data_1XOX
# 
_entry.id   1XOX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XOX         
RCSB  RCSB030595   
WWPDB D_1000030595 
# 
_pdbx_database_status.entry_id                        1XOX 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sun, C.'          1 
'Nettesheim, D.'   2 
'Liu, Z.'          3 
'Olejniczak, E.T.' 4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of human survivin and its binding interface with smac/diablo' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            44 
_citation.page_first                11 
_citation.page_last                 17 
_citation.year                      2005 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15628841 
_citation.pdbx_database_id_DOI      10.1021/bi0485171 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sun, C.'          1 
primary 'Nettesheim, D.'   2 
primary 'Liu, Z.'          3 
primary 'Olejniczak, E.T.' 4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Apoptosis inhibitor survivin' 13477.332 2 ? ? 'residues 1-117' ? 
2 non-polymer syn 'ZINC ION'                     65.409    2 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKH
SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKET
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKH
SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKET
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ALA n 
1 4   PRO n 
1 5   THR n 
1 6   LEU n 
1 7   PRO n 
1 8   PRO n 
1 9   ALA n 
1 10  TRP n 
1 11  GLN n 
1 12  PRO n 
1 13  PHE n 
1 14  LEU n 
1 15  LYS n 
1 16  ASP n 
1 17  HIS n 
1 18  ARG n 
1 19  ILE n 
1 20  SER n 
1 21  THR n 
1 22  PHE n 
1 23  LYS n 
1 24  ASN n 
1 25  TRP n 
1 26  PRO n 
1 27  PHE n 
1 28  LEU n 
1 29  GLU n 
1 30  GLY n 
1 31  CYS n 
1 32  ALA n 
1 33  CYS n 
1 34  THR n 
1 35  PRO n 
1 36  GLU n 
1 37  ARG n 
1 38  MET n 
1 39  ALA n 
1 40  GLU n 
1 41  ALA n 
1 42  GLY n 
1 43  PHE n 
1 44  ILE n 
1 45  HIS n 
1 46  CYS n 
1 47  PRO n 
1 48  THR n 
1 49  GLU n 
1 50  ASN n 
1 51  GLU n 
1 52  PRO n 
1 53  ASP n 
1 54  LEU n 
1 55  ALA n 
1 56  GLN n 
1 57  CYS n 
1 58  PHE n 
1 59  PHE n 
1 60  CYS n 
1 61  PHE n 
1 62  LYS n 
1 63  GLU n 
1 64  LEU n 
1 65  GLU n 
1 66  GLY n 
1 67  TRP n 
1 68  GLU n 
1 69  PRO n 
1 70  ASP n 
1 71  ASP n 
1 72  ASP n 
1 73  PRO n 
1 74  ILE n 
1 75  GLU n 
1 76  GLU n 
1 77  HIS n 
1 78  LYS n 
1 79  LYS n 
1 80  HIS n 
1 81  SER n 
1 82  SER n 
1 83  GLY n 
1 84  CYS n 
1 85  ALA n 
1 86  PHE n 
1 87  LEU n 
1 88  SER n 
1 89  VAL n 
1 90  LYS n 
1 91  LYS n 
1 92  GLN n 
1 93  PHE n 
1 94  GLU n 
1 95  GLU n 
1 96  LEU n 
1 97  THR n 
1 98  LEU n 
1 99  GLY n 
1 100 GLU n 
1 101 PHE n 
1 102 LEU n 
1 103 LYS n 
1 104 LEU n 
1 105 ASP n 
1 106 ARG n 
1 107 GLU n 
1 108 ARG n 
1 109 ALA n 
1 110 LYS n 
1 111 ASN n 
1 112 LYS n 
1 113 ILE n 
1 114 ALA n 
1 115 LYS n 
1 116 GLU n 
1 117 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'BIRC5, API4, IAP4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'bl21(de3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pet15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BIRC5_HUMAN 
_struct_ref.pdbx_db_accession          O15392 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKH
SSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKET
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XOX A 1 ? 117 ? O15392 1 ? 117 ? 1 117 
2 1 1XOX B 1 ? 117 ? O15392 1 ? 117 ? 1 117 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY          
2 2 1 3D_13C-separated_NOESY          
3 4 1 '3d 12C filtered 13C-sep Noesy' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50 mM phosphate' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 500 
2 ? Bruker DRX 600 
3 ? Bruker DRX 800 
# 
_pdbx_nmr_refine.entry_id           1XOX 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;Structures were calculated using 1394 intra-monomer NOE constraints,
thirty hydrogen bond restraints derived from an analysis of amide
exchange rates and fifty-six torsional restraints from an analysis of
the backbone chemical shifts.  Dimer structures were calculated using
additional inter-monomer NOE constraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1XOX 
_pdbx_nmr_details.text       'This structure was determined using standard 3D NMR techniques' 
# 
_pdbx_nmr_ensemble.entry_id                             1XOX 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_representative.entry_id             1XOX 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
_pdbx_nmr_software.name             cnx 
_pdbx_nmr_software.version          2000.1 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.authors          Brunger 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1XOX 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1XOX 
_struct.title                     'SOLUTION STRUCTURE OF HUMAN SURVIVIN' 
_struct.pdbx_descriptor           'Apoptosis inhibitor survivin' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1XOX 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'Bir Domain; Apoptosis, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 14 ? THR A 21  ? LEU A 14 THR A 21  1 ? 8  
HELX_P HELX_P2 2 THR A 34 ? GLU A 40  ? THR A 34 GLU A 40  1 ? 7  
HELX_P HELX_P3 3 ASP A 72 ? SER A 81  ? ASP A 72 SER A 81  1 ? 10 
HELX_P HELX_P4 4 THR A 97 ? THR A 117 ? THR A 97 THR A 117 1 ? 21 
HELX_P HELX_P5 5 LEU B 14 ? THR B 21  ? LEU B 14 THR B 21  1 ? 8  
HELX_P HELX_P6 6 THR B 34 ? GLU B 40  ? THR B 34 GLU B 40  1 ? 7  
HELX_P HELX_P7 7 ASP B 72 ? SER B 81  ? ASP B 72 SER B 81  1 ? 10 
HELX_P HELX_P8 8 THR B 97 ? THR B 117 ? THR B 97 THR B 117 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 57 SG  ? ? A ZN 999 A CYS 57 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc2 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 84 SG  ? ? A ZN 999 A CYS 84 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 77 ND1 ? ? A ZN 999 A HIS 77 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 60 SG  ? ? A ZN 999 A CYS 60 1_555 ? ? ? ? ? ? ? 2.102 ? 
metalc5 metalc ? ? D ZN . ZN ? ? ? 1_555 B CYS 84 SG  ? ? B ZN 998 B CYS 84 1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc6 metalc ? ? D ZN . ZN ? ? ? 1_555 B HIS 77 ND1 ? ? B ZN 998 B HIS 77 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc7 metalc ? ? D ZN . ZN ? ? ? 1_555 B CYS 60 SG  ? ? B ZN 998 B CYS 60 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc8 metalc ? ? D ZN . ZN ? ? ? 1_555 B CYS 57 SG  ? ? B ZN 998 B CYS 57 1_555 ? ? ? ? ? ? ? 2.099 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 43 ? HIS A 45 ? PHE A 43 HIS A 45 
A 2 ALA A 55 ? CYS A 57 ? ALA A 55 CYS A 57 
B 1 PHE B 43 ? HIS B 45 ? PHE B 43 HIS B 45 
B 2 ALA B 55 ? CYS B 57 ? ALA B 55 CYS B 57 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 44 ? N ILE A 44 O GLN A 56 ? O GLN A 56 
B 1 2 N ILE B 44 ? N ILE B 44 O GLN B 56 ? O GLN B 56 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 998' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS B 57 ? CYS B 57 . ? 1_555 ? 
2  AC1 5 PHE B 58 ? PHE B 58 . ? 1_555 ? 
3  AC1 5 CYS B 60 ? CYS B 60 . ? 1_555 ? 
4  AC1 5 HIS B 77 ? HIS B 77 . ? 1_555 ? 
5  AC1 5 CYS B 84 ? CYS B 84 . ? 1_555 ? 
6  AC2 5 CYS A 57 ? CYS A 57 . ? 1_555 ? 
7  AC2 5 PHE A 58 ? PHE A 58 . ? 1_555 ? 
8  AC2 5 CYS A 60 ? CYS A 60 . ? 1_555 ? 
9  AC2 5 HIS A 77 ? HIS A 77 . ? 1_555 ? 
10 AC2 5 CYS A 84 ? CYS A 84 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1XOX 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . MET A 1 1   ? -6.103  -42.895 -75.161  1.00 5.26 ? 1   MET A N    1 
ATOM   2    C  CA   . MET A 1 1   ? -7.531  -43.217 -75.420  1.00 4.86 ? 1   MET A CA   1 
ATOM   3    C  C    . MET A 1 1   ? -8.328  -41.959 -75.752  1.00 4.32 ? 1   MET A C    1 
ATOM   4    O  O    . MET A 1 1   ? -8.849  -41.817 -76.858  1.00 4.79 ? 1   MET A O    1 
ATOM   5    C  CB   . MET A 1 1   ? -8.110  -43.896 -74.178  1.00 5.35 ? 1   MET A CB   1 
ATOM   6    C  CG   . MET A 1 1   ? -7.287  -43.671 -72.920  1.00 5.76 ? 1   MET A CG   1 
ATOM   7    S  SD   . MET A 1 1   ? -8.144  -44.204 -71.425  1.00 6.58 ? 1   MET A SD   1 
ATOM   8    C  CE   . MET A 1 1   ? -7.073  -43.523 -70.161  1.00 7.24 ? 1   MET A CE   1 
ATOM   9    H  H1   . MET A 1 1   ? -6.030  -42.123 -74.468  1.00 5.35 ? 1   MET A H1   1 
ATOM   10   H  H2   . MET A 1 1   ? -5.637  -42.599 -76.042  1.00 5.52 ? 1   MET A H2   1 
ATOM   11   H  H3   . MET A 1 1   ? -5.610  -43.731 -74.786  1.00 5.47 ? 1   MET A H3   1 
ATOM   12   H  HA   . MET A 1 1   ? -7.583  -43.898 -76.256  1.00 5.01 ? 1   MET A HA   1 
ATOM   13   H  HB2  . MET A 1 1   ? -9.106  -43.514 -74.004  1.00 5.65 ? 1   MET A HB2  1 
ATOM   14   H  HB3  . MET A 1 1   ? -8.169  -44.960 -74.358  1.00 5.45 ? 1   MET A HB3  1 
ATOM   15   H  HG2  . MET A 1 1   ? -6.365  -44.225 -73.006  1.00 5.55 ? 1   MET A HG2  1 
ATOM   16   H  HG3  . MET A 1 1   ? -7.066  -42.617 -72.835  1.00 6.12 ? 1   MET A HG3  1 
ATOM   17   H  HE1  . MET A 1 1   ? -7.408  -43.854 -69.189  1.00 7.38 ? 1   MET A HE1  1 
ATOM   18   H  HE2  . MET A 1 1   ? -7.106  -42.444 -70.205  1.00 7.21 ? 1   MET A HE2  1 
ATOM   19   H  HE3  . MET A 1 1   ? -6.061  -43.860 -70.327  1.00 7.79 ? 1   MET A HE3  1 
ATOM   20   N  N    . GLY A 1 2   ? -8.418  -41.050 -74.787  1.00 3.73 ? 2   GLY A N    1 
ATOM   21   C  CA   . GLY A 1 2   ? -9.153  -39.817 -74.998  1.00 3.65 ? 2   GLY A CA   1 
ATOM   22   C  C    . GLY A 1 2   ? -10.650 -40.041 -75.089  1.00 3.50 ? 2   GLY A C    1 
ATOM   23   O  O    . GLY A 1 2   ? -11.283 -39.655 -76.072  1.00 3.75 ? 2   GLY A O    1 
ATOM   24   H  H    . GLY A 1 2   ? -7.982  -41.218 -73.926  1.00 3.69 ? 2   GLY A H    1 
ATOM   25   H  HA2  . GLY A 1 2   ? -8.951  -39.146 -74.176  1.00 4.18 ? 2   GLY A HA2  1 
ATOM   26   H  HA3  . GLY A 1 2   ? -8.812  -39.359 -75.914  1.00 3.59 ? 2   GLY A HA3  1 
ATOM   27   N  N    . ALA A 1 3   ? -11.216 -40.668 -74.063  1.00 3.30 ? 3   ALA A N    1 
ATOM   28   C  CA   . ALA A 1 3   ? -12.647 -40.943 -74.032  1.00 3.27 ? 3   ALA A CA   1 
ATOM   29   C  C    . ALA A 1 3   ? -13.261 -40.507 -72.706  1.00 2.87 ? 3   ALA A C    1 
ATOM   30   O  O    . ALA A 1 3   ? -12.594 -40.505 -71.672  1.00 2.57 ? 3   ALA A O    1 
ATOM   31   C  CB   . ALA A 1 3   ? -12.905 -42.423 -74.274  1.00 3.46 ? 3   ALA A CB   1 
ATOM   32   H  H    . ALA A 1 3   ? -10.658 -40.951 -73.309  1.00 3.31 ? 3   ALA A H    1 
ATOM   33   H  HA   . ALA A 1 3   ? -13.111 -40.386 -74.833  1.00 3.64 ? 3   ALA A HA   1 
ATOM   34   H  HB1  . ALA A 1 3   ? -13.553 -42.540 -75.130  1.00 3.49 ? 3   ALA A HB1  1 
ATOM   35   H  HB2  . ALA A 1 3   ? -13.377 -42.853 -73.403  1.00 3.92 ? 3   ALA A HB2  1 
ATOM   36   H  HB3  . ALA A 1 3   ? -11.967 -42.926 -74.460  1.00 3.57 ? 3   ALA A HB3  1 
ATOM   37   N  N    . PRO A 1 4   ? -14.549 -40.131 -72.723  1.00 3.11 ? 4   PRO A N    1 
ATOM   38   C  CA   . PRO A 1 4   ? -15.262 -39.690 -71.521  1.00 3.10 ? 4   PRO A CA   1 
ATOM   39   C  C    . PRO A 1 4   ? -15.115 -40.675 -70.367  1.00 2.72 ? 4   PRO A C    1 
ATOM   40   O  O    . PRO A 1 4   ? -14.498 -41.730 -70.513  1.00 2.89 ? 4   PRO A O    1 
ATOM   41   C  CB   . PRO A 1 4   ? -16.719 -39.616 -71.980  1.00 3.61 ? 4   PRO A CB   1 
ATOM   42   C  CG   . PRO A 1 4   ? -16.641 -39.384 -73.449  1.00 3.92 ? 4   PRO A CG   1 
ATOM   43   C  CD   . PRO A 1 4   ? -15.409 -40.107 -73.919  1.00 3.68 ? 4   PRO A CD   1 
ATOM   44   H  HA   . PRO A 1 4   ? -14.931 -38.712 -71.202  1.00 3.27 ? 4   PRO A HA   1 
ATOM   45   H  HB2  . PRO A 1 4   ? -17.218 -40.547 -71.752  1.00 3.45 ? 4   PRO A HB2  1 
ATOM   46   H  HB3  . PRO A 1 4   ? -17.217 -38.800 -71.478  1.00 4.12 ? 4   PRO A HB3  1 
ATOM   47   H  HG2  . PRO A 1 4   ? -17.520 -39.786 -73.931  1.00 4.12 ? 4   PRO A HG2  1 
ATOM   48   H  HG3  . PRO A 1 4   ? -16.554 -38.326 -73.649  1.00 4.31 ? 4   PRO A HG3  1 
ATOM   49   H  HD2  . PRO A 1 4   ? -15.658 -41.110 -74.235  1.00 3.82 ? 4   PRO A HD2  1 
ATOM   50   H  HD3  . PRO A 1 4   ? -14.936 -39.563 -74.724  1.00 3.90 ? 4   PRO A HD3  1 
ATOM   51   N  N    . THR A 1 5   ? -15.685 -40.324 -69.219  1.00 2.64 ? 5   THR A N    1 
ATOM   52   C  CA   . THR A 1 5   ? -15.617 -41.178 -68.039  1.00 2.46 ? 5   THR A CA   1 
ATOM   53   C  C    . THR A 1 5   ? -16.984 -41.765 -67.706  1.00 2.31 ? 5   THR A C    1 
ATOM   54   O  O    . THR A 1 5   ? -17.435 -41.703 -66.562  1.00 2.94 ? 5   THR A O    1 
