data_1XL4
# 
_entry.id   1XL4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XL4         
RCSB  RCSB030479   
WWPDB D_1000030479 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XL4 
_pdbx_database_status.recvd_initial_deposition_date   2004-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gulbis, J.M.'   1 
'Kuo, A.'        2 
'Smith, B.'      3 
'Doyle, D.A.'    4 
'Edwards, A.'    5 
'Arrowsmith, C.' 6 
'Sundstrom, M.'  7 
# 
_citation.id                        primary 
_citation.title                     'Two intermediate gating state crystal structures of the KirBac3.1 K+ channel' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gulbis, J.M.'   1 
primary 'Kuo, A.'        2 
primary 'Smith, B.'      3 
primary 'Doyle, D.A.'    4 
primary 'Edwards, A.'    5 
primary 'Arrowsmith, C.' 6 
primary 'Sundstrom, M.'  7 
# 
_cell.entry_id           1XL4 
_cell.length_a           105.627 
_cell.length_b           109.385 
_cell.length_c           88.786 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XL4 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Inward rectifier potassium channel' 33782.766 2   ? ? ? ? 
2 non-polymer syn 'POTASSIUM ION'                      39.098    5   ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                      24.305    1   ? ? ? ? 
4 water       nat water                                18.015    180 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Inwardly rectifying K+ channel KirBac3.1, COG1226: Kef-type K+ transport systems, predicted NAD-binding component' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTGGMKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARP
GSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLM
MRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFL
VLFTGHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   GLY n 
1 4   GLY n 
1 5   MET n 
1 6   LYS n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  ARG n 
1 14  ILE n 
1 15  LEU n 
1 16  ASN n 
1 17  SER n 
1 18  ASP n 
1 19  GLY n 
1 20  SER n 
1 21  SER n 
1 22  ASN n 
1 23  ILE n 
1 24  THR n 
1 25  ARG n 
1 26  LEU n 
1 27  GLY n 
1 28  LEU n 
1 29  GLU n 
1 30  LYS n 
1 31  ARG n 
1 32  GLY n 
1 33  TRP n 
1 34  LEU n 
1 35  ASP n 
1 36  ASP n 
1 37  HIS n 
1 38  TYR n 
1 39  HIS n 
1 40  ASP n 
1 41  LEU n 
1 42  LEU n 
1 43  THR n 
1 44  VAL n 
1 45  SER n 
1 46  TRP n 
1 47  PRO n 
1 48  VAL n 
1 49  PHE n 
1 50  ILE n 
1 51  THR n 
1 52  LEU n 
1 53  ILE n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  TYR n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  ALA n 
1 63  LEU n 
1 64  PHE n 
1 65  ALA n 
1 66  LEU n 
1 67  ALA n 
1 68  TYR n 
1 69  LEU n 
1 70  ALA n 
1 71  CYS n 
1 72  GLY n 
1 73  ASP n 
1 74  VAL n 
1 75  ILE n 
1 76  GLU n 
1 77  ASN n 
1 78  ALA n 
1 79  ARG n 
1 80  PRO n 
1 81  GLY n 
1 82  SER n 
1 83  PHE n 
1 84  THR n 
1 85  ASP n 
1 86  ALA n 
1 87  PHE n 
1 88  PHE n 
1 89  PHE n 
1 90  SER n 
1 91  VAL n 
1 92  GLN n 
1 93  THR n 
1 94  MET n 
1 95  ALA n 
1 96  THR n 
1 97  ILE n 
1 98  GLY n 
1 99  TYR n 
1 100 GLY n 
1 101 LYS n 
1 102 LEU n 
1 103 ILE n 
1 104 PRO n 
1 105 ILE n 
1 106 GLY n 
1 107 PRO n 
1 108 LEU n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 LEU n 
1 113 VAL n 
1 114 THR n 
1 115 LEU n 
1 116 GLU n 
1 117 ALA n 
1 118 LEU n 
1 119 CYS n 
1 120 GLY n 
1 121 MET n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 ALA n 
1 126 VAL n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ILE n 
1 132 TYR n 
1 133 ALA n 
1 134 ARG n 
1 135 PHE n 
1 136 THR n 
1 137 ARG n 
1 138 PRO n 
1 139 THR n 
1 140 ALA n 
1 141 GLY n 
1 142 VAL n 
1 143 LEU n 
1 144 PHE n 
1 145 SER n 
1 146 SER n 
1 147 ARG n 
1 148 MET n 
1 149 VAL n 
1 150 ILE n 
1 151 SER n 
1 152 ASP n 
1 153 PHE n 
1 154 GLU n 
1 155 GLY n 
1 156 LYS n 
1 157 PRO n 
1 158 THR n 
1 159 LEU n 
1 160 MET n 
1 161 MET n 
1 162 ARG n 
1 163 LEU n 
1 164 ALA n 
1 165 ASN n 
1 166 LEU n 
1 167 ARG n 
1 168 ILE n 
1 169 GLU n 
1 170 GLN n 
1 171 ILE n 
1 172 ILE n 
1 173 GLU n 
1 174 ALA n 
1 175 ASP n 
1 176 VAL n 
1 177 HIS n 
1 178 LEU n 
1 179 VAL n 
1 180 LEU n 
1 181 VAL n 
1 182 ARG n 
1 183 SER n 
1 184 GLU n 
1 185 ILE n 
1 186 SER n 
1 187 GLN n 
1 188 GLU n 
1 189 GLY n 
1 190 MET n 
1 191 VAL n 
1 192 PHE n 
1 193 ARG n 
1 194 ARG n 
1 195 PHE n 
1 196 HIS n 
1 197 ASP n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 THR n 
1 202 ARG n 
1 203 SER n 
1 204 ARG n 
1 205 SER n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 TRP n 
1 213 THR n 
1 214 VAL n 
1 215 MET n 
1 216 HIS n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 SER n 
1 223 PRO n 
1 224 ILE n 
1 225 TYR n 
1 226 GLY n 
1 227 GLU n 
1 228 THR n 
1 229 ASP n 
1 230 GLU n 
1 231 THR n 
1 232 LEU n 
1 233 ARG n 
1 234 ASN n 
1 235 SER n 
1 236 HIS n 
1 237 SER n 
1 238 GLU n 
1 239 PHE n 
1 240 LEU n 
1 241 VAL n 
1 242 LEU n 
1 243 PHE n 
1 244 THR n 
1 245 GLY n 
1 246 HIS n 
1 247 HIS n 
1 248 GLU n 
1 249 ALA n 
1 250 PHE n 
1 251 ALA n 
1 252 GLN n 
1 253 ASN n 
1 254 VAL n 
1 255 HIS n 
1 256 ALA n 
1 257 ARG n 
1 258 HIS n 
1 259 ALA n 
1 260 TYR n 
1 261 SER n 
1 262 CYS n 
1 263 ASP n 
1 264 GLU n 
1 265 ILE n 
1 266 ILE n 
1 267 TRP n 
1 268 GLY n 
1 269 GLY n 
1 270 HIS n 
1 271 PHE n 
1 272 VAL n 
1 273 ASP n 
1 274 VAL n 
1 275 PHE n 
1 276 THR n 
1 277 THR n 
1 278 LEU n 
1 279 PRO n 
1 280 ASP n 
1 281 GLY n 
1 282 ARG n 
1 283 ARG n 
1 284 ALA n 
1 285 LEU n 
1 286 ASP n 
1 287 LEU n 
1 288 GLY n 
1 289 LYS n 
1 290 PHE n 
1 291 HIS n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 GLN n 
1 296 HIS n 
1 297 HIS n 
1 298 HIS n 
1 299 HIS n 
1 300 HIS n 
1 301 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Magnetospirillum 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Magnetospirillum magnetotacticum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     188 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl-21(DE3)star' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-30a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    ZP_00055625 
_struct_ref.pdbx_db_accession          46201166 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKPPARKPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARPGSFT
DAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLA
NLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFT
GHHEAFAQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XL4 A 5 ? 295 ? 46201166 1 ? 291 ? 5 295 
2 1 1XL4 B 5 ? 295 ? 46201166 1 ? 291 ? 5 295 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XL4 MET A 1   ? GB 46201166 ? ? 'EXPRESSION TAG' 1   1  
1 1XL4 THR A 2   ? GB 46201166 ? ? 'EXPRESSION TAG' 2   2  
1 1XL4 GLY A 3   ? GB 46201166 ? ? 'EXPRESSION TAG' 3   3  
1 1XL4 GLY A 4   ? GB 46201166 ? ? 'EXPRESSION TAG' 4   4  
1 1XL4 HIS A 296 ? GB 46201166 ? ? 'EXPRESSION TAG' 296 5  
1 1XL4 HIS A 297 ? GB 46201166 ? ? 'EXPRESSION TAG' 297 6  
1 1XL4 HIS A 298 ? GB 46201166 ? ? 'EXPRESSION TAG' 298 7  
1 1XL4 HIS A 299 ? GB 46201166 ? ? 'EXPRESSION TAG' 299 8  
1 1XL4 HIS A 300 ? GB 46201166 ? ? 'EXPRESSION TAG' 300 9  
1 1XL4 HIS A 301 ? GB 46201166 ? ? 'EXPRESSION TAG' 301 10 
2 1XL4 MET B 1   ? GB 46201166 ? ? 'EXPRESSION TAG' 1   11 
2 1XL4 THR B 2   ? GB 46201166 ? ? 'EXPRESSION TAG' 2   12 
2 1XL4 GLY B 3   ? GB 46201166 ? ? 'EXPRESSION TAG' 3   13 
2 1XL4 GLY B 4   ? GB 46201166 ? ? 'EXPRESSION TAG' 4   14 
2 1XL4 HIS B 296 ? GB 46201166 ? ? 'EXPRESSION TAG' 296 15 
2 1XL4 HIS B 297 ? GB 46201166 ? ? 'EXPRESSION TAG' 297 16 
2 1XL4 HIS B 298 ? GB 46201166 ? ? 'EXPRESSION TAG' 298 17 
2 1XL4 HIS B 299 ? GB 46201166 ? ? 'EXPRESSION TAG' 299 18 
2 1XL4 HIS B 300 ? GB 46201166 ? ? 'EXPRESSION TAG' 300 19 
2 1XL4 HIS B 301 ? GB 46201166 ? ? 'EXPRESSION TAG' 301 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XL4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.80 
_exptl_crystal.density_percent_sol   65.0 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.6 
_exptl_crystal_grow.pdbx_details    
;90mM Hepes, 2.5% PEG 8000, 2.5% PEG 4000, 20% PEG 400, 12.5mM magnesium chloride, 42.5mM magnesium acetate, 2.5% glycerol, 14mM Hega-10, pH 7.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_reflns.entry_id                     1XL4 
_reflns.number_all                   ? 
_reflns.number_obs                   29551 
_reflns.percent_possible_obs         ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.6 
_reflns.d_resolution_low             26.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1XL4 
_refine.ls_d_res_high                            2.6 
_refine.ls_d_res_low                             12.0 
_refine.pdbx_ls_sigma_F                          3 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     29249 
_refine.ls_number_reflns_obs                     27724 
_refine.ls_number_reflns_R_free                  1525 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.226 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1P7B' 
_refine.pdbx_ls_cross_valid_method               Brunger 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -3.752 
_refine.aniso_B[1][2]                            0.0 
_refine.aniso_B[1][3]                            0.0 
_refine.aniso_B[2][2]                            -3.714 
_refine.aniso_B[2][3]                            0.0 
_refine.aniso_B[3][3]                            7.466 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4487 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             180 
_refine_hist.number_atoms_total               4673 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        12.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d     0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d    1.26  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it  1.695 1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it 2.086 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it  2.972 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it 3.243 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1XL4 
_struct.title                     'Intermediate gating structure 1 of the inwardly rectifying K+ channel KirBac3.1' 
_struct.pdbx_descriptor           'Inward rectifier potassium channel' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XL4 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'integral membrane protein, ion channel, inwardly rectifying K+ channel, METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 39  ? VAL A 44  ? HIS A 39  VAL A 44  1 ? 6  
HELX_P HELX_P2  2  SER A 45  ? CYS A 71  ? SER A 45  CYS A 71  1 ? 27 
HELX_P HELX_P3  3  SER A 82  ? ALA A 95  ? SER A 82  ALA A 95  1 ? 14 
HELX_P HELX_P4  4  ILE A 105 ? THR A 136 ? ILE A 105 THR A 136 1 ? 32 
HELX_P HELX_P5  5  THR A 228 ? HIS A 236 ? THR A 228 HIS A 236 1 ? 9  
HELX_P HELX_P6  6  HIS B 37  ? VAL B 44  ? HIS B 37  VAL B 44  1 ? 8  
HELX_P HELX_P7  7  SER B 45  ? ALA B 70  ? SER B 45  ALA B 70  1 ? 26 
HELX_P HELX_P8  8  SER B 82  ? ALA B 95  ? SER B 82  ALA B 95  1 ? 14 
HELX_P HELX_P9  9  ILE B 105 ? THR B 136 ? ILE B 105 THR B 136 1 ? 32 
HELX_P HELX_P10 10 THR B 228 ? SER B 235 ? THR B 228 SER B 235 1 ? 8  
HELX_P HELX_P11 11 LEU B 287 ? PHE B 290 ? LEU B 287 PHE B 290 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 96 O   ? ? ? 1_555 G K   . K  B ? A THR 96   A K   1004 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc2  metalc ? ? A THR 96 OG1 ? ? ? 1_555 G K   . K  B ? A THR 96   A K   1004 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc3  metalc ? ? A THR 96 OG1 ? ? ? 1_555 H MG  . MG A ? A THR 96   A MG  2001 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc4  metalc ? ? A ILE 97 O   ? ? ? 1_555 F K   . K  A ? A ILE 97   A K   1003 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc5  metalc ? ? A GLY 98 O   ? ? ? 1_555 E K   . K  B ? A GLY 98   A K   1002 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc6  metalc ? ? A TYR 99 O   ? ? ? 1_555 E K   . K  B ? A TYR 99   A K   1002 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc7  metalc ? ? B THR 96 O   ? ? ? 1_555 G K   . K  B ? B THR 96   A K   1004 1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc8  metalc ? ? B THR 96 OG1 ? ? ? 1_555 G K   . K  B ? B THR 96   A K   1004 1_555 ? ? ? ? ? ? ? 2.668 ? 
metalc9  metalc ? ? B THR 96 OG1 ? ? ? 1_555 H MG  . MG A ? B THR 96   A MG  2001 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc10 metalc ? ? B ILE 97 O   ? ? ? 1_555 F K   . K  A ? B ILE 97   A K   1003 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc11 metalc ? ? B TYR 99 O   ? ? ? 1_555 E K   . K  B ? B TYR 99   A K   1002 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc12 metalc ? ? E K   .  K   B ? ? 1_555 I HOH . O  B ? A K   1002 A HOH 2003 1_555 ? ? ? ? ? ? ? 2.810 ? 
metalc13 metalc ? ? F K   .  K   A ? ? 1_555 I HOH . O  A ? A K   1003 A HOH 2002 1_555 ? ? ? ? ? ? ? 2.972 ? 
metalc14 metalc ? ? H MG  .  MG  A ? ? 1_555 J HOH . O  A ? A MG  2001 B HOH 2002 1_555 ? ? ? ? ? ? ? 2.083 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
E ? 4 ? 
F ? 2 ? 
G ? 2 ? 
H ? 3 ? 
I ? 4 ? 
J ? 3 ? 
K ? 4 ? 
L ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 24  ? ARG A 25  ? THR A 24  ARG A 25  
A 2 ARG B 283 ? LEU B 285 ? ARG B 283 LEU B 285 
A 3 PHE B 275 ? THR B 277 ? PHE B 275 THR B 277 
B 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
B 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
B 3 SER A 211 ? PRO A 217 ? SER A 211 PRO A 217 
C 1 VAL A 142 ? PHE A 144 ? VAL A 142 PHE A 144 
C 2 LYS A 156 ? ASN A 165 ? LYS A 156 ASN A 165 
C 3 MET A 148 ? PHE A 153 ? MET A 148 PHE A 153 
C 4 ILE A 265 ? TRP A 267 ? ILE A 265 TRP A 267 
D 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
D 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
D 3 ARG A 204 ? PHE A 208 ? ARG A 204 PHE A 208 
E 1 VAL A 191 ? ASP A 197 ? VAL A 191 ASP A 197 
E 2 ILE A 171 ? ILE A 185 ? ILE A 171 ILE A 185 
E 3 GLU A 238 ? HIS A 247 ? GLU A 238 HIS A 247 
E 4 GLN A 252 ? SER A 261 ? GLN A 252 SER A 261 
F 1 HIS A 270 ? PHE A 271 ? HIS A 270 PHE A 271 
F 2 ILE A 293 ? ALA A 294 ? ILE A 293 ALA A 294 
G 1 PHE A 275 ? THR A 277 ? PHE A 275 THR A 277 
G 2 ARG A 283 ? LEU A 285 ? ARG A 283 LEU A 285 
H 1 VAL B 142 ? PHE B 144 ? VAL B 142 PHE B 144 
H 2 LYS B 156 ? ASN B 165 ? LYS B 156 ASN B 165 
H 3 SER B 211 ? PRO B 217 ? SER B 211 PRO B 217 
I 1 VAL B 142 ? PHE B 144 ? VAL B 142 PHE B 144 
I 2 LYS B 156 ? ASN B 165 ? LYS B 156 ASN B 165 
I 3 MET B 148 ? PHE B 153 ? MET B 148 PHE B 153 
I 4 ILE B 265 ? TRP B 267 ? ILE B 265 TRP B 267 
J 1 VAL B 191 ? ASP B 197 ? VAL B 191 ASP B 197 
J 2 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
J 3 ARG B 204 ? PHE B 208 ? ARG B 204 PHE B 208 
K 1 VAL B 191 ? ASP B 197 ? VAL B 191 ASP B 197 
K 2 ILE B 171 ? ILE B 185 ? ILE B 171 ILE B 185 
K 3 GLU B 238 ? HIS B 247 ? GLU B 238 HIS B 247 
K 4 GLN B 252 ? SER B 261 ? GLN B 252 SER B 261 
L 1 HIS B 270 ? PHE B 271 ? HIS B 270 PHE B 271 
L 2 ILE B 293 ? ALA B 294 ? ILE B 293 ALA B 294 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 24  ? N THR A 24  O LEU B 285 ? O LEU B 285 
A 2 3 O ALA B 284 ? O ALA B 284 N THR B 276 ? N THR B 276 
B 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
B 2 3 N LEU A 159 ? N LEU A 159 O HIS A 216 ? O HIS A 216 
C 1 2 N LEU A 143 ? N LEU A 143 O ALA A 164 ? O ALA A 164 
C 2 3 O MET A 160 ? O MET A 160 N VAL A 149 ? N VAL A 149 
C 3 4 N MET A 148 ? N MET A 148 O ILE A 266 ? O ILE A 266 
D 1 2 O HIS A 196 ? O HIS A 196 N LEU A 180 ? N LEU A 180 
D 2 3 N ILE A 171 ? N ILE A 171 O PHE A 208 ? O PHE A 208 
E 1 2 O HIS A 196 ? O HIS A 196 N LEU A 180 ? N LEU A 180 
E 2 3 N VAL A 179 ? N VAL A 179 O LEU A 240 ? O LEU A 240 
E 3 4 N GLY A 245 ? N GLY A 245 O VAL A 254 ? O VAL A 254 
F 1 2 N HIS A 270 ? N HIS A 270 O ALA A 294 ? O ALA A 294 
G 1 2 N THR A 276 ? N THR A 276 O ALA A 284 ? O ALA A 284 
H 1 2 N LEU B 143 ? N LEU B 143 O ALA B 164 ? O ALA B 164 
H 2 3 N LEU B 159 ? N LEU B 159 O HIS B 216 ? O HIS B 216 
I 1 2 N LEU B 143 ? N LEU B 143 O ALA B 164 ? O ALA B 164 
I 2 3 O MET B 160 ? O MET B 160 N VAL B 149 ? N VAL B 149 
I 3 4 N MET B 148 ? N MET B 148 O ILE B 266 ? O ILE B 266 
J 1 2 O ARG B 194 ? O ARG B 194 N ARG B 182 ? N ARG B 182 
J 2 3 N ILE B 171 ? N ILE B 171 O PHE B 208 ? O PHE B 208 
K 1 2 O ARG B 194 ? O ARG B 194 N ARG B 182 ? N ARG B 182 
K 2 3 N ILE B 172 ? N ILE B 172 O HIS B 246 ? O HIS B 246 
K 3 4 N PHE B 243 ? N PHE B 243 O ALA B 256 ? O ALA B 256 
L 1 2 N HIS B 270 ? N HIS B 270 O ALA B 294 ? O ALA B 294 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K A 1002'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K A 1003'  
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE K A 1004'  
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLY A 98 ? GLY A 98   . ? 1_555 ? 
2  AC1 5 TYR A 99 ? TYR A 99   . ? 2_645 ? 
3  AC1 5 HOH I .  ? HOH A 2003 . ? 1_555 ? 
4  AC1 5 GLY B 98 ? GLY B 98   . ? 1_555 ? 
5  AC1 5 TYR B 99 ? TYR B 99   . ? 2_645 ? 
6  AC2 5 ILE A 97 ? ILE A 97   . ? 1_555 ? 
7  AC2 5 GLY A 98 ? GLY A 98   . ? 1_555 ? 
8  AC2 5 HOH I .  ? HOH A 2002 . ? 1_555 ? 
9  AC2 5 ILE B 97 ? ILE B 97   . ? 2_645 ? 
10 AC2 5 GLY B 98 ? GLY B 98   . ? 2_645 ? 
11 AC3 2 THR A 96 ? THR A 96   . ? 1_555 ? 
12 AC3 2 THR B 96 ? THR B 96   . ? 1_555 ? 
13 AC4 3 THR A 96 ? THR A 96   . ? 1_555 ? 
14 AC4 3 THR B 96 ? THR B 96   . ? 1_555 ? 
15 AC4 3 HOH J .  ? HOH B 2002 . ? 2_645 ? 
# 
_database_PDB_matrix.entry_id          1XL4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XL4 
_atom_sites.fract_transf_matrix[1][1]   0.009467 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009142 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011263 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
K  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 11  ? 48.253 -93.178  217.042 1.00 89.05  ? 11   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 11  ? 47.570 -92.069  217.770 1.00 88.88  ? 11   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 11  ? 47.526 -90.804  216.915 1.00 88.12  ? 11   LYS A C   1 
ATOM   4    O  O   . LYS A 1 11  ? 48.524 -90.093  216.786 1.00 88.27  ? 11   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 11  ? 48.299 -91.771  219.085 1.00 89.73  ? 11   LYS A CB  1 
ATOM   6    N  N   . PRO A 1 12  ? 46.358 -90.508  216.319 1.00 87.11  ? 12   PRO A N   1 
ATOM   7    C  CA  . PRO A 1 12  ? 46.204 -89.320  215.476 1.00 85.12  ? 12   PRO A CA  1 
ATOM   8    C  C   . PRO A 1 12  ? 46.772 -88.066  216.128 1.00 82.34  ? 12   PRO A C   1 
ATOM   9    O  O   . PRO A 1 12  ? 46.319 -87.656  217.200 1.00 82.41  ? 12   PRO A O   1 
ATOM   10   C  CB  . PRO A 1 12  ? 44.691 -89.228  215.282 1.00 85.99  ? 12   PRO A CB  1 
ATOM   11   C  CG  . PRO A 1 12  ? 44.282 -90.662  215.266 1.00 87.56  ? 12   PRO A CG  1 
ATOM   12   C  CD  . PRO A 1 12  ? 45.082 -91.241  216.423 1.00 87.76  ? 12   PRO A CD  1 
ATOM   13   N  N   . ARG A 1 13  ? 47.772 -87.468  215.486 1.00 78.09  ? 13   ARG A N   1 
ATOM   14   C  CA  . ARG A 1 13  ? 48.370 -86.246  216.001 1.00 73.50  ? 13   ARG A CA  1 
ATOM   15   C  C   . ARG A 1 13  ? 47.585 -85.057  215.461 1.00 70.01  ? 13   ARG A C   1 
ATOM   16   O  O   . ARG A 1 13  ? 47.496 -84.865  214.250 1.00 70.52  ? 13   ARG A O   1 
ATOM   17   C  CB  . ARG A 1 13  ? 49.850 -86.163  215.600 1.00 72.98  ? 13   ARG A CB  1 
ATOM   18   C  CG  . ARG A 1 13  ? 50.149 -86.393  214.128 1.00 70.92  ? 13   ARG A CG  1 
ATOM   19   C  CD  . ARG A 1 13  ? 51.642 -86.653  213.925 1.00 69.70  ? 13   ARG A CD  1 
ATOM   20   N  NE  . ARG A 1 13  ? 52.467 -85.555  214.426 1.00 69.78  ? 13   ARG A NE  1 
ATOM   21   C  CZ  . ARG A 1 13  ? 53.794 -85.589  214.526 1.00 68.48  ? 13   ARG A CZ  1 
ATOM   22   N  NH1 . ARG A 1 13  ? 54.471 -86.671  214.161 1.00 67.01  ? 13   ARG A NH1 1 
ATOM   23   N  NH2 . ARG A 1 13  ? 54.446 -84.537  215.000 1.00 66.19  ? 13   ARG A NH2 1 
ATOM   24   N  N   . ILE A 1 14  ? 47.003 -84.278  216.371 1.00 66.23  ? 14   ILE A N   1 
ATOM   25   C  CA  . ILE A 1 14  ? 46.202 -83.108  216.012 1.00 63.45  ? 14   ILE A CA  1 
ATOM   26   C  C   . ILE A 1 14  ? 46.911 -82.197  215.013 1.00 60.91  ? 14   ILE A C   1 
ATOM   27   O  O   . ILE A 1 14  ? 46.299 -81.704  214.070 1.00 60.77  ? 14   ILE A O   1 
ATOM   28   C  CB  . ILE A 1 14  ? 45.854 -82.271  217.255 1.00 64.61  ? 14   ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 14  ? 45.212 -83.159  218.320 1.00 65.84  ? 14   ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 14  ? 44.904 -81.142  216.874 1.00 65.82  ? 14   ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 14  ? 43.852 -83.661  217.953 1.00 65.56  ? 14   ILE A CD1 1 
ATOM   32   N  N   . LEU A 1 15  ? 48.200 -81.968  215.229 1.00 58.04  ? 15   LEU A N   1 
ATOM   33   C  CA  . LEU A 1 15  ? 48.978 -81.122  214.342 1.00 55.53  ? 15   LEU A CA  1 
ATOM   34   C  C   . LEU A 1 15  ? 50.076 -81.929  213.684 1.00 54.29  ? 15   LEU A C   1 
ATOM   35   O  O   . LEU A 1 15  ? 50.716 -82.753  214.330 1.00 55.01  ? 15   LEU A O   1 
ATOM   36   C  CB  . LEU A 1 15  ? 49.611 -79.970  215.121 1.00 55.11  ? 15   LEU A CB  1 
ATOM   37   C  CG  . LEU A 1 15  ? 48.639 -78.949  215.703 1.00 55.58  ? 15   LEU A CG  1 
ATOM   38   C  CD1 . LEU A 1 15  ? 49.365 -78.064  216.698 1.00 56.35  ? 15   LEU A CD1 1 
ATOM   39   C  CD2 . LEU A 1 15  ? 48.027 -78.132  214.575 1.00 54.62  ? 15   LEU A CD2 1 
ATOM   40   N  N   . ASN A 1 16  ? 50.287 -81.691  212.395 1.00 52.13  ? 16   ASN A N   1 
ATOM   41   C  CA  . ASN A 1 16  ? 51.339 -82.379  211.668 1.00 50.50  ? 16   ASN A CA  1 
ATOM   42   C  C   . ASN A 1 16  ? 52.644 -81.701  212.057 1.00 48.28  ? 16   ASN A C   1 
ATOM   43   O  O   . ASN A 1 16  ? 52.634 -80.670  212.723 1.00 47.53  ? 16   ASN A O   1 
ATOM   44   C  CB  . ASN A 1 16  ? 51.102 -82.259  210.162 1.00 52.78  ? 16   ASN A CB  1 
ATOM   45   C  CG  . ASN A 1 16  ? 49.782 -82.883  209.732 1.00 54.39  ? 16   ASN A CG  1 
ATOM   46   O  OD1 . ASN A 1 16  ? 49.548 -84.076  209.948 1.00 54.65  ? 16   ASN A OD1 1 
ATOM   47   N  ND2 . ASN A 1 16  ? 48.914 -82.080  209.127 1.00 52.26  ? 16   ASN A ND2 1 
ATOM   48   N  N   . SER A 1 17  ? 53.765 -82.274  211.646 1.00 46.99  ? 17   SER A N   1 
ATOM   49   C  CA  . SER A 1 17  ? 55.063 -81.703  211.981 1.00 47.11  ? 17   SER A CA  1 
ATOM   50   C  C   . SER A 1 17  ? 55.277 -80.318  211.387 1.00 46.29  ? 17   SER A C   1 
ATOM   51   O  O   . SER A 1 17  ? 55.945 -79.472  211.985 1.00 44.75  ? 17   SER A O   1 
ATOM   52   C  CB  . SER A 1 17  ? 56.177 -82.636  211.521 1.00 46.63  ? 17   SER A CB  1 
ATOM   53   O  OG  . SER A 1 17  ? 56.130 -83.841  212.258 1.00 49.88  ? 17   SER A OG  1 
ATOM   54   N  N   . ASP A 1 18  ? 54.705 -80.093  210.211 1.00 46.22  ? 18   ASP A N   1 
ATOM   55   C  CA  . ASP A 1 18  ? 54.842 -78.811  209.542 1.00 47.77  ? 18   ASP A CA  1 
ATOM   56   C  C   . ASP A 1 18  ? 53.795 -77.820  210.034 1.00 47.45  ? 18   ASP A C   1 
ATOM   57   O  O   . ASP A 1 18  ? 53.451 -76.873  209.334 1.00 48.14  ? 18   ASP A O   1 
ATOM   58   C  CB  . ASP A 1 18  ? 54.726 -78.995  208.029 1.00 48.01  ? 18   ASP A CB  1 
ATOM   59   C  CG  . ASP A 1 18  ? 53.318 -79.297  207.587 1.00 50.32  ? 18   ASP A CG  1 
ATOM   60   O  OD1 . ASP A 1 18  ? 52.461 -79.587  208.448 1.00 50.58  ? 18   ASP A OD1 1 
ATOM   61   O  OD2 . ASP A 1 18  ? 53.068 -79.251  206.366 1.00 53.65  ? 18   ASP A OD2 1 
ATOM   62   N  N   . GLY A 1 19  ? 53.278 -78.062  211.235 1.00 48.04  ? 19   GLY A N   1 
ATOM   63   C  CA  . GLY A 1 19  ? 52.301 -77.169  211.833 1.00 51.18  ? 19   GLY A CA  1 
ATOM   64   C  C   . GLY A 1 19  ? 50.887 -77.148  211.282 1.00 52.46  ? 19   GLY A C   1 
ATOM   65   O  O   . GLY A 1 19  ? 50.024 -76.488  211.856 1.00 52.07  ? 19   GLY A O   1 
ATOM   66   N  N   . SER A 1 20  ? 50.641 -77.853  210.183 1.00 54.42  ? 20   SER A N   1 
ATOM   67   C  CA  . SER A 1 20  ? 49.309 -77.880  209.588 1.00 56.63  ? 20   SER A CA  1 
ATOM   68   C  C   . SER A 1 20  ? 48.373 -78.780  210.387 1.00 59.27  ? 20   SER A C   1 
ATOM   69   O  O   . SER A 1 20  ? 48.817 -79.580  211.217 1.00 59.38  ? 20   SER A O   1 
ATOM   70   C  CB  . SER A 1 20  ? 49.378 -78.361  208.136 1.00 56.24  ? 20   SER A CB  1 
ATOM   71   O  OG  . SER A 1 20  ? 49.898 -79.675  208.053 1.00 56.61  ? 20   SER A OG  1 
ATOM   72   N  N   . SER A 1 21  ? 47.075 -78.645  210.135 1.00 62.63  ? 21   SER A N   1 
ATOM   73   C  CA  . SER A 1 21  ? 46.087 -79.447  210.847 1.00 66.05  ? 21   SER A CA  1 
ATOM   74   C  C   . SER A 1 21  ? 45.883 -80.816  210.218 1.00 66.53  ? 21   SER A C   1 
ATOM   75   O  O   . SER A 1 21  ? 45.886 -80.969  208.997 1.00 66.09  ? 21   SER A O   1 
ATOM   76   C  CB  . SER A 1 21  ? 44.744 -78.721  210.919 1.00 66.86  ? 21   SER A CB  1 
ATOM   77   O  OG  . SER A 1 21  ? 43.869 -79.409  211.798 1.00 67.63  ? 21   SER A OG  1 
ATOM   78   N  N   . ASN A 1 22  ? 45.692 -81.809  211.073 1.00 67.91  ? 22   ASN A N   1 
ATOM   79   C  CA  . ASN A 1 22  ? 45.500 -83.177  210.631 1.00 70.22  ? 22   ASN A CA  1 
ATOM   80   C  C   . ASN A 1 22  ? 44.056 -83.619  210.848 1.00 71.03  ? 22   ASN A C   1 
ATOM   81   O  O   . ASN A 1 22  ? 43.773 -84.809  210.961 1.00 72.11  ? 22   ASN A O   1 
ATOM   82   C  CB  . ASN A 1 22  ? 46.457 -84.085  211.402 1.00 70.57  ? 22   ASN A CB  1 
ATOM   83   C  CG  . ASN A 1 22  ? 46.461 -85.496  210.882 1.00 69.20  ? 22   ASN A CG  1 
ATOM   84   O  OD1 . ASN A 1 22  ? 46.566 -85.721  209.677 1.00 68.48  ? 22   ASN A OD1 1 
ATOM   85   N  ND2 . ASN A 1 22  ? 46.362 -86.462  211.789 1.00 68.55  ? 22   ASN A ND2 1 
ATOM   86   N  N   . ILE A 1 23  ? 43.149 -82.650  210.891 1.00 72.56  ? 23   ILE A N   1 
ATOM   87   C  CA  . ILE A 1 23  ? 41.728 -82.914  211.100 1.00 74.37  ? 23   ILE A CA  1 
ATOM   88   C  C   . ILE A 1 23  ? 40.940 -82.816  209.789 1.00 76.59  ? 23   ILE A C   1 
ATOM   89   O  O   . ILE A 1 23  ? 41.345 -82.102  208.869 1.00 76.89  ? 23   ILE A O   1 
ATOM   90   C  CB  . ILE A 1 23  ? 41.162 -81.926  212.146 1.00 73.65  ? 23   ILE A CB  1 
ATOM   91   C  CG1 . ILE A 1 23  ? 41.900 -82.132  213.478 1.00 73.85  ? 23   ILE A CG1 1 
ATOM   92   C  CG2 . ILE A 1 23  ? 39.666 -82.122  212.310 1.00 71.01  ? 23   ILE A CG2 1 
ATOM   93   C  CD1 . ILE A 1 23  ? 41.538 -81.148  214.561 1.00 74.07  ? 23   ILE A CD1 1 
ATOM   94   N  N   . THR A 1 24  ? 39.828 -83.547  209.705 1.00 78.43  ? 24   THR A N   1 
ATOM   95   C  CA  . THR A 1 24  ? 38.981 -83.559  208.508 1.00 80.09  ? 24   THR A CA  1 
ATOM   96   C  C   . THR A 1 24  ? 37.921 -82.463  208.564 1.00 81.94  ? 24   THR A C   1 
ATOM   97   O  O   . THR A 1 24  ? 37.342 -82.212  209.620 1.00 81.51  ? 24   THR A O   1 
ATOM   98   C  CB  . THR A 1 24  ? 38.243 -84.910  208.356 1.00 79.95  ? 24   THR A CB  1 
ATOM   99   O  OG1 . THR A 1 24  ? 39.180 -85.992  208.428 1.00 79.04  ? 24   THR A OG1 1 
ATOM   100  C  CG2 . THR A 1 24  ? 37.520 -84.966  207.022 1.00 79.29  ? 24   THR A CG2 1 
ATOM   101  N  N   . ARG A 1 25  ? 37.664 -81.817  207.428 1.00 85.19  ? 25   ARG A N   1 
ATOM   102  C  CA  . ARG A 1 25  ? 36.657 -80.757  207.366 1.00 89.85  ? 25   ARG A CA  1 
ATOM   103  C  C   . ARG A 1 25  ? 35.330 -81.288  206.832 1.00 93.00  ? 25   ARG A C   1 
ATOM   104  O  O   . ARG A 1 25  ? 35.276 -81.871  205.751 1.00 93.73  ? 25   ARG A O   1 
ATOM   105  C  CB  . ARG A 1 25  ? 37.120 -79.600  206.472 1.00 89.54  ? 25   ARG A CB  1 
ATOM   106  C  CG  . ARG A 1 25  ? 38.180 -78.701  207.074 1.00 90.10  ? 25   ARG A CG  1 
ATOM   107  C  CD  . ARG A 1 25  ? 39.576 -79.164  206.715 1.00 91.76  ? 25   ARG A CD  1 
ATOM   108  N  NE  . ARG A 1 25  ? 40.602 -78.323  207.324 1.00 93.19  ? 25   ARG A NE  1 
ATOM   109  C  CZ  . ARG A 1 25  ? 41.907 -78.463  207.113 1.00 93.85  ? 25   ARG A CZ  1 
ATOM   110  N  NH1 . ARG A 1 25  ? 42.355 -79.414  206.302 1.00 93.63  ? 25   ARG A NH1 1 
ATOM   111  N  NH2 . ARG A 1 25  ? 42.767 -77.657  207.720 1.00 94.25  ? 25   ARG A NH2 1 
ATOM   112  N  N   . LEU A 1 26  ? 34.259 -81.075  207.589 1.00 96.85  ? 26   LEU A N   1 
ATOM   113  C  CA  . LEU A 1 26  ? 32.942 -81.537  207.175 1.00 101.06 ? 26   LEU A CA  1 
ATOM   114  C  C   . LEU A 1 26  ? 32.054 -80.377  206.733 1.00 104.90 ? 26   LEU A C   1 
ATOM   115  O  O   . LEU A 1 26  ? 30.890 -80.568  206.386 1.00 105.47 ? 26   LEU A O   1 
ATOM   116  C  CB  . LEU A 1 26  ? 32.281 -82.323  208.310 1.00 99.71  ? 26   LEU A CB  1 
ATOM   117  C  CG  . LEU A 1 26  ? 33.072 -83.564  208.732 1.00 98.78  ? 26   LEU A CG  1 
ATOM   118  C  CD1 . LEU A 1 26  ? 32.357 -84.281  209.856 1.00 98.24  ? 26   LEU A CD1 1 
ATOM   119  C  CD2 . LEU A 1 26  ? 33.249 -84.483  207.539 1.00 97.93  ? 26   LEU A CD2 1 
ATOM   120  N  N   . GLY A 1 27  ? 32.612 -79.172  206.757 1.00 109.00 ? 27   GLY A N   1 
ATOM   121  C  CA  . GLY A 1 27  ? 31.871 -78.008  206.310 1.00 115.14 ? 27   GLY A CA  1 
ATOM   122  C  C   . GLY A 1 27  ? 32.278 -77.803  204.862 1.00 119.62 ? 27   GLY A C   1 
ATOM   123  O  O   . GLY A 1 27  ? 32.281 -76.687  204.336 1.00 119.72 ? 27   GLY A O   1 
ATOM   124  N  N   . LEU A 1 28  ? 32.629 -78.920  204.228 1.00 123.69 ? 28   LEU A N   1 
ATOM   125  C  CA  . LEU A 1 28  ? 33.078 -78.967  202.843 1.00 127.97 ? 28   LEU A CA  1 
ATOM   126  C  C   . LEU A 1 28  ? 32.395 -78.032  201.846 1.00 130.69 ? 28   LEU A C   1 
ATOM   127  O  O   . LEU A 1 28  ? 31.270 -78.274  201.406 1.00 131.29 ? 28   LEU A O   1 
ATOM   128  C  CB  . LEU A 1 28  ? 32.995 -80.409  202.327 1.00 128.24 ? 28   LEU A CB  1 
ATOM   129  C  CG  . LEU A 1 28  ? 33.986 -81.396  202.951 1.00 128.79 ? 28   LEU A CG  1 
ATOM   130  C  CD1 . LEU A 1 28  ? 33.704 -82.807  202.452 1.00 128.77 ? 28   LEU A CD1 1 
ATOM   131  C  CD2 . LEU A 1 28  ? 35.409 -80.975  202.601 1.00 128.63 ? 28   LEU A CD2 1 
ATOM   132  N  N   . GLU A 1 29  ? 33.102 -76.961  201.499 1.00 133.45 ? 29   GLU A N   1 
ATOM   133  C  CA  . GLU A 1 29  ? 32.640 -75.978  200.526 1.00 136.18 ? 29   GLU A CA  1 
ATOM   134  C  C   . GLU A 1 29  ? 33.879 -75.638  199.708 1.00 137.63 ? 29   GLU A C   1 
ATOM   135  O  O   . GLU A 1 29  ? 34.756 -74.900  200.159 1.00 137.61 ? 29   GLU A O   1 
ATOM   136  C  CB  . GLU A 1 29  ? 32.085 -74.735  201.223 1.00 137.01 ? 29   GLU A CB  1 
ATOM   137  C  CG  . GLU A 1 29  ? 30.858 -75.016  202.078 1.00 138.46 ? 29   GLU A CG  1 
ATOM   138  C  CD  . GLU A 1 29  ? 30.100 -73.756  202.454 1.00 139.26 ? 29   GLU A CD  1 
ATOM   139  O  OE1 . GLU A 1 29  ? 30.717 -72.834  203.030 1.00 139.44 ? 29   GLU A OE1 1 
ATOM   140  O  OE2 . GLU A 1 29  ? 28.883 -73.689  202.174 1.00 139.66 ? 29   GLU A OE2 1 
ATOM   141  N  N   . LYS A 1 30  ? 33.941 -76.195  198.504 1.00 139.53 ? 30   LYS A N   1 
ATOM   142  C  CA  . LYS A 1 30  ? 35.081 -76.029  197.613 1.00 141.56 ? 30   LYS A CA  1 
ATOM   143  C  C   . LYS A 1 30  ? 35.604 -74.621  197.309 1.00 142.78 ? 30   LYS A C   1 
ATOM   144  O  O   . LYS A 1 30  ? 36.341 -74.040  198.108 1.00 143.09 ? 30   LYS A O   1 
ATOM   145  C  CB  . LYS A 1 30  ? 34.809 -76.766  196.294 1.00 141.56 ? 30   LYS A CB  1 
ATOM   146  C  CG  . LYS A 1 30  ? 36.006 -76.815  195.353 1.00 142.03 ? 30   LYS A CG  1 
ATOM   147  C  CD  . LYS A 1 30  ? 37.233 -77.394  196.045 1.00 142.17 ? 30   LYS A CD  1 
ATOM   148  C  CE  . LYS A 1 30  ? 38.462 -77.315  195.156 1.00 142.16 ? 30   LYS A CE  1 
ATOM   149  N  NZ  . LYS A 1 30  ? 39.684 -77.791  195.862 1.00 142.15 ? 30   LYS A NZ  1 
ATOM   150  N  N   . ARG A 1 31  ? 35.225 -74.083  196.152 1.00 143.93 ? 31   ARG A N   1 
ATOM   151  C  CA  . ARG A 1 31  ? 35.702 -72.774  195.703 1.00 144.86 ? 31   ARG A CA  1 
ATOM   152  C  C   . ARG A 1 31  ? 34.796 -71.563  195.937 1.00 145.61 ? 31   ARG A C   1 
ATOM   153  O  O   . ARG A 1 31  ? 33.750 -71.658  196.580 1.00 145.88 ? 31   ARG A O   1 
ATOM   154  C  CB  . ARG A 1 31  ? 36.042 -72.860  194.213 1.00 144.45 ? 31   ARG A CB  1 
ATOM   155  C  CG  . ARG A 1 31  ? 37.172 -73.826  193.890 1.00 144.07 ? 31   ARG A CG  1 
ATOM   156  C  CD  . ARG A 1 31  ? 37.060 -74.348  192.469 1.00 143.68 ? 31   ARG A CD  1 
ATOM   157  N  NE  . ARG A 1 31  ? 36.784 -73.279  191.516 1.00 143.35 ? 31   ARG A NE  1 
ATOM   158  C  CZ  . ARG A 1 31  ? 36.624 -73.467  190.211 1.00 143.12 ? 31   ARG A CZ  1 
ATOM   159  N  NH1 . ARG A 1 31  ? 36.716 -74.686  189.697 1.00 142.81 ? 31   ARG A NH1 1 
ATOM   160  N  NH2 . ARG A 1 31  ? 36.355 -72.438  189.422 1.00 143.39 ? 31   ARG A NH2 1 
ATOM   161  N  N   . GLY A 1 32  ? 35.230 -70.424  195.400 1.00 146.16 ? 32   GLY A N   1 
ATOM   162  C  CA  . GLY A 1 32  ? 34.490 -69.180  195.524 1.00 146.68 ? 32   GLY A CA  1 
ATOM   163  C  C   . GLY A 1 32  ? 34.970 -68.168  194.495 1.00 147.08 ? 32   GLY A C   1 
ATOM   164  O  O   . GLY A 1 32  ? 35.279 -68.537  193.361 1.00 146.99 ? 32   GLY A O   1 
ATOM   165  N  N   . TRP A 1 33  ? 35.035 -66.894  194.882 1.00 147.43 ? 33   TRP A N   1 
ATOM   166  C  CA  . TRP A 1 33  ? 35.491 -65.840  193.977 1.00 147.58 ? 33   TRP A CA  1 
ATOM   167  C  C   . TRP A 1 33  ? 36.929 -65.454  194.293 1.00 147.33 ? 33   TRP A C   1 
ATOM   168  O  O   . TRP A 1 33  ? 37.283 -65.259  195.457 1.00 147.71 ? 33   TRP A O   1 
ATOM   169  C  CB  . TRP A 1 33  ? 34.592 -64.610  194.088 1.00 148.04 ? 33   TRP A CB  1 
ATOM   170  C  CG  . TRP A 1 33  ? 33.151 -64.924  193.890 1.00 148.76 ? 33   TRP A CG  1 
ATOM   171  C  CD1 . TRP A 1 33  ? 32.627 -65.876  193.064 1.00 148.93 ? 33   TRP A CD1 1 
ATOM   172  C  CD2 . TRP A 1 33  ? 32.039 -64.268  194.506 1.00 149.15 ? 33   TRP A CD2 1 
ATOM   173  N  NE1 . TRP A 1 33  ? 31.256 -65.854  193.127 1.00 149.23 ? 33   TRP A NE1 1 
ATOM   174  C  CE2 . TRP A 1 33  ? 30.867 -64.876  194.003 1.00 149.47 ? 33   TRP A CE2 1 
ATOM   175  C  CE3 . TRP A 1 33  ? 31.917 -63.223  195.432 1.00 149.24 ? 33   TRP A CE3 1 
ATOM   176  C  CZ2 . TRP A 1 33  ? 29.585 -64.474  194.398 1.00 149.68 ? 33   TRP A CZ2 1 
ATOM   177  C  CZ3 . TRP A 1 33  ? 30.641 -62.822  195.824 1.00 149.41 ? 33   TRP A CZ3 1 
ATOM   178  C  CH2 . TRP A 1 33  ? 29.493 -63.448  195.305 1.00 149.54 ? 33   TRP A CH2 1 
ATOM   179  N  N   . LEU A 1 34  ? 37.748 -65.332  193.250 1.00 146.59 ? 34   LEU A N   1 
ATOM   180  C  CA  . LEU A 1 34  ? 39.162 -65.005  193.409 1.00 145.88 ? 34   LEU A CA  1 
ATOM   181  C  C   . LEU A 1 34  ? 39.798 -66.174  194.166 1.00 145.86 ? 34   LEU A C   1 
ATOM   182  O  O   . LEU A 1 34  ? 40.889 -66.053  194.730 1.00 146.22 ? 34   LEU A O   1 
ATOM   183  C  CB  . LEU A 1 34  ? 39.337 -63.704  194.205 1.00 145.05 ? 34   LEU A CB  1 
ATOM   184  C  CG  . LEU A 1 34  ? 40.766 -63.170  194.330 1.00 144.17 ? 34   LEU A CG  1 
ATOM   185  C  CD1 . LEU A 1 34  ? 41.248 -62.738  192.964 1.00 143.68 ? 34   LEU A CD1 1 
ATOM   186  C  CD2 . LEU A 1 34  ? 40.817 -62.004  195.303 1.00 144.01 ? 34   LEU A CD2 1 
ATOM   187  N  N   . ASP A 1 35  ? 39.096 -67.308  194.169 1.00 145.03 ? 35   ASP A N   1 
ATOM   188  C  CA  . ASP A 1 35  ? 39.552 -68.515  194.852 1.00 143.54 ? 35   ASP A CA  1 
ATOM   189  C  C   . ASP A 1 35  ? 39.457 -69.760  193.973 1.00 142.56 ? 35   ASP A C   1 
ATOM   190  O  O   . ASP A 1 35  ? 39.214 -70.860  194.469 1.00 142.74 ? 35   ASP A O   1 
ATOM   191  C  CB  . ASP A 1 35  ? 38.735 -68.741  196.127 1.00 143.58 ? 35   ASP A CB  1 
ATOM   192  C  CG  . ASP A 1 35  ? 38.912 -67.626  197.137 1.00 143.62 ? 35   ASP A CG  1 
ATOM   193  O  OD1 . ASP A 1 35  ? 40.070 -67.349  197.514 1.00 143.86 ? 35   ASP A OD1 1 
ATOM   194  O  OD2 . ASP A 1 35  ? 37.894 -67.032  197.555 1.00 143.20 ? 35   ASP A OD2 1 
ATOM   195  N  N   . ASP A 1 36  ? 39.639 -69.583  192.670 1.00 141.02 ? 36   ASP A N   1 
ATOM   196  C  CA  . ASP A 1 36  ? 39.588 -70.703  191.741 1.00 139.47 ? 36   ASP A CA  1 
ATOM   197  C  C   . ASP A 1 36  ? 40.857 -71.507  192.002 1.00 138.87 ? 36   ASP A C   1 
ATOM   198  O  O   . ASP A 1 36  ? 40.997 -72.141  193.049 1.00 138.77 ? 36   ASP A O   1 
ATOM   199  C  CB  . ASP A 1 36  ? 39.582 -70.183  190.304 1.00 138.64 ? 36   ASP A CB  1 
ATOM   200  C  CG  . ASP A 1 36  ? 38.851 -71.101  189.358 1.00 138.09 ? 36   ASP A CG  1 
ATOM   201  O  OD1 . ASP A 1 36  ? 39.205 -72.296  189.286 1.00 137.75 ? 36   ASP A OD1 1 
ATOM   202  O  OD2 . ASP A 1 36  ? 37.916 -70.623  188.685 1.00 138.07 ? 36   ASP A OD2 1 
ATOM   203  N  N   . HIS A 1 37  ? 41.778 -71.480  191.046 1.00 138.01 ? 37   HIS A N   1 
ATOM   204  C  CA  . HIS A 1 37  ? 43.053 -72.167  191.194 1.00 136.83 ? 37   HIS A CA  1 
ATOM   205  C  C   . HIS A 1 37  ? 44.069 -71.052  191.401 1.00 135.37 ? 37   HIS A C   1 
ATOM   206  O  O   . HIS A 1 37  ? 45.279 -71.258  191.311 1.00 135.47 ? 37   HIS A O   1 
ATOM   207  C  CB  . HIS A 1 37  ? 43.399 -72.966  189.936 1.00 137.94 ? 37   HIS A CB  1 
ATOM   208  C  CG  . HIS A 1 37  ? 42.314 -73.900  189.496 1.00 139.23 ? 37   HIS A CG  1 
ATOM   209  N  ND1 . HIS A 1 37  ? 41.610 -74.693  190.377 1.00 139.71 ? 37   HIS A ND1 1 
ATOM   210  C  CD2 . HIS A 1 37  ? 41.823 -74.176  188.265 1.00 139.41 ? 37   HIS A CD2 1 
ATOM   211  C  CE1 . HIS A 1 37  ? 40.729 -75.416  189.707 1.00 139.66 ? 37   HIS A CE1 1 
ATOM   212  N  NE2 . HIS A 1 37  ? 40.838 -75.121  188.424 1.00 139.64 ? 37   HIS A NE2 1 
ATOM   213  N  N   . TYR A 1 38  ? 43.539 -69.861  191.667 1.00 133.26 ? 38   TYR A N   1 
ATOM   214  C  CA  . TYR A 1 38  ? 44.341 -68.669  191.905 1.00 130.80 ? 38   TYR A CA  1 
ATOM   215  C  C   . TYR A 1 38  ? 45.449 -68.967  192.909 1.00 128.51 ? 38   TYR A C   1 
ATOM   216  O  O   . TYR A 1 38  ? 46.521 -68.364  192.864 1.00 128.86 ? 38   TYR A O   1 
ATOM   217  C  CB  . TYR A 1 38  ? 43.437 -67.541  192.421 1.00 131.35 ? 38   TYR A CB  1 
ATOM   218  C  CG  . TYR A 1 38  ? 44.165 -66.339  192.989 1.00 131.75 ? 38   TYR A CG  1 
ATOM   219  C  CD1 . TYR A 1 38  ? 45.117 -65.650  192.237 1.00 131.85 ? 38   TYR A CD1 1 
ATOM   220  C  CD2 . TYR A 1 38  ? 43.891 -65.883  194.280 1.00 132.17 ? 38   TYR A CD2 1 
ATOM   221  C  CE1 . TYR A 1 38  ? 45.779 -64.536  192.760 1.00 131.94 ? 38   TYR A CE1 1 
ATOM   222  C  CE2 . TYR A 1 38  ? 44.545 -64.772  194.810 1.00 131.93 ? 38   TYR A CE2 1 
ATOM   223  C  CZ  . TYR A 1 38  ? 45.486 -64.105  194.047 1.00 131.73 ? 38   TYR A CZ  1 
ATOM   224  O  OH  . TYR A 1 38  ? 46.133 -63.011  194.572 1.00 131.32 ? 38   TYR A OH  1 
ATOM   225  N  N   . HIS A 1 39  ? 45.183 -69.905  193.812 1.00 124.92 ? 39   HIS A N   1 
ATOM   226  C  CA  . HIS A 1 39  ? 46.163 -70.288  194.816 1.00 121.09 ? 39   HIS A CA  1 
ATOM   227  C  C   . HIS A 1 39  ? 47.094 -71.352  194.255 1.00 117.96 ? 39   HIS A C   1 
ATOM   228  O  O   . HIS A 1 39  ? 48.256 -71.445  194.655 1.00 118.10 ? 39   HIS A O   1 
ATOM   229  C  CB  . HIS A 1 39  ? 45.455 -70.818  196.064 1.00 121.77 ? 39   HIS A CB  1 
ATOM   230  C  CG  . HIS A 1 39  ? 44.576 -69.807  196.731 1.00 122.19 ? 39   HIS A CG  1 
ATOM   231  N  ND1 . HIS A 1 39  ? 45.069 -68.651  197.296 1.00 121.98 ? 39   HIS A ND1 1 
ATOM   232  C  CD2 . HIS A 1 39  ? 43.233 -69.769  196.905 1.00 122.60 ? 39   HIS A CD2 1 
ATOM   233  C  CE1 . HIS A 1 39  ? 44.068 -67.944  197.790 1.00 122.15 ? 39   HIS A CE1 1 
ATOM   234  N  NE2 . HIS A 1 39  ? 42.943 -68.600  197.565 1.00 122.67 ? 39   HIS A NE2 1 
ATOM   235  N  N   . ASP A 1 40  ? 46.586 -72.148  193.320 1.00 114.09 ? 40   ASP A N   1 
ATOM   236  C  CA  . ASP A 1 40  ? 47.383 -73.208  192.713 1.00 110.22 ? 40   ASP A CA  1 
ATOM   237  C  C   . ASP A 1 40  ? 48.443 -72.645  191.772 1.00 106.52 ? 40   ASP A C   1 
ATOM   238  O  O   . ASP A 1 40  ? 49.448 -73.296  191.488 1.00 105.61 ? 40   ASP A O   1 
ATOM   239  C  CB  . ASP A 1 40  ? 46.474 -74.182  191.943 1.00 111.52 ? 40   ASP A CB  1 
ATOM   240  C  CG  . ASP A 1 40  ? 45.432 -74.841  192.834 1.00 111.62 ? 40   ASP A CG  1 
ATOM   241  O  OD1 . ASP A 1 40  ? 45.648 -74.897  194.067 1.00 110.89 ? 40   ASP A OD1 1 
ATOM   242  O  OD2 . ASP A 1 40  ? 44.403 -75.315  192.306 1.00 112.30 ? 40   ASP A OD2 1 
ATOM   243  N  N   . LEU A 1 41  ? 48.210 -71.430  191.294 1.00 102.49 ? 41   LEU A N   1 
ATOM   244  C  CA  . LEU A 1 41  ? 49.144 -70.773  190.392 1.00 98.80  ? 41   LEU A CA  1 
ATOM   245  C  C   . LEU A 1 41  ? 50.239 -70.068  191.183 1.00 96.06  ? 41   LEU A C   1 
ATOM   246  O  O   . LEU A 1 41  ? 51.340 -69.841  190.681 1.00 94.51  ? 41   LEU A O   1 
ATOM   247  C  CB  . LEU A 1 41  ? 48.396 -69.759  189.530 1.00 99.21  ? 41   LEU A CB  1 
ATOM   248  C  CG  . LEU A 1 41  ? 47.353 -70.334  188.572 1.00 98.84  ? 41   LEU A CG  1 
ATOM   249  C  CD1 . LEU A 1 41  ? 46.529 -69.205  187.979 1.00 98.22  ? 41   LEU A CD1 1 
ATOM   250  C  CD2 . LEU A 1 41  ? 48.054 -71.133  187.479 1.00 98.66  ? 41   LEU A CD2 1 
ATOM   251  N  N   . LEU A 1 42  ? 49.919 -69.729  192.428 1.00 93.26  ? 42   LEU A N   1 
ATOM   252  C  CA  . LEU A 1 42  ? 50.851 -69.043  193.314 1.00 90.35  ? 42   LEU A CA  1 
ATOM   253  C  C   . LEU A 1 42  ? 51.697 -70.022  194.113 1.00 87.67  ? 42   LEU A C   1 
ATOM   254  O  O   . LEU A 1 42  ? 52.806 -69.693  194.536 1.00 87.18  ? 42   LEU A O   1 
ATOM   255  C  CB  . LEU A 1 42  ? 50.082 -68.150  194.288 1.00 91.02  ? 42   LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 42  ? 49.271 -67.001  193.684 1.00 91.28  ? 42   LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 42  ? 48.376 -66.390  194.751 1.00 91.36  ? 42   LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 42  ? 50.219 -65.962  193.097 1.00 90.96  ? 42   LEU A CD2 1 
ATOM   259  N  N   . THR A 1 43  ? 51.166 -71.225  194.310 1.00 85.08  ? 43   THR A N   1 
ATOM   260  C  CA  . THR A 1 43  ? 51.848 -72.251  195.088 1.00 82.43  ? 43   THR A CA  1 
ATOM   261  C  C   . THR A 1 43  ? 52.703 -73.210  194.270 1.00 80.08  ? 43   THR A C   1 
ATOM   262  O  O   . THR A 1 43  ? 53.844 -73.497  194.633 1.00 80.51  ? 43   THR A O   1 
ATOM   263  C  CB  . THR A 1 43  ? 50.845 -73.097  195.886 1.00 82.19  ? 43   THR A CB  1 
ATOM   264  O  OG1 . THR A 1 43  ? 49.858 -72.243  196.472 1.00 81.86  ? 43   THR A OG1 1 
ATOM   265  C  CG2 . THR A 1 43  ? 51.561 -73.852  196.994 1.00 83.54  ? 43   THR A CG2 1 
ATOM   266  N  N   . VAL A 1 44  ? 52.149 -73.707  193.172 1.00 76.75  ? 44   VAL A N   1 
ATOM   267  C  CA  . VAL A 1 44  ? 52.861 -74.653  192.325 1.00 73.55  ? 44   VAL A CA  1 
ATOM   268  C  C   . VAL A 1 44  ? 54.279 -74.185  191.971 1.00 72.24  ? 44   VAL A C   1 
ATOM   269  O  O   . VAL A 1 44  ? 54.654 -73.045  192.238 1.00 71.51  ? 44   VAL A O   1 
ATOM   270  C  CB  . VAL A 1 44  ? 52.047 -74.946  191.043 1.00 72.61  ? 44   VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 44  ? 52.119 -73.779  190.080 1.00 72.23  ? 44   VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 44  ? 52.541 -76.215  190.412 1.00 74.26  ? 44   VAL A CG2 1 
ATOM   273  N  N   . SER A 1 45  ? 55.067 -75.079  191.380 1.00 71.17  ? 45   SER A N   1 
ATOM   274  C  CA  . SER A 1 45  ? 56.448 -74.779  191.001 1.00 70.40  ? 45   SER A CA  1 
ATOM   275  C  C   . SER A 1 45  ? 56.558 -74.025  189.679 1.00 70.11  ? 45   SER A C   1 
ATOM   276  O  O   . SER A 1 45  ? 55.669 -74.110  188.832 1.00 70.76  ? 45   SER A O   1 
ATOM   277  C  CB  . SER A 1 45  ? 57.241 -76.078  190.902 1.00 70.13  ? 45   SER A CB  1 
ATOM   278  O  OG  . SER A 1 45  ? 56.628 -76.962  189.980 1.00 69.89  ? 45   SER A OG  1 
ATOM   279  N  N   . TRP A 1 46  ? 57.659 -73.301  189.498 1.00 69.17  ? 46   TRP A N   1 
ATOM   280  C  CA  . TRP A 1 46  ? 57.868 -72.532  188.278 1.00 69.60  ? 46   TRP A CA  1 
ATOM   281  C  C   . TRP A 1 46  ? 57.674 -73.343  187.001 1.00 69.98  ? 46   TRP A C   1 
ATOM   282  O  O   . TRP A 1 46  ? 57.001 -72.898  186.069 1.00 70.58  ? 46   TRP A O   1 
ATOM   283  C  CB  . TRP A 1 46  ? 59.252 -71.880  188.289 1.00 68.92  ? 46   TRP A CB  1 
ATOM   284  C  CG  . TRP A 1 46  ? 59.308 -70.682  189.189 1.00 70.00  ? 46   TRP A CG  1 
ATOM   285  C  CD1 . TRP A 1 46  ? 59.937 -70.588  190.394 1.00 69.48  ? 46   TRP A CD1 1 
ATOM   286  C  CD2 . TRP A 1 46  ? 58.647 -69.424  188.984 1.00 70.39  ? 46   TRP A CD2 1 
ATOM   287  N  NE1 . TRP A 1 46  ? 59.708 -69.355  190.957 1.00 69.87  ? 46   TRP A NE1 1 
ATOM   288  C  CE2 . TRP A 1 46  ? 58.919 -68.621  190.112 1.00 70.17  ? 46   TRP A CE2 1 
ATOM   289  C  CE3 . TRP A 1 46  ? 57.850 -68.900  187.957 1.00 69.54  ? 46   TRP A CE3 1 
ATOM   290  C  CZ2 . TRP A 1 46  ? 58.420 -67.322  190.245 1.00 69.51  ? 46   TRP A CZ2 1 
ATOM   291  C  CZ3 . TRP A 1 46  ? 57.354 -67.606  188.091 1.00 69.62  ? 46   TRP A CZ3 1 
ATOM   292  C  CH2 . TRP A 1 46  ? 57.644 -66.833  189.227 1.00 69.11  ? 46   TRP A CH2 1 
ATOM   293  N  N   . PRO A 1 47  ? 58.265 -74.544  186.934 1.00 69.80  ? 47   PRO A N   1 
ATOM   294  C  CA  . PRO A 1 47  ? 58.111 -75.372  185.737 1.00 68.43  ? 47   PRO A CA  1 
ATOM   295  C  C   . PRO A 1 47  ? 56.636 -75.613  185.435 1.00 66.87  ? 47   PRO A C   1 
ATOM   296  O  O   . PRO A 1 47  ? 56.200 -75.532  184.287 1.00 66.94  ? 47   PRO A O   1 
ATOM   297  C  CB  . PRO A 1 47  ? 58.841 -76.650  186.120 1.00 68.90  ? 47   PRO A CB  1 
ATOM   298  C  CG  . PRO A 1 47  ? 59.946 -76.136  186.982 1.00 69.12  ? 47   PRO A CG  1 
ATOM   299  C  CD  . PRO A 1 47  ? 59.220 -75.159  187.871 1.00 70.19  ? 47   PRO A CD  1 
ATOM   300  N  N   . VAL A 1 48  ? 55.868 -75.904  186.476 1.00 65.39  ? 48   VAL A N   1 
ATOM   301  C  CA  . VAL A 1 48  ? 54.443 -76.149  186.310 1.00 64.99  ? 48   VAL A CA  1 
ATOM   302  C  C   . VAL A 1 48  ? 53.711 -74.844  186.037 1.00 63.03  ? 48   VAL A C   1 
ATOM   303  O  O   . VAL A 1 48  ? 52.799 -74.793  185.213 1.00 63.11  ? 48   VAL A O   1 
ATOM   304  C  CB  . VAL A 1 48  ? 53.838 -76.796  187.562 1.00 65.37  ? 48   VAL A CB  1 
ATOM   305  C  CG1 . VAL A 1 48  ? 52.370 -77.123  187.319 1.00 65.95  ? 48   VAL A CG1 1 
ATOM   306  C  CG2 . VAL A 1 48  ? 54.618 -78.050  187.922 1.00 67.00  ? 48   VAL A CG2 1 
ATOM   307  N  N   . PHE A 1 49  ? 54.113 -73.792  186.739 1.00 61.09  ? 49   PHE A N   1 
ATOM   308  C  CA  . PHE A 1 49  ? 53.501 -72.487  186.560 1.00 59.57  ? 49   PHE A CA  1 
ATOM   309  C  C   . PHE A 1 49  ? 53.617 -72.097  185.092 1.00 59.45  ? 49   PHE A C   1 
ATOM   310  O  O   . PHE A 1 49  ? 52.627 -71.734  184.450 1.00 58.39  ? 49   PHE A O   1 
ATOM   311  C  CB  . PHE A 1 49  ? 54.214 -71.443  187.422 1.00 58.86  ? 49   PHE A CB  1 
ATOM   312  C  CG  . PHE A 1 49  ? 53.691 -70.046  187.235 1.00 58.51  ? 49   PHE A CG  1 
ATOM   313  C  CD1 . PHE A 1 49  ? 52.395 -69.717  187.621 1.00 57.88  ? 49   PHE A CD1 1 
ATOM   314  C  CD2 . PHE A 1 49  ? 54.484 -69.067  186.645 1.00 57.28  ? 49   PHE A CD2 1 
ATOM   315  C  CE1 . PHE A 1 49  ? 51.897 -68.436  187.423 1.00 57.19  ? 49   PHE A CE1 1 
ATOM   316  C  CE2 . PHE A 1 49  ? 53.995 -67.787  186.443 1.00 57.09  ? 49   PHE A CE2 1 
ATOM   317  C  CZ  . PHE A 1 49  ? 52.696 -67.470  186.833 1.00 57.13  ? 49   PHE A CZ  1 
ATOM   318  N  N   . ILE A 1 50  ? 54.837 -72.187  184.569 1.00 59.29  ? 50   ILE A N   1 
ATOM   319  C  CA  . ILE A 1 50  ? 55.110 -71.842  183.183 1.00 59.45  ? 50   ILE A CA  1 
ATOM   320  C  C   . ILE A 1 50  ? 54.363 -72.750  182.225 1.00 59.62  ? 50   ILE A C   1 
ATOM   321  O  O   . ILE A 1 50  ? 53.822 -72.288  181.224 1.00 61.01  ? 50   ILE A O   1 
ATOM   322  C  CB  . ILE A 1 50  ? 56.622 -71.907  182.889 1.00 58.91  ? 50   ILE A CB  1 
ATOM   323  C  CG1 . ILE A 1 50  ? 57.336 -70.814  183.687 1.00 58.01  ? 50   ILE A CG1 1 
ATOM   324  C  CG2 . ILE A 1 50  ? 56.881 -71.730  181.400 1.00 58.08  ? 50   ILE A CG2 1 
ATOM   325  C  CD1 . ILE A 1 50  ? 58.829 -70.786  183.502 1.00 60.41  ? 50   ILE A CD1 1 
ATOM   326  N  N   . THR A 1 51  ? 54.323 -74.040  182.535 1.00 59.72  ? 51   THR A N   1 
ATOM   327  C  CA  . THR A 1 51  ? 53.622 -74.985  181.679 1.00 58.94  ? 51   THR A CA  1 
ATOM   328  C  C   . THR A 1 51  ? 52.145 -74.631  181.626 1.00 58.13  ? 51   THR A C   1 
ATOM   329  O  O   . THR A 1 51  ? 51.552 -74.575  180.552 1.00 58.74  ? 51   THR A O   1 
ATOM   330  C  CB  . THR A 1 51  ? 53.793 -76.441  182.182 1.00 59.29  ? 51   THR A CB  1 
ATOM   331  O  OG1 . THR A 1 51  ? 55.130 -76.884  181.907 1.00 59.29  ? 51   THR A OG1 1 
ATOM   332  C  CG2 . THR A 1 51  ? 52.807 -77.377  181.491 1.00 57.77  ? 51   THR A CG2 1 
ATOM   333  N  N   . LEU A 1 52  ? 51.556 -74.383  182.787 1.00 56.92  ? 52   LEU A N   1 
ATOM   334  C  CA  . LEU A 1 52  ? 50.145 -74.026  182.854 1.00 58.12  ? 52   LEU A CA  1 
ATOM   335  C  C   . LEU A 1 52  ? 49.839 -72.766  182.035 1.00 58.44  ? 52   LEU A C   1 
ATOM   336  O  O   . LEU A 1 52  ? 48.835 -72.701  181.320 1.00 57.62  ? 52   LEU A O   1 
ATOM   337  C  CB  . LEU A 1 52  ? 49.739 -73.802  184.312 1.00 59.37  ? 52   LEU A CB  1 
ATOM   338  C  CG  . LEU A 1 52  ? 49.937 -74.998  185.248 1.00 61.33  ? 52   LEU A CG  1 
ATOM   339  C  CD1 . LEU A 1 52  ? 49.674 -74.566  186.682 1.00 60.85  ? 52   LEU A CD1 1 
ATOM   340  C  CD2 . LEU A 1 52  ? 49.013 -76.142  184.833 1.00 59.09  ? 52   LEU A CD2 1 
ATOM   341  N  N   . ILE A 1 53  ? 50.708 -71.765  182.156 1.00 57.82  ? 53   ILE A N   1 
ATOM   342  C  CA  . ILE A 1 53  ? 50.540 -70.510  181.439 1.00 56.92  ? 53   ILE A CA  1 
ATOM   343  C  C   . ILE A 1 53  ? 50.647 -70.758  179.950 1.00 55.94  ? 53   ILE A C   1 
ATOM   344  O  O   . ILE A 1 53  ? 49.788 -70.336  179.177 1.00 55.32  ? 53   ILE A O   1 
ATOM   345  C  CB  . ILE A 1 53  ? 51.612 -69.482  181.856 1.00 58.10  ? 53   ILE A CB  1 
ATOM   346  C  CG1 . ILE A 1 53  ? 51.277 -68.925  183.237 1.00 58.32  ? 53   ILE A CG1 1 
ATOM   347  C  CG2 . ILE A 1 53  ? 51.688 -68.353  180.848 1.00 56.99  ? 53   ILE A CG2 1 
ATOM   348  C  CD1 . ILE A 1 53  ? 52.252 -67.870  183.693 1.00 60.62  ? 53   ILE A CD1 1 
ATOM   349  N  N   . THR A 1 54  ? 51.712 -71.440  179.550 1.00 53.94  ? 54   THR A N   1 
ATOM   350  C  CA  . THR A 1 54  ? 51.902 -71.747  178.150 1.00 53.16  ? 54   THR A CA  1 
ATOM   351  C  C   . THR A 1 54  ? 50.660 -72.489  177.685 1.00 53.86  ? 54   THR A C   1 
ATOM   352  O  O   . THR A 1 54  ? 50.134 -72.234  176.602 1.00 54.94  ? 54   THR A O   1 
ATOM   353  C  CB  . THR A 1 54  ? 53.131 -72.624  177.958 1.00 52.45  ? 54   THR A CB  1 
ATOM   354  O  OG1 . THR A 1 54  ? 54.277 -71.926  178.460 1.00 52.78  ? 54   THR A OG1 1 
ATOM   355  C  CG2 . THR A 1 54  ? 53.339 -72.943  176.482 1.00 51.28  ? 54   THR A CG2 1 
ATOM   356  N  N   . GLY A 1 55  ? 50.185 -73.395  178.531 1.00 53.98  ? 55   GLY A N   1 
ATOM   357  C  CA  . GLY A 1 55  ? 49.001 -74.163  178.209 1.00 53.19  ? 55   GLY A CA  1 
ATOM   358  C  C   . GLY A 1 55  ? 47.810 -73.275  177.928 1.00 53.52  ? 55   GLY A C   1 
ATOM   359  O  O   . GLY A 1 55  ? 47.210 -73.360  176.860 1.00 52.85  ? 55   GLY A O   1 
ATOM   360  N  N   . LEU A 1 56  ? 47.455 -72.419  178.877 1.00 54.64  ? 56   LEU A N   1 
ATOM   361  C  CA  . LEU A 1 56  ? 46.313 -71.537  178.668 1.00 56.71  ? 56   LEU A CA  1 
ATOM   362  C  C   . LEU A 1 56  ? 46.544 -70.649  177.451 1.00 56.09  ? 56   LEU A C   1 
ATOM   363  O  O   . LEU A 1 56  ? 45.594 -70.241  176.790 1.00 56.79  ? 56   LEU A O   1 
ATOM   364  C  CB  . LEU A 1 56  ? 46.057 -70.673  179.907 1.00 58.68  ? 56   LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 56  ? 44.827 -69.761  179.789 1.00 62.22  ? 56   LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 56  ? 43.601 -70.583  179.429 1.00 62.11  ? 56   LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 56  ? 44.599 -69.019  181.098 1.00 63.10  ? 56   LEU A CD2 1 
ATOM   368  N  N   . TYR A 1 57  ? 47.811 -70.368  177.152 1.00 54.85  ? 57   TYR A N   1 
ATOM   369  C  CA  . TYR A 1 57  ? 48.181 -69.539  176.007 1.00 54.66  ? 57   TYR A CA  1 
ATOM   370  C  C   . TYR A 1 57  ? 47.862 -70.224  174.682 1.00 54.23  ? 57   TYR A C   1 
ATOM   371  O  O   . TYR A 1 57  ? 47.240 -69.633  173.804 1.00 55.03  ? 57   TYR A O   1 
ATOM   372  C  CB  . TYR A 1 57  ? 49.677 -69.205  176.059 1.00 55.29  ? 57   TYR A CB  1 
ATOM   373  C  CG  . TYR A 1 57  ? 50.229 -68.524  174.817 1.00 55.47  ? 57   TYR A CG  1 
ATOM   374  C  CD1 . TYR A 1 57  ? 49.922 -67.195  174.521 1.00 55.19  ? 57   TYR A CD1 1 
ATOM   375  C  CD2 . TYR A 1 57  ? 51.088 -69.203  173.957 1.00 55.82  ? 57   TYR A CD2 1 
ATOM   376  C  CE1 . TYR A 1 57  ? 50.466 -66.560  173.400 1.00 54.70  ? 57   TYR A CE1 1 
ATOM   377  C  CE2 . TYR A 1 57  ? 51.631 -68.580  172.837 1.00 55.66  ? 57   TYR A CE2 1 
ATOM   378  C  CZ  . TYR A 1 57  ? 51.320 -67.262  172.565 1.00 55.49  ? 57   TYR A CZ  1 
ATOM   379  O  OH  . TYR A 1 57  ? 51.876 -66.652  171.462 1.00 56.22  ? 57   TYR A OH  1 
ATOM   380  N  N   . LEU A 1 58  ? 48.295 -71.467  174.531 1.00 53.73  ? 58   LEU A N   1 
ATOM   381  C  CA  . LEU A 1 58  ? 48.034 -72.201  173.303 1.00 54.09  ? 58   LEU A CA  1 
ATOM   382  C  C   . LEU A 1 58  ? 46.539 -72.437  173.084 1.00 54.04  ? 58   LEU A C   1 
ATOM   383  O  O   . LEU A 1 58  ? 45.996 -72.078  172.042 1.00 53.67  ? 58   LEU A O   1 
ATOM   384  C  CB  . LEU A 1 58  ? 48.791 -73.530  173.331 1.00 53.50  ? 58   LEU A CB  1 
ATOM   385  C  CG  . LEU A 1 58  ? 50.306 -73.322  173.410 1.00 52.80  ? 58   LEU A CG  1 
ATOM   386  C  CD1 . LEU A 1 58  ? 51.022 -74.650  173.534 1.00 52.40  ? 58   LEU A CD1 1 
ATOM   387  C  CD2 . LEU A 1 58  ? 50.767 -72.578  172.173 1.00 51.15  ? 58   LEU A CD2 1 
ATOM   388  N  N   . VAL A 1 59  ? 45.873 -73.024  174.073 1.00 55.81  ? 59   VAL A N   1 
ATOM   389  C  CA  . VAL A 1 59  ? 44.440 -73.301  173.976 1.00 58.53  ? 59   VAL A CA  1 
ATOM   390  C  C   . VAL A 1 59  ? 43.616 -72.054  173.639 1.00 59.67  ? 59   VAL A C   1 
ATOM   391  O  O   . VAL A 1 59  ? 42.702 -72.111  172.812 1.00 59.94  ? 59   VAL A O   1 
ATOM   392  C  CB  . VAL A 1 59  ? 43.900 -73.940  175.290 1.00 58.39  ? 59   VAL A CB  1 
ATOM   393  C  CG1 . VAL A 1 59  ? 44.231 -73.060  176.477 1.00 61.07  ? 59   VAL A CG1 1 
ATOM   394  C  CG2 . VAL A 1 59  ? 42.396 -74.151  175.194 1.00 58.00  ? 59   VAL A CG2 1 
ATOM   395  N  N   . THR A 1 60  ? 43.940 -70.931  174.276 1.00 61.00  ? 60   THR A N   1 
ATOM   396  C  CA  . THR A 1 60  ? 43.225 -69.678  174.030 1.00 61.13  ? 60   THR A CA  1 
ATOM   397  C  C   . THR A 1 60  ? 43.345 -69.282  172.563 1.00 60.76  ? 60   THR A C   1 
ATOM   398  O  O   . THR A 1 60  ? 42.364 -68.873  171.940 1.00 60.18  ? 60   THR A O   1 
ATOM   399  C  CB  . THR A 1 60  ? 43.774 -68.529  174.910 1.00 61.11  ? 60   THR A CB  1 
ATOM   400  O  OG1 . THR A 1 60  ? 43.507 -68.814  176.290 1.00 62.14  ? 60   THR A OG1 1 
ATOM   401  C  CG2 . THR A 1 60  ? 43.110 -67.213  174.546 1.00 60.61  ? 60   THR A CG2 1 
ATOM   402  N  N   . ASN A 1 61  ? 44.553 -69.398  172.018 1.00 60.79  ? 61   ASN A N   1 
ATOM   403  C  CA  . ASN A 1 61  ? 44.787 -69.074  170.620 1.00 60.26  ? 61   ASN A CA  1 
ATOM   404  C  C   . ASN A 1 61  ? 44.036 -70.089  169.775 1.00 61.27  ? 61   ASN A C   1 
ATOM   405  O  O   . ASN A 1 61  ? 43.549 -69.771  168.689 1.00 61.20  ? 61   ASN A O   1 
ATOM   406  C  CB  . ASN A 1 61  ? 46.282 -69.127  170.298 1.00 58.61  ? 61   ASN A CB  1 
ATOM   407  C  CG  . ASN A 1 61  ? 46.953 -67.771  170.417 1.00 58.93  ? 61   ASN A CG  1 
ATOM   408  O  OD1 . ASN A 1 61  ? 46.703 -66.870  169.616 1.00 59.50  ? 61   ASN A OD1 1 
ATOM   409  N  ND2 . ASN A 1 61  ? 47.805 -67.619  171.420 1.00 58.32  ? 61   ASN A ND2 1 
ATOM   410  N  N   . ALA A 1 62  ? 43.937 -71.312  170.287 1.00 62.07  ? 62   ALA A N   1 
ATOM   411  C  CA  . ALA A 1 62  ? 43.234 -72.374  169.584 1.00 63.28  ? 62   ALA A CA  1 
ATOM   412  C  C   . ALA A 1 62  ? 41.758 -72.015  169.468 1.00 63.88  ? 62   ALA A C   1 
ATOM   413  O  O   . ALA A 1 62  ? 41.166 -72.113  168.389 1.00 63.73  ? 62   ALA A O   1 
ATOM   414  C  CB  . ALA A 1 62  ? 43.394 -73.691  170.328 1.00 62.41  ? 62   ALA A CB  1 
ATOM   415  N  N   . LEU A 1 63  ? 41.168 -71.591  170.580 1.00 64.50  ? 63   LEU A N   1 
ATOM   416  C  CA  . LEU A 1 63  ? 39.763 -71.225  170.586 1.00 65.75  ? 63   LEU A CA  1 
ATOM   417  C  C   . LEU A 1 63  ? 39.462 -70.123  169.582 1.00 66.78  ? 63   LEU A C   1 
ATOM   418  O  O   . LEU A 1 63  ? 38.473 -70.203  168.854 1.00 67.52  ? 63   LEU A O   1 
ATOM   419  C  CB  . LEU A 1 63  ? 39.329 -70.805  171.992 1.00 66.19  ? 63   LEU A CB  1 
ATOM   420  C  CG  . LEU A 1 63  ? 39.273 -71.966  172.992 1.00 66.98  ? 63   LEU A CG  1 
ATOM   421  C  CD1 . LEU A 1 63  ? 38.826 -71.464  174.359 1.00 66.38  ? 63   LEU A CD1 1 
ATOM   422  C  CD2 . LEU A 1 63  ? 38.311 -73.031  172.474 1.00 66.81  ? 63   LEU A CD2 1 
ATOM   423  N  N   . PHE A 1 64  ? 40.307 -69.096  169.532 1.00 67.01  ? 64   PHE A N   1 
ATOM   424  C  CA  . PHE A 1 64  ? 40.091 -68.011  168.578 1.00 66.96  ? 64   PHE A CA  1 
ATOM   425  C  C   . PHE A 1 64  ? 40.249 -68.510  167.139 1.00 67.86  ? 64   PHE A C   1 
ATOM   426  O  O   . PHE A 1 64  ? 39.418 -68.213  166.278 1.00 67.25  ? 64   PHE A O   1 
ATOM   427  C  CB  . PHE A 1 64  ? 41.056 -66.842  168.835 1.00 65.25  ? 64   PHE A CB  1 
ATOM   428  C  CG  . PHE A 1 64  ? 40.556 -65.849  169.856 1.00 63.67  ? 64   PHE A CG  1 
ATOM   429  C  CD1 . PHE A 1 64  ? 40.733 -66.073  171.220 1.00 62.25  ? 64   PHE A CD1 1 
ATOM   430  C  CD2 . PHE A 1 64  ? 39.885 -64.695  169.452 1.00 61.82  ? 64   PHE A CD2 1 
ATOM   431  C  CE1 . PHE A 1 64  ? 40.250 -65.163  172.163 1.00 60.46  ? 64   PHE A CE1 1 
ATOM   432  C  CE2 . PHE A 1 64  ? 39.400 -63.783  170.389 1.00 61.17  ? 64   PHE A CE2 1 
ATOM   433  C  CZ  . PHE A 1 64  ? 39.583 -64.017  171.745 1.00 60.27  ? 64   PHE A CZ  1 
ATOM   434  N  N   . ALA A 1 65  ? 41.311 -69.270  166.879 1.00 68.99  ? 65   ALA A N   1 
ATOM   435  C  CA  . ALA A 1 65  ? 41.550 -69.805  165.542 1.00 70.46  ? 65   ALA A CA  1 
ATOM   436  C  C   . ALA A 1 65  ? 40.262 -70.424  165.002 1.00 71.99  ? 65   ALA A C   1 
ATOM   437  O  O   . ALA A 1 65  ? 39.922 -70.249  163.832 1.00 72.06  ? 65   ALA A O   1 
ATOM   438  C  CB  . ALA A 1 65  ? 42.660 -70.851  165.582 1.00 69.38  ? 65   ALA A CB  1 
ATOM   439  N  N   . LEU A 1 66  ? 39.548 -71.140  165.869 1.00 73.19  ? 66   LEU A N   1 
ATOM   440  C  CA  . LEU A 1 66  ? 38.294 -71.781  165.496 1.00 74.08  ? 66   LEU A CA  1 
ATOM   441  C  C   . LEU A 1 66  ? 37.215 -70.735  165.247 1.00 75.42  ? 66   LEU A C   1 
ATOM   442  O  O   . LEU A 1 66  ? 36.485 -70.808  164.258 1.00 76.15  ? 66   LEU A O   1 
ATOM   443  C  CB  . LEU A 1 66  ? 37.829 -72.731  166.602 1.00 72.88  ? 66   LEU A CB  1 
ATOM   444  C  CG  . LEU A 1 66  ? 38.778 -73.862  167.000 1.00 72.63  ? 66   LEU A CG  1 
