   HIS K CE1 1 
ATOM   8108 N  NE2 . HIS K  2 94 ? 16.464  -2.360  124.685 1.00 66.72 ? 95   HIS K NE2 1 
ATOM   8109 N  N   . LYS L  2 3  ? 1.943   37.287  133.408 1.00 50.90 ? 4    LYS L N   1 
ATOM   8110 C  CA  . LYS L  2 3  ? 0.812   36.461  133.924 1.00 49.73 ? 4    LYS L CA  1 
ATOM   8111 C  C   . LYS L  2 3  ? 0.988   34.969  133.619 1.00 47.07 ? 4    LYS L C   1 
ATOM   8112 O  O   . LYS L  2 3  ? 0.579   34.129  134.423 1.00 47.16 ? 4    LYS L O   1 
ATOM   8113 C  CB  . LYS L  2 3  ? -0.534  36.969  133.396 1.00 52.32 ? 4    LYS L CB  1 
ATOM   8114 C  CG  . LYS L  2 3  ? -1.602  37.136  134.486 1.00 55.22 ? 4    LYS L CG  1 
ATOM   8115 C  CD  . LYS L  2 3  ? -2.309  35.823  134.828 1.00 57.27 ? 4    LYS L CD  1 
ATOM   8116 C  CE  . LYS L  2 3  ? -3.263  35.404  133.715 1.00 58.39 ? 4    LYS L CE  1 
ATOM   8117 N  NZ  . LYS L  2 3  ? -4.314  36.441  133.465 1.00 58.97 ? 4    LYS L NZ  1 
ATOM   8118 N  N   . MET L  2 4  ? 1.585   34.636  132.473 1.00 41.51 ? 5    MET L N   1 
ATOM   8119 C  CA  . MET L  2 4  ? 2.039   33.256  132.256 1.00 37.89 ? 5    MET L CA  1 
ATOM   8120 C  C   . MET L  2 4  ? 3.079   32.876  133.305 1.00 30.81 ? 5    MET L C   1 
ATOM   8121 O  O   . MET L  2 4  ? 4.023   33.622  133.541 1.00 27.60 ? 5    MET L O   1 
ATOM   8122 C  CB  . MET L  2 4  ? 2.638   33.060  130.863 1.00 39.54 ? 5    MET L CB  1 
ATOM   8123 C  CG  . MET L  2 4  ? 1.824   32.129  129.975 1.00 43.07 ? 5    MET L CG  1 
ATOM   8124 S  SD  . MET L  2 4  ? 2.739   31.573  128.508 1.00 46.18 ? 5    MET L SD  1 
ATOM   8125 C  CE  . MET L  2 4  ? 3.200   33.153  127.835 1.00 45.03 ? 5    MET L CE  1 
ATOM   8126 N  N   . SER L  2 5  ? 2.902   31.728  133.951 1.00 26.10 ? 6    SER L N   1 
ATOM   8127 C  CA  . SER L  2 5  ? 3.869   31.292  134.945 1.00 22.18 ? 6    SER L CA  1 
ATOM   8128 C  C   . SER L  2 5  ? 5.156   30.828  134.280 1.00 20.43 ? 6    SER L C   1 
ATOM   8129 O  O   . SER L  2 5  ? 5.224   30.662  133.055 1.00 19.56 ? 6    SER L O   1 
ATOM   8130 C  CB  . SER L  2 5  ? 3.307   30.094  135.723 1.00 18.43 ? 6    SER L CB  1 
ATOM   8131 O  OG  . SER L  2 5  ? 3.206   28.985  134.843 1.00 21.57 ? 6    SER L OG  1 
ATOM   8132 N  N   . GLN L  2 6  ? 6.166   30.533  135.102 1.00 20.40 ? 7    GLN L N   1 
ATOM   8133 C  CA  . GLN L  2 6  ? 7.427   30.004  134.553 1.00 20.03 ? 7    GLN L CA  1 
ATOM   8134 C  C   . GLN L  2 6  ? 7.201   28.664  133.855 1.00 18.69 ? 7    GLN L C   1 
ATOM   8135 O  O   . GLN L  2 6  ? 7.671   28.473  132.743 1.00 17.57 ? 7    GLN L O   1 
ATOM   8136 C  CB  . GLN L  2 6  ? 8.500   29.901  135.663 1.00 20.09 ? 7    GLN L CB  1 
ATOM   8137 C  CG  . GLN L  2 6  ? 9.894   29.358  135.245 1.00 21.80 ? 7    GLN L CG  1 
ATOM   8138 C  CD  . GLN L  2 6  ? 10.803  29.184  136.460 1.00 24.93 ? 7    GLN L CD  1 
ATOM   8139 O  OE1 . GLN L  2 6  ? 10.381  29.508  137.581 1.00 28.16 ? 7    GLN L OE1 1 
ATOM   8140 N  NE2 . GLN L  2 6  ? 12.018  28.660  136.262 1.00 24.24 ? 7    GLN L NE2 1 
ATOM   8141 N  N   . LEU L  2 7  ? 6.488   27.744  134.515 1.00 18.84 ? 8    LEU L N   1 
ATOM   8142 C  CA  . LEU L  2 7  ? 6.217   26.412  133.939 1.00 19.21 ? 8    LEU L CA  1 
ATOM   8143 C  C   . LEU L  2 7  ? 5.409   26.516  132.639 1.00 18.87 ? 8    LEU L C   1 
ATOM   8144 O  O   . LEU L  2 7  ? 5.679   25.824  131.653 1.00 19.51 ? 8    LEU L O   1 
ATOM   8145 C  CB  . LEU L  2 7  ? 5.453   25.559  134.993 1.00 18.02 ? 8    LEU L CB  1 
ATOM   8146 C  CG  . LEU L  2 7  ? 5.222   24.077  134.628 1.00 20.45 ? 8    LEU L CG  1 
ATOM   8147 C  CD1 . LEU L  2 7  ? 6.488   23.380  134.130 1.00 22.77 ? 8    LEU L CD1 1 
ATOM   8148 C  CD2 . LEU L  2 7  ? 4.540   23.291  135.788 1.00 18.94 ? 8    LEU L CD2 1 
ATOM   8149 N  N   . GLU L  2 8  ? 4.426   27.407  132.618 1.00 20.41 ? 9    GLU L N   1 
ATOM   8150 C  CA  . GLU L  2 8  ? 3.633   27.614  131.398 1.00 20.40 ? 9    GLU L CA  1 
ATOM   8151 C  C   . GLU L  2 8  ? 4.476   28.160  130.255 1.00 20.69 ? 9    GLU L C   1 
ATOM   8152 O  O   . GLU L  2 8  ? 4.327   27.716  129.111 1.00 21.28 ? 9    GLU L O   1 
ATOM   8153 C  CB  . GLU L  2 8  ? 2.488   28.584  131.658 1.00 22.13 ? 9    GLU L CB  1 
ATOM   8154 C  CG  . GLU L  2 8  ? 1.317   27.947  132.375 1.00 24.71 ? 9    GLU L CG  1 
ATOM   8155 C  CD  . GLU L  2 8  ? 0.415   28.997  132.977 1.00 29.00 ? 9    GLU L CD  1 
ATOM   8156 O  OE1 . GLU L  2 8  ? 0.778   30.205  132.955 1.00 30.17 ? 9    GLU L OE1 1 
ATOM   8157 O  OE2 . GLU L  2 8  ? -0.658  28.607  133.471 1.00 31.38 ? 9    GLU L OE2 1 
ATOM   8158 N  N   . ARG L  2 9  ? 5.349   29.117  130.555 1.00 18.93 ? 10   ARG L N   1 
ATOM   8159 C  CA  . ARG L  2 9  ? 6.309   29.569  129.527 1.00 19.28 ? 10   ARG L CA  1 
ATOM   8160 C  C   . ARG L  2 9  ? 7.188   28.435  128.980 1.00 18.63 ? 10   ARG L C   1 
ATOM   8161 O  O   . ARG L  2 9  ? 7.447   28.383  127.775 1.00 18.91 ? 10   ARG L O   1 
ATOM   8162 C  CB  . ARG L  2 9  ? 7.231   30.656  130.073 1.00 19.45 ? 10   ARG L CB  1 
ATOM   8163 C  CG  . ARG L  2 9  ? 6.604   32.012  130.107 1.00 23.02 ? 10   ARG L CG  1 
ATOM   8164 C  CD  . ARG L  2 9  ? 7.583   33.108  130.461 1.00 27.30 ? 10   ARG L CD  1 
ATOM   8165 N  NE  . ARG L  2 9  ? 7.922   33.138  131.879 1.00 32.52 ? 10   ARG L NE  1 
ATOM   8166 C  CZ  . ARG L  2 9  ? 9.112   32.824  132.361 1.00 34.18 ? 10   ARG L CZ  1 
ATOM   8167 N  NH1 . ARG L  2 9  ? 10.074  32.427  131.531 1.00 34.68 ? 10   ARG L NH1 1 
ATOM   8168 N  NH2 . ARG L  2 9  ? 9.332   32.912  133.670 1.00 32.96 ? 10   ARG L NH2 1 
ATOM   8169 N  N   . ASN L  2 10 ? 7.648   27.547  129.870 1.00 19.47 ? 11   ASN L N   1 
ATOM   8170 C  CA  . ASN L  2 10 ? 8.495   26.430  129.481 1.00 18.29 ? 11   ASN L CA  1 
ATOM   8171 C  C   . ASN L  2 10 ? 7.786   25.454  128.568 1.00 18.23 ? 11   ASN L C   1 
ATOM   8172 O  O   . ASN L  2 10 ? 8.337   25.046  127.542 1.00 17.45 ? 11   ASN L O   1 
ATOM   8173 C  CB  . ASN L  2 10 ? 9.065   25.692  130.697 1.00 18.00 ? 11   ASN L CB  1 
ATOM   8174 C  CG  . ASN L  2 10 ? 9.939   26.602  131.563 1.00 20.09 ? 11   ASN L CG  1 
ATOM   8175 O  OD1 . ASN L  2 10 ? 10.530  27.600  131.072 1.00 22.78 ? 11   ASN L OD1 1 
ATOM   8176 N  ND2 . ASN L  2 10 ? 10.070  26.252  132.811 1.00 17.54 ? 11   ASN L ND2 1 
ATOM   8177 N  N   . ILE L  2 11 ? 6.545   25.135  128.900 1.00 20.11 ? 12   ILE L N   1 
ATOM   8178 C  CA  . ILE L  2 11 ? 5.716   24.246  128.083 1.00 19.36 ? 12   ILE L CA  1 
ATOM   8179 C  C   . ILE L  2 11 ? 5.407   24.916  126.740 1.00 21.07 ? 12   ILE L C   1 
ATOM   8180 O  O   . ILE L  2 11 ? 5.381   24.252  125.697 1.00 20.18 ? 12   ILE L O   1 
ATOM   8181 C  CB  . ILE L  2 11 ? 4.439   23.915  128.863 1.00 23.48 ? 12   ILE L CB  1 
ATOM   8182 C  CG1 . ILE L  2 11 ? 4.763   22.897  129.956 1.00 22.86 ? 12   ILE L CG1 1 
ATOM   8183 C  CG2 . ILE L  2 11 ? 3.320   23.422  127.919 1.00 23.47 ? 12   ILE L CG2 1 
ATOM   8184 C  CD1 . ILE L  2 11 ? 3.666   22.793  130.969 1.00 27.26 ? 12   ILE L CD1 1 
ATOM   8185 N  N   . GLU L  2 12 ? 5.217   26.235  126.750 1.00 19.85 ? 13   GLU L N   1 
ATOM   8186 C  CA  . GLU L  2 12 ? 5.000   26.978  125.496 1.00 20.45 ? 13   GLU L CA  1 
ATOM   8187 C  C   . GLU L  2 12 ? 6.200   26.917  124.571 1.00 20.31 ? 13   GLU L C   1 
ATOM   8188 O  O   . GLU L  2 12 ? 6.032   26.819  123.366 1.00 17.96 ? 13   GLU L O   1 
ATOM   8189 C  CB  . GLU L  2 12 ? 4.647   28.436  125.792 1.00 24.71 ? 13   GLU L CB  1 
ATOM   8190 C  CG  . GLU L  2 12 ? 4.480   29.301  124.543 1.00 27.41 ? 13   GLU L CG  1 
ATOM   8191 C  CD  . GLU L  2 12 ? 4.006   30.695  124.904 1.00 31.56 ? 13   GLU L CD  1 
ATOM   8192 O  OE1 . GLU L  2 12 ? 2.961   31.118  124.360 1.00 33.23 ? 13   GLU L OE1 1 
ATOM   8193 O  OE2 . GLU L  2 12 ? 4.646   31.342  125.771 1.00 32.20 ? 13   GLU L OE2 1 
ATOM   8194 N  N   . THR L  2 13 ? 7.401   27.035  125.114 1.00 18.59 ? 14   THR L N   1 
ATOM   8195 C  CA  . THR L  2 13 ? 8.614   26.911  124.281 1.00 20.01 ? 14   THR L CA  1 
ATOM   8196 C  C   . THR L  2 13 ? 8.662   25.519  123.642 1.00 21.21 ? 14   THR L C   1 
ATOM   8197 O  O   . THR L  2 13 ? 9.014   25.378  122.462 1.00 20.49 ? 14   THR L O   1 
ATOM   8198 C  CB  . THR L  2 13 ? 9.842   27.115  125.176 1.00 19.88 ? 14   THR L CB  1 
ATOM   8199 O  OG1 . THR L  2 13 ? 9.805   28.449  125.717 1.00 19.69 ? 14   THR L OG1 1 
ATOM   8200 C  CG2 . THR L  2 13 ? 11.153  26.998  124.411 1.00 20.83 ? 14   THR L CG2 1 
ATOM   8201 N  N   . ILE L  2 14 ? 8.371   24.486  124.436 1.00 19.19 ? 15   ILE L N   1 
ATOM   8202 C  CA  . ILE L  2 14 ? 8.345   23.140  123.890 1.00 20.31 ? 15   ILE L CA  1 
ATOM   8203 C  C   . ILE L  2 14 ? 7.306   23.029  122.767 1.00 16.94 ? 15   ILE L C   1 
ATOM   8204 O  O   . ILE L  2 14 ? 7.585   22.501  121.693 1.00 20.07 ? 15   ILE L O   1 
ATOM   8205 C  CB  . ILE L  2 14 ? 8.036   22.092  125.013 1.00 19.60 ? 15   ILE L CB  1 
ATOM   8206 C  CG1 . ILE L  2 14 ? 9.160   22.122  126.059 1.00 18.82 ? 15   ILE L CG1 1 
ATOM   8207 C  CG2 . ILE L  2 14 ? 7.902   20.716  124.343 1.00 18.50 ? 15   ILE L CG2 1 
ATOM   8208 C  CD1 . ILE L  2 14 ? 8.932   21.253  127.350 1.00 17.67 ? 15   ILE L CD1 1 
ATOM   8209 N  N   . ILE L  2 15 ? 6.079   23.482  123.022 1.00 18.05 ? 16   ILE L N   1 
ATOM   8210 C  CA  . ILE L  2 15 ? 5.046   23.427  121.970 1.00 17.92 ? 16   ILE L CA  1 
ATOM   8211 C  C   . ILE L  2 15 ? 5.435   24.176  120.681 1.00 20.67 ? 16   ILE L C   1 
ATOM   8212 O  O   . ILE L  2 15 ? 5.300   23.642  119.554 1.00 18.74 ? 16   ILE L O   1 
ATOM   8213 C  CB  . ILE L  2 15 ? 3.689   23.929  122.535 1.00 18.77 ? 16   ILE L CB  1 
ATOM   8214 C  CG1 . ILE L  2 15 ? 3.175   22.896  123.561 1.00 17.77 ? 16   ILE L CG1 1 
ATOM   8215 C  CG2 . ILE L  2 15 ? 2.686   24.186  121.381 1.00 19.24 ? 16   ILE L CG2 1 
ATOM   8216 C  CD1 . ILE L  2 15 ? 2.077   23.554  124.388 1.00 19.81 ? 16   ILE L CD1 1 
ATOM   8217 N  N   . ASN L  2 16 ? 5.941   25.399  120.843 1.00 20.27 ? 17   ASN L N   1 
ATOM   8218 C  CA  . ASN L  2 16 ? 6.220   26.238  119.681 1.00 20.54 ? 17   ASN L CA  1 
ATOM   8219 C  C   . ASN L  2 16 ? 7.443   25.757  118.926 1.00 21.37 ? 17   ASN L C   1 
ATOM   8220 O  O   . ASN L  2 16 ? 7.616   26.056  117.737 1.00 22.69 ? 17   ASN L O   1 
ATOM   8221 C  CB  . ASN L  2 16 ? 6.412   27.678  120.100 1.00 21.64 ? 17   ASN L CB  1 
ATOM   8222 C  CG  . ASN L  2 16 ? 5.114   28.337  120.486 1.00 24.08 ? 17   ASN L CG  1 
ATOM   8223 O  OD1 . ASN L  2 16 ? 4.050   27.728  120.389 1.00 27.44 ? 17   ASN L OD1 1 
ATOM   8224 N  ND2 . ASN L  2 16 ? 5.195   29.563  120.972 1.00 24.08 ? 17   ASN L ND2 1 
ATOM   8225 N  N   . THR L  2 17 ? 8.312   25.045  119.633 1.00 20.85 ? 18   THR L N   1 
ATOM   8226 C  CA  . THR L  2 17 ? 9.496   24.467  118.989 1.00 18.87 ? 18   THR L CA  1 
ATOM   8227 C  C   . THR L  2 17 ? 9.064   23.283  118.132 1.00 19.88 ? 18   THR L C   1 
ATOM   8228 O  O   . THR L  2 17 ? 9.413   23.231  116.963 1.00 18.26 ? 18   THR L O   1 
ATOM   8229 C  CB  . THR L  2 17 ? 10.537  24.045  120.023 1.00 20.82 ? 18   THR L CB  1 
ATOM   8230 O  OG1 . THR L  2 17 ? 10.945  25.187  120.793 1.00 23.25 ? 18   THR L OG1 1 
ATOM   8231 C  CG2 . THR L  2 17 ? 11.826  23.567  119.367 1.00 18.81 ? 18   THR L CG2 1 
ATOM   8232 N  N   . PHE L  2 18 ? 8.249   22.386  118.685 1.00 21.45 ? 19   PHE L N   1 
ATOM   8233 C  CA  . PHE L  2 18 ? 7.608   21.302  117.924 1.00 19.34 ? 19   PHE L CA  1 
ATOM   8234 C  C   . PHE L  2 18 ? 6.894   21.854  116.692 1.00 20.85 ? 19   PHE L C   1 
ATOM   8235 O  O   . PHE L  2 18 ? 7.099   21.369  115.576 1.00 20.15 ? 19   PHE L O   1 
ATOM   8236 C  CB  . PHE L  2 18 ? 6.594   20.573  118.844 1.00 21.09 ? 19   PHE L CB  1 
ATOM   8237 C  CG  . PHE L  2 18 ? 5.900   19.412  118.177 1.00 20.91 ? 19   PHE L CG  1 
ATOM   8238 C  CD1 . PHE L  2 18 ? 6.433   18.123  118.270 1.00 21.33 ? 19   PHE L CD1 1 
ATOM   8239 C  CD2 . PHE L  2 18 ? 4.701   19.593  117.495 1.00 22.64 ? 19   PHE L CD2 1 
ATOM   8240 C  CE1 . PHE L  2 18 ? 5.793   17.041  117.691 1.00 20.46 ? 19   PHE L CE1 1 
ATOM   8241 C  CE2 . PHE L  2 18 ? 4.063   18.519  116.874 1.00 19.19 ? 19   PHE L CE2 1 
ATOM   8242 C  CZ  . PHE L  2 18 ? 4.619   17.248  116.956 1.00 22.57 ? 19   PHE L CZ  1 
ATOM   8243 N  N   . HIS L  2 19 ? 6.082   22.891  116.881 1.00 20.49 ? 20   HIS L N   1 
ATOM   8244 C  CA  . HIS L  2 19 ? 5.325   23.492  115.764 1.00 18.78 ? 20   HIS L CA  1 
ATOM   8245 C  C   . HIS L  2 19 ? 6.195   24.093  114.652 1.00 20.71 ? 20   HIS L C   1 
ATOM   8246 O  O   . HIS L  2 19 ? 5.896   23.919  113.459 1.00 19.12 ? 20   HIS L O   1 
ATOM   8247 C  CB  . HIS L  2 19 ? 4.359   24.549  116.318 1.00 21.69 ? 20   HIS L CB  1 
ATOM   8248 C  CG  . HIS L  2 19 ? 3.525   25.200  115.259 1.00 23.58 ? 20   HIS L CG  1 
ATOM   8249 N  ND1 . HIS L  2 19 ? 2.314   24.682  114.856 1.00 24.78 ? 20   HIS L ND1 1 
ATOM   8250 C  CD2 . HIS L  2 19 ? 3.700   26.342  114.561 1.00 24.32 ? 20   HIS L CD2 1 
ATOM   8251 C  CE1 . HIS L  2 19 ? 1.793   25.463  113.924 1.00 25.38 ? 20   HIS L CE1 1 
ATOM   8252 N  NE2 . HIS L  2 19 ? 2.623   26.469  113.711 1.00 27.77 ? 20   HIS L NE2 1 
ATOM   8253 N  N   . GLN L  2 20 ? 7.232   24.827  115.037 1.00 19.37 ? 21   GLN L N   1 
ATOM   8254 C  CA  . GLN L  2 20 ? 8.185   25.375  114.079 1.00 19.33 ? 21   GLN L CA  1 
ATOM   8255 C  C   . GLN L  2 20 ? 8.569   24.359  112.997 1.00 20.78 ? 21   GLN L C   1 
ATOM   8256 O  O   . GLN L  2 20 ? 8.675   24.707  111.803 1.00 22.21 ? 21   GLN L O   1 
ATOM   8257 C  CB  . GLN L  2 20 ? 9.446   25.889  114.813 1.00 20.11 ? 21   GLN L CB  1 
ATOM   8258 C  CG  . GLN L  2 20 ? 10.559  26.536  113.902 1.00 19.45 ? 21   GLN L CG  1 
ATOM   8259 C  CD  . GLN L  2 20 ? 10.078  27.615  112.891 1.00 23.23 ? 21   GLN L CD  1 
ATOM   8260 O  OE1 . GLN L  2 20 ? 9.076   28.327  113.091 1.00 22.21 ? 21   GLN L OE1 1 
ATOM   8261 N  NE2 . GLN L  2 20 ? 10.828  27.742  111.809 1.00 23.61 ? 21   GLN L NE2 1 
ATOM   8262 N  N   . TYR L  2 21 ? 8.842   23.125  113.425 1.00 18.75 ? 22   TYR L N   1 
ATOM   8263 C  CA  . TYR L  2 21 ? 9.261   22.079  112.481 1.00 21.14 ? 22   TYR L CA  1 
ATOM   8264 C  C   . TYR L  2 21 ? 8.122   21.255  111.886 1.00 21.43 ? 22   TYR L C   1 
ATOM   8265 O  O   . TYR L  2 21 ? 8.172   20.890  110.722 1.00 20.67 ? 22   TYR L O   1 
ATOM   8266 C  CB  . TYR L  2 21 ? 10.295  21.171  113.153 1.00 21.68 ? 22   TYR L CB  1 
ATOM   8267 C  CG  . TYR L  2 21 ? 11.574  21.931  113.512 1.00 23.55 ? 22   TYR L CG  1 
ATOM   8268 C  CD1 . TYR L  2 21 ? 11.775  22.450  114.787 1.00 23.62 ? 22   TYR L CD1 1 
ATOM   8269 C  CD2 . TYR L  2 21 ? 12.571  22.142  112.553 1.00 24.72 ? 22   TYR L CD2 1 
ATOM   8270 C  CE1 . TYR L  2 21 ? 12.938  23.141  115.102 1.00 22.44 ? 22   TYR L CE1 1 
ATOM   8271 C  CE2 . TYR L  2 21 ? 13.757  22.842  112.864 1.00 23.84 ? 22   TYR L CE2 1 
ATOM   8272 C  CZ  . TYR L  2 21 ? 13.919  23.337  114.156 1.00 24.47 ? 22   TYR L CZ  1 
ATOM   8273 O  OH  . TYR L  2 21 ? 15.053  24.013  114.526 1.00 22.00 ? 22   TYR L OH  1 
ATOM   8274 N  N   . SER L  2 22 ? 7.098   20.942  112.679 1.00 20.22 ? 23   SER L N   1 
ATOM   8275 C  CA  . SER L  2 22 ? 6.047   20.041  112.206 1.00 20.12 ? 23   SER L CA  1 
ATOM   8276 C  C   . SER L  2 22 ? 5.369   20.605  110.952 1.00 22.26 ? 23   SER L C   1 
ATOM   8277 O  O   . SER L  2 22 ? 5.094   19.895  109.993 1.00 20.20 ? 23   SER L O   1 
ATOM   8278 C  CB  . SER L  2 22 ? 5.029   19.752  113.326 1.00 18.54 ? 23   SER L CB  1 
ATOM   8279 O  OG  . SER L  2 22 ? 4.258   20.908  113.652 1.00 24.88 ? 23   SER L OG  1 
ATOM   8280 N  N   . VAL L  2 23 ? 5.143   21.908  110.943 1.00 21.29 ? 24   VAL L N   1 
ATOM   8281 C  CA  . VAL L  2 23 ? 4.350   22.546  109.895 1.00 21.87 ? 24   VAL L CA  1 
ATOM   8282 C  C   . VAL L  2 23 ? 5.085   22.665  108.565 1.00 22.44 ? 24   VAL L C   1 
ATOM   8283 O  O   . VAL L  2 23 ? 4.451   22.946  107.549 1.00 22.88 ? 24   VAL L O   1 
ATOM   8284 C  CB  . VAL L  2 23 ? 3.898   23.973  110.358 1.00 23.56 ? 24   VAL L CB  1 
ATOM   8285 C  CG1 . VAL L  2 23 ? 5.079   24.912  110.380 1.00 20.86 ? 24   VAL L CG1 1 
ATOM   8286 C  CG2 . VAL L  2 23 ? 2.865   24.554  109.417 1.00 27.86 ? 24   VAL L CG2 1 
ATOM   8287 N  N   . LYS L  2 24 ? 6.401   22.444  108.548 1.00 22.96 ? 25   LYS L N   1 
ATOM   8288 C  CA  . LYS L  2 24 ? 7.208   22.681  107.340 1.00 24.37 ? 25   LYS L CA  1 
ATOM   8289 C  C   . LYS L  2 24 ? 6.836   21.774  106.151 1.00 24.66 ? 25   LYS L C   1 
ATOM   8290 O  O   . LYS L  2 24 ? 6.851   22.210  104.991 1.00 22.52 ? 25   LYS L O   1 
ATOM   8291 C  CB  . LYS L  2 24 ? 8.689   22.435  107.649 1.00 26.31 ? 25   LYS L CB  1 
ATOM   8292 C  CG  . LYS L  2 24 ? 9.348   23.449  108.574 1.00 29.19 ? 25   LYS L CG  1 
ATOM   8293 C  CD  . LYS L  2 24 ? 10.863  23.182  108.633 1.00 29.32 ? 25   LYS L CD  1 
ATOM   8294 C  CE  . LYS L  2 24 ? 11.564  24.077  109.650 1.00 32.06 ? 25   LYS L CE  1 
ATOM   8295 N  NZ  . LYS L  2 24 ? 11.799  25.404  108.989 1.00 34.03 ? 25   LYS L NZ  1 
ATOM   8296 N  N   . LEU L  2 25 ? 6.516   20.513  106.436 1.00 22.06 ? 26   LEU L N   1 
ATOM   8297 C  CA  . LEU L  2 25 ? 6.264   19.526  105.397 1.00 24.23 ? 26   LEU L CA  1 
ATOM   8298 C  C   . LEU L  2 25 ? 5.373   18.410  105.959 1.00 24.16 ? 26   LEU L C   1 
ATOM   8299 O  O   . LEU L  2 25 ? 5.440   18.078  107.148 1.00 23.47 ? 26   LEU L O   1 
ATOM   8300 C  CB  . LEU L  2 25 ? 7.619   18.969  104.939 1.00 25.49 ? 26   LEU L CB  1 
ATOM   8301 C  CG  . LEU L  2 25 ? 7.962   18.555  103.501 1.00 30.46 ? 26   LEU L CG  1 
ATOM   8302 C  CD1 . LEU L  2 25 ? 7.292   17.227  103.191 1.00 33.30 ? 26   LEU L CD1 1 
ATOM   8303 C  CD2 . LEU L  2 25 ? 7.538   19.609  102.504 1.00 30.17 ? 26   LEU L CD2 1 
ATOM   8304 N  N   . GLY L  2 26 ? 4.519   17.848  105.119 1.00 24.63 ? 27   GLY L N   1 
ATOM   8305 C  CA  . GLY L  2 26 ? 3.777   16.645  105.524 1.00 25.11 ? 27   GLY L CA  1 
ATOM   8306 C  C   . GLY L  2 26 ? 2.624   17.003  106.423 1.00 24.19 ? 27   GLY L C   1 
ATOM   8307 O  O   . GLY L  2 26 ? 2.087   18.101  106.325 1.00 22.64 ? 27   GLY L O   1 
ATOM   8308 N  N   . HIS L  2 27 ? 2.229   16.090  107.306 1.00 22.77 ? 28   HIS L N   1 
ATOM   8309 C  CA  . HIS L  2 27 ? 1.258   16.444  108.317 1.00 24.39 ? 28   HIS L CA  1 
ATOM   8310 C  C   . HIS L  2 27 ? 1.803   17.582  109.181 1.00 23.40 ? 28   HIS L C   1 
ATOM   8311 O  O   . HIS L  2 27 ? 2.949   17.530  109.679 1.00 20.87 ? 28   HIS L O   1 
ATOM   8312 C  CB  . HIS L  2 27 ? 0.874   15.213  109.146 1.00 27.04 ? 28   HIS L CB  1 
ATOM   8313 C  CG  . HIS L  2 27 ? 0.451   14.049  108.304 1.00 31.33 ? 28   HIS L CG  1 
ATOM   8314 N  ND1 . HIS L  2 27 ? -0.871  13.758  108.046 1.00 34.61 ? 28   HIS L ND1 1 
ATOM   8315 C  CD2 . HIS L  2 27 ? 1.181   13.133  107.624 1.00 33.65 ? 28   HIS L CD2 1 
ATOM   8316 C  CE1 . HIS L  2 27 ? -0.941  12.693  107.267 1.00 35.19 ? 28   HIS L CE1 1 
ATOM   8317 N  NE2 . HIS L  2 27 ? 0.290   12.295  106.993 1.00 35.60 ? 28   HIS L NE2 1 
ATOM   8318 N  N   . PRO L  2 28 ? 0.973   18.611  109.320 1.00 25.03 ? 29   PRO L N   1 
ATOM   8319 C  CA  . PRO L  2 28 ? 1.373   19.882  109.958 1.00 25.13 ? 29   PRO L CA  1 
ATOM   8320 C  C   . PRO L  2 28 ? 1.457   19.853  111.486 1.00 24.46 ? 29   PRO L C   1 
ATOM   8321 O  O   . PRO L  2 28 ? 2.033   20.781  112.081 1.00 23.32 ? 29   PRO L O   1 
ATOM   8322 C  CB  . PRO L  2 28 ? 0.293   20.870  109.491 1.00 26.21 ? 29   PRO L CB  1 
ATOM   8323 C  CG  . PRO L  2 28 ? -0.928  20.012  109.223 1.00 27.09 ? 29   PRO L CG  1 
ATOM   8324 C  CD  . PRO L  2 28 ? -0.399  18.669  108.768 1.00 26.32 ? 29   PRO L CD  1 
ATOM   8325 N  N   . ASP L  2 29 ? 0.869   18.825  112.105 1.00 22.81 ? 30   ASP L N   1 
ATOM   8326 C  CA  . ASP L  2 29 ? 0.965   18.648  113.550 1.00 23.80 ? 30   ASP L CA  1 
ATOM   8327 C  C   . ASP L  2 29 ? 1.705   17.350  113.958 1.00 22.77 ? 30   ASP L C   1 
ATOM   8328 O  O   . ASP L  2 29 ? 1.607   16.906  115.106 1.00 21.12 ? 30   ASP L O   1 
ATOM   8329 C  CB  . ASP L  2 29 ? -0.443  18.714  114.162 1.00 24.17 ? 30   ASP L CB  1 
ATOM   8330 C  CG  . ASP L  2 29 ? -0.442  18.955  115.678 1.00 28.09 ? 30   ASP L CG  1 
ATOM   8331 O  OD1 . ASP L  2 29 ? 0.388   19.747  116.187 1.00 27.25 ? 30   ASP L OD1 1 
ATOM   8332 O  OD2 . ASP L  2 29 ? -1.276  18.391  116.427 1.00 26.89 ? 30   ASP L OD2 1 
ATOM   8333 N  N   . THR L  2 30 ? 2.492   16.755  113.058 1.00 21.18 ? 31   THR L N   1 
ATOM   8334 C  CA  . THR L  2 30 ? 3.479   15.756  113.504 1.00 21.49 ? 31   THR L CA  1 
ATOM   8335 C  C   . THR L  2 30 ? 4.853   16.065  112.951 1.00 21.69 ? 31   THR L C   1 
ATOM   8336 O  O   . THR L  2 30 ? 4.999   16.793  111.960 1.00 18.93 ? 31   THR L O   1 
ATOM   8337 C  CB  . THR L  2 30 ? 3.143   14.328  113.029 1.00 24.07 ? 31   THR L CB  1 
ATOM   8338 O  OG1 . THR L  2 30 ? 3.138   14.306  111.599 1.00 22.07 ? 31   THR L OG1 1 
ATOM   8339 C  CG2 . THR L  2 30 ? 1.735   13.907  113.462 1.00 24.57 ? 31   THR L CG2 1 
ATOM   8340 N  N   . LEU L  2 31 ? 5.866   15.459  113.541 1.00 17.69 ? 32   LEU L N   1 
ATOM   8341 C  CA  . LEU L  2 31 ? 7.227   15.586  112.997 1.00 19.94 ? 32   LEU L CA  1 
ATOM   8342 C  C   . LEU L  2 31 ? 7.528   14.354  112.159 1.00 21.38 ? 32   LEU L C   1 
ATOM   8343 O  O   . LEU L  2 31 ? 7.466   13.240  112.661 1.00 20.73 ? 32   LEU L O   1 
ATOM   8344 C  CB  . LEU L  2 31 ? 8.250   15.610  114.128 1.00 19.51 ? 32   LEU L CB  1 
ATOM   8345 C  CG  . LEU L  2 31 ? 8.189   16.771  115.123 1.00 17.86 ? 32   LEU L CG  1 
ATOM   8346 C  CD1 . LEU L  2 31 ? 9.104   16.555  116.334 1.00 20.29 ? 32   LEU L CD1 1 
ATOM   8347 C  CD2 . LEU L  2 31 ? 8.488   18.094  114.435 1.00 19.69 ? 32   LEU L CD2 1 
ATOM   8348 N  N   . ASN L  2 32 ? 7.906   14.543  110.905 1.00 21.12 ? 33   ASN L N   1 
ATOM   8349 C  CA  . ASN L  2 32 ? 8.412   13.397  110.166 1.00 20.84 ? 33   ASN L CA  1 
ATOM   8350 C  C   . ASN L  2 32 ? 9.899   13.264  110.502 1.00 20.76 ? 33   ASN L C   1 
ATOM   8351 O  O   . ASN L  2 32 ? 10.446  14.047  111.271 1.00 18.53 ? 33   ASN L O   1 
ATOM   8352 C  CB  . ASN L  2 32 ? 8.124   13.517  108.647 1.00 23.08 ? 33   ASN L CB  1 
ATOM   8353 C  CG  . ASN L  2 32 ? 8.703   14.779  108.049 1.00 24.85 ? 33   ASN L CG  1 
ATOM   8354 O  OD1 . ASN L  2 32 ? 9.747   15.266  108.489 1.00 23.64 ? 33   ASN L OD1 1 
ATOM   8355 N  ND2 . ASN L  2 32 ? 8.062   15.289  106.993 1.00 26.02 ? 33   ASN L ND2 1 
ATOM   8356 N  N   . GLN L  2 33 ? 10.568  12.307  109.874 1.00 22.78 ? 34   GLN L N   1 
ATOM   8357 C  CA  . GLN L  2 33 ? 11.950  12.009  110.199 1.00 25.40 ? 34   GLN L CA  1 
ATOM   8358 C  C   . GLN L  2 33 ? 12.864  13.206  109.956 1.00 24.08 ? 34   GLN L C   1 
ATOM   8359 O  O   . GLN L  2 33 ? 13.667  13.539  110.826 1.00 22.12 ? 34   GLN L O   1 
ATOM   8360 C  CB  . GLN L  2 33 ? 12.431  10.763  109.441 1.00 29.25 ? 34   GLN L CB  1 
ATOM   8361 C  CG  . GLN L  2 33 ? 13.821  10.339  109.872 1.00 34.25 ? 34   GLN L CG  1 
ATOM   8362 C  CD  . GLN L  2 33 ? 14.314  9.101   109.146 1.00 36.23 ? 34   GLN L CD  1 
ATOM   8363 O  OE1 . GLN L  2 33 ? 15.161  9.180   108.263 1.00 38.72 ? 34   GLN L OE1 1 
ATOM   8364 N  NE2 . GLN L  2 33 ? 13.759  7.958   109.512 1.00 38.64 ? 34   GLN L NE2 1 
ATOM   8365 N  N   . GLY L  2 34 ? 12.737  13.860  108.797 1.00 22.73 ? 35   GLY L N   1 
ATOM   8366 C  CA  . GLY L  2 34 ? 13.535  15.041  108.479 1.00 20.69 ? 35   GLY L CA  1 
ATOM   8367 C  C   . GLY L  2 34 ? 13.334  16.160  109.489 1.00 21.74 ? 35   GLY L C   1 
ATOM   8368 O  O   . GLY L  2 34 ? 14.284  16.849  109.842 1.00 21.08 ? 35   GLY L O   1 
ATOM   8369 N  N   . GLU L  2 35 ? 12.096  16.328  109.956 1.00 18.01 ? 36   GLU L N   1 
ATOM   8370 C  CA  . GLU L  2 35 ? 11.743  17.406  110.890 1.00 21.79 ? 36   GLU L CA  1 
ATOM   8371 C  C   . GLU L  2 35 ? 12.270  17.144  112.295 1.00 21.67 ? 36   GLU L C   1 
ATOM   8372 O  O   . GLU L  2 35 ? 12.781  18.041  112.946 1.00 21.97 ? 36   GLU L O   1 
ATOM   8373 C  CB  . GLU L  2 35 ? 10.229  17.635  110.893 1.00 21.32 ? 36   GLU L CB  1 
ATOM   8374 C  CG  . GLU L  2 35 ? 9.835   18.372  109.627 1.00 22.40 ? 36   GLU L CG  1 
ATOM   8375 C  CD  . GLU L  2 35 ? 8.405   18.155  109.222 1.00 21.28 ? 36   GLU L CD  1 
ATOM   8376 O  OE1 . GLU L  2 35 ? 7.643   17.515  109.965 1.00 18.58 ? 36   GLU L OE1 1 
ATOM   8377 O  OE2 . GLU L  2 35 ? 8.040   18.615  108.147 1.00 21.25 ? 36   GLU L OE2 1 
ATOM   8378 N  N   . PHE L  2 36 ? 12.209  15.885  112.724 1.00 21.60 ? 37   PHE L N   1 
ATOM   8379 C  CA  . PHE L  2 36 ? 12.769  15.489  114.005 1.00 20.59 ? 37   PHE L CA  1 
ATOM   8380 C  C   . PHE L  2 36 ? 14.283  15.665  113.946 1.00 22.04 ? 37   PHE L C   1 
ATOM   8381 O  O   . PHE L  2 36 ? 14.887  16.255  114.837 1.00 21.69 ? 37   PHE L O   1 
ATOM   8382 C  CB  . PHE L  2 36 ? 12.424  14.027  114.255 1.00 22.02 ? 37   PHE L CB  1 
ATOM   8383 C  CG  . PHE L  2 36 ? 12.935  13.519  115.559 1.00 20.17 ? 37   PHE L CG  1 
ATOM   8384 C  CD1 . PHE L  2 36 ? 12.407  14.013  116.739 1.00 18.66 ? 37   PHE L CD1 1 
ATOM   8385 C  CD2 . PHE L  2 36 ? 13.974  12.601  115.599 1.00 20.68 ? 37   PHE L CD2 1 
ATOM   8386 C  CE1 . PHE L  2 36 ? 12.864  13.538  118.006 1.00 22.73 ? 37   PHE L CE1 1 
ATOM   8387 C  CE2 . PHE L  2 36 ? 14.448  12.112  116.834 1.00 24.07 ? 37   PHE L CE2 1 
ATOM   8388 C  CZ  . PHE L  2 36 ? 13.895  12.592  118.046 1.00 21.93 ? 37   PHE L CZ  1 
ATOM   8389 N  N   . LYS L  2 37 ? 14.905  15.195  112.865 1.00 21.44 ? 38   LYS L N   1 
ATOM   8390 C  CA  . LYS L  2 37 ? 16.342  15.388  112.725 1.00 22.98 ? 38   LYS L CA  1 
ATOM   8391 C  C   . LYS L  2 37 ? 16.775  16.849  112.829 1.00 23.65 ? 38   LYS L C   1 
ATOM   8392 O  O   . LYS L  2 37 ? 17.779  17.139  113.474 1.00 23.52 ? 38   LYS L O   1 
ATOM   8393 C  CB  . LYS L  2 37 ? 16.853  14.788  111.404 1.00 24.08 ? 38   LYS L CB  1 
ATOM   8394 C  CG  . LYS L  2 37 ? 16.787  13.278  111.417 1.00 27.10 ? 38   LYS L CG  1 
ATOM   8395 C  CD  . LYS L  2 37 ? 17.312  12.696  110.104 1.00 30.00 ? 38   LYS L CD  1 
ATOM   8396 C  CE  . LYS L  2 37 ? 17.530  11.205  110.267 1.00 32.24 ? 38   LYS L CE  1 
ATOM   8397 N  NZ  . LYS L  2 37 ? 17.869  10.591  108.928 1.00 34.12 ? 38   LYS L NZ  1 
ATOM   8398 N  N   . GLU L  2 38 ? 16.018  17.752  112.206 1.00 23.49 ? 39   GLU L N   1 
ATOM   8399 C  CA  . GLU L  2 38 ? 16.345  19.173  112.192 1.00 24.94 ? 39   GLU L CA  1 
ATOM   8400 C  C   . GLU L  2 38 ? 16.209  19.762  113.588 1.00 24.06 ? 39   GLU L C   1 
ATOM   8401 O  O   . GLU L  2 38 ? 17.091  20.457  114.076 1.00 22.10 ? 39   GLU L O   1 
ATOM   8402 C  CB  . GLU L  2 38 ? 15.427  19.912  111.218 1.00 30.72 ? 39   GLU L CB  1 
ATOM   8403 C  CG  . GLU L  2 38 ? 16.175  20.923  110.365 1.00 36.69 ? 39   GLU L CG  1 
ATOM   8404 C  CD  . GLU L  2 38 ? 15.331  21.466  109.244 1.00 40.02 ? 39   GLU L CD  1 
ATOM   8405 O  OE1 . GLU L  2 38 ? 15.856  21.568  108.126 1.00 41.46 ? 39   GLU L OE1 1 
ATOM   8406 O  OE2 . GLU L  2 38 ? 14.140  21.778  109.500 1.00 41.62 ? 39   GLU L OE2 1 
ATOM   8407 N  N   . LEU L  2 39 ? 15.105  19.426  114.256 1.00 22.04 ? 40   LEU L N   1 
ATOM   8408 C  CA  . LEU L  2 39 ? 14.907  19.867  115.615 1.00 23.71 ? 40   LEU L CA  1 
ATOM   8409 C  C   . LEU L  2 39 ? 16.044  19.419  116.545 1.00 22.70 ? 40   LEU L C   1 
ATOM   8410 O  O   . LEU L  2 39 ? 16.556  20.216  117.303 1.00 21.19 ? 40   LEU L O   1 
ATOM   8411 C  CB  . LEU L  2 39 ? 13.559  19.362  116.115 1.00 21.36 ? 40   LEU L CB  1 
ATOM   8412 C  CG  . LEU L  2 39 ? 13.039  19.864  117.468 1.00 21.59 ? 40   LEU L CG  1 
ATOM   8413 C  CD1 . LEU L  2 39 ? 11.527  19.823  117.488 1.00 23.93 ? 40   LEU L CD1 1 
ATOM   8414 C  CD2 . LEU L  2 39 ? 13.624  19.052  118.630 1.00 20.25 ? 40   LEU L CD2 1 