ATOM   55   C  CB   . THR A 1 5   ? -15.092 -40.404 -66.816  1.00 2.93 ? 5   THR A CB   1 
ATOM   56   O  OG1  . THR A 1 5   ? -15.681 -39.100 -66.769  1.00 3.38 ? 5   THR A OG1  1 
ATOM   57   C  CG2  . THR A 1 5   ? -13.576 -40.279 -66.864  1.00 2.95 ? 5   THR A CG2  1 
ATOM   58   H  H    . THR A 1 5   ? -16.163 -39.470 -69.164  1.00 2.98 ? 5   THR A H    1 
ATOM   59   H  HA   . THR A 1 5   ? -14.931 -41.985 -68.251  1.00 2.30 ? 5   THR A HA   1 
ATOM   60   H  HB   . THR A 1 5   ? -15.364 -40.947 -65.922  1.00 3.14 ? 5   THR A HB   1 
ATOM   61   H  HG1  . THR A 1 5   ? -16.636 -39.181 -66.717  1.00 3.83 ? 5   THR A HG1  1 
ATOM   62   H  HG21 . THR A 1 5   ? -13.161 -41.132 -67.381  1.00 3.24 ? 5   THR A HG21 1 
ATOM   63   H  HG22 . THR A 1 5   ? -13.185 -40.242 -65.858  1.00 2.68 ? 5   THR A HG22 1 
ATOM   64   H  HG23 . THR A 1 5   ? -13.307 -39.374 -67.389  1.00 3.40 ? 5   THR A HG23 1 
ATOM   65   N  N    . LEU A 1 6   ? -17.639 -42.336 -68.711  1.00 1.77 ? 6   LEU A N    1 
ATOM   66   C  CA   . LEU A 1 6   ? -18.955 -42.936 -68.523  1.00 1.63 ? 6   LEU A CA   1 
ATOM   67   C  C    . LEU A 1 6   ? -18.839 -44.442 -68.305  1.00 1.69 ? 6   LEU A C    1 
ATOM   68   O  O    . LEU A 1 6   ? -17.972 -45.098 -68.882  1.00 1.71 ? 6   LEU A O    1 
ATOM   69   C  CB   . LEU A 1 6   ? -19.846 -42.651 -69.733  1.00 1.41 ? 6   LEU A CB   1 
ATOM   70   C  CG   . LEU A 1 6   ? -20.786 -41.454 -69.578  1.00 1.15 ? 6   LEU A CG   1 
ATOM   71   C  CD1  . LEU A 1 6   ? -21.048 -40.802 -70.926  1.00 1.17 ? 6   LEU A CD1  1 
ATOM   72   C  CD2  . LEU A 1 6   ? -22.093 -41.886 -68.930  1.00 0.75 ? 6   LEU A CD2  1 
ATOM   73   H  H    . LEU A 1 6   ? -17.227 -42.356 -69.601  1.00 1.80 ? 6   LEU A H    1 
ATOM   74   H  HA   . LEU A 1 6   ? -19.399 -42.489 -67.647  1.00 1.71 ? 6   LEU A HA   1 
ATOM   75   H  HB2  . LEU A 1 6   ? -19.210 -42.474 -70.589  1.00 1.66 ? 6   LEU A HB2  1 
ATOM   76   H  HB3  . LEU A 1 6   ? -20.446 -43.527 -69.927  1.00 1.32 ? 6   LEU A HB3  1 
ATOM   77   H  HG   . LEU A 1 6   ? -20.321 -40.720 -68.937  1.00 1.39 ? 6   LEU A HG   1 
ATOM   78   H  HD11 . LEU A 1 6   ? -20.797 -39.753 -70.873  1.00 1.65 ? 6   LEU A HD11 1 
ATOM   79   H  HD12 . LEU A 1 6   ? -22.092 -40.910 -71.182  1.00 1.37 ? 6   LEU A HD12 1 
ATOM   80   H  HD13 . LEU A 1 6   ? -20.441 -41.279 -71.681  1.00 1.58 ? 6   LEU A HD13 1 
ATOM   81   H  HD21 . LEU A 1 6   ? -22.015 -41.783 -67.858  1.00 1.15 ? 6   LEU A HD21 1 
ATOM   82   H  HD22 . LEU A 1 6   ? -22.295 -42.917 -69.180  1.00 1.15 ? 6   LEU A HD22 1 
ATOM   83   H  HD23 . LEU A 1 6   ? -22.898 -41.264 -69.294  1.00 0.72 ? 6   LEU A HD23 1 
ATOM   84   N  N    . PRO A 1 7   ? -19.717 -45.010 -67.463  1.00 1.82 ? 7   PRO A N    1 
ATOM   85   C  CA   . PRO A 1 7   ? -19.713 -46.445 -67.166  1.00 2.00 ? 7   PRO A CA   1 
ATOM   86   C  C    . PRO A 1 7   ? -20.244 -47.280 -68.327  1.00 1.77 ? 7   PRO A C    1 
ATOM   87   O  O    . PRO A 1 7   ? -20.793 -46.746 -69.291  1.00 1.50 ? 7   PRO A O    1 
ATOM   88   C  CB   . PRO A 1 7   ? -20.643 -46.556 -65.958  1.00 2.22 ? 7   PRO A CB   1 
ATOM   89   C  CG   . PRO A 1 7   ? -21.576 -45.403 -66.096  1.00 2.38 ? 7   PRO A CG   1 
ATOM   90   C  CD   . PRO A 1 7   ? -20.781 -44.296 -66.734  1.00 1.95 ? 7   PRO A CD   1 
ATOM   91   H  HA   . PRO A 1 7   ? -18.726 -46.791 -66.897  1.00 2.20 ? 7   PRO A HA   1 
ATOM   92   H  HB2  . PRO A 1 7   ? -21.170 -47.498 -65.991  1.00 2.31 ? 7   PRO A HB2  1 
ATOM   93   H  HB3  . PRO A 1 7   ? -20.067 -46.490 -65.048  1.00 2.30 ? 7   PRO A HB3  1 
ATOM   94   H  HG2  . PRO A 1 7   ? -22.409 -45.677 -66.726  1.00 2.60 ? 7   PRO A HG2  1 
ATOM   95   H  HG3  . PRO A 1 7   ? -21.927 -45.097 -65.121  1.00 2.79 ? 7   PRO A HG3  1 
ATOM   96   H  HD2  . PRO A 1 7   ? -21.400 -43.731 -67.414  1.00 1.68 ? 7   PRO A HD2  1 
ATOM   97   H  HD3  . PRO A 1 7   ? -20.361 -43.648 -65.978  1.00 2.18 ? 7   PRO A HD3  1 
ATOM   98   N  N    . PRO A 1 8   ? -20.084 -48.609 -68.243  1.00 1.91 ? 8   PRO A N    1 
ATOM   99   C  CA   . PRO A 1 8   ? -20.545 -49.533 -69.286  1.00 1.78 ? 8   PRO A CA   1 
ATOM   100  C  C    . PRO A 1 8   ? -22.045 -49.422 -69.546  1.00 1.72 ? 8   PRO A C    1 
ATOM   101  O  O    . PRO A 1 8   ? -22.534 -49.855 -70.590  1.00 1.62 ? 8   PRO A O    1 
ATOM   102  C  CB   . PRO A 1 8   ? -20.205 -50.917 -68.719  1.00 2.01 ? 8   PRO A CB   1 
ATOM   103  C  CG   . PRO A 1 8   ? -19.145 -50.668 -67.702  1.00 2.39 ? 8   PRO A CG   1 
ATOM   104  C  CD   . PRO A 1 8   ? -19.438 -49.314 -67.125  1.00 2.24 ? 8   PRO A CD   1 
ATOM   105  H  HA   . PRO A 1 8   ? -20.010 -49.381 -70.212  1.00 1.62 ? 8   PRO A HA   1 
ATOM   106  H  HB2  . PRO A 1 8   ? -21.087 -51.351 -68.272  1.00 2.27 ? 8   PRO A HB2  1 
ATOM   107  H  HB3  . PRO A 1 8   ? -19.847 -51.555 -69.513  1.00 1.80 ? 8   PRO A HB3  1 
ATOM   108  H  HG2  . PRO A 1 8   ? -19.191 -51.423 -66.931  1.00 2.67 ? 8   PRO A HG2  1 
ATOM   109  H  HG3  . PRO A 1 8   ? -18.174 -50.673 -68.175  1.00 2.64 ? 8   PRO A HG3  1 
ATOM   110  H  HD2  . PRO A 1 8   ? -20.108 -49.398 -66.282  1.00 2.22 ? 8   PRO A HD2  1 
ATOM   111  H  HD3  . PRO A 1 8   ? -18.523 -48.819 -66.835  1.00 2.43 ? 8   PRO A HD3  1 
ATOM   112  N  N    . ALA A 1 9   ? -22.770 -48.843 -68.591  1.00 1.84 ? 9   ALA A N    1 
ATOM   113  C  CA   . ALA A 1 9   ? -24.214 -48.679 -68.718  1.00 1.85 ? 9   ALA A CA   1 
ATOM   114  C  C    . ALA A 1 9   ? -24.596 -48.184 -70.110  1.00 1.34 ? 9   ALA A C    1 
ATOM   115  O  O    . ALA A 1 9   ? -24.986 -48.970 -70.972  1.00 1.95 ? 9   ALA A O    1 
ATOM   116  C  CB   . ALA A 1 9   ? -24.731 -47.722 -67.654  1.00 2.28 ? 9   ALA A CB   1 
ATOM   117  H  H    . ALA A 1 9   ? -22.324 -48.521 -67.781  1.00 1.97 ? 9   ALA A H    1 
ATOM   118  H  HA   . ALA A 1 9   ? -24.674 -49.643 -68.553  1.00 2.07 ? 9   ALA A HA   1 
ATOM   119  H  HB1  . ALA A 1 9   ? -25.596 -47.197 -68.031  1.00 2.19 ? 9   ALA A HB1  1 
ATOM   120  H  HB2  . ALA A 1 9   ? -23.958 -47.010 -67.405  1.00 3.02 ? 9   ALA A HB2  1 
ATOM   121  H  HB3  . ALA A 1 9   ? -25.005 -48.279 -66.770  1.00 2.41 ? 9   ALA A HB3  1 
ATOM   122  N  N    . TRP A 1 10  ? -24.480 -46.877 -70.323  1.00 1.14 ? 10  TRP A N    1 
ATOM   123  C  CA   . TRP A 1 10  ? -24.813 -46.283 -71.613  1.00 0.82 ? 10  TRP A CA   1 
ATOM   124  C  C    . TRP A 1 10  ? -23.553 -45.848 -72.353  1.00 0.72 ? 10  TRP A C    1 
ATOM   125  O  O    . TRP A 1 10  ? -23.381 -44.669 -72.665  1.00 0.73 ? 10  TRP A O    1 
ATOM   126  C  CB   . TRP A 1 10  ? -25.745 -45.084 -71.424  1.00 1.13 ? 10  TRP A CB   1 
ATOM   127  C  CG   . TRP A 1 10  ? -26.600 -45.179 -70.198  1.00 1.04 ? 10  TRP A CG   1 
ATOM   128  C  CD1  . TRP A 1 10  ? -27.759 -45.886 -70.059  1.00 1.25 ? 10  TRP A CD1  1 
ATOM   129  C  CD2  . TRP A 1 10  ? -26.364 -44.542 -68.937  1.00 1.10 ? 10  TRP A CD2  1 
ATOM   130  N  NE1  . TRP A 1 10  ? -28.259 -45.727 -68.789  1.00 1.24 ? 10  TRP A NE1  1 
ATOM   131  C  CE2  . TRP A 1 10  ? -27.421 -44.907 -68.081  1.00 1.18 ? 10  TRP A CE2  1 
ATOM   132  C  CE3  . TRP A 1 10  ? -25.363 -43.699 -68.449  1.00 1.44 ? 10  TRP A CE3  1 
ATOM   133  C  CZ2  . TRP A 1 10  ? -27.503 -44.457 -66.766  1.00 1.50 ? 10  TRP A CZ2  1 
ATOM   134  C  CZ3  . TRP A 1 10  ? -25.445 -43.253 -67.143  1.00 1.86 ? 10  TRP A CZ3  1 
ATOM   135  C  CH2  . TRP A 1 10  ? -26.508 -43.633 -66.314  1.00 1.85 ? 10  TRP A CH2  1 
ATOM   136  H  H    . TRP A 1 10  ? -24.163 -46.299 -69.599  1.00 1.83 ? 10  TRP A H    1 
ATOM   137  H  HA   . TRP A 1 10  ? -25.321 -47.033 -72.201  1.00 0.88 ? 10  TRP A HA   1 
ATOM   138  H  HB2  . TRP A 1 10  ? -25.152 -44.185 -71.348  1.00 1.58 ? 10  TRP A HB2  1 
ATOM   139  H  HB3  . TRP A 1 10  ? -26.398 -45.007 -72.281  1.00 1.40 ? 10  TRP A HB3  1 
ATOM   140  H  HD1  . TRP A 1 10  ? -28.208 -46.479 -70.842  1.00 1.59 ? 10  TRP A HD1  1 
ATOM   141  H  HE1  . TRP A 1 10  ? -29.082 -46.135 -68.446  1.00 1.44 ? 10  TRP A HE1  1 
ATOM   142  H  HE3  . TRP A 1 10  ? -24.535 -43.395 -69.072  1.00 1.54 ? 10  TRP A HE3  1 
ATOM   143  H  HZ2  . TRP A 1 10  ? -28.316 -44.741 -66.114  1.00 1.62 ? 10  TRP A HZ2  1 
ATOM   144  H  HZ3  . TRP A 1 10  ? -24.680 -42.601 -66.749  1.00 2.27 ? 10  TRP A HZ3  1 
ATOM   145  H  HH2  . TRP A 1 10  ? -26.533 -43.261 -65.301  1.00 2.23 ? 10  TRP A HH2  1 
ATOM   146  N  N    . GLN A 1 11  ? -22.675 -46.805 -72.633  1.00 0.74 ? 11  GLN A N    1 
ATOM   147  C  CA   . GLN A 1 11  ? -21.431 -46.517 -73.337  1.00 0.69 ? 11  GLN A CA   1 
ATOM   148  C  C    . GLN A 1 11  ? -21.682 -46.335 -74.831  1.00 0.59 ? 11  GLN A C    1 
ATOM   149  O  O    . GLN A 1 11  ? -21.311 -45.315 -75.412  1.00 0.57 ? 11  GLN A O    1 
ATOM   150  C  CB   . GLN A 1 11  ? -20.416 -47.638 -73.108  1.00 0.76 ? 11  GLN A CB   1 
ATOM   151  C  CG   . GLN A 1 11  ? -19.130 -47.167 -72.448  1.00 1.21 ? 11  GLN A CG   1 
ATOM   152  C  CD   . GLN A 1 11  ? -17.907 -47.422 -73.307  1.00 2.09 ? 11  GLN A CD   1 
ATOM   153  O  OE1  . GLN A 1 11  ? -17.401 -46.518 -73.971  1.00 2.70 ? 11  GLN A OE1  1 
ATOM   154  N  NE2  . GLN A 1 11  ? -17.425 -48.659 -73.298  1.00 2.81 ? 11  GLN A NE2  1 
ATOM   155  H  H    . GLN A 1 11  ? -22.867 -47.726 -72.359  1.00 0.84 ? 11  GLN A H    1 
ATOM   156  H  HA   . GLN A 1 11  ? -21.032 -45.596 -72.938  1.00 0.74 ? 11  GLN A HA   1 
ATOM   157  H  HB2  . GLN A 1 11  ? -20.864 -48.390 -72.476  1.00 0.98 ? 11  GLN A HB2  1 
ATOM   158  H  HB3  . GLN A 1 11  ? -20.165 -48.081 -74.060  1.00 0.87 ? 11  GLN A HB3  1 
ATOM   159  H  HG2  . GLN A 1 11  ? -19.204 -46.106 -72.261  1.00 1.58 ? 11  GLN A HG2  1 
ATOM   160  H  HG3  . GLN A 1 11  ? -19.009 -47.690 -71.511  1.00 1.59 ? 11  GLN A HG3  1 
ATOM   161  H  HE21 . GLN A 1 11  ? -17.880 -49.329 -72.745  1.00 2.82 ? 11  GLN A HE21 1 
ATOM   162  H  HE22 . GLN A 1 11  ? -16.635 -48.852 -73.844  1.00 3.58 ? 11  GLN A HE22 1 
ATOM   163  N  N    . PRO A 1 12  ? -22.322 -47.325 -75.474  1.00 0.57 ? 12  PRO A N    1 
ATOM   164  C  CA   . PRO A 1 12  ? -22.626 -47.270 -76.906  1.00 0.54 ? 12  PRO A CA   1 
ATOM   165  C  C    . PRO A 1 12  ? -23.298 -45.960 -77.303  1.00 0.50 ? 12  PRO A C    1 
ATOM   166  O  O    . PRO A 1 12  ? -23.199 -45.522 -78.449  1.00 0.50 ? 12  PRO A O    1 
ATOM   167  C  CB   . PRO A 1 12  ? -23.584 -48.444 -77.110  1.00 0.61 ? 12  PRO A CB   1 
ATOM   168  C  CG   . PRO A 1 12  ? -23.236 -49.406 -76.028  1.00 0.64 ? 12  PRO A CG   1 
ATOM   169  C  CD   . PRO A 1 12  ? -22.802 -48.573 -74.852  1.00 0.66 ? 12  PRO A CD   1 
ATOM   170  H  HA   . PRO A 1 12  ? -21.740 -47.415 -77.506  1.00 0.56 ? 12  PRO A HA   1 
ATOM   171  H  HB2  . PRO A 1 12  ? -24.604 -48.100 -77.021  1.00 0.67 ? 12  PRO A HB2  1 
ATOM   172  H  HB3  . PRO A 1 12  ? -23.427 -48.876 -78.087  1.00 0.64 ? 12  PRO A HB3  1 
ATOM   173  H  HG2  . PRO A 1 12  ? -24.102 -49.998 -75.770  1.00 0.73 ? 12  PRO A HG2  1 
ATOM   174  H  HG3  . PRO A 1 12  ? -22.428 -50.045 -76.352  1.00 0.62 ? 12  PRO A HG3  1 
ATOM   175  H  HD2  . PRO A 1 12  ? -23.640 -48.380 -74.198  1.00 0.75 ? 12  PRO A HD2  1 
ATOM   176  H  HD3  . PRO A 1 12  ? -22.008 -49.067 -74.314  1.00 0.68 ? 12  PRO A HD3  1 
ATOM   177  N  N    . PHE A 1 13  ? -23.981 -45.339 -76.346  1.00 0.49 ? 13  PHE A N    1 
ATOM   178  C  CA   . PHE A 1 13  ? -24.669 -44.078 -76.593  1.00 0.46 ? 13  PHE A CA   1 
ATOM   179  C  C    . PHE A 1 13  ? -23.714 -43.043 -77.180  1.00 0.50 ? 13  PHE A C    1 
ATOM   180  O  O    . PHE A 1 13  ? -24.133 -42.135 -77.897  1.00 0.51 ? 13  PHE A O    1 
ATOM   181  C  CB   . PHE A 1 13  ? -25.279 -43.545 -75.295  1.00 0.46 ? 13  PHE A CB   1 
ATOM   182  C  CG   . PHE A 1 13  ? -26.597 -44.176 -74.945  1.00 0.46 ? 13  PHE A CG   1 
ATOM   183  C  CD1  . PHE A 1 13  ? -26.688 -45.538 -74.702  1.00 1.04 ? 13  PHE A CD1  1 
ATOM   184  C  CD2  . PHE A 1 13  ? -27.746 -43.406 -74.857  1.00 1.37 ? 13  PHE A CD2  1 
ATOM   185  C  CE1  . PHE A 1 13  ? -27.899 -46.119 -74.377  1.00 1.15 ? 13  PHE A CE1  1 
ATOM   186  C  CE2  . PHE A 1 13  ? -28.960 -43.982 -74.533  1.00 1.37 ? 13  PHE A CE2  1 
ATOM   187  C  CZ   . PHE A 1 13  ? -29.036 -45.340 -74.293  1.00 0.64 ? 13  PHE A CZ   1 
ATOM   188  H  H    . PHE A 1 13  ? -24.021 -45.738 -75.453  1.00 0.50 ? 13  PHE A H    1 
ATOM   189  H  HA   . PHE A 1 13  ? -25.460 -44.265 -77.303  1.00 0.43 ? 13  PHE A HA   1 
ATOM   190  H  HB2  . PHE A 1 13  ? -24.596 -43.733 -74.481  1.00 0.47 ? 13  PHE A HB2  1 