ATOM   445  C  CD1 . LEU A 1 66  ? 38.112 -74.736  168.043 1.00 71.96  ? 66   LEU A CD1 1 
ATOM   446  C  CD2 . LEU A 1 66  ? 39.140 -74.687  165.785 1.00 72.41  ? 66   LEU A CD2 1 
ATOM   447  N  N   . ALA A 1 67  ? 37.121 -69.764  166.151 1.00 76.26  ? 67   ALA A N   1 
ATOM   448  C  CA  . ALA A 1 67  ? 36.133 -68.698  166.046 1.00 76.75  ? 67   ALA A CA  1 
ATOM   449  C  C   . ALA A 1 67  ? 36.214 -67.972  164.704 1.00 78.11  ? 67   ALA A C   1 
ATOM   450  O  O   . ALA A 1 67  ? 35.208 -67.471  164.205 1.00 78.83  ? 67   ALA A O   1 
ATOM   451  C  CB  . ALA A 1 67  ? 36.314 -67.711  167.186 1.00 76.33  ? 67   ALA A CB  1 
ATOM   452  N  N   . TYR A 1 68  ? 37.409 -67.908  164.124 1.00 79.05  ? 68   TYR A N   1 
ATOM   453  C  CA  . TYR A 1 68  ? 37.589 -67.251  162.833 1.00 80.30  ? 68   TYR A CA  1 
ATOM   454  C  C   . TYR A 1 68  ? 37.080 -68.162  161.724 1.00 81.12  ? 68   TYR A C   1 
ATOM   455  O  O   . TYR A 1 68  ? 36.547 -67.698  160.717 1.00 80.38  ? 68   TYR A O   1 
ATOM   456  C  CB  . TYR A 1 68  ? 39.066 -66.926  162.590 1.00 80.65  ? 68   TYR A CB  1 
ATOM   457  C  CG  . TYR A 1 68  ? 39.578 -65.736  163.372 1.00 81.53  ? 68   TYR A CG  1 
ATOM   458  C  CD1 . TYR A 1 68  ? 40.629 -65.871  164.277 1.00 81.36  ? 68   TYR A CD1 1 
ATOM   459  C  CD2 . TYR A 1 68  ? 39.010 -64.472  163.208 1.00 81.83  ? 68   TYR A CD2 1 
ATOM   460  C  CE1 . TYR A 1 68  ? 41.101 -64.777  164.999 1.00 81.62  ? 68   TYR A CE1 1 
ATOM   461  C  CE2 . TYR A 1 68  ? 39.475 -63.374  163.924 1.00 81.73  ? 68   TYR A CE2 1 
ATOM   462  C  CZ  . TYR A 1 68  ? 40.518 -63.535  164.818 1.00 81.56  ? 68   TYR A CZ  1 
ATOM   463  O  OH  . TYR A 1 68  ? 40.971 -62.458  165.539 1.00 82.03  ? 68   TYR A OH  1 
ATOM   464  N  N   . LEU A 1 69  ? 37.253 -69.465  161.925 1.00 82.27  ? 69   LEU A N   1 
ATOM   465  C  CA  . LEU A 1 69  ? 36.818 -70.467  160.961 1.00 83.21  ? 69   LEU A CA  1 
ATOM   466  C  C   . LEU A 1 69  ? 35.292 -70.557  160.924 1.00 84.31  ? 69   LEU A C   1 
ATOM   467  O  O   . LEU A 1 69  ? 34.708 -70.921  159.905 1.00 84.77  ? 69   LEU A O   1 
ATOM   468  C  CB  . LEU A 1 69  ? 37.421 -71.829  161.318 1.00 82.45  ? 69   LEU A CB  1 
ATOM   469  C  CG  . LEU A 1 69  ? 38.951 -71.922  161.282 1.00 81.75  ? 69   LEU A CG  1 
ATOM   470  C  CD1 . LEU A 1 69  ? 39.397 -73.296  161.754 1.00 81.33  ? 69   LEU A CD1 1 
ATOM   471  C  CD2 . LEU A 1 69  ? 39.454 -71.653  159.874 1.00 80.94  ? 69   LEU A CD2 1 
ATOM   472  N  N   . ALA A 1 70  ? 34.653 -70.227  162.042 1.00 85.57  ? 70   ALA A N   1 
ATOM   473  C  CA  . ALA A 1 70  ? 33.196 -70.248  162.126 1.00 86.52  ? 70   ALA A CA  1 
ATOM   474  C  C   . ALA A 1 70  ? 32.639 -69.145  161.230 1.00 87.93  ? 70   ALA A C   1 
ATOM   475  O  O   . ALA A 1 70  ? 31.526 -69.245  160.717 1.00 88.74  ? 70   ALA A O   1 
ATOM   476  C  CB  . ALA A 1 70  ? 32.750 -70.028  163.567 1.00 85.66  ? 70   ALA A CB  1 
ATOM   477  N  N   . CYS A 1 71  ? 33.429 -68.090  161.050 1.00 89.22  ? 71   CYS A N   1 
ATOM   478  C  CA  . CYS A 1 71  ? 33.040 -66.961  160.213 1.00 89.93  ? 71   CYS A CA  1 
ATOM   479  C  C   . CYS A 1 71  ? 33.441 -67.251  158.769 1.00 90.43  ? 71   CYS A C   1 
ATOM   480  O  O   . CYS A 1 71  ? 33.373 -66.379  157.900 1.00 90.36  ? 71   CYS A O   1 
ATOM   481  C  CB  . CYS A 1 71  ? 33.737 -65.687  160.697 1.00 90.34  ? 71   CYS A CB  1 
ATOM   482  S  SG  . CYS A 1 71  ? 33.418 -65.281  162.427 1.00 90.18  ? 71   CYS A SG  1 
ATOM   483  N  N   . GLY A 1 72  ? 33.865 -68.487  158.527 1.00 90.60  ? 72   GLY A N   1 
ATOM   484  C  CA  . GLY A 1 72  ? 34.276 -68.884  157.195 1.00 90.71  ? 72   GLY A CA  1 
ATOM   485  C  C   . GLY A 1 72  ? 35.699 -68.477  156.874 1.00 90.55  ? 72   GLY A C   1 
ATOM   486  O  O   . GLY A 1 72  ? 36.616 -68.690  157.668 1.00 91.31  ? 72   GLY A O   1 
ATOM   487  N  N   . ASP A 1 73  ? 35.888 -67.896  155.697 1.00 89.96  ? 73   ASP A N   1 
ATOM   488  C  CA  . ASP A 1 73  ? 37.207 -67.458  155.272 1.00 89.86  ? 73   ASP A CA  1 
ATOM   489  C  C   . ASP A 1 73  ? 37.305 -65.952  155.428 1.00 89.49  ? 73   ASP A C   1 
ATOM   490  O  O   . ASP A 1 73  ? 36.976 -65.207  154.508 1.00 90.17  ? 73   ASP A O   1 
ATOM   491  C  CB  . ASP A 1 73  ? 37.451 -67.833  153.809 1.00 90.42  ? 73   ASP A CB  1 
ATOM   492  C  CG  . ASP A 1 73  ? 37.430 -69.331  153.577 1.00 90.91  ? 73   ASP A CG  1 
ATOM   493  O  OD1 . ASP A 1 73  ? 36.374 -69.961  153.801 1.00 90.95  ? 73   ASP A OD1 1 
ATOM   494  O  OD2 . ASP A 1 73  ? 38.474 -69.879  153.168 1.00 91.97  ? 73   ASP A OD2 1 
ATOM   495  N  N   . VAL A 1 74  ? 37.753 -65.505  156.596 1.00 88.52  ? 74   VAL A N   1 
ATOM   496  C  CA  . VAL A 1 74  ? 37.889 -64.077  156.852 1.00 87.44  ? 74   VAL A CA  1 
ATOM   497  C  C   . VAL A 1 74  ? 39.348 -63.693  157.091 1.00 86.45  ? 74   VAL A C   1 
ATOM   498  O  O   . VAL A 1 74  ? 39.655 -62.547  157.420 1.00 86.01  ? 74   VAL A O   1 
ATOM   499  C  CB  . VAL A 1 74  ? 37.033 -63.653  158.062 1.00 87.37  ? 74   VAL A CB  1 
ATOM   500  C  CG1 . VAL A 1 74  ? 35.556 -63.771  157.715 1.00 86.92  ? 74   VAL A CG1 1 
ATOM   501  C  CG2 . VAL A 1 74  ? 37.355 -64.533  159.258 1.00 88.29  ? 74   VAL A CG2 1 
ATOM   502  N  N   . ILE A 1 75  ? 40.243 -64.663  156.917 1.00 84.86  ? 75   ILE A N   1 
ATOM   503  C  CA  . ILE A 1 75  ? 41.671 -64.433  157.095 1.00 83.19  ? 75   ILE A CA  1 
ATOM   504  C  C   . ILE A 1 75  ? 42.300 -64.274  155.715 1.00 82.57  ? 75   ILE A C   1 
ATOM   505  O  O   . ILE A 1 75  ? 42.612 -65.264  155.048 1.00 81.97  ? 75   ILE A O   1 
ATOM   506  C  CB  . ILE A 1 75  ? 42.362 -65.623  157.805 1.00 83.29  ? 75   ILE A CB  1 
ATOM   507  C  CG1 . ILE A 1 75  ? 41.479 -66.155  158.936 1.00 82.61  ? 75   ILE A CG1 1 
ATOM   508  C  CG2 . ILE A 1 75  ? 43.707 -65.179  158.372 1.00 82.07  ? 75   ILE A CG2 1 
ATOM   509  C  CD1 . ILE A 1 75  ? 41.208 -65.155  160.032 1.00 84.02  ? 75   ILE A CD1 1 
ATOM   510  N  N   . GLU A 1 76  ? 42.481 -63.030  155.288 1.00 81.84  ? 76   GLU A N   1 
ATOM   511  C  CA  . GLU A 1 76  ? 43.064 -62.761  153.984 1.00 81.70  ? 76   GLU A CA  1 
ATOM   512  C  C   . GLU A 1 76  ? 44.471 -63.342  153.859 1.00 81.94  ? 76   GLU A C   1 
ATOM   513  O  O   . GLU A 1 76  ? 45.281 -63.236  154.778 1.00 82.62  ? 76   GLU A O   1 
ATOM   514  C  CB  . GLU A 1 76  ? 43.082 -61.255  153.716 1.00 81.45  ? 76   GLU A CB  1 
ATOM   515  C  CG  . GLU A 1 76  ? 43.567 -60.894  152.328 1.00 82.48  ? 76   GLU A CG  1 
ATOM   516  C  CD  . GLU A 1 76  ? 43.006 -59.575  151.826 1.00 83.79  ? 76   GLU A CD  1 
ATOM   517  O  OE1 . GLU A 1 76  ? 43.261 -58.524  152.455 1.00 83.45  ? 76   GLU A OE1 1 
ATOM   518  O  OE2 . GLU A 1 76  ? 42.306 -59.596  150.793 1.00 83.64  ? 76   GLU A OE2 1 
ATOM   519  N  N   . ASN A 1 77  ? 44.742 -63.959  152.710 1.00 81.95  ? 77   ASN A N   1 
ATOM   520  C  CA  . ASN A 1 77  ? 46.028 -64.588  152.409 1.00 81.11  ? 77   ASN A CA  1 
ATOM   521  C  C   . ASN A 1 77  ? 46.273 -65.853  153.222 1.00 80.64  ? 77   ASN A C   1 
ATOM   522  O  O   . ASN A 1 77  ? 47.409 -66.296  153.367 1.00 79.72  ? 77   ASN A O   1 
ATOM   523  C  CB  . ASN A 1 77  ? 47.181 -63.601  152.618 1.00 81.10  ? 77   ASN A CB  1 
ATOM   524  C  CG  . ASN A 1 77  ? 47.283 -62.579  151.502 1.00 81.44  ? 77   ASN A CG  1 
ATOM   525  O  OD1 . ASN A 1 77  ? 47.510 -62.927  150.344 1.00 82.37  ? 77   ASN A OD1 1 
ATOM   526  N  ND2 . ASN A 1 77  ? 47.115 -61.310  151.845 1.00 81.97  ? 77   ASN A ND2 1 
ATOM   527  N  N   . ALA A 1 78  ? 45.198 -66.437  153.738 1.00 80.99  ? 78   ALA A N   1 
ATOM   528  C  CA  . ALA A 1 78  ? 45.291 -67.656  154.528 1.00 82.89  ? 78   ALA A CA  1 
ATOM   529  C  C   . ALA A 1 78  ? 44.615 -68.815  153.799 1.00 84.80  ? 78   ALA A C   1 
ATOM   530  O  O   . ALA A 1 78  ? 43.621 -68.624  153.095 1.00 85.76  ? 78   ALA A O   1 
ATOM   531  C  CB  . ALA A 1 78  ? 44.638 -67.448  155.881 1.00 82.36  ? 78   ALA A CB  1 
ATOM   532  N  N   . ARG A 1 79  ? 45.154 -70.018  153.974 1.00 85.94  ? 79   ARG A N   1 
ATOM   533  C  CA  . ARG A 1 79  ? 44.597 -71.202  153.332 1.00 86.26  ? 79   ARG A CA  1 
ATOM   534  C  C   . ARG A 1 79  ? 43.244 -71.558  153.942 1.00 86.46  ? 79   ARG A C   1 
ATOM   535  O  O   . ARG A 1 79  ? 43.138 -71.797  155.143 1.00 86.58  ? 79   ARG A O   1 
ATOM   536  C  CB  . ARG A 1 79  ? 45.563 -72.370  153.481 1.00 86.06  ? 79   ARG A CB  1 
ATOM   537  C  CG  . ARG A 1 79  ? 46.943 -72.068  152.934 1.00 88.17  ? 79   ARG A CG  1 
ATOM   538  C  CD  . ARG A 1 79  ? 47.917 -73.165  153.296 1.00 90.08  ? 79   ARG A CD  1 
ATOM   539  N  NE  . ARG A 1 79  ? 47.950 -73.389  154.737 1.00 92.05  ? 79   ARG A NE  1 
ATOM   540  C  CZ  . ARG A 1 79  ? 48.673 -74.333  155.328 1.00 93.11  ? 79   ARG A CZ  1 
ATOM   541  N  NH1 . ARG A 1 79  ? 49.426 -75.143  154.596 1.00 93.71  ? 79   ARG A NH1 1 
ATOM   542  N  NH2 . ARG A 1 79  ? 48.638 -74.475  156.647 1.00 93.84  ? 79   ARG A NH2 1 
ATOM   543  N  N   . PRO A 1 80  ? 42.190 -71.600  153.108 1.00 87.11  ? 80   PRO A N   1 
ATOM   544  C  CA  . PRO A 1 80  ? 40.820 -71.919  153.519 1.00 86.68  ? 80   PRO A CA  1 
ATOM   545  C  C   . PRO A 1 80  ? 40.686 -73.161  154.395 1.00 86.31  ? 80   PRO A C   1 
ATOM   546  O  O   . PRO A 1 80  ? 41.241 -74.219  154.085 1.00 86.50  ? 80   PRO A O   1 
ATOM   547  C  CB  . PRO A 1 80  ? 40.094 -72.077  152.188 1.00 86.62  ? 80   PRO A CB  1 
ATOM   548  C  CG  . PRO A 1 80  ? 40.799 -71.084  151.318 1.00 87.44  ? 80   PRO A CG  1 
ATOM   549  C  CD  . PRO A 1 80  ? 42.247 -71.358  151.654 1.00 87.57  ? 80   PRO A CD  1 
ATOM   550  N  N   . GLY A 1 81  ? 39.943 -73.019  155.490 1.00 85.20  ? 81   GLY A N   1 
ATOM   551  C  CA  . GLY A 1 81  ? 39.719 -74.130  156.397 1.00 83.37  ? 81   GLY A CA  1 
ATOM   552  C  C   . GLY A 1 81  ? 40.920 -74.551  157.222 1.00 82.40  ? 81   GLY A C   1 
ATOM   553  O  O   . GLY A 1 81  ? 40.780 -75.335  158.162 1.00 82.39  ? 81   GLY A O   1 
ATOM   554  N  N   . SER A 1 82  ? 42.099 -74.039  156.881 1.00 80.81  ? 82   SER A N   1 
ATOM   555  C  CA  . SER A 1 82  ? 43.314 -74.380  157.613 1.00 79.02  ? 82   SER A CA  1 
ATOM   556  C  C   . SER A 1 82  ? 43.281 -73.863  159.048 1.00 78.28  ? 82   SER A C   1 
ATOM   557  O  O   . SER A 1 82  ? 42.978 -72.694  159.293 1.00 77.79  ? 82   SER A O   1 
ATOM   558  C  CB  . SER A 1 82  ? 44.545 -73.811  156.904 1.00 78.61  ? 82   SER A CB  1 
ATOM   559  O  OG  . SER A 1 82  ? 45.731 -74.164  157.596 1.00 77.06  ? 82   SER A OG  1 
ATOM   560  N  N   . PHE A 1 83  ? 43.583 -74.747  159.993 1.00 77.41  ? 83   PHE A N   1 
ATOM   561  C  CA  . PHE A 1 83  ? 43.619 -74.389  161.408 1.00 76.03  ? 83   PHE A CA  1 
ATOM   562  C  C   . PHE A 1 83  ? 44.961 -73.698  161.639 1.00 75.25  ? 83   PHE A C   1 
ATOM   563  O  O   . PHE A 1 83  ? 45.040 -72.649  162.278 1.00 75.01  ? 83   PHE A O   1 
ATOM   564  C  CB  . PHE A 1 83  ? 43.527 -75.654  162.270 1.00 73.80  ? 83   PHE A CB  1 
ATOM   565  C  CG  . PHE A 1 83  ? 43.612 -75.395  163.752 1.00 72.47  ? 83   PHE A CG  1 
ATOM   566  C  CD1 . PHE A 1 83  ? 42.556 -74.795  164.430 1.00 71.39  ? 83   PHE A CD1 1 
ATOM   567  C  CD2 . PHE A 1 83  ? 44.749 -75.753  164.469 1.00 71.47  ? 83   PHE A CD2 1 
ATOM   568  C  CE1 . PHE A 1 83  ? 42.632 -74.559  165.799 1.00 69.23  ? 83   PHE A CE1 1 
ATOM   569  C  CE2 . PHE A 1 83  ? 44.833 -75.519  165.837 1.00 69.49  ? 83   PHE A CE2 1 
ATOM   570  C  CZ  . PHE A 1 83  ? 43.772 -74.922  166.501 1.00 69.25  ? 83   PHE A CZ  1 
ATOM   571  N  N   . THR A 1 84  ? 46.006 -74.307  161.092 1.00 74.28  ? 84   THR A N   1 
ATOM   572  C  CA  . THR A 1 84  ? 47.367 -73.809  161.191 1.00 73.58  ? 84   THR A CA  1 
ATOM   573  C  C   . THR A 1 84  ? 47.461 -72.321  160.877 1.00 72.93  ? 84   THR A C   1 
ATOM   574  O  O   . THR A 1 84  ? 48.011 -71.548  161.658 1.00 72.98  ? 84   THR A O   1 
ATOM   575  C  CB  . THR A 1 84  ? 48.281 -74.581  160.225 1.00 74.04  ? 84   THR A CB  1 
ATOM   576  O  OG1 . THR A 1 84  ? 48.321 -75.957  160.614 1.00 74.02  ? 84   THR A OG1 1 
ATOM   577  C  CG2 . THR A 1 84  ? 49.692 -74.009  160.233 1.00 75.35  ? 84   THR A CG2 1 
ATOM   578  N  N   . ASP A 1 85  ? 46.926 -71.929  159.727 1.00 72.14  ? 85   ASP A N   1 
ATOM   579  C  CA  . ASP A 1 85  ? 46.952 -70.534  159.298 1.00 70.82  ? 85   ASP A CA  1 
ATOM   580  C  C   . ASP A 1 85  ? 46.090 -69.622  160.176 1.00 68.46  ? 85   ASP A C   1 
ATOM   581  O  O   . ASP A 1 85  ? 46.445 -68.466  160.415 1.00 67.70  ? 85   ASP A O   1 
ATOM   582  C  CB  . ASP A 1 85  ? 46.499 -70.435  157.835 1.00 73.23  ? 85   ASP A CB  1 
ATOM   583  C  CG  . ASP A 1 85  ? 47.523 -71.010  156.863 1.00 75.12  ? 85   ASP A CG  1 
ATOM   584  O  OD1 . ASP A 1 85  ? 48.144 -72.043  157.194 1.00 76.27  ? 85   ASP A OD1 1 
ATOM   585  O  OD2 . ASP A 1 85  ? 47.696 -70.436  155.764 1.00 75.35  ? 85   ASP A OD2 1 
ATOM   586  N  N   . ALA A 1 86  ? 44.961 -70.140  160.653 1.00 65.60  ? 86   ALA A N   1 
ATOM   587  C  CA  . ALA A 1 86  ? 44.071 -69.355  161.499 1.00 64.20  ? 86   ALA A CA  1 
ATOM   588  C  C   . ALA A 1 86  ? 44.655 -69.252  162.904 1.00 63.20  ? 86   ALA A C   1 
ATOM   589  O  O   . ALA A 1 86  ? 44.481 -68.240  163.587 1.00 62.82  ? 86   ALA A O   1 
ATOM   590  C  CB  . ALA A 1 86  ? 42.684 -69.991  161.547 1.00 63.55  ? 86   ALA A CB  1 
ATOM   591  N  N   . PHE A 1 87  ? 45.347 -70.309  163.324 1.00 61.38  ? 87   PHE A N   1 
ATOM   592  C  CA  . PHE A 1 87  ? 45.977 -70.362  164.637 1.00 59.17  ? 87   PHE A CA  1 
ATOM   593  C  C   . PHE A 1 87  ? 47.117 -69.352  164.728 1.00 59.41  ? 87   PHE A C   1 
ATOM   594  O  O   . PHE A 1 87  ? 47.257 -68.648  165.730 1.00 60.22  ? 87   PHE A O   1 
ATOM   595  C  CB  . PHE A 1 87  ? 46.537 -71.758  164.906 1.00 57.56  ? 87   PHE A CB  1 
ATOM   596  C  CG  . PHE A 1 87  ? 47.259 -71.873  166.217 1.00 55.27  ? 87   PHE A CG  1 
ATOM   597  C  CD1 . PHE A 1 87  ? 46.552 -72.042  167.404 1.00 54.17  ? 87   PHE A CD1 1 
ATOM   598  C  CD2 . PHE A 1 87  ? 48.644 -71.773  166.270 1.00 53.25  ? 87   PHE A CD2 1 
ATOM   599  C  CE1 . PHE A 1 87  ? 47.215 -72.107  168.625 1.00 53.91  ? 87   PHE A CE1 1 
ATOM   600  C  CE2 . PHE A 1 87  ? 49.317 -71.835  167.486 1.00 53.19  ? 87   PHE A CE2 1 
ATOM   601  C  CZ  . PHE A 1 87  ? 48.601 -72.002  168.667 1.00 52.66  ? 87   PHE A CZ  1 
ATOM   602  N  N   . PHE A 1 88  ? 47.943 -69.301  163.687 1.00 57.63  ? 88   PHE A N   1 
ATOM   603  C  CA  . PHE A 1 88  ? 49.063 -68.376  163.657 1.00 56.26  ? 88   PHE A CA  1 
ATOM   604  C  C   . PHE A 1 88  ? 48.587 -66.950  163.402 1.00 55.10  ? 88   PHE A C   1 
ATOM   605  O  O   . PHE A 1 88  ? 49.324 -65.991  163.639 1.00 54.57  ? 88   PHE A O   1 
ATOM   606  C  CB  . PHE A 1 88  ? 50.077 -68.822  162.607 1.00 56.83  ? 88   PHE A CB  1 
ATOM   607  C  CG  . PHE A 1 88  ? 50.765 -70.116  162.952 1.00 57.74  ? 88   PHE A CG  1 
ATOM   608  C  CD1 . PHE A 1 88  ? 51.116 -71.027  161.956 1.00 58.75  ? 88   PHE A CD1 1 
ATOM   609  C  CD2 . PHE A 1 88  ? 51.062 -70.426  164.277 1.00 57.03  ? 88   PHE A CD2 1 
ATOM   610  C  CE1 . PHE A 1 88  ? 51.756 -72.231  162.280 1.00 57.94  ? 88   PHE A CE1 1 
ATOM   611  C  CE2 . PHE A 1 88  ? 51.698 -71.620  164.609 1.00 56.97  ? 88   PHE A CE2 1 
ATOM   612  C  CZ  . PHE A 1 88  ? 52.046 -72.525  163.609 1.00 57.76  ? 88   PHE A CZ  1 
ATOM   613  N  N   . PHE A 1 89  ? 47.357 -66.807  162.918 1.00 53.07  ? 89   PHE A N   1 
ATOM   614  C  CA  . PHE A 1 89  ? 46.809 -65.474  162.707 1.00 51.34  ? 89   PHE A CA  1 
ATOM   615  C  C   . PHE A 1 89  ? 46.471 -64.973  164.106 1.00 51.15  ? 89   PHE A C   1 
ATOM   616  O  O   . PHE A 1 89  ? 46.825 -63.854  164.489 1.00 52.03  ? 89   PHE A O   1 
ATOM   617  C  CB  . PHE A 1 89  ? 45.526 -65.509  161.872 1.00 47.60  ? 89   PHE A CB  1 
ATOM   618  C  CG  . PHE A 1 89  ? 44.836 -64.171  161.780 1.00 44.08  ? 89   PHE A CG  1 
ATOM   619  C  CD1 . PHE A 1 89  ? 45.470 -63.087  161.174 1.00 41.17  ? 89   PHE A CD1 1 
ATOM   620  C  CD2 . PHE A 1 89  ? 43.576 -63.980  162.346 1.00 42.83  ? 89   PHE A CD2 1 
ATOM   621  C  CE1 . PHE A 1 89  ? 44.861 -61.828  161.136 1.00 40.27  ? 89   PHE A CE1 1 
ATOM   622  C  CE2 . PHE A 1 89  ? 42.959 -62.724  162.313 1.00 41.88  ? 89   PHE A CE2 1 
ATOM   623  C  CZ  . PHE A 1 89  ? 43.607 -61.647  161.707 1.00 38.66  ? 89   PHE A CZ  1 
ATOM   624  N  N   . SER A 1 90  ? 45.785 -65.831  164.857 1.00 49.87  ? 90   SER A N   1 
ATOM   625  C  CA  . SER A 1 90  ? 45.376 -65.548  166.222 1.00 49.85  ? 90   SER A CA  1 
ATOM   626  C  C   . SER A 1 90  ? 46.593 -65.082  167.011 1.00 49.02  ? 90   SER A C   1 
ATOM   627  O  O   . SER A 1 90  ? 46.612 -63.962  167.518 1.00 48.85  ? 90   SER A O   1 
ATOM   628  C  CB  . SER A 1 90  ? 44.785 -66.813  166.850 1.00 52.31  ? 90   SER A CB  1 
ATOM   629  O  OG  . SER A 1 90  ? 44.103 -66.529  168.061 1.00 56.48  ? 90   SER A OG  1 
ATOM   630  N  N   . VAL A 1 91  ? 47.606 -65.944  167.097 1.00 46.94  ? 91   VAL A N   1 
ATOM   631  C  CA  . VAL A 1 91  ? 48.845 -65.621  167.799 1.00 46.83  ? 91   VAL A CA  1 
ATOM   632  C  C   . VAL A 1 91  ? 49.345 -64.231  167.409 1.00 47.93  ? 91   VAL A C   1 
ATOM   633  O  O   . VAL A 1 91  ? 49.557 -63.378  168.266 1.00 50.12  ? 91   VAL A O   1 
ATOM   634  C  CB  . VAL A 1 91  ? 49.966 -66.627  167.468 1.00 44.87  ? 91   VAL A CB  1 
ATOM   635  C  CG1 . VAL A 1 91  ? 51.266 -66.203  168.146 1.00 41.43  ? 91   VAL A CG1 1 
ATOM   636  C  CG2 . VAL A 1 91  ? 49.563 -68.010  167.910 1.00 42.84  ? 91   VAL A CG2 1 
ATOM   637  N  N   . GLN A 1 92  ? 49.534 -64.020  166.111 1.00 48.39  ? 92   GLN A N   1 
ATOM   638  C  CA  . GLN A 1 92  ? 50.012 -62.750  165.584 1.00 49.42  ? 92   GLN A CA  1 
ATOM   639  C  C   . GLN A 1 92  ? 49.177 -61.574  166.041 1.00 49.69  ? 92   GLN A C   1 
ATOM   640  O  O   . GLN A 1 92  ? 49.696 -60.474  166.238 1.00 49.20  ? 92   GLN A O   1 
ATOM   641  C  CB  . GLN A 1 92  ? 50.014 -62.787  164.062 1.00 50.77  ? 92   GLN A CB  1 
ATOM   642  C  CG  . GLN A 1 92  ? 51.144 -63.594  163.464 1.00 54.13  ? 92   GLN A CG  1 
ATOM   643  C  CD  . GLN A 1 92  ? 51.025 -63.707  161.959 1.00 54.89  ? 92   GLN A CD  1 
ATOM   644  O  OE1 . GLN A 1 92  ? 50.708 -62.727  161.276 1.00 55.44  ? 92   GLN A OE1 1 
ATOM   645  N  NE2 . GLN A 1 92  ? 51.283 -64.898  161.432 1.00 54.59  ? 92   GLN A NE2 1 
ATOM   646  N  N   . THR A 1 93  ? 47.880 -61.818  166.196 1.00 49.62  ? 93   THR A N   1 
ATOM   647  C  CA  . THR A 1 93  ? 46.932 -60.796  166.620 1.00 49.73  ? 93   THR A CA  1 
ATOM   648  C  C   . THR A 1 93  ? 46.993 -60.587  168.133 1.00 49.78  ? 93   THR A C   1 
ATOM   649  O  O   . THR A 1 93  ? 47.220 -59.473  168.617 1.00 49.51  ? 93   THR A O   1 
ATOM   650  C  CB  . THR A 1 93  ? 45.483 -61.204  166.235 1.00 51.33  ? 93   THR A CB  1 
ATOM   651  O  OG1 . THR A 1 93  ? 45.397 -61.394  164.817 1.00 52.90  ? 93   THR A OG1 1 
ATOM   652  C  CG2 . THR A 1 93  ? 44.488 -60.132  166.654 1.00 51.51  ? 93   THR A CG2 1 
ATOM   653  N  N   . MET A 1 94  ? 46.797 -61.670  168.879 1.00 48.79  ? 94   MET A N   1 
ATOM   654  C  CA  . MET A 1 94  ? 46.801 -61.594  170.327 1.00 46.59  ? 94   MET A CA  1 
ATOM   655  C  C   . MET A 1 94  ? 48.097 -61.029  170.893 1.00 44.73  ? 94   MET A C   1 
ATOM   656  O  O   . MET A 1 94  ? 48.069 -60.246  171.834 1.00 45.72  ? 94   MET A O   1 
ATOM   657  C  CB  . MET A 1 94  ? 46.526 -62.966  170.935 1.00 46.29  ? 94   MET A CB  1 
ATOM   658  C  CG  . MET A 1 94  ? 46.383 -62.917  172.448 1.00 48.51  ? 94   MET A CG  1 
ATOM   659  S  SD  . MET A 1 94  ? 45.945 -64.490  173.187 1.00 51.00  ? 94   MET A SD  1 
ATOM   660  C  CE  . MET A 1 94  ? 47.526 -65.263  173.289 1.00 47.96  ? 94   MET A CE  1 
ATOM   661  N  N   . ALA A 1 95  ? 49.233 -61.417  170.330 1.00 41.37  ? 95   ALA A N   1 
ATOM   662  C  CA  . ALA A 1 95  ? 50.501 -60.909  170.821 1.00 39.20  ? 95   ALA A CA  1 
ATOM   663  C  C   . ALA A 1 95  ? 50.771 -59.526  170.225 1.00 38.80  ? 95   ALA A C   1 
ATOM   664  O  O   . ALA A 1 95  ? 51.739 -58.858  170.580 1.00 37.91  ? 95   ALA A O   1 
ATOM   665  C  CB  . ALA A 1 95  ? 51.615 -61.872  170.449 1.00 38.17  ? 95   ALA A CB  1 
ATOM   666  N  N   . THR A 1 96  ? 49.891 -59.114  169.319 1.00 39.25  ? 96   THR A N   1 
ATOM   667  C  CA  . THR A 1 96  ? 49.978 -57.840  168.600 1.00 39.00  ? 96   THR A CA  1 
ATOM   668  C  C   . THR A 1 96  ? 51.203 -57.732  167.692 1.00 39.04  ? 96   THR A C   1 
ATOM   669  O  O   . THR A 1 96  ? 51.676 -56.635  167.442 1.00 39.30  ? 96   THR A O   1 
ATOM   670  C  CB  . THR A 1 96  ? 50.000 -56.597  169.539 1.00 38.73  ? 96   THR A CB  1 
ATOM   671  O  OG1 . THR A 1 96  ? 51.337 -56.372  169.997 1.00 38.35  ? 96   THR A OG1 1 
ATOM   672  C  CG2 . THR A 1 96  ? 49.058 -56.782  170.721 1.00 37.97  ? 96   THR A CG2 1 
ATOM   673  N  N   . ILE A 1 97  ? 51.725 -58.851  167.200 1.00 39.29  ? 97   ILE A N   1 
ATOM   674  C  CA  . ILE A 1 97  ? 52.877 -58.784  166.304 1.00 40.87  ? 97   ILE A CA  1 
ATOM   675  C  C   . ILE A 1 97  ? 52.413 -58.113  165.007 1.00 42.22  ? 97   ILE A C   1 
ATOM   676  O  O   . ILE A 1 97  ? 53.057 -57.186  164.497 1.00 39.58  ? 97   ILE A O   1 
ATOM   677  C  CB  . ILE A 1 97  ? 53.430 -60.190  165.994 1.00 42.58  ? 97   ILE A CB  1 
ATOM   678  C  CG1 . ILE A 1 97  ? 53.954 -60.831  167.288 1.00 43.21  ? 97   ILE A CG1 1 
ATOM   679  C  CG2 . ILE A 1 97  ? 54.526 -60.097  164.939 1.00 39.83  ? 97   ILE A CG2 1 
ATOM   680  C  CD1 . ILE A 1 97  ? 54.358 -62.268  167.146 1.00 42.30  ? 97   ILE A CD1 1 
ATOM   681  N  N   . GLY A 1 98  ? 51.274 -58.588  164.504 1.00 42.97  ? 98   GLY A N   1 
ATOM   682  C  CA  . GLY A 1 98  ? 50.672 -58.034  163.303 1.00 46.70  ? 98   GLY A CA  1 
ATOM   683  C  C   . GLY A 1 98  ? 51.572 -57.834  162.097 1.00 48.09  ? 98   GLY A C   1 
ATOM   684  O  O   . GLY A 1 98  ? 51.770 -56.708  161.634 1.00 45.08  ? 98   GLY A O   1 
ATOM   685  N  N   . TYR A 1 99  ? 52.110 -58.930  161.579 1.00 49.19  ? 99   TYR A N   1 
ATOM   686  C  CA  . TYR A 1 99  ? 52.984 -58.848  160.422 1.00 52.79  ? 99   TYR A CA  1 
ATOM   687  C  C   . TYR A 1 99  ? 52.339 -58.063  159.272 1.00 55.73  ? 99   TYR A C   1 
ATOM   688  O  O   . TYR A 1 99  ? 52.780 -56.963  158.920 1.00 55.24  ? 99   TYR A O   1 
ATOM   689  C  CB  . TYR A 1 99  ? 53.360 -60.256  159.969 1.00 50.31  ? 99   TYR A CB  1 
ATOM   690  C  CG  . TYR A 1 99  ? 54.302 -60.955  160.920 1.00 47.69  ? 99   TYR A CG  1 
ATOM   691  C  CD1 . TYR A 1 99  ? 53.943 -62.149  161.544 1.00 47.02  ? 99   TYR A CD1 1 
ATOM   692  C  CD2 . TYR A 1 99  ? 55.560 -60.418  161.192 1.00 46.67  ? 99   TYR A CD2 1 
ATOM   693  C  CE1 . TYR A 1 99  ? 54.823 -62.795  162.421 1.00 48.13  ? 99   TYR A CE1 1 
ATOM   694  C  CE2 . TYR A 1 99  ? 56.439 -61.047  162.059 1.00 46.48  ? 99   TYR A CE2 1 
ATOM   695  C  CZ  . TYR A 1 99  ? 56.068 -62.234  162.667 1.00 47.64  ? 99   TYR A CZ  1 
ATOM   696  O  OH  . TYR A 1 99  ? 56.952 -62.876  163.502 1.00 49.03  ? 99   TYR A OH  1 
ATOM   697  N  N   . GLY A 1 100 ? 51.274 -58.610  158.703 1.00 58.37  ? 100  GLY A N   1 
ATOM   698  C  CA  . GLY A 1 100 ? 50.614 -57.905  157.626 1.00 63.11  ? 100  GLY A CA  1 
ATOM   699  C  C   . GLY A 1 100 ? 50.146 -58.796  156.498 1.00 66.83  ? 100  GLY A C   1 
ATOM   700  O  O   . GLY A 1 100 ? 49.405 -58.341  155.623 1.00 68.56  ? 100  GLY A O   1 
ATOM   701  N  N   . LYS A 1 101 ? 50.577 -60.052  156.496 1.00 68.38  ? 101  LYS A N   1 
ATOM   702  C  CA  . LYS A 1 101 ? 50.166 -60.972  155.459 1.00 70.76  ? 101  LYS A CA  1 
ATOM   703  C  C   . LYS A 1 101 ? 48.810 -61.601  155.778 1.00 72.04  ? 101  LYS A C   1 
ATOM   704  O  O   . LYS A 1 101 ? 47.938 -61.673  154.914 1.00 72.58  ? 101  LYS A O   1 
ATOM   705  C  CB  . LYS A 1 101 ? 51.219 -62.076  155.273 1.00 72.38  ? 101  LYS A CB  1 
ATOM   706  C  CG  . LYS A 1 101 ? 50.802 -63.135  154.255 1.00 73.69  ? 101  LYS A CG  1 
ATOM   707  C  CD  . LYS A 1 101 ? 51.966 -63.975  153.723 1.00 76.14  ? 101  LYS A CD  1 
ATOM   708  C  CE  . LYS A 1 101 ? 52.561 -64.917  154.769 1.00 77.67  ? 101  LYS A CE  1 
ATOM   709  N  NZ  . LYS A 1 101 ? 53.430 -65.964  154.137 1.00 78.57  ? 101  LYS A NZ  1 
ATOM   710  N  N   . LEU A 1 102 ? 48.609 -62.019  157.024 1.00 72.85  ? 102  LEU A N   1 
ATOM   711  C  CA  . LEU A 1 102 ? 47.361 -62.680  157.397 1.00 74.08  ? 102  LEU A CA  1 
ATOM   712  C  C   . LEU A 1 102 ? 46.150 -61.813  157.752 1.00 75.60  ? 102  LEU A C   1 
ATOM   713  O  O   . LEU A 1 102 ? 45.097 -62.347  158.100 1.00 76.84  ? 102  LEU A O   1 
ATOM   714  C  CB  . LEU A 1 102 ? 47.625 -63.652  158.542 1.00 73.44  ? 102  LEU A CB  1 
ATOM   715  C  CG  . LEU A 1 102 ? 48.616 -64.793  158.314 1.00 73.30  ? 102  LEU A CG  1 
ATOM   716  C  CD1 . LEU A 1 102 ? 48.742 -65.605  159.586 1.00 74.88  ? 102  LEU A CD1 1 
ATOM   717  C  CD2 . LEU A 1 102 ? 48.146 -65.673  157.185 1.00 72.71  ? 102  LEU A CD2 1 
ATOM   718  N  N   . ILE A 1 103 ? 46.284 -60.494  157.652 1.00 76.05  ? 103  ILE A N   1 
ATOM   719  C  CA  . ILE A 1 103 ? 45.197 -59.547  157.970 1.00 77.10  ? 103  ILE A CA  1 
ATOM   720  C  C   . ILE A 1 103 ? 43.741 -60.063  157.900 1.00 76.56  ? 103  ILE A C   1 
ATOM   721  O  O   . ILE A 1 103 ? 43.398 -60.900  157.063 1.00 75.97  ? 103  ILE A O   1 
ATOM   722  C  CB  . ILE A 1 103 ? 45.276 -58.318  157.059 1.00 78.54  ? 103  ILE A CB  1 
ATOM   723  C  CG1 . ILE A 1 103 ? 44.850 -58.705  155.641 1.00 78.88  ? 103  ILE A CG1 1 
ATOM   724  C  CG2 . ILE A 1 103 ? 46.698 -57.781  157.040 1.00 79.22  ? 103  ILE A CG2 1 
ATOM   725  C  CD1 . ILE A 1 103 ? 44.682 -57.532  154.719 1.00 80.78  ? 103  ILE A CD1 1 
ATOM   726  N  N   . PRO A 1 104 ? 42.861 -59.535  158.770 1.00 76.71  ? 104  PRO A N   1 
ATOM   727  C  CA  . PRO A 1 104 ? 41.437 -59.898  158.858 1.00 77.43  ? 104  PRO A CA  1 
ATOM   728  C  C   . PRO A 1 104 ? 40.664 -59.559  157.585 1.00 79.01  ? 104  PRO A C   1 
ATOM   729  O  O   . PRO A 1 104 ? 41.237 -59.030  156.636 1.00 80.07  ? 104  PRO A O   1 
ATOM   730  C  CB  . PRO A 1 104 ? 40.933 -59.067  160.037 1.00 76.23  ? 104  PRO A CB  1 
ATOM   731  C  CG  . PRO A 1 104 ? 42.163 -58.769  160.819 1.00 76.83  ? 104  PRO A CG  1 
ATOM   732  C  CD  . PRO A 1 104 ? 43.184 -58.498  159.761 1.00 76.08  ? 104  PRO A CD  1 
ATOM   733  N  N   . ILE A 1 105 ? 39.362 -59.852  157.583 1.00 79.63  ? 105  ILE A N   1 
ATOM   734  C  CA  . ILE A 1 105 ? 38.488 -59.578  156.438 1.00 79.38  ? 105  ILE A CA  1 
ATOM   735  C  C   . ILE A 1 105 ? 37.016 -59.486  156.853 1.00 78.21  ? 105  ILE A C   1 
ATOM   736  O  O   . ILE A 1 105 ? 36.425 -60.473  157.286 1.00 77.17  ? 105  ILE A O   1 
ATOM   737  C  CB  . ILE A 1 105 ? 38.598 -60.682  155.347 1.00 80.94  ? 105  ILE A CB  1 
ATOM   738  C  CG1 . ILE A 1 105 ? 39.973 -60.639  154.672 1.00 82.26  ? 105  ILE A CG1 1 
ATOM   739  C  CG2 . ILE A 1 105 ? 37.504 -60.493  154.303 1.00 81.71  ? 105  ILE A CG2 1 
ATOM   740  C  CD1 . ILE A 1 105 ? 40.256 -59.353  153.904 1.00 82.22  ? 105  ILE A CD1 1 
ATOM   741  N  N   . GLY A 1 106 ? 36.430 -58.302  156.716 1.00 77.58  ? 106  GLY A N   1 
ATOM   742  C  CA  . GLY A 1 106 ? 35.032 -58.128  157.068 1.00 77.64  ? 106  GLY A CA  1 
ATOM   743  C  C   . GLY A 1 106 ? 34.778 -57.867  158.540 1.00 77.35  ? 106  GLY A C   1 
ATOM   744  O  O   . GLY A 1 106 ? 35.549 -58.313  159.385 1.00 78.75  ? 106  GLY A O   1 
ATOM   745  N  N   . PRO A 1 107 ? 33.693 -57.151  158.878 1.00 76.61  ? 107  PRO A N   1 
ATOM   746  C  CA  . PRO A 1 107 ? 33.314 -56.813  160.250 1.00 75.85  ? 107  PRO A CA  1 
ATOM   747  C  C   . PRO A 1 107 ? 33.424 -57.943  161.270 1.00 74.76  ? 107  PRO A C   1 
ATOM   748  O  O   . PRO A 1 107 ? 33.752 -57.696  162.430 1.00 74.63  ? 107  PRO A O   1 
ATOM   749  C  CB  . PRO A 1 107 ? 31.887 -56.309  160.086 1.00 75.80  ? 107  PRO A CB  1 
ATOM   750  C  CG  . PRO A 1 107 ? 31.972 -55.582  158.800 1.00 76.52  ? 107  PRO A CG  1 
ATOM   751  C  CD  . PRO A 1 107 ? 32.730 -56.568  157.929 1.00 77.10  ? 107  PRO A CD  1 
ATOM   752  N  N   . LEU A 1 108 ? 33.151 -59.175  160.852 1.00 73.93  ? 108  LEU A N   1 
ATOM   753  C  CA  . LEU A 1 108 ? 33.239 -60.301  161.775 1.00 72.62  ? 108  LEU A CA  1 
ATOM   754  C  C   . LEU A 1 108 ? 34.669 -60.554  162.235 1.00 71.54  ? 108  LEU A C   1 
ATOM   755  O  O   . LEU A 1 108 ? 34.942 -60.607  163.434 1.00 72.82  ? 108  LEU A O   1 
ATOM   756  C  CB  . LEU A 1 108 ? 32.678 -61.573  161.141 1.00 72.28  ? 108  LEU A CB  1 
ATOM   757  C  CG  . LEU A 1 108 ? 31.156 -61.650  161.052 1.00 72.66  ? 108  LEU A CG  1 
ATOM   758  C  CD1 . LEU A 1 108 ? 30.758 -63.043  160.597 1.00 72.73  ? 108  LEU A CD1 1 
ATOM   759  C  CD2 . LEU A 1 108 ? 30.537 -61.345  162.408 1.00 72.22  ? 108  LEU A CD2 1 
ATOM   760  N  N   . ALA A 1 109 ? 35.579 -60.710  161.284 1.00 69.11  ? 109  ALA A N   1 
ATOM   761  C  CA  . ALA A 1 109 ? 36.973 -60.954  161.617 1.00 67.85  ? 109  ALA A CA  1 
ATOM   762  C  C   . ALA A 1 109 ? 37.556 -59.822  162.462 1.00 66.77  ? 109  ALA A C   1 
ATOM   763  O  O   . ALA A 1 109 ? 38.302 -60.066  163.407 1.00 68.05  ? 109  ALA A O   1 
ATOM   764  C  CB  . ALA A 1 109 ? 37.789 -61.122  160.341 1.00 68.29  ? 109  ALA A CB  1 
ATOM   765  N  N   . ASN A 1 110 ? 37.207 -58.587  162.123 1.00 64.60  ? 110  ASN A N   1 
ATOM   766  C  CA  . ASN A 1 110 ? 37.712 -57.418  162.834 1.00 62.75  ? 110  ASN A CA  1 
ATOM   767  C  C   . ASN A 1 110 ? 37.153 -57.233  164.248 1.00 62.47  ? 110  ASN A C   1 
ATOM   768  O  O   . ASN A 1 110 ? 37.733 -56.510  165.062 1.00 61.55  ? 110  ASN A O   1 
ATOM   769  C  CB  . ASN A 1 110 ? 37.440 -56.164  162.007 1.00 61.07  ? 110  ASN A CB  1 
ATOM   770  C  CG  . ASN A 1 110 ? 38.371 -56.029  160.821 1.00 60.45  ? 110  ASN A CG  1 
ATOM   771  O  OD1 . ASN A 1 110 ? 39.447 -55.451  160.930 1.00 60.42  ? 110  ASN A OD1 1 
ATOM   772  N  ND2 . ASN A 1 110 ? 37.963 -56.572  159.681 1.00 60.40  ? 110  ASN A ND2 1 
ATOM   773  N  N   . THR A 1 111 ? 36.027 -57.875  164.541 1.00 62.05  ? 111  THR A N   1 
ATOM   774  C  CA  . THR A 1 111 ? 35.432 -57.760  165.868 1.00 61.76  ? 111  THR A CA  1 
ATOM   775  C  C   . THR A 1 111 ? 36.089 -58.774  166.795 1.00 61.14  ? 111  THR A C   1 
ATOM   776  O  O   . THR A 1 111 ? 36.129 -58.594  168.014 1.00 60.04  ? 111  THR A O   1 
ATOM   777  C  CB  . THR A 1 111 ? 33.910 -57.996  165.826 1.00 61.34  ? 111  THR A CB  1 
ATOM   778  O  OG1 . THR A 1 111 ? 33.319 -57.076  164.901 1.00 61.10  ? 111  THR A OG1 1 
ATOM   779  C  CG2 . THR A 1 111 ? 33.297 -57.773  167.205 1.00 59.82  ? 111  THR A CG2 1 
ATOM   780  N  N   . LEU A 1 112 ? 36.603 -59.845  166.204 1.00 59.71  ? 112  LEU A N   1 
ATOM   781  C  CA  . LEU A 1 112 ? 37.291 -60.858  166.979 1.00 58.68  ? 112  LEU A CA  1 
ATOM   782  C  C   . LEU A 1 112 ? 38.659 -60.286  167.307 1.00 58.04  ? 112  LEU A C   1 
ATOM   783  O  O   . LEU A 1 112 ? 39.153 -60.418  168.426 1.00 58.95  ? 112  LEU A O   1 
ATOM   784  C  CB  . LEU A 1 112 ? 37.428 -62.147  166.172 1.00 58.39  ? 112  LEU A CB  1 
ATOM   785  C  CG  . LEU A 1 112 ? 36.148 -62.981  166.108 1.00 58.96  ? 112  LEU A CG  1 
ATOM   786  C  CD1 . LEU A 1 112 ? 36.359 -64.189  165.223 1.00 59.72  ? 112  LEU A CD1 1 
ATOM   787  C  CD2 . LEU A 1 112 ? 35.758 -63.410  167.513 1.00 57.26  ? 112  LEU A CD2 1 
ATOM   788  N  N   . VAL A 1 113 ? 39.260 -59.632  166.320 1.00 56.40  ? 113  VAL A N   1 
ATOM   789  C  CA  . VAL A 1 113 ? 40.567 -59.020  166.499 1.00 54.40  ? 113  VAL A CA  1 
ATOM   790  C  C   . VAL A 1 113 ? 40.527 -58.043  167.669 1.00 54.93  ? 113  VAL A C   1 
ATOM   791  O  O   . VAL A 1 113 ? 41.372 -58.084  168.561 1.00 55.47  ? 113  VAL A O   1 
ATOM   792  C  CB  . VAL A 1 113 ? 40.998 -58.267  165.227 1.00 51.48  ? 113  VAL A CB  1 
ATOM   793  C  CG1 . VAL A 1 113 ? 42.178 -57.351  165.530 1.00 48.50  ? 113  VAL A CG1 1 
ATOM   794  C  CG2 . VAL A 1 113 ? 41.354 -59.268  164.142 1.00 49.47  ? 113  VAL A CG2 1 
ATOM   795  N  N   . THR A 1 114 ? 39.533 -57.165  167.656 1.00 54.66  ? 114  THR A N   1 
ATOM   796  C  CA  . THR A 1 114 ? 39.381 -56.176  168.707 1.00 54.33  ? 114  THR A CA  1 
ATOM   797  C  C   . THR A 1 114 ? 39.293 -56.851  170.069 1.00 54.82  ? 114  THR A C   1 
ATOM   798  O  O   . THR A 1 114 ? 39.905 -56.405  171.044 1.00 55.79  ? 114  THR A O   1 
ATOM   799  C  CB  . THR A 1 114 ? 38.113 -55.347  168.486 1.00 52.58  ? 114  THR A CB  1 
ATOM   800  O  OG1 . THR A 1 114 ? 38.261 -54.572  167.293 1.00 52.65  ? 114  THR A OG1 1 
ATOM   801  C  CG2 . THR A 1 114 ? 37.860 -54.429  169.672 1.00 53.20  ? 114  THR A CG2 1 
ATOM   802  N  N   . LEU A 1 115 ? 38.530 -57.934  170.115 1.00 53.88  ? 115  LEU A N   1 
ATOM   803  C  CA  . LEU A 1 115 ? 38.315 -58.683  171.337 1.00 53.26  ? 115  LEU A CA  1 
ATOM   804  C  C   . LEU A 1 115 ? 39.565 -59.457  171.737 1.00 53.48  ? 115  LEU A C   1 
ATOM   805  O  O   . LEU A 1 115 ? 39.946 -59.485  172.911 1.00 53.86  ? 115  LEU A O   1 
ATOM   806  C  CB  . LEU A 1 115 ? 37.139 -59.633  171.132 1.00 53.68  ? 115  LEU A CB  1 
ATOM   807  C  CG  . LEU A 1 115 ? 36.497 -60.247  172.369 1.00 54.52  ? 115  LEU A CG  1 
ATOM   808  C  CD1 . LEU A 1 115 ? 36.097 -59.147  173.336 1.00 54.93  ? 115  LEU A CD1 1 
ATOM   809  C  CD2 . LEU A 1 115 ? 35.283 -61.057  171.949 1.00 55.33  ? 115  LEU A CD2 1 
ATOM   810  N  N   . GLU A 1 116 ? 40.204 -60.083  170.756 1.00 52.22  ? 116  GLU A N   1 
ATOM   811  C  CA  . GLU A 1 116 ? 41.408 -60.856  171.009 1.00 52.03  ? 116  GLU A CA  1 
ATOM   812  C  C   . GLU A 1 116 ? 42.535 -59.947  171.485 1.00 52.63  ? 116  GLU A C   1 
ATOM   813  O  O   . GLU A 1 116 ? 43.416 -60.371  172.240 1.00 54.44  ? 116  GLU A O   1 
ATOM   814  C  CB  . GLU A 1 116 ? 41.818 -61.605  169.743 1.00 52.08  ? 116  GLU A CB  1 
ATOM   815  C  CG  . GLU A 1 116 ? 43.132 -62.338  169.847 1.00 51.48  ? 116  GLU A CG  1 
ATOM   816  C  CD  . GLU A 1 116 ? 43.270 -63.413  168.791 1.00 51.42  ? 116  GLU A CD  1 
ATOM   817  O  OE1 . GLU A 1 116 ? 42.831 -63.182  167.649 1.00 49.92  ? 116  GLU A OE1 1 
ATOM   818  O  OE2 . GLU A 1 116 ? 43.825 -64.486  169.104 1.00 52.40  ? 116  GLU A OE2 1 
ATOM   819  N  N   . ALA A 1 117 ? 42.497 -58.694  171.045 1.00 51.80  ? 117  ALA A N   1 
ATOM   820  C  CA  . ALA A 1 117 ? 43.493 -57.704  171.437 1.00 49.97  ? 117  ALA A CA  1 
ATOM   821  C  C   . ALA A 1 117 ? 43.337 -57.393  172.925 1.00 49.89  ? 117  ALA A C   1 
ATOM   822  O  O   . ALA A 1 117 ? 44.322 -57.211  173.644 1.00 48.92  ? 117  ALA A O   1 
ATOM   823  C  CB  . ALA A 1 117 ? 43.308 -56.432  170.619 1.00 49.60  ? 117  ALA A CB  1 
ATOM   824  N  N   . LEU A 1 118 ? 42.090 -57.331  173.380 1.00 49.50  ? 118  LEU A N   1 
ATOM   825  C  CA  . LEU A 1 118 ? 41.811 -57.041  174.774 1.00 51.06  ? 118  LEU A CA  1 
ATOM   826  C  C   . LEU A 1 118 ? 42.219 -58.221  175.638 1.00 51.83  ? 118  LEU A C   1 
ATOM   827  O  O   . LEU A 1 118 ? 42.756 -58.035  176.724 1.00 52.92  ? 118  LEU A O   1 
ATOM   828  C  CB  . LEU A 1 118 ? 40.322 -56.740  174.975 1.00 52.66  ? 118  LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 118 ? 39.904 -56.194  176.346 1.00 52.97  ? 118  LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 118 ? 40.573 -54.856  176.588 1.00 53.30  ? 118  LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 118 ? 38.394 -56.030  176.402 1.00 53.65  ? 118  LEU A CD2 1 
ATOM   832  N  N   . CYS A 1 119 ? 41.973 -59.435  175.155 1.00 51.99  ? 119  CYS A N   1 
ATOM   833  C  CA  . CYS A 1 119 ? 42.333 -60.637  175.907 1.00 54.26  ? 119  CYS A CA  1 
ATOM   834  C  C   . CYS A 1 119 ? 43.839 -60.745  176.134 1.00 54.29  ? 119  CYS A C   1 
ATOM   835  O  O   . CYS A 1 119 ? 44.289 -61.031  177.244 1.00 55.27  ? 119  CYS A O   1 
ATOM   836  C  CB  . CYS A 1 119 ? 41.833 -61.889  175.186 1.00 55.39  ? 119  CYS A CB  1 
ATOM   837  S  SG  . CYS A 1 119 ? 40.038 -61.935  175.009 1.00 62.59  ? 119  CYS A SG  1 
ATOM   838  N  N   . GLY A 1 120 ? 44.621 -60.534  175.083 1.00 53.35  ? 120  GLY A N   1 
ATOM   839  C  CA  . GLY A 1 120 ? 46.060 -60.601  175.240 1.00 50.99  ? 120  GLY A CA  1 
ATOM   840  C  C   . GLY A 1 120 ? 46.507 -59.502  176.187 1.00 50.48  ? 120  GLY A C   1 
ATOM   841  O  O   . GLY A 1 120 ? 47.441 -59.683  176.967 1.00 48.99  ? 120  GLY A O   1 
ATOM   842  N  N   . MET A 1 121 ? 45.834 -58.355  176.120 1.00 50.95  ? 121  MET A N   1 
ATOM   843  C  CA  . MET A 1 121 ? 46.166 -57.229  176.983 1.00 50.48  ? 121  MET A CA  1 
ATOM   844  C  C   . MET A 1 121 ? 45.912 -57.646  178.431 1.00 48.56  ? 121  MET A C   1 
ATOM   845  O  O   . MET A 1 121 ? 46.792 -57.541  179.274 1.00 46.43  ? 121  MET A O   1 
ATOM   846  C  CB  . MET A 1 121 ? 45.315 -56.011  176.604 1.00 53.94  ? 121  MET A CB  1 
ATOM   847  C  CG  . MET A 1 121 ? 45.623 -54.729  177.387 1.00 59.75  ? 121  MET A CG  1 
ATOM   848  S  SD  . MET A 1 121 ? 44.793 -54.562  179.016 1.00 68.25  ? 121  MET A SD  1 
ATOM   849  C  CE  . MET A 1 121 ? 43.563 -53.218  178.693 1.00 63.41  ? 121  MET A CE  1 
ATOM   850  N  N   . LEU A 1 122 ? 44.710 -58.135  178.711 1.00 46.70  ? 122  LEU A N   1 
ATOM   851  C  CA  . LEU A 1 122 ? 44.373 -58.570  180.054 1.00 47.47  ? 122  LEU A CA  1 
ATOM   852  C  C   . LEU A 1 122 ? 45.268 -59.752  180.443 1.00 47.32  ? 122  LEU A C   1 
ATOM   853  O  O   . LEU A 1 122 ? 45.704 -59.867  181.593 1.00 47.94  ? 122  LEU A O   1 
ATOM   854  C  CB  . LEU A 1 122 ? 42.896 -58.965  180.119 1.00 46.90  ? 122  LEU A CB  1 
ATOM   855  C  CG  . LEU A 1 122 ? 41.907 -57.859  179.735 1.00 47.72  ? 122  LEU A CG  1 
ATOM   856  C  CD1 . LEU A 1 122 ? 40.483 -58.366  179.874 1.00 47.00  ? 122  LEU A CD1 1 
ATOM   857  C  CD2 . LEU A 1 122 ? 42.113 -56.646  180.622 1.00 47.96  ? 122  LEU A CD2 1 
ATOM   858  N  N   . GLY A 1 123 ? 45.549 -60.617  179.474 1.00 45.59  ? 123  GLY A N   1 
ATOM   859  C  CA  . GLY A 1 123 ? 46.394 -61.771  179.724 1.00 43.53  ? 123  GLY A CA  1 
ATOM   860  C  C   . GLY A 1 123 ? 47.757 -61.382  180.258 1.00 43.48  ? 123  GLY A C   1 
ATOM   861  O  O   . GLY A 1 123 ? 48.243 -61.974  181.216 1.00 45.93  ? 123  GLY A O   1 
ATOM   862  N  N   . LEU A 1 124 ? 48.377 -60.381  179.645 1.00 42.14  ? 124  LEU A N   1 
ATOM   863  C  CA  . LEU A 1 124 ? 49.693 -59.926  180.077 1.00 41.83  ? 124  LEU A CA  1 
ATOM   864  C  C   . LEU A 1 124 ? 49.633 -59.402  181.494 1.00 41.45  ? 124  LEU A C   1 
ATOM   865  O  O   . LEU A 1 124 ? 50.485 -59.718  182.327 1.00 41.54  ? 124  LEU A O   1 
ATOM   866  C  CB  . LEU A 1 124 ? 50.206 -58.809  179.167 1.00 42.02  ? 124  LEU A CB  1 
ATOM   867  C  CG  . LEU A 1 124 ? 51.427 -58.031  179.674 1.00 42.56  ? 124  LEU A CG  1 
ATOM   868  C  CD1 . LEU A 1 124 ? 52.639 -58.952  179.809 1.00 43.30  ? 124  LEU A CD1 1 
ATOM   869  C  CD2 . LEU A 1 124 ? 51.733 -56.903  178.705 1.00 45.78  ? 124  LEU A CD2 1 
ATOM   870  N  N   . ALA A 1 125 ? 48.615 -58.593  181.754 1.00 40.64  ? 125  ALA A N   1 
ATOM   871  C  CA  . ALA A 1 125 ? 48.427 -57.986  183.054 1.00 39.01  ? 125  ALA A CA  1 
ATOM   872  C  C   . ALA A 1 125 ? 48.291 -59.050  184.127 1.00 40.15  ? 125  ALA A C   1 
ATOM   873  O  O   . ALA A 1 125 ? 48.930 -58.967  185.181 1.00 39.11  ? 125  ALA A O   1 
ATOM   874  C  CB  . ALA A 1 125 ? 47.197 -57.103  183.030 1.00 39.59  ? 125  ALA A CB  1 
ATOM   875  N  N   . VAL A 1 126 ? 47.458 -60.052  183.866 1.00 40.61  ? 126  VAL A N   1 
ATOM   876  C  CA  . VAL A 1 126 ? 47.265 -61.111  184.835 1.00 41.63  ? 126  VAL A CA  1 
ATOM   877  C  C   . VAL A 1 126 ? 48.564 -61.879  185.032 1.00 43.11  ? 126  VAL A C   1 
ATOM   878  O  O   . VAL A 1 126 ? 49.041 -62.024  186.157 1.00 43.95  ? 126  VAL A O   1 
ATOM   879  C  CB  . VAL A 1 126 ? 46.163 -62.072  184.390 1.00 41.86  ? 126  VAL A CB  1 
ATOM   880  C  CG1 . VAL A 1 126 ? 46.087 -63.254  185.341 1.00 42.12  ? 126  VAL A CG1 1 
ATOM   881  C  CG2 . VAL A 1 126 ? 44.838 -61.337  184.363 1.00 41.23  ? 126  VAL A CG2 1 
ATOM   882  N  N   . ALA A 1 127 ? 49.150 -62.353  183.938 1.00 43.14  ? 127  ALA A N   1 
ATOM   883  C  CA  . ALA A 1 127 ? 50.399 -63.099  184.023 1.00 43.66  ? 127  ALA A CA  1 
ATOM   884  C  C   . ALA A 1 127 ? 51.477 -62.310  184.761 1.00 44.30  ? 127  ALA A C   1 
ATOM   885  O  O   . ALA A 1 127 ? 52.299 -62.884  185.473 1.00 45.56  ? 127  ALA A O   1 
ATOM   886  C  CB  . ALA A 1 127 ? 50.879 -63.463  182.638 1.00 44.14  ? 127  ALA A CB  1 
ATOM   887  N  N   . ALA A 1 128 ? 51.484 -60.994  184.598 1.00 43.10  ? 128  ALA A N   1 
ATOM   888  C  CA  . ALA A 1 128 ? 52.480 -60.188  185.280 1.00 42.90  ? 128  ALA A CA  1 
ATOM   889  C  C   . ALA A 1 128 ? 52.159 -60.128  186.774 1.00 44.00  ? 128  ALA A C   1 
ATOM   890  O  O   . ALA A 1 128 ? 53.060 -60.074  187.608 1.00 43.72  ? 128  ALA A O   1 
ATOM   891  C  CB  . ALA A 1 128 ? 52.515 -58.798  184.688 1.00 42.45  ? 128  ALA A CB  1 
ATOM   892  N  N   . SER A 1 129 ? 50.870 -60.140  187.107 1.00 45.89  ? 129  SER A N   1 
ATOM   893  C  CA  . SER A 1 129 ? 50.436 -60.104  188.503 1.00 46.24  ? 129  SER A CA  1 
ATOM   894  C  C   . SER A 1 129 ? 50.911 -61.377  189.174 1.00 46.31  ? 129  SER A C   1 
ATOM   895  O  O   . SER A 1 129 ? 51.655 -61.347  190.152 1.00 46.39  ? 129  SER A O   1 
ATOM   896  C  CB  . SER A 1 129 ? 48.909 -60.026  188.597 1.00 46.83  ? 129  SER A CB  1 
ATOM   897  O  OG  . SER A 1 129 ? 48.428 -58.802  188.064 1.00 51.22  ? 129  SER A OG  1 
ATOM   898  N  N   . LEU A 1 130 ? 50.478 -62.502  188.630 1.00 46.15  ? 130  LEU A N   1 
ATOM   899  C  CA  . LEU A 1 130 ? 50.859 -63.786  189.175 1.00 45.74  ? 130  LEU A CA  1 
ATOM   900  C  C   . LEU A 1 130 ? 52.367 -63.875  189.393 1.00 45.44  ? 130  LEU A C   1 
ATOM   901  O  O   . LEU A 1 130 ? 52.822 -64.216  190.487 1.00 45.31  ? 130  LEU A O   1 
ATOM   902  C  CB  . LEU A 1 130 ? 50.395 -64.904  188.243 1.00 46.06  ? 130  LEU A CB  1 
ATOM   903  C  CG  . LEU A 1 130 ? 48.878 -65.026  188.065 1.00 47.44  ? 130  LEU A CG  1 
ATOM   904  C  CD1 . LEU A 1 130 ? 48.580 -66.215  187.156 1.00 47.46  ? 130  LEU A CD1 1 
ATOM   905  C  CD2 . LEU A 1 130 ? 48.198 -65.202  189.422 1.00 45.31  ? 130  LEU A CD2 1 
ATOM   906  N  N   . ILE A 1 131 ? 53.142 -63.560  188.361 1.00 43.81  ? 131  ILE A N   1 
ATOM   907  C  CA  . ILE A 1 131 ? 54.591 -63.631  188.475 1.00 42.81  ? 131  ILE A CA  1 
ATOM   908  C  C   . ILE A 1 131 ? 55.117 -62.777  189.621 1.00 45.03  ? 131  ILE A C   1 
ATOM   909  O  O   . ILE A 1 131 ? 56.001 -63.207  190.367 1.00 44.08  ? 131  ILE A O   1 
ATOM   910  C  CB  . ILE A 1 131 ? 55.269 -63.200  187.175 1.00 41.05  ? 131  ILE A CB  1 
ATOM   911  C  CG1 . ILE A 1 131 ? 54.955 -64.226  186.077 1.00 40.27  ? 131  ILE A CG1 1 
ATOM   912  C  CG2 . ILE A 1 131 ? 56.766 -63.036  187.399 1.00 39.00  ? 131  ILE A CG2 1 
ATOM   913  C  CD1 . ILE A 1 131 ? 55.559 -63.903  184.737 1.00 34.15  ? 131  ILE A CD1 1 
ATOM   914  N  N   . TYR A 1 132 ? 54.581 -61.571  189.772 1.00 45.94  ? 132  TYR A N   1 
ATOM   915  C  CA  . TYR A 1 132 ? 55.034 -60.712  190.860 1.00 49.14  ? 132  TYR A CA  1 
ATOM   916  C  C   . TYR A 1 132 ? 54.640 -61.315  192.206 1.00 49.75  ? 132  TYR A C   1 
ATOM   917  O  O   . TYR A 1 132 ? 55.454 -61.386  193.128 1.00 48.48  ? 132  TYR A O   1 
ATOM   918  C  CB  . TYR A 1 132 ? 54.435 -59.311  190.752 1.00 49.47  ? 132  TYR A CB  1 
ATOM   919  C  CG  . TYR A 1 132 ? 54.947 -58.394  191.835 1.00 52.40  ? 132  TYR A CG  1 
ATOM   920  C  CD1 . TYR A 1 132 ? 56.214 -57.816  191.747 1.00 54.16  ? 132  TYR A CD1 1 
ATOM   921  C  CD2 . TYR A 1 132 ? 54.187 -58.136  192.974 1.00 54.63  ? 132  TYR A CD2 1 
ATOM   922  C  CE1 . TYR A 1 132 ? 56.709 -57.001  192.767 1.00 53.57  ? 132  TYR A CE1 1 
ATOM   923  C  CE2 . TYR A 1 132 ? 54.671 -57.328  193.999 1.00 55.38  ? 132  TYR A CE2 1 
ATOM   924  C  CZ  . TYR A 1 132 ? 55.931 -56.763  193.886 1.00 55.13  ? 132  TYR A CZ  1 
ATOM   925  O  OH  . TYR A 1 132 ? 56.398 -55.947  194.893 1.00 56.77  ? 132  TYR A OH  1 
ATOM   926  N  N   . ALA A 1 133 ? 53.381 -61.735  192.311 1.00 50.65  ? 133  ALA A N   1 
ATOM   927  C  CA  . ALA A 1 133 ? 52.864 -62.338  193.533 1.00 51.03  ? 133  ALA A CA  1 
ATOM   928  C  C   . ALA A 1 133 ? 53.740 -63.506  193.970 1.00 52.73  ? 133  ALA A C   1 
ATOM   929  O  O   . ALA A 1 133 ? 54.138 -63.600  195.128 1.00 53.31  ? 133  ALA A O   1 
ATOM   930  C  CB  . ALA A 1 133 ? 51.442 -62.811  193.311 1.00 50.09  ? 133  ALA A CB  1 
ATOM   931  N  N   . ARG A 1 134 ? 54.033 -64.405  193.042 1.00 54.36  ? 134  ARG A N   1 
ATOM   932  C  CA  . ARG A 1 134 ? 54.870 -65.544  193.362 1.00 57.07  ? 134  ARG A CA  1 
ATOM   933  C  C   . ARG A 1 134 ? 56.217 -65.065  193.894 1.00 59.32  ? 134  ARG A C   1 
ATOM   934  O  O   . ARG A 1 134 ? 56.869 -65.764  194.674 1.00 61.18  ? 134  ARG A O   1 
ATOM   935  C  CB  . ARG A 1 134 ? 55.047 -66.418  192.123 1.00 57.17  ? 134  ARG A CB  1 
ATOM   936  C  CG  . ARG A 1 134 ? 53.783 -67.190  191.760 1.00 59.03  ? 134  ARG A CG  1 
ATOM   937  C  CD  . ARG A 1 134 ? 53.846 -67.736  190.343 1.00 59.45  ? 134  ARG A CD  1 
ATOM   938  N  NE  . ARG A 1 134 ? 55.015 -68.583  190.118 1.00 61.16  ? 134  ARG A NE  1 
ATOM   939  C  CZ  . ARG A 1 134 ? 55.156 -69.817  190.593 1.00 60.75  ? 134  ARG A CZ  1 
ATOM   940  N  NH1 . ARG A 1 134 ? 54.198 -70.369  191.329 1.00 59.93  ? 134  ARG A NH1 1 
ATOM   941  N  NH2 . ARG A 1 134 ? 56.258 -70.501  190.325 1.00 59.92  ? 134  ARG A NH2 1 
ATOM   942  N  N   . PHE A 1 135 ? 56.626 -63.868  193.482 1.00 61.03  ? 135  PHE A N   1 
ATOM   943  C  CA  . PHE A 1 135 ? 57.890 -63.284  193.931 1.00 63.16  ? 135  PHE A CA  1 
ATOM   944  C  C   . PHE A 1 135 ? 57.768 -62.752  195.358 1.00 64.57  ? 135  PHE A C   1 
ATOM   945  O  O   . PHE A 1 135 ? 58.774 -62.594  196.049 1.00 64.91  ? 135  PHE A O   1 
ATOM   946  C  CB  . PHE A 1 135 ? 58.313 -62.111  193.034 1.00 64.83  ? 135  PHE A CB  1 
ATOM   947  C  CG  . PHE A 1 135 ? 59.005 -62.510  191.759 1.00 64.55  ? 135  PHE A CG  1 
ATOM   948  C  CD1 . PHE A 1 135 ? 59.303 -63.837  191.482 1.00 64.76  ? 135  PHE A CD1 1 
ATOM   949  C  CD2 . PHE A 1 135 ? 59.386 -61.535  190.843 1.00 64.87  ? 135  PHE A CD2 1 
ATOM   950  C  CE1 . PHE A 1 135 ? 59.975 -64.186  190.314 1.00 64.95  ? 135  PHE A CE1 1 
ATOM   951  C  CE2 . PHE A 1 135 ? 60.056 -61.873  189.676 1.00 65.72  ? 135  PHE A CE2 1 
ATOM   952  C  CZ  . PHE A 1 135 ? 60.351 -63.203  189.411 1.00 65.40  ? 135  PHE A CZ  1 
ATOM   953  N  N   . THR A 1 136 ? 56.538 -62.469  195.788 1.00 65.43  ? 136  THR A N   1 
ATOM   954  C  CA  . THR A 1 136 ? 56.296 -61.925  197.122 1.00 66.34  ? 136  THR A CA  1 
ATOM   955  C  C   . THR A 1 136 ? 55.835 -62.939  198.182 1.00 67.81  ? 136  THR A C   1 
ATOM   956  O  O   . THR A 1 136 ? 55.215 -62.568  199.181 1.00 69.37  ? 136  THR A O   1 
ATOM   957  C  CB  . THR A 1 136 ? 55.263 -60.768  197.069 1.00 65.71  ? 136  THR A CB  1 
ATOM   958  O  OG1 . THR A 1 136 ? 53.991 -61.269  196.640 1.00 64.94  ? 136  THR A OG1 1 
ATOM   959  C  CG2 . THR A 1 136 ? 55.725 -59.688  196.109 1.00 65.76  ? 136  THR A CG2 1 
ATOM   960  N  N   . ARG A 1 137 ? 56.134 -64.215  197.967 1.00 67.97  ? 137  ARG A N   1 
ATOM   961  C  CA  . ARG A 1 137 ? 55.769 -65.257  198.926 1.00 67.02  ? 137  ARG A CA  1 
ATOM   962  C  C   . ARG A 1 137 ? 57.008 -66.119  199.167 1.00 64.83  ? 137  ARG A C   1 
ATOM   963  O  O   . ARG A 1 137 ? 56.960 -67.343  199.031 1.00 65.05  ? 137  ARG A O   1 
ATOM   964  C  CB  . ARG A 1 137 ? 54.657 -66.143  198.365 1.00 70.19  ? 137  ARG A CB  1 
ATOM   965  C  CG  . ARG A 1 137 ? 53.520 -65.400  197.693 1.00 75.61  ? 137  ARG A CG  1 
ATOM   966  C  CD  . ARG A 1 137 ? 52.683 -66.366  196.849 1.00 79.08  ? 137  ARG A CD  1 
ATOM   967  N  NE  . ARG A 1 137 ? 51.827 -67.237  197.653 1.00 81.15  ? 137  ARG A NE  1 
ATOM   968  C  CZ  . ARG A 1 137 ? 50.695 -66.844  198.230 1.00 82.63  ? 137  ARG A CZ  1 
ATOM   969  N  NH1 . ARG A 1 137 ? 50.280 -65.588  198.092 1.00 81.90  ? 137  ARG A NH1 1 
ATOM   970  N  NH2 . ARG A 1 137 ? 49.973 -67.705  198.937 1.00 82.33  ? 137  ARG A NH2 1 
ATOM   971  N  N   . PRO A 1 138 ? 58.141 -65.488  199.519 1.00 61.62  ? 138  PRO A N   1 
ATOM   972  C  CA  . PRO A 1 138 ? 59.384 -66.220  199.768 1.00 58.18  ? 138  PRO A CA  1 
ATOM   973  C  C   . PRO A 1 138 ? 59.227 -67.172  200.935 1.00 54.27  ? 138  PRO A C   1 
ATOM   974  O  O   . PRO A 1 138 ? 58.419 -66.941  201.835 1.00 53.19  ? 138  PRO A O   1 
ATOM   975  C  CB  . PRO A 1 138 ? 60.387 -65.115  200.102 1.00 59.50  ? 138  PRO A CB  1 
ATOM   976  C  CG  . PRO A 1 138 ? 59.788 -63.891  199.495 1.00 61.34  ? 138  PRO A CG  1 
ATOM   977  C  CD  . PRO A 1 138 ? 58.331 -64.058  199.793 1.00 61.29  ? 138  PRO A CD  1 
ATOM   978  N  N   . THR A 1 139 ? 60.003 -68.245  200.918 1.00 50.22  ? 139  THR A N   1 
ATOM   979  C  CA  . THR A 1 139 ? 59.958 -69.198  202.005 1.00 46.85  ? 139  THR A CA  1 
ATOM   980  C  C   . THR A 1 139 ? 60.915 -68.654  203.058 1.00 44.55  ? 139  THR A C   1 
ATOM   981  O  O   . THR A 1 139 ? 61.839 -67.905  202.733 1.00 44.54  ? 139  THR A O   1 
ATOM   982  C  CB  . THR A 1 139 ? 60.404 -70.591  201.533 1.00 47.35  ? 139  THR A CB  1 
ATOM   983  O  OG1 . THR A 1 139 ? 61.720 -70.515  200.971 1.00 47.58  ? 139  THR A OG1 1 
ATOM   984  C  CG2 . THR A 1 139 ? 59.436 -71.121  200.486 1.00 44.69  ? 139  THR A CG2 1 
ATOM   985  N  N   . ALA A 1 140 ? 60.684 -69.006  204.318 1.00 41.09  ? 140  ALA A N   1 
ATOM   986  C  CA  . ALA A 1 140 ? 61.530 -68.525  205.397 1.00 38.35  ? 140  ALA A CA  1 
ATOM   987  C  C   . ALA A 1 140 ? 62.890 -69.221  205.438 1.00 38.44  ? 140  ALA A C   1 
ATOM   988  O  O   . ALA A 1 140 ? 63.828 -68.712  206.052 1.00 39.31  ? 140  ALA A O   1 
ATOM   989  C  CB  . ALA A 1 140 ? 60.817 -68.705  206.725 1.00 36.08  ? 140  ALA A CB  1 
ATOM   990  N  N   . GLY A 1 141 ? 63.000 -70.380  204.789 1.00 36.03  ? 141  GLY A N   1 
ATOM   991  C  CA  . GLY A 1 141 ? 64.256 -71.109  204.808 1.00 33.01  ? 141  GLY A CA  1 
ATOM   992  C  C   . GLY A 1 141 ? 64.742 -71.297  206.237 1.00 33.54  ? 141  GLY A C   1 
ATOM   993  O  O   . GLY A 1 141 ? 65.877 -70.958  206.580 1.00 32.30  ? 141  GLY A O   1 
ATOM   994  N  N   . VAL A 1 142 ? 63.862 -71.820  207.082 1.00 32.50  ? 142  VAL A N   1 
ATOM   995  C  CA  . VAL A 1 142 ? 64.193 -72.069  208.475 1.00 32.57  ? 142  VAL A CA  1 
ATOM   996  C  C   . VAL A 1 142 ? 64.044 -73.558  208.771 1.00 32.68  ? 142  VAL A C   1 
ATOM   997  O  O   . VAL A 1 142 ? 63.013 -74.154  208.458 1.00 35.06  ? 142  VAL A O   1 
ATOM   998  C  CB  . VAL A 1 142 ? 63.263 -71.298  209.414 1.00 33.37  ? 142  VAL A CB  1 
ATOM   999  C  CG1 . VAL A 1 142 ? 63.615 -71.604  210.855 1.00 34.78  ? 142  VAL A CG1 1 
ATOM   1000 C  CG2 . VAL A 1 142 ? 63.373 -69.816  209.151 1.00 35.87  ? 142  VAL A CG2 1 
ATOM   1001 N  N   . LEU A 1 143 ? 65.069 -74.150  209.378 1.00 31.37  ? 143  LEU A N   1 
ATOM   1002 C  CA  . LEU A 1 143 ? 65.057 -75.568  209.719 1.00 28.81  ? 143  LEU A CA  1 
ATOM   1003 C  C   . LEU A 1 143 ? 64.726 -75.777  211.185 1.00 28.61  ? 143  LEU A C   1 
ATOM   1004 O  O   . LEU A 1 143 ? 65.251 -75.081  212.053 1.00 27.54  ? 143  LEU A O   1 
ATOM   1005 C  CB  . LEU A 1 143 ? 66.427 -76.179  209.422 1.00 31.80  ? 143  LEU A CB  1 
ATOM   1006 C  CG  . LEU A 1 143 ? 66.692 -77.660  209.713 1.00 33.16  ? 143  LEU A CG  1 
ATOM   1007 C  CD1 . LEU A 1 143 ? 65.699 -78.546  208.965 1.00 30.63  ? 143  LEU A CD1 1 
ATOM   1008 C  CD2 . LEU A 1 143 ? 68.125 -77.989  209.291 1.00 32.05  ? 143  LEU A CD2 1 
ATOM   1009 N  N   . PHE A 1 144 ? 63.838 -76.726  211.461 1.00 28.33  ? 144  PHE A N   1 
ATOM   1010 C  CA  . PHE A 1 144 ? 63.479 -77.038  212.839 1.00 27.03  ? 144  PHE A CA  1 
ATOM   1011 C  C   . PHE A 1 144 ? 64.165 -78.350  213.227 1.00 27.72  ? 144  PHE A C   1 
ATOM   1012 O  O   . PHE A 1 144 ? 64.338 -79.235  212.389 1.00 26.98  ? 144  PHE A O   1 
ATOM   1013 C  CB  . PHE A 1 144 ? 61.962 -77.183  212.990 1.00 26.55  ? 144  PHE A CB  1 
ATOM   1014 C  CG  . PHE A 1 144 ? 61.195 -75.902  212.745 1.00 29.96  ? 144  PHE A CG  1 
ATOM   1015 C  CD1 . PHE A 1 144 ? 60.786 -75.550  211.465 1.00 29.57  ? 144  PHE A CD1 1 
ATOM   1016 C  CD2 . PHE A 1 144 ? 60.893 -75.045  213.794 1.00 29.47  ? 144  PHE A CD2 1 
ATOM   1017 C  CE1 . PHE A 1 144 ? 60.086 -74.368  211.232 1.00 31.02  ? 144  PHE A CE1 1 
ATOM   1018 C  CE2 . PHE A 1 144 ? 60.192 -73.856  213.564 1.00 33.50  ? 144  PHE A CE2 1 
ATOM   1019 C  CZ  . PHE A 1 144 ? 59.788 -73.523  212.278 1.00 29.19  ? 144  PHE A CZ  1 
ATOM   1020 N  N   . SER A 1 145 ? 64.574 -78.471  214.486 1.00 26.98  ? 145  SER A N   1 
ATOM   1021 C  CA  . SER A 1 145 ? 65.212 -79.696  214.940 1.00 25.48  ? 145  SER A CA  1 
ATOM   1022 C  C   . SER A 1 145 ? 64.108 -80.742  214.950 1.00 26.76  ? 145  SER A C   1 
ATOM   1023 O  O   . SER A 1 145 ? 62.960 -80.442  215.264 1.00 26.22  ? 145  SER A O   1 
ATOM   1024 C  CB  . SER A 1 145 ? 65.810 -79.510  216.335 1.00 25.18  ? 145  SER A CB  1 
ATOM   1025 O  OG  . SER A 1 145 ? 64.815 -79.245  217.300 1.00 25.78  ? 145  SER A OG  1 
ATOM   1026 N  N   . SER A 1 146 ? 64.447 -81.973  214.596 1.00 27.67  ? 146  SER A N   1 
ATOM   1027 C  CA  . SER A 1 146 ? 63.444 -83.013  214.517 1.00 26.59  ? 146  SER A CA  1 
ATOM   1028 C  C   . SER A 1 146 ? 62.799 -83.320  215.845 1.00 27.17  ? 146  SER A C   1 
ATOM   1029 O  O   . SER A 1 146 ? 61.679 -83.842  215.896 1.00 27.84  ? 146  SER A O   1 
ATOM   1030 C  CB  . SER A 1 146 ? 64.057 -84.286  213.928 1.00 28.64  ? 146  SER A CB  1 
ATOM   1031 O  OG  . SER A 1 146 ? 64.885 -84.949  214.869 1.00 33.20  ? 146  SER A OG  1 
ATOM   1032 N  N   . ARG A 1 147 ? 63.495 -82.984  216.922 1.00 27.30  ? 147  ARG A N   1 
ATOM   1033 C  CA  . ARG A 1 147 ? 63.003 -83.257  218.264 1.00 28.54  ? 147  ARG A CA  1 
ATOM   1034 C  C   . ARG A 1 147 ? 63.178 -82.082  219.212 1.00 29.61  ? 147  ARG A C   1 
ATOM   1035 O  O   . ARG A 1 147 ? 63.853 -81.095  218.911 1.00 28.50  ? 147  ARG A O   1 
ATOM   1036 C  CB  . ARG A 1 147 ? 63.769 -84.437  218.871 1.00 30.29  ? 147  ARG A CB  1 
ATOM   1037 C  CG  . ARG A 1 147 ? 63.794 -85.698  218.035 1.00 34.06  ? 147  ARG A CG  1 
ATOM   1038 C  CD  . ARG A 1 147 ? 62.578 -86.547  218.286 1.00 36.91  ? 147  ARG A CD  1 
ATOM   1039 N  NE  . ARG A 1 147 ? 62.603 -87.737  217.445 1.00 43.91  ? 147  ARG A NE  1 
ATOM   1040 C  CZ  . ARG A 1 147 ? 62.415 -87.734  216.128 1.00 45.07  ? 147  ARG A CZ  1 
ATOM   1041 N  NH1 . ARG A 1 147 ? 62.174 -86.596  215.485 1.00 45.42  ? 147  ARG A NH1 1 
ATOM   1042 N  NH2 . ARG A 1 147 ? 62.491 -88.872  215.450 1.00 44.37  ? 147  ARG A NH2 1 
ATOM   1043 N  N   . MET A 1 148 ? 62.571 -82.227  220.382 1.00 30.29  ? 148  MET A N   1 
ATOM   1044 C  CA  . MET A 1 148 ? 62.675 -81.246  221.447 1.00 30.55  ? 148  MET A CA  1 
ATOM   1045 C  C   . MET A 1 148 ? 63.444 -81.991  222.541 1.00 30.18  ? 148  MET A C   1 
ATOM   1046 O  O   . MET A 1 148 ? 63.639 -83.192  222.441 1.00 30.99  ? 148  MET A O   1 
ATOM   1047 C  CB  . MET A 1 148 ? 61.288 -80.878  221.973 1.00 29.54  ? 148  MET A CB  1 
ATOM   1048 C  CG  . MET A 1 148 ? 60.341 -80.257  220.948 1.00 32.11  ? 148  MET A CG  1 
ATOM   1049 S  SD  . MET A 1 148 ? 58.903 -79.506  221.776 1.00 31.74  ? 148  MET A SD  1 
ATOM   1050 C  CE  . MET A 1 148 ? 59.640 -77.938  222.220 1.00 25.07  ? 148  MET A CE  1 
ATOM   1051 N  N   . VAL A 1 149 ? 63.881 -81.287  223.574 1.00 31.50  ? 149  VAL A N   1 
ATOM   1052 C  CA  . VAL A 1 149 ? 64.572 -81.923  224.687 1.00 32.11  ? 149  VAL A CA  1 
ATOM   1053 C  C   . VAL A 1 149 ? 64.228 -81.178  225.968 1.00 32.34  ? 149  VAL A C   1 
ATOM   1054 O  O   . VAL A 1 149 ? 63.888 -80.003  225.940 1.00 35.51  ? 149  VAL A O   1 
ATOM   1055 C  CB  . VAL A 1 149 ? 66.109 -81.891  224.511 1.00 31.80  ? 149  VAL A CB  1 
ATOM   1056 C  CG1 . VAL A 1 149 ? 66.493 -82.462  223.146 1.00 33.47  ? 149  VAL A CG1 1 
ATOM   1057 C  CG2 . VAL A 1 149 ? 66.625 -80.474  224.660 1.00 28.12  ? 149  VAL A CG2 1 
ATOM   1058 N  N   . ILE A 1 150 ? 64.295 -81.877  227.088 1.00 33.90  ? 150  ILE A N   1 
ATOM   1059 C  CA  . ILE A 1 150 ? 64.057 -81.281  228.393 1.00 33.76  ? 150  ILE A CA  1 
ATOM   1060 C  C   . ILE A 1 150 ? 65.267 -81.638  229.243 1.00 36.59  ? 150  ILE A C   1 
ATOM   1061 O  O   . ILE A 1 150 ? 65.470 -82.803  229.572 1.00 38.14  ? 150  ILE A O   1 
ATOM   1062 C  CB  . ILE A 1 150 ? 62.817 -81.854  229.106 1.00 30.51  ? 150  ILE A CB  1 
ATOM   1063 C  CG1 . ILE A 1 150 ? 61.538 -81.377  228.424 1.00 30.13  ? 150  ILE A CG1 1 
ATOM   1064 C  CG2 . ILE A 1 150 ? 62.827 -81.423  230.555 1.00 26.70  ? 150  ILE A CG2 1 
ATOM   1065 C  CD1 . ILE A 1 150 ? 60.268 -81.858  229.090 1.00 25.99  ? 150  ILE A CD1 1 
ATOM   1066 N  N   . SER A 1 151 ? 66.076 -80.641  229.578 1.00 38.51  ? 151  SER A N   1 
ATOM   1067 C  CA  . SER A 1 151 ? 67.248 -80.858  230.406 1.00 40.04  ? 151  SER A CA  1 
ATOM   1068 C  C   . SER A 1 151 ? 67.615 -79.555  231.117 1.00 42.94  ? 151  SER A C   1 
ATOM   1069 O  O   . SER A 1 151 ? 67.041 -78.506  230.836 1.00 44.52  ? 151  SER A O   1 
ATOM   1070 C  CB  . SER A 1 151 ? 68.410 -81.371  229.557 1.00 38.11  ? 151  SER A CB  1 
ATOM   1071 O  OG  . SER A 1 151 ? 68.739 -80.463  228.529 1.00 39.00  ? 151  SER A OG  1 
ATOM   1072 N  N   . ASP A 1 152 ? 68.575 -79.626  232.032 1.00 44.65  ? 152  ASP A N   1 
ATOM   1073 C  CA  . ASP A 1 152 ? 68.993 -78.474  232.821 1.00 46.20  ? 152  ASP A CA  1 
ATOM   1074 C  C   . ASP A 1 152 ? 69.713 -77.311  232.148 1.00 47.22  ? 152  ASP A C   1 
ATOM   1075 O  O   . ASP A 1 152 ? 70.689 -77.493  231.421 1.00 47.60  ? 152  ASP A O   1 
ATOM   1076 C  CB  . ASP A 1 152 ? 69.865 -78.941  233.986 1.00 49.66  ? 152  ASP A CB  1 
ATOM   1077 C  CG  . ASP A 1 152 ? 69.078 -79.656  235.060 1.00 52.30  ? 152  ASP A CG  1 
ATOM   1078 O  OD1 . ASP A 1 152 ? 69.707 -80.146  236.022 1.00 56.33  ? 152  ASP A OD1 1 
ATOM   1079 O  OD2 . ASP A 1 152 ? 67.839 -79.728  234.953 1.00 53.88  ? 152  ASP A OD2 1 
ATOM   1080 N  N   . PHE A 1 153 ? 69.208 -76.111  232.418 1.00 48.04  ? 153  PHE A N   1 
ATOM   1081 C  CA  . PHE A 1 153 ? 69.798 -74.861  231.954 1.00 47.78  ? 153  PHE A CA  1 
ATOM   1082 C  C   . PHE A 1 153 ? 69.602 -73.902  233.124 1.00 48.12  ? 153  PHE A C   1 
ATOM   1083 O  O   . PHE A 1 153 ? 68.475 -73.677  233.567 1.00 46.74  ? 153  PHE A O   1 
ATOM   1084 C  CB  . PHE A 1 153 ? 69.100 -74.297  230.720 1.00 48.48  ? 153  PHE A CB  1 