ATOM   8415 N  N   . VAL L  2 40 ? 16.458  18.156  116.472 1.00 20.32 ? 41   VAL L N   1 
ATOM   8416 C  CA  . VAL L  2 40 ? 17.447  17.639  117.410 1.00 22.13 ? 41   VAL L CA  1 
ATOM   8417 C  C   . VAL L  2 40 ? 18.792  18.267  117.115 1.00 24.05 ? 41   VAL L C   1 
ATOM   8418 O  O   . VAL L  2 40 ? 19.581  18.605  117.994 1.00 23.47 ? 41   VAL L O   1 
ATOM   8419 C  CB  . VAL L  2 40 ? 17.533  16.113  117.255 1.00 23.30 ? 41   VAL L CB  1 
ATOM   8420 C  CG1 . VAL L  2 40 ? 18.722  15.578  118.023 1.00 25.14 ? 41   VAL L CG1 1 
ATOM   8421 C  CG2 . VAL L  2 40 ? 16.213  15.477  117.743 1.00 20.82 ? 41   VAL L CG2 1 
ATOM   8422 N  N   . ARG L  2 41 ? 19.041  18.433  115.832 1.00 24.55 ? 42   ARG L N   1 
ATOM   8423 C  CA  . ARG L  2 41 ? 20.327  18.934  115.413 1.00 27.08 ? 42   ARG L CA  1 
ATOM   8424 C  C   . ARG L  2 41 ? 20.531  20.375  115.883 1.00 27.08 ? 42   ARG L C   1 
ATOM   8425 O  O   . ARG L  2 41 ? 21.658  20.752  116.231 1.00 27.06 ? 42   ARG L O   1 
ATOM   8426 C  CB  . ARG L  2 41 ? 20.434  18.830  113.897 1.00 29.62 ? 42   ARG L CB  1 
ATOM   8427 C  CG  . ARG L  2 41 ? 21.709  19.428  113.355 1.00 33.14 ? 42   ARG L CG  1 
ATOM   8428 C  CD  . ARG L  2 41 ? 22.011  19.067  111.895 1.00 35.49 ? 42   ARG L CD  1 
ATOM   8429 N  NE  . ARG L  2 41 ? 21.190  19.863  110.986 1.00 43.96 ? 42   ARG L NE  1 
ATOM   8430 C  CZ  . ARG L  2 41 ? 20.101  19.427  110.350 1.00 46.73 ? 42   ARG L CZ  1 
ATOM   8431 N  NH1 . ARG L  2 41 ? 19.429  20.260  109.552 1.00 47.37 ? 42   ARG L NH1 1 
ATOM   8432 N  NH2 . ARG L  2 41 ? 19.688  18.168  110.500 1.00 46.96 ? 42   ARG L NH2 1 
ATOM   8433 N  N   . LYS L  2 42 ? 19.455  21.168  115.880 1.00 23.86 ? 43   LYS L N   1 
ATOM   8434 C  CA  . LYS L  2 42 ? 19.567  22.594  116.164 1.00 26.00 ? 43   LYS L CA  1 
ATOM   8435 C  C   . LYS L  2 42 ? 19.172  22.852  117.611 1.00 24.86 ? 43   LYS L C   1 
ATOM   8436 O  O   . LYS L  2 42 ? 19.942  23.397  118.386 1.00 26.43 ? 43   LYS L O   1 
ATOM   8437 C  CB  . LYS L  2 42 ? 18.678  23.430  115.227 1.00 28.27 ? 43   LYS L CB  1 
ATOM   8438 C  CG  . LYS L  2 42 ? 19.028  23.330  113.745 1.00 33.42 ? 43   LYS L CG  1 
ATOM   8439 C  CD  . LYS L  2 42 ? 18.683  24.657  113.059 1.00 37.82 ? 43   LYS L CD  1 
ATOM   8440 C  CE  . LYS L  2 42 ? 18.033  24.374  111.726 1.00 40.89 ? 43   LYS L CE  1 
ATOM   8441 N  NZ  . LYS L  2 42 ? 17.890  25.614  110.943 1.00 42.50 ? 43   LYS L NZ  1 
ATOM   8442 N  N   . ASP L  2 43 ? 17.975  22.431  117.990 1.00 21.83 ? 44   ASP L N   1 
ATOM   8443 C  CA  . ASP L  2 43 ? 17.465  22.808  119.297 1.00 23.34 ? 44   ASP L CA  1 
ATOM   8444 C  C   . ASP L  2 43 ? 17.919  21.924  120.448 1.00 22.13 ? 44   ASP L C   1 
ATOM   8445 O  O   . ASP L  2 43 ? 17.747  22.298  121.604 1.00 21.52 ? 44   ASP L O   1 
ATOM   8446 C  CB  . ASP L  2 43 ? 15.954  22.923  119.232 1.00 23.84 ? 44   ASP L CB  1 
ATOM   8447 C  CG  . ASP L  2 43 ? 15.548  23.894  118.162 1.00 24.82 ? 44   ASP L CG  1 
ATOM   8448 O  OD1 . ASP L  2 43 ? 15.893  25.081  118.323 1.00 23.77 ? 44   ASP L OD1 1 
ATOM   8449 O  OD2 . ASP L  2 43 ? 15.011  23.566  117.099 1.00 25.83 ? 44   ASP L OD2 1 
ATOM   8450 N  N   . LEU L  2 44 ? 18.537  20.789  120.133 1.00 20.68 ? 45   LEU L N   1 
ATOM   8451 C  CA  . LEU L  2 44 ? 19.091  19.902  121.170 1.00 21.90 ? 45   LEU L CA  1 
ATOM   8452 C  C   . LEU L  2 44 ? 20.569  19.666  120.861 1.00 22.02 ? 45   LEU L C   1 
ATOM   8453 O  O   . LEU L  2 44 ? 21.123  18.616  121.178 1.00 22.50 ? 45   LEU L O   1 
ATOM   8454 C  CB  . LEU L  2 44 ? 18.307  18.582  121.233 1.00 20.38 ? 45   LEU L CB  1 
ATOM   8455 C  CG  . LEU L  2 44 ? 16.864  18.825  121.706 1.00 21.23 ? 45   LEU L CG  1 
ATOM   8456 C  CD1 . LEU L  2 44 ? 16.052  17.553  121.511 1.00 19.99 ? 45   LEU L CD1 1 
ATOM   8457 C  CD2 . LEU L  2 44 ? 16.878  19.318  123.148 1.00 21.60 ? 45   LEU L CD2 1 
ATOM   8458 N  N   . GLN L  2 45 ? 21.204  20.675  120.264 1.00 22.89 ? 46   GLN L N   1 
ATOM   8459 C  CA  . GLN L  2 45 ? 22.609  20.554  119.880 1.00 25.19 ? 46   GLN L CA  1 
ATOM   8460 C  C   . GLN L  2 45 ? 23.546  20.304  121.043 1.00 25.89 ? 46   GLN L C   1 
ATOM   8461 O  O   . GLN L  2 45 ? 24.621  19.735  120.851 1.00 27.33 ? 46   GLN L O   1 
ATOM   8462 C  CB  . GLN L  2 45 ? 23.099  21.772  119.094 1.00 25.29 ? 46   GLN L CB  1 
ATOM   8463 C  CG  . GLN L  2 45 ? 22.896  23.089  119.811 1.00 29.03 ? 46   GLN L CG  1 
ATOM   8464 C  CD  . GLN L  2 45 ? 23.232  24.289  118.941 1.00 28.96 ? 46   GLN L CD  1 
ATOM   8465 O  OE1 . GLN L  2 45 ? 24.409  24.622  118.781 1.00 30.89 ? 46   GLN L OE1 1 
ATOM   8466 N  NE2 . GLN L  2 45 ? 22.219  24.943  118.382 1.00 30.28 ? 46   GLN L NE2 1 
ATOM   8467 N  N   . ASN L  2 46 ? 23.167  20.718  122.247 1.00 26.28 ? 47   ASN L N   1 
ATOM   8468 C  CA  . ASN L  2 46 ? 23.994  20.420  123.421 1.00 27.43 ? 47   ASN L CA  1 
ATOM   8469 C  C   . ASN L  2 46 ? 23.582  19.131  124.157 1.00 27.99 ? 47   ASN L C   1 
ATOM   8470 O  O   . ASN L  2 46 ? 24.438  18.273  124.434 1.00 28.32 ? 47   ASN L O   1 
ATOM   8471 C  CB  . ASN L  2 46 ? 24.062  21.629  124.366 1.00 28.31 ? 47   ASN L CB  1 
ATOM   8472 C  CG  . ASN L  2 46 ? 24.487  22.912  123.649 1.00 30.72 ? 47   ASN L CG  1 
ATOM   8473 O  OD1 . ASN L  2 46 ? 25.675  23.133  123.407 1.00 29.48 ? 47   ASN L OD1 1 
ATOM   8474 N  ND2 . ASN L  2 46 ? 23.516  23.757  123.296 1.00 31.35 ? 47   ASN L ND2 1 
ATOM   8475 N  N   . PHE L  2 47 ? 22.284  18.965  124.425 1.00 25.58 ? 48   PHE L N   1 
ATOM   8476 C  CA  . PHE L  2 47 ? 21.801  17.815  125.193 1.00 27.06 ? 48   PHE L CA  1 
ATOM   8477 C  C   . PHE L  2 47 ? 22.002  16.475  124.465 1.00 27.07 ? 48   PHE L C   1 
ATOM   8478 O  O   . PHE L  2 47 ? 22.154  15.427  125.121 1.00 24.92 ? 48   PHE L O   1 
ATOM   8479 C  CB  . PHE L  2 47 ? 20.311  17.970  125.494 1.00 26.62 ? 48   PHE L CB  1 
ATOM   8480 C  CG  . PHE L  2 47 ? 20.002  18.901  126.633 1.00 24.93 ? 48   PHE L CG  1 
ATOM   8481 C  CD1 . PHE L  2 47 ? 18.733  18.923  127.191 1.00 25.15 ? 48   PHE L CD1 1 
ATOM   8482 C  CD2 . PHE L  2 47 ? 20.975  19.759  127.138 1.00 25.57 ? 48   PHE L CD2 1 
ATOM   8483 C  CE1 . PHE L  2 47 ? 18.435  19.791  128.258 1.00 24.45 ? 48   PHE L CE1 1 
ATOM   8484 C  CE2 . PHE L  2 47 ? 20.691  20.615  128.208 1.00 25.63 ? 48   PHE L CE2 1 
ATOM   8485 C  CZ  . PHE L  2 47 ? 19.416  20.638  128.753 1.00 26.03 ? 48   PHE L CZ  1 
ATOM   8486 N  N   . LEU L  2 48 ? 21.949  16.509  123.131 1.00 25.85 ? 49   LEU L N   1 
ATOM   8487 C  CA  . LEU L  2 48 ? 22.158  15.329  122.291 1.00 26.24 ? 49   LEU L CA  1 
ATOM   8488 C  C   . LEU L  2 48 ? 23.393  15.487  121.405 1.00 26.96 ? 49   LEU L C   1 
ATOM   8489 O  O   . LEU L  2 48 ? 23.425  15.033  120.273 1.00 29.08 ? 49   LEU L O   1 
ATOM   8490 C  CB  . LEU L  2 48 ? 20.933  15.005  121.445 1.00 24.90 ? 49   LEU L CB  1 
ATOM   8491 C  CG  . LEU L  2 48 ? 19.737  14.512  122.252 1.00 27.14 ? 49   LEU L CG  1 
ATOM   8492 C  CD1 . LEU L  2 48 ? 18.544  14.208  121.364 1.00 26.09 ? 49   LEU L CD1 1 
ATOM   8493 C  CD2 . LEU L  2 48 ? 20.133  13.296  123.072 1.00 28.77 ? 49   LEU L CD2 1 
ATOM   8494 N  N   . LYS L  2 49 ? 24.405  16.139  121.952 1.00 28.47 ? 50   LYS L N   1 
ATOM   8495 C  CA  . LYS L  2 49 ? 25.653  16.398  121.243 1.00 32.32 ? 50   LYS L CA  1 
ATOM   8496 C  C   . LYS L  2 49 ? 26.299  15.111  120.703 1.00 32.15 ? 50   LYS L C   1 
ATOM   8497 O  O   . LYS L  2 49 ? 26.627  15.018  119.516 1.00 32.98 ? 50   LYS L O   1 
ATOM   8498 C  CB  . LYS L  2 49 ? 26.613  17.146  122.176 1.00 34.38 ? 50   LYS L CB  1 
ATOM   8499 C  CG  . LYS L  2 49 ? 27.959  17.474  121.580 1.00 38.41 ? 50   LYS L CG  1 
ATOM   8500 C  CD  . LYS L  2 49 ? 28.829  18.147  122.626 1.00 41.87 ? 50   LYS L CD  1 
ATOM   8501 C  CE  . LYS L  2 49 ? 30.232  18.414  122.117 1.00 44.90 ? 50   LYS L CE  1 
ATOM   8502 N  NZ  . LYS L  2 49 ? 30.579  17.636  120.887 1.00 46.80 ? 50   LYS L NZ  1 
ATOM   8503 N  N   . LYS L  2 50 ? 26.490  14.122  121.566 1.00 33.12 ? 51   LYS L N   1 
ATOM   8504 C  CA  . LYS L  2 50 ? 27.075  12.851  121.149 1.00 35.36 ? 51   LYS L CA  1 
ATOM   8505 C  C   . LYS L  2 50 ? 26.225  12.151  120.082 1.00 33.09 ? 51   LYS L C   1 
ATOM   8506 O  O   . LYS L  2 50 ? 26.725  11.690  119.053 1.00 32.48 ? 51   LYS L O   1 
ATOM   8507 C  CB  . LYS L  2 50 ? 27.259  11.938  122.367 1.00 37.90 ? 51   LYS L CB  1 
ATOM   8508 C  CG  . LYS L  2 50 ? 27.851  10.578  122.003 1.00 41.73 ? 51   LYS L CG  1 
ATOM   8509 C  CD  . LYS L  2 50 ? 28.031  9.645   123.188 1.00 42.93 ? 51   LYS L CD  1 
ATOM   8510 C  CE  . LYS L  2 50 ? 28.666  8.330   122.724 1.00 46.22 ? 51   LYS L CE  1 
ATOM   8511 N  NZ  . LYS L  2 50 ? 29.072  7.455   123.865 1.00 47.83 ? 51   LYS L NZ  1 
ATOM   8512 N  N   . GLU L  2 51 ? 24.922  12.108  120.312 1.00 31.33 ? 52   GLU L N   1 
ATOM   8513 C  CA  . GLU L  2 51 ? 24.004  11.375  119.446 1.00 29.98 ? 52   GLU L CA  1 
ATOM   8514 C  C   . GLU L  2 51 ? 23.867  12.002  118.067 1.00 29.77 ? 52   GLU L C   1 
ATOM   8515 O  O   . GLU L  2 51 ? 23.734  11.282  117.078 1.00 29.87 ? 52   GLU L O   1 
ATOM   8516 C  CB  . GLU L  2 51 ? 22.625  11.267  120.104 1.00 30.42 ? 52   GLU L CB  1 
ATOM   8517 C  CG  . GLU L  2 51 ? 22.548  10.388  121.361 1.00 31.13 ? 52   GLU L CG  1 
ATOM   8518 C  CD  . GLU L  2 51 ? 22.953  11.077  122.670 1.00 33.23 ? 52   GLU L CD  1 
ATOM   8519 O  OE1 . GLU L  2 51 ? 23.267  12.286  122.713 1.00 32.69 ? 52   GLU L OE1 1 
ATOM   8520 O  OE2 . GLU L  2 51 ? 22.951  10.394  123.713 1.00 34.50 ? 52   GLU L OE2 1 
ATOM   8521 N  N   . ASN L  2 52 ? 23.880  13.332  118.014 1.00 29.85 ? 53   ASN L N   1 
ATOM   8522 C  CA  . ASN L  2 52 ? 23.895  14.084  116.747 1.00 30.30 ? 53   ASN L CA  1 
ATOM   8523 C  C   . ASN L  2 52 ? 25.057  13.745  115.798 1.00 31.05 ? 53   ASN L C   1 
ATOM   8524 O  O   . ASN L  2 52 ? 24.991  14.008  114.597 1.00 29.77 ? 53   ASN L O   1 
ATOM   8525 C  CB  . ASN L  2 52 ? 23.841  15.596  117.010 1.00 30.05 ? 53   ASN L CB  1 
ATOM   8526 C  CG  . ASN L  2 52 ? 22.404  16.123  117.111 1.00 30.76 ? 53   ASN L CG  1 
ATOM   8527 O  OD1 . ASN L  2 52 ? 21.569  15.845  116.247 1.00 32.70 ? 53   ASN L OD1 1 
ATOM   8528 N  ND2 . ASN L  2 52 ? 22.130  16.915  118.134 1.00 28.52 ? 53   ASN L ND2 1 
ATOM   8529 N  N   . LYS L  2 53 ? 26.119  13.166  116.338 1.00 33.09 ? 54   LYS L N   1 
ATOM   8530 C  CA  . LYS L  2 53 ? 27.240  12.773  115.502 1.00 36.02 ? 54   LYS L CA  1 
ATOM   8531 C  C   . LYS L  2 53 ? 26.942  11.552  114.634 1.00 36.35 ? 54   LYS L C   1 
ATOM   8532 O  O   . LYS L  2 53 ? 27.702  11.238  113.716 1.00 36.78 ? 54   LYS L O   1 
ATOM   8533 C  CB  . LYS L  2 53 ? 28.487  12.538  116.353 1.00 37.52 ? 54   LYS L CB  1 
ATOM   8534 C  CG  . LYS L  2 53 ? 29.007  13.819  116.962 1.00 40.19 ? 54   LYS L CG  1 
ATOM   8535 C  CD  . LYS L  2 53 ? 30.219  13.589  117.829 1.00 42.67 ? 54   LYS L CD  1 
ATOM   8536 C  CE  . LYS L  2 53 ? 30.774  14.929  118.314 1.00 44.57 ? 54   LYS L CE  1 
ATOM   8537 N  NZ  . LYS L  2 53 ? 31.922  14.739  119.250 1.00 46.42 ? 54   LYS L NZ  1 
ATOM   8538 N  N   . ASN L  2 54 ? 25.841  10.867  114.918 1.00 36.13 ? 55   ASN L N   1 
ATOM   8539 C  CA  . ASN L  2 54 ? 25.473  9.689   114.154 1.00 36.77 ? 55   ASN L CA  1 
ATOM   8540 C  C   . ASN L  2 54 ? 24.003  9.729   113.794 1.00 36.57 ? 55   ASN L C   1 
ATOM   8541 O  O   . ASN L  2 54 ? 23.141  9.514   114.646 1.00 34.63 ? 55   ASN L O   1 
ATOM   8542 C  CB  . ASN L  2 54 ? 25.789  8.417   114.947 1.00 38.04 ? 55   ASN L CB  1 
ATOM   8543 C  CG  . ASN L  2 54 ? 25.607  7.149   114.130 1.00 39.68 ? 55   ASN L CG  1 
ATOM   8544 O  OD1 . ASN L  2 54 ? 25.086  7.170   113.012 1.00 39.96 ? 55   ASN L OD1 1 
ATOM   8545 N  ND2 . ASN L  2 54 ? 26.053  6.032   114.686 1.00 40.36 ? 55   ASN L ND2 1 
ATOM   8546 N  N   . GLU L  2 55 ? 23.734  10.002  112.524 1.00 36.99 ? 56   GLU L N   1 
ATOM   8547 C  CA  . GLU L  2 55 ? 22.378  10.073  111.992 1.00 38.87 ? 56   GLU L CA  1 
ATOM   8548 C  C   . GLU L  2 55 ? 21.538  8.827   112.287 1.00 37.09 ? 56   GLU L C   1 
ATOM   8549 O  O   . GLU L  2 55 ? 20.330  8.925   112.542 1.00 35.43 ? 56   GLU L O   1 
ATOM   8550 C  CB  . GLU L  2 55 ? 22.427  10.324  110.482 1.00 43.31 ? 56   GLU L CB  1 
ATOM   8551 C  CG  . GLU L  2 55 ? 21.061  10.498  109.847 1.00 48.08 ? 56   GLU L CG  1 
ATOM   8552 C  CD  . GLU L  2 55 ? 21.118  11.132  108.467 1.00 51.68 ? 56   GLU L CD  1 
ATOM   8553 O  OE1 . GLU L  2 55 ? 22.162  11.022  107.778 1.00 53.27 ? 56   GLU L OE1 1 
ATOM   8554 O  OE2 . GLU L  2 55 ? 20.105  11.740  108.058 1.00 52.95 ? 56   GLU L OE2 1 
ATOM   8555 N  N   . LYS L  2 56 ? 22.167  7.659   112.255 1.00 35.25 ? 57   LYS L N   1 
ATOM   8556 C  CA  . LYS L  2 56 ? 21.440  6.432   112.563 1.00 35.26 ? 57   LYS L CA  1 
ATOM   8557 C  C   . LYS L  2 56 ? 20.998  6.347   114.024 1.00 31.72 ? 57   LYS L C   1 
ATOM   8558 O  O   . LYS L  2 56 ? 19.973  5.747   114.311 1.00 30.03 ? 57   LYS L O   1 
ATOM   8559 C  CB  . LYS L  2 56 ? 22.234  5.190   112.181 1.00 37.95 ? 57   LYS L CB  1 
ATOM   8560 C  CG  . LYS L  2 56 ? 22.406  5.047   110.667 1.00 40.03 ? 57   LYS L CG  1 
ATOM   8561 C  CD  . LYS L  2 56 ? 23.328  3.904   110.300 1.00 42.51 ? 57   LYS L CD  1 
ATOM   8562 C  CE  . LYS L  2 56 ? 23.728  3.991   108.817 1.00 44.31 ? 57   LYS L CE  1 
ATOM   8563 N  NZ  . LYS L  2 56 ? 24.569  2.834   108.349 1.00 45.67 ? 57   LYS L NZ  1 
ATOM   8564 N  N   . VAL L  2 57 ? 21.793  6.896   114.937 1.00 28.43 ? 58   VAL L N   1 
ATOM   8565 C  CA  . VAL L  2 57 ? 21.370  6.980   116.339 1.00 28.72 ? 58   VAL L CA  1 
ATOM   8566 C  C   . VAL L  2 57 ? 20.115  7.833   116.463 1.00 27.64 ? 58   VAL L C   1 
ATOM   8567 O  O   . VAL L  2 57 ? 19.200  7.500   117.225 1.00 26.84 ? 58   VAL L O   1 
ATOM   8568 C  CB  . VAL L  2 57 ? 22.473  7.596   117.225 1.00 30.32 ? 58   VAL L CB  1 
ATOM   8569 C  CG1 . VAL L  2 57 ? 21.983  7.786   118.680 1.00 28.94 ? 58   VAL L CG1 1 
ATOM   8570 C  CG2 . VAL L  2 57 ? 23.753  6.728   117.155 1.00 32.06 ? 58   VAL L CG2 1 
ATOM   8571 N  N   . ILE L  2 58 ? 20.071  8.950   115.738 1.00 25.85 ? 59   ILE L N   1 
ATOM   8572 C  CA  . ILE L  2 58 ? 18.928  9.871   115.856 1.00 24.87 ? 59   ILE L CA  1 
ATOM   8573 C  C   . ILE L  2 58 ? 17.662  9.201   115.304 1.00 24.86 ? 59   ILE L C   1 
ATOM   8574 O  O   . ILE L  2 58 ? 16.582  9.279   115.913 1.00 26.28 ? 59   ILE L O   1 
ATOM   8575 C  CB  . ILE L  2 58 ? 19.256  11.220  115.138 1.00 25.97 ? 59   ILE L CB  1 
ATOM   8576 C  CG1 . ILE L  2 58 ? 20.459  11.896  115.803 1.00 26.73 ? 59   ILE L CG1 1 
ATOM   8577 C  CG2 . ILE L  2 58 ? 18.067  12.136  115.115 1.00 26.20 ? 59   ILE L CG2 1 
ATOM   8578 C  CD1 . ILE L  2 58 ? 20.295  12.221  117.268 1.00 24.98 ? 59   ILE L CD1 1 
ATOM   8579 N  N   . GLU L  2 59 ? 17.802  8.502   114.172 1.00 26.82 ? 60   GLU L N   1 
ATOM   8580 C  CA  . GLU L  2 59 ? 16.694  7.732   113.600 1.00 26.46 ? 60   GLU L CA  1 
ATOM   8581 C  C   . GLU L  2 59 ? 16.169  6.684   114.577 1.00 25.11 ? 60   GLU L C   1 
ATOM   8582 O  O   . GLU L  2 59 ? 14.958  6.428   114.639 1.00 26.73 ? 60   GLU L O   1 
ATOM   8583 C  CB  . GLU L  2 59 ? 17.142  7.021   112.311 1.00 26.91 ? 60   GLU L CB  1 
ATOM   8584 C  CG  . GLU L  2 59 ? 17.349  7.962   111.134 1.00 29.08 ? 60   GLU L CG  1 
ATOM   8585 C  CD  . GLU L  2 59 ? 18.049  7.293   109.963 1.00 30.73 ? 60   GLU L CD  1 
ATOM   8586 O  OE1 . GLU L  2 59 ? 18.119  6.034   109.940 1.00 31.79 ? 60   GLU L OE1 1 
ATOM   8587 O  OE2 . GLU L  2 59 ? 18.543  8.036   109.077 1.00 33.02 ? 60   GLU L OE2 1 
ATOM   8588 N  N   . HIS L  2 60 ? 17.073  6.038   115.310 1.00 25.94 ? 61   HIS L N   1 
ATOM   8589 C  CA  . HIS L  2 60 ? 16.673  4.961   116.218 1.00 26.55 ? 61   HIS L CA  1 
ATOM   8590 C  C   . HIS L  2 60 ? 15.917  5.562   117.401 1.00 24.37 ? 61   HIS L C   1 
ATOM   8591 O  O   . HIS L  2 60 ? 14.952  4.985   117.894 1.00 27.90 ? 61   HIS L O   1 
ATOM   8592 C  CB  . HIS L  2 60 ? 17.860  4.154   116.712 1.00 31.96 ? 61   HIS L CB  1 
ATOM   8593 C  CG  . HIS L  2 60 ? 17.467  2.908   117.449 1.00 38.04 ? 61   HIS L CG  1 
ATOM   8594 N  ND1 . HIS L  2 60 ? 16.923  1.809   116.817 1.00 40.69 ? 61   HIS L ND1 1 
ATOM   8595 C  CD2 . HIS L  2 60 ? 17.527  2.593   118.765 1.00 40.15 ? 61   HIS L CD2 1 
ATOM   8596 C  CE1 . HIS L  2 60 ? 16.671  0.869   117.711 1.00 41.03 ? 61   HIS L CE1 1 
ATOM   8597 N  NE2 . HIS L  2 60 ? 17.028  1.319   118.901 1.00 42.24 ? 61   HIS L NE2 1 
ATOM   8598 N  N   . ILE L  2 61 ? 16.359  6.726   117.859 1.00 24.33 ? 62   ILE L N   1 
ATOM   8599 C  CA  . ILE L  2 61 ? 15.617  7.445   118.919 1.00 23.94 ? 62   ILE L CA  1 
ATOM   8600 C  C   . ILE L  2 61 ? 14.197  7.753   118.441 1.00 22.67 ? 62   ILE L C   1 
ATOM   8601 O  O   . ILE L  2 61 ? 13.221  7.548   119.178 1.00 21.63 ? 62   ILE L O   1 
ATOM   8602 C  CB  . ILE L  2 61 ? 16.365  8.745   119.300 1.00 23.14 ? 62   ILE L CB  1 
ATOM   8603 C  CG1 . ILE L  2 61 ? 17.683  8.393   119.989 1.00 27.44 ? 62   ILE L CG1 1 
ATOM   8604 C  CG2 . ILE L  2 61 ? 15.477  9.700   120.108 1.00 24.43 ? 62   ILE L CG2 1 
ATOM   8605 C  CD1 . ILE L  2 61 ? 18.674  9.521   120.142 1.00 26.95 ? 62   ILE L CD1 1 
ATOM   8606 N  N   . MET L  2 62 ? 14.073  8.300   117.224 1.00 23.51 ? 63   MET L N   1 
ATOM   8607 C  CA  . MET L  2 62 ? 12.747  8.520   116.700 1.00 25.65 ? 63   MET L CA  1 
ATOM   8608 C  C   . MET L  2 62 ? 11.888  7.271   116.605 1.00 24.60 ? 63   MET L C   1 
ATOM   8609 O  O   . MET L  2 62 ? 10.712  7.298   116.977 1.00 23.67 ? 63   MET L O   1 
ATOM   8610 C  CB  . MET L  2 62 ? 12.784  9.161   115.330 1.00 25.63 ? 63   MET L CB  1 
ATOM   8611 C  CG  . MET L  2 62 ? 11.363  9.565   114.982 1.00 28.98 ? 63   MET L CG  1 
ATOM   8612 S  SD  . MET L  2 62 ? 11.316  10.334  113.376 1.00 31.59 ? 63   MET L SD  1 
ATOM   8613 C  CE  . MET L  2 62 ? 9.543   10.552  113.199 1.00 30.43 ? 63   MET L CE  1 
ATOM   8614 N  N   . GLU L  2 63 ? 12.474  6.193   116.095 1.00 23.21 ? 64   GLU L N   1 
ATOM   8615 C  CA  . GLU L  2 63 ? 11.783  4.912   115.961 1.00 25.85 ? 64   GLU L CA  1 
ATOM   8616 C  C   . GLU L  2 63 ? 11.261  4.423   117.305 1.00 23.90 ? 64   GLU L C   1 
ATOM   8617 O  O   . GLU L  2 63 ? 10.123  3.953   117.415 1.00 23.36 ? 64   GLU L O   1 
ATOM   8618 C  CB  . GLU L  2 63 ? 12.707  3.855   115.349 1.00 28.80 ? 64   GLU L CB  1 
ATOM   8619 C  CG  . GLU L  2 63 ? 13.007  4.094   113.877 1.00 35.29 ? 64   GLU L CG  1 
ATOM   8620 C  CD  . GLU L  2 63 ? 14.241  3.349   113.401 1.00 39.02 ? 64   GLU L CD  1 
ATOM   8621 O  OE1 . GLU L  2 63 ? 14.830  3.773   112.377 1.00 42.26 ? 64   GLU L OE1 1 
ATOM   8622 O  OE2 . GLU L  2 63 ? 14.617  2.343   114.040 1.00 41.79 ? 64   GLU L OE2 1 
ATOM   8623 N  N   . ASP L  2 64 ? 12.090  4.544   118.332 1.00 23.00 ? 65   ASP L N   1 
ATOM   8624 C  CA  . ASP L  2 64 ? 11.648  4.166   119.680 1.00 24.02 ? 65   ASP L CA  1 
ATOM   8625 C  C   . ASP L  2 64 ? 10.494  5.019   120.233 1.00 22.25 ? 65   ASP L C   1 
ATOM   8626 O  O   . ASP L  2 64 ? 9.625   4.465   120.910 1.00 20.89 ? 65   ASP L O   1 
ATOM   8627 C  CB  . ASP L  2 64 ? 12.812  4.121   120.665 1.00 26.33 ? 65   ASP L CB  1 
ATOM   8628 C  CG  . ASP L  2 64 ? 13.888  3.123   120.234 1.00 32.31 ? 65   ASP L CG  1 
ATOM   8629 O  OD1 . ASP L  2 64 ? 14.978  3.143   120.845 1.00 37.72 ? 65   ASP L OD1 1 
ATOM   8630 O  OD2 . ASP L  2 64 ? 13.762  2.297   119.293 1.00 34.33 ? 65   ASP L OD2 1 
ATOM   8631 N  N   . LEU L  2 65 ? 10.476  6.317   119.919 1.00 19.96 ? 66   LEU L N   1 
ATOM   8632 C  CA  . LEU L  2 65 ? 9.415   7.224   120.398 1.00 22.38 ? 66   LEU L CA  1 
ATOM   8633 C  C   . LEU L  2 65 ? 8.165   7.001   119.561 1.00 22.86 ? 66   LEU L C   1 
ATOM   8634 O  O   . LEU L  2 65 ? 7.074   7.314   120.004 1.00 19.88 ? 66   LEU L O   1 
ATOM   8635 C  CB  . LEU L  2 65 ? 9.845   8.688   120.250 1.00 23.08 ? 66   LEU L CB  1 
ATOM   8636 C  CG  . LEU L  2 65 ? 10.980  9.167   121.176 1.00 22.66 ? 66   LEU L CG  1 
ATOM   8637 C  CD1 . LEU L  2 65 ? 11.491  10.514  120.673 1.00 23.34 ? 66   LEU L CD1 1 
ATOM   8638 C  CD2 . LEU L  2 65 ? 10.493  9.273   122.597 1.00 22.40 ? 66   LEU L CD2 1 
ATOM   8639 N  N   . ASP L  2 66 ? 8.317   6.468   118.345 1.00 20.31 ? 67   ASP L N   1 
ATOM   8640 C  CA  . ASP L  2 66 ? 7.167   6.336   117.457 1.00 21.18 ? 67   ASP L CA  1 
ATOM   8641 C  C   . ASP L  2 66 ? 6.328   5.096   117.833 1.00 21.05 ? 67   ASP L C   1 
ATOM   8642 O  O   . ASP L  2 66 ? 6.359   4.065   117.129 1.00 21.08 ? 67   ASP L O   1 
ATOM   8643 C  CB  . ASP L  2 66 ? 7.694   6.233   116.025 1.00 20.19 ? 67   ASP L CB  1 
ATOM   8644 C  CG  . ASP L  2 66 ? 6.606   6.186   114.973 1.00 20.37 ? 67   ASP L CG  1 
ATOM   8645 O  OD1 . ASP L  2 66 ? 5.426   6.468   115.235 1.00 23.30 ? 67   ASP L OD1 1 
ATOM   8646 O  OD2 . ASP L  2 66 ? 6.862   5.870   113.793 1.00 25.13 ? 67   ASP L OD2 1 
ATOM   8647 N  N   . THR L  2 67 ? 5.557   5.218   118.904 1.00 22.29 ? 68   THR L N   1 
ATOM   8648 C  CA  . THR L  2 67 ? 4.870   4.063   119.467 1.00 22.85 ? 68   THR L CA  1 
ATOM   8649 C  C   . THR L  2 67 ? 3.793   3.500   118.526 1.00 22.10 ? 68   THR L C   1 
ATOM   8650 O  O   . THR L  2 67 ? 3.491   2.321   118.587 1.00 24.67 ? 68   THR L O   1 
ATOM   8651 C  CB  . THR L  2 67 ? 4.335   4.346   120.897 1.00 26.45 ? 68   THR L CB  1 
ATOM   8652 O  OG1 . THR L  2 67 ? 3.715   5.621   120.894 1.00 28.03 ? 68   THR L OG1 1 
ATOM   8653 C  CG2 . THR L  2 67 ? 5.513   4.599   121.856 1.00 27.65 ? 68   THR L CG2 1 
ATOM   8654 N  N   . ASN L  2 68 ? 3.219   4.311   117.638 1.00 22.13 ? 69   ASN L N   1 
ATOM   8655 C  CA  . ASN L  2 68 ? 2.224   3.756   116.730 1.00 22.45 ? 69   ASN L CA  1 
ATOM   8656 C  C   . ASN L  2 68 ? 2.811   3.369   115.387 1.00 22.92 ? 69   ASN L C   1 
ATOM   8657 O  O   . ASN L  2 68 ? 2.095   3.042   114.453 1.00 24.53 ? 69   ASN L O   1 
ATOM   8658 C  CB  . ASN L  2 68 ? 0.991   4.641   116.571 1.00 24.07 ? 69   ASN L CB  1 
ATOM   8659 C  CG  . ASN L  2 68 ? 1.274   5.862   115.763 1.00 23.52 ? 69   ASN L CG  1 
ATOM   8660 O  OD1 . ASN L  2 68 ? 2.430   6.267   115.616 1.00 26.93 ? 69   ASN L OD1 1 
ATOM   8661 N  ND2 . ASN L  2 68 ? 0.227   6.460   115.212 1.00 25.23 ? 69   ASN L ND2 1 
ATOM   8662 N  N   . ALA L  2 69 ? 4.134   3.426   115.297 1.00 23.33 ? 70   ALA L N   1 
ATOM   8663 C  CA  . ALA L  2 69 ? 4.832   2.958   114.106 1.00 22.49 ? 70   ALA L CA  1 
ATOM   8664 C  C   . ALA L  2 69 ? 4.372   3.590   112.771 1.00 24.95 ? 70   ALA L C   1 
ATOM   8665 O  O   . ALA L  2 69 ? 4.352   2.909   111.749 1.00 26.57 ? 70   ALA L O   1 
ATOM   8666 C  CB  . ALA L  2 69 ? 4.774   1.417   114.058 1.00 23.95 ? 70   ALA L CB  1 
ATOM   8667 N  N   . ASP L  2 70 ? 4.022   4.880   112.767 1.00 22.91 ? 71   ASP L N   1 
ATOM   8668 C  CA  . ASP L  2 70 ? 3.565   5.560   111.547 1.00 23.40 ? 71   ASP L CA  1 
ATOM   8669 C  C   . ASP L  2 70 ? 4.582   6.493   110.908 1.00 23.72 ? 71   ASP L C   1 
ATOM   8670 O  O   . ASP L  2 70 ? 4.270   7.249   109.974 1.00 22.69 ? 71   ASP L O   1 
ATOM   8671 C  CB  . ASP L  2 70 ? 2.217   6.252   111.753 1.00 23.80 ? 71   ASP L CB  1 
ATOM   8672 C  CG  . ASP L  2 70 ? 2.301   7.428   112.694 1.00 25.49 ? 71   ASP L CG  1 
ATOM   8673 O  OD1 . ASP L  2 70 ? 3.408   7.724   113.213 1.00 22.27 ? 71   ASP L OD1 1 
ATOM   8674 O  OD2 . ASP L  2 70 ? 1.295   8.127   112.940 1.00 28.33 ? 71   ASP L OD2 1 
ATOM   8675 N  N   . LYS L  2 71 ? 5.821   6.406   111.382 1.00 22.73 ? 72   LYS L N   1 
ATOM   8676 C  CA  . LYS L  2 71 ? 6.918   7.186   110.829 1.00 25.02 ? 72   LYS L CA  1 
ATOM   8677 C  C   . LYS L  2 71 ? 6.770   8.692   111.064 1.00 25.37 ? 72   LYS L C   1 
ATOM   8678 O  O   . LYS L  2 71 ? 7.384   9.506   110.376 1.00 25.43 ? 72   LYS L O   1 
ATOM   8679 C  CB  . LYS L  2 71 ? 7.117   6.853   109.342 1.00 28.04 ? 72   LYS L CB  1 
ATOM   8680 C  CG  . LYS L  2 71 ? 7.272   5.354   109.120 1.00 30.51 ? 72   LYS L CG  1 
ATOM   8681 C  CD  . LYS L  2 71 ? 7.534   4.975   107.662 1.00 34.90 ? 72   LYS L CD  1 
ATOM   8682 C  CE  . LYS L  2 71 ? 7.987   3.512   107.616 1.00 38.87 ? 72   LYS L CE  1 
ATOM   8683 N  NZ  . LYS L  2 71 ? 7.970   2.924   106.230 1.00 42.21 ? 72   LYS L NZ  1 
ATOM   8684 N  N   . GLN L  2 72 ? 5.933   9.054   112.037 1.00 24.73 ? 73   GLN L N   1 
ATOM   8685 C  CA  . GLN L  2 72 ? 5.753   10.458  112.465 1.00 25.46 ? 73   GLN L CA  1 
ATOM   8686 C  C   . GLN L  2 72 ? 5.762   10.488  113.969 1.00 24.34 ? 73   GLN L C   1 
ATOM   8687 O  O   . GLN L  2 72 ? 5.338   9.516   114.595 1.00 24.80 ? 73   GLN L O   1 
ATOM   8688 C  CB  . GLN L  2 72 ? 4.368   10.967  112.061 1.00 24.86 ? 73   GLN L CB  1 
ATOM   8689 C  CG  . GLN L  2 72 ? 4.144   10.988  110.561 1.00 27.77 ? 73   GLN L CG  1 
ATOM   8690 C  CD  . GLN L  2 72 ? 2.674   11.061  110.238 1.00 31.30 ? 73   GLN L CD  1 
ATOM   8691 O  OE1 . GLN L  2 72 ? 2.011   12.058  110.545 1.00 33.10 ? 73   GLN L OE1 1 
ATOM   8692 N  NE2 . GLN L  2 72 ? 2.147   9.996   109.654 1.00 31.36 ? 73   GLN L NE2 1 
ATOM   8693 N  N   . LEU L  2 73 ? 6.213   11.589  114.566 1.00 22.37 ? 74   LEU L N   1 
ATOM   8694 C  CA  . LEU L  2 73 ? 6.055   11.746  116.006 1.00 22.70 ? 74   LEU L CA  1 
ATOM   8695 C  C   . LEU L  2 73 ? 4.931   12.745  116.268 1.00 22.13 ? 74   LEU L C   1 
ATOM   8696 O  O   . LEU L  2 73 ? 5.016   13.877  115.806 1.00 22.44 ? 74   LEU L O   1 
ATOM   8697 C  CB  . LEU L  2 73 ? 7.346   12.245  116.667 1.00 22.77 ? 74   LEU L CB  1 
ATOM   8698 C  CG  . LEU L  2 73 ? 8.544   11.307  116.787 1.00 26.18 ? 74   LEU L CG  1 
ATOM   8699 C  CD1 . LEU L  2 73 ? 9.575   11.926  117.740 1.00 26.45 ? 74   LEU L CD1 1 
ATOM   8700 C  CD2 . LEU L  2 73 ? 8.088   9.970   117.315 1.00 25.88 ? 74   LEU L CD2 1 
ATOM   8701 N  N   . SER L  2 74 ? 3.859   12.325  116.935 1.00 20.66 ? 75   SER L N   1 
ATOM   8702 C  CA  . SER L  2 74 ? 2.833   13.234  117.427 1.00 21.70 ? 75   SER L CA  1 
ATOM   8703 C  C   . SER L  2 74 ? 3.412   14.003  118.604 1.00 21.47 ? 75   SER L C   1 
ATOM   8704 O  O   . SER L  2 74 ? 4.499   13.674  119.104 1.00 22.75 ? 75   SER L O   1 
ATOM   8705 C  CB  . SER L  2 74 ? 1.622   12.451  117.924 1.00 21.96 ? 75   SER L CB  1 
ATOM   8706 O  OG  . SER L  2 74 ? 1.976   11.562  119.014 1.00 22.31 ? 75   SER L OG  1 
ATOM   8707 N  N   . PHE L  2 75 ? 2.695   15.023  119.061 1.00 20.00 ? 76   PHE L N   1 
ATOM   8708 C  CA  . PHE L  2 75 ? 3.180   15.730  120.224 1.00 17.83 ? 76   PHE L CA  1 
ATOM   8709 C  C   . PHE L  2 75 ? 3.189   14.821  121.455 1.00 19.57 ? 76   PHE L C   1 
ATOM   8710 O  O   . PHE L  2 75 ? 4.111   14.884  122.273 1.00 20.41 ? 76   PHE L O   1 
ATOM   8711 C  CB  . PHE L  2 75 ? 2.363   16.973  120.517 1.00 18.75 ? 76   PHE L CB  1 
ATOM   8712 C  CG  . PHE L  2 75 ? 2.953   17.784  121.628 1.00 19.13 ? 76   PHE L CG  1 
ATOM   8713 C  CD1 . PHE L  2 75 ? 4.015   18.642  121.395 1.00 18.78 ? 76   PHE L CD1 1 
ATOM   8714 C  CD2 . PHE L  2 75 ? 2.504   17.623  122.932 1.00 18.97 ? 76   PHE L CD2 1 
ATOM   8715 C  CE1 . PHE L  2 75 ? 4.581   19.382  122.451 1.00 15.98 ? 76   PHE L CE1 1 
ATOM   8716 C  CE2 . PHE L  2 75 ? 3.103   18.326  123.977 1.00 19.44 ? 76   PHE L CE2 1 
ATOM   8717 C  CZ  . PHE L  2 75 ? 4.110   19.209  123.747 1.00 19.48 ? 76   PHE L CZ  1 
ATOM   8718 N  N   . GLU L  2 76 ? 2.183   13.962  121.566 1.00 19.01 ? 77   GLU L N   1 
ATOM   8719 C  CA  . GLU L  2 76 ? 2.176   12.962  122.650 1.00 20.01 ? 77   GLU L CA  1 
ATOM   8720 C  C   . GLU L  2 76 ? 3.422   12.073  122.708 1.00 19.67 ? 77   GLU L C   1 
ATOM   8721 O  O   . GLU L  2 76 ? 3.961   11.838  123.800 1.00 20.01 ? 77   GLU L O   1 
ATOM   8722 C  CB  . GLU L  2 76 ? 0.903   12.117  122.596 1.00 21.58 ? 77   GLU L CB  1 