ATOM   191  H  HB3  . PHE A 1 13  ? -25.435 -42.481 -75.390  1.00 0.55 ? 13  PHE A HB3  1 
ATOM   192  H  HD1  . PHE A 1 13  ? -25.800 -46.148 -74.767  1.00 1.84 ? 13  PHE A HD1  1 
ATOM   193  H  HD2  . PHE A 1 13  ? -27.687 -42.344 -75.045  1.00 2.23 ? 13  PHE A HD2  1 
ATOM   194  H  HE1  . PHE A 1 13  ? -27.956 -47.181 -74.191  1.00 1.99 ? 13  PHE A HE1  1 
ATOM   195  H  HE2  . PHE A 1 13  ? -29.847 -43.370 -74.468  1.00 2.19 ? 13  PHE A HE2  1 
ATOM   196  H  HZ   . PHE A 1 13  ? -29.984 -45.792 -74.038  1.00 0.75 ? 13  PHE A HZ   1 
ATOM   197  N  N    . LEU A 1 14  ? -22.428 -43.186 -76.870  1.00 0.55 ? 14  LEU A N    1 
ATOM   198  C  CA   . LEU A 1 14  ? -21.416 -42.262 -77.367  1.00 0.62 ? 14  LEU A CA   1 
ATOM   199  C  C    . LEU A 1 14  ? -21.114 -42.523 -78.839  1.00 0.57 ? 14  LEU A C    1 
ATOM   200  O  O    . LEU A 1 14  ? -21.078 -43.670 -79.282  1.00 0.62 ? 14  LEU A O    1 
ATOM   201  C  CB   . LEU A 1 14  ? -20.134 -42.386 -76.541  1.00 0.68 ? 14  LEU A CB   1 
ATOM   202  C  CG   . LEU A 1 14  ? -20.328 -42.293 -75.026  1.00 0.72 ? 14  LEU A CG   1 
ATOM   203  C  CD1  . LEU A 1 14  ? -19.004 -42.010 -74.335  1.00 0.94 ? 14  LEU A CD1  1 
ATOM   204  C  CD2  . LEU A 1 14  ? -21.350 -41.218 -74.687  1.00 0.80 ? 14  LEU A CD2  1 
ATOM   205  H  H    . LEU A 1 14  ? -22.155 -43.929 -76.294  1.00 0.56 ? 14  LEU A H    1 
ATOM   206  H  HA   . LEU A 1 14  ? -21.803 -41.259 -77.263  1.00 0.70 ? 14  LEU A HA   1 
ATOM   207  H  HB2  . LEU A 1 14  ? -19.676 -43.339 -76.767  1.00 0.70 ? 14  LEU A HB2  1 
ATOM   208  H  HB3  . LEU A 1 14  ? -19.458 -41.600 -76.843  1.00 0.73 ? 14  LEU A HB3  1 
ATOM   209  H  HG   . LEU A 1 14  ? -20.701 -43.238 -74.659  1.00 0.96 ? 14  LEU A HG   1 
ATOM   210  H  HD11 . LEU A 1 14  ? -19.096 -41.118 -73.732  1.00 1.28 ? 14  LEU A HD11 1 
ATOM   211  H  HD12 . LEU A 1 14  ? -18.234 -41.864 -75.078  1.00 1.20 ? 14  LEU A HD12 1 
ATOM   212  H  HD13 . LEU A 1 14  ? -18.742 -42.846 -73.703  1.00 1.58 ? 14  LEU A HD13 1 
ATOM   213  H  HD21 . LEU A 1 14  ? -21.221 -40.910 -73.660  1.00 1.19 ? 14  LEU A HD21 1 
ATOM   214  H  HD22 . LEU A 1 14  ? -22.346 -41.613 -74.822  1.00 1.69 ? 14  LEU A HD22 1 
ATOM   215  H  HD23 . LEU A 1 14  ? -21.209 -40.368 -75.338  1.00 0.97 ? 14  LEU A HD23 1 
ATOM   216  N  N    . LYS A 1 15  ? -20.896 -41.449 -79.591  1.00 0.79 ? 15  LYS A N    1 
ATOM   217  C  CA   . LYS A 1 15  ? -20.596 -41.560 -81.014  1.00 0.78 ? 15  LYS A CA   1 
ATOM   218  C  C    . LYS A 1 15  ? -19.195 -42.123 -81.231  1.00 0.73 ? 15  LYS A C    1 
ATOM   219  O  O    . LYS A 1 15  ? -19.007 -43.068 -81.997  1.00 0.65 ? 15  LYS A O    1 
ATOM   220  C  CB   . LYS A 1 15  ? -20.722 -40.193 -81.690  1.00 0.96 ? 15  LYS A CB   1 
ATOM   221  C  CG   . LYS A 1 15  ? -20.354 -40.204 -83.166  1.00 1.29 ? 15  LYS A CG   1 
ATOM   222  C  CD   . LYS A 1 15  ? -21.582 -40.046 -84.050  1.00 1.04 ? 15  LYS A CD   1 
ATOM   223  C  CE   . LYS A 1 15  ? -21.337 -39.055 -85.176  1.00 1.40 ? 15  LYS A CE   1 
ATOM   224  N  NZ   . LYS A 1 15  ? -19.926 -39.088 -85.651  1.00 2.30 ? 15  LYS A NZ   1 
ATOM   225  H  H    . LYS A 1 15  ? -20.937 -40.561 -79.179  1.00 1.06 ? 15  LYS A H    1 
ATOM   226  H  HA   . LYS A 1 15  ? -21.314 -42.236 -81.452  1.00 0.73 ? 15  LYS A HA   1 
ATOM   227  H  HB2  . LYS A 1 15  ? -21.742 -39.852 -81.598  1.00 1.43 ? 15  LYS A HB2  1 
ATOM   228  H  HB3  . LYS A 1 15  ? -20.072 -39.494 -81.185  1.00 0.78 ? 15  LYS A HB3  1 
ATOM   229  H  HG2  . LYS A 1 15  ? -19.675 -39.389 -83.363  1.00 1.68 ? 15  LYS A HG2  1 
ATOM   230  H  HG3  . LYS A 1 15  ? -19.872 -41.142 -83.400  1.00 1.99 ? 15  LYS A HG3  1 
ATOM   231  H  HD2  . LYS A 1 15  ? -21.831 -41.006 -84.478  1.00 1.24 ? 15  LYS A HD2  1 
ATOM   232  H  HD3  . LYS A 1 15  ? -22.406 -39.695 -83.446  1.00 1.29 ? 15  LYS A HD3  1 
ATOM   233  H  HE2  . LYS A 1 15  ? -21.990 -39.298 -86.001  1.00 1.91 ? 15  LYS A HE2  1 
ATOM   234  H  HE3  . LYS A 1 15  ? -21.564 -38.061 -84.819  1.00 1.66 ? 15  LYS A HE3  1 
ATOM   235  H  HZ1  . LYS A 1 15  ? -19.354 -38.401 -85.119  1.00 2.38 ? 15  LYS A HZ1  1 
ATOM   236  H  HZ2  . LYS A 1 15  ? -19.883 -38.848 -86.662  1.00 2.89 ? 15  LYS A HZ2  1 
ATOM   237  H  HZ3  . LYS A 1 15  ? -19.525 -40.038 -85.514  1.00 2.91 ? 15  LYS A HZ3  1 
ATOM   238  N  N    . ASP A 1 16  ? -18.214 -41.535 -80.553  1.00 0.79 ? 16  ASP A N    1 
ATOM   239  C  CA   . ASP A 1 16  ? -16.830 -41.978 -80.673  1.00 0.79 ? 16  ASP A CA   1 
ATOM   240  C  C    . ASP A 1 16  ? -16.715 -43.479 -80.430  1.00 0.78 ? 16  ASP A C    1 
ATOM   241  O  O    . ASP A 1 16  ? -15.974 -44.175 -81.124  1.00 0.83 ? 16  ASP A O    1 
ATOM   242  C  CB   . ASP A 1 16  ? -15.944 -41.220 -79.683  1.00 0.85 ? 16  ASP A CB   1 
ATOM   243  C  CG   . ASP A 1 16  ? -16.239 -41.591 -78.243  1.00 1.92 ? 16  ASP A CG   1 
ATOM   244  O  OD1  . ASP A 1 16  ? -17.222 -41.061 -77.683  1.00 2.47 ? 16  ASP A OD1  1 
ATOM   245  O  OD2  . ASP A 1 16  ? -15.487 -42.411 -77.675  1.00 2.73 ? 16  ASP A OD2  1 
ATOM   246  H  H    . ASP A 1 16  ? -18.427 -40.785 -79.959  1.00 0.87 ? 16  ASP A H    1 
ATOM   247  H  HA   . ASP A 1 16  ? -16.499 -41.761 -81.678  1.00 0.78 ? 16  ASP A HA   1 
ATOM   248  H  HB2  . ASP A 1 16  ? -14.908 -41.448 -79.888  1.00 1.02 ? 16  ASP A HB2  1 
ATOM   249  H  HB3  . ASP A 1 16  ? -16.105 -40.159 -79.803  1.00 1.24 ? 16  ASP A HB3  1 
ATOM   250  N  N    . HIS A 1 17  ? -17.452 -43.972 -79.440  1.00 0.76 ? 17  HIS A N    1 
ATOM   251  C  CA   . HIS A 1 17  ? -17.432 -45.391 -79.105  1.00 0.79 ? 17  HIS A CA   1 
ATOM   252  C  C    . HIS A 1 17  ? -17.877 -46.239 -80.292  1.00 0.79 ? 17  HIS A C    1 
ATOM   253  O  O    . HIS A 1 17  ? -17.137 -47.103 -80.763  1.00 0.83 ? 17  HIS A O    1 
ATOM   254  C  CB   . HIS A 1 17  ? -18.334 -45.665 -77.901  1.00 0.80 ? 17  HIS A CB   1 
ATOM   255  C  CG   . HIS A 1 17  ? -18.456 -47.118 -77.564  1.00 1.03 ? 17  HIS A CG   1 
ATOM   256  N  ND1  . HIS A 1 17  ? -17.585 -47.771 -76.717  1.00 1.49 ? 17  HIS A ND1  1 
ATOM   257  C  CD2  . HIS A 1 17  ? -19.355 -48.048 -77.965  1.00 1.24 ? 17  HIS A CD2  1 
ATOM   258  C  CE1  . HIS A 1 17  ? -17.942 -49.038 -76.612  1.00 1.73 ? 17  HIS A CE1  1 
ATOM   259  N  NE2  . HIS A 1 17  ? -19.013 -49.232 -77.359  1.00 1.62 ? 17  HIS A NE2  1 
ATOM   260  H  H    . HIS A 1 17  ? -18.023 -43.366 -78.922  1.00 0.76 ? 17  HIS A H    1 
ATOM   261  H  HA   . HIS A 1 17  ? -16.417 -45.656 -78.849  1.00 0.85 ? 17  HIS A HA   1 
ATOM   262  H  HB2  . HIS A 1 17  ? -17.934 -45.157 -77.036  1.00 0.98 ? 17  HIS A HB2  1 
ATOM   263  H  HB3  . HIS A 1 17  ? -19.324 -45.286 -78.108  1.00 0.79 ? 17  HIS A HB3  1 
ATOM   264  H  HD1  . HIS A 1 17  ? -16.819 -47.365 -76.260  1.00 1.76 ? 17  HIS A HD1  1 
ATOM   265  H  HD2  . HIS A 1 17  ? -20.186 -47.887 -78.637  1.00 1.36 ? 17  HIS A HD2  1 
ATOM   266  H  HE1  . HIS A 1 17  ? -17.444 -49.788 -76.016  1.00 2.11 ? 17  HIS A HE1  1 
ATOM   267  H  HE2  . HIS A 1 17  ? -19.536 -50.060 -77.393  1.00 1.91 ? 17  HIS A HE2  1 
ATOM   268  N  N    . ARG A 1 18  ? -19.090 -45.987 -80.772  1.00 0.75 ? 18  ARG A N    1 
ATOM   269  C  CA   . ARG A 1 18  ? -19.633 -46.728 -81.905  1.00 0.76 ? 18  ARG A CA   1 
ATOM   270  C  C    . ARG A 1 18  ? -18.659 -46.717 -83.078  1.00 0.77 ? 18  ARG A C    1 
ATOM   271  O  O    . ARG A 1 18  ? -18.601 -47.667 -83.859  1.00 0.85 ? 18  ARG A O    1 
ATOM   272  C  CB   . ARG A 1 18  ? -20.974 -46.131 -82.337  1.00 0.75 ? 18  ARG A CB   1 
ATOM   273  C  CG   . ARG A 1 18  ? -22.134 -46.527 -81.439  1.00 0.85 ? 18  ARG A CG   1 
ATOM   274  C  CD   . ARG A 1 18  ? -23.410 -45.796 -81.824  1.00 0.82 ? 18  ARG A CD   1 
ATOM   275  N  NE   . ARG A 1 18  ? -23.559 -44.536 -81.101  1.00 0.95 ? 18  ARG A NE   1 
ATOM   276  C  CZ   . ARG A 1 18  ? -24.701 -43.859 -81.024  1.00 0.82 ? 18  ARG A CZ   1 
ATOM   277  N  NH1  . ARG A 1 18  ? -25.792 -44.317 -81.624  1.00 1.43 ? 18  ARG A NH1  1 
ATOM   278  N  NH2  . ARG A 1 18  ? -24.754 -42.721 -80.345  1.00 1.39 ? 18  ARG A NH2  1 
ATOM   279  H  H    . ARG A 1 18  ? -19.634 -45.287 -80.355  1.00 0.74 ? 18  ARG A H    1 
ATOM   280  H  HA   . ARG A 1 18  ? -19.788 -47.749 -81.590  1.00 0.79 ? 18  ARG A HA   1 
ATOM   281  H  HB2  . ARG A 1 18  ? -20.893 -45.054 -82.330  1.00 0.74 ? 18  ARG A HB2  1 
ATOM   282  H  HB3  . ARG A 1 18  ? -21.195 -46.460 -83.341  1.00 0.77 ? 18  ARG A HB3  1 
ATOM   283  H  HG2  . ARG A 1 18  ? -22.300 -47.590 -81.528  1.00 1.20 ? 18  ARG A HG2  1 
ATOM   284  H  HG3  . ARG A 1 18  ? -21.885 -46.284 -80.416  1.00 1.34 ? 18  ARG A HG3  1 
ATOM   285  H  HD2  . ARG A 1 18  ? -23.386 -45.591 -82.884  1.00 1.37 ? 18  ARG A HD2  1 
ATOM   286  H  HD3  . ARG A 1 18  ? -24.255 -46.431 -81.600  1.00 1.46 ? 18  ARG A HD3  1 
ATOM   287  H  HE   . ARG A 1 18  ? -22.767 -44.175 -80.650  1.00 1.77 ? 18  ARG A HE   1 
ATOM   288  H  HH11 . ARG A 1 18  ? -25.759 -45.174 -82.139  1.00 1.85 ? 18  ARG A HH11 1 
ATOM   289  H  HH12 . ARG A 1 18  ? -26.649 -43.806 -81.561  1.00 1.91 ? 18  ARG A HH12 1 
ATOM   290  H  HH21 . ARG A 1 18  ? -23.935 -42.371 -79.891  1.00 2.11 ? 18  ARG A HH21 1 
ATOM   291  H  HH22 . ARG A 1 18  ? -25.613 -42.212 -80.288  1.00 1.45 ? 18  ARG A HH22 1 
ATOM   292  N  N    . ILE A 1 19  ? -17.894 -45.636 -83.196  1.00 0.73 ? 19  ILE A N    1 
ATOM   293  C  CA   . ILE A 1 19  ? -16.922 -45.502 -84.273  1.00 0.76 ? 19  ILE A CA   1 
ATOM   294  C  C    . ILE A 1 19  ? -15.666 -46.316 -83.984  1.00 0.76 ? 19  ILE A C    1 
ATOM   295  O  O    . ILE A 1 19  ? -15.064 -46.891 -84.891  1.00 0.80 ? 19  ILE A O    1 
ATOM   296  C  CB   . ILE A 1 19  ? -16.526 -44.030 -84.491  1.00 0.79 ? 19  ILE A CB   1 
ATOM   297  C  CG1  . ILE A 1 19  ? -17.410 -43.395 -85.567  1.00 0.81 ? 19  ILE A CG1  1 
ATOM   298  C  CG2  . ILE A 1 19  ? -15.058 -43.928 -84.876  1.00 0.80 ? 19  ILE A CG2  1 
ATOM   299  C  CD1  . ILE A 1 19  ? -18.497 -42.503 -85.007  1.00 0.90 ? 19  ILE A CD1  1 
ATOM   300  H  H    . ILE A 1 19  ? -17.987 -44.912 -82.542  1.00 0.71 ? 19  ILE A H    1 
ATOM   301  H  HA   . ILE A 1 19  ? -17.377 -45.869 -85.181  1.00 0.77 ? 19  ILE A HA   1 
ATOM   302  H  HB   . ILE A 1 19  ? -16.666 -43.500 -83.561  1.00 0.82 ? 19  ILE A HB   1 
ATOM   303  H  HG12 . ILE A 1 19  ? -16.795 -42.797 -86.222  1.00 0.76 ? 19  ILE A HG12 1 
ATOM   304  H  HG13 . ILE A 1 19  ? -17.884 -44.177 -86.141  1.00 0.85 ? 19  ILE A HG13 1 
ATOM   305  H  HG21 . ILE A 1 19  ? -14.847 -42.932 -85.235  1.00 1.44 ? 19  ILE A HG21 1 
ATOM   306  H  HG22 . ILE A 1 19  ? -14.839 -44.645 -85.653  1.00 1.19 ? 19  ILE A HG22 1 
ATOM   307  H  HG23 . ILE A 1 19  ? -14.444 -44.136 -84.011  1.00 0.83 ? 19  ILE A HG23 1 
ATOM   308  H  HD11 . ILE A 1 19  ? -18.908 -41.896 -85.800  1.00 1.39 ? 19  ILE A HD11 1 
ATOM   309  H  HD12 . ILE A 1 19  ? -18.080 -41.863 -84.243  1.00 1.32 ? 19  ILE A HD12 1 
ATOM   310  H  HD13 . ILE A 1 19  ? -19.278 -43.113 -84.579  1.00 1.18 ? 19  ILE A HD13 1 
ATOM   311  N  N    . SER A 1 20  ? -15.276 -46.362 -82.714  1.00 0.76 ? 20  SER A N    1 
ATOM   312  C  CA   . SER A 1 20  ? -14.091 -47.107 -82.305  1.00 0.80 ? 20  SER A CA   1 
ATOM   313  C  C    . SER A 1 20  ? -14.260 -48.596 -82.589  1.00 0.76 ? 20  SER A C    1 
ATOM   314  O  O    . SER A 1 20  ? -13.289 -49.298 -82.874  1.00 0.78 ? 20  SER A O    1 
ATOM   315  C  CB   . SER A 1 20  ? -13.813 -46.889 -80.817  1.00 0.87 ? 20  SER A CB   1 
ATOM   316  O  OG   . SER A 1 20  ? -12.520 -47.352 -80.466  1.00 1.47 ? 20  SER A OG   1 
ATOM   317  H  H    . SER A 1 20  ? -15.797 -45.884 -82.036  1.00 0.76 ? 20  SER A H    1 
ATOM   318  H  HA   . SER A 1 20  ? -13.253 -46.737 -82.877  1.00 0.84 ? 20  SER A HA   1 
ATOM   319  H  HB2  . SER A 1 20  ? -13.876 -45.834 -80.592  1.00 1.05 ? 20  SER A HB2  1 
ATOM   320  H  HB3  . SER A 1 20  ? -14.546 -47.426 -80.233  1.00 1.18 ? 20  SER A HB3  1 
ATOM   321  H  HG   . SER A 1 20  ? -12.559 -47.796 -79.616  1.00 2.23 ? 20  SER A HG   1 
ATOM   322  N  N    . THR A 1 21  ? -15.498 -49.072 -82.509  1.00 0.72 ? 21  THR A N    1 
ATOM   323  C  CA   . THR A 1 21  ? -15.794 -50.478 -82.758  1.00 0.70 ? 21  THR A CA   1 
ATOM   324  C  C    . THR A 1 21  ? -15.309 -50.905 -84.139  1.00 0.63 ? 21  THR A C    1 
ATOM   325  O  O    . THR A 1 21  ? -14.839 -52.027 -84.323  1.00 0.74 ? 21  THR A O    1 
ATOM   326  C  CB   . THR A 1 21  ? -17.303 -50.764 -82.644  1.00 0.75 ? 21  THR A CB   1 
ATOM   327  O  OG1  . THR A 1 21  ? -18.000 -49.575 -82.255  1.00 1.23 ? 21  THR A OG1  1 