ATOM   1085 C  CG  . PHE A 1 153 ? 69.656 -72.961  230.280 1.00 49.85  ? 153  PHE A CG  1 
ATOM   1086 C  CD1 . PHE A 1 153 ? 70.976 -72.853  229.842 1.00 48.80  ? 153  PHE A CD1 1 
ATOM   1087 C  CD2 . PHE A 1 153 ? 68.874 -71.805  230.343 1.00 49.19  ? 153  PHE A CD2 1 
ATOM   1088 C  CE1 . PHE A 1 153 ? 71.515 -71.610  229.474 1.00 49.92  ? 153  PHE A CE1 1 
ATOM   1089 C  CE2 . PHE A 1 153 ? 69.401 -70.559  229.979 1.00 49.66  ? 153  PHE A CE2 1 
ATOM   1090 C  CZ  . PHE A 1 153 ? 70.726 -70.461  229.543 1.00 50.41  ? 153  PHE A CZ  1 
ATOM   1091 N  N   . GLU A 1 154 ? 70.701 -73.349  233.631 1.00 49.55  ? 154  GLU A N   1 
ATOM   1092 C  CA  . GLU A 1 154 ? 70.637 -72.445  234.769 1.00 50.74  ? 154  GLU A CA  1 
ATOM   1093 C  C   . GLU A 1 154 ? 70.000 -73.169  235.954 1.00 51.68  ? 154  GLU A C   1 
ATOM   1094 O  O   . GLU A 1 154 ? 69.243 -72.577  236.724 1.00 53.17  ? 154  GLU A O   1 
ATOM   1095 C  CB  . GLU A 1 154 ? 69.818 -71.201  234.422 1.00 52.21  ? 154  GLU A CB  1 
ATOM   1096 C  CG  . GLU A 1 154 ? 70.352 -70.426  233.234 1.00 55.06  ? 154  GLU A CG  1 
ATOM   1097 C  CD  . GLU A 1 154 ? 71.719 -69.827  233.483 1.00 57.10  ? 154  GLU A CD  1 
ATOM   1098 O  OE1 . GLU A 1 154 ? 72.629 -70.560  233.920 1.00 58.70  ? 154  GLU A OE1 1 
ATOM   1099 O  OE2 . GLU A 1 154 ? 71.883 -68.617  233.230 1.00 60.23  ? 154  GLU A OE2 1 
ATOM   1100 N  N   . GLY A 1 155 ? 70.300 -74.461  236.078 1.00 51.54  ? 155  GLY A N   1 
ATOM   1101 C  CA  . GLY A 1 155 ? 69.783 -75.254  237.179 1.00 50.54  ? 155  GLY A CA  1 
ATOM   1102 C  C   . GLY A 1 155 ? 68.320 -75.652  237.140 1.00 50.57  ? 155  GLY A C   1 
ATOM   1103 O  O   . GLY A 1 155 ? 67.787 -76.113  238.147 1.00 52.74  ? 155  GLY A O   1 
ATOM   1104 N  N   . LYS A 1 156 ? 67.661 -75.493  235.997 1.00 49.24  ? 156  LYS A N   1 
ATOM   1105 C  CA  . LYS A 1 156 ? 66.252 -75.859  235.888 1.00 46.29  ? 156  LYS A CA  1 
ATOM   1106 C  C   . LYS A 1 156 ? 65.923 -76.710  234.668 1.00 42.91  ? 156  LYS A C   1 
ATOM   1107 O  O   . LYS A 1 156 ? 66.511 -76.536  233.597 1.00 42.85  ? 156  LYS A O   1 
ATOM   1108 C  CB  . LYS A 1 156 ? 65.374 -74.610  235.825 1.00 47.80  ? 156  LYS A CB  1 
ATOM   1109 C  CG  . LYS A 1 156 ? 65.306 -73.805  237.086 1.00 51.86  ? 156  LYS A CG  1 
ATOM   1110 C  CD  . LYS A 1 156 ? 64.449 -72.572  236.864 1.00 54.29  ? 156  LYS A CD  1 
ATOM   1111 C  CE  . LYS A 1 156 ? 64.481 -71.652  238.073 1.00 57.46  ? 156  LYS A CE  1 
ATOM   1112 N  NZ  . LYS A 1 156 ? 63.963 -70.296  237.740 1.00 59.24  ? 156  LYS A NZ  1 
ATOM   1113 N  N   . PRO A 1 157 ? 64.976 -77.650  234.816 1.00 38.76  ? 157  PRO A N   1 
ATOM   1114 C  CA  . PRO A 1 157 ? 64.607 -78.480  233.670 1.00 35.46  ? 157  PRO A CA  1 
ATOM   1115 C  C   . PRO A 1 157 ? 64.067 -77.486  232.637 1.00 35.31  ? 157  PRO A C   1 
ATOM   1116 O  O   . PRO A 1 157 ? 63.243 -76.634  232.966 1.00 32.91  ? 157  PRO A O   1 
ATOM   1117 C  CB  . PRO A 1 157 ? 63.513 -79.378  234.237 1.00 34.63  ? 157  PRO A CB  1 
ATOM   1118 C  CG  . PRO A 1 157 ? 63.889 -79.495  235.694 1.00 35.42  ? 157  PRO A CG  1 
ATOM   1119 C  CD  . PRO A 1 157 ? 64.278 -78.087  236.039 1.00 37.61  ? 157  PRO A CD  1 
ATOM   1120 N  N   . THR A 1 158 ? 64.528 -77.591  231.397 1.00 35.31  ? 158  THR A N   1 
ATOM   1121 C  CA  . THR A 1 158 ? 64.112 -76.663  230.357 1.00 33.73  ? 158  THR A CA  1 
ATOM   1122 C  C   . THR A 1 158 ? 63.722 -77.372  229.064 1.00 35.51  ? 158  THR A C   1 
ATOM   1123 O  O   . THR A 1 158 ? 64.463 -78.219  228.544 1.00 36.14  ? 158  THR A O   1 
ATOM   1124 C  CB  . THR A 1 158 ? 65.260 -75.663  230.043 1.00 34.17  ? 158  THR A CB  1 
ATOM   1125 O  OG1 . THR A 1 158 ? 65.692 -75.040  231.255 1.00 34.03  ? 158  THR A OG1 1 
ATOM   1126 C  CG2 . THR A 1 158 ? 64.803 -74.588  229.071 1.00 31.84  ? 158  THR A CG2 1 
ATOM   1127 N  N   . LEU A 1 159 ? 62.550 -77.019  228.548 1.00 33.52  ? 159  LEU A N   1 
ATOM   1128 C  CA  . LEU A 1 159 ? 62.075 -77.587  227.303 1.00 31.27  ? 159  LEU A CA  1 
ATOM   1129 C  C   . LEU A 1 159 ? 62.844 -76.808  226.251 1.00 31.63  ? 159  LEU A C   1 
ATOM   1130 O  O   . LEU A 1 159 ? 62.886 -75.573  226.297 1.00 29.76  ? 159  LEU A O   1 
ATOM   1131 C  CB  . LEU A 1 159 ? 60.574 -77.342  227.143 1.00 31.72  ? 159  LEU A CB  1 
ATOM   1132 C  CG  . LEU A 1 159 ? 59.983 -77.811  225.820 1.00 30.42  ? 159  LEU A CG  1 
ATOM   1133 C  CD1 . LEU A 1 159 ? 60.212 -79.310  225.696 1.00 29.70  ? 159  LEU A CD1 1 
ATOM   1134 C  CD2 . LEU A 1 159 ? 58.497 -77.464  225.762 1.00 29.88  ? 159  LEU A CD2 1 
ATOM   1135 N  N   . MET A 1 160 ? 63.461 -77.520  225.312 1.00 30.12  ? 160  MET A N   1 
ATOM   1136 C  CA  . MET A 1 160 ? 64.245 -76.858  224.285 1.00 27.68  ? 160  MET A CA  1 
ATOM   1137 C  C   . MET A 1 160 ? 63.992 -77.430  222.907 1.00 25.85  ? 160  MET A C   1 
ATOM   1138 O  O   . MET A 1 160 ? 63.503 -78.538  222.767 1.00 26.48  ? 160  MET A O   1 
ATOM   1139 C  CB  . MET A 1 160 ? 65.738 -76.994  224.597 1.00 29.06  ? 160  MET A CB  1 
ATOM   1140 C  CG  . MET A 1 160 ? 66.198 -76.456  225.949 1.00 28.44  ? 160  MET A CG  1 
ATOM   1141 S  SD  . MET A 1 160 ? 68.029 -76.496  226.053 1.00 28.95  ? 160  MET A SD  1 
ATOM   1142 C  CE  . MET A 1 160 ? 68.269 -77.048  227.699 1.00 22.54  ? 160  MET A CE  1 
ATOM   1143 N  N   . MET A 1 161 ? 64.314 -76.642  221.893 1.00 24.83  ? 161  MET A N   1 
ATOM   1144 C  CA  . MET A 1 161 ? 64.209 -77.046  220.497 1.00 27.16  ? 161  MET A CA  1 
ATOM   1145 C  C   . MET A 1 161 ? 65.045 -76.006  219.773 1.00 26.61  ? 161  MET A C   1 
ATOM   1146 O  O   . MET A 1 161 ? 65.431 -75.011  220.375 1.00 24.21  ? 161  MET A O   1 
ATOM   1147 C  CB  . MET A 1 161 ? 62.742 -77.076  219.991 1.00 29.56  ? 161  MET A CB  1 
ATOM   1148 C  CG  . MET A 1 161 ? 61.919 -75.773  220.047 1.00 30.92  ? 161  MET A CG  1 
ATOM   1149 S  SD  . MET A 1 161 ? 62.415 -74.523  218.851 1.00 35.93  ? 161  MET A SD  1 
ATOM   1150 C  CE  . MET A 1 161 ? 61.773 -75.145  217.326 1.00 33.76  ? 161  MET A CE  1 
ATOM   1151 N  N   . ARG A 1 162 ? 65.391 -76.231  218.516 1.00 27.32  ? 162  ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 162 ? 66.172 -75.209  217.858 1.00 30.78  ? 162  ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 162 ? 65.871 -75.034  216.395 1.00 30.45  ? 162  ARG A C   1 
ATOM   1154 O  O   . ARG A 1 162 ? 65.290 -75.907  215.754 1.00 27.53  ? 162  ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 162 ? 67.671 -75.423  218.081 1.00 35.76  ? 162  ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 162 ? 68.233 -76.764  217.669 1.00 40.18  ? 162  ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 162 ? 69.731 -76.784  217.927 1.00 44.59  ? 162  ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 162 ? 70.330 -78.070  217.586 1.00 50.25  ? 162  ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 162 ? 71.623 -78.349  217.713 1.00 51.82  ? 162  ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 162 ? 72.462 -77.432  218.177 1.00 52.79  ? 162  ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 162 ? 72.076 -79.548  217.371 1.00 54.00  ? 162  ARG A NH2 1 
ATOM   1162 N  N   . LEU A 1 163 ? 66.253 -73.869  215.888 1.00 31.05  ? 163  LEU A N   1 
ATOM   1163 C  CA  . LEU A 1 163 ? 66.010 -73.523  214.506 1.00 33.85  ? 163  LEU A CA  1 
ATOM   1164 C  C   . LEU A 1 163 ? 67.326 -73.121  213.899 1.00 33.95  ? 163  LEU A C   1 
ATOM   1165 O  O   . LEU A 1 163 ? 68.228 -72.696  214.607 1.00 33.84  ? 163  LEU A O   1 
ATOM   1166 C  CB  . LEU A 1 163 ? 65.058 -72.323  214.397 1.00 36.76  ? 163  LEU A CB  1 
ATOM   1167 C  CG  . LEU A 1 163 ? 63.679 -72.270  215.049 1.00 38.83  ? 163  LEU A CG  1 
ATOM   1168 C  CD1 . LEU A 1 163 ? 63.771 -71.589  216.404 1.00 42.55  ? 163  LEU A CD1 1 
ATOM   1169 C  CD2 . LEU A 1 163 ? 62.754 -71.463  214.165 1.00 42.14  ? 163  LEU A CD2 1 
ATOM   1170 N  N   . ALA A 1 164 ? 67.420 -73.233  212.580 1.00 34.84  ? 164  ALA A N   1 
ATOM   1171 C  CA  . ALA A 1 164 ? 68.627 -72.848  211.873 1.00 36.33  ? 164  ALA A CA  1 
ATOM   1172 C  C   . ALA A 1 164 ? 68.231 -72.128  210.595 1.00 37.38  ? 164  ALA A C   1 
ATOM   1173 O  O   . ALA A 1 164 ? 67.213 -72.453  209.980 1.00 37.28  ? 164  ALA A O   1 
ATOM   1174 C  CB  . ALA A 1 164 ? 69.475 -74.091  211.542 1.00 33.92  ? 164  ALA A CB  1 
ATOM   1175 N  N   . ASN A 1 165 ? 69.030 -71.142  210.207 1.00 38.96  ? 165  ASN A N   1 
ATOM   1176 C  CA  . ASN A 1 165 ? 68.781 -70.399  208.981 1.00 40.75  ? 165  ASN A CA  1 
ATOM   1177 C  C   . ASN A 1 165 ? 69.455 -71.174  207.855 1.00 41.84  ? 165  ASN A C   1 
ATOM   1178 O  O   . ASN A 1 165 ? 70.650 -71.458  207.927 1.00 42.57  ? 165  ASN A O   1 
ATOM   1179 C  CB  . ASN A 1 165 ? 69.396 -69.005  209.065 1.00 41.59  ? 165  ASN A CB  1 
ATOM   1180 C  CG  . ASN A 1 165 ? 69.048 -68.159  207.873 1.00 42.20  ? 165  ASN A CG  1 
ATOM   1181 O  OD1 . ASN A 1 165 ? 68.675 -68.681  206.824 1.00 42.44  ? 165  ASN A OD1 1 
ATOM   1182 N  ND2 . ASN A 1 165 ? 69.167 -66.850  208.018 1.00 44.43  ? 165  ASN A ND2 1 
ATOM   1183 N  N   . LEU A 1 166 ? 68.699 -71.512  206.818 1.00 42.39  ? 166  LEU A N   1 
ATOM   1184 C  CA  . LEU A 1 166 ? 69.252 -72.273  205.702 1.00 42.36  ? 166  LEU A CA  1 
ATOM   1185 C  C   . LEU A 1 166 ? 69.811 -71.425  204.560 1.00 45.31  ? 166  LEU A C   1 
ATOM   1186 O  O   . LEU A 1 166 ? 70.237 -71.963  203.532 1.00 47.15  ? 166  LEU A O   1 
ATOM   1187 C  CB  . LEU A 1 166 ? 68.194 -73.231  205.156 1.00 38.21  ? 166  LEU A CB  1 
ATOM   1188 C  CG  . LEU A 1 166 ? 67.738 -74.342  206.102 1.00 36.56  ? 166  LEU A CG  1 
ATOM   1189 C  CD1 . LEU A 1 166 ? 66.648 -75.158  205.438 1.00 32.95  ? 166  LEU A CD1 1 
ATOM   1190 C  CD2 . LEU A 1 166 ? 68.917 -75.231  206.461 1.00 36.05  ? 166  LEU A CD2 1 
ATOM   1191 N  N   . ARG A 1 167 ? 69.804 -70.106  204.728 1.00 46.16  ? 167  ARG A N   1 
ATOM   1192 C  CA  . ARG A 1 167 ? 70.333 -69.214  203.707 1.00 46.60  ? 167  ARG A CA  1 
ATOM   1193 C  C   . ARG A 1 167 ? 71.495 -68.422  204.280 1.00 47.78  ? 167  ARG A C   1 
ATOM   1194 O  O   . ARG A 1 167 ? 71.673 -68.360  205.492 1.00 48.80  ? 167  ARG A O   1 
ATOM   1195 C  CB  . ARG A 1 167 ? 69.259 -68.246  203.221 1.00 48.03  ? 167  ARG A CB  1 
ATOM   1196 C  CG  . ARG A 1 167 ? 68.097 -68.873  202.465 1.00 49.75  ? 167  ARG A CG  1 
ATOM   1197 C  CD  . ARG A 1 167 ? 67.122 -67.775  202.084 1.00 53.77  ? 167  ARG A CD  1 
ATOM   1198 N  NE  . ARG A 1 167 ? 65.722 -68.184  202.164 1.00 55.92  ? 167  ARG A NE  1 
ATOM   1199 C  CZ  . ARG A 1 167 ? 65.054 -68.756  201.171 1.00 58.29  ? 167  ARG A CZ  1 
ATOM   1200 N  NH1 . ARG A 1 167 ? 65.661 -68.990  200.018 1.00 62.44  ? 167  ARG A NH1 1 
ATOM   1201 N  NH2 . ARG A 1 167 ? 63.779 -69.080  201.324 1.00 58.17  ? 167  ARG A NH2 1 
ATOM   1202 N  N   . ILE A 1 168 ? 72.287 -67.815  203.403 1.00 51.03  ? 168  ILE A N   1 
ATOM   1203 C  CA  . ILE A 1 168 ? 73.441 -67.021  203.824 1.00 52.10  ? 168  ILE A CA  1 
ATOM   1204 C  C   . ILE A 1 168 ? 72.955 -65.672  204.327 1.00 51.22  ? 168  ILE A C   1 
ATOM   1205 O  O   . ILE A 1 168 ? 73.534 -65.095  205.245 1.00 51.79  ? 168  ILE A O   1 
ATOM   1206 C  CB  . ILE A 1 168 ? 74.419 -66.785  202.653 1.00 54.43  ? 168  ILE A CB  1 
ATOM   1207 C  CG1 . ILE A 1 168 ? 74.819 -68.128  202.034 1.00 57.88  ? 168  ILE A CG1 1 
ATOM   1208 C  CG2 . ILE A 1 168 ? 75.652 -66.048  203.144 1.00 53.68  ? 168  ILE A CG2 1 
ATOM   1209 C  CD1 . ILE A 1 168 ? 75.593 -68.008  200.726 1.00 61.03  ? 168  ILE A CD1 1 
ATOM   1210 N  N   . GLU A 1 169 ? 71.895 -65.162  203.712 1.00 50.56  ? 169  GLU A N   1 
ATOM   1211 C  CA  . GLU A 1 169 ? 71.346 -63.884  204.133 1.00 50.39  ? 169  GLU A CA  1 
ATOM   1212 C  C   . GLU A 1 169 ? 70.671 -64.077  205.487 1.00 49.54  ? 169  GLU A C   1 
ATOM   1213 O  O   . GLU A 1 169 ? 70.078 -65.121  205.764 1.00 48.81  ? 169  GLU A O   1 
ATOM   1214 C  CB  . GLU A 1 169 ? 70.341 -63.355  203.110 1.00 52.58  ? 169  GLU A CB  1 
ATOM   1215 C  CG  . GLU A 1 169 ? 70.918 -63.191  201.717 1.00 56.14  ? 169  GLU A CG  1 
ATOM   1216 C  CD  . GLU A 1 169 ? 70.780 -64.449  200.881 1.00 60.29  ? 169  GLU A CD  1 
ATOM   1217 O  OE1 . GLU A 1 169 ? 70.766 -65.560  201.464 1.00 60.72  ? 169  GLU A OE1 1 
ATOM   1218 O  OE2 . GLU A 1 169 ? 70.695 -64.326  199.638 1.00 62.83  ? 169  GLU A OE2 1 
ATOM   1219 N  N   . GLN A 1 170 ? 70.765 -63.057  206.325 1.00 47.84  ? 170  GLN A N   1 
ATOM   1220 C  CA  . GLN A 1 170 ? 70.204 -63.111  207.660 1.00 46.25  ? 170  GLN A CA  1 
ATOM   1221 C  C   . GLN A 1 170 ? 68.774 -62.619  207.745 1.00 43.14  ? 170  GLN A C   1 
ATOM   1222 O  O   . GLN A 1 170 ? 68.316 -61.836  206.921 1.00 42.81  ? 170  GLN A O   1 
ATOM   1223 C  CB  . GLN A 1 170 ? 71.081 -62.291  208.601 1.00 49.67  ? 170  GLN A CB  1 
ATOM   1224 C  CG  . GLN A 1 170 ? 72.551 -62.670  208.515 1.00 53.32  ? 170  GLN A CG  1 
ATOM   1225 C  CD  . GLN A 1 170 ? 73.447 -61.641  209.156 1.00 55.59  ? 170  GLN A CD  1 
ATOM   1226 O  OE1 . GLN A 1 170 ? 73.411 -60.466  208.794 1.00 57.61  ? 170  GLN A OE1 1 
ATOM   1227 N  NE2 . GLN A 1 170 ? 74.259 -62.072  210.116 1.00 59.15  ? 170  GLN A NE2 1 
ATOM   1228 N  N   . ILE A 1 171 ? 68.070 -63.114  208.752 1.00 39.26  ? 171  ILE A N   1 
ATOM   1229 C  CA  . ILE A 1 171 ? 66.699 -62.726  209.005 1.00 37.48  ? 171  ILE A CA  1 
ATOM   1230 C  C   . ILE A 1 171 ? 66.831 -61.867  210.254 1.00 37.92  ? 171  ILE A C   1 
ATOM   1231 O  O   . ILE A 1 171 ? 67.504 -62.257  211.213 1.00 38.37  ? 171  ILE A O   1 
ATOM   1232 C  CB  . ILE A 1 171 ? 65.814 -63.970  209.292 1.00 36.82  ? 171  ILE A CB  1 
ATOM   1233 C  CG1 . ILE A 1 171 ? 65.883 -64.936  208.101 1.00 37.04  ? 171  ILE A CG1 1 
ATOM   1234 C  CG2 . ILE A 1 171 ? 64.380 -63.548  209.561 1.00 32.17  ? 171  ILE A CG2 1 
ATOM   1235 C  CD1 . ILE A 1 171 ? 65.101 -66.226  208.282 1.00 36.62  ? 171  ILE A CD1 1 
ATOM   1236 N  N   . ILE A 1 172 ? 66.207 -60.699  210.250 1.00 37.13  ? 172  ILE A N   1 
ATOM   1237 C  CA  . ILE A 1 172 ? 66.313 -59.809  211.395 1.00 39.78  ? 172  ILE A CA  1 
ATOM   1238 C  C   . ILE A 1 172 ? 64.975 -59.549  212.066 1.00 40.92  ? 172  ILE A C   1 
ATOM   1239 O  O   . ILE A 1 172 ? 63.925 -59.767  211.468 1.00 42.51  ? 172  ILE A O   1 
ATOM   1240 C  CB  . ILE A 1 172 ? 66.921 -58.457  210.971 1.00 40.84  ? 172  ILE A CB  1 
ATOM   1241 C  CG1 . ILE A 1 172 ? 65.919 -57.699  210.091 1.00 38.43  ? 172  ILE A CG1 1 
ATOM   1242 C  CG2 . ILE A 1 172 ? 68.238 -58.700  210.223 1.00 37.08  ? 172  ILE A CG2 1 
ATOM   1243 C  CD1 . ILE A 1 172 ? 66.362 -56.334  209.685 1.00 38.03  ? 172  ILE A CD1 1 
ATOM   1244 N  N   . GLU A 1 173 ? 65.019 -59.060  213.303 1.00 42.27  ? 173  GLU A N   1 
ATOM   1245 C  CA  . GLU A 1 173 ? 63.797 -58.777  214.047 1.00 44.11  ? 173  GLU A CA  1 
ATOM   1246 C  C   . GLU A 1 173 ? 62.944 -60.034  214.091 1.00 41.96  ? 173  GLU A C   1 
ATOM   1247 O  O   . GLU A 1 173 ? 61.732 -59.999  213.913 1.00 39.44  ? 173  GLU A O   1 
ATOM   1248 C  CB  . GLU A 1 173 ? 63.027 -57.643  213.380 1.00 48.95  ? 173  GLU A CB  1 
ATOM   1249 C  CG  . GLU A 1 173 ? 63.597 -56.270  213.674 1.00 56.77  ? 173  GLU A CG  1 
ATOM   1250 C  CD  . GLU A 1 173 ? 63.159 -55.235  212.661 1.00 61.14  ? 173  GLU A CD  1 
ATOM   1251 O  OE1 . GLU A 1 173 ? 61.933 -55.117  212.421 1.00 64.16  ? 173  GLU A OE1 1 
ATOM   1252 O  OE2 . GLU A 1 173 ? 64.044 -54.541  212.109 1.00 62.45  ? 173  GLU A OE2 1 
ATOM   1253 N  N   . ALA A 1 174 ? 63.615 -61.149  214.333 1.00 40.79  ? 174  ALA A N   1 
ATOM   1254 C  CA  . ALA A 1 174 ? 62.976 -62.444  214.403 1.00 38.49  ? 174  ALA A CA  1 
ATOM   1255 C  C   . ALA A 1 174 ? 62.472 -62.730  215.811 1.00 36.97  ? 174  ALA A C   1 
ATOM   1256 O  O   . ALA A 1 174 ? 63.030 -62.254  216.803 1.00 35.32  ? 174  ALA A O   1 
ATOM   1257 C  CB  . ALA A 1 174 ? 63.969 -63.520  213.977 1.00 36.36  ? 174  ALA A CB  1 
ATOM   1258 N  N   . ASP A 1 175 ? 61.395 -63.489  215.895 1.00 33.86  ? 175  ASP A N   1 
ATOM   1259 C  CA  . ASP A 1 175 ? 60.873 -63.864  217.190 1.00 36.07  ? 175  ASP A CA  1 
ATOM   1260 C  C   . ASP A 1 175 ? 60.185 -65.205  217.044 1.00 34.04  ? 175  ASP A C   1 
ATOM   1261 O  O   . ASP A 1 175 ? 59.797 -65.614  215.947 1.00 32.76  ? 175  ASP A O   1 
ATOM   1262 C  CB  . ASP A 1 175 ? 59.937 -62.796  217.755 1.00 41.08  ? 175  ASP A CB  1 
ATOM   1263 C  CG  . ASP A 1 175 ? 58.728 -62.571  216.903 1.00 45.16  ? 175  ASP A CG  1 
ATOM   1264 O  OD1 . ASP A 1 175 ? 58.861 -62.602  215.666 1.00 47.48  ? 175  ASP A OD1 1 
ATOM   1265 O  OD2 . ASP A 1 175 ? 57.643 -62.345  217.475 1.00 50.79  ? 175  ASP A OD2 1 
ATOM   1266 N  N   . VAL A 1 176 ? 60.065 -65.909  218.151 1.00 30.94  ? 176  VAL A N   1 
ATOM   1267 C  CA  . VAL A 1 176 ? 59.475 -67.220  218.091 1.00 31.92  ? 176  VAL A CA  1 
ATOM   1268 C  C   . VAL A 1 176 ? 58.421 -67.412  219.144 1.00 32.56  ? 176  VAL A C   1 
ATOM   1269 O  O   . VAL A 1 176 ? 58.420 -66.756  220.186 1.00 29.59  ? 176  VAL A O   1 
ATOM   1270 C  CB  . VAL A 1 176 ? 60.579 -68.336  218.235 1.00 31.12  ? 176  VAL A CB  1 
ATOM   1271 C  CG1 . VAL A 1 176 ? 61.337 -68.156  219.540 1.00 30.67  ? 176  VAL A CG1 1 
ATOM   1272 C  CG2 . VAL A 1 176 ? 59.961 -69.715  218.195 1.00 29.05  ? 176  VAL A CG2 1 
ATOM   1273 N  N   . HIS A 1 177 ? 57.519 -68.331  218.847 1.00 36.77  ? 177  HIS A N   1 
ATOM   1274 C  CA  . HIS A 1 177 ? 56.443 -68.689  219.749 1.00 40.85  ? 177  HIS A CA  1 
ATOM   1275 C  C   . HIS A 1 177 ? 56.359 -70.178  220.046 1.00 39.45  ? 177  HIS A C   1 
ATOM   1276 O  O   . HIS A 1 177 ? 56.254 -70.982  219.121 1.00 41.60  ? 177  HIS A O   1 
ATOM   1277 C  CB  . HIS A 1 177 ? 55.131 -68.241  219.158 1.00 47.90  ? 177  HIS A CB  1 
ATOM   1278 C  CG  . HIS A 1 177 ? 54.675 -66.937  219.696 1.00 54.14  ? 177  HIS A CG  1 
ATOM   1279 N  ND1 . HIS A 1 177 ? 53.497 -66.800  220.395 1.00 58.38  ? 177  HIS A ND1 1 
ATOM   1280 C  CD2 . HIS A 1 177 ? 55.274 -65.724  219.712 1.00 57.60  ? 177  HIS A CD2 1 
ATOM   1281 C  CE1 . HIS A 1 177 ? 53.391 -65.554  220.823 1.00 60.76  ? 177  HIS A CE1 1 
ATOM   1282 N  NE2 . HIS A 1 177 ? 54.457 -64.882  220.424 1.00 59.37  ? 177  HIS A NE2 1 
ATOM   1283 N  N   . LEU A 1 178 ? 56.411 -70.549  221.322 1.00 35.00  ? 178  LEU A N   1 
ATOM   1284 C  CA  . LEU A 1 178 ? 56.303 -71.949  221.700 1.00 32.11  ? 178  LEU A CA  1 
ATOM   1285 C  C   . LEU A 1 178 ? 54.984 -72.105  222.467 1.00 31.63  ? 178  LEU A C   1 
ATOM   1286 O  O   . LEU A 1 178 ? 54.826 -71.605  223.587 1.00 33.31  ? 178  LEU A O   1 
ATOM   1287 C  CB  . LEU A 1 178 ? 57.499 -72.356  222.561 1.00 32.17  ? 178  LEU A CB  1 
ATOM   1288 C  CG  . LEU A 1 178 ? 57.576 -73.849  222.871 1.00 32.92  ? 178  LEU A CG  1 
ATOM   1289 C  CD1 . LEU A 1 178 ? 57.641 -74.646  221.573 1.00 32.61  ? 178  LEU A CD1 1 
ATOM   1290 C  CD2 . LEU A 1 178 ? 58.786 -74.118  223.736 1.00 32.26  ? 178  LEU A CD2 1 
ATOM   1291 N  N   . VAL A 1 179 ? 54.025 -72.776  221.844 1.00 28.65  ? 179  VAL A N   1 
ATOM   1292 C  CA  . VAL A 1 179 ? 52.711 -72.963  222.440 1.00 28.20  ? 179  VAL A CA  1 
ATOM   1293 C  C   . VAL A 1 179 ? 52.386 -74.432  222.730 1.00 29.25  ? 179  VAL A C   1 
ATOM   1294 O  O   . VAL A 1 179 ? 52.545 -75.301  221.873 1.00 29.62  ? 179  VAL A O   1 
ATOM   1295 C  CB  . VAL A 1 179 ? 51.606 -72.398  221.500 1.00 29.65  ? 179  VAL A CB  1 
ATOM   1296 C  CG1 . VAL A 1 179 ? 50.266 -72.457  222.172 1.00 29.84  ? 179  VAL A CG1 1 
ATOM   1297 C  CG2 . VAL A 1 179 ? 51.914 -70.970  221.122 1.00 28.51  ? 179  VAL A CG2 1 
ATOM   1298 N  N   . LEU A 1 180 ? 51.942 -74.697  223.952 1.00 29.70  ? 180  LEU A N   1 
ATOM   1299 C  CA  . LEU A 1 180 ? 51.531 -76.038  224.366 1.00 28.90  ? 180  LEU A CA  1 
ATOM   1300 C  C   . LEU A 1 180 ? 50.056 -76.198  223.979 1.00 30.36  ? 180  LEU A C   1 
ATOM   1301 O  O   . LEU A 1 180 ? 49.270 -75.259  224.120 1.00 32.15  ? 180  LEU A O   1 
ATOM   1302 C  CB  . LEU A 1 180 ? 51.655 -76.190  225.891 1.00 26.72  ? 180  LEU A CB  1 
ATOM   1303 C  CG  . LEU A 1 180 ? 50.817 -77.309  226.541 1.00 29.12  ? 180  LEU A CG  1 
ATOM   1304 C  CD1 . LEU A 1 180 ? 51.345 -78.671  226.121 1.00 27.61  ? 180  LEU A CD1 1 
ATOM   1305 C  CD2 . LEU A 1 180 ? 50.835 -77.191  228.049 1.00 23.42  ? 180  LEU A CD2 1 
ATOM   1306 N  N   . VAL A 1 181 ? 49.677 -77.365  223.480 1.00 31.10  ? 181  VAL A N   1 
ATOM   1307 C  CA  . VAL A 1 181 ? 48.279 -77.611  223.140 1.00 32.61  ? 181  VAL A CA  1 
ATOM   1308 C  C   . VAL A 1 181 ? 47.865 -78.940  223.732 1.00 34.49  ? 181  VAL A C   1 
ATOM   1309 O  O   . VAL A 1 181 ? 48.382 -79.986  223.336 1.00 33.98  ? 181  VAL A O   1 
ATOM   1310 C  CB  . VAL A 1 181 ? 48.037 -77.719  221.643 1.00 33.71  ? 181  VAL A CB  1 
ATOM   1311 C  CG1 . VAL A 1 181 ? 46.538 -77.735  221.387 1.00 32.16  ? 181  VAL A CG1 1 
ATOM   1312 C  CG2 . VAL A 1 181 ? 48.711 -76.575  220.910 1.00 36.04  ? 181  VAL A CG2 1 
ATOM   1313 N  N   . ARG A 1 182 ? 46.933 -78.909  224.674 1.00 35.47  ? 182  ARG A N   1 
ATOM   1314 C  CA  . ARG A 1 182 ? 46.482 -80.137  225.293 1.00 37.79  ? 182  ARG A CA  1 
ATOM   1315 C  C   . ARG A 1 182 ? 45.004 -80.125  225.660 1.00 40.28  ? 182  ARG A C   1 
ATOM   1316 O  O   . ARG A 1 182 ? 44.359 -79.071  225.702 1.00 38.86  ? 182  ARG A O   1 
ATOM   1317 C  CB  . ARG A 1 182 ? 47.307 -80.426  226.544 1.00 38.83  ? 182  ARG A CB  1 
ATOM   1318 C  CG  . ARG A 1 182 ? 47.030 -79.506  227.699 1.00 39.23  ? 182  ARG A CG  1 
ATOM   1319 C  CD  . ARG A 1 182 ? 47.966 -79.825  228.846 1.00 40.76  ? 182  ARG A CD  1 
ATOM   1320 N  NE  . ARG A 1 182 ? 47.879 -78.824  229.907 1.00 41.32  ? 182  ARG A NE  1 
ATOM   1321 C  CZ  . ARG A 1 182 ? 48.777 -78.684  230.873 1.00 40.91  ? 182  ARG A CZ  1 
ATOM   1322 N  NH1 . ARG A 1 182 ? 49.838 -79.483  230.921 1.00 41.01  ? 182  ARG A NH1 1 
ATOM   1323 N  NH2 . ARG A 1 182 ? 48.620 -77.735  231.781 1.00 40.45  ? 182  ARG A NH2 1 
ATOM   1324 N  N   . SER A 1 183 ? 44.481 -81.317  225.932 1.00 41.50  ? 183  SER A N   1 
ATOM   1325 C  CA  . SER A 1 183 ? 43.090 -81.482  226.310 1.00 41.31  ? 183  SER A CA  1 
ATOM   1326 C  C   . SER A 1 183 ? 42.981 -81.331  227.811 1.00 41.23  ? 183  SER A C   1 
ATOM   1327 O  O   . SER A 1 183 ? 43.791 -81.872  228.559 1.00 41.11  ? 183  SER A O   1 
ATOM   1328 C  CB  . SER A 1 183 ? 42.595 -82.866  225.905 1.00 39.91  ? 183  SER A CB  1 
ATOM   1329 O  OG  . SER A 1 183 ? 42.729 -83.055  224.510 1.00 44.10  ? 183  SER A OG  1 
ATOM   1330 N  N   . GLU A 1 184 ? 41.972 -80.591  228.243 1.00 41.98  ? 184  GLU A N   1 
ATOM   1331 C  CA  . GLU A 1 184 ? 41.737 -80.369  229.652 1.00 43.40  ? 184  GLU A CA  1 
ATOM   1332 C  C   . GLU A 1 184 ? 40.247 -80.504  229.962 1.00 44.43  ? 184  GLU A C   1 
ATOM   1333 O  O   . GLU A 1 184 ? 39.414 -80.569  229.052 1.00 43.89  ? 184  GLU A O   1 
ATOM   1334 C  CB  . GLU A 1 184 ? 42.270 -78.994  230.038 1.00 44.38  ? 184  GLU A CB  1 
ATOM   1335 C  CG  . GLU A 1 184 ? 43.795 -78.958  230.099 1.00 47.66  ? 184  GLU A CG  1 
ATOM   1336 C  CD  . GLU A 1 184 ? 44.361 -77.560  230.321 1.00 51.66  ? 184  GLU A CD  1 
ATOM   1337 O  OE1 . GLU A 1 184 ? 43.596 -76.672  230.766 1.00 52.62  ? 184  GLU A OE1 1 
ATOM   1338 O  OE2 . GLU A 1 184 ? 45.576 -77.354  230.059 1.00 49.10  ? 184  GLU A OE2 1 
ATOM   1339 N  N   . ILE A 1 185 ? 39.915 -80.571  231.245 1.00 44.58  ? 185  ILE A N   1 
ATOM   1340 C  CA  . ILE A 1 185 ? 38.527 -80.715  231.670 1.00 46.10  ? 185  ILE A CA  1 
ATOM   1341 C  C   . ILE A 1 185 ? 38.110 -79.524  232.528 1.00 46.31  ? 185  ILE A C   1 
ATOM   1342 O  O   . ILE A 1 185 ? 38.727 -79.241  233.557 1.00 46.59  ? 185  ILE A O   1 
ATOM   1343 C  CB  . ILE A 1 185 ? 38.340 -82.018  232.487 1.00 47.13  ? 185  ILE A CB  1 
ATOM   1344 C  CG1 . ILE A 1 185 ? 38.782 -83.224  231.653 1.00 49.40  ? 185  ILE A CG1 1 
ATOM   1345 C  CG2 . ILE A 1 185 ? 36.888 -82.181  232.897 1.00 46.76  ? 185  ILE A CG2 1 
ATOM   1346 C  CD1 . ILE A 1 185 ? 38.799 -84.539  232.425 1.00 50.73  ? 185  ILE A CD1 1 
ATOM   1347 N  N   . SER A 1 186 ? 37.065 -78.821  232.114 1.00 46.07  ? 186  SER A N   1 
ATOM   1348 C  CA  . SER A 1 186 ? 36.620 -77.673  232.889 1.00 49.51  ? 186  SER A CA  1 
ATOM   1349 C  C   . SER A 1 186 ? 35.851 -78.131  234.119 1.00 51.27  ? 186  SER A C   1 
ATOM   1350 O  O   . SER A 1 186 ? 35.591 -79.323  234.290 1.00 50.99  ? 186  SER A O   1 
ATOM   1351 C  CB  . SER A 1 186 ? 35.729 -76.761  232.038 1.00 50.13  ? 186  SER A CB  1 
ATOM   1352 O  OG  . SER A 1 186 ? 34.507 -77.388  231.698 1.00 46.96  ? 186  SER A OG  1 
ATOM   1353 N  N   . GLN A 1 187 ? 35.497 -77.180  234.978 1.00 52.86  ? 187  GLN A N   1 
ATOM   1354 C  CA  . GLN A 1 187 ? 34.729 -77.490  236.179 1.00 54.92  ? 187  GLN A CA  1 
ATOM   1355 C  C   . GLN A 1 187 ? 33.363 -78.019  235.749 1.00 55.65  ? 187  GLN A C   1 
ATOM   1356 O  O   . GLN A 1 187 ? 32.836 -78.960  236.336 1.00 56.36  ? 187  GLN A O   1 
ATOM   1357 C  CB  . GLN A 1 187 ? 34.542 -76.237  237.033 1.00 56.13  ? 187  GLN A CB  1 
ATOM   1358 C  CG  . GLN A 1 187 ? 35.807 -75.740  237.697 1.00 59.09  ? 187  GLN A CG  1 
ATOM   1359 C  CD  . GLN A 1 187 ? 35.563 -74.489  238.510 1.00 61.11  ? 187  GLN A CD  1 
ATOM   1360 O  OE1 . GLN A 1 187 ? 34.519 -74.351  239.158 1.00 62.60  ? 187  GLN A OE1 1 
ATOM   1361 N  NE2 . GLN A 1 187 ? 36.526 -73.571  238.494 1.00 61.55  ? 187  GLN A NE2 1 
ATOM   1362 N  N   . GLU A 1 188 ? 32.798 -77.407  234.715 1.00 54.44  ? 188  GLU A N   1 
ATOM   1363 C  CA  . GLU A 1 188 ? 31.507 -77.827  234.204 1.00 54.33  ? 188  GLU A CA  1 
ATOM   1364 C  C   . GLU A 1 188 ? 31.636 -79.195  233.535 1.00 55.14  ? 188  GLU A C   1 
ATOM   1365 O  O   . GLU A 1 188 ? 30.740 -79.643  232.812 1.00 56.25  ? 188  GLU A O   1 
ATOM   1366 C  CB  . GLU A 1 188 ? 30.981 -76.797  233.207 1.00 53.91  ? 188  GLU A CB  1 
ATOM   1367 C  CG  . GLU A 1 188 ? 30.899 -75.387  233.766 1.00 54.40  ? 188  GLU A CG  1 
ATOM   1368 C  CD  . GLU A 1 188 ? 32.265 -74.781  234.050 1.00 54.07  ? 188  GLU A CD  1 
ATOM   1369 O  OE1 . GLU A 1 188 ? 33.157 -74.884  233.182 1.00 54.97  ? 188  GLU A OE1 1 
ATOM   1370 O  OE2 . GLU A 1 188 ? 32.443 -74.190  235.133 1.00 53.03  ? 188  GLU A OE2 1 
ATOM   1371 N  N   . GLY A 1 189 ? 32.762 -79.854  233.780 1.00 54.62  ? 189  GLY A N   1 
ATOM   1372 C  CA  . GLY A 1 189 ? 32.988 -81.168  233.212 1.00 55.89  ? 189  GLY A CA  1 
ATOM   1373 C  C   . GLY A 1 189 ? 33.061 -81.218  231.701 1.00 56.14  ? 189  GLY A C   1 
ATOM   1374 O  O   . GLY A 1 189 ? 32.664 -82.207  231.091 1.00 56.29  ? 189  GLY A O   1 
ATOM   1375 N  N   . MET A 1 190 ? 33.567 -80.157  231.086 1.00 57.78  ? 190  MET A N   1 
ATOM   1376 C  CA  . MET A 1 190 ? 33.687 -80.125  229.636 1.00 58.37  ? 190  MET A CA  1 
ATOM   1377 C  C   . MET A 1 190 ? 35.136 -80.375  229.226 1.00 58.30  ? 190  MET A C   1 
ATOM   1378 O  O   . MET A 1 190 ? 36.073 -79.920  229.889 1.00 57.64  ? 190  MET A O   1 
ATOM   1379 C  CB  . MET A 1 190 ? 33.235 -78.772  229.087 1.00 60.24  ? 190  MET A CB  1 
ATOM   1380 C  CG  . MET A 1 190 ? 32.946 -78.803  227.598 1.00 64.49  ? 190  MET A CG  1 
ATOM   1381 S  SD  . MET A 1 190 ? 33.278 -77.242  226.755 1.00 69.10  ? 190  MET A SD  1 
ATOM   1382 C  CE  . MET A 1 190 ? 33.903 -77.854  225.136 1.00 67.90  ? 190  MET A CE  1 
ATOM   1383 N  N   . VAL A 1 191 ? 35.311 -81.108  228.133 1.00 57.52  ? 191  VAL A N   1 
ATOM   1384 C  CA  . VAL A 1 191 ? 36.634 -81.420  227.610 1.00 58.18  ? 191  VAL A CA  1 
ATOM   1385 C  C   . VAL A 1 191 ? 36.930 -80.547  226.400 1.00 57.47  ? 191  VAL A C   1 
ATOM   1386 O  O   . VAL A 1 191 ? 36.213 -80.596  225.401 1.00 57.94  ? 191  VAL A O   1 
ATOM   1387 C  CB  . VAL A 1 191 ? 36.725 -82.887  227.182 1.00 59.73  ? 191  VAL A CB  1 
ATOM   1388 C  CG1 . VAL A 1 191 ? 36.978 -83.762  228.397 1.00 60.03  ? 191  VAL A CG1 1 
ATOM   1389 C  CG2 . VAL A 1 191 ? 35.426 -83.302  226.493 1.00 61.97  ? 191  VAL A CG2 1 
ATOM   1390 N  N   . PHE A 1 192 ? 37.993 -79.754  226.491 1.00 55.08  ? 192  PHE A N   1 
ATOM   1391 C  CA  . PHE A 1 192 ? 38.366 -78.860  225.400 1.00 52.69  ? 192  PHE A CA  1 
ATOM   1392 C  C   . PHE A 1 192 ? 39.885 -78.766  225.240 1.00 52.07  ? 192  PHE A C   1 
ATOM   1393 O  O   . PHE A 1 192 ? 40.642 -79.147  226.131 1.00 51.34  ? 192  PHE A O   1 
ATOM   1394 C  CB  . PHE A 1 192 ? 37.786 -77.472  225.673 1.00 49.36  ? 192  PHE A CB  1 
ATOM   1395 C  CG  . PHE A 1 192 ? 38.371 -76.805  226.884 1.00 47.03  ? 192  PHE A CG  1 
ATOM   1396 C  CD1 . PHE A 1 192 ? 39.319 -75.792  226.746 1.00 46.75  ? 192  PHE A CD1 1 
ATOM   1397 C  CD2 . PHE A 1 192 ? 38.010 -77.214  228.162 1.00 45.08  ? 192  PHE A CD2 1 
ATOM   1398 C  CE1 . PHE A 1 192 ? 39.904 -75.196  227.865 1.00 44.07  ? 192  PHE A CE1 1 
ATOM   1399 C  CE2 . PHE A 1 192 ? 38.591 -76.625  229.291 1.00 45.02  ? 192  PHE A CE2 1 
ATOM   1400 C  CZ  . PHE A 1 192 ? 39.539 -75.614  229.140 1.00 43.37  ? 192  PHE A CZ  1 
ATOM   1401 N  N   . ARG A 1 193 ? 40.326 -78.265  224.094 1.00 52.10  ? 193  ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 193 ? 41.749 -78.106  223.833 1.00 51.77  ? 193  ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 193 ? 42.105 -76.666  224.150 1.00 52.05  ? 193  ARG A C   1 
ATOM   1404 O  O   . ARG A 1 193 ? 41.465 -75.742  223.650 1.00 53.18  ? 193  ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 193 ? 42.052 -78.414  222.373 1.00 51.67  ? 193  ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 193 ? 41.746 -79.846  221.986 1.00 50.38  ? 193  ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 193 ? 42.816 -80.766  222.492 1.00 50.79  ? 193  ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 193 ? 44.027 -80.645  221.691 1.00 50.20  ? 193  ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 193 ? 45.163 -81.282  221.954 1.00 50.03  ? 193  ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 193 ? 45.252 -82.087  223.004 1.00 49.87  ? 193  ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 193 ? 46.208 -81.120  221.160 1.00 50.29  ? 193  ARG A NH2 1 
ATOM   1412 N  N   . ARG A 1 194 ? 43.116 -76.483  224.993 1.00 51.64  ? 194  ARG A N   1 
ATOM   1413 C  CA  . ARG A 1 194 ? 43.550 -75.156  225.407 1.00 52.39  ? 194  ARG A CA  1 
ATOM   1414 C  C   . ARG A 1 194 ? 45.000 -74.856  225.025 1.00 51.89  ? 194  ARG A C   1 
ATOM   1415 O  O   . ARG A 1 194 ? 45.892 -75.690  225.207 1.00 51.59  ? 194  ARG A O   1 
ATOM   1416 C  CB  . ARG A 1 194 ? 43.387 -75.007  226.919 1.00 54.79  ? 194  ARG A CB  1 
ATOM   1417 C  CG  . ARG A 1 194 ? 44.119 -73.815  227.505 1.00 58.54  ? 194  ARG A CG  1 
ATOM   1418 C  CD  . ARG A 1 194 ? 44.011 -73.796  229.022 1.00 63.30  ? 194  ARG A CD  1 
ATOM   1419 N  NE  . ARG A 1 194 ? 42.702 -73.337  229.488 1.00 65.90  ? 194  ARG A NE  1 
ATOM   1420 C  CZ  . ARG A 1 194 ? 42.272 -73.464  230.741 1.00 66.90  ? 194  ARG A CZ  1 
ATOM   1421 N  NH1 . ARG A 1 194 ? 43.042 -74.041  231.654 1.00 67.42  ? 194  ARG A NH1 1 
ATOM   1422 N  NH2 . ARG A 1 194 ? 41.076 -73.004  231.088 1.00 67.37  ? 194  ARG A NH2 1 
ATOM   1423 N  N   . PHE A 1 195 ? 45.222 -73.650  224.504 1.00 49.99  ? 195  PHE A N   1 
ATOM   1424 C  CA  . PHE A 1 195 ? 46.547 -73.205  224.099 1.00 46.10  ? 195  PHE A CA  1 
ATOM   1425 C  C   . PHE A 1 195 ? 47.239 -72.520  225.267 1.00 43.19  ? 195  PHE A C   1 
ATOM   1426 O  O   . PHE A 1 195 ? 46.604 -71.790  226.015 1.00 41.58  ? 195  PHE A O   1 
ATOM   1427 C  CB  . PHE A 1 195 ? 46.442 -72.217  222.936 1.00 48.74  ? 195  PHE A CB  1 
ATOM   1428 C  CG  . PHE A 1 195 ? 46.103 -72.853  221.621 1.00 52.89  ? 195  PHE A CG  1 
ATOM   1429 C  CD1 . PHE A 1 195 ? 44.952 -73.632  221.477 1.00 54.95  ? 195  PHE A CD1 1 
ATOM   1430 C  CD2 . PHE A 1 195 ? 46.937 -72.671  220.515 1.00 53.92  ? 195  PHE A CD2 1 
ATOM   1431 C  CE1 . PHE A 1 195 ? 44.635 -74.227  220.246 1.00 54.88  ? 195  PHE A CE1 1 
ATOM   1432 C  CE2 . PHE A 1 195 ? 46.633 -73.260  219.279 1.00 55.02  ? 195  PHE A CE2 1 
ATOM   1433 C  CZ  . PHE A 1 195 ? 45.479 -74.039  219.146 1.00 55.23  ? 195  PHE A CZ  1 
ATOM   1434 N  N   . HIS A 1 196 ? 48.537 -72.773  225.422 1.00 40.92  ? 196  HIS A N   1 
ATOM   1435 C  CA  . HIS A 1 196 ? 49.334 -72.149  226.473 1.00 40.10  ? 196  HIS A CA  1 
ATOM   1436 C  C   . HIS A 1 196 ? 50.605 -71.612  225.854 1.00 40.34  ? 196  HIS A C   1 
ATOM   1437 O  O   . HIS A 1 196 ? 51.486 -72.390  225.498 1.00 42.61  ? 196  HIS A O   1 
ATOM   1438 C  CB  . HIS A 1 196 ? 49.747 -73.151  227.534 1.00 38.96  ? 196  HIS A CB  1 
ATOM   1439 C  CG  . HIS A 1 196 ? 48.616 -73.682  228.344 1.00 38.76  ? 196  HIS A CG  1 
ATOM   1440 N  ND1 . HIS A 1 196 ? 48.318 -73.205  229.601 1.00 41.43  ? 196  HIS A ND1 1 
ATOM   1441 C  CD2 . HIS A 1 196 ? 47.739 -74.683  228.102 1.00 38.01  ? 196  HIS A CD2 1 
ATOM   1442 C  CE1 . HIS A 1 196 ? 47.309 -73.894  230.102 1.00 40.05  ? 196  HIS A CE1 1 
ATOM   1443 N  NE2 . HIS A 1 196 ? 46.939 -74.796  229.212 1.00 41.58  ? 196  HIS A NE2 1 
ATOM   1444 N  N   . ASP A 1 197 ? 50.705 -70.298  225.705 1.00 42.69  ? 197  ASP A N   1 
ATOM   1445 C  CA  . ASP A 1 197 ? 51.919 -69.722  225.152 1.00 44.05  ? 197  ASP A CA  1 
ATOM   1446 C  C   . ASP A 1 197 ? 52.953 -69.933  226.249 1.00 41.46  ? 197  ASP A C   1 
ATOM   1447 O  O   . ASP A 1 197 ? 52.684 -69.635  227.398 1.00 44.18  ? 197  ASP A O   1 
ATOM   1448 C  CB  . ASP A 1 197 ? 51.759 -68.220  224.863 1.00 48.39  ? 197  ASP A CB  1 
ATOM   1449 C  CG  . ASP A 1 197 ? 52.856 -67.689  223.928 1.00 57.21  ? 197  ASP A CG  1 
ATOM   1450 O  OD1 . ASP A 1 197 ? 54.027 -68.095  224.090 1.00 60.90  ? 197  ASP A OD1 1 
ATOM   1451 O  OD2 . ASP A 1 197 ? 52.567 -66.872  223.028 1.00 60.53  ? 197  ASP A OD2 1 
ATOM   1452 N  N   . LEU A 1 198 ? 54.124 -70.452  225.894 1.00 38.92  ? 198  LEU A N   1 
ATOM   1453 C  CA  . LEU A 1 198 ? 55.162 -70.725  226.881 1.00 35.52  ? 198  LEU A CA  1 
ATOM   1454 C  C   . LEU A 1 198 ? 56.223 -69.626  227.000 1.00 33.18  ? 198  LEU A C   1 
ATOM   1455 O  O   . LEU A 1 198 ? 56.763 -69.135  226.004 1.00 31.26  ? 198  LEU A O   1 
ATOM   1456 C  CB  . LEU A 1 198 ? 55.832 -72.060  226.559 1.00 35.49  ? 198  LEU A CB  1 
ATOM   1457 C  CG  . LEU A 1 198 ? 54.922 -73.291  226.496 1.00 35.03  ? 198  LEU A CG  1 
ATOM   1458 C  CD1 . LEU A 1 198 ? 55.702 -74.447  225.918 1.00 37.52  ? 198  LEU A CD1 1 
ATOM   1459 C  CD2 . LEU A 1 198 ? 54.397 -73.658  227.878 1.00 32.32  ? 198  LEU A CD2 1 
ATOM   1460 N  N   . THR A 1 199 ? 56.502 -69.242  228.238 1.00 30.08  ? 199  THR A N   1 
ATOM   1461 C  CA  . THR A 1 199 ? 57.494 -68.226  228.528 1.00 31.13  ? 199  THR A CA  1 
ATOM   1462 C  C   . THR A 1 199 ? 58.880 -68.726  228.104 1.00 31.46  ? 199  THR A C   1 
ATOM   1463 O  O   . THR A 1 199 ? 59.345 -69.757  228.589 1.00 30.01  ? 199  THR A O   1 
ATOM   1464 C  CB  . THR A 1 199 ? 57.507 -67.910  230.050 1.00 32.42  ? 199  THR A CB  1 
ATOM   1465 O  OG1 . THR A 1 199 ? 56.255 -67.318  230.424 1.00 34.32  ? 199  THR A OG1 1 
ATOM   1466 C  CG2 . THR A 1 199 ? 58.644 -66.964  230.406 1.00 26.19  ? 199  THR A CG2 1 
ATOM   1467 N  N   . LEU A 1 200 ? 59.530 -67.997  227.201 1.00 29.90  ? 200  LEU A N   1 
ATOM   1468 C  CA  . LEU A 1 200 ? 60.861 -68.366  226.738 1.00 29.99  ? 200  LEU A CA  1 
ATOM   1469 C  C   . LEU A 1 200 ? 61.913 -67.551  227.480 1.00 33.09  ? 200  LEU A C   1 
ATOM   1470 O  O   . LEU A 1 200 ? 61.625 -66.487  228.010 1.00 32.56  ? 200  LEU A O   1 
ATOM   1471 C  CB  . LEU A 1 200 ? 61.011 -68.092  225.247 1.00 26.21  ? 200  LEU A CB  1 
ATOM   1472 C  CG  . LEU A 1 200 ? 59.908 -68.613  224.326 1.00 29.16  ? 200  LEU A CG  1 
ATOM   1473 C  CD1 . LEU A 1 200 ? 60.298 -68.330  222.899 1.00 24.45  ? 200  LEU A CD1 1 
ATOM   1474 C  CD2 . LEU A 1 200 ? 59.686 -70.115  224.533 1.00 28.41  ? 200  LEU A CD2 1 
ATOM   1475 N  N   . THR A 1 201 ? 63.139 -68.054  227.529 1.00 36.88  ? 201  THR A N   1 
ATOM   1476 C  CA  . THR A 1 201 ? 64.203 -67.306  228.182 1.00 35.77  ? 201  THR A CA  1 
ATOM   1477 C  C   . THR A 1 201 ? 64.468 -66.115  227.275 1.00 34.40  ? 201  THR A C   1 
ATOM   1478 O  O   . THR A 1 201 ? 64.845 -65.047  227.733 1.00 36.09  ? 201  THR A O   1 
ATOM   1479 C  CB  . THR A 1 201 ? 65.488 -68.130  228.289 1.00 35.72  ? 201  THR A CB  1 
ATOM   1480 O  OG1 . THR A 1 201 ? 65.810 -68.644  226.994 1.00 39.87  ? 201  THR A OG1 1 
ATOM   1481 C  CG2 . THR A 1 201 ? 65.318 -69.287  229.281 1.00 32.48  ? 201  THR A CG2 1 
ATOM   1482 N  N   . ARG A 1 202 ? 64.238 -66.312  225.981 1.00 33.23  ? 202  ARG A N   1 
ATOM   1483 C  CA  . ARG A 1 202 ? 64.453 -65.285  224.979 1.00 32.90  ? 202  ARG A CA  1 
ATOM   1484 C  C   . ARG A 1 202 ? 63.617 -65.637  223.752 1.00 33.48  ? 202  ARG A C   1 
ATOM   1485 O  O   . ARG A 1 202 ? 63.848 -66.652  223.112 1.00 35.11  ? 202  ARG A O   1 
ATOM   1486 C  CB  . ARG A 1 202 ? 65.938 -65.237  224.606 1.00 32.26  ? 202  ARG A CB  1 
ATOM   1487 C  CG  . ARG A 1 202 ? 66.311 -64.224  223.534 1.00 34.27  ? 202  ARG A CG  1 
ATOM   1488 C  CD  . ARG A 1 202 ? 67.807 -64.294  223.255 1.00 37.44  ? 202  ARG A CD  1 
ATOM   1489 N  NE  . ARG A 1 202 ? 68.124 -64.975  221.999 1.00 39.65  ? 202  ARG A NE  1 
ATOM   1490 C  CZ  . ARG A 1 202 ? 69.230 -65.686  221.793 1.00 40.27  ? 202  ARG A CZ  1 
ATOM   1491 N  NH1 . ARG A 1 202 ? 70.125 -65.825  222.763 1.00 45.46  ? 202  ARG A NH1 1 
ATOM   1492 N  NH2 . ARG A 1 202 ? 69.458 -66.241  220.613 1.00 41.20  ? 202  ARG A NH2 1 
ATOM   1493 N  N   . SER A 1 203 ? 62.652 -64.792  223.416 1.00 33.69  ? 203  SER A N   1 
ATOM   1494 C  CA  . SER A 1 203 ? 61.791 -65.057  222.276 1.00 34.85  ? 203  SER A CA  1 
ATOM   1495 C  C   . SER A 1 203 ? 62.073 -64.216  221.040 1.00 35.95  ? 203  SER A C   1 
ATOM   1496 O  O   . SER A 1 203 ? 61.289 -64.219  220.087 1.00 34.52  ? 203  SER A O   1 
ATOM   1497 C  CB  . SER A 1 203 ? 60.337 -64.890  222.694 1.00 35.72  ? 203  SER A CB  1 
ATOM   1498 O  OG  . SER A 1 203 ? 60.201 -63.834  223.618 1.00 39.91  ? 203  SER A OG  1 
ATOM   1499 N  N   . ARG A 1 204 ? 63.211 -63.523  221.046 1.00 37.48  ? 204  ARG A N   1 
ATOM   1500 C  CA  . ARG A 1 204 ? 63.611 -62.669  219.928 1.00 35.92  ? 204  ARG A CA  1 
ATOM   1501 C  C   . ARG A 1 204 ? 65.093 -62.796  219.586 1.00 36.23  ? 204  ARG A C   1 
ATOM   1502 O  O   . ARG A 1 204 ? 65.942 -63.006  220.462 1.00 35.77  ? 204  ARG A O   1 
ATOM   1503 C  CB  . ARG A 1 204 ? 63.336 -61.209  220.257 1.00 33.34  ? 204  ARG A CB  1 
ATOM   1504 C  CG  . ARG A 1 204 ? 61.886 -60.869  220.460 1.00 36.37  ? 204  ARG A CG  1 
ATOM   1505 C  CD  . ARG A 1 204 ? 61.762 -59.501  221.096 1.00 37.06  ? 204  ARG A CD  1 
ATOM   1506 N  NE  . ARG A 1 204 ? 62.310 -59.503  222.449 1.00 42.51  ? 204  ARG A NE  1 
ATOM   1507 C  CZ  . ARG A 1 204 ? 62.526 -58.407  223.172 1.00 43.73  ? 204  ARG A CZ  1 
ATOM   1508 N  NH1 . ARG A 1 204 ? 62.247 -57.207  222.672 1.00 41.22  ? 204  ARG A NH1 1 
ATOM   1509 N  NH2 . ARG A 1 204 ? 63.005 -58.514  224.406 1.00 42.93  ? 204  ARG A NH2 1 
ATOM   1510 N  N   . SER A 1 205 ? 65.392 -62.662  218.301 1.00 35.18  ? 205  SER A N   1 
ATOM   1511 C  CA  . SER A 1 205 ? 66.754 -62.707  217.834 1.00 35.54  ? 205  SER A CA  1 
ATOM   1512 C  C   . SER A 1 205 ? 66.936 -61.502  216.930 1.00 36.84  ? 205  SER A C   1 
ATOM   1513 O  O   . SER A 1 205 ? 66.277 -61.391  215.889 1.00 36.55  ? 205  SER A O   1 
ATOM   1514 C  CB  . SER A 1 205 ? 67.013 -63.986  217.057 1.00 37.34  ? 205  SER A CB  1 
ATOM   1515 O  OG  . SER A 1 205 ? 68.402 -64.139  216.828 1.00 41.24  ? 205  SER A OG  1 
ATOM   1516 N  N   . PRO A 1 206 ? 67.806 -60.559  217.329 1.00 36.75  ? 206  PRO A N   1 
ATOM   1517 C  CA  . PRO A 1 206 ? 68.035 -59.367  216.506 1.00 35.92  ? 206  PRO A CA  1 
ATOM   1518 C  C   . PRO A 1 206 ? 68.541 -59.740  215.121 1.00 36.54  ? 206  PRO A C   1 
ATOM   1519 O  O   . PRO A 1 206 ? 68.056 -59.231  214.112 1.00 35.90  ? 206  PRO A O   1 
ATOM   1520 C  CB  . PRO A 1 206 ? 69.052 -58.566  217.320 1.00 35.71  ? 206  PRO A CB  1 
ATOM   1521 C  CG  . PRO A 1 206 ? 69.730 -59.606  218.172 1.00 37.45  ? 206  PRO A CG  1 
ATOM   1522 C  CD  . PRO A 1 206 ? 68.588 -60.497  218.574 1.00 36.18  ? 206  PRO A CD  1 
ATOM   1523 N  N   . ILE A 1 207 ? 69.511 -60.643  215.077 1.00 37.52  ? 207  ILE A N   1 
ATOM   1524 C  CA  . ILE A 1 207 ? 70.067 -61.087  213.814 1.00 39.50  ? 207  ILE A CA  1 
ATOM   1525 C  C   . ILE A 1 207 ? 70.127 -62.602  213.808 1.00 40.78  ? 207  ILE A C   1 
ATOM   1526 O  O   . ILE A 1 207 ? 71.002 -63.188  214.440 1.00 41.66  ? 207  ILE A O   1 
ATOM   1527 C  CB  . ILE A 1 207 ? 71.486 -60.571  213.620 1.00 41.95  ? 207  ILE A CB  1 
ATOM   1528 C  CG1 . ILE A 1 207 ? 71.521 -59.050  213.795 1.00 43.62  ? 207  ILE A CG1 1 
ATOM   1529 C  CG2 . ILE A 1 207 ? 71.986 -60.979  212.243 1.00 41.71  ? 207  ILE A CG2 1 
ATOM   1530 C  CD1 . ILE A 1 207 ? 72.921 -58.471  213.743 1.00 46.20  ? 207  ILE A CD1 1 
ATOM   1531 N  N   . PHE A 1 208 ? 69.197 -63.235  213.103 1.00 41.28  ? 208  PHE A N   1 
ATOM   1532 C  CA  . PHE A 1 208 ? 69.161 -64.690  213.031 1.00 41.91  ? 208  PHE A CA  1 
ATOM   1533 C  C   . PHE A 1 208 ? 69.993 -65.130  211.830 1.00 42.18  ? 208  PHE A C   1 
ATOM   1534 O  O   . PHE A 1 208 ? 69.538 -65.040  210.689 1.00 42.10  ? 208  PHE A O   1 
ATOM   1535 C  CB  . PHE A 1 208 ? 67.702 -65.154  212.898 1.00 42.76  ? 208  PHE A CB  1 
ATOM   1536 C  CG  . PHE A 1 208 ? 67.531 -66.649  212.844 1.00 42.62  ? 208  PHE A CG  1 
ATOM   1537 C  CD1 . PHE A 1 208 ? 68.108 -67.466  213.807 1.00 43.51  ? 208  PHE A CD1 1 
ATOM   1538 C  CD2 . PHE A 1 208 ? 66.767 -67.236  211.842 1.00 43.04  ? 208  PHE A CD2 1 
ATOM   1539 C  CE1 . PHE A 1 208 ? 67.924 -68.849  213.773 1.00 46.34  ? 208  PHE A CE1 1 
ATOM   1540 C  CE2 . PHE A 1 208 ? 66.575 -68.616  211.797 1.00 44.16  ? 208  PHE A CE2 1 
ATOM   1541 C  CZ  . PHE A 1 208 ? 67.154 -69.426  212.765 1.00 43.80  ? 208  PHE A CZ  1 
ATOM   1542 N  N   . SER A 1 209 ? 71.210 -65.613  212.070 1.00 42.73  ? 209  SER A N   1 
ATOM   1543 C  CA  . SER A 1 209 ? 72.049 -66.009  210.943 1.00 45.36  ? 209  SER A CA  1 
ATOM   1544 C  C   . SER A 1 209 ? 72.549 -67.448  210.919 1.00 44.79  ? 209  SER A C   1 
ATOM   1545 O  O   . SER A 1 209 ? 72.795 -67.995  209.845 1.00 45.49  ? 209  SER A O   1 
ATOM   1546 C  CB  . SER A 1 209 ? 73.240 -65.049  210.818 1.00 47.18  ? 209  SER A CB  1 
ATOM   1547 O  OG  . SER A 1 209 ? 73.971 -64.981  212.030 1.00 51.56  ? 209  SER A OG  1 
ATOM   1548 N  N   . LEU A 1 210 ? 72.705 -68.067  212.083 1.00 44.45  ? 210  LEU A N   1 
ATOM   1549 C  CA  . LEU A 1 210 ? 73.173 -69.451  212.105 1.00 45.36  ? 210  LEU A CA  1 
ATOM   1550 C  C   . LEU A 1 210 ? 72.172 -70.410  212.725 1.00 45.28  ? 210  LEU A C   1 
ATOM   1551 O  O   . LEU A 1 210 ? 71.327 -70.969  212.038 1.00 46.13  ? 210  LEU A O   1 
ATOM   1552 C  CB  . LEU A 1 210 ? 74.502 -69.565  212.855 1.00 46.39  ? 210  LEU A CB  1 
ATOM   1553 C  CG  . LEU A 1 210 ? 75.758 -68.975  212.213 1.00 47.99  ? 210  LEU A CG  1 
ATOM   1554 C  CD1 . LEU A 1 210 ? 76.947 -69.218  213.132 1.00 46.42  ? 210  LEU A CD1 1 
ATOM   1555 C  CD2 . LEU A 1 210 ? 75.990 -69.613  210.846 1.00 47.41  ? 210  LEU A CD2 1 
ATOM   1556 N  N   . SER A 1 211 ? 72.281 -70.596  214.033 1.00 45.02  ? 211  SER A N   1 
ATOM   1557 C  CA  . SER A 1 211 ? 71.407 -71.498  214.760 1.00 43.53  ? 211  SER A CA  1 
ATOM   1558 C  C   . SER A 1 211 ? 70.903 -70.799  216.011 1.00 43.05  ? 211  SER A C   1 
ATOM   1559 O  O   . SER A 1 211 ? 71.536 -69.863  216.512 1.00 45.95  ? 211  SER A O   1 
ATOM   1560 C  CB  . SER A 1 211 ? 72.171 -72.758  215.148 1.00 45.04  ? 211  SER A CB  1 
ATOM   1561 O  OG  . SER A 1 211 ? 71.321 -73.685  215.793 1.00 50.00  ? 211  SER A OG  1 
ATOM   1562 N  N   . TRP A 1 212 ? 69.765 -71.254  216.521 1.00 38.58  ? 212  TRP A N   1 
ATOM   1563 C  CA  . TRP A 1 212 ? 69.177 -70.655  217.708 1.00 33.61  ? 212  TRP A CA  1 
ATOM   1564 C  C   . TRP A 1 212 ? 68.466 -71.705  218.549 1.00 35.01  ? 212  TRP A C   1 
ATOM   1565 O  O   . TRP A 1 212 ? 67.575 -72.426  218.077 1.00 36.20  ? 212  TRP A O   1 
ATOM   1566 C  CB  . TRP A 1 212 ? 68.205 -69.539  217.289 1.00 29.06  ? 212  TRP A CB  1 
ATOM   1567 C  CG  . TRP A 1 212 ? 67.531 -68.820  218.432 1.00 25.99  ? 212  TRP A CG  1 
ATOM   1568 C  CD1 . TRP A 1 212 ? 67.840 -68.908  219.761 1.00 21.52  ? 212  TRP A CD1 1 
ATOM   1569 C  CD2 . TRP A 1 212 ? 66.410 -67.925  218.339 1.00 22.30  ? 212  TRP A CD2 1 
ATOM   1570 N  NE1 . TRP A 1 212 ? 66.979 -68.130  220.497 1.00 20.18  ? 212  TRP A NE1 1 
ATOM   1571 C  CE2 . TRP A 1 212 ? 66.092 -67.518  219.649 1.00 17.74  ? 212  TRP A CE2 1 
ATOM   1572 C  CE3 . TRP A 1 212 ? 65.644 -67.434  217.273 1.00 22.68  ? 212  TRP A CE3 1 
ATOM   1573 C  CZ2 . TRP A 1 212 ? 65.042 -66.645  219.925 1.00 19.50  ? 212  TRP A CZ2 1 
ATOM   1574 C  CZ3 . TRP A 1 212 ? 64.593 -66.559  217.549 1.00 23.31  ? 212  TRP A CZ3 1 
ATOM   1575 C  CH2 . TRP A 1 212 ? 64.303 -66.177  218.866 1.00 21.93  ? 212  TRP A CH2 1 
ATOM   1576 N  N   . THR A 1 213 ? 68.893 -71.814  219.798 1.00 35.28  ? 213  THR A N   1 
ATOM   1577 C  CA  . THR A 1 213 ? 68.281 -72.757  220.707 1.00 36.50  ? 213  THR A CA  1 
ATOM   1578 C  C   . THR A 1 213 ? 67.290 -71.980  221.564 1.00 36.87  ? 213  THR A C   1 
ATOM   1579 O  O   . THR A 1 213 ? 67.680 -71.122  222.348 1.00 36.19  ? 213  THR A O   1 
ATOM   1580 C  CB  . THR A 1 213 ? 69.342 -73.431  221.585 1.00 36.26  ? 213  THR A CB  1 
ATOM   1581 O  OG1 . THR A 1 213 ? 70.179 -74.246  220.757 1.00 37.95  ? 213  THR A OG1 1 
ATOM   1582 C  CG2 . THR A 1 213 ? 68.691 -74.300  222.640 1.00 33.60  ? 213  THR A CG2 1 
ATOM   1583 N  N   . VAL A 1 214 ? 66.007 -72.272  221.364 1.00 38.45  ? 214  VAL A N   1 
ATOM   1584 C  CA  . VAL A 1 214 ? 64.911 -71.635  222.079 1.00 37.71  ? 214  VAL A CA  1 
ATOM   1585 C  C   . VAL A 1 214 ? 64.649 -72.448  223.329 1.00 37.16  ? 214  VAL A C   1 
ATOM   1586 O  O   . VAL A 1 214 ? 64.595 -73.671  223.268 1.00 38.94  ? 214  VAL A O   1 
ATOM   1587 C  CB  . VAL A 1 214 ? 63.652 -71.601  221.213 1.00 38.83  ? 214  VAL A CB  1 
ATOM   1588 C  CG1 . VAL A 1 214 ? 62.498 -71.024  222.000 1.00 42.03  ? 214  VAL A CG1 1 
ATOM   1589 C  CG2 . VAL A 1 214 ? 63.909 -70.766  219.967 1.00 39.14  ? 214  VAL A CG2 1 
ATOM   1590 N  N   . MET A 1 215 ? 64.482 -71.765  224.460 1.00 36.81  ? 215  MET A N   1 
ATOM   1591 C  CA  . MET A 1 215 ? 64.282 -72.444  225.736 1.00 34.25  ? 215  MET A CA  1 
ATOM   1592 C  C   . MET A 1 215 ? 63.101 -71.977  226.594 1.00 35.05  ? 215  MET A C   1 
ATOM   1593 O  O   . MET A 1 215 ? 62.791 -70.783  226.669 1.00 36.23  ? 215  MET A O   1 
ATOM   1594 C  CB  . MET A 1 215 ? 65.560 -72.321  226.557 1.00 33.94  ? 215  MET A CB  1 
ATOM   1595 C  CG  . MET A 1 215 ? 66.825 -72.797  225.849 1.00 35.67  ? 215  MET A CG  1 
ATOM   1596 S  SD  . MET A 1 215 ? 68.284 -72.559  226.909 1.00 37.89  ? 215  MET A SD  1 
ATOM   1597 C  CE  . MET A 1 215 ? 68.624 -70.831  226.639 1.00 39.00  ? 215  MET A CE  1 
ATOM   1598 N  N   . HIS A 1 216 ? 62.463 -72.939  227.254 1.00 32.94  ? 216  HIS A N   1 
ATOM   1599 C  CA  . HIS A 1 216 ? 61.339 -72.679  228.138 1.00 30.69  ? 216  HIS A CA  1 
ATOM   1600 C  C   . HIS A 1 216 ? 61.621 -73.255  229.524 1.00 31.34  ? 216  HIS A C   1 
ATOM   1601 O  O   . HIS A 1 216 ? 61.439 -74.451  229.750 1.00 31.08  ? 216  HIS A O   1 
ATOM   1602 C  CB  . HIS A 1 216 ? 60.065 -73.320  227.585 1.00 29.75  ? 216  HIS A CB  1 
ATOM   1603 C  CG  . HIS A 1 216 ? 58.928 -73.339  228.566 1.00 32.87  ? 216  HIS A CG  1 
ATOM   1604 N  ND1 . HIS A 1 216 ? 58.470 -74.500  229.157 1.00 34.48  ? 216  HIS A ND1 1 
ATOM   1605 C  CD2 . HIS A 1 216 ? 58.178 -72.337  229.082 1.00 30.43  ? 216  HIS A CD2 1 
ATOM   1606 C  CE1 . HIS A 1 216 ? 57.488 -74.211  229.993 1.00 31.08  ? 216  HIS A CE1 1 
ATOM   1607 N  NE2 . HIS A 1 216 ? 57.291 -72.905  229.965 1.00 30.77  ? 216  HIS A NE2 1 
ATOM   1608 N  N   . PRO A 1 217 ? 62.080 -72.422  230.474 1.00 30.82  ? 217  PRO A N   1 
ATOM   1609 C  CA  . PRO A 1 217 ? 62.336 -73.004  231.792 1.00 30.37  ? 217  PRO A CA  1 
ATOM   1610 C  C   . PRO A 1 217 ? 61.035 -73.528  232.381 1.00 32.16  ? 217  PRO A C   1 
ATOM   1611 O  O   . PRO A 1 217 ? 60.002 -72.861  232.323 1.00 32.70  ? 217  PRO A O   1 
ATOM   1612 C  CB  . PRO A 1 217 ? 62.895 -71.826  232.585 1.00 28.09  ? 217  PRO A CB  1 
ATOM   1613 C  CG  . PRO A 1 217 ? 63.554 -70.997  231.537 1.00 26.58  ? 217  PRO A CG  1 
ATOM   1614 C  CD  . PRO A 1 217 ? 62.538 -71.024  230.427 1.00 28.37  ? 217  PRO A CD  1 
ATOM   1615 N  N   . ILE A 1 218 ? 61.081 -74.726  232.942 1.00 33.14  ? 218  ILE A N   1 
ATOM   1616 C  CA  . ILE A 1 218 ? 59.896 -75.299  233.534 1.00 35.55  ? 218  ILE A CA  1 
ATOM   1617 C  C   . ILE A 1 218 ? 59.856 -74.964  235.015 1.00 38.00  ? 218  ILE A C   1 
ATOM   1618 O  O   . ILE A 1 218 ? 60.145 -75.807  235.854 1.00 39.16  ? 218  ILE A O   1 
ATOM   1619 C  CB  . ILE A 1 218 ? 59.869 -76.822  233.336 1.00 35.66  ? 218  ILE A CB  1 
ATOM   1620 C  CG1 . ILE A 1 218 ? 60.009 -77.132  231.839 1.00 37.60  ? 218  ILE A CG1 1 
ATOM   1621 C  CG2 . ILE A 1 218 ? 58.555 -77.401  233.869 1.00 33.61  ? 218  ILE A CG2 1 
ATOM   1622 C  CD1 . ILE A 1 218 ? 60.181 -78.594  231.504 1.00 36.25  ? 218  ILE A CD1 1 
ATOM   1623 N  N   . ASP A 1 219 ? 59.504 -73.719  235.327 1.00 40.28  ? 219  ASP A N   1 
ATOM   1624 C  CA  . ASP A 1 219 ? 59.408 -73.264  236.711 1.00 43.24  ? 219  ASP A CA  1 
ATOM   1625 C  C   . ASP A 1 219 ? 57.953 -73.374  237.177 1.00 45.15  ? 219  ASP A C   1 
ATOM   1626 O  O   . ASP A 1 219 ? 57.088 -73.789  236.405 1.00 44.87  ? 219  ASP A O   1 
ATOM   1627 C  CB  . ASP A 1 219 ? 59.922 -71.819  236.830 1.00 42.60  ? 219  ASP A CB  1 
ATOM   1628 C  CG  . ASP A 1 219 ? 59.056 -70.817  236.077 1.00 45.30  ? 219  ASP A CG  1 
ATOM   1629 O  OD1 . ASP A 1 219 ? 59.522 -69.675  235.864 1.00 45.34  ? 219  ASP A OD1 1 
ATOM   1630 O  OD2 . ASP A 1 219 ? 57.910 -71.158  235.706 1.00 46.58  ? 219  ASP A OD2 1 
ATOM   1631 N  N   . HIS A 1 220 ? 57.691 -73.005  238.431 1.00 48.53  ? 220  HIS A N   1 
ATOM   1632 C  CA  . HIS A 1 220 ? 56.345 -73.074  239.010 1.00 50.97  ? 220  HIS A CA  1 
ATOM   1633 C  C   . HIS A 1 220 ? 55.254 -72.476  238.128 1.00 50.47  ? 220  HIS A C   1 
ATOM   1634 O  O   . HIS A 1 220 ? 54.107 -72.927  238.157 1.00 50.96  ? 220  HIS A O   1 
ATOM   1635 C  CB  . HIS A 1 220 ? 56.308 -72.374  240.374 1.00 55.52  ? 220  HIS A CB  1 
ATOM   1636 C  CG  . HIS A 1 220 ? 57.079 -73.084  241.443 1.00 61.61  ? 220  HIS A CG  1 
ATOM   1637 N  ND1 . HIS A 1 220 ? 58.451 -72.999  241.557 1.00 64.16  ? 220  HIS A ND1 1 
ATOM   1638 C  CD2 . HIS A 1 220 ? 56.670 -73.914  242.434 1.00 63.67  ? 220  HIS A CD2 1 
ATOM   1639 C  CE1 . HIS A 1 220 ? 58.855 -73.745  242.571 1.00 65.23  ? 220  HIS A CE1 1 
ATOM   1640 N  NE2 . HIS A 1 220 ? 57.795 -74.311  243.120 1.00 65.48  ? 220  HIS A NE2 1 
ATOM   1641 N  N   . HIS A 1 221 ? 55.616 -71.463  237.351 1.00 48.98  ? 221  HIS A N   1 
ATOM   1642 C  CA  . HIS A 1 221 ? 54.681 -70.782  236.462 1.00 48.31  ? 221  HIS A CA  1 
ATOM   1643 C  C   . HIS A 1 221 ? 54.389 -71.535  235.170 1.00 46.73  ? 221  HIS A C   1 
ATOM   1644 O  O   . HIS A 1 221 ? 53.494 -71.155  234.417 1.00 47.01  ? 221  HIS A O   1 
ATOM   1645 C  CB  . HIS A 1 221 ? 55.234 -69.401  236.107 1.00 51.58  ? 221  HIS A CB  1 
ATOM   1646 C  CG  . HIS A 1 221 ? 55.232 -68.430  237.248 1.00 55.95  ? 221  HIS A CG  1 
ATOM   1647 N  ND1 . HIS A 1 221 ? 56.046 -67.319  237.278 1.00 56.10  ? 221  HIS A ND1 1 
ATOM   1648 C  CD2 . HIS A 1 221 ? 54.495 -68.387  238.384 1.00 58.47  ? 221  HIS A CD2 1 
ATOM   1649 C  CE1 . HIS A 1 221 ? 55.814 -66.634  238.383 1.00 58.27  ? 221  HIS A CE1 1 
ATOM   1650 N  NE2 . HIS A 1 221 ? 54.878 -67.260  239.072 1.00 59.65  ? 221  HIS A NE2 1 
ATOM   1651 N  N   . SER A 1 222 ? 55.139 -72.601  234.913 1.00 44.38  ? 222  SER A N   1 
ATOM   1652 C  CA  . SER A 1 222 ? 54.978 -73.377  233.689 1.00 41.08  ? 222  SER A CA  1 
ATOM   1653 C  C   . SER A 1 222 ? 53.795 -74.338  233.637 1.00 40.62  ? 222  SER A C   1 
ATOM   1654 O  O   . SER A 1 222 ? 53.473 -74.997  234.618 1.00 42.51  ? 222  SER A O   1 
ATOM   1655 C  CB  . SER A 1 222 ? 56.257 -74.168  233.410 1.00 39.33  ? 222  SER A CB  1 
ATOM   1656 O  OG  . SER A 1 222 ? 56.091 -75.006  232.284 1.00 32.91  ? 222  SER A OG  1 
ATOM   1657 N  N   . PRO A 1 223 ? 53.128 -74.421  232.476 1.00 39.96  ? 223  PRO A N   1 
ATOM   1658 C  CA  . PRO A 1 223 ? 51.984 -75.318  232.302 1.00 38.11  ? 223  PRO A CA  1 
ATOM   1659 C  C   . PRO A 1 223 ? 52.440 -76.783  232.358 1.00 38.85  ? 223  PRO A C   1 
ATOM   1660 O  O   . PRO A 1 223 ? 51.618 -77.681  232.537 1.00 40.56  ? 223  PRO A O   1 
ATOM   1661 C  CB  . PRO A 1 223 ? 51.455 -74.947  230.918 1.00 35.83  ? 223  PRO A CB  1 
ATOM   1662 C  CG  . PRO A 1 223 ? 51.832 -73.529  230.779 1.00 38.58  ? 223  PRO A CG  1 
ATOM   1663 C  CD  . PRO A 1 223 ? 53.224 -73.477  231.348 1.00 38.75  ? 223  PRO A CD  1 
ATOM   1664 N  N   . ILE A 1 224 ? 53.735 -77.037  232.172 1.00 36.77  ? 224  ILE A N   1 
ATOM   1665 C  CA  . ILE A 1 224 ? 54.207 -78.415  232.252 1.00 38.18  ? 224  ILE A CA  1 
ATOM   1666 C  C   . ILE A 1 224 ? 55.051 -78.638  233.488 1.00 39.30  ? 224  ILE A C   1 
ATOM   1667 O  O   . ILE A 1 224 ? 55.811 -79.599  233.572 1.00 39.57  ? 224  ILE A O   1 
ATOM   1668 C  CB  . ILE A 1 224 ? 55.005 -78.883  230.995 1.00 38.39  ? 224  ILE A CB  1 
ATOM   1669 C  CG1 . ILE A 1 224 ? 56.157 -77.935  230.692 1.00 38.66  ? 224  ILE A CG1 1 
ATOM   1670 C  CG2 . ILE A 1 224 ? 54.077 -78.990  229.797 1.00 38.26  ? 224  ILE A CG2 1 
ATOM   1671 C  CD1 . ILE A 1 224 ? 57.045 -78.453  229.610 1.00 38.93  ? 224  ILE A CD1 1 
ATOM   1672 N  N   . TYR A 1 225 ? 54.914 -77.742  234.457 1.00 40.68  ? 225  TYR A N   1 
ATOM   1673 C  CA  . TYR A 1 225 ? 55.638 -77.901  235.701 1.00 41.59  ? 225  TYR A CA  1 
ATOM   1674 C  C   . TYR A 1 225 ? 55.063 -79.132  236.379 1.00 42.81  ? 225  TYR A C   1 
ATOM   1675 O  O   . TYR A 1 225 ? 53.871 -79.179  236.670 1.00 43.44  ? 225  TYR A O   1 
ATOM   1676 C  CB  . TYR A 1 225 ? 55.421 -76.704  236.614 1.00 43.41  ? 225  TYR A CB  1 
ATOM   1677 C  CG  . TYR A 1 225 ? 56.169 -76.823  237.918 1.00 43.96  ? 225  TYR A CG  1 
ATOM   1678 C  CD1 . TYR A 1 225 ? 57.558 -76.700  237.954 1.00 45.68  ? 225  TYR A CD1 1 
ATOM   1679 C  CD2 . TYR A 1 225 ? 55.498 -77.089  239.107 1.00 43.99  ? 225  TYR A CD2 1 
ATOM   1680 C  CE1 . TYR A 1 225 ? 58.262 -76.839  239.141 1.00 47.22  ? 225  TYR A CE1 1 
ATOM   1681 C  CE2 . TYR A 1 225 ? 56.190 -77.235  240.304 1.00 45.85  ? 225  TYR A CE2 1 
ATOM   1682 C  CZ  . TYR A 1 225 ? 57.573 -77.109  240.314 1.00 48.56  ? 225  TYR A CZ  1 
ATOM   1683 O  OH  . TYR A 1 225 ? 58.272 -77.254  241.488 1.00 50.57  ? 225  TYR A OH  1 
ATOM   1684 N  N   . GLY A 1 226 ? 55.901 -80.132  236.619 1.00 44.18  ? 226  GLY A N   1 
ATOM   1685 C  CA  . GLY A 1 226 ? 55.424 -81.335  237.273 1.00 43.97  ? 226  GLY A CA  1 
ATOM   1686 C  C   . GLY A 1 226 ? 54.906 -82.413  236.337 1.00 43.74  ? 226  GLY A C   1 
ATOM   1687 O  O   . GLY A 1 226 ? 54.530 -83.487  236.787 1.00 43.51  ? 226  GLY A O   1 
ATOM   1688 N  N   . GLU A 1 227 ? 54.864 -82.137  235.041 1.00 44.30  ? 227  GLU A N   1 
ATOM   1689 C  CA  . GLU A 1 227 ? 54.393 -83.140  234.088 1.00 45.23  ? 227  GLU A CA  1 
ATOM   1690 C  C   . GLU A 1 227 ? 55.495 -84.161  233.818 1.00 44.69  ? 227  GLU A C   1 
ATOM   1691 O  O   . GLU A 1 227 ? 56.666 -83.935  234.122 1.00 46.30  ? 227  GLU A O   1 
ATOM   1692 C  CB  . GLU A 1 227 ? 53.996 -82.497  232.755 1.00 44.21  ? 227  GLU A CB  1 
ATOM   1693 C  CG  . GLU A 1 227 ? 52.814 -81.551  232.796 1.00 44.57  ? 227  GLU A CG  1 
ATOM   1694 C  CD  . GLU A 1 227 ? 51.519 -82.237  233.171 1.00 44.86  ? 227  GLU A CD  1 
ATOM   1695 O  OE1 . GLU A 1 227 ? 51.203 -82.286  234.377 1.00 44.71  ? 227  GLU A OE1 1 
ATOM   1696 O  OE2 . GLU A 1 227 ? 50.820 -82.728  232.258 1.00 47.03  ? 227  GLU A OE2 1 
ATOM   1697 N  N   . THR A 1 228 ? 55.105 -85.287  233.242 1.00 44.39  ? 228  THR A N   1 
ATOM   1698 C  CA  . THR A 1 228 ? 56.035 -86.348  232.899 1.00 45.21  ? 228  THR A CA  1 
ATOM   1699 C  C   . THR A 1 228 ? 55.625 -86.815  231.518 1.00 46.49  ? 228  THR A C   1 
ATOM   1700 O  O   . THR A 1 228 ? 54.600 -86.384  230.989 1.00 47.64  ? 228  THR A O   1 
ATOM   1701 C  CB  . THR A 1 228 ? 55.926 -87.550  233.875 1.00 44.28  ? 228  THR A CB  1 
ATOM   1702 O  OG1 . THR A 1 228 ? 54.565 -87.996  233.932 1.00 43.78  ? 228  THR A OG1 1 
ATOM   1703 C  CG2 . THR A 1 228 ? 56.397 -87.161  235.270 1.00 40.55  ? 228  THR A CG2 1 
ATOM   1704 N  N   . ASP A 1 229 ? 56.418 -87.693  230.928 1.00 48.02  ? 229  ASP A N   1 
ATOM   1705 C  CA  . ASP A 1 229 ? 56.086 -88.207  229.615 1.00 50.10  ? 229  ASP A CA  1 
ATOM   1706 C  C   . ASP A 1 229 ? 54.694 -88.845  229.666 1.00 50.12  ? 229  ASP A C   1 
ATOM   1707 O  O   . ASP A 1 229 ? 53.909 -88.734  228.727 1.00 50.19  ? 229  ASP A O   1 
ATOM   1708 C  CB  . ASP A 1 229 ? 57.135 -89.237  229.178 1.00 52.34  ? 229  ASP A CB  1 
ATOM   1709 C  CG  . ASP A 1 229 ? 56.746 -89.960  227.904 1.00 56.22  ? 229  ASP A CG  1 
ATOM   1710 O  OD1 . ASP A 1 229 ? 55.840 -90.819  227.962 1.00 58.78  ? 229  ASP A OD1 1 
ATOM   1711 O  OD2 . ASP A 1 229 ? 57.335 -89.666  226.841 1.00 59.32  ? 229  ASP A OD2 1 
ATOM   1712 N  N   . GLU A 1 230 ? 54.380 -89.493  230.781 1.00 50.48  ? 230  GLU A N   1 
ATOM   1713 C  CA  . GLU A 1 230 ? 53.089 -90.143  230.910 1.00 50.67  ? 230  GLU A CA  1 
ATOM   1714 C  C   . GLU A 1 230 ? 51.963 -89.123  230.940 1.00 49.23  ? 230  GLU A C   1 
ATOM   1715 O  O   . GLU A 1 230 ? 51.046 -89.187  230.123 1.00 47.84  ? 230  GLU A O   1 
ATOM   1716 C  CB  . GLU A 1 230 ? 53.032 -91.006  232.180 1.00 52.22  ? 230  GLU A CB  1 
ATOM   1717 C  CG  . GLU A 1 230 ? 51.881 -92.019  232.175 1.00 58.11  ? 230  GLU A CG  1 
ATOM   1718 C  CD  . GLU A 1 230 ? 51.665 -92.721  233.521 1.00 62.19  ? 230  GLU A CD  1 
ATOM   1719 O  OE1 . GLU A 1 230 ? 51.121 -93.850  233.518 1.00 63.28  ? 230  GLU A OE1 1 
ATOM   1720 O  OE2 . GLU A 1 230 ? 52.017 -92.148  234.579 1.00 62.59  ? 230  GLU A OE2 1 
ATOM   1721 N  N   . THR A 1 231 ? 52.039 -88.177  231.874 1.00 48.07  ? 231  THR A N   1 
ATOM   1722 C  CA  . THR A 1 231 ? 50.997 -87.166  232.011 1.00 48.34  ? 231  THR A CA  1 
ATOM   1723 C  C   . THR A 1 231 ? 50.792 -86.330  230.751 1.00 48.45  ? 231  THR A C   1 