ATOM   8723 C  CG  . GLU L  2 76 ? -0.365  12.865  122.927 1.00 25.97 ? 77   GLU L CG  1 
ATOM   8724 C  CD  . GLU L  2 76 ? -0.926  13.709  121.776 1.00 27.11 ? 77   GLU L CD  1 
ATOM   8725 O  OE1 . GLU L  2 76 ? -0.343  13.779  120.652 1.00 27.24 ? 77   GLU L OE1 1 
ATOM   8726 O  OE2 . GLU L  2 76 ? -1.973  14.347  122.046 1.00 30.74 ? 77   GLU L OE2 1 
ATOM   8727 N  N   . GLU L  2 77 ? 3.905   11.613  121.553 1.00 19.45 ? 78   GLU L N   1 
ATOM   8728 C  CA  . GLU L  2 77 ? 5.098   10.758  121.476 1.00 20.37 ? 78   GLU L CA  1 
ATOM   8729 C  C   . GLU L  2 77 ? 6.360   11.556  121.775 1.00 21.41 ? 78   GLU L C   1 
ATOM   8730 O  O   . GLU L  2 77 ? 7.197   11.140  122.574 1.00 23.07 ? 78   GLU L O   1 
ATOM   8731 C  CB  . GLU L  2 77 ? 5.201   10.060  120.105 1.00 18.60 ? 78   GLU L CB  1 
ATOM   8732 C  CG  . GLU L  2 77 ? 4.070   9.082   119.804 1.00 21.68 ? 78   GLU L CG  1 
ATOM   8733 C  CD  . GLU L  2 77 ? 4.020   8.661   118.327 1.00 20.35 ? 78   GLU L CD  1 
ATOM   8734 O  OE1 . GLU L  2 77 ? 4.466   9.423   117.425 1.00 21.54 ? 78   GLU L OE1 1 
ATOM   8735 O  OE2 . GLU L  2 77 ? 3.494   7.564   118.040 1.00 19.83 ? 78   GLU L OE2 1 
ATOM   8736 N  N   . PHE L  2 78 ? 6.437   12.749  121.186 1.00 20.99 ? 79   PHE L N   1 
ATOM   8737 C  CA  . PHE L  2 78 ? 7.546   13.661  121.355 1.00 20.75 ? 79   PHE L CA  1 
ATOM   8738 C  C   . PHE L  2 78 ? 7.806   14.090  122.789 1.00 22.26 ? 79   PHE L C   1 
ATOM   8739 O  O   . PHE L  2 78 ? 8.943   14.220  123.229 1.00 22.92 ? 79   PHE L O   1 
ATOM   8740 C  CB  . PHE L  2 78 ? 7.256   14.930  120.537 1.00 19.97 ? 79   PHE L CB  1 
ATOM   8741 C  CG  . PHE L  2 78 ? 8.372   15.960  120.591 1.00 21.80 ? 79   PHE L CG  1 
ATOM   8742 C  CD1 . PHE L  2 78 ? 9.593   15.722  119.973 1.00 22.19 ? 79   PHE L CD1 1 
ATOM   8743 C  CD2 . PHE L  2 78 ? 8.188   17.156  121.251 1.00 22.47 ? 79   PHE L CD2 1 
ATOM   8744 C  CE1 . PHE L  2 78 ? 10.587  16.679  120.019 1.00 21.79 ? 79   PHE L CE1 1 
ATOM   8745 C  CE2 . PHE L  2 78 ? 9.174   18.104  121.312 1.00 22.88 ? 79   PHE L CE2 1 
ATOM   8746 C  CZ  . PHE L  2 78 ? 10.368  17.877  120.695 1.00 20.66 ? 79   PHE L CZ  1 
ATOM   8747 N  N   . ILE L  2 79 ? 6.744   14.336  123.529 1.00 18.39 ? 80   ILE L N   1 
ATOM   8748 C  CA  . ILE L  2 79 ? 6.945   14.908  124.846 1.00 21.00 ? 80   ILE L CA  1 
ATOM   8749 C  C   . ILE L  2 79 ? 7.649   13.917  125.781 1.00 21.62 ? 80   ILE L C   1 
ATOM   8750 O  O   . ILE L  2 79 ? 8.256   14.320  126.781 1.00 21.99 ? 80   ILE L O   1 
ATOM   8751 C  CB  . ILE L  2 79 ? 5.607   15.399  125.415 1.00 21.88 ? 80   ILE L CB  1 
ATOM   8752 C  CG1 . ILE L  2 79 ? 5.891   16.500  126.459 1.00 24.98 ? 80   ILE L CG1 1 
ATOM   8753 C  CG2 . ILE L  2 79 ? 4.686   14.217  125.847 1.00 23.52 ? 80   ILE L CG2 1 
ATOM   8754 C  CD1 . ILE L  2 79 ? 4.692   16.934  127.219 1.00 27.14 ? 80   ILE L CD1 1 
ATOM   8755 N  N   . MET L  2 80 ? 7.595   12.620  125.453 1.00 20.07 ? 81   MET L N   1 
ATOM   8756 C  CA  . MET L  2 80 ? 8.278   11.634  126.298 1.00 20.41 ? 81   MET L CA  1 
ATOM   8757 C  C   . MET L  2 80 ? 9.801   11.871  126.151 1.00 20.68 ? 81   MET L C   1 
ATOM   8758 O  O   . MET L  2 80 ? 10.565  11.646  127.100 1.00 22.01 ? 81   MET L O   1 
ATOM   8759 C  CB  . MET L  2 80 ? 7.910   10.195  125.896 1.00 22.58 ? 81   MET L CB  1 
ATOM   8760 C  CG  . MET L  2 80 ? 6.634   9.651   126.500 1.00 28.21 ? 81   MET L CG  1 
ATOM   8761 S  SD  . MET L  2 80 ? 6.726   9.246   128.278 1.00 33.33 ? 81   MET L SD  1 
ATOM   8762 C  CE  . MET L  2 80 ? 8.429   9.120   128.498 1.00 20.36 ? 81   MET L CE  1 
ATOM   8763 N  N   . LEU L  2 81 ? 10.240  12.357  125.004 1.00 21.13 ? 82   LEU L N   1 
ATOM   8764 C  CA  . LEU L  2 81 ? 11.674  12.671  124.844 1.00 20.42 ? 82   LEU L CA  1 
ATOM   8765 C  C   . LEU L  2 81 ? 12.037  13.888  125.713 1.00 22.60 ? 82   LEU L C   1 
ATOM   8766 O  O   . LEU L  2 81 ? 13.110  13.943  126.349 1.00 21.91 ? 82   LEU L O   1 
ATOM   8767 C  CB  . LEU L  2 81 ? 12.027  12.974  123.393 1.00 22.44 ? 82   LEU L CB  1 
ATOM   8768 C  CG  . LEU L  2 81 ? 13.455  13.482  123.163 1.00 20.85 ? 82   LEU L CG  1 
ATOM   8769 C  CD1 . LEU L  2 81 ? 14.512  12.430  123.579 1.00 25.47 ? 82   LEU L CD1 1 
ATOM   8770 C  CD2 . LEU L  2 81 ? 13.678  13.899  121.699 1.00 22.87 ? 82   LEU L CD2 1 
ATOM   8771 N  N   . MET L  2 82 ? 11.136  14.873  125.727 1.00 19.57 ? 83   MET L N   1 
ATOM   8772 C  CA  . MET L  2 82 ? 11.366  16.062  126.537 1.00 20.72 ? 83   MET L CA  1 
ATOM   8773 C  C   . MET L  2 82 ? 11.506  15.693  128.017 1.00 20.96 ? 83   MET L C   1 
ATOM   8774 O  O   . MET L  2 82 ? 12.398  16.164  128.717 1.00 21.79 ? 83   MET L O   1 
ATOM   8775 C  CB  . MET L  2 82 ? 10.234  17.083  126.359 1.00 20.48 ? 83   MET L CB  1 
ATOM   8776 C  CG  . MET L  2 82 ? 10.045  17.593  124.948 1.00 21.89 ? 83   MET L CG  1 
ATOM   8777 S  SD  . MET L  2 82 ? 11.457  18.510  124.337 1.00 23.93 ? 83   MET L SD  1 
ATOM   8778 C  CE  . MET L  2 82 ? 12.424  17.278  123.460 1.00 20.01 ? 83   MET L CE  1 
ATOM   8779 N  N   . ALA L  2 83 ? 10.618  14.839  128.497 1.00 19.70 ? 84   ALA L N   1 
ATOM   8780 C  CA  . ALA L  2 83 ? 10.712  14.391  129.889 1.00 21.51 ? 84   ALA L CA  1 
ATOM   8781 C  C   . ALA L  2 83 ? 11.996  13.584  130.160 1.00 20.49 ? 84   ALA L C   1 
ATOM   8782 O  O   . ALA L  2 83 ? 12.658  13.741  131.190 1.00 23.61 ? 84   ALA L O   1 
ATOM   8783 C  CB  . ALA L  2 83 ? 9.464   13.596  130.262 1.00 20.50 ? 84   ALA L CB  1 
ATOM   8784 N  N   . ARG L  2 84 ? 12.364  12.711  129.236 1.00 21.29 ? 85   ARG L N   1 
ATOM   8785 C  CA  . ARG L  2 84 ? 13.593  11.930  129.417 1.00 24.37 ? 85   ARG L CA  1 
ATOM   8786 C  C   . ARG L  2 84 ? 14.820  12.822  129.493 1.00 21.88 ? 85   ARG L C   1 
ATOM   8787 O  O   . ARG L  2 84 ? 15.722  12.590  130.292 1.00 21.13 ? 85   ARG L O   1 
ATOM   8788 C  CB  . ARG L  2 84 ? 13.791  10.937  128.271 1.00 25.97 ? 85   ARG L CB  1 
ATOM   8789 C  CG  . ARG L  2 84 ? 12.903  9.722   128.391 1.00 32.28 ? 85   ARG L CG  1 
ATOM   8790 C  CD  . ARG L  2 84 ? 12.989  8.779   127.188 1.00 34.19 ? 85   ARG L CD  1 
ATOM   8791 N  NE  . ARG L  2 84 ? 11.896  7.804   127.185 1.00 40.29 ? 85   ARG L NE  1 
ATOM   8792 C  CZ  . ARG L  2 84 ? 11.545  7.087   126.124 1.00 42.94 ? 85   ARG L CZ  1 
ATOM   8793 N  NH1 . ARG L  2 84 ? 10.544  6.223   126.198 1.00 45.31 ? 85   ARG L NH1 1 
ATOM   8794 N  NH2 . ARG L  2 84 ? 12.212  7.212   124.990 1.00 42.93 ? 85   ARG L NH2 1 
ATOM   8795 N  N   . LEU L  2 85 ? 14.862  13.833  128.627 1.00 21.53 ? 86   LEU L N   1 
ATOM   8796 C  CA  . LEU L  2 85 ? 15.947  14.773  128.621 1.00 20.12 ? 86   LEU L CA  1 
ATOM   8797 C  C   . LEU L  2 85 ? 16.012  15.679  129.838 1.00 22.00 ? 86   LEU L C   1 
ATOM   8798 O  O   . LEU L  2 85 ? 17.117  15.993  130.323 1.00 18.50 ? 86   LEU L O   1 
ATOM   8799 C  CB  . LEU L  2 85 ? 15.914  15.571  127.309 1.00 21.24 ? 86   LEU L CB  1 
ATOM   8800 C  CG  . LEU L  2 85 ? 16.834  15.179  126.126 1.00 24.74 ? 86   LEU L CG  1 
ATOM   8801 C  CD1 . LEU L  2 85 ? 17.368  13.771  125.995 1.00 24.36 ? 86   LEU L CD1 1 
ATOM   8802 C  CD2 . LEU L  2 85 ? 16.457  15.858  124.765 1.00 21.80 ? 86   LEU L CD2 1 
ATOM   8803 N  N   . THR L  2 86 ? 14.838  16.043  130.378 1.00 18.40 ? 87   THR L N   1 
ATOM   8804 C  CA  . THR L  2 86 ? 14.788  16.810  131.605 1.00 22.17 ? 87   THR L CA  1 
ATOM   8805 C  C   . THR L  2 86 ? 15.318  15.944  132.759 1.00 23.95 ? 87   THR L C   1 
ATOM   8806 O  O   . THR L  2 86 ? 16.075  16.411  133.601 1.00 25.30 ? 87   THR L O   1 
ATOM   8807 C  CB  . THR L  2 86 ? 13.330  17.219  131.850 1.00 21.66 ? 87   THR L CB  1 
ATOM   8808 O  OG1 . THR L  2 86 ? 12.868  17.995  130.727 1.00 21.43 ? 87   THR L OG1 1 
ATOM   8809 C  CG2 . THR L  2 86 ? 13.181  18.140  133.048 1.00 23.57 ? 87   THR L CG2 1 
ATOM   8810 N  N   . TRP L  2 87 ? 14.931  14.677  132.789 1.00 24.17 ? 88   TRP L N   1 
ATOM   8811 C  CA  . TRP L  2 87 ? 15.451  13.764  133.804 1.00 25.51 ? 88   TRP L CA  1 
ATOM   8812 C  C   . TRP L  2 87 ? 16.979  13.673  133.700 1.00 25.17 ? 88   TRP L C   1 
ATOM   8813 O  O   . TRP L  2 87 ? 17.694  13.756  134.700 1.00 25.72 ? 88   TRP L O   1 
ATOM   8814 C  CB  . TRP L  2 87 ? 14.820  12.386  133.643 1.00 26.98 ? 88   TRP L CB  1 
ATOM   8815 C  CG  . TRP L  2 87 ? 15.437  11.343  134.556 1.00 27.68 ? 88   TRP L CG  1 
ATOM   8816 C  CD1 . TRP L  2 87 ? 16.322  10.363  134.225 1.00 28.75 ? 88   TRP L CD1 1 
ATOM   8817 C  CD2 . TRP L  2 87 ? 15.231  11.243  135.962 1.00 28.75 ? 88   TRP L CD2 1 
ATOM   8818 N  NE1 . TRP L  2 87 ? 16.666  9.636   135.346 1.00 27.83 ? 88   TRP L NE1 1 
ATOM   8819 C  CE2 . TRP L  2 87 ? 16.001  10.155  136.428 1.00 28.30 ? 88   TRP L CE2 1 
ATOM   8820 C  CE3 . TRP L  2 87 ? 14.452  11.954  136.883 1.00 29.58 ? 88   TRP L CE3 1 
ATOM   8821 C  CZ2 . TRP L  2 87 ? 16.018  9.770   137.776 1.00 28.84 ? 88   TRP L CZ2 1 
ATOM   8822 C  CZ3 . TRP L  2 87 ? 14.459  11.571  138.205 1.00 28.77 ? 88   TRP L CZ3 1 
ATOM   8823 C  CH2 . TRP L  2 87 ? 15.237  10.490  138.648 1.00 29.43 ? 88   TRP L CH2 1 
ATOM   8824 N  N   . ALA L  2 88 ? 17.489  13.504  132.483 1.00 24.18 ? 89   ALA L N   1 
ATOM   8825 C  CA  . ALA L  2 88 ? 18.925  13.296  132.279 1.00 24.78 ? 89   ALA L CA  1 
ATOM   8826 C  C   . ALA L  2 88 ? 19.703  14.528  132.715 1.00 26.28 ? 89   ALA L C   1 
ATOM   8827 O  O   . ALA L  2 88 ? 20.751  14.424  133.354 1.00 27.90 ? 89   ALA L O   1 
ATOM   8828 C  CB  . ALA L  2 88 ? 19.232  12.919  130.811 1.00 24.21 ? 89   ALA L CB  1 
ATOM   8829 N  N   . SER L  2 89 ? 19.175  15.709  132.408 1.00 26.93 ? 90   SER L N   1 
ATOM   8830 C  CA  . SER L  2 89 ? 19.778  16.956  132.844 1.00 27.35 ? 90   SER L CA  1 
ATOM   8831 C  C   . SER L  2 89 ? 19.794  17.092  134.376 1.00 27.98 ? 90   SER L C   1 
ATOM   8832 O  O   . SER L  2 89 ? 20.825  17.437  134.960 1.00 28.69 ? 90   SER L O   1 
ATOM   8833 C  CB  . SER L  2 89 ? 19.072  18.144  132.187 1.00 27.86 ? 90   SER L CB  1 
ATOM   8834 O  OG  . SER L  2 89 ? 19.858  19.319  132.363 1.00 28.62 ? 90   SER L OG  1 
ATOM   8835 N  N   . HIS L  2 90 ? 18.655  16.816  135.010 1.00 26.91 ? 91   HIS L N   1 
ATOM   8836 C  CA  . HIS L  2 90 ? 18.548  16.773  136.486 1.00 29.30 ? 91   HIS L CA  1 
ATOM   8837 C  C   . HIS L  2 90 ? 19.566  15.799  137.088 1.00 31.04 ? 91   HIS L C   1 
ATOM   8838 O  O   . HIS L  2 90 ? 20.171  16.095  138.116 1.00 30.43 ? 91   HIS L O   1 
ATOM   8839 C  CB  . HIS L  2 90 ? 17.111  16.397  136.869 1.00 30.31 ? 91   HIS L CB  1 
ATOM   8840 C  CG  . HIS L  2 90 ? 16.883  16.121  138.329 1.00 33.03 ? 91   HIS L CG  1 
ATOM   8841 N  ND1 . HIS L  2 90 ? 16.895  14.849  138.861 1.00 33.04 ? 91   HIS L ND1 1 
ATOM   8842 C  CD2 . HIS L  2 90 ? 16.591  16.956  139.356 1.00 34.23 ? 91   HIS L CD2 1 
ATOM   8843 C  CE1 . HIS L  2 90 ? 16.632  14.911  140.156 1.00 34.83 ? 91   HIS L CE1 1 
ATOM   8844 N  NE2 . HIS L  2 90 ? 16.439  16.179  140.482 1.00 35.54 ? 91   HIS L NE2 1 
ATOM   8845 N  N   . GLU L  2 91 ? 19.787  14.658  136.440 1.00 32.92 ? 92   GLU L N   1 
ATOM   8846 C  CA  . GLU L  2 91 ? 20.683  13.661  137.012 1.00 36.82 ? 92   GLU L CA  1 
ATOM   8847 C  C   . GLU L  2 91 ? 22.139  14.084  136.852 1.00 38.42 ? 92   GLU L C   1 
ATOM   8848 O  O   . GLU L  2 91 ? 22.974  13.772  137.700 1.00 39.00 ? 92   GLU L O   1 
ATOM   8849 C  CB  . GLU L  2 91 ? 20.433  12.284  136.393 1.00 38.71 ? 92   GLU L CB  1 
ATOM   8850 C  CG  . GLU L  2 91 ? 19.112  11.662  136.815 1.00 41.95 ? 92   GLU L CG  1 
ATOM   8851 C  CD  . GLU L  2 91 ? 19.055  11.330  138.299 1.00 44.32 ? 92   GLU L CD  1 
ATOM   8852 O  OE1 . GLU L  2 91 ? 19.523  10.233  138.692 1.00 45.27 ? 92   GLU L OE1 1 
ATOM   8853 O  OE2 . GLU L  2 91 ? 18.521  12.154  139.083 1.00 46.24 ? 92   GLU L OE2 1 
ATOM   8854 N  N   . LYS L  2 92 ? 22.439  14.796  135.771 1.00 38.31 ? 93   LYS L N   1 
ATOM   8855 C  CA  . LYS L  2 92 ? 23.783  15.278  135.543 1.00 44.56 ? 93   LYS L CA  1 
ATOM   8856 C  C   . LYS L  2 92 ? 24.087  16.432  136.494 1.00 46.93 ? 93   LYS L C   1 
ATOM   8857 O  O   . LYS L  2 92 ? 25.217  16.575  136.963 1.00 47.80 ? 93   LYS L O   1 
ATOM   8858 C  CB  . LYS L  2 92 ? 23.982  15.687  134.087 1.00 45.52 ? 93   LYS L CB  1 
ATOM   8859 C  CG  . LYS L  2 92 ? 24.962  16.825  133.937 1.00 49.67 ? 93   LYS L CG  1 
ATOM   8860 C  CD  . LYS L  2 92 ? 26.021  16.551  132.891 1.00 52.10 ? 93   LYS L CD  1 
ATOM   8861 C  CE  . LYS L  2 92 ? 27.107  17.626  132.937 1.00 53.75 ? 93   LYS L CE  1 
ATOM   8862 N  NZ  . LYS L  2 92 ? 27.994  17.529  131.745 1.00 55.54 ? 93   LYS L NZ  1 
ATOM   8863 N  N   . MET L  2 93 ? 23.070  17.235  136.795 1.00 48.55 ? 94   MET L N   1 
ATOM   8864 C  CA  . MET L  2 93 ? 23.198  18.296  137.786 1.00 50.52 ? 94   MET L CA  1 
ATOM   8865 C  C   . MET L  2 93 ? 23.727  17.794  139.136 1.00 53.74 ? 94   MET L C   1 
ATOM   8866 O  O   . MET L  2 93 ? 24.562  18.448  139.752 1.00 53.76 ? 94   MET L O   1 
ATOM   8867 C  CB  . MET L  2 93 ? 21.887  19.076  137.934 1.00 49.81 ? 94   MET L CB  1 
ATOM   8868 C  CG  . MET L  2 93 ? 21.732  20.210  136.907 1.00 50.29 ? 94   MET L CG  1 
ATOM   8869 S  SD  . MET L  2 93 ? 20.072  20.928  136.742 1.00 49.50 ? 94   MET L SD  1 
ATOM   8870 C  CE  . MET L  2 93 ? 19.482  20.938  138.440 1.00 51.02 ? 94   MET L CE  1 
ATOM   8871 N  N   . HIS L  2 94 ? 23.286  16.634  139.610 1.00 57.84 ? 95   HIS L N   1 
ATOM   8872 C  CA  . HIS L  2 94 ? 23.972  16.078  140.782 1.00 61.30 ? 95   HIS L CA  1 
ATOM   8873 C  C   . HIS L  2 94 ? 24.561  14.691  140.560 1.00 61.76 ? 95   HIS L C   1 
ATOM   8874 O  O   . HIS L  2 94 ? 25.786  14.547  140.487 1.00 62.20 ? 95   HIS L O   1 
ATOM   8875 C  CB  . HIS L  2 94 ? 23.118  16.160  142.053 1.00 64.42 ? 95   HIS L CB  1 
ATOM   8876 C  CG  . HIS L  2 94 ? 22.062  15.104  142.155 1.00 66.96 ? 95   HIS L CG  1 
ATOM   8877 N  ND1 . HIS L  2 94 ? 21.299  14.707  141.078 1.00 67.82 ? 95   HIS L ND1 1 
ATOM   8878 C  CD2 . HIS L  2 94 ? 21.618  14.389  143.218 1.00 67.79 ? 95   HIS L CD2 1 
ATOM   8879 C  CE1 . HIS L  2 94 ? 20.444  13.776  141.468 1.00 68.77 ? 95   HIS L CE1 1 
ATOM   8880 N  NE2 . HIS L  2 94 ? 20.615  13.567  142.763 1.00 68.85 ? 95   HIS L NE2 1 
HETATM 8881 CA CA  . CA  M  3 .  ? 23.626  44.191  176.896 1.00 16.25 ? 1501 CA  A CA  1 
HETATM 8882 CA CA  . CA  N  3 .  ? 26.346  54.783  180.985 0.70 22.23 ? 1502 CA  A CA  1 
HETATM 8883 CL CL  . CL  O  4 .  ? 25.939  51.267  187.638 1.00 75.22 ? 2004 CL  A CL  1 
HETATM 8884 CA CA  . CA  P  3 .  ? 16.946  40.243  158.584 1.00 15.74 ? 2501 CA  B CA  1 
HETATM 8885 CA CA  . CA  Q  3 .  ? 20.676  31.531  151.667 0.70 24.17 ? 2502 CA  B CA  1 
HETATM 8886 CL CL  . CL  R  4 .  ? 13.652  32.684  148.070 1.00 74.48 ? 2005 CL  B CL  1 
HETATM 8887 CA CA  . CA  S  3 .  ? 15.126  42.975  147.553 1.00 19.23 ? 3501 CA  C CA  1 
HETATM 8888 CA CA  . CA  T  3 .  ? 12.553  52.599  142.365 0.70 22.11 ? 3502 CA  C CA  1 
HETATM 8889 CA CA  . CA  U  3 .  ? 31.231  43.335  185.339 1.00 18.95 ? 4501 CA  D CA  1 
HETATM 8890 CA CA  . CA  V  3 .  ? 37.906  35.091  188.803 0.70 21.34 ? 4502 CA  D CA  1 
HETATM 8891 CA CA  . CA  W  3 .  ? 7.852   54.139  111.123 1.00 15.90 ? 1511 CA  E CA  1 
HETATM 8892 CA CA  . CA  X  3 .  ? 13.911  62.840  116.203 0.70 23.31 ? 1512 CA  E CA  1 
HETATM 8893 CA CA  . CA  Y  3 .  ? 7.590   50.191  91.637  1.00 17.01 ? 2511 CA  F CA  1 
HETATM 8894 CA CA  . CA  Z  3 .  ? 8.586   39.628  86.793  0.70 21.61 ? 2512 CA  F CA  1 
HETATM 8895 CL CL  . CL  AA 4 .  ? 5.958   43.340  80.781  1.00 74.84 ? 2006 CL  F CL  1 
HETATM 8896 C  CAC . FLC BA 5 .  ? 17.317  27.478  115.487 1.00 53.73 ? 2008 FLC F CAC 1 
HETATM 8897 C  CA  . FLC BA 5 .  ? 16.646  27.050  116.757 1.00 52.22 ? 2008 FLC F CA  1 
HETATM 8898 C  CB  . FLC BA 5 .  ? 17.083  28.191  117.671 1.00 51.51 ? 2008 FLC F CB  1 
HETATM 8899 C  CBC . FLC BA 5 .  ? 18.564  28.053  117.983 1.00 52.95 ? 2008 FLC F CBC 1 
HETATM 8900 C  CG  . FLC BA 5 .  ? 16.243  28.290  118.930 1.00 48.26 ? 2008 FLC F CG  1 
HETATM 8901 C  CGC . FLC BA 5 .  ? 17.075  29.092  119.895 1.00 42.56 ? 2008 FLC F CGC 1 
HETATM 8902 O  OA1 . FLC BA 5 .  ? 16.841  28.495  114.939 1.00 51.93 ? 2008 FLC F OA1 1 
HETATM 8903 O  OA2 . FLC BA 5 .  ? 18.321  26.843  115.081 1.00 56.44 ? 2008 FLC F OA2 1 
HETATM 8904 O  OB1 . FLC BA 5 .  ? 19.352  28.975  117.650 1.00 52.92 ? 2008 FLC F OB1 1 
HETATM 8905 O  OB2 . FLC BA 5 .  ? 18.955  27.009  118.552 1.00 53.94 ? 2008 FLC F OB2 1 
HETATM 8906 O  OG1 . FLC BA 5 .  ? 17.125  30.333  119.762 1.00 40.90 ? 2008 FLC F OG1 1 
HETATM 8907 O  OG2 . FLC BA 5 .  ? 17.682  28.461  120.768 1.00 35.81 ? 2008 FLC F OG2 1 
HETATM 8908 O  OHB . FLC BA 5 .  ? 16.893  29.434  116.994 1.00 53.78 ? 2008 FLC F OHB 1 
HETATM 8909 CA CA  . CA  CA 3 .  ? 11.792  50.998  81.036  1.00 18.85 ? 3511 CA  G CA  1 
HETATM 8910 CA CA  . CA  DA 3 .  ? 16.675  59.241  75.400  0.70 21.51 ? 3512 CA  G CA  1 
HETATM 8911 CA CA  . CA  EA 3 .  ? 10.034  51.415  122.104 1.00 19.94 ? 4511 CA  H CA  1 
HETATM 8912 CA CA  . CA  FA 3 .  ? 9.503   41.753  127.811 0.70 26.08 ? 4512 CA  H CA  1 
HETATM 8913 CA CA  . CA  GA 3 .  ? 2.469   5.942   126.788 1.00 15.52 ? 1521 CA  I CA  1 
HETATM 8914 CA CA  . CA  HA 3 .  ? 5.151   -3.926  121.168 0.70 19.88 ? 1522 CA  I CA  1 
HETATM 8915 CA CA  . CA  IA 3 .  ? 6.123   9.682   146.044 1.00 14.08 ? 2521 CA  J CA  1 
HETATM 8916 CA CA  . CA  JA 3 .  ? 10.687  19.633  150.222 0.70 19.46 ? 2522 CA  J CA  1 
HETATM 8917 CL CL  . CL  KA 4 .  ? 7.893   17.041  156.913 1.00 66.82 ? 2007 CL  J CL  1 
HETATM 8918 CA CA  . CA  LA 3 .  ? 11.375  7.538   156.014 1.00 18.29 ? 3521 CA  K CA  1 
HETATM 8919 CA CA  . CA  MA 3 .  ? 14.824  -1.788  161.054 0.70 21.39 ? 3522 CA  K CA  1 
HETATM 8920 CA CA  . CA  NA 3 .  ? 3.735   8.075   115.593 1.00 19.70 ? 4521 CA  L CA  1 
HETATM 8921 CA CA  . CA  OA 3 .  ? 5.146   17.490  109.658 0.70 23.90 ? 4522 CA  L CA  1 
HETATM 8922 O  O   . HOH PA 6 .  ? 14.741  44.568  169.684 1.00 60.51 ? 2005 HOH A O   1 
HETATM 8923 O  O   . HOH PA 6 .  ? 9.525   64.394  177.746 1.00 57.12 ? 2006 HOH A O   1 
HETATM 8924 O  O   . HOH PA 6 .  ? 7.919   52.406  182.716 1.00 58.18 ? 2007 HOH A O   1 
HETATM 8925 O  O   . HOH PA 6 .  ? 6.275   61.844  157.083 1.00 53.61 ? 2008 HOH A O   1 
HETATM 8926 O  O   . HOH PA 6 .  ? 11.528  44.773  188.267 1.00 51.41 ? 2009 HOH A O   1 
HETATM 8927 O  O   . HOH PA 6 .  ? 1.927   59.398  151.131 1.00 52.00 ? 2010 HOH A O   1 
HETATM 8928 O  O   . HOH PA 6 .  ? 16.151  41.943  170.000 1.00 52.51 ? 2011 HOH A O   1 
HETATM 8929 O  O   . HOH PA 6 .  ? 1.308   49.875  154.951 1.00 52.71 ? 2012 HOH A O   1 
HETATM 8930 O  O   . HOH PA 6 .  ? 23.294  42.705  168.469 1.00 44.10 ? 2013 HOH A O   1 
HETATM 8931 O  O   . HOH PA 6 .  ? 14.156  47.262  162.177 1.00 55.67 ? 2014 HOH A O   1 
HETATM 8932 O  O   . HOH PA 6 .  ? 18.277  50.932  186.162 1.00 44.62 ? 2015 HOH A O   1 
HETATM 8933 O  O   . HOH PA 6 .  ? 30.587  53.521  188.000 1.00 41.97 ? 2016 HOH A O   1 
HETATM 8934 O  O   . HOH PA 6 .  ? 16.233  38.529  181.331 1.00 41.93 ? 2017 HOH A O   1 
HETATM 8935 O  O   . HOH PA 6 .  ? 4.212   50.329  164.165 1.00 51.31 ? 2018 HOH A O   1 
HETATM 8936 O  O   . HOH PA 6 .  ? 22.030  44.925  186.295 1.00 51.40 ? 2019 HOH A O   1 
HETATM 8937 O  O   . HOH PA 6 .  ? 17.073  41.211  180.197 1.00 43.74 ? 2020 HOH A O   1 
HETATM 8938 O  O   . HOH PA 6 .  ? 10.460  44.609  167.809 1.00 53.45 ? 2021 HOH A O   1 
HETATM 8939 O  O   . HOH PA 6 .  ? 28.352  44.284  164.034 1.00 48.01 ? 2022 HOH A O   1 
HETATM 8940 O  O   . HOH PA 6 .  ? 8.896   41.745  178.206 1.00 56.21 ? 2023 HOH A O   1 
HETATM 8941 O  O   . HOH PA 6 .  ? 4.732   60.533  168.435 1.00 43.50 ? 2024 HOH A O   1 
HETATM 8942 O  O   . HOH PA 6 .  ? 15.715  51.015  186.541 1.00 45.33 ? 2025 HOH A O   1 
HETATM 8943 O  O   . HOH PA 6 .  ? 26.299  40.722  167.963 1.00 46.57 ? 2026 HOH A O   1 
HETATM 8944 O  O   . HOH PA 6 .  ? 13.462  39.516  172.046 1.00 49.38 ? 2027 HOH A O   1 
HETATM 8945 O  O   . HOH PA 6 .  ? 28.563  42.210  166.654 1.00 53.54 ? 2028 HOH A O   1 
HETATM 8946 O  O   . HOH PA 6 .  ? 0.780   52.991  158.479 1.00 46.55 ? 2029 HOH A O   1 
HETATM 8947 O  O   . HOH PA 6 .  ? 10.632  64.980  172.336 1.00 40.71 ? 2030 HOH A O   1 
HETATM 8948 O  O   . HOH PA 6 .  ? 30.849  61.203  185.414 1.00 39.90 ? 2031 HOH A O   1 
HETATM 8949 O  O   . HOH PA 6 .  ? 17.338  36.240  176.560 1.00 44.93 ? 2032 HOH A O   1 
HETATM 8950 O  O   . HOH PA 6 .  ? 24.659  65.238  176.690 1.00 39.22 ? 2033 HOH A O   1 
HETATM 8951 O  O   . HOH PA 6 .  ? 11.916  50.894  183.249 1.00 50.00 ? 2034 HOH A O   1 
HETATM 8952 O  O   . HOH PA 6 .  ? 11.164  58.157  164.259 1.00 39.38 ? 2035 HOH A O   1 
HETATM 8953 O  O   . HOH PA 6 .  ? 13.122  44.573  181.262 1.00 37.71 ? 2036 HOH A O   1 
HETATM 8954 O  O   . HOH PA 6 .  ? 24.591  39.238  183.897 1.00 33.96 ? 2037 HOH A O   1 
HETATM 8955 O  O   . HOH PA 6 .  ? 9.319   54.848  178.068 1.00 47.39 ? 2038 HOH A O   1 
HETATM 8956 O  O   . HOH PA 6 .  ? 32.641  60.707  160.340 1.00 39.59 ? 2039 HOH A O   1 
HETATM 8957 O  O   . HOH PA 6 .  ? 13.701  52.416  184.640 1.00 47.41 ? 2040 HOH A O   1 
HETATM 8958 O  O   . HOH PA 6 .  ? 9.045   48.020  167.017 1.00 38.69 ? 2041 HOH A O   1 
HETATM 8959 O  O   . HOH PA 6 .  ? 30.819  67.648  158.140 1.00 45.31 ? 2042 HOH A O   1 
HETATM 8960 O  O   . HOH PA 6 .  ? 25.844  66.713  179.383 1.00 36.87 ? 2043 HOH A O   1 
HETATM 8961 O  O   . HOH PA 6 .  ? 21.838  64.341  180.032 1.00 46.36 ? 2044 HOH A O   1 
HETATM 8962 O  O   . HOH PA 6 .  ? 9.875   42.564  172.499 1.00 40.99 ? 2045 HOH A O   1 
HETATM 8963 O  O   . HOH PA 6 .  ? 8.710   58.150  152.131 1.00 37.38 ? 2046 HOH A O   1 
HETATM 8964 O  O   . HOH PA 6 .  ? 7.013   48.395  161.712 1.00 41.15 ? 2047 HOH A O   1 
HETATM 8965 O  O   . HOH PA 6 .  ? 14.361  56.913  183.873 1.00 41.74 ? 2048 HOH A O   1 
HETATM 8966 O  O   . HOH PA 6 .  ? 28.311  60.256  184.347 1.00 42.39 ? 2049 HOH A O   1 
HETATM 8967 O  O   . HOH PA 6 .  ? 27.480  64.798  177.070 1.00 33.73 ? 2050 HOH A O   1 
HETATM 8968 O  O   . HOH PA 6 .  ? 29.857  67.027  160.556 1.00 38.57 ? 2051 HOH A O   1 
HETATM 8969 O  O   . HOH PA 6 .  ? 24.011  46.981  185.717 1.00 47.23 ? 2052 HOH A O   1 
HETATM 8970 O  O   . HOH PA 6 .  ? 18.982  60.644  184.285 1.00 51.00 ? 2053 HOH A O   1 
HETATM 8971 O  O   . HOH PA 6 .  ? 18.634  58.107  183.865 1.00 48.16 ? 2054 HOH A O   1 
HETATM 8972 O  O   . HOH PA 6 .  ? 25.294  46.256  183.550 1.00 31.52 ? 2055 HOH A O   1 
HETATM 8973 O  O   . HOH PA 6 .  ? 22.519  66.561  161.116 1.00 38.73 ? 2056 HOH A O   1 
HETATM 8974 O  O   . HOH PA 6 .  ? 16.067  38.149  177.513 1.00 28.97 ? 2057 HOH A O   1 
HETATM 8975 O  O   . HOH PA 6 .  ? 18.823  42.476  181.246 1.00 36.21 ? 2058 HOH A O   1 
HETATM 8976 O  O   . HOH PA 6 .  ? 12.331  40.071  174.838 1.00 31.68 ? 2059 HOH A O   1 
HETATM 8977 O  O   . HOH PA 6 .  ? 24.770  66.911  162.596 1.00 29.48 ? 2060 HOH A O   1 
HETATM 8978 O  O   . HOH PA 6 .  ? 9.607   48.039  163.234 1.00 31.42 ? 2061 HOH A O   1 
HETATM 8979 O  O   . HOH PA 6 .  ? 23.834  66.025  151.312 1.00 30.36 ? 2062 HOH A O   1 
HETATM 8980 O  O   . HOH PA 6 .  ? 33.249  54.413  181.139 1.00 32.34 ? 2063 HOH A O   1 
HETATM 8981 O  O   . HOH PA 6 .  ? 4.782   56.756  176.609 1.00 48.44 ? 2064 HOH A O   1 
HETATM 8982 O  O   . HOH PA 6 .  ? 7.643   58.668  159.682 1.00 28.71 ? 2065 HOH A O   1 
HETATM 8983 O  O   . HOH PA 6 .  ? 7.144   58.381  162.337 1.00 34.44 ? 2066 HOH A O   1 
HETATM 8984 O  O   . HOH PA 6 .  ? 10.689  42.232  175.253 1.00 29.37 ? 2067 HOH A O   1 
HETATM 8985 O  O   . HOH PA 6 .  ? 23.912  63.207  179.235 1.00 32.63 ? 2068 HOH A O   1 
HETATM 8986 O  O   . HOH PA 6 .  ? 23.431  66.472  165.130 1.00 29.38 ? 2069 HOH A O   1 
HETATM 8987 O  O   . HOH PA 6 .  ? 28.915  45.457  175.924 1.00 27.73 ? 2070 HOH A O   1 
HETATM 8988 O  O   . HOH PA 6 .  ? 7.556   47.957  179.998 1.00 44.15 ? 2071 HOH A O   1 
HETATM 8989 O  O   . HOH PA 6 .  ? 28.262  56.798  187.670 1.00 32.71 ? 2072 HOH A O   1 
HETATM 8990 O  O   . HOH PA 6 .  ? 13.417  65.547  172.131 1.00 34.71 ? 2073 HOH A O   1 
HETATM 8991 O  O   . HOH PA 6 .  ? 27.961  62.904  181.795 1.00 24.30 ? 2074 HOH A O   1 
HETATM 8992 O  O   . HOH PA 6 .  ? 22.004  35.951  181.992 1.00 39.11 ? 2075 HOH A O   1 
HETATM 8993 O  O   . HOH PA 6 .  ? 25.865  45.105  176.959 1.00 19.76 ? 2076 HOH A O   1 
HETATM 8994 O  O   . HOH PA 6 .  ? 29.784  52.749  172.765 1.00 33.06 ? 2077 HOH A O   1 
HETATM 8995 O  O   . HOH PA 6 .  ? 26.545  63.859  179.569 1.00 27.44 ? 2078 HOH A O   1 
HETATM 8996 O  O   . HOH PA 6 .  ? 17.261  40.584  177.765 1.00 21.67 ? 2079 HOH A O   1 
HETATM 8997 O  O   . HOH PA 6 .  ? 9.282   49.956  156.279 1.00 25.23 ? 2080 HOH A O   1 
HETATM 8998 O  O   . HOH PA 6 .  ? 9.929   55.414  164.462 1.00 30.42 ? 2081 HOH A O   1 
HETATM 8999 O  O   . HOH PA 6 .  ? 28.786  64.638  161.743 1.00 31.51 ? 2082 HOH A O   1 
HETATM 9000 O  O   . HOH PA 6 .  ? 21.708  65.251  158.713 1.00 19.09 ? 2083 HOH A O   1 
HETATM 9001 O  O   . HOH PA 6 .  ? 26.451  64.723  162.630 1.00 18.04 ? 2084 HOH A O   1 
HETATM 9002 O  O   . HOH PA 6 .  ? 28.535  50.712  173.566 1.00 19.66 ? 2085 HOH A O   1 
HETATM 9003 O  O   . HOH PA 6 .  ? 19.814  48.313  184.013 1.00 20.51 ? 2086 HOH A O   1 
HETATM 9004 O  O   . HOH PA 6 .  ? 24.210  55.984  181.405 1.00 16.81 ? 2087 HOH A O   1 
HETATM 9005 O  O   . HOH PA 6 .  ? 21.446  36.371  176.870 1.00 23.47 ? 2088 HOH A O   1 
HETATM 9006 O  O   . HOH QA 6 .  ? 11.877  14.961  166.420 1.00 56.00 ? 2503 HOH B O   1 
HETATM 9007 O  O   . HOH QA 6 .  ? 17.315  15.622  170.744 1.00 69.43 ? 2504 HOH B O   1 
HETATM 9008 O  O   . HOH QA 6 .  ? 11.679  33.816  173.462 1.00 56.67 ? 2505 HOH B O   1 
HETATM 9009 O  O   . HOH QA 6 .  ? 20.354  28.112  180.608 1.00 54.66 ? 2506 HOH B O   1 
HETATM 9010 O  O   . HOH QA 6 .  ? 16.603  31.742  175.131 1.00 48.86 ? 2507 HOH B O   1 
HETATM 9011 O  O   . HOH QA 6 .  ? 14.571  18.848  166.171 1.00 51.44 ? 2508 HOH B O   1 
HETATM 9012 O  O   . HOH QA 6 .  ? 41.360  22.405  163.184 1.00 52.39 ? 2509 HOH B O   1 
HETATM 9013 O  O   . HOH QA 6 .  ? 16.797  18.004  167.193 1.00 52.82 ? 2510 HOH B O   1 
HETATM 9014 O  O   . HOH QA 6 .  ? 41.009  33.865  160.864 1.00 45.78 ? 2511 HOH B O   1 
HETATM 9015 O  O   . HOH QA 6 .  ? 8.332   30.213  172.806 1.00 41.22 ? 2512 HOH B O   1 
HETATM 9016 O  O   . HOH QA 6 .  ? 13.563  16.267  162.916 1.00 50.05 ? 2513 HOH B O   1 
HETATM 9017 O  O   . HOH QA 6 .  ? 9.150   38.681  161.649 1.00 40.94 ? 2514 HOH B O   1 
HETATM 9018 O  O   . HOH QA 6 .  ? 6.197   33.753  165.702 1.00 45.05 ? 2515 HOH B O   1 
HETATM 9019 O  O   . HOH QA 6 .  ? 23.491  27.919  142.874 1.00 50.12 ? 2516 HOH B O   1 
HETATM 9020 O  O   . HOH QA 6 .  ? 10.727  21.992  177.868 1.00 41.10 ? 2517 HOH B O   1 
HETATM 9021 O  O   . HOH QA 6 .  ? 31.440  27.102  183.440 1.00 44.17 ? 2518 HOH B O   1 
HETATM 9022 O  O   . HOH QA 6 .  ? 5.770   34.696  163.230 1.00 43.76 ? 2519 HOH B O   1 
HETATM 9023 O  O   . HOH QA 6 .  ? 8.115   34.140  162.365 1.00 35.63 ? 2520 HOH B O   1 
HETATM 9024 O  O   . HOH QA 6 .  ? 19.642  34.812  177.357 1.00 37.60 ? 2521 HOH B O   1 
HETATM 9025 O  O   . HOH QA 6 .  ? 42.515  27.181  160.941 1.00 37.43 ? 2522 HOH B O   1 
HETATM 9026 O  O   . HOH QA 6 .  ? 33.090  29.859  156.171 1.00 51.48 ? 2523 HOH B O   1 
HETATM 9027 O  O   . HOH QA 6 .  ? 5.463   32.883  158.272 1.00 52.58 ? 2524 HOH B O   1 
HETATM 9028 O  O   . HOH QA 6 .  ? 30.863  32.521  155.675 1.00 43.00 ? 2525 HOH B O   1 
HETATM 9029 O  O   . HOH QA 6 .  ? 9.990   43.390  153.959 1.00 45.23 ? 2526 HOH B O   1 
HETATM 9030 O  O   . HOH QA 6 .  ? 11.811  33.387  155.321 1.00 34.68 ? 2527 HOH B O   1 