ATOM   328  C  CG2  . THR A 1 21  ? -17.568 -51.867 -81.629  1.00 1.15 ? 21  THR A CG2  1 
ATOM   329  H  H    . THR A 1 21  ? -16.231 -48.464 -82.278  1.00 0.71 ? 21  THR A H    1 
ATOM   330  H  HA   . THR A 1 21  ? -15.279 -51.064 -82.010  1.00 0.75 ? 21  THR A HA   1 
ATOM   331  H  HB   . THR A 1 21  ? -17.667 -51.088 -83.608  1.00 0.54 ? 21  THR A HB   1 
ATOM   332  H  HG1  . THR A 1 21  ? -18.937 -49.679 -82.437  1.00 1.51 ? 21  THR A HG1  1 
ATOM   333  H  HG21 . THR A 1 21  ? -17.714 -52.804 -82.146  1.00 1.47 ? 21  THR A HG21 1 
ATOM   334  H  HG22 . THR A 1 21  ? -18.455 -51.627 -81.062  1.00 1.74 ? 21  THR A HG22 1 
ATOM   335  H  HG23 . THR A 1 21  ? -16.725 -51.952 -80.961  1.00 1.19 ? 21  THR A HG23 1 
ATOM   336  N  N    . PHE A 1 22  ? -15.424 -50.001 -85.107  1.00 0.60 ? 22  PHE A N    1 
ATOM   337  C  CA   . PHE A 1 22  ? -14.995 -50.284 -86.472  1.00 0.61 ? 22  PHE A CA   1 
ATOM   338  C  C    . PHE A 1 22  ? -13.485 -50.490 -86.533  1.00 0.65 ? 22  PHE A C    1 
ATOM   339  O  O    . PHE A 1 22  ? -12.712 -49.560 -86.301  1.00 0.81 ? 22  PHE A O    1 
ATOM   340  C  CB   . PHE A 1 22  ? -15.406 -49.144 -87.405  1.00 0.73 ? 22  PHE A CB   1 
ATOM   341  C  CG   . PHE A 1 22  ? -16.888 -49.061 -87.636  1.00 0.67 ? 22  PHE A CG   1 
ATOM   342  C  CD1  . PHE A 1 22  ? -17.571 -50.112 -88.228  1.00 1.44 ? 22  PHE A CD1  1 
ATOM   343  C  CD2  . PHE A 1 22  ? -17.599 -47.933 -87.260  1.00 0.81 ? 22  PHE A CD2  1 
ATOM   344  C  CE1  . PHE A 1 22  ? -18.934 -50.038 -88.442  1.00 1.44 ? 22  PHE A CE1  1 
ATOM   345  C  CE2  . PHE A 1 22  ? -18.962 -47.853 -87.470  1.00 0.83 ? 22  PHE A CE2  1 
ATOM   346  C  CZ   . PHE A 1 22  ? -19.631 -48.907 -88.062  1.00 0.69 ? 22  PHE A CZ   1 
ATOM   347  H  H    . PHE A 1 22  ? -15.805 -49.122 -84.898  1.00 0.66 ? 22  PHE A H    1 
ATOM   348  H  HA   . PHE A 1 22  ? -15.483 -51.193 -86.790  1.00 0.59 ? 22  PHE A HA   1 
ATOM   349  H  HB2  . PHE A 1 22  ? -15.083 -48.206 -86.980  1.00 0.83 ? 22  PHE A HB2  1 
ATOM   350  H  HB3  . PHE A 1 22  ? -14.927 -49.283 -88.364  1.00 0.82 ? 22  PHE A HB3  1 
ATOM   351  H  HD1  . PHE A 1 22  ? -17.027 -50.996 -88.525  1.00 2.17 ? 22  PHE A HD1  1 
ATOM   352  H  HD2  . PHE A 1 22  ? -17.077 -47.108 -86.798  1.00 1.45 ? 22  PHE A HD2  1 
ATOM   353  H  HE1  . PHE A 1 22  ? -19.454 -50.864 -88.904  1.00 2.16 ? 22  PHE A HE1  1 
ATOM   354  H  HE2  . PHE A 1 22  ? -19.505 -46.968 -87.173  1.00 1.49 ? 22  PHE A HE2  1 
ATOM   355  H  HZ   . PHE A 1 22  ? -20.697 -48.848 -88.227  1.00 0.73 ? 22  PHE A HZ   1 
ATOM   356  N  N    . LYS A 1 23  ? -13.071 -51.713 -86.846  1.00 0.70 ? 23  LYS A N    1 
ATOM   357  C  CA   . LYS A 1 23  ? -11.653 -52.041 -86.936  1.00 0.79 ? 23  LYS A CA   1 
ATOM   358  C  C    . LYS A 1 23  ? -11.090 -51.666 -88.303  1.00 0.98 ? 23  LYS A C    1 
ATOM   359  O  O    . LYS A 1 23  ? -10.170 -50.854 -88.404  1.00 1.89 ? 23  LYS A O    1 
ATOM   360  C  CB   . LYS A 1 23  ? -11.435 -53.532 -86.674  1.00 0.83 ? 23  LYS A CB   1 
ATOM   361  C  CG   . LYS A 1 23  ? -10.238 -53.824 -85.784  1.00 1.18 ? 23  LYS A CG   1 
ATOM   362  C  CD   . LYS A 1 23  ? -10.569 -53.609 -84.316  1.00 1.92 ? 23  LYS A CD   1 
ATOM   363  C  CE   . LYS A 1 23  ? -9.958  -52.319 -83.791  1.00 2.46 ? 23  LYS A CE   1 
ATOM   364  N  NZ   . LYS A 1 23  ? -10.931 -51.533 -82.984  1.00 2.96 ? 23  LYS A NZ   1 
ATOM   365  H  H    . LYS A 1 23  ? -13.735 -52.413 -87.018  1.00 0.80 ? 23  LYS A H    1 
ATOM   366  H  HA   . LYS A 1 23  ? -11.134 -51.473 -86.178  1.00 1.00 ? 23  LYS A HA   1 
ATOM   367  H  HB2  . LYS A 1 23  ? -12.317 -53.935 -86.198  1.00 0.83 ? 23  LYS A HB2  1 
ATOM   368  H  HB3  . LYS A 1 23  ? -11.285 -54.033 -87.619  1.00 0.86 ? 23  LYS A HB3  1 
ATOM   369  H  HG2  . LYS A 1 23  ? -9.937  -54.851 -85.928  1.00 1.27 ? 23  LYS A HG2  1 
ATOM   370  H  HG3  . LYS A 1 23  ? -9.427  -53.167 -86.062  1.00 1.46 ? 23  LYS A HG3  1 
ATOM   371  H  HD2  . LYS A 1 23  ? -11.641 -53.560 -84.203  1.00 2.20 ? 23  LYS A HD2  1 
ATOM   372  H  HD3  . LYS A 1 23  ? -10.182 -54.439 -83.744  1.00 2.22 ? 23  LYS A HD3  1 
ATOM   373  H  HE2  . LYS A 1 23  ? -9.107  -52.564 -83.174  1.00 2.76 ? 23  LYS A HE2  1 
ATOM   374  H  HE3  . LYS A 1 23  ? -9.634  -51.722 -84.631  1.00 2.45 ? 23  LYS A HE3  1 
ATOM   375  H  HZ1  . LYS A 1 23  ? -10.619 -50.543 -82.913  1.00 3.39 ? 23  LYS A HZ1  1 
ATOM   376  H  HZ2  . LYS A 1 23  ? -11.004 -51.930 -82.026  1.00 3.52 ? 23  LYS A HZ2  1 
ATOM   377  H  HZ3  . LYS A 1 23  ? -11.870 -51.559 -83.430  1.00 2.59 ? 23  LYS A HZ3  1 
ATOM   378  N  N    . ASN A 1 24  ? -11.646 -52.263 -89.352  1.00 0.82 ? 24  ASN A N    1 
ATOM   379  C  CA   . ASN A 1 24  ? -11.195 -51.992 -90.712  1.00 1.11 ? 24  ASN A CA   1 
ATOM   380  C  C    . ASN A 1 24  ? -12.343 -51.488 -91.579  1.00 1.03 ? 24  ASN A C    1 
ATOM   381  O  O    . ASN A 1 24  ? -12.415 -50.302 -91.904  1.00 1.08 ? 24  ASN A O    1 
ATOM   382  C  CB   . ASN A 1 24  ? -10.589 -53.253 -91.331  1.00 1.30 ? 24  ASN A CB   1 
ATOM   383  C  CG   . ASN A 1 24  ? -9.074  -53.213 -91.359  1.00 2.02 ? 24  ASN A CG   1 
ATOM   384  O  OD1  . ASN A 1 24  ? -8.446  -52.491 -90.584  1.00 2.85 ? 24  ASN A OD1  1 
ATOM   385  N  ND2  . ASN A 1 24  ? -8.478  -53.990 -92.256  1.00 2.12 ? 24  ASN A ND2  1 
ATOM   386  H  H    . ASN A 1 24  ? -12.374 -52.903 -89.208  1.00 1.26 ? 24  ASN A H    1 
ATOM   387  H  HA   . ASN A 1 24  ? -10.435 -51.226 -90.662  1.00 1.38 ? 24  ASN A HA   1 
ATOM   388  H  HB2  . ASN A 1 24  ? -10.897 -54.113 -90.755  1.00 1.31 ? 24  ASN A HB2  1 
ATOM   389  H  HB3  . ASN A 1 24  ? -10.948 -53.357 -92.344  1.00 1.40 ? 24  ASN A HB3  1 
ATOM   390  H  HD21 . ASN A 1 24  ? -9.041  -54.538 -92.841  1.00 2.02 ? 24  ASN A HD21 1 
ATOM   391  H  HD22 . ASN A 1 24  ? -7.499  -53.984 -92.296  1.00 2.62 ? 24  ASN A HD22 1 
ATOM   392  N  N    . TRP A 1 25  ? -13.239 -52.396 -91.954  1.00 0.94 ? 25  TRP A N    1 
ATOM   393  C  CA   . TRP A 1 25  ? -14.382 -52.044 -92.787  1.00 0.86 ? 25  TRP A CA   1 
ATOM   394  C  C    . TRP A 1 25  ? -13.926 -51.385 -94.088  1.00 0.91 ? 25  TRP A C    1 
ATOM   395  O  O    . TRP A 1 25  ? -13.572 -50.207 -94.106  1.00 0.92 ? 25  TRP A O    1 
ATOM   396  C  CB   . TRP A 1 25  ? -15.324 -51.106 -92.032  1.00 0.77 ? 25  TRP A CB   1 
ATOM   397  C  CG   . TRP A 1 25  ? -16.701 -51.067 -92.616  1.00 0.67 ? 25  TRP A CG   1 
ATOM   398  C  CD1  . TRP A 1 25  ? -17.284 -50.022 -93.271  1.00 0.59 ? 25  TRP A CD1  1 
ATOM   399  C  CD2  . TRP A 1 25  ? -17.668 -52.123 -92.601  1.00 0.66 ? 25  TRP A CD2  1 
ATOM   400  N  NE1  . TRP A 1 25  ? -18.553 -50.364 -93.668  1.00 0.52 ? 25  TRP A NE1  1 
ATOM   401  C  CE2  . TRP A 1 25  ? -18.813 -51.649 -93.267  1.00 0.56 ? 25  TRP A CE2  1 
ATOM   402  C  CE3  . TRP A 1 25  ? -17.675 -53.423 -92.090  1.00 0.75 ? 25  TRP A CE3  1 
ATOM   403  C  CZ2  . TRP A 1 25  ? -19.953 -52.430 -93.435  1.00 0.56 ? 25  TRP A CZ2  1 
ATOM   404  C  CZ3  . TRP A 1 25  ? -18.806 -54.198 -92.257  1.00 0.75 ? 25  TRP A CZ3  1 
ATOM   405  C  CH2  . TRP A 1 25  ? -19.932 -53.700 -92.925  1.00 0.66 ? 25  TRP A CH2  1 
ATOM   406  H  H    . TRP A 1 25  ? -13.127 -53.325 -91.665  1.00 0.96 ? 25  TRP A H    1 
ATOM   407  H  HA   . TRP A 1 25  ? -14.911 -52.954 -93.022  1.00 0.87 ? 25  TRP A HA   1 
ATOM   408  H  HB2  . TRP A 1 25  ? -15.404 -51.435 -91.006  1.00 0.79 ? 25  TRP A HB2  1 
ATOM   409  H  HB3  . TRP A 1 25  ? -14.921 -50.104 -92.055  1.00 0.79 ? 25  TRP A HB3  1 
ATOM   410  H  HD1  . TRP A 1 25  ? -16.804 -49.071 -93.445  1.00 0.60 ? 25  TRP A HD1  1 
ATOM   411  H  HE1  . TRP A 1 25  ? -19.171 -49.784 -94.158  1.00 0.47 ? 25  TRP A HE1  1 
ATOM   412  H  HE3  . TRP A 1 25  ? -16.816 -53.825 -91.572  1.00 0.84 ? 25  TRP A HE3  1 
ATOM   413  H  HZ2  . TRP A 1 25  ? -20.829 -52.061 -93.948  1.00 0.50 ? 25  TRP A HZ2  1 
ATOM   414  H  HZ3  . TRP A 1 25  ? -18.829 -55.205 -91.869  1.00 0.84 ? 25  TRP A HZ3  1 
ATOM   415  H  HH2  . TRP A 1 25  ? -20.795 -54.341 -93.032  1.00 0.68 ? 25  TRP A HH2  1 
ATOM   416  N  N    . PRO A 1 26  ? -13.925 -52.145 -95.195  1.00 1.08 ? 26  PRO A N    1 
ATOM   417  C  CA   . PRO A 1 26  ? -13.505 -51.637 -96.506  1.00 1.16 ? 26  PRO A CA   1 
ATOM   418  C  C    . PRO A 1 26  ? -14.221 -50.347 -96.898  1.00 1.10 ? 26  PRO A C    1 
ATOM   419  O  O    . PRO A 1 26  ? -13.604 -49.425 -97.431  1.00 1.15 ? 26  PRO A O    1 
ATOM   420  C  CB   . PRO A 1 26  ? -13.885 -52.768 -97.464  1.00 1.26 ? 26  PRO A CB   1 
ATOM   421  C  CG   . PRO A 1 26  ? -13.876 -53.996 -96.622  1.00 1.70 ? 26  PRO A CG   1 
ATOM   422  C  CD   . PRO A 1 26  ? -14.327 -53.562 -95.254  1.00 1.32 ? 26  PRO A CD   1 
ATOM   423  H  HA   . PRO A 1 26  ? -12.438 -51.478 -96.543  1.00 1.24 ? 26  PRO A HA   1 
ATOM   424  H  HB2  . PRO A 1 26  ? -14.865 -52.579 -97.878  1.00 1.20 ? 26  PRO A HB2  1 
ATOM   425  H  HB3  . PRO A 1 26  ? -13.158 -52.831 -98.259  1.00 1.34 ? 26  PRO A HB3  1 
ATOM   426  H  HG2  . PRO A 1 26  ? -14.561 -54.726 -97.028  1.00 2.10 ? 26  PRO A HG2  1 
ATOM   427  H  HG3  . PRO A 1 26  ? -12.877 -54.402 -96.575  1.00 2.11 ? 26  PRO A HG3  1 
ATOM   428  H  HD2  . PRO A 1 26  ? -15.398 -53.663 -95.161  1.00 1.35 ? 26  PRO A HD2  1 
ATOM   429  H  HD3  . PRO A 1 26  ? -13.824 -54.137 -94.491  1.00 1.33 ? 26  PRO A HD3  1 
ATOM   430  N  N    . PHE A 1 27  ? -15.523 -50.288 -96.638  1.00 1.05 ? 27  PHE A N    1 
ATOM   431  C  CA   . PHE A 1 27  ? -16.312 -49.107 -96.974  1.00 1.03 ? 27  PHE A CA   1 
ATOM   432  C  C    . PHE A 1 27  ? -15.917 -47.919 -96.105  1.00 1.01 ? 27  PHE A C    1 
ATOM   433  O  O    . PHE A 1 27  ? -16.556 -47.637 -95.092  1.00 1.24 ? 27  PHE A O    1 
ATOM   434  C  CB   . PHE A 1 27  ? -17.804 -49.402 -96.815  1.00 1.00 ? 27  PHE A CB   1 
ATOM   435  C  CG   . PHE A 1 27  ? -18.356 -50.291 -97.892  1.00 1.09 ? 27  PHE A CG   1 
ATOM   436  C  CD1  . PHE A 1 27  ? -17.998 -50.099 -99.217  1.00 1.16 ? 27  PHE A CD1  1 
ATOM   437  C  CD2  . PHE A 1 27  ? -19.230 -51.319 -97.580  1.00 1.21 ? 27  PHE A CD2  1 
ATOM   438  C  CE1  . PHE A 1 27  ? -18.503 -50.916 -100.211 1.00 1.28 ? 27  PHE A CE1  1 
ATOM   439  C  CE2  . PHE A 1 27  ? -19.738 -52.139 -98.569  1.00 1.32 ? 27  PHE A CE2  1 
ATOM   440  C  CZ   . PHE A 1 27  ? -19.374 -51.938 -99.886  1.00 1.32 ? 27  PHE A CZ   1 
ATOM   441  H  H    . PHE A 1 27  ? -15.965 -51.054 -96.214  1.00 1.08 ? 27  PHE A H    1 
ATOM   442  H  HA   . PHE A 1 27  ? -16.112 -48.862 -98.006  1.00 1.07 ? 27  PHE A HA   1 
ATOM   443  H  HB2  . PHE A 1 27  ? -17.969 -49.888 -95.866  1.00 0.94 ? 27  PHE A HB2  1 
ATOM   444  H  HB3  . PHE A 1 27  ? -18.352 -48.471 -96.837  1.00 1.04 ? 27  PHE A HB3  1 
ATOM   445  H  HD1  . PHE A 1 27  ? -17.317 -49.300 -99.472  1.00 1.19 ? 27  PHE A HD1  1 
ATOM   446  H  HD2  . PHE A 1 27  ? -19.516 -51.477 -96.551  1.00 1.27 ? 27  PHE A HD2  1 
ATOM   447  H  HE1  . PHE A 1 27  ? -18.216 -50.756 -101.240 1.00 1.39 ? 27  PHE A HE1  1 
ATOM   448  H  HE2  . PHE A 1 27  ? -20.418 -52.938 -98.313  1.00 1.46 ? 27  PHE A HE2  1 
ATOM   449  H  HZ   . PHE A 1 27  ? -19.769 -52.578 -100.661 1.00 1.43 ? 27  PHE A HZ   1 
ATOM   450  N  N    . LEU A 1 28  ? -14.860 -47.225 -96.510  1.00 0.89 ? 28  LEU A N    1 
ATOM   451  C  CA   . LEU A 1 28  ? -14.377 -46.066 -95.771  1.00 0.89 ? 28  LEU A CA   1 
ATOM   452  C  C    . LEU A 1 28  ? -14.514 -44.794 -96.600  1.00 0.98 ? 28  LEU A C    1 
ATOM   453  O  O    . LEU A 1 28  ? -15.442 -44.010 -96.405  1.00 1.13 ? 28  LEU A O    1 
ATOM   454  C  CB   . LEU A 1 28  ? -12.917 -46.269 -95.359  1.00 0.92 ? 28  LEU A CB   1 
ATOM   455  C  CG   . LEU A 1 28  ? -12.703 -47.243 -94.198  1.00 0.96 ? 28  LEU A CG   1 
ATOM   456  C  CD1  . LEU A 1 28  ? -11.651 -48.281 -94.558  1.00 2.04 ? 28  LEU A CD1  1 
ATOM   457  C  CD2  . LEU A 1 28  ? -12.302 -46.489 -92.939  1.00 0.88 ? 28  LEU A CD2  1 
ATOM   458  H  H    . LEU A 1 28  ? -14.394 -47.500 -97.328  1.00 0.94 ? 28  LEU A H    1 
ATOM   459  H  HA   . LEU A 1 28  ? -14.979 -45.965 -94.884  1.00 0.86 ? 28  LEU A HA   1 
ATOM   460  H  HB2  . LEU A 1 28  ? -12.372 -46.636 -96.216  1.00 0.97 ? 28  LEU A HB2  1 
ATOM   461  H  HB3  . LEU A 1 28  ? -12.508 -45.311 -95.075  1.00 0.99 ? 28  LEU A HB3  1 
ATOM   462  H  HG   . LEU A 1 28  ? -13.629 -47.762 -93.997  1.00 1.53 ? 28  LEU A HG   1 
ATOM   463  H  HD11 . LEU A 1 28  ? -11.659 -49.071 -93.822  1.00 2.62 ? 28  LEU A HD11 1 