ATOM   1724 O  O   . THR A 1 231 ? 49.655 -85.992  230.410 1.00 48.97  ? 231  THR A O   1 
ATOM   1725 C  CB  . THR A 1 231 ? 51.251 -86.240  233.233 1.00 48.30  ? 231  THR A CB  1 
ATOM   1726 O  OG1 . THR A 1 231 ? 52.530 -85.605  233.117 1.00 49.98  ? 231  THR A OG1 1 
ATOM   1727 C  CG2 . THR A 1 231 ? 51.220 -87.053  234.514 1.00 45.44  ? 231  THR A CG2 1 
ATOM   1728 N  N   . LEU A 1 232 ? 51.872 -86.004  230.046 1.00 46.61  ? 232  LEU A N   1 
ATOM   1729 C  CA  . LEU A 1 232 ? 51.718 -85.235  228.819 1.00 45.89  ? 232  LEU A CA  1 
ATOM   1730 C  C   . LEU A 1 232 ? 50.936 -86.071  227.814 1.00 45.65  ? 232  LEU A C   1 
ATOM   1731 O  O   . LEU A 1 232 ? 50.062 -85.560  227.119 1.00 45.55  ? 232  LEU A O   1 
ATOM   1732 C  CB  . LEU A 1 232 ? 53.078 -84.849  228.223 1.00 43.16  ? 232  LEU A CB  1 
ATOM   1733 C  CG  . LEU A 1 232 ? 53.923 -83.809  228.965 1.00 43.19  ? 232  LEU A CG  1 
ATOM   1734 C  CD1 . LEU A 1 232 ? 55.110 -83.443  228.105 1.00 42.84  ? 232  LEU A CD1 1 
ATOM   1735 C  CD2 . LEU A 1 232 ? 53.106 -82.568  229.261 1.00 40.99  ? 232  LEU A CD2 1 
ATOM   1736 N  N   . ARG A 1 233 ? 51.250 -87.360  227.743 1.00 46.91  ? 233  ARG A N   1 
ATOM   1737 C  CA  . ARG A 1 233 ? 50.573 -88.256  226.808 1.00 48.75  ? 233  ARG A CA  1 
ATOM   1738 C  C   . ARG A 1 233 ? 49.071 -88.331  227.035 1.00 47.73  ? 233  ARG A C   1 
ATOM   1739 O  O   . ARG A 1 233 ? 48.293 -88.257  226.084 1.00 45.78  ? 233  ARG A O   1 
ATOM   1740 C  CB  . ARG A 1 233 ? 51.159 -89.668  226.886 1.00 51.78  ? 233  ARG A CB  1 
ATOM   1741 C  CG  . ARG A 1 233 ? 52.541 -89.792  226.289 1.00 56.27  ? 233  ARG A CG  1 
ATOM   1742 C  CD  . ARG A 1 233 ? 53.047 -91.230  226.321 1.00 59.47  ? 233  ARG A CD  1 
ATOM   1743 N  NE  . ARG A 1 233 ? 54.410 -91.324  225.796 1.00 62.73  ? 233  ARG A NE  1 
ATOM   1744 C  CZ  . ARG A 1 233 ? 54.755 -91.031  224.543 1.00 64.00  ? 233  ARG A CZ  1 
ATOM   1745 N  NH1 . ARG A 1 233 ? 53.838 -90.628  223.672 1.00 64.82  ? 233  ARG A NH1 1 
ATOM   1746 N  NH2 . ARG A 1 233 ? 56.021 -91.129  224.162 1.00 64.65  ? 233  ARG A NH2 1 
ATOM   1747 N  N   . ASN A 1 234 ? 48.670 -88.473  228.294 1.00 47.63  ? 234  ASN A N   1 
ATOM   1748 C  CA  . ASN A 1 234 ? 47.259 -88.574  228.630 1.00 50.98  ? 234  ASN A CA  1 
ATOM   1749 C  C   . ASN A 1 234 ? 46.445 -87.342  228.240 1.00 51.19  ? 234  ASN A C   1 
ATOM   1750 O  O   . ASN A 1 234 ? 45.265 -87.452  227.917 1.00 52.30  ? 234  ASN A O   1 
ATOM   1751 C  CB  . ASN A 1 234 ? 47.089 -88.853  230.125 1.00 54.70  ? 234  ASN A CB  1 
ATOM   1752 C  CG  . ASN A 1 234 ? 47.801 -90.123  230.565 1.00 59.07  ? 234  ASN A CG  1 
ATOM   1753 O  OD1 . ASN A 1 234 ? 47.648 -91.184  229.949 1.00 59.46  ? 234  ASN A OD1 1 
ATOM   1754 N  ND2 . ASN A 1 234 ? 48.580 -90.022  231.638 1.00 60.57  ? 234  ASN A ND2 1 
ATOM   1755 N  N   . SER A 1 235 ? 47.066 -86.169  228.271 1.00 51.73  ? 235  SER A N   1 
ATOM   1756 C  CA  . SER A 1 235 ? 46.361 -84.942  227.909 1.00 51.07  ? 235  SER A CA  1 
ATOM   1757 C  C   . SER A 1 235 ? 46.469 -84.691  226.408 1.00 50.06  ? 235  SER A C   1 
ATOM   1758 O  O   . SER A 1 235 ? 45.862 -83.765  225.877 1.00 48.76  ? 235  SER A O   1 
ATOM   1759 C  CB  . SER A 1 235 ? 46.939 -83.758  228.685 1.00 51.30  ? 235  SER A CB  1 
ATOM   1760 O  OG  . SER A 1 235 ? 48.347 -83.697  228.541 1.00 54.29  ? 235  SER A OG  1 
ATOM   1761 N  N   . HIS A 1 236 ? 47.227 -85.551  225.735 1.00 49.87  ? 236  HIS A N   1 
ATOM   1762 C  CA  . HIS A 1 236 ? 47.456 -85.460  224.296 1.00 50.32  ? 236  HIS A CA  1 
ATOM   1763 C  C   . HIS A 1 236 ? 48.141 -84.133  223.966 1.00 46.22  ? 236  HIS A C   1 
ATOM   1764 O  O   . HIS A 1 236 ? 47.777 -83.426  223.023 1.00 43.95  ? 236  HIS A O   1 
ATOM   1765 C  CB  . HIS A 1 236 ? 46.143 -85.592  223.513 1.00 54.98  ? 236  HIS A CB  1 
ATOM   1766 C  CG  . HIS A 1 236 ? 46.336 -86.100  222.114 1.00 63.15  ? 236  HIS A CG  1 
ATOM   1767 N  ND1 . HIS A 1 236 ? 47.168 -85.481  221.203 1.00 67.24  ? 236  HIS A ND1 1 
ATOM   1768 C  CD2 . HIS A 1 236 ? 45.845 -87.195  221.484 1.00 66.53  ? 236  HIS A CD2 1 
ATOM   1769 C  CE1 . HIS A 1 236 ? 47.183 -86.173  220.077 1.00 67.35  ? 236  HIS A CE1 1 
ATOM   1770 N  NE2 . HIS A 1 236 ? 46.389 -87.218  220.221 1.00 67.71  ? 236  HIS A NE2 1 
ATOM   1771 N  N   . SER A 1 237 ? 49.153 -83.821  224.764 1.00 42.79  ? 237  SER A N   1 
ATOM   1772 C  CA  . SER A 1 237 ? 49.919 -82.593  224.625 1.00 37.80  ? 237  SER A CA  1 
ATOM   1773 C  C   . SER A 1 237 ? 50.769 -82.530  223.361 1.00 36.65  ? 237  SER A C   1 
ATOM   1774 O  O   . SER A 1 237 ? 51.451 -83.489  222.994 1.00 37.61  ? 237  SER A O   1 
ATOM   1775 C  CB  . SER A 1 237 ? 50.827 -82.406  225.845 1.00 35.18  ? 237  SER A CB  1 
ATOM   1776 O  OG  . SER A 1 237 ? 50.070 -82.309  227.043 1.00 33.49  ? 237  SER A OG  1 
ATOM   1777 N  N   . GLU A 1 238 ? 50.707 -81.391  222.686 1.00 33.15  ? 238  GLU A N   1 
ATOM   1778 C  CA  . GLU A 1 238 ? 51.512 -81.172  221.509 1.00 31.26  ? 238  GLU A CA  1 
ATOM   1779 C  C   . GLU A 1 238 ? 52.174 -79.806  221.694 1.00 28.61  ? 238  GLU A C   1 
ATOM   1780 O  O   . GLU A 1 238 ? 51.820 -79.062  222.608 1.00 26.61  ? 238  GLU A O   1 
ATOM   1781 C  CB  . GLU A 1 238 ? 50.638 -81.231  220.259 1.00 32.93  ? 238  GLU A CB  1 
ATOM   1782 C  CG  . GLU A 1 238 ? 50.073 -82.625  220.016 1.00 37.06  ? 238  GLU A CG  1 
ATOM   1783 C  CD  . GLU A 1 238 ? 49.348 -82.757  218.688 1.00 40.22  ? 238  GLU A CD  1 
ATOM   1784 O  OE1 . GLU A 1 238 ? 49.042 -81.722  218.068 1.00 43.36  ? 238  GLU A OE1 1 
ATOM   1785 O  OE2 . GLU A 1 238 ? 49.068 -83.896  218.263 1.00 43.65  ? 238  GLU A OE2 1 
ATOM   1786 N  N   . PHE A 1 239 ? 53.162 -79.490  220.870 1.00 26.77  ? 239  PHE A N   1 
ATOM   1787 C  CA  . PHE A 1 239 ? 53.844 -78.208  220.998 1.00 26.66  ? 239  PHE A CA  1 
ATOM   1788 C  C   . PHE A 1 239 ? 53.945 -77.587  219.636 1.00 29.55  ? 239  PHE A C   1 
ATOM   1789 O  O   . PHE A 1 239 ? 54.471 -78.193  218.700 1.00 28.87  ? 239  PHE A O   1 
ATOM   1790 C  CB  . PHE A 1 239 ? 55.238 -78.369  221.624 1.00 22.66  ? 239  PHE A CB  1 
ATOM   1791 C  CG  . PHE A 1 239 ? 55.205 -78.922  223.020 1.00 21.93  ? 239  PHE A CG  1 
ATOM   1792 C  CD1 . PHE A 1 239 ? 55.048 -80.294  223.237 1.00 23.59  ? 239  PHE A CD1 1 
ATOM   1793 C  CD2 . PHE A 1 239 ? 55.253 -78.075  224.119 1.00 21.08  ? 239  PHE A CD2 1 
ATOM   1794 C  CE1 . PHE A 1 239 ? 54.933 -80.804  224.525 1.00 23.05  ? 239  PHE A CE1 1 
ATOM   1795 C  CE2 . PHE A 1 239 ? 55.139 -78.573  225.418 1.00 22.29  ? 239  PHE A CE2 1 
ATOM   1796 C  CZ  . PHE A 1 239 ? 54.977 -79.940  225.624 1.00 23.61  ? 239  PHE A CZ  1 
ATOM   1797 N  N   . LEU A 1 240 ? 53.409 -76.373  219.535 1.00 31.82  ? 240  LEU A N   1 
ATOM   1798 C  CA  . LEU A 1 240 ? 53.371 -75.632  218.289 1.00 32.19  ? 240  LEU A CA  1 
ATOM   1799 C  C   . LEU A 1 240 ? 54.401 -74.512  218.335 1.00 32.19  ? 240  LEU A C   1 
ATOM   1800 O  O   . LEU A 1 240 ? 54.575 -73.857  219.357 1.00 31.57  ? 240  LEU A O   1 
ATOM   1801 C  CB  . LEU A 1 240 ? 51.962 -75.089  218.103 1.00 33.99  ? 240  LEU A CB  1 
ATOM   1802 C  CG  . LEU A 1 240 ? 51.605 -74.359  216.822 1.00 38.42  ? 240  LEU A CG  1 
ATOM   1803 C  CD1 . LEU A 1 240 ? 51.807 -75.265  215.610 1.00 40.69  ? 240  LEU A CD1 1 
ATOM   1804 C  CD2 . LEU A 1 240 ? 50.164 -73.908  216.932 1.00 39.06  ? 240  LEU A CD2 1 
ATOM   1805 N  N   . VAL A 1 241 ? 55.096 -74.301  217.226 1.00 32.78  ? 241  VAL A N   1 
ATOM   1806 C  CA  . VAL A 1 241 ? 56.129 -73.275  217.170 1.00 32.70  ? 241  VAL A CA  1 
ATOM   1807 C  C   . VAL A 1 241 ? 55.929 -72.383  215.961 1.00 32.76  ? 241  VAL A C   1 
ATOM   1808 O  O   . VAL A 1 241 ? 55.806 -72.876  214.839 1.00 34.07  ? 241  VAL A O   1 
ATOM   1809 C  CB  . VAL A 1 241 ? 57.545 -73.903  217.049 1.00 35.78  ? 241  VAL A CB  1 
ATOM   1810 C  CG1 . VAL A 1 241 ? 58.627 -72.819  217.223 1.00 36.61  ? 241  VAL A CG1 1 
ATOM   1811 C  CG2 . VAL A 1 241 ? 57.722 -75.010  218.074 1.00 37.61  ? 241  VAL A CG2 1 
ATOM   1812 N  N   . LEU A 1 242 ? 55.885 -71.074  216.185 1.00 31.70  ? 242  LEU A N   1 
ATOM   1813 C  CA  . LEU A 1 242 ? 55.757 -70.132  215.082 1.00 29.51  ? 242  LEU A CA  1 
ATOM   1814 C  C   . LEU A 1 242 ? 56.982 -69.245  215.136 1.00 28.22  ? 242  LEU A C   1 
ATOM   1815 O  O   . LEU A 1 242 ? 57.379 -68.780  216.205 1.00 27.50  ? 242  LEU A O   1 
ATOM   1816 C  CB  . LEU A 1 242 ? 54.500 -69.263  215.203 1.00 29.61  ? 242  LEU A CB  1 
ATOM   1817 C  CG  . LEU A 1 242 ? 54.420 -68.138  214.147 1.00 32.65  ? 242  LEU A CG  1 
ATOM   1818 C  CD1 . LEU A 1 242 ? 54.246 -68.721  212.738 1.00 30.44  ? 242  LEU A CD1 1 
ATOM   1819 C  CD2 . LEU A 1 242 ? 53.268 -67.181  214.488 1.00 32.15  ? 242  LEU A CD2 1 
ATOM   1820 N  N   . PHE A 1 243 ? 57.586 -69.028  213.978 1.00 26.84  ? 243  PHE A N   1 
ATOM   1821 C  CA  . PHE A 1 243 ? 58.759 -68.186  213.862 1.00 26.76  ? 243  PHE A CA  1 
ATOM   1822 C  C   . PHE A 1 243 ? 58.465 -67.104  212.824 1.00 27.48  ? 243  PHE A C   1 
ATOM   1823 O  O   . PHE A 1 243 ? 57.850 -67.381  211.796 1.00 27.66  ? 243  PHE A O   1 
ATOM   1824 C  CB  . PHE A 1 243 ? 59.959 -69.013  213.387 1.00 25.34  ? 243  PHE A CB  1 
ATOM   1825 C  CG  . PHE A 1 243 ? 61.121 -68.174  212.901 1.00 25.75  ? 243  PHE A CG  1 
ATOM   1826 C  CD1 . PHE A 1 243 ? 62.161 -67.827  213.760 1.00 24.50  ? 243  PHE A CD1 1 
ATOM   1827 C  CD2 . PHE A 1 243 ? 61.151 -67.694  211.590 1.00 24.03  ? 243  PHE A CD2 1 
ATOM   1828 C  CE1 . PHE A 1 243 ? 63.215 -67.010  213.323 1.00 26.01  ? 243  PHE A CE1 1 
ATOM   1829 C  CE2 . PHE A 1 243 ? 62.201 -66.877  211.147 1.00 26.43  ? 243  PHE A CE2 1 
ATOM   1830 C  CZ  . PHE A 1 243 ? 63.232 -66.537  212.019 1.00 24.45  ? 243  PHE A CZ  1 
ATOM   1831 N  N   . THR A 1 244 ? 58.895 -65.874  213.076 1.00 25.66  ? 244  THR A N   1 
ATOM   1832 C  CA  . THR A 1 244 ? 58.685 -64.823  212.084 1.00 26.71  ? 244  THR A CA  1 
ATOM   1833 C  C   . THR A 1 244 ? 59.891 -63.899  212.063 1.00 28.62  ? 244  THR A C   1 
ATOM   1834 O  O   . THR A 1 244 ? 60.638 -63.801  213.043 1.00 27.75  ? 244  THR A O   1 
ATOM   1835 C  CB  . THR A 1 244 ? 57.433 -63.959  212.371 1.00 26.09  ? 244  THR A CB  1 
ATOM   1836 O  OG1 . THR A 1 244 ? 57.609 -63.277  213.614 1.00 24.52  ? 244  THR A OG1 1 
ATOM   1837 C  CG2 . THR A 1 244 ? 56.179 -64.814  212.433 1.00 24.21  ? 244  THR A CG2 1 
ATOM   1838 N  N   . GLY A 1 245 ? 60.087 -63.227  210.939 1.00 28.95  ? 245  GLY A N   1 
ATOM   1839 C  CA  . GLY A 1 245 ? 61.198 -62.307  210.841 1.00 30.06  ? 245  GLY A CA  1 
ATOM   1840 C  C   . GLY A 1 245 ? 61.215 -61.557  209.536 1.00 30.80  ? 245  GLY A C   1 
ATOM   1841 O  O   . GLY A 1 245 ? 60.403 -61.805  208.644 1.00 30.94  ? 245  GLY A O   1 
ATOM   1842 N  N   . HIS A 1 246 ? 62.147 -60.622  209.428 1.00 33.38  ? 246  HIS A N   1 
ATOM   1843 C  CA  . HIS A 1 246 ? 62.282 -59.851  208.213 1.00 35.20  ? 246  HIS A CA  1 
ATOM   1844 C  C   . HIS A 1 246 ? 63.481 -60.441  207.512 1.00 36.46  ? 246  HIS A C   1 
ATOM   1845 O  O   . HIS A 1 246 ? 64.600 -60.384  208.019 1.00 35.69  ? 246  HIS A O   1 
ATOM   1846 C  CB  . HIS A 1 246 ? 62.528 -58.364  208.504 1.00 36.16  ? 246  HIS A CB  1 
ATOM   1847 C  CG  . HIS A 1 246 ? 62.588 -57.525  207.266 1.00 37.21  ? 246  HIS A CG  1 
ATOM   1848 N  ND1 . HIS A 1 246 ? 61.483 -57.298  206.473 1.00 39.05  ? 246  HIS A ND1 1 
ATOM   1849 C  CD2 . HIS A 1 246 ? 63.635 -56.951  206.625 1.00 39.52  ? 246  HIS A CD2 1 
ATOM   1850 C  CE1 . HIS A 1 246 ? 61.848 -56.628  205.393 1.00 38.71  ? 246  HIS A CE1 1 
ATOM   1851 N  NE2 . HIS A 1 246 ? 63.148 -56.405  205.459 1.00 40.21  ? 246  HIS A NE2 1 
ATOM   1852 N  N   . HIS A 1 247 ? 63.241 -61.029  206.350 1.00 40.05  ? 247  HIS A N   1 
ATOM   1853 C  CA  . HIS A 1 247 ? 64.317 -61.622  205.589 1.00 43.26  ? 247  HIS A CA  1 
ATOM   1854 C  C   . HIS A 1 247 ? 64.947 -60.559  204.694 1.00 46.29  ? 247  HIS A C   1 
ATOM   1855 O  O   . HIS A 1 247 ? 64.305 -60.040  203.783 1.00 46.10  ? 247  HIS A O   1 
ATOM   1856 C  CB  . HIS A 1 247 ? 63.790 -62.781  204.744 1.00 42.24  ? 247  HIS A CB  1 
ATOM   1857 C  CG  . HIS A 1 247 ? 64.776 -63.895  204.590 1.00 44.21  ? 247  HIS A CG  1 
ATOM   1858 N  ND1 . HIS A 1 247 ? 66.033 -63.705  204.057 1.00 44.01  ? 247  HIS A ND1 1 
ATOM   1859 C  CD2 . HIS A 1 247 ? 64.711 -65.199  204.948 1.00 43.01  ? 247  HIS A CD2 1 
ATOM   1860 C  CE1 . HIS A 1 247 ? 66.700 -64.844  204.095 1.00 44.37  ? 247  HIS A CE1 1 
ATOM   1861 N  NE2 . HIS A 1 247 ? 65.920 -65.766  204.630 1.00 44.61  ? 247  HIS A NE2 1 
ATOM   1862 N  N   . GLU A 1 248 ? 66.206 -60.229  204.964 1.00 49.50  ? 248  GLU A N   1 
ATOM   1863 C  CA  . GLU A 1 248 ? 66.904 -59.226  204.172 1.00 53.08  ? 248  GLU A CA  1 
ATOM   1864 C  C   . GLU A 1 248 ? 67.067 -59.672  202.725 1.00 54.52  ? 248  GLU A C   1 
ATOM   1865 O  O   . GLU A 1 248 ? 67.091 -58.846  201.813 1.00 53.93  ? 248  GLU A O   1 
ATOM   1866 C  CB  . GLU A 1 248 ? 68.277 -58.930  204.777 1.00 53.45  ? 248  GLU A CB  1 
ATOM   1867 C  CG  . GLU A 1 248 ? 68.214 -58.409  206.197 1.00 53.30  ? 248  GLU A CG  1 
ATOM   1868 C  CD  . GLU A 1 248 ? 69.463 -57.659  206.597 1.00 52.63  ? 248  GLU A CD  1 
ATOM   1869 O  OE1 . GLU A 1 248 ? 70.570 -58.189  206.367 1.00 53.22  ? 248  GLU A OE1 1 
ATOM   1870 O  OE2 . GLU A 1 248 ? 69.335 -56.544  207.146 1.00 52.34  ? 248  GLU A OE2 1 
ATOM   1871 N  N   . ALA A 1 249 ? 67.179 -60.983  202.522 1.00 56.48  ? 249  ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 249 ? 67.337 -61.540  201.185 1.00 57.17  ? 249  ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 249 ? 66.253 -61.040  200.238 1.00 58.23  ? 249  ALA A C   1 
ATOM   1874 O  O   . ALA A 1 249 ? 66.544 -60.657  199.109 1.00 58.51  ? 249  ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 249 ? 67.305 -63.056  201.247 1.00 55.76  ? 249  ALA A CB  1 
ATOM   1876 N  N   . PHE A 1 250 ? 65.008 -61.031  200.709 1.00 60.26  ? 250  PHE A N   1 
ATOM   1877 C  CA  . PHE A 1 250 ? 63.870 -60.602  199.896 1.00 61.37  ? 250  PHE A CA  1 
ATOM   1878 C  C   . PHE A 1 250 ? 63.315 -59.254  200.330 1.00 60.78  ? 250  PHE A C   1 
ATOM   1879 O  O   . PHE A 1 250 ? 62.366 -58.742  199.740 1.00 59.11  ? 250  PHE A O   1 
ATOM   1880 C  CB  . PHE A 1 250 ? 62.746 -61.638  199.970 1.00 63.69  ? 250  PHE A CB  1 
ATOM   1881 C  CG  . PHE A 1 250 ? 63.227 -63.056  199.985 1.00 65.96  ? 250  PHE A CG  1 
ATOM   1882 C  CD1 . PHE A 1 250 ? 63.478 -63.704  201.191 1.00 68.07  ? 250  PHE A CD1 1 
ATOM   1883 C  CD2 . PHE A 1 250 ? 63.438 -63.745  198.793 1.00 67.40  ? 250  PHE A CD2 1 
ATOM   1884 C  CE1 . PHE A 1 250 ? 63.935 -65.022  201.213 1.00 68.50  ? 250  PHE A CE1 1 
ATOM   1885 C  CE2 . PHE A 1 250 ? 63.895 -65.061  198.803 1.00 68.96  ? 250  PHE A CE2 1 
ATOM   1886 C  CZ  . PHE A 1 250 ? 64.143 -65.702  200.016 1.00 69.30  ? 250  PHE A CZ  1 
ATOM   1887 N  N   . ALA A 1 251 ? 63.908 -58.691  201.372 1.00 61.66  ? 251  ALA A N   1 
ATOM   1888 C  CA  . ALA A 1 251 ? 63.474 -57.409  201.900 1.00 62.03  ? 251  ALA A CA  1 
ATOM   1889 C  C   . ALA A 1 251 ? 62.007 -57.439  202.323 1.00 61.51  ? 251  ALA A C   1 
ATOM   1890 O  O   . ALA A 1 251 ? 61.323 -56.419  202.294 1.00 64.08  ? 251  ALA A O   1 
ATOM   1891 C  CB  . ALA A 1 251 ? 63.711 -56.310  200.870 1.00 63.08  ? 251  ALA A CB  1 
ATOM   1892 N  N   . GLN A 1 252 ? 61.518 -58.614  202.699 1.00 59.88  ? 252  GLN A N   1 
ATOM   1893 C  CA  . GLN A 1 252 ? 60.146 -58.741  203.180 1.00 58.12  ? 252  GLN A CA  1 
ATOM   1894 C  C   . GLN A 1 252 ? 60.044 -59.782  204.287 1.00 54.67  ? 252  GLN A C   1 
ATOM   1895 O  O   . GLN A 1 252 ? 60.942 -60.606  204.453 1.00 54.49  ? 252  GLN A O   1 
ATOM   1896 C  CB  . GLN A 1 252 ? 59.174 -59.061  202.039 1.00 60.57  ? 252  GLN A CB  1 
ATOM   1897 C  CG  . GLN A 1 252 ? 59.573 -60.160  201.092 1.00 62.48  ? 252  GLN A CG  1 
ATOM   1898 C  CD  . GLN A 1 252 ? 58.775 -60.066  199.805 1.00 66.89  ? 252  GLN A CD  1 
ATOM   1899 O  OE1 . GLN A 1 252 ? 58.755 -59.015  199.151 1.00 68.00  ? 252  GLN A OE1 1 
ATOM   1900 N  NE2 . GLN A 1 252 ? 58.107 -61.154  199.435 1.00 67.77  ? 252  GLN A NE2 1 
ATOM   1901 N  N   . ASN A 1 253 ? 58.958 -59.732  205.054 1.00 50.36  ? 253  ASN A N   1 
ATOM   1902 C  CA  . ASN A 1 253 ? 58.782 -60.661  206.162 1.00 47.03  ? 253  ASN A CA  1 
ATOM   1903 C  C   . ASN A 1 253 ? 58.479 -62.101  205.773 1.00 44.06  ? 253  ASN A C   1 
ATOM   1904 O  O   . ASN A 1 253 ? 57.894 -62.381  204.722 1.00 44.04  ? 253  ASN A O   1 
ATOM   1905 C  CB  . ASN A 1 253 ? 57.700 -60.158  207.113 1.00 46.59  ? 253  ASN A CB  1 
ATOM   1906 C  CG  . ASN A 1 253 ? 58.041 -58.810  207.716 1.00 47.57  ? 253  ASN A CG  1 
ATOM   1907 O  OD1 . ASN A 1 253 ? 59.200 -58.525  208.027 1.00 48.52  ? 253  ASN A OD1 1 
ATOM   1908 N  ND2 . ASN A 1 253 ? 57.028 -57.978  207.898 1.00 46.70  ? 253  ASN A ND2 1 
ATOM   1909 N  N   . VAL A 1 254 ? 58.896 -63.015  206.640 1.00 39.25  ? 254  VAL A N   1 
ATOM   1910 C  CA  . VAL A 1 254 ? 58.676 -64.429  206.414 1.00 35.78  ? 254  VAL A CA  1 
ATOM   1911 C  C   . VAL A 1 254 ? 58.279 -65.071  207.726 1.00 33.12  ? 254  VAL A C   1 
ATOM   1912 O  O   . VAL A 1 254 ? 58.468 -64.490  208.790 1.00 31.47  ? 254  VAL A O   1 
ATOM   1913 C  CB  . VAL A 1 254 ? 59.953 -65.114  205.887 1.00 34.61  ? 254  VAL A CB  1 
ATOM   1914 C  CG1 . VAL A 1 254 ? 60.331 -64.515  204.553 1.00 33.92  ? 254  VAL A CG1 1 
ATOM   1915 C  CG2 . VAL A 1 254 ? 61.096 -64.945  206.893 1.00 32.04  ? 254  VAL A CG2 1 
ATOM   1916 N  N   . HIS A 1 255 ? 57.703 -66.261  207.643 1.00 32.68  ? 255  HIS A N   1 
ATOM   1917 C  CA  . HIS A 1 255 ? 57.314 -66.989  208.843 1.00 34.59  ? 255  HIS A CA  1 
ATOM   1918 C  C   . HIS A 1 255 ? 57.426 -68.487  208.613 1.00 32.08  ? 255  HIS A C   1 
ATOM   1919 O  O   . HIS A 1 255 ? 57.446 -68.953  207.468 1.00 32.02  ? 255  HIS A O   1 
ATOM   1920 C  CB  . HIS A 1 255 ? 55.888 -66.639  209.283 1.00 37.26  ? 255  HIS A CB  1 
ATOM   1921 C  CG  . HIS A 1 255 ? 54.824 -67.191  208.390 1.00 41.33  ? 255  HIS A CG  1 
ATOM   1922 N  ND1 . HIS A 1 255 ? 54.486 -66.611  207.185 1.00 45.46  ? 255  HIS A ND1 1 
ATOM   1923 C  CD2 . HIS A 1 255 ? 54.026 -68.277  208.524 1.00 42.36  ? 255  HIS A CD2 1 
ATOM   1924 C  CE1 . HIS A 1 255 ? 53.525 -67.316  206.614 1.00 46.39  ? 255  HIS A CE1 1 
ATOM   1925 N  NE2 . HIS A 1 255 ? 53.227 -68.332  207.406 1.00 45.88  ? 255  HIS A NE2 1 
ATOM   1926 N  N   . ALA A 1 256 ? 57.509 -69.235  209.706 1.00 29.30  ? 256  ALA A N   1 
ATOM   1927 C  CA  . ALA A 1 256 ? 57.632 -70.678  209.630 1.00 29.03  ? 256  ALA A CA  1 
ATOM   1928 C  C   . ALA A 1 256 ? 56.935 -71.318  210.828 1.00 29.10  ? 256  ALA A C   1 
ATOM   1929 O  O   . ALA A 1 256 ? 56.873 -70.744  211.911 1.00 26.50  ? 256  ALA A O   1 
ATOM   1930 C  CB  . ALA A 1 256 ? 59.117 -71.072  209.577 1.00 27.64  ? 256  ALA A CB  1 
ATOM   1931 N  N   . ARG A 1 257 ? 56.390 -72.509  210.621 1.00 31.12  ? 257  ARG A N   1 
ATOM   1932 C  CA  . ARG A 1 257 ? 55.684 -73.200  211.685 1.00 31.56  ? 257  ARG A CA  1 
ATOM   1933 C  C   . ARG A 1 257 ? 56.134 -74.657  211.766 1.00 28.65  ? 257  ARG A C   1 
ATOM   1934 O  O   . ARG A 1 257 ? 56.561 -75.244  210.779 1.00 26.97  ? 257  ARG A O   1 
ATOM   1935 C  CB  . ARG A 1 257 ? 54.173 -73.094  211.437 1.00 35.58  ? 257  ARG A CB  1 
ATOM   1936 C  CG  . ARG A 1 257 ? 53.724 -73.664  210.101 1.00 45.19  ? 257  ARG A CG  1 
ATOM   1937 C  CD  . ARG A 1 257 ? 52.953 -72.637  209.288 1.00 51.13  ? 257  ARG A CD  1 
ATOM   1938 N  NE  . ARG A 1 257 ? 51.642 -73.125  208.860 1.00 58.69  ? 257  ARG A NE  1 
ATOM   1939 C  CZ  . ARG A 1 257 ? 51.439 -74.220  208.130 1.00 62.23  ? 257  ARG A CZ  1 
ATOM   1940 N  NH1 . ARG A 1 257 ? 52.456 -74.971  207.733 1.00 64.22  ? 257  ARG A NH1 1 
ATOM   1941 N  NH2 . ARG A 1 257 ? 50.208 -74.555  207.772 1.00 66.15  ? 257  ARG A NH2 1 
ATOM   1942 N  N   . HIS A 1 258 ? 56.055 -75.226  212.955 1.00 26.21  ? 258  HIS A N   1 
ATOM   1943 C  CA  . HIS A 1 258 ? 56.445 -76.607  213.149 1.00 28.78  ? 258  HIS A CA  1 
ATOM   1944 C  C   . HIS A 1 258 ? 55.674 -77.071  214.370 1.00 28.90  ? 258  HIS A C   1 
ATOM   1945 O  O   . HIS A 1 258 ? 55.256 -76.256  215.187 1.00 31.03  ? 258  HIS A O   1 
ATOM   1946 C  CB  . HIS A 1 258 ? 57.954 -76.707  213.412 1.00 27.01  ? 258  HIS A CB  1 
ATOM   1947 C  CG  . HIS A 1 258 ? 58.505 -78.080  213.236 1.00 30.05  ? 258  HIS A CG  1 
ATOM   1948 N  ND1 . HIS A 1 258 ? 58.933 -78.563  212.015 1.00 31.37  ? 258  HIS A ND1 1 
ATOM   1949 C  CD2 . HIS A 1 258 ? 58.687 -79.089  214.122 1.00 32.00  ? 258  HIS A CD2 1 
ATOM   1950 C  CE1 . HIS A 1 258 ? 59.355 -79.806  212.157 1.00 29.28  ? 258  HIS A CE1 1 
ATOM   1951 N  NE2 . HIS A 1 258 ? 59.217 -80.150  213.426 1.00 31.20  ? 258  HIS A NE2 1 
ATOM   1952 N  N   . ALA A 1 259 ? 55.471 -78.372  214.499 1.00 30.36  ? 259  ALA A N   1 
ATOM   1953 C  CA  . ALA A 1 259 ? 54.756 -78.887  215.659 1.00 30.01  ? 259  ALA A CA  1 
ATOM   1954 C  C   . ALA A 1 259 ? 55.411 -80.187  216.097 1.00 30.06  ? 259  ALA A C   1 
ATOM   1955 O  O   . ALA A 1 259 ? 55.995 -80.895  215.273 1.00 28.73  ? 259  ALA A O   1 
ATOM   1956 C  CB  . ALA A 1 259 ? 53.297 -79.117  215.314 1.00 29.84  ? 259  ALA A CB  1 
ATOM   1957 N  N   . TYR A 1 260 ? 55.315 -80.485  217.390 1.00 30.64  ? 260  TYR A N   1 
ATOM   1958 C  CA  . TYR A 1 260 ? 55.890 -81.698  217.969 1.00 32.49  ? 260  TYR A CA  1 
ATOM   1959 C  C   . TYR A 1 260 ? 54.905 -82.428  218.875 1.00 32.93  ? 260  TYR A C   1 
ATOM   1960 O  O   . TYR A 1 260 ? 54.097 -81.803  219.556 1.00 32.90  ? 260  TYR A O   1 
ATOM   1961 C  CB  . TYR A 1 260 ? 57.102 -81.382  218.844 1.00 30.98  ? 260  TYR A CB  1 
ATOM   1962 C  CG  . TYR A 1 260 ? 58.230 -80.640  218.192 1.00 32.82  ? 260  TYR A CG  1 
ATOM   1963 C  CD1 . TYR A 1 260 ? 58.297 -79.247  218.249 1.00 31.53  ? 260  TYR A CD1 1 
ATOM   1964 C  CD2 . TYR A 1 260 ? 59.274 -81.331  217.575 1.00 31.27  ? 260  TYR A CD2 1 
ATOM   1965 C  CE1 . TYR A 1 260 ? 59.386 -78.559  217.708 1.00 32.46  ? 260  TYR A CE1 1 
ATOM   1966 C  CE2 . TYR A 1 260 ? 60.362 -80.654  217.036 1.00 29.85  ? 260  TYR A CE2 1 
ATOM   1967 C  CZ  . TYR A 1 260 ? 60.412 -79.271  217.106 1.00 29.89  ? 260  TYR A CZ  1 
ATOM   1968 O  OH  . TYR A 1 260 ? 61.478 -78.603  216.574 1.00 26.61  ? 260  TYR A OH  1 
ATOM   1969 N  N   . SER A 1 261 ? 55.012 -83.751  218.912 1.00 34.93  ? 261  SER A N   1 
ATOM   1970 C  CA  . SER A 1 261 ? 54.165 -84.560  219.780 1.00 40.49  ? 261  SER A CA  1 
ATOM   1971 C  C   . SER A 1 261 ? 55.014 -84.974  220.989 1.00 41.70  ? 261  SER A C   1 
ATOM   1972 O  O   . SER A 1 261 ? 56.222 -84.750  221.000 1.00 41.31  ? 261  SER A O   1 
ATOM   1973 C  CB  . SER A 1 261 ? 53.676 -85.799  219.030 1.00 41.23  ? 261  SER A CB  1 
ATOM   1974 O  OG  . SER A 1 261 ? 54.775 -86.541  218.535 1.00 45.35  ? 261  SER A OG  1 
ATOM   1975 N  N   . CYS A 1 262 ? 54.386 -85.567  222.000 1.00 44.93  ? 262  CYS A N   1 
ATOM   1976 C  CA  . CYS A 1 262 ? 55.097 -86.010  223.203 1.00 47.56  ? 262  CYS A CA  1 
ATOM   1977 C  C   . CYS A 1 262 ? 56.265 -86.913  222.868 1.00 47.01  ? 262  CYS A C   1 
ATOM   1978 O  O   . CYS A 1 262 ? 57.304 -86.860  223.522 1.00 46.65  ? 262  CYS A O   1 
ATOM   1979 C  CB  . CYS A 1 262 ? 54.170 -86.792  224.125 1.00 48.97  ? 262  CYS A CB  1 
ATOM   1980 S  SG  . CYS A 1 262 ? 52.768 -85.883  224.687 1.00 57.40  ? 262  CYS A SG  1 
ATOM   1981 N  N   . ASP A 1 263 ? 56.067 -87.757  221.860 1.00 47.79  ? 263  ASP A N   1 
ATOM   1982 C  CA  . ASP A 1 263 ? 57.080 -88.706  221.411 1.00 49.79  ? 263  ASP A CA  1 
ATOM   1983 C  C   . ASP A 1 263 ? 58.356 -88.031  220.952 1.00 48.57  ? 263  ASP A C   1 
ATOM   1984 O  O   . ASP A 1 263 ? 59.426 -88.647  220.933 1.00 50.21  ? 263  ASP A O   1 
ATOM   1985 C  CB  . ASP A 1 263 ? 56.567 -89.538  220.231 1.00 53.55  ? 263  ASP A CB  1 
ATOM   1986 C  CG  . ASP A 1 263 ? 55.341 -90.341  220.573 1.00 58.71  ? 263  ASP A CG  1 
ATOM   1987 O  OD1 . ASP A 1 263 ? 55.298 -90.896  221.693 1.00 61.34  ? 263  ASP A OD1 1 
ATOM   1988 O  OD2 . ASP A 1 263 ? 54.427 -90.425  219.720 1.00 60.87  ? 263  ASP A OD2 1 
ATOM   1989 N  N   . GLU A 1 264 ? 58.246 -86.767  220.572 1.00 44.81  ? 264  GLU A N   1 
ATOM   1990 C  CA  . GLU A 1 264 ? 59.396 -86.076  220.051 1.00 40.29  ? 264  GLU A CA  1 
ATOM   1991 C  C   . GLU A 1 264 ? 60.144 -85.264  221.071 1.00 38.63  ? 264  GLU A C   1 
ATOM   1992 O  O   . GLU A 1 264 ? 60.904 -84.359  220.735 1.00 39.18  ? 264  GLU A O   1 
ATOM   1993 C  CB  . GLU A 1 264 ? 58.942 -85.274  218.846 1.00 39.54  ? 264  GLU A CB  1 
ATOM   1994 C  CG  . GLU A 1 264 ? 58.115 -86.193  217.947 1.00 39.97  ? 264  GLU A CG  1 
ATOM   1995 C  CD  . GLU A 1 264 ? 57.528 -85.527  216.735 1.00 40.53  ? 264  GLU A CD  1 
ATOM   1996 O  OE1 . GLU A 1 264 ? 56.772 -84.548  216.892 1.00 42.84  ? 264  GLU A OE1 1 
ATOM   1997 O  OE2 . GLU A 1 264 ? 57.810 -86.000  215.619 1.00 43.02  ? 264  GLU A OE2 1 
ATOM   1998 N  N   . ILE A 1 265 ? 59.928 -85.608  222.334 1.00 36.19  ? 265  ILE A N   1 
ATOM   1999 C  CA  . ILE A 1 265 ? 60.637 -84.957  223.420 1.00 35.12  ? 265  ILE A CA  1 
ATOM   2000 C  C   . ILE A 1 265 ? 61.593 -85.978  224.031 1.00 36.63  ? 265  ILE A C   1 
ATOM   2001 O  O   . ILE A 1 265 ? 61.171 -87.048  224.494 1.00 34.26  ? 265  ILE A O   1 
ATOM   2002 C  CB  . ILE A 1 265 ? 59.725 -84.505  224.547 1.00 33.67  ? 265  ILE A CB  1 
ATOM   2003 C  CG1 . ILE A 1 265 ? 58.674 -83.529  224.037 1.00 33.11  ? 265  ILE A CG1 1 
ATOM   2004 C  CG2 . ILE A 1 265 ? 60.573 -83.864  225.633 1.00 33.18  ? 265  ILE A CG2 1 
ATOM   2005 C  CD1 . ILE A 1 265 ? 57.838 -82.940  225.162 1.00 34.23  ? 265  ILE A CD1 1 
ATOM   2006 N  N   . ILE A 1 266 ? 62.880 -85.654  224.026 1.00 35.87  ? 266  ILE A N   1 
ATOM   2007 C  CA  . ILE A 1 266 ? 63.861 -86.543  224.608 1.00 34.56  ? 266  ILE A CA  1 
ATOM   2008 C  C   . ILE A 1 266 ? 64.211 -86.032  225.998 1.00 35.35  ? 266  ILE A C   1 
ATOM   2009 O  O   . ILE A 1 266 ? 65.024 -85.120  226.142 1.00 36.49  ? 266  ILE A O   1 
ATOM   2010 C  CB  . ILE A 1 266 ? 65.139 -86.590  223.780 1.00 34.69  ? 266  ILE A CB  1 
ATOM   2011 C  CG1 . ILE A 1 266 ? 64.799 -86.829  222.312 1.00 34.18  ? 266  ILE A CG1 1 
ATOM   2012 C  CG2 . ILE A 1 266 ? 66.051 -87.681  224.323 1.00 34.65  ? 266  ILE A CG2 1 
ATOM   2013 C  CD1 . ILE A 1 266 ? 63.912 -88.032  222.078 1.00 34.74  ? 266  ILE A CD1 1 
ATOM   2014 N  N   . TRP A 1 267 ? 63.576 -86.601  227.017 1.00 34.81  ? 267  TRP A N   1 
ATOM   2015 C  CA  . TRP A 1 267 ? 63.848 -86.206  228.393 1.00 36.12  ? 267  TRP A CA  1 
ATOM   2016 C  C   . TRP A 1 267 ? 65.312 -86.538  228.734 1.00 37.60  ? 267  TRP A C   1 
ATOM   2017 O  O   . TRP A 1 267 ? 65.752 -87.672  228.562 1.00 39.77  ? 267  TRP A O   1 
ATOM   2018 C  CB  . TRP A 1 267 ? 62.899 -86.944  229.339 1.00 33.18  ? 267  TRP A CB  1 
ATOM   2019 C  CG  . TRP A 1 267 ? 61.454 -86.631  229.098 1.00 33.81  ? 267  TRP A CG  1 
ATOM   2020 C  CD1 . TRP A 1 267 ? 60.684 -87.039  228.040 1.00 35.09  ? 267  TRP A CD1 1 
ATOM   2021 C  CD2 . TRP A 1 267 ? 60.608 -85.804  229.909 1.00 32.68  ? 267  TRP A CD2 1 
ATOM   2022 N  NE1 . TRP A 1 267 ? 59.414 -86.515  228.144 1.00 31.44  ? 267  TRP A NE1 1 
ATOM   2023 C  CE2 . TRP A 1 267 ? 59.342 -85.753  229.280 1.00 31.63  ? 267  TRP A CE2 1 
ATOM   2024 C  CE3 . TRP A 1 267 ? 60.798 -85.098  231.105 1.00 33.80  ? 267  TRP A CE3 1 
ATOM   2025 C  CZ2 . TRP A 1 267 ? 58.271 -85.022  229.809 1.00 32.16  ? 267  TRP A CZ2 1 
ATOM   2026 C  CZ3 . TRP A 1 267 ? 59.724 -84.367  231.635 1.00 31.60  ? 267  TRP A CZ3 1 
ATOM   2027 C  CH2 . TRP A 1 267 ? 58.482 -84.339  230.983 1.00 31.08  ? 267  TRP A CH2 1 
ATOM   2028 N  N   . GLY A 1 268 ? 66.065 -85.545  229.198 1.00 37.67  ? 268  GLY A N   1 
ATOM   2029 C  CA  . GLY A 1 268 ? 67.457 -85.772  229.532 1.00 37.24  ? 268  GLY A CA  1 
ATOM   2030 C  C   . GLY A 1 268 ? 68.414 -85.466  228.387 1.00 40.05  ? 268  GLY A C   1 
ATOM   2031 O  O   . GLY A 1 268 ? 69.619 -85.319  228.601 1.00 40.87  ? 268  GLY A O   1 
ATOM   2032 N  N   . GLY A 1 269 ? 67.892 -85.353  227.171 1.00 39.36  ? 269  GLY A N   1 
ATOM   2033 C  CA  . GLY A 1 269 ? 68.745 -85.080  226.032 1.00 39.16  ? 269  GLY A CA  1 
ATOM   2034 C  C   . GLY A 1 269 ? 69.321 -83.681  225.988 1.00 41.79  ? 269  GLY A C   1 
ATOM   2035 O  O   . GLY A 1 269 ? 68.880 -82.787  226.704 1.00 42.45  ? 269  GLY A O   1 
ATOM   2036 N  N   . HIS A 1 270 ? 70.331 -83.494  225.148 1.00 43.64  ? 270  HIS A N   1 
ATOM   2037 C  CA  . HIS A 1 270 ? 70.970 -82.193  224.980 1.00 45.81  ? 270  HIS A CA  1 
ATOM   2038 C  C   . HIS A 1 270 ? 71.357 -82.101  223.511 1.00 45.19  ? 270  HIS A C   1 
ATOM   2039 O  O   . HIS A 1 270 ? 71.806 -83.083  222.918 1.00 44.16  ? 270  HIS A O   1 
ATOM   2040 C  CB  . HIS A 1 270 ? 72.246 -82.064  225.827 1.00 49.17  ? 270  HIS A CB  1 
ATOM   2041 C  CG  . HIS A 1 270 ? 72.069 -82.429  227.266 1.00 55.51  ? 270  HIS A CG  1 
ATOM   2042 N  ND1 . HIS A 1 270 ? 72.107 -83.734  227.715 1.00 59.41  ? 270  HIS A ND1 1 
ATOM   2043 C  CD2 . HIS A 1 270 ? 71.840 -81.662  228.359 1.00 57.52  ? 270  HIS A CD2 1 
ATOM   2044 C  CE1 . HIS A 1 270 ? 71.907 -83.754  229.022 1.00 59.32  ? 270  HIS A CE1 1 
ATOM   2045 N  NE2 . HIS A 1 270 ? 71.742 -82.510  229.437 1.00 58.54  ? 270  HIS A NE2 1 
ATOM   2046 N  N   . PHE A 1 271 ? 71.161 -80.939  222.909 1.00 43.83  ? 271  PHE A N   1 
ATOM   2047 C  CA  . PHE A 1 271 ? 71.540 -80.796  221.523 1.00 46.13  ? 271  PHE A CA  1 
ATOM   2048 C  C   . PHE A 1 271 ? 73.061 -80.777  221.508 1.00 49.42  ? 271  PHE A C   1 
ATOM   2049 O  O   . PHE A 1 271 ? 73.687 -80.398  222.493 1.00 49.24  ? 271  PHE A O   1 
ATOM   2050 C  CB  . PHE A 1 271 ? 70.944 -79.515  220.924 1.00 41.59  ? 271  PHE A CB  1 
ATOM   2051 C  CG  . PHE A 1 271 ? 69.461 -79.604  220.669 1.00 40.14  ? 271  PHE A CG  1 
ATOM   2052 C  CD1 . PHE A 1 271 ? 68.551 -78.888  221.458 1.00 40.24  ? 271  PHE A CD1 1 
ATOM   2053 C  CD2 . PHE A 1 271 ? 68.963 -80.430  219.659 1.00 38.41  ? 271  PHE A CD2 1 
ATOM   2054 C  CE1 . PHE A 1 271 ? 67.175 -78.995  221.248 1.00 34.17  ? 271  PHE A CE1 1 
ATOM   2055 C  CE2 . PHE A 1 271 ? 67.590 -80.547  219.438 1.00 36.09  ? 271  PHE A CE2 1 
ATOM   2056 C  CZ  . PHE A 1 271 ? 66.694 -79.825  220.239 1.00 37.68  ? 271  PHE A CZ  1 
ATOM   2057 N  N   . VAL A 1 272 ? 73.646 -81.218  220.402 1.00 54.26  ? 272  VAL A N   1 
ATOM   2058 C  CA  . VAL A 1 272 ? 75.093 -81.272  220.246 1.00 59.67  ? 272  VAL A CA  1 
ATOM   2059 C  C   . VAL A 1 272 ? 75.585 -80.067  219.463 1.00 62.79  ? 272  VAL A C   1 
ATOM   2060 O  O   . VAL A 1 272 ? 74.900 -79.602  218.558 1.00 62.76  ? 272  VAL A O   1 
ATOM   2061 C  CB  . VAL A 1 272 ? 75.512 -82.546  219.475 1.00 60.59  ? 272  VAL A CB  1 
ATOM   2062 C  CG1 . VAL A 1 272 ? 77.019 -82.564  219.264 1.00 61.10  ? 272  VAL A CG1 1 
ATOM   2063 C  CG2 . VAL A 1 272 ? 75.059 -83.779  220.229 1.00 60.09  ? 272  VAL A CG2 1 
ATOM   2064 N  N   . ASP A 1 273 ? 76.767 -79.564  219.804 1.00 67.65  ? 273  ASP A N   1 
ATOM   2065 C  CA  . ASP A 1 273 ? 77.328 -78.424  219.093 1.00 74.28  ? 273  ASP A CA  1 
ATOM   2066 C  C   . ASP A 1 273 ? 77.277 -78.762  217.612 1.00 75.84  ? 273  ASP A C   1 
ATOM   2067 O  O   . ASP A 1 273 ? 77.655 -79.858  217.202 1.00 76.37  ? 273  ASP A O   1 
ATOM   2068 C  CB  . ASP A 1 273 ? 78.767 -78.178  219.535 1.00 79.17  ? 273  ASP A CB  1 
ATOM   2069 C  CG  . ASP A 1 273 ? 78.882 -77.984  221.033 1.00 85.27  ? 273  ASP A CG  1 
ATOM   2070 O  OD1 . ASP A 1 273 ? 78.190 -77.088  221.569 1.00 88.03  ? 273  ASP A OD1 1 
ATOM   2071 O  OD2 . ASP A 1 273 ? 79.661 -78.727  221.675 1.00 88.42  ? 273  ASP A OD2 1 
ATOM   2072 N  N   . VAL A 1 274 ? 76.801 -77.821  216.810 1.00 77.74  ? 274  VAL A N   1 
ATOM   2073 C  CA  . VAL A 1 274 ? 76.653 -78.051  215.382 1.00 79.70  ? 274  VAL A CA  1 
ATOM   2074 C  C   . VAL A 1 274 ? 77.858 -77.720  214.515 1.00 81.53  ? 274  VAL A C   1 
ATOM   2075 O  O   . VAL A 1 274 ? 77.797 -77.865  213.297 1.00 82.08  ? 274  VAL A O   1 
ATOM   2076 C  CB  . VAL A 1 274 ? 75.440 -77.272  214.845 1.00 78.30  ? 274  VAL A CB  1 
ATOM   2077 C  CG1 . VAL A 1 274 ? 74.157 -77.985  215.218 1.00 78.30  ? 274  VAL A CG1 1 
ATOM   2078 C  CG2 . VAL A 1 274 ? 75.439 -75.873  215.428 1.00 78.04  ? 274  VAL A CG2 1 
ATOM   2079 N  N   . PHE A 1 275 ? 78.955 -77.290  215.124 1.00 84.04  ? 275  PHE A N   1 
ATOM   2080 C  CA  . PHE A 1 275 ? 80.129 -76.936  214.340 1.00 86.56  ? 275  PHE A CA  1 
ATOM   2081 C  C   . PHE A 1 275 ? 81.206 -78.012  214.256 1.00 87.68  ? 275  PHE A C   1 
ATOM   2082 O  O   . PHE A 1 275 ? 81.470 -78.731  215.222 1.00 88.42  ? 275  PHE A O   1 
ATOM   2083 C  CB  . PHE A 1 275 ? 80.748 -75.643  214.878 1.00 87.83  ? 275  PHE A CB  1 
ATOM   2084 C  CG  . PHE A 1 275 ? 79.784 -74.495  214.947 1.00 89.21  ? 275  PHE A CG  1 
ATOM   2085 C  CD1 . PHE A 1 275 ? 78.917 -74.363  216.024 1.00 89.59  ? 275  PHE A CD1 1 
ATOM   2086 C  CD2 . PHE A 1 275 ? 79.732 -73.552  213.924 1.00 90.52  ? 275  PHE A CD2 1 
ATOM   2087 C  CE1 . PHE A 1 275 ? 78.013 -73.309  216.085 1.00 90.66  ? 275  PHE A CE1 1 
ATOM   2088 C  CE2 . PHE A 1 275 ? 78.831 -72.493  213.974 1.00 91.22  ? 275  PHE A CE2 1 
ATOM   2089 C  CZ  . PHE A 1 275 ? 77.969 -72.371  215.058 1.00 91.02  ? 275  PHE A CZ  1 
ATOM   2090 N  N   . THR A 1 276 ? 81.819 -78.117  213.081 1.00 88.27  ? 276  THR A N   1 
ATOM   2091 C  CA  . THR A 1 276 ? 82.893 -79.073  212.847 1.00 88.88  ? 276  THR A CA  1 
ATOM   2092 C  C   . THR A 1 276 ? 84.168 -78.285  212.555 1.00 89.42  ? 276  THR A C   1 
ATOM   2093 O  O   . THR A 1 276 ? 84.286 -77.114  212.930 1.00 88.75  ? 276  THR A O   1 
ATOM   2094 C  CB  . THR A 1 276 ? 82.596 -80.001  211.642 1.00 88.44  ? 276  THR A CB  1 
ATOM   2095 O  OG1 . THR A 1 276 ? 82.498 -79.223  210.444 1.00 87.73  ? 276  THR A OG1 1 
ATOM   2096 C  CG2 . THR A 1 276 ? 81.303 -80.755  211.858 1.00 88.68  ? 276  THR A CG2 1 
ATOM   2097 N  N   . THR A 1 277 ? 85.119 -78.931  211.890 1.00 89.82  ? 277  THR A N   1 
ATOM   2098 C  CA  . THR A 1 277 ? 86.376 -78.290  211.546 1.00 90.26  ? 277  THR A CA  1 
ATOM   2099 C  C   . THR A 1 277 ? 86.850 -78.808  210.201 1.00 91.28  ? 277  THR A C   1 
ATOM   2100 O  O   . THR A 1 277 ? 87.126 -79.996  210.047 1.00 90.80  ? 277  THR A O   1 
ATOM   2101 C  CB  . THR A 1 277 ? 87.462 -78.577  212.603 1.00 89.74  ? 277  THR A CB  1 
ATOM   2102 O  OG1 . THR A 1 277 ? 87.052 -78.046  213.868 1.00 89.29  ? 277  THR A OG1 1 
ATOM   2103 C  CG2 . THR A 1 277 ? 88.778 -77.934  212.202 1.00 90.05  ? 277  THR A CG2 1 
ATOM   2104 N  N   . LEU A 1 278 ? 86.926 -77.916  209.221 1.00 93.21  ? 278  LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 278 ? 87.377 -78.296  207.891 1.00 94.50  ? 278  LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 278 ? 88.865 -78.625  207.937 1.00 95.20  ? 278  LEU A C   1 
ATOM   2107 O  O   . LEU A 1 278 ? 89.574 -78.204  208.853 1.00 94.03  ? 278  LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 278 ? 87.112 -77.163  206.893 1.00 94.51  ? 278  LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 278 ? 85.649 -76.852  206.571 1.00 94.40  ? 278  LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 278 ? 85.587 -75.744  205.532 1.00 94.23  ? 278  LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 278 ? 84.952 -78.101  206.049 1.00 94.27  ? 278  LEU A CD2 1 
ATOM   2112 N  N   . PRO A 1 279 ? 89.359 -79.379  206.942 1.00 96.50  ? 279  PRO A N   1 
ATOM   2113 C  CA  . PRO A 1 279 ? 90.772 -79.760  206.889 1.00 97.77  ? 279  PRO A CA  1 
ATOM   2114 C  C   . PRO A 1 279 ? 91.757 -78.619  207.126 1.00 99.39  ? 279  PRO A C   1 
ATOM   2115 O  O   . PRO A 1 279 ? 92.788 -78.818  207.763 1.00 100.09 ? 279  PRO A O   1 
ATOM   2116 C  CB  . PRO A 1 279 ? 90.911 -80.384  205.499 1.00 97.48  ? 279  PRO A CB  1 
ATOM   2117 C  CG  . PRO A 1 279 ? 89.831 -79.711  204.707 1.00 97.43  ? 279  PRO A CG  1 
ATOM   2118 C  CD  . PRO A 1 279 ? 88.684 -79.723  205.680 1.00 96.76  ? 279  PRO A CD  1 
ATOM   2119 N  N   . ASP A 1 280 ? 91.449 -77.428  206.625 1.00 100.74 ? 280  ASP A N   1 
ATOM   2120 C  CA  . ASP A 1 280 ? 92.351 -76.300  206.820 1.00 102.08 ? 280  ASP A CA  1 
ATOM   2121 C  C   . ASP A 1 280 ? 92.383 -75.915  208.296 1.00 102.66 ? 280  ASP A C   1 
ATOM   2122 O  O   . ASP A 1 280 ? 93.425 -75.519  208.816 1.00 103.08 ? 280  ASP A O   1 
ATOM   2123 C  CB  . ASP A 1 280 ? 91.912 -75.095  205.984 1.00 103.05 ? 280  ASP A CB  1 
ATOM   2124 C  CG  . ASP A 1 280 ? 90.669 -74.430  206.531 1.00 104.18 ? 280  ASP A CG  1 
ATOM   2125 O  OD1 . ASP A 1 280 ? 89.603 -75.077  206.532 1.00 104.98 ? 280  ASP A OD1 1 
ATOM   2126 O  OD2 . ASP A 1 280 ? 90.763 -73.260  206.964 1.00 104.26 ? 280  ASP A OD2 1 
ATOM   2127 N  N   . GLY A 1 281 ? 91.240 -76.028  208.965 1.00 103.04 ? 281  GLY A N   1 
ATOM   2128 C  CA  . GLY A 1 281 ? 91.190 -75.696  210.377 1.00 104.12 ? 281  GLY A CA  1 
ATOM   2129 C  C   . GLY A 1 281 ? 90.086 -74.744  210.800 1.00 104.78 ? 281  GLY A C   1 
ATOM   2130 O  O   . GLY A 1 281 ? 89.908 -74.496  211.993 1.00 104.67 ? 281  GLY A O   1 
ATOM   2131 N  N   . ARG A 1 282 ? 89.339 -74.208  209.839 1.00 105.45 ? 282  ARG A N   1 
ATOM   2132 C  CA  . ARG A 1 282 ? 88.263 -73.279  210.168 1.00 105.96 ? 282  ARG A CA  1 
ATOM   2133 C  C   . ARG A 1 282 ? 86.925 -73.973  210.398 1.00 105.20 ? 282  ARG A C   1 
ATOM   2134 O  O   . ARG A 1 282 ? 86.619 -74.987  209.772 1.00 104.61 ? 282  ARG A O   1 
ATOM   2135 C  CB  . ARG A 1 282 ? 88.130 -72.204  209.077 1.00 107.30 ? 282  ARG A CB  1 
ATOM   2136 C  CG  . ARG A 1 282 ? 87.911 -72.718  207.662 1.00 108.84 ? 282  ARG A CG  1 
ATOM   2137 C  CD  . ARG A 1 282 ? 87.966 -71.568  206.658 1.00 110.07 ? 282  ARG A CD  1 
ATOM   2138 N  NE  . ARG A 1 282 ? 87.853 -72.026  205.276 1.00 111.99 ? 282  ARG A NE  1 
ATOM   2139 C  CZ  . ARG A 1 282 ? 86.748 -72.533  204.740 1.00 113.37 ? 282  ARG A CZ  1 
ATOM   2140 N  NH1 . ARG A 1 282 ? 85.646 -72.648  205.469 1.00 114.57 ? 282  ARG A NH1 1 
ATOM   2141 N  NH2 . ARG A 1 282 ? 86.745 -72.932  203.475 1.00 113.50 ? 282  ARG A NH2 1 
ATOM   2142 N  N   . ARG A 1 283 ? 86.137 -73.413  211.313 1.00 104.86 ? 283  ARG A N   1 
ATOM   2143 C  CA  . ARG A 1 283 ? 84.821 -73.945  211.665 1.00 104.23 ? 283  ARG A CA  1 
ATOM   2144 C  C   . ARG A 1 283 ? 83.843 -73.995  210.490 1.00 102.13 ? 283  ARG A C   1 
ATOM   2145 O  O   . ARG A 1 283 ? 84.135 -73.505  209.398 1.00 102.22 ? 283  ARG A O   1 
ATOM   2146 C  CB  . ARG A 1 283 ? 84.214 -73.111  212.797 1.00 105.81 ? 283  ARG A CB  1 
ATOM   2147 C  CG  . ARG A 1 283 ? 84.939 -73.239  214.131 1.00 108.40 ? 283  ARG A CG  1 
ATOM   2148 C  CD  . ARG A 1 283 ? 84.251 -74.247  215.042 1.00 109.82 ? 283  ARG A CD  1 
ATOM   2149 N  NE  . ARG A 1 283 ? 83.789 -73.629  216.283 1.00 111.24 ? 283  ARG A NE  1 
ATOM   2150 C  CZ  . ARG A 1 283 ? 82.957 -72.591  216.344 1.00 111.87 ? 283  ARG A CZ  1 
ATOM   2151 N  NH1 . ARG A 1 283 ? 82.485 -72.043  215.232 1.00 112.73 ? 283  ARG A NH1 1 
ATOM   2152 N  NH2 . ARG A 1 283 ? 82.593 -72.099  217.521 1.00 112.21 ? 283  ARG A NH2 1 
ATOM   2153 N  N   . ALA A 1 284 ? 82.678 -74.592  210.730 1.00 99.35  ? 284  ALA A N   1 
ATOM   2154 C  CA  . ALA A 1 284 ? 81.641 -74.720  209.711 1.00 96.30  ? 284  ALA A CA  1 
ATOM   2155 C  C   . ALA A 1 284 ? 80.400 -75.373  210.303 1.00 94.43  ? 284  ALA A C   1 
ATOM   2156 O  O   . ALA A 1 284 ? 80.467 -76.479  210.836 1.00 94.17  ? 284  ALA A O   1 
ATOM   2157 C  CB  . ALA A 1 284 ? 82.151 -75.546  208.539 1.00 96.37  ? 284  ALA A CB  1 
ATOM   2158 N  N   . LEU A 1 285 ? 79.269 -74.682  210.209 1.00 92.03  ? 285  LEU A N   1 
ATOM   2159 C  CA  . LEU A 1 285 ? 78.013 -75.200  210.732 1.00 88.26  ? 285  LEU A CA  1 
ATOM   2160 C  C   . LEU A 1 285 ? 77.642 -76.497  210.030 1.00 85.61  ? 285  LEU A C   1 
ATOM   2161 O  O   . LEU A 1 285 ? 77.314 -76.500  208.843 1.00 85.14  ? 285  LEU A O   1 
ATOM   2162 C  CB  . LEU A 1 285 ? 76.890 -74.175  210.540 1.00 88.68  ? 285  LEU A CB  1 
ATOM   2163 C  CG  . LEU A 1 285 ? 75.463 -74.655  210.838 1.00 89.01  ? 285  LEU A CG  1 
ATOM   2164 C  CD1 . LEU A 1 285 ? 75.351 -75.082  212.284 1.00 88.95  ? 285  LEU A CD1 1 
ATOM   2165 C  CD2 . LEU A 1 285 ? 74.475 -73.544  210.540 1.00 89.38  ? 285  LEU A CD2 1 
ATOM   2166 N  N   . ASP A 1 286 ? 77.703 -77.601  210.763 1.00 82.16  ? 286  ASP A N   1 
ATOM   2167 C  CA  . ASP A 1 286 ? 77.351 -78.892  210.196 1.00 79.84  ? 286  ASP A CA  1 
ATOM   2168 C  C   . ASP A 1 286 ? 75.888 -79.171  210.515 1.00 77.11  ? 286  ASP A C   1 
ATOM   2169 O  O   . ASP A 1 286 ? 75.561 -79.739  211.558 1.00 76.79  ? 286  ASP A O   1 
ATOM   2170 C  CB  . ASP A 1 286 ? 78.236 -80.005  210.776 1.00 80.76  ? 286  ASP A CB  1 
ATOM   2171 C  CG  . ASP A 1 286 ? 78.092 -81.322  210.020 1.00 81.01  ? 286  ASP A CG  1 
ATOM   2172 O  OD1 . ASP A 1 286 ? 76.953 -81.817  209.893 1.00 81.51  ? 286  ASP A OD1 1 
ATOM   2173 O  OD2 . ASP A 1 286 ? 79.116 -81.866  209.554 1.00 80.18  ? 286  ASP A OD2 1 
ATOM   2174 N  N   . LEU A 1 287 ? 75.009 -78.754  209.611 1.00 74.22  ? 287  LEU A N   1 
ATOM   2175 C  CA  . LEU A 1 287 ? 73.581 -78.954  209.787 1.00 70.69  ? 287  LEU A CA  1 
ATOM   2176 C  C   . LEU A 1 287 ? 73.261 -80.433  209.772 1.00 67.84  ? 287  LEU A C   1 
ATOM   2177 O  O   . LEU A 1 287 ? 72.102 -80.828  209.869 1.00 66.77  ? 287  LEU A O   1 
ATOM   2178 C  CB  . LEU A 1 287 ? 72.805 -78.237  208.680 1.00 71.67  ? 287  LEU A CB  1 
ATOM   2179 C  CG  . LEU A 1 287 ? 72.968 -76.717  208.688 1.00 71.27  ? 287  LEU A CG  1 
ATOM   2180 C  CD1 . LEU A 1 287 ? 72.166 -76.113  207.552 1.00 71.52  ? 287  LEU A CD1 1 
ATOM   2181 C  CD2 . LEU A 1 287 ? 72.511 -76.160  210.030 1.00 71.09  ? 287  LEU A CD2 1 
ATOM   2182 N  N   . GLY A 1 288 ? 74.302 -81.246  209.643 1.00 65.97  ? 288  GLY A N   1 
ATOM   2183 C  CA  . GLY A 1 288 ? 74.126 -82.685  209.637 1.00 63.55  ? 288  GLY A CA  1 
ATOM   2184 C  C   . GLY A 1 288 ? 73.991 -83.174  211.064 1.00 61.86  ? 288  GLY A C   1 
ATOM   2185 O  O   . GLY A 1 288 ? 73.439 -84.241  211.330 1.00 62.53  ? 288  GLY A O   1 
ATOM   2186 N  N   . LYS A 1 289 ? 74.506 -82.384  211.994 1.00 59.69  ? 289  LYS A N   1 
ATOM   2187 C  CA  . LYS A 1 289 ? 74.422 -82.734  213.399 1.00 59.61  ? 289  LYS A CA  1 
ATOM   2188 C  C   . LYS A 1 289 ? 73.304 -81.943  214.079 1.00 57.60  ? 289  LYS A C   1 
ATOM   2189 O  O   . LYS A 1 289 ? 72.997 -82.163  215.259 1.00 57.66  ? 289  LYS A O   1 
ATOM   2190 C  CB  . LYS A 1 289 ? 75.761 -82.463  214.086 1.00 62.13  ? 289  LYS A CB  1 
ATOM   2191 C  CG  . LYS A 1 289 ? 76.788 -83.557  213.850 1.00 65.15  ? 289  LYS A CG  1 
ATOM   2192 C  CD  . LYS A 1 289 ? 78.112 -83.245  214.523 1.00 67.59  ? 289  LYS A CD  1 
ATOM   2193 C  CE  . LYS A 1 289 ? 78.859 -82.162  213.775 1.00 68.07  ? 289  LYS A CE  1 
ATOM   2194 N  NZ  . LYS A 1 289 ? 80.129 -81.825  214.464 1.00 70.56  ? 289  LYS A NZ  1 
ATOM   2195 N  N   . PHE A 1 290 ? 72.691 -81.038  213.316 1.00 51.71  ? 290  PHE A N   1 
ATOM   2196 C  CA  . PHE A 1 290 ? 71.617 -80.195  213.820 1.00 45.67  ? 290  PHE A CA  1 
ATOM   2197 C  C   . PHE A 1 290 ? 70.542 -80.971  214.577 1.00 42.66  ? 290  PHE A C   1 
ATOM   2198 O  O   . PHE A 1 290 ? 70.038 -80.486  215.582 1.00 41.56  ? 290  PHE A O   1 
ATOM   2199 C  CB  . PHE A 1 290 ? 70.975 -79.407  212.673 1.00 45.30  ? 290  PHE A CB  1 
ATOM   2200 C  CG  . PHE A 1 290 ? 70.026 -78.348  213.135 1.00 41.72  ? 290  PHE A CG  1 
ATOM   2201 C  CD1 . PHE A 1 290 ? 70.502 -77.154  213.655 1.00 40.59  ? 290  PHE A CD1 1 
ATOM   2202 C  CD2 . PHE A 1 290 ? 68.648 -78.575  213.121 1.00 42.67  ? 290  PHE A CD2 1 
ATOM   2203 C  CE1 . PHE A 1 290 ? 69.621 -76.197  214.160 1.00 39.28  ? 290  PHE A CE1 1 
ATOM   2204 C  CE2 . PHE A 1 290 ? 67.763 -77.626  213.626 1.00 37.87  ? 290  PHE A CE2 1 
ATOM   2205 C  CZ  . PHE A 1 290 ? 68.251 -76.440  214.145 1.00 38.11  ? 290  PHE A CZ  1 
ATOM   2206 N  N   . HIS A 1 291 ? 70.197 -82.168  214.098 1.00 39.60  ? 291  HIS A N   1 
ATOM   2207 C  CA  . HIS A 1 291 ? 69.180 -83.005  214.741 1.00 36.93  ? 291  HIS A CA  1 
ATOM   2208 C  C   . HIS A 1 291 ? 69.750 -84.025  215.726 1.00 39.17  ? 291  HIS A C   1 
ATOM   2209 O  O   . HIS A 1 291 ? 69.013 -84.860  216.254 1.00 40.08  ? 291  HIS A O   1 
ATOM   2210 C  CB  . HIS A 1 291 ? 68.395 -83.777  213.696 1.00 31.83  ? 291  HIS A CB  1 
ATOM   2211 C  CG  . HIS A 1 291 ? 67.777 -82.918  212.650 1.00 32.54  ? 291  HIS A CG  1 
ATOM   2212 N  ND1 . HIS A 1 291 ? 66.684 -82.114  212.898 1.00 31.85  ? 291  HIS A ND1 1 
ATOM   2213 C  CD2 . HIS A 1 291 ? 68.103 -82.724  211.352 1.00 29.19  ? 291  HIS A CD2 1 
ATOM   2214 C  CE1 . HIS A 1 291 ? 66.367 -81.462  211.796 1.00 30.14  ? 291  HIS A CE1 1 
ATOM   2215 N  NE2 . HIS A 1 291 ? 67.212 -81.813  210.844 1.00 31.56  ? 291  HIS A NE2 1 
ATOM   2216 N  N   . GLU A 1 292 ? 71.055 -83.989  215.954 1.00 40.74  ? 292  GLU A N   1 
ATOM   2217 C  CA  . GLU A 1 292 ? 71.667 -84.946  216.867 1.00 43.61  ? 292  GLU A CA  1 
ATOM   2218 C  C   . GLU A 1 292 ? 71.445 -84.573  218.321 1.00 44.27  ? 292  GLU A C   1 
ATOM   2219 O  O   . GLU A 1 292 ? 71.516 -83.397  218.700 1.00 46.43  ? 292  GLU A O   1 
ATOM   2220 C  CB  . GLU A 1 292 ? 73.165 -85.059  216.597 1.00 47.09  ? 292  GLU A CB  1 
ATOM   2221 C  CG  . GLU A 1 292 ? 73.552 -86.110  215.583 1.00 48.05  ? 292  GLU A CG  1 
ATOM   2222 C  CD  . GLU A 1 292 ? 75.027 -86.033  215.243 1.00 51.46  ? 292  GLU A CD  1 
ATOM   2223 O  OE1 . GLU A 1 292 ? 75.817 -85.676  216.145 1.00 52.13  ? 292  GLU A OE1 1 
ATOM   2224 O  OE2 . GLU A 1 292 ? 75.401 -86.332  214.086 1.00 53.83  ? 292  GLU A OE2 1 
ATOM   2225 N  N   . ILE A 1 293 ? 71.193 -85.587  219.137 1.00 43.45  ? 293  ILE A N   1 
ATOM   2226 C  CA  . ILE A 1 293 ? 70.951 -85.376  220.557 1.00 42.58  ? 293  ILE A CA  1 
ATOM   2227 C  C   . ILE A 1 293 ? 71.753 -86.329  221.454 1.00 41.11  ? 293  ILE A C   1 
ATOM   2228 O  O   . ILE A 1 293 ? 71.653 -87.552  221.337 1.00 37.94  ? 293  ILE A O   1 
ATOM   2229 C  CB  . ILE A 1 293 ? 69.430 -85.521  220.880 1.00 40.48  ? 293  ILE A CB  1 
ATOM   2230 C  CG1 . ILE A 1 293 ? 68.647 -84.413  220.164 1.00 38.34  ? 293  ILE A CG1 1 
ATOM   2231 C  CG2 . ILE A 1 293 ? 69.199 -85.471  222.392 1.00 36.81  ? 293  ILE A CG2 1 
ATOM   2232 C  CD1 . ILE A 1 293 ? 67.154 -84.518  220.330 1.00 38.49  ? 293  ILE A CD1 1 
ATOM   2233 N  N   . ALA A 1 294 ? 72.534 -85.738  222.352 1.00 40.96  ? 294  ALA A N   1 
ATOM   2234 C  CA  . ALA A 1 294 ? 73.347 -86.484  223.299 1.00 41.38  ? 294  ALA A CA  1 
ATOM   2235 C  C   . ALA A 1 294 ? 72.484 -86.987  224.446 1.00 41.85  ? 294  ALA A C   1 
ATOM   2236 O  O   . ALA A 1 294 ? 71.590 -86.300  224.907 1.00 44.13  ? 294  ALA A O   1 
ATOM   2237 C  CB  . ALA A 1 294 ? 74.460 -85.596  223.837 1.00 38.53  ? 294  ALA A CB  1 
ATOM   2238 N  N   . GLN A 1 295 ? 72.761 -88.198  224.903 1.00 44.40  ? 295  GLN A N   1 
ATOM   2239 C  CA  . GLN A 1 295 ? 72.023 -88.797  226.008 1.00 43.63  ? 295  GLN A CA  1 
ATOM   2240 C  C   . GLN A 1 295 ? 72.913 -89.716  226.833 1.00 44.88  ? 295  GLN A C   1 
ATOM   2241 O  O   . GLN A 1 295 ? 73.806 -90.382  226.307 1.00 45.90  ? 295  GLN A O   1 
ATOM   2242 C  CB  . GLN A 1 295 ? 70.859 -89.622  225.494 1.00 42.31  ? 295  GLN A CB  1 
ATOM   2243 C  CG  . GLN A 1 295 ? 69.557 -88.903  225.387 1.00 37.36  ? 295  GLN A CG  1 
ATOM   2244 C  CD  . GLN A 1 295 ? 68.450 -89.871  225.029 1.00 35.53  ? 295  GLN A CD  1 
ATOM   2245 O  OE1 . GLN A 1 295 ? 68.311 -90.278  223.874 1.00 32.16  ? 295  GLN A OE1 1 
ATOM   2246 N  NE2 . GLN A 1 295 ? 67.674 -90.269  226.026 1.00 33.23  ? 295  GLN A NE2 1 
ATOM   2247 N  N   . HIS A 1 296 ? 72.647 -89.751  228.131 1.00 45.74  ? 296  HIS A N   1 
ATOM   2248 C  CA  . HIS A 1 296 ? 73.387 -90.593  229.044 1.00 46.03  ? 296  HIS A CA  1 
ATOM   2249 C  C   . HIS A 1 296 ? 72.757 -91.982  229.014 1.00 47.46  ? 296  HIS A C   1 
ATOM   2250 O  O   . HIS A 1 296 ? 71.538 -92.117  229.062 1.00 47.16  ? 296  HIS A O   1 
ATOM   2251 C  CB  . HIS A 1 296 ? 73.306 -90.028  230.460 1.00 44.85  ? 296  HIS A CB  1 
ATOM   2252 C  CG  . HIS A 1 296 ? 73.871 -90.941  231.499 1.00 46.10  ? 296  HIS A CG  1 
ATOM   2253 N  ND1 . HIS A 1 296 ? 75.183 -90.872  231.918 1.00 45.58  ? 296  HIS A ND1 1 
ATOM   2254 C  CD2 . HIS A 1 296 ? 73.323 -91.993  232.151 1.00 46.37  ? 296  HIS A CD2 1 
ATOM   2255 C  CE1 . HIS A 1 296 ? 75.419 -91.843  232.781 1.00 45.94  ? 296  HIS A CE1 1 
ATOM   2256 N  NE2 . HIS A 1 296 ? 74.307 -92.539  232.940 1.00 47.56  ? 296  HIS A NE2 1 
ATOM   2257 N  N   . HIS A 1 297 ? 73.591 -93.010  228.922 1.00 50.08  ? 297  HIS A N   1 
ATOM   2258 C  CA  . HIS A 1 297 ? 73.116 -94.386  228.906 1.00 52.31  ? 297  HIS A CA  1 
ATOM   2259 C  C   . HIS A 1 297 ? 73.568 -95.050  230.198 1.00 55.29  ? 297  HIS A C   1 
ATOM   2260 O  O   . HIS A 1 297 ? 74.714 -94.891  230.615 1.00 54.95  ? 297  HIS A O   1 
ATOM   2261 C  CB  . HIS A 1 297 ? 73.680 -95.115  227.690 1.00 50.98  ? 297  HIS A CB  1 
ATOM   2262 C  CG  . HIS A 1 297 ? 73.093 -94.656  226.393 1.00 48.81  ? 297  HIS A CG  1 
ATOM   2263 N  ND1 . HIS A 1 297 ? 72.053 -95.314  225.773 1.00 48.36  ? 297  HIS A ND1 1 
ATOM   2264 C  CD2 . HIS A 1 297 ? 73.386 -93.594  225.609 1.00 48.37  ? 297  HIS A CD2 1 
ATOM   2265 C  CE1 . HIS A 1 297 ? 71.735 -94.679  224.660 1.00 48.71  ? 297  HIS A CE1 1 
ATOM   2266 N  NE2 . HIS A 1 297 ? 72.529 -93.631  224.538 1.00 49.09  ? 297  HIS A NE2 1 
ATOM   2267 N  N   . HIS A 1 298 ? 72.661 -95.786  230.832 1.00 59.81  ? 298  HIS A N   1 
ATOM   2268 C  CA  . HIS A 1 298 ? 72.955 -96.441  232.103 1.00 63.42  ? 298  HIS A CA  1 
ATOM   2269 C  C   . HIS A 1 298 ? 73.531 -97.849  231.995 1.00 64.43  ? 298  HIS A C   1 
ATOM   2270 O  O   . HIS A 1 298 ? 73.242 -98.587  231.049 1.00 63.54  ? 298  HIS A O   1 
ATOM   2271 C  CB  . HIS A 1 298 ? 71.686 -96.488  232.949 1.00 66.08  ? 298  HIS A CB  1 
ATOM   2272 C  CG  . HIS A 1 298 ? 71.064 -95.147  233.175 1.00 70.45  ? 298  HIS A CG  1 
ATOM   2273 N  ND1 . HIS A 1 298 ? 71.624 -94.198  234.003 1.00 72.69  ? 298  HIS A ND1 1 
ATOM   2274 C  CD2 . HIS A 1 298 ? 69.937 -94.591  232.670 1.00 72.39  ? 298  HIS A CD2 1 
ATOM   2275 C  CE1 . HIS A 1 298 ? 70.866 -93.114  233.999 1.00 73.88  ? 298  HIS A CE1 1 
ATOM   2276 N  NE2 . HIS A 1 298 ? 69.836 -93.327  233.198 1.00 73.71  ? 298  HIS A NE2 1 
ATOM   2277 N  N   . HIS A 1 299 ? 74.340 -98.212  232.987 1.00 65.43  ? 299  HIS A N   1 
ATOM   2278 C  CA  . HIS A 1 299 ? 74.957 -99.530  233.051 1.00 67.64  ? 299  HIS A CA  1 
ATOM   2279 C  C   . HIS A 1 299 ? 73.919 -100.572 233.468 1.00 68.53  ? 299  HIS A C   1 
ATOM   2280 O  O   . HIS A 1 299 ? 73.065 -100.908 232.618 1.00 69.13  ? 299  HIS A O   1 
ATOM   2281 C  CB  . HIS A 1 299 ? 76.111 -99.524  234.059 1.00 68.47  ? 299  HIS A CB  1 
ATOM   2282 C  CG  . HIS A 1 299 ? 77.471 -99.448  233.431 1.00 70.20  ? 299  HIS A CG  1 
ATOM   2283 N  ND1 . HIS A 1 299 ? 78.411 -98.507  233.799 1.00 70.39  ? 299  HIS A ND1 1 
ATOM   2284 C  CD2 . HIS A 1 299 ? 78.060 -100.216 232.482 1.00 68.98  ? 299  HIS A CD2 1 
ATOM   2285 C  CE1 . HIS A 1 299 ? 79.519 -98.698  233.105 1.00 69.17  ? 299  HIS A CE1 1 
ATOM   2286 N  NE2 . HIS A 1 299 ? 79.334 -99.729  232.299 1.00 68.83  ? 299  HIS A NE2 1 
ATOM   2287 N  N   . ILE B 1 23  ? 24.779 -41.046  207.982 1.00 122.25 ? 23   ILE B N   1 
ATOM   2288 C  CA  . ILE B 1 23  ? 24.644 -39.605  208.340 1.00 122.56 ? 23   ILE B CA  1 
ATOM   2289 C  C   . ILE B 1 23  ? 25.278 -38.712  207.274 1.00 122.96 ? 23   ILE B C   1 
ATOM   2290 O  O   . ILE B 1 23  ? 26.377 -38.986  206.792 1.00 123.03 ? 23   ILE B O   1 
ATOM   2291 C  CB  . ILE B 1 23  ? 25.310 -39.311  209.704 1.00 122.16 ? 23   ILE B CB  1 
ATOM   2292 C  CG1 . ILE B 1 23  ? 24.600 -40.098  210.808 1.00 121.86 ? 23   ILE B CG1 1 
ATOM   2293 C  CG2 . ILE B 1 23  ? 25.256 -37.822  210.003 1.00 122.29 ? 23   ILE B CG2 1 
ATOM   2294 C  CD1 . ILE B 1 23  ? 25.117 -39.809  212.204 1.00 121.58 ? 23   ILE B CD1 1 
ATOM   2295 N  N   . THR B 1 24  ? 24.576 -37.641  206.914 1.00 123.48 ? 24   THR B N   1 
ATOM   2296 C  CA  . THR B 1 24  ? 25.056 -36.703  205.901 1.00 124.23 ? 24   THR B CA  1 
ATOM   2297 C  C   . THR B 1 24  ? 26.130 -35.768  206.454 1.00 124.92 ? 24   THR B C   1 
ATOM   2298 O  O   . THR B 1 24  ? 26.044 -35.319  207.597 1.00 124.97 ? 24   THR B O   1 
ATOM   2299 C  CB  . THR B 1 24  ? 23.899 -35.831  205.357 1.00 124.02 ? 24   THR B CB  1 
ATOM   2300 O  OG1 . THR B 1 24  ? 22.831 -36.673  204.903 1.00 123.57 ? 24   THR B OG1 1 
ATOM   2301 C  CG2 . THR B 1 24  ? 24.378 -34.966  204.197 1.00 123.57 ? 24   THR B CG2 1 
ATOM   2302 N  N   . ARG B 1 25  ? 27.142 -35.479  205.640 1.00 125.61 ? 25   ARG B N   1 
ATOM   2303 C  CA  . ARG B 1 25  ? 28.220 -34.579  206.040 1.00 126.60 ? 25   ARG B CA  1 
ATOM   2304 C  C   . ARG B 1 25  ? 28.039 -33.240  205.328 1.00 126.92 ? 25   ARG B C   1 
ATOM   2305 O  O   . ARG B 1 25  ? 27.501 -33.191  204.220 1.00 126.58 ? 25   ARG B O   1 
ATOM   2306 C  CB  . ARG B 1 25  ? 29.583 -35.178  205.682 1.00 127.27 ? 25   ARG B CB  1 
ATOM   2307 C  CG  . ARG B 1 25  ? 29.948 -36.433  206.465 1.00 128.31 ? 25   ARG B CG  1 
ATOM   2308 C  CD  . ARG B 1 25  ? 31.338 -36.934  206.086 1.00 128.77 ? 25   ARG B CD  1 
ATOM   2309 N  NE  . ARG B 1 25  ? 31.768 -38.071  206.899 1.00 129.15 ? 25   ARG B NE  1 
ATOM   2310 C  CZ  . ARG B 1 25  ? 31.173 -39.261  206.908 1.00 129.39 ? 25   ARG B CZ  1 
ATOM   2311 N  NH1 . ARG B 1 25  ? 30.112 -39.487  206.146 1.00 129.21 ? 25   ARG B NH1 1 
ATOM   2312 N  NH2 . ARG B 1 25  ? 31.642 -40.230  207.684 1.00 129.66 ? 25   ARG B NH2 1 
ATOM   2313 N  N   . LEU B 1 26  ? 28.487 -32.157  205.958 1.00 127.43 ? 26   LEU B N   1 
ATOM   2314 C  CA  . LEU B 1 26  ? 28.345 -30.829  205.368 1.00 128.12 ? 26   LEU B CA  1 
ATOM   2315 C  C   . LEU B 1 26  ? 29.675 -30.086  205.233 1.00 129.18 ? 26   LEU B C   1 
ATOM   2316 O  O   . LEU B 1 26  ? 30.062 -29.321  206.117 1.00 129.01 ? 26   LEU B O   1 
ATOM   2317 C  CB  . LEU B 1 26  ? 27.367 -29.993  206.201 1.00 127.20 ? 26   LEU B CB  1 
ATOM   2318 C  CG  . LEU B 1 26  ? 25.983 -30.604  206.453 1.00 126.58 ? 26   LEU B CG  1 
ATOM   2319 C  CD1 . LEU B 1 26  ? 25.161 -29.665  207.316 1.00 126.08 ? 26   LEU B CD1 1 
ATOM   2320 C  CD2 . LEU B 1 26  ? 25.275 -30.868  205.136 1.00 126.20 ? 26   LEU B CD2 1 
ATOM   2321 N  N   . GLY B 1 27  ? 30.359 -30.312  204.113 1.00 130.78 ? 27   GLY B N   1 
ATOM   2322 C  CA  . GLY B 1 27  ? 31.639 -29.668  203.853 1.00 132.49 ? 27   GLY B CA  1 
ATOM   2323 C  C   . GLY B 1 27  ? 32.130 -29.988  202.449 1.00 134.08 ? 27   GLY B C   1 
ATOM   2324 O  O   . GLY B 1 27  ? 32.291 -29.098  201.615 1.00 134.24 ? 27   GLY B O   1 
ATOM   2325 N  N   . LEU B 1 28  ? 32.371 -31.273  202.203 1.00 135.62 ? 28   LEU B N   1 
ATOM   2326 C  CA  . LEU B 1 28  ? 32.823 -31.785  200.909 1.00 137.09 ? 28   LEU B CA  1 
ATOM   2327 C  C   . LEU B 1 28  ? 32.519 -33.282  200.925 1.00 138.24 ? 28   LEU B C   1 
ATOM   2328 O  O   . LEU B 1 28  ? 33.418 -34.121  200.909 1.00 138.18 ? 28   LEU B O   1 
ATOM   2329 C  CB  . LEU B 1 28  ? 34.324 -31.545  200.716 1.00 136.56 ? 28   LEU B CB  1 
ATOM   2330 C  CG  . LEU B 1 28  ? 34.762 -30.099  200.457 1.00 136.55 ? 28   LEU B CG  1 
ATOM   2331 C  CD1 . LEU B 1 28  ? 36.275 -30.037  200.307 1.00 136.03 ? 28   LEU B CD1 1 
ATOM   2332 C  CD2 . LEU B 1 28  ? 34.081 -29.572  199.199 1.00 136.41 ? 28   LEU B CD2 1 
ATOM   2333 N  N   . GLU B 1 29  ? 31.224 -33.583  200.954 1.00 139.77 ? 29   GLU B N   1 
ATOM   2334 C  CA  . GLU B 1 29  ? 30.686 -34.940  201.024 1.00 141.16 ? 29   GLU B CA  1 
ATOM   2335 C  C   . GLU B 1 29  ? 31.018 -35.971  199.937 1.00 142.08 ? 29   GLU B C   1 
ATOM   2336 O  O   . GLU B 1 29  ? 30.927 -37.174  200.196 1.00 142.19 ? 29   GLU B O   1 
ATOM   2337 C  CB  . GLU B 1 29  ? 29.161 -34.851  201.170 1.00 141.13 ? 29   GLU B CB  1 
ATOM   2338 C  CG  . GLU B 1 29  ? 28.442 -36.190  201.252 1.00 141.14 ? 29   GLU B CG  1 
ATOM   2339 C  CD  . GLU B 1 29  ? 26.937 -36.038  201.368 1.00 140.94 ? 29   GLU B CD  1 
ATOM   2340 O  OE1 . GLU B 1 29  ? 26.323 -35.453  200.451 1.00 140.92 ? 29   GLU B OE1 1 
ATOM   2341 O  OE2 . GLU B 1 29  ? 26.369 -36.503  202.379 1.00 140.83 ? 29   GLU B OE2 1 
ATOM   2342 N  N   . LYS B 1 30  ? 31.403 -35.539  198.738 1.00 142.85 ? 30   LYS B N   1 
ATOM   2343 C  CA  . LYS B 1 30  ? 31.677 -36.518  197.684 1.00 143.62 ? 30   LYS B CA  1 
ATOM   2344 C  C   . LYS B 1 30  ? 32.914 -36.318  196.801 1.00 144.54 ? 30   LYS B C   1 
ATOM   2345 O  O   . LYS B 1 30  ? 33.249 -35.200  196.405 1.00 144.72 ? 30   LYS B O   1 
ATOM   2346 C  CB  . LYS B 1 30  ? 30.434 -36.645  196.791 1.00 142.98 ? 30   LYS B CB  1 
ATOM   2347 C  CG  . LYS B 1 30  ? 30.537 -37.677  195.676 1.00 141.92 ? 30   LYS B CG  1 
ATOM   2348 C  CD  . LYS B 1 30  ? 30.542 -39.097  196.211 1.00 140.84 ? 30   LYS B CD  1 
ATOM   2349 C  CE  . LYS B 1 30  ? 30.581 -40.096  195.069 1.00 140.47 ? 30   LYS B CE  1 
ATOM   2350 N  NZ  . LYS B 1 30  ? 30.551 -41.500  195.553 1.00 140.48 ? 30   LYS B NZ  1 
ATOM   2351 N  N   . ARG B 1 31  ? 33.577 -37.437  196.507 1.00 145.36 ? 31   ARG B N   1 
ATOM   2352 C  CA  . ARG B 1 31  ? 34.763 -37.506  195.649 1.00 146.01 ? 31   ARG B CA  1 
ATOM   2353 C  C   . ARG B 1 31  ? 35.923 -36.541  195.907 1.00 146.59 ? 31   ARG B C   1 
ATOM   2354 O  O   . ARG B 1 31  ? 35.830 -35.630  196.728 1.00 146.70 ? 31   ARG B O   1 
ATOM   2355 C  CB  . ARG B 1 31  ? 34.328 -37.397  194.185 1.00 145.65 ? 31   ARG B CB  1 
ATOM   2356 C  CG  . ARG B 1 31  ? 33.379 -38.507  193.759 1.00 145.24 ? 31   ARG B CG  1 
ATOM   2357 C  CD  . ARG B 1 31  ? 32.928 -38.350  192.318 1.00 144.53 ? 31   ARG B CD  1 
ATOM   2358 N  NE  . ARG B 1 31  ? 34.055 -38.303  191.390 1.00 144.03 ? 31   ARG B NE  1 
ATOM   2359 C  CZ  . ARG B 1 31  ? 33.936 -38.367  190.068 1.00 143.73 ? 31   ARG B CZ  1 
ATOM   2360 N  NH1 . ARG B 1 31  ? 32.738 -38.486  189.512 1.00 143.39 ? 31   ARG B NH1 1 
ATOM   2361 N  NH2 . ARG B 1 31  ? 35.015 -38.305  189.301 1.00 143.64 ? 31   ARG B NH2 1 
ATOM   2362 N  N   . GLY B 1 32  ? 37.021 -36.772  195.185 1.00 147.19 ? 32   GLY B N   1 