HETATM 9031 O  O   . HOH QA 6 .  ? 14.159  37.836  152.361 1.00 34.31 ? 2528 HOH B O   1 
HETATM 9032 O  O   . HOH QA 6 .  ? 25.660  23.629  152.817 1.00 45.90 ? 2529 HOH B O   1 
HETATM 9033 O  O   . HOH QA 6 .  ? 12.098  28.279  149.624 1.00 34.89 ? 2530 HOH B O   1 
HETATM 9034 O  O   . HOH QA 6 .  ? 20.092  32.260  179.432 1.00 34.95 ? 2531 HOH B O   1 
HETATM 9035 O  O   . HOH QA 6 .  ? 45.635  27.705  161.952 1.00 45.03 ? 2532 HOH B O   1 
HETATM 9036 O  O   . HOH QA 6 .  ? 7.395   28.878  166.734 1.00 49.96 ? 2533 HOH B O   1 
HETATM 9037 O  O   . HOH QA 6 .  ? 37.983  23.638  165.874 1.00 45.63 ? 2534 HOH B O   1 
HETATM 9038 O  O   . HOH QA 6 .  ? 9.547   44.001  164.393 1.00 42.15 ? 2535 HOH B O   1 
HETATM 9039 O  O   . HOH QA 6 .  ? 38.251  24.979  168.759 1.00 30.94 ? 2536 HOH B O   1 
HETATM 9040 O  O   . HOH QA 6 .  ? 10.604  38.400  159.721 1.00 38.58 ? 2537 HOH B O   1 
HETATM 9041 O  O   . HOH QA 6 .  ? 11.368  31.547  153.924 1.00 35.28 ? 2538 HOH B O   1 
HETATM 9042 O  O   . HOH QA 6 .  ? 24.755  25.050  173.318 1.00 43.23 ? 2539 HOH B O   1 
HETATM 9043 O  O   . HOH QA 6 .  ? 9.695   36.137  168.676 1.00 44.41 ? 2540 HOH B O   1 
HETATM 9044 O  O   . HOH QA 6 .  ? 48.722  32.518  161.622 1.00 43.87 ? 2541 HOH B O   1 
HETATM 9045 O  O   . HOH QA 6 .  ? 35.185  30.124  158.899 1.00 37.96 ? 2542 HOH B O   1 
HETATM 9046 O  O   . HOH QA 6 .  ? 24.644  18.158  164.366 1.00 42.17 ? 2543 HOH B O   1 
HETATM 9047 O  O   . HOH QA 6 .  ? 19.961  32.601  176.562 1.00 30.40 ? 2544 HOH B O   1 
HETATM 9048 O  O   . HOH QA 6 .  ? 9.815   46.077  162.787 1.00 35.16 ? 2545 HOH B O   1 
HETATM 9049 O  O   . HOH QA 6 .  ? 30.198  22.831  157.916 1.00 48.67 ? 2546 HOH B O   1 
HETATM 9050 O  O   . HOH QA 6 .  ? 11.703  45.974  161.543 1.00 25.90 ? 2547 HOH B O   1 
HETATM 9051 O  O   . HOH QA 6 .  ? 14.516  28.300  145.493 1.00 44.94 ? 2548 HOH B O   1 
HETATM 9052 O  O   . HOH QA 6 .  ? 11.544  29.417  161.272 1.00 26.99 ? 2549 HOH B O   1 
HETATM 9053 O  O   . HOH QA 6 .  ? 23.071  43.773  164.454 1.00 37.76 ? 2550 HOH B O   1 
HETATM 9054 O  O   . HOH QA 6 .  ? 14.718  20.271  160.675 1.00 31.20 ? 2551 HOH B O   1 
HETATM 9055 O  O   . HOH QA 6 .  ? 38.101  26.936  162.503 1.00 31.35 ? 2552 HOH B O   1 
HETATM 9056 O  O   . HOH QA 6 .  ? 44.923  26.967  171.709 1.00 35.72 ? 2553 HOH B O   1 
HETATM 9057 O  O   . HOH QA 6 .  ? 20.140  23.436  148.326 1.00 35.01 ? 2554 HOH B O   1 
HETATM 9058 O  O   . HOH QA 6 .  ? 19.097  18.565  173.407 1.00 33.80 ? 2555 HOH B O   1 
HETATM 9059 O  O   . HOH QA 6 .  ? 10.224  24.662  165.379 1.00 47.03 ? 2556 HOH B O   1 
HETATM 9060 O  O   . HOH QA 6 .  ? 12.233  36.004  151.468 1.00 39.15 ? 2557 HOH B O   1 
HETATM 9061 O  O   . HOH QA 6 .  ? 11.193  40.139  162.916 1.00 27.99 ? 2558 HOH B O   1 
HETATM 9062 O  O   . HOH QA 6 .  ? 14.871  25.335  153.363 1.00 47.16 ? 2559 HOH B O   1 
HETATM 9063 O  O   . HOH QA 6 .  ? 24.297  23.159  177.055 1.00 38.70 ? 2560 HOH B O   1 
HETATM 9064 O  O   . HOH QA 6 .  ? 16.367  39.336  169.003 1.00 29.34 ? 2561 HOH B O   1 
HETATM 9065 O  O   . HOH QA 6 .  ? 17.053  40.132  173.853 1.00 29.56 ? 2562 HOH B O   1 
HETATM 9066 O  O   . HOH QA 6 .  ? 24.065  35.290  146.949 1.00 36.09 ? 2563 HOH B O   1 
HETATM 9067 O  O   . HOH QA 6 .  ? 9.626   25.142  157.623 1.00 25.70 ? 2564 HOH B O   1 
HETATM 9068 O  O   . HOH QA 6 .  ? 18.558  40.664  156.861 1.00 19.84 ? 2565 HOH B O   1 
HETATM 9069 O  O   . HOH QA 6 .  ? 12.938  17.587  157.680 1.00 30.88 ? 2566 HOH B O   1 
HETATM 9070 O  O   . HOH QA 6 .  ? 17.477  29.360  145.509 1.00 29.91 ? 2567 HOH B O   1 
HETATM 9071 O  O   . HOH QA 6 .  ? 26.219  23.680  178.817 1.00 24.94 ? 2568 HOH B O   1 
HETATM 9072 O  O   . HOH QA 6 .  ? 19.105  26.134  146.275 1.00 28.58 ? 2569 HOH B O   1 
HETATM 9073 O  O   . HOH QA 6 .  ? 13.204  41.275  165.929 1.00 25.71 ? 2570 HOH B O   1 
HETATM 9074 O  O   . HOH QA 6 .  ? 25.269  37.450  156.135 1.00 24.04 ? 2571 HOH B O   1 
HETATM 9075 O  O   . HOH QA 6 .  ? 13.506  20.126  158.212 1.00 28.71 ? 2572 HOH B O   1 
HETATM 9076 O  O   . HOH QA 6 .  ? 20.946  41.813  155.331 1.00 19.48 ? 2573 HOH B O   1 
HETATM 9077 O  O   . HOH QA 6 .  ? 25.409  40.736  158.838 1.00 27.85 ? 2574 HOH B O   1 
HETATM 9078 O  O   . HOH QA 6 .  ? 12.058  29.095  154.206 1.00 19.95 ? 2575 HOH B O   1 
HETATM 9079 O  O   . HOH QA 6 .  ? 11.601  21.481  157.285 1.00 20.81 ? 2576 HOH B O   1 
HETATM 9080 O  O   . HOH QA 6 .  ? 23.018  26.685  174.290 1.00 23.41 ? 2577 HOH B O   1 
HETATM 9081 O  O   . HOH QA 6 .  ? 39.846  28.549  161.447 1.00 30.58 ? 2578 HOH B O   1 
HETATM 9082 O  O   . HOH QA 6 .  ? 13.552  41.112  151.646 1.00 20.06 ? 2579 HOH B O   1 
HETATM 9083 O  O   . HOH QA 6 .  ? 19.788  29.475  152.750 1.00 17.91 ? 2580 HOH B O   1 
HETATM 9084 O  O   . HOH RA 6 .  ? 32.042  64.036  142.509 1.00 62.67 ? 3503 HOH C O   1 
HETATM 9085 O  O   . HOH RA 6 .  ? 35.206  64.412  155.524 1.00 61.67 ? 3504 HOH C O   1 
HETATM 9086 O  O   . HOH RA 6 .  ? 32.329  37.989  148.349 1.00 59.75 ? 3505 HOH C O   1 
HETATM 9087 O  O   . HOH RA 6 .  ? 28.039  66.629  135.157 1.00 61.27 ? 3506 HOH C O   1 
HETATM 9088 O  O   . HOH RA 6 .  ? 27.947  68.764  136.400 1.00 61.42 ? 3507 HOH C O   1 
HETATM 9089 O  O   . HOH RA 6 .  ? 33.633  54.745  139.494 1.00 55.60 ? 3508 HOH C O   1 
HETATM 9090 O  O   . HOH RA 6 .  ? 35.632  49.595  158.017 1.00 52.84 ? 3509 HOH C O   1 
HETATM 9091 O  O   . HOH RA 6 .  ? 28.699  63.997  137.611 1.00 62.71 ? 3510 HOH C O   1 
HETATM 9092 O  O   . HOH RA 6 .  ? 5.486   67.921  166.665 1.00 53.16 ? 3511 HOH C O   1 
HETATM 9093 O  O   . HOH RA 6 .  ? 25.673  65.585  136.976 1.00 51.70 ? 3512 HOH C O   1 
HETATM 9094 O  O   . HOH RA 6 .  ? 17.746  52.156  136.038 1.00 48.92 ? 3513 HOH C O   1 
HETATM 9095 O  O   . HOH RA 6 .  ? 2.185   49.418  147.429 1.00 57.65 ? 3514 HOH C O   1 
HETATM 9096 O  O   . HOH RA 6 .  ? 14.202  63.997  135.356 1.00 44.61 ? 3515 HOH C O   1 
HETATM 9097 O  O   . HOH RA 6 .  ? 13.339  73.669  166.255 1.00 50.68 ? 3516 HOH C O   1 
HETATM 9098 O  O   . HOH RA 6 .  ? 7.813   62.496  168.905 1.00 52.79 ? 3517 HOH C O   1 
HETATM 9099 O  O   . HOH RA 6 .  ? 15.976  48.527  136.877 1.00 46.41 ? 3518 HOH C O   1 
HETATM 9100 O  O   . HOH RA 6 .  ? 29.933  42.259  141.624 1.00 41.38 ? 3519 HOH C O   1 
HETATM 9101 O  O   . HOH RA 6 .  ? 5.064   57.461  142.262 1.00 49.15 ? 3520 HOH C O   1 
HETATM 9102 O  O   . HOH RA 6 .  ? 15.148  64.993  138.581 1.00 41.84 ? 3521 HOH C O   1 
HETATM 9103 O  O   . HOH RA 6 .  ? 8.811   71.813  159.505 1.00 40.90 ? 3522 HOH C O   1 
HETATM 9104 O  O   . HOH RA 6 .  ? 9.596   52.815  135.863 1.00 39.60 ? 3523 HOH C O   1 
HETATM 9105 O  O   . HOH RA 6 .  ? 16.808  64.664  153.495 1.00 39.55 ? 3524 HOH C O   1 
HETATM 9106 O  O   . HOH RA 6 .  ? 5.996   49.468  149.840 1.00 36.75 ? 3525 HOH C O   1 
HETATM 9107 O  O   . HOH RA 6 .  ? 18.734  65.509  152.105 1.00 26.12 ? 3526 HOH C O   1 
HETATM 9108 O  O   . HOH RA 6 .  ? 11.848  36.895  146.051 1.00 42.66 ? 3527 HOH C O   1 
HETATM 9109 O  O   . HOH RA 6 .  ? 9.103   45.458  145.276 1.00 46.92 ? 3528 HOH C O   1 
HETATM 9110 O  O   . HOH RA 6 .  ? 26.936  66.023  144.098 1.00 48.84 ? 3529 HOH C O   1 
HETATM 9111 O  O   . HOH RA 6 .  ? 35.185  50.858  138.207 1.00 55.03 ? 3530 HOH C O   1 
HETATM 9112 O  O   . HOH RA 6 .  ? 12.895  71.381  165.103 1.00 42.23 ? 3531 HOH C O   1 
HETATM 9113 O  O   . HOH RA 6 .  ? 35.548  62.290  156.231 1.00 53.90 ? 3532 HOH C O   1 
HETATM 9114 O  O   . HOH RA 6 .  ? 13.052  59.583  136.574 1.00 44.75 ? 3533 HOH C O   1 
HETATM 9115 O  O   . HOH RA 6 .  ? 35.382  61.513  148.108 1.00 52.87 ? 3534 HOH C O   1 
HETATM 9116 O  O   . HOH RA 6 .  ? 7.804   54.909  139.414 1.00 41.13 ? 3535 HOH C O   1 
HETATM 9117 O  O   . HOH RA 6 .  ? 7.699   45.746  137.623 1.00 52.80 ? 3536 HOH C O   1 
HETATM 9118 O  O   . HOH RA 6 .  ? 7.375   48.803  138.089 1.00 54.49 ? 3537 HOH C O   1 
HETATM 9119 O  O   . HOH RA 6 .  ? 38.537  54.230  169.035 1.00 44.64 ? 3538 HOH C O   1 
HETATM 9120 O  O   . HOH RA 6 .  ? 30.325  48.059  154.352 1.00 62.48 ? 3539 HOH C O   1 
HETATM 9121 O  O   . HOH RA 6 .  ? 17.847  65.097  148.521 1.00 27.80 ? 3540 HOH C O   1 
HETATM 9122 O  O   . HOH RA 6 .  ? 25.701  65.883  146.902 1.00 46.63 ? 3541 HOH C O   1 
HETATM 9123 O  O   . HOH RA 6 .  ? 16.512  56.005  138.503 1.00 42.40 ? 3542 HOH C O   1 
HETATM 9124 O  O   . HOH RA 6 .  ? 37.042  48.528  147.098 1.00 48.69 ? 3543 HOH C O   1 
HETATM 9125 O  O   . HOH RA 6 .  ? 9.465   71.867  153.501 1.00 30.85 ? 3544 HOH C O   1 
HETATM 9126 O  O   . HOH RA 6 .  ? 9.392   46.888  149.388 1.00 37.82 ? 3545 HOH C O   1 
HETATM 9127 O  O   . HOH RA 6 .  ? 20.408  45.487  138.696 1.00 52.74 ? 3546 HOH C O   1 
HETATM 9128 O  O   . HOH RA 6 .  ? 4.546   49.668  141.506 1.00 48.25 ? 3547 HOH C O   1 
HETATM 9129 O  O   . HOH RA 6 .  ? 20.582  67.101  166.082 1.00 36.53 ? 3548 HOH C O   1 
HETATM 9130 O  O   . HOH RA 6 .  ? 13.458  64.287  137.466 1.00 36.74 ? 3549 HOH C O   1 
HETATM 9131 O  O   . HOH RA 6 .  ? 9.913   48.137  137.647 1.00 44.09 ? 3550 HOH C O   1 
HETATM 9132 O  O   . HOH RA 6 .  ? 8.650   69.765  161.439 1.00 53.71 ? 3551 HOH C O   1 
HETATM 9133 O  O   . HOH RA 6 .  ? 10.500  69.211  163.585 1.00 48.79 ? 3552 HOH C O   1 
HETATM 9134 O  O   . HOH RA 6 .  ? 4.740   57.693  144.490 1.00 45.78 ? 3553 HOH C O   1 
HETATM 9135 O  O   . HOH RA 6 .  ? 32.740  56.454  158.915 1.00 50.91 ? 3554 HOH C O   1 
HETATM 9136 O  O   . HOH RA 6 .  ? 16.960  64.058  150.534 1.00 45.92 ? 3555 HOH C O   1 
HETATM 9137 O  O   . HOH RA 6 .  ? 11.732  46.477  138.853 1.00 43.22 ? 3556 HOH C O   1 
HETATM 9138 O  O   . HOH RA 6 .  ? 13.378  49.379  138.062 1.00 35.46 ? 3557 HOH C O   1 
HETATM 9139 O  O   . HOH RA 6 .  ? 11.258  51.019  134.833 1.00 51.35 ? 3558 HOH C O   1 
HETATM 9140 O  O   . HOH RA 6 .  ? 25.021  58.817  139.893 1.00 45.29 ? 3559 HOH C O   1 
HETATM 9141 O  O   . HOH RA 6 .  ? 25.911  56.602  139.754 1.00 40.51 ? 3560 HOH C O   1 
HETATM 9142 O  O   . HOH RA 6 .  ? 17.243  66.221  150.733 1.00 29.89 ? 3561 HOH C O   1 
HETATM 9143 O  O   . HOH RA 6 .  ? 12.050  48.454  139.954 1.00 33.23 ? 3562 HOH C O   1 
HETATM 9144 O  O   . HOH RA 6 .  ? 25.294  40.227  155.142 1.00 46.95 ? 3563 HOH C O   1 
HETATM 9145 O  O   . HOH RA 6 .  ? 15.105  68.349  169.149 1.00 38.21 ? 3564 HOH C O   1 
HETATM 9146 O  O   . HOH RA 6 .  ? 5.029   51.561  146.143 1.00 61.12 ? 3565 HOH C O   1 
HETATM 9147 O  O   . HOH RA 6 .  ? 5.526   53.913  147.208 1.00 46.04 ? 3566 HOH C O   1 
HETATM 9148 O  O   . HOH RA 6 .  ? 20.148  40.393  144.096 1.00 52.45 ? 3567 HOH C O   1 
HETATM 9149 O  O   . HOH RA 6 .  ? 17.278  54.009  137.454 1.00 42.93 ? 3568 HOH C O   1 
HETATM 9150 O  O   . HOH RA 6 .  ? 7.354   55.992  147.141 1.00 41.11 ? 3569 HOH C O   1 
HETATM 9151 O  O   . HOH RA 6 .  ? 32.213  57.171  168.727 1.00 46.78 ? 3570 HOH C O   1 
HETATM 9152 O  O   . HOH RA 6 .  ? 17.024  64.028  139.153 1.00 35.94 ? 3571 HOH C O   1 
HETATM 9153 O  O   . HOH RA 6 .  ? 26.795  44.579  151.576 1.00 44.74 ? 3572 HOH C O   1 
HETATM 9154 O  O   . HOH RA 6 .  ? 9.956   60.138  159.461 1.00 30.73 ? 3573 HOH C O   1 
HETATM 9155 O  O   . HOH RA 6 .  ? 5.948   58.422  146.545 1.00 44.38 ? 3574 HOH C O   1 
HETATM 9156 O  O   . HOH RA 6 .  ? 27.279  39.283  146.933 1.00 46.13 ? 3575 HOH C O   1 
HETATM 9157 O  O   . HOH RA 6 .  ? 26.617  46.172  153.925 1.00 37.16 ? 3576 HOH C O   1 
HETATM 9158 O  O   . HOH RA 6 .  ? 8.714   48.627  152.845 1.00 34.60 ? 3577 HOH C O   1 
HETATM 9159 O  O   . HOH RA 6 .  ? 10.056  60.793  151.716 1.00 36.70 ? 3578 HOH C O   1 
HETATM 9160 O  O   . HOH RA 6 .  ? 35.691  53.981  152.077 1.00 37.25 ? 3579 HOH C O   1 
HETATM 9161 O  O   . HOH RA 6 .  ? 17.614  68.322  169.120 1.00 35.73 ? 3580 HOH C O   1 
HETATM 9162 O  O   . HOH RA 6 .  ? 18.081  61.614  138.168 1.00 45.49 ? 3581 HOH C O   1 
HETATM 9163 O  O   . HOH RA 6 .  ? 24.829  63.603  139.321 1.00 42.21 ? 3582 HOH C O   1 
HETATM 9164 O  O   . HOH RA 6 .  ? 7.528   57.018  140.515 1.00 34.42 ? 3583 HOH C O   1 
HETATM 9165 O  O   . HOH RA 6 .  ? 18.914  71.436  166.862 1.00 56.44 ? 3584 HOH C O   1 
HETATM 9166 O  O   . HOH RA 6 .  ? 19.805  67.681  151.302 1.00 36.73 ? 3585 HOH C O   1 
HETATM 9167 O  O   . HOH RA 6 .  ? 6.727   71.557  157.190 1.00 46.52 ? 3586 HOH C O   1 
HETATM 9168 O  O   . HOH RA 6 .  ? 32.561  59.019  164.958 1.00 49.22 ? 3587 HOH C O   1 
HETATM 9169 O  O   . HOH RA 6 .  ? 8.303   66.170  159.389 1.00 47.43 ? 3588 HOH C O   1 
HETATM 9170 O  O   . HOH RA 6 .  ? 30.350  54.672  171.636 1.00 57.24 ? 3589 HOH C O   1 
HETATM 9171 O  O   . HOH RA 6 .  ? 7.948   69.370  154.370 1.00 31.11 ? 3590 HOH C O   1 
HETATM 9172 O  O   . HOH RA 6 .  ? 5.674   61.325  148.482 1.00 35.82 ? 3591 HOH C O   1 
HETATM 9173 O  O   . HOH RA 6 .  ? 19.644  63.203  148.506 1.00 34.12 ? 3592 HOH C O   1 
HETATM 9174 O  O   . HOH RA 6 .  ? 7.177   50.383  145.361 1.00 29.50 ? 3593 HOH C O   1 
HETATM 9175 O  O   . HOH RA 6 .  ? 23.339  55.121  138.698 1.00 31.33 ? 3594 HOH C O   1 
HETATM 9176 O  O   . HOH RA 6 .  ? 35.357  57.568  145.567 1.00 35.90 ? 3595 HOH C O   1 
HETATM 9177 O  O   . HOH RA 6 .  ? 17.712  46.481  139.653 1.00 24.60 ? 3596 HOH C O   1 
HETATM 9178 O  O   . HOH RA 6 .  ? 18.857  50.096  137.476 1.00 28.52 ? 3597 HOH C O   1 
HETATM 9179 O  O   . HOH RA 6 .  ? 9.666   64.902  155.459 1.00 30.01 ? 3598 HOH C O   1 
HETATM 9180 O  O   . HOH RA 6 .  ? 12.023  43.547  152.187 1.00 38.06 ? 3599 HOH C O   1 
HETATM 9181 O  O   . HOH RA 6 .  ? 18.208  67.449  147.292 1.00 30.61 ? 3600 HOH C O   1 
HETATM 9182 O  O   . HOH RA 6 .  ? 14.421  66.038  156.427 1.00 30.18 ? 3601 HOH C O   1 
HETATM 9183 O  O   . HOH RA 6 .  ? 27.929  53.977  143.595 1.00 25.62 ? 3602 HOH C O   1 
HETATM 9184 O  O   . HOH RA 6 .  ? 12.855  62.925  149.526 1.00 24.63 ? 3603 HOH C O   1 
HETATM 9185 O  O   . HOH RA 6 .  ? 31.383  59.430  144.795 1.00 30.78 ? 3604 HOH C O   1 
HETATM 9186 O  O   . HOH RA 6 .  ? 22.528  39.957  153.865 1.00 22.85 ? 3605 HOH C O   1 
HETATM 9187 O  O   . HOH RA 6 .  ? 33.134  58.939  146.801 1.00 32.07 ? 3606 HOH C O   1 
HETATM 9188 O  O   . HOH RA 6 .  ? 12.346  63.421  147.447 1.00 29.75 ? 3607 HOH C O   1 
HETATM 9189 O  O   . HOH RA 6 .  ? 11.068  56.355  151.920 1.00 29.25 ? 3608 HOH C O   1 
HETATM 9190 O  O   . HOH RA 6 .  ? 20.588  63.276  152.338 1.00 27.34 ? 3609 HOH C O   1 
HETATM 9191 O  O   . HOH RA 6 .  ? 8.649   45.590  157.580 1.00 30.00 ? 3610 HOH C O   1 
HETATM 9192 O  O   . HOH RA 6 .  ? 23.075  67.831  150.649 1.00 26.61 ? 3611 HOH C O   1 
HETATM 9193 O  O   . HOH RA 6 .  ? 22.441  65.921  146.238 1.00 24.73 ? 3612 HOH C O   1 
HETATM 9194 O  O   . HOH RA 6 .  ? 16.403  65.562  141.478 1.00 18.99 ? 3613 HOH C O   1 
HETATM 9195 O  O   . HOH RA 6 .  ? 12.726  50.217  141.807 1.00 22.51 ? 3614 HOH C O   1 
HETATM 9196 O  O   . HOH RA 6 .  ? 13.054  43.807  147.887 1.00 29.92 ? 3615 HOH C O   1 
HETATM 9197 O  O   . HOH RA 6 .  ? 13.675  62.942  140.777 1.00 18.69 ? 3616 HOH C O   1 
HETATM 9198 O  O   . HOH RA 6 .  ? 19.057  66.991  160.919 1.00 26.15 ? 3617 HOH C O   1 
HETATM 9199 O  O   . HOH RA 6 .  ? 14.006  66.028  153.888 1.00 23.94 ? 3618 HOH C O   1 
HETATM 9200 O  O   . HOH RA 6 .  ? 11.363  59.908  161.797 1.00 29.17 ? 3619 HOH C O   1 
HETATM 9201 O  O   . HOH RA 6 .  ? 23.017  63.291  151.760 1.00 19.70 ? 3620 HOH C O   1 
HETATM 9202 O  O   . HOH RA 6 .  ? 17.194  67.499  159.397 1.00 21.96 ? 3621 HOH C O   1 
HETATM 9203 O  O   . HOH RA 6 .  ? 11.248  63.524  144.724 1.00 17.98 ? 3622 HOH C O   1 
HETATM 9204 O  O   . HOH RA 6 .  ? 19.571  43.530  153.960 1.00 20.39 ? 3623 HOH C O   1 
HETATM 9205 O  O   . HOH RA 6 .  ? 12.898  62.125  143.135 1.00 21.12 ? 3624 HOH C O   1 
HETATM 9206 O  O   . HOH RA 6 .  ? 10.388  55.582  149.473 1.00 25.17 ? 3625 HOH C O   1 
HETATM 9207 O  O   . HOH RA 6 .  ? 16.362  65.076  170.773 1.00 26.81 ? 3626 HOH C O   1 
HETATM 9208 O  O   . HOH RA 6 .  ? 19.302  64.378  160.286 1.00 19.56 ? 3627 HOH C O   1 
HETATM 9209 O  O   . HOH RA 6 .  ? 10.700  49.645  150.714 1.00 21.83 ? 3628 HOH C O   1 
HETATM 9210 O  O   . HOH RA 6 .  ? 15.239  65.502  158.900 1.00 17.69 ? 3629 HOH C O   1 
HETATM 9211 O  O   . HOH SA 6 .  ? 32.733  35.314  155.578 1.00 66.41 ? 4503 HOH D O   1 
HETATM 9212 O  O   . HOH SA 6 .  ? 34.264  33.903  195.546 1.00 63.70 ? 4504 HOH D O   1 
HETATM 9213 O  O   . HOH SA 6 .  ? 46.681  36.968  158.851 1.00 57.94 ? 4505 HOH D O   1 
HETATM 9214 O  O   . HOH SA 6 .  ? 41.120  54.730  181.024 1.00 64.35 ? 4506 HOH D O   1 
HETATM 9215 O  O   . HOH SA 6 .  ? 38.756  42.869  153.729 1.00 52.27 ? 4507 HOH D O   1 
HETATM 9216 O  O   . HOH SA 6 .  ? 40.815  42.713  154.791 1.00 50.28 ? 4508 HOH D O   1 
HETATM 9217 O  O   . HOH SA 6 .  ? 35.884  52.492  172.492 1.00 54.24 ? 4509 HOH D O   1 
HETATM 9218 O  O   . HOH SA 6 .  ? 45.105  48.868  168.848 1.00 55.32 ? 4510 HOH D O   1 
HETATM 9219 O  O   . HOH SA 6 .  ? 47.189  40.447  161.999 1.00 50.12 ? 4511 HOH D O   1 
HETATM 9220 O  O   . HOH SA 6 .  ? 31.004  28.008  186.452 1.00 51.96 ? 4512 HOH D O   1 
HETATM 9221 O  O   . HOH SA 6 .  ? 45.830  43.749  185.913 1.00 48.33 ? 4513 HOH D O   1 
HETATM 9222 O  O   . HOH SA 6 .  ? 29.496  42.866  191.279 1.00 50.26 ? 4514 HOH D O   1 
HETATM 9223 O  O   . HOH SA 6 .  ? 26.817  40.457  189.154 1.00 47.69 ? 4515 HOH D O   1 
HETATM 9224 O  O   . HOH SA 6 .  ? 42.991  41.674  157.289 1.00 50.22 ? 4516 HOH D O   1 
HETATM 9225 O  O   . HOH SA 6 .  ? 47.407  51.960  171.229 1.00 51.39 ? 4517 HOH D O   1 
HETATM 9226 O  O   . HOH SA 6 .  ? 55.570  46.668  163.371 1.00 46.70 ? 4518 HOH D O   1 
HETATM 9227 O  O   . HOH SA 6 .  ? 31.387  29.061  189.509 1.00 51.00 ? 4519 HOH D O   1 
HETATM 9228 O  O   . HOH SA 6 .  ? 50.333  45.642  184.872 1.00 53.95 ? 4520 HOH D O   1 
HETATM 9229 O  O   . HOH SA 6 .  ? 22.910  18.358  170.197 1.00 44.11 ? 4521 HOH D O   1 
HETATM 9230 O  O   . HOH SA 6 .  ? 29.353  49.015  172.432 1.00 52.01 ? 4522 HOH D O   1 
HETATM 9231 O  O   . HOH SA 6 .  ? 50.080  40.967  176.307 1.00 52.71 ? 4523 HOH D O   1 
HETATM 9232 O  O   . HOH SA 6 .  ? 32.501  20.113  164.755 1.00 47.49 ? 4524 HOH D O   1 
HETATM 9233 O  O   . HOH SA 6 .  ? 31.363  50.126  171.286 1.00 51.96 ? 4525 HOH D O   1 
HETATM 9234 O  O   . HOH SA 6 .  ? 38.181  45.115  169.774 1.00 51.01 ? 4526 HOH D O   1 
HETATM 9235 O  O   . HOH SA 6 .  ? 57.144  45.988  167.177 1.00 53.72 ? 4527 HOH D O   1 
HETATM 9236 O  O   . HOH SA 6 .  ? 43.641  36.719  162.530 1.00 53.57 ? 4528 HOH D O   1 
HETATM 9237 O  O   . HOH SA 6 .  ? 34.553  24.866  160.758 1.00 51.00 ? 4529 HOH D O   1 
HETATM 9238 O  O   . HOH SA 6 .  ? 52.687  36.716  166.483 1.00 47.60 ? 4530 HOH D O   1 
HETATM 9239 O  O   . HOH SA 6 .  ? 51.712  48.079  176.963 1.00 38.36 ? 4531 HOH D O   1 
HETATM 9240 O  O   . HOH SA 6 .  ? 52.993  36.501  163.407 1.00 56.36 ? 4532 HOH D O   1 
HETATM 9241 O  O   . HOH SA 6 .  ? 55.075  43.426  172.411 1.00 44.25 ? 4533 HOH D O   1 
HETATM 9242 O  O   . HOH SA 6 .  ? 27.502  16.386  165.482 1.00 41.54 ? 4534 HOH D O   1 
HETATM 9243 O  O   . HOH SA 6 .  ? 44.968  41.009  163.705 1.00 54.38 ? 4535 HOH D O   1 
HETATM 9244 O  O   . HOH SA 6 .  ? 50.644  52.361  176.731 1.00 49.41 ? 4536 HOH D O   1 
HETATM 9245 O  O   . HOH SA 6 .  ? 33.697  22.543  165.607 1.00 39.43 ? 4537 HOH D O   1 
HETATM 9246 O  O   . HOH SA 6 .  ? 36.238  26.982  160.283 1.00 36.47 ? 4538 HOH D O   1 
HETATM 9247 O  O   . HOH SA 6 .  ? 30.398  38.898  190.664 1.00 49.16 ? 4539 HOH D O   1 
HETATM 9248 O  O   . HOH SA 6 .  ? 34.826  44.587  172.248 1.00 48.98 ? 4540 HOH D O   1 
HETATM 9249 O  O   . HOH SA 6 .  ? 45.358  28.249  182.734 1.00 44.35 ? 4541 HOH D O   1 
HETATM 9250 O  O   . HOH SA 6 .  ? 41.316  38.041  161.952 1.00 51.15 ? 4542 HOH D O   1 
HETATM 9251 O  O   . HOH SA 6 .  ? 28.671  36.563  187.119 1.00 39.90 ? 4543 HOH D O   1 
HETATM 9252 O  O   . HOH SA 6 .  ? 33.296  49.720  183.388 1.00 32.74 ? 4544 HOH D O   1 
HETATM 9253 O  O   . HOH SA 6 .  ? 33.780  23.184  180.427 1.00 42.34 ? 4545 HOH D O   1 
HETATM 9254 O  O   . HOH SA 6 .  ? 52.712  46.324  176.544 1.00 43.23 ? 4546 HOH D O   1 
HETATM 9255 O  O   . HOH SA 6 .  ? 34.278  26.405  189.248 1.00 50.79 ? 4547 HOH D O   1 
HETATM 9256 O  O   . HOH SA 6 .  ? 33.707  50.162  171.656 1.00 42.50 ? 4548 HOH D O   1 
HETATM 9257 O  O   . HOH SA 6 .  ? 40.437  36.254  159.718 1.00 51.23 ? 4549 HOH D O   1 
HETATM 9258 O  O   . HOH SA 6 .  ? 39.821  38.946  163.013 1.00 50.28 ? 4550 HOH D O   1 
HETATM 9259 O  O   . HOH SA 6 .  ? 36.919  52.896  182.499 1.00 49.17 ? 4551 HOH D O   1 
HETATM 9260 O  O   . HOH SA 6 .  ? 37.944  43.959  157.643 1.00 44.26 ? 4552 HOH D O   1 
HETATM 9261 O  O   . HOH SA 6 .  ? 33.418  28.726  187.754 1.00 42.69 ? 4553 HOH D O   1 
HETATM 9262 O  O   . HOH SA 6 .  ? 50.112  37.307  172.730 1.00 49.14 ? 4554 HOH D O   1 
HETATM 9263 O  O   . HOH SA 6 .  ? 49.417  38.545  170.158 1.00 37.07 ? 4555 HOH D O   1 
HETATM 9264 O  O   . HOH SA 6 .  ? 36.451  47.927  184.315 1.00 37.59 ? 4556 HOH D O   1 
HETATM 9265 O  O   . HOH SA 6 .  ? 51.272  39.923  174.513 1.00 49.61 ? 4557 HOH D O   1 
HETATM 9266 O  O   . HOH SA 6 .  ? 29.775  47.901  176.318 1.00 29.85 ? 4558 HOH D O   1 
HETATM 9267 O  O   . HOH SA 6 .  ? 37.359  21.849  186.914 1.00 34.34 ? 4559 HOH D O   1 
HETATM 9268 O  O   . HOH SA 6 .  ? 34.351  24.546  182.105 1.00 47.43 ? 4560 HOH D O   1 
HETATM 9269 O  O   . HOH SA 6 .  ? 47.932  38.698  183.800 1.00 46.05 ? 4561 HOH D O   1 
HETATM 9270 O  O   . HOH SA 6 .  ? 27.046  34.601  184.741 1.00 33.21 ? 4562 HOH D O   1 
HETATM 9271 O  O   . HOH SA 6 .  ? 37.163  42.893  160.439 1.00 38.26 ? 4563 HOH D O   1 
HETATM 9272 O  O   . HOH SA 6 .  ? 27.696  23.913  174.094 1.00 29.13 ? 4564 HOH D O   1 
HETATM 9273 O  O   . HOH SA 6 .  ? 36.334  24.283  188.887 1.00 37.38 ? 4565 HOH D O   1 
HETATM 9274 O  O   . HOH SA 6 .  ? 26.958  40.553  184.165 1.00 31.00 ? 4566 HOH D O   1 
HETATM 9275 O  O   . HOH SA 6 .  ? 44.946  42.556  165.690 1.00 39.04 ? 4567 HOH D O   1 
HETATM 9276 O  O   . HOH SA 6 .  ? 37.502  37.431  189.391 1.00 21.50 ? 4568 HOH D O   1 
HETATM 9277 O  O   . HOH SA 6 .  ? 42.158  26.774  185.558 1.00 29.01 ? 4569 HOH D O   1 
HETATM 9278 O  O   . HOH SA 6 .  ? 27.366  35.928  155.354 1.00 31.01 ? 4570 HOH D O   1 
HETATM 9279 O  O   . HOH SA 6 .  ? 38.850  24.449  188.569 1.00 24.84 ? 4571 HOH D O   1 
HETATM 9280 O  O   . HOH SA 6 .  ? 40.083  43.436  187.937 1.00 25.57 ? 4572 HOH D O   1 
HETATM 9281 O  O   . HOH SA 6 .  ? 38.443  25.150  182.319 1.00 28.25 ? 4573 HOH D O   1 
HETATM 9282 O  O   . HOH SA 6 .  ? 32.507  28.970  182.153 1.00 27.79 ? 4574 HOH D O   1 
HETATM 9283 O  O   . HOH SA 6 .  ? 31.769  33.780  190.723 1.00 29.01 ? 4575 HOH D O   1 
HETATM 9284 O  O   . HOH SA 6 .  ? 29.632  34.753  184.767 1.00 19.33 ? 4576 HOH D O   1 
HETATM 9285 O  O   . HOH SA 6 .  ? 33.806  30.098  184.657 1.00 26.30 ? 4577 HOH D O   1 
HETATM 9286 O  O   . HOH SA 6 .  ? 27.314  19.732  163.514 1.00 27.39 ? 4578 HOH D O   1 
HETATM 9287 O  O   . HOH SA 6 .  ? 30.396  41.444  186.338 1.00 25.35 ? 4579 HOH D O   1 
HETATM 9288 O  O   . HOH SA 6 .  ? 25.554  32.831  181.521 1.00 30.52 ? 4580 HOH D O   1 
HETATM 9289 O  O   . HOH SA 6 .  ? 40.506  24.011  180.959 1.00 19.76 ? 4581 HOH D O   1 
HETATM 9290 O  O   . HOH SA 6 .  ? 37.562  22.293  182.865 1.00 24.13 ? 4582 HOH D O   1 
HETATM 9291 O  O   . HOH SA 6 .  ? 42.611  28.597  172.890 1.00 22.38 ? 4583 HOH D O   1 
HETATM 9292 O  O   . HOH SA 6 .  ? 35.409  24.160  169.073 1.00 24.36 ? 4584 HOH D O   1 
HETATM 9293 O  O   . HOH SA 6 .  ? 29.784  43.503  177.674 1.00 18.29 ? 4585 HOH D O   1 
HETATM 9294 O  O   . HOH SA 6 .  ? 27.093  43.163  183.807 1.00 21.59 ? 4586 HOH D O   1 
HETATM 9295 O  O   . HOH TA 6 .  ? -4.564  60.899  108.558 1.00 57.68 ? 1513 HOH E O   1 
HETATM 9296 O  O   . HOH TA 6 .  ? 21.999  59.373  117.904 1.00 52.16 ? 1514 HOH E O   1 
HETATM 9297 O  O   . HOH TA 6 .  ? 25.437  66.105  113.710 1.00 49.26 ? 1515 HOH E O   1 
HETATM 9298 O  O   . HOH TA 6 .  ? 10.801  65.834  124.410 1.00 53.06 ? 1516 HOH E O   1 
HETATM 9299 O  O   . HOH TA 6 .  ? 23.734  69.851  108.657 1.00 50.78 ? 1517 HOH E O   1 
HETATM 9300 O  O   . HOH TA 6 .  ? 5.532   62.207  82.638  1.00 45.02 ? 1518 HOH E O   1 
HETATM 9301 O  O   . HOH TA 6 .  ? 1.825   65.104  125.298 1.00 52.86 ? 1519 HOH E O   1 
HETATM 9302 O  O   . HOH TA 6 .  ? -0.521  65.245  116.333 1.00 45.27 ? 1520 HOH E O   1 
HETATM 9303 O  O   . HOH TA 6 .  ? 2.719   62.665  95.487  1.00 46.49 ? 1521 HOH E O   1 
HETATM 9304 O  O   . HOH TA 6 .  ? -2.632  60.231  110.433 1.00 49.20 ? 1522 HOH E O   1 
HETATM 9305 O  O   . HOH TA 6 .  ? -2.351  58.354  104.037 1.00 40.54 ? 1523 HOH E O   1 
HETATM 9306 O  O   . HOH TA 6 .  ? 13.562  68.001  82.854  1.00 40.26 ? 1524 HOH E O   1 
HETATM 9307 O  O   . HOH TA 6 .  ? 11.486  50.272  103.712 1.00 42.75 ? 1525 HOH E O   1 
HETATM 9308 O  O   . HOH TA 6 .  ? 13.412  65.279  123.003 1.00 36.29 ? 1526 HOH E O   1 
HETATM 9309 O  O   . HOH TA 6 .  ? -1.121  60.892  95.924  1.00 51.77 ? 1527 HOH E O   1 
HETATM 9310 O  O   . HOH TA 6 .  ? 33.021  63.074  101.141 1.00 63.02 ? 1528 HOH E O   1 
HETATM 9311 O  O   . HOH TA 6 .  ? 18.123  54.160  111.168 1.00 43.77 ? 1529 HOH E O   1 
HETATM 9312 O  O   . HOH TA 6 .  ? -5.224  69.399  103.984 1.00 50.66 ? 1530 HOH E O   1 
HETATM 9313 O  O   . HOH TA 6 .  ? -4.554  50.441  108.127 1.00 51.67 ? 1531 HOH E O   1 
HETATM 9314 O  O   . HOH TA 6 .  ? 7.347   56.567  117.979 1.00 39.46 ? 1532 HOH E O   1 
HETATM 9315 O  O   . HOH TA 6 .  ? -1.000  68.816  118.707 1.00 41.88 ? 1533 HOH E O   1 
HETATM 9316 O  O   . HOH TA 6 .  ? 17.998  70.811  115.925 1.00 41.82 ? 1534 HOH E O   1 
HETATM 9317 O  O   . HOH TA 6 .  ? 12.513  67.737  126.207 1.00 52.57 ? 1535 HOH E O   1 
HETATM 9318 O  O   . HOH TA 6 .  ? 7.365   62.465  120.456 1.00 50.28 ? 1536 HOH E O   1 
HETATM 9319 O  O   . HOH TA 6 .  ? 20.542  53.533  110.464 1.00 54.22 ? 1537 HOH E O   1 
HETATM 9320 O  O   . HOH TA 6 .  ? 2.295   70.704  106.639 1.00 44.17 ? 1538 HOH E O   1 
HETATM 9321 O  O   . HOH TA 6 .  ? 36.538  61.886  96.769  1.00 55.49 ? 1539 HOH E O   1 
HETATM 9322 O  O   . HOH TA 6 .  ? 18.138  70.461  113.632 1.00 38.92 ? 1540 HOH E O   1 
HETATM 9323 O  O   . HOH TA 6 .  ? 21.907  61.709  109.004 1.00 45.71 ? 1541 HOH E O   1 
HETATM 9324 O  O   . HOH TA 6 .  ? 2.260   64.500  90.307  1.00 47.46 ? 1542 HOH E O   1 
HETATM 9325 O  O   . HOH TA 6 .  ? -0.663  50.490  107.861 1.00 54.35 ? 1543 HOH E O   1 
HETATM 9326 O  O   . HOH TA 6 .  ? 3.018   65.395  120.384 1.00 35.02 ? 1544 HOH E O   1 
HETATM 9327 O  O   . HOH TA 6 .  ? 4.390   59.732  117.247 1.00 36.42 ? 1545 HOH E O   1 
HETATM 9328 O  O   . HOH TA 6 .  ? -1.944  52.880  108.643 1.00 39.47 ? 1546 HOH E O   1 
HETATM 9329 O  O   . HOH TA 6 .  ? 19.672  61.111  110.607 1.00 44.56 ? 1547 HOH E O   1 
HETATM 9330 O  O   . HOH TA 6 .  ? 18.282  74.560  106.920 1.00 49.47 ? 1548 HOH E O   1 
HETATM 9331 O  O   . HOH TA 6 .  ? 9.654   62.896  121.424 1.00 40.60 ? 1549 HOH E O   1 
HETATM 9332 O  O   . HOH TA 6 .  ? 30.922  67.065  99.279  1.00 43.78 ? 1550 HOH E O   1 
HETATM 9333 O  O   . HOH TA 6 .  ? 23.632  72.281  105.280 1.00 54.43 ? 1551 HOH E O   1 
HETATM 9334 O  O   . HOH TA 6 .  ? 16.928  63.566  122.072 1.00 43.54 ? 1552 HOH E O   1 
HETATM 9335 O  O   . HOH TA 6 .  ? 4.012   62.421  117.601 1.00 42.64 ? 1553 HOH E O   1 
HETATM 9336 O  O   . HOH TA 6 .  ? 30.801  73.893  93.943  1.00 42.87 ? 1554 HOH E O   1 
HETATM 9337 O  O   . HOH TA 6 .  ? -3.620  68.704  107.591 1.00 49.90 ? 1555 HOH E O   1 