ATOM   464  H  HD12 . LEU A 1 28  ? -10.677 -47.815 -94.576  1.00 2.58 ? 28  LEU A HD12 1 
ATOM   465  H  HD13 . LEU A 1 28  ? -11.871 -48.693 -95.532  1.00 2.45 ? 28  LEU A HD13 1 
ATOM   466  H  HD21 . LEU A 1 28  ? -11.236 -46.580 -92.789  1.00 1.53 ? 28  LEU A HD21 1 
ATOM   467  H  HD22 . LEU A 1 28  ? -12.821 -46.906 -92.089  1.00 1.60 ? 28  LEU A HD22 1 
ATOM   468  H  HD23 . LEU A 1 28  ? -12.563 -45.447 -93.045  1.00 1.15 ? 28  LEU A HD23 1 
ATOM   469  N  N    . GLU A 1 29  ? -13.583 -44.598 -97.523  1.00 1.04 ? 29  GLU A N    1 
ATOM   470  C  CA   . GLU A 1 29  ? -13.595 -43.422 -98.386  1.00 1.14 ? 29  GLU A CA   1 
ATOM   471  C  C    . GLU A 1 29  ? -14.386 -43.689 -99.662  1.00 1.13 ? 29  GLU A C    1 
ATOM   472  O  O    . GLU A 1 29  ? -14.445 -44.820 -100.143 1.00 1.13 ? 29  GLU A O    1 
ATOM   473  C  CB   . GLU A 1 29  ? -12.165 -43.006 -98.737  1.00 1.34 ? 29  GLU A CB   1 
ATOM   474  C  CG   . GLU A 1 29  ? -11.257 -42.867 -97.526  1.00 1.31 ? 29  GLU A CG   1 
ATOM   475  C  CD   . GLU A 1 29  ? -11.159 -41.437 -97.032  1.00 2.02 ? 29  GLU A CD   1 
ATOM   476  O  OE1  . GLU A 1 29  ? -10.640 -40.584 -97.782  1.00 2.35 ? 29  GLU A OE1  1 
ATOM   477  O  OE2  . GLU A 1 29  ? -11.601 -41.170 -95.894  1.00 2.85 ? 29  GLU A OE2  1 
ATOM   478  H  H    . GLU A 1 29  ? -12.870 -45.261 -97.627  1.00 1.12 ? 29  GLU A H    1 
ATOM   479  H  HA   . GLU A 1 29  ? -14.070 -42.619 -97.843  1.00 1.13 ? 29  GLU A HA   1 
ATOM   480  H  HB2  . GLU A 1 29  ? -11.739 -43.747 -99.396  1.00 1.63 ? 29  GLU A HB2  1 
ATOM   481  H  HB3  . GLU A 1 29  ? -12.194 -42.056 -99.249  1.00 1.73 ? 29  GLU A HB3  1 
ATOM   482  H  HG2  . GLU A 1 29  ? -11.646 -43.481 -96.728  1.00 1.45 ? 29  GLU A HG2  1 
ATOM   483  H  HG3  . GLU A 1 29  ? -10.268 -43.209 -97.793  1.00 1.79 ? 29  GLU A HG3  1 
ATOM   484  N  N    . GLY A 1 30  ? -14.994 -42.639 -100.206 1.00 1.16 ? 30  GLY A N    1 
ATOM   485  C  CA   . GLY A 1 30  ? -15.773 -42.779 -101.422 1.00 1.17 ? 30  GLY A CA   1 
ATOM   486  C  C    . GLY A 1 30  ? -16.939 -43.734 -101.258 1.00 1.13 ? 30  GLY A C    1 
ATOM   487  O  O    . GLY A 1 30  ? -17.311 -44.437 -102.197 1.00 1.15 ? 30  GLY A O    1 
ATOM   488  H  H    . GLY A 1 30  ? -14.911 -41.761 -99.778  1.00 1.19 ? 30  GLY A H    1 
ATOM   489  H  HA2  . GLY A 1 30  ? -16.153 -41.809 -101.706 1.00 1.20 ? 30  GLY A HA2  1 
ATOM   490  H  HA3  . GLY A 1 30  ? -15.130 -43.147 -102.208 1.00 1.21 ? 30  GLY A HA3  1 
ATOM   491  N  N    . CYS A 1 31  ? -17.518 -43.759 -100.062 1.00 1.09 ? 31  CYS A N    1 
ATOM   492  C  CA   . CYS A 1 31  ? -18.650 -44.634 -99.779  1.00 1.05 ? 31  CYS A CA   1 
ATOM   493  C  C    . CYS A 1 31  ? -19.565 -44.018 -98.725  1.00 1.03 ? 31  CYS A C    1 
ATOM   494  O  O    . CYS A 1 31  ? -19.129 -43.206 -97.909  1.00 1.08 ? 31  CYS A O    1 
ATOM   495  C  CB   . CYS A 1 31  ? -18.157 -46.003 -99.305  1.00 0.99 ? 31  CYS A CB   1 
ATOM   496  S  SG   . CYS A 1 31  ? -16.997 -46.803 -100.438 1.00 1.71 ? 31  CYS A SG   1 
ATOM   497  H  H    . CYS A 1 31  ? -17.177 -43.175 -99.353  1.00 1.09 ? 31  CYS A H    1 
ATOM   498  H  HA   . CYS A 1 31  ? -19.208 -44.760 -100.694 1.00 1.12 ? 31  CYS A HA   1 
ATOM   499  H  HB2  . CYS A 1 31  ? -17.660 -45.889 -98.354  1.00 1.45 ? 31  CYS A HB2  1 
ATOM   500  H  HB3  . CYS A 1 31  ? -19.006 -46.660 -99.184  1.00 1.41 ? 31  CYS A HB3  1 
ATOM   501  H  HG   . CYS A 1 31  ? -15.872 -47.031 -99.776  1.00 2.35 ? 31  CYS A HG   1 
ATOM   502  N  N    . ALA A 1 32  ? -20.834 -44.411 -98.749  1.00 1.01 ? 32  ALA A N    1 
ATOM   503  C  CA   . ALA A 1 32  ? -21.810 -43.897 -97.794  1.00 1.00 ? 32  ALA A CA   1 
ATOM   504  C  C    . ALA A 1 32  ? -21.934 -44.812 -96.578  1.00 0.90 ? 32  ALA A C    1 
ATOM   505  O  O    . ALA A 1 32  ? -22.903 -44.725 -95.823  1.00 0.98 ? 32  ALA A O    1 
ATOM   506  C  CB   . ALA A 1 32  ? -23.163 -43.730 -98.467  1.00 1.09 ? 32  ALA A CB   1 
ATOM   507  H  H    . ALA A 1 32  ? -21.122 -45.061 -99.423  1.00 1.06 ? 32  ALA A H    1 
ATOM   508  H  HA   . ALA A 1 32  ? -21.476 -42.923 -97.467  1.00 1.04 ? 32  ALA A HA   1 
ATOM   509  H  HB1  . ALA A 1 32  ? -23.826 -43.184 -97.813  1.00 0.91 ? 32  ALA A HB1  1 
ATOM   510  H  HB2  . ALA A 1 32  ? -23.584 -44.703 -98.675  1.00 1.73 ? 32  ALA A HB2  1 
ATOM   511  H  HB3  . ALA A 1 32  ? -23.041 -43.186 -99.392  1.00 1.17 ? 32  ALA A HB3  1 
ATOM   512  N  N    . CYS A 1 33  ? -20.951 -45.687 -96.392  1.00 0.85 ? 33  CYS A N    1 
ATOM   513  C  CA   . CYS A 1 33  ? -20.956 -46.613 -95.266  1.00 0.76 ? 33  CYS A CA   1 
ATOM   514  C  C    . CYS A 1 33  ? -19.658 -46.511 -94.471  1.00 0.70 ? 33  CYS A C    1 
ATOM   515  O  O    . CYS A 1 33  ? -19.076 -47.523 -94.080  1.00 0.63 ? 33  CYS A O    1 
ATOM   516  C  CB   . CYS A 1 33  ? -21.154 -48.048 -95.759  1.00 0.79 ? 33  CYS A CB   1 
ATOM   517  S  SG   . CYS A 1 33  ? -22.317 -48.201 -97.135  1.00 1.31 ? 33  CYS A SG   1 
ATOM   518  H  H    . CYS A 1 33  ? -20.205 -45.711 -97.025  1.00 0.95 ? 33  CYS A H    1 
ATOM   519  H  HA   . CYS A 1 33  ? -21.781 -46.347 -94.622  1.00 0.76 ? 33  CYS A HA   1 
ATOM   520  H  HB2  . CYS A 1 33  ? -20.204 -48.441 -96.088  1.00 0.96 ? 33  CYS A HB2  1 
ATOM   521  H  HB3  . CYS A 1 33  ? -21.526 -48.652 -94.945  1.00 1.09 ? 33  CYS A HB3  1 
ATOM   522  H  HG   . CYS A 1 33  ? -23.479 -47.696 -96.747  1.00 1.44 ? 33  CYS A HG   1 
ATOM   523  N  N    . THR A 1 34  ? -19.210 -45.282 -94.236  1.00 0.79 ? 34  THR A N    1 
ATOM   524  C  CA   . THR A 1 34  ? -17.982 -45.047 -93.487  1.00 0.76 ? 34  THR A CA   1 
ATOM   525  C  C    . THR A 1 34  ? -18.193 -45.289 -91.996  1.00 0.73 ? 34  THR A C    1 
ATOM   526  O  O    . THR A 1 34  ? -19.326 -45.318 -91.516  1.00 0.74 ? 34  THR A O    1 
ATOM   527  C  CB   . THR A 1 34  ? -17.463 -43.611 -93.693  1.00 0.81 ? 34  THR A CB   1 
ATOM   528  O  OG1  . THR A 1 34  ? -18.102 -42.721 -92.771  1.00 1.20 ? 34  THR A OG1  1 
ATOM   529  C  CG2  . THR A 1 34  ? -17.719 -43.142 -95.118  1.00 1.04 ? 34  THR A CG2  1 
ATOM   530  H  H    . THR A 1 34  ? -19.719 -44.515 -94.573  1.00 0.89 ? 34  THR A H    1 
ATOM   531  H  HA   . THR A 1 34  ? -17.232 -45.734 -93.851  1.00 0.74 ? 34  THR A HA   1 
ATOM   532  H  HB   . THR A 1 34  ? -16.398 -43.600 -93.513  1.00 0.73 ? 34  THR A HB   1 
ATOM   533  H  HG1  . THR A 1 34  ? -17.645 -41.876 -92.772  1.00 1.22 ? 34  THR A HG1  1 
ATOM   534  H  HG21 . THR A 1 34  ? -16.876 -42.562 -95.463  1.00 1.58 ? 34  THR A HG21 1 
ATOM   535  H  HG22 . THR A 1 34  ? -18.610 -42.532 -95.141  1.00 1.56 ? 34  THR A HG22 1 
ATOM   536  H  HG23 . THR A 1 34  ? -17.853 -44.000 -95.761  1.00 1.42 ? 34  THR A HG23 1 
ATOM   537  N  N    . PRO A 1 35  ? -17.096 -45.466 -91.244  1.00 0.72 ? 35  PRO A N    1 
ATOM   538  C  CA   . PRO A 1 35  ? -17.157 -45.707 -89.800  1.00 0.71 ? 35  PRO A CA   1 
ATOM   539  C  C    . PRO A 1 35  ? -18.021 -44.679 -89.078  1.00 0.77 ? 35  PRO A C    1 
ATOM   540  O  O    . PRO A 1 35  ? -18.923 -45.034 -88.319  1.00 0.81 ? 35  PRO A O    1 
ATOM   541  C  CB   . PRO A 1 35  ? -15.698 -45.585 -89.359  1.00 0.73 ? 35  PRO A CB   1 
ATOM   542  C  CG   . PRO A 1 35  ? -14.907 -45.933 -90.572  1.00 0.70 ? 35  PRO A CG   1 
ATOM   543  C  CD   . PRO A 1 35  ? -15.711 -45.443 -91.746  1.00 0.72 ? 35  PRO A CD   1 
ATOM   544  H  HA   . PRO A 1 35  ? -17.522 -46.699 -89.579  1.00 0.68 ? 35  PRO A HA   1 
ATOM   545  H  HB2  . PRO A 1 35  ? -15.500 -44.573 -89.034  1.00 0.79 ? 35  PRO A HB2  1 
ATOM   546  H  HB3  . PRO A 1 35  ? -15.503 -46.274 -88.551  1.00 0.72 ? 35  PRO A HB3  1 
ATOM   547  H  HG2  . PRO A 1 35  ? -13.948 -45.437 -90.541  1.00 0.73 ? 35  PRO A HG2  1 
ATOM   548  H  HG3  . PRO A 1 35  ? -14.775 -47.004 -90.630  1.00 0.66 ? 35  PRO A HG3  1 
ATOM   549  H  HD2  . PRO A 1 35  ? -15.414 -44.440 -92.013  1.00 0.78 ? 35  PRO A HD2  1 
ATOM   550  H  HD3  . PRO A 1 35  ? -15.595 -46.110 -92.588  1.00 0.69 ? 35  PRO A HD3  1 
ATOM   551  N  N    . GLU A 1 36  ? -17.741 -43.402 -89.320  1.00 0.81 ? 36  GLU A N    1 
ATOM   552  C  CA   . GLU A 1 36  ? -18.494 -42.322 -88.694  1.00 0.88 ? 36  GLU A CA   1 
ATOM   553  C  C    . GLU A 1 36  ? -19.871 -42.177 -89.334  1.00 0.90 ? 36  GLU A C    1 
ATOM   554  O  O    . GLU A 1 36  ? -20.832 -41.772 -88.679  1.00 0.90 ? 36  GLU A O    1 
ATOM   555  C  CB   . GLU A 1 36  ? -17.726 -41.004 -88.808  1.00 0.98 ? 36  GLU A CB   1 
ATOM   556  C  CG   . GLU A 1 36  ? -16.710 -40.794 -87.697  1.00 1.29 ? 36  GLU A CG   1 
ATOM   557  C  CD   . GLU A 1 36  ? -16.020 -39.447 -87.785  1.00 1.45 ? 36  GLU A CD   1 
ATOM   558  O  OE1  . GLU A 1 36  ? -16.708 -38.445 -88.077  1.00 1.92 ? 36  GLU A OE1  1 
ATOM   559  O  OE2  . GLU A 1 36  ? -14.793 -39.393 -87.562  1.00 1.86 ? 36  GLU A OE2  1 
ATOM   560  H  H    . GLU A 1 36  ? -17.011 -43.182 -89.936  1.00 0.81 ? 36  GLU A H    1 
ATOM   561  H  HA   . GLU A 1 36  ? -18.619 -42.567 -87.650  1.00 0.88 ? 36  GLU A HA   1 
ATOM   562  H  HB2  . GLU A 1 36  ? -17.203 -40.986 -89.752  1.00 1.67 ? 36  GLU A HB2  1 
ATOM   563  H  HB3  . GLU A 1 36  ? -18.431 -40.186 -88.781  1.00 1.07 ? 36  GLU A HB3  1 
ATOM   564  H  HG2  . GLU A 1 36  ? -17.218 -40.859 -86.746  1.00 1.49 ? 36  GLU A HG2  1 
ATOM   565  H  HG3  . GLU A 1 36  ? -15.962 -41.570 -87.759  1.00 2.03 ? 36  GLU A HG3  1 
ATOM   566  N  N    . ARG A 1 37  ? -19.959 -42.509 -90.618  1.00 0.93 ? 37  ARG A N    1 
ATOM   567  C  CA   . ARG A 1 37  ? -21.217 -42.414 -91.349  1.00 0.97 ? 37  ARG A CA   1 
ATOM   568  C  C    . ARG A 1 37  ? -22.208 -43.472 -90.871  1.00 0.91 ? 37  ARG A C    1 
ATOM   569  O  O    . ARG A 1 37  ? -23.403 -43.203 -90.742  1.00 0.90 ? 37  ARG A O    1 
ATOM   570  C  CB   . ARG A 1 37  ? -20.967 -42.572 -92.851  1.00 1.01 ? 37  ARG A CB   1 
ATOM   571  C  CG   . ARG A 1 37  ? -22.240 -42.655 -93.678  1.00 1.12 ? 37  ARG A CG   1 
ATOM   572  C  CD   . ARG A 1 37  ? -22.995 -41.337 -93.676  1.00 0.83 ? 37  ARG A CD   1 
ATOM   573  N  NE   . ARG A 1 37  ? -22.124 -40.205 -93.982  1.00 1.25 ? 37  ARG A NE   1 
ATOM   574  C  CZ   . ARG A 1 37  ? -22.433 -38.940 -93.713  1.00 1.82 ? 37  ARG A CZ   1 
ATOM   575  N  NH1  . ARG A 1 37  ? -23.589 -38.643 -93.133  1.00 2.25 ? 37  ARG A NH1  1 
ATOM   576  N  NH2  . ARG A 1 37  ? -21.585 -37.969 -94.023  1.00 2.67 ? 37  ARG A NH2  1 
ATOM   577  H  H    . ARG A 1 37  ? -19.158 -42.824 -91.086  1.00 0.93 ? 37  ARG A H    1 
ATOM   578  H  HA   . ARG A 1 37  ? -21.636 -41.437 -91.164  1.00 1.04 ? 37  ARG A HA   1 
ATOM   579  H  HB2  . ARG A 1 37  ? -20.393 -41.725 -93.198  1.00 1.38 ? 37  ARG A HB2  1 
ATOM   580  H  HB3  . ARG A 1 37  ? -20.397 -43.474 -93.015  1.00 1.14 ? 37  ARG A HB3  1 
ATOM   581  H  HG2  . ARG A 1 37  ? -21.980 -42.907 -94.695  1.00 1.44 ? 37  ARG A HG2  1 
ATOM   582  H  HG3  . ARG A 1 37  ? -22.875 -43.425 -93.267  1.00 1.90 ? 37  ARG A HG3  1 
ATOM   583  H  HD2  . ARG A 1 37  ? -23.780 -41.385 -94.416  1.00 1.19 ? 37  ARG A HD2  1 
ATOM   584  H  HD3  . ARG A 1 37  ? -23.432 -41.189 -92.699  1.00 1.56 ? 37  ARG A HD3  1 
ATOM   585  H  HE   . ARG A 1 37  ? -21.264 -40.399 -94.411  1.00 1.87 ? 37  ARG A HE   1 
ATOM   586  H  HH11 . ARG A 1 37  ? -24.233 -39.370 -92.896  1.00 2.31 ? 37  ARG A HH11 1 
ATOM   587  H  HH12 . ARG A 1 37  ? -23.817 -37.690 -92.933  1.00 2.93 ? 37  ARG A HH12 1 
ATOM   588  H  HH21 . ARG A 1 37  ? -20.713 -38.188 -94.460  1.00 3.10 ? 37  ARG A HH21 1 
ATOM   589  H  HH22 . ARG A 1 37  ? -21.818 -37.018 -93.821  1.00 3.16 ? 37  ARG A HH22 1 
ATOM   590  N  N    . MET A 1 38  ? -21.705 -44.675 -90.612  1.00 0.91 ? 38  MET A N    1 
ATOM   591  C  CA   . MET A 1 38  ? -22.548 -45.774 -90.152  1.00 0.88 ? 38  MET A CA   1 
ATOM   592  C  C    . MET A 1 38  ? -22.838 -45.657 -88.658  1.00 0.88 ? 38  MET A C    1 
ATOM   593  O  O    . MET A 1 38  ? -23.993 -45.715 -88.235  1.00 0.94 ? 38  MET A O    1 
ATOM   594  C  CB   . MET A 1 38  ? -21.877 -47.116 -90.448  1.00 0.88 ? 38  MET A CB   1 
ATOM   595  C  CG   . MET A 1 38  ? -21.973 -47.537 -91.905  1.00 1.02 ? 38  MET A CG   1 
ATOM   596  S  SD   . MET A 1 38  ? -21.040 -49.039 -92.258  1.00 1.38 ? 38  MET A SD   1 
ATOM   597  C  CE   . MET A 1 38  ? -22.336 -50.271 -92.172  1.00 0.85 ? 38  MET A CE   1 
ATOM   598  H  H    . MET A 1 38  ? -20.745 -44.828 -90.735  1.00 0.94 ? 38  MET A H    1 
ATOM   599  H  HA   . MET A 1 38  ? -23.481 -45.723 -90.692  1.00 0.90 ? 38  MET A HA   1 