ATOM   2363 C  CA  . GLY B 1 32  ? 38.216 -35.951  195.306 1.00 147.46 ? 32   GLY B CA  1 
ATOM   2364 C  C   . GLY B 1 32  ? 39.293 -36.386  194.321 1.00 147.58 ? 32   GLY B C   1 
ATOM   2365 O  O   . GLY B 1 32  ? 39.003 -36.609  193.145 1.00 147.61 ? 32   GLY B O   1 
ATOM   2366 N  N   . TRP B 1 33  ? 40.533 -36.506  194.793 1.00 147.64 ? 33   TRP B N   1 
ATOM   2367 C  CA  . TRP B 1 33  ? 41.650 -36.929  193.944 1.00 147.45 ? 33   TRP B CA  1 
ATOM   2368 C  C   . TRP B 1 33  ? 41.966 -38.398  194.193 1.00 147.14 ? 33   TRP B C   1 
ATOM   2369 O  O   . TRP B 1 33  ? 42.009 -38.839  195.342 1.00 147.58 ? 33   TRP B O   1 
ATOM   2370 C  CB  . TRP B 1 33  ? 42.896 -36.093  194.232 1.00 147.61 ? 33   TRP B CB  1 
ATOM   2371 C  CG  . TRP B 1 33  ? 42.696 -34.630  194.037 1.00 147.83 ? 33   TRP B CG  1 
ATOM   2372 C  CD1 . TRP B 1 33  ? 41.614 -34.016  193.475 1.00 147.77 ? 33   TRP B CD1 1 
ATOM   2373 C  CD2 . TRP B 1 33  ? 43.614 -33.590  194.384 1.00 148.05 ? 33   TRP B CD2 1 
ATOM   2374 N  NE1 . TRP B 1 33  ? 41.800 -32.656  193.452 1.00 148.09 ? 33   TRP B NE1 1 
ATOM   2375 C  CE2 . TRP B 1 33  ? 43.020 -32.366  194.003 1.00 148.26 ? 33   TRP B CE2 1 
ATOM   2376 C  CE3 . TRP B 1 33  ? 44.883 -33.571  194.980 1.00 147.91 ? 33   TRP B CE3 1 
ATOM   2377 C  CZ2 . TRP B 1 33  ? 43.652 -31.133  194.199 1.00 148.44 ? 33   TRP B CZ2 1 
ATOM   2378 C  CZ3 . TRP B 1 33  ? 45.512 -32.344  195.175 1.00 148.09 ? 33   TRP B CZ3 1 
ATOM   2379 C  CH2 . TRP B 1 33  ? 44.894 -31.142  194.785 1.00 148.39 ? 33   TRP B CH2 1 
ATOM   2380 N  N   . LEU B 1 34  ? 42.204 -39.148  193.120 1.00 146.52 ? 34   LEU B N   1 
ATOM   2381 C  CA  . LEU B 1 34  ? 42.489 -40.574  193.242 1.00 145.89 ? 34   LEU B CA  1 
ATOM   2382 C  C   . LEU B 1 34  ? 41.336 -41.175  194.045 1.00 145.59 ? 34   LEU B C   1 
ATOM   2383 O  O   . LEU B 1 34  ? 41.472 -42.229  194.672 1.00 145.92 ? 34   LEU B O   1 
ATOM   2384 C  CB  . LEU B 1 34  ? 43.823 -40.797  193.969 1.00 145.55 ? 34   LEU B CB  1 
ATOM   2385 C  CG  . LEU B 1 34  ? 44.301 -42.239  194.172 1.00 145.29 ? 34   LEU B CG  1 
ATOM   2386 C  CD1 . LEU B 1 34  ? 44.374 -42.948  192.832 1.00 145.20 ? 34   LEU B CD1 1 
ATOM   2387 C  CD2 . LEU B 1 34  ? 45.660 -42.239  194.856 1.00 144.91 ? 34   LEU B CD2 1 
ATOM   2388 N  N   . ASP B 1 35  ? 40.202 -40.476  194.017 1.00 144.43 ? 35   ASP B N   1 
ATOM   2389 C  CA  . ASP B 1 35  ? 39.003 -40.895  194.730 1.00 142.74 ? 35   ASP B CA  1 
ATOM   2390 C  C   . ASP B 1 35  ? 37.754 -40.864  193.863 1.00 141.50 ? 35   ASP B C   1 
ATOM   2391 O  O   . ASP B 1 35  ? 36.660 -40.572  194.348 1.00 141.25 ? 35   ASP B O   1 
ATOM   2392 C  CB  . ASP B 1 35  ? 38.783 -40.023  195.969 1.00 142.84 ? 35   ASP B CB  1 
ATOM   2393 C  CG  . ASP B 1 35  ? 39.716 -40.382  197.105 1.00 142.86 ? 35   ASP B CG  1 
ATOM   2394 O  OD1 . ASP B 1 35  ? 39.664 -41.539  197.570 1.00 143.08 ? 35   ASP B OD1 1 
ATOM   2395 O  OD2 . ASP B 1 35  ? 40.500 -39.509  197.536 1.00 142.73 ? 35   ASP B OD2 1 
ATOM   2396 N  N   . ASP B 1 36  ? 37.916 -41.156  192.578 1.00 140.11 ? 36   ASP B N   1 
ATOM   2397 C  CA  . ASP B 1 36  ? 36.782 -41.209  191.666 1.00 139.03 ? 36   ASP B CA  1 
ATOM   2398 C  C   . ASP B 1 36  ? 36.073 -42.458  192.188 1.00 138.43 ? 36   ASP B C   1 
ATOM   2399 O  O   . ASP B 1 36  ? 36.330 -42.867  193.320 1.00 138.99 ? 36   ASP B O   1 
ATOM   2400 C  CB  . ASP B 1 36  ? 37.284 -41.434  190.238 1.00 138.69 ? 36   ASP B CB  1 
ATOM   2401 C  CG  . ASP B 1 36  ? 36.428 -40.742  189.202 1.00 138.49 ? 36   ASP B CG  1 
ATOM   2402 O  OD1 . ASP B 1 36  ? 35.230 -41.070  189.099 1.00 138.60 ? 36   ASP B OD1 1 
ATOM   2403 O  OD2 . ASP B 1 36  ? 36.958 -39.864  188.487 1.00 137.88 ? 36   ASP B OD2 1 
ATOM   2404 N  N   . HIS B 1 37  ? 35.186 -43.076  191.418 1.00 137.35 ? 37   HIS B N   1 
ATOM   2405 C  CA  . HIS B 1 37  ? 34.582 -44.294  191.943 1.00 135.93 ? 37   HIS B CA  1 
ATOM   2406 C  C   . HIS B 1 37  ? 35.588 -45.429  191.755 1.00 134.52 ? 37   HIS B C   1 
ATOM   2407 O  O   . HIS B 1 37  ? 35.233 -46.565  191.442 1.00 134.31 ? 37   HIS B O   1 
ATOM   2408 C  CB  . HIS B 1 37  ? 33.237 -44.619  191.274 1.00 136.70 ? 37   HIS B CB  1 
ATOM   2409 C  CG  . HIS B 1 37  ? 33.101 -44.112  189.873 1.00 137.73 ? 37   HIS B CG  1 
ATOM   2410 N  ND1 . HIS B 1 37  ? 33.215 -42.778  189.548 1.00 137.93 ? 37   HIS B ND1 1 
ATOM   2411 C  CD2 . HIS B 1 37  ? 32.795 -44.755  188.721 1.00 138.05 ? 37   HIS B CD2 1 
ATOM   2412 C  CE1 . HIS B 1 37  ? 32.982 -42.620  188.257 1.00 137.91 ? 37   HIS B CE1 1 
ATOM   2413 N  NE2 . HIS B 1 37  ? 32.725 -43.804  187.732 1.00 138.14 ? 37   HIS B NE2 1 
ATOM   2414 N  N   . TYR B 1 38  ? 36.858 -45.077  191.955 1.00 132.76 ? 38   TYR B N   1 
ATOM   2415 C  CA  . TYR B 1 38  ? 37.994 -45.989  191.851 1.00 130.59 ? 38   TYR B CA  1 
ATOM   2416 C  C   . TYR B 1 38  ? 37.833 -47.124  192.856 1.00 128.39 ? 38   TYR B C   1 
ATOM   2417 O  O   . TYR B 1 38  ? 38.267 -48.251  192.616 1.00 128.53 ? 38   TYR B O   1 
ATOM   2418 C  CB  . TYR B 1 38  ? 39.290 -45.199  192.111 1.00 131.29 ? 38   TYR B CB  1 
ATOM   2419 C  CG  . TYR B 1 38  ? 40.452 -45.979  192.699 1.00 131.77 ? 38   TYR B CG  1 
ATOM   2420 C  CD1 . TYR B 1 38  ? 41.004 -47.073  192.033 1.00 132.07 ? 38   TYR B CD1 1 
ATOM   2421 C  CD2 . TYR B 1 38  ? 41.014 -45.603  193.921 1.00 131.98 ? 38   TYR B CD2 1 
ATOM   2422 C  CE1 . TYR B 1 38  ? 42.089 -47.775  192.572 1.00 132.25 ? 38   TYR B CE1 1 
ATOM   2423 C  CE2 . TYR B 1 38  ? 42.095 -46.294  194.466 1.00 132.42 ? 38   TYR B CE2 1 
ATOM   2424 C  CZ  . TYR B 1 38  ? 42.626 -47.378  193.788 1.00 132.39 ? 38   TYR B CZ  1 
ATOM   2425 O  OH  . TYR B 1 38  ? 43.688 -48.066  194.333 1.00 132.50 ? 38   TYR B OH  1 
ATOM   2426 N  N   . HIS B 1 39  ? 37.196 -46.817  193.979 1.00 125.41 ? 39   HIS B N   1 
ATOM   2427 C  CA  . HIS B 1 39  ? 36.959 -47.811  195.018 1.00 122.61 ? 39   HIS B CA  1 
ATOM   2428 C  C   . HIS B 1 39  ? 35.992 -48.844  194.456 1.00 119.51 ? 39   HIS B C   1 
ATOM   2429 O  O   . HIS B 1 39  ? 36.042 -50.021  194.817 1.00 119.20 ? 39   HIS B O   1 
ATOM   2430 C  CB  . HIS B 1 39  ? 36.343 -47.145  196.245 1.00 124.05 ? 39   HIS B CB  1 
ATOM   2431 C  CG  . HIS B 1 39  ? 37.084 -45.929  196.698 1.00 125.23 ? 39   HIS B CG  1 
ATOM   2432 N  ND1 . HIS B 1 39  ? 38.384 -45.977  197.150 1.00 126.22 ? 39   HIS B ND1 1 
ATOM   2433 C  CD2 . HIS B 1 39  ? 36.717 -44.627  196.741 1.00 125.75 ? 39   HIS B CD2 1 
ATOM   2434 C  CE1 . HIS B 1 39  ? 38.789 -44.756  197.451 1.00 126.50 ? 39   HIS B CE1 1 
ATOM   2435 N  NE2 . HIS B 1 39  ? 37.795 -43.918  197.212 1.00 126.51 ? 39   HIS B NE2 1 
ATOM   2436 N  N   . ASP B 1 40  ? 35.110 -48.388  193.577 1.00 115.78 ? 40   ASP B N   1 
ATOM   2437 C  CA  . ASP B 1 40  ? 34.136 -49.266  192.958 1.00 111.98 ? 40   ASP B CA  1 
ATOM   2438 C  C   . ASP B 1 40  ? 34.846 -50.268  192.046 1.00 108.78 ? 40   ASP B C   1 
ATOM   2439 O  O   . ASP B 1 40  ? 34.437 -51.421  191.944 1.00 108.62 ? 40   ASP B O   1 
ATOM   2440 C  CB  . ASP B 1 40  ? 33.131 -48.437  192.123 1.00 111.93 ? 40   ASP B CB  1 
ATOM   2441 C  CG  . ASP B 1 40  ? 31.921 -49.249  191.676 1.00 114.46 ? 40   ASP B CG  1 
ATOM   2442 O  OD1 . ASP B 1 40  ? 32.040 -50.494  191.571 1.00 114.91 ? 40   ASP B OD1 1 
ATOM   2443 O  OD2 . ASP B 1 40  ? 30.854 -48.651  191.416 1.00 112.11 ? 40   ASP B OD2 1 
ATOM   2444 N  N   . LEU B 1 41  ? 35.914 -49.820  191.391 1.00 104.39 ? 41   LEU B N   1 
ATOM   2445 C  CA  . LEU B 1 41  ? 36.678 -50.689  190.508 1.00 100.89 ? 41   LEU B CA  1 
ATOM   2446 C  C   . LEU B 1 41  ? 37.466 -51.712  191.310 1.00 98.78  ? 41   LEU B C   1 
ATOM   2447 O  O   . LEU B 1 41  ? 37.917 -52.727  190.777 1.00 98.18  ? 41   LEU B O   1 
ATOM   2448 C  CB  . LEU B 1 41  ? 37.643 -49.866  189.650 1.00 100.78 ? 41   LEU B CB  1 
ATOM   2449 C  CG  . LEU B 1 41  ? 37.046 -49.039  188.511 1.00 100.47 ? 41   LEU B CG  1 
ATOM   2450 C  CD1 . LEU B 1 41  ? 38.136 -48.215  187.855 1.00 99.87  ? 41   LEU B CD1 1 
ATOM   2451 C  CD2 . LEU B 1 41  ? 36.393 -49.965  187.495 1.00 100.11 ? 41   LEU B CD2 1 
ATOM   2452 N  N   . LEU B 1 42  ? 37.622 -51.433  192.599 1.00 96.26  ? 42   LEU B N   1 
ATOM   2453 C  CA  . LEU B 1 42  ? 38.359 -52.307  193.505 1.00 93.61  ? 42   LEU B CA  1 
ATOM   2454 C  C   . LEU B 1 42  ? 37.453 -53.341  194.167 1.00 91.61  ? 42   LEU B C   1 
ATOM   2455 O  O   . LEU B 1 42  ? 37.873 -54.464  194.447 1.00 90.81  ? 42   LEU B O   1 
ATOM   2456 C  CB  . LEU B 1 42  ? 39.032 -51.471  194.598 1.00 94.25  ? 42   LEU B CB  1 
ATOM   2457 C  CG  . LEU B 1 42  ? 40.139 -50.489  194.210 1.00 94.47  ? 42   LEU B CG  1 
ATOM   2458 C  CD1 . LEU B 1 42  ? 40.288 -49.429  195.288 1.00 95.28  ? 42   LEU B CD1 1 
ATOM   2459 C  CD2 . LEU B 1 42  ? 41.443 -51.244  194.008 1.00 95.05  ? 42   LEU B CD2 1 
ATOM   2460 N  N   . THR B 1 43  ? 36.203 -52.953  194.403 1.00 89.48  ? 43   THR B N   1 
ATOM   2461 C  CA  . THR B 1 43  ? 35.237 -53.814  195.076 1.00 87.01  ? 43   THR B CA  1 
ATOM   2462 C  C   . THR B 1 43  ? 34.331 -54.633  194.161 1.00 84.26  ? 43   THR B C   1 
ATOM   2463 O  O   . THR B 1 43  ? 34.149 -55.836  194.365 1.00 84.05  ? 43   THR B O   1 
ATOM   2464 C  CB  . THR B 1 43  ? 34.334 -52.976  195.996 1.00 87.92  ? 43   THR B CB  1 
ATOM   2465 O  OG1 . THR B 1 43  ? 35.053 -51.812  196.431 1.00 88.19  ? 43   THR B OG1 1 
ATOM   2466 C  CG2 . THR B 1 43  ? 33.903 -53.798  197.214 1.00 88.06  ? 43   THR B CG2 1 
ATOM   2467 N  N   . VAL B 1 44  ? 33.758 -53.969  193.165 1.00 80.54  ? 44   VAL B N   1 
ATOM   2468 C  CA  . VAL B 1 44  ? 32.852 -54.604  192.220 1.00 76.56  ? 44   VAL B CA  1 
ATOM   2469 C  C   . VAL B 1 44  ? 33.310 -55.998  191.780 1.00 74.17  ? 44   VAL B C   1 
ATOM   2470 O  O   . VAL B 1 44  ? 34.482 -56.342  191.889 1.00 73.65  ? 44   VAL B O   1 
ATOM   2471 C  CB  . VAL B 1 44  ? 32.653 -53.699  190.987 1.00 76.68  ? 44   VAL B CB  1 
ATOM   2472 C  CG1 . VAL B 1 44  ? 33.926 -53.636  190.165 1.00 76.43  ? 44   VAL B CG1 1 
ATOM   2473 C  CG2 . VAL B 1 44  ? 31.494 -54.195  190.168 1.00 77.95  ? 44   VAL B CG2 1 
ATOM   2474 N  N   . SER B 1 45  ? 32.371 -56.797  191.289 1.00 72.20  ? 45   SER B N   1 
ATOM   2475 C  CA  . SER B 1 45  ? 32.662 -58.156  190.847 1.00 71.43  ? 45   SER B CA  1 
ATOM   2476 C  C   . SER B 1 45  ? 33.496 -58.219  189.570 1.00 70.80  ? 45   SER B C   1 
ATOM   2477 O  O   . SER B 1 45  ? 33.418 -57.326  188.724 1.00 71.63  ? 45   SER B O   1 
ATOM   2478 C  CB  . SER B 1 45  ? 31.350 -58.909  190.638 1.00 71.88  ? 45   SER B CB  1 
ATOM   2479 O  OG  . SER B 1 45  ? 30.451 -58.137  189.860 1.00 72.60  ? 45   SER B OG  1 
ATOM   2480 N  N   . TRP B 1 46  ? 34.284 -59.282  189.425 1.00 69.12  ? 46   TRP B N   1 
ATOM   2481 C  CA  . TRP B 1 46  ? 35.127 -59.431  188.247 1.00 69.17  ? 46   TRP B CA  1 
ATOM   2482 C  C   . TRP B 1 46  ? 34.376 -59.242  186.934 1.00 68.89  ? 46   TRP B C   1 
ATOM   2483 O  O   . TRP B 1 46  ? 34.813 -58.475  186.074 1.00 68.92  ? 46   TRP B O   1 
ATOM   2484 C  CB  . TRP B 1 46  ? 35.845 -60.784  188.259 1.00 69.68  ? 46   TRP B CB  1 
ATOM   2485 C  CG  . TRP B 1 46  ? 37.019 -60.796  189.177 1.00 71.62  ? 46   TRP B CG  1 
ATOM   2486 C  CD1 . TRP B 1 46  ? 37.091 -61.374  190.408 1.00 72.89  ? 46   TRP B CD1 1 
ATOM   2487 C  CD2 . TRP B 1 46  ? 38.282 -60.148  188.964 1.00 72.40  ? 46   TRP B CD2 1 
ATOM   2488 N  NE1 . TRP B 1 46  ? 38.317 -61.126  190.980 1.00 73.06  ? 46   TRP B NE1 1 
ATOM   2489 C  CE2 . TRP B 1 46  ? 39.066 -60.374  190.114 1.00 72.32  ? 46   TRP B CE2 1 
ATOM   2490 C  CE3 . TRP B 1 46  ? 38.823 -59.394  187.915 1.00 72.27  ? 46   TRP B CE3 1 
ATOM   2491 C  CZ2 . TRP B 1 46  ? 40.367 -59.875  190.245 1.00 71.98  ? 46   TRP B CZ2 1 
ATOM   2492 C  CZ3 . TRP B 1 46  ? 40.119 -58.897  188.046 1.00 71.44  ? 46   TRP B CZ3 1 
ATOM   2493 C  CH2 . TRP B 1 46  ? 40.874 -59.141  189.204 1.00 71.72  ? 46   TRP B CH2 1 
ATOM   2494 N  N   . PRO B 1 47  ? 33.239 -59.938  186.757 1.00 68.19  ? 47   PRO B N   1 
ATOM   2495 C  CA  . PRO B 1 47  ? 32.464 -59.800  185.520 1.00 65.52  ? 47   PRO B CA  1 
ATOM   2496 C  C   . PRO B 1 47  ? 32.129 -58.339  185.245 1.00 62.92  ? 47   PRO B C   1 
ATOM   2497 O  O   . PRO B 1 47  ? 32.257 -57.863  184.118 1.00 61.94  ? 47   PRO B O   1 
ATOM   2498 C  CB  . PRO B 1 47  ? 31.222 -60.635  185.804 1.00 66.09  ? 47   PRO B CB  1 
ATOM   2499 C  CG  . PRO B 1 47  ? 31.768 -61.736  186.652 1.00 66.76  ? 47   PRO B CG  1 
ATOM   2500 C  CD  . PRO B 1 47  ? 32.639 -60.968  187.625 1.00 68.39  ? 47   PRO B CD  1 
ATOM   2501 N  N   . VAL B 1 48  ? 31.701 -57.629  186.284 1.00 61.22  ? 48   VAL B N   1 
ATOM   2502 C  CA  . VAL B 1 48  ? 31.364 -56.221  186.134 1.00 60.70  ? 48   VAL B CA  1 
ATOM   2503 C  C   . VAL B 1 48  ? 32.629 -55.427  185.875 1.00 59.47  ? 48   VAL B C   1 
ATOM   2504 O  O   . VAL B 1 48  ? 32.617 -54.448  185.129 1.00 59.71  ? 48   VAL B O   1 
ATOM   2505 C  CB  . VAL B 1 48  ? 30.688 -55.651  187.394 1.00 60.71  ? 48   VAL B CB  1 
ATOM   2506 C  CG1 . VAL B 1 48  ? 30.418 -54.163  187.211 1.00 59.77  ? 48   VAL B CG1 1 
ATOM   2507 C  CG2 . VAL B 1 48  ? 29.390 -56.388  187.661 1.00 61.83  ? 48   VAL B CG2 1 
ATOM   2508 N  N   . PHE B 1 49  ? 33.719 -55.852  186.504 1.00 57.55  ? 49   PHE B N   1 
ATOM   2509 C  CA  . PHE B 1 49  ? 34.999 -55.181  186.336 1.00 54.39  ? 49   PHE B CA  1 
ATOM   2510 C  C   . PHE B 1 49  ? 35.453 -55.308  184.883 1.00 53.05  ? 49   PHE B C   1 
ATOM   2511 O  O   . PHE B 1 49  ? 35.877 -54.330  184.262 1.00 52.52  ? 49   PHE B O   1 
ATOM   2512 C  CB  . PHE B 1 49  ? 36.049 -55.802  187.261 1.00 50.76  ? 49   PHE B CB  1 
ATOM   2513 C  CG  . PHE B 1 49  ? 37.424 -55.222  187.085 1.00 49.19  ? 49   PHE B CG  1 
ATOM   2514 C  CD1 . PHE B 1 49  ? 37.690 -53.904  187.458 1.00 46.49  ? 49   PHE B CD1 1 
ATOM   2515 C  CD2 . PHE B 1 49  ? 38.448 -55.985  186.521 1.00 47.51  ? 49   PHE B CD2 1 
ATOM   2516 C  CE1 . PHE B 1 49  ? 38.956 -53.350  187.272 1.00 46.24  ? 49   PHE B CE1 1 
ATOM   2517 C  CE2 . PHE B 1 49  ? 39.718 -55.445  186.331 1.00 46.77  ? 49   PHE B CE2 1 
ATOM   2518 C  CZ  . PHE B 1 49  ? 39.974 -54.121  186.709 1.00 47.19  ? 49   PHE B CZ  1 
ATOM   2519 N  N   . ILE B 1 50  ? 35.356 -56.518  184.346 1.00 51.11  ? 50   ILE B N   1 
ATOM   2520 C  CA  . ILE B 1 50  ? 35.758 -56.779  182.973 1.00 50.85  ? 50   ILE B CA  1 
ATOM   2521 C  C   . ILE B 1 50  ? 34.855 -56.052  181.985 1.00 51.53  ? 50   ILE B C   1 
ATOM   2522 O  O   . ILE B 1 50  ? 35.300 -55.624  180.921 1.00 51.44  ? 50   ILE B O   1 
ATOM   2523 C  CB  . ILE B 1 50  ? 35.729 -58.283  182.681 1.00 50.84  ? 50   ILE B CB  1 
ATOM   2524 C  CG1 . ILE B 1 50  ? 36.717 -58.998  183.608 1.00 50.85  ? 50   ILE B CG1 1 
ATOM   2525 C  CG2 . ILE B 1 50  ? 36.059 -58.541  181.217 1.00 51.72  ? 50   ILE B CG2 1 
ATOM   2526 C  CD1 . ILE B 1 50  ? 36.637 -60.513  183.548 1.00 51.82  ? 50   ILE B CD1 1 
ATOM   2527 N  N   . THR B 1 51  ? 33.586 -55.902  182.345 1.00 52.09  ? 51   THR B N   1 
ATOM   2528 C  CA  . THR B 1 51  ? 32.630 -55.221  181.483 1.00 52.09  ? 51   THR B CA  1 
ATOM   2529 C  C   . THR B 1 51  ? 32.920 -53.725  181.459 1.00 51.17  ? 51   THR B C   1 
ATOM   2530 O  O   . THR B 1 51  ? 32.786 -53.073  180.427 1.00 50.82  ? 51   THR B O   1 
ATOM   2531 C  CB  . THR B 1 51  ? 31.187 -55.482  181.962 1.00 53.74  ? 51   THR B CB  1 
ATOM   2532 O  OG1 . THR B 1 51  ? 30.910 -56.888  181.870 1.00 53.60  ? 51   THR B OG1 1 
ATOM   2533 C  CG2 . THR B 1 51  ? 30.184 -54.717  181.107 1.00 52.74  ? 51   THR B CG2 1 
ATOM   2534 N  N   . LEU B 1 52  ? 33.327 -53.187  182.600 1.00 50.13  ? 52   LEU B N   1 
ATOM   2535 C  CA  . LEU B 1 52  ? 33.661 -51.771  182.694 1.00 50.23  ? 52   LEU B CA  1 
ATOM   2536 C  C   . LEU B 1 52  ? 34.903 -51.474  181.864 1.00 49.81  ? 52   LEU B C   1 
ATOM   2537 O  O   . LEU B 1 52  ? 34.966 -50.469  181.153 1.00 49.02  ? 52   LEU B O   1 
ATOM   2538 C  CB  . LEU B 1 52  ? 33.923 -51.382  184.149 1.00 49.54  ? 52   LEU B CB  1 
ATOM   2539 C  CG  . LEU B 1 52  ? 32.685 -51.247  185.031 1.00 50.12  ? 52   LEU B CG  1 
ATOM   2540 C  CD1 . LEU B 1 52  ? 33.089 -51.174  186.495 1.00 50.59  ? 52   LEU B CD1 1 
ATOM   2541 C  CD2 . LEU B 1 52  ? 31.918 -50.006  184.612 1.00 49.09  ? 52   LEU B CD2 1 
ATOM   2542 N  N   . ILE B 1 53  ? 35.895 -52.354  181.971 1.00 49.28  ? 53   ILE B N   1 
ATOM   2543 C  CA  . ILE B 1 53  ? 37.139 -52.197  181.236 1.00 47.59  ? 53   ILE B CA  1 
ATOM   2544 C  C   . ILE B 1 53  ? 36.880 -52.347  179.747 1.00 46.85  ? 53   ILE B C   1 
ATOM   2545 O  O   . ILE B 1 53  ? 37.310 -51.517  178.946 1.00 44.21  ? 53   ILE B O   1 
ATOM   2546 C  CB  . ILE B 1 53  ? 38.180 -53.233  181.705 1.00 48.21  ? 53   ILE B CB  1 
ATOM   2547 C  CG1 . ILE B 1 53  ? 38.692 -52.826  183.081 1.00 48.42  ? 53   ILE B CG1 1 
ATOM   2548 C  CG2 . ILE B 1 53  ? 39.337 -53.335  180.714 1.00 47.75  ? 53   ILE B CG2 1 
ATOM   2549 C  CD1 . ILE B 1 53  ? 39.865 -53.629  183.538 1.00 53.00  ? 53   ILE B CD1 1 
ATOM   2550 N  N   . THR B 1 54  ? 36.167 -53.407  179.385 1.00 46.99  ? 54   THR B N   1 
ATOM   2551 C  CA  . THR B 1 54  ? 35.842 -53.654  177.993 1.00 49.09  ? 54   THR B CA  1 
ATOM   2552 C  C   . THR B 1 54  ? 35.099 -52.446  177.440 1.00 50.44  ? 54   THR B C   1 
ATOM   2553 O  O   . THR B 1 54  ? 35.395 -51.965  176.340 1.00 51.36  ? 54   THR B O   1 
ATOM   2554 C  CB  . THR B 1 54  ? 34.957 -54.898  177.848 1.00 48.89  ? 54   THR B CB  1 
ATOM   2555 O  OG1 . THR B 1 54  ? 35.660 -56.034  178.358 1.00 48.35  ? 54   THR B OG1 1 
ATOM   2556 C  CG2 . THR B 1 54  ? 34.616 -55.144  176.386 1.00 48.59  ? 54   THR B CG2 1 
ATOM   2557 N  N   . GLY B 1 55  ? 34.138 -51.953  178.215 1.00 50.87  ? 55   GLY B N   1 
ATOM   2558 C  CA  . GLY B 1 55  ? 33.372 -50.801  177.788 1.00 51.45  ? 55   GLY B CA  1 
ATOM   2559 C  C   . GLY B 1 55  ? 34.268 -49.595  177.600 1.00 52.02  ? 55   GLY B C   1 
ATOM   2560 O  O   . GLY B 1 55  ? 34.254 -48.956  176.552 1.00 52.77  ? 55   GLY B O   1 
ATOM   2561 N  N   . LEU B 1 56  ? 35.052 -49.282  178.621 1.00 52.52  ? 56   LEU B N   1 
ATOM   2562 C  CA  . LEU B 1 56  ? 35.955 -48.144  178.553 1.00 54.14  ? 56   LEU B CA  1 
ATOM   2563 C  C   . LEU B 1 56  ? 36.913 -48.312  177.387 1.00 53.62  ? 56   LEU B C   1 
ATOM   2564 O  O   . LEU B 1 56  ? 37.428 -47.337  176.848 1.00 54.34  ? 56   LEU B O   1 
ATOM   2565 C  CB  . LEU B 1 56  ? 36.741 -48.023  179.859 1.00 56.92  ? 56   LEU B CB  1 
ATOM   2566 C  CG  . LEU B 1 56  ? 37.867 -46.988  179.912 1.00 59.32  ? 56   LEU B CG  1 
ATOM   2567 C  CD1 . LEU B 1 56  ? 37.337 -45.604  179.575 1.00 60.50  ? 56   LEU B CD1 1 
ATOM   2568 C  CD2 . LEU B 1 56  ? 38.478 -47.006  181.302 1.00 61.32  ? 56   LEU B CD2 1 
ATOM   2569 N  N   . TYR B 1 57  ? 37.141 -49.563  177.001 1.00 52.46  ? 57   TYR B N   1 
ATOM   2570 C  CA  . TYR B 1 57  ? 38.041 -49.889  175.902 1.00 51.67  ? 57   TYR B CA  1 
ATOM   2571 C  C   . TYR B 1 57  ? 37.405 -49.557  174.557 1.00 51.38  ? 57   TYR B C   1 
ATOM   2572 O  O   . TYR B 1 57  ? 38.059 -49.044  173.647 1.00 49.86  ? 57   TYR B O   1 
ATOM   2573 C  CB  . TYR B 1 57  ? 38.395 -51.378  175.966 1.00 51.27  ? 57   TYR B CB  1 
ATOM   2574 C  CG  . TYR B 1 57  ? 39.066 -51.939  174.733 1.00 50.08  ? 57   TYR B CG  1 
ATOM   2575 C  CD1 . TYR B 1 57  ? 40.335 -51.512  174.340 1.00 48.62  ? 57   TYR B CD1 1 
ATOM   2576 C  CD2 . TYR B 1 57  ? 38.438 -52.928  173.975 1.00 51.23  ? 57   TYR B CD2 1 
ATOM   2577 C  CE1 . TYR B 1 57  ? 40.965 -52.062  173.224 1.00 46.74  ? 57   TYR B CE1 1 
ATOM   2578 C  CE2 . TYR B 1 57  ? 39.057 -53.482  172.859 1.00 50.70  ? 57   TYR B CE2 1 
ATOM   2579 C  CZ  . TYR B 1 57  ? 40.320 -53.045  172.493 1.00 49.47  ? 57   TYR B CZ  1 
ATOM   2580 O  OH  . TYR B 1 57  ? 40.932 -53.615  171.407 1.00 50.86  ? 57   TYR B OH  1 
ATOM   2581 N  N   . LEU B 1 58  ? 36.120 -49.852  174.438 1.00 51.15  ? 58   LEU B N   1 
ATOM   2582 C  CA  . LEU B 1 58  ? 35.406 -49.589  173.203 1.00 50.91  ? 58   LEU B CA  1 
ATOM   2583 C  C   . LEU B 1 58  ? 35.129 -48.099  172.955 1.00 51.77  ? 58   LEU B C   1 
ATOM   2584 O  O   . LEU B 1 58  ? 35.385 -47.595  171.861 1.00 50.54  ? 58   LEU B O   1 
ATOM   2585 C  CB  . LEU B 1 58  ? 34.106 -50.390  173.193 1.00 47.47  ? 58   LEU B CB  1 
ATOM   2586 C  CG  . LEU B 1 58  ? 34.331 -51.896  173.331 1.00 46.19  ? 58   LEU B CG  1 
ATOM   2587 C  CD1 . LEU B 1 58  ? 33.015 -52.626  173.257 1.00 46.64  ? 58   LEU B CD1 1 
ATOM   2588 C  CD2 . LEU B 1 58  ? 35.240 -52.374  172.230 1.00 45.67  ? 58   LEU B CD2 1 
ATOM   2589 N  N   . VAL B 1 59  ? 34.626 -47.389  173.962 1.00 53.06  ? 59   VAL B N   1 
ATOM   2590 C  CA  . VAL B 1 59  ? 34.317 -45.974  173.781 1.00 55.69  ? 59   VAL B CA  1 
ATOM   2591 C  C   . VAL B 1 59  ? 35.556 -45.147  173.459 1.00 57.65  ? 59   VAL B C   1 
ATOM   2592 O  O   . VAL B 1 59  ? 35.486 -44.178  172.700 1.00 59.87  ? 59   VAL B O   1 
ATOM   2593 C  CB  . VAL B 1 59  ? 33.612 -45.368  175.023 1.00 55.46  ? 59   VAL B CB  1 
ATOM   2594 C  CG1 . VAL B 1 59  ? 32.713 -46.405  175.659 1.00 54.47  ? 59   VAL B CG1 1 
ATOM   2595 C  CG2 . VAL B 1 59  ? 34.626 -44.831  176.009 1.00 55.24  ? 59   VAL B CG2 1 
ATOM   2596 N  N   . THR B 1 60  ? 36.692 -45.523  174.035 1.00 58.38  ? 60   THR B N   1 
ATOM   2597 C  CA  . THR B 1 60  ? 37.932 -44.799  173.780 1.00 57.35  ? 60   THR B CA  1 
ATOM   2598 C  C   . THR B 1 60  ? 38.331 -45.002  172.314 1.00 57.57  ? 60   THR B C   1 
ATOM   2599 O  O   . THR B 1 60  ? 38.865 -44.098  171.673 1.00 57.71  ? 60   THR B O   1 
ATOM   2600 C  CB  . THR B 1 60  ? 39.060 -45.282  174.718 1.00 55.92  ? 60   THR B CB  1 
ATOM   2601 O  OG1 . THR B 1 60  ? 38.647 -45.108  176.079 1.00 53.20  ? 60   THR B OG1 1 
ATOM   2602 C  CG2 . THR B 1 60  ? 40.332 -44.484  174.488 1.00 54.45  ? 60   THR B CG2 1 
ATOM   2603 N  N   . ASN B 1 61  ? 38.066 -46.190  171.781 1.00 57.24  ? 61   ASN B N   1 
ATOM   2604 C  CA  . ASN B 1 61  ? 38.380 -46.457  170.386 1.00 57.68  ? 61   ASN B CA  1 
ATOM   2605 C  C   . ASN B 1 61  ? 37.293 -45.848  169.508 1.00 58.56  ? 61   ASN B C   1 
ATOM   2606 O  O   . ASN B 1 61  ? 37.485 -45.655  168.310 1.00 59.29  ? 61   ASN B O   1 
ATOM   2607 C  CB  . ASN B 1 61  ? 38.497 -47.960  170.135 1.00 56.05  ? 61   ASN B CB  1 
ATOM   2608 C  CG  . ASN B 1 61  ? 39.905 -48.476  170.370 1.00 57.36  ? 61   ASN B CG  1 
ATOM   2609 O  OD1 . ASN B 1 61  ? 40.834 -48.134  169.637 1.00 56.83  ? 61   ASN B OD1 1 
ATOM   2610 N  ND2 . ASN B 1 61  ? 40.072 -49.296  171.404 1.00 56.77  ? 61   ASN B ND2 1 
ATOM   2611 N  N   . ALA B 1 62  ? 36.150 -45.543  170.117 1.00 58.62  ? 62   ALA B N   1 
ATOM   2612 C  CA  . ALA B 1 62  ? 35.046 -44.926  169.398 1.00 56.70  ? 62   ALA B CA  1 
ATOM   2613 C  C   . ALA B 1 62  ? 35.396 -43.454  169.256 1.00 56.37  ? 62   ALA B C   1 
ATOM   2614 O  O   . ALA B 1 62  ? 35.157 -42.847  168.214 1.00 56.81  ? 62   ALA B O   1 
ATOM   2615 C  CB  . ALA B 1 62  ? 33.754 -45.083  170.175 1.00 55.31  ? 62   ALA B CB  1 
ATOM   2616 N  N   . LEU B 1 63  ? 35.978 -42.881  170.304 1.00 55.60  ? 63   LEU B N   1 
ATOM   2617 C  CA  . LEU B 1 63  ? 36.362 -41.480  170.264 1.00 57.27  ? 63   LEU B CA  1 
ATOM   2618 C  C   . LEU B 1 63  ? 37.500 -41.245  169.273 1.00 58.67  ? 63   LEU B C   1 
ATOM   2619 O  O   . LEU B 1 63  ? 37.426 -40.328  168.454 1.00 60.46  ? 63   LEU B O   1 
ATOM   2620 C  CB  . LEU B 1 63  ? 36.760 -40.986  171.658 1.00 58.18  ? 63   LEU B CB  1 
ATOM   2621 C  CG  . LEU B 1 63  ? 35.619 -40.909  172.683 1.00 59.28  ? 63   LEU B CG  1 
ATOM   2622 C  CD1 . LEU B 1 63  ? 36.132 -40.323  173.994 1.00 58.14  ? 63   LEU B CD1 1 
ATOM   2623 C  CD2 . LEU B 1 63  ? 34.491 -40.050  172.126 1.00 58.52  ? 63   LEU B CD2 1 
ATOM   2624 N  N   . PHE B 1 64  ? 38.551 -42.061  169.333 1.00 57.79  ? 64   PHE B N   1 
ATOM   2625 C  CA  . PHE B 1 64  ? 39.656 -41.896  168.396 1.00 56.66  ? 64   PHE B CA  1 
ATOM   2626 C  C   . PHE B 1 64  ? 39.162 -42.112  166.967 1.00 58.77  ? 64   PHE B C   1 
ATOM   2627 O  O   . PHE B 1 64  ? 39.614 -41.440  166.041 1.00 59.49  ? 64   PHE B O   1 
ATOM   2628 C  CB  . PHE B 1 64  ? 40.803 -42.874  168.698 1.00 53.54  ? 64   PHE B CB  1 
ATOM   2629 C  CG  . PHE B 1 64  ? 41.813 -42.341  169.673 1.00 51.43  ? 64   PHE B CG  1 
ATOM   2630 C  CD1 . PHE B 1 64  ? 41.711 -42.621  171.033 1.00 50.17  ? 64   PHE B CD1 1 
ATOM   2631 C  CD2 . PHE B 1 64  ? 42.846 -41.520  169.239 1.00 51.64  ? 64   PHE B CD2 1 
ATOM   2632 C  CE1 . PHE B 1 64  ? 42.620 -42.091  171.945 1.00 48.45  ? 64   PHE B CE1 1 
ATOM   2633 C  CE2 . PHE B 1 64  ? 43.767 -40.977  170.146 1.00 51.30  ? 64   PHE B CE2 1 
ATOM   2634 C  CZ  . PHE B 1 64  ? 43.651 -41.265  171.502 1.00 49.90  ? 64   PHE B CZ  1 
ATOM   2635 N  N   . ALA B 1 65  ? 38.236 -43.052  166.787 1.00 59.50  ? 65   ALA B N   1 
ATOM   2636 C  CA  . ALA B 1 65  ? 37.697 -43.328  165.464 1.00 60.25  ? 65   ALA B CA  1 
ATOM   2637 C  C   . ALA B 1 65  ? 37.095 -42.045  164.896 1.00 63.02  ? 65   ALA B C   1 
ATOM   2638 O  O   . ALA B 1 65  ? 37.341 -41.679  163.746 1.00 63.21  ? 65   ALA B O   1 
ATOM   2639 C  CB  . ALA B 1 65  ? 36.643 -44.412  165.544 1.00 58.16  ? 65   ALA B CB  1 
ATOM   2640 N  N   . LEU B 1 66  ? 36.308 -41.355  165.711 1.00 64.83  ? 66   LEU B N   1 
ATOM   2641 C  CA  . LEU B 1 66  ? 35.689 -40.115  165.281 1.00 66.11  ? 66   LEU B CA  1 
ATOM   2642 C  C   . LEU B 1 66  ? 36.767 -39.087  164.957 1.00 67.66  ? 66   LEU B C   1 
ATOM   2643 O  O   . LEU B 1 66  ? 36.767 -38.496  163.877 1.00 68.76  ? 66   LEU B O   1 
ATOM   2644 C  CB  . LEU B 1 66  ? 34.770 -39.578  166.376 1.00 65.00  ? 66   LEU B CB  1 
ATOM   2645 C  CG  . LEU B 1 66  ? 33.639 -40.512  166.810 1.00 64.73  ? 66   LEU B CG  1 
ATOM   2646 C  CD1 . LEU B 1 66  ? 32.772 -39.809  167.848 1.00 64.64  ? 66   LEU B CD1 1 
ATOM   2647 C  CD2 . LEU B 1 66  ? 32.811 -40.917  165.602 1.00 63.69  ? 66   LEU B CD2 1 
ATOM   2648 N  N   . ALA B 1 67  ? 37.685 -38.884  165.897 1.00 69.06  ? 67   ALA B N   1 
ATOM   2649 C  CA  . ALA B 1 67  ? 38.774 -37.925  165.728 1.00 70.84  ? 67   ALA B CA  1 
ATOM   2650 C  C   . ALA B 1 67  ? 39.482 -38.086  164.386 1.00 72.21  ? 67   ALA B C   1 
ATOM   2651 O  O   . ALA B 1 67  ? 39.924 -37.106  163.789 1.00 73.06  ? 67   ALA B O   1 
ATOM   2652 C  CB  . ALA B 1 67  ? 39.775 -38.069  166.869 1.00 70.23  ? 67   ALA B CB  1 
ATOM   2653 N  N   . TYR B 1 68  ? 39.600 -39.318  163.913 1.00 73.62  ? 68   TYR B N   1 
ATOM   2654 C  CA  . TYR B 1 68  ? 40.244 -39.561  162.630 1.00 76.12  ? 68   TYR B CA  1 
ATOM   2655 C  C   . TYR B 1 68  ? 39.335 -39.075  161.505 1.00 77.59  ? 68   TYR B C   1 
ATOM   2656 O  O   . TYR B 1 68  ? 39.805 -38.548  160.492 1.00 77.63  ? 68   TYR B O   1 
ATOM   2657 C  CB  . TYR B 1 68  ? 40.542 -41.054  162.459 1.00 75.70  ? 68   TYR B CB  1 
ATOM   2658 C  CG  . TYR B 1 68  ? 41.742 -41.529  163.246 1.00 76.02  ? 68   TYR B CG  1 
ATOM   2659 C  CD1 . TYR B 1 68  ? 41.728 -42.763  163.897 1.00 75.81  ? 68   TYR B CD1 1 
ATOM   2660 C  CD2 . TYR B 1 68  ? 42.898 -40.754  163.330 1.00 75.47  ? 68   TYR B CD2 1 
ATOM   2661 C  CE1 . TYR B 1 68  ? 42.834 -43.211  164.612 1.00 75.03  ? 68   TYR B CE1 1 
ATOM   2662 C  CE2 . TYR B 1 68  ? 44.010 -41.196  164.041 1.00 75.28  ? 68   TYR B CE2 1 
ATOM   2663 C  CZ  . TYR B 1 68  ? 43.970 -42.425  164.680 1.00 74.51  ? 68   TYR B CZ  1 
ATOM   2664 O  OH  . TYR B 1 68  ? 45.065 -42.867  165.386 1.00 73.27  ? 68   TYR B OH  1 
ATOM   2665 N  N   . LEU B 1 69  ? 38.030 -39.255  161.691 1.00 78.76  ? 69   LEU B N   1 
ATOM   2666 C  CA  . LEU B 1 69  ? 37.046 -38.827  160.704 1.00 79.96  ? 69   LEU B CA  1 
ATOM   2667 C  C   . LEU B 1 69  ? 36.966 -37.303  160.694 1.00 80.90  ? 69   LEU B C   1 
ATOM   2668 O  O   . LEU B 1 69  ? 36.688 -36.689  159.661 1.00 81.22  ? 69   LEU B O   1 
ATOM   2669 C  CB  . LEU B 1 69  ? 35.675 -39.417  161.033 1.00 79.14  ? 69   LEU B CB  1 
ATOM   2670 C  CG  . LEU B 1 69  ? 35.573 -40.942  160.998 1.00 79.01  ? 69   LEU B CG  1 
ATOM   2671 C  CD1 . LEU B 1 69  ? 34.190 -41.371  161.455 1.00 79.43  ? 69   LEU B CD1 1 
ATOM   2672 C  CD2 . LEU B 1 69  ? 35.855 -41.448  159.598 1.00 78.06  ? 69   LEU B CD2 1 
ATOM   2673 N  N   . ALA B 1 70  ? 37.216 -36.701  161.853 1.00 80.89  ? 70   ALA B N   1 
ATOM   2674 C  CA  . ALA B 1 70  ? 37.193 -35.251  161.987 1.00 81.52  ? 70   ALA B CA  1 
ATOM   2675 C  C   . ALA B 1 70  ? 38.432 -34.657  161.318 1.00 82.17  ? 70   ALA B C   1 
ATOM   2676 O  O   . ALA B 1 70  ? 38.718 -33.468  161.449 1.00 82.12  ? 70   ALA B O   1 
ATOM   2677 C  CB  . ALA B 1 70  ? 37.152 -34.864  163.457 1.00 81.10  ? 70   ALA B CB  1 
ATOM   2678 N  N   . CYS B 1 71  ? 39.169 -35.506  160.610 1.00 83.10  ? 71   CYS B N   1 
ATOM   2679 C  CA  . CYS B 1 71  ? 40.369 -35.094  159.894 1.00 83.14  ? 71   CYS B CA  1 
ATOM   2680 C  C   . CYS B 1 71  ? 40.148 -35.422  158.426 1.00 83.63  ? 71   CYS B C   1 
ATOM   2681 O  O   . CYS B 1 71  ? 41.007 -35.167  157.582 1.00 84.14  ? 71   CYS B O   1 
ATOM   2682 C  CB  . CYS B 1 71  ? 41.592 -35.863  160.397 1.00 82.85  ? 71   CYS B CB  1 
ATOM   2683 S  SG  . CYS B 1 71  ? 41.943 -35.667  162.139 1.00 80.37  ? 71   CYS B SG  1 
ATOM   2684 N  N   . GLY B 1 72  ? 38.990 -36.006  158.135 1.00 83.67  ? 72   GLY B N   1 
ATOM   2685 C  CA  . GLY B 1 72  ? 38.665 -36.374  156.770 1.00 84.95  ? 72   GLY B CA  1 
ATOM   2686 C  C   . GLY B 1 72  ? 39.032 -37.809  156.458 1.00 85.52  ? 72   GLY B C   1 
ATOM   2687 O  O   . GLY B 1 72  ? 38.711 -38.722  157.221 1.00 85.65  ? 72   GLY B O   1 
ATOM   2688 N  N   . ASP B 1 73  ? 39.699 -38.008  155.326 1.00 86.17  ? 73   ASP B N   1 
ATOM   2689 C  CA  . ASP B 1 73  ? 40.126 -39.340  154.903 1.00 86.84  ? 73   ASP B CA  1 
ATOM   2690 C  C   . ASP B 1 73  ? 41.625 -39.465  155.120 1.00 85.78  ? 73   ASP B C   1 
ATOM   2691 O  O   . ASP B 1 73  ? 42.390 -39.538  154.159 1.00 86.64  ? 73   ASP B O   1 
ATOM   2692 C  CB  . ASP B 1 73  ? 39.808 -39.569  153.417 1.00 87.64  ? 73   ASP B CB  1 
ATOM   2693 C  CG  . ASP B 1 73  ? 38.324 -39.759  153.155 1.00 88.78  ? 73   ASP B CG  1 
ATOM   2694 O  OD1 . ASP B 1 73  ? 37.736 -40.715  153.705 1.00 89.31  ? 73   ASP B OD1 1 
ATOM   2695 O  OD2 . ASP B 1 73  ? 37.747 -38.952  152.396 1.00 89.50  ? 73   ASP B OD2 1 
ATOM   2696 N  N   . VAL B 1 74  ? 42.041 -39.493  156.382 1.00 83.31  ? 74   VAL B N   1 
ATOM   2697 C  CA  . VAL B 1 74  ? 43.456 -39.591  156.706 1.00 80.57  ? 74   VAL B CA  1 
ATOM   2698 C  C   . VAL B 1 74  ? 43.948 -41.019  156.960 1.00 79.18  ? 74   VAL B C   1 
ATOM   2699 O  O   . VAL B 1 74  ? 45.088 -41.225  157.375 1.00 78.79  ? 74   VAL B O   1 
ATOM   2700 C  CB  . VAL B 1 74  ? 43.787 -38.702  157.914 1.00 80.13  ? 74   VAL B CB  1 
ATOM   2701 C  CG1 . VAL B 1 74  ? 43.712 -37.237  157.510 1.00 78.20  ? 74   VAL B CG1 1 
ATOM   2702 C  CG2 . VAL B 1 74  ? 42.806 -38.977  159.040 1.00 80.51  ? 74   VAL B CG2 1 
ATOM   2703 N  N   . ILE B 1 75  ? 43.092 -42.002  156.697 1.00 77.19  ? 75   ILE B N   1 
ATOM   2704 C  CA  . ILE B 1 75  ? 43.464 -43.402  156.882 1.00 75.84  ? 75   ILE B CA  1 
ATOM   2705 C  C   . ILE B 1 75  ? 43.456 -44.107  155.532 1.00 76.61  ? 75   ILE B C   1 
ATOM   2706 O  O   . ILE B 1 75  ? 42.391 -44.315  154.953 1.00 76.98  ? 75   ILE B O   1 
ATOM   2707 C  CB  . ILE B 1 75  ? 42.469 -44.152  157.796 1.00 73.82  ? 75   ILE B CB  1 
ATOM   2708 C  CG1 . ILE B 1 75  ? 42.305 -43.425  159.130 1.00 71.24  ? 75   ILE B CG1 1 
ATOM   2709 C  CG2 . ILE B 1 75  ? 42.966 -45.567  158.038 1.00 71.60  ? 75   ILE B CG2 1 
ATOM   2710 C  CD1 . ILE B 1 75  ? 41.222 -44.012  160.008 1.00 67.37  ? 75   ILE B CD1 1 
ATOM   2711 N  N   . GLU B 1 76  ? 44.630 -44.482  155.032 1.00 77.28  ? 76   GLU B N   1 
ATOM   2712 C  CA  . GLU B 1 76  ? 44.708 -45.164  153.743 1.00 78.39  ? 76   GLU B CA  1 
ATOM   2713 C  C   . GLU B 1 76  ? 43.927 -46.475  153.707 1.00 78.54  ? 76   GLU B C   1 
ATOM   2714 O  O   . GLU B 1 76  ? 43.748 -47.136  154.726 1.00 79.19  ? 76   GLU B O   1 
ATOM   2715 C  CB  . GLU B 1 76  ? 46.164 -45.446  153.354 1.00 79.63  ? 76   GLU B CB  1 
ATOM   2716 C  CG  . GLU B 1 76  ? 46.916 -44.235  152.815 1.00 82.50  ? 76   GLU B CG  1 
ATOM   2717 C  CD  . GLU B 1 76  ? 48.186 -44.608  152.058 1.00 83.86  ? 76   GLU B CD  1 
ATOM   2718 O  OE1 . GLU B 1 76  ? 48.075 -45.232  150.981 1.00 83.94  ? 76   GLU B OE1 1 
ATOM   2719 O  OE2 . GLU B 1 76  ? 49.295 -44.279  152.539 1.00 84.38  ? 76   GLU B OE2 1 
ATOM   2720 N  N   . ASN B 1 77  ? 43.465 -46.834  152.513 1.00 78.14  ? 77   ASN B N   1 
ATOM   2721 C  CA  . ASN B 1 77  ? 42.719 -48.064  152.289 1.00 77.21  ? 77   ASN B CA  1 
ATOM   2722 C  C   . ASN B 1 77  ? 41.481 -48.251  153.152 1.00 77.24  ? 77   ASN B C   1 
ATOM   2723 O  O   . ASN B 1 77  ? 41.046 -49.382  153.377 1.00 76.43  ? 77   ASN B O   1 
ATOM   2724 C  CB  . ASN B 1 77  ? 43.651 -49.263  152.458 1.00 76.86  ? 77   ASN B CB  1 
ATOM   2725 C  CG  . ASN B 1 77  ? 44.722 -49.310  151.394 1.00 77.41  ? 77   ASN B CG  1 
ATOM   2726 O  OD1 . ASN B 1 77  ? 44.431 -49.552  150.222 1.00 78.31  ? 77   ASN B OD1 1 
ATOM   2727 N  ND2 . ASN B 1 77  ? 45.966 -49.067  151.790 1.00 76.09  ? 77   ASN B ND2 1 
ATOM   2728 N  N   . ALA B 1 78  ? 40.903 -47.151  153.623 1.00 77.63  ? 78   ALA B N   1 
ATOM   2729 C  CA  . ALA B 1 78  ? 39.701 -47.226  154.447 1.00 79.39  ? 78   ALA B CA  1 
ATOM   2730 C  C   . ALA B 1 78  ? 38.523 -46.525  153.775 1.00 80.72  ? 78   ALA B C   1 
ATOM   2731 O  O   . ALA B 1 78  ? 38.664 -45.409  153.270 1.00 81.42  ? 78   ALA B O   1 
ATOM   2732 C  CB  . ALA B 1 78  ? 39.964 -46.605  155.813 1.00 78.52  ? 78   ALA B CB  1 
ATOM   2733 N  N   . ARG B 1 79  ? 37.365 -47.181  153.764 1.00 82.02  ? 79   ARG B N   1 
ATOM   2734 C  CA  . ARG B 1 79  ? 36.167 -46.598  153.164 1.00 82.82  ? 79   ARG B CA  1 
ATOM   2735 C  C   . ARG B 1 79  ? 35.967 -45.201  153.743 1.00 82.95  ? 79   ARG B C   1 
ATOM   2736 O  O   . ARG B 1 79  ? 35.899 -45.031  154.959 1.00 83.18  ? 79   ARG B O   1 
ATOM   2737 C  CB  . ARG B 1 79  ? 34.944 -47.470  153.461 1.00 83.44  ? 79   ARG B CB  1 
ATOM   2738 C  CG  . ARG B 1 79  ? 34.970 -48.822  152.762 1.00 85.97  ? 79   ARG B CG  1 
ATOM   2739 C  CD  . ARG B 1 79  ? 33.800 -49.706  153.178 1.00 87.13  ? 79   ARG B CD  1 
ATOM   2740 N  NE  . ARG B 1 79  ? 33.941 -50.204  154.544 1.00 89.54  ? 79   ARG B NE  1 
ATOM   2741 C  CZ  . ARG B 1 79  ? 33.112 -51.075  155.112 1.00 91.48  ? 79   ARG B CZ  1 
ATOM   2742 N  NH1 . ARG B 1 79  ? 32.077 -51.546  154.432 1.00 92.05  ? 79   ARG B NH1 1 
ATOM   2743 N  NH2 . ARG B 1 79  ? 33.320 -51.487  156.358 1.00 92.39  ? 79   ARG B NH2 1 
ATOM   2744 N  N   . PRO B 1 80  ? 35.883 -44.177  152.877 1.00 83.46  ? 80   PRO B N   1 
ATOM   2745 C  CA  . PRO B 1 80  ? 35.695 -42.806  153.359 1.00 82.73  ? 80   PRO B CA  1 
ATOM   2746 C  C   . PRO B 1 80  ? 34.509 -42.660  154.312 1.00 81.91  ? 80   PRO B C   1 
ATOM   2747 O  O   . PRO B 1 80  ? 33.494 -43.343  154.168 1.00 81.65  ? 80   PRO B O   1 
ATOM   2748 C  CB  . PRO B 1 80  ? 35.507 -42.014  152.067 1.00 82.29  ? 80   PRO B CB  1 
ATOM   2749 C  CG  . PRO B 1 80  ? 36.359 -42.767  151.097 1.00 82.76  ? 80   PRO B CG  1 
ATOM   2750 C  CD  . PRO B 1 80  ? 35.986 -44.198  151.407 1.00 83.06  ? 80   PRO B CD  1 
ATOM   2751 N  N   . GLY B 1 81  ? 34.658 -41.771  155.290 1.00 80.98  ? 81   GLY B N   1 
ATOM   2752 C  CA  . GLY B 1 81  ? 33.599 -41.523  156.252 1.00 79.62  ? 81   GLY B CA  1 
ATOM   2753 C  C   . GLY B 1 81  ? 33.019 -42.746  156.934 1.00 79.39  ? 81   GLY B C   1 
ATOM   2754 O  O   . GLY B 1 81  ? 31.939 -42.663  157.516 1.00 79.74  ? 81   GLY B O   1 
ATOM   2755 N  N   . SER B 1 82  ? 33.721 -43.876  156.872 1.00 78.69  ? 82   SER B N   1 
ATOM   2756 C  CA  . SER B 1 82  ? 33.249 -45.106  157.509 1.00 78.04  ? 82   SER B CA  1 
ATOM   2757 C  C   . SER B 1 82  ? 33.748 -45.208  158.944 1.00 78.04  ? 82   SER B C   1 
ATOM   2758 O  O   . SER B 1 82  ? 34.951 -45.125  159.195 1.00 78.20  ? 82   SER B O   1 
ATOM   2759 C  CB  . SER B 1 82  ? 33.723 -46.333  156.730 1.00 77.64  ? 82   SER B CB  1 
ATOM   2760 O  OG  . SER B 1 82  ? 33.231 -47.525  157.320 1.00 76.81  ? 82   SER B OG  1 
ATOM   2761 N  N   . PHE B 1 83  ? 32.823 -45.388  159.882 1.00 77.16  ? 83   PHE B N   1 
ATOM   2762 C  CA  . PHE B 1 83  ? 33.179 -45.503  161.293 1.00 76.35  ? 83   PHE B CA  1 
ATOM   2763 C  C   . PHE B 1 83  ? 33.911 -46.819  161.532 1.00 75.48  ? 83   PHE B C   1 
ATOM   2764 O  O   . PHE B 1 83  ? 34.929 -46.861  162.219 1.00 75.49  ? 83   PHE B O   1 
ATOM   2765 C  CB  . PHE B 1 83  ? 31.924 -45.454  162.165 1.00 75.46  ? 83   PHE B CB  1 
ATOM   2766 C  CG  . PHE B 1 83  ? 32.209 -45.492  163.638 1.00 75.11  ? 83   PHE B CG  1 
ATOM   2767 C  CD1 . PHE B 1 83  ? 32.893 -44.449  164.256 1.00 74.75  ? 83   PHE B CD1 1 
ATOM   2768 C  CD2 . PHE B 1 83  ? 31.793 -46.571  164.411 1.00 74.74  ? 83   PHE B CD2 1 
ATOM   2769 C  CE1 . PHE B 1 83  ? 33.159 -44.479  165.623 1.00 73.63  ? 83   PHE B CE1 1 
ATOM   2770 C  CE2 . PHE B 1 83  ? 32.053 -46.611  165.776 1.00 73.86  ? 83   PHE B CE2 1 
ATOM   2771 C  CZ  . PHE B 1 83  ? 32.739 -45.560  166.384 1.00 73.76  ? 83   PHE B CZ  1 
ATOM   2772 N  N   . THR B 1 84  ? 33.382 -47.891  160.956 1.00 73.98  ? 84   THR B N   1 
ATOM   2773 C  CA  . THR B 1 84  ? 33.978 -49.211  161.092 1.00 72.76  ? 84   THR B CA  1 
ATOM   2774 C  C   . THR B 1 84  ? 35.482 -49.182  160.855 1.00 71.09  ? 84   THR B C   1 
ATOM   2775 O  O   . THR B 1 84  ? 36.275 -49.371  161.776 1.00 71.44  ? 84   THR B O   1 
ATOM   2776 C  CB  . THR B 1 84  ? 33.349 -50.191  160.094 1.00 73.04  ? 84   THR B CB  1 
ATOM   2777 O  OG1 . THR B 1 84  ? 31.973 -50.395  160.436 1.00 72.12  ? 84   THR B OG1 1 
ATOM   2778 C  CG2 . THR B 1 84  ? 34.088 -51.525  160.109 1.00 73.66  ? 84   THR B CG2 1 
ATOM   2779 N  N   . ASP B 1 85  ? 35.860 -48.948  159.608 1.00 69.23  ? 85   ASP B N   1 
ATOM   2780 C  CA  . ASP B 1 85  ? 37.257 -48.896  159.215 1.00 67.00  ? 85   ASP B CA  1 
ATOM   2781 C  C   . ASP B 1 85  ? 38.073 -47.955  160.101 1.00 64.22  ? 85   ASP B C   1 
ATOM   2782 O  O   . ASP B 1 85  ? 39.269 -48.159  160.301 1.00 63.23  ? 85   ASP B O   1 
ATOM   2783 C  CB  . ASP B 1 85  ? 37.352 -48.460  157.750 1.00 69.51  ? 85   ASP B CB  1 
ATOM   2784 C  CG  . ASP B 1 85  ? 36.504 -49.323  156.831 1.00 72.13  ? 85   ASP B CG  1 
ATOM   2785 O  OD1 . ASP B 1 85  ? 35.276 -49.393  157.050 1.00 73.34  ? 85   ASP B OD1 1 
ATOM   2786 O  OD2 . ASP B 1 85  ? 37.062 -49.932  155.893 1.00 74.71  ? 85   ASP B OD2 1 
ATOM   2787 N  N   . ALA B 1 86  ? 37.424 -46.929  160.638 1.00 61.57  ? 86   ALA B N   1 
ATOM   2788 C  CA  . ALA B 1 86  ? 38.108 -45.970  161.498 1.00 60.47  ? 86   ALA B CA  1 
ATOM   2789 C  C   . ALA B 1 86  ? 38.236 -46.510  162.919 1.00 59.12  ? 86   ALA B C   1 
ATOM   2790 O  O   . ALA B 1 86  ? 39.213 -46.238  163.616 1.00 58.01  ? 86   ALA B O   1 
ATOM   2791 C  CB  . ALA B 1 86  ? 37.355 -44.646  161.506 1.00 59.77  ? 86   ALA B CB  1 
ATOM   2792 N  N   . PHE B 1 87  ? 37.237 -47.275  163.340 1.00 57.89  ? 87   PHE B N   1 
ATOM   2793 C  CA  . PHE B 1 87  ? 37.223 -47.863  164.668 1.00 57.14  ? 87   PHE B CA  1 
ATOM   2794 C  C   . PHE B 1 87  ? 38.291 -48.942  164.732 1.00 56.89  ? 87   PHE B C   1 
ATOM   2795 O  O   . PHE B 1 87  ? 39.100 -48.985  165.663 1.00 57.11  ? 87   PHE B O   1 
ATOM   2796 C  CB  . PHE B 1 87  ? 35.856 -48.485  164.950 1.00 56.74  ? 87   PHE B CB  1 
ATOM   2797 C  CG  . PHE B 1 87  ? 35.758 -49.152  166.289 1.00 55.06  ? 87   PHE B CG  1 
ATOM   2798 C  CD1 . PHE B 1 87  ? 35.668 -48.395  167.454 1.00 54.75  ? 87   PHE B CD1 1 
ATOM   2799 C  CD2 . PHE B 1 87  ? 35.765 -50.537  166.388 1.00 54.90  ? 87   PHE B CD2 1 
ATOM   2800 C  CE1 . PHE B 1 87  ? 35.587 -49.010  168.697 1.00 54.31  ? 87   PHE B CE1 1 
ATOM   2801 C  CE2 . PHE B 1 87  ? 35.685 -51.161  167.629 1.00 54.88  ? 87   PHE B CE2 1 
ATOM   2802 C  CZ  . PHE B 1 87  ? 35.595 -50.396  168.784 1.00 53.37  ? 87   PHE B CZ  1 
ATOM   2803 N  N   . PHE B 1 88  ? 38.285 -49.814  163.732 1.00 54.94  ? 88   PHE B N   1 
ATOM   2804 C  CA  . PHE B 1 88  ? 39.247 -50.899  163.667 1.00 53.23  ? 88   PHE B CA  1 
ATOM   2805 C  C   . PHE B 1 88  ? 40.667 -50.404  163.460 1.00 52.02  ? 88   PHE B C   1 
ATOM   2806 O  O   . PHE B 1 88  ? 41.617 -51.052  163.899 1.00 53.37  ? 88   PHE B O   1 
ATOM   2807 C  CB  . PHE B 1 88  ? 38.830 -51.881  162.576 1.00 53.14  ? 88   PHE B CB  1 
ATOM   2808 C  CG  . PHE B 1 88  ? 37.554 -52.607  162.894 1.00 55.84  ? 88   PHE B CG  1 
ATOM   2809 C  CD1 . PHE B 1 88  ? 36.739 -53.102  161.885 1.00 57.43  ? 88   PHE B CD1 1 
ATOM   2810 C  CD2 . PHE B 1 88  ? 37.163 -52.792  164.218 1.00 55.92  ? 88   PHE B CD2 1 
ATOM   2811 C  CE1 . PHE B 1 88  ? 35.548 -53.772  162.189 1.00 57.71  ? 88   PHE B CE1 1 
ATOM   2812 C  CE2 . PHE B 1 88  ? 35.984 -53.458  164.532 1.00 57.23  ? 88   PHE B CE2 1 
ATOM   2813 C  CZ  . PHE B 1 88  ? 35.173 -53.949  163.516 1.00 58.13  ? 88   PHE B CZ  1 
ATOM   2814 N  N   . PHE B 1 89  ? 40.824 -49.256  162.804 1.00 48.82  ? 89   PHE B N   1 
ATOM   2815 C  CA  . PHE B 1 89  ? 42.162 -48.715  162.607 1.00 45.01  ? 89   PHE B CA  1 
ATOM   2816 C  C   . PHE B 1 89  ? 42.679 -48.311  163.975 1.00 45.85  ? 89   PHE B C   1 
ATOM   2817 O  O   . PHE B 1 89  ? 43.830 -48.577  164.324 1.00 46.58  ? 89   PHE B O   1 
ATOM   2818 C  CB  . PHE B 1 89  ? 42.156 -47.479  161.711 1.00 39.02  ? 89   PHE B CB  1 
ATOM   2819 C  CG  . PHE B 1 89  ? 43.486 -46.785  161.657 1.00 33.72  ? 89   PHE B CG  1 
ATOM   2820 C  CD1 . PHE B 1 89  ? 44.609 -47.448  161.158 1.00 32.42  ? 89   PHE B CD1 1 
ATOM   2821 C  CD2 . PHE B 1 89  ? 43.637 -45.496  162.160 1.00 32.07  ? 89   PHE B CD2 1 
ATOM   2822 C  CE1 . PHE B 1 89  ? 45.873 -46.834  161.163 1.00 31.99  ? 89   PHE B CE1 1 
ATOM   2823 C  CE2 . PHE B 1 89  ? 44.891 -44.869  162.172 1.00 31.49  ? 89   PHE B CE2 1 
ATOM   2824 C  CZ  . PHE B 1 89  ? 46.012 -45.542  161.672 1.00 31.78  ? 89   PHE B CZ  1 
ATOM   2825 N  N   . SER B 1 90  ? 41.815 -47.644  164.734 1.00 46.06  ? 90   SER B N   1 
ATOM   2826 C  CA  . SER B 1 90  ? 42.140 -47.192  166.079 1.00 46.92  ? 90   SER B CA  1 
ATOM   2827 C  C   . SER B 1 90  ? 42.564 -48.413  166.899 1.00 48.60  ? 90   SER B C   1 
ATOM   2828 O  O   . SER B 1 90  ? 43.679 -48.468  167.420 1.00 48.71  ? 90   SER B O   1 
ATOM   2829 C  CB  . SER B 1 90  ? 40.909 -46.529  166.700 1.00 45.61  ? 90   SER B CB  1 
ATOM   2830 O  OG  . SER B 1 90  ? 41.105 -46.252  168.073 1.00 46.89  ? 90   SER B OG  1 
ATOM   2831 N  N   . VAL B 1 91  ? 41.666 -49.390  166.989 1.00 48.75  ? 91   VAL B N   1 
ATOM   2832 C  CA  . VAL B 1 91  ? 41.923 -50.623  167.713 1.00 49.90  ? 91   VAL B CA  1 
ATOM   2833 C  C   . VAL B 1 91  ? 43.273 -51.242  167.342 1.00 50.98  ? 91   VAL B C   1 
ATOM   2834 O  O   . VAL B 1 91  ? 43.966 -51.779  168.199 1.00 53.60  ? 91   VAL B O   1 
ATOM   2835 C  CB  . VAL B 1 91  ? 40.806 -51.665  167.447 1.00 49.57  ? 91   VAL B CB  1 
ATOM   2836 C  CG1 . VAL B 1 91  ? 41.268 -53.056  167.875 1.00 49.00  ? 91   VAL B CG1 1 
ATOM   2837 C  CG2 . VAL B 1 91  ? 39.549 -51.280  168.210 1.00 49.24  ? 91   VAL B CG2 1 
ATOM   2838 N  N   . GLN B 1 92  ? 43.642 -51.167  166.069 1.00 50.46  ? 92   GLN B N   1 
ATOM   2839 C  CA  . GLN B 1 92  ? 44.902 -51.733  165.600 1.00 49.86  ? 92   GLN B CA  1 
ATOM   2840 C  C   . GLN B 1 92  ? 46.091 -50.856  165.932 1.00 49.76  ? 92   GLN B C   1 
ATOM   2841 O  O   . GLN B 1 92  ? 47.238 -51.282  165.827 1.00 50.60  ? 92   GLN B O   1 
ATOM   2842 C  CB  . GLN B 1 92  ? 44.846 -51.944  164.095 1.00 50.83  ? 92   GLN B CB  1 
ATOM   2843 C  CG  . GLN B 1 92  ? 44.008 -53.128  163.681 1.00 53.97  ? 92   GLN B CG  1 
ATOM   2844 C  CD  . GLN B 1 92  ? 43.801 -53.203  162.186 1.00 53.90  ? 92   GLN B CD  1 
ATOM   2845 O  OE1 . GLN B 1 92  ? 44.738 -53.023  161.401 1.00 55.19  ? 92   GLN B OE1 1 
ATOM   2846 N  NE2 . GLN B 1 92  ? 42.570 -53.484  161.782 1.00 52.77  ? 92   GLN B NE2 1 
ATOM   2847 N  N   . THR B 1 93  ? 45.811 -49.621  166.317 1.00 48.31  ? 93   THR B N   1 
ATOM   2848 C  CA  . THR B 1 93  ? 46.851 -48.674  166.670 1.00 47.15  ? 93   THR B CA  1 
ATOM   2849 C  C   . THR B 1 93  ? 47.076 -48.742  168.182 1.00 46.38  ? 93   THR B C   1 
ATOM   2850 O  O   . THR B 1 93  ? 48.198 -48.934  168.662 1.00 43.79  ? 93   THR B O   1 
ATOM   2851 C  CB  . THR B 1 93  ? 46.422 -47.238  166.279 1.00 49.26  ? 93   THR B CB  1 
ATOM   2852 O  OG1 . THR B 1 93  ? 46.249 -47.163  164.858 1.00 50.60  ? 93   THR B OG1 1 
ATOM   2853 C  CG2 . THR B 1 93  ? 47.465 -46.216  166.719 1.00 48.87  ? 93   THR B CG2 1 
ATOM   2854 N  N   . MET B 1 94  ? 45.987 -48.598  168.926 1.00 45.07  ? 94   MET B N   1 
ATOM   2855 C  CA  . MET B 1 94  ? 46.049 -48.617  170.374 1.00 44.21  ? 94   MET B CA  1 
ATOM   2856 C  C   . MET B 1 94  ? 46.642 -49.920  170.902 1.00 41.84  ? 94   MET B C   1 
ATOM   2857 O  O   . MET B 1 94  ? 47.535 -49.890  171.745 1.00 41.18  ? 94   MET B O   1 
ATOM   2858 C  CB  . MET B 1 94  ? 44.653 -48.391  170.950 1.00 46.14  ? 94   MET B CB  1 
ATOM   2859 C  CG  . MET B 1 94  ? 44.646 -47.971  172.406 1.00 47.75  ? 94   MET B CG  1 
ATOM   2860 S  SD  . MET B 1 94  ? 42.970 -47.640  172.947 1.00 51.35  ? 94   MET B SD  1 
ATOM   2861 C  CE  . MET B 1 94  ? 42.441 -49.272  173.233 1.00 50.21  ? 94   MET B CE  1 
ATOM   2862 N  N   . ALA B 1 95  ? 46.149 -51.055  170.409 1.00 38.58  ? 95   ALA B N   1 
ATOM   2863 C  CA  . ALA B 1 95  ? 46.658 -52.355  170.836 1.00 35.64  ? 95   ALA B CA  1 
ATOM   2864 C  C   . ALA B 1 95  ? 48.039 -52.585  170.234 1.00 36.38  ? 95   ALA B C   1 
ATOM   2865 O  O   . ALA B 1 95  ? 48.714 -53.559  170.547 1.00 36.49  ? 95   ALA B O   1 
ATOM   2866 C  CB  . ALA B 1 95  ? 45.716 -53.455  170.391 1.00 30.98  ? 95   ALA B CB  1 
ATOM   2867 N  N   . THR B 1 96  ? 48.443 -51.671  169.361 1.00 37.23  ? 96   THR B N   1 
ATOM   2868 C  CA  . THR B 1 96  ? 49.725 -51.738  168.674 1.00 38.62  ? 96   THR B CA  1 
ATOM   2869 C  C   . THR B 1 96  ? 49.857 -52.965  167.759 1.00 40.31  ? 96   THR B C   1 
ATOM   2870 O  O   . THR B 1 96  ? 50.958 -53.444  167.527 1.00 40.53  ? 96   THR B O   1 
ATOM   2871 C  CB  . THR B 1 96  ? 50.929 -51.735  169.671 1.00 36.83  ? 96   THR B CB  1 
ATOM   2872 O  OG1 . THR B 1 96  ? 51.166 -53.062  170.147 1.00 36.54  ? 96   THR B OG1 1 
ATOM   2873 C  CG2 . THR B 1 96  ? 50.657 -50.823  170.838 1.00 34.08  ? 96   THR B CG2 1 
ATOM   2874 N  N   . ILE B 1 97  ? 48.748 -53.483  167.244 1.00 41.80  ? 97   ILE B N   1 
ATOM   2875 C  CA  . ILE B 1 97  ? 48.829 -54.629  166.341 1.00 44.09  ? 97   ILE B CA  1 
ATOM   2876 C  C   . ILE B 1 97  ? 49.444 -54.162  165.015 1.00 46.60  ? 97   ILE B C   1 
ATOM   2877 O  O   . ILE B 1 97  ? 50.263 -54.860  164.410 1.00 46.56  ? 97   ILE B O   1 
ATOM   2878 C  CB  . ILE B 1 97  ? 47.449 -55.223  166.071 1.00 44.19  ? 97   ILE B CB  1 
ATOM   2879 C  CG1 . ILE B 1 97  ? 46.865 -55.776  167.372 1.00 43.84  ? 97   ILE B CG1 1 
ATOM   2880 C  CG2 . ILE B 1 97  ? 47.560 -56.322  165.024 1.00 43.76  ? 97   ILE B CG2 1 
ATOM   2881 C  CD1 . ILE B 1 97  ? 45.422 -56.199  167.282 1.00 42.68  ? 97   ILE B CD1 1 
ATOM   2882 N  N   . GLY B 1 98  ? 49.037 -52.969  164.587 1.00 47.39  ? 98   GLY B N   1 
ATOM   2883 C  CA  . GLY B 1 98  ? 49.551 -52.364  163.370 1.00 50.01  ? 98   GLY B CA  1 
ATOM   2884 C  C   . GLY B 1 98  ? 49.712 -53.255  162.154 1.00 52.13  ? 98   GLY B C   1 
ATOM   2885 O  O   . GLY B 1 98  ? 50.822 -53.404  161.635 1.00 51.15  ? 98   GLY B O   1 
ATOM   2886 N  N   . TYR B 1 99  ? 48.611 -53.831  161.681 1.00 53.47  ? 99   TYR B N   1 
ATOM   2887 C  CA  . TYR B 1 99  ? 48.661 -54.702  160.515 1.00 55.42  ? 99   TYR B CA  1 
ATOM   2888 C  C   . TYR B 1 99  ? 49.436 -54.036  159.370 1.00 57.92  ? 99   TYR B C   1 
ATOM   2889 O  O   . TYR B 1 99  ? 50.476 -54.541  158.920 1.00 57.02  ? 99   TYR B O   1 
ATOM   2890 C  CB  . TYR B 1 99  ? 47.240 -55.060  160.092 1.00 54.07  ? 99   TYR B CB  1 
ATOM   2891 C  CG  . TYR B 1 99  ? 46.621 -56.127  160.971 1.00 51.70  ? 99   TYR B CG  1 
ATOM   2892 C  CD1 . TYR B 1 99  ? 45.379 -55.937  161.582 1.00 49.37  ? 99   TYR B CD1 1 
ATOM   2893 C  CD2 . TYR B 1 99  ? 47.296 -57.332  161.206 1.00 50.12  ? 99   TYR B CD2 1 
ATOM   2894 C  CE1 . TYR B 1 99  ? 44.832 -56.920  162.406 1.00 49.10  ? 99   TYR B CE1 1 
ATOM   2895 C  CE2 . TYR B 1 99  ? 46.758 -58.309  162.018 1.00 48.38  ? 99   TYR B CE2 1 
ATOM   2896 C  CZ  . TYR B 1 99  ? 45.531 -58.094  162.614 1.00 48.17  ? 99   TYR B CZ  1 
ATOM   2897 O  OH  . TYR B 1 99  ? 44.993 -59.044  163.435 1.00 50.89  ? 99   TYR B OH  1 
ATOM   2898 N  N   . GLY B 1 100 ? 48.965 -52.882  158.923 1.00 59.85  ? 100  GLY B N   1 
ATOM   2899 C  CA  . GLY B 1 100 ? 49.686 -52.203  157.874 1.00 64.23  ? 100  GLY B CA  1 
ATOM   2900 C  C   . GLY B 1 100 ? 48.881 -51.819  156.657 1.00 67.29  ? 100  GLY B C   1 
ATOM   2901 O  O   . GLY B 1 100 ? 49.388 -51.098  155.809 1.00 68.11  ? 100  GLY B O   1 
ATOM   2902 N  N   . LYS B 1 101 ? 47.647 -52.301  156.565 1.00 69.95  ? 101  LYS B N   1 
ATOM   2903 C  CA  . LYS B 1 101 ? 46.782 -51.985  155.446 1.00 71.74  ? 101  LYS B CA  1 
ATOM   2904 C  C   . LYS B 1 101 ? 46.128 -50.632  155.719 1.00 71.42  ? 101  LYS B C   1 
ATOM   2905 O  O   . LYS B 1 101 ? 45.931 -49.830  154.814 1.00 72.53  ? 101  LYS B O   1 
ATOM   2906 C  CB  . LYS B 1 101 ? 45.720 -53.073  155.299 1.00 74.03  ? 101  LYS B CB  1 
ATOM   2907 C  CG  . LYS B 1 101 ? 44.685 -52.768  154.250 1.00 79.09  ? 101  LYS B CG  1 
ATOM   2908 C  CD  . LYS B 1 101 ? 43.623 -53.851  154.211 1.00 82.32  ? 101  LYS B CD  1 
ATOM   2909 C  CE  . LYS B 1 101 ? 42.299 -53.317  153.660 1.00 84.62  ? 101  LYS B CE  1 
ATOM   2910 N  NZ  . LYS B 1 101 ? 41.213 -54.346  153.718 1.00 86.76  ? 101  LYS B NZ  1 
ATOM   2911 N  N   . LEU B 1 102 ? 45.832 -50.361  156.983 1.00 71.14  ? 102  LEU B N   1 
ATOM   2912 C  CA  . LEU B 1 102 ? 45.181 -49.112  157.336 1.00 70.69  ? 102  LEU B CA  1 
ATOM   2913 C  C   . LEU B 1 102 ? 46.057 -47.947  157.789 1.00 72.18  ? 102  LEU B C   1 
ATOM   2914 O  O   . LEU B 1 102 ? 45.552 -47.008  158.394 1.00 75.18  ? 102  LEU B O   1 
ATOM   2915 C  CB  . LEU B 1 102 ? 44.116 -49.389  158.393 1.00 69.03  ? 102  LEU B CB  1 
ATOM   2916 C  CG  . LEU B 1 102 ? 42.916 -50.201  157.904 1.00 68.73  ? 102  LEU B CG  1 
ATOM   2917 C  CD1 . LEU B 1 102 ? 42.058 -50.636  159.070 1.00 68.45  ? 102  LEU B CD1 1 
ATOM   2918 C  CD2 . LEU B 1 102 ? 42.103 -49.355  156.948 1.00 69.05  ? 102  LEU B CD2 1 
ATOM   2919 N  N   . ILE B 1 103 ? 47.348 -47.978  157.481 1.00 72.63  ? 103  ILE B N   1 
ATOM   2920 C  CA  . ILE B 1 103 ? 48.262 -46.898  157.881 1.00 72.89  ? 103  ILE B CA  1 
ATOM   2921 C  C   . ILE B 1 103 ? 47.658 -45.483  157.937 1.00 71.99  ? 103  ILE B C   1 
ATOM   2922 O  O   . ILE B 1 103 ? 46.619 -45.212  157.342 1.00 71.11  ? 103  ILE B O   1 
ATOM   2923 C  CB  . ILE B 1 103 ? 49.483 -46.835  156.950 1.00 73.99  ? 103  ILE B CB  1 
ATOM   2924 C  CG1 . ILE B 1 103 ? 49.027 -46.535  155.518 1.00 74.75  ? 103  ILE B CG1 1 
ATOM   2925 C  CG2 . ILE B 1 103 ? 50.258 -48.142  157.026 1.00 74.11  ? 103  ILE B CG2 1 
ATOM   2926 C  CD1 . ILE B 1 103 ? 50.166 -46.261  154.557 1.00 74.93  ? 103  ILE B CD1 1 
ATOM   2927 N  N   . PRO B 1 104 ? 48.320 -44.560  158.659 1.00 72.14  ? 104  PRO B N   1 
ATOM   2928 C  CA  . PRO B 1 104 ? 47.879 -43.168  158.813 1.00 72.85  ? 104  PRO B CA  1 
ATOM   2929 C  C   . PRO B 1 104 ? 48.324 -42.305  157.635 1.00 74.34  ? 104  PRO B C   1 
ATOM   2930 O  O   . PRO B 1 104 ? 49.162 -42.724  156.835 1.00 73.90  ? 104  PRO B O   1 
ATOM   2931 C  CB  . PRO B 1 104 ? 48.566 -42.717  160.105 1.00 72.14  ? 104  PRO B CB  1 
ATOM   2932 C  CG  . PRO B 1 104 ? 49.109 -43.985  160.721 1.00 72.02  ? 104  PRO B CG  1 
ATOM   2933 C  CD  . PRO B 1 104 ? 49.458 -44.828  159.548 1.00 71.33  ? 104  PRO B CD  1 
ATOM   2934 N  N   . ILE B 1 105 ? 47.784 -41.091  157.554 1.00 75.04  ? 105  ILE B N   1 
ATOM   2935 C  CA  . ILE B 1 105 ? 48.123 -40.168  156.476 1.00 76.49  ? 105  ILE B CA  1 
ATOM   2936 C  C   . ILE B 1 105 ? 48.131 -38.706  156.911 1.00 76.56  ? 105  ILE B C   1 
ATOM   2937 O  O   . ILE B 1 105 ? 47.122 -38.188  157.385 1.00 76.50  ? 105  ILE B O   1 
ATOM   2938 C  CB  . ILE B 1 105 ? 47.135 -40.320  155.291 1.00 78.67  ? 105  ILE B CB  1 
ATOM   2939 C  CG1 . ILE B 1 105 ? 47.380 -41.651  154.586 1.00 80.30  ? 105  ILE B CG1 1 
ATOM   2940 C  CG2 . ILE B 1 105 ? 47.305 -39.172  154.299 1.00 79.25  ? 105  ILE B CG2 1 
ATOM   2941 C  CD1 . ILE B 1 105 ? 48.795 -41.799  154.035 1.00 81.80  ? 105  ILE B CD1 1 
ATOM   2942 N  N   . GLY B 1 106 ? 49.274 -38.047  156.742 1.00 76.32  ? 106  GLY B N   1 
ATOM   2943 C  CA  . GLY B 1 106 ? 49.381 -36.644  157.098 1.00 77.03  ? 106  GLY B CA  1 
ATOM   2944 C  C   . GLY B 1 106 ? 49.427 -36.354  158.583 1.00 77.58  ? 106  GLY B C   1 
ATOM   2945 O  O   . GLY B 1 106 ? 48.756 -37.019  159.363 1.00 78.82  ? 106  GLY B O   1 
ATOM   2946 N  N   . PRO B 1 107 ? 50.205 -35.344  159.002 1.00 77.44  ? 107  PRO B N   1 
ATOM   2947 C  CA  . PRO B 1 107 ? 50.375 -34.923  160.392 1.00 76.43  ? 107  PRO B CA  1 
ATOM   2948 C  C   . PRO B 1 107 ? 49.182 -35.137  161.317 1.00 74.68  ? 107  PRO B C   1 
ATOM   2949 O  O   . PRO B 1 107 ? 49.359 -35.495  162.479 1.00 75.22  ? 107  PRO B O   1 
ATOM   2950 C  CB  . PRO B 1 107 ? 50.750 -33.457  160.246 1.00 76.98  ? 107  PRO B CB  1 
ATOM   2951 C  CG  . PRO B 1 107 ? 51.654 -33.505  159.069 1.00 77.56  ? 107  PRO B CG  1 
ATOM   2952 C  CD  . PRO B 1 107 ? 50.885 -34.396  158.100 1.00 77.92  ? 107  PRO B CD  1 
ATOM   2953 N  N   . LEU B 1 108 ? 47.972 -34.921  160.818 1.00 72.96  ? 108  LEU B N   1 
ATOM   2954 C  CA  . LEU B 1 108 ? 46.791 -35.105  161.653 1.00 72.46  ? 108  LEU B CA  1 
ATOM   2955 C  C   . LEU B 1 108 ? 46.677 -36.528  162.183 1.00 70.76  ? 108  LEU B C   1 
ATOM   2956 O  O   . LEU B 1 108 ? 46.591 -36.744  163.390 1.00 70.73  ? 108  LEU B O   1 
ATOM   2957 C  CB  . LEU B 1 108 ? 45.523 -34.745  160.881 1.00 73.41  ? 108  LEU B CB  1 
ATOM   2958 C  CG  . LEU B 1 108 ? 45.415 -33.282  160.445 1.00 75.23  ? 108  LEU B CG  1 
ATOM   2959 C  CD1 . LEU B 1 108 ? 44.091 -33.077  159.717 1.00 75.40  ? 108  LEU B CD1 1 
ATOM   2960 C  CD2 . LEU B 1 108 ? 45.518 -32.360  161.660 1.00 73.53  ? 108  LEU B CD2 1 
ATOM   2961 N  N   . ALA B 1 109 ? 46.681 -37.500  161.281 1.00 69.00  ? 109  ALA B N   1 
ATOM   2962 C  CA  . ALA B 1 109 ? 46.568 -38.898  161.675 1.00 68.23  ? 109  ALA B CA  1 
ATOM   2963 C  C   . ALA B 1 109 ? 47.779 -39.395  162.476 1.00 67.56  ? 109  ALA B C   1 
ATOM   2964 O  O   . ALA B 1 109 ? 47.620 -40.093  163.478 1.00 67.91  ? 109  ALA B O   1 
ATOM   2965 C  CB  . ALA B 1 109 ? 46.362 -39.771  160.435 1.00 66.49  ? 109  ALA B CB  1 
ATOM   2966 N  N   . ASN B 1 110 ? 48.980 -39.034  162.035 1.00 65.27  ? 110  ASN B N   1 
ATOM   2967 C  CA  . ASN B 1 110 ? 50.207 -39.450  162.703 1.00 63.52  ? 110  ASN B CA  1 
ATOM   2968 C  C   . ASN B 1 110 ? 50.377 -38.865  164.098 1.00 63.58  ? 110  ASN B C   1 
ATOM   2969 O  O   . ASN B 1 110 ? 51.189 -39.355  164.885 1.00 63.40  ? 110  ASN B O   1 
ATOM   2970 C  CB  . ASN B 1 110 ? 51.414 -39.075  161.852 1.00 61.87  ? 110  ASN B CB  1 
ATOM   2971 C  CG  . ASN B 1 110 ? 51.650 -40.039  160.718 1.00 61.32  ? 110  ASN B CG  1 
ATOM   2972 O  OD1 . ASN B 1 110 ? 52.268 -41.091  160.894 1.00 58.79  ? 110  ASN B OD1 1 
ATOM   2973 N  ND2 . ASN B 1 110 ? 51.149 -39.691  159.539 1.00 62.12  ? 110  ASN B ND2 1 
ATOM   2974 N  N   . THR B 1 111 ? 49.627 -37.810  164.402 1.00 63.09  ? 111  THR B N   1 
ATOM   2975 C  CA  . THR B 1 111 ? 49.708 -37.184  165.719 1.00 62.30  ? 111  THR B CA  1 
ATOM   2976 C  C   . THR B 1 111 ? 48.689 -37.831  166.650 1.00 61.39  ? 111  THR B C   1 
ATOM   2977 O  O   . THR B 1 111 ? 48.929 -37.974  167.850 1.00 61.54  ? 111  THR B O   1 
ATOM   2978 C  CB  . THR B 1 111 ? 49.451 -35.663  165.640 1.00 61.74  ? 111  THR B CB  1 
ATOM   2979 O  OG1 . THR B 1 111 ? 50.544 -35.040  164.952 1.00 61.02  ? 111  THR B OG1 1 
ATOM   2980 C  CG2 . THR B 1 111 ? 49.330 -35.061  167.036 1.00 60.66  ? 111  THR B CG2 1 
ATOM   2981 N  N   . LEU B 1 112 ? 47.550 -38.221  166.089 1.00 59.99  ? 112  LEU B N   1 
ATOM   2982 C  CA  . LEU B 1 112 ? 46.519 -38.885  166.866 1.00 59.53  ? 112  LEU B CA  1 
ATOM   2983 C  C   . LEU B 1 112 ? 47.037 -40.283  167.207 1.00 59.10  ? 112  LEU B C   1 
ATOM   2984 O  O   . LEU B 1 112 ? 46.715 -40.840  168.257 1.00 59.64  ? 112  LEU B O   1 
ATOM   2985 C  CB  . LEU B 1 112 ? 45.217 -38.965  166.062 1.00 59.06  ? 112  LEU B CB  1 
ATOM   2986 C  CG  . LEU B 1 112 ? 44.134 -37.940  166.414 1.00 58.62  ? 112  LEU B CG  1 
ATOM   2987 C  CD1 . LEU B 1 112 ? 44.730 -36.551  166.511 1.00 60.35  ? 112  LEU B CD1 1 
ATOM   2988 C  CD2 . LEU B 1 112 ? 43.047 -37.980  165.365 1.00 58.96  ? 112  LEU B CD2 1 
ATOM   2989 N  N   . VAL B 1 113 ? 47.854 -40.835  166.312 1.00 57.20  ? 113  VAL B N   1 
ATOM   2990 C  CA  . VAL B 1 113 ? 48.449 -42.151  166.509 1.00 54.53  ? 113  VAL B CA  1 
ATOM   2991 C  C   . VAL B 1 113 ? 49.448 -42.094  167.659 1.00 53.96  ? 113  VAL B C   1 
ATOM   2992 O  O   . VAL B 1 113 ? 49.496 -42.993  168.499 1.00 53.44  ? 113  VAL B O   1 
ATOM   2993 C  CB  . VAL B 1 113 ? 49.181 -42.635  165.238 1.00 54.24  ? 113  VAL B CB  1 
ATOM   2994 C  CG1 . VAL B 1 113 ? 50.151 -43.765  165.584 1.00 54.55  ? 113  VAL B CG1 1 
ATOM   2995 C  CG2 . VAL B 1 113 ? 48.169 -43.121  164.213 1.00 53.34  ? 113  VAL B CG2 1 
ATOM   2996 N  N   . THR B 1 114 ? 50.257 -41.042  167.684 1.00 52.33  ? 114  THR B N   1 
ATOM   2997 C  CA  . THR B 1 114 ? 51.242 -40.878  168.742 1.00 51.63  ? 114  THR B CA  1 
ATOM   2998 C  C   . THR B 1 114 ? 50.504 -40.783  170.074 1.00 51.82  ? 114  THR B C   1 
ATOM   2999 O  O   . THR B 1 114 ? 50.929 -41.360  171.076 1.00 51.47  ? 114  THR B O   1 
ATOM   3000 C  CB  . THR B 1 114 ? 52.087 -39.607  168.515 1.00 50.68  ? 114  THR B CB  1 
ATOM   3001 O  OG1 . THR B 1 114 ? 52.959 -39.812  167.399 1.00 48.96  ? 114  THR B OG1 1 
ATOM   3002 C  CG2 . THR B 1 114 ? 52.923 -39.282  169.744 1.00 50.54  ? 114  THR B CG2 1 
ATOM   3003 N  N   . LEU B 1 115 ? 49.388 -40.063  170.062 1.00 51.55  ? 115  LEU B N   1 