HETATM 9338 O  O   . HOH TA 6 .  ? 4.725   61.597  93.136  1.00 38.74 ? 1556 HOH E O   1 
HETATM 9339 O  O   . HOH TA 6 .  ? 6.248   58.207  119.351 1.00 40.61 ? 1557 HOH E O   1 
HETATM 9340 O  O   . HOH TA 6 .  ? 3.471   62.113  90.447  1.00 34.32 ? 1558 HOH E O   1 
HETATM 9341 O  O   . HOH TA 6 .  ? 25.086  70.893  96.282  1.00 42.16 ? 1559 HOH E O   1 
HETATM 9342 O  O   . HOH TA 6 .  ? 12.176  79.549  117.608 1.00 42.24 ? 1560 HOH E O   1 
HETATM 9343 O  O   . HOH TA 6 .  ? 1.079   67.936  117.155 1.00 42.01 ? 1561 HOH E O   1 
HETATM 9344 O  O   . HOH TA 6 .  ? 25.044  64.247  104.283 1.00 39.17 ? 1562 HOH E O   1 
HETATM 9345 O  O   . HOH TA 6 .  ? 29.580  67.327  88.713  1.00 38.14 ? 1563 HOH E O   1 
HETATM 9346 O  O   . HOH TA 6 .  ? 0.403   66.896  111.688 1.00 47.14 ? 1564 HOH E O   1 
HETATM 9347 O  O   . HOH TA 6 .  ? 5.093   61.152  115.755 1.00 38.66 ? 1565 HOH E O   1 
HETATM 9348 O  O   . HOH TA 6 .  ? 14.687  72.299  112.003 1.00 45.11 ? 1566 HOH E O   1 
HETATM 9349 O  O   . HOH TA 6 .  ? 2.840   66.640  89.441  1.00 42.64 ? 1567 HOH E O   1 
HETATM 9350 O  O   . HOH TA 6 .  ? 20.803  70.946  107.192 1.00 49.93 ? 1568 HOH E O   1 
HETATM 9351 O  O   . HOH TA 6 .  ? 4.235   76.837  113.303 1.00 35.84 ? 1569 HOH E O   1 
HETATM 9352 O  O   . HOH TA 6 .  ? -0.947  69.787  106.724 1.00 38.15 ? 1570 HOH E O   1 
HETATM 9353 O  O   . HOH TA 6 .  ? 5.259   75.874  96.567  1.00 47.89 ? 1571 HOH E O   1 
HETATM 9354 O  O   . HOH TA 6 .  ? 10.757  77.420  117.473 1.00 30.95 ? 1572 HOH E O   1 
HETATM 9355 O  O   . HOH TA 6 .  ? 28.572  73.067  94.688  1.00 46.86 ? 1573 HOH E O   1 
HETATM 9356 O  O   . HOH TA 6 .  ? 2.168   65.044  110.570 1.00 43.58 ? 1574 HOH E O   1 
HETATM 9357 O  O   . HOH TA 6 .  ? 9.230   76.004  115.699 1.00 33.57 ? 1575 HOH E O   1 
HETATM 9358 O  O   . HOH TA 6 .  ? 25.506  67.529  102.513 1.00 31.70 ? 1576 HOH E O   1 
HETATM 9359 O  O   . HOH TA 6 .  ? 3.840   55.064  101.509 1.00 36.16 ? 1577 HOH E O   1 
HETATM 9360 O  O   . HOH TA 6 .  ? 6.385   66.014  121.140 1.00 31.16 ? 1578 HOH E O   1 
HETATM 9361 O  O   . HOH TA 6 .  ? 10.440  69.330  94.679  1.00 38.19 ? 1579 HOH E O   1 
HETATM 9362 O  O   . HOH TA 6 .  ? 14.917  68.285  121.791 1.00 38.12 ? 1580 HOH E O   1 
HETATM 9363 O  O   . HOH TA 6 .  ? 7.980   66.415  123.460 1.00 31.43 ? 1581 HOH E O   1 
HETATM 9364 O  O   . HOH TA 6 .  ? 8.071   71.206  91.322  1.00 32.69 ? 1582 HOH E O   1 
HETATM 9365 O  O   . HOH TA 6 .  ? 15.105  71.081  118.880 1.00 35.84 ? 1583 HOH E O   1 
HETATM 9366 O  O   . HOH TA 6 .  ? 4.746   74.361  112.715 1.00 26.26 ? 1584 HOH E O   1 
HETATM 9367 O  O   . HOH TA 6 .  ? 0.398   48.980  114.781 1.00 34.73 ? 1585 HOH E O   1 
HETATM 9368 O  O   . HOH TA 6 .  ? 9.219   70.571  89.015  1.00 30.71 ? 1586 HOH E O   1 
HETATM 9369 O  O   . HOH TA 6 .  ? 15.896  53.705  107.989 1.00 27.84 ? 1587 HOH E O   1 
HETATM 9370 O  O   . HOH TA 6 .  ? 2.567   54.436  96.733  1.00 28.90 ? 1588 HOH E O   1 
HETATM 9371 O  O   . HOH TA 6 .  ? 18.789  58.926  119.258 1.00 31.28 ? 1589 HOH E O   1 
HETATM 9372 O  O   . HOH TA 6 .  ? 12.763  52.524  112.626 1.00 20.61 ? 1590 HOH E O   1 
HETATM 9373 O  O   . HOH TA 6 .  ? 3.368   72.862  114.271 1.00 22.77 ? 1591 HOH E O   1 
HETATM 9374 O  O   . HOH TA 6 .  ? 16.417  56.789  110.559 1.00 21.61 ? 1592 HOH E O   1 
HETATM 9375 O  O   . HOH TA 6 .  ? 3.507   66.655  118.308 1.00 25.15 ? 1593 HOH E O   1 
HETATM 9376 O  O   . HOH TA 6 .  ? 0.900   54.358  109.039 1.00 27.31 ? 1594 HOH E O   1 
HETATM 9377 O  O   . HOH TA 6 .  ? 28.401  65.664  100.131 1.00 26.64 ? 1595 HOH E O   1 
HETATM 9378 O  O   . HOH TA 6 .  ? 8.081   69.077  116.812 1.00 35.82 ? 1596 HOH E O   1 
HETATM 9379 O  O   . HOH TA 6 .  ? 24.203  69.462  94.135  1.00 32.97 ? 1597 HOH E O   1 
HETATM 9380 O  O   . HOH TA 6 .  ? 26.244  67.347  99.908  1.00 25.77 ? 1598 HOH E O   1 
HETATM 9381 O  O   . HOH TA 6 .  ? 1.567   69.348  114.782 1.00 28.36 ? 1599 HOH E O   1 
HETATM 9382 O  O   . HOH TA 6 .  ? 7.783   61.695  86.578  1.00 28.83 ? 1600 HOH E O   1 
HETATM 9383 O  O   . HOH TA 6 .  ? 2.174   48.540  109.953 1.00 28.61 ? 1601 HOH E O   1 
HETATM 9384 O  O   . HOH TA 6 .  ? 8.118   67.781  94.351  1.00 20.84 ? 1602 HOH E O   1 
HETATM 9385 O  O   . HOH TA 6 .  ? 5.276   65.369  116.985 1.00 17.14 ? 1603 HOH E O   1 
HETATM 9386 O  O   . HOH TA 6 .  ? 12.878  64.814  115.441 1.00 16.62 ? 1604 HOH E O   1 
HETATM 9387 O  O   . HOH TA 6 .  ? 9.689   53.775  112.082 1.00 19.56 ? 1605 HOH E O   1 
HETATM 9388 O  O   . HOH UA 6 .  ? -5.789  44.468  109.077 1.00 57.71 ? 2513 HOH F O   1 
HETATM 9389 O  O   . HOH UA 6 .  ? -10.057 38.096  86.145  1.00 62.23 ? 2514 HOH F O   1 
HETATM 9390 O  O   . HOH UA 6 .  ? -2.196  44.512  120.001 1.00 51.50 ? 2515 HOH F O   1 
HETATM 9391 O  O   . HOH UA 6 .  ? -0.358  55.924  89.513  1.00 51.62 ? 2516 HOH F O   1 
HETATM 9392 O  O   . HOH UA 6 .  ? 19.434  40.430  92.649  1.00 53.83 ? 2517 HOH F O   1 
HETATM 9393 O  O   . HOH UA 6 .  ? 22.113  29.935  97.503  1.00 49.56 ? 2518 HOH F O   1 
HETATM 9394 O  O   . HOH UA 6 .  ? -10.183 31.781  102.783 1.00 48.44 ? 2519 HOH F O   1 
HETATM 9395 O  O   . HOH UA 6 .  ? -5.851  35.920  89.695  1.00 53.94 ? 2520 HOH F O   1 
HETATM 9396 O  O   . HOH UA 6 .  ? 16.205  38.207  90.637  1.00 55.69 ? 2521 HOH F O   1 
HETATM 9397 O  O   . HOH UA 6 .  ? -2.871  37.842  83.899  1.00 48.51 ? 2522 HOH F O   1 
HETATM 9398 O  O   . HOH UA 6 .  ? 20.007  23.596  107.312 1.00 45.69 ? 2523 HOH F O   1 
HETATM 9399 O  O   . HOH UA 6 .  ? 22.458  23.284  106.674 1.00 50.05 ? 2524 HOH F O   1 
HETATM 9400 O  O   . HOH UA 6 .  ? 19.094  24.953  95.906  1.00 26.08 ? 2525 HOH F O   1 
HETATM 9401 O  O   . HOH UA 6 .  ? -8.066  37.461  96.901  1.00 47.30 ? 2526 HOH F O   1 
HETATM 9402 O  O   . HOH UA 6 .  ? 0.427   42.642  84.114  1.00 45.27 ? 2527 HOH F O   1 
HETATM 9403 O  O   . HOH UA 6 .  ? -4.157  50.274  91.656  1.00 49.10 ? 2528 HOH F O   1 
HETATM 9404 O  O   . HOH UA 6 .  ? 3.461   31.478  91.291  1.00 33.57 ? 2529 HOH F O   1 
HETATM 9405 O  O   . HOH UA 6 .  ? -10.526 38.166  98.694  1.00 48.35 ? 2530 HOH F O   1 
HETATM 9406 O  O   . HOH UA 6 .  ? -6.096  59.038  94.262  1.00 45.91 ? 2531 HOH F O   1 
HETATM 9407 O  O   . HOH UA 6 .  ? -8.642  41.846  94.367  1.00 48.27 ? 2532 HOH F O   1 
HETATM 9408 O  O   . HOH UA 6 .  ? 21.810  33.725  103.914 1.00 35.28 ? 2533 HOH F O   1 
HETATM 9409 O  O   . HOH UA 6 .  ? 20.265  26.238  98.691  1.00 39.97 ? 2534 HOH F O   1 
HETATM 9410 O  O   . HOH UA 6 .  ? 3.174   52.410  84.282  1.00 40.18 ? 2535 HOH F O   1 
HETATM 9411 O  O   . HOH UA 6 .  ? 0.154   56.201  93.699  1.00 37.87 ? 2536 HOH F O   1 
HETATM 9412 O  O   . HOH UA 6 .  ? -8.543  45.056  93.191  1.00 45.27 ? 2537 HOH F O   1 
HETATM 9413 O  O   . HOH UA 6 .  ? 19.316  35.264  99.441  1.00 50.56 ? 2538 HOH F O   1 
HETATM 9414 O  O   . HOH UA 6 .  ? 16.401  51.690  100.967 1.00 45.59 ? 2539 HOH F O   1 
HETATM 9415 O  O   . HOH UA 6 .  ? -4.831  45.397  111.873 1.00 55.07 ? 2540 HOH F O   1 
HETATM 9416 O  O   . HOH UA 6 .  ? -2.971  29.471  101.015 1.00 55.73 ? 2541 HOH F O   1 
HETATM 9417 O  O   . HOH UA 6 .  ? 15.943  44.480  93.995  1.00 52.19 ? 2542 HOH F O   1 
HETATM 9418 O  O   . HOH UA 6 .  ? 10.549  51.147  99.628  1.00 41.25 ? 2543 HOH F O   1 
HETATM 9419 O  O   . HOH UA 6 .  ? -4.677  42.335  87.983  1.00 50.67 ? 2544 HOH F O   1 
HETATM 9420 O  O   . HOH UA 6 .  ? 1.686   45.124  83.815  1.00 38.06 ? 2545 HOH F O   1 
HETATM 9421 O  O   . HOH UA 6 .  ? -2.178  46.212  111.548 1.00 36.27 ? 2546 HOH F O   1 
HETATM 9422 O  O   . HOH UA 6 .  ? 20.871  28.065  102.502 1.00 45.11 ? 2547 HOH F O   1 
HETATM 9423 O  O   . HOH UA 6 .  ? 22.237  27.800  104.221 1.00 38.72 ? 2548 HOH F O   1 
HETATM 9424 O  O   . HOH UA 6 .  ? 21.628  27.046  114.491 1.00 53.04 ? 2549 HOH F O   1 
HETATM 9425 O  O   . HOH UA 6 .  ? 0.000   48.241  109.814 1.00 46.76 ? 2550 HOH F O   1 
HETATM 9426 O  O   . HOH UA 6 .  ? 11.118  50.762  101.613 1.00 45.45 ? 2551 HOH F O   1 
HETATM 9427 O  O   . HOH UA 6 .  ? -5.632  43.525  90.260  1.00 41.17 ? 2552 HOH F O   1 
HETATM 9428 O  O   . HOH UA 6 .  ? 21.127  26.575  106.458 1.00 35.16 ? 2553 HOH F O   1 
HETATM 9429 O  O   . HOH UA 6 .  ? 11.054  27.845  102.658 1.00 33.55 ? 2554 HOH F O   1 
HETATM 9430 O  O   . HOH UA 6 .  ? -7.370  33.869  105.662 1.00 35.25 ? 2555 HOH F O   1 
HETATM 9431 O  O   . HOH UA 6 .  ? -0.695  46.084  109.141 1.00 38.04 ? 2556 HOH F O   1 
HETATM 9432 O  O   . HOH UA 6 .  ? 16.577  33.110  99.461  1.00 35.35 ? 2557 HOH F O   1 
HETATM 9433 O  O   . HOH UA 6 .  ? -0.333  28.876  99.731  1.00 36.62 ? 2558 HOH F O   1 
HETATM 9434 O  O   . HOH UA 6 .  ? -2.823  36.196  111.042 1.00 34.31 ? 2559 HOH F O   1 
HETATM 9435 O  O   . HOH UA 6 .  ? -3.729  37.634  88.598  1.00 35.97 ? 2560 HOH F O   1 
HETATM 9436 O  O   . HOH UA 6 .  ? 0.116   50.557  87.000  1.00 41.76 ? 2561 HOH F O   1 
HETATM 9437 O  O   . HOH UA 6 .  ? -1.539  35.822  113.500 1.00 30.71 ? 2562 HOH F O   1 
HETATM 9438 O  O   . HOH UA 6 .  ? 1.134   36.706  83.859  1.00 38.59 ? 2563 HOH F O   1 
HETATM 9439 O  O   . HOH UA 6 .  ? 4.808   47.096  83.327  1.00 45.25 ? 2564 HOH F O   1 
HETATM 9440 O  O   . HOH UA 6 .  ? -2.909  46.197  106.362 1.00 43.67 ? 2565 HOH F O   1 
HETATM 9441 O  O   . HOH UA 6 .  ? 0.395   53.192  90.956  1.00 39.32 ? 2566 HOH F O   1 
HETATM 9442 O  O   . HOH UA 6 .  ? 10.290  46.263  89.926  1.00 30.09 ? 2567 HOH F O   1 
HETATM 9443 O  O   . HOH UA 6 .  ? -2.410  51.896  90.722  1.00 36.87 ? 2568 HOH F O   1 
HETATM 9444 O  O   . HOH UA 6 .  ? -0.016  36.428  86.910  1.00 39.53 ? 2569 HOH F O   1 
HETATM 9445 O  O   . HOH UA 6 .  ? 13.384  27.581  104.491 1.00 26.66 ? 2570 HOH F O   1 
HETATM 9446 O  O   . HOH UA 6 .  ? 15.225  39.819  84.227  1.00 32.28 ? 2571 HOH F O   1 
HETATM 9447 O  O   . HOH UA 6 .  ? 5.662   55.058  84.949  1.00 33.28 ? 2572 HOH F O   1 
HETATM 9448 O  O   . HOH UA 6 .  ? 1.676   52.159  89.341  1.00 36.23 ? 2573 HOH F O   1 
HETATM 9449 O  O   . HOH UA 6 .  ? 6.706   48.101  84.703  1.00 27.17 ? 2574 HOH F O   1 
HETATM 9450 O  O   . HOH UA 6 .  ? 19.315  27.391  104.495 1.00 32.10 ? 2575 HOH F O   1 
HETATM 9451 O  O   . HOH UA 6 .  ? 17.469  30.578  100.720 1.00 35.18 ? 2576 HOH F O   1 
HETATM 9452 O  O   . HOH UA 6 .  ? -0.141  48.357  86.011  1.00 33.05 ? 2577 HOH F O   1 
HETATM 9453 O  O   . HOH UA 6 .  ? 9.591   49.392  90.916  1.00 19.58 ? 2578 HOH F O   1 
HETATM 9454 O  O   . HOH UA 6 .  ? -0.840  38.898  108.010 1.00 26.58 ? 2579 HOH F O   1 
HETATM 9455 O  O   . HOH UA 6 .  ? -8.640  46.601  94.558  1.00 38.25 ? 2580 HOH F O   1 
HETATM 9456 O  O   . HOH UA 6 .  ? 1.532   44.421  115.963 1.00 23.95 ? 2581 HOH F O   1 
HETATM 9457 O  O   . HOH UA 6 .  ? -3.963  52.255  97.642  1.00 35.19 ? 2582 HOH F O   1 
HETATM 9458 O  O   . HOH UA 6 .  ? 1.703   53.152  105.533 1.00 29.52 ? 2583 HOH F O   1 
HETATM 9459 O  O   . HOH UA 6 .  ? 15.383  30.502  101.402 1.00 25.28 ? 2584 HOH F O   1 
HETATM 9460 O  O   . HOH UA 6 .  ? 1.491   46.081  86.347  1.00 25.11 ? 2585 HOH F O   1 
HETATM 9461 O  O   . HOH UA 6 .  ? 17.615  29.894  103.929 1.00 27.45 ? 2586 HOH F O   1 
HETATM 9462 O  O   . HOH UA 6 .  ? 14.804  32.568  95.435  1.00 25.33 ? 2587 HOH F O   1 
HETATM 9463 O  O   . HOH UA 6 .  ? 12.809  48.987  90.739  1.00 24.10 ? 2588 HOH F O   1 
HETATM 9464 O  O   . HOH UA 6 .  ? 4.300   38.017  119.555 1.00 29.76 ? 2589 HOH F O   1 
HETATM 9465 O  O   . HOH UA 6 .  ? 1.470   53.839  93.050  1.00 24.00 ? 2590 HOH F O   1 
HETATM 9466 O  O   . HOH UA 6 .  ? 15.153  29.661  103.928 1.00 21.73 ? 2591 HOH F O   1 
HETATM 9467 O  O   . HOH UA 6 .  ? 5.542   57.996  92.420  1.00 23.65 ? 2592 HOH F O   1 
HETATM 9468 O  O   . HOH UA 6 .  ? 15.870  31.052  115.365 1.00 23.74 ? 2593 HOH F O   1 
HETATM 9469 O  O   . HOH UA 6 .  ? 13.611  29.870  95.515  1.00 27.17 ? 2594 HOH F O   1 
HETATM 9470 O  O   . HOH UA 6 .  ? 11.147  30.927  95.006  1.00 21.94 ? 2595 HOH F O   1 
HETATM 9471 O  O   . HOH UA 6 .  ? 13.295  43.556  92.976  1.00 21.04 ? 2596 HOH F O   1 
HETATM 9472 O  O   . HOH UA 6 .  ? 6.669   38.496  87.129  1.00 17.79 ? 2597 HOH F O   1 
HETATM 9473 O  O   . HOH UA 6 .  ? 11.960  29.097  109.209 1.00 21.98 ? 2598 HOH F O   1 
HETATM 9474 O  O   . HOH VA 6 .  ? 39.888  57.490  90.681  1.00 57.70 ? 3513 HOH G O   1 
HETATM 9475 O  O   . HOH VA 6 .  ? 27.292  73.819  96.261  1.00 61.00 ? 3514 HOH G O   1 
HETATM 9476 O  O   . HOH VA 6 .  ? 38.099  49.320  93.534  1.00 49.12 ? 3515 HOH G O   1 
HETATM 9477 O  O   . HOH VA 6 .  ? 22.843  75.483  98.606  1.00 55.12 ? 3516 HOH G O   1 
HETATM 9478 O  O   . HOH VA 6 .  ? 28.596  75.644  97.313  1.00 47.22 ? 3517 HOH G O   1 
HETATM 9479 O  O   . HOH VA 6 .  ? 7.638   46.437  77.710  1.00 45.74 ? 3518 HOH G O   1 
HETATM 9480 O  O   . HOH VA 6 .  ? 23.113  45.122  77.650  1.00 47.70 ? 3519 HOH G O   1 
HETATM 9481 O  O   . HOH VA 6 .  ? 18.566  41.608  81.641  1.00 42.14 ? 3520 HOH G O   1 
HETATM 9482 O  O   . HOH VA 6 .  ? 14.976  71.053  87.839  1.00 41.13 ? 3521 HOH G O   1 
HETATM 9483 O  O   . HOH VA 6 .  ? 25.488  50.890  75.234  1.00 40.92 ? 3522 HOH G O   1 
HETATM 9484 O  O   . HOH VA 6 .  ? 26.893  66.636  84.561  1.00 39.41 ? 3523 HOH G O   1 
HETATM 9485 O  O   . HOH VA 6 .  ? 12.134  70.663  89.961  1.00 37.82 ? 3524 HOH G O   1 
HETATM 9486 O  O   . HOH VA 6 .  ? 19.542  75.612  100.441 1.00 49.74 ? 3525 HOH G O   1 
HETATM 9487 O  O   . HOH VA 6 .  ? 23.978  49.511  94.121  1.00 51.87 ? 3526 HOH G O   1 
HETATM 9488 O  O   . HOH VA 6 .  ? 20.254  80.240  96.704  1.00 38.01 ? 3527 HOH G O   1 
HETATM 9489 O  O   . HOH VA 6 .  ? 26.529  51.273  102.077 1.00 40.09 ? 3528 HOH G O   1 
HETATM 9490 O  O   . HOH VA 6 .  ? 20.616  50.323  98.859  1.00 44.64 ? 3529 HOH G O   1 
HETATM 9491 O  O   . HOH VA 6 .  ? 37.990  57.526  89.575  1.00 53.91 ? 3530 HOH G O   1 
HETATM 9492 O  O   . HOH VA 6 .  ? 31.407  76.791  96.804  1.00 51.79 ? 3531 HOH G O   1 
HETATM 9493 O  O   . HOH VA 6 .  ? 10.263  76.244  99.776  1.00 49.52 ? 3532 HOH G O   1 
HETATM 9494 O  O   . HOH VA 6 .  ? 33.069  46.061  89.079  1.00 41.75 ? 3533 HOH G O   1 
HETATM 9495 O  O   . HOH VA 6 .  ? 20.812  73.863  99.865  1.00 39.44 ? 3534 HOH G O   1 
HETATM 9496 O  O   . HOH VA 6 .  ? 23.667  80.520  97.963  1.00 46.88 ? 3535 HOH G O   1 
HETATM 9497 O  O   . HOH VA 6 .  ? 30.805  45.146  91.417  1.00 58.04 ? 3536 HOH G O   1 
HETATM 9498 O  O   . HOH VA 6 .  ? 16.728  48.963  102.961 1.00 54.10 ? 3537 HOH G O   1 
HETATM 9499 O  O   . HOH VA 6 .  ? 28.982  58.268  101.484 1.00 45.86 ? 3538 HOH G O   1 
HETATM 9500 O  O   . HOH VA 6 .  ? 28.083  55.417  98.288  1.00 47.66 ? 3539 HOH G O   1 
HETATM 9501 O  O   . HOH VA 6 .  ? 13.873  41.860  81.872  1.00 33.11 ? 3540 HOH G O   1 
HETATM 9502 O  O   . HOH VA 6 .  ? 26.387  42.546  87.741  1.00 51.13 ? 3541 HOH G O   1 
HETATM 9503 O  O   . HOH VA 6 .  ? 24.085  73.291  94.684  1.00 56.94 ? 3542 HOH G O   1 
HETATM 9504 O  O   . HOH VA 6 .  ? 22.085  72.675  95.663  1.00 44.59 ? 3543 HOH G O   1 
HETATM 9505 O  O   . HOH VA 6 .  ? 8.836   75.889  97.981  1.00 42.27 ? 3544 HOH G O   1 
HETATM 9506 O  O   . HOH VA 6 .  ? 25.011  74.994  96.309  1.00 45.14 ? 3545 HOH G O   1 
HETATM 9507 O  O   . HOH VA 6 .  ? 8.217   59.937  83.095  1.00 39.20 ? 3546 HOH G O   1 
HETATM 9508 O  O   . HOH VA 6 .  ? 18.920  50.929  75.409  1.00 32.16 ? 3547 HOH G O   1 
HETATM 9509 O  O   . HOH VA 6 .  ? 10.360  77.563  96.019  1.00 55.97 ? 3548 HOH G O   1 
HETATM 9510 O  O   . HOH VA 6 .  ? 16.138  56.963  74.988  1.00 24.29 ? 3549 HOH G O   1 
HETATM 9511 O  O   . HOH VA 6 .  ? 33.877  56.748  86.066  1.00 37.76 ? 3550 HOH G O   1 
HETATM 9512 O  O   . HOH VA 6 .  ? 16.649  42.113  85.497  1.00 45.31 ? 3551 HOH G O   1 
HETATM 9513 O  O   . HOH VA 6 .  ? 23.887  71.333  100.518 1.00 41.71 ? 3552 HOH G O   1 
HETATM 9514 O  O   . HOH VA 6 .  ? 21.901  71.621  98.540  1.00 43.27 ? 3553 HOH G O   1 
HETATM 9515 O  O   . HOH VA 6 .  ? 4.622   58.555  87.458  1.00 38.55 ? 3554 HOH G O   1 
HETATM 9516 O  O   . HOH VA 6 .  ? 34.488  54.851  84.113  1.00 40.18 ? 3555 HOH G O   1 
HETATM 9517 O  O   . HOH VA 6 .  ? 29.925  51.549  81.720  1.00 45.77 ? 3556 HOH G O   1 
HETATM 9518 O  O   . HOH VA 6 .  ? 8.655   57.848  80.114  1.00 34.77 ? 3557 HOH G O   1 
HETATM 9519 O  O   . HOH VA 6 .  ? 14.703  44.500  82.137  1.00 34.65 ? 3558 HOH G O   1 
HETATM 9520 O  O   . HOH VA 6 .  ? 24.841  66.928  88.239  1.00 36.14 ? 3559 HOH G O   1 
HETATM 9521 O  O   . HOH VA 6 .  ? 13.359  46.402  89.945  1.00 33.09 ? 3560 HOH G O   1 
HETATM 9522 O  O   . HOH VA 6 .  ? 21.812  68.825  86.738  1.00 33.19 ? 3561 HOH G O   1 
HETATM 9523 O  O   . HOH VA 6 .  ? 13.999  76.615  103.146 1.00 35.45 ? 3562 HOH G O   1 
HETATM 9524 O  O   . HOH VA 6 .  ? 29.193  53.625  83.238  1.00 39.65 ? 3563 HOH G O   1 
HETATM 9525 O  O   . HOH VA 6 .  ? 25.172  77.150  96.925  1.00 30.64 ? 3564 HOH G O   1 
HETATM 9526 O  O   . HOH VA 6 .  ? 29.380  51.417  108.350 1.00 49.84 ? 3565 HOH G O   1 
HETATM 9527 O  O   . HOH VA 6 .  ? 24.077  69.722  88.568  1.00 29.54 ? 3566 HOH G O   1 
HETATM 9528 O  O   . HOH VA 6 .  ? 35.943  53.322  88.406  1.00 37.17 ? 3567 HOH G O   1 
HETATM 9529 O  O   . HOH VA 6 .  ? 31.952  51.828  94.437  1.00 35.09 ? 3568 HOH G O   1 
HETATM 9530 O  O   . HOH VA 6 .  ? 15.909  45.609  80.060  1.00 30.66 ? 3569 HOH G O   1 
HETATM 9531 O  O   . HOH VA 6 .  ? 34.218  55.736  88.440  1.00 37.74 ? 3570 HOH G O   1 
HETATM 9532 O  O   . HOH VA 6 .  ? 12.466  70.445  92.749  1.00 28.52 ? 3571 HOH G O   1 
HETATM 9533 O  O   . HOH VA 6 .  ? 18.492  58.277  110.400 1.00 32.69 ? 3572 HOH G O   1 
HETATM 9534 O  O   . HOH VA 6 .  ? 8.071   54.011  84.110  1.00 33.70 ? 3573 HOH G O   1 
HETATM 9535 O  O   . HOH VA 6 .  ? 10.508  52.894  80.498  1.00 29.51 ? 3574 HOH G O   1 
HETATM 9536 O  O   . HOH VA 6 .  ? 15.922  74.715  102.800 1.00 26.81 ? 3575 HOH G O   1 
HETATM 9537 O  O   . HOH VA 6 .  ? 14.305  65.288  83.560  1.00 29.75 ? 3576 HOH G O   1 
HETATM 9538 O  O   . HOH VA 6 .  ? 26.931  65.611  88.676  1.00 24.71 ? 3577 HOH G O   1 
HETATM 9539 O  O   . HOH VA 6 .  ? 21.559  70.081  94.746  1.00 21.98 ? 3578 HOH G O   1 
HETATM 9540 O  O   . HOH VA 6 .  ? 13.183  50.885  88.757  1.00 17.79 ? 3579 HOH G O   1 
HETATM 9541 O  O   . HOH VA 6 .  ? 23.319  70.729  91.141  1.00 26.60 ? 3580 HOH G O   1 
HETATM 9542 O  O   . HOH VA 6 .  ? 8.406   51.145  83.840  1.00 21.79 ? 3581 HOH G O   1 
HETATM 9543 O  O   . HOH VA 6 .  ? 10.624  59.550  82.073  1.00 23.79 ? 3582 HOH G O   1 
HETATM 9544 O  O   . HOH WA 6 .  ? 28.858  52.210  119.328 1.00 59.98 ? 4513 HOH H O   1 
HETATM 9545 O  O   . HOH WA 6 .  ? 12.045  43.882  133.883 1.00 52.20 ? 4514 HOH H O   1 
HETATM 9546 O  O   . HOH WA 6 .  ? 7.330   45.889  133.648 1.00 52.90 ? 4515 HOH H O   1 
HETATM 9547 O  O   . HOH WA 6 .  ? 12.878  48.036  129.635 1.00 50.58 ? 4516 HOH H O   1 
HETATM 9548 O  O   . HOH WA 6 .  ? -2.577  23.102  109.180 1.00 49.19 ? 4517 HOH H O   1 
HETATM 9549 O  O   . HOH WA 6 .  ? 24.120  40.116  106.555 1.00 54.03 ? 4518 HOH H O   1 
HETATM 9550 O  O   . HOH WA 6 .  ? 14.726  48.977  111.266 1.00 59.82 ? 4519 HOH H O   1 
HETATM 9551 O  O   . HOH WA 6 .  ? 22.768  37.972  125.412 1.00 48.95 ? 4520 HOH H O   1 
HETATM 9552 O  O   . HOH WA 6 .  ? -11.056 25.117  108.305 1.00 47.93 ? 4521 HOH H O   1 
HETATM 9553 O  O   . HOH WA 6 .  ? -8.295  21.124  107.178 1.00 50.14 ? 4522 HOH H O   1 
HETATM 9554 O  O   . HOH WA 6 .  ? 20.929  44.422  128.902 1.00 45.43 ? 4523 HOH H O   1 
HETATM 9555 O  O   . HOH WA 6 .  ? 0.052   31.881  114.237 1.00 43.56 ? 4524 HOH H O   1 
HETATM 9556 O  O   . HOH WA 6 .  ? 2.070   41.249  132.766 1.00 41.40 ? 4525 HOH H O   1 
HETATM 9557 O  O   . HOH WA 6 .  ? 11.500  45.325  131.109 1.00 39.23 ? 4526 HOH H O   1 
HETATM 9558 O  O   . HOH WA 6 .  ? 5.344   48.712  126.510 1.00 39.86 ? 4527 HOH H O   1 
HETATM 9559 O  O   . HOH WA 6 .  ? 14.138  45.381  132.050 1.00 53.72 ? 4528 HOH H O   1 
HETATM 9560 O  O   . HOH WA 6 .  ? 1.631   33.067  116.625 1.00 42.97 ? 4529 HOH H O   1 
HETATM 9561 O  O   . HOH WA 6 .  ? 28.057  32.642  110.568 1.00 48.02 ? 4530 HOH H O   1 
HETATM 9562 O  O   . HOH WA 6 .  ? 34.775  43.383  118.104 1.00 46.45 ? 4531 HOH H O   1 
HETATM 9563 O  O   . HOH WA 6 .  ? 27.548  35.855  120.807 1.00 53.56 ? 4532 HOH H O   1 
HETATM 9564 O  O   . HOH WA 6 .  ? 32.547  33.941  121.462 1.00 50.81 ? 4533 HOH H O   1 
HETATM 9565 O  O   . HOH WA 6 .  ? 26.553  52.504  120.595 1.00 62.24 ? 4534 HOH H O   1 
HETATM 9566 O  O   . HOH WA 6 .  ? 16.142  53.918  111.967 1.00 43.35 ? 4535 HOH H O   1 
HETATM 9567 O  O   . HOH WA 6 .  ? 34.959  43.547  122.014 1.00 57.25 ? 4536 HOH H O   1 
HETATM 9568 O  O   . HOH WA 6 .  ? 31.021  51.116  120.098 1.00 54.80 ? 4537 HOH H O   1 
HETATM 9569 O  O   . HOH WA 6 .  ? 4.926   44.804  136.217 1.00 43.41 ? 4538 HOH H O   1 
HETATM 9570 O  O   . HOH WA 6 .  ? 24.696  34.515  107.183 1.00 40.25 ? 4539 HOH H O   1 
HETATM 9571 O  O   . HOH WA 6 .  ? 25.240  36.475  106.301 1.00 47.23 ? 4540 HOH H O   1 
HETATM 9572 O  O   . HOH WA 6 .  ? 17.028  55.887  125.557 1.00 46.84 ? 4541 HOH H O   1 
HETATM 9573 O  O   . HOH WA 6 .  ? 18.264  50.436  124.611 1.00 51.82 ? 4542 HOH H O   1 
HETATM 9574 O  O   . HOH WA 6 .  ? 3.161   44.159  132.139 1.00 48.06 ? 4543 HOH H O   1 
HETATM 9575 O  O   . HOH WA 6 .  ? -0.242  36.027  108.414 1.00 41.51 ? 4544 HOH H O   1 
HETATM 9576 O  O   . HOH WA 6 .  ? 27.888  51.282  125.903 1.00 51.15 ? 4545 HOH H O   1 
HETATM 9577 O  O   . HOH WA 6 .  ? -0.283  21.315  104.953 1.00 46.78 ? 4546 HOH H O   1 
HETATM 9578 O  O   . HOH WA 6 .  ? 23.497  28.576  119.665 1.00 57.47 ? 4547 HOH H O   1 
HETATM 9579 O  O   . HOH WA 6 .  ? 20.084  46.792  105.432 1.00 41.52 ? 4548 HOH H O   1 
HETATM 9580 O  O   . HOH WA 6 .  ? 5.229   44.432  133.688 1.00 55.02 ? 4549 HOH H O   1 
HETATM 9581 O  O   . HOH WA 6 .  ? 21.426  46.499  109.924 1.00 52.60 ? 4550 HOH H O   1 
HETATM 9582 O  O   . HOH WA 6 .  ? 9.046   60.716  122.064 1.00 51.54 ? 4551 HOH H O   1 
HETATM 9583 O  O   . HOH WA 6 .  ? 22.183  38.740  105.802 1.00 43.85 ? 4552 HOH H O   1 
HETATM 9584 O  O   . HOH WA 6 .  ? 5.785   39.931  132.935 1.00 43.87 ? 4553 HOH H O   1 
HETATM 9585 O  O   . HOH WA 6 .  ? 33.773  43.244  114.169 1.00 40.50 ? 4554 HOH H O   1 
HETATM 9586 O  O   . HOH WA 6 .  ? -0.701  25.502  112.162 1.00 44.05 ? 4555 HOH H O   1 
HETATM 9587 O  O   . HOH WA 6 .  ? 9.494   46.446  133.415 1.00 40.44 ? 4556 HOH H O   1 
HETATM 9588 O  O   . HOH WA 6 .  ? 0.268   25.346  108.861 1.00 41.63 ? 4557 HOH H O   1 
HETATM 9589 O  O   . HOH WA 6 .  ? 14.183  31.072  119.375 1.00 36.97 ? 4558 HOH H O   1 
HETATM 9590 O  O   . HOH WA 6 .  ? 9.633   46.133  130.266 1.00 32.15 ? 4559 HOH H O   1 
HETATM 9591 O  O   . HOH WA 6 .  ? 3.769   33.611  119.931 1.00 34.38 ? 4560 HOH H O   1 
HETATM 9592 O  O   . HOH WA 6 .  ? 16.396  53.533  123.615 1.00 41.58 ? 4561 HOH H O   1 
HETATM 9593 O  O   . HOH WA 6 .  ? 5.563   37.145  131.245 1.00 40.11 ? 4562 HOH H O   1 
HETATM 9594 O  O   . HOH WA 6 .  ? 16.168  33.137  129.588 1.00 39.48 ? 4563 HOH H O   1 
HETATM 9595 O  O   . HOH WA 6 .  ? 2.305   29.525  116.387 1.00 39.83 ? 4564 HOH H O   1 
HETATM 9596 O  O   . HOH WA 6 .  ? 1.008   44.846  123.175 1.00 37.43 ? 4565 HOH H O   1 
HETATM 9597 O  O   . HOH WA 6 .  ? 29.851  37.048  119.399 1.00 35.67 ? 4566 HOH H O   1 
HETATM 9598 O  O   . HOH WA 6 .  ? 18.269  37.508  96.090  1.00 50.01 ? 4567 HOH H O   1 
HETATM 9599 O  O   . HOH WA 6 .  ? 16.686  37.089  128.343 1.00 49.31 ? 4568 HOH H O   1 
HETATM 9600 O  O   . HOH WA 6 .  ? 8.111   50.747  122.405 1.00 28.25 ? 4569 HOH H O   1 
HETATM 9601 O  O   . HOH WA 6 .  ? 8.475   37.006  134.226 1.00 37.18 ? 4570 HOH H O   1 
HETATM 9602 O  O   . HOH WA 6 .  ? 29.579  36.848  116.567 1.00 37.42 ? 4571 HOH H O   1 
HETATM 9603 O  O   . HOH WA 6 .  ? 15.761  40.890  130.598 1.00 33.77 ? 4572 HOH H O   1 
HETATM 9604 O  O   . HOH WA 6 .  ? 20.969  39.332  127.433 1.00 32.76 ? 4573 HOH H O   1 
HETATM 9605 O  O   . HOH WA 6 .  ? 5.542   26.035  101.379 1.00 54.53 ? 4574 HOH H O   1 
HETATM 9606 O  O   . HOH WA 6 .  ? 13.396  31.023  115.784 1.00 32.61 ? 4575 HOH H O   1 
HETATM 9607 O  O   . HOH WA 6 .  ? 3.448   26.052  101.474 1.00 46.99 ? 4576 HOH H O   1 
HETATM 9608 O  O   . HOH WA 6 .  ? 15.175  47.795  128.445 1.00 27.35 ? 4577 HOH H O   1 
HETATM 9609 O  O   . HOH WA 6 .  ? -0.571  28.064  113.687 1.00 37.14 ? 4578 HOH H O   1 
HETATM 9610 O  O   . HOH WA 6 .  ? 14.806  41.422  93.315  1.00 34.12 ? 4579 HOH H O   1 
HETATM 9611 O  O   . HOH WA 6 .  ? 16.898  44.147  130.277 1.00 26.71 ? 4580 HOH H O   1 
HETATM 9612 O  O   . HOH WA 6 .  ? 5.079   50.889  118.593 1.00 45.53 ? 4581 HOH H O   1 
HETATM 9613 O  O   . HOH WA 6 .  ? 12.058  50.677  114.513 1.00 22.00 ? 4582 HOH H O   1 
HETATM 9614 O  O   . HOH WA 6 .  ? 27.646  40.283  110.223 1.00 38.05 ? 4583 HOH H O   1 
HETATM 9615 O  O   . HOH WA 6 .  ? 2.528   29.529  99.928  1.00 27.20 ? 4584 HOH H O   1 
HETATM 9616 O  O   . HOH WA 6 .  ? 7.471   30.860  123.278 1.00 34.93 ? 4585 HOH H O   1 
HETATM 9617 O  O   . HOH WA 6 .  ? 26.040  34.952  118.568 1.00 33.60 ? 4586 HOH H O   1 
HETATM 9618 O  O   . HOH WA 6 .  ? 9.644   32.210  126.901 1.00 20.45 ? 4587 HOH H O   1 
HETATM 9619 O  O   . HOH WA 6 .  ? 27.176  35.539  116.308 1.00 29.86 ? 4588 HOH H O   1 
HETATM 9620 O  O   . HOH WA 6 .  ? 2.452   45.567  119.288 1.00 32.93 ? 4589 HOH H O   1 
HETATM 9621 O  O   . HOH WA 6 .  ? 1.271   34.565  110.046 1.00 26.79 ? 4590 HOH H O   1 
HETATM 9622 O  O   . HOH WA 6 .  ? 23.430  40.344  121.099 1.00 29.36 ? 4591 HOH H O   1 
HETATM 9623 O  O   . HOH WA 6 .  ? 9.842   44.290  128.277 1.00 22.43 ? 4592 HOH H O   1 
HETATM 9624 O  O   . HOH WA 6 .  ? 3.403   44.212  126.961 1.00 23.86 ? 4593 HOH H O   1 
HETATM 9625 O  O   . HOH WA 6 .  ? 7.362   53.204  118.842 1.00 20.22 ? 4594 HOH H O   1 
HETATM 9626 O  O   . HOH WA 6 .  ? 4.421   44.852  120.768 1.00 27.17 ? 4595 HOH H O   1 
HETATM 9627 O  O   . HOH WA 6 .  ? 7.460   31.279  120.955 1.00 21.76 ? 4596 HOH H O   1 
HETATM 9628 O  O   . HOH WA 6 .  ? 5.264   38.808  122.114 1.00 26.92 ? 4597 HOH H O   1 
HETATM 9629 O  O   . HOH WA 6 .  ? 14.783  54.429  113.512 1.00 23.84 ? 4598 HOH H O   1 
HETATM 9630 O  O   . HOH WA 6 .  ? 9.372   30.066  108.659 1.00 18.75 ? 4599 HOH H O   1 
HETATM 9631 O  O   . HOH WA 6 .  ? 11.364  28.374  99.810  1.00 24.79 ? 4600 HOH H O   1 
HETATM 9632 O  O   . HOH WA 6 .  ? 5.984   28.875  111.478 1.00 17.25 ? 4601 HOH H O   1 
HETATM 9633 O  O   . HOH XA 6 .  ? -1.934  -15.171 159.880 1.00 66.90 ? 1523 HOH I O   1 
HETATM 9634 O  O   . HOH XA 6 .  ? -10.110 -10.247 137.794 1.00 53.98 ? 1524 HOH I O   1 
HETATM 9635 O  O   . HOH XA 6 .  ? -7.690  -10.647 134.533 1.00 58.23 ? 1525 HOH I O   1 
HETATM 9636 O  O   . HOH XA 6 .  ? -5.089  7.598   123.599 1.00 49.08 ? 1526 HOH I O   1 
HETATM 9637 O  O   . HOH XA 6 .  ? -4.481  -18.312 127.032 1.00 55.25 ? 1527 HOH I O   1 
HETATM 9638 O  O   . HOH XA 6 .  ? 13.176  7.160   135.431 1.00 49.66 ? 1528 HOH I O   1 
HETATM 9639 O  O   . HOH XA 6 .  ? -3.111  -2.438  148.411 1.00 47.39 ? 1529 HOH I O   1 
HETATM 9640 O  O   . HOH XA 6 .  ? -4.149  -14.663 125.794 1.00 51.12 ? 1530 HOH I O   1 
HETATM 9641 O  O   . HOH XA 6 .  ? -12.857 -0.035  132.081 1.00 47.17 ? 1531 HOH I O   1 
HETATM 9642 O  O   . HOH XA 6 .  ? -2.876  10.211  118.445 1.00 49.82 ? 1532 HOH I O   1 
HETATM 9643 O  O   . HOH XA 6 .  ? -5.540  -3.243  128.823 1.00 41.85 ? 1533 HOH I O   1 
HETATM 9644 O  O   . HOH XA 6 .  ? -6.668  -8.512  132.776 1.00 45.86 ? 1534 HOH I O   1 
HETATM 9645 O  O   . HOH XA 6 .  ? -3.261  7.535   120.010 1.00 48.35 ? 1535 HOH I O   1 