ATOM   600  H  HB2  . MET A 1 38  ? -20.832 -47.049 -90.183  1.00 0.78 ? 38  MET A HB2  1 
ATOM   601  H  HB3  . MET A 1 38  ? -22.344 -47.880 -89.843  1.00 1.14 ? 38  MET A HB3  1 
ATOM   602  H  HG2  . MET A 1 38  ? -23.011 -47.710 -92.148  1.00 1.59 ? 38  MET A HG2  1 
ATOM   603  H  HG3  . MET A 1 38  ? -21.589 -46.738 -92.522  1.00 1.64 ? 38  MET A HG3  1 
ATOM   604  H  HE1  . MET A 1 38  ? -21.896 -51.257 -92.167  1.00 1.21 ? 38  MET A HE1  1 
ATOM   605  H  HE2  . MET A 1 38  ? -22.985 -50.171 -93.029  1.00 1.12 ? 38  MET A HE2  1 
ATOM   606  H  HE3  . MET A 1 38  ? -22.909 -50.129 -91.268  1.00 1.41 ? 38  MET A HE3  1 
ATOM   607  N  N    . ALA A 1 39  ? -21.785 -45.497 -87.864  1.00 0.86 ? 39  ALA A N    1 
ATOM   608  C  CA   . ALA A 1 39  ? -21.930 -45.376 -86.418  1.00 0.86 ? 39  ALA A CA   1 
ATOM   609  C  C    . ALA A 1 39  ? -22.975 -44.327 -86.052  1.00 0.90 ? 39  ALA A C    1 
ATOM   610  O  O    . ALA A 1 39  ? -23.617 -44.415 -85.006  1.00 0.90 ? 39  ALA A O    1 
ATOM   611  C  CB   . ALA A 1 39  ? -20.592 -45.033 -85.780  1.00 0.89 ? 39  ALA A CB   1 
ATOM   612  H  H    . ALA A 1 39  ? -20.889 -45.461 -88.260  1.00 0.89 ? 39  ALA A H    1 
ATOM   613  H  HA   . ALA A 1 39  ? -22.248 -46.335 -86.034  1.00 0.84 ? 39  ALA A HA   1 
ATOM   614  H  HB1  . ALA A 1 39  ? -20.012 -44.430 -86.463  1.00 1.45 ? 39  ALA A HB1  1 
ATOM   615  H  HB2  . ALA A 1 39  ? -20.054 -45.943 -85.559  1.00 1.33 ? 39  ALA A HB2  1 
ATOM   616  H  HB3  . ALA A 1 39  ? -20.759 -44.482 -84.867  1.00 1.07 ? 39  ALA A HB3  1 
ATOM   617  N  N    . GLU A 1 40  ? -23.138 -43.333 -86.919  1.00 0.97 ? 40  GLU A N    1 
ATOM   618  C  CA   . GLU A 1 40  ? -24.104 -42.265 -86.685  1.00 1.05 ? 40  GLU A CA   1 
ATOM   619  C  C    . GLU A 1 40  ? -25.539 -42.779 -86.792  1.00 1.06 ? 40  GLU A C    1 
ATOM   620  O  O    . GLU A 1 40  ? -26.482 -42.087 -86.408  1.00 1.17 ? 40  GLU A O    1 
ATOM   621  C  CB   . GLU A 1 40  ? -23.883 -41.125 -87.680  1.00 1.16 ? 40  GLU A CB   1 
ATOM   622  C  CG   . GLU A 1 40  ? -25.065 -40.177 -87.793  1.00 1.14 ? 40  GLU A CG   1 
ATOM   623  C  CD   . GLU A 1 40  ? -25.432 -39.541 -86.467  1.00 1.17 ? 40  GLU A CD   1 
ATOM   624  O  OE1  . GLU A 1 40  ? -24.524 -39.339 -85.634  1.00 1.97 ? 40  GLU A OE1  1 
ATOM   625  O  OE2  . GLU A 1 40  ? -26.628 -39.244 -86.261  1.00 1.72 ? 40  GLU A OE2  1 
ATOM   626  H  H    . GLU A 1 40  ? -22.596 -43.315 -87.735  1.00 0.99 ? 40  GLU A H    1 
ATOM   627  H  HA   . GLU A 1 40  ? -23.945 -41.891 -85.685  1.00 1.06 ? 40  GLU A HA   1 
ATOM   628  H  HB2  . GLU A 1 40  ? -23.020 -40.554 -87.369  1.00 1.24 ? 40  GLU A HB2  1 
ATOM   629  H  HB3  . GLU A 1 40  ? -23.692 -41.546 -88.656  1.00 1.24 ? 40  GLU A HB3  1 
ATOM   630  H  HG2  . GLU A 1 40  ? -24.816 -39.393 -88.493  1.00 1.75 ? 40  GLU A HG2  1 
ATOM   631  H  HG3  . GLU A 1 40  ? -25.919 -40.728 -88.161  1.00 1.73 ? 40  GLU A HG3  1 
ATOM   632  N  N    . ALA A 1 41  ? -25.703 -43.991 -87.316  1.00 1.00 ? 41  ALA A N    1 
ATOM   633  C  CA   . ALA A 1 41  ? -27.027 -44.584 -87.469  1.00 1.04 ? 41  ALA A CA   1 
ATOM   634  C  C    . ALA A 1 41  ? -27.278 -45.676 -86.431  1.00 0.93 ? 41  ALA A C    1 
ATOM   635  O  O    . ALA A 1 41  ? -28.377 -46.226 -86.355  1.00 1.13 ? 41  ALA A O    1 
ATOM   636  C  CB   . ALA A 1 41  ? -27.191 -45.147 -88.871  1.00 1.14 ? 41  ALA A CB   1 
ATOM   637  H  H    . ALA A 1 41  ? -24.917 -44.499 -87.606  1.00 0.96 ? 41  ALA A H    1 
ATOM   638  H  HA   . ALA A 1 41  ? -27.758 -43.801 -87.335  1.00 1.15 ? 41  ALA A HA   1 
ATOM   639  H  HB1  . ALA A 1 41  ? -28.202 -45.504 -88.999  1.00 1.41 ? 41  ALA A HB1  1 
ATOM   640  H  HB2  . ALA A 1 41  ? -26.500 -45.965 -89.013  1.00 1.32 ? 41  ALA A HB2  1 
ATOM   641  H  HB3  . ALA A 1 41  ? -26.988 -44.373 -89.596  1.00 1.51 ? 41  ALA A HB3  1 
ATOM   642  N  N    . GLY A 1 42  ? -26.260 -45.989 -85.634  1.00 0.67 ? 42  GLY A N    1 
ATOM   643  C  CA   . GLY A 1 42  ? -26.406 -47.015 -84.619  1.00 0.56 ? 42  GLY A CA   1 
ATOM   644  C  C    . GLY A 1 42  ? -25.639 -48.282 -84.954  1.00 0.56 ? 42  GLY A C    1 
ATOM   645  O  O    . GLY A 1 42  ? -25.466 -49.153 -84.101  1.00 0.99 ? 42  GLY A O    1 
ATOM   646  H  H    . GLY A 1 42  ? -25.405 -45.523 -85.736  1.00 0.62 ? 42  GLY A H    1 
ATOM   647  H  HA2  . GLY A 1 42  ? -26.044 -46.628 -83.678  1.00 0.47 ? 42  GLY A HA2  1 
ATOM   648  H  HA3  . GLY A 1 42  ? -27.455 -47.258 -84.516  1.00 0.69 ? 42  GLY A HA3  1 
ATOM   649  N  N    . PHE A 1 43  ? -25.182 -48.388 -86.199  1.00 0.63 ? 43  PHE A N    1 
ATOM   650  C  CA   . PHE A 1 43  ? -24.435 -49.560 -86.642  1.00 0.59 ? 43  PHE A CA   1 
ATOM   651  C  C    . PHE A 1 43  ? -23.087 -49.653 -85.936  1.00 0.45 ? 43  PHE A C    1 
ATOM   652  O  O    . PHE A 1 43  ? -22.329 -48.684 -85.891  1.00 0.36 ? 43  PHE A O    1 
ATOM   653  C  CB   . PHE A 1 43  ? -24.230 -49.514 -88.157  1.00 0.72 ? 43  PHE A CB   1 
ATOM   654  C  CG   . PHE A 1 43  ? -25.502 -49.683 -88.937  1.00 0.85 ? 43  PHE A CG   1 
ATOM   655  C  CD1  . PHE A 1 43  ? -26.255 -50.839 -88.817  1.00 1.11 ? 43  PHE A CD1  1 
ATOM   656  C  CD2  . PHE A 1 43  ? -25.945 -48.685 -89.789  1.00 1.81 ? 43  PHE A CD2  1 
ATOM   657  C  CE1  . PHE A 1 43  ? -27.427 -50.997 -89.533  1.00 1.22 ? 43  PHE A CE1  1 
ATOM   658  C  CE2  . PHE A 1 43  ? -27.116 -48.837 -90.507  1.00 1.95 ? 43  PHE A CE2  1 
ATOM   659  C  CZ   . PHE A 1 43  ? -27.858 -49.994 -90.379  1.00 1.22 ? 43  PHE A CZ   1 
ATOM   660  H  H    . PHE A 1 43  ? -25.354 -47.664 -86.836  1.00 0.99 ? 43  PHE A H    1 
ATOM   661  H  HA   . PHE A 1 43  ? -25.017 -50.435 -86.396  1.00 0.67 ? 43  PHE A HA   1 
ATOM   662  H  HB2  . PHE A 1 43  ? -23.799 -48.562 -88.427  1.00 0.75 ? 43  PHE A HB2  1 
ATOM   663  H  HB3  . PHE A 1 43  ? -23.554 -50.305 -88.446  1.00 0.80 ? 43  PHE A HB3  1 
ATOM   664  H  HD1  . PHE A 1 43  ? -25.920 -51.624 -88.154  1.00 1.85 ? 43  PHE A HD1  1 
ATOM   665  H  HD2  . PHE A 1 43  ? -25.365 -47.779 -89.891  1.00 2.62 ? 43  PHE A HD2  1 
ATOM   666  H  HE1  . PHE A 1 43  ? -28.006 -51.903 -89.431  1.00 1.92 ? 43  PHE A HE1  1 
ATOM   667  H  HE2  . PHE A 1 43  ? -27.450 -48.052 -91.168  1.00 2.83 ? 43  PHE A HE2  1 
ATOM   668  H  HZ   . PHE A 1 43  ? -28.773 -50.115 -90.939  1.00 1.38 ? 43  PHE A HZ   1 
ATOM   669  N  N    . ILE A 1 44  ? -22.795 -50.828 -85.387  1.00 0.63 ? 44  ILE A N    1 
ATOM   670  C  CA   . ILE A 1 44  ? -21.538 -51.054 -84.685  1.00 0.57 ? 44  ILE A CA   1 
ATOM   671  C  C    . ILE A 1 44  ? -20.808 -52.267 -85.250  1.00 0.67 ? 44  ILE A C    1 
ATOM   672  O  O    . ILE A 1 44  ? -21.431 -53.267 -85.607  1.00 1.57 ? 44  ILE A O    1 
ATOM   673  C  CB   . ILE A 1 44  ? -21.766 -51.264 -83.175  1.00 0.53 ? 44  ILE A CB   1 
ATOM   674  C  CG1  . ILE A 1 44  ? -22.177 -49.949 -82.510  1.00 0.52 ? 44  ILE A CG1  1 
ATOM   675  C  CG2  . ILE A 1 44  ? -20.512 -51.826 -82.524  1.00 0.64 ? 44  ILE A CG2  1 
ATOM   676  C  CD1  . ILE A 1 44  ? -22.581 -50.106 -81.059  1.00 0.51 ? 44  ILE A CD1  1 
ATOM   677  H  H    . ILE A 1 44  ? -23.441 -51.561 -85.459  1.00 0.86 ? 44  ILE A H    1 
ATOM   678  H  HA   . ILE A 1 44  ? -20.919 -50.178 -84.817  1.00 0.57 ? 44  ILE A HA   1 
ATOM   679  H  HB   . ILE A 1 44  ? -22.559 -51.986 -83.051  1.00 0.61 ? 44  ILE A HB   1 
ATOM   680  H  HG12 . ILE A 1 44  ? -21.347 -49.259 -82.549  1.00 0.63 ? 44  ILE A HG12 1 
ATOM   681  H  HG13 . ILE A 1 44  ? -23.015 -49.529 -83.045  1.00 0.60 ? 44  ILE A HG13 1 
ATOM   682  H  HG21 . ILE A 1 44  ? -19.644 -51.510 -83.082  1.00 1.33 ? 44  ILE A HG21 1 
ATOM   683  H  HG22 . ILE A 1 44  ? -20.562 -52.905 -82.517  1.00 0.87 ? 44  ILE A HG22 1 
ATOM   684  H  HG23 . ILE A 1 44  ? -20.440 -51.463 -81.509  1.00 1.14 ? 44  ILE A HG23 1 
ATOM   685  H  HD11 . ILE A 1 44  ? -22.161 -49.297 -80.479  1.00 1.24 ? 44  ILE A HD11 1 
ATOM   686  H  HD12 . ILE A 1 44  ? -22.212 -51.048 -80.682  1.00 0.92 ? 44  ILE A HD12 1 
ATOM   687  H  HD13 . ILE A 1 44  ? -23.658 -50.084 -80.982  1.00 0.77 ? 44  ILE A HD13 1 
ATOM   688  N  N    . HIS A 1 45  ? -19.485 -52.173 -85.329  1.00 0.84 ? 45  HIS A N    1 
ATOM   689  C  CA   . HIS A 1 45  ? -18.670 -53.263 -85.852  1.00 0.86 ? 45  HIS A CA   1 
ATOM   690  C  C    . HIS A 1 45  ? -19.070 -54.593 -85.220  1.00 0.92 ? 45  HIS A C    1 
ATOM   691  O  O    . HIS A 1 45  ? -19.065 -54.738 -83.998  1.00 1.52 ? 45  HIS A O    1 
ATOM   692  C  CB   . HIS A 1 45  ? -17.188 -52.988 -85.594  1.00 0.99 ? 45  HIS A CB   1 
ATOM   693  C  CG   . HIS A 1 45  ? -16.275 -53.654 -86.576  1.00 0.84 ? 45  HIS A CG   1 
ATOM   694  N  ND1  . HIS A 1 45  ? -15.104 -54.283 -86.209  1.00 0.80 ? 45  HIS A ND1  1 
ATOM   695  C  CD2  . HIS A 1 45  ? -16.365 -53.786 -87.921  1.00 0.82 ? 45  HIS A CD2  1 
ATOM   696  C  CE1  . HIS A 1 45  ? -14.514 -54.773 -87.284  1.00 0.76 ? 45  HIS A CE1  1 
ATOM   697  N  NE2  . HIS A 1 45  ? -15.258 -54.486 -88.335  1.00 0.75 ? 45  HIS A NE2  1 
ATOM   698  H  H    . HIS A 1 45  ? -19.046 -51.349 -85.029  1.00 1.55 ? 45  HIS A H    1 
ATOM   699  H  HA   . HIS A 1 45  ? -18.837 -53.320 -86.917  1.00 0.86 ? 45  HIS A HA   1 
ATOM   700  H  HB2  . HIS A 1 45  ? -17.012 -51.924 -85.646  1.00 1.20 ? 45  HIS A HB2  1 
ATOM   701  H  HB3  . HIS A 1 45  ? -16.930 -53.342 -84.606  1.00 1.10 ? 45  HIS A HB3  1 
ATOM   702  H  HD1  . HIS A 1 45  ? -14.757 -54.359 -85.295  1.00 0.87 ? 45  HIS A HD1  1 
ATOM   703  H  HD2  . HIS A 1 45  ? -17.160 -53.412 -88.550  1.00 0.93 ? 45  HIS A HD2  1 
ATOM   704  H  HE1  . HIS A 1 45  ? -13.581 -55.317 -87.300  1.00 0.83 ? 45  HIS A HE1  1 
ATOM   705  H  HE2  . HIS A 1 45  ? -15.007 -54.652 -89.268  1.00 0.77 ? 45  HIS A HE2  1 
ATOM   706  N  N    . CYS A 1 46  ? -19.416 -55.561 -86.063  1.00 1.05 ? 46  CYS A N    1 
ATOM   707  C  CA   . CYS A 1 46  ? -19.818 -56.880 -85.589  1.00 1.06 ? 46  CYS A CA   1 
ATOM   708  C  C    . CYS A 1 46  ? -19.747 -57.907 -86.714  1.00 0.97 ? 46  CYS A C    1 
ATOM   709  O  O    . CYS A 1 46  ? -20.752 -58.519 -87.076  1.00 0.86 ? 46  CYS A O    1 
ATOM   710  C  CB   . CYS A 1 46  ? -21.237 -56.830 -85.018  1.00 1.06 ? 46  CYS A CB   1 
ATOM   711  S  SG   . CYS A 1 46  ? -21.555 -58.050 -83.723  1.00 2.01 ? 46  CYS A SG   1 
ATOM   712  H  H    . CYS A 1 46  ? -19.399 -55.385 -87.027  1.00 1.54 ? 46  CYS A H    1 
ATOM   713  H  HA   . CYS A 1 46  ? -19.135 -57.174 -84.806  1.00 1.26 ? 46  CYS A HA   1 
ATOM   714  H  HB2  . CYS A 1 46  ? -21.413 -55.851 -84.597  1.00 1.01 ? 46  CYS A HB2  1 
ATOM   715  H  HB3  . CYS A 1 46  ? -21.944 -57.005 -85.816  1.00 0.94 ? 46  CYS A HB3  1 
ATOM   716  H  HG   . CYS A 1 46  ? -22.148 -57.430 -82.714  1.00 2.48 ? 46  CYS A HG   1 
ATOM   717  N  N    . PRO A 1 47  ? -18.548 -58.108 -87.281  1.00 1.09 ? 47  PRO A N    1 
ATOM   718  C  CA   . PRO A 1 47  ? -18.337 -59.064 -88.372  1.00 1.10 ? 47  PRO A CA   1 
ATOM   719  C  C    . PRO A 1 47  ? -18.479 -60.510 -87.909  1.00 1.09 ? 47  PRO A C    1 
ATOM   720  O  O    . PRO A 1 47  ? -18.085 -60.858 -86.796  1.00 1.14 ? 47  PRO A O    1 
ATOM   721  C  CB   . PRO A 1 47  ? -16.900 -58.784 -88.818  1.00 1.28 ? 47  PRO A CB   1 
ATOM   722  C  CG   . PRO A 1 47  ? -16.239 -58.194 -87.621  1.00 1.54 ? 47  PRO A CG   1 
ATOM   723  C  CD   . PRO A 1 47  ? -17.305 -57.415 -86.901  1.00 1.29 ? 47  PRO A CD   1 
ATOM   724  H  HA   . PRO A 1 47  ? -19.014 -58.883 -89.194  1.00 1.07 ? 47  PRO A HA   1 
ATOM   725  H  HB2  . PRO A 1 47  ? -16.427 -59.708 -89.117  1.00 1.22 ? 47  PRO A HB2  1 
ATOM   726  H  HB3  . PRO A 1 47  ? -16.906 -58.092 -89.647  1.00 1.53 ? 47  PRO A HB3  1 
ATOM   727  H  HG2  . PRO A 1 47  ? -15.857 -58.980 -86.987  1.00 1.85 ? 47  PRO A HG2  1 
ATOM   728  H  HG3  . PRO A 1 47  ? -15.439 -57.537 -87.929  1.00 1.83 ? 47  PRO A HG3  1 
ATOM   729  H  HD2  . PRO A 1 47  ? -17.149 -57.459 -85.833  1.00 1.45 ? 47  PRO A HD2  1 
ATOM   730  H  HD3  . PRO A 1 47  ? -17.317 -56.389 -87.240  1.00 1.18 ? 47  PRO A HD3  1 
ATOM   731  N  N    . THR A 1 48  ? -19.043 -61.350 -88.771  1.00 1.09 ? 48  THR A N    1 
ATOM   732  C  CA   . THR A 1 48  ? -19.236 -62.758 -88.451  1.00 1.17 ? 48  THR A CA   1 
ATOM   733  C  C    . THR A 1 48  ? -17.962 -63.558 -88.699  1.00 1.07 ? 48  THR A C    1 
ATOM   734  O  O    . THR A 1 48  ? -16.909 -62.991 -88.992  1.00 1.49 ? 48  THR A O    1 
ATOM   735  C  CB   . THR A 1 48  ? -20.381 -63.371 -89.279  1.00 1.41 ? 48  THR A CB   1 
ATOM   736  O  OG1  . THR A 1 48  ? -21.034 -62.350 -90.044  1.00 1.51 ? 48  THR A OG1  1 