ATOM   3004 C  CA  . LEU B 1 115 ? 48.559 -39.876  171.247 1.00 51.91  ? 115  LEU B CA  1 
ATOM   3005 C  C   . LEU B 1 115 ? 47.946 -41.214  171.668 1.00 51.28  ? 115  LEU B C   1 
ATOM   3006 O  O   . LEU B 1 115 ? 48.039 -41.626  172.823 1.00 51.04  ? 115  LEU B O   1 
ATOM   3007 C  CB  . LEU B 1 115 ? 47.428 -38.889  170.937 1.00 52.83  ? 115  LEU B CB  1 
ATOM   3008 C  CG  . LEU B 1 115 ? 46.970 -37.920  172.028 1.00 55.21  ? 115  LEU B CG  1 
ATOM   3009 C  CD1 . LEU B 1 115 ? 47.850 -36.665  171.972 1.00 55.42  ? 115  LEU B CD1 1 
ATOM   3010 C  CD2 . LEU B 1 115 ? 45.509 -37.533  171.812 1.00 54.17  ? 115  LEU B CD2 1 
ATOM   3011 N  N   . GLU B 1 116 ? 47.315 -41.885  170.713 1.00 49.73  ? 116  GLU B N   1 
ATOM   3012 C  CA  . GLU B 1 116 ? 46.664 -43.159  170.966 1.00 48.99  ? 116  GLU B CA  1 
ATOM   3013 C  C   . GLU B 1 116 ? 47.658 -44.248  171.376 1.00 49.55  ? 116  GLU B C   1 
ATOM   3014 O  O   . GLU B 1 116 ? 47.293 -45.220  172.042 1.00 49.07  ? 116  GLU B O   1 
ATOM   3015 C  CB  . GLU B 1 116 ? 45.873 -43.577  169.725 1.00 47.27  ? 116  GLU B CB  1 
ATOM   3016 C  CG  . GLU B 1 116 ? 45.136 -44.875  169.887 1.00 50.42  ? 116  GLU B CG  1 
ATOM   3017 C  CD  . GLU B 1 116 ? 44.077 -45.095  168.826 1.00 51.11  ? 116  GLU B CD  1 
ATOM   3018 O  OE1 . GLU B 1 116 ? 44.316 -44.743  167.654 1.00 51.68  ? 116  GLU B OE1 1 
ATOM   3019 O  OE2 . GLU B 1 116 ? 43.008 -45.639  169.168 1.00 51.57  ? 116  GLU B OE2 1 
ATOM   3020 N  N   . ALA B 1 117 ? 48.917 -44.082  170.991 1.00 49.43  ? 117  ALA B N   1 
ATOM   3021 C  CA  . ALA B 1 117 ? 49.940 -45.053  171.354 1.00 48.88  ? 117  ALA B CA  1 
ATOM   3022 C  C   . ALA B 1 117 ? 50.176 -44.918  172.857 1.00 48.98  ? 117  ALA B C   1 
ATOM   3023 O  O   . ALA B 1 117 ? 50.229 -45.907  173.587 1.00 48.68  ? 117  ALA B O   1 
ATOM   3024 C  CB  . ALA B 1 117 ? 51.229 -44.774  170.590 1.00 48.23  ? 117  ALA B CB  1 
ATOM   3025 N  N   . LEU B 1 118 ? 50.311 -43.678  173.308 1.00 48.35  ? 118  LEU B N   1 
ATOM   3026 C  CA  . LEU B 1 118 ? 50.538 -43.391  174.714 1.00 48.51  ? 118  LEU B CA  1 
ATOM   3027 C  C   . LEU B 1 118 ? 49.370 -43.908  175.557 1.00 49.61  ? 118  LEU B C   1 
ATOM   3028 O  O   . LEU B 1 118 ? 49.580 -44.559  176.578 1.00 50.83  ? 118  LEU B O   1 
ATOM   3029 C  CB  . LEU B 1 118 ? 50.702 -41.884  174.914 1.00 46.59  ? 118  LEU B CB  1 
ATOM   3030 C  CG  . LEU B 1 118 ? 51.209 -41.427  176.277 1.00 46.30  ? 118  LEU B CG  1 
ATOM   3031 C  CD1 . LEU B 1 118 ? 52.552 -42.075  176.573 1.00 45.49  ? 118  LEU B CD1 1 
ATOM   3032 C  CD2 . LEU B 1 118 ? 51.331 -39.918  176.290 1.00 46.22  ? 118  LEU B CD2 1 
ATOM   3033 N  N   . CYS B 1 119 ? 48.145 -43.627  175.119 1.00 49.11  ? 119  CYS B N   1 
ATOM   3034 C  CA  . CYS B 1 119 ? 46.952 -44.064  175.837 1.00 50.08  ? 119  CYS B CA  1 
ATOM   3035 C  C   . CYS B 1 119 ? 46.908 -45.565  176.065 1.00 49.91  ? 119  CYS B C   1 
ATOM   3036 O  O   . CYS B 1 119 ? 46.735 -46.020  177.187 1.00 50.60  ? 119  CYS B O   1 
ATOM   3037 C  CB  . CYS B 1 119 ? 45.691 -43.636  175.085 1.00 51.54  ? 119  CYS B CB  1 
ATOM   3038 S  SG  . CYS B 1 119 ? 45.480 -41.855  175.013 1.00 57.25  ? 119  CYS B SG  1 
ATOM   3039 N  N   . GLY B 1 120 ? 47.051 -46.337  174.997 1.00 49.98  ? 120  GLY B N   1 
ATOM   3040 C  CA  . GLY B 1 120 ? 47.022 -47.777  175.143 1.00 48.71  ? 120  GLY B CA  1 
ATOM   3041 C  C   . GLY B 1 120 ? 48.043 -48.246  176.161 1.00 48.69  ? 120  GLY B C   1 
ATOM   3042 O  O   . GLY B 1 120 ? 47.806 -49.204  176.894 1.00 48.35  ? 120  GLY B O   1 
ATOM   3043 N  N   . MET B 1 121 ? 49.185 -47.569  176.204 1.00 48.22  ? 121  MET B N   1 
ATOM   3044 C  CA  . MET B 1 121 ? 50.240 -47.923  177.139 1.00 49.57  ? 121  MET B CA  1 
ATOM   3045 C  C   . MET B 1 121 ? 49.783 -47.590  178.561 1.00 48.12  ? 121  MET B C   1 
ATOM   3046 O  O   . MET B 1 121 ? 49.924 -48.399  179.476 1.00 47.19  ? 121  MET B O   1 
ATOM   3047 C  CB  . MET B 1 121 ? 51.530 -47.157  176.800 1.00 52.71  ? 121  MET B CB  1 
ATOM   3048 C  CG  . MET B 1 121 ? 52.695 -47.439  177.747 1.00 59.09  ? 121  MET B CG  1 
ATOM   3049 S  SD  . MET B 1 121 ? 53.325 -45.980  178.645 1.00 68.15  ? 121  MET B SD  1 
ATOM   3050 C  CE  . MET B 1 121 ? 52.215 -45.937  180.033 1.00 65.79  ? 121  MET B CE  1 
ATOM   3051 N  N   . LEU B 1 122 ? 49.233 -46.395  178.742 1.00 46.64  ? 122  LEU B N   1 
ATOM   3052 C  CA  . LEU B 1 122 ? 48.762 -45.980  180.048 1.00 45.60  ? 122  LEU B CA  1 
ATOM   3053 C  C   . LEU B 1 122 ? 47.587 -46.868  180.451 1.00 45.88  ? 122  LEU B C   1 
ATOM   3054 O  O   . LEU B 1 122 ? 47.499 -47.313  181.597 1.00 47.89  ? 122  LEU B O   1 
ATOM   3055 C  CB  . LEU B 1 122 ? 48.330 -44.519  180.008 1.00 45.17  ? 122  LEU B CB  1 
ATOM   3056 C  CG  . LEU B 1 122 ? 49.383 -43.468  179.639 1.00 45.34  ? 122  LEU B CG  1 
ATOM   3057 C  CD1 . LEU B 1 122 ? 48.683 -42.132  179.440 1.00 46.63  ? 122  LEU B CD1 1 
ATOM   3058 C  CD2 . LEU B 1 122 ? 50.437 -43.345  180.725 1.00 44.09  ? 122  LEU B CD2 1 
ATOM   3059 N  N   . GLY B 1 123 ? 46.697 -47.135  179.499 1.00 43.51  ? 123  GLY B N   1 
ATOM   3060 C  CA  . GLY B 1 123 ? 45.538 -47.969  179.764 1.00 42.10  ? 123  GLY B CA  1 
ATOM   3061 C  C   . GLY B 1 123 ? 45.933 -49.329  180.298 1.00 41.71  ? 123  GLY B C   1 
ATOM   3062 O  O   . GLY B 1 123 ? 45.364 -49.821  181.270 1.00 42.57  ? 123  GLY B O   1 
ATOM   3063 N  N   . LEU B 1 124 ? 46.913 -49.943  179.649 1.00 41.94  ? 124  LEU B N   1 
ATOM   3064 C  CA  . LEU B 1 124 ? 47.409 -51.246  180.060 1.00 41.02  ? 124  LEU B CA  1 
ATOM   3065 C  C   . LEU B 1 124 ? 48.028 -51.116  181.443 1.00 41.34  ? 124  LEU B C   1 
ATOM   3066 O  O   . LEU B 1 124 ? 47.775 -51.922  182.334 1.00 40.33  ? 124  LEU B O   1 
ATOM   3067 C  CB  . LEU B 1 124 ? 48.465 -51.734  179.069 1.00 39.65  ? 124  LEU B CB  1 
ATOM   3068 C  CG  . LEU B 1 124 ? 49.271 -52.964  179.474 1.00 40.94  ? 124  LEU B CG  1 
ATOM   3069 C  CD1 . LEU B 1 124 ? 48.326 -54.056  179.944 1.00 43.30  ? 124  LEU B CD1 1 
ATOM   3070 C  CD2 . LEU B 1 124 ? 50.103 -53.442  178.292 1.00 42.26  ? 124  LEU B CD2 1 
ATOM   3071 N  N   . ALA B 1 125 ? 48.846 -50.086  181.611 1.00 42.69  ? 125  ALA B N   1 
ATOM   3072 C  CA  . ALA B 1 125 ? 49.507 -49.845  182.879 1.00 43.16  ? 125  ALA B CA  1 
ATOM   3073 C  C   . ALA B 1 125 ? 48.444 -49.768  183.963 1.00 43.89  ? 125  ALA B C   1 
ATOM   3074 O  O   . ALA B 1 125 ? 48.572 -50.408  185.005 1.00 44.70  ? 125  ALA B O   1 
ATOM   3075 C  CB  . ALA B 1 125 ? 50.310 -48.550  182.813 1.00 42.40  ? 125  ALA B CB  1 
ATOM   3076 N  N   . VAL B 1 126 ? 47.390 -48.996  183.711 1.00 43.59  ? 126  VAL B N   1 
ATOM   3077 C  CA  . VAL B 1 126 ? 46.296 -48.858  184.670 1.00 44.91  ? 126  VAL B CA  1 
ATOM   3078 C  C   . VAL B 1 126 ? 45.545 -50.167  184.885 1.00 45.10  ? 126  VAL B C   1 
ATOM   3079 O  O   . VAL B 1 126 ? 45.401 -50.637  186.010 1.00 46.95  ? 126  VAL B O   1 
ATOM   3080 C  CB  . VAL B 1 126 ? 45.272 -47.807  184.217 1.00 46.28  ? 126  VAL B CB  1 
ATOM   3081 C  CG1 . VAL B 1 126 ? 43.978 -47.984  184.995 1.00 47.25  ? 126  VAL B CG1 1 
ATOM   3082 C  CG2 . VAL B 1 126 ? 45.830 -46.406  184.442 1.00 45.83  ? 126  VAL B CG2 1 
ATOM   3083 N  N   . ALA B 1 127 ? 45.059 -50.754  183.803 1.00 43.90  ? 127  ALA B N   1 
ATOM   3084 C  CA  . ALA B 1 127 ? 44.324 -52.000  183.911 1.00 42.01  ? 127  ALA B CA  1 
ATOM   3085 C  C   . ALA B 1 127 ? 45.123 -53.053  184.661 1.00 41.28  ? 127  ALA B C   1 
ATOM   3086 O  O   . ALA B 1 127 ? 44.552 -53.917  185.316 1.00 42.82  ? 127  ALA B O   1 
ATOM   3087 C  CB  . ALA B 1 127 ? 43.958 -52.504  182.535 1.00 42.27  ? 127  ALA B CB  1 
ATOM   3088 N  N   . ALA B 1 128 ? 46.444 -52.998  184.569 1.00 40.79  ? 128  ALA B N   1 
ATOM   3089 C  CA  . ALA B 1 128 ? 47.253 -53.982  185.274 1.00 41.37  ? 128  ALA B CA  1 
ATOM   3090 C  C   . ALA B 1 128 ? 47.323 -53.602  186.750 1.00 42.34  ? 128  ALA B C   1 
ATOM   3091 O  O   . ALA B 1 128 ? 47.317 -54.467  187.619 1.00 40.96  ? 128  ALA B O   1 
ATOM   3092 C  CB  . ALA B 1 128 ? 48.640 -54.050  184.675 1.00 40.37  ? 128  ALA B CB  1 
ATOM   3093 N  N   . SER B 1 129 ? 47.379 -52.302  187.026 1.00 43.54  ? 129  SER B N   1 
ATOM   3094 C  CA  . SER B 1 129 ? 47.421 -51.815  188.399 1.00 44.86  ? 129  SER B CA  1 
ATOM   3095 C  C   . SER B 1 129 ? 46.170 -52.276  189.119 1.00 44.93  ? 129  SER B C   1 
ATOM   3096 O  O   . SER B 1 129 ? 46.250 -52.918  190.160 1.00 45.84  ? 129  SER B O   1 
ATOM   3097 C  CB  . SER B 1 129 ? 47.489 -50.282  188.444 1.00 45.90  ? 129  SER B CB  1 
ATOM   3098 O  OG  . SER B 1 129 ? 48.804 -49.820  188.194 1.00 49.13  ? 129  SER B OG  1 
ATOM   3099 N  N   . LEU B 1 130 ? 45.012 -51.952  188.555 1.00 44.95  ? 130  LEU B N   1 
ATOM   3100 C  CA  . LEU B 1 130 ? 43.743 -52.334  189.154 1.00 45.10  ? 130  LEU B CA  1 
ATOM   3101 C  C   . LEU B 1 130 ? 43.614 -53.841  189.360 1.00 46.48  ? 130  LEU B C   1 
ATOM   3102 O  O   . LEU B 1 130 ? 43.120 -54.278  190.397 1.00 47.20  ? 130  LEU B O   1 
ATOM   3103 C  CB  . LEU B 1 130 ? 42.583 -51.831  188.296 1.00 43.63  ? 130  LEU B CB  1 
ATOM   3104 C  CG  . LEU B 1 130 ? 42.465 -50.313  188.166 1.00 42.37  ? 130  LEU B CG  1 
ATOM   3105 C  CD1 . LEU B 1 130 ? 41.406 -49.985  187.146 1.00 42.93  ? 130  LEU B CD1 1 
ATOM   3106 C  CD2 . LEU B 1 130 ? 42.121 -49.692  189.514 1.00 43.13  ? 130  LEU B CD2 1 
ATOM   3107 N  N   . ILE B 1 131 ? 44.054 -54.636  188.388 1.00 46.96  ? 131  ILE B N   1 
ATOM   3108 C  CA  . ILE B 1 131 ? 43.960 -56.088  188.516 1.00 47.60  ? 131  ILE B CA  1 
ATOM   3109 C  C   . ILE B 1 131 ? 44.839 -56.632  189.645 1.00 52.17  ? 131  ILE B C   1 
ATOM   3110 O  O   . ILE B 1 131 ? 44.399 -57.481  190.428 1.00 51.10  ? 131  ILE B O   1 
ATOM   3111 C  CB  . ILE B 1 131 ? 44.363 -56.793  187.222 1.00 44.54  ? 131  ILE B CB  1 
ATOM   3112 C  CG1 . ILE B 1 131 ? 43.321 -56.522  186.139 1.00 45.08  ? 131  ILE B CG1 1 
ATOM   3113 C  CG2 . ILE B 1 131 ? 44.517 -58.275  187.469 1.00 40.22  ? 131  ILE B CG2 1 
ATOM   3114 C  CD1 . ILE B 1 131 ? 43.625 -57.197  184.818 1.00 43.70  ? 131  ILE B CD1 1 
ATOM   3115 N  N   . TYR B 1 132 ? 46.083 -56.165  189.727 1.00 54.94  ? 132  TYR B N   1 
ATOM   3116 C  CA  . TYR B 1 132 ? 46.956 -56.643  190.787 1.00 56.57  ? 132  TYR B CA  1 
ATOM   3117 C  C   . TYR B 1 132 ? 46.434 -56.163  192.136 1.00 56.91  ? 132  TYR B C   1 
ATOM   3118 O  O   . TYR B 1 132 ? 46.603 -56.840  193.153 1.00 57.22  ? 132  TYR B O   1 
ATOM   3119 C  CB  . TYR B 1 132 ? 48.401 -56.160  190.613 1.00 57.24  ? 132  TYR B CB  1 
ATOM   3120 C  CG  . TYR B 1 132 ? 49.295 -56.739  191.694 1.00 59.61  ? 132  TYR B CG  1 
ATOM   3121 C  CD1 . TYR B 1 132 ? 49.633 -58.096  191.690 1.00 61.00  ? 132  TYR B CD1 1 
ATOM   3122 C  CD2 . TYR B 1 132 ? 49.691 -55.968  192.789 1.00 60.48  ? 132  TYR B CD2 1 
ATOM   3123 C  CE1 . TYR B 1 132 ? 50.330 -58.674  192.755 1.00 61.31  ? 132  TYR B CE1 1 
ATOM   3124 C  CE2 . TYR B 1 132 ? 50.389 -56.533  193.860 1.00 61.56  ? 132  TYR B CE2 1 
ATOM   3125 C  CZ  . TYR B 1 132 ? 50.699 -57.887  193.839 1.00 62.37  ? 132  TYR B CZ  1 
ATOM   3126 O  OH  . TYR B 1 132 ? 51.338 -58.462  194.915 1.00 62.48  ? 132  TYR B OH  1 
ATOM   3127 N  N   . ALA B 1 133 ? 45.805 -54.991  192.145 1.00 55.66  ? 133  ALA B N   1 
ATOM   3128 C  CA  . ALA B 1 133 ? 45.264 -54.440  193.376 1.00 55.85  ? 133  ALA B CA  1 
ATOM   3129 C  C   . ALA B 1 133 ? 44.156 -55.348  193.857 1.00 57.60  ? 133  ALA B C   1 
ATOM   3130 O  O   . ALA B 1 133 ? 44.216 -55.873  194.963 1.00 59.52  ? 133  ALA B O   1 
ATOM   3131 C  CB  . ALA B 1 133 ? 44.721 -53.041  193.145 1.00 54.75  ? 133  ALA B CB  1 
ATOM   3132 N  N   . ARG B 1 134 ? 43.145 -55.531  193.016 1.00 58.34  ? 134  ARG B N   1 
ATOM   3133 C  CA  . ARG B 1 134 ? 42.014 -56.376  193.353 1.00 59.11  ? 134  ARG B CA  1 
ATOM   3134 C  C   . ARG B 1 134 ? 42.481 -57.743  193.831 1.00 60.91  ? 134  ARG B C   1 
ATOM   3135 O  O   . ARG B 1 134 ? 41.817 -58.387  194.638 1.00 61.21  ? 134  ARG B O   1 
ATOM   3136 C  CB  . ARG B 1 134 ? 41.089 -56.504  192.143 1.00 58.03  ? 134  ARG B CB  1 
ATOM   3137 C  CG  . ARG B 1 134 ? 40.292 -55.229  191.846 1.00 56.95  ? 134  ARG B CG  1 
ATOM   3138 C  CD  . ARG B 1 134 ? 39.711 -55.230  190.428 1.00 56.58  ? 134  ARG B CD  1 
ATOM   3139 N  NE  . ARG B 1 134 ? 38.846 -56.380  190.168 1.00 55.97  ? 134  ARG B NE  1 
ATOM   3140 C  CZ  . ARG B 1 134 ? 37.596 -56.498  190.607 1.00 55.31  ? 134  ARG B CZ  1 
ATOM   3141 N  NH1 . ARG B 1 134 ? 37.041 -55.533  191.332 1.00 51.58  ? 134  ARG B NH1 1 
ATOM   3142 N  NH2 . ARG B 1 134 ? 36.904 -57.592  190.327 1.00 54.74  ? 134  ARG B NH2 1 
ATOM   3143 N  N   . PHE B 1 135 ? 43.634 -58.179  193.336 1.00 64.35  ? 135  PHE B N   1 
ATOM   3144 C  CA  . PHE B 1 135 ? 44.198 -59.464  193.734 1.00 67.68  ? 135  PHE B CA  1 
ATOM   3145 C  C   . PHE B 1 135 ? 44.733 -59.382  195.164 1.00 69.46  ? 135  PHE B C   1 
ATOM   3146 O  O   . PHE B 1 135 ? 44.767 -60.383  195.885 1.00 69.82  ? 135  PHE B O   1 
ATOM   3147 C  CB  . PHE B 1 135 ? 45.364 -59.865  192.821 1.00 69.36  ? 135  PHE B CB  1 
ATOM   3148 C  CG  . PHE B 1 135 ? 44.959 -60.592  191.566 1.00 70.62  ? 135  PHE B CG  1 
ATOM   3149 C  CD1 . PHE B 1 135 ? 43.892 -61.475  191.563 1.00 71.16  ? 135  PHE B CD1 1 
ATOM   3150 C  CD2 . PHE B 1 135 ? 45.704 -60.445  190.401 1.00 71.91  ? 135  PHE B CD2 1 
ATOM   3151 C  CE1 . PHE B 1 135 ? 43.571 -62.205  190.419 1.00 72.02  ? 135  PHE B CE1 1 
ATOM   3152 C  CE2 . PHE B 1 135 ? 45.394 -61.170  189.255 1.00 72.05  ? 135  PHE B CE2 1 
ATOM   3153 C  CZ  . PHE B 1 135 ? 44.326 -62.052  189.265 1.00 71.75  ? 135  PHE B CZ  1 
ATOM   3154 N  N   . THR B 1 136 ? 45.149 -58.186  195.570 1.00 70.80  ? 136  THR B N   1 
ATOM   3155 C  CA  . THR B 1 136 ? 45.721 -57.996  196.895 1.00 71.90  ? 136  THR B CA  1 
ATOM   3156 C  C   . THR B 1 136 ? 44.819 -57.398  197.980 1.00 72.89  ? 136  THR B C   1 
ATOM   3157 O  O   . THR B 1 136 ? 45.310 -56.819  198.952 1.00 73.70  ? 136  THR B O   1 
ATOM   3158 C  CB  . THR B 1 136 ? 47.030 -57.168  196.809 1.00 72.08  ? 136  THR B CB  1 
ATOM   3159 O  OG1 . THR B 1 136 ? 46.750 -55.855  196.303 1.00 72.55  ? 136  THR B OG1 1 
ATOM   3160 C  CG2 . THR B 1 136 ? 48.032 -57.868  195.898 1.00 69.72  ? 136  THR B CG2 1 
ATOM   3161 N  N   . ARG B 1 137 ? 43.507 -57.516  197.821 1.00 72.98  ? 137  ARG B N   1 
ATOM   3162 C  CA  . ARG B 1 137 ? 42.594 -57.040  198.852 1.00 73.35  ? 137  ARG B CA  1 
ATOM   3163 C  C   . ARG B 1 137 ? 41.606 -58.176  199.121 1.00 72.86  ? 137  ARG B C   1 
ATOM   3164 O  O   . ARG B 1 137 ? 40.390 -58.012  198.999 1.00 73.11  ? 137  ARG B O   1 
ATOM   3165 C  CB  . ARG B 1 137 ? 41.860 -55.766  198.417 1.00 74.99  ? 137  ARG B CB  1 
ATOM   3166 C  CG  . ARG B 1 137 ? 40.928 -55.902  197.230 1.00 78.78  ? 137  ARG B CG  1 
ATOM   3167 C  CD  . ARG B 1 137 ? 39.795 -54.886  197.345 1.00 81.60  ? 137  ARG B CD  1 
ATOM   3168 N  NE  . ARG B 1 137 ? 40.291 -53.536  197.604 1.00 84.73  ? 137  ARG B NE  1 
ATOM   3169 C  CZ  . ARG B 1 137 ? 39.532 -52.527  198.025 1.00 86.60  ? 137  ARG B CZ  1 
ATOM   3170 N  NH1 . ARG B 1 137 ? 38.234 -52.710  198.238 1.00 87.06  ? 137  ARG B NH1 1 
ATOM   3171 N  NH2 . ARG B 1 137 ? 40.072 -51.334  198.239 1.00 87.21  ? 137  ARG B NH2 1 
ATOM   3172 N  N   . PRO B 1 138 ? 42.132 -59.356  199.502 1.00 71.57  ? 138  PRO B N   1 
ATOM   3173 C  CA  . PRO B 1 138 ? 41.353 -60.562  199.794 1.00 70.23  ? 138  PRO B CA  1 
ATOM   3174 C  C   . PRO B 1 138 ? 40.506 -60.477  201.053 1.00 67.77  ? 138  PRO B C   1 
ATOM   3175 O  O   . PRO B 1 138 ? 40.786 -59.686  201.955 1.00 67.33  ? 138  PRO B O   1 
ATOM   3176 C  CB  . PRO B 1 138 ? 42.423 -61.647  199.920 1.00 70.94  ? 138  PRO B CB  1 
ATOM   3177 C  CG  . PRO B 1 138 ? 43.626 -61.064  199.223 1.00 71.96  ? 138  PRO B CG  1 
ATOM   3178 C  CD  . PRO B 1 138 ? 43.565 -59.641  199.655 1.00 71.75  ? 138  PRO B CD  1 
ATOM   3179 N  N   . THR B 1 139 ? 39.477 -61.317  201.098 1.00 64.40  ? 139  THR B N   1 
ATOM   3180 C  CA  . THR B 1 139 ? 38.570 -61.383  202.235 1.00 61.53  ? 139  THR B CA  1 
ATOM   3181 C  C   . THR B 1 139 ? 39.162 -62.304  203.291 1.00 57.40  ? 139  THR B C   1 
ATOM   3182 O  O   . THR B 1 139 ? 39.844 -63.272  202.965 1.00 57.62  ? 139  THR B O   1 
ATOM   3183 C  CB  . THR B 1 139 ? 37.205 -61.941  201.819 1.00 63.40  ? 139  THR B CB  1 
ATOM   3184 O  OG1 . THR B 1 139 ? 37.394 -63.176  201.115 1.00 63.32  ? 139  THR B OG1 1 
ATOM   3185 C  CG2 . THR B 1 139 ? 36.475 -60.951  200.922 1.00 65.03  ? 139  THR B CG2 1 
ATOM   3186 N  N   . ALA B 1 140 ? 38.892 -62.001  204.554 1.00 52.94  ? 140  ALA B N   1 
ATOM   3187 C  CA  . ALA B 1 140 ? 39.405 -62.800  205.655 1.00 49.17  ? 140  ALA B CA  1 
ATOM   3188 C  C   . ALA B 1 140 ? 38.956 -64.255  205.579 1.00 46.55  ? 140  ALA B C   1 
ATOM   3189 O  O   . ALA B 1 140 ? 39.697 -65.152  205.975 1.00 47.22  ? 140  ALA B O   1 
ATOM   3190 C  CB  . ALA B 1 140 ? 38.967 -62.194  206.981 1.00 48.06  ? 140  ALA B CB  1 
ATOM   3191 N  N   . GLY B 1 141 ? 37.751 -64.487  205.058 1.00 43.86  ? 141  GLY B N   1 
ATOM   3192 C  CA  . GLY B 1 141 ? 37.222 -65.841  204.974 1.00 39.23  ? 141  GLY B CA  1 
ATOM   3193 C  C   . GLY B 1 141 ? 37.023 -66.375  206.383 1.00 37.97  ? 141  GLY B C   1 
ATOM   3194 O  O   . GLY B 1 141 ? 37.425 -67.489  206.704 1.00 37.30  ? 141  GLY B O   1 
ATOM   3195 N  N   . VAL B 1 142 ? 36.412 -65.556  207.232 1.00 36.45  ? 142  VAL B N   1 
ATOM   3196 C  CA  . VAL B 1 142 ? 36.170 -65.911  208.619 1.00 35.77  ? 142  VAL B CA  1 
ATOM   3197 C  C   . VAL B 1 142 ? 34.686 -65.891  208.934 1.00 36.24  ? 142  VAL B C   1 
ATOM   3198 O  O   . VAL B 1 142 ? 33.986 -64.921  208.637 1.00 38.62  ? 142  VAL B O   1 
ATOM   3199 C  CB  . VAL B 1 142 ? 36.893 -64.938  209.574 1.00 35.03  ? 142  VAL B CB  1 
ATOM   3200 C  CG1 . VAL B 1 142 ? 36.438 -65.167  211.000 1.00 36.04  ? 142  VAL B CG1 1 
ATOM   3201 C  CG2 . VAL B 1 142 ? 38.385 -65.145  209.477 1.00 34.48  ? 142  VAL B CG2 1 
ATOM   3202 N  N   . LEU B 1 143 ? 34.209 -66.972  209.538 1.00 35.39  ? 143  LEU B N   1 
ATOM   3203 C  CA  . LEU B 1 143 ? 32.807 -67.083  209.890 1.00 33.10  ? 143  LEU B CA  1 
ATOM   3204 C  C   . LEU B 1 143 ? 32.614 -66.738  211.356 1.00 31.92  ? 143  LEU B C   1 
ATOM   3205 O  O   . LEU B 1 143 ? 33.343 -67.228  212.218 1.00 30.51  ? 143  LEU B O   1 
ATOM   3206 C  CB  . LEU B 1 143 ? 32.320 -68.511  209.629 1.00 35.17  ? 143  LEU B CB  1 
ATOM   3207 C  CG  . LEU B 1 143 ? 30.876 -68.827  210.032 1.00 36.67  ? 143  LEU B CG  1 
ATOM   3208 C  CD1 . LEU B 1 143 ? 29.892 -68.052  209.160 1.00 37.40  ? 143  LEU B CD1 1 
ATOM   3209 C  CD2 . LEU B 1 143 ? 30.643 -70.301  209.890 1.00 35.15  ? 143  LEU B CD2 1 
ATOM   3210 N  N   . PHE B 1 144 ? 31.639 -65.880  211.632 1.00 30.83  ? 144  PHE B N   1 
ATOM   3211 C  CA  . PHE B 1 144 ? 31.329 -65.491  212.997 1.00 30.08  ? 144  PHE B CA  1 
ATOM   3212 C  C   . PHE B 1 144 ? 30.038 -66.202  213.441 1.00 32.07  ? 144  PHE B C   1 
ATOM   3213 O  O   . PHE B 1 144 ? 29.069 -66.276  212.676 1.00 31.07  ? 144  PHE B O   1 
ATOM   3214 C  CB  . PHE B 1 144 ? 31.105 -63.982  213.092 1.00 30.55  ? 144  PHE B CB  1 
ATOM   3215 C  CG  . PHE B 1 144 ? 32.336 -63.157  212.847 1.00 31.36  ? 144  PHE B CG  1 
ATOM   3216 C  CD1 . PHE B 1 144 ? 32.723 -62.828  211.556 1.00 30.86  ? 144  PHE B CD1 1 
ATOM   3217 C  CD2 . PHE B 1 144 ? 33.098 -62.699  213.912 1.00 29.62  ? 144  PHE B CD2 1 
ATOM   3218 C  CE1 . PHE B 1 144 ? 33.853 -62.048  211.332 1.00 33.72  ? 144  PHE B CE1 1 
ATOM   3219 C  CE2 . PHE B 1 144 ? 34.231 -61.920  213.696 1.00 31.36  ? 144  PHE B CE2 1 
ATOM   3220 C  CZ  . PHE B 1 144 ? 34.610 -61.591  212.409 1.00 30.74  ? 144  PHE B CZ  1 
ATOM   3221 N  N   . SER B 1 145 ? 30.020 -66.724  214.666 1.00 30.20  ? 145  SER B N   1 
ATOM   3222 C  CA  . SER B 1 145 ? 28.820 -67.378  215.159 1.00 31.49  ? 145  SER B CA  1 
ATOM   3223 C  C   . SER B 1 145 ? 27.691 -66.332  215.085 1.00 30.34  ? 145  SER B C   1 
ATOM   3224 O  O   . SER B 1 145 ? 27.925 -65.149  215.262 1.00 28.53  ? 145  SER B O   1 
ATOM   3225 C  CB  . SER B 1 145 ? 29.031 -67.876  216.596 1.00 31.47  ? 145  SER B CB  1 
ATOM   3226 O  OG  . SER B 1 145 ? 29.127 -66.800  217.508 1.00 34.35  ? 145  SER B OG  1 
ATOM   3227 N  N   . SER B 1 146 ? 26.472 -66.769  214.806 1.00 30.85  ? 146  SER B N   1 
ATOM   3228 C  CA  . SER B 1 146 ? 25.363 -65.841  214.672 1.00 30.36  ? 146  SER B CA  1 
ATOM   3229 C  C   . SER B 1 146 ? 24.916 -65.245  215.983 1.00 31.09  ? 146  SER B C   1 
ATOM   3230 O  O   . SER B 1 146 ? 24.150 -64.280  215.996 1.00 33.85  ? 146  SER B O   1 
ATOM   3231 C  CB  . SER B 1 146 ? 24.174 -66.536  214.025 1.00 29.93  ? 146  SER B CB  1 
ATOM   3232 O  OG  . SER B 1 146 ? 23.698 -67.560  214.873 1.00 32.62  ? 146  SER B OG  1 
ATOM   3233 N  N   . ARG B 1 147 ? 25.387 -65.812  217.086 1.00 30.35  ? 147  ARG B N   1 
ATOM   3234 C  CA  . ARG B 1 147 ? 24.997 -65.324  218.401 1.00 29.99  ? 147  ARG B CA  1 
ATOM   3235 C  C   . ARG B 1 147 ? 26.154 -65.414  219.387 1.00 31.22  ? 147  ARG B C   1 
ATOM   3236 O  O   . ARG B 1 147 ? 27.203 -65.999  219.102 1.00 28.36  ? 147  ARG B O   1 
ATOM   3237 C  CB  . ARG B 1 147 ? 23.854 -66.180  218.968 1.00 33.94  ? 147  ARG B CB  1 
ATOM   3238 C  CG  . ARG B 1 147 ? 22.585 -66.237  218.153 1.00 33.79  ? 147  ARG B CG  1 
ATOM   3239 C  CD  . ARG B 1 147 ? 21.745 -65.016  218.395 1.00 34.40  ? 147  ARG B CD  1 
ATOM   3240 N  NE  . ARG B 1 147 ? 20.537 -65.053  217.579 1.00 42.75  ? 147  ARG B NE  1 
ATOM   3241 C  CZ  . ARG B 1 147 ? 20.522 -65.080  216.247 1.00 43.13  ? 147  ARG B CZ  1 
ATOM   3242 N  NH1 . ARG B 1 147 ? 21.655 -65.072  215.557 1.00 44.15  ? 147  ARG B NH1 1 
ATOM   3243 N  NH2 . ARG B 1 147 ? 19.364 -65.116  215.602 1.00 42.65  ? 147  ARG B NH2 1 
ATOM   3244 N  N   . MET B 1 148 ? 25.932 -64.830  220.559 1.00 32.36  ? 148  MET B N   1 
ATOM   3245 C  CA  . MET B 1 148 ? 26.890 -64.876  221.655 1.00 33.68  ? 148  MET B CA  1 
ATOM   3246 C  C   . MET B 1 148 ? 26.152 -65.614  222.770 1.00 33.54  ? 148  MET B C   1 
ATOM   3247 O  O   . MET B 1 148 ? 24.934 -65.777  222.708 1.00 32.60  ? 148  MET B O   1 
ATOM   3248 C  CB  . MET B 1 148 ? 27.258 -63.467  222.141 1.00 33.61  ? 148  MET B CB  1 
ATOM   3249 C  CG  . MET B 1 148 ? 28.243 -62.716  221.250 1.00 37.77  ? 148  MET B CG  1 
ATOM   3250 S  SD  . MET B 1 148 ? 29.018 -61.317  222.090 1.00 35.12  ? 148  MET B SD  1 
ATOM   3251 C  CE  . MET B 1 148 ? 27.760 -60.196  221.969 1.00 35.88  ? 148  MET B CE  1 
ATOM   3252 N  N   . VAL B 1 149 ? 26.885 -66.065  223.779 1.00 33.03  ? 149  VAL B N   1 
ATOM   3253 C  CA  . VAL B 1 149 ? 26.274 -66.748  224.906 1.00 32.22  ? 149  VAL B CA  1 
ATOM   3254 C  C   . VAL B 1 149 ? 26.928 -66.261  226.187 1.00 32.20  ? 149  VAL B C   1 
ATOM   3255 O  O   . VAL B 1 149 ? 28.023 -65.719  226.169 1.00 33.64  ? 149  VAL B O   1 
ATOM   3256 C  CB  . VAL B 1 149 ? 26.472 -68.308  224.841 1.00 31.26  ? 149  VAL B CB  1 
ATOM   3257 C  CG1 . VAL B 1 149 ? 25.934 -68.858  223.544 1.00 32.99  ? 149  VAL B CG1 1 
ATOM   3258 C  CG2 . VAL B 1 149 ? 27.938 -68.669  224.988 1.00 29.58  ? 149  VAL B CG2 1 
ATOM   3259 N  N   . ILE B 1 150 ? 26.235 -66.431  227.298 1.00 33.69  ? 150  ILE B N   1 
ATOM   3260 C  CA  . ILE B 1 150 ? 26.805 -66.111  228.591 1.00 35.48  ? 150  ILE B CA  1 
ATOM   3261 C  C   . ILE B 1 150 ? 26.465 -67.330  229.447 1.00 37.94  ? 150  ILE B C   1 
ATOM   3262 O  O   . ILE B 1 150 ? 25.313 -67.532  229.832 1.00 39.05  ? 150  ILE B O   1 
ATOM   3263 C  CB  . ILE B 1 150 ? 26.208 -64.841  229.235 1.00 33.78  ? 150  ILE B CB  1 
ATOM   3264 C  CG1 . ILE B 1 150 ? 26.514 -63.614  228.368 1.00 31.69  ? 150  ILE B CG1 1 
ATOM   3265 C  CG2 . ILE B 1 150 ? 26.821 -64.641  230.618 1.00 29.40  ? 150  ILE B CG2 1 
ATOM   3266 C  CD1 . ILE B 1 150 ? 26.083 -62.307  228.990 1.00 25.76  ? 150  ILE B CD1 1 
ATOM   3267 N  N   . SER B 1 151 ? 27.467 -68.165  229.697 1.00 38.37  ? 151  SER B N   1 
ATOM   3268 C  CA  . SER B 1 151 ? 27.276 -69.356  230.505 1.00 39.63  ? 151  SER B CA  1 
ATOM   3269 C  C   . SER B 1 151 ? 28.558 -69.649  231.276 1.00 40.44  ? 151  SER B C   1 
ATOM   3270 O  O   . SER B 1 151 ? 29.618 -69.105  230.959 1.00 42.20  ? 151  SER B O   1 
ATOM   3271 C  CB  . SER B 1 151 ? 26.888 -70.550  229.623 1.00 39.99  ? 151  SER B CB  1 
ATOM   3272 O  OG  . SER B 1 151 ? 27.942 -70.964  228.774 1.00 41.50  ? 151  SER B OG  1 
ATOM   3273 N  N   . ASP B 1 152 ? 28.464 -70.505  232.285 1.00 39.58  ? 152  ASP B N   1 
ATOM   3274 C  CA  . ASP B 1 152 ? 29.614 -70.823  233.112 1.00 40.29  ? 152  ASP B CA  1 
ATOM   3275 C  C   . ASP B 1 152 ? 30.754 -71.582  232.458 1.00 40.49  ? 152  ASP B C   1 
ATOM   3276 O  O   . ASP B 1 152 ? 30.548 -72.566  231.740 1.00 39.91  ? 152  ASP B O   1 
ATOM   3277 C  CB  . ASP B 1 152 ? 29.174 -71.584  234.363 1.00 41.28  ? 152  ASP B CB  1 
ATOM   3278 C  CG  . ASP B 1 152 ? 28.402 -70.713  235.333 1.00 46.85  ? 152  ASP B CG  1 
ATOM   3279 O  OD1 . ASP B 1 152 ? 28.277 -71.104  236.513 1.00 50.31  ? 152  ASP B OD1 1 
ATOM   3280 O  OD2 . ASP B 1 152 ? 27.912 -69.637  234.921 1.00 48.68  ? 152  ASP B OD2 1 
ATOM   3281 N  N   . PHE B 1 153 ? 31.962 -71.085  232.702 1.00 39.14  ? 153  PHE B N   1 
ATOM   3282 C  CA  . PHE B 1 153 ? 33.187 -71.713  232.230 1.00 38.09  ? 153  PHE B CA  1 
ATOM   3283 C  C   . PHE B 1 153 ? 34.168 -71.542  233.379 1.00 38.32  ? 153  PHE B C   1 
ATOM   3284 O  O   . PHE B 1 153 ? 34.320 -70.444  233.913 1.00 36.76  ? 153  PHE B O   1 
ATOM   3285 C  CB  . PHE B 1 153 ? 33.751 -71.042  230.989 1.00 35.48  ? 153  PHE B CB  1 
ATOM   3286 C  CG  . PHE B 1 153 ? 35.032 -71.675  230.500 1.00 37.73  ? 153  PHE B CG  1 
ATOM   3287 C  CD1 . PHE B 1 153 ? 35.015 -72.924  229.881 1.00 36.05  ? 153  PHE B CD1 1 
ATOM   3288 C  CD2 . PHE B 1 153 ? 36.264 -71.035  230.686 1.00 37.74  ? 153  PHE B CD2 1 
ATOM   3289 C  CE1 . PHE B 1 153 ? 36.205 -73.532  229.450 1.00 34.83  ? 153  PHE B CE1 1 
ATOM   3290 C  CE2 . PHE B 1 153 ? 37.453 -71.632  230.261 1.00 37.41  ? 153  PHE B CE2 1 
ATOM   3291 C  CZ  . PHE B 1 153 ? 37.421 -72.887  229.640 1.00 37.18  ? 153  PHE B CZ  1 
ATOM   3292 N  N   . GLU B 1 154 ? 34.812 -72.633  233.775 1.00 38.15  ? 154  GLU B N   1 
ATOM   3293 C  CA  . GLU B 1 154 ? 35.758 -72.582  234.878 1.00 40.23  ? 154  GLU B CA  1 
ATOM   3294 C  C   . GLU B 1 154 ? 35.182 -71.887  236.106 1.00 40.97  ? 154  GLU B C   1 
ATOM   3295 O  O   . GLU B 1 154 ? 35.893 -71.160  236.799 1.00 43.35  ? 154  GLU B O   1 
ATOM   3296 C  CB  . GLU B 1 154 ? 37.038 -71.871  234.444 1.00 41.72  ? 154  GLU B CB  1 
ATOM   3297 C  CG  . GLU B 1 154 ? 37.755 -72.567  233.312 1.00 44.06  ? 154  GLU B CG  1 
ATOM   3298 C  CD  . GLU B 1 154 ? 38.290 -73.916  233.715 1.00 46.51  ? 154  GLU B CD  1 
ATOM   3299 O  OE1 . GLU B 1 154 ? 37.535 -74.716  234.300 1.00 48.74  ? 154  GLU B OE1 1 
ATOM   3300 O  OE2 . GLU B 1 154 ? 39.472 -74.185  233.436 1.00 50.71  ? 154  GLU B OE2 1 
ATOM   3301 N  N   . GLY B 1 155 ? 33.891 -72.093  236.354 1.00 41.11  ? 155  GLY B N   1 
ATOM   3302 C  CA  . GLY B 1 155 ? 33.254 -71.517  237.525 1.00 40.91  ? 155  GLY B CA  1 
ATOM   3303 C  C   . GLY B 1 155 ? 32.724 -70.097  237.478 1.00 41.40  ? 155  GLY B C   1 
ATOM   3304 O  O   . GLY B 1 155 ? 32.176 -69.617  238.469 1.00 43.76  ? 155  GLY B O   1 
ATOM   3305 N  N   . LYS B 1 156 ? 32.868 -69.415  236.350 1.00 41.25  ? 156  LYS B N   1 
ATOM   3306 C  CA  . LYS B 1 156 ? 32.379 -68.045  236.246 1.00 39.13  ? 156  LYS B CA  1 
ATOM   3307 C  C   . LYS B 1 156 ? 31.504 -67.876  235.035 1.00 36.12  ? 156  LYS B C   1 
ATOM   3308 O  O   . LYS B 1 156 ? 31.654 -68.600  234.053 1.00 37.00  ? 156  LYS B O   1 
ATOM   3309 C  CB  . LYS B 1 156 ? 33.532 -67.052  236.076 1.00 42.39  ? 156  LYS B CB  1 
ATOM   3310 C  CG  . LYS B 1 156 ? 34.655 -67.157  237.070 1.00 47.63  ? 156  LYS B CG  1 
ATOM   3311 C  CD  . LYS B 1 156 ? 35.611 -65.997  236.882 1.00 50.53  ? 156  LYS B CD  1 
ATOM   3312 C  CE  . LYS B 1 156 ? 36.671 -65.986  237.962 1.00 53.03  ? 156  LYS B CE  1 
ATOM   3313 N  NZ  . LYS B 1 156 ? 37.581 -64.826  237.770 1.00 59.05  ? 156  LYS B NZ  1 
ATOM   3314 N  N   . PRO B 1 157 ? 30.563 -66.925  235.091 1.00 33.06  ? 157  PRO B N   1 
ATOM   3315 C  CA  . PRO B 1 157 ? 29.678 -66.659  233.954 1.00 30.73  ? 157  PRO B CA  1 
ATOM   3316 C  C   . PRO B 1 157 ? 30.637 -66.068  232.921 1.00 31.30  ? 157  PRO B C   1 
ATOM   3317 O  O   . PRO B 1 157 ? 31.465 -65.229  233.265 1.00 29.02  ? 157  PRO B O   1 
ATOM   3318 C  CB  . PRO B 1 157 ? 28.722 -65.604  234.498 1.00 30.17  ? 157  PRO B CB  1 
ATOM   3319 C  CG  . PRO B 1 157 ? 28.633 -65.954  235.943 1.00 31.71  ? 157  PRO B CG  1 
ATOM   3320 C  CD  . PRO B 1 157 ? 30.070 -66.255  236.306 1.00 32.80  ? 157  PRO B CD  1 
ATOM   3321 N  N   . THR B 1 158 ? 30.531 -66.493  231.666 1.00 32.20  ? 158  THR B N   1 
ATOM   3322 C  CA  . THR B 1 158 ? 31.440 -66.016  230.631 1.00 29.56  ? 158  THR B CA  1 
ATOM   3323 C  C   . THR B 1 158 ? 30.727 -65.658  229.332 1.00 31.94  ? 158  THR B C   1 
ATOM   3324 O  O   . THR B 1 158 ? 29.825 -66.376  228.893 1.00 35.37  ? 158  THR B O   1 
ATOM   3325 C  CB  . THR B 1 158 ? 32.486 -67.101  230.355 1.00 27.16  ? 158  THR B CB  1 
ATOM   3326 O  OG1 . THR B 1 158 ? 33.187 -67.384  231.569 1.00 26.64  ? 158  THR B OG1 1 
ATOM   3327 C  CG2 . THR B 1 158 ? 33.459 -66.674  229.293 1.00 26.39  ? 158  THR B CG2 1 
ATOM   3328 N  N   . LEU B 1 159 ? 31.121 -64.538  228.728 1.00 32.23  ? 159  LEU B N   1 
ATOM   3329 C  CA  . LEU B 1 159 ? 30.543 -64.094  227.465 1.00 30.26  ? 159  LEU B CA  1 
ATOM   3330 C  C   . LEU B 1 159 ? 31.384 -64.769  226.398 1.00 29.88  ? 159  LEU B C   1 
ATOM   3331 O  O   . LEU B 1 159 ? 32.609 -64.717  226.454 1.00 28.47  ? 159  LEU B O   1 
ATOM   3332 C  CB  . LEU B 1 159 ? 30.650 -62.576  227.324 1.00 31.81  ? 159  LEU B CB  1 
ATOM   3333 C  CG  . LEU B 1 159 ? 30.209 -61.947  225.995 1.00 34.53  ? 159  LEU B CG  1 
ATOM   3334 C  CD1 . LEU B 1 159 ? 28.707 -62.127  225.817 1.00 33.15  ? 159  LEU B CD1 1 
ATOM   3335 C  CD2 . LEU B 1 159 ? 30.571 -60.455  225.983 1.00 33.17  ? 159  LEU B CD2 1 
ATOM   3336 N  N   . MET B 1 160 ? 30.730 -65.407  225.430 1.00 29.51  ? 160  MET B N   1 
ATOM   3337 C  CA  . MET B 1 160 ? 31.448 -66.111  224.382 1.00 26.70  ? 160  MET B CA  1 
ATOM   3338 C  C   . MET B 1 160 ? 30.803 -65.983  223.027 1.00 25.40  ? 160  MET B C   1 
ATOM   3339 O  O   . MET B 1 160 ? 29.646 -65.599  222.893 1.00 28.36  ? 160  MET B O   1 
ATOM   3340 C  CB  . MET B 1 160 ? 31.519 -67.601  224.684 1.00 27.77  ? 160  MET B CB  1 
ATOM   3341 C  CG  . MET B 1 160 ? 31.812 -67.982  226.099 1.00 26.51  ? 160  MET B CG  1 
ATOM   3342 S  SD  . MET B 1 160 ? 31.706 -69.803  226.234 1.00 29.13  ? 160  MET B SD  1 
ATOM   3343 C  CE  . MET B 1 160 ? 31.242 -69.970  227.956 1.00 17.27  ? 160  MET B CE  1 
ATOM   3344 N  N   . MET B 1 161 ? 31.582 -66.356  222.026 1.00 25.28  ? 161  MET B N   1 
ATOM   3345 C  CA  . MET B 1 161 ? 31.183 -66.359  220.629 1.00 23.78  ? 161  MET B CA  1 
ATOM   3346 C  C   . MET B 1 161 ? 32.334 -67.146  220.018 1.00 24.02  ? 161  MET B C   1 
ATOM   3347 O  O   . MET B 1 161 ? 33.296 -67.465  220.725 1.00 22.46  ? 161  MET B O   1 
ATOM   3348 C  CB  . MET B 1 161 ? 31.100 -64.926  220.071 1.00 24.21  ? 161  MET B CB  1 
ATOM   3349 C  CG  . MET B 1 161 ? 32.389 -64.072  220.151 1.00 24.78  ? 161  MET B CG  1 
ATOM   3350 S  SD  . MET B 1 161 ? 33.566 -64.422  218.846 1.00 28.30  ? 161  MET B SD  1 
ATOM   3351 C  CE  . MET B 1 161 ? 32.700 -63.850  217.497 1.00 26.28  ? 161  MET B CE  1 
ATOM   3352 N  N   . ARG B 1 162 ? 32.242 -67.508  218.744 1.00 23.57  ? 162  ARG B N   1 
ATOM   3353 C  CA  . ARG B 1 162 ? 33.336 -68.246  218.145 1.00 24.81  ? 162  ARG B CA  1 
ATOM   3354 C  C   . ARG B 1 162 ? 33.528 -67.907  216.697 1.00 25.56  ? 162  ARG B C   1 
ATOM   3355 O  O   . ARG B 1 162 ? 32.625 -67.369  216.046 1.00 25.80  ? 162  ARG B O   1 
ATOM   3356 C  CB  . ARG B 1 162 ? 33.162 -69.758  218.330 1.00 27.44  ? 162  ARG B CB  1 
ATOM   3357 C  CG  . ARG B 1 162 ? 31.860 -70.351  217.835 1.00 29.18  ? 162  ARG B CG  1 
ATOM   3358 C  CD  . ARG B 1 162 ? 31.826 -71.841  218.140 1.00 32.28  ? 162  ARG B CD  1 
ATOM   3359 N  NE  . ARG B 1 162 ? 30.533 -72.439  217.822 1.00 38.58  ? 162  ARG B NE  1 
ATOM   3360 C  CZ  . ARG B 1 162 ? 30.212 -73.710  218.047 1.00 39.50  ? 162  ARG B CZ  1 
ATOM   3361 N  NH1 . ARG B 1 162 ? 31.088 -74.542  218.598 1.00 37.81  ? 162  ARG B NH1 1 
ATOM   3362 N  NH2 . ARG B 1 162 ? 29.010 -74.150  217.710 1.00 39.67  ? 162  ARG B NH2 1 
ATOM   3363 N  N   . LEU B 1 163 ? 34.727 -68.209  216.207 1.00 25.21  ? 163  LEU B N   1 
ATOM   3364 C  CA  . LEU B 1 163 ? 35.115 -67.927  214.828 1.00 27.31  ? 163  LEU B CA  1 
ATOM   3365 C  C   . LEU B 1 163 ? 35.608 -69.188  214.162 1.00 26.39  ? 163  LEU B C   1 
ATOM   3366 O  O   . LEU B 1 163 ? 36.190 -70.055  214.812 1.00 26.23  ? 163  LEU B O   1 
ATOM   3367 C  CB  . LEU B 1 163 ? 36.284 -66.946  214.784 1.00 29.66  ? 163  LEU B CB  1 
ATOM   3368 C  CG  . LEU B 1 163 ? 36.289 -65.650  215.560 1.00 33.05  ? 163  LEU B CG  1 
ATOM   3369 C  CD1 . LEU B 1 163 ? 37.726 -65.214  215.760 1.00 36.77  ? 163  LEU B CD1 1 
ATOM   3370 C  CD2 . LEU B 1 163 ? 35.514 -64.616  214.805 1.00 35.59  ? 163  LEU B CD2 1 
ATOM   3371 N  N   . ALA B 1 164 ? 35.423 -69.265  212.854 1.00 27.33  ? 164  ALA B N   1 
ATOM   3372 C  CA  . ALA B 1 164 ? 35.894 -70.417  212.108 1.00 30.52  ? 164  ALA B CA  1 
ATOM   3373 C  C   . ALA B 1 164 ? 36.604 -69.950  210.841 1.00 31.64  ? 164  ALA B C   1 
ATOM   3374 O  O   . ALA B 1 164 ? 36.172 -69.003  210.182 1.00 30.81  ? 164  ALA B O   1 
ATOM   3375 C  CB  . ALA B 1 164 ? 34.717 -71.350  211.757 1.00 26.05  ? 164  ALA B CB  1 
ATOM   3376 N  N   . ASN B 1 165 ? 37.708 -70.619  210.530 1.00 34.50  ? 165  ASN B N   1 
ATOM   3377 C  CA  . ASN B 1 165 ? 38.495 -70.340  209.340 1.00 35.98  ? 165  ASN B CA  1 
ATOM   3378 C  C   . ASN B 1 165 ? 37.878 -71.163  208.212 1.00 37.50  ? 165  ASN B C   1 
ATOM   3379 O  O   . ASN B 1 165 ? 37.926 -72.396  208.241 1.00 38.47  ? 165  ASN B O   1 
ATOM   3380 C  CB  . ASN B 1 165 ? 39.943 -70.767  209.572 1.00 36.78  ? 165  ASN B CB  1 
ATOM   3381 C  CG  . ASN B 1 165 ? 40.807 -70.574  208.349 1.00 39.26  ? 165  ASN B CG  1 
ATOM   3382 O  OD1 . ASN B 1 165 ? 40.334 -70.126  207.304 1.00 37.56  ? 165  ASN B OD1 1 
ATOM   3383 N  ND2 . ASN B 1 165 ? 42.084 -70.915  208.470 1.00 42.23  ? 165  ASN B ND2 1 
ATOM   3384 N  N   . LEU B 1 166 ? 37.299 -70.474  207.231 1.00 37.96  ? 166  LEU B N   1 
ATOM   3385 C  CA  . LEU B 1 166 ? 36.626 -71.113  206.100 1.00 39.56  ? 166  LEU B CA  1 
ATOM   3386 C  C   . LEU B 1 166 ? 37.522 -71.613  204.971 1.00 42.88  ? 166  LEU B C   1 
ATOM   3387 O  O   . LEU B 1 166 ? 37.031 -72.106  203.953 1.00 43.19  ? 166  LEU B O   1 
ATOM   3388 C  CB  . LEU B 1 166 ? 35.598 -70.155  205.506 1.00 36.75  ? 166  LEU B CB  1 
ATOM   3389 C  CG  . LEU B 1 166 ? 34.420 -69.739  206.377 1.00 36.38  ? 166  LEU B CG  1 
ATOM   3390 C  CD1 . LEU B 1 166 ? 33.610 -68.692  205.643 1.00 36.06  ? 166  LEU B CD1 1 
ATOM   3391 C  CD2 . LEU B 1 166 ? 33.558 -70.947  206.705 1.00 36.90  ? 166  LEU B CD2 1 
ATOM   3392 N  N   . ARG B 1 167 ? 38.829 -71.469  205.131 1.00 45.89  ? 167  ARG B N   1 
ATOM   3393 C  CA  . ARG B 1 167 ? 39.756 -71.924  204.105 1.00 48.88  ? 167  ARG B CA  1 
ATOM   3394 C  C   . ARG B 1 167 ? 40.698 -72.908  204.765 1.00 51.52  ? 167  ARG B C   1 
ATOM   3395 O  O   . ARG B 1 167 ? 40.761 -72.993  205.991 1.00 51.88  ? 167  ARG B O   1 
ATOM   3396 C  CB  . ARG B 1 167 ? 40.567 -70.756  203.536 1.00 49.71  ? 167  ARG B CB  1 
ATOM   3397 C  CG  . ARG B 1 167 ? 39.775 -69.737  202.732 1.00 52.60  ? 167  ARG B CG  1 
ATOM   3398 C  CD  . ARG B 1 167 ? 40.707 -68.644  202.214 1.00 54.83  ? 167  ARG B CD  1 
ATOM   3399 N  NE  . ARG B 1 167 ? 40.122 -67.305  202.304 1.00 56.60  ? 167  ARG B NE  1 
ATOM   3400 C  CZ  . ARG B 1 167 ? 39.502 -66.682  201.307 1.00 57.88  ? 167  ARG B CZ  1 
ATOM   3401 N  NH1 . ARG B 1 167 ? 39.382 -67.275  200.126 1.00 59.96  ? 167  ARG B NH1 1 
ATOM   3402 N  NH2 . ARG B 1 167 ? 39.008 -65.462  201.487 1.00 55.94  ? 167  ARG B NH2 1 
ATOM   3403 N  N   . ILE B 1 168 ? 41.434 -73.657  203.959 1.00 53.83  ? 168  ILE B N   1 
ATOM   3404 C  CA  . ILE B 1 168 ? 42.368 -74.605  204.524 1.00 55.57  ? 168  ILE B CA  1 
ATOM   3405 C  C   . ILE B 1 168 ? 43.653 -73.881  204.869 1.00 55.60  ? 168  ILE B C   1 
ATOM   3406 O  O   . ILE B 1 168 ? 44.366 -74.289  205.785 1.00 56.93  ? 168  ILE B O   1 
ATOM   3407 C  CB  . ILE B 1 168 ? 42.647 -75.773  203.562 1.00 58.04  ? 168  ILE B CB  1 
ATOM   3408 C  CG1 . ILE B 1 168 ? 41.429 -76.705  203.532 1.00 59.15  ? 168  ILE B CG1 1 
ATOM   3409 C  CG2 . ILE B 1 168 ? 43.895 -76.528  204.005 1.00 58.96  ? 168  ILE B CG2 1 
ATOM   3410 C  CD1 . ILE B 1 168 ? 41.611 -77.953  202.684 1.00 61.43  ? 168  ILE B CD1 1 
ATOM   3411 N  N   . GLU B 1 169 ? 43.953 -72.801  204.150 1.00 54.96  ? 169  GLU B N   1 
ATOM   3412 C  CA  . GLU B 1 169 ? 45.162 -72.048  204.461 1.00 55.04  ? 169  GLU B CA  1 
ATOM   3413 C  C   . GLU B 1 169 ? 44.993 -71.500  205.868 1.00 53.34  ? 169  GLU B C   1 
ATOM   3414 O  O   . GLU B 1 169 ? 43.892 -71.140  206.281 1.00 51.25  ? 169  GLU B O   1 
ATOM   3415 C  CB  . GLU B 1 169 ? 45.376 -70.888  203.493 1.00 58.44  ? 169  GLU B CB  1 
ATOM   3416 C  CG  . GLU B 1 169 ? 45.577 -71.305  202.055 1.00 63.15  ? 169  GLU B CG  1 
ATOM   3417 C  CD  . GLU B 1 169 ? 44.297 -71.793  201.425 1.00 65.76  ? 169  GLU B CD  1 
ATOM   3418 O  OE1 . GLU B 1 169 ? 43.282 -71.063  201.487 1.00 68.59  ? 169  GLU B OE1 1 
ATOM   3419 O  OE2 . GLU B 1 169 ? 44.308 -72.904  200.864 1.00 68.46  ? 169  GLU B OE2 1 
ATOM   3420 N  N   . GLN B 1 170 ? 46.090 -71.429  206.601 1.00 51.33  ? 170  GLN B N   1 
ATOM   3421 C  CA  . GLN B 1 170 ? 46.028 -70.950  207.961 1.00 49.27  ? 170  GLN B CA  1 
ATOM   3422 C  C   . GLN B 1 170 ? 46.325 -69.459  208.073 1.00 46.91  ? 170  GLN B C   1 
ATOM   3423 O  O   . GLN B 1 170 ? 46.895 -68.858  207.167 1.00 45.39  ? 170  GLN B O   1 
ATOM   3424 C  CB  . GLN B 1 170 ? 46.995 -71.767  208.810 1.00 51.81  ? 170  GLN B CB  1 
ATOM   3425 C  CG  . GLN B 1 170 ? 46.914 -73.258  208.502 1.00 54.82  ? 170  GLN B CG  1 
ATOM   3426 C  CD  . GLN B 1 170 ? 47.746 -74.100  209.436 1.00 55.55  ? 170  GLN B CD  1 
ATOM   3427 O  OE1 . GLN B 1 170 ? 48.917 -73.818  209.659 1.00 58.20  ? 170  GLN B OE1 1 
ATOM   3428 N  NE2 . GLN B 1 170 ? 47.145 -75.148  209.985 1.00 58.46  ? 170  GLN B NE2 1 
ATOM   3429 N  N   . ILE B 1 171 ? 45.913 -68.873  209.192 1.00 42.76  ? 171  ILE B N   1 
ATOM   3430 C  CA  . ILE B 1 171 ? 46.128 -67.468  209.453 1.00 38.73  ? 171  ILE B CA  1 
ATOM   3431 C  C   . ILE B 1 171 ? 47.140 -67.353  210.594 1.00 40.74  ? 171  ILE B C   1 
ATOM   3432 O  O   . ILE B 1 171 ? 46.969 -67.936  211.665 1.00 39.93  ? 171  ILE B O   1 
ATOM   3433 C  CB  . ILE B 1 171 ? 44.808 -66.793  209.834 1.00 37.23  ? 171  ILE B CB  1 
ATOM   3434 C  CG1 . ILE B 1 171 ? 43.799 -66.997  208.702 1.00 36.22  ? 171  ILE B CG1 1 
ATOM   3435 C  CG2 . ILE B 1 171 ? 45.036 -65.318  210.131 1.00 33.17  ? 171  ILE B CG2 1 
ATOM   3436 C  CD1 . ILE B 1 171 ? 42.432 -66.411  208.979 1.00 36.03  ? 171  ILE B CD1 1 
ATOM   3437 N  N   . ILE B 1 172 ? 48.203 -66.602  210.344 1.00 41.70  ? 172  ILE B N   1 
ATOM   3438 C  CA  . ILE B 1 172 ? 49.276 -66.420  211.309 1.00 42.80  ? 172  ILE B CA  1 
ATOM   3439 C  C   . ILE B 1 172 ? 49.099 -65.162  212.144 1.00 42.04  ? 172  ILE B C   1 
ATOM   3440 O  O   . ILE B 1 172 ? 48.652 -64.132  211.648 1.00 41.66  ? 172  ILE B O   1 
ATOM   3441 C  CB  . ILE B 1 172 ? 50.639 -66.366  210.571 1.00 43.16  ? 172  ILE B CB  1 
ATOM   3442 C  CG1 . ILE B 1 172 ? 50.813 -67.639  209.741 1.00 42.73  ? 172  ILE B CG1 1 
ATOM   3443 C  CG2 . ILE B 1 172 ? 51.775 -66.216  211.556 1.00 45.39  ? 172  ILE B CG2 1 
ATOM   3444 C  CD1 . ILE B 1 172 ? 50.568 -68.911  210.533 1.00 40.15  ? 172  ILE B CD1 1 
ATOM   3445 N  N   . GLU B 1 173 ? 49.453 -65.250  213.418 1.00 42.57  ? 173  GLU B N   1 
ATOM   3446 C  CA  . GLU B 1 173 ? 49.332 -64.103  214.308 1.00 43.16  ? 173  GLU B CA  1 
ATOM   3447 C  C   . GLU B 1 173 ? 47.932 -63.491  214.256 1.00 41.93  ? 173  GLU B C   1 
ATOM   3448 O  O   . GLU B 1 173 ? 47.760 -62.310  213.942 1.00 41.23  ? 173  GLU B O   1 
ATOM   3449 C  CB  . GLU B 1 173 ? 50.381 -63.056  213.941 1.00 45.02  ? 173  GLU B CB  1 
ATOM   3450 C  CG  . GLU B 1 173 ? 51.770 -63.431  214.394 1.00 50.43  ? 173  GLU B CG  1 
ATOM   3451 C  CD  . GLU B 1 173 ? 52.834 -62.522  213.827 1.00 53.57  ? 173  GLU B CD  1 
ATOM   3452 O  OE1 . GLU B 1 173 ? 53.899 -62.384  214.468 1.00 55.65  ? 173  GLU B OE1 1 
ATOM   3453 O  OE2 . GLU B 1 173 ? 52.610 -61.956  212.735 1.00 56.43  ? 173  GLU B OE2 1 
ATOM   3454 N  N   . ALA B 1 174 ? 46.938 -64.321  214.562 1.00 39.62  ? 174  ALA B N   1 
ATOM   3455 C  CA  . ALA B 1 174 ? 45.547 -63.902  214.585 1.00 35.72  ? 174  ALA B CA  1 
ATOM   3456 C  C   . ALA B 1 174 ? 45.264 -63.195  215.906 1.00 34.70  ? 174  ALA B C   1 
ATOM   3457 O  O   . ALA B 1 174 ? 45.624 -63.692  216.973 1.00 33.65  ? 174  ALA B O   1 
ATOM   3458 C  CB  . ALA B 1 174 ? 44.633 -65.118  214.438 1.00 34.16  ? 174  ALA B CB  1 
ATOM   3459 N  N   . ASP B 1 175 ? 44.635 -62.027  215.820 1.00 33.08  ? 175  ASP B N   1 
ATOM   3460 C  CA  . ASP B 1 175 ? 44.277 -61.247  216.995 1.00 35.35  ? 175  ASP B CA  1 
ATOM   3461 C  C   . ASP B 1 175 ? 42.788 -61.010  216.970 1.00 33.72  ? 175  ASP B C   1 
ATOM   3462 O  O   . ASP B 1 175 ? 42.207 -60.779  215.908 1.00 35.40  ? 175  ASP B O   1 
ATOM   3463 C  CB  . ASP B 1 175 ? 44.942 -59.869  216.983 1.00 40.96  ? 175  ASP B CB  1 
ATOM   3464 C  CG  . ASP B 1 175 ? 46.400 -59.916  217.344 1.00 47.11  ? 175  ASP B CG  1 
ATOM   3465 O  OD1 . ASP B 1 175 ? 46.716 -60.228  218.518 1.00 48.80  ? 175  ASP B OD1 1 
ATOM   3466 O  OD2 . ASP B 1 175 ? 47.227 -59.632  216.449 1.00 50.46  ? 175  ASP B OD2 1 
ATOM   3467 N  N   . VAL B 1 176 ? 42.171 -61.054  218.138 1.00 30.48  ? 176  VAL B N   1 
ATOM   3468 C  CA  . VAL B 1 176 ? 40.753 -60.788  218.228 1.00 28.54  ? 176  VAL B CA  1 
ATOM   3469 C  C   . VAL B 1 176 ? 40.496 -59.879  219.410 1.00 28.46  ? 176  VAL B C   1 
ATOM   3470 O  O   . VAL B 1 176 ? 41.150 -59.982  220.456 1.00 26.96  ? 176  VAL B O   1 
ATOM   3471 C  CB  . VAL B 1 176 ? 39.889 -62.096  218.382 1.00 28.28  ? 176  VAL B CB  1 
ATOM   3472 C  CG1 . VAL B 1 176 ? 40.309 -62.883  219.612 1.00 26.66  ? 176  VAL B CG1 1 
ATOM   3473 C  CG2 . VAL B 1 176 ? 38.411 -61.717  218.510 1.00 22.83  ? 176  VAL B CG2 1 
ATOM   3474 N  N   . HIS B 1 177 ? 39.562 -58.959  219.221 1.00 28.32  ? 177  HIS B N   1 
ATOM   3475 C  CA  . HIS B 1 177 ? 39.169 -58.050  220.281 1.00 28.69  ? 177  HIS B CA  1 
ATOM   3476 C  C   . HIS B 1 177 ? 37.658 -58.124  220.442 1.00 29.47  ? 177  HIS B C   1 
ATOM   3477 O  O   . HIS B 1 177 ? 36.916 -58.209  219.450 1.00 26.53  ? 177  HIS B O   1 
ATOM   3478 C  CB  . HIS B 1 177 ? 39.557 -56.613  219.943 1.00 31.19  ? 177  HIS B CB  1 
ATOM   3479 C  CG  . HIS B 1 177 ? 40.999 -56.306  220.185 1.00 35.18  ? 177  HIS B CG  1 
ATOM   3480 N  ND1 . HIS B 1 177 ? 41.964 -56.435  219.207 1.00 33.36  ? 177  HIS B ND1 1 
ATOM   3481 C  CD2 . HIS B 1 177 ? 41.648 -55.931  221.313 1.00 34.00  ? 177  HIS B CD2 1 
ATOM   3482 C  CE1 . HIS B 1 177 ? 43.146 -56.154  219.724 1.00 38.22  ? 177  HIS B CE1 1 
ATOM   3483 N  NE2 . HIS B 1 177 ? 42.983 -55.848  221.001 1.00 38.39  ? 177  HIS B NE2 1 
ATOM   3484 N  N   . LEU B 1 178 ? 37.211 -58.116  221.690 1.00 28.72  ? 178  LEU B N   1 
ATOM   3485 C  CA  . LEU B 1 178 ? 35.793 -58.130  221.987 1.00 30.11  ? 178  LEU B CA  1 
ATOM   3486 C  C   . LEU B 1 178 ? 35.586 -56.796  222.693 1.00 30.02  ? 178  LEU B C   1 
ATOM   3487 O  O   . LEU B 1 178 ? 36.083 -56.588  223.810 1.00 29.66  ? 178  LEU B O   1 
ATOM   3488 C  CB  . LEU B 1 178 ? 35.443 -59.306  222.895 1.00 33.29  ? 178  LEU B CB  1 
ATOM   3489 C  CG  . LEU B 1 178 ? 33.954 -59.462  223.231 1.00 37.39  ? 178  LEU B CG  1 
ATOM   3490 C  CD1 . LEU B 1 178 ? 33.135 -59.494  221.951 1.00 39.60  ? 178  LEU B CD1 1 
ATOM   3491 C  CD2 . LEU B 1 178 ? 33.731 -60.734  224.029 1.00 37.53  ? 178  LEU B CD2 1 
ATOM   3492 N  N   . VAL B 1 179 ? 34.880 -55.887  222.023 1.00 28.23  ? 179  VAL B N   1 
ATOM   3493 C  CA  . VAL B 1 179 ? 34.656 -54.547  222.556 1.00 27.24  ? 179  VAL B CA  1 
ATOM   3494 C  C   . VAL B 1 179 ? 33.196 -54.241  222.864 1.00 26.88  ? 179  VAL B C   1 
ATOM   3495 O  O   . VAL B 1 179 ? 32.327 -54.380  222.005 1.00 26.20  ? 179  VAL B O   1 
ATOM   3496 C  CB  . VAL B 1 179 ? 35.196 -53.455  221.553 1.00 28.21  ? 179  VAL B CB  1 
ATOM   3497 C  CG1 . VAL B 1 179 ? 35.124 -52.062  222.173 1.00 24.86  ? 179  VAL B CG1 1 
ATOM   3498 C  CG2 . VAL B 1 179 ? 36.634 -53.769  221.158 1.00 26.61  ? 179  VAL B CG2 1 
ATOM   3499 N  N   . LEU B 1 180 ? 32.942 -53.827  224.100 1.00 27.51  ? 180  LEU B N   1 
ATOM   3500 C  CA  . LEU B 1 180 ? 31.606 -53.452  224.537 1.00 30.39  ? 180  LEU B CA  1 
ATOM   3501 C  C   . LEU B 1 180 ? 31.401 -51.957  224.319 1.00 33.75  ? 180  LEU B C   1 
ATOM   3502 O  O   . LEU B 1 180 ? 32.205 -51.136  224.788 1.00 35.26  ? 180  LEU B O   1 
ATOM   3503 C  CB  . LEU B 1 180 ? 31.405 -53.728  226.028 1.00 28.61  ? 180  LEU B CB  1 
ATOM   3504 C  CG  . LEU B 1 180 ? 30.219 -52.915  226.599 1.00 28.73  ? 180  LEU B CG  1 
ATOM   3505 C  CD1 . LEU B 1 180 ? 28.900 -53.459  226.037 1.00 24.66  ? 180  LEU B CD1 1 
ATOM   3506 C  CD2 . LEU B 1 180 ? 30.209 -52.962  228.131 1.00 25.39  ? 180  LEU B CD2 1 
ATOM   3507 N  N   . VAL B 1 181 ? 30.328 -51.606  223.621 1.00 34.04  ? 181  VAL B N   1 
ATOM   3508 C  CA  . VAL B 1 181 ? 30.004 -50.210  223.386 1.00 35.38  ? 181  VAL B CA  1 
ATOM   3509 C  C   . VAL B 1 181 ? 28.634 -49.927  223.992 1.00 36.89  ? 181  VAL B C   1 
ATOM   3510 O  O   . VAL B 1 181 ? 27.641 -50.556  223.629 1.00 36.20  ? 181  VAL B O   1 
ATOM   3511 C  CB  . VAL B 1 181 ? 29.958 -49.895  221.896 1.00 36.76  ? 181  VAL B CB  1 
ATOM   3512 C  CG1 . VAL B 1 181 ? 29.881 -48.386  221.688 1.00 37.23  ? 181  VAL B CG1 1 
ATOM   3513 C  CG2 . VAL B 1 181 ? 31.184 -50.473  221.216 1.00 39.04  ? 181  VAL B CG2 1 
ATOM   3514 N  N   . ARG B 1 182 ? 28.586 -49.002  224.941 1.00 38.91  ? 182  ARG B N   1 
ATOM   3515 C  CA  . ARG B 1 182 ? 27.322 -48.647  225.576 1.00 40.98  ? 182  ARG B CA  1 
ATOM   3516 C  C   . ARG B 1 182 ? 27.333 -47.186  225.990 1.00 41.66  ? 182  ARG B C   1 
ATOM   3517 O  O   . ARG B 1 182 ? 28.382 -46.543  226.007 1.00 39.64  ? 182  ARG B O   1 
ATOM   3518 C  CB  . ARG B 1 182 ? 27.073 -49.518  226.804 1.00 41.57  ? 182  ARG B CB  1 
ATOM   3519 C  CG  . ARG B 1 182 ? 28.008 -49.226  227.929 1.00 38.44  ? 182  ARG B CG  1 
ATOM   3520 C  CD  . ARG B 1 182 ? 27.705 -50.066  229.142 1.00 37.16  ? 182  ARG B CD  1 
ATOM   3521 N  NE  . ARG B 1 182 ? 28.726 -49.822  230.147 1.00 35.86  ? 182  ARG B NE  1 
ATOM   3522 C  CZ  . ARG B 1 182 ? 28.969 -50.613  231.178 1.00 36.00  ? 182  ARG B CZ  1 
ATOM   3523 N  NH1 . ARG B 1 182 ? 28.255 -51.719  231.356 1.00 35.87  ? 182  ARG B NH1 1 
ATOM   3524 N  NH2 . ARG B 1 182 ? 29.942 -50.297  232.020 1.00 36.74  ? 182  ARG B NH2 1 
ATOM   3525 N  N   . SER B 1 183 ? 26.157 -46.673  226.336 1.00 43.85  ? 183  SER B N   1 
ATOM   3526 C  CA  . SER B 1 183 ? 26.017 -45.279  226.735 1.00 44.50  ? 183  SER B CA  1 
ATOM   3527 C  C   . SER B 1 183 ? 26.173 -45.117  228.233 1.00 46.14  ? 183  SER B C   1 
ATOM   3528 O  O   . SER B 1 183 ? 25.508 -45.803  229.011 1.00 45.32  ? 183  SER B O   1 
ATOM   3529 C  CB  . SER B 1 183 ? 24.653 -44.756  226.300 1.00 44.54  ? 183  SER B CB  1 
ATOM   3530 O  OG  . SER B 1 183 ? 24.477 -44.913  224.905 1.00 45.09  ? 183  SER B OG  1 
ATOM   3531 N  N   . GLU B 1 184 ? 27.056 -44.207  228.628 1.00 48.50  ? 184  GLU B N   1 
ATOM   3532 C  CA  . GLU B 1 184 ? 27.311 -43.933  230.037 1.00 52.03  ? 184  GLU B CA  1 
ATOM   3533 C  C   . GLU B 1 184 ? 27.264 -42.429  230.308 1.00 54.60  ? 184  GLU B C   1 
ATOM   3534 O  O   . GLU B 1 184 ? 27.354 -41.618  229.384 1.00 55.30  ? 184  GLU B O   1 
ATOM   3535 C  CB  . GLU B 1 184 ? 28.664 -44.525  230.442 1.00 52.05  ? 184  GLU B CB  1 
ATOM   3536 C  CG  . GLU B 1 184 ? 28.645 -46.052  230.442 1.00 54.84  ? 184  GLU B CG  1 
ATOM   3537 C  CD  . GLU B 1 184 ? 30.010 -46.697  230.674 1.00 55.21  ? 184  GLU B CD  1 
ATOM   3538 O  OE1 . GLU B 1 184 ? 30.701 -46.331  231.648 1.00 55.52  ? 184  GLU B OE1 1 
ATOM   3539 O  OE2 . GLU B 1 184 ? 30.382 -47.591  229.881 1.00 53.50  ? 184  GLU B OE2 1 
ATOM   3540 N  N   . ILE B 1 185 ? 27.114 -42.059  231.576 1.00 57.19  ? 185  ILE B N   1 
ATOM   3541 C  CA  . ILE B 1 185 ? 27.029 -40.649  231.960 1.00 59.44  ? 185  ILE B CA  1 
ATOM   3542 C  C   . ILE B 1 185 ? 28.284 -40.162  232.694 1.00 60.53  ? 185  ILE B C   1 
ATOM   3543 O  O   . ILE B 1 185 ? 28.719 -40.784  233.670 1.00 60.43  ? 185  ILE B O   1 
ATOM   3544 C  CB  . ILE B 1 185 ? 25.814 -40.419  232.886 1.00 59.98  ? 185  ILE B CB  1 
ATOM   3545 C  CG1 . ILE B 1 185 ? 24.607 -41.199  232.359 1.00 59.54  ? 185  ILE B CG1 1 
ATOM   3546 C  CG2 . ILE B 1 185 ? 25.506 -38.924  232.977 1.00 59.40  ? 185  ILE B CG2 1 
ATOM   3547 C  CD1 . ILE B 1 185 ? 23.458 -41.289  233.338 1.00 58.36  ? 185  ILE B CD1 1 
ATOM   3548 N  N   . SER B 1 186 ? 28.858 -39.051  232.236 1.00 61.02  ? 186  SER B N   1 
ATOM   3549 C  CA  . SER B 1 186 ? 30.053 -38.506  232.881 1.00 63.06  ? 186  SER B CA  1 
ATOM   3550 C  C   . SER B 1 186 ? 29.643 -37.772  234.147 1.00 65.03  ? 186  SER B C   1 
ATOM   3551 O  O   . SER B 1 186 ? 28.457 -37.695  234.466 1.00 65.56  ? 186  SER B O   1 
ATOM   3552 C  CB  . SER B 1 186 ? 30.791 -37.537  231.949 1.00 62.75  ? 186  SER B CB  1 
ATOM   3553 O  OG  . SER B 1 186 ? 30.120 -36.291  231.836 1.00 61.22  ? 186  SER B OG  1 
ATOM   3554 N  N   . GLN B 1 187 ? 30.619 -37.243  234.877 1.00 66.86  ? 187  GLN B N   1 
ATOM   3555 C  CA  . GLN B 1 187 ? 30.318 -36.495  236.091 1.00 68.48  ? 187  GLN B CA  1 
ATOM   3556 C  C   . GLN B 1 187 ? 29.687 -35.164  235.701 1.00 68.94  ? 187  GLN B C   1 
ATOM   3557 O  O   . GLN B 1 187 ? 28.767 -34.685  236.358 1.00 70.00  ? 187  GLN B O   1 
ATOM   3558 C  CB  . GLN B 1 187 ? 31.587 -36.252  236.907 1.00 68.70  ? 187  GLN B CB  1 
ATOM   3559 C  CG  . GLN B 1 187 ? 32.045 -37.464  237.694 1.00 71.07  ? 187  GLN B CG  1 
ATOM   3560 C  CD  . GLN B 1 187 ? 33.271 -37.175  238.535 1.00 71.47  ? 187  GLN B CD  1 
ATOM   3561 O  OE1 . GLN B 1 187 ? 33.360 -36.124  239.174 1.00 71.72  ? 187  GLN B OE1 1 
ATOM   3562 N  NE2 . GLN B 1 187 ? 34.219 -38.108  238.548 1.00 69.85  ? 187  GLN B NE2 1 
ATOM   3563 N  N   . GLU B 1 188 ? 30.182 -34.579  234.616 1.00 69.28  ? 188  GLU B N   1 
ATOM   3564 C  CA  . GLU B 1 188 ? 29.659 -33.311  234.124 1.00 69.52  ? 188  GLU B CA  1 
ATOM   3565 C  C   . GLU B 1 188 ? 28.229 -33.511  233.634 1.00 70.68  ? 188  GLU B C   1 
ATOM   3566 O  O   . GLU B 1 188 ? 27.623 -32.597  233.079 1.00 71.01  ? 188  GLU B O   1 
ATOM   3567 C  CB  . GLU B 1 188 ? 30.522 -32.782  232.974 1.00 67.83  ? 188  GLU B CB  1 
ATOM   3568 C  CG  . GLU B 1 188 ? 31.981 -32.492  233.329 1.00 66.12  ? 188  GLU B CG  1 
ATOM   3569 C  CD  . GLU B 1 188 ? 32.752 -33.731  233.761 1.00 65.65  ? 188  GLU B CD  1 
ATOM   3570 O  OE1 . GLU B 1 188 ? 32.616 -34.786  233.098 1.00 63.81  ? 188  GLU B OE1 1 
ATOM   3571 O  OE2 . GLU B 1 188 ? 33.506 -33.642  234.757 1.00 64.29  ? 188  GLU B OE2 1 
ATOM   3572 N  N   . GLY B 1 189 ? 27.707 -34.721  233.819 1.00 72.34  ? 189  GLY B N   1 
ATOM   3573 C  CA  . GLY B 1 189 ? 26.346 -35.023  233.405 1.00 73.08  ? 189  GLY B CA  1 
ATOM   3574 C  C   . GLY B 1 189 ? 26.141 -35.397  231.946 1.00 73.23  ? 189  GLY B C   1 
ATOM   3575 O  O   . GLY B 1 189 ? 25.016 -35.684  231.536 1.00 73.27  ? 189  GLY B O   1 
ATOM   3576 N  N   . MET B 1 190 ? 27.213 -35.400  231.160 1.00 73.26  ? 190  MET B N   1 
ATOM   3577 C  CA  . MET B 1 190 ? 27.117 -35.746  229.744 1.00 73.63  ? 190  MET B CA  1 
ATOM   3578 C  C   . MET B 1 190 ? 27.005 -37.255  229.480 1.00 72.79  ? 190  MET B C   1 
ATOM   3579 O  O   . MET B 1 190 ? 27.732 -38.062  230.070 1.00 72.95  ? 190  MET B O   1 
ATOM   3580 C  CB  . MET B 1 190 ? 28.326 -35.192  228.986 1.00 74.39  ? 190  MET B CB  1 
ATOM   3581 C  CG  . MET B 1 190 ? 28.412 -35.660  227.541 1.00 76.31  ? 190  MET B CG  1 
ATOM   3582 S  SD  . MET B 1 190 ? 29.855 -35.014  226.671 1.00 79.15  ? 190  MET B SD  1 
ATOM   3583 C  CE  . MET B 1 190 ? 31.143 -36.152  227.234 1.00 78.16  ? 190  MET B CE  1 
ATOM   3584 N  N   . VAL B 1 191 ? 26.086 -37.627  228.592 1.00 70.73  ? 191  VAL B N   1 
ATOM   3585 C  CA  . VAL B 1 191 ? 25.890 -39.028  228.230 1.00 68.67  ? 191  VAL B CA  1 
ATOM   3586 C  C   . VAL B 1 191 ? 26.559 -39.267  226.882 1.00 67.10  ? 191  VAL B C   1 
ATOM   3587 O  O   . VAL B 1 191 ? 26.181 -38.664  225.876 1.00 67.79  ? 191  VAL B O   1 
ATOM   3588 C  CB  . VAL B 1 191 ? 24.393 -39.387  228.126 1.00 68.00  ? 191  VAL B CB  1 
ATOM   3589 C  CG1 . VAL B 1 191 ? 24.235 -40.793  227.558 1.00 68.40  ? 191  VAL B CG1 1 
ATOM   3590 C  CG2 . VAL B 1 191 ? 23.750 -39.307  229.499 1.00 67.09  ? 191  VAL B CG2 1 
ATOM   3591 N  N   . PHE B 1 192 ? 27.554 -40.151  226.877 1.00 63.39  ? 192  PHE B N   1 
ATOM   3592 C  CA  . PHE B 1 192 ? 28.317 -40.469  225.673 1.00 58.72  ? 192  PHE B CA  1 
ATOM   3593 C  C   . PHE B 1 192 ? 28.517 -41.978  225.532 1.00 55.94  ? 192  PHE B C   1 
ATOM   3594 O  O   . PHE B 1 192 ? 28.270 -42.739  226.469 1.00 54.72  ? 192  PHE B O   1 
ATOM   3595 C  CB  . PHE B 1 192 ? 29.677 -39.779  225.758 1.00 58.67  ? 192  PHE B CB  1 
ATOM   3596 C  CG  . PHE B 1 192 ? 30.516 -40.251  226.913 1.00 59.69  ? 192  PHE B CG  1 
ATOM   3597 C  CD1 . PHE B 1 192 ? 31.473 -41.254  226.734 1.00 60.11  ? 192  PHE B CD1 1 
ATOM   3598 C  CD2 . PHE B 1 192 ? 30.315 -39.738  228.190 1.00 58.90  ? 192  PHE B CD2 1 
ATOM   3599 C  CE1 . PHE B 1 192 ? 32.217 -41.742  227.814 1.00 59.31  ? 192  PHE B CE1 1 
ATOM   3600 C  CE2 . PHE B 1 192 ? 31.053 -40.219  229.276 1.00 60.26  ? 192  PHE B CE2 1 
ATOM   3601 C  CZ  . PHE B 1 192 ? 32.005 -41.224  229.087 1.00 60.11  ? 192  PHE B CZ  1 
ATOM   3602 N  N   . ARG B 1 193 ? 28.971 -42.403  224.358 1.00 53.73  ? 193  ARG B N   1 
ATOM   3603 C  CA  . ARG B 1 193 ? 29.225 -43.817  224.099 1.00 51.32  ? 193  ARG B CA  1 
ATOM   3604 C  C   . ARG B 1 193 ? 30.624 -44.179  224.570 1.00 50.58  ? 193  ARG B C   1 
ATOM   3605 O  O   . ARG B 1 193 ? 31.611 -43.632  224.079 1.00 51.43  ? 193  ARG B O   1 
ATOM   3606 C  CB  . ARG B 1 193 ? 29.106 -44.119  222.607 1.00 50.46  ? 193  ARG B CB  1 
ATOM   3607 C  CG  . ARG B 1 193 ? 27.705 -43.979  222.071 1.00 52.06  ? 193  ARG B CG  1 
ATOM   3608 C  CD  . ARG B 1 193 ? 26.785 -45.034  222.656 1.00 51.96  ? 193  ARG B CD  1 
ATOM   3609 N  NE  . ARG B 1 193 ? 26.673 -46.188  221.777 1.00 51.91  ? 193  ARG B NE  1 
ATOM   3610 C  CZ  . ARG B 1 193 ? 26.085 -47.329  222.118 1.00 52.27  ? 193  ARG B CZ  1 
ATOM   3611 N  NH1 . ARG B 1 193 ? 25.559 -47.467  223.327 1.00 52.46  ? 193  ARG B NH1 1 
ATOM   3612 N  NH2 . ARG B 1 193 ? 26.017 -48.329  221.248 1.00 50.72  ? 193  ARG B NH2 1 
ATOM   3613 N  N   . ARG B 1 194 ? 30.702 -45.099  225.525 1.00 48.65  ? 194  ARG B N   1 
ATOM   3614 C  CA  . ARG B 1 194 ? 31.984 -45.537  226.050 1.00 47.62  ? 194  ARG B CA  1 
ATOM   3615 C  C   . ARG B 1 194 ? 32.352 -46.899  225.460 1.00 44.13  ? 194  ARG B C   1 
ATOM   3616 O  O   . ARG B 1 194 ? 31.489 -47.747  225.213 1.00 41.27  ? 194  ARG B O   1 
ATOM   3617 C  CB  . ARG B 1 194 ? 31.931 -45.620  227.578 1.00 50.27  ? 194  ARG B CB  1 
ATOM   3618 C  CG  . ARG B 1 194 ? 33.283 -45.878  228.237 1.00 56.34  ? 194  ARG B CG  1 
ATOM   3619 C  CD  . ARG B 1 194 ? 33.677 -44.761  229.210 1.00 61.98  ? 194  ARG B CD  1 
ATOM   3620 N  NE  . ARG B 1 194 ? 34.914 -44.090  228.800 1.00 68.54  ? 194  ARG B NE  1 
ATOM   3621 C  CZ  . ARG B 1 194 ? 35.483 -43.082  229.459 1.00 70.63  ? 194  ARG B CZ  1 
ATOM   3622 N  NH1 . ARG B 1 194 ? 34.926 -42.615  230.571 1.00 72.98  ? 194  ARG B NH1 1 
ATOM   3623 N  NH2 . ARG B 1 194 ? 36.614 -42.547  229.012 1.00 70.09  ? 194  ARG B NH2 1 
ATOM   3624 N  N   . PHE B 1 195 ? 33.643 -47.084  225.216 1.00 41.17  ? 195  PHE B N   1 
ATOM   3625 C  CA  . PHE B 1 195 ? 34.163 -48.326  224.664 1.00 35.86  ? 195  PHE B CA  1 
ATOM   3626 C  C   . PHE B 1 195 ? 34.893 -49.079  225.751 1.00 34.85  ? 195  PHE B C   1 
ATOM   3627 O  O   . PHE B 1 195 ? 35.522 -48.463  226.608 1.00 33.05  ? 195  PHE B O   1 
ATOM   3628 C  CB  . PHE B 1 195 ? 35.137 -48.045  223.531 1.00 30.91  ? 195  PHE B CB  1 
ATOM   3629 C  CG  . PHE B 1 195 ? 34.496 -47.478  222.313 1.00 31.02  ? 195  PHE B CG  1 
ATOM   3630 C  CD1 . PHE B 1 195 ? 34.047 -46.162  222.295 1.00 32.32  ? 195  PHE B CD1 1 
ATOM   3631 C  CD2 . PHE B 1 195 ? 34.330 -48.262  221.173 1.00 31.03  ? 195  PHE B CD2 1 
ATOM   3632 C  CE1 . PHE B 1 195 ? 33.443 -45.637  221.147 1.00 31.04  ? 195  PHE B CE1 1 
ATOM   3633 C  CE2 . PHE B 1 195 ? 33.730 -47.747  220.032 1.00 28.28  ? 195  PHE B CE2 1 
ATOM   3634 C  CZ  . PHE B 1 195 ? 33.287 -46.438  220.017 1.00 28.38  ? 195  PHE B CZ  1 
ATOM   3635 N  N   . HIS B 1 196 ? 34.793 -50.406  225.719 1.00 35.10  ? 196  HIS B N   1 
ATOM   3636 C  CA  . HIS B 1 196 ? 35.472 -51.268  226.693 1.00 34.36  ? 196  HIS B CA  1 
ATOM   3637 C  C   . HIS B 1 196 ? 36.079 -52.478  225.997 1.00 32.84  ? 196  HIS B C   1 
ATOM   3638 O  O   . HIS B 1 196 ? 35.351 -53.320  225.493 1.00 34.10  ? 196  HIS B O   1 
ATOM   3639 C  CB  . HIS B 1 196 ? 34.495 -51.773  227.754 1.00 33.54  ? 196  HIS B CB  1 
ATOM   3640 C  CG  . HIS B 1 196 ? 33.986 -50.707  228.673 1.00 33.40  ? 196  HIS B CG  1 
ATOM   3641 N  ND1 . HIS B 1 196 ? 34.521 -50.486  229.926 1.00 32.76  ? 196  HIS B ND1 1 
ATOM   3642 C  CD2 . HIS B 1 196 ? 32.980 -49.812  228.529 1.00 29.73  ? 196  HIS B CD2 1 
ATOM   3643 C  CE1 . HIS B 1 196 ? 33.863 -49.502  230.513 1.00 28.30  ? 196  HIS B CE1 1 
ATOM   3644 N  NE2 . HIS B 1 196 ? 32.924 -49.077  229.687 1.00 28.76  ? 196  HIS B NE2 1 