HETATM 9646 O  O   . HOH XA 6 .  ? 0.622   -8.556  161.546 1.00 51.41 ? 1536 HOH I O   1 
HETATM 9647 O  O   . HOH XA 6 .  ? -3.552  -0.764  120.234 1.00 42.73 ? 1537 HOH I O   1 
HETATM 9648 O  O   . HOH XA 6 .  ? -6.380  7.441   135.019 1.00 39.00 ? 1538 HOH I O   1 
HETATM 9649 O  O   . HOH XA 6 .  ? -2.064  10.132  120.784 1.00 41.21 ? 1539 HOH I O   1 
HETATM 9650 O  O   . HOH XA 6 .  ? -5.466  9.707   130.812 1.00 34.10 ? 1540 HOH I O   1 
HETATM 9651 O  O   . HOH XA 6 .  ? -1.726  3.689   144.602 1.00 42.53 ? 1541 HOH I O   1 
HETATM 9652 O  O   . HOH XA 6 .  ? -5.842  -11.589 126.924 1.00 38.97 ? 1542 HOH I O   1 
HETATM 9653 O  O   . HOH XA 6 .  ? -3.267  13.989  129.142 1.00 36.00 ? 1543 HOH I O   1 
HETATM 9654 O  O   . HOH XA 6 .  ? -1.097  2.372   118.936 1.00 36.22 ? 1544 HOH I O   1 
HETATM 9655 O  O   . HOH XA 6 .  ? 6.945   8.057   134.236 1.00 49.41 ? 1545 HOH I O   1 
HETATM 9656 O  O   . HOH XA 6 .  ? -10.851 3.915   133.045 1.00 46.75 ? 1546 HOH I O   1 
HETATM 9657 O  O   . HOH XA 6 .  ? -8.194  -15.724 143.297 1.00 46.34 ? 1547 HOH I O   1 
HETATM 9658 O  O   . HOH XA 6 .  ? -2.336  -0.914  143.012 1.00 43.52 ? 1548 HOH I O   1 
HETATM 9659 O  O   . HOH XA 6 .  ? -0.370  -1.699  116.582 1.00 55.05 ? 1549 HOH I O   1 
HETATM 9660 O  O   . HOH XA 6 .  ? -7.611  -4.167  127.825 1.00 40.31 ? 1550 HOH I O   1 
HETATM 9661 O  O   . HOH XA 6 .  ? -4.597  -3.103  121.460 1.00 43.91 ? 1551 HOH I O   1 
HETATM 9662 O  O   . HOH XA 6 .  ? -7.511  -5.220  125.171 1.00 42.27 ? 1552 HOH I O   1 
HETATM 9663 O  O   . HOH XA 6 .  ? 3.523   -17.056 134.603 1.00 44.08 ? 1553 HOH I O   1 
HETATM 9664 O  O   . HOH XA 6 .  ? -3.717  -14.312 142.576 1.00 41.57 ? 1554 HOH I O   1 
HETATM 9665 O  O   . HOH XA 6 .  ? -6.484  -6.285  148.244 1.00 61.96 ? 1555 HOH I O   1 
HETATM 9666 O  O   . HOH XA 6 .  ? -1.636  -14.030 137.319 1.00 35.89 ? 1556 HOH I O   1 
HETATM 9667 O  O   . HOH XA 6 .  ? 14.970  -7.987  128.520 1.00 43.53 ? 1557 HOH I O   1 
HETATM 9668 O  O   . HOH XA 6 .  ? -1.000  -1.015  148.147 1.00 37.38 ? 1558 HOH I O   1 
HETATM 9669 O  O   . HOH XA 6 .  ? -10.914 -3.934  131.535 1.00 41.20 ? 1559 HOH I O   1 
HETATM 9670 O  O   . HOH XA 6 .  ? -7.848  4.811   127.899 1.00 42.46 ? 1560 HOH I O   1 
HETATM 9671 O  O   . HOH XA 6 .  ? 8.177   3.807   123.427 1.00 36.78 ? 1561 HOH I O   1 
HETATM 9672 O  O   . HOH XA 6 .  ? -9.848  -6.486  132.819 1.00 43.36 ? 1562 HOH I O   1 
HETATM 9673 O  O   . HOH XA 6 .  ? -7.777  -8.116  124.526 1.00 36.58 ? 1563 HOH I O   1 
HETATM 9674 O  O   . HOH XA 6 .  ? 3.118   -9.673  143.221 1.00 35.89 ? 1564 HOH I O   1 
HETATM 9675 O  O   . HOH XA 6 .  ? -0.354  6.076   137.093 1.00 38.61 ? 1565 HOH I O   1 
HETATM 9676 O  O   . HOH XA 6 .  ? -4.245  6.018   125.605 1.00 33.66 ? 1566 HOH I O   1 
HETATM 9677 O  O   . HOH XA 6 .  ? 5.312   -11.481 147.689 1.00 29.12 ? 1567 HOH I O   1 
HETATM 9678 O  O   . HOH XA 6 .  ? 0.524   3.595   120.135 1.00 30.79 ? 1568 HOH I O   1 
HETATM 9679 O  O   . HOH XA 6 .  ? 12.741  8.667   133.480 1.00 51.51 ? 1569 HOH I O   1 
HETATM 9680 O  O   . HOH XA 6 .  ? 7.918   7.682   135.830 1.00 46.48 ? 1570 HOH I O   1 
HETATM 9681 O  O   . HOH XA 6 .  ? 1.316   -0.415  115.888 1.00 39.86 ? 1571 HOH I O   1 
HETATM 9682 O  O   . HOH XA 6 .  ? 20.460  -10.707 135.147 1.00 27.54 ? 1572 HOH I O   1 
HETATM 9683 O  O   . HOH XA 6 .  ? -10.734 -2.356  132.862 1.00 36.05 ? 1573 HOH I O   1 
HETATM 9684 O  O   . HOH XA 6 .  ? -7.812  -4.136  123.214 1.00 43.81 ? 1574 HOH I O   1 
HETATM 9685 O  O   . HOH XA 6 .  ? -0.356  -0.628  145.424 1.00 25.48 ? 1575 HOH I O   1 
HETATM 9686 O  O   . HOH XA 6 .  ? 4.213   -12.988 125.352 1.00 34.64 ? 1576 HOH I O   1 
HETATM 9687 O  O   . HOH XA 6 .  ? 3.101   -10.514 148.913 1.00 27.83 ? 1577 HOH I O   1 
HETATM 9688 O  O   . HOH XA 6 .  ? -5.404  6.579   127.926 1.00 35.52 ? 1578 HOH I O   1 
HETATM 9689 O  O   . HOH XA 6 .  ? 10.219  4.244   128.726 1.00 36.88 ? 1579 HOH I O   1 
HETATM 9690 O  O   . HOH XA 6 .  ? 23.224  -6.114  134.512 1.00 31.71 ? 1580 HOH I O   1 
HETATM 9691 O  O   . HOH XA 6 .  ? 17.040  -8.370  131.337 1.00 35.34 ? 1581 HOH I O   1 
HETATM 9692 O  O   . HOH XA 6 .  ? -5.447  -9.462  125.400 1.00 30.22 ? 1582 HOH I O   1 
HETATM 9693 O  O   . HOH XA 6 .  ? -1.423  -9.203  122.815 1.00 32.25 ? 1583 HOH I O   1 
HETATM 9694 O  O   . HOH XA 6 .  ? 7.410   6.219   124.644 1.00 21.16 ? 1584 HOH I O   1 
HETATM 9695 O  O   . HOH XA 6 .  ? -2.554  5.714   145.342 1.00 26.26 ? 1585 HOH I O   1 
HETATM 9696 O  O   . HOH XA 6 .  ? 1.155   -10.653 146.693 1.00 37.32 ? 1586 HOH I O   1 
HETATM 9697 O  O   . HOH XA 6 .  ? -3.688  13.149  124.107 1.00 37.44 ? 1587 HOH I O   1 
HETATM 9698 O  O   . HOH XA 6 .  ? -3.308  0.328   122.640 1.00 23.75 ? 1588 HOH I O   1 
HETATM 9699 O  O   . HOH XA 6 .  ? 10.080  1.209   126.297 1.00 25.71 ? 1589 HOH I O   1 
HETATM 9700 O  O   . HOH XA 6 .  ? -1.204  12.910  128.414 1.00 20.53 ? 1590 HOH I O   1 
HETATM 9701 O  O   . HOH XA 6 .  ? 4.090   -1.448  151.333 1.00 21.50 ? 1591 HOH I O   1 
HETATM 9702 O  O   . HOH XA 6 .  ? 17.951  -11.673 135.684 1.00 22.41 ? 1592 HOH I O   1 
HETATM 9703 O  O   . HOH XA 6 .  ? -1.968  -4.979  149.402 1.00 41.73 ? 1593 HOH I O   1 
HETATM 9704 O  O   . HOH XA 6 .  ? -4.011  7.475   129.786 1.00 20.61 ? 1594 HOH I O   1 
HETATM 9705 O  O   . HOH XA 6 .  ? -0.671  7.115   141.794 1.00 31.54 ? 1595 HOH I O   1 
HETATM 9706 O  O   . HOH XA 6 .  ? 3.787   -5.599  121.968 1.00 16.10 ? 1596 HOH I O   1 
HETATM 9707 O  O   . HOH XA 6 .  ? 1.522   -7.408  143.795 1.00 22.88 ? 1597 HOH I O   1 
HETATM 9708 O  O   . HOH XA 6 .  ? 4.407   5.651   125.518 1.00 19.26 ? 1598 HOH I O   1 
HETATM 9709 O  O   . HOH YA 6 .  ? -3.519  32.001  139.132 1.00 59.55 ? 2523 HOH J O   1 
HETATM 9710 O  O   . HOH YA 6 .  ? -7.239  28.023  112.970 1.00 54.09 ? 2524 HOH J O   1 
HETATM 9711 O  O   . HOH YA 6 .  ? -6.484  3.357   144.860 1.00 54.43 ? 2525 HOH J O   1 
HETATM 9712 O  O   . HOH YA 6 .  ? -7.242  24.977  114.499 1.00 56.10 ? 2526 HOH J O   1 
HETATM 9713 O  O   . HOH YA 6 .  ? 27.002  25.038  127.255 1.00 51.28 ? 2527 HOH J O   1 
HETATM 9714 O  O   . HOH YA 6 .  ? 5.089   17.103  156.200 1.00 62.15 ? 2528 HOH J O   1 
HETATM 9715 O  O   . HOH YA 6 .  ? -6.829  17.976  127.915 1.00 51.85 ? 2529 HOH J O   1 
HETATM 9716 O  O   . HOH YA 6 .  ? 24.014  28.574  128.516 1.00 55.88 ? 2530 HOH J O   1 
HETATM 9717 O  O   . HOH YA 6 .  ? -8.399  14.755  152.800 1.00 50.72 ? 2531 HOH J O   1 
HETATM 9718 O  O   . HOH YA 6 .  ? 5.012   21.361  158.212 1.00 48.01 ? 2532 HOH J O   1 
HETATM 9719 O  O   . HOH YA 6 .  ? -1.702  22.534  116.182 1.00 51.05 ? 2533 HOH J O   1 
HETATM 9720 O  O   . HOH YA 6 .  ? 4.018   19.568  157.280 1.00 45.30 ? 2534 HOH J O   1 
HETATM 9721 O  O   . HOH YA 6 .  ? 8.175   6.987   137.936 1.00 50.27 ? 2535 HOH J O   1 
HETATM 9722 O  O   . HOH YA 6 .  ? 20.898  25.215  137.569 1.00 45.19 ? 2536 HOH J O   1 
HETATM 9723 O  O   . HOH YA 6 .  ? -1.350  7.752   138.429 1.00 47.14 ? 2537 HOH J O   1 
HETATM 9724 O  O   . HOH YA 6 .  ? 17.785  24.180  136.524 1.00 36.99 ? 2538 HOH J O   1 
HETATM 9725 O  O   . HOH YA 6 .  ? -3.087  28.158  124.076 1.00 36.05 ? 2539 HOH J O   1 
HETATM 9726 O  O   . HOH YA 6 .  ? -5.545  14.473  153.097 1.00 53.21 ? 2540 HOH J O   1 
HETATM 9727 O  O   . HOH YA 6 .  ? -8.771  11.310  144.576 1.00 45.26 ? 2541 HOH J O   1 
HETATM 9728 O  O   . HOH YA 6 .  ? -7.993  12.761  146.458 1.00 44.60 ? 2542 HOH J O   1 
HETATM 9729 O  O   . HOH YA 6 .  ? 16.613  27.349  134.987 1.00 35.61 ? 2543 HOH J O   1 
HETATM 9730 O  O   . HOH YA 6 .  ? 9.771   20.911  157.949 1.00 41.90 ? 2544 HOH J O   1 
HETATM 9731 O  O   . HOH YA 6 .  ? 0.165   1.334   145.701 1.00 39.81 ? 2545 HOH J O   1 
HETATM 9732 O  O   . HOH YA 6 .  ? 22.492  21.879  131.221 1.00 34.93 ? 2546 HOH J O   1 
HETATM 9733 O  O   . HOH YA 6 .  ? 3.305   18.756  154.784 1.00 50.31 ? 2547 HOH J O   1 
HETATM 9734 O  O   . HOH YA 6 .  ? -0.719  11.430  151.797 1.00 41.28 ? 2548 HOH J O   1 
HETATM 9735 O  O   . HOH YA 6 .  ? -4.053  26.149  115.073 1.00 45.09 ? 2549 HOH J O   1 
HETATM 9736 O  O   . HOH YA 6 .  ? -6.288  11.468  138.806 1.00 44.30 ? 2550 HOH J O   1 
HETATM 9737 O  O   . HOH YA 6 .  ? -6.041  14.392  133.621 1.00 40.33 ? 2551 HOH J O   1 
HETATM 9738 O  O   . HOH YA 6 .  ? -1.005  29.855  146.090 1.00 46.35 ? 2552 HOH J O   1 
HETATM 9739 O  O   . HOH YA 6 .  ? -4.568  18.311  118.963 1.00 47.68 ? 2553 HOH J O   1 
HETATM 9740 O  O   . HOH YA 6 .  ? 17.475  23.609  139.597 1.00 41.33 ? 2554 HOH J O   1 
HETATM 9741 O  O   . HOH YA 6 .  ? -5.744  29.691  133.671 1.00 41.60 ? 2555 HOH J O   1 
HETATM 9742 O  O   . HOH YA 6 .  ? 15.259  27.023  142.405 1.00 49.46 ? 2556 HOH J O   1 
HETATM 9743 O  O   . HOH YA 6 .  ? 10.749  31.449  140.152 1.00 50.68 ? 2557 HOH J O   1 
HETATM 9744 O  O   . HOH YA 6 .  ? 19.776  19.491  147.693 1.00 40.17 ? 2558 HOH J O   1 
HETATM 9745 O  O   . HOH YA 6 .  ? -2.502  23.454  151.731 1.00 35.77 ? 2559 HOH J O   1 
HETATM 9746 O  O   . HOH YA 6 .  ? -0.476  30.940  136.293 1.00 52.54 ? 2560 HOH J O   1 
HETATM 9747 O  O   . HOH YA 6 .  ? 1.467   15.399  156.620 1.00 35.24 ? 2561 HOH J O   1 
HETATM 9748 O  O   . HOH YA 6 .  ? 5.319   13.039  154.783 1.00 47.10 ? 2562 HOH J O   1 
HETATM 9749 O  O   . HOH YA 6 .  ? 1.021   25.091  118.382 1.00 41.45 ? 2563 HOH J O   1 
HETATM 9750 O  O   . HOH YA 6 .  ? -8.135  19.046  146.430 1.00 41.21 ? 2564 HOH J O   1 
HETATM 9751 O  O   . HOH YA 6 .  ? 16.460  30.526  131.584 1.00 39.06 ? 2565 HOH J O   1 
HETATM 9752 O  O   . HOH YA 6 .  ? -4.875  16.417  127.417 1.00 38.72 ? 2566 HOH J O   1 
HETATM 9753 O  O   . HOH YA 6 .  ? -3.122  20.776  150.915 1.00 43.59 ? 2567 HOH J O   1 
HETATM 9754 O  O   . HOH YA 6 .  ? 3.068   16.169  154.535 1.00 42.61 ? 2568 HOH J O   1 
HETATM 9755 O  O   . HOH YA 6 .  ? -6.508  20.594  126.873 1.00 43.87 ? 2569 HOH J O   1 
HETATM 9756 O  O   . HOH YA 6 .  ? -5.074  13.038  147.923 1.00 34.64 ? 2570 HOH J O   1 
HETATM 9757 O  O   . HOH YA 6 .  ? 7.967   26.171  155.449 1.00 36.35 ? 2571 HOH J O   1 
HETATM 9758 O  O   . HOH YA 6 .  ? 20.382  16.784  148.577 1.00 47.78 ? 2572 HOH J O   1 
HETATM 9759 O  O   . HOH YA 6 .  ? 21.956  30.636  126.014 1.00 38.22 ? 2573 HOH J O   1 
HETATM 9760 O  O   . HOH YA 6 .  ? -6.326  10.850  141.800 1.00 32.90 ? 2574 HOH J O   1 
HETATM 9761 O  O   . HOH YA 6 .  ? 2.220   22.451  118.428 1.00 39.12 ? 2575 HOH J O   1 
HETATM 9762 O  O   . HOH YA 6 .  ? 7.006   11.798  152.796 1.00 28.79 ? 2576 HOH J O   1 
HETATM 9763 O  O   . HOH YA 6 .  ? 1.698   18.739  153.520 1.00 37.66 ? 2577 HOH J O   1 
HETATM 9764 O  O   . HOH YA 6 .  ? 11.924  27.971  147.252 1.00 33.14 ? 2578 HOH J O   1 
HETATM 9765 O  O   . HOH YA 6 .  ? -7.793  22.160  145.022 1.00 36.51 ? 2579 HOH J O   1 
HETATM 9766 O  O   . HOH YA 6 .  ? 2.881   32.205  138.202 1.00 39.26 ? 2580 HOH J O   1 
HETATM 9767 O  O   . HOH YA 6 .  ? 8.035   28.451  146.923 1.00 40.94 ? 2581 HOH J O   1 
HETATM 9768 O  O   . HOH YA 6 .  ? 14.352  29.939  129.751 1.00 36.95 ? 2582 HOH J O   1 
HETATM 9769 O  O   . HOH YA 6 .  ? -3.317  15.986  129.553 1.00 25.26 ? 2583 HOH J O   1 
HETATM 9770 O  O   . HOH YA 6 .  ? 10.001  27.608  153.467 1.00 23.24 ? 2584 HOH J O   1 
HETATM 9771 O  O   . HOH YA 6 .  ? 0.479   25.249  130.425 1.00 35.80 ? 2585 HOH J O   1 
HETATM 9772 O  O   . HOH YA 6 .  ? -0.837  24.882  150.262 1.00 27.07 ? 2586 HOH J O   1 
HETATM 9773 O  O   . HOH YA 6 .  ? -8.251  27.609  132.056 1.00 37.48 ? 2587 HOH J O   1 
HETATM 9774 O  O   . HOH YA 6 .  ? -1.560  26.160  125.175 1.00 26.97 ? 2588 HOH J O   1 
HETATM 9775 O  O   . HOH YA 6 .  ? -3.694  10.789  148.665 1.00 31.73 ? 2589 HOH J O   1 
HETATM 9776 O  O   . HOH YA 6 .  ? -8.697  17.621  144.905 1.00 46.19 ? 2590 HOH J O   1 
HETATM 9777 O  O   . HOH YA 6 .  ? -0.177  13.923  152.325 1.00 35.64 ? 2591 HOH J O   1 
HETATM 9778 O  O   . HOH YA 6 .  ? 0.377   9.674   149.345 1.00 34.22 ? 2592 HOH J O   1 
HETATM 9779 O  O   . HOH YA 6 .  ? -1.697  8.851   147.881 1.00 32.63 ? 2593 HOH J O   1 
HETATM 9780 O  O   . HOH YA 6 .  ? -2.802  26.296  128.009 1.00 35.36 ? 2594 HOH J O   1 
HETATM 9781 O  O   . HOH YA 6 .  ? 3.710   24.769  151.108 1.00 28.83 ? 2595 HOH J O   1 
HETATM 9782 O  O   . HOH YA 6 .  ? -2.367  8.512   133.153 1.00 24.01 ? 2596 HOH J O   1 
HETATM 9783 O  O   . HOH YA 6 .  ? 16.971  17.104  151.803 1.00 29.44 ? 2597 HOH J O   1 
HETATM 9784 O  O   . HOH YA 6 .  ? 12.557  11.364  141.453 1.00 31.28 ? 2598 HOH J O   1 
HETATM 9785 O  O   . HOH YA 6 .  ? 19.501  26.529  131.887 1.00 27.46 ? 2599 HOH J O   1 
HETATM 9786 O  O   . HOH YA 6 .  ? -1.138  22.908  130.595 1.00 27.48 ? 2600 HOH J O   1 
HETATM 9787 O  O   . HOH YA 6 .  ? -1.118  7.971   145.564 1.00 23.07 ? 2601 HOH J O   1 
HETATM 9788 O  O   . HOH YA 6 .  ? -1.454  17.063  122.579 1.00 24.37 ? 2602 HOH J O   1 
HETATM 9789 O  O   . HOH YA 6 .  ? 13.176  14.567  143.727 1.00 19.27 ? 2603 HOH J O   1 
HETATM 9790 O  O   . HOH YA 6 .  ? 13.232  28.893  127.357 1.00 22.36 ? 2604 HOH J O   1 
HETATM 9791 O  O   . HOH YA 6 .  ? 16.963  27.479  132.209 1.00 23.65 ? 2605 HOH J O   1 
HETATM 9792 O  O   . HOH YA 6 .  ? 11.450  9.438   146.298 1.00 20.84 ? 2606 HOH J O   1 
HETATM 9793 O  O   . HOH YA 6 .  ? 8.545   9.924   146.461 1.00 14.35 ? 2607 HOH J O   1 
HETATM 9794 O  O   . HOH YA 6 .  ? 2.231   15.211  152.097 1.00 21.36 ? 2608 HOH J O   1 
HETATM 9795 O  O   . HOH YA 6 .  ? 1.968   2.710   145.905 1.00 18.55 ? 2609 HOH J O   1 
HETATM 9796 O  O   . HOH YA 6 .  ? 8.894   21.190  150.099 1.00 14.57 ? 2610 HOH J O   1 
HETATM 9797 O  O   . HOH ZA 6 .  ? 18.860  6.905   133.765 1.00 63.61 ? 3523 HOH K O   1 
HETATM 9798 O  O   . HOH ZA 6 .  ? 23.517  2.043   126.203 1.00 61.66 ? 3524 HOH K O   1 
HETATM 9799 O  O   . HOH ZA 6 .  ? 7.647   4.412   166.916 1.00 59.47 ? 3525 HOH K O   1 
HETATM 9800 O  O   . HOH ZA 6 .  ? 30.521  -0.437  137.733 1.00 64.26 ? 3526 HOH K O   1 
HETATM 9801 O  O   . HOH ZA 6 .  ? 27.053  -3.806  157.286 1.00 73.60 ? 3527 HOH K O   1 
HETATM 9802 O  O   . HOH ZA 6 .  ? 16.906  9.503   164.279 1.00 52.61 ? 3528 HOH K O   1 
HETATM 9803 O  O   . HOH ZA 6 .  ? -0.192  -15.377 138.157 1.00 49.40 ? 3529 HOH K O   1 
HETATM 9804 O  O   . HOH ZA 6 .  ? 22.085  -2.390  122.041 1.00 50.18 ? 3530 HOH K O   1 
HETATM 9805 O  O   . HOH ZA 6 .  ? 15.473  6.817   164.226 1.00 49.40 ? 3531 HOH K O   1 
HETATM 9806 O  O   . HOH ZA 6 .  ? 25.447  4.023   159.479 1.00 49.53 ? 3532 HOH K O   1 
HETATM 9807 O  O   . HOH ZA 6 .  ? 30.401  11.203  159.460 1.00 52.06 ? 3533 HOH K O   1 
HETATM 9808 O  O   . HOH ZA 6 .  ? 14.869  2.500   166.517 1.00 44.69 ? 3534 HOH K O   1 
HETATM 9809 O  O   . HOH ZA 6 .  ? 31.077  10.522  156.827 1.00 50.77 ? 3535 HOH K O   1 
HETATM 9810 O  O   . HOH ZA 6 .  ? 9.467   -17.464 133.234 1.00 43.61 ? 3536 HOH K O   1 
HETATM 9811 O  O   . HOH ZA 6 .  ? 7.478   -4.287  166.504 1.00 45.52 ? 3537 HOH K O   1 
HETATM 9812 O  O   . HOH ZA 6 .  ? 16.252  5.068   163.073 1.00 41.27 ? 3538 HOH K O   1 
HETATM 9813 O  O   . HOH ZA 6 .  ? 6.359   -2.824  162.292 1.00 39.78 ? 3539 HOH K O   1 
HETATM 9814 O  O   . HOH ZA 6 .  ? 14.289  4.121   164.682 1.00 38.64 ? 3540 HOH K O   1 
HETATM 9815 O  O   . HOH ZA 6 .  ? 33.669  8.807   161.402 1.00 43.08 ? 3541 HOH K O   1 
HETATM 9816 O  O   . HOH ZA 6 .  ? 15.583  2.333   163.686 1.00 33.03 ? 3542 HOH K O   1 
HETATM 9817 O  O   . HOH ZA 6 .  ? 27.296  1.462   159.371 1.00 56.48 ? 3543 HOH K O   1 
HETATM 9818 O  O   . HOH ZA 6 .  ? 21.058  5.843   142.316 1.00 55.69 ? 3544 HOH K O   1 
HETATM 9819 O  O   . HOH ZA 6 .  ? 20.790  5.548   132.806 1.00 52.66 ? 3545 HOH K O   1 
HETATM 9820 O  O   . HOH ZA 6 .  ? 24.844  -3.315  132.915 1.00 50.08 ? 3546 HOH K O   1 
HETATM 9821 O  O   . HOH ZA 6 .  ? 17.782  10.200  156.329 1.00 37.88 ? 3547 HOH K O   1 
HETATM 9822 O  O   . HOH ZA 6 .  ? 6.474   5.979   155.925 1.00 53.29 ? 3548 HOH K O   1 
HETATM 9823 O  O   . HOH ZA 6 .  ? 5.306   -1.277  158.272 1.00 37.43 ? 3549 HOH K O   1 
HETATM 9824 O  O   . HOH ZA 6 .  ? 23.008  -7.161  127.631 1.00 46.85 ? 3550 HOH K O   1 
HETATM 9825 O  O   . HOH ZA 6 .  ? 29.513  -0.739  158.246 1.00 53.12 ? 3551 HOH K O   1 
HETATM 9826 O  O   . HOH ZA 6 .  ? 20.366  4.589   162.739 1.00 41.10 ? 3552 HOH K O   1 
HETATM 9827 O  O   . HOH ZA 6 .  ? 18.134  7.065   144.095 1.00 36.51 ? 3553 HOH K O   1 
HETATM 9828 O  O   . HOH ZA 6 .  ? 15.974  8.322   128.664 1.00 48.84 ? 3554 HOH K O   1 
HETATM 9829 O  O   . HOH ZA 6 .  ? 23.506  -4.530  130.622 1.00 57.03 ? 3555 HOH K O   1 
HETATM 9830 O  O   . HOH ZA 6 .  ? 30.442  -0.686  150.709 1.00 39.68 ? 3556 HOH K O   1 
HETATM 9831 O  O   . HOH ZA 6 .  ? 36.574  0.583   148.614 1.00 43.21 ? 3557 HOH K O   1 
HETATM 9832 O  O   . HOH ZA 6 .  ? 23.208  4.941   161.749 1.00 46.28 ? 3558 HOH K O   1 
HETATM 9833 O  O   . HOH ZA 6 .  ? 23.248  -0.098  136.900 1.00 50.71 ? 3559 HOH K O   1 
HETATM 9834 O  O   . HOH ZA 6 .  ? 22.648  -3.886  133.130 1.00 49.42 ? 3560 HOH K O   1 
HETATM 9835 O  O   . HOH ZA 6 .  ? 22.122  0.873   163.033 1.00 45.14 ? 3561 HOH K O   1 
HETATM 9836 O  O   . HOH ZA 6 .  ? 24.041  2.196   161.949 1.00 44.20 ? 3562 HOH K O   1 
HETATM 9837 O  O   . HOH ZA 6 .  ? 28.021  -5.659  133.883 1.00 44.46 ? 3563 HOH K O   1 
HETATM 9838 O  O   . HOH ZA 6 .  ? 28.907  11.922  155.084 1.00 48.51 ? 3564 HOH K O   1 
HETATM 9839 O  O   . HOH ZA 6 .  ? 24.900  3.668   163.871 1.00 39.43 ? 3565 HOH K O   1 
HETATM 9840 O  O   . HOH ZA 6 .  ? 25.919  -3.333  136.364 1.00 49.13 ? 3566 HOH K O   1 
HETATM 9841 O  O   . HOH ZA 6 .  ? 18.427  6.043   137.192 1.00 53.58 ? 3567 HOH K O   1 
HETATM 9842 O  O   . HOH ZA 6 .  ? 23.850  -1.815  135.751 1.00 46.17 ? 3568 HOH K O   1 
HETATM 9843 O  O   . HOH ZA 6 .  ? 15.792  12.802  154.392 1.00 35.03 ? 3569 HOH K O   1 
HETATM 9844 O  O   . HOH ZA 6 .  ? 7.133   -17.831 134.976 1.00 50.33 ? 3570 HOH K O   1 
HETATM 9845 O  O   . HOH ZA 6 .  ? 14.124  12.425  143.295 1.00 53.03 ? 3571 HOH K O   1 
HETATM 9846 O  O   . HOH ZA 6 .  ? 30.236  -3.896  148.115 1.00 36.11 ? 3572 HOH K O   1 
HETATM 9847 O  O   . HOH ZA 6 .  ? 8.708   3.624   161.286 1.00 36.10 ? 3573 HOH K O   1 
HETATM 9848 O  O   . HOH ZA 6 .  ? -1.216  -14.880 140.663 1.00 41.17 ? 3574 HOH K O   1 
HETATM 9849 O  O   . HOH ZA 6 .  ? 15.172  -12.782 133.382 1.00 41.18 ? 3575 HOH K O   1 
HETATM 9850 O  O   . HOH ZA 6 .  ? 33.719  5.089   152.711 1.00 42.65 ? 3576 HOH K O   1 
HETATM 9851 O  O   . HOH ZA 6 .  ? 22.942  2.122   164.893 1.00 34.46 ? 3577 HOH K O   1 
HETATM 9852 O  O   . HOH ZA 6 .  ? 22.199  3.768   132.900 1.00 43.17 ? 3578 HOH K O   1 
HETATM 9853 O  O   . HOH ZA 6 .  ? 6.654   5.797   153.809 1.00 34.40 ? 3579 HOH K O   1 
HETATM 9854 O  O   . HOH ZA 6 .  ? 28.325  0.028   162.369 1.00 33.54 ? 3580 HOH K O   1 
HETATM 9855 O  O   . HOH ZA 6 .  ? 29.899  -0.677  161.386 1.00 30.99 ? 3581 HOH K O   1 
HETATM 9856 O  O   . HOH ZA 6 .  ? 9.929   -1.468  166.887 1.00 40.89 ? 3582 HOH K O   1 
HETATM 9857 O  O   . HOH ZA 6 .  ? 16.773  -2.454  168.189 1.00 36.59 ? 3583 HOH K O   1 
HETATM 9858 O  O   . HOH ZA 6 .  ? 21.449  2.808   161.834 1.00 28.29 ? 3584 HOH K O   1 
HETATM 9859 O  O   . HOH ZA 6 .  ? 26.066  -0.272  161.252 1.00 33.15 ? 3585 HOH K O   1 
HETATM 9860 O  O   . HOH ZA 6 .  ? 32.752  -1.181  145.554 1.00 34.08 ? 3586 HOH K O   1 
HETATM 9861 O  O   . HOH ZA 6 .  ? 5.212   -11.117 144.726 1.00 22.83 ? 3587 HOH K O   1 
HETATM 9862 O  O   . HOH ZA 6 .  ? 5.272   -0.109  154.673 1.00 30.18 ? 3588 HOH K O   1 
HETATM 9863 O  O   . HOH ZA 6 .  ? 28.143  1.785   139.918 1.00 33.25 ? 3589 HOH K O   1 
HETATM 9864 O  O   . HOH ZA 6 .  ? 8.545   -15.664 150.736 1.00 32.06 ? 3590 HOH K O   1 
HETATM 9865 O  O   . HOH ZA 6 .  ? 25.863  -1.471  158.445 1.00 32.32 ? 3591 HOH K O   1 
HETATM 9866 O  O   . HOH ZA 6 .  ? 9.901   -11.430 154.090 1.00 33.16 ? 3592 HOH K O   1 
HETATM 9867 O  O   . HOH ZA 6 .  ? 26.834  0.388   151.332 1.00 30.12 ? 3593 HOH K O   1 
HETATM 9868 O  O   . HOH ZA 6 .  ? 1.617   2.556   150.774 1.00 38.39 ? 3594 HOH K O   1 
HETATM 9869 O  O   . HOH ZA 6 .  ? 9.426   6.179   156.693 1.00 25.16 ? 3595 HOH K O   1 
HETATM 9870 O  O   . HOH ZA 6 .  ? 14.673  0.451   161.356 1.00 21.61 ? 3596 HOH K O   1 
HETATM 9871 O  O   . HOH ZA 6 .  ? 10.158  -5.977  156.277 1.00 24.71 ? 3597 HOH K O   1 
HETATM 9872 O  O   . HOH ZA 6 .  ? 12.006  -0.756  126.298 1.00 28.90 ? 3598 HOH K O   1 
HETATM 9873 O  O   . HOH ZA 6 .  ? 30.542  -2.864  145.477 1.00 30.87 ? 3599 HOH K O   1 
HETATM 9874 O  O   . HOH ZA 6 .  ? 18.985  5.603   160.727 1.00 26.56 ? 3600 HOH K O   1 
HETATM 9875 O  O   . HOH ZA 6 .  ? 7.545   8.410   153.689 1.00 17.88 ? 3601 HOH K O   1 
HETATM 9876 O  O   . HOH ZA 6 .  ? 5.607   -15.696 134.435 1.00 26.85 ? 3602 HOH K O   1 
HETATM 9877 O  O   . HOH ZA 6 .  ? 11.548  7.512   148.268 1.00 19.03 ? 3603 HOH K O   1 
HETATM 9878 O  O   . HOH ZA 6 .  ? 20.868  -10.415 146.560 1.00 17.51 ? 3604 HOH K O   1 
HETATM 9879 O  O   . HOH ZA 6 .  ? 8.337   -1.307  161.699 1.00 26.14 ? 3605 HOH K O   1 
HETATM 9880 O  O   . HOH ZA 6 .  ? 7.966   -0.530  155.244 1.00 19.79 ? 3606 HOH K O   1 
HETATM 9881 O  O   . HOH ZA 6 .  ? 13.731  -13.031 141.439 1.00 16.88 ? 3607 HOH K O   1 
HETATM 9882 O  O   . HOH ZA 6 .  ? 16.729  1.742   164.187 1.00 34.33 ? 3608 HOH K O   1 
HETATM 9883 O  O   . HOH ZA 6 .  ? 14.847  3.629   162.141 1.00 64.68 ? 3609 HOH K O   1 
HETATM 9884 O  O   . HOH ZA 6 .  ? 14.003  2.001   163.664 1.00 35.21 ? 3610 HOH K O   1 
HETATM 9885 O  O   . HOH AB 6 .  ? 0.212   18.461  102.400 1.00 57.55 ? 4523 HOH L O   1 
HETATM 9886 O  O   . HOH AB 6 .  ? -1.141  11.348  104.025 1.00 57.04 ? 4524 HOH L O   1 
HETATM 9887 O  O   . HOH AB 6 .  ? 20.076  10.869  126.268 1.00 53.18 ? 4525 HOH L O   1 
HETATM 9888 O  O   . HOH AB 6 .  ? 6.633   2.343   109.509 1.00 51.01 ? 4526 HOH L O   1 
HETATM 9889 O  O   . HOH AB 6 .  ? -3.208  30.542  134.094 1.00 52.03 ? 4527 HOH L O   1 
HETATM 9890 O  O   . HOH AB 6 .  ? 9.422   4.908   113.060 1.00 49.58 ? 4528 HOH L O   1 
HETATM 9891 O  O   . HOH AB 6 .  ? -3.590  15.962  101.366 1.00 50.23 ? 4529 HOH L O   1 
HETATM 9892 O  O   . HOH AB 6 .  ? 18.119  17.944  142.718 1.00 47.15 ? 4530 HOH L O   1 
HETATM 9893 O  O   . HOH AB 6 .  ? 30.129  17.393  114.527 1.00 52.22 ? 4531 HOH L O   1 
HETATM 9894 O  O   . HOH AB 6 .  ? 3.191   19.834  103.027 1.00 48.85 ? 4532 HOH L O   1 
HETATM 9895 O  O   . HOH AB 6 .  ? 5.045   22.901  102.948 1.00 46.88 ? 4533 HOH L O   1 
HETATM 9896 O  O   . HOH AB 6 .  ? 23.269  16.225  113.346 1.00 43.60 ? 4534 HOH L O   1 
HETATM 9897 O  O   . HOH AB 6 .  ? 21.316  13.738  112.378 1.00 45.93 ? 4535 HOH L O   1 
HETATM 9898 O  O   . HOH AB 6 .  ? 14.163  7.204   122.051 1.00 33.98 ? 4536 HOH L O   1 
HETATM 9899 O  O   . HOH AB 6 .  ? 10.697  30.391  118.773 1.00 33.28 ? 4537 HOH L O   1 
HETATM 9900 O  O   . HOH AB 6 .  ? 10.505  7.637   108.623 1.00 49.01 ? 4538 HOH L O   1 
HETATM 9901 O  O   . HOH AB 6 .  ? 13.250  10.686  105.907 1.00 43.79 ? 4539 HOH L O   1 
HETATM 9902 O  O   . HOH AB 6 .  ? 0.175   9.886   119.635 1.00 36.73 ? 4540 HOH L O   1 
HETATM 9903 O  O   . HOH AB 6 .  ? -0.902  7.417   111.522 1.00 47.17 ? 4541 HOH L O   1 
HETATM 9904 O  O   . HOH AB 6 .  ? 26.388  14.539  124.204 1.00 40.43 ? 4542 HOH L O   1 
HETATM 9905 O  O   . HOH AB 6 .  ? 21.006  19.601  142.122 1.00 57.38 ? 4543 HOH L O   1 
HETATM 9906 O  O   . HOH AB 6 .  ? 11.390  13.234  103.010 1.00 38.96 ? 4544 HOH L O   1 
HETATM 9907 O  O   . HOH AB 6 .  ? -1.554  16.599  105.777 1.00 51.08 ? 4545 HOH L O   1 
HETATM 9908 O  O   . HOH AB 6 .  ? 3.104   13.123  104.443 1.00 58.53 ? 4546 HOH L O   1 
HETATM 9909 O  O   . HOH AB 6 .  ? 24.723  20.721  134.573 1.00 59.79 ? 4547 HOH L O   1 
HETATM 9910 O  O   . HOH AB 6 .  ? 18.501  7.490   139.131 1.00 45.48 ? 4548 HOH L O   1 
HETATM 9911 O  O   . HOH AB 6 .  ? 13.788  3.557   126.708 1.00 49.37 ? 4549 HOH L O   1 
HETATM 9912 O  O   . HOH AB 6 .  ? 22.911  19.503  132.551 1.00 46.67 ? 4550 HOH L O   1 
HETATM 9913 O  O   . HOH AB 6 .  ? 27.165  16.802  114.974 1.00 45.38 ? 4551 HOH L O   1 
HETATM 9914 O  O   . HOH AB 6 .  ? -1.220  35.364  130.130 1.00 43.36 ? 4552 HOH L O   1 
HETATM 9915 O  O   . HOH AB 6 .  ? 22.751  17.563  129.977 1.00 54.58 ? 4553 HOH L O   1 
HETATM 9916 O  O   . HOH AB 6 .  ? 17.990  9.581   125.224 1.00 50.56 ? 4554 HOH L O   1 
HETATM 9917 O  O   . HOH AB 6 .  ? 12.876  27.009  116.921 1.00 38.27 ? 4555 HOH L O   1 
HETATM 9918 O  O   . HOH AB 6 .  ? 13.593  34.241  132.322 1.00 39.81 ? 4556 HOH L O   1 
HETATM 9919 O  O   . HOH AB 6 .  ? 14.315  8.357   124.335 1.00 45.61 ? 4557 HOH L O   1 
HETATM 9920 O  O   . HOH AB 6 .  ? 15.082  28.830  135.493 1.00 39.64 ? 4558 HOH L O   1 
HETATM 9921 O  O   . HOH AB 6 .  ? 19.757  16.755  141.753 1.00 56.13 ? 4559 HOH L O   1 
HETATM 9922 O  O   . HOH AB 6 .  ? 3.706   11.354  106.628 1.00 46.64 ? 4560 HOH L O   1 
HETATM 9923 O  O   . HOH AB 6 .  ? 5.399   8.725   105.997 1.00 45.85 ? 4561 HOH L O   1 
HETATM 9924 O  O   . HOH AB 6 .  ? 24.413  19.125  128.152 1.00 50.33 ? 4562 HOH L O   1 
HETATM 9925 O  O   . HOH AB 6 .  ? 9.460   29.777  115.929 1.00 34.42 ? 4563 HOH L O   1 
HETATM 9926 O  O   . HOH AB 6 .  ? 18.315  16.082  103.716 1.00 33.86 ? 4564 HOH L O   1 
HETATM 9927 O  O   . HOH AB 6 .  ? 11.130  28.056  118.299 1.00 33.83 ? 4565 HOH L O   1 
HETATM 9928 O  O   . HOH AB 6 .  ? 11.834  28.993  116.407 1.00 25.37 ? 4566 HOH L O   1 
HETATM 9929 O  O   . HOH AB 6 .  ? 4.034   13.456  107.199 1.00 26.88 ? 4567 HOH L O   1 
HETATM 9930 O  O   . HOH AB 6 .  ? -3.310  16.836  115.650 1.00 39.63 ? 4568 HOH L O   1 
HETATM 9931 O  O   . HOH AB 6 .  ? 1.255   36.804  128.630 1.00 41.42 ? 4569 HOH L O   1 
HETATM 9932 O  O   . HOH AB 6 .  ? 15.336  15.879  105.240 1.00 40.60 ? 4570 HOH L O   1 
HETATM 9933 O  O   . HOH AB 6 .  ? -1.087  13.606  115.984 1.00 40.73 ? 4571 HOH L O   1 
HETATM 9934 O  O   . HOH AB 6 .  ? 5.056   34.534  136.412 1.00 40.10 ? 4572 HOH L O   1 
HETATM 9935 O  O   . HOH AB 6 .  ? 12.037  30.265  132.288 1.00 43.07 ? 4573 HOH L O   1 
HETATM 9936 O  O   . HOH AB 6 .  ? -0.226  12.008  111.432 1.00 40.72 ? 4574 HOH L O   1 
HETATM 9937 O  O   . HOH AB 6 .  ? 2.703   31.389  121.358 1.00 37.37 ? 4575 HOH L O   1 
HETATM 9938 O  O   . HOH AB 6 .  ? 13.374  13.406  105.231 1.00 44.88 ? 4576 HOH L O   1 
HETATM 9939 O  O   . HOH AB 6 .  ? 1.126   16.514  102.990 1.00 44.07 ? 4577 HOH L O   1 
HETATM 9940 O  O   . HOH AB 6 .  ? 11.866  27.986  106.803 1.00 33.13 ? 4578 HOH L O   1 
HETATM 9941 O  O   . HOH AB 6 .  ? 5.543   16.251  100.141 1.00 41.46 ? 4579 HOH L O   1 
HETATM 9942 O  O   . HOH AB 6 .  ? 1.391   27.038  125.375 1.00 30.19 ? 4580 HOH L O   1 
HETATM 9943 O  O   . HOH AB 6 .  ? 11.059  12.792  106.420 1.00 33.38 ? 4581 HOH L O   1 
HETATM 9944 O  O   . HOH AB 6 .  ? 2.819   36.807  130.837 1.00 41.54 ? 4582 HOH L O   1 
HETATM 9945 O  O   . HOH AB 6 .  ? 12.086  29.304  120.191 1.00 29.84 ? 4583 HOH L O   1 
HETATM 9946 O  O   . HOH AB 6 .  ? 4.221   17.994  102.226 1.00 39.89 ? 4584 HOH L O   1 
HETATM 9947 O  O   . HOH AB 6 .  ? 11.389  2.884   126.504 1.00 54.66 ? 4585 HOH L O   1 
HETATM 9948 O  O   . HOH AB 6 .  ? 8.843   27.403  108.142 1.00 28.84 ? 4586 HOH L O   1 
HETATM 9949 O  O   . HOH AB 6 .  ? 24.137  19.812  115.947 1.00 29.76 ? 4587 HOH L O   1 
HETATM 9950 O  O   . HOH AB 6 .  ? -0.129  22.295  113.107 1.00 33.67 ? 4588 HOH L O   1 
HETATM 9951 O  O   . HOH AB 6 .  ? 27.182  16.867  117.483 1.00 34.85 ? 4589 HOH L O   1 
HETATM 9952 O  O   . HOH AB 6 .  ? 2.703   26.972  117.885 1.00 32.61 ? 4590 HOH L O   1 
HETATM 9953 O  O   . HOH AB 6 .  ? 7.826   33.895  136.252 1.00 38.95 ? 4591 HOH L O   1 