ATOM   737  C  CG2  . THR A 1 48  ? -21.393 -64.059 -88.376  1.00 1.63 ? 48  THR A CG2  1 
ATOM   738  H  H    . THR A 1 48  ? -19.336 -61.014 -89.644  1.00 1.09 ? 48  THR A H    1 
ATOM   739  H  HA   . THR A 1 48  ? -19.497 -62.830 -87.405  1.00 1.25 ? 48  THR A HA   1 
ATOM   740  H  HB   . THR A 1 48  ? -19.965 -64.105 -89.953  1.00 1.44 ? 48  THR A HB   1 
ATOM   741  H  HG1  . THR A 1 48  ? -21.840 -62.704 -90.427  1.00 1.67 ? 48  THR A HG1  1 
ATOM   742  H  HG21 . THR A 1 48  ? -22.366 -64.041 -88.845  1.00 2.23 ? 48  THR A HG21 1 
ATOM   743  H  HG22 . THR A 1 48  ? -21.441 -63.543 -87.428  1.00 1.17 ? 48  THR A HG22 1 
ATOM   744  H  HG23 . THR A 1 48  ? -21.092 -65.084 -88.212  1.00 2.14 ? 48  THR A HG23 1 
ATOM   745  N  N    . GLU A 1 49  ? -18.065 -64.877 -88.580  1.00 1.17 ? 49  GLU A N    1 
ATOM   746  C  CA   . GLU A 1 49  ? -16.920 -65.755 -88.793  1.00 1.21 ? 49  GLU A CA   1 
ATOM   747  C  C    . GLU A 1 49  ? -16.659 -65.957 -90.282  1.00 1.38 ? 49  GLU A C    1 
ATOM   748  O  O    . GLU A 1 49  ? -15.513 -66.097 -90.708  1.00 1.70 ? 49  GLU A O    1 
ATOM   749  C  CB   . GLU A 1 49  ? -17.154 -67.106 -88.116  1.00 1.29 ? 49  GLU A CB   1 
ATOM   750  C  CG   . GLU A 1 49  ? -15.924 -67.655 -87.412  1.00 1.92 ? 49  GLU A CG   1 
ATOM   751  C  CD   . GLU A 1 49  ? -16.264 -68.729 -86.396  1.00 2.63 ? 49  GLU A CD   1 
ATOM   752  O  OE1  . GLU A 1 49  ? -16.947 -69.705 -86.771  1.00 3.44 ? 49  GLU A OE1  1 
ATOM   753  O  OE2  . GLU A 1 49  ? -15.848 -68.593 -85.227  1.00 2.97 ? 49  GLU A OE2  1 
ATOM   754  H  H    . GLU A 1 49  ? -18.931 -65.270 -88.345  1.00 1.59 ? 49  GLU A H    1 
ATOM   755  H  HA   . GLU A 1 49  ? -16.055 -65.285 -88.349  1.00 1.15 ? 49  GLU A HA   1 
ATOM   756  H  HB2  . GLU A 1 49  ? -17.942 -66.998 -87.385  1.00 1.59 ? 49  GLU A HB2  1 
ATOM   757  H  HB3  . GLU A 1 49  ? -17.464 -67.821 -88.863  1.00 1.40 ? 49  GLU A HB3  1 
ATOM   758  H  HG2  . GLU A 1 49  ? -15.261 -68.079 -88.151  1.00 2.30 ? 49  GLU A HG2  1 
ATOM   759  H  HG3  . GLU A 1 49  ? -15.424 -66.844 -86.903  1.00 2.25 ? 49  GLU A HG3  1 
ATOM   760  N  N    . ASN A 1 50  ? -17.730 -65.972 -91.068  1.00 1.53 ? 50  ASN A N    1 
ATOM   761  C  CA   . ASN A 1 50  ? -17.618 -66.158 -92.510  1.00 1.79 ? 50  ASN A CA   1 
ATOM   762  C  C    . ASN A 1 50  ? -17.992 -64.880 -93.256  1.00 1.84 ? 50  ASN A C    1 
ATOM   763  O  O    . ASN A 1 50  ? -17.467 -64.604 -94.335  1.00 2.11 ? 50  ASN A O    1 
ATOM   764  C  CB   . ASN A 1 50  ? -18.514 -67.310 -92.967  1.00 2.04 ? 50  ASN A CB   1 
ATOM   765  C  CG   . ASN A 1 50  ? -18.033 -68.654 -92.459  1.00 2.36 ? 50  ASN A CG   1 
ATOM   766  O  OD1  . ASN A 1 50  ? -17.081 -68.732 -91.681  1.00 2.48 ? 50  ASN A OD1  1 
ATOM   767  N  ND2  . ASN A 1 50  ? -18.689 -69.722 -92.897  1.00 3.04 ? 50  ASN A ND2  1 
ATOM   768  H  H    . ASN A 1 50  ? -18.618 -65.856 -90.668  1.00 1.69 ? 50  ASN A H    1 
ATOM   769  H  HA   . ASN A 1 50  ? -16.591 -66.403 -92.733  1.00 1.83 ? 50  ASN A HA   1 
ATOM   770  H  HB2  . ASN A 1 50  ? -19.517 -67.146 -92.601  1.00 1.99 ? 50  ASN A HB2  1 
ATOM   771  H  HB3  . ASN A 1 50  ? -18.530 -67.338 -94.047  1.00 2.38 ? 50  ASN A HB3  1 
ATOM   772  H  HD21 . ASN A 1 50  ? -19.437 -69.585 -93.515  1.00 3.36 ? 50  ASN A HD21 1 
ATOM   773  H  HD22 . ASN A 1 50  ? -18.399 -70.604 -92.584  1.00 3.42 ? 50  ASN A HD22 1 
ATOM   774  N  N    . GLU A 1 51  ? -18.901 -64.105 -92.674  1.00 1.68 ? 51  GLU A N    1 
ATOM   775  C  CA   . GLU A 1 51  ? -19.344 -62.857 -93.286  1.00 1.77 ? 51  GLU A CA   1 
ATOM   776  C  C    . GLU A 1 51  ? -18.805 -61.654 -92.518  1.00 1.45 ? 51  GLU A C    1 
ATOM   777  O  O    . GLU A 1 51  ? -19.494 -61.084 -91.672  1.00 1.35 ? 51  GLU A O    1 
ATOM   778  C  CB   . GLU A 1 51  ? -20.872 -62.803 -93.335  1.00 2.14 ? 51  GLU A CB   1 
ATOM   779  C  CG   . GLU A 1 51  ? -21.508 -64.066 -93.891  1.00 2.56 ? 51  GLU A CG   1 
ATOM   780  C  CD   . GLU A 1 51  ? -20.782 -64.594 -95.113  1.00 2.85 ? 51  GLU A CD   1 
ATOM   781  O  OE1  . GLU A 1 51  ? -20.433 -63.781 -95.994  1.00 2.87 ? 51  GLU A OE1  1 
ATOM   782  O  OE2  . GLU A 1 51  ? -20.564 -65.822 -95.189  1.00 3.45 ? 51  GLU A OE2  1 
ATOM   783  H  H    . GLU A 1 51  ? -19.284 -64.377 -91.814  1.00 1.58 ? 51  GLU A H    1 
ATOM   784  H  HA   . GLU A 1 51  ? -18.959 -62.827 -94.294  1.00 1.94 ? 51  GLU A HA   1 
ATOM   785  H  HB2  . GLU A 1 51  ? -21.247 -62.647 -92.334  1.00 2.62 ? 51  GLU A HB2  1 
ATOM   786  H  HB3  . GLU A 1 51  ? -21.171 -61.971 -93.955  1.00 2.38 ? 51  GLU A HB3  1 
ATOM   787  H  HG2  . GLU A 1 51  ? -21.494 -64.828 -93.126  1.00 2.97 ? 51  GLU A HG2  1 
ATOM   788  H  HG3  . GLU A 1 51  ? -22.531 -63.849 -94.164  1.00 2.98 ? 51  GLU A HG3  1 
ATOM   789  N  N    . PRO A 1 52  ? -17.559 -61.254 -92.810  1.00 1.46 ? 52  PRO A N    1 
ATOM   790  C  CA   . PRO A 1 52  ? -16.918 -60.112 -92.149  1.00 1.40 ? 52  PRO A CA   1 
ATOM   791  C  C    . PRO A 1 52  ? -17.558 -58.781 -92.532  1.00 1.52 ? 52  PRO A C    1 
ATOM   792  O  O    . PRO A 1 52  ? -17.391 -57.780 -91.837  1.00 2.04 ? 52  PRO A O    1 
ATOM   793  C  CB   . PRO A 1 52  ? -15.473 -60.175 -92.652  1.00 1.67 ? 52  PRO A CB   1 
ATOM   794  C  CG   . PRO A 1 52  ? -15.554 -60.897 -93.952  1.00 1.91 ? 52  PRO A CG   1 
ATOM   795  C  CD   . PRO A 1 52  ? -16.679 -61.885 -93.808  1.00 1.77 ? 52  PRO A CD   1 
ATOM   796  H  HA   . PRO A 1 52  ? -16.932 -60.220 -91.074  1.00 1.31 ? 52  PRO A HA   1 
ATOM   797  H  HB2  . PRO A 1 52  ? -15.091 -59.172 -92.779  1.00 1.75 ? 52  PRO A HB2  1 
ATOM   798  H  HB3  . PRO A 1 52  ? -14.864 -60.711 -91.940  1.00 1.75 ? 52  PRO A HB3  1 
ATOM   799  H  HG2  . PRO A 1 52  ? -15.768 -60.198 -94.747  1.00 1.92 ? 52  PRO A HG2  1 
ATOM   800  H  HG3  . PRO A 1 52  ? -14.625 -61.413 -94.144  1.00 2.30 ? 52  PRO A HG3  1 
ATOM   801  H  HD2  . PRO A 1 52  ? -17.192 -62.012 -94.749  1.00 1.83 ? 52  PRO A HD2  1 
ATOM   802  H  HD3  . PRO A 1 52  ? -16.305 -62.832 -93.448  1.00 1.97 ? 52  PRO A HD3  1 
ATOM   803  N  N    . ASP A 1 53  ? -18.291 -58.776 -93.642  1.00 1.21 ? 53  ASP A N    1 
ATOM   804  C  CA   . ASP A 1 53  ? -18.953 -57.564 -94.113  1.00 1.42 ? 53  ASP A CA   1 
ATOM   805  C  C    . ASP A 1 53  ? -20.378 -57.474 -93.573  1.00 1.20 ? 53  ASP A C    1 
ATOM   806  O  O    . ASP A 1 53  ? -21.319 -57.199 -94.317  1.00 1.06 ? 53  ASP A O    1 
ATOM   807  C  CB   . ASP A 1 53  ? -18.972 -57.531 -95.643  1.00 1.69 ? 53  ASP A CB   1 
ATOM   808  C  CG   . ASP A 1 53  ? -18.618 -56.164 -96.195  1.00 2.36 ? 53  ASP A CG   1 
ATOM   809  O  OD1  . ASP A 1 53  ? -17.647 -55.556 -95.698  1.00 3.13 ? 53  ASP A OD1  1 
ATOM   810  O  OD2  . ASP A 1 53  ? -19.312 -55.702 -97.125  1.00 2.65 ? 53  ASP A OD2  1 
ATOM   811  H  H    . ASP A 1 53  ? -18.388 -59.603 -94.157  1.00 1.03 ? 53  ASP A H    1 
ATOM   812  H  HA   . ASP A 1 53  ? -18.390 -56.718 -93.751  1.00 1.67 ? 53  ASP A HA   1 
ATOM   813  H  HB2  . ASP A 1 53  ? -18.258 -58.247 -96.021  1.00 1.56 ? 53  ASP A HB2  1 
ATOM   814  H  HB3  . ASP A 1 53  ? -19.960 -57.795 -95.991  1.00 2.21 ? 53  ASP A HB3  1 
ATOM   815  N  N    . LEU A 1 54  ? -20.528 -57.703 -92.272  1.00 1.25 ? 54  LEU A N    1 
ATOM   816  C  CA   . LEU A 1 54  ? -21.837 -57.643 -91.631  1.00 1.07 ? 54  LEU A CA   1 
ATOM   817  C  C    . LEU A 1 54  ? -21.852 -56.584 -90.535  1.00 1.06 ? 54  LEU A C    1 
ATOM   818  O  O    . LEU A 1 54  ? -21.173 -56.719 -89.517  1.00 1.48 ? 54  LEU A O    1 
ATOM   819  C  CB   . LEU A 1 54  ? -22.205 -59.008 -91.045  1.00 1.04 ? 54  LEU A CB   1 
ATOM   820  C  CG   . LEU A 1 54  ? -23.705 -59.296 -90.963  1.00 1.26 ? 54  LEU A CG   1 
ATOM   821  C  CD1  . LEU A 1 54  ? -23.974 -60.467 -90.031  1.00 1.88 ? 54  LEU A CD1  1 
ATOM   822  C  CD2  . LEU A 1 54  ? -24.460 -58.059 -90.500  1.00 0.96 ? 54  LEU A CD2  1 
ATOM   823  H  H    . LEU A 1 54  ? -19.740 -57.914 -91.730  1.00 1.45 ? 54  LEU A H    1 
ATOM   824  H  HA   . LEU A 1 54  ? -22.563 -57.375 -92.383  1.00 1.00 ? 54  LEU A HA   1 
ATOM   825  H  HB2  . LEU A 1 54  ? -21.745 -59.773 -91.654  1.00 1.17 ? 54  LEU A HB2  1 
ATOM   826  H  HB3  . LEU A 1 54  ? -21.795 -59.071 -90.048  1.00 0.99 ? 54  LEU A HB3  1 
ATOM   827  H  HG   . LEU A 1 54  ? -24.068 -59.562 -91.946  1.00 1.47 ? 54  LEU A HG   1 
ATOM   828  H  HD11 . LEU A 1 54  ? -23.941 -60.127 -89.007  1.00 2.17 ? 54  LEU A HD11 1 
ATOM   829  H  HD12 . LEU A 1 54  ? -23.222 -61.227 -90.182  1.00 2.52 ? 54  LEU A HD12 1 
ATOM   830  H  HD13 . LEU A 1 54  ? -24.950 -60.878 -90.242  1.00 2.09 ? 54  LEU A HD13 1 
ATOM   831  H  HD21 . LEU A 1 54  ? -25.514 -58.284 -90.435  1.00 1.59 ? 54  LEU A HD21 1 
ATOM   832  H  HD22 . LEU A 1 54  ? -24.305 -57.257 -91.206  1.00 0.97 ? 54  LEU A HD22 1 
ATOM   833  H  HD23 . LEU A 1 54  ? -24.095 -57.758 -89.528  1.00 1.08 ? 54  LEU A HD23 1 
ATOM   834  N  N    . ALA A 1 55  ? -22.628 -55.528 -90.752  1.00 1.07 ? 55  ALA A N    1 
ATOM   835  C  CA   . ALA A 1 55  ? -22.727 -54.443 -89.785  1.00 1.03 ? 55  ALA A CA   1 
ATOM   836  C  C    . ALA A 1 55  ? -24.109 -54.400 -89.141  1.00 0.99 ? 55  ALA A C    1 
ATOM   837  O  O    . ALA A 1 55  ? -25.094 -54.036 -89.784  1.00 1.05 ? 55  ALA A O    1 
ATOM   838  C  CB   . ALA A 1 55  ? -22.415 -53.114 -90.456  1.00 0.99 ? 55  ALA A CB   1 
ATOM   839  H  H    . ALA A 1 55  ? -23.143 -55.476 -91.584  1.00 1.42 ? 55  ALA A H    1 
ATOM   840  H  HA   . ALA A 1 55  ? -21.988 -54.612 -89.016  1.00 1.09 ? 55  ALA A HA   1 
ATOM   841  H  HB1  . ALA A 1 55  ? -22.702 -53.160 -91.497  1.00 1.47 ? 55  ALA A HB1  1 
ATOM   842  H  HB2  . ALA A 1 55  ? -21.356 -52.915 -90.384  1.00 1.62 ? 55  ALA A HB2  1 
ATOM   843  H  HB3  . ALA A 1 55  ? -22.964 -52.324 -89.966  1.00 0.95 ? 55  ALA A HB3  1 
ATOM   844  N  N    . GLN A 1 56  ? -24.174 -54.769 -87.865  1.00 0.92 ? 56  GLN A N    1 
ATOM   845  C  CA   . GLN A 1 56  ? -25.435 -54.767 -87.132  1.00 0.92 ? 56  GLN A CA   1 
ATOM   846  C  C    . GLN A 1 56  ? -25.643 -53.432 -86.426  1.00 0.82 ? 56  GLN A C    1 
ATOM   847  O  O    . GLN A 1 56  ? -24.714 -52.635 -86.304  1.00 0.93 ? 56  GLN A O    1 
ATOM   848  C  CB   . GLN A 1 56  ? -25.461 -55.908 -86.113  1.00 0.97 ? 56  GLN A CB   1 
ATOM   849  C  CG   . GLN A 1 56  ? -24.495 -55.712 -84.956  1.00 1.73 ? 56  GLN A CG   1 
ATOM   850  C  CD   . GLN A 1 56  ? -24.678 -56.745 -83.861  1.00 1.97 ? 56  GLN A CD   1 
ATOM   851  O  OE1  . GLN A 1 56  ? -24.791 -56.405 -82.683  1.00 1.52 ? 56  GLN A OE1  1 
ATOM   852  N  NE2  . GLN A 1 56  ? -24.709 -58.015 -84.246  1.00 3.05 ? 56  GLN A NE2  1 
ATOM   853  H  H    . GLN A 1 56  ? -23.354 -55.045 -87.405  1.00 0.91 ? 56  GLN A H    1 
ATOM   854  H  HA   . GLN A 1 56  ? -26.233 -54.914 -87.844  1.00 1.06 ? 56  GLN A HA   1 
ATOM   855  H  HB2  . GLN A 1 56  ? -26.459 -55.992 -85.710  1.00 1.40 ? 56  GLN A HB2  1 
ATOM   856  H  HB3  . GLN A 1 56  ? -25.205 -56.829 -86.614  1.00 1.23 ? 56  GLN A HB3  1 
ATOM   857  H  HG2  . GLN A 1 56  ? -23.485 -55.783 -85.330  1.00 2.05 ? 56  GLN A HG2  1 
ATOM   858  H  HG3  . GLN A 1 56  ? -24.653 -54.730 -84.534  1.00 2.49 ? 56  GLN A HG3  1 
ATOM   859  H  HE21 . GLN A 1 56  ? -24.613 -58.212 -85.201  1.00 3.51 ? 56  GLN A HE21 1 
ATOM   860  H  HE22 . GLN A 1 56  ? -24.827 -58.704 -83.559  1.00 3.42 ? 56  GLN A HE22 1 
ATOM   861  N  N    . CYS A 1 57  ? -26.866 -53.191 -85.967  1.00 0.78 ? 57  CYS A N    1 
ATOM   862  C  CA   . CYS A 1 57  ? -27.187 -51.946 -85.279  1.00 0.71 ? 57  CYS A CA   1 
ATOM   863  C  C    . CYS A 1 57  ? -27.656 -52.203 -83.852  1.00 0.51 ? 57  CYS A C    1 
ATOM   864  O  O    . CYS A 1 57  ? -28.440 -53.117 -83.599  1.00 0.53 ? 57  CYS A O    1 
ATOM   865  C  CB   . CYS A 1 57  ? -28.264 -51.177 -86.045  1.00 0.82 ? 57  CYS A CB   1 
ATOM   866  S  SG   . CYS A 1 57  ? -28.518 -49.471 -85.454  1.00 1.01 ? 57  CYS A SG   1 
ATOM   867  H  H    . CYS A 1 57  ? -27.569 -53.862 -86.096  1.00 0.89 ? 57  CYS A H    1 
ATOM   868  H  HA   . CYS A 1 57  ? -26.289 -51.348 -85.245  1.00 0.78 ? 57  CYS A HA   1 
ATOM   869  H  HB2  . CYS A 1 57  ? -27.989 -51.125 -87.087  1.00 1.00 ? 57  CYS A HB2  1 
ATOM   870  H  HB3  . CYS A 1 57  ? -29.204 -51.700 -85.952  1.00 0.70 ? 57  CYS A HB3  1 
ATOM   871  N  N    . PHE A 1 58  ? -27.177 -51.380 -82.926  1.00 0.38 ? 58  PHE A N    1 
ATOM   872  C  CA   . PHE A 1 58  ? -27.552 -51.505 -81.523  1.00 0.40 ? 58  PHE A CA   1 