ATOM   3645 N  N   . ASP B 1 197 ? 37.406 -52.547  225.957 1.00 31.87  ? 197  ASP B N   1 
ATOM   3646 C  CA  . ASP B 1 197 ? 38.104 -53.676  225.358 1.00 29.34  ? 197  ASP B CA  1 
ATOM   3647 C  C   . ASP B 1 197 ? 38.042 -54.732  226.447 1.00 28.18  ? 197  ASP B C   1 
ATOM   3648 O  O   . ASP B 1 197 ? 38.704 -54.608  227.470 1.00 28.46  ? 197  ASP B O   1 
ATOM   3649 C  CB  . ASP B 1 197 ? 39.554 -53.289  225.054 1.00 31.60  ? 197  ASP B CB  1 
ATOM   3650 C  CG  . ASP B 1 197 ? 40.303 -54.354  224.250 1.00 35.87  ? 197  ASP B CG  1 
ATOM   3651 O  OD1 . ASP B 1 197 ? 39.681 -55.043  223.406 1.00 34.53  ? 197  ASP B OD1 1 
ATOM   3652 O  OD2 . ASP B 1 197 ? 41.531 -54.486  224.452 1.00 37.97  ? 197  ASP B OD2 1 
ATOM   3653 N  N   . LEU B 1 198 ? 37.223 -55.758  226.238 1.00 28.81  ? 198  LEU B N   1 
ATOM   3654 C  CA  . LEU B 1 198 ? 37.037 -56.818  227.230 1.00 26.37  ? 198  LEU B CA  1 
ATOM   3655 C  C   . LEU B 1 198 ? 38.183 -57.821  227.323 1.00 25.28  ? 198  LEU B C   1 
ATOM   3656 O  O   . LEU B 1 198 ? 38.710 -58.291  226.313 1.00 20.00  ? 198  LEU B O   1 
ATOM   3657 C  CB  . LEU B 1 198 ? 35.720 -57.552  226.938 1.00 29.08  ? 198  LEU B CB  1 
ATOM   3658 C  CG  . LEU B 1 198 ? 34.481 -56.642  226.919 1.00 27.97  ? 198  LEU B CG  1 
ATOM   3659 C  CD1 . LEU B 1 198 ? 33.265 -57.399  226.431 1.00 29.94  ? 198  LEU B CD1 1 
ATOM   3660 C  CD2 . LEU B 1 198 ? 34.234 -56.110  228.302 1.00 27.79  ? 198  LEU B CD2 1 
ATOM   3661 N  N   . THR B 1 199 ? 38.571 -58.142  228.552 1.00 27.19  ? 199  THR B N   1 
ATOM   3662 C  CA  . THR B 1 199 ? 39.652 -59.103  228.790 1.00 28.44  ? 199  THR B CA  1 
ATOM   3663 C  C   . THR B 1 199 ? 39.270 -60.512  228.305 1.00 30.50  ? 199  THR B C   1 
ATOM   3664 O  O   . THR B 1 199 ? 38.272 -61.085  228.746 1.00 29.45  ? 199  THR B O   1 
ATOM   3665 C  CB  . THR B 1 199 ? 39.980 -59.186  230.285 1.00 27.85  ? 199  THR B CB  1 
ATOM   3666 O  OG1 . THR B 1 199 ? 40.367 -57.897  230.753 1.00 28.45  ? 199  THR B OG1 1 
ATOM   3667 C  CG2 . THR B 1 199 ? 41.119 -60.166  230.537 1.00 30.32  ? 199  THR B CG2 1 
ATOM   3668 N  N   . LEU B 1 200 ? 40.066 -61.070  227.400 1.00 30.64  ? 200  LEU B N   1 
ATOM   3669 C  CA  . LEU B 1 200 ? 39.790 -62.404  226.888 1.00 30.30  ? 200  LEU B CA  1 
ATOM   3670 C  C   . LEU B 1 200 ? 40.728 -63.417  227.556 1.00 32.40  ? 200  LEU B C   1 
ATOM   3671 O  O   . LEU B 1 200 ? 41.817 -63.053  227.998 1.00 32.58  ? 200  LEU B O   1 
ATOM   3672 C  CB  . LEU B 1 200 ? 39.982 -62.430  225.372 1.00 27.22  ? 200  LEU B CB  1 
ATOM   3673 C  CG  . LEU B 1 200 ? 39.193 -61.407  224.543 1.00 29.37  ? 200  LEU B CG  1 
ATOM   3674 C  CD1 . LEU B 1 200 ? 39.343 -61.728  223.067 1.00 24.45  ? 200  LEU B CD1 1 
ATOM   3675 C  CD2 . LEU B 1 200 ? 37.726 -61.418  224.934 1.00 27.83  ? 200  LEU B CD2 1 
ATOM   3676 N  N   . THR B 1 201 ? 40.295 -64.675  227.657 1.00 32.46  ? 201  THR B N   1 
ATOM   3677 C  CA  . THR B 1 201 ? 41.131 -65.711  228.255 1.00 32.32  ? 201  THR B CA  1 
ATOM   3678 C  C   . THR B 1 201 ? 42.316 -65.901  227.315 1.00 33.33  ? 201  THR B C   1 
ATOM   3679 O  O   . THR B 1 201 ? 43.428 -66.210  227.737 1.00 30.73  ? 201  THR B O   1 
ATOM   3680 C  CB  . THR B 1 201 ? 40.368 -67.040  228.398 1.00 30.40  ? 201  THR B CB  1 
ATOM   3681 O  OG1 . THR B 1 201 ? 39.774 -67.383  227.146 1.00 34.81  ? 201  THR B OG1 1 
ATOM   3682 C  CG2 . THR B 1 201 ? 39.275 -66.920  229.445 1.00 28.73  ? 201  THR B CG2 1 
ATOM   3683 N  N   . ARG B 1 202 ? 42.050 -65.690  226.033 1.00 35.48  ? 202  ARG B N   1 
ATOM   3684 C  CA  . ARG B 1 202 ? 43.046 -65.783  224.982 1.00 38.10  ? 202  ARG B CA  1 
ATOM   3685 C  C   . ARG B 1 202 ? 42.621 -64.816  223.874 1.00 38.45  ? 202  ARG B C   1 
ATOM   3686 O  O   . ARG B 1 202 ? 41.516 -64.917  223.347 1.00 36.59  ? 202  ARG B O   1 
ATOM   3687 C  CB  . ARG B 1 202 ? 43.123 -67.204  224.429 1.00 41.45  ? 202  ARG B CB  1 
ATOM   3688 C  CG  . ARG B 1 202 ? 44.081 -67.316  223.240 1.00 49.00  ? 202  ARG B CG  1 
ATOM   3689 C  CD  . ARG B 1 202 ? 44.363 -68.762  222.825 1.00 53.80  ? 202  ARG B CD  1 
ATOM   3690 N  NE  . ARG B 1 202 ? 45.783 -68.960  222.530 1.00 56.49  ? 202  ARG B NE  1 
ATOM   3691 C  CZ  . ARG B 1 202 ? 46.750 -68.908  223.448 1.00 60.29  ? 202  ARG B CZ  1 
ATOM   3692 N  NH1 . ARG B 1 202 ? 46.448 -68.669  224.724 1.00 63.14  ? 202  ARG B NH1 1 
ATOM   3693 N  NH2 . ARG B 1 202 ? 48.021 -69.082  223.098 1.00 59.96  ? 202  ARG B NH2 1 
ATOM   3694 N  N   . SER B 1 203 ? 43.493 -63.874  223.529 1.00 40.08  ? 203  SER B N   1 
ATOM   3695 C  CA  . SER B 1 203 ? 43.181 -62.901  222.489 1.00 42.96  ? 203  SER B CA  1 
ATOM   3696 C  C   . SER B 1 203 ? 44.124 -63.021  221.304 1.00 44.28  ? 203  SER B C   1 
ATOM   3697 O  O   . SER B 1 203 ? 43.860 -62.491  220.227 1.00 42.63  ? 203  SER B O   1 
ATOM   3698 C  CB  . SER B 1 203 ? 43.255 -61.488  223.053 1.00 41.67  ? 203  SER B CB  1 
ATOM   3699 O  OG  . SER B 1 203 ? 44.553 -61.228  223.521 1.00 43.47  ? 203  SER B OG  1 
ATOM   3700 N  N   . ARG B 1 204 ? 45.229 -63.725  221.510 1.00 48.24  ? 204  ARG B N   1 
ATOM   3701 C  CA  . ARG B 1 204 ? 46.206 -63.920  220.452 1.00 49.61  ? 204  ARG B CA  1 
ATOM   3702 C  C   . ARG B 1 204 ? 46.332 -65.395  220.133 1.00 49.18  ? 204  ARG B C   1 
ATOM   3703 O  O   . ARG B 1 204 ? 46.416 -66.222  221.024 1.00 50.74  ? 204  ARG B O   1 
ATOM   3704 C  CB  . ARG B 1 204 ? 47.570 -63.354  220.875 1.00 51.95  ? 204  ARG B CB  1 
ATOM   3705 C  CG  . ARG B 1 204 ? 48.688 -63.490  219.834 1.00 54.14  ? 204  ARG B CG  1 
ATOM   3706 C  CD  . ARG B 1 204 ? 48.187 -63.191  218.423 1.00 58.48  ? 204  ARG B CD  1 
ATOM   3707 N  NE  . ARG B 1 204 ? 49.245 -62.728  217.534 1.00 61.33  ? 204  ARG B NE  1 
ATOM   3708 C  CZ  . ARG B 1 204 ? 49.824 -61.534  217.630 1.00 64.45  ? 204  ARG B CZ  1 
ATOM   3709 N  NH1 . ARG B 1 204 ? 49.444 -60.684  218.577 1.00 65.93  ? 204  ARG B NH1 1 
ATOM   3710 N  NH2 . ARG B 1 204 ? 50.786 -61.186  216.788 1.00 66.10  ? 204  ARG B NH2 1 
ATOM   3711 N  N   . SER B 1 205 ? 46.322 -65.716  218.849 1.00 50.55  ? 205  SER B N   1 
ATOM   3712 C  CA  . SER B 1 205 ? 46.466 -67.090  218.396 1.00 50.53  ? 205  SER B CA  1 
ATOM   3713 C  C   . SER B 1 205 ? 47.582 -67.093  217.348 1.00 50.64  ? 205  SER B C   1 
ATOM   3714 O  O   . SER B 1 205 ? 47.443 -66.486  216.285 1.00 47.65  ? 205  SER B O   1 
ATOM   3715 C  CB  . SER B 1 205 ? 45.158 -67.591  217.780 1.00 49.03  ? 205  SER B CB  1 
ATOM   3716 O  OG  . SER B 1 205 ? 45.338 -68.866  217.195 1.00 46.81  ? 205  SER B OG  1 
ATOM   3717 N  N   . PRO B 1 206 ? 48.719 -67.747  217.654 1.00 51.89  ? 206  PRO B N   1 
ATOM   3718 C  CA  . PRO B 1 206 ? 49.850 -67.812  216.721 1.00 51.00  ? 206  PRO B CA  1 
ATOM   3719 C  C   . PRO B 1 206 ? 49.479 -68.459  215.388 1.00 49.67  ? 206  PRO B C   1 
ATOM   3720 O  O   . PRO B 1 206 ? 49.955 -68.033  214.328 1.00 49.27  ? 206  PRO B O   1 
ATOM   3721 C  CB  . PRO B 1 206 ? 50.890 -68.607  217.505 1.00 53.42  ? 206  PRO B CB  1 
ATOM   3722 C  CG  . PRO B 1 206 ? 50.614 -68.174  218.932 1.00 54.19  ? 206  PRO B CG  1 
ATOM   3723 C  CD  . PRO B 1 206 ? 49.106 -68.272  218.980 1.00 52.46  ? 206  PRO B CD  1 
ATOM   3724 N  N   . ILE B 1 207 ? 48.628 -69.480  215.443 1.00 47.54  ? 207  ILE B N   1 
ATOM   3725 C  CA  . ILE B 1 207 ? 48.175 -70.154  214.233 1.00 48.74  ? 207  ILE B CA  1 
ATOM   3726 C  C   . ILE B 1 207 ? 46.690 -70.496  214.314 1.00 49.06  ? 207  ILE B C   1 
ATOM   3727 O  O   . ILE B 1 207 ? 46.291 -71.357  215.100 1.00 51.49  ? 207  ILE B O   1 
ATOM   3728 C  CB  . ILE B 1 207 ? 48.973 -71.444  213.973 1.00 51.51  ? 207  ILE B CB  1 
ATOM   3729 C  CG1 . ILE B 1 207 ? 50.444 -71.095  213.721 1.00 52.84  ? 207  ILE B CG1 1 
ATOM   3730 C  CG2 . ILE B 1 207 ? 48.376 -72.196  212.782 1.00 50.10  ? 207  ILE B CG2 1 
ATOM   3731 C  CD1 . ILE B 1 207 ? 51.326 -72.287  213.458 1.00 56.11  ? 207  ILE B CD1 1 
ATOM   3732 N  N   . PHE B 1 208 ? 45.881 -69.814  213.502 1.00 47.26  ? 208  PHE B N   1 
ATOM   3733 C  CA  . PHE B 1 208 ? 44.431 -70.021  213.458 1.00 46.30  ? 208  PHE B CA  1 
ATOM   3734 C  C   . PHE B 1 208 ? 44.132 -70.953  212.304 1.00 45.32  ? 208  PHE B C   1 
ATOM   3735 O  O   . PHE B 1 208 ? 44.351 -70.602  211.147 1.00 45.83  ? 208  PHE B O   1 
ATOM   3736 C  CB  . PHE B 1 208 ? 43.711 -68.681  213.248 1.00 44.39  ? 208  PHE B CB  1 
ATOM   3737 C  CG  . PHE B 1 208 ? 42.211 -68.780  213.230 1.00 42.98  ? 208  PHE B CG  1 
ATOM   3738 C  CD1 . PHE B 1 208 ? 41.524 -69.407  214.260 1.00 44.58  ? 208  PHE B CD1 1 
ATOM   3739 C  CD2 . PHE B 1 208 ? 41.477 -68.185  212.212 1.00 44.99  ? 208  PHE B CD2 1 
ATOM   3740 C  CE1 . PHE B 1 208 ? 40.127 -69.434  214.279 1.00 43.44  ? 208  PHE B CE1 1 
ATOM   3741 C  CE2 . PHE B 1 208 ? 40.079 -68.205  212.222 1.00 43.61  ? 208  PHE B CE2 1 
ATOM   3742 C  CZ  . PHE B 1 208 ? 39.407 -68.829  213.257 1.00 42.97  ? 208  PHE B CZ  1 
ATOM   3743 N  N   . SER B 1 209 ? 43.620 -72.137  212.613 1.00 46.76  ? 209  SER B N   1 
ATOM   3744 C  CA  . SER B 1 209 ? 43.341 -73.120  211.567 1.00 47.54  ? 209  SER B CA  1 
ATOM   3745 C  C   . SER B 1 209 ? 41.898 -73.561  211.412 1.00 45.48  ? 209  SER B C   1 
ATOM   3746 O  O   . SER B 1 209 ? 41.392 -73.655  210.298 1.00 46.62  ? 209  SER B O   1 
ATOM   3747 C  CB  . SER B 1 209 ? 44.197 -74.374  211.790 1.00 48.71  ? 209  SER B CB  1 
ATOM   3748 O  OG  . SER B 1 209 ? 45.579 -74.062  211.814 1.00 50.97  ? 209  SER B OG  1 
ATOM   3749 N  N   . LEU B 1 210 ? 41.240 -73.834  212.530 1.00 45.09  ? 210  LEU B N   1 
ATOM   3750 C  CA  . LEU B 1 210 ? 39.867 -74.327  212.497 1.00 43.75  ? 210  LEU B CA  1 
ATOM   3751 C  C   . LEU B 1 210 ? 38.822 -73.400  213.116 1.00 42.39  ? 210  LEU B C   1 
ATOM   3752 O  O   . LEU B 1 210 ? 38.273 -72.513  212.459 1.00 43.10  ? 210  LEU B O   1 
ATOM   3753 C  CB  . LEU B 1 210 ? 39.822 -75.688  213.206 1.00 44.71  ? 210  LEU B CB  1 
ATOM   3754 C  CG  . LEU B 1 210 ? 40.928 -76.658  212.766 1.00 45.73  ? 210  LEU B CG  1 
ATOM   3755 C  CD1 . LEU B 1 210 ? 41.146 -77.737  213.828 1.00 46.01  ? 210  LEU B CD1 1 
ATOM   3756 C  CD2 . LEU B 1 210 ? 40.571 -77.251  211.413 1.00 42.51  ? 210  LEU B CD2 1 
ATOM   3757 N  N   . SER B 1 211 ? 38.542 -73.632  214.389 1.00 39.83  ? 211  SER B N   1 
ATOM   3758 C  CA  . SER B 1 211 ? 37.552 -72.854  215.100 1.00 38.69  ? 211  SER B CA  1 
ATOM   3759 C  C   . SER B 1 211 ? 38.250 -72.255  216.306 1.00 37.76  ? 211  SER B C   1 
ATOM   3760 O  O   . SER B 1 211 ? 39.339 -72.691  216.672 1.00 40.47  ? 211  SER B O   1 
ATOM   3761 C  CB  . SER B 1 211 ? 36.385 -73.760  215.525 1.00 37.76  ? 211  SER B CB  1 
ATOM   3762 O  OG  . SER B 1 211 ? 35.269 -73.000  215.967 1.00 37.75  ? 211  SER B OG  1 
ATOM   3763 N  N   . TRP B 1 212 ? 37.629 -71.255  216.921 1.00 34.08  ? 212  TRP B N   1 
ATOM   3764 C  CA  . TRP B 1 212 ? 38.230 -70.591  218.065 1.00 29.86  ? 212  TRP B CA  1 
ATOM   3765 C  C   . TRP B 1 212 ? 37.108 -69.985  218.882 1.00 29.41  ? 212  TRP B C   1 
ATOM   3766 O  O   . TRP B 1 212 ? 36.358 -69.155  218.392 1.00 28.79  ? 212  TRP B O   1 
ATOM   3767 C  CB  . TRP B 1 212 ? 39.207 -69.515  217.557 1.00 27.49  ? 212  TRP B CB  1 
ATOM   3768 C  CG  . TRP B 1 212 ? 39.852 -68.640  218.598 1.00 23.85  ? 212  TRP B CG  1 
ATOM   3769 C  CD1 . TRP B 1 212 ? 39.760 -68.760  219.952 1.00 22.48  ? 212  TRP B CD1 1 
ATOM   3770 C  CD2 . TRP B 1 212 ? 40.713 -67.515  218.354 1.00 23.50  ? 212  TRP B CD2 1 
ATOM   3771 N  NE1 . TRP B 1 212 ? 40.505 -67.784  220.568 1.00 21.11  ? 212  TRP B NE1 1 
ATOM   3772 C  CE2 . TRP B 1 212 ? 41.102 -67.006  219.613 1.00 22.01  ? 212  TRP B CE2 1 
ATOM   3773 C  CE3 . TRP B 1 212 ? 41.195 -66.893  217.195 1.00 19.91  ? 212  TRP B CE3 1 
ATOM   3774 C  CZ2 . TRP B 1 212 ? 41.950 -65.899  219.748 1.00 22.28  ? 212  TRP B CZ2 1 
ATOM   3775 C  CZ3 . TRP B 1 212 ? 42.041 -65.789  217.331 1.00 23.17  ? 212  TRP B CZ3 1 
ATOM   3776 C  CH2 . TRP B 1 212 ? 42.409 -65.305  218.596 1.00 18.86  ? 212  TRP B CH2 1 
ATOM   3777 N  N   . THR B 1 213 ? 36.970 -70.431  220.122 1.00 30.59  ? 213  THR B N   1 
ATOM   3778 C  CA  . THR B 1 213 ? 35.923 -69.901  220.971 1.00 32.28  ? 213  THR B CA  1 
ATOM   3779 C  C   . THR B 1 213 ? 36.547 -68.816  221.821 1.00 32.20  ? 213  THR B C   1 
ATOM   3780 O  O   . THR B 1 213 ? 37.441 -69.072  222.630 1.00 33.30  ? 213  THR B O   1 
ATOM   3781 C  CB  . THR B 1 213 ? 35.296 -71.015  221.847 1.00 34.30  ? 213  THR B CB  1 
ATOM   3782 O  OG1 . THR B 1 213 ? 34.788 -72.040  220.985 1.00 33.92  ? 213  THR B OG1 1 
ATOM   3783 C  CG2 . THR B 1 213 ? 34.126 -70.468  222.694 1.00 30.65  ? 213  THR B CG2 1 
ATOM   3784 N  N   . VAL B 1 214 ? 36.085 -67.595  221.581 1.00 31.92  ? 214  VAL B N   1 
ATOM   3785 C  CA  . VAL B 1 214 ? 36.558 -66.402  222.260 1.00 30.47  ? 214  VAL B CA  1 
ATOM   3786 C  C   . VAL B 1 214 ? 35.712 -66.191  223.493 1.00 30.67  ? 214  VAL B C   1 
ATOM   3787 O  O   . VAL B 1 214 ? 34.507 -66.029  223.396 1.00 33.32  ? 214  VAL B O   1 
ATOM   3788 C  CB  . VAL B 1 214 ? 36.441 -65.193  221.305 1.00 31.59  ? 214  VAL B CB  1 
ATOM   3789 C  CG1 . VAL B 1 214 ? 36.678 -63.876  222.051 1.00 25.94  ? 214  VAL B CG1 1 
ATOM   3790 C  CG2 . VAL B 1 214 ? 37.430 -65.374  220.155 1.00 27.56  ? 214  VAL B CG2 1 
ATOM   3791 N  N   . MET B 1 215 ? 36.349 -66.170  224.654 1.00 33.06  ? 215  MET B N   1 
ATOM   3792 C  CA  . MET B 1 215 ? 35.612 -66.030  225.904 1.00 33.29  ? 215  MET B CA  1 
ATOM   3793 C  C   . MET B 1 215 ? 36.047 -64.862  226.758 1.00 32.22  ? 215  MET B C   1 
ATOM   3794 O  O   . MET B 1 215 ? 37.236 -64.550  226.846 1.00 33.28  ? 215  MET B O   1 
ATOM   3795 C  CB  . MET B 1 215 ? 35.767 -67.305  226.745 1.00 34.71  ? 215  MET B CB  1 
ATOM   3796 C  CG  . MET B 1 215 ? 35.571 -68.607  225.980 1.00 36.03  ? 215  MET B CG  1 
ATOM   3797 S  SD  . MET B 1 215 ? 35.969 -70.025  227.025 1.00 39.24  ? 215  MET B SD  1 
ATOM   3798 C  CE  . MET B 1 215 ? 37.740 -69.923  227.043 1.00 37.93  ? 215  MET B CE  1 
ATOM   3799 N  N   . HIS B 1 216 ? 35.069 -64.234  227.400 1.00 29.55  ? 216  HIS B N   1 
ATOM   3800 C  CA  . HIS B 1 216 ? 35.321 -63.129  228.300 1.00 28.49  ? 216  HIS B CA  1 
ATOM   3801 C  C   . HIS B 1 216 ? 34.810 -63.487  229.700 1.00 29.02  ? 216  HIS B C   1 
ATOM   3802 O  O   . HIS B 1 216 ? 33.604 -63.495  229.954 1.00 28.90  ? 216  HIS B O   1 
ATOM   3803 C  CB  . HIS B 1 216 ? 34.613 -61.858  227.835 1.00 27.90  ? 216  HIS B CB  1 
ATOM   3804 C  CG  . HIS B 1 216 ? 34.651 -60.758  228.853 1.00 31.13  ? 216  HIS B CG  1 
ATOM   3805 N  ND1 . HIS B 1 216 ? 33.513 -60.211  229.406 1.00 32.03  ? 216  HIS B ND1 1 
ATOM   3806 C  CD2 . HIS B 1 216 ? 35.696 -60.144  229.461 1.00 30.74  ? 216  HIS B CD2 1 
ATOM   3807 C  CE1 . HIS B 1 216 ? 33.855 -59.311  230.313 1.00 32.77  ? 216  HIS B CE1 1 
ATOM   3808 N  NE2 . HIS B 1 216 ? 35.174 -59.253  230.367 1.00 31.82  ? 216  HIS B NE2 1 
ATOM   3809 N  N   . PRO B 1 217 ? 35.716 -63.814  230.622 1.00 27.81  ? 217  PRO B N   1 
ATOM   3810 C  CA  . PRO B 1 217 ? 35.221 -64.148  231.958 1.00 28.77  ? 217  PRO B CA  1 
ATOM   3811 C  C   . PRO B 1 217 ? 34.645 -62.906  232.611 1.00 31.15  ? 217  PRO B C   1 
ATOM   3812 O  O   . PRO B 1 217 ? 35.314 -61.876  232.688 1.00 33.62  ? 217  PRO B O   1 
ATOM   3813 C  CB  . PRO B 1 217 ? 36.473 -64.643  232.672 1.00 28.96  ? 217  PRO B CB  1 
ATOM   3814 C  CG  . PRO B 1 217 ? 37.264 -65.269  231.557 1.00 27.21  ? 217  PRO B CG  1 
ATOM   3815 C  CD  . PRO B 1 217 ? 37.112 -64.246  230.450 1.00 27.33  ? 217  PRO B CD  1 
ATOM   3816 N  N   . ILE B 1 218 ? 33.401 -62.985  233.068 1.00 32.17  ? 218  ILE B N   1 
ATOM   3817 C  CA  . ILE B 1 218 ? 32.781 -61.844  233.720 1.00 32.12  ? 218  ILE B CA  1 
ATOM   3818 C  C   . ILE B 1 218 ? 33.118 -61.871  235.207 1.00 35.37  ? 218  ILE B C   1 
ATOM   3819 O  O   . ILE B 1 218 ? 32.330 -62.318  236.037 1.00 35.84  ? 218  ILE B O   1 
ATOM   3820 C  CB  . ILE B 1 218 ? 31.263 -61.864  233.536 1.00 30.94  ? 218  ILE B CB  1 
ATOM   3821 C  CG1 . ILE B 1 218 ? 30.938 -61.836  232.041 1.00 33.18  ? 218  ILE B CG1 1 
ATOM   3822 C  CG2 . ILE B 1 218 ? 30.636 -60.672  234.255 1.00 26.45  ? 218  ILE B CG2 1 
ATOM   3823 C  CD1 . ILE B 1 218 ? 29.514 -62.225  231.701 1.00 33.47  ? 218  ILE B CD1 1 
ATOM   3824 N  N   . ASP B 1 219 ? 34.310 -61.395  235.536 1.00 38.09  ? 219  ASP B N   1 
ATOM   3825 C  CA  . ASP B 1 219 ? 34.756 -61.358  236.918 1.00 41.07  ? 219  ASP B CA  1 
ATOM   3826 C  C   . ASP B 1 219 ? 34.447 -59.982  237.510 1.00 43.39  ? 219  ASP B C   1 
ATOM   3827 O  O   . ASP B 1 219 ? 33.845 -59.142  236.838 1.00 43.31  ? 219  ASP B O   1 
ATOM   3828 C  CB  . ASP B 1 219 ? 36.259 -61.662  236.980 1.00 41.44  ? 219  ASP B CB  1 
ATOM   3829 C  CG  . ASP B 1 219 ? 37.094 -60.693  236.160 1.00 42.50  ? 219  ASP B CG  1 
ATOM   3830 O  OD1 . ASP B 1 219 ? 38.285 -61.002  235.921 1.00 43.73  ? 219  ASP B OD1 1 
ATOM   3831 O  OD2 . ASP B 1 219 ? 36.572 -59.627  235.761 1.00 41.70  ? 219  ASP B OD2 1 
ATOM   3832 N  N   . HIS B 1 220 ? 34.846 -59.754  238.760 1.00 45.39  ? 220  HIS B N   1 
ATOM   3833 C  CA  . HIS B 1 220 ? 34.593 -58.472  239.415 1.00 46.29  ? 220  HIS B CA  1 
ATOM   3834 C  C   . HIS B 1 220 ? 35.097 -57.282  238.617 1.00 45.01  ? 220  HIS B C   1 
ATOM   3835 O  O   . HIS B 1 220 ? 34.583 -56.179  238.758 1.00 44.73  ? 220  HIS B O   1 
ATOM   3836 C  CB  . HIS B 1 220 ? 35.229 -58.440  240.808 1.00 49.80  ? 220  HIS B CB  1 
ATOM   3837 C  CG  . HIS B 1 220 ? 34.431 -59.159  241.851 1.00 56.15  ? 220  HIS B CG  1 
ATOM   3838 N  ND1 . HIS B 1 220 ? 34.451 -60.531  241.994 1.00 59.61  ? 220  HIS B ND1 1 
ATOM   3839 C  CD2 . HIS B 1 220 ? 33.556 -58.697  242.778 1.00 58.21  ? 220  HIS B CD2 1 
ATOM   3840 C  CE1 . HIS B 1 220 ? 33.625 -60.884  242.962 1.00 59.51  ? 220  HIS B CE1 1 
ATOM   3841 N  NE2 . HIS B 1 220 ? 33.069 -59.790  243.455 1.00 59.86  ? 220  HIS B NE2 1 
ATOM   3842 N  N   . HIS B 1 221 ? 36.096 -57.510  237.773 1.00 45.11  ? 221  HIS B N   1 
ATOM   3843 C  CA  . HIS B 1 221 ? 36.677 -56.444  236.968 1.00 45.28  ? 221  HIS B CA  1 
ATOM   3844 C  C   . HIS B 1 221 ? 35.978 -56.198  235.643 1.00 42.95  ? 221  HIS B C   1 
ATOM   3845 O  O   . HIS B 1 221 ? 36.346 -55.283  234.915 1.00 44.71  ? 221  HIS B O   1 
ATOM   3846 C  CB  . HIS B 1 221 ? 38.152 -56.746  236.695 1.00 49.19  ? 221  HIS B CB  1 
ATOM   3847 C  CG  . HIS B 1 221 ? 39.006 -56.730  237.924 1.00 56.09  ? 221  HIS B CG  1 
ATOM   3848 N  ND1 . HIS B 1 221 ? 39.915 -57.727  238.214 1.00 58.38  ? 221  HIS B ND1 1 
ATOM   3849 C  CD2 . HIS B 1 221 ? 39.087 -55.838  238.941 1.00 57.19  ? 221  HIS B CD2 1 
ATOM   3850 C  CE1 . HIS B 1 221 ? 40.517 -57.450  239.357 1.00 57.81  ? 221  HIS B CE1 1 
ATOM   3851 N  NE2 . HIS B 1 221 ? 40.033 -56.310  239.819 1.00 58.82  ? 221  HIS B NE2 1 
ATOM   3852 N  N   . SER B 1 222 ? 34.975 -57.003  235.323 1.00 40.59  ? 222  SER B N   1 
ATOM   3853 C  CA  . SER B 1 222 ? 34.275 -56.853  234.057 1.00 37.67  ? 222  SER B CA  1 
ATOM   3854 C  C   . SER B 1 222 ? 33.284 -55.696  234.003 1.00 39.36  ? 222  SER B C   1 
ATOM   3855 O  O   . SER B 1 222 ? 32.606 -55.390  234.979 1.00 39.74  ? 222  SER B O   1 
ATOM   3856 C  CB  . SER B 1 222 ? 33.539 -58.148  233.718 1.00 35.83  ? 222  SER B CB  1 
ATOM   3857 O  OG  . SER B 1 222 ? 32.761 -57.990  232.547 1.00 32.53  ? 222  SER B OG  1 
ATOM   3858 N  N   . PRO B 1 223 ? 33.198 -55.027  232.849 1.00 39.82  ? 223  PRO B N   1 
ATOM   3859 C  CA  . PRO B 1 223 ? 32.275 -53.910  232.679 1.00 39.64  ? 223  PRO B CA  1 
ATOM   3860 C  C   . PRO B 1 223 ? 30.834 -54.422  232.737 1.00 41.46  ? 223  PRO B C   1 
ATOM   3861 O  O   . PRO B 1 223 ? 29.924 -53.674  233.074 1.00 42.00  ? 223  PRO B O   1 
ATOM   3862 C  CB  . PRO B 1 223 ? 32.606 -53.384  231.285 1.00 40.16  ? 223  PRO B CB  1 
ATOM   3863 C  CG  . PRO B 1 223 ? 33.989 -53.829  231.045 1.00 40.88  ? 223  PRO B CG  1 
ATOM   3864 C  CD  . PRO B 1 223 ? 34.056 -55.187  231.664 1.00 41.38  ? 223  PRO B CD  1 
ATOM   3865 N  N   . ILE B 1 224 ? 30.620 -55.690  232.384 1.00 42.40  ? 224  ILE B N   1 
ATOM   3866 C  CA  . ILE B 1 224 ? 29.267 -56.235  232.403 1.00 42.43  ? 224  ILE B CA  1 
ATOM   3867 C  C   . ILE B 1 224 ? 28.990 -57.058  233.642 1.00 42.93  ? 224  ILE B C   1 
ATOM   3868 O  O   . ILE B 1 224 ? 28.044 -57.835  233.685 1.00 45.02  ? 224  ILE B O   1 
ATOM   3869 C  CB  . ILE B 1 224 ? 28.943 -57.103  231.148 1.00 41.88  ? 224  ILE B CB  1 
ATOM   3870 C  CG1 . ILE B 1 224 ? 29.931 -58.257  231.023 1.00 41.23  ? 224  ILE B CG1 1 
ATOM   3871 C  CG2 . ILE B 1 224 ? 28.958 -56.240  229.892 1.00 41.56  ? 224  ILE B CG2 1 
ATOM   3872 C  CD1 . ILE B 1 224 ? 29.530 -59.248  229.975 1.00 37.32  ? 224  ILE B CD1 1 
ATOM   3873 N  N   . TYR B 1 225 ? 29.816 -56.881  234.660 1.00 44.20  ? 225  TYR B N   1 
ATOM   3874 C  CA  . TYR B 1 225 ? 29.625 -57.604  235.905 1.00 44.42  ? 225  TYR B CA  1 
ATOM   3875 C  C   . TYR B 1 225 ? 28.360 -57.087  236.576 1.00 44.61  ? 225  TYR B C   1 
ATOM   3876 O  O   . TYR B 1 225 ? 28.225 -55.894  236.826 1.00 44.92  ? 225  TYR B O   1 
ATOM   3877 C  CB  . TYR B 1 225 ? 30.810 -57.373  236.834 1.00 45.24  ? 225  TYR B CB  1 
ATOM   3878 C  CG  . TYR B 1 225 ? 30.721 -58.139  238.129 1.00 47.24  ? 225  TYR B CG  1 
ATOM   3879 C  CD1 . TYR B 1 225 ? 30.909 -59.516  238.152 1.00 47.10  ? 225  TYR B CD1 1 
ATOM   3880 C  CD2 . TYR B 1 225 ? 30.447 -57.490  239.332 1.00 47.58  ? 225  TYR B CD2 1 
ATOM   3881 C  CE1 . TYR B 1 225 ? 30.832 -60.233  239.329 1.00 47.75  ? 225  TYR B CE1 1 
ATOM   3882 C  CE2 . TYR B 1 225 ? 30.366 -58.202  240.525 1.00 47.94  ? 225  TYR B CE2 1 
ATOM   3883 C  CZ  . TYR B 1 225 ? 30.563 -59.576  240.514 1.00 49.47  ? 225  TYR B CZ  1 
ATOM   3884 O  OH  . TYR B 1 225 ? 30.519 -60.301  241.681 1.00 48.97  ? 225  TYR B OH  1 
ATOM   3885 N  N   . GLY B 1 226 ? 27.428 -57.981  236.864 1.00 44.50  ? 226  GLY B N   1 
ATOM   3886 C  CA  . GLY B 1 226 ? 26.211 -57.554  237.519 1.00 44.66  ? 226  GLY B CA  1 
ATOM   3887 C  C   . GLY B 1 226 ? 25.168 -57.042  236.553 1.00 45.84  ? 226  GLY B C   1 
ATOM   3888 O  O   . GLY B 1 226 ? 24.073 -56.660  236.959 1.00 47.44  ? 226  GLY B O   1 
ATOM   3889 N  N   . GLU B 1 227 ? 25.509 -57.007  235.272 1.00 46.17  ? 227  GLU B N   1 
ATOM   3890 C  CA  . GLU B 1 227 ? 24.556 -56.566  234.272 1.00 46.61  ? 227  GLU B CA  1 
ATOM   3891 C  C   . GLU B 1 227 ? 23.599 -57.722  233.996 1.00 46.35  ? 227  GLU B C   1 
ATOM   3892 O  O   . GLU B 1 227 ? 23.900 -58.880  234.281 1.00 46.62  ? 227  GLU B O   1 
ATOM   3893 C  CB  . GLU B 1 227 ? 25.262 -56.192  232.973 1.00 48.50  ? 227  GLU B CB  1 
ATOM   3894 C  CG  . GLU B 1 227 ? 26.194 -55.011  233.061 1.00 52.51  ? 227  GLU B CG  1 
ATOM   3895 C  CD  . GLU B 1 227 ? 25.478 -53.713  233.339 1.00 54.05  ? 227  GLU B CD  1 
ATOM   3896 O  OE1 . GLU B 1 227 ? 25.153 -53.456  234.513 1.00 58.45  ? 227  GLU B OE1 1 
ATOM   3897 O  OE2 . GLU B 1 227 ? 25.235 -52.951  232.380 1.00 54.65  ? 227  GLU B OE2 1 
ATOM   3898 N  N   . THR B 1 228 ? 22.446 -57.391  233.434 1.00 47.14  ? 228  THR B N   1 
ATOM   3899 C  CA  . THR B 1 228 ? 21.427 -58.368  233.084 1.00 48.70  ? 228  THR B CA  1 
ATOM   3900 C  C   . THR B 1 228 ? 21.021 -58.015  231.664 1.00 49.57  ? 228  THR B C   1 
ATOM   3901 O  O   . THR B 1 228 ? 21.494 -57.022  231.113 1.00 49.17  ? 228  THR B O   1 
ATOM   3902 C  CB  . THR B 1 228 ? 20.190 -58.238  233.997 1.00 49.48  ? 228  THR B CB  1 
ATOM   3903 O  OG1 . THR B 1 228 ? 19.687 -56.896  233.929 1.00 48.44  ? 228  THR B OG1 1 
ATOM   3904 C  CG2 . THR B 1 228 ? 20.550 -58.567  235.440 1.00 48.73  ? 228  THR B CG2 1 
ATOM   3905 N  N   . ASP B 1 229 ? 20.150 -58.812  231.066 1.00 50.57  ? 229  ASP B N   1 
ATOM   3906 C  CA  . ASP B 1 229 ? 19.718 -58.510  229.715 1.00 53.23  ? 229  ASP B CA  1 
ATOM   3907 C  C   . ASP B 1 229 ? 19.013 -57.153  229.703 1.00 54.01  ? 229  ASP B C   1 
ATOM   3908 O  O   . ASP B 1 229 ? 19.097 -56.405  228.730 1.00 54.30  ? 229  ASP B O   1 
ATOM   3909 C  CB  . ASP B 1 229 ? 18.771 -59.594  229.202 1.00 55.54  ? 229  ASP B CB  1 
ATOM   3910 C  CG  . ASP B 1 229 ? 18.394 -59.390  227.751 1.00 58.27  ? 229  ASP B CG  1 
ATOM   3911 O  OD1 . ASP B 1 229 ? 17.818 -58.328  227.427 1.00 58.49  ? 229  ASP B OD1 1 
ATOM   3912 O  OD2 . ASP B 1 229 ? 18.677 -60.292  226.930 1.00 61.32  ? 229  ASP B OD2 1 
ATOM   3913 N  N   . GLU B 1 230 ? 18.332 -56.828  230.797 1.00 55.69  ? 230  GLU B N   1 
ATOM   3914 C  CA  . GLU B 1 230 ? 17.619 -55.562  230.885 1.00 56.07  ? 230  GLU B CA  1 
ATOM   3915 C  C   . GLU B 1 230 ? 18.539 -54.355  230.963 1.00 54.12  ? 230  GLU B C   1 
ATOM   3916 O  O   . GLU B 1 230 ? 18.364 -53.394  230.214 1.00 53.02  ? 230  GLU B O   1 
ATOM   3917 C  CB  . GLU B 1 230 ? 16.676 -55.557  232.090 1.00 59.67  ? 230  GLU B CB  1 
ATOM   3918 C  CG  . GLU B 1 230 ? 15.987 -54.210  232.300 1.00 64.46  ? 230  GLU B CG  1 
ATOM   3919 C  CD  . GLU B 1 230 ? 14.851 -54.277  233.302 1.00 69.17  ? 230  GLU B CD  1 
ATOM   3920 O  OE1 . GLU B 1 230 ? 13.821 -54.923  232.990 1.00 71.06  ? 230  GLU B OE1 1 
ATOM   3921 O  OE2 . GLU B 1 230 ? 14.989 -53.688  234.399 1.00 70.57  ? 230  GLU B OE2 1 
ATOM   3922 N  N   . THR B 1 231 ? 19.512 -54.398  231.868 1.00 52.45  ? 231  THR B N   1 
ATOM   3923 C  CA  . THR B 1 231 ? 20.437 -53.282  232.014 1.00 51.28  ? 231  THR B CA  1 
ATOM   3924 C  C   . THR B 1 231 ? 21.236 -53.045  230.742 1.00 51.17  ? 231  THR B C   1 
ATOM   3925 O  O   . THR B 1 231 ? 21.530 -51.903  230.395 1.00 52.14  ? 231  THR B O   1 
ATOM   3926 C  CB  . THR B 1 231 ? 21.435 -53.495  233.181 1.00 51.40  ? 231  THR B CB  1 
ATOM   3927 O  OG1 . THR B 1 231 ? 22.206 -54.681  232.958 1.00 48.51  ? 231  THR B OG1 1 
ATOM   3928 C  CG2 . THR B 1 231 ? 20.699 -53.603  234.491 1.00 50.33  ? 231  THR B CG2 1 
ATOM   3929 N  N   . LEU B 1 232 ? 21.594 -54.114  230.042 1.00 49.89  ? 232  LEU B N   1 
ATOM   3930 C  CA  . LEU B 1 232 ? 22.360 -53.941  228.818 1.00 51.45  ? 232  LEU B CA  1 
ATOM   3931 C  C   . LEU B 1 232 ? 21.496 -53.269  227.760 1.00 52.07  ? 232  LEU B C   1 
ATOM   3932 O  O   . LEU B 1 232 ? 21.996 -52.519  226.928 1.00 52.70  ? 232  LEU B O   1 
ATOM   3933 C  CB  . LEU B 1 232 ? 22.896 -55.290  228.312 1.00 51.33  ? 232  LEU B CB  1 
ATOM   3934 C  CG  . LEU B 1 232 ? 23.906 -55.961  229.251 1.00 50.88  ? 232  LEU B CG  1 
ATOM   3935 C  CD1 . LEU B 1 232 ? 24.405 -57.263  228.649 1.00 50.94  ? 232  LEU B CD1 1 
ATOM   3936 C  CD2 . LEU B 1 232 ? 25.062 -55.008  229.503 1.00 50.89  ? 232  LEU B CD2 1 
ATOM   3937 N  N   . ARG B 1 233 ? 20.196 -53.531  227.791 1.00 53.51  ? 233  ARG B N   1 
ATOM   3938 C  CA  . ARG B 1 233 ? 19.303 -52.909  226.827 1.00 54.74  ? 233  ARG B CA  1 
ATOM   3939 C  C   . ARG B 1 233 ? 19.204 -51.412  227.071 1.00 53.95  ? 233  ARG B C   1 
ATOM   3940 O  O   . ARG B 1 233 ? 19.239 -50.625  226.126 1.00 52.44  ? 233  ARG B O   1 
ATOM   3941 C  CB  . ARG B 1 233 ? 17.912 -53.532  226.894 1.00 56.59  ? 233  ARG B CB  1 
ATOM   3942 C  CG  . ARG B 1 233 ? 17.865 -54.941  226.350 1.00 60.40  ? 233  ARG B CG  1 
ATOM   3943 C  CD  . ARG B 1 233 ? 16.439 -55.428  226.193 1.00 63.32  ? 233  ARG B CD  1 
ATOM   3944 N  NE  . ARG B 1 233 ? 16.418 -56.757  225.600 1.00 67.67  ? 233  ARG B NE  1 
ATOM   3945 C  CZ  . ARG B 1 233 ? 16.871 -57.041  224.382 1.00 69.34  ? 233  ARG B CZ  1 
ATOM   3946 N  NH1 . ARG B 1 233 ? 17.380 -56.084  223.615 1.00 68.78  ? 233  ARG B NH1 1 
ATOM   3947 N  NH2 . ARG B 1 233 ? 16.827 -58.291  223.936 1.00 70.63  ? 233  ARG B NH2 1 
ATOM   3948 N  N   . ASN B 1 234 ? 19.100 -51.027  228.341 1.00 54.38  ? 234  ASN B N   1 
ATOM   3949 C  CA  . ASN B 1 234 ? 18.991 -49.619  228.717 1.00 56.84  ? 234  ASN B CA  1 
ATOM   3950 C  C   . ASN B 1 234 ? 20.201 -48.804  228.278 1.00 57.22  ? 234  ASN B C   1 
ATOM   3951 O  O   . ASN B 1 234 ? 20.059 -47.702  227.737 1.00 57.58  ? 234  ASN B O   1 
ATOM   3952 C  CB  . ASN B 1 234 ? 18.810 -49.476  230.232 1.00 58.74  ? 234  ASN B CB  1 
ATOM   3953 C  CG  . ASN B 1 234 ? 17.585 -50.216  230.747 1.00 62.69  ? 234  ASN B CG  1 
ATOM   3954 O  OD1 . ASN B 1 234 ? 16.533 -50.228  230.098 1.00 63.30  ? 234  ASN B OD1 1 
ATOM   3955 N  ND2 . ASN B 1 234 ? 17.709 -50.829  231.925 1.00 63.18  ? 234  ASN B ND2 1 
ATOM   3956 N  N   . SER B 1 235 ? 21.389 -49.349  228.512 1.00 56.07  ? 235  SER B N   1 
ATOM   3957 C  CA  . SER B 1 235 ? 22.627 -48.673  228.145 1.00 54.41  ? 235  SER B CA  1 
ATOM   3958 C  C   . SER B 1 235 ? 22.907 -48.762  226.643 1.00 53.43  ? 235  SER B C   1 
ATOM   3959 O  O   . SER B 1 235 ? 23.936 -48.275  226.166 1.00 53.00  ? 235  SER B O   1 
ATOM   3960 C  CB  . SER B 1 235 ? 23.791 -49.282  228.927 1.00 54.36  ? 235  SER B CB  1 
ATOM   3961 O  OG  . SER B 1 235 ? 23.861 -50.683  228.713 1.00 53.83  ? 235  SER B OG  1 
ATOM   3962 N  N   . HIS B 1 236 ? 21.986 -49.383  225.908 1.00 52.11  ? 236  HIS B N   1 
ATOM   3963 C  CA  . HIS B 1 236 ? 22.133 -49.550  224.462 1.00 52.36  ? 236  HIS B CA  1 
ATOM   3964 C  C   . HIS B 1 236 ? 23.425 -50.291  224.158 1.00 49.74  ? 236  HIS B C   1 
ATOM   3965 O  O   . HIS B 1 236 ? 24.107 -50.009  223.172 1.00 47.79  ? 236  HIS B O   1 
ATOM   3966 C  CB  . HIS B 1 236 ? 22.140 -48.188  223.774 1.00 54.73  ? 236  HIS B CB  1 
ATOM   3967 C  CG  . HIS B 1 236 ? 20.845 -47.451  223.900 1.00 61.19  ? 236  HIS B CG  1 
ATOM   3968 N  ND1 . HIS B 1 236 ? 19.697 -47.847  223.244 1.00 62.15  ? 236  HIS B ND1 1 
ATOM   3969 C  CD2 . HIS B 1 236 ? 20.505 -46.363  224.633 1.00 61.86  ? 236  HIS B CD2 1 
ATOM   3970 C  CE1 . HIS B 1 236 ? 18.707 -47.035  223.568 1.00 62.81  ? 236  HIS B CE1 1 
ATOM   3971 N  NE2 . HIS B 1 236 ? 19.171 -46.126  224.409 1.00 62.99  ? 236  HIS B NE2 1 
ATOM   3972 N  N   . SER B 1 237 ? 23.745 -51.251  225.017 1.00 47.55  ? 237  SER B N   1 
ATOM   3973 C  CA  . SER B 1 237 ? 24.961 -52.030  224.869 1.00 45.84  ? 237  SER B CA  1 
ATOM   3974 C  C   . SER B 1 237 ? 25.049 -52.766  223.545 1.00 44.88  ? 237  SER B C   1 
ATOM   3975 O  O   . SER B 1 237 ? 24.051 -53.240  223.014 1.00 46.08  ? 237  SER B O   1 
ATOM   3976 C  CB  . SER B 1 237 ? 25.092 -53.026  226.021 1.00 43.35  ? 237  SER B CB  1 
ATOM   3977 O  OG  . SER B 1 237 ? 25.277 -52.350  227.251 1.00 43.28  ? 237  SER B OG  1 
ATOM   3978 N  N   . GLU B 1 238 ? 26.264 -52.852  223.022 1.00 44.31  ? 238  GLU B N   1 
ATOM   3979 C  CA  . GLU B 1 238 ? 26.530 -53.543  221.773 1.00 42.37  ? 238  GLU B CA  1 
ATOM   3980 C  C   . GLU B 1 238 ? 27.901 -54.196  221.906 1.00 37.94  ? 238  GLU B C   1 
ATOM   3981 O  O   . GLU B 1 238 ? 28.717 -53.756  222.715 1.00 36.38  ? 238  GLU B O   1 
ATOM   3982 C  CB  . GLU B 1 238 ? 26.552 -52.531  220.637 1.00 45.98  ? 238  GLU B CB  1 
ATOM   3983 C  CG  . GLU B 1 238 ? 26.385 -53.142  219.277 1.00 54.89  ? 238  GLU B CG  1 
ATOM   3984 C  CD  . GLU B 1 238 ? 26.435 -52.088  218.180 1.00 61.73  ? 238  GLU B CD  1 
ATOM   3985 O  OE1 . GLU B 1 238 ? 26.280 -50.885  218.499 1.00 61.92  ? 238  GLU B OE1 1 
ATOM   3986 O  OE2 . GLU B 1 238 ? 26.622 -52.461  216.998 1.00 65.74  ? 238  GLU B OE2 1 
ATOM   3987 N  N   . PHE B 1 239 ? 28.163 -55.229  221.117 1.00 33.93  ? 239  PHE B N   1 
ATOM   3988 C  CA  . PHE B 1 239 ? 29.458 -55.905  221.190 1.00 32.09  ? 239  PHE B CA  1 
ATOM   3989 C  C   . PHE B 1 239 ? 30.134 -56.032  219.853 1.00 32.65  ? 239  PHE B C   1 
ATOM   3990 O  O   . PHE B 1 239 ? 29.573 -56.600  218.913 1.00 35.44  ? 239  PHE B O   1 
ATOM   3991 C  CB  . PHE B 1 239 ? 29.320 -57.294  221.813 1.00 29.37  ? 239  PHE B CB  1 
ATOM   3992 C  CG  . PHE B 1 239 ? 28.878 -57.263  223.242 1.00 29.44  ? 239  PHE B CG  1 
ATOM   3993 C  CD1 . PHE B 1 239 ? 27.532 -57.131  223.566 1.00 29.67  ? 239  PHE B CD1 1 
ATOM   3994 C  CD2 . PHE B 1 239 ? 29.808 -57.283  224.265 1.00 28.37  ? 239  PHE B CD2 1 
ATOM   3995 C  CE1 . PHE B 1 239 ? 27.128 -57.016  224.892 1.00 31.70  ? 239  PHE B CE1 1 
ATOM   3996 C  CE2 . PHE B 1 239 ? 29.410 -57.171  225.598 1.00 31.28  ? 239  PHE B CE2 1 
ATOM   3997 C  CZ  . PHE B 1 239 ? 28.073 -57.036  225.911 1.00 30.60  ? 239  PHE B CZ  1 
ATOM   3998 N  N   . LEU B 1 240 ? 31.348 -55.497  219.765 1.00 31.77  ? 240  LEU B N   1 
ATOM   3999 C  CA  . LEU B 1 240 ? 32.107 -55.564  218.529 1.00 31.10  ? 240  LEU B CA  1 
ATOM   4000 C  C   . LEU B 1 240 ? 33.208 -56.605  218.631 1.00 29.85  ? 240  LEU B C   1 
ATOM   4001 O  O   . LEU B 1 240 ? 33.912 -56.693  219.636 1.00 27.75  ? 240  LEU B O   1 
ATOM   4002 C  CB  . LEU B 1 240 ? 32.752 -54.219  218.215 1.00 34.71  ? 240  LEU B CB  1 
ATOM   4003 C  CG  . LEU B 1 240 ? 31.880 -52.972  218.184 1.00 38.35  ? 240  LEU B CG  1 
ATOM   4004 C  CD1 . LEU B 1 240 ? 32.739 -51.798  217.732 1.00 37.64  ? 240  LEU B CD1 1 
ATOM   4005 C  CD2 . LEU B 1 240 ? 30.694 -53.180  217.239 1.00 39.73  ? 240  LEU B CD2 1 
ATOM   4006 N  N   . VAL B 1 241 ? 33.340 -57.398  217.579 1.00 30.41  ? 241  VAL B N   1 
ATOM   4007 C  CA  . VAL B 1 241 ? 34.381 -58.406  217.505 1.00 30.40  ? 241  VAL B CA  1 
ATOM   4008 C  C   . VAL B 1 241 ? 35.211 -57.990  216.314 1.00 29.47  ? 241  VAL B C   1 
ATOM   4009 O  O   . VAL B 1 241 ? 34.674 -57.813  215.225 1.00 28.40  ? 241  VAL B O   1 
ATOM   4010 C  CB  . VAL B 1 241 ? 33.823 -59.809  217.220 1.00 30.93  ? 241  VAL B CB  1 
ATOM   4011 C  CG1 . VAL B 1 241 ? 34.968 -60.830  217.222 1.00 30.01  ? 241  VAL B CG1 1 
ATOM   4012 C  CG2 . VAL B 1 241 ? 32.772 -60.168  218.247 1.00 33.42  ? 241  VAL B CG2 1 
ATOM   4013 N  N   . LEU B 1 242 ? 36.510 -57.807  216.528 1.00 29.85  ? 242  LEU B N   1 
ATOM   4014 C  CA  . LEU B 1 242 ? 37.413 -57.420  215.452 1.00 28.66  ? 242  LEU B CA  1 
ATOM   4015 C  C   . LEU B 1 242 ? 38.503 -58.461  215.340 1.00 27.98  ? 242  LEU B C   1 
ATOM   4016 O  O   . LEU B 1 242 ? 39.155 -58.815  216.322 1.00 26.47  ? 242  LEU B O   1 
ATOM   4017 C  CB  . LEU B 1 242 ? 37.998 -56.046  215.735 1.00 31.87  ? 242  LEU B CB  1 
ATOM   4018 C  CG  . LEU B 1 242 ? 36.879 -54.993  215.726 1.00 33.92  ? 242  LEU B CG  1 
ATOM   4019 C  CD1 . LEU B 1 242 ? 37.016 -54.091  216.937 1.00 35.32  ? 242  LEU B CD1 1 
ATOM   4020 C  CD2 . LEU B 1 242 ? 36.928 -54.201  214.434 1.00 30.32  ? 242  LEU B CD2 1 
ATOM   4021 N  N   . PHE B 1 243 ? 38.677 -58.967  214.132 1.00 28.80  ? 243  PHE B N   1 
ATOM   4022 C  CA  . PHE B 1 243 ? 39.663 -60.001  213.875 1.00 30.05  ? 243  PHE B CA  1 
ATOM   4023 C  C   . PHE B 1 243 ? 40.672 -59.586  212.807 1.00 28.68  ? 243  PHE B C   1 
ATOM   4024 O  O   . PHE B 1 243 ? 40.311 -59.010  211.779 1.00 26.73  ? 243  PHE B O   1 
ATOM   4025 C  CB  . PHE B 1 243 ? 38.960 -61.295  213.421 1.00 27.48  ? 243  PHE B CB  1 
ATOM   4026 C  CG  . PHE B 1 243 ? 39.909 -62.390  212.982 1.00 28.96  ? 243  PHE B CG  1 
ATOM   4027 C  CD1 . PHE B 1 243 ? 40.381 -63.329  213.891 1.00 31.81  ? 243  PHE B CD1 1 
ATOM   4028 C  CD2 . PHE B 1 243 ? 40.322 -62.482  211.658 1.00 27.21  ? 243  PHE B CD2 1 
ATOM   4029 C  CE1 . PHE B 1 243 ? 41.256 -64.357  213.485 1.00 33.30  ? 243  PHE B CE1 1 
ATOM   4030 C  CE2 . PHE B 1 243 ? 41.191 -63.494  211.248 1.00 32.15  ? 243  PHE B CE2 1 
ATOM   4031 C  CZ  . PHE B 1 243 ? 41.660 -64.438  212.168 1.00 28.85  ? 243  PHE B CZ  1 
ATOM   4032 N  N   . THR B 1 244 ? 41.936 -59.898  213.063 1.00 28.66  ? 244  THR B N   1 
ATOM   4033 C  CA  . THR B 1 244 ? 42.999 -59.609  212.113 1.00 30.34  ? 244  THR B CA  1 
ATOM   4034 C  C   . THR B 1 244 ? 44.094 -60.684  212.192 1.00 30.17  ? 244  THR B C   1 
ATOM   4035 O  O   . THR B 1 244 ? 44.290 -61.325  213.224 1.00 29.63  ? 244  THR B O   1 
ATOM   4036 C  CB  . THR B 1 244 ? 43.624 -58.223  212.363 1.00 29.29  ? 244  THR B CB  1 
ATOM   4037 O  OG1 . THR B 1 244 ? 44.564 -57.946  211.322 1.00 37.34  ? 244  THR B OG1 1 
ATOM   4038 C  CG2 . THR B 1 244 ? 44.332 -58.177  213.701 1.00 30.17  ? 244  THR B CG2 1 
ATOM   4039 N  N   . GLY B 1 245 ? 44.784 -60.895  211.082 1.00 29.96  ? 245  GLY B N   1 
ATOM   4040 C  CA  . GLY B 1 245 ? 45.841 -61.878  211.049 1.00 29.96  ? 245  GLY B CA  1 
ATOM   4041 C  C   . GLY B 1 245 ? 46.469 -61.911  209.675 1.00 31.16  ? 245  GLY B C   1 
ATOM   4042 O  O   . GLY B 1 245 ? 46.003 -61.241  208.755 1.00 28.79  ? 245  GLY B O   1 
ATOM   4043 N  N   . HIS B 1 246 ? 47.539 -62.685  209.547 1.00 34.33  ? 246  HIS B N   1 
ATOM   4044 C  CA  . HIS B 1 246 ? 48.237 -62.835  208.282 1.00 36.52  ? 246  HIS B CA  1 
ATOM   4045 C  C   . HIS B 1 246 ? 47.776 -64.149  207.684 1.00 37.43  ? 246  HIS B C   1 
ATOM   4046 O  O   . HIS B 1 246 ? 48.085 -65.213  208.206 1.00 37.78  ? 246  HIS B O   1 
ATOM   4047 C  CB  . HIS B 1 246 ? 49.747 -62.885  208.497 1.00 37.74  ? 246  HIS B CB  1 
ATOM   4048 C  CG  . HIS B 1 246 ? 50.517 -63.154  207.246 1.00 44.19  ? 246  HIS B CG  1 
ATOM   4049 N  ND1 . HIS B 1 246 ? 50.946 -62.149  206.404 1.00 46.91  ? 246  HIS B ND1 1 
ATOM   4050 C  CD2 . HIS B 1 246 ? 50.882 -64.319  206.656 1.00 46.40  ? 246  HIS B CD2 1 
ATOM   4051 C  CE1 . HIS B 1 246 ? 51.540 -62.682  205.350 1.00 46.67  ? 246  HIS B CE1 1 
ATOM   4052 N  NE2 . HIS B 1 246 ? 51.513 -63.997  205.478 1.00 49.09  ? 246  HIS B NE2 1 
ATOM   4053 N  N   . HIS B 1 247 ? 47.026 -64.067  206.595 1.00 39.44  ? 247  HIS B N   1 
ATOM   4054 C  CA  . HIS B 1 247 ? 46.513 -65.248  205.919 1.00 42.80  ? 247  HIS B CA  1 
ATOM   4055 C  C   . HIS B 1 247 ? 47.609 -65.771  205.001 1.00 44.89  ? 247  HIS B C   1 
ATOM   4056 O  O   . HIS B 1 247 ? 48.202 -65.007  204.253 1.00 46.51  ? 247  HIS B O   1 
ATOM   4057 C  CB  . HIS B 1 247 ? 45.279 -64.866  205.096 1.00 43.91  ? 247  HIS B CB  1 
ATOM   4058 C  CG  . HIS B 1 247 ? 44.287 -65.974  204.929 1.00 45.46  ? 247  HIS B CG  1 
ATOM   4059 N  ND1 . HIS B 1 247 ? 44.598 -67.171  204.324 1.00 44.51  ? 247  HIS B ND1 1 
ATOM   4060 C  CD2 . HIS B 1 247 ? 42.985 -66.062  205.293 1.00 45.69  ? 247  HIS B CD2 1 
ATOM   4061 C  CE1 . HIS B 1 247 ? 43.530 -67.950  204.324 1.00 47.30  ? 247  HIS B CE1 1 
ATOM   4062 N  NE2 . HIS B 1 247 ? 42.538 -67.300  204.906 1.00 46.06  ? 247  HIS B NE2 1 
ATOM   4063 N  N   . GLU B 1 248 ? 47.890 -67.067  205.054 1.00 48.68  ? 248  GLU B N   1 
ATOM   4064 C  CA  . GLU B 1 248 ? 48.929 -67.627  204.197 1.00 51.75  ? 248  GLU B CA  1 
ATOM   4065 C  C   . GLU B 1 248 ? 48.432 -67.722  202.769 1.00 54.21  ? 248  GLU B C   1 
ATOM   4066 O  O   . GLU B 1 248 ? 49.227 -67.710  201.827 1.00 55.20  ? 248  GLU B O   1 
ATOM   4067 C  CB  . GLU B 1 248 ? 49.343 -69.009  204.676 1.00 52.12  ? 248  GLU B CB  1 
ATOM   4068 C  CG  . GLU B 1 248 ? 49.891 -69.036  206.081 1.00 52.96  ? 248  GLU B CG  1 
ATOM   4069 C  CD  . GLU B 1 248 ? 50.363 -70.413  206.478 1.00 54.01  ? 248  GLU B CD  1 
ATOM   4070 O  OE1 . GLU B 1 248 ? 49.621 -71.393  206.236 1.00 53.82  ? 248  GLU B OE1 1 
ATOM   4071 O  OE2 . GLU B 1 248 ? 51.471 -70.509  207.040 1.00 54.79  ? 248  GLU B OE2 1 
ATOM   4072 N  N   . ALA B 1 249 ? 47.115 -67.810  202.614 1.00 55.82  ? 249  ALA B N   1 
ATOM   4073 C  CA  . ALA B 1 249 ? 46.508 -67.906  201.296 1.00 57.24  ? 249  ALA B CA  1 
ATOM   4074 C  C   . ALA B 1 249 ? 46.794 -66.655  200.461 1.00 58.88  ? 249  ALA B C   1 
ATOM   4075 O  O   . ALA B 1 249 ? 46.865 -66.725  199.235 1.00 60.11  ? 249  ALA B O   1 
ATOM   4076 C  CB  . ALA B 1 249 ? 45.002 -68.115  201.427 1.00 55.35  ? 249  ALA B CB  1 
ATOM   4077 N  N   . PHE B 1 250 ? 46.982 -65.515  201.118 1.00 59.94  ? 250  PHE B N   1 
ATOM   4078 C  CA  . PHE B 1 250 ? 47.237 -64.282  200.386 1.00 60.84  ? 250  PHE B CA  1 
ATOM   4079 C  C   . PHE B 1 250 ? 48.561 -63.618  200.735 1.00 60.28  ? 250  PHE B C   1 
ATOM   4080 O  O   . PHE B 1 250 ? 48.920 -62.600  200.146 1.00 61.82  ? 250  PHE B O   1 
ATOM   4081 C  CB  . PHE B 1 250 ? 46.084 -63.298  200.617 1.00 62.75  ? 250  PHE B CB  1 
ATOM   4082 C  CG  . PHE B 1 250 ? 44.729 -63.931  200.502 1.00 65.11  ? 250  PHE B CG  1 
ATOM   4083 C  CD1 . PHE B 1 250 ? 43.979 -64.210  201.642 1.00 66.86  ? 250  PHE B CD1 1 
ATOM   4084 C  CD2 . PHE B 1 250 ? 44.222 -64.301  199.261 1.00 66.10  ? 250  PHE B CD2 1 
ATOM   4085 C  CE1 . PHE B 1 250 ? 42.745 -64.853  201.548 1.00 66.60  ? 250  PHE B CE1 1 
ATOM   4086 C  CE2 . PHE B 1 250 ? 42.990 -64.944  199.154 1.00 67.32  ? 250  PHE B CE2 1 
ATOM   4087 C  CZ  . PHE B 1 250 ? 42.252 -65.220  200.300 1.00 67.13  ? 250  PHE B CZ  1 
ATOM   4088 N  N   . ALA B 1 251 ? 49.290 -64.192  201.682 1.00 59.41  ? 251  ALA B N   1 
ATOM   4089 C  CA  . ALA B 1 251 ? 50.570 -63.619  202.085 1.00 58.87  ? 251  ALA B CA  1 
ATOM   4090 C  C   . ALA B 1 251 ? 50.422 -62.121  202.350 1.00 58.01  ? 251  ALA B C   1 
ATOM   4091 O  O   . ALA B 1 251 ? 51.212 -61.306  201.875 1.00 57.77  ? 251  ALA B O   1 
ATOM   4092 C  CB  . ALA B 1 251 ? 51.620 -63.863  201.005 1.00 57.95  ? 251  ALA B CB  1 
ATOM   4093 N  N   . GLN B 1 252 ? 49.390 -61.771  203.107 1.00 58.24  ? 252  GLN B N   1 
ATOM   4094 C  CA  . GLN B 1 252 ? 49.123 -60.383  203.469 1.00 57.69  ? 252  GLN B CA  1 
ATOM   4095 C  C   . GLN B 1 252 ? 48.014 -60.396  204.514 1.00 53.98  ? 252  GLN B C   1 
ATOM   4096 O  O   . GLN B 1 252 ? 47.208 -61.328  204.556 1.00 51.61  ? 252  GLN B O   1 
ATOM   4097 C  CB  . GLN B 1 252 ? 48.678 -59.575  202.250 1.00 61.46  ? 252  GLN B CB  1 
ATOM   4098 C  CG  . GLN B 1 252 ? 47.200 -59.708  201.929 1.00 68.24  ? 252  GLN B CG  1 
ATOM   4099 C  CD  . GLN B 1 252 ? 46.704 -58.610  201.000 1.00 72.41  ? 252  GLN B CD  1 
ATOM   4100 O  OE1 . GLN B 1 252 ? 45.531 -58.218  201.051 1.00 72.75  ? 252  GLN B OE1 1 
ATOM   4101 N  NE2 . GLN B 1 252 ? 47.595 -58.112  200.140 1.00 71.25  ? 252  GLN B NE2 1 
ATOM   4102 N  N   . ASN B 1 253 ? 47.969 -59.362  205.346 1.00 50.62  ? 253  ASN B N   1 
ATOM   4103 C  CA  . ASN B 1 253 ? 46.971 -59.286  206.403 1.00 48.42  ? 253  ASN B CA  1 
ATOM   4104 C  C   . ASN B 1 253 ? 45.535 -59.238  205.931 1.00 45.95  ? 253  ASN B C   1 
ATOM   4105 O  O   . ASN B 1 253 ? 45.245 -58.813  204.816 1.00 45.74  ? 253  ASN B O   1 
ATOM   4106 C  CB  . ASN B 1 253 ? 47.240 -58.086  207.307 1.00 49.83  ? 253  ASN B CB  1 
ATOM   4107 C  CG  . ASN B 1 253 ? 48.392 -58.327  208.263 1.00 53.39  ? 253  ASN B CG  1 
ATOM   4108 O  OD1 . ASN B 1 253 ? 48.334 -59.213  209.118 1.00 55.65  ? 253  ASN B OD1 1 
ATOM   4109 N  ND2 . ASN B 1 253 ? 49.447 -57.538  208.124 1.00 53.84  ? 253  ASN B ND2 1 
ATOM   4110 N  N   . VAL B 1 254 ? 44.640 -59.706  206.795 1.00 43.57  ? 254  VAL B N   1 
ATOM   4111 C  CA  . VAL B 1 254 ? 43.217 -59.703  206.510 1.00 39.98  ? 254  VAL B CA  1 
ATOM   4112 C  C   . VAL B 1 254 ? 42.490 -59.185  207.734 1.00 37.75  ? 254  VAL B C   1 
ATOM   4113 O  O   . VAL B 1 254 ? 43.023 -59.223  208.846 1.00 36.26  ? 254  VAL B O   1 
ATOM   4114 C  CB  . VAL B 1 254 ? 42.712 -61.104  206.129 1.00 39.27  ? 254  VAL B CB  1 
ATOM   4115 C  CG1 . VAL B 1 254 ? 43.392 -61.543  204.840 1.00 37.11  ? 254  VAL B CG1 1 
ATOM   4116 C  CG2 . VAL B 1 254 ? 42.986 -62.092  207.243 1.00 38.43  ? 254  VAL B CG2 1 
ATOM   4117 N  N   . HIS B 1 255 ? 41.289 -58.661  207.520 1.00 36.55  ? 255  HIS B N   1 
ATOM   4118 C  CA  . HIS B 1 255 ? 40.503 -58.108  208.614 1.00 35.05  ? 255  HIS B CA  1 
ATOM   4119 C  C   . HIS B 1 255 ? 39.060 -58.530  208.458 1.00 33.21  ? 255  HIS B C   1 
ATOM   4120 O  O   . HIS B 1 255 ? 38.560 -58.684  207.342 1.00 32.55  ? 255  HIS B O   1 
ATOM   4121 C  CB  . HIS B 1 255 ? 40.539 -56.573  208.617 1.00 35.65  ? 255  HIS B CB  1 
ATOM   4122 C  CG  . HIS B 1 255 ? 41.915 -55.981  208.602 1.00 39.83  ? 255  HIS B CG  1 
ATOM   4123 N  ND1 . HIS B 1 255 ? 42.741 -56.031  207.496 1.00 40.03  ? 255  HIS B ND1 1 
ATOM   4124 C  CD2 . HIS B 1 255 ? 42.599 -55.295  209.551 1.00 38.58  ? 255  HIS B CD2 1 
ATOM   4125 C  CE1 . HIS B 1 255 ? 43.873 -55.403  207.766 1.00 40.19  ? 255  HIS B CE1 1 
ATOM   4126 N  NE2 . HIS B 1 255 ? 43.811 -54.948  209.007 1.00 40.17  ? 255  HIS B NE2 1 
ATOM   4127 N  N   . ALA B 1 256 ? 38.394 -58.699  209.589 1.00 31.65  ? 256  ALA B N   1 
ATOM   4128 C  CA  . ALA B 1 256 ? 36.995 -59.082  209.612 1.00 31.19  ? 256  ALA B CA  1 
ATOM   4129 C  C   . ALA B 1 256 ? 36.436 -58.663  210.955 1.00 30.93  ? 256  ALA B C   1 
ATOM   4130 O  O   . ALA B 1 256 ? 37.147 -58.622  211.952 1.00 31.38  ? 256  ALA B O   1 
ATOM   4131 C  CB  . ALA B 1 256 ? 36.854 -60.583  209.423 1.00 30.38  ? 256  ALA B CB  1 
ATOM   4132 N  N   . ARG B 1 257 ? 35.163 -58.319  210.979 1.00 33.44  ? 257  ARG B N   1 
ATOM   4133 C  CA  . ARG B 1 257 ? 34.537 -57.915  212.222 1.00 34.05  ? 257  ARG B CA  1 
ATOM   4134 C  C   . ARG B 1 257 ? 33.064 -58.211  212.172 1.00 32.79  ? 257  ARG B C   1 
ATOM   4135 O  O   . ARG B 1 257 ? 32.496 -58.456  211.114 1.00 33.14  ? 257  ARG B O   1 
ATOM   4136 C  CB  . ARG B 1 257 ? 34.765 -56.432  212.486 1.00 34.56  ? 257  ARG B CB  1 
ATOM   4137 C  CG  . ARG B 1 257 ? 34.317 -55.517  211.368 1.00 39.47  ? 257  ARG B CG  1 
ATOM   4138 C  CD  . ARG B 1 257 ? 34.938 -54.140  211.550 1.00 42.90  ? 257  ARG B CD  1 
ATOM   4139 N  NE  . ARG B 1 257 ? 34.790 -53.299  210.372 1.00 43.89  ? 257  ARG B NE  1 
ATOM   4140 C  CZ  . ARG B 1 257 ? 33.645 -52.757  209.991 1.00 46.18  ? 257  ARG B CZ  1 
ATOM   4141 N  NH1 . ARG B 1 257 ? 32.545 -52.976  210.700 1.00 47.28  ? 257  ARG B NH1 1 
ATOM   4142 N  NH2 . ARG B 1 257 ? 33.605 -51.980  208.918 1.00 46.90  ? 257  ARG B NH2 1 
ATOM   4143 N  N   . HIS B 1 258 ? 32.446 -58.177  213.334 1.00 33.72  ? 258  HIS B N   1 
ATOM   4144 C  CA  . HIS B 1 258 ? 31.034 -58.461  213.443 1.00 35.66  ? 258  HIS B CA  1 
ATOM   4145 C  C   . HIS B 1 258 ? 30.516 -57.703  214.663 1.00 35.35  ? 258  HIS B C   1 
ATOM   4146 O  O   . HIS B 1 258 ? 31.251 -57.472  215.628 1.00 36.60  ? 258  HIS B O   1 
ATOM   4147 C  CB  . HIS B 1 258 ? 30.840 -59.967  213.618 1.00 34.70  ? 258  HIS B CB  1 
ATOM   4148 C  CG  . HIS B 1 258 ? 29.410 -60.406  213.564 1.00 40.14  ? 258  HIS B CG  1 
ATOM   4149 N  ND1 . HIS B 1 258 ? 28.792 -60.785  212.392 1.00 39.62  ? 258  HIS B ND1 1 
ATOM   4150 C  CD2 . HIS B 1 258 ? 28.480 -60.534  214.540 1.00 38.75  ? 258  HIS B CD2 1 
ATOM   4151 C  CE1 . HIS B 1 258 ? 27.544 -61.132  212.648 1.00 37.88  ? 258  HIS B CE1 1 
ATOM   4152 N  NE2 . HIS B 1 258 ? 27.328 -60.988  213.944 1.00 38.85  ? 258  HIS B NE2 1 
ATOM   4153 N  N   . ALA B 1 259 ? 29.253 -57.304  214.616 1.00 33.79  ? 259  ALA B N   1 
ATOM   4154 C  CA  . ALA B 1 259 ? 28.664 -56.583  215.731 1.00 31.47  ? 259  ALA B CA  1 
ATOM   4155 C  C   . ALA B 1 259 ? 27.495 -57.386  216.253 1.00 31.14  ? 259  ALA B C   1 
ATOM   4156 O  O   . ALA B 1 259 ? 26.751 -57.969  215.464 1.00 32.10  ? 259  ALA B O   1 
ATOM   4157 C  CB  . ALA B 1 259 ? 28.191 -55.207  215.269 1.00 30.27  ? 259  ALA B CB  1 
ATOM   4158 N  N   . TYR B 1 260 ? 27.339 -57.436  217.572 1.00 29.67  ? 260  TYR B N   1 
ATOM   4159 C  CA  . TYR B 1 260 ? 26.216 -58.151  218.167 1.00 32.14  ? 260  TYR B CA  1 
ATOM   4160 C  C   . TYR B 1 260 ? 25.383 -57.255  219.075 1.00 32.84  ? 260  TYR B C   1 
ATOM   4161 O  O   . TYR B 1 260 ? 25.925 -56.526  219.898 1.00 32.86  ? 260  TYR B O   1 
ATOM   4162 C  CB  . TYR B 1 260 ? 26.673 -59.335  219.020 1.00 30.23  ? 260  TYR B CB  1 
ATOM   4163 C  CG  . TYR B 1 260 ? 27.420 -60.427  218.308 1.00 30.90  ? 260  TYR B CG  1 
ATOM   4164 C  CD1 . TYR B 1 260 ? 28.815 -60.414  218.263 1.00 29.18  ? 260  TYR B CD1 1 
ATOM   4165 C  CD2 . TYR B 1 260 ? 26.745 -61.522  217.748 1.00 27.18  ? 260  TYR B CD2 1 
ATOM   4166 C  CE1 . TYR B 1 260 ? 29.525 -61.454  217.691 1.00 27.83  ? 260  TYR B CE1 1 
ATOM   4167 C  CE2 . TYR B 1 260 ? 27.451 -62.580  217.174 1.00 25.24  ? 260  TYR B CE2 1 
ATOM   4168 C  CZ  . TYR B 1 260 ? 28.849 -62.535  217.151 1.00 29.44  ? 260  TYR B CZ  1 
ATOM   4169 O  OH  . TYR B 1 260 ? 29.598 -63.548  216.594 1.00 30.11  ? 260  TYR B OH  1 
ATOM   4170 N  N   . SER B 1 261 ? 24.063 -57.328  218.951 1.00 35.63  ? 261  SER B N   1 
ATOM   4171 C  CA  . SER B 1 261 ? 23.203 -56.536  219.826 1.00 40.32  ? 261  SER B CA  1 
ATOM   4172 C  C   . SER B 1 261 ? 22.789 -57.419  221.007 1.00 41.50  ? 261  SER B C   1 
ATOM   4173 O  O   . SER B 1 261 ? 22.978 -58.633  220.978 1.00 38.17  ? 261  SER B O   1 
ATOM   4174 C  CB  . SER B 1 261 ? 21.950 -56.065  219.086 1.00 40.75  ? 261  SER B CB  1 
ATOM   4175 O  OG  . SER B 1 261 ? 21.057 -57.149  218.883 1.00 47.02  ? 261  SER B OG  1 
ATOM   4176 N  N   . CYS B 1 262 ? 22.226 -56.796  222.038 1.00 45.81  ? 262  CYS B N   1 
ATOM   4177 C  CA  . CYS B 1 262 ? 21.759 -57.507  223.228 1.00 49.19  ? 262  CYS B CA  1 
ATOM   4178 C  C   . CYS B 1 262 ? 20.846 -58.675  222.884 1.00 49.95  ? 262  CYS B C   1 
ATOM   4179 O  O   . CYS B 1 262 ? 20.903 -59.725  223.523 1.00 51.38  ? 262  CYS B O   1 
ATOM   4180 C  CB  . CYS B 1 262 ? 20.997 -56.550  224.141 1.00 49.91  ? 262  CYS B CB  1 
ATOM   4181 S  SG  . CYS B 1 262 ? 22.019 -55.235  224.792 1.00 55.72  ? 262  CYS B SG  1 
ATOM   4182 N  N   . ASP B 1 263 ? 19.997 -58.481  221.881 1.00 50.44  ? 263  ASP B N   1 
ATOM   4183 C  CA  . ASP B 1 263 ? 19.071 -59.523  221.463 1.00 52.17  ? 263  ASP B CA  1 
ATOM   4184 C  C   . ASP B 1 263 ? 19.802 -60.793  221.056 1.00 49.28  ? 263  ASP B C   1 
ATOM   4185 O  O   . ASP B 1 263 ? 19.292 -61.891  221.231 1.00 51.38  ? 263  ASP B O   1 
ATOM   4186 C  CB  . ASP B 1 263 ? 18.233 -59.063  220.260 1.00 57.96  ? 263  ASP B CB  1 
ATOM   4187 C  CG  . ASP B 1 263 ? 17.567 -57.714  220.477 1.00 63.05  ? 263  ASP B CG  1 
ATOM   4188 O  OD1 . ASP B 1 263 ? 16.862 -57.551  221.498 1.00 65.48  ? 263  ASP B OD1 1 
ATOM   4189 O  OD2 . ASP B 1 263 ? 17.743 -56.820  219.618 1.00 64.50  ? 263  ASP B OD2 1 
ATOM   4190 N  N   . GLU B 1 264 ? 21.000 -60.643  220.512 1.00 46.39  ? 264  GLU B N   1 
ATOM   4191 C  CA  . GLU B 1 264 ? 21.749 -61.792  220.037 1.00 43.19  ? 264  GLU B CA  1 
ATOM   4192 C  C   . GLU B 1 264 ? 22.615 -62.490  221.073 1.00 42.00  ? 264  GLU B C   1 
ATOM   4193 O  O   . GLU B 1 264 ? 23.519 -63.253  220.731 1.00 42.42  ? 264  GLU B O   1 
ATOM   4194 C  CB  . GLU B 1 264 ? 22.570 -61.372  218.827 1.00 43.17  ? 264  GLU B CB  1 
ATOM   4195 C  CG  . GLU B 1 264 ? 21.719 -60.658  217.783 1.00 43.61  ? 264  GLU B CG  1 
ATOM   4196 C  CD  . GLU B 1 264 ? 22.542 -59.921  216.752 1.00 46.10  ? 264  GLU B CD  1 
ATOM   4197 O  OE1 . GLU B 1 264 ? 23.379 -59.082  217.149 1.00 46.43  ? 264  GLU B OE1 1 
ATOM   4198 O  OE2 . GLU B 1 264 ? 22.350 -60.173  215.545 1.00 49.47  ? 264  GLU B OE2 1 
ATOM   4199 N  N   . ILE B 1 265 ? 22.322 -62.248  222.343 1.00 40.31  ? 265  ILE B N   1 
ATOM   4200 C  CA  . ILE B 1 265 ? 23.056 -62.890  223.420 1.00 41.07  ? 265  ILE B CA  1 
ATOM   4201 C  C   . ILE B 1 265 ? 22.136 -63.931  224.059 1.00 40.71  ? 265  ILE B C   1 
ATOM   4202 O  O   . ILE B 1 265 ? 21.057 -63.599  224.555 1.00 41.14  ? 265  ILE B O   1 
ATOM   4203 C  CB  . ILE B 1 265 ? 23.489 -61.871  224.496 1.00 42.56  ? 265  ILE B CB  1 
ATOM   4204 C  CG1 . ILE B 1 265 ? 24.387 -60.801  223.873 1.00 41.12  ? 265  ILE B CG1 1 
ATOM   4205 C  CG2 . ILE B 1 265 ? 24.212 -62.596  225.638 1.00 41.00  ? 265  ILE B CG2 1 
ATOM   4206 C  CD1 . ILE B 1 265 ? 24.915 -59.804  224.883 1.00 42.68  ? 265  ILE B CD1 1 
ATOM   4207 N  N   . ILE B 1 266 ? 22.565 -65.187  224.040 1.00 38.95  ? 266  ILE B N   1 
ATOM   4208 C  CA  . ILE B 1 266 ? 21.779 -66.274  224.603 1.00 38.03  ? 266  ILE B CA  1 
ATOM   4209 C  C   . ILE B 1 266 ? 22.262 -66.582  226.013 1.00 38.08  ? 266  ILE B C   1 
ATOM   4210 O  O   . ILE B 1 266 ? 23.291 -67.234  226.195 1.00 38.69  ? 266  ILE B O   1 
ATOM   4211 C  CB  . ILE B 1 266 ? 21.905 -67.562  223.741 1.00 38.99  ? 266  ILE B CB  1 
ATOM   4212 C  CG1 . ILE B 1 266 ? 21.534 -67.255  222.288 1.00 38.63  ? 266  ILE B CG1 1 
ATOM   4213 C  CG2 . ILE B 1 266 ? 21.012 -68.678  224.310 1.00 37.79  ? 266  ILE B CG2 1 
ATOM   4214 C  CD1 . ILE B 1 266 ? 20.199 -66.566  222.115 1.00 38.84  ? 266  ILE B CD1 1 
ATOM   4215 N  N   . TRP B 1 267 ? 21.517 -66.119  227.008 1.00 37.13  ? 267  TRP B N   1 
ATOM   4216 C  CA  . TRP B 1 267 ? 21.892 -66.350  228.388 1.00 38.20  ? 267  TRP B CA  1 
ATOM   4217 C  C   . TRP B 1 267 ? 21.627 -67.797  228.790 1.00 38.12  ? 267  TRP B C   1 
ATOM   4218 O  O   . TRP B 1 267 ? 20.500 -68.286  228.723 1.00 40.02  ? 267  TRP B O   1 
ATOM   4219 C  CB  . TRP B 1 267 ? 21.138 -65.390  229.310 1.00 39.40  ? 267  TRP B CB  1 
ATOM   4220 C  CG  . TRP B 1 267 ? 21.432 -63.943  229.041 1.00 41.21  ? 267  TRP B CG  1 
ATOM   4221 C  CD1 . TRP B 1 267 ? 21.054 -63.215  227.943 1.00 41.99  ? 267  TRP B CD1 1 
ATOM   4222 C  CD2 . TRP B 1 267 ? 22.165 -63.046  229.883 1.00 41.78  ? 267  TRP B CD2 1 
ATOM   4223 N  NE1 . TRP B 1 267 ? 21.506 -61.922  228.053 1.00 43.16  ? 267  TRP B NE1 1 
ATOM   4224 C  CE2 . TRP B 1 267 ? 22.191 -61.789  229.233 1.00 42.70  ? 267  TRP B CE2 1 
ATOM   4225 C  CE3 . TRP B 1 267 ? 22.803 -63.182  231.128 1.00 43.82  ? 267  TRP B CE3 1 
ATOM   4226 C  CZ2 . TRP B 1 267 ? 22.831 -60.667  229.786 1.00 43.51  ? 267  TRP B CZ2 1 
ATOM   4227 C  CZ3 . TRP B 1 267 ? 23.441 -62.064  231.682 1.00 43.38  ? 267  TRP B CZ3 1 
ATOM   4228 C  CH2 . TRP B 1 267 ? 23.449 -60.823  231.007 1.00 44.20  ? 267  TRP B CH2 1 
ATOM   4229 N  N   . GLY B 1 268 ? 22.685 -68.480  229.205 1.00 35.95  ? 268  GLY B N   1 
ATOM   4230 C  CA  . GLY B 1 268 ? 22.553 -69.860  229.594 1.00 35.08  ? 268  GLY B CA  1 
ATOM   4231 C  C   . GLY B 1 268 ? 22.918 -70.753  228.436 1.00 36.13  ? 268  GLY B C   1 
ATOM   4232 O  O   . GLY B 1 268 ? 22.946 -71.973  228.582 1.00 40.21  ? 268  GLY B O   1 
ATOM   4233 N  N   . GLY B 1 269 ? 23.216 -70.156  227.285 1.00 34.25  ? 269  GLY B N   1 
ATOM   4234 C  CA  . GLY B 1 269 ? 23.558 -70.951  226.122 1.00 31.82  ? 269  GLY B CA  1 
ATOM   4235 C  C   . GLY B 1 269 ? 24.906 -71.631  226.203 1.00 32.92  ? 269  GLY B C   1 
ATOM   4236 O  O   . GLY B 1 269 ? 25.777 -71.210  226.950 1.00 34.74  ? 269  GLY B O   1 
ATOM   4237 N  N   . HIS B 1 270 ? 25.072 -72.696  225.430 1.00 34.63  ? 270  HIS B N   1 
ATOM   4238 C  CA  . HIS B 1 270 ? 26.319 -73.445  225.374 1.00 37.58  ? 270  HIS B CA  1 
ATOM   4239 C  C   . HIS B 1 270 ? 26.498 -73.854  223.913 1.00 39.58  ? 270  HIS B C   1 
ATOM   4240 O  O   . HIS B 1 270 ? 25.630 -74.513  223.341 1.00 40.14  ? 270  HIS B O   1 
ATOM   4241 C  CB  . HIS B 1 270 ? 26.261 -74.722  226.228 1.00 42.49  ? 270  HIS B CB  1 
ATOM   4242 C  CG  . HIS B 1 270 ? 26.034 -74.481  227.689 1.00 49.23  ? 270  HIS B CG  1 
ATOM   4243 N  ND1 . HIS B 1 270 ? 24.794 -74.169  228.213 1.00 52.45  ? 270  HIS B ND1 1 
ATOM   4244 C  CD2 . HIS B 1 270 ? 26.890 -74.501  228.740 1.00 50.58  ? 270  HIS B CD2 1 
ATOM   4245 C  CE1 . HIS B 1 270 ? 24.900 -74.007  229.522 1.00 52.65  ? 270  HIS B CE1 1 
ATOM   4246 N  NE2 . HIS B 1 270 ? 26.161 -74.204  229.867 1.00 52.25  ? 270  HIS B NE2 1 
ATOM   4247 N  N   . PHE B 1 271 ? 27.613 -73.463  223.303 1.00 38.16  ? 271  PHE B N   1 
ATOM   4248 C  CA  . PHE B 1 271 ? 27.853 -73.827  221.920 1.00 36.28  ? 271  PHE B CA  1 
ATOM   4249 C  C   . PHE B 1 271 ? 27.971 -75.339  221.787 1.00 38.18  ? 271  PHE B C   1 
ATOM   4250 O  O   . PHE B 1 271 ? 28.577 -76.001  222.624 1.00 40.24  ? 271  PHE B O   1 
ATOM   4251 C  CB  . PHE B 1 271 ? 29.131 -73.161  221.394 1.00 32.47  ? 271  PHE B CB  1 
ATOM   4252 C  CG  . PHE B 1 271 ? 28.961 -71.704  221.050 1.00 31.74  ? 271  PHE B CG  1 
ATOM   4253 C  CD1 . PHE B 1 271 ? 29.610 -70.711  221.792 1.00 30.88  ? 271  PHE B CD1 1 
ATOM   4254 C  CD2 . PHE B 1 271 ? 28.137 -71.319  219.999 1.00 26.77  ? 271  PHE B CD2 1 
ATOM   4255 C  CE1 . PHE B 1 271 ? 29.435 -69.358  221.489 1.00 25.48  ? 271  PHE B CE1 1 
ATOM   4256 C  CE2 . PHE B 1 271 ? 27.957 -69.970  219.691 1.00 26.51  ? 271  PHE B CE2 1 
ATOM   4257 C  CZ  . PHE B 1 271 ? 28.609 -68.989  220.439 1.00 26.96  ? 271  PHE B CZ  1 
ATOM   4258 N  N   . VAL B 1 272 ? 27.380 -75.878  220.729 1.00 38.45  ? 272  VAL B N   1 
ATOM   4259 C  CA  . VAL B 1 272 ? 27.440 -77.299  220.466 1.00 39.51  ? 272  VAL B CA  1 
ATOM   4260 C  C   . VAL B 1 272 ? 28.799 -77.612  219.877 1.00 41.41  ? 272  VAL B C   1 
ATOM   4261 O  O   . VAL B 1 272 ? 29.173 -77.055  218.849 1.00 42.91  ? 272  VAL B O   1 
ATOM   4262 C  CB  . VAL B 1 272 ? 26.355 -77.729  219.451 1.00 40.16  ? 272  VAL B CB  1 
ATOM   4263 C  CG1 . VAL B 1 272 ? 26.648 -79.140  218.930 1.00 36.36  ? 272  VAL B CG1 1 
ATOM   4264 C  CG2 . VAL B 1 272 ? 24.991 -77.673  220.105 1.00 38.48  ? 272  VAL B CG2 1 
ATOM   4265 N  N   . ASP B 1 273 ? 29.533 -78.510  220.520 1.00 43.90  ? 273  ASP B N   1 
ATOM   4266 C  CA  . ASP B 1 273 ? 30.849 -78.890  220.042 1.00 46.35  ? 273  ASP B CA  1 
ATOM   4267 C  C   . ASP B 1 273 ? 30.800 -79.117  218.539 1.00 47.42  ? 273  ASP B C   1 
ATOM   4268 O  O   . ASP B 1 273 ? 29.824 -79.659  218.019 1.00 47.62  ? 273  ASP B O   1 
ATOM   4269 C  CB  . ASP B 1 273 ? 31.321 -80.159  220.761 1.00 49.63  ? 273  ASP B CB  1 
ATOM   4270 C  CG  . ASP B 1 273 ? 32.769 -80.516  220.439 1.00 55.47  ? 273  ASP B CG  1 
ATOM   4271 O  OD1 . ASP B 1 273 ? 33.573 -79.592  220.170 1.00 58.60  ? 273  ASP B OD1 1 
ATOM   4272 O  OD2 . ASP B 1 273 ? 33.108 -81.720  220.472 1.00 59.69  ? 273  ASP B OD2 1 
ATOM   4273 N  N   . VAL B 1 274 ? 31.843 -78.671  217.845 1.00 48.26  ? 274  VAL B N   1 
ATOM   4274 C  CA  . VAL B 1 274 ? 31.929 -78.837  216.402 1.00 49.18  ? 274  VAL B CA  1 
ATOM   4275 C  C   . VAL B 1 274 ? 33.022 -79.832  216.048 1.00 51.12  ? 274  VAL B C   1 
ATOM   4276 O  O   . VAL B 1 274 ? 33.122 -80.280  214.912 1.00 49.90  ? 274  VAL B O   1 
ATOM   4277 C  CB  . VAL B 1 274 ? 32.225 -77.497  215.680 1.00 49.00  ? 274  VAL B CB  1 
ATOM   4278 C  CG1 . VAL B 1 274 ? 30.974 -76.635  215.649 1.00 47.70  ? 274  VAL B CG1 1 
ATOM   4279 C  CG2 . VAL B 1 274 ? 33.370 -76.766  216.378 1.00 48.25  ? 274  VAL B CG2 1 
ATOM   4280 N  N   . PHE B 1 275 ? 33.853 -80.173  217.021 1.00 55.77  ? 275  PHE B N   1 
ATOM   4281 C  CA  . PHE B 1 275 ? 34.910 -81.135  216.770 1.00 60.92  ? 275  PHE B CA  1 
ATOM   4282 C  C   . PHE B 1 275 ? 34.334 -82.535  216.946 1.00 64.52  ? 275  PHE B C   1 
ATOM   4283 O  O   . PHE B 1 275 ? 34.136 -83.017  218.060 1.00 65.88  ? 275  PHE B O   1 
ATOM   4284 C  CB  . PHE B 1 275 ? 36.085 -80.896  217.716 1.00 61.00  ? 275  PHE B CB  1 
ATOM   4285 C  CG  . PHE B 1 275 ? 36.787 -79.592  217.477 1.00 63.19  ? 275  PHE B CG  1 