HETATM 9954 O  O   . HOH AB 6 .  ? 24.464  13.686  124.756 1.00 34.91 ? 4592 HOH L O   1 
HETATM 9955 O  O   . HOH AB 6 .  ? 15.299  12.160  106.924 1.00 36.72 ? 4593 HOH L O   1 
HETATM 9956 O  O   . HOH AB 6 .  ? -1.429  15.520  118.888 1.00 33.65 ? 4594 HOH L O   1 
HETATM 9957 O  O   . HOH AB 6 .  ? 4.813   15.065  109.380 1.00 24.45 ? 4595 HOH L O   1 
HETATM 9958 O  O   . HOH AB 6 .  ? 13.285  26.865  121.142 1.00 26.89 ? 4596 HOH L O   1 
HETATM 9959 O  O   . HOH AB 6 .  ? 19.646  15.288  114.221 1.00 33.29 ? 4597 HOH L O   1 
HETATM 9960 O  O   . HOH AB 6 .  ? 1.942   26.768  128.206 1.00 28.01 ? 4598 HOH L O   1 
HETATM 9961 O  O   . HOH AB 6 .  ? 1.915   9.405   115.581 1.00 32.28 ? 4599 HOH L O   1 
HETATM 9962 O  O   . HOH AB 6 .  ? 16.088  17.240  108.065 1.00 28.63 ? 4600 HOH L O   1 
HETATM 9963 O  O   . HOH AB 6 .  ? 11.135  31.461  128.858 1.00 25.44 ? 4601 HOH L O   1 
HETATM 9964 O  O   . HOH AB 6 .  ? 6.432   28.539  114.034 1.00 32.66 ? 4602 HOH L O   1 
HETATM 9965 O  O   . HOH AB 6 .  ? 6.711   28.244  116.533 1.00 26.79 ? 4603 HOH L O   1 
HETATM 9966 O  O   . HOH AB 6 .  ? 2.293   21.388  115.756 1.00 30.19 ? 4604 HOH L O   1 
HETATM 9967 O  O   . HOH AB 6 .  ? 15.785  26.120  120.877 1.00 20.44 ? 4605 HOH L O   1 
HETATM 9968 O  O   . HOH AB 6 .  ? 25.066  18.585  118.203 1.00 35.79 ? 4606 HOH L O   1 
HETATM 9969 O  O   . HOH AB 6 .  ? 15.109  16.378  143.096 1.00 32.63 ? 4607 HOH L O   1 
HETATM 9970 O  O   . HOH AB 6 .  ? 9.112   10.143  108.459 1.00 26.67 ? 4608 HOH L O   1 
HETATM 9971 O  O   . HOH AB 6 .  ? 1.167   7.061   119.071 1.00 18.53 ? 4609 HOH L O   1 
HETATM 9972 O  O   . HOH AB 6 .  ? -1.083  16.711  111.463 1.00 29.11 ? 4610 HOH L O   1 
HETATM 9973 O  O   . HOH AB 6 .  ? 7.709   26.835  110.326 1.00 21.02 ? 4611 HOH L O   1 
HETATM 9974 O  O   . HOH AB 6 .  ? 0.581   15.843  117.506 1.00 22.62 ? 4612 HOH L O   1 
HETATM 9975 O  O   . HOH AB 6 .  ? 10.700  28.793  128.252 1.00 17.41 ? 4613 HOH L O   1 
HETATM 9976 O  O   . HOH AB 6 .  ? 5.971   31.333  137.767 1.00 23.93 ? 4614 HOH L O   1 
HETATM 9977 O  O   . HOH AB 6 .  ? 7.371   30.764  126.060 1.00 20.79 ? 4615 HOH L O   1 
HETATM 9978 O  O   . HOH AB 6 .  ? 6.822   8.157   122.755 1.00 19.94 ? 4616 HOH L O   1 
HETATM 9979 O  O   . HOH AB 6 .  ? 4.741   12.244  109.012 1.00 54.78 ? 4617 HOH L O   1 
HETATM 9980 O  O   . HOH AB 6 .  ? 5.750   13.688  106.191 1.00 33.42 ? 4618 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1  MET MET A . n 
A 1 2   LEU 2   2   2  LEU LEU A . n 
A 1 3   THR 3   3   3  THR THR A . n 
A 1 4   GLU 4   4   4  GLU GLU A . n 
A 1 5   LEU 5   5   5  LEU LEU A . n 
A 1 6   GLU 6   6   6  GLU GLU A . n 
A 1 7   LYS 7   7   7  LYS LYS A . n 
A 1 8   ALA 8   8   8  ALA ALA A . n 
A 1 9   LEU 9   9   9  LEU LEU A . n 
A 1 10  ASN 10  10  10 ASN ASN A . n 
A 1 11  SER 11  11  11 SER SER A . n 
A 1 12  ILE 12  12  12 ILE ILE A . n 
A 1 13  ILE 13  13  13 ILE ILE A . n 
A 1 14  ASP 14  14  14 ASP ASP A . n 
A 1 15  VAL 15  15  15 VAL VAL A . n 
A 1 16  TYR 16  16  16 TYR TYR A . n 
A 1 17  HIS 17  17  17 HIS HIS A . n 
A 1 18  LYS 18  18  18 LYS LYS A . n 
A 1 19  TYR 19  19  19 TYR TYR A . n 
A 1 20  SER 20  20  20 SER SER A . n 
A 1 21  LEU 21  21  21 LEU LEU A . n 
A 1 22  ILE 22  22  22 ILE ILE A . n 
A 1 23  LYS 23  23  23 LYS LYS A . n 
A 1 24  GLY 24  24  24 GLY GLY A . n 
A 1 25  ASN 25  25  25 ASN ASN A . n 
A 1 26  PHE 26  26  26 PHE PHE A . n 
A 1 27  HIS 27  27  27 HIS HIS A . n 
A 1 28  ALA 28  28  28 ALA ALA A . n 
A 1 29  VAL 29  29  29 VAL VAL A . n 
A 1 30  TYR 30  30  30 TYR TYR A . n 
A 1 31  ARG 31  31  31 ARG ARG A . n 
A 1 32  ASP 32  32  32 ASP ASP A . n 
A 1 33  ASP 33  33  33 ASP ASP A . n 
A 1 34  LEU 34  34  34 LEU LEU A . n 
A 1 35  LYS 35  35  35 LYS LYS A . n 
A 1 36  LYS 36  36  36 LYS LYS A . n 
A 1 37  LEU 37  37  37 LEU LEU A . n 
A 1 38  LEU 38  38  38 LEU LEU A . n 
A 1 39  GLU 39  39  39 GLU GLU A . n 
A 1 40  THR 40  40  40 THR THR A . n 
A 1 41  GLU 41  41  41 GLU GLU A . n 
A 1 42  SER 42  42  42 SER SER A . n 
A 1 43  PRO 43  43  43 PRO PRO A . n 
A 1 44  GLN 44  44  44 GLN GLN A . n 
A 1 45  TYR 45  45  45 TYR TYR A . n 
A 1 46  ILE 46  46  46 ILE ILE A . n 
A 1 47  ARG 47  47  47 ARG ARG A . n 
A 1 48  LYS 48  48  48 LYS LYS A . n 
A 1 49  LYS 49  49  49 LYS LYS A . n 
A 1 50  GLY 50  50  50 GLY GLY A . n 
A 1 51  ALA 51  51  51 ALA ALA A . n 
A 1 52  ASP 52  52  52 ASP ASP A . n 
A 1 53  VAL 53  53  53 VAL VAL A . n 
A 1 54  TRP 54  54  54 TRP TRP A . n 
A 1 55  PHE 55  55  55 PHE PHE A . n 
A 1 56  LYS 56  56  56 LYS LYS A . n 
A 1 57  GLU 57  57  57 GLU GLU A . n 
A 1 58  LEU 58  58  58 LEU LEU A . n 
A 1 59  ASP 59  59  59 ASP ASP A . n 
A 1 60  ILE 60  60  60 ILE ILE A . n 
A 1 61  ASN 61  61  61 ASN ASN A . n 
A 1 62  THR 62  62  62 THR THR A . n 
A 1 63  ASP 63  63  63 ASP ASP A . n 
A 1 64  GLY 64  64  64 GLY GLY A . n 
A 1 65  ALA 65  65  65 ALA ALA A . n 
A 1 66  VAL 66  66  66 VAL VAL A . n 
A 1 67  ASN 67  67  67 ASN ASN A . n 
A 1 68  PHE 68  68  68 PHE PHE A . n 
A 1 69  GLN 69  69  69 GLN GLN A . n 
A 1 70  GLU 70  70  70 GLU GLU A . n 
A 1 71  PHE 71  71  71 PHE PHE A . n 
A 1 72  LEU 72  72  72 LEU LEU A . n 
A 1 73  ILE 73  73  73 ILE ILE A . n 
A 1 74  LEU 74  74  74 LEU LEU A . n 
A 1 75  VAL 75  75  75 VAL VAL A . n 
A 1 76  ILE 76  76  76 ILE ILE A . n 
A 1 77  LYS 77  77  77 LYS LYS A . n 
A 1 78  MET 78  78  78 MET MET A . n 
A 1 79  GLY 79  79  79 GLY GLY A . n 
A 1 80  VAL 80  80  80 VAL VAL A . n 
A 1 81  ALA 81  81  81 ALA ALA A . n 
A 1 82  ALA 82  82  82 ALA ALA A . n 
A 1 83  HIS 83  83  83 HIS HIS A . n 
A 1 84  LYS 84  84  84 LYS LYS A . n 
A 1 85  LYS 85  85  85 LYS LYS A . n 
A 1 86  SER 86  86  86 SER SER A . n 
A 1 87  HIS 87  87  87 HIS HIS A . n 
A 1 88  GLU 88  88  ?  ?   ?   A . n 
A 1 89  GLU 89  89  ?  ?   ?   A . n 
A 1 90  SER 90  90  ?  ?   ?   A . n 
A 1 91  HIS 91  91  ?  ?   ?   A . n 
A 1 92  LYS 92  92  ?  ?   ?   A . n 
A 1 93  GLU 93  93  ?  ?   ?   A . n 
B 1 1   MET 1   1   1  MET MET B . n 
B 1 2   LEU 2   2   2  LEU LEU B . n 
B 1 3   THR 3   3   3  THR THR B . n 
B 1 4   GLU 4   4   4  GLU GLU B . n 
B 1 5   LEU 5   5   5  LEU LEU B . n 
B 1 6   GLU 6   6   6  GLU GLU B . n 
B 1 7   LYS 7   7   7  LYS LYS B . n 
B 1 8   ALA 8   8   8  ALA ALA B . n 
B 1 9   LEU 9   9   9  LEU LEU B . n 
B 1 10  ASN 10  10  10 ASN ASN B . n 
B 1 11  SER 11  11  11 SER SER B . n 
B 1 12  ILE 12  12  12 ILE ILE B . n 
B 1 13  ILE 13  13  13 ILE ILE B . n 
B 1 14  ASP 14  14  14 ASP ASP B . n 
B 1 15  VAL 15  15  15 VAL VAL B . n 
B 1 16  TYR 16  16  16 TYR TYR B . n 
B 1 17  HIS 17  17  17 HIS HIS B . n 
B 1 18  LYS 18  18  18 LYS LYS B . n 
B 1 19  TYR 19  19  19 TYR TYR B . n 
B 1 20  SER 20  20  20 SER SER B . n 
B 1 21  LEU 21  21  21 LEU LEU B . n 
B 1 22  ILE 22  22  22 ILE ILE B . n 
B 1 23  LYS 23  23  23 LYS LYS B . n 
B 1 24  GLY 24  24  24 GLY GLY B . n 
B 1 25  ASN 25  25  25 ASN ASN B . n 
B 1 26  PHE 26  26  26 PHE PHE B . n 
B 1 27  HIS 27  27  27 HIS HIS B . n 
B 1 28  ALA 28  28  28 ALA ALA B . n 
B 1 29  VAL 29  29  29 VAL VAL B . n 
B 1 30  TYR 30  30  30 TYR TYR B . n 
B 1 31  ARG 31  31  31 ARG ARG B . n 
B 1 32  ASP 32  32  32 ASP ASP B . n 
B 1 33  ASP 33  33  33 ASP ASP B . n 
B 1 34  LEU 34  34  34 LEU LEU B . n 
B 1 35  LYS 35  35  35 LYS LYS B . n 
B 1 36  LYS 36  36  36 LYS LYS B . n 
B 1 37  LEU 37  37  37 LEU LEU B . n 
B 1 38  LEU 38  38  38 LEU LEU B . n 
B 1 39  GLU 39  39  39 GLU GLU B . n 
B 1 40  THR 40  40  40 THR THR B . n 
B 1 41  GLU 41  41  41 GLU GLU B . n 
B 1 42  SER 42  42  42 SER SER B . n 
B 1 43  PRO 43  43  43 PRO PRO B . n 
B 1 44  GLN 44  44  44 GLN GLN B . n 
B 1 45  TYR 45  45  45 TYR TYR B . n 
B 1 46  ILE 46  46  46 ILE ILE B . n 
B 1 47  ARG 47  47  47 ARG ARG B . n 
B 1 48  LYS 48  48  48 LYS LYS B . n 
B 1 49  LYS 49  49  49 LYS LYS B . n 
B 1 50  GLY 50  50  50 GLY GLY B . n 
B 1 51  ALA 51  51  51 ALA ALA B . n 
B 1 52  ASP 52  52  52 ASP ASP B . n 
B 1 53  VAL 53  53  53 VAL VAL B . n 
B 1 54  TRP 54  54  54 TRP TRP B . n 
B 1 55  PHE 55  55  55 PHE PHE B . n 
B 1 56  LYS 56  56  56 LYS LYS B . n 
B 1 57  GLU 57  57  57 GLU GLU B . n 
B 1 58  LEU 58  58  58 LEU LEU B . n 
B 1 59  ASP 59  59  59 ASP ASP B . n 
B 1 60  ILE 60  60  60 ILE ILE B . n 
B 1 61  ASN 61  61  61 ASN ASN B . n 
B 1 62  THR 62  62  62 THR THR B . n 
B 1 63  ASP 63  63  63 ASP ASP B . n 
B 1 64  GLY 64  64  64 GLY GLY B . n 
B 1 65  ALA 65  65  65 ALA ALA B . n 
B 1 66  VAL 66  66  66 VAL VAL B . n 
B 1 67  ASN 67  67  67 ASN ASN B . n 
B 1 68  PHE 68  68  68 PHE PHE B . n 
B 1 69  GLN 69  69  69 GLN GLN B . n 
B 1 70  GLU 70  70  70 GLU GLU B . n 
B 1 71  PHE 71  71  71 PHE PHE B . n 
B 1 72  LEU 72  72  72 LEU LEU B . n 
B 1 73  ILE 73  73  73 ILE ILE B . n 
B 1 74  LEU 74  74  74 LEU LEU B . n 
B 1 75  VAL 75  75  75 VAL VAL B . n 
B 1 76  ILE 76  76  76 ILE ILE B . n 
B 1 77  LYS 77  77  77 LYS LYS B . n 
B 1 78  MET 78  78  78 MET MET B . n 
B 1 79  GLY 79  79  79 GLY GLY B . n 
B 1 80  VAL 80  80  80 VAL VAL B . n 
B 1 81  ALA 81  81  81 ALA ALA B . n 
B 1 82  ALA 82  82  82 ALA ALA B . n 
B 1 83  HIS 83  83  83 HIS HIS B . n 
B 1 84  LYS 84  84  84 LYS LYS B . n 
B 1 85  LYS 85  85  85 LYS LYS B . n 
B 1 86  SER 86  86  86 SER SER B . n 
B 1 87  HIS 87  87  87 HIS HIS B . n 
B 1 88  GLU 88  88  88 GLU GLU B . n 
B 1 89  GLU 89  89  ?  ?   ?   B . n 
B 1 90  SER 90  90  ?  ?   ?   B . n 
B 1 91  HIS 91  91  ?  ?   ?   B . n 
B 1 92  LYS 92  92  ?  ?   ?   B . n 
B 1 93  GLU 93  93  ?  ?   ?   B . n 
C 2 1   THR 1   2   ?  ?   ?   C . n 
C 2 2   SER 2   3   ?  ?   ?   C . n 
C 2 3   LYS 3   4   4  LYS LYS C . n 
C 2 4   MET 4   5   5  MET MET C . n 
C 2 5   SER 5   6   6  SER SER C . n 
C 2 6   GLN 6   7   7  GLN GLN C . n 
C 2 7   LEU 7   8   8  LEU LEU C . n 
C 2 8   GLU 8   9   9  GLU GLU C . n 
C 2 9   ARG 9   10  10 ARG ARG C . n 
C 2 10  ASN 10  11  11 ASN ASN C . n 
C 2 11  ILE 11  12  12 ILE ILE C . n 
C 2 12  GLU 12  13  13 GLU GLU C . n 
C 2 13  THR 13  14  14 THR THR C . n 
C 2 14  ILE 14  15  15 ILE ILE C . n 
C 2 15  ILE 15  16  16 ILE ILE C . n 
C 2 16  ASN 16  17  17 ASN ASN C . n 
C 2 17  THR 17  18  18 THR THR C . n 
C 2 18  PHE 18  19  19 PHE PHE C . n 
C 2 19  HIS 19  20  20 HIS HIS C . n 
C 2 20  GLN 20  21  21 GLN GLN C . n 
C 2 21  TYR 21  22  22 TYR TYR C . n 
C 2 22  SER 22  23  23 SER SER C . n 
C 2 23  VAL 23  24  24 VAL VAL C . n 
C 2 24  LYS 24  25  25 LYS LYS C . n 
C 2 25  LEU 25  26  26 LEU LEU C . n 
C 2 26  GLY 26  27  27 GLY GLY C . n 
C 2 27  HIS 27  28  28 HIS HIS C . n 
C 2 28  PRO 28  29  29 PRO PRO C . n 
C 2 29  ASP 29  30  30 ASP ASP C . n 
C 2 30  THR 30  31  31 THR THR C . n 
C 2 31  LEU 31  32  32 LEU LEU C . n 
C 2 32  ASN 32  33  33 ASN ASN C . n 
C 2 33  GLN 33  34  34 GLN GLN C . n 
C 2 34  GLY 34  35  35 GLY GLY C . n 
C 2 35  GLU 35  36  36 GLU GLU C . n 
C 2 36  PHE 36  37  37 PHE PHE C . n 
C 2 37  LYS 37  38  38 LYS LYS C . n 
C 2 38  GLU 38  39  39 GLU GLU C . n 
C 2 39  LEU 39  40  40 LEU LEU C . n 
C 2 40  VAL 40  41  41 VAL VAL C . n 
C 2 41  ARG 41  42  42 ARG ARG C . n 
C 2 42  LYS 42  43  43 LYS LYS C . n 
C 2 43  ASP 43  44  44 ASP ASP C . n 
C 2 44  LEU 44  45  45 LEU LEU C . n 
C 2 45  GLN 45  46  46 GLN GLN C . n 
C 2 46  ASN 46  47  47 ASN ASN C . n 
C 2 47  PHE 47  48  48 PHE PHE C . n 
C 2 48  LEU 48  49  49 LEU LEU C . n 
C 2 49  LYS 49  50  50 LYS LYS C . n 
C 2 50  LYS 50  51  51 LYS LYS C . n 
C 2 51  GLU 51  52  52 GLU GLU C . n 
C 2 52  ASN 52  53  53 ASN ASN C . n 
C 2 53  LYS 53  54  54 LYS LYS C . n 
C 2 54  ASN 54  55  55 ASN ASN C . n 
C 2 55  GLU 55  56  56 GLU GLU C . n 
C 2 56  LYS 56  57  57 LYS LYS C . n 
C 2 57  VAL 57  58  58 VAL VAL C . n 
C 2 58  ILE 58  59  59 ILE ILE C . n 
C 2 59  GLU 59  60  60 GLU GLU C . n 
C 2 60  HIS 60  61  61 HIS HIS C . n 
C 2 61  ILE 61  62  62 ILE ILE C . n 
C 2 62  MET 62  63  63 MET MET C . n 
C 2 63  GLU 63  64  64 GLU GLU C . n 
C 2 64  ASP 64  65  65 ASP ASP C . n 
C 2 65  LEU 65  66  66 LEU LEU C . n 
C 2 66  ASP 66  67  67 ASP ASP C . n 
C 2 67  THR 67  68  68 THR THR C . n 
C 2 68  ASN 68  69  69 ASN ASN C . n 
C 2 69  ALA 69  70  70 ALA ALA C . n 
C 2 70  ASP 70  71  71 ASP ASP C . n 
C 2 71  LYS 71  72  72 LYS LYS C . n 
C 2 72  GLN 72  73  73 GLN GLN C . n 
C 2 73  LEU 73  74  74 LEU LEU C . n 
C 2 74  SER 74  75  75 SER SER C . n 
C 2 75  PHE 75  76  76 PHE PHE C . n 
C 2 76  GLU 76  77  77 GLU GLU C . n 
C 2 77  GLU 77  78  78 GLU GLU C . n 
C 2 78  PHE 78  79  79 PHE PHE C . n 
C 2 79  ILE 79  80  80 ILE ILE C . n 
C 2 80  MET 80  81  81 MET MET C . n 
C 2 81  LEU 81  82  82 LEU LEU C . n 
C 2 82  MET 82  83  83 MET MET C . n 
C 2 83  ALA 83  84  84 ALA ALA C . n 
C 2 84  ARG 84  85  85 ARG ARG C . n 
C 2 85  LEU 85  86  86 LEU LEU C . n 
C 2 86  THR 86  87  87 THR THR C . n 
C 2 87  TRP 87  88  88 TRP TRP C . n 
C 2 88  ALA 88  89  89 ALA ALA C . n 
C 2 89  SER 89  90  90 SER SER C . n 
C 2 90  HIS 90  91  91 HIS HIS C . n 
C 2 91  GLU 91  92  92 GLU GLU C . n 
C 2 92  LYS 92  93  ?  ?   ?   C . n 
C 2 93  MET 93  94  ?  ?   ?   C . n 
C 2 94  HIS 94  95  ?  ?   ?   C . n 
C 2 95  GLU 95  96  ?  ?   ?   C . n 
C 2 96  GLY 96  97  ?  ?   ?   C . n 
C 2 97  ASP 97  98  ?  ?   ?   C . n 
C 2 98  GLU 98  99  ?  ?   ?   C . n 
C 2 99  GLY 99  100 ?  ?   ?   C . n 
C 2 100 PRO 100 101 ?  ?   ?   C . n 
C 2 101 GLY 101 102 ?  ?   ?   C . n 
C 2 102 HIS 102 103 ?  ?   ?   C . n 
C 2 103 HIS 103 104 ?  ?   ?   C . n 
C 2 104 HIS 104 105 ?  ?   ?   C . n 
C 2 105 LYS 105 106 ?  ?   ?   C . n 
C 2 106 PRO 106 107 ?  ?   ?   C . n 
C 2 107 GLY 107 108 ?  ?   ?   C . n 
C 2 108 LEU 108 109 ?  ?   ?   C . n 
C 2 109 GLY 109 110 ?  ?   ?   C . n 
C 2 110 GLU 110 111 ?  ?   ?   C . n 
C 2 111 GLY 111 112 ?  ?   ?   C . n 
C 2 112 THR 112 113 ?  ?   ?   C . n 
C 2 113 PRO 113 114 ?  ?   ?   C . n 
D 2 1   THR 1   2   ?  ?   ?   D . n 
D 2 2   SER 2   3   ?  ?   ?   D . n 
D 2 3   LYS 3   4   4  LYS LYS D . n 
D 2 4   MET 4   5   5  MET MET D . n 
D 2 5   SER 5   6   6  SER SER D . n 
D 2 6   GLN 6   7   7  GLN GLN D . n 
D 2 7   LEU 7   8   8  LEU LEU D . n 
D 2 8   GLU 8   9   9  GLU GLU D . n 
D 2 9   ARG 9   10  10 ARG ARG D . n 
D 2 10  ASN 10  11  11 ASN ASN D . n 
D 2 11  ILE 11  12  12 ILE ILE D . n 
D 2 12  GLU 12  13  13 GLU GLU D . n 
D 2 13  THR 13  14  14 THR THR D . n 
D 2 14  ILE 14  15  15 ILE ILE D . n 
D 2 15  ILE 15  16  16 ILE ILE D . n 
D 2 16  ASN 16  17  17 ASN ASN D . n 
D 2 17  THR 17  18  18 THR THR D . n 
D 2 18  PHE 18  19  19 PHE PHE D . n 
D 2 19  HIS 19  20  20 HIS HIS D . n 
D 2 20  GLN 20  21  21 GLN GLN D . n 
D 2 21  TYR 21  22  22 TYR TYR D . n 
D 2 22  SER 22  23  23 SER SER D . n 
D 2 23  VAL 23  24  24 VAL VAL D . n 
D 2 24  LYS 24  25  25 LYS LYS D . n 
D 2 25  LEU 25  26  26 LEU LEU D . n 
D 2 26  GLY 26  27  27 GLY GLY D . n 
D 2 27  HIS 27  28  28 HIS HIS D . n 
D 2 28  PRO 28  29  29 PRO PRO D . n 
D 2 29  ASP 29  30  30 ASP ASP D . n 
D 2 30  THR 30  31  31 THR THR D . n 
D 2 31  LEU 31  32  32 LEU LEU D . n 
D 2 32  ASN 32  33  33 ASN ASN D . n 
D 2 33  GLN 33  34  34 GLN GLN D . n 
D 2 34  GLY 34  35  35 GLY GLY D . n 
D 2 35  GLU 35  36  36 GLU GLU D . n 
D 2 36  PHE 36  37  37 PHE PHE D . n 
D 2 37  LYS 37  38  38 LYS LYS D . n 
D 2 38  GLU 38  39  39 GLU GLU D . n 
D 2 39  LEU 39  40  40 LEU LEU D . n 
D 2 40  VAL 40  41  41 VAL VAL D . n 
D 2 41  ARG 41  42  42 ARG ARG D . n 
D 2 42  LYS 42  43  43 LYS LYS D . n 
D 2 43  ASP 43  44  44 ASP ASP D . n 
D 2 44  LEU 44  45  45 LEU LEU D . n 
D 2 45  GLN 45  46  46 GLN GLN D . n 
D 2 46  ASN 46  47  47 ASN ASN D . n 
D 2 47  PHE 47  48  48 PHE PHE D . n 
D 2 48  LEU 48  49  49 LEU LEU D . n 
D 2 49  LYS 49  50  50 LYS LYS D . n 
D 2 50  LYS 50  51  51 LYS LYS D . n 
D 2 51  GLU 51  52  52 GLU GLU D . n 
D 2 52  ASN 52  53  53 ASN ASN D . n 
D 2 53  LYS 53  54  54 LYS LYS D . n 
D 2 54  ASN 54  55  55 ASN ASN D . n 
D 2 55  GLU 55  56  56 GLU GLU D . n 
D 2 56  LYS 56  57  57 LYS LYS D . n 
D 2 57  VAL 57  58  58 VAL VAL D . n 
D 2 58  ILE 58  59  59 ILE ILE D . n 
D 2 59  GLU 59  60  60 GLU GLU D . n 
D 2 60  HIS 60  61  61 HIS HIS D . n 
D 2 61  ILE 61  62  62 ILE ILE D . n 
D 2 62  MET 62  63  63 MET MET D . n 
D 2 63  GLU 63  64  64 GLU GLU D . n 
D 2 64  ASP 64  65  65 ASP ASP D . n 
D 2 65  LEU 65  66  66 LEU LEU D . n 
D 2 66  ASP 66  67  67 ASP ASP D . n 
D 2 67  THR 67  68  68 THR THR D . n 
D 2 68  ASN 68  69  69 ASN ASN D . n 
D 2 69  ALA 69  70  70 ALA ALA D . n 
D 2 70  ASP 70  71  71 ASP ASP D . n 
D 2 71  LYS 71  72  72 LYS LYS D . n 
D 2 72  GLN 72  73  73 GLN GLN D . n 
D 2 73  LEU 73  74  74 LEU LEU D . n 
D 2 74  SER 74  75  75 SER SER D . n 
D 2 75  PHE 75  76  76 PHE PHE D . n 
D 2 76  GLU 76  77  77 GLU GLU D . n 
D 2 77  GLU 77  78  78 GLU GLU D . n 
D 2 78  PHE 78  79  79 PHE PHE D . n 
D 2 79  ILE 79  80  80 ILE ILE D . n 
D 2 80  MET 80  81  81 MET MET D . n 
D 2 81  LEU 81  82  82 LEU LEU D . n 
D 2 82  MET 82  83  83 MET MET D . n 
D 2 83  ALA 83  84  84 ALA ALA D . n 
D 2 84  ARG 84  85  85 ARG ARG D . n 
D 2 85  LEU 85  86  86 LEU LEU D . n 
D 2 86  THR 86  87  87 THR THR D . n 
D 2 87  TRP 87  88  88 TRP TRP D . n 
D 2 88  ALA 88  89  89 ALA ALA D . n 
D 2 89  SER 89  90  90 SER SER D . n 
D 2 90  HIS 90  91  91 HIS HIS D . n 
D 2 91  GLU 91  92  92 GLU GLU D . n 
D 2 92  LYS 92  93  93 LYS LYS D . n 
D 2 93  MET 93  94  94 MET MET D . n 
D 2 94  HIS 94  95  95 HIS HIS D . n 
D 2 95  GLU 95  96  ?  ?   ?   D . n 
D 2 96  GLY 96  97  ?  ?   ?   D . n 
D 2 97  ASP 97  98  ?  ?   ?   D . n 
D 2 98  GLU 98  99  ?  ?   ?   D . n 
D 2 99  GLY 99  100 ?  ?   ?   D . n 
D 2 100 PRO 100 101 ?  ?   ?   D . n 
D 2 101 GLY 101 102 ?  ?   ?   D . n 
D 2 102 HIS 102 103 ?  ?   ?   D . n 
D 2 103 HIS 103 104 ?  ?   ?   D . n 
D 2 104 HIS 104 105 ?  ?   ?   D . n 
D 2 105 LYS 105 106 ?  ?   ?   D . n 
D 2 106 PRO 106 107 ?  ?   ?   D . n 
D 2 107 GLY 107 108 ?  ?   ?   D . n 
D 2 108 LEU 108 109 ?  ?   ?   D . n 
D 2 109 GLY 109 110 ?  ?   ?   D . n 
D 2 110 GLU 110 111 ?  ?   ?   D . n 
D 2 111 GLY 111 112 ?  ?   ?   D . n 
D 2 112 THR 112 113 ?  ?   ?   D . n 
D 2 113 PRO 113 114 ?  ?   ?   D . n 
E 1 1   MET 1   1   1  MET MET E . n 
E 1 2   LEU 2   2   2  LEU LEU E . n 
E 1 3   THR 3   3   3  THR THR E . n 
E 1 4   GLU 4   4   4  GLU GLU E . n 
E 1 5   LEU 5   5   5  LEU LEU E . n 
E 1 6   GLU 6   6   6  GLU GLU E . n 
E 1 7   LYS 7   7   7  LYS LYS E . n 
E 1 8   ALA 8   8   8  ALA ALA E . n 
E 1 9   LEU 9   9   9  LEU LEU E . n 
E 1 10  ASN 10  10  10 ASN ASN E . n 
E 1 11  SER 11  11  11 SER SER E . n 
E 1 12  ILE 12  12  12 ILE ILE E . n 
E 1 13  ILE 13  13  13 ILE ILE E . n 
E 1 14  ASP 14  14  14 ASP ASP E . n 
E 1 15  VAL 15  15  15 VAL VAL E . n 
E 1 16  TYR 16  16  16 TYR TYR E . n 
E 1 17  HIS 17  17  17 HIS HIS E . n 
E 1 18  LYS 18  18  18 LYS LYS E . n 
E 1 19  TYR 19  19  19 TYR TYR E . n 
E 1 20  SER 20  20  20 SER SER E . n 
E 1 21  LEU 21  21  21 LEU LEU E . n 
E 1 22  ILE 22  22  22 ILE ILE E . n 
E 1 23  LYS 23  23  23 LYS LYS E . n 
E 1 24  GLY 24  24  24 GLY GLY E . n 
E 1 25  ASN 25  25  25 ASN ASN E . n 
E 1 26  PHE 26  26  26 PHE PHE E . n 
E 1 27  HIS 27  27  27 HIS HIS E . n 
E 1 28  ALA 28  28  28 ALA ALA E . n 
E 1 29  VAL 29  29  29 VAL VAL E . n 
E 1 30  TYR 30  30  30 TYR TYR E . n 
E 1 31  ARG 31  31  31 ARG ARG E . n 
E 1 32  ASP 32  32  32 ASP ASP E . n 
E 1 33  ASP 33  33  33 ASP ASP E . n 
E 1 34  LEU 34  34  34 LEU LEU E . n 
E 1 35  LYS 35  35  35 LYS LYS E . n 
E 1 36  LYS 36  36  36 LYS LYS E . n 
E 1 37  LEU 37  37  37 LEU LEU E . n 
E 1 38  LEU 38  38  38 LEU LEU E . n 
E 1 39  GLU 39  39  39 GLU GLU E . n 
E 1 40  THR 40  40  40 THR THR E . n 
E 1 41  GLU 41  41  41 GLU GLU E . n 
E 1 42  SER 42  42  42 SER SER E . n 
E 1 43  PRO 43  43  43 PRO PRO E . n 
E 1 44  GLN 44  44  44 GLN GLN E . n 
E 1 45  TYR 45  45  45 TYR TYR E . n 
E 1 46  ILE 46  46  46 ILE ILE E . n 
E 1 47  ARG 47  47  47 ARG ARG E . n 
E 1 48  LYS 48  48  48 LYS LYS E . n 
E 1 49  LYS 49  49  49 LYS LYS E . n 
E 1 50  GLY 50  50  50 GLY GLY E . n 
E 1 51  ALA 51  51  51 ALA ALA E . n 
E 1 52  ASP 52  52  52 ASP ASP E . n 
E 1 53  VAL 53  53  53 VAL VAL E . n 
E 1 54  TRP 54  54  54 TRP TRP E . n 
E 1 55  PHE 55  55  55 PHE PHE E . n 
E 1 56  LYS 56  56  56 LYS LYS E . n 
E 1 57  GLU 57  57  57 GLU GLU E . n 
E 1 58  LEU 58  58  58 LEU LEU E . n 
E 1 59  ASP 59  59  59 ASP ASP E . n 
E 1 60  ILE 60  60  60 ILE ILE E . n 
E 1 61  ASN 61  61  61 ASN ASN E . n 
E 1 62  THR 62  62  62 THR THR E . n 
E 1 63  ASP 63  63  63 ASP ASP E . n 
E 1 64  GLY 64  64  64 GLY GLY E . n 
E 1 65  ALA 65  65  65 ALA ALA E . n 
E 1 66  VAL 66  66  66 VAL VAL E . n 
E 1 67  ASN 67  67  67 ASN ASN E . n 
E 1 68  PHE 68  68  68 PHE PHE E . n 
E 1 69  GLN 69  69  69 GLN GLN E . n 
E 1 70  GLU 70  70  70 GLU GLU E . n 
E 1 71  PHE 71  71  71 PHE PHE E . n 
E 1 72  LEU 72  72  72 LEU LEU E . n 
E 1 73  ILE 73  73  73 ILE ILE E . n 
E 1 74  LEU 74  74  74 LEU LEU E . n 
E 1 75  VAL 75  75  75 VAL VAL E . n 
E 1 76  ILE 76  76  76 ILE ILE E . n 
E 1 77  LYS 77  77  77 LYS LYS E . n 
E 1 78  MET 78  78  78 MET MET E . n 
E 1 79  GLY 79  79  79 GLY GLY E . n 
E 1 80  VAL 80  80  80 VAL VAL E . n 
E 1 81  ALA 81  81  81 ALA ALA E . n 
E 1 82  ALA 82  82  82 ALA ALA E . n 
E 1 83  HIS 83  83  83 HIS HIS E . n 
E 1 84  LYS 84  84  84 LYS LYS E . n 
E 1 85  LYS 85  85  85 LYS LYS E . n 
E 1 86  SER 86  86  86 SER SER E . n 
E 1 87  HIS 87  87  87 HIS HIS E . n 
E 1 88  GLU 88  88  88 GLU GLU E . n 
E 1 89  GLU 89  89  89 GLU GLU E . n 
E 1 90  SER 90  90  ?  ?   ?   E . n 
E 1 91  HIS 91  91  ?  ?   ?   E . n 
E 1 92  LYS 92  92  ?  ?   ?   E . n 
E 1 93  GLU 93  93  ?  ?   ?   E . n 
F 1 1   MET 1   1   1  MET MET F . n 
F 1 2   LEU 2   2   2  LEU LEU F . n 
F 1 3   THR 3   3   3  THR THR F . n 
F 1 4   GLU 4   4   4  GLU GLU F . n 
F 1 5   LEU 5   5   5  LEU LEU F . n 
F 1 6   GLU 6   6   6  GLU GLU F . n 
F 1 7   LYS 7   7   7  LYS LYS F . n 
F 1 8   ALA 8   8   8  ALA ALA F . n 
F 1 9   LEU 9   9   9  LEU LEU F . n 
F 1 10  ASN 10  10  10 ASN ASN F . n 
F 1 11  SER 11  11  11 SER SER F . n 
F 1 12  ILE 12  12  12 ILE ILE F . n 
F 1 13  ILE 13  13  13 ILE ILE F . n 
F 1 14  ASP 14  14  14 ASP ASP F . n 
F 1 15  VAL 15  15  15 VAL VAL F . n 
F 1 16  TYR 16  16  16 TYR TYR F . n 
F 1 17  HIS 17  17  17 HIS HIS F . n 
F 1 18  LYS 18  18  18 LYS LYS F . n 
F 1 19  TYR 19  19  19 TYR TYR F . n 
F 1 20  SER 20  20  20 SER SER F . n 
F 1 21  LEU 21  21  21 LEU LEU F . n 
F 1 22  ILE 22  22  22 ILE ILE F . n 
F 1 23  LYS 23  23  23 LYS LYS F . n 
F 1 24  GLY 24  24  24 GLY GLY F . n 
F 1 25  ASN 25  25  25 ASN ASN F . n 
F 1 26  PHE 26  26  26 PHE PHE F . n 
F 1 27  HIS 27  27  27 HIS HIS F . n 
F 1 28  ALA 28  28  28 ALA ALA F . n 
F 1 29  VAL 29  29  29 VAL VAL F . n 
F 1 30  TYR 30  30  30 TYR TYR F . n 
F 1 31  ARG 31  31  31 ARG ARG F . n 
F 1 32  ASP 32  32  32 ASP ASP F . n 
F 1 33  ASP 33  33  33 ASP ASP F . n 
F 1 34  LEU 34  34  34 LEU LEU F . n 
F 1 35  LYS 35  35  35 LYS LYS F . n 
F 1 36  LYS 36  36  36 LYS LYS F . n 
F 1 37  LEU 37  37  37 LEU LEU F . n 
F 1 38  LEU 38  38  38 LEU LEU F . n 
F 1 39  GLU 39  39  39 GLU GLU F . n 
F 1 40  THR 40  40  40 THR THR F . n 
F 1 41  GLU 41  41  41 GLU GLU F . n 
F 1 42  SER 42  42  42 SER SER F . n 
F 1 43  PRO 43  43  43 PRO PRO F . n 
F 1 44  GLN 44  44  44 GLN GLN F . n 
F 1 45  TYR 45  45  45 TYR TYR F . n 
F 1 46  ILE 46  46  46 ILE ILE F . n 
F 1 47  ARG 47  47  47 ARG ARG F . n 
F 1 48  LYS 48  48  48 LYS LYS F . n 
F 1 49  LYS 49  49  49 LYS LYS F . n 
F 1 50  GLY 50  50  50 GLY GLY F . n 
F 1 51  ALA 51  51  51 ALA ALA F . n 
F 1 52  ASP 52  52  52 ASP ASP F . n 
F 1 53  VAL 53  53  53 VAL VAL F . n 
F 1 54  TRP 54  54  54 TRP TRP F . n 
F 1 55  PHE 55  55  55 PHE PHE F . n 
F 1 56  LYS 56  56  56 LYS LYS F . n 
F 1 57  GLU 57  57  57 GLU GLU F . n 
F 1 58  LEU 58  58  58 LEU LEU F . n 
F 1 59  ASP 59  59  59 ASP ASP F . n 
F 1 60  ILE 60  60  60 ILE ILE F . n 
F 1 61  ASN 61  61  61 ASN ASN F . n 
F 1 62  THR 62  62  62 THR THR F . n 
F 1 63  ASP 63  63  63 ASP ASP F . n 
F 1 64  GLY 64  64  64 GLY GLY F . n 
F 1 65  ALA 65  65  65 ALA ALA F . n 
F 1 66  VAL 66  66  66 VAL VAL F . n 
F 1 67  ASN 67  67  67 ASN ASN F . n 
F 1 68  PHE 68  68  68 PHE PHE F . n 
F 1 69  GLN 69  69  69 GLN GLN F . n 
F 1 70  GLU 70  70  70 GLU GLU F . n 
F 1 71  PHE 71  71  71 PHE PHE F . n 
F 1 72  LEU 72  72  72 LEU LEU F . n 
F 1 73  ILE 73  73  73 ILE ILE F . n 
F 1 74  LEU 74  74  74 LEU LEU F . n 
F 1 75  VAL 75  75  75 VAL VAL F . n 
F 1 76  ILE 76  76  76 ILE ILE F . n 
F 1 77  LYS 77  77  77 LYS LYS F . n 
F 1 78  MET 78  78  78 MET MET F . n 
F 1 79  GLY 79  79  79 GLY GLY F . n 
F 1 80  VAL 80  80  80 VAL VAL F . n 
F 1 81  ALA 81  81  81 ALA ALA F . n 
F 1 82  ALA 82  82  82 ALA ALA F . n 
F 1 83  HIS 83  83  83 HIS HIS F . n 
F 1 84  LYS 84  84  84 LYS LYS F . n 
F 1 85  LYS 85  85  85 LYS LYS F . n 
F 1 86  SER 86  86  86 SER SER F . n 
F 1 87  HIS 87  87  87 HIS HIS F . n 
F 1 88  GLU 88  88  ?  ?   ?   F . n 
F 1 89  GLU 89  89  ?  ?   ?   F . n 
F 1 90  SER 90  90  ?  ?   ?   F . n 
F 1 91  HIS 91  91  ?  ?   ?   F . n 
F 1 92  LYS 92  92  ?  ?   ?   F . n 
F 1 93  GLU 93  93  ?  ?   ?   F . n 
G 2 1   THR 1   2   ?  ?   ?   G . n 
G 2 2   SER 2   3   ?  ?   ?   G . n 
G 2 3   LYS 3   4   4  LYS LYS G . n 
G 2 4   MET 4   5   5  MET MET G . n 
G 2 5   SER 5   6   6  SER SER G . n 
G 2 6   GLN 6   7   7  GLN GLN G . n 
G 2 7   LEU 7   8   8  LEU LEU G . n 
G 2 8   GLU 8   9   9  GLU GLU G . n 
G 2 9   ARG 9   10  10 ARG ARG G . n 
G 2 10  ASN 10  11  11 ASN ASN G . n 
G 2 11  ILE 11  12  12 ILE ILE G . n 
G 2 12  GLU 12  13  13 GLU GLU G . n 
G 2 13  THR 13  14  14 THR THR G . n 
G 2 14  ILE 14  15  15 ILE ILE G . n 
G 2 15  ILE 15  16  16 ILE ILE G . n 
G 2 16  ASN 16  17  17 ASN ASN G . n 
G 2 17  THR 17  18  18 THR THR G . n 
G 2 18  PHE 18  19  19 PHE PHE G . n 
G 2 19  HIS 19  20  20 HIS HIS G . n 
G 2 20  GLN 20  21  21 GLN GLN G . n 
G 2 21  TYR 21  22  22 TYR TYR G . n 
G 2 22  SER 22  23  23 SER SER G . n 
G 2 23  VAL 23  24  24 VAL VAL G . n 
G 2 24  LYS 24  25  25 LYS LYS G . n 
G 2 25  LEU 25  26  26 LEU LEU G . n 
G 2 26  GLY 26  27  27 GLY GLY G . n 
G 2 27  HIS 27  28  28 HIS HIS G . n 
G 2 28  PRO 28  29  29 PRO PRO G . n 
G 2 29  ASP 29  30  30 ASP ASP G . n 
G 2 30  THR 30  31  31 THR THR G . n 
G 2 31  LEU 31  32  32 LEU LEU G . n 
G 2 32  ASN 32  33  33 ASN ASN G . n 
G 2 33  GLN 33  34  34 GLN GLN G . n 
G 2 34  GLY 34  35  35 GLY GLY G . n 
G 2 35  GLU 35  36  36 GLU GLU G . n 
G 2 36  PHE 36  37  37 PHE PHE G . n 
G 2 37  LYS 37  38  38 LYS LYS G . n 
G 2 38  GLU 38  39  39 GLU GLU G . n 
G 2 39  LEU 39  40  40 LEU LEU G . n 
G 2 40  VAL 40  41  41 VAL VAL G . n 
G 2 41  ARG 41  42  42 ARG ARG G . n 
G 2 42  LYS 42  43  43 LYS LYS G . n 
G 2 43  ASP 43  44  44 ASP ASP G . n 
G 2 44  LEU 44  45  45 LEU LEU G . n 
G 2 45  GLN 45  46  46 GLN GLN G . n 
G 2 46  ASN 46  47  47 ASN ASN G . n 
G 2 47  PHE 47  48  48 PHE PHE G . n 
G 2 48  LEU 48  49  49 LEU LEU G . n 
G 2 49  LYS 49  50  50 LYS LYS G . n 
G 2 50  LYS 50  51  51 LYS LYS G . n 
G 2 51  GLU 51  52  52 GLU GLU G . n 
G 2 52  ASN 52  53  53 ASN ASN G . n 
G 2 53  LYS 53  54  54 LYS LYS G . n 
G 2 54  ASN 54  55  55 ASN ASN G . n 
G 2 55  GLU 55  56  56 GLU GLU G . n 
G 2 56  LYS 56  57  57 LYS LYS G . n 
G 2 57  VAL 57  58  58 VAL VAL G . n 
G 2 58  ILE 58  59  59 ILE ILE G . n 
G 2 59  GLU 59  60  60 GLU GLU G . n 
G 2 60  HIS 60  61  61 HIS HIS G . n 
G 2 61  ILE 61  62  62 ILE ILE G . n 
G 2 62  MET 62  63  63 MET MET G . n 
G 2 63  GLU 63  64  64 GLU GLU G . n 
G 2 64  ASP 64  65  65 ASP ASP G . n 
G 2 65  LEU 65  66  66 LEU LEU G . n 
G 2 66  ASP 66  67  67 ASP ASP G . n 
G 2 67  THR 67  68  68 THR THR G . n 
G 2 68  ASN 68  69  69 ASN ASN G . n 
G 2 69  ALA 69  70  70 ALA ALA G . n 
G 2 70  ASP 70  71  71 ASP ASP G . n 
G 2 71  LYS 71  72  72 LYS LYS G . n 
G 2 72  GLN 72  73  73 GLN GLN G . n 
G 2 73  LEU 73  74  74 LEU LEU G . n 
G 2 74  SER 74  75  75 SER SER G . n 
G 2 75  PHE 75  76  76 PHE PHE G . n 
G 2 76  GLU 76  77  77 GLU GLU G . n 
G 2 77  GLU 77  78  78 GLU GLU G . n 
G 2 78  PHE 78  79  79 PHE PHE G . n 
G 2 79  ILE 79  80  80 ILE ILE G . n 
G 2 80  MET 80  81  81 MET MET G . n 
G 2 81  LEU 81  82  82 LEU LEU G . n 
G 2 82  MET 82  83  83 MET MET G . n 
G 2 83  ALA 83  84  84 ALA ALA G . n 
G 2 84  ARG 84  85  85 ARG ARG G . n 
G 2 85  LEU 85  86  86 LEU LEU G . n 
G 2 86  THR 86  87  87 THR THR G . n 
G 2 87  TRP 87  88  88 TRP TRP G . n 
G 2 88  ALA 88  89  89 ALA ALA G . n 
G 2 89  SER 89  90  90 SER SER G . n 
G 2 90  HIS 90  91  91 HIS HIS G . n 
G 2 91  GLU 91  92  92 GLU GLU G . n 
G 2 92  LYS 92  93  93 LYS LYS G . n 
G 2 93  MET 93  94  94 MET MET G . n 
G 2 94  HIS 94  95  95 HIS HIS G . n 
G 2 95  GLU 95  96  ?  ?   ?   G . n 
G 2 96  GLY 96  97  ?  ?   ?   G . n 
G 2 97  ASP 97  98  ?  ?   ?   G . n 
G 2 98  GLU 98  99  ?  ?   ?   G . n 
G 2 99  GLY 99  100 ?  ?   ?   G . n 
G 2 100 PRO 100 101 ?  ?   ?   G . n 
G 2 101 GLY 101 102 ?  ?   ?   G . n 
G 2 102 HIS 102 103 ?  ?   ?   G . n 
G 2 103 HIS 103 104 ?  ?   ?   G . n 
G 2 104 HIS 104 105 ?  ?   ?   G . n 
G 2 105 LYS 105 106 ?  ?   ?   G . n 
G 2 106 PRO 106 107 ?  ?   ?   G . n 
G 2 107 GLY 107 108 ?  ?   ?   G . n 
G 2 108 LEU 108 109 ?  ?   ?   G . n 
G 2 109 GLY 109 110 ?  ?   ?   G . n 
G 2 110 GLU 110 111 ?  ?   ?   G . n 
G 2 111 GLY 111 112 ?  ?   ?   G . n 
G 2 112 THR 112 113 ?  ?   ?   G . n 
G 2 113 PRO 113 114 ?  ?   ?   G . n 
H 2 1   THR 1   2   ?  ?   ?   H . n 
H 2 2   SER 2   3   ?  ?   ?   H . n 
H 2 3   LYS 3   4   4  LYS LYS H . n 
H 2 4   MET 4   5   5  MET MET H . n 
H 2 5   SER 5   6   6  SER SER H . n 
H 2 6   GLN 6   7   7  GLN GLN H . n 
H 2 7   LEU 7   8   8  LEU LEU H . n 
H 2 8   GLU 8   9   9  GLU GLU H . n 
H 2 9   ARG 9   10  10 ARG ARG H . n 
H 2 10  ASN 10  11  11 ASN ASN H . n 
H 2 11  ILE 11  12  12 ILE ILE H . n 
H 2 12  GLU 12  13  13 GLU GLU H . n 
H 2 13  THR 13  14  14 THR THR H . n 
H 2 14  ILE 14  15  15 ILE ILE H . n 
H 2 15  ILE 15  16  16 ILE ILE H . n 
H 2 16  ASN 16  17  17 ASN ASN H . n 
H 2 17  THR 17  18  18 THR THR H . n 
H 2 18  PHE 18  19  19 PHE PHE H . n 
H 2 19  HIS 19  20  20 HIS HIS H . n 
H 2 20  GLN 20  21  21 GLN GLN H . n 
H 2 21  TYR 21  22  22 TYR TYR H . n 
H 2 22  SER 22  23  23 SER SER H . n 
H 2 23  VAL 23  24  24 VAL VAL H . n 
H 2 24  LYS 24  25  25 LYS LYS H . n 
H 2 25  LEU 25  26  26 LEU LEU H . n 
H 2 26  GLY 26  27  27 GLY GLY H . n 
H 2 27  HIS 27  28  28 HIS HIS H . n 
H 2 28  PRO 28  29  29 PRO PRO H . n 
H 2 29  ASP 29  30  30 ASP ASP H . n 
H 2 30  THR 30  31  31 THR THR H . n 
H 2 31  LEU 31  32  32 LEU LEU H . n 
H 2 32  ASN 32  33  33 ASN ASN H . n 
H 2 33  GLN 33  34  34 GLN GLN H . n 
H 2 34  GLY 34  35  35 GLY GLY H . n 
H 2 35  GLU 35  36  36 GLU GLU H . n 
H 2 36  PHE 36  37  37 PHE PHE H . n 
H 2 37  LYS 37  38  38 LYS LYS H . n 
H 2 38  GLU 38  39  39 GLU GLU H . n 
H 2 39  LEU 39  40  40 LEU LEU H . n 
H 2 40  VAL 40  41  41 VAL VAL H . n 
H 2 41  ARG 41  42  42 ARG ARG H . n 
H 2 42  LYS 42  43  43 LYS LYS H . n 
H 2 43  ASP 43  44  44 ASP ASP H . n 
H 2 44  LEU 44  45  45 LEU LEU H . n 
H 2 45  GLN 45  46  46 GLN GLN H . n 
H 2 46  ASN 46  47  47 ASN ASN H . n 
H 2 47  PHE 47  48  48 PHE PHE H . n 
H 2 48  LEU 48  49  49 LEU LEU H . n 
H 2 49  LYS 49  50  50 LYS LYS H . n 
H 2 50  LYS 50  51  51 LYS LYS H . n 
H 2 51  GLU 51  52  52 GLU GLU H . n 
H 2 52  ASN 52  53  53 ASN ASN H . n 
H 2 53  LYS 53  54  54 LYS LYS H . n 
H 2 54  ASN 54  55  55 ASN ASN H . n 
H 2 55  GLU 55  56  56 GLU GLU H . n 
H 2 56  LYS 56  57  57 LYS LYS H . n 
H 2 57  VAL 57  58  58 VAL VAL H . n 
H 2 58  ILE 58  59  59 ILE ILE H . n 
H 2 59  GLU 59  60  60 GLU GLU H . n 
H 2 60  HIS 60  61  61 HIS HIS H . n 
H 2 61  ILE 61  62  62 ILE ILE H . n 
H 2 62  MET 62  63  63 MET MET H . n 
H 2 63  GLU 63  64  64 GLU GLU H . n 
H 2 64  ASP 64  65  65 ASP ASP H . n 
H 2 65  LEU 65  66  66 LEU LEU H . n 
H 2 66  ASP 66  67  67 ASP ASP H . n 
H 2 67  THR 67  68  68 THR THR H . n 
H 2 68  ASN 68  69  69 ASN ASN H . n 
H 2 69  ALA 69  70  70 ALA ALA H . n 
H 2 70  ASP 70  71  71 ASP ASP H . n 
H 2 71  LYS 71  72  72 LYS LYS H . n 
H 2 72  GLN 72  73  73 GLN GLN H . n 
H 2 73  LEU 73  74  74 LEU LEU H . n 
H 2 74  SER 74  75  75 SER SER H . n 
H 2 75  PHE 75  76  76 PHE PHE H . n 
H 2 76  GLU 76  77  77 GLU GLU H . n 
H 2 77  GLU 77  78  78 GLU GLU H . n 
H 2 78  PHE 78  79  79 PHE PHE H . n 
H 2 79  ILE 79  80  80 ILE ILE H . n 
H 2 80  MET 80  81  81 MET MET H . n 
H 2 81  LEU 81  82  82 LEU LEU H . n 
H 2 82  MET 82  83  83 MET MET H . n 
H 2 83  ALA 83  84  84 ALA ALA H . n 
H 2 84  ARG 84  85  85 ARG ARG H . n 
H 2 85  LEU 85  86  86 LEU LEU H . n 
H 2 86  THR 86  87  87 THR THR H . n 
H 2 87  TRP 87  88  88 TRP TRP H . n 
H 2 88  ALA 88  89  89 ALA ALA H . n 
H 2 89  SER 89  90  90 SER SER H . n 
H 2 90  HIS 90  91  91 HIS HIS H . n 
H 2 91  GLU 91  92  92 GLU GLU H . n 
H 2 92  LYS 92  93  ?  ?   ?   H . n 
H 2 93  MET 93  94  ?  ?   ?   H . n 
H 2 94  HIS 94  95  ?  ?   ?   H . n 
H 2 95  GLU 95  96  ?  ?   ?   H . n 
H 2 96  GLY 96  97  ?  ?   ?   H . n 
H 2 97  ASP 97  98  ?  ?   ?   H . n 
H 2 98  GLU 98  99  ?  ?   ?   H . n 
H 2 99  GLY 99  100 ?  ?   ?   H . n 
H 2 100 PRO 100 101 ?  ?   ?   H . n 
H 2 101 GLY 101 102 ?  ?   ?   H . n 
H 2 102 HIS 102 103 ?  ?   ?   H . n 
H 2 103 HIS 103 104 ?  ?   ?   H . n 
H 2 104 HIS 104 105 ?  ?   ?   H . n 
H 2 105 LYS 105 106 ?  ?   ?   H . n 
H 2 106 PRO 106 107 ?  ?   ?   H . n 
H 2 107 GLY 107 108 ?  ?   ?   H . n 
H 2 108 LEU 108 109 ?  ?   ?   H . n 
H 2 109 GLY 109 110 ?  ?   ?   H . n 
H 2 110 GLU 110 111 ?  ?   ?   H . n 
H 2 111 GLY 111 112 ?  ?   ?   H . n 
H 2 112 THR 112 113 ?  ?   ?   H . n 
H 2 113 PRO 113 114 ?  ?   ?   H . n 
I 1 1   MET 1   1   1  MET MET I . n 
I 1 2   LEU 2   2   2  LEU LEU I . n 
I 1 3   THR 3   3   3  THR THR I . n 
I 1 4   GLU 4   4   4  GLU GLU I . n 
I 1 5   LEU 5   5   5  LEU LEU I . n 
I 1 6   GLU 6   6   6  GLU GLU I . n 
I 1 7   LYS 7   7   7  LYS LYS I . n 
I 1 8   ALA 8   8   8  ALA ALA I . n 
I 1 9   LEU 9   9   9  LEU LEU I . n 
I 1 10  ASN 10  10  10 ASN ASN I . n 
I 1 11  SER 11  11  11 SER SER I . n 
I 1 12  ILE 12  12  12 ILE ILE I . n 
I 1 13  ILE 13  13  13 ILE ILE I . n 
I 1 14  ASP 14  14  14 ASP ASP I . n 
I 1 15  VAL 15  15  15 VAL VAL I . n 
I 1 16  TYR 16  16  16 TYR TYR I . n 
I 1 17  HIS 17  17  17 HIS HIS I . n 
I 1 18  LYS 18  18  18 LYS LYS I . n 
I 1 19  TYR 19  19  19 TYR TYR I . n 
I 1 20  SER 20  20  20 SER SER I . n 
I 1 21  LEU 21  21  21 LEU LEU I . n 
I 1 22  ILE 22  22  22 ILE ILE I . n 
I 1 23  LYS 23  23  23 LYS LYS I . n 
I 1 24  GLY 24  24  24 GLY GLY I . n 
I 1 25  ASN 25  25  25 ASN ASN I . n 
I 1 26  PHE 26  26  26 PHE PHE I . n 
I 1 27  HIS 27  27  27 HIS HIS I . n 
I 1 28  ALA 28  28  28 ALA ALA I . n 
I 1 29  VAL 29  29  29 VAL VAL I . n 
I 1 30  TYR 30  30  30 TYR TYR I . n 
I 1 31  ARG 31  31  31 ARG ARG I . n 
I 1 32  ASP 32  32  32 ASP ASP I . n 
I 1 33  ASP 33  33  33 ASP ASP I . n 
I 1 34  LEU 34  34  34 LEU LEU I . n 
I 1 35  LYS 35  35  35 LYS LYS I . n 
I 1 36  LYS 36  36  36 LYS LYS I . n 
I 1 37  LEU 37  37  37 LEU LEU I . n 
I 1 38  LEU 38  38  38 LEU LEU I . n 
I 1 39  GLU 39  39  39 GLU GLU I . n 
I 1 40  THR 40  40  40 THR THR I . n 
I 1 41  GLU 41  41  41 GLU GLU I . n 
I 1 42  SER 42  42  42 SER SER I . n 
I 1 43  PRO 43  43  43 PRO PRO I . n 
I 1 44  GLN 44  44  44 GLN GLN I . n 
I 1 45  TYR 45  45  45 TYR TYR I . n 
I 1 46  ILE 46  46  46 ILE ILE I . n 
I 1 47  ARG 47  47  47 ARG ARG I . n 
I 1 48  LYS 48  48  48 LYS LYS I . n 
I 1 49  LYS 49  49  49 LYS LYS I . n 
I 1 50  GLY 50  50  50 GLY GLY I . n 
I 1 51  ALA 51  51  51 ALA ALA I . n 
I 1 52  ASP 52  52  52 ASP ASP I . n 
I 1 53  VAL 53  53  53 VAL VAL I . n 
I 1 54  TRP 54  54  54 TRP TRP I . n 
I 1 55  PHE 55  55  55 PHE PHE I . n 
I 1 56  LYS 56  56  56 LYS LYS I . n 
I 1 57  GLU 57  57  57 GLU GLU I . n 
I 1 58  LEU 58  58  58 LEU LEU I . n 
I 1 59  ASP 59  59  59 ASP ASP I . n 
I 1 60  ILE 60  60  60 ILE ILE I . n 
I 1 61  ASN 61  61  61 ASN ASN I . n 
I 1 62  THR 62  62  62 THR THR I . n 
I 1 63  ASP 63  63  63 ASP ASP I . n 
I 1 64  GLY 64  64  64 GLY GLY I . n 
I 1 65  ALA 65  65  65 ALA ALA I . n 
I 1 66  VAL 66  66  66 VAL VAL I . n 
I 1 67  ASN 67  67  67 ASN ASN I . n 
I 1 68  PHE 68  68  68 PHE PHE I . n 
I 1 69  GLN 69  69  69 GLN GLN I . n 
I 1 70  GLU 70  70  70 GLU GLU I . n 
I 1 71  PHE 71  71  71 PHE PHE I . n 
I 1 72  LEU 72  72  72 LEU LEU I . n 
I 1 73  ILE 73  73  73 ILE ILE I . n 
I 1 74  LEU 74  74  74 LEU LEU I . n 
I 1 75  VAL 75  75  75 VAL VAL I . n 
I 1 76  ILE 76  76  76 ILE ILE I . n 
I 1 77  LYS 77  77  77 LYS LYS I . n 
I 1 78  MET 78  78  78 MET MET I . n 
I 1 79  GLY 79  79  79 GLY GLY I . n 
I 1 80  VAL 80  80  80 VAL VAL I . n 
I 1 81  ALA 81  81  81 ALA ALA I . n 
I 1 82  ALA 82  82  82 ALA ALA I . n 
I 1 83  HIS 83  83  83 HIS HIS I . n 
I 1 84  LYS 84  84  84 LYS LYS I . n 
I 1 85  LYS 85  85  85 LYS LYS I . n 
I 1 86  SER 86  86  86 SER SER I . n 
I 1 87  HIS 87  87  87 HIS HIS I . n 
I 1 88  GLU 88  88  ?  ?   ?   I . n 
I 1 89  GLU 89  89  ?  ?   ?   I . n 
I 1 90  SER 90  90  ?  ?   ?   I . n 
I 1 91  HIS 91  91  ?  ?   ?   I . n 
I 1 92  LYS 92  92  ?  ?   ?   I . n 
I 1 93  GLU 93  93  ?  ?   ?   I . n 
J 1 1   MET 1   1   1  MET MET J . n 
J 1 2   LEU 2   2   2  LEU LEU J . n 
J 1 3   THR 3   3   3  THR THR J . n 
J 1 4   GLU 4   4   4  GLU GLU J . n 
J 1 5   LEU 5   5   5  LEU LEU J . n 
J 1 6   GLU 6   6   6  GLU GLU J . n 
J 1 7   LYS 7   7   7  LYS LYS J . n 
J 1 8   ALA 8   8   8  ALA ALA J . n 
J 1 9   LEU 9   9   9  LEU LEU J . n 
J 1 10  ASN 10  10  10 ASN ASN J . n 
J 1 11  SER 11  11  11 SER SER J . n 
J 1 12  ILE 12  12  12 ILE ILE J . n 
J 1 13  ILE 13  13  13 ILE ILE J . n 
J 1 14  ASP 14  14  14 ASP ASP J . n 
J 1 15  VAL 15  15  15 VAL VAL J . n 
J 1 16  TYR 16  16  16 TYR TYR J . n 
J 1 17  HIS 17  17  17 HIS HIS J . n 
J 1 18  LYS 18  18  18 LYS LYS J . n 
J 1 19  TYR 19  19  19 TYR TYR J . n 
J 1 20  SER 20  20  20 SER SER J . n 
J 1 21  LEU 21  21  21 LEU LEU J . n 
J 1 22  ILE 22  22  22 ILE ILE J . n 
J 1 23  LYS 23  23  23 LYS LYS J . n 
J 1 24  GLY 24  24  24 GLY GLY J . n 
J 1 25  ASN 25  25  25 ASN ASN J . n 
J 1 26  PHE 26  26  26 PHE PHE J . n 
J 1 27  HIS 27  27  27 HIS HIS J . n 
J 1 28  ALA 28  28  28 ALA ALA J . n 
J 1 29  VAL 29  29  29 VAL VAL J . n 
J 1 30  TYR 30  30  30 TYR TYR J . n 
J 1 31  ARG 31  31  31 ARG ARG J . n 
J 1 32  ASP 32  32  32 ASP ASP J . n 
J 1 33  ASP 33  33  33 ASP ASP J . n 
J 1 34  LEU 34  34  34 LEU LEU J . n 
J 1 35  LYS 35  35  35 LYS LYS J . n 
J 1 36  LYS 36  36  36 LYS LYS J . n 
J 1 37  LEU 37  37  37 LEU LEU J . n 
J 1 38  LEU 38  38  38 LEU LEU J . n 
J 1 39  GLU 39  39  39 GLU GLU J . n 
J 1 40  THR 40  40  40 THR THR J . n 
J 1 41  GLU 41  41  41 GLU GLU J . n 
J 1 42  SER 42  42  42 SER SER J . n 
J 1 43  PRO 43  43  43 PRO PRO J . n 
J 1 44  GLN 44  44  44 GLN GLN J . n 
J 1 45  TYR 45  45  45 TYR TYR J . n 
J 1 46  ILE 46  46  46 ILE ILE J . n 
J 1 47  ARG 47  47  47 ARG ARG J . n 
J 1 48  LYS 48  48  48 LYS LYS J . n 
J 1 49  LYS 49  49  49 LYS LYS J . n 
J 1 50  GLY 50  50  50 GLY GLY J . n 
J 1 51  ALA 51  51  51 ALA ALA J . n 
J 1 52  ASP 52  52  52 ASP ASP J . n 
J 1 53  VAL 53  53  53 VAL VAL J . n 
J 1 54  TRP 54  54  54 TRP TRP J . n 
J 1 55  PHE 55  55  55 PHE PHE J . n 
J 1 56  LYS 56  56  56 LYS LYS J . n 
J 1 57  GLU 57  57  57 GLU GLU J . n 
J 1 58  LEU 58  58  58 LEU LEU J . n 
J 1 59  ASP 59  59  59 ASP ASP J . n 
J 1 60  ILE 60  60  60 ILE ILE J . n 
J 1 61  ASN 61  61  61 ASN ASN J . n 
J 1 62  THR 62  62  62 THR THR J . n 
J 1 63  ASP 63  63  63 ASP ASP J . n 
J 1 64  GLY 64  64  64 GLY GLY J . n 
J 1 65  ALA 65  65  65 ALA ALA J . n 
J 1 66  VAL 66  66  66 VAL VAL J . n 
J 1 67  ASN 67  67  67 ASN ASN J . n 
J 1 68  PHE 68  68  68 PHE PHE J . n 
J 1 69  GLN 69  69  69 GLN GLN J . n 
J 1 70  GLU 70  70  70 GLU GLU J . n 
J 1 71  PHE 71  71  71 PHE PHE J . n 
J 1 72  LEU 72  72  72 LEU LEU J . n 
J 1 73  ILE 73  73  73 ILE ILE J . n 
J 1 74  LEU 74  74  74 LEU LEU J . n 
J 1 75  VAL 75  75  75 VAL VAL J . n 
J 1 76  ILE 76  76  76 ILE ILE J . n 
J 1 77  LYS 77  77  77 LYS LYS J . n 
J 1 78  MET 78  78  78 MET MET J . n 
J 1 79  GLY 79  79  79 GLY GLY J . n 
J 1 80  VAL 80  80  80 VAL VAL J . n 
J 1 81  ALA 81  81  81 ALA ALA J . n 
J 1 82  ALA 82  82  82 ALA ALA J . n 
J 1 83  HIS 83  83  83 HIS HIS J . n 
J 1 84  LYS 84  84  84 LYS LYS J . n 
J 1 85  LYS 85  85  85 LYS LYS J . n 
J 1 86  SER 86  86  86 SER SER J . n 
J 1 87  HIS 87  87  87 HIS HIS J . n 
J 1 88  GLU 88  88  88 GLU GLU J . n 
J 1 89  GLU 89  89  ?  ?   ?   J . n 
J 1 90  SER 90  90  ?  ?   ?   J . n 
J 1 91  HIS 91  91  ?  ?   ?   J . n 
J 1 92  LYS 92  92  ?  ?   ?   J . n 
J 1 93  GLU 93  93  ?  ?   ?   J . n 
K 2 1   THR 1   2   ?  ?   ?   K . n 
K 2 2   SER 2   3   ?  ?   ?   K . n 
K 2 3   LYS 3   4   4  LYS LYS K . n 
K 2 4   MET 4   5   5  MET MET K . n 
K 2 5   SER 5   6   6  SER SER K . n 
K 2 6   GLN 6   7   7  GLN GLN K . n 
K 2 7   LEU 7   8   8  LEU LEU K . n 
K 2 8   GLU 8   9   9  GLU GLU K . n 
K 2 9   ARG 9   10  10 ARG ARG K . n 
K 2 10  ASN 10  11  11 ASN ASN K . n 
K 2 11  ILE 11  12  12 ILE ILE K . n 
K 2 12  GLU 12  13  13 GLU GLU K . n 
K 2 13  THR 13  14  14 THR THR K . n 
K 2 14  ILE 14  15  15 ILE ILE K . n 
K 2 15  ILE 15  16  16 ILE ILE K . n 
K 2 16  ASN 16  17  17 ASN ASN K . n 
K 2 17  THR 17  18  18 THR THR K . n 
K 2 18  PHE 18  19  19 PHE PHE K . n 
K 2 19  HIS 19  20  20 HIS HIS K . n 
K 2 20  GLN 20  21  21 GLN GLN K . n 
K 2 21  TYR 21  22  22 TYR TYR K . n 
K 2 22  SER 22  23  23 SER SER K . n 
K 2 23  VAL 23  24  24 VAL VAL K . n 
K 2 24  LYS 24  25  25 LYS LYS K . n 
K 2 25  LEU 25  26  26 LEU LEU K . n 
K 2 26  GLY 26  27  27 GLY GLY K . n 
K 2 27  HIS 27  28  28 HIS HIS K . n 
K 2 28  PRO 28  29  29 PRO PRO K . n 
K 2 29  ASP 29  30  30 ASP ASP K . n 
K 2 30  THR 30  31  31 THR THR K . n 
K 2 31  LEU 31  32  32 LEU LEU K . n 
K 2 32  ASN 32  33  33 ASN ASN K . n 
K 2 33  GLN 33  34  34 GLN GLN K . n 
K 2 34  GLY 34  35  35 GLY GLY K . n 
K 2 35  GLU 35  36  36 GLU GLU K . n 
K 2 36  PHE 36  37  37 PHE PHE K . n 
K 2 37  LYS 37  38  38 LYS LYS K . n 
K 2 38  GLU 38  39  39 GLU GLU K . n 
K 2 39  LEU 39  40  40 LEU LEU K . n 
K 2 40  VAL 40  41  41 VAL VAL K . n 
K 2 41  ARG 41  42  42 ARG ARG K . n 
K 2 42  LYS 42  43  43 LYS LYS K . n 
K 2 43  ASP 43  44  44 ASP ASP K . n 
K 2 44  LEU 44  45  45 LEU LEU K . n 
K 2 45  GLN 45  46  46 GLN GLN K . n 
K 2 46  ASN 46  47  47 ASN ASN K . n 
K 2 47  PHE 47  48  48 PHE PHE K . n 
K 2 48  LEU 48  49  49 LEU LEU K . n 
K 2 49  LYS 49  50  50 LYS LYS K . n 
K 2 50  LYS 50  51  51 LYS LYS K . n 
K 2 51  GLU 51  52  52 GLU GLU K . n 
K 2 52  ASN 52  53  53 ASN ASN K . n 
K 2 53  LYS 53  54  54 LYS LYS K . n 
K 2 54  ASN 54  55  55 ASN ASN K . n 
K 2 55  GLU 55  56  56 GLU GLU K . n 
K 2 56  LYS 56  57  57 LYS LYS K . n 
K 2 57  VAL 57  58  58 VAL VAL K . n 
K 2 58  ILE 58  59  59 ILE ILE K . n 
K 2 59  GLU 59  60  60 GLU GLU K . n 
K 2 60  HIS 60  61  61 HIS HIS K . n 
K 2 61  ILE 61  62  62 ILE ILE K . n 
K 2 62  MET 62  63  63 MET MET K . n 
K 2 63  GLU 63  64  64 GLU GLU K . n 
K 2 64  ASP 64  65  65 ASP ASP K . n 
K 2 65  LEU 65  66  66 LEU LEU K . n 
K 2 66  ASP 66  67  67 ASP ASP K . n 
K 2 67  THR 67  68  68 THR THR K . n 
K 2 68  ASN 68  69  69 ASN ASN K . n 
K 2 69  ALA 69  70  70 ALA ALA K . n 
K 2 70  ASP 70  71  71 ASP ASP K . n 
K 2 71  LYS 71  72  72 LYS LYS K . n 
K 2 72  GLN 72  73  73 GLN GLN K . n 
K 2 73  LEU 73  74  74 LEU LEU K . n 
K 2 74  SER 74  75  75 SER SER K . n 
K 2 75  PHE 75  76  76 PHE PHE K . n 
K 2 76  GLU 76  77  77 GLU GLU K . n 
K 2 77  GLU 77  78  78 GLU GLU K . n 
K 2 78  PHE 78  79  79 PHE PHE K . n 
K 2 79  ILE 79  80  80 ILE ILE K . n 
K 2 80  MET 80  81  81 MET MET K . n 
K 2 81  LEU 81  82  82 LEU LEU K . n 
K 2 82  MET 82  83  83 MET MET K . n 
K 2 83  ALA 83  84  84 ALA ALA K . n 
K 2 84  ARG 84  85  85 ARG ARG K . n 
K 2 85  LEU 85  86  86 LEU LEU K . n 
K 2 86  THR 86  87  87 THR THR K . n 
K 2 87  TRP 87  88  88 TRP TRP K . n 
K 2 88  ALA 88  89  89 ALA ALA K . n 
K 2 89  SER 89  90  90 SER SER K . n 
K 2 90  HIS 90  91  91 HIS HIS K . n 
K 2 91  GLU 91  92  92 GLU GLU K . n 
K 2 92  LYS 92  93  93 LYS LYS K . n 
K 2 93  MET 93  94  94 MET MET K . n 
K 2 94  HIS 94  95  95 HIS HIS K . n 
K 2 95  GLU 95  96  ?  ?   ?   K . n 
K 2 96  GLY 96  97  ?  ?   ?   K . n 
K 2 97  ASP 97  98  ?  ?   ?   K . n 
K 2 98  GLU 98  99  ?  ?   ?   K . n 
K 2 99  GLY 99  100 ?  ?   ?   K . n 
K 2 100 PRO 100 101 ?  ?   ?   K . n 
K 2 101 GLY 101 102 ?  ?   ?   K . n 
K 2 102 HIS 102 103 ?  ?   ?   K . n 
K 2 103 HIS 103 104 ?  ?   ?   K . n 
K 2 104 HIS 104 105 ?  ?   ?   K . n 
K 2 105 LYS 105 106 ?  ?   ?   K . n 
K 2 106 PRO 106 107 ?  ?   ?   K . n 
K 2 107 GLY 107 108 ?  ?   ?   K . n 
K 2 108 LEU 108 109 ?  ?   ?   K . n 
K 2 109 GLY 109 110 ?  ?   ?   K . n 
K 2 110 GLU 110 111 ?  ?   ?   K . n 
K 2 111 GLY 111 112 ?  ?   ?   K . n 
K 2 112 THR 112 113 ?  ?   ?   K . n 
K 2 113 PRO 113 114 ?  ?   ?   K . n 
L 2 1   THR 1   2   ?  ?   ?   L . n 
L 2 2   SER 2   3   ?  ?   ?   L . n 
L 2 3   LYS 3   4   4  LYS LYS L . n 
L 2 4   MET 4   5   5  MET MET L . n 
L 2 5   SER 5   6   6  SER SER L . n 
L 2 6   GLN 6   7   7  GLN GLN L . n 
L 2 7   LEU 7   8   8  LEU LEU L . n 
L 2 8   GLU 8   9   9  GLU GLU L . n 
L 2 9   ARG 9   10  10 ARG ARG L . n 
L 2 10  ASN 10  11  11 ASN ASN L . n 
L 2 11  ILE 11  12  12 ILE ILE L . n 
L 2 12  GLU 12  13  13 GLU GLU L . n 
L 2 13  THR 13  14  14 THR THR L . n 
L 2 14  ILE 14  15  15 ILE ILE L . n 
L 2 15  ILE 15  16  16 ILE ILE L . n 
L 2 16  ASN 16  17  17 ASN ASN L . n 
L 2 17  THR 17  18  18 THR THR L . n 
L 2 18  PHE 18  19  19 PHE PHE L . n 
L 2 19  HIS 19  20  20 HIS HIS L . n 
L 2 20  GLN 20  21  21 GLN GLN L . n 
L 2 21  TYR 21  22  22 TYR TYR L . n 
L 2 22  SER 22  23  23 SER SER L . n 
L 2 23  VAL 23  24  24 VAL VAL L . n 
L 2 24  LYS 24  25  25 LYS LYS L . n 
L 2 25  LEU 25  26  26 LEU LEU L . n 
L 2 26  GLY 26  27  27 GLY GLY L . n 
L 2 27  HIS 27  28  28 HIS HIS L . n 
L 2 28  PRO 28  29  29 PRO PRO L . n 
L 2 29  ASP 29  30  30 ASP ASP L . n 
L 2 30  THR 30  31  31 THR THR L . n 
L 2 31  LEU 31  32  32 LEU LEU L . n 
L 2 32  ASN 32  33  33 ASN ASN L . n 
L 2 33  GLN 33  34  34 GLN GLN L . n 
L 2 34  GLY 34  35  35 GLY GLY L . n 
L 2 35  GLU 35  36  36 GLU GLU L . n 
L 2 36  PHE 36  37  37 PHE PHE L . n 
L 2 37  LYS 37  38  38 LYS LYS L . n 
L 2 38  GLU 38  39  39 GLU GLU L . n 
L 2 39  LEU 39  40  40 LEU LEU L . n 
L 2 40  VAL 40  41  41 VAL VAL L . n 
L 2 41  ARG 41  42  42 ARG ARG L . n 
L 2 42  LYS 42  43  43 LYS LYS L . n 
L 2 43  ASP 43  44  44 ASP ASP L . n 
L 2 44  LEU 44  45  45 LEU LEU L . n 
L 2 45  GLN 45  46  46 GLN GLN L . n 
L 2 46  ASN 46  47  47 ASN ASN L . n 
L 2 47  PHE 47  48  48 PHE PHE L . n 
L 2 48  LEU 48  49  49 LEU LEU L . n 
L 2 49  LYS 49  50  50 LYS LYS L . n 
L 2 50  LYS 50  51  51 LYS LYS L . n 
L 2 51  GLU 51  52  52 GLU GLU L . n 
L 2 52  ASN 52  53  53 ASN ASN L . n 
L 2 53  LYS 53  54  54 LYS LYS L . n 
L 2 54  ASN 54  55  55 ASN ASN L . n 
L 2 55  GLU 55  56  56 GLU GLU L . n 
L 2 56  LYS 56  57  57 LYS LYS L . n 
L 2 57  VAL 57  58  58 VAL VAL L . n 
L 2 58  ILE 58  59  59 ILE ILE L . n 
L 2 59  GLU 59  60  60 GLU GLU L . n 
L 2 60  HIS 60  61  61 HIS HIS L . n 
L 2 61  ILE 61  62  62 ILE ILE L . n 
L 2 62  MET 62  63  63 MET MET L . n 
L 2 63  GLU 63  64  64 GLU GLU L . n 
L 2 64  ASP 64  65  65 ASP ASP L . n 
L 2 65  LEU 65  66  66 LEU LEU L . n 
L 2 66  ASP 66  67  67 ASP ASP L . n 
L 2 67  THR 67  68  68 THR THR L . n 
L 2 68  ASN 68  69  69 ASN ASN L . n 
L 2 69  ALA 69  70  70 ALA ALA L . n 
L 2 70  ASP 70  71  71 ASP ASP L . n 
L 2 71  LYS 71  72  72 LYS LYS L . n 
L 2 72  GLN 72  73  73 GLN GLN L . n 
L 2 73  LEU 73  74  74 LEU LEU L . n 
L 2 74  SER 74  75  75 SER SER L . n 
L 2 75  PHE 75  76  76 PHE PHE L . n 
L 2 76  GLU 76  77  77 GLU GLU L . n 
L 2 77  GLU 77  78  78 GLU GLU L . n 
L 2 78  PHE 78  79  79 PHE PHE L . n 
L 2 79  ILE 79  80  80 ILE ILE L . n 
L 2 80  MET 80  81  81 MET MET L . n 
L 2 81  LEU 81  82  82 LEU LEU L . n 
L 2 82  MET 82  83  83 MET MET L . n 
L 2 83  ALA 83  84  84 ALA ALA L . n 
L 2 84  ARG 84  85  85 ARG ARG L . n 
L 2 85  LEU 85  86  86 LEU LEU L . n 
L 2 86  THR 86  87  87 THR THR L . n 
L 2 87  TRP 87  88  88 TRP TRP L . n 
L 2 88  ALA 88  89  89 ALA ALA L . n 
L 2 89  SER 89  90  90 SER SER L . n 
L 2 90  HIS 90  91  91 HIS HIS L . n 
L 2 91  GLU 91  92  92 GLU GLU L . n 
L 2 92  LYS 92  93  93 LYS LYS L . n 
L 2 93  MET 93  94  94 MET MET L . n 
L 2 94  HIS 94  95  95 HIS HIS L . n 
L 2 95  GLU 95  96  ?  ?   ?   L . n 
L 2 96  GLY 96  97  ?  ?   ?   L . n 
L 2 97  ASP 97  98  ?  ?   ?   L . n 
L 2 98  GLU 98  99  ?  ?   ?   L . n 
L 2 99  GLY 99  100 ?  ?   ?   L . n 
L 2 100 PRO 100 101 ?  ?   ?   L . n 
L 2 101 GLY 101 102 ?  ?   ?   L . n 
L 2 102 HIS 102 103 ?  ?   ?   L . n 
L 2 103 HIS 103 104 ?  ?   ?   L . n 
L 2 104 HIS 104 105 ?  ?   ?   L . n 
L 2 105 LYS 105 106 ?  ?   ?   L . n 
L 2 106 PRO 106 107 ?  ?   ?   L . n 
L 2 107 GLY 107 108 ?  ?   ?   L . n 
L 2 108 LEU 108 109 ?  ?   ?   L . n 
L 2 109 GLY 109 110 ?  ?   ?   L . n 
L 2 110 GLU 110 111 ?  ?   ?   L . n 
L 2 111 GLY 111 112 ?  ?   ?   L . n 
L 2 112 THR 112 113 ?  ?   ?   L . n 
L 2 113 PRO 113 114 ?  ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
M  3 CA  1   1501 1501 CA  CA  A . 
N  3 CA  1   1502 1502 CA  CA  A . 
O  4 CL  1   2004 2004 CL  CL  A . 
P  3 CA  1   2501 2501 CA  CA  B . 
Q  3 CA  1   2502 2502 CA  CA  B . 
R  4 CL  1   2005 2005 CL  CL  B . 
S  3 CA  1   3501 3501 CA  CA  C . 
T  3 CA  1   3502 3502 CA  CA  C . 
U  3 CA  1   4501 4501 CA  CA  D . 
V  3 CA  1   4502 4502 CA  CA  D . 
W  3 CA  1   1511 1511 CA  CA  E . 
X  3 CA  1   1512 1512 CA  CA  E . 
Y  3 CA  1   2511 2511 CA  CA  F . 
Z  3 CA  1   2512 2512 CA  CA  F . 
AA 4 CL  1   2006 2006 CL  CL  F . 
BA 5 FLC 1   2008 2008 FLC FLC F . 
CA 3 CA  1   3511 3511 CA  CA  G . 
DA 3 CA  1   3512 3512 CA  CA  G . 
EA 3 CA  1   4511 4511 CA  CA  H . 
FA 3 CA  1   4512 4512 CA  CA  H . 
GA 3 CA  1   1521 1521 CA  CA  I . 
HA 3 CA  1   1522 1522 CA  CA  I . 
IA 3 CA  1   2521 2521 CA  CA  J . 
JA 3 CA  1   2522 2522 CA  CA  J . 
KA 4 CL  1   2007 2007 CL  CL  J . 
LA 3 CA  1   3521 3521 CA  CA  K . 
MA 3 CA  1   3522 3522 CA  CA  K . 
NA 3 CA  1   4521 4521 CA  CA  L . 
OA 3 CA  1   4522 4522 CA  CA  L . 
PA 6 HOH 1   2005 1222 HOH HOH A . 
PA 6 HOH 2   2006 1186 HOH HOH A . 
PA 6 HOH 3   2007 1063 HOH HOH A . 
PA 6 HOH 4   2008 1148 HOH HOH A . 
PA 6 HOH 5   2009 1123 HOH HOH A . 
PA 6 HOH 6   2010 1205 HOH HOH A . 
PA 6 HOH 7   2011 1290 HOH HOH A . 
PA 6 HOH 8   2012 1271 HOH HOH A . 
PA 6 HOH 9   2013 1084 HOH HOH A . 
PA 6 HOH 10  2014 1255 HOH HOH A . 
PA 6 HOH 11  2015 1128 HOH HOH A . 
PA 6 HOH 12  2016 1074 HOH HOH A . 
PA 6 HOH 13  2017 998  HOH HOH A . 
PA 6 HOH 14  2018 991  HOH HOH A . 
PA 6 HOH 15  2019 975  HOH HOH A . 
PA 6 HOH 16  2020 973  HOH HOH A . 
PA 6 HOH 17  2021 970  HOH HOH A . 
PA 6 HOH 18  2022 965  HOH HOH A . 
PA 6 HOH 19  2023 954  HOH HOH A . 
PA 6 HOH 20  2024 950  HOH HOH A . 
PA 6 HOH 21  2025 932  HOH HOH A . 
PA 6 HOH 22  2026 929  HOH HOH A . 
PA 6 HOH 23  2027 910  HOH HOH A . 
PA 6 HOH 24  2028 908  HOH HOH A . 
PA 6 HOH 25  2029 872  HOH HOH A . 
PA 6 HOH 26  2030 858  HOH HOH A . 
PA 6 HOH 27  2031 817  HOH HOH A . 
PA 6 HOH 28  2032 815  HOH HOH A . 
PA 6 HOH 29  2033 792  HOH HOH A . 
PA 6 HOH 30  2034 772  HOH HOH A . 
PA 6 HOH 31  2035 764  HOH HOH A . 
PA 6 HOH 32  2036 745  HOH HOH A . 
PA 6 HOH 33  2037 732  HOH HOH A . 
PA 6 HOH 34  2038 729  HOH HOH A . 
PA 6 HOH 35  2039 726  HOH HOH A . 
PA 6 HOH 36  2040 697  HOH HOH A . 
PA 6 HOH 37  2041 657  HOH HOH A . 
PA 6 HOH 38  2042 608  HOH HOH A . 
PA 6 HOH 39  2043 604  HOH HOH A . 
PA 6 HOH 40  2044 577  HOH HOH A . 
PA 6 HOH 41  2045 575  HOH HOH A . 
PA 6 HOH 42  2046 572  HOH HOH A . 
PA 6 HOH 43  2047 566  HOH HOH A . 
PA 6 HOH 44  2048 521  HOH HOH A . 
PA 6 HOH 45  2049 505  HOH HOH A . 
PA 6 HOH 46  2050 470  HOH HOH A . 
PA 6 HOH 47  2051 454  HOH HOH A . 
PA 6 HOH 48  2052 445  HOH HOH A . 
PA 6 HOH 49  2053 444  HOH HOH A . 
PA 6 HOH 50  2054 442  HOH HOH A . 
PA 6 HOH 51  2055 441  HOH HOH A . 
PA 6 HOH 52  2056 439  HOH HOH A . 
PA 6 HOH 53  2057 425  HOH HOH A . 
PA 6 HOH 54  2058 396  HOH HOH A . 
PA 6 HOH 55  2059 394  HOH HOH A . 
PA 6 HOH 56  2060 393  HOH HOH A . 
PA 6 HOH 57  2061 369  HOH HOH A . 
PA 6 HOH 58  2062 367  HOH HOH A . 
PA 6 HOH 59  2063 365  HOH HOH A . 
PA 6 HOH 60  2064 354  HOH HOH A . 
PA 6 HOH 61  2065 340  HOH HOH A . 
PA 6 HOH 62  2066 335  HOH HOH A . 
PA 6 HOH 63  2067 312  HOH HOH A . 
PA 6 HOH 64  2068 309  HOH HOH A . 
PA 6 HOH 65  2069 308  HOH HOH A . 
PA 6 HOH 66  2070 297  HOH HOH A . 
PA 6 HOH 67  2071 290  HOH HOH A . 
PA 6 HOH 68  2072 287  HOH HOH A . 
PA 6 HOH 69  2073 255  HOH HOH A . 
PA 6 HOH 70  2074 241  HOH HOH A . 
PA 6 HOH 71  2075 186  HOH HOH A . 
PA 6 HOH 72  2076 175  HOH HOH A . 
PA 6 HOH 73  2077 150  HOH HOH A . 
PA 6 HOH 74  2078 140  HOH HOH A . 
PA 6 HOH 75  2079 130  HOH HOH A . 
PA 6 HOH 76  2080 114  HOH HOH A . 
PA 6 HOH 77  2081 112  HOH HOH A . 
PA 6 HOH 78  2082 104  HOH HOH A . 
PA 6 HOH 79  2083 91   HOH HOH A . 
PA 6 HOH 80  2084 70   HOH HOH A . 
PA 6 HOH 81  2085 47   HOH HOH A . 
PA 6 HOH 82  2086 44   HOH HOH A . 
PA 6 HOH 83  2087 29   HOH HOH A . 
PA 6 HOH 84  2088 18   HOH HOH A . 
QA 6 HOH 1   2503 1183 HOH HOH B . 
QA 6 HOH 2   2504 1223 HOH HOH B . 
QA 6 HOH 3   2505 1158 HOH HOH B . 
QA 6 HOH 4   2506 1037 HOH HOH B . 
QA 6 HOH 5   2507 1103 HOH HOH B . 
QA 6 HOH 6   2508 1152 HOH HOH B . 
QA 6 HOH 7   2509 1217 HOH HOH B . 
QA 6 HOH 8   2510 1274 HOH HOH B . 
QA 6 HOH 9   2511 1215 HOH HOH B . 
QA 6 HOH 10  2512 1185 HOH HOH B . 
QA 6 HOH 11  2513 964  HOH HOH B . 
QA 6 HOH 12  2514 947  HOH HOH B . 
QA 6 HOH 13  2515 928  HOH HOH B . 
QA 6 HOH 14  2516 897  HOH HOH B . 
QA 6 HOH 15  2517 893  HOH HOH B . 
QA 6 HOH 16  2518 863  HOH HOH B . 
QA 6 HOH 17  2519 837  HOH HOH B . 
QA 6 HOH 18  2520 809  HOH HOH B . 
QA 6 HOH 19  2521 744  HOH HOH B . 
QA 6 HOH 20  2522 740  HOH HOH B . 
QA 6 HOH 21  2523 703  HOH HOH B . 
QA 6 HOH 22  2524 673  HOH HOH B . 
QA 6 HOH 23  2525 627  HOH HOH B . 
QA 6 HOH 24  2526 607  HOH HOH B . 
QA 6 HOH 25  2527 602  HOH HOH B . 
QA 6 HOH 26  2528 592  HOH HOH B . 
QA 6 HOH 27  2529 582  HOH HOH B . 
QA 6 HOH 28  2530 580  HOH HOH B . 
QA 6 HOH 29  2531 558  HOH HOH B . 
QA 6 HOH 30  2532 552  HOH HOH B . 
QA 6 HOH 31  2533 536  HOH HOH B . 
QA 6 HOH 32  2534 526  HOH HOH B . 
QA 6 HOH 33  2535 519  HOH HOH B . 
QA 6 HOH 34  2536 518  HOH HOH B . 
QA 6 HOH 35  2537 516  HOH HOH B . 
QA 6 HOH 36  2538 503  HOH HOH B . 
QA 6 HOH 37  2539 498  HOH HOH B . 
QA 6 HOH 38  2540 497  HOH HOH B . 
QA 6 HOH 39  2541 494  HOH HOH B . 
QA 6 HOH 40  2542 492  HOH HOH B . 
QA 6 HOH 41  2543 488  HOH HOH B . 
QA 6 HOH 42  2544 484  HOH HOH B . 
QA 6 HOH 43  2545 475  HOH HOH B . 
QA 6 HOH 44  2546 468  HOH HOH B . 
QA 6 HOH 45  2547 443  HOH HOH B . 
QA 6 HOH 46  2548 434  HOH HOH B . 
QA 6 HOH 47  2549 390  HOH HOH B . 
QA 6 HOH 48  2550 376  HOH HOH B . 
QA 6 HOH 49  2551 374  HOH HOH B . 
QA 6 HOH 50  2552 353  HOH HOH B . 
QA 6 HOH 51  2553