ATOM   4286 C  CD1 . PHE B 1 275 ? 36.260 -78.399  217.972 1.00 65.03  ? 275  PHE B CD1 1 
ATOM   4287 C  CD2 . PHE B 1 275 ? 37.958 -79.545  216.727 1.00 63.87  ? 275  PHE B CD2 1 
ATOM   4288 C  CE1 . PHE B 1 275 ? 36.890 -77.178  217.724 1.00 63.31  ? 275  PHE B CE1 1 
ATOM   4289 C  CE2 . PHE B 1 275 ? 38.596 -78.332  216.471 1.00 64.44  ? 275  PHE B CE2 1 
ATOM   4290 C  CZ  . PHE B 1 275 ? 38.060 -77.143  216.973 1.00 64.28  ? 275  PHE B CZ  1 
ATOM   4291 N  N   . THR B 1 276 ? 34.045 -83.170  215.819 1.00 68.58  ? 276  THR B N   1 
ATOM   4292 C  CA  . THR B 1 276 ? 33.467 -84.500  215.801 1.00 72.11  ? 276  THR B CA  1 
ATOM   4293 C  C   . THR B 1 276 ? 34.529 -85.576  215.706 1.00 74.29  ? 276  THR B C   1 
ATOM   4294 O  O   . THR B 1 276 ? 35.600 -85.368  215.140 1.00 74.07  ? 276  THR B O   1 
ATOM   4295 C  CB  . THR B 1 276 ? 32.527 -84.679  214.586 1.00 72.87  ? 276  THR B CB  1 
ATOM   4296 O  OG1 . THR B 1 276 ? 31.514 -83.668  214.610 1.00 74.20  ? 276  THR B OG1 1 
ATOM   4297 C  CG2 . THR B 1 276 ? 31.864 -86.050  214.614 1.00 74.61  ? 276  THR B CG2 1 
ATOM   4298 N  N   . THR B 1 277 ? 34.225 -86.730  216.279 1.00 77.81  ? 277  THR B N   1 
ATOM   4299 C  CA  . THR B 1 277 ? 35.122 -87.863  216.201 1.00 80.81  ? 277  THR B CA  1 
ATOM   4300 C  C   . THR B 1 277 ? 34.460 -88.758  215.155 1.00 81.98  ? 277  THR B C   1 
ATOM   4301 O  O   . THR B 1 277 ? 33.347 -89.241  215.354 1.00 81.61  ? 277  THR B O   1 
ATOM   4302 C  CB  . THR B 1 277 ? 35.242 -88.589  217.558 1.00 81.63  ? 277  THR B CB  1 
ATOM   4303 O  OG1 . THR B 1 277 ? 36.134 -89.702  217.420 1.00 81.34  ? 277  THR B OG1 1 
ATOM   4304 C  CG2 . THR B 1 277 ? 33.876 -89.070  218.045 1.00 82.65  ? 277  THR B CG2 1 
ATOM   4305 N  N   . LEU B 1 278 ? 35.126 -88.934  214.018 1.00 84.38  ? 278  LEU B N   1 
ATOM   4306 C  CA  . LEU B 1 278 ? 34.584 -89.748  212.938 1.00 87.07  ? 278  LEU B CA  1 
ATOM   4307 C  C   . LEU B 1 278 ? 34.393 -91.202  213.338 1.00 89.36  ? 278  LEU B C   1 
ATOM   4308 O  O   . LEU B 1 278 ? 35.162 -91.748  214.134 1.00 88.96  ? 278  LEU B O   1 
ATOM   4309 C  CB  . LEU B 1 278 ? 35.487 -89.675  211.705 1.00 87.53  ? 278  LEU B CB  1 
ATOM   4310 C  CG  . LEU B 1 278 ? 35.394 -88.407  210.855 1.00 87.97  ? 278  LEU B CG  1 
ATOM   4311 C  CD1 . LEU B 1 278 ? 36.362 -88.506  209.691 1.00 88.18  ? 278  LEU B CD1 1 
ATOM   4312 C  CD2 . LEU B 1 278 ? 33.975 -88.228  210.344 1.00 87.65  ? 278  LEU B CD2 1 
ATOM   4313 N  N   . PRO B 1 279 ? 33.352 -91.850  212.786 1.00 91.07  ? 279  PRO B N   1 
ATOM   4314 C  CA  . PRO B 1 279 ? 33.051 -93.252  213.080 1.00 91.69  ? 279  PRO B CA  1 
ATOM   4315 C  C   . PRO B 1 279 ? 34.297 -94.126  212.985 1.00 92.29  ? 279  PRO B C   1 
ATOM   4316 O  O   . PRO B 1 279 ? 34.384 -95.168  213.633 1.00 92.10  ? 279  PRO B O   1 
ATOM   4317 C  CB  . PRO B 1 279 ? 32.011 -93.602  212.021 1.00 91.69  ? 279  PRO B CB  1 
ATOM   4318 C  CG  . PRO B 1 279 ? 31.263 -92.314  211.870 1.00 91.60  ? 279  PRO B CG  1 
ATOM   4319 C  CD  . PRO B 1 279 ? 32.381 -91.300  211.819 1.00 91.38  ? 279  PRO B CD  1 
ATOM   4320 N  N   . ASP B 1 280 ? 35.263 -93.683  212.183 1.00 92.88  ? 280  ASP B N   1 
ATOM   4321 C  CA  . ASP B 1 280 ? 36.505 -94.422  211.992 1.00 93.03  ? 280  ASP B CA  1 
ATOM   4322 C  C   . ASP B 1 280 ? 37.746 -93.782  212.620 1.00 92.32  ? 280  ASP B C   1 
ATOM   4323 O  O   . ASP B 1 280 ? 38.697 -93.433  211.917 1.00 93.27  ? 280  ASP B O   1 
ATOM   4324 C  CB  . ASP B 1 280 ? 36.746 -94.657  210.494 1.00 94.55  ? 280  ASP B CB  1 
ATOM   4325 C  CG  . ASP B 1 280 ? 36.700 -93.378  209.682 1.00 96.07  ? 280  ASP B CG  1 
ATOM   4326 O  OD1 . ASP B 1 280 ? 35.630 -92.729  209.653 1.00 97.13  ? 280  ASP B OD1 1 
ATOM   4327 O  OD2 . ASP B 1 280 ? 37.733 -93.026  209.071 1.00 95.74  ? 280  ASP B OD2 1 
ATOM   4328 N  N   . GLY B 1 281 ? 37.728 -93.635  213.944 1.00 90.62  ? 281  GLY B N   1 
ATOM   4329 C  CA  . GLY B 1 281 ? 38.855 -93.072  214.679 1.00 88.61  ? 281  GLY B CA  1 
ATOM   4330 C  C   . GLY B 1 281 ? 39.502 -91.754  214.262 1.00 86.76  ? 281  GLY B C   1 
ATOM   4331 O  O   . GLY B 1 281 ? 40.556 -91.394  214.796 1.00 86.82  ? 281  GLY B O   1 
ATOM   4332 N  N   . ARG B 1 282 ? 38.899 -91.026  213.328 1.00 84.08  ? 282  ARG B N   1 
ATOM   4333 C  CA  . ARG B 1 282 ? 39.467 -89.752  212.887 1.00 80.77  ? 282  ARG B CA  1 
ATOM   4334 C  C   . ARG B 1 282 ? 38.762 -88.559  213.509 1.00 78.68  ? 282  ARG B C   1 
ATOM   4335 O  O   . ARG B 1 282 ? 37.573 -88.625  213.823 1.00 78.01  ? 282  ARG B O   1 
ATOM   4336 C  CB  . ARG B 1 282 ? 39.379 -89.613  211.369 1.00 80.16  ? 282  ARG B CB  1 
ATOM   4337 C  CG  . ARG B 1 282 ? 40.370 -90.431  210.588 1.00 79.99  ? 282  ARG B CG  1 
ATOM   4338 C  CD  . ARG B 1 282 ? 40.195 -90.125  209.124 1.00 80.76  ? 282  ARG B CD  1 
ATOM   4339 N  NE  . ARG B 1 282 ? 38.834 -90.425  208.699 1.00 82.22  ? 282  ARG B NE  1 
ATOM   4340 C  CZ  . ARG B 1 282 ? 38.309 -90.047  207.539 1.00 83.12  ? 282  ARG B CZ  1 
ATOM   4341 N  NH1 . ARG B 1 282 ? 39.029 -89.341  206.678 1.00 83.45  ? 282  ARG B NH1 1 
ATOM   4342 N  NH2 . ARG B 1 282 ? 37.063 -90.386  207.235 1.00 83.73  ? 282  ARG B NH2 1 
ATOM   4343 N  N   . ARG B 1 283 ? 39.498 -87.464  213.677 1.00 75.18  ? 283  ARG B N   1 
ATOM   4344 C  CA  . ARG B 1 283 ? 38.916 -86.253  214.236 1.00 71.93  ? 283  ARG B CA  1 
ATOM   4345 C  C   . ARG B 1 283 ? 38.434 -85.404  213.073 1.00 67.19  ? 283  ARG B C   1 
ATOM   4346 O  O   . ARG B 1 283 ? 39.098 -85.311  212.043 1.00 65.95  ? 283  ARG B O   1 
ATOM   4347 C  CB  . ARG B 1 283 ? 39.947 -85.485  215.063 1.00 75.56  ? 283  ARG B CB  1 
ATOM   4348 C  CG  . ARG B 1 283 ? 40.585 -86.323  216.159 1.00 79.92  ? 283  ARG B CG  1 
ATOM   4349 C  CD  . ARG B 1 283 ? 41.361 -85.472  217.144 1.00 83.06  ? 283  ARG B CD  1 
ATOM   4350 N  NE  . ARG B 1 283 ? 42.400 -86.239  217.831 1.00 86.70  ? 283  ARG B NE  1 
ATOM   4351 C  CZ  . ARG B 1 283 ? 42.178 -87.329  218.561 1.00 88.52  ? 283  ARG B CZ  1 
ATOM   4352 N  NH1 . ARG B 1 283 ? 40.943 -87.793  218.709 1.00 89.82  ? 283  ARG B NH1 1 
ATOM   4353 N  NH2 . ARG B 1 283 ? 43.193 -87.958  219.140 1.00 88.37  ? 283  ARG B NH2 1 
ATOM   4354 N  N   . ALA B 1 284 ? 37.265 -84.800  213.230 1.00 62.10  ? 284  ALA B N   1 
ATOM   4355 C  CA  . ALA B 1 284 ? 36.716 -83.977  212.168 1.00 58.25  ? 284  ALA B CA  1 
ATOM   4356 C  C   . ALA B 1 284 ? 36.101 -82.701  212.706 1.00 54.76  ? 284  ALA B C   1 
ATOM   4357 O  O   . ALA B 1 284 ? 35.759 -82.611  213.881 1.00 51.54  ? 284  ALA B O   1 
ATOM   4358 C  CB  . ALA B 1 284 ? 35.668 -84.766  211.389 1.00 58.65  ? 284  ALA B CB  1 
ATOM   4359 N  N   . LEU B 1 285 ? 35.986 -81.707  211.838 1.00 52.13  ? 285  LEU B N   1 
ATOM   4360 C  CA  . LEU B 1 285 ? 35.372 -80.447  212.216 1.00 51.57  ? 285  LEU B CA  1 
ATOM   4361 C  C   . LEU B 1 285 ? 34.116 -80.314  211.380 1.00 49.68  ? 285  LEU B C   1 
ATOM   4362 O  O   . LEU B 1 285 ? 34.166 -80.361  210.153 1.00 50.89  ? 285  LEU B O   1 
ATOM   4363 C  CB  . LEU B 1 285 ? 36.301 -79.262  211.935 1.00 53.00  ? 285  LEU B CB  1 
ATOM   4364 C  CG  . LEU B 1 285 ? 35.619 -77.898  212.103 1.00 53.25  ? 285  LEU B CG  1 
ATOM   4365 C  CD1 . LEU B 1 285 ? 35.235 -77.691  213.560 1.00 52.04  ? 285  LEU B CD1 1 
ATOM   4366 C  CD2 . LEU B 1 285 ? 36.549 -76.793  211.631 1.00 55.43  ? 285  LEU B CD2 1 
ATOM   4367 N  N   . ASP B 1 286 ? 32.982 -80.156  212.039 1.00 46.77  ? 286  ASP B N   1 
ATOM   4368 C  CA  . ASP B 1 286 ? 31.741 -80.021  211.307 1.00 46.09  ? 286  ASP B CA  1 
ATOM   4369 C  C   . ASP B 1 286 ? 31.136 -78.647  211.537 1.00 43.55  ? 286  ASP B C   1 
ATOM   4370 O  O   . ASP B 1 286 ? 30.410 -78.421  212.500 1.00 43.82  ? 286  ASP B O   1 
ATOM   4371 C  CB  . ASP B 1 286 ? 30.778 -81.133  211.727 1.00 47.74  ? 286  ASP B CB  1 
ATOM   4372 C  CG  . ASP B 1 286 ? 29.393 -80.944  211.167 1.00 50.06  ? 286  ASP B CG  1 
ATOM   4373 O  OD1 . ASP B 1 286 ? 29.244 -80.274  210.116 1.00 49.75  ? 286  ASP B OD1 1 
ATOM   4374 O  OD2 . ASP B 1 286 ? 28.450 -81.478  211.780 1.00 52.42  ? 286  ASP B OD2 1 
ATOM   4375 N  N   . LEU B 1 287 ? 31.452 -77.724  210.638 1.00 41.97  ? 287  LEU B N   1 
ATOM   4376 C  CA  . LEU B 1 287 ? 30.954 -76.360  210.745 1.00 41.16  ? 287  LEU B CA  1 
ATOM   4377 C  C   . LEU B 1 287 ? 29.445 -76.254  210.587 1.00 41.29  ? 287  LEU B C   1 
ATOM   4378 O  O   . LEU B 1 287 ? 28.884 -75.164  210.683 1.00 40.69  ? 287  LEU B O   1 
ATOM   4379 C  CB  . LEU B 1 287 ? 31.647 -75.463  209.714 1.00 39.74  ? 287  LEU B CB  1 
ATOM   4380 C  CG  . LEU B 1 287 ? 33.154 -75.285  209.931 1.00 38.60  ? 287  LEU B CG  1 
ATOM   4381 C  CD1 . LEU B 1 287 ? 33.713 -74.332  208.912 1.00 37.19  ? 287  LEU B CD1 1 
ATOM   4382 C  CD2 . LEU B 1 287 ? 33.410 -74.769  211.330 1.00 37.67  ? 287  LEU B CD2 1 
ATOM   4383 N  N   . GLY B 1 288 ? 28.787 -77.383  210.345 1.00 41.99  ? 288  GLY B N   1 
ATOM   4384 C  CA  . GLY B 1 288 ? 27.346 -77.363  210.194 1.00 42.61  ? 288  GLY B CA  1 
ATOM   4385 C  C   . GLY B 1 288 ? 26.671 -76.996  211.504 1.00 44.56  ? 288  GLY B C   1 
ATOM   4386 O  O   . GLY B 1 288 ? 25.603 -76.386  211.513 1.00 44.14  ? 288  GLY B O   1 
ATOM   4387 N  N   . LYS B 1 289 ? 27.307 -77.358  212.614 1.00 44.78  ? 289  LYS B N   1 
ATOM   4388 C  CA  . LYS B 1 289 ? 26.768 -77.076  213.937 1.00 46.16  ? 289  LYS B CA  1 
ATOM   4389 C  C   . LYS B 1 289 ? 27.313 -75.784  214.552 1.00 45.32  ? 289  LYS B C   1 
ATOM   4390 O  O   . LYS B 1 289 ? 26.992 -75.442  215.690 1.00 45.02  ? 289  LYS B O   1 
ATOM   4391 C  CB  . LYS B 1 289 ? 27.073 -78.253  214.872 1.00 50.58  ? 289  LYS B CB  1 
ATOM   4392 C  CG  . LYS B 1 289 ? 26.279 -79.520  214.559 1.00 55.27  ? 289  LYS B CG  1 
ATOM   4393 C  CD  . LYS B 1 289 ? 26.321 -80.526  215.709 1.00 58.00  ? 289  LYS B CD  1 
ATOM   4394 C  CE  . LYS B 1 289 ? 27.634 -81.286  215.750 1.00 58.97  ? 289  LYS B CE  1 
ATOM   4395 N  NZ  . LYS B 1 289 ? 27.765 -82.186  214.577 1.00 59.88  ? 289  LYS B NZ  1 
ATOM   4396 N  N   . PHE B 1 290 ? 28.120 -75.061  213.785 1.00 42.99  ? 290  PHE B N   1 
ATOM   4397 C  CA  . PHE B 1 290 ? 28.744 -73.835  214.253 1.00 40.05  ? 290  PHE B CA  1 
ATOM   4398 C  C   . PHE B 1 290 ? 27.808 -72.839  214.936 1.00 39.66  ? 290  PHE B C   1 
ATOM   4399 O  O   . PHE B 1 290 ? 28.170 -72.253  215.956 1.00 37.41  ? 290  PHE B O   1 
ATOM   4400 C  CB  . PHE B 1 290 ? 29.448 -73.146  213.083 1.00 39.80  ? 290  PHE B CB  1 
ATOM   4401 C  CG  . PHE B 1 290 ? 30.434 -72.105  213.503 1.00 36.74  ? 290  PHE B CG  1 
ATOM   4402 C  CD1 . PHE B 1 290 ? 31.657 -72.475  214.059 1.00 38.08  ? 290  PHE B CD1 1 
ATOM   4403 C  CD2 . PHE B 1 290 ? 30.139 -70.755  213.361 1.00 36.44  ? 290  PHE B CD2 1 
ATOM   4404 C  CE1 . PHE B 1 290 ? 32.577 -71.512  214.470 1.00 35.74  ? 290  PHE B CE1 1 
ATOM   4405 C  CE2 . PHE B 1 290 ? 31.049 -69.785  213.768 1.00 34.79  ? 290  PHE B CE2 1 
ATOM   4406 C  CZ  . PHE B 1 290 ? 32.268 -70.165  214.323 1.00 35.11  ? 290  PHE B CZ  1 
ATOM   4407 N  N   . HIS B 1 291 ? 26.616 -72.643  214.372 1.00 37.83  ? 291  HIS B N   1 
ATOM   4408 C  CA  . HIS B 1 291 ? 25.653 -71.704  214.929 1.00 37.47  ? 291  HIS B CA  1 
ATOM   4409 C  C   . HIS B 1 291 ? 24.656 -72.327  215.916 1.00 39.69  ? 291  HIS B C   1 
ATOM   4410 O  O   . HIS B 1 291 ? 23.636 -71.712  216.254 1.00 37.54  ? 291  HIS B O   1 
ATOM   4411 C  CB  . HIS B 1 291 ? 24.879 -71.026  213.795 1.00 37.28  ? 291  HIS B CB  1 
ATOM   4412 C  CG  . HIS B 1 291 ? 25.743 -70.256  212.845 1.00 39.08  ? 291  HIS B CG  1 
ATOM   4413 N  ND1 . HIS B 1 291 ? 26.504 -69.172  213.234 1.00 37.33  ? 291  HIS B ND1 1 
ATOM   4414 C  CD2 . HIS B 1 291 ? 25.982 -70.428  211.524 1.00 35.57  ? 291  HIS B CD2 1 
ATOM   4415 C  CE1 . HIS B 1 291 ? 27.176 -68.714  212.194 1.00 36.18  ? 291  HIS B CE1 1 
ATOM   4416 N  NE2 . HIS B 1 291 ? 26.877 -69.458  211.145 1.00 36.17  ? 291  HIS B NE2 1 
ATOM   4417 N  N   . GLU B 1 292 ? 24.940 -73.534  216.391 1.00 40.13  ? 292  GLU B N   1 
ATOM   4418 C  CA  . GLU B 1 292 ? 24.017 -74.167  217.315 1.00 42.77  ? 292  GLU B CA  1 
ATOM   4419 C  C   . GLU B 1 292 ? 24.312 -73.893  218.780 1.00 42.68  ? 292  GLU B C   1 
ATOM   4420 O  O   . GLU B 1 292 ? 25.460 -73.972  219.222 1.00 42.43  ? 292  GLU B O   1 
ATOM   4421 C  CB  . GLU B 1 292 ? 23.977 -75.671  217.074 1.00 46.87  ? 292  GLU B CB  1 
ATOM   4422 C  CG  . GLU B 1 292 ? 23.408 -76.054  215.723 1.00 51.85  ? 292  GLU B CG  1 
ATOM   4423 C  CD  . GLU B 1 292 ? 23.117 -77.535  215.621 1.00 55.36  ? 292  GLU B CD  1 
ATOM   4424 O  OE1 . GLU B 1 292 ? 23.994 -78.348  215.999 1.00 56.32  ? 292  GLU B OE1 1 
ATOM   4425 O  OE2 . GLU B 1 292 ? 22.012 -77.886  215.157 1.00 59.07  ? 292  GLU B OE2 1 
ATOM   4426 N  N   . ILE B 1 293 ? 23.255 -73.575  219.523 1.00 41.60  ? 293  ILE B N   1 
ATOM   4427 C  CA  . ILE B 1 293 ? 23.346 -73.298  220.955 1.00 41.11  ? 293  ILE B CA  1 
ATOM   4428 C  C   . ILE B 1 293 ? 22.426 -74.245  221.744 1.00 40.35  ? 293  ILE B C   1 
ATOM   4429 O  O   . ILE B 1 293 ? 21.239 -74.386  221.431 1.00 34.23  ? 293  ILE B O   1 
ATOM   4430 C  CB  . ILE B 1 293 ? 22.890 -71.860  221.287 1.00 41.68  ? 293  ILE B CB  1 
ATOM   4431 C  CG1 . ILE B 1 293 ? 23.620 -70.840  220.406 1.00 43.81  ? 293  ILE B CG1 1 
ATOM   4432 C  CG2 . ILE B 1 293 ? 23.113 -71.583  222.758 1.00 40.41  ? 293  ILE B CG2 1 
ATOM   4433 C  CD1 . ILE B 1 293 ? 25.072 -70.689  220.698 1.00 44.20  ? 293  ILE B CD1 1 
ATOM   4434 N  N   . ALA B 1 294 ? 22.979 -74.885  222.765 1.00 41.48  ? 294  ALA B N   1 
ATOM   4435 C  CA  . ALA B 1 294 ? 22.198 -75.775  223.617 1.00 43.78  ? 294  ALA B CA  1 
ATOM   4436 C  C   . ALA B 1 294 ? 21.608 -74.922  224.746 1.00 44.90  ? 294  ALA B C   1 
ATOM   4437 O  O   . ALA B 1 294 ? 22.321 -74.166  225.398 1.00 46.54  ? 294  ALA B O   1 
ATOM   4438 C  CB  . ALA B 1 294 ? 23.083 -76.877  224.189 1.00 40.97  ? 294  ALA B CB  1 
ATOM   4439 N  N   . GLN B 1 295 ? 20.302 -75.039  224.955 1.00 47.53  ? 295  GLN B N   1 
ATOM   4440 C  CA  . GLN B 1 295 ? 19.596 -74.286  225.993 1.00 49.19  ? 295  GLN B CA  1 
ATOM   4441 C  C   . GLN B 1 295 ? 18.698 -75.206  226.819 1.00 50.97  ? 295  GLN B C   1 
ATOM   4442 O  O   . GLN B 1 295 ? 18.063 -76.110  226.280 1.00 52.33  ? 295  GLN B O   1 
ATOM   4443 C  CB  . GLN B 1 295 ? 18.729 -73.197  225.361 1.00 46.46  ? 295  GLN B CB  1 
ATOM   4444 C  CG  . GLN B 1 295 ? 19.361 -71.846  225.297 1.00 44.77  ? 295  GLN B CG  1 
ATOM   4445 C  CD  . GLN B 1 295 ? 18.431 -70.796  224.705 1.00 45.75  ? 295  GLN B CD  1 
ATOM   4446 O  OE1 . GLN B 1 295 ? 18.099 -70.836  223.512 1.00 43.59  ? 295  GLN B OE1 1 
ATOM   4447 N  NE2 . GLN B 1 295 ? 18.004 -69.846  225.538 1.00 42.29  ? 295  GLN B NE2 1 
ATOM   4448 N  N   . HIS B 1 296 ? 18.642 -74.961  228.123 1.00 53.82  ? 296  HIS B N   1 
ATOM   4449 C  CA  . HIS B 1 296 ? 17.816 -75.758  229.024 1.00 56.62  ? 296  HIS B CA  1 
ATOM   4450 C  C   . HIS B 1 296 ? 16.372 -75.281  228.953 1.00 59.19  ? 296  HIS B C   1 
ATOM   4451 O  O   . HIS B 1 296 ? 16.119 -74.093  228.778 1.00 58.07  ? 296  HIS B O   1 
ATOM   4452 C  CB  . HIS B 1 296 ? 18.315 -75.618  230.461 1.00 56.06  ? 296  HIS B CB  1 
ATOM   4453 C  CG  . HIS B 1 296 ? 17.464 -76.326  231.465 1.00 58.38  ? 296  HIS B CG  1 
ATOM   4454 N  ND1 . HIS B 1 296 ? 17.735 -77.607  231.902 1.00 59.05  ? 296  HIS B ND1 1 
ATOM   4455 C  CD2 . HIS B 1 296 ? 16.316 -75.953  232.079 1.00 57.92  ? 296  HIS B CD2 1 
ATOM   4456 C  CE1 . HIS B 1 296 ? 16.789 -77.991  232.741 1.00 58.31  ? 296  HIS B CE1 1 
ATOM   4457 N  NE2 . HIS B 1 296 ? 15.915 -77.007  232.865 1.00 58.41  ? 296  HIS B NE2 1 
ATOM   4458 N  N   . HIS B 1 297 ? 15.428 -76.209  229.082 1.00 63.98  ? 297  HIS B N   1 
ATOM   4459 C  CA  . HIS B 1 297 ? 14.009 -75.857  229.050 1.00 68.86  ? 297  HIS B CA  1 
ATOM   4460 C  C   . HIS B 1 297 ? 13.315 -76.271  230.347 1.00 73.22  ? 297  HIS B C   1 
ATOM   4461 O  O   . HIS B 1 297 ? 13.617 -77.320  230.920 1.00 73.18  ? 297  HIS B O   1 
ATOM   4462 C  CB  . HIS B 1 297 ? 13.317 -76.503  227.846 1.00 67.94  ? 297  HIS B CB  1 
ATOM   4463 C  CG  . HIS B 1 297 ? 13.693 -75.889  226.532 1.00 65.82  ? 297  HIS B CG  1 
ATOM   4464 N  ND1 . HIS B 1 297 ? 14.942 -76.042  225.965 1.00 64.38  ? 297  HIS B ND1 1 
ATOM   4465 C  CD2 . HIS B 1 297 ? 12.990 -75.101  225.684 1.00 63.84  ? 297  HIS B CD2 1 
ATOM   4466 C  CE1 . HIS B 1 297 ? 14.991 -75.375  224.827 1.00 63.72  ? 297  HIS B CE1 1 
ATOM   4467 N  NE2 . HIS B 1 297 ? 13.820 -74.795  224.633 1.00 63.22  ? 297  HIS B NE2 1 
ATOM   4468 N  N   . HIS B 1 298 ? 12.380 -75.440  230.801 1.00 78.49  ? 298  HIS B N   1 
ATOM   4469 C  CA  . HIS B 1 298 ? 11.662 -75.690  232.050 1.00 83.75  ? 298  HIS B CA  1 
ATOM   4470 C  C   . HIS B 1 298 ? 10.239 -76.207  231.840 1.00 85.60  ? 298  HIS B C   1 
ATOM   4471 O  O   . HIS B 1 298 ? 9.535  -75.755  230.940 1.00 85.91  ? 298  HIS B O   1 
ATOM   4472 C  CB  . HIS B 1 298 ? 11.618 -74.399  232.870 1.00 86.19  ? 298  HIS B CB  1 
ATOM   4473 C  CG  . HIS B 1 298 ? 12.871 -73.585  232.774 1.00 89.31  ? 298  HIS B CG  1 
ATOM   4474 N  ND1 . HIS B 1 298 ? 14.109 -74.078  233.126 1.00 90.84  ? 298  HIS B ND1 1 
ATOM   4475 C  CD2 . HIS B 1 298 ? 13.077 -72.314  232.353 1.00 90.22  ? 298  HIS B CD2 1 
ATOM   4476 C  CE1 . HIS B 1 298 ? 15.024 -73.146  232.925 1.00 90.88  ? 298  HIS B CE1 1 
ATOM   4477 N  NE2 . HIS B 1 298 ? 14.425 -72.066  232.456 1.00 90.36  ? 298  HIS B NE2 1 
ATOM   4478 N  N   . HIS B 1 299 ? 9.816  -77.148  232.681 1.00 87.96  ? 299  HIS B N   1 
ATOM   4479 C  CA  . HIS B 1 299 ? 8.475  -77.714  232.571 1.00 90.32  ? 299  HIS B CA  1 
ATOM   4480 C  C   . HIS B 1 299 ? 7.404  -76.641  232.715 1.00 91.11  ? 299  HIS B C   1 
ATOM   4481 O  O   . HIS B 1 299 ? 6.520  -76.620  231.832 1.00 92.15  ? 299  HIS B O   1 
ATOM   4482 C  CB  . HIS B 1 299 ? 8.248  -78.803  233.628 1.00 91.53  ? 299  HIS B CB  1 
ATOM   4483 C  CG  . HIS B 1 299 ? 8.934  -80.103  233.327 1.00 93.23  ? 299  HIS B CG  1 
ATOM   4484 N  ND1 . HIS B 1 299 ? 10.294 -80.284  233.478 1.00 93.53  ? 299  HIS B ND1 1 
ATOM   4485 C  CD2 . HIS B 1 299 ? 8.444  -81.290  232.893 1.00 92.78  ? 299  HIS B CD2 1 
ATOM   4486 C  CE1 . HIS B 1 299 ? 10.609 -81.526  233.153 1.00 93.23  ? 299  HIS B CE1 1 
ATOM   4487 N  NE2 . HIS B 1 299 ? 9.506  -82.157  232.794 1.00 92.26  ? 299  HIS B NE2 1 
HETATM 4488 K  K   . K   C 2 .   ? 52.814 -54.693  147.340 0.50 57.14  ? 1000 K   A K   1 
HETATM 4489 K  K   A K   D 2 .   ? 52.814 -54.693  154.980 0.50 45.21  ? 1001 K   A K   1 
HETATM 4490 K  K   B K   E 2 .   ? 52.814 -54.695  159.753 0.50 44.87  ? 1002 K   A K   1 
HETATM 4491 K  K   A K   F 2 .   ? 52.814 -54.693  163.609 0.50 14.46  ? 1003 K   A K   1 
HETATM 4492 K  K   B K   G 2 .   ? 52.814 -54.693  168.828 0.50 27.67  ? 1004 K   A K   1 
HETATM 4493 MG MG  A MG  H 3 .   ? 52.814 -54.693  169.732 0.50 44.10  ? 2001 MG  A MG  1 
HETATM 4494 O  O   A HOH I 4 .   ? 52.814 -54.693  160.637 0.50 53.37  ? 2002 HOH A O   1 
HETATM 4495 O  O   B HOH I 4 .   ? 52.814 -54.693  162.563 0.50 55.89  ? 2003 HOH A O   1 
HETATM 4496 O  O   . HOH I 4 .   ? 55.146 -70.455  231.027 1.00 25.05  ? 2004 HOH A O   1 
HETATM 4497 O  O   . HOH I 4 .   ? 62.843 -89.591  226.523 1.00 43.47  ? 2005 HOH A O   1 
HETATM 4498 O  O   . HOH I 4 .   ? 56.380 -68.643  223.581 1.00 23.23  ? 2006 HOH A O   1 
HETATM 4499 O  O   . HOH I 4 .   ? 62.917 -61.973  224.653 1.00 21.67  ? 2007 HOH A O   1 
HETATM 4500 O  O   . HOH I 4 .   ? 72.099 -74.099  218.413 1.00 40.08  ? 2008 HOH A O   1 
HETATM 4501 O  O   . HOH I 4 .   ? 66.327 -83.815  216.460 1.00 34.70  ? 2009 HOH A O   1 
HETATM 4502 O  O   . HOH I 4 .   ? 55.598 -64.184  223.191 1.00 53.10  ? 2010 HOH A O   1 
HETATM 4503 O  O   . HOH I 4 .   ? 57.982 -77.558  209.742 1.00 39.93  ? 2011 HOH A O   1 
HETATM 4504 O  O   . HOH I 4 .   ? 66.313 -72.740  232.657 1.00 38.83  ? 2012 HOH A O   1 
HETATM 4505 O  O   . HOH I 4 .   ? 64.919 -68.854  224.390 1.00 31.35  ? 2013 HOH A O   1 
HETATM 4506 O  O   . HOH I 4 .   ? 60.939 -72.381  205.681 1.00 33.91  ? 2014 HOH A O   1 
HETATM 4507 O  O   . HOH I 4 .   ? 71.460 -62.394  216.901 1.00 62.25  ? 2015 HOH A O   1 
HETATM 4508 O  O   . HOH I 4 .   ? 58.293 -70.789  205.315 1.00 51.58  ? 2016 HOH A O   1 
HETATM 4509 O  O   . HOH I 4 .   ? 57.186 -86.657  226.463 1.00 33.29  ? 2017 HOH A O   1 
HETATM 4510 O  O   . HOH I 4 .   ? 57.101 -73.681  207.831 1.00 35.17  ? 2018 HOH A O   1 
HETATM 4511 O  O   . HOH I 4 .   ? 47.120 -79.628  218.878 1.00 49.98  ? 2019 HOH A O   1 
HETATM 4512 O  O   . HOH I 4 .   ? 42.481 -81.115  232.794 1.00 44.03  ? 2020 HOH A O   1 
HETATM 4513 O  O   . HOH I 4 .   ? 68.512 -89.143  228.128 1.00 50.36  ? 2021 HOH A O   1 
HETATM 4514 O  O   . HOH I 4 .   ? 57.443 -67.175  204.770 1.00 28.69  ? 2022 HOH A O   1 
HETATM 4515 O  O   . HOH I 4 .   ? 66.526 -68.383  205.248 1.00 41.55  ? 2023 HOH A O   1 
HETATM 4516 O  O   . HOH I 4 .   ? 57.366 -83.450  214.591 1.00 25.69  ? 2024 HOH A O   1 
HETATM 4517 O  O   . HOH I 4 .   ? 57.655 -66.014  223.460 1.00 47.47  ? 2025 HOH A O   1 
HETATM 4518 O  O   . HOH I 4 .   ? 55.415 -75.798  207.266 1.00 40.57  ? 2026 HOH A O   1 
HETATM 4519 O  O   . HOH I 4 .   ? 41.474 -86.663  210.121 1.00 57.33  ? 2027 HOH A O   1 
HETATM 4520 O  O   . HOH I 4 .   ? 34.369 -61.061  158.545 1.00 64.11  ? 2028 HOH A O   1 
HETATM 4521 O  O   . HOH I 4 .   ? 57.407 -63.795  220.361 1.00 61.34  ? 2029 HOH A O   1 
HETATM 4522 O  O   . HOH I 4 .   ? 56.492 -60.899  215.209 1.00 36.64  ? 2030 HOH A O   1 
HETATM 4523 O  O   . HOH I 4 .   ? 59.862 -82.968  214.282 1.00 30.63  ? 2031 HOH A O   1 
HETATM 4524 O  O   . HOH I 4 .   ? 56.627 -68.626  194.506 1.00 76.67  ? 2032 HOH A O   1 
HETATM 4525 O  O   . HOH I 4 .   ? 51.241 -77.000  205.160 1.00 58.14  ? 2033 HOH A O   1 
HETATM 4526 O  O   . HOH I 4 .   ? 56.376 -61.087  201.346 1.00 65.39  ? 2034 HOH A O   1 
HETATM 4527 O  O   . HOH I 4 .   ? 56.837 -57.921  203.885 1.00 46.39  ? 2035 HOH A O   1 
HETATM 4528 O  O   . HOH I 4 .   ? 50.824 -86.044  221.016 1.00 48.39  ? 2036 HOH A O   1 
HETATM 4529 O  O   . HOH I 4 .   ? 55.934 -71.272  194.628 1.00 59.11  ? 2037 HOH A O   1 
HETATM 4530 O  O   . HOH I 4 .   ? 57.278 -70.158  233.494 1.00 46.42  ? 2038 HOH A O   1 
HETATM 4531 O  O   . HOH I 4 .   ? 49.141 -69.573  232.823 1.00 61.52  ? 2039 HOH A O   1 
HETATM 4532 O  O   . HOH I 4 .   ? 66.654 -53.388  212.119 1.00 41.94  ? 2040 HOH A O   1 
HETATM 4533 O  O   . HOH I 4 .   ? 71.368 -70.104  220.624 1.00 38.01  ? 2041 HOH A O   1 
HETATM 4534 O  O   . HOH I 4 .   ? 69.917 -66.063  217.816 1.00 41.25  ? 2042 HOH A O   1 
HETATM 4535 O  O   . HOH I 4 .   ? 38.814 -75.925  207.542 1.00 60.26  ? 2043 HOH A O   1 
HETATM 4536 O  O   . HOH I 4 .   ? 50.482 -70.867  158.285 1.00 59.06  ? 2044 HOH A O   1 
HETATM 4537 O  O   . HOH I 4 .   ? 75.513 -75.417  218.540 1.00 76.27  ? 2045 HOH A O   1 
HETATM 4538 O  O   . HOH I 4 .   ? 52.553 -66.695  163.436 1.00 54.21  ? 2046 HOH A O   1 
HETATM 4539 O  O   . HOH I 4 .   ? 44.883 -69.901  227.347 1.00 44.86  ? 2047 HOH A O   1 
HETATM 4540 O  O   . HOH I 4 .   ? 58.417 -65.809  225.951 1.00 36.37  ? 2048 HOH A O   1 
HETATM 4541 O  O   . HOH I 4 .   ? 58.617 -80.453  236.811 1.00 44.32  ? 2049 HOH A O   1 
HETATM 4542 O  O   . HOH I 4 .   ? 71.635 -67.880  218.945 1.00 49.35  ? 2050 HOH A O   1 
HETATM 4543 O  O   . HOH I 4 .   ? 58.986 -70.216  231.681 1.00 53.45  ? 2051 HOH A O   1 
HETATM 4544 O  O   . HOH I 4 .   ? 55.478 -64.942  226.356 1.00 45.33  ? 2052 HOH A O   1 
HETATM 4545 O  O   . HOH I 4 .   ? 49.878 -71.174  230.507 1.00 46.16  ? 2053 HOH A O   1 
HETATM 4546 O  O   . HOH I 4 .   ? 60.449 -63.907  226.521 1.00 48.69  ? 2054 HOH A O   1 
HETATM 4547 O  O   . HOH I 4 .   ? 60.746 -78.570  236.504 1.00 39.41  ? 2055 HOH A O   1 
HETATM 4548 O  O   . HOH I 4 .   ? 73.735 -63.862  214.319 1.00 69.58  ? 2056 HOH A O   1 
HETATM 4549 O  O   . HOH I 4 .   ? 62.078 -78.146  209.108 1.00 26.99  ? 2057 HOH A O   1 
HETATM 4550 O  O   . HOH I 4 .   ? 67.157 -56.174  202.489 1.00 57.19  ? 2058 HOH A O   1 
HETATM 4551 O  O   . HOH I 4 .   ? 65.380 -54.893  204.103 1.00 42.36  ? 2059 HOH A O   1 
HETATM 4552 O  O   . HOH I 4 .   ? 52.001 -89.005  217.881 1.00 45.58  ? 2060 HOH A O   1 
HETATM 4553 O  O   . HOH I 4 .   ? 59.884 -57.390  197.022 1.00 52.96  ? 2061 HOH A O   1 
HETATM 4554 O  O   . HOH I 4 .   ? 51.262 -62.134  158.294 1.00 42.58  ? 2062 HOH A O   1 
HETATM 4555 O  O   . HOH I 4 .   ? 65.016 -91.011  225.614 1.00 56.95  ? 2063 HOH A O   1 
HETATM 4556 O  O   . HOH I 4 .   ? 53.201 -64.544  158.492 1.00 45.56  ? 2064 HOH A O   1 
HETATM 4557 O  O   . HOH I 4 .   ? 38.490 -77.420  221.916 1.00 38.83  ? 2065 HOH A O   1 
HETATM 4558 O  O   . HOH I 4 .   ? 59.246 -60.516  214.188 1.00 65.67  ? 2066 HOH A O   1 
HETATM 4559 O  O   . HOH I 4 .   ? 38.218 -79.984  221.524 1.00 45.65  ? 2067 HOH A O   1 
HETATM 4560 O  O   . HOH I 4 .   ? 70.841 -66.495  215.013 1.00 68.51  ? 2068 HOH A O   1 
HETATM 4561 O  O   . HOH I 4 .   ? 43.227 -71.221  225.120 1.00 45.31  ? 2069 HOH A O   1 
HETATM 4562 O  O   . HOH I 4 .   ? 73.370 -66.033  207.760 1.00 52.05  ? 2070 HOH A O   1 
HETATM 4563 O  O   . HOH I 4 .   ? 70.710 -82.505  236.775 1.00 45.45  ? 2071 HOH A O   1 
HETATM 4564 O  O   . HOH I 4 .   ? 58.865 -88.349  231.991 1.00 42.58  ? 2072 HOH A O   1 
HETATM 4565 O  O   . HOH I 4 .   ? 67.283 -68.585  223.188 1.00 42.03  ? 2073 HOH A O   1 
HETATM 4566 O  O   . HOH I 4 .   ? 56.500 -67.242  233.196 1.00 51.74  ? 2074 HOH A O   1 
HETATM 4567 O  O   . HOH I 4 .   ? 62.555 -56.763  197.357 1.00 54.63  ? 2075 HOH A O   1 
HETATM 4568 O  O   . HOH I 4 .   ? 73.149 -66.569  214.827 1.00 51.57  ? 2076 HOH A O   1 
HETATM 4569 O  O   . HOH I 4 .   ? 66.580 -77.592  239.751 1.00 54.05  ? 2077 HOH A O   1 
HETATM 4570 O  O   . HOH I 4 .   ? 42.437 -78.472  218.694 1.00 52.04  ? 2078 HOH A O   1 
HETATM 4571 O  O   . HOH I 4 .   ? 29.804 -69.258  158.173 1.00 53.24  ? 2079 HOH A O   1 
HETATM 4572 O  O   . HOH I 4 .   ? 57.490 -62.421  222.894 1.00 59.68  ? 2080 HOH A O   1 
HETATM 4573 O  O   . HOH I 4 .   ? 55.160 -64.101  207.015 1.00 31.13  ? 2081 HOH A O   1 
HETATM 4574 O  O   . HOH I 4 .   ? 41.220 -71.276  229.167 1.00 51.10  ? 2082 HOH A O   1 
HETATM 4575 O  O   . HOH I 4 .   ? 54.669 -62.808  209.219 1.00 60.53  ? 2083 HOH A O   1 
HETATM 4576 O  O   . HOH I 4 .   ? 57.436 -60.350  212.745 1.00 48.84  ? 2084 HOH A O   1 
HETATM 4577 O  O   . HOH I 4 .   ? 49.437 -57.630  174.468 1.00 66.29  ? 2085 HOH A O   1 
HETATM 4578 O  O   . HOH I 4 .   ? 68.018 -64.272  219.770 1.00 60.39  ? 2086 HOH A O   1 
HETATM 4579 O  O   . HOH I 4 .   ? 57.468 -61.101  210.393 1.00 65.12  ? 2087 HOH A O   1 
HETATM 4580 O  O   . HOH I 4 .   ? 50.996 -55.743  174.172 1.00 56.14  ? 2088 HOH A O   1 
HETATM 4581 O  O   A HOH J 4 .   ? 52.813 -54.692  167.649 0.50 34.71  ? 2002 HOH B O   1 
HETATM 4582 O  O   . HOH J 4 .   ? 46.921 -69.936  230.189 1.00 74.78  ? 2003 HOH B O   1 
HETATM 4583 O  O   . HOH J 4 .   ? 46.390 -64.308  224.374 1.00 28.82  ? 2004 HOH B O   1 
HETATM 4584 O  O   . HOH J 4 .   ? 19.753 -70.561  227.898 1.00 56.24  ? 2005 HOH B O   1 
HETATM 4585 O  O   . HOH J 4 .   ? 19.422 -72.484  221.619 1.00 32.08  ? 2006 HOH B O   1 
HETATM 4586 O  O   . HOH J 4 .   ? 35.675 -68.312  232.892 1.00 53.13  ? 2007 HOH B O   1 
HETATM 4587 O  O   . HOH J 4 .   ? 30.185 -64.747  209.411 1.00 28.21  ? 2008 HOH B O   1 
HETATM 4588 O  O   . HOH J 4 .   ? 30.586 -51.292  210.825 1.00 56.23  ? 2009 HOH B O   1 
HETATM 4589 O  O   . HOH J 4 .   ? 47.369 -70.326  218.102 1.00 53.17  ? 2010 HOH B O   1 
HETATM 4590 O  O   . HOH J 4 .   ? 45.578 -34.230  156.475 1.00 61.61  ? 2011 HOH B O   1 
HETATM 4591 O  O   . HOH J 4 .   ? 26.981 -69.366  208.160 1.00 47.34  ? 2012 HOH B O   1 
HETATM 4592 O  O   . HOH J 4 .   ? 21.106 -59.711  226.322 1.00 38.66  ? 2013 HOH B O   1 
HETATM 4593 O  O   . HOH J 4 .   ? 46.318 -36.140  158.553 1.00 55.51  ? 2014 HOH B O   1 
HETATM 4594 O  O   . HOH J 4 .   ? 35.632 -62.901  204.612 1.00 43.33  ? 2015 HOH B O   1 
HETATM 4595 O  O   . HOH J 4 .   ? 40.979 -61.059  234.671 1.00 63.61  ? 2016 HOH B O   1 
HETATM 4596 O  O   . HOH J 4 .   ? 24.718 -65.595  234.396 1.00 50.76  ? 2017 HOH B O   1 
HETATM 4597 O  O   . HOH J 4 .   ? 45.588 -53.058  158.486 1.00 34.51  ? 2018 HOH B O   1 
HETATM 4598 O  O   . HOH J 4 .   ? 40.961 -72.892  201.508 1.00 50.42  ? 2019 HOH B O   1 
HETATM 4599 O  O   . HOH J 4 .   ? 39.597 -63.333  239.029 1.00 53.20  ? 2020 HOH B O   1 
HETATM 4600 O  O   . HOH J 4 .   ? 40.138 -67.976  205.313 1.00 44.77  ? 2021 HOH B O   1 
HETATM 4601 O  O   . HOH J 4 .   ? 41.011 -66.224  233.075 1.00 58.73  ? 2022 HOH B O   1 
HETATM 4602 O  O   . HOH J 4 .   ? 29.955 -54.069  212.096 1.00 54.69  ? 2023 HOH B O   1 
HETATM 4603 O  O   . HOH J 4 .   ? 25.213 -50.575  231.873 1.00 51.67  ? 2024 HOH B O   1 
HETATM 4604 O  O   . HOH J 4 .   ? 24.663 -74.296  212.532 1.00 31.05  ? 2025 HOH B O   1 
HETATM 4605 O  O   . HOH J 4 .   ? 29.421 -69.248  239.173 1.00 51.58  ? 2026 HOH B O   1 
HETATM 4606 O  O   . HOH J 4 .   ? 34.900 -73.428  218.785 1.00 47.30  ? 2027 HOH B O   1 
HETATM 4607 O  O   . HOH J 4 .   ? 24.540 -59.019  214.708 1.00 50.62  ? 2028 HOH B O   1 
HETATM 4608 O  O   . HOH J 4 .   ? 26.199 -68.096  234.011 1.00 39.89  ? 2029 HOH B O   1 
HETATM 4609 O  O   . HOH J 4 .   ? 18.660 -65.473  226.393 1.00 40.82  ? 2030 HOH B O   1 
HETATM 4610 O  O   . HOH J 4 .   ? 30.277 -66.960  239.906 1.00 62.04  ? 2031 HOH B O   1 
HETATM 4611 O  O   . HOH J 4 .   ? 23.854 -58.379  212.106 1.00 56.64  ? 2032 HOH B O   1 
HETATM 4612 O  O   . HOH J 4 .   ? 31.162 -62.866  241.862 1.00 53.41  ? 2033 HOH B O   1 
HETATM 4613 O  O   . HOH J 4 .   ? 40.815 -64.127  231.751 1.00 53.55  ? 2034 HOH B O   1 
HETATM 4614 O  O   . HOH J 4 .   ? 34.248 -58.237  208.298 1.00 38.38  ? 2035 HOH B O   1 
HETATM 4615 O  O   . HOH J 4 .   ? 37.270 -59.829  204.849 1.00 55.36  ? 2036 HOH B O   1 
HETATM 4616 O  O   . HOH J 4 .   ? 47.691 -51.039  160.611 1.00 54.75  ? 2037 HOH B O   1 
HETATM 4617 O  O   . HOH J 4 .   ? 20.591 -73.290  229.645 1.00 43.92  ? 2038 HOH B O   1 
HETATM 4618 O  O   . HOH J 4 .   ? 41.875 -56.754  153.795 1.00 70.64  ? 2039 HOH B O   1 
HETATM 4619 O  O   . HOH J 4 .   ? 38.870 -53.002  157.972 1.00 66.07  ? 2040 HOH B O   1 
HETATM 4620 O  O   . HOH J 4 .   ? 31.185 -57.234  207.502 1.00 55.67  ? 2041 HOH B O   1 
HETATM 4621 O  O   . HOH J 4 .   ? 36.155 -40.133  156.675 1.00 47.03  ? 2042 HOH B O   1 
HETATM 4622 O  O   . HOH J 4 .   ? 16.295 -67.804  225.455 1.00 53.72  ? 2043 HOH B O   1 
HETATM 4623 O  O   . HOH J 4 .   ? 35.243 -62.861  206.891 1.00 42.99  ? 2044 HOH B O   1 
HETATM 4624 O  O   . HOH J 4 .   ? 39.775 -52.211  155.380 1.00 76.07  ? 2045 HOH B O   1 
HETATM 4625 O  O   . HOH J 4 .   ? 43.441 -54.792  158.114 1.00 42.65  ? 2046 HOH B O   1 
HETATM 4626 O  O   . HOH J 4 .   ? 41.912 -57.094  216.505 1.00 28.62  ? 2047 HOH B O   1 
HETATM 4627 O  O   . HOH J 4 .   ? 37.325 -56.937  231.077 1.00 11.85  ? 2048 HOH B O   1 
HETATM 4628 O  O   . HOH J 4 .   ? 39.168 -57.932  223.922 1.00 20.01  ? 2049 HOH B O   1 
HETATM 4629 O  O   . HOH J 4 .   ? 39.211 -65.929  224.490 1.00 34.70  ? 2050 HOH B O   1 
HETATM 4630 O  O   . HOH J 4 .   ? 43.282 -56.743  223.781 1.00 49.87  ? 2051 HOH B O   1 
HETATM 4631 O  O   . HOH J 4 .   ? 47.912 -68.621  227.785 1.00 46.45  ? 2052 HOH B O   1 
HETATM 4632 O  O   . HOH J 4 .   ? 41.818 -58.902  223.636 1.00 47.25  ? 2053 HOH B O   1 
HETATM 4633 O  O   . HOH J 4 .   ? 44.413 -65.351  230.451 1.00 68.86  ? 2054 HOH B O   1 
HETATM 4634 O  O   . HOH J 4 .   ? 32.600 -53.872  237.306 1.00 49.95  ? 2055 HOH B O   1 
HETATM 4635 O  O   . HOH J 4 .   ? 42.111 -59.562  226.676 1.00 34.39  ? 2056 HOH B O   1 
HETATM 4636 O  O   . HOH J 4 .   ? 48.291 -59.658  212.932 1.00 64.31  ? 2057 HOH B O   1 
HETATM 4637 O  O   . HOH J 4 .   ? 36.382 -56.136  207.348 1.00 53.04  ? 2058 HOH B O   1 
HETATM 4638 O  O   . HOH J 4 .   ? 42.368 -87.544  213.402 1.00 85.38  ? 2059 HOH B O   1 
HETATM 4639 O  O   . HOH J 4 .   ? 39.696 -69.393  232.338 1.00 47.59  ? 2060 HOH B O   1 
HETATM 4640 O  O   . HOH J 4 .   ? 38.160 -67.601  233.752 1.00 59.29  ? 2061 HOH B O   1 
HETATM 4641 O  O   . HOH J 4 .   ? 24.730 -61.873  214.418 1.00 43.22  ? 2062 HOH B O   1 
HETATM 4642 O  O   . HOH J 4 .   ? 36.982 -55.343  209.779 1.00 46.87  ? 2063 HOH B O   1 
HETATM 4643 O  O   . HOH J 4 .   ? 28.333 -51.725  213.761 1.00 50.37  ? 2064 HOH B O   1 
HETATM 4644 O  O   . HOH J 4 .   ? 41.575 -56.668  201.995 1.00 52.91  ? 2065 HOH B O   1 
HETATM 4645 O  O   . HOH J 4 .   ? 43.036 -73.214  215.379 1.00 30.21  ? 2066 HOH B O   1 
HETATM 4646 O  O   . HOH J 4 .   ? 43.085 -70.333  217.416 1.00 32.62  ? 2067 HOH B O   1 
HETATM 4647 O  O   . HOH J 4 .   ? 35.427 -44.866  225.056 1.00 63.11  ? 2068 HOH B O   1 
HETATM 4648 O  O   . HOH J 4 .   ? 42.694 -56.943  226.542 1.00 34.29  ? 2069 HOH B O   1 
HETATM 4649 O  O   . HOH J 4 .   ? 42.464 -70.399  221.308 1.00 58.94  ? 2070 HOH B O   1 
HETATM 4650 O  O   . HOH J 4 .   ? 50.095 -50.914  174.680 1.00 44.01  ? 2071 HOH B O   1 
HETATM 4651 O  O   . HOH J 4 .   ? 39.809 -68.600  223.405 1.00 45.14  ? 2072 HOH B O   1 
HETATM 4652 O  O   . HOH J 4 .   ? 39.611 -62.661  233.359 1.00 43.39  ? 2073 HOH B O   1 
HETATM 4653 O  O   . HOH J 4 .   ? 29.293 -72.248  225.239 1.00 34.55  ? 2074 HOH B O   1 
HETATM 4654 O  O   . HOH J 4 .   ? 30.151 -72.723  229.081 1.00 49.92  ? 2075 HOH B O   1 
HETATM 4655 O  O   . HOH J 4 .   ? 19.559 -61.287  231.809 1.00 63.21  ? 2076 HOH B O   1 
HETATM 4656 O  O   . HOH J 4 .   ? 49.690 -56.991  204.223 1.00 63.65  ? 2077 HOH B O   1 
HETATM 4657 O  O   . HOH J 4 .   ? 44.849 -55.807  216.524 1.00 46.37  ? 2078 HOH B O   1 
HETATM 4658 O  O   . HOH J 4 .   ? 16.929 -58.802  232.267 1.00 58.56  ? 2079 HOH B O   1 
HETATM 4659 O  O   . HOH J 4 .   ? 20.198 -67.411  232.584 1.00 61.19  ? 2080 HOH B O   1 
HETATM 4660 O  O   . HOH J 4 .   ? 20.673 -76.739  231.669 1.00 58.57  ? 2081 HOH B O   1 
HETATM 4661 O  O   . HOH J 4 .   ? 37.696 -60.470  232.509 1.00 56.54  ? 2082 HOH B O   1 
HETATM 4662 O  O   . HOH J 4 .   ? 22.733 -66.909  233.226 1.00 52.10  ? 2083 HOH B O   1 
HETATM 4663 O  O   . HOH J 4 .   ? 42.956 -63.181  230.565 1.00 51.07  ? 2084 HOH B O   1 
HETATM 4664 O  O   . HOH J 4 .   ? 52.058 -66.523  203.381 1.00 46.46  ? 2085 HOH B O   1 
HETATM 4665 O  O   . HOH J 4 .   ? 24.862 -68.983  216.527 1.00 37.41  ? 2086 HOH B O   1 
HETATM 4666 O  O   . HOH J 4 .   ? 25.315 -47.301  231.257 1.00 67.60  ? 2087 HOH B O   1 
HETATM 4667 O  O   . HOH J 4 .   ? 16.527 -68.504  222.202 1.00 48.70  ? 2088 HOH B O   1 
HETATM 4668 O  O   . HOH J 4 .   ? 21.010 -53.743  222.228 1.00 71.63  ? 2089 HOH B O   1 
HETATM 4669 O  O   . HOH J 4 .   ? 41.103 -76.843  233.996 1.00 65.52  ? 2090 HOH B O   1 
HETATM 4670 O  O   . HOH J 4 .   ? 40.791 -75.714  231.734 1.00 74.30  ? 2091 HOH B O   1 
HETATM 4671 O  O   . HOH J 4 .   ? 36.223 -41.595  225.230 1.00 48.68  ? 2092 HOH B O   1 
HETATM 4672 O  O   . HOH J 4 .   ? 30.147 -40.219  222.427 1.00 54.78  ? 2093 HOH B O   1 
HETATM 4673 O  O   . HOH J 4 .   ? 51.597 -52.965  174.362 1.00 52.39  ? 2094 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   MET 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   ALA 9   9   ?   ?   ?   A . n 
A 1 10  ARG 10  10  ?   ?   ?   A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  TRP 33  33  33  TRP TRP A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  TRP 46  46  46  TRP TRP A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  TYR 57  57  57  TYR TYR A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 PRO 107 107 107 PRO PRO A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 CYS 119 119 119 CYS CYS A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 TYR 132 132 132 TYR TYR A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 MET 161 161 161 MET MET A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLU 173 173 173 GLU GLU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLN 187 187 187 GLN GLN A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 PHE 195 195 195 PHE PHE A . n 
A 1 196 HIS 196 196 196 HIS HIS A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ARG 202 202 202 ARG ARG A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 PRO 206 206 206 PRO PRO A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 MET 215 215 215 MET MET A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 HIS 220 220 220 HIS HIS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 SER 222 222 222 SER SER A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 TYR 225 225 225 TYR TYR A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 HIS 236 236 236 HIS HIS A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 HIS 246 246 246 HIS HIS A . n 
A 1 247 HIS 247 247 247 HIS HIS A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 HIS 255 255 255 HIS HIS A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 HIS 258 258 258 HIS HIS A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 TYR 260 260 260 TYR TYR A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 ILE 266 266 266 ILE ILE A . n 
A 1 267 TRP 267 267 267 TRP TRP A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 HIS 270 270 270 HIS HIS A . n 
A 1 271 PHE 271 271 271 PHE PHE A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 ASP 273 273 273 ASP ASP A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 HIS 291 291 291 HIS HIS A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 HIS 297 297 297 HIS HIS A . n 
A 1 298 HIS 298 298 298 HIS HIS A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 HIS 300 300 ?   ?   ?   A . n 
A 1 301 HIS 301 301 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   GLY 3   3   ?   ?   ?   B . n 
B 1 4   GLY 4   4   ?   ?   ?   B . n 
B 1 5   MET 5   5   ?   ?   ?   B . n 
B 1 6   LYS 6   6   ?   ?   ?   B . n 
B 1 7   PRO 7   7   ?   ?   ?   B . n 
B 1 8   PRO 8   8   ?   ?   ?   B . n 
B 1 9   ALA 9   9   ?   ?   ?   B . n 
B 1 10  ARG 10  10  ?   ?   ?   B . n 
B 1 11  LYS 11  11  ?   ?   ?   B . n 
B 1 12  PRO 12  12  ?   ?   ?   B . n 
B 1 13  ARG 13  13  ?   ?   ?   B . n 
B 1 14  ILE 14  14  ?   ?   ?   B . n 
B 1 15  LEU 15  15  ?   ?   ?   B . n 
B 1 16  ASN 16  16  ?   ?   ?   B . n 
B 1 17  SER 17  17  ?   ?   ?   B . n 
B 1 18  ASP 18  18  ?   ?   ?   B . n 
B 1 19  GLY 19  19  ?   ?   ?   B . n 
B 1 20  SER 20  20  ?   ?   ?   B . n 
B 1 21  SER 21  21  ?   ?   ?   B . n 
B 1 22  ASN 22  22  ?   ?   ?   B . n 
B 1 23  ILE 23  23  23  ILE ILE B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  ARG 25  25  25  ARG ARG B . n 
B 1 26  LEU 26  26  26  LEU LEU B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  ARG 31  31  31  ARG ARG B . n 
B 1 32  GLY 32  32  32  GLY GLY B . n 
B 1 33  TRP 33  33  33  TRP TRP B . n 
B 1 34  LEU 34  34  34  LEU LEU B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  TYR 38  38  38  TYR TYR B . n 
B 1 39  HIS 39  39  39  HIS HIS B . n 
B 1 40  ASP 40  40  40  ASP ASP B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  LEU 42  42  42  LEU LEU B . n 
B 1 43  THR 43  43  43  THR THR B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  TRP 46  46  46  TRP TRP B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  PHE 49  49  49  PHE PHE B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  TYR 57  57  57  TYR TYR B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  ASN 61  61  61  ASN ASN B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  ALA 65  65  65  ALA ALA B . n 
B 1 66  LEU 66  66  66  LEU LEU B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  TYR 68  68  68  TYR TYR B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  CYS 71  71  71  CYS CYS B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  ASP 73  73  73  ASP ASP B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  ILE 75  75  75  ILE ILE B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  ASN 77  77  77  ASN ASN B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  PHE 83  83  83  PHE PHE B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  PHE 87  87  87  PHE PHE B . n 
B 1 88  PHE 88  88  88  PHE PHE B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  GLN 92  92  92  GLN GLN B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  MET 94  94  94  MET MET B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  TYR 99  99  99  TYR TYR B . n 
B 1 100 GLY 100 100 100 GLY GLY B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 PRO 107 107 107 PRO PRO B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 THR 111 111 111 THR THR B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 CYS 119 119 119 CYS CYS B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 MET 121 121 121 MET MET B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ILE 131 131 131 ILE ILE B . n 
B 1 132 TYR 132 132 132 TYR TYR B . n 
B 1 133 ALA 133 133 133 ALA ALA B . n 
B 1 134 ARG 134 134 134 ARG ARG B . n 
B 1 135 PHE 135 135 135 PHE PHE B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 PRO 138 138 138 PRO PRO B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 ALA 140 140 140 ALA ALA B . n 
B 1 141 GLY 141 141 141 GLY GLY B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 ARG 147 147 147 ARG ARG B . n 
B 1 148 MET 148 148 148 MET MET B . n 
B 1 149 VAL 149 149 149 VAL VAL B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 ASP 152 152 152 ASP ASP B . n 
B 1 153 PHE 153 153 153 PHE PHE B . n 
B 1 154 GLU 154 154 154 GLU GLU B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 PRO 157 157 157 PRO PRO B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 MET 160 160 160 MET MET B . n 
B 1 161 MET 161 161 161 MET MET B . n 
B 1 162 ARG 162 162 162 ARG ARG B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 ASN 165 165 165 ASN ASN B . n 
B 1 166 LEU 166 166 166 LEU LEU B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 ILE 168 168 168 ILE ILE B . n 
B 1 169 GLU 169 169 169 GLU GLU B . n 
B 1 170 GLN 170 170 170 GLN GLN B . n 
B 1 171 ILE 171 171 171 ILE ILE B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 GLU 173 173 173 GLU GLU B . n 
B 1 174 ALA 174 174 174 ALA ALA B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 HIS 177 177 177 HIS HIS B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 GLU 184 184 184 GLU GLU B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 GLN 187 187 187 GLN GLN B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 MET 190 190 190 MET MET B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 PHE 192 192 192 PHE PHE B . n 
B 1 193 ARG 193 193 193 ARG ARG B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 PHE 195 195 195 PHE PHE B . n 
B 1 196 HIS 196 196 196 HIS HIS B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 THR 199 199 199 THR THR B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 ARG 202 202 202 ARG ARG B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 PRO 206 206 206 PRO PRO B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 PHE 208 208 208 PHE PHE B . n 
B 1 209 SER 209 209 209 SER SER B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 SER 211 211 211 SER SER B . n 
B 1 212 TRP 212 212 212 TRP TRP B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 MET 215 215 215 MET MET B . n 
B 1 216 HIS 216 216 216 HIS HIS B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 ASP 219 219 219 ASP ASP B . n 
B 1 220 HIS 220 220 220 HIS HIS B . n 
B 1 221 HIS 221 221 221 HIS HIS B . n 
B 1 222 SER 222 222 222 SER SER B . n 
B 1 223 PRO 223 223 223 PRO PRO B . n 
B 1 224 ILE 224 224 224 ILE ILE B . n 
B 1 225 TYR 225 225 225 TYR TYR B . n 
B 1 226 GLY 226 226 226 GLY GLY B . n 
B 1 227 GLU 227 227 227 GLU GLU B . n 
B 1 228 THR 228 228 228 THR THR B . n 
B 1 229 ASP 229 229 229 ASP ASP B . n 
B 1 230 GLU 230 230 230 GLU GLU B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 ASN 234 234 234 ASN ASN B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 HIS 236 236 236 HIS HIS B . n 
B 1 237 SER 237 237 237 SER SER B . n 
B 1 238 GLU 238 238 238 GLU GLU B . n 
B 1 239 PHE 239 239 239 PHE PHE B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 VAL 241 241 241 VAL VAL B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 PHE 243 243 243 PHE PHE B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 HIS 246 246 246 HIS HIS B . n 
B 1 247 HIS 247 247 247 HIS HIS B . n 
B 1 248 GLU 248 248 248 GLU GLU B . n 
B 1 249 ALA 249 249 249 ALA ALA B . n 
B 1 250 PHE 250 250 250 PHE PHE B . n 
B 1 251 ALA 251 251 251 ALA ALA B . n 
B 1 252 GLN 252 252 252 GLN GLN B . n 
B 1 253 ASN 253 253 253 ASN ASN B . n 
B 1 254 VAL 254 254 254 VAL VAL B . n 
B 1 255 HIS 255 255 255 HIS HIS B . n 
B 1 256 ALA 256 256 256 ALA ALA B . n 
B 1 257 ARG 257 257 257 ARG ARG B . n 
B 1 258 HIS 258 258 258 HIS HIS B . n 
B 1 259 ALA 259 259 259 ALA ALA B . n 
B 1 260 TYR 260 260 260 TYR TYR B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 CYS 262 262 262 CYS CYS B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 ILE 266 266 266 ILE ILE B . n 
B 1 267 TRP 267 267 267 TRP TRP B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 GLY 269 269 269 GLY GLY B . n 
B 1 270 HIS 270 270 270 HIS HIS B . n 
B 1 271 PHE 271 271 271 PHE PHE B . n 
B 1 272 VAL 272 272 272 VAL VAL B . n 
B 1 273 ASP 273 273 273 ASP ASP B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 PHE 275 275 275 PHE PHE B . n 
B 1 276 THR 276 276 276 THR THR B . n 
B 1 277 THR 277 277 277 THR THR B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 ARG 282 282 282 ARG ARG B . n 
B 1 283 ARG 283 283 283 ARG ARG B . n 
B 1 284 ALA 284 284 284 ALA ALA B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 ASP 286 286 286 ASP ASP B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 GLY 288 288 288 GLY GLY B . n 
B 1 289 LYS 289 289 289 LYS LYS B . n 
B 1 290 PHE 290 290 290 PHE PHE B . n 
B 1 291 HIS 291 291 291 HIS HIS B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 ILE 293 293 293 ILE ILE B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 HIS 296 296 296 HIS HIS B . n 
B 1 297 HIS 297 297 297 HIS HIS B . n 
B 1 298 HIS 298 298 298 HIS HIS B . n 
B 1 299 HIS 299 299 299 HIS HIS B . n 
B 1 300 HIS 300 300 ?   ?   ?   B . n 
B 1 301 HIS 301 301 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 21070 ? 
1 MORE         -128  ? 
1 'SSA (A^2)'  50790 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_645 -x+1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 105.6270000000 0.0000000000 -1.0000000000 
0.0000000000 -109.3850000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A K   1000 ? C K   . 
2 1 A K   1001 ? D K   . 
3 1 A K   1002 ? E K   . 
4 1 A K   1003 ? F K   . 
5 1 A K   1004 ? G K   . 
6 1 A MG  2001 ? H MG  . 
7 1 A HOH 2002 ? I HOH . 
8 1 A HOH 2003 ? I HOH . 
9 1 B HOH 2002 ? J HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 96 ? A THR 96 ? 1_555 K  B G K  . ? A K  1004 ? 1_555 OG1 ? A THR 96 ? A THR 96   ? 1_555 60.1  ? 
2  O   ? A THR 96 ? A THR 96 ? 1_555 K  B G K  . ? A K  1004 ? 1_555 O   ? B THR 96 ? B THR 96   ? 1_555 77.4  ? 
3  OG1 ? A THR 96 ? A THR 96 ? 1_555 K  B G K  . ? A K  1004 ? 1_555 O   ? B THR 96 ? B THR 96   ? 1_555 97.7  ? 
4  O   ? A THR 96 ? A THR 96 ? 1_555 K  B G K  . ? A K  1004 ? 1_555 OG1 ? B THR 96 ? B THR 96   ? 1_555 116.3 ? 
5  OG1 ? A THR 96 ? A THR 96 ? 1_555 K  B G K  . ? A K  1004 ? 1_555 OG1 ? B THR 96 ? B THR 96   ? 1_555 79.4  ? 
6  O   ? B THR 96 ? B THR 96 ? 1_555 K  B G K  . ? A K  1004 ? 1_555 OG1 ? B THR 96 ? B THR 96   ? 1_555 60.7  ? 
7  OG1 ? A THR 96 ? A THR 96 ? 1_555 MG A H MG . ? A MG 2001 ? 1_555 OG1 ? B THR 96 ? B THR 96   ? 1_555 92.1  ? 
8  OG1 ? A THR 96 ? A THR 96 ? 1_555 MG A H MG . ? A MG 2001 ? 1_555 O   A J HOH .  ? B HOH 2002 ? 1_555 96.8  ? 
9  OG1 ? B THR 96 ? B THR 96 ? 1_555 MG A H MG . ? A MG 2001 ? 1_555 O   A J HOH .  ? B HOH 2002 ? 1_555 100.1 ? 
10 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  A F K  . ? A K  1003 ? 1_555 O   ? B ILE 97 ? B ILE 97   ? 1_555 85.9  ? 
11 O   ? A ILE 97 ? A ILE 97 ? 1_555 K  A F K  . ? A K  1003 ? 1_555 O   A I HOH .  ? A HOH 2002 ? 1_555 109.5 ? 
12 O   ? B ILE 97 ? B ILE 97 ? 1_555 K  A F K  . ? A K  1003 ? 1_555 O   A I HOH .  ? A HOH 2002 ? 1_555 107.4 ? 
13 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  B E K  . ? A K  1002 ? 1_555 O   ? A TYR 99 ? A TYR 99   ? 1_555 64.8  ? 
14 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  B E K  . ? A K  1002 ? 1_555 O   ? B TYR 99 ? B TYR 99   ? 1_555 85.6  ? 
15 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  B E K  . ? A K  1002 ? 1_555 O   ? B TYR 99 ? B TYR 99   ? 1_555 86.0  ? 
16 O   ? A GLY 98 ? A GLY 98 ? 1_555 K  B E K  . ? A K  1002 ? 1_555 O   B I HOH .  ? A HOH 2003 ? 1_555 50.4  ? 
17 O   ? A TYR 99 ? A TYR 99 ? 1_555 K  B E K  . ? A K  1002 ? 1_555 O   B I HOH .  ? A HOH 2003 ? 1_555 110.2 ? 
18 O   ? B TYR 99 ? B TYR 99 ? 1_555 K  B E K  . ? A K  1002 ? 1_555 O   B I HOH .  ? A HOH 2003 ? 1_555 109.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-12-07 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
CNS    refinement       .         ? 3 
X-PLOR refinement       .         ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
CNS    phasing          .         ? 6 
# 
_pdbx_entry_details.entry_id             1XL4 
_pdbx_entry_details.nonpolymer_details   
;THERE ARE TWO ALTERNATE ARRANGEMENTS OF IONS AND 
COORDINATED WATER MOLECULES.
THE FIRST INCLUDES K(A1001), K(A1003), HOH(A2002), 
MG(A2001) AND HOH(B2002).
THE SECOND INCLUDES K(A1002), K(A1004) AND HOH(A2003).
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 28  ? ? -37.75  103.64  
2  1 LYS A 30  ? ? -51.20  -99.97  
3  1 ASP A 36  ? ? -71.39  -110.39 
4  1 VAL A 44  ? ? -49.47  169.79  
5  1 ILE A 103 ? ? -23.41  146.94  
6  1 PRO A 104 ? ? -63.08  -179.76 
7  1 GLU A 188 ? ? -69.36  13.64   
8  1 LEU A 210 ? ? -118.46 -90.15  
9  1 THR A 276 ? ? -115.71 -158.05 
10 1 ALA A 284 ? ? -176.73 122.78  
11 1 LEU A 287 ? ? -64.91  1.70    
12 1 LEU B 28  ? ? -161.33 66.13   
13 1 ARG B 31  ? ? 49.50   172.59  
14 1 ASP B 36  ? ? -69.15  -161.75 
15 1 HIS B 37  ? ? -79.01  37.70   
16 1 VAL B 44  ? ? -41.13  158.90  
17 1 ASP B 73  ? ? -105.55 68.71   
18 1 ILE B 103 ? ? -32.76  160.80  
19 1 PRO B 107 ? ? -30.42  -38.32  
20 1 GLU B 188 ? ? -66.62  4.34    
21 1 LEU B 210 ? ? -115.61 -93.70  
22 1 ASP B 280 ? ? -109.42 61.62   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 11 ? CG ? A LYS 11 CG 
2 1 Y 1 A LYS 11 ? CD ? A LYS 11 CD 
3 1 Y 1 A LYS 11 ? CE ? A LYS 11 CE 
4 1 Y 1 A LYS 11 ? NZ ? A LYS 11 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A GLY 4   ? A GLY 4   
5  1 Y 1 A MET 5   ? A MET 5   
6  1 Y 1 A LYS 6   ? A LYS 6   
7  1 Y 1 A PRO 7   ? A PRO 7   
8  1 Y 1 A PRO 8   ? A PRO 8   
9  1 Y 1 A ALA 9   ? A ALA 9   
10 1 Y 1 A ARG 10  ? A ARG 10  
11 1 Y 1 A HIS 300 ? A HIS 300 
12 1 Y 1 A HIS 301 ? A HIS 301 
13 1 Y 1 B MET 1   ? B MET 1   
14 1 Y 1 B THR 2   ? B THR 2   
15 1 Y 1 B GLY 3   ? B GLY 3   
16 1 Y 1 B GLY 4   ? B GLY 4   
17 1 Y 1 B MET 5   ? B MET 5   
18 1 Y 1 B LYS 6   ? B LYS 6   
19 1 Y 1 B PRO 7   ? B PRO 7   
20 1 Y 1 B PRO 8   ? B PRO 8   
21 1 Y 1 B ALA 9   ? B ALA 9   
22 1 Y 1 B ARG 10  ? B ARG 10  
23 1 Y 1 B LYS 11  ? B LYS 11  
24 1 Y 1 B PRO 12  ? B PRO 12  
25 1 Y 1 B ARG 13  ? B ARG 13  
26 1 Y 1 B ILE 14  ? B ILE 14  
27 1 Y 1 B LEU 15  ? B LEU 15  
28 1 Y 1 B ASN 16  ? B ASN 16  
29 1 Y 1 B SER 17  ? B SER 17  
30 1 Y 1 B ASP 18  ? B ASP 18  
31 1 Y 1 B GLY 19  ? B GLY 19  
32 1 Y 1 B SER 20  ? B SER 20  
33 1 Y 1 B SER 21  ? B SER 21  
34 1 Y 1 B ASN 22  ? B ASN 22  
35 1 Y 1 B HIS 300 ? B HIS 300 
36 1 Y 1 B HIS 301 ? B HIS 301 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'POTASSIUM ION' K   
3 'MAGNESIUM ION' MG  
4 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 K   1  1000 1000 K   K   A . 
D 2 K   1  1001 1001 K   K   A . 
E 2 K   1  1002 1002 K   K   A . 
F 2 K   1  1003 1003 K   K   A . 
G 2 K   1  1004 1004 K   K   A . 
H 3 MG  1  2001 2001 MG  MG  A . 
I 4 HOH 1  2002 1005 HOH HOH A . 
I 4 HOH 2  2003 1006 HOH HOH A . 
I 4 HOH 3  2004 5    HOH HOH A . 
I 4 HOH 4  2005 6    HOH HOH A . 
I 4 HOH 5  2006 9    HOH HOH A . 
I 4 HOH 6  2007 10   HOH HOH A . 
I 4 HOH 7  2008 11   HOH HOH A . 
I 4 HOH 8  2009 13   HOH HOH A . 
I 4 HOH 9  2010 14   HOH HOH A . 
I 4 HOH 10 2011 15   HOH HOH A . 
I 4 HOH 11 2012 16   HOH HOH A . 
I 4 HOH 12 2013 18   HOH HOH A . 
I 4 HOH 13 2014 19   HOH HOH A . 
I 4 HOH 14 2015 21   HOH HOH A . 
I 4 HOH 15 2016 23   HOH HOH A . 
I 4 HOH 16 2017 24   HOH HOH A . 
I 4 HOH 17 2018 25   HOH HOH A . 
I 4 HOH 18 2019 36   HOH HOH A . 
I 4 HOH 19 2020 37   HOH HOH A . 
I 4 HOH 20 2021 38   HOH HOH A . 
I 4 HOH 21 2022 40   HOH HOH A . 
I 4 HOH 22 2023 43   HOH HOH A . 
I 4 HOH 23 2024 44   HOH HOH A . 
I 4 HOH 24 2025 46   HOH HOH A . 
I 4 HOH 25 2026 47   HOH HOH A . 
I 4 HOH 26 2027 50   HOH HOH A . 
I 4 HOH 27 2028 51   HOH HOH A . 
I 4 HOH 28 2029 52   HOH HOH A . 
I 4 HOH 29 2030 54   HOH HOH A . 
I 4 HOH 30 2031 55   HOH HOH A . 
I 4 HOH 31 2032 56   HOH HOH A . 
I 4 HOH 32 2033 57   HOH HOH A . 
I 4 HOH 33 2034 58   HOH HOH A . 
I 4 HOH 34 2035 59   HOH HOH A . 
I 4 HOH 35 2036 60   HOH HOH A . 
I 4 HOH 36 2037 64   HOH HOH A . 
I 4 HOH 37 2038 65   HOH HOH A . 
I 4 HOH 38 2039 68   HOH HOH A . 
I 4 HOH 39 2040 71   HOH HOH A . 
I 4 HOH 40 2041 72   HOH HOH A . 
I 4 HOH 41 2042 74   HOH HOH A . 
I 4 HOH 42 2043 77   HOH HOH A . 
I 4 HOH 43 2044 80   HOH HOH A . 
I 4 HOH 44 2045 82   HOH HOH A . 
I 4 HOH 45 2046 84   HOH HOH A . 
I 4 HOH 46 2047 95   HOH HOH A . 
I 4 HOH 47 2048 96   HOH HOH A . 
I 4 HOH 48 2049 99   HOH HOH A . 
I 4 HOH 49 2050 100  HOH HOH A . 
I 4 HOH 50 2051 101  HOH HOH A . 
I 4 HOH 51 2052 102  HOH HOH A . 
I 4 HOH 52 2053 103  HOH HOH A . 
I 4 HOH 53 2054 104  HOH HOH A . 
I 4 HOH 54 2055 106  HOH HOH A . 
I 4 HOH 55 2056 110  HOH HOH A . 
I 4 HOH 56 2057 111  HOH HOH A . 
I 4 HOH 57 2058 116  HOH HOH A . 
I 4 HOH 58 2059 117  HOH HOH A . 
I 4 HOH 59 2060 118  HOH HOH A . 
I 4 HOH 60 2061 119  HOH HOH A . 
I 4 HOH 61 2062 120  HOH HOH A . 
I 4 HOH 62 2063 121  HOH HOH A . 
I 4 HOH 63 2064 122  HOH HOH A . 
I 4 HOH 64 2065 127  HOH HOH A . 
I 4 HOH 65 2066 129  HOH HOH A . 
I 4 HOH 66 2067 131  HOH HOH A . 
I 4 HOH 67 2068 136  HOH HOH A . 
I 4 HOH 68 2069 139  HOH HOH A . 
I 4 HOH 69 2070 142  HOH HOH A . 
I 4 HOH 70 2071 144  HOH HOH A . 
I 4 HOH 71 2072 145  HOH HOH A . 
I 4 HOH 72 2073 146  HOH HOH A . 
I 4 HOH 73 2074 149  HOH HOH A . 
I 4 HOH 74 2075 150  HOH HOH A . 
I 4 HOH 75 2076 151  HOH HOH A . 
I 4 HOH 76 2077 153  HOH HOH A . 
I 4 HOH 77 2078 154  HOH HOH A . 
I 4 HOH 78 2079 156  HOH HOH A . 
I 4 HOH 79 2080 159  HOH HOH A . 
I 4 HOH 80 2081 160  HOH HOH A . 
I 4 HOH 81 2082 161  HOH HOH A . 
I 4 HOH 82 2083 162  HOH HOH A . 
I 4 HOH 83 2084 163  HOH HOH A . 
I 4 HOH 84 2085 170  HOH HOH A . 
I 4 HOH 85 2086 171  HOH HOH A . 
I 4 HOH 86 2087 173  HOH HOH A . 
I 4 HOH 87 2088 176  HOH HOH A . 
J 4 HOH 1  2002 2002 HOH HOH B . 
J 4 HOH 2  2003 1    HOH HOH B . 
J 4 HOH 3  2004 2    HOH HOH B . 
J 4 HOH 4  2005 3    HOH HOH B . 
J 4 HOH 5  2006 4    HOH HOH B . 
J 4 HOH 6  2007 7    HOH HOH B . 
J 4 HOH 7  2008 8    HOH HOH B . 
J 4 HOH 8  2009 12   HOH HOH B . 
J 4 HOH 9  2010 17   HOH HOH B . 
J 4 HOH 10 2011 20   HOH HOH B . 
J 4 HOH 11 2012 22   HOH HOH B . 
J 4 HOH 12 2013 26   HOH HOH B . 
J 4 HOH 13 2014 27   HOH HOH B . 
J 4 HOH 14 2015 28   HOH HOH B . 
J 4 HOH 15 2016 29   HOH HOH B . 
J 4 HOH 16 2017 30   HOH HOH B . 
J 4 HOH 17 2018 31   HOH HOH B . 
J 4 HOH 18 2019 32   HOH HOH B . 
J 4 HOH 19 2020 33   HOH HOH B . 
J 4 HOH 20 2021 34   HOH HOH B . 
J 4 HOH 21 2022 35   HOH HOH B . 
J 4 HOH 22 2023 39   HOH HOH B . 
J 4 HOH 23 2024 41   HOH HOH B . 
J 4 HOH 24 2025 42   HOH HOH B . 
J 4 HOH 25 2026 45   HOH HOH B . 
J 4 HOH 26 2027 48   HOH HOH B . 
J 4 HOH 27 2028 49   HOH HOH B . 
J 4 HOH 28 2029 53   HOH HOH B . 
J 4 HOH 29 2030 61   HOH HOH B . 
J 4 HOH 30 2031 62   HOH HOH B . 
J 4 HOH 31 2032 63   HOH HOH B . 
J 4 HOH 32 2033 66   HOH HOH B . 
J 4 HOH 33 2034 67   HOH HOH B . 
J 4 HOH 34 2035 69   HOH HOH B . 
J 4 HOH 35 2036 70   HOH HOH B . 
J 4 HOH 36 2037 73   HOH HOH B . 
J 4 HOH 37 2038 75   HOH HOH B . 
J 4 HOH 38 2039 76   HOH HOH B . 
J 4 HOH 39 2040 78   HOH HOH B . 
J 4 HOH 40 2041 79   HOH HOH B . 
J 4 HOH 41 2042 81   HOH HOH B . 
J 4 HOH 42 2043 83   HOH HOH B . 
J 4 HOH 43 2044 85   HOH HOH B . 
J 4 HOH 44 2045 86   HOH HOH B . 
J 4 HOH 45 2046 87   HOH HOH B . 
J 4 HOH 46 2047 88   HOH HOH B . 
J 4 HOH 47 2048 89   HOH HOH B . 
J 4 HOH 48 2049 90   HOH HOH B . 
J 4 HOH 49 2050 91   HOH HOH B . 
J 4 HOH 50 2051 92   HOH HOH B . 
J 4 HOH 51 2052 93   HOH HOH B . 
J 4 HOH 52 2053 94   HOH HOH B . 
J 4 HOH 53 2054 97   HOH HOH B . 
J 4 HOH 54 2055 98   HOH HOH B . 
J 4 HOH 55 2056 105  HOH HOH B . 
J 4 HOH 56 2057 107  HOH HOH B . 
J 4 HOH 57 2058 108  HOH HOH B . 
J 4 HOH 58 2059 109  HOH HOH B . 
J 4 HOH 59 2060 112  HOH HOH B . 
J 4 HOH 60 2061 113  HOH HOH B . 
J 4 HOH 61 2062 114  HOH HOH B . 
J 4 HOH 62 2063 115  HOH HOH B . 
J 4 HOH 63 2064 123  HOH HOH B . 
J 4 HOH 64 2065 124  HOH HOH B . 
J 4 HOH 65 2066 125  HOH HOH B . 
J 4 HOH 66 2067 126  HOH HOH B . 
J 4 HOH 67 2068 128  HOH HOH B . 
J 4 HOH 68 2069 130  HOH HOH B . 
J 4 HOH 69 2070 132  HOH HOH B . 
J 4 HOH 70 2071 133  HOH HOH B . 
J 4 HOH 71 2072 134  HOH HOH B . 
J 4 HOH 72 2073 135  HOH HOH B . 
J 4 HOH 73 2074 137  HOH HOH B . 
J 4 HOH 74 2075 138  HOH HOH B . 
J 4 HOH 75 2076 140  HOH HOH B . 
J 4 HOH 76 2077 141  HOH HOH B . 
J 4 HOH 77 2078 143  HOH HOH B . 
J 4 HOH 78 2079 147  HOH HOH B . 
J 4 HOH 79 2080 148  HOH HOH B . 
J 4 HOH 80 2081 152  HOH HOH B . 
J 4 HOH 81 2082 155  HOH HOH B . 
J 4 HOH 82 2083 157  HOH HOH B . 
J 4 HOH 83 2084 158  HOH HOH B . 
J 4 HOH 84 2085 164  HOH HOH B . 
J 4 HOH 85 2086 165  HOH HOH B . 
J 4 HOH 86 2087 166  HOH HOH B . 
J 4 HOH 87 2088 167  HOH HOH B . 
J 4 HOH 88 2089 168  HOH HOH B . 
J 4 HOH 89 2090 169  HOH HOH B . 
J 4 HOH 90 2091 172  HOH HOH B . 
J 4 HOH 91 2092 174  HOH HOH B . 
J 4 HOH 92 2093 175  HOH HOH B . 
J 4 HOH 93 2094 177  HOH HOH B . 
#