ATOM   873  C  C    . PHE A 1 58  ? -28.797 -50.673 -81.232  1.00 0.62 ? 58  PHE A C    1 
ATOM   874  O  O    . PHE A 1 58  ? -29.364 -50.057 -82.134  1.00 1.48 ? 58  PHE A O    1 
ATOM   875  C  CB   . PHE A 1 58  ? -26.398 -51.061 -80.622  1.00 0.38 ? 58  PHE A CB   1 
ATOM   876  C  CG   . PHE A 1 58  ? -26.569 -49.678 -80.060  1.00 0.48 ? 58  PHE A CG   1 
ATOM   877  C  CD1  . PHE A 1 58  ? -26.619 -48.577 -80.900  1.00 1.22 ? 58  PHE A CD1  1 
ATOM   878  C  CD2  . PHE A 1 58  ? -26.679 -49.480 -78.693  1.00 1.36 ? 58  PHE A CD2  1 
ATOM   879  C  CE1  . PHE A 1 58  ? -26.777 -47.303 -80.386  1.00 1.24 ? 58  PHE A CE1  1 
ATOM   880  C  CE2  . PHE A 1 58  ? -26.836 -48.209 -78.174  1.00 1.49 ? 58  PHE A CE2  1 
ATOM   881  C  CZ   . PHE A 1 58  ? -26.885 -47.120 -79.021  1.00 0.80 ? 58  PHE A CZ   1 
ATOM   882  H  H    . PHE A 1 58  ? -26.561 -50.666 -83.194  1.00 0.39 ? 58  PHE A H    1 
ATOM   883  H  HA   . PHE A 1 58  ? -27.773 -52.544 -81.329  1.00 0.43 ? 58  PHE A HA   1 
ATOM   884  H  HB2  . PHE A 1 58  ? -26.315 -51.747 -79.792  1.00 0.44 ? 58  PHE A HB2  1 
ATOM   885  H  HB3  . PHE A 1 58  ? -25.479 -51.079 -81.190  1.00 0.34 ? 58  PHE A HB3  1 
ATOM   886  H  HD1  . PHE A 1 58  ? -26.535 -48.719 -81.967  1.00 2.10 ? 58  PHE A HD1  1 
ATOM   887  H  HD2  . PHE A 1 58  ? -26.641 -50.332 -78.030  1.00 2.19 ? 58  PHE A HD2  1 
ATOM   888  H  HE1  . PHE A 1 58  ? -26.815 -46.453 -81.050  1.00 2.06 ? 58  PHE A HE1  1 
ATOM   889  H  HE2  . PHE A 1 58  ? -26.921 -48.069 -77.106  1.00 2.39 ? 58  PHE A HE2  1 
ATOM   890  H  HZ   . PHE A 1 58  ? -27.008 -46.126 -78.617  1.00 0.94 ? 58  PHE A HZ   1 
ATOM   891  N  N    . PHE A 1 59  ? -29.221 -50.658 -79.974  1.00 0.54 ? 59  PHE A N    1 
ATOM   892  C  CA   . PHE A 1 59  ? -30.402 -49.899 -79.582  1.00 0.52 ? 59  PHE A CA   1 
ATOM   893  C  C    . PHE A 1 59  ? -31.596 -50.256 -80.464  1.00 0.65 ? 59  PHE A C    1 
ATOM   894  O  O    . PHE A 1 59  ? -32.517 -49.457 -80.629  1.00 1.37 ? 59  PHE A O    1 
ATOM   895  C  CB   . PHE A 1 59  ? -30.117 -48.400 -79.676  1.00 0.56 ? 59  PHE A CB   1 
ATOM   896  C  CG   . PHE A 1 59  ? -30.961 -47.568 -78.754  1.00 0.40 ? 59  PHE A CG   1 
ATOM   897  C  CD1  . PHE A 1 59  ? -30.583 -47.375 -77.436  1.00 0.49 ? 59  PHE A CD1  1 
ATOM   898  C  CD2  . PHE A 1 59  ? -32.129 -46.977 -79.206  1.00 0.52 ? 59  PHE A CD2  1 
ATOM   899  C  CE1  . PHE A 1 59  ? -31.357 -46.609 -76.584  1.00 0.54 ? 59  PHE A CE1  1 
ATOM   900  C  CE2  . PHE A 1 59  ? -32.906 -46.210 -78.361  1.00 0.56 ? 59  PHE A CE2  1 
ATOM   901  C  CZ   . PHE A 1 59  ? -32.520 -46.025 -77.048  1.00 0.50 ? 59  PHE A CZ   1 
ATOM   902  H  H    . PHE A 1 59  ? -28.732 -51.168 -79.295  1.00 1.13 ? 59  PHE A H    1 
ATOM   903  H  HA   . PHE A 1 59  ? -30.635 -50.150 -78.558  1.00 0.57 ? 59  PHE A HA   1 
ATOM   904  H  HB2  . PHE A 1 59  ? -29.082 -48.221 -79.429  1.00 0.75 ? 59  PHE A HB2  1 
ATOM   905  H  HB3  . PHE A 1 59  ? -30.303 -48.068 -80.687  1.00 0.75 ? 59  PHE A HB3  1 
ATOM   906  H  HD1  . PHE A 1 59  ? -29.674 -47.832 -77.073  1.00 0.70 ? 59  PHE A HD1  1 
ATOM   907  H  HD2  . PHE A 1 59  ? -32.433 -47.122 -80.232  1.00 0.74 ? 59  PHE A HD2  1 
ATOM   908  H  HE1  . PHE A 1 59  ? -31.053 -46.465 -75.558  1.00 0.77 ? 59  PHE A HE1  1 
ATOM   909  H  HE2  . PHE A 1 59  ? -33.815 -45.754 -78.726  1.00 0.78 ? 59  PHE A HE2  1 
ATOM   910  H  HZ   . PHE A 1 59  ? -33.126 -45.426 -76.385  1.00 0.64 ? 59  PHE A HZ   1 
ATOM   911  N  N    . CYS A 1 60  ? -31.572 -51.461 -81.028  1.00 0.67 ? 60  CYS A N    1 
ATOM   912  C  CA   . CYS A 1 60  ? -32.652 -51.923 -81.893  1.00 0.63 ? 60  CYS A CA   1 
ATOM   913  C  C    . CYS A 1 60  ? -32.381 -53.340 -82.389  1.00 0.67 ? 60  CYS A C    1 
ATOM   914  O  O    . CYS A 1 60  ? -33.294 -54.160 -82.483  1.00 0.76 ? 60  CYS A O    1 
ATOM   915  C  CB   . CYS A 1 60  ? -32.821 -50.979 -83.086  1.00 0.67 ? 60  CYS A CB   1 
ATOM   916  S  SG   . CYS A 1 60  ? -31.350 -50.856 -84.155  1.00 0.77 ? 60  CYS A SG   1 
ATOM   917  H  H    . CYS A 1 60  ? -30.812 -52.054 -80.858  1.00 1.20 ? 60  CYS A H    1 
ATOM   918  H  HA   . CYS A 1 60  ? -33.563 -51.925 -81.314  1.00 0.64 ? 60  CYS A HA   1 
ATOM   919  H  HB2  . CYS A 1 60  ? -33.640 -51.327 -83.696  1.00 0.68 ? 60  CYS A HB2  1 
ATOM   920  H  HB3  . CYS A 1 60  ? -33.047 -49.988 -82.722  1.00 0.71 ? 60  CYS A HB3  1 
ATOM   921  N  N    . PHE A 1 61  ? -31.121 -53.619 -82.705  1.00 0.62 ? 61  PHE A N    1 
ATOM   922  C  CA   . PHE A 1 61  ? -30.727 -54.936 -83.193  1.00 0.68 ? 61  PHE A CA   1 
ATOM   923  C  C    . PHE A 1 61  ? -31.256 -55.173 -84.604  1.00 0.66 ? 61  PHE A C    1 
ATOM   924  O  O    . PHE A 1 61  ? -32.467 -55.212 -84.825  1.00 0.68 ? 61  PHE A O    1 
ATOM   925  C  CB   . PHE A 1 61  ? -31.241 -56.027 -82.252  1.00 0.75 ? 61  PHE A CB   1 
ATOM   926  C  CG   . PHE A 1 61  ? -31.017 -55.720 -80.798  1.00 0.82 ? 61  PHE A CG   1 
ATOM   927  C  CD1  . PHE A 1 61  ? -29.753 -55.825 -80.242  1.00 1.63 ? 61  PHE A CD1  1 
ATOM   928  C  CD2  . PHE A 1 61  ? -32.072 -55.326 -79.989  1.00 1.24 ? 61  PHE A CD2  1 
ATOM   929  C  CE1  . PHE A 1 61  ? -29.544 -55.543 -78.905  1.00 1.79 ? 61  PHE A CE1  1 
ATOM   930  C  CE2  . PHE A 1 61  ? -31.868 -55.044 -78.651  1.00 1.24 ? 61  PHE A CE2  1 
ATOM   931  C  CZ   . PHE A 1 61  ? -30.602 -55.152 -78.109  1.00 1.10 ? 61  PHE A CZ   1 
ATOM   932  H  H    . PHE A 1 61  ? -30.438 -52.922 -82.609  1.00 0.57 ? 61  PHE A H    1 
ATOM   933  H  HA   . PHE A 1 61  ? -29.648 -54.971 -83.216  1.00 0.71 ? 61  PHE A HA   1 
ATOM   934  H  HB2  . PHE A 1 61  ? -32.302 -56.155 -82.404  1.00 0.67 ? 61  PHE A HB2  1 
ATOM   935  H  HB3  . PHE A 1 61  ? -30.736 -56.954 -82.478  1.00 0.88 ? 61  PHE A HB3  1 
ATOM   936  H  HD1  . PHE A 1 61  ? -28.924 -56.130 -80.863  1.00 2.40 ? 61  PHE A HD1  1 
ATOM   937  H  HD2  . PHE A 1 61  ? -33.062 -55.242 -80.412  1.00 2.03 ? 61  PHE A HD2  1 
ATOM   938  H  HE1  . PHE A 1 61  ? -28.553 -55.629 -78.483  1.00 2.67 ? 61  PHE A HE1  1 
ATOM   939  H  HE2  . PHE A 1 61  ? -32.698 -54.738 -78.031  1.00 1.93 ? 61  PHE A HE2  1 
ATOM   940  H  HZ   . PHE A 1 61  ? -30.441 -54.932 -77.064  1.00 1.23 ? 61  PHE A HZ   1 
ATOM   941  N  N    . LYS A 1 62  ? -30.341 -55.331 -85.555  1.00 0.89 ? 62  LYS A N    1 
ATOM   942  C  CA   . LYS A 1 62  ? -30.717 -55.565 -86.945  1.00 0.94 ? 62  LYS A CA   1 
ATOM   943  C  C    . LYS A 1 62  ? -29.486 -55.845 -87.801  1.00 0.94 ? 62  LYS A C    1 
ATOM   944  O  O    . LYS A 1 62  ? -28.799 -54.923 -88.238  1.00 1.09 ? 62  LYS A O    1 
ATOM   945  C  CB   . LYS A 1 62  ? -31.475 -54.357 -87.500  1.00 0.92 ? 62  LYS A CB   1 
ATOM   946  C  CG   . LYS A 1 62  ? -32.765 -54.726 -88.214  1.00 1.05 ? 62  LYS A CG   1 
ATOM   947  C  CD   . LYS A 1 62  ? -32.495 -55.262 -89.611  1.00 1.31 ? 62  LYS A CD   1 
ATOM   948  C  CE   . LYS A 1 62  ? -33.763 -55.793 -90.259  1.00 1.53 ? 62  LYS A CE   1 
ATOM   949  N  NZ   . LYS A 1 62  ? -33.982 -57.234 -89.954  1.00 1.64 ? 62  LYS A NZ   1 
ATOM   950  H  H    . LYS A 1 62  ? -29.392 -55.289 -85.317  1.00 1.13 ? 62  LYS A H    1 
ATOM   951  H  HA   . LYS A 1 62  ? -31.364 -56.428 -86.972  1.00 1.01 ? 62  LYS A HA   1 
ATOM   952  H  HB2  . LYS A 1 62  ? -31.717 -53.692 -86.684  1.00 1.07 ? 62  LYS A HB2  1 
ATOM   953  H  HB3  . LYS A 1 62  ? -30.837 -53.837 -88.200  1.00 1.06 ? 62  LYS A HB3  1 
ATOM   954  H  HG2  . LYS A 1 62  ? -33.279 -55.483 -87.642  1.00 1.19 ? 62  LYS A HG2  1 
ATOM   955  H  HG3  . LYS A 1 62  ? -33.387 -53.845 -88.290  1.00 1.63 ? 62  LYS A HG3  1 
ATOM   956  H  HD2  . LYS A 1 62  ? -32.097 -54.465 -90.221  1.00 1.89 ? 62  LYS A HD2  1 
ATOM   957  H  HD3  . LYS A 1 62  ? -31.772 -56.063 -89.544  1.00 1.81 ? 62  LYS A HD3  1 
ATOM   958  H  HE2  . LYS A 1 62  ? -34.605 -55.225 -89.892  1.00 2.03 ? 62  LYS A HE2  1 
ATOM   959  H  HE3  . LYS A 1 62  ? -33.684 -55.668 -91.329  1.00 2.12 ? 62  LYS A HE3  1 
ATOM   960  H  HZ1  . LYS A 1 62  ? -33.533 -57.825 -90.683  1.00 1.76 ? 62  LYS A HZ1  1 
ATOM   961  H  HZ2  . LYS A 1 62  ? -35.000 -57.444 -89.932  1.00 2.20 ? 62  LYS A HZ2  1 
ATOM   962  H  HZ3  . LYS A 1 62  ? -33.570 -57.470 -89.029  1.00 1.99 ? 62  LYS A HZ3  1 
ATOM   963  N  N    . GLU A 1 63  ? -29.215 -57.125 -88.037  1.00 0.84 ? 63  GLU A N    1 
ATOM   964  C  CA   . GLU A 1 63  ? -28.068 -57.528 -88.841  1.00 0.83 ? 63  GLU A CA   1 
ATOM   965  C  C    . GLU A 1 63  ? -28.265 -57.142 -90.304  1.00 0.82 ? 63  GLU A C    1 
ATOM   966  O  O    . GLU A 1 63  ? -29.299 -57.442 -90.901  1.00 0.84 ? 63  GLU A O    1 
ATOM   967  C  CB   . GLU A 1 63  ? -27.843 -59.037 -88.726  1.00 0.91 ? 63  GLU A CB   1 
ATOM   968  C  CG   . GLU A 1 63  ? -27.292 -59.468 -87.377  1.00 0.91 ? 63  GLU A CG   1 
ATOM   969  C  CD   . GLU A 1 63  ? -27.620 -60.912 -87.048  1.00 1.00 ? 63  GLU A CD   1 
ATOM   970  O  OE1  . GLU A 1 63  ? -27.491 -61.769 -87.946  1.00 1.80 ? 63  GLU A OE1  1 
ATOM   971  O  OE2  . GLU A 1 63  ? -28.008 -61.184 -85.892  1.00 0.97 ? 63  GLU A OE2  1 
ATOM   972  H  H    . GLU A 1 63  ? -29.801 -57.815 -87.660  1.00 0.83 ? 63  GLU A H    1 
ATOM   973  H  HA   . GLU A 1 63  ? -27.199 -57.013 -88.460  1.00 0.78 ? 63  GLU A HA   1 
ATOM   974  H  HB2  . GLU A 1 63  ? -28.784 -59.542 -88.885  1.00 1.52 ? 63  GLU A HB2  1 
ATOM   975  H  HB3  . GLU A 1 63  ? -27.145 -59.344 -89.491  1.00 1.58 ? 63  GLU A HB3  1 
ATOM   976  H  HG2  . GLU A 1 63  ? -26.219 -59.353 -87.387  1.00 1.50 ? 63  GLU A HG2  1 
ATOM   977  H  HG3  . GLU A 1 63  ? -27.714 -58.835 -86.611  1.00 1.64 ? 63  GLU A HG3  1 
ATOM   978  N  N    . LEU A 1 64  ? -27.267 -56.475 -90.874  1.00 0.84 ? 64  LEU A N    1 
ATOM   979  C  CA   . LEU A 1 64  ? -27.330 -56.048 -92.267  1.00 0.85 ? 64  LEU A CA   1 
ATOM   980  C  C    . LEU A 1 64  ? -25.975 -56.215 -92.948  1.00 0.88 ? 64  LEU A C    1 
ATOM   981  O  O    . LEU A 1 64  ? -25.005 -55.544 -92.593  1.00 1.17 ? 64  LEU A O    1 
ATOM   982  C  CB   . LEU A 1 64  ? -27.781 -54.589 -92.355  1.00 0.81 ? 64  LEU A CB   1 
ATOM   983  C  CG   . LEU A 1 64  ? -29.263 -54.349 -92.058  1.00 0.82 ? 64  LEU A CG   1 
ATOM   984  C  CD1  . LEU A 1 64  ? -29.444 -53.081 -91.240  1.00 0.72 ? 64  LEU A CD1  1 
ATOM   985  C  CD2  . LEU A 1 64  ? -30.058 -54.269 -93.352  1.00 1.15 ? 64  LEU A CD2  1 
ATOM   986  H  H    . LEU A 1 64  ? -26.469 -56.265 -90.346  1.00 0.88 ? 64  LEU A H    1 
ATOM   987  H  HA   . LEU A 1 64  ? -28.053 -56.670 -92.773  1.00 0.87 ? 64  LEU A HA   1 
ATOM   988  H  HB2  . LEU A 1 64  ? -27.197 -54.010 -91.655  1.00 0.88 ? 64  LEU A HB2  1 
ATOM   989  H  HB3  . LEU A 1 64  ? -27.575 -54.230 -93.353  1.00 0.91 ? 64  LEU A HB3  1 
ATOM   990  H  HG   . LEU A 1 64  ? -29.645 -55.177 -91.480  1.00 0.83 ? 64  LEU A HG   1 
ATOM   991  H  HD11 . LEU A 1 64  ? -30.429 -52.676 -91.417  1.00 1.34 ? 64  LEU A HD11 1 
ATOM   992  H  HD12 . LEU A 1 64  ? -28.699 -52.355 -91.530  1.00 0.80 ? 64  LEU A HD12 1 
ATOM   993  H  HD13 . LEU A 1 64  ? -29.333 -53.310 -90.190  1.00 1.30 ? 64  LEU A HD13 1 
ATOM   994  H  HD21 . LEU A 1 64  ? -29.868 -55.150 -93.947  1.00 1.73 ? 64  LEU A HD21 1 
ATOM   995  H  HD22 . LEU A 1 64  ? -29.760 -53.390 -93.904  1.00 1.75 ? 64  LEU A HD22 1 
ATOM   996  H  HD23 . LEU A 1 64  ? -31.112 -54.210 -93.124  1.00 1.06 ? 64  LEU A HD23 1 
ATOM   997  N  N    . GLU A 1 65  ? -25.915 -57.112 -93.926  1.00 0.92 ? 65  GLU A N    1 
ATOM   998  C  CA   . GLU A 1 65  ? -24.678 -57.366 -94.654  1.00 1.02 ? 65  GLU A CA   1 
ATOM   999  C  C    . GLU A 1 65  ? -24.888 -57.200 -96.157  1.00 1.09 ? 65  GLU A C    1 
ATOM   1000 O  O    . GLU A 1 65  ? -26.019 -57.222 -96.641  1.00 1.54 ? 65  GLU A O    1 
ATOM   1001 C  CB   . GLU A 1 65  ? -24.161 -58.774 -94.344  1.00 1.08 ? 65  GLU A CB   1 
ATOM   1002 C  CG   . GLU A 1 65  ? -23.599 -59.504 -95.554  1.00 1.18 ? 65  GLU A CG   1 
ATOM   1003 C  CD   . GLU A 1 65  ? -23.061 -60.878 -95.208  1.00 1.56 ? 65  GLU A CD   1 
ATOM   1004 O  OE1  . GLU A 1 65  ? -23.351 -61.366 -94.095  1.00 2.08 ? 65  GLU A OE1  1 
ATOM   1005 O  OE2  . GLU A 1 65  ? -22.349 -61.466 -96.048  1.00 2.05 ? 65  GLU A OE2  1 
ATOM   1006 H  H    . GLU A 1 65  ? -26.722 -57.616 -94.163  1.00 1.11 ? 65  GLU A H    1 
ATOM   1007 H  HA   . GLU A 1 65  ? -23.947 -56.642 -94.323  1.00 1.04 ? 65  GLU A HA   1 
ATOM   1008 H  HB2  . GLU A 1 65  ? -23.379 -58.702 -93.602  1.00 1.52 ? 65  GLU A HB2  1 
ATOM   1009 H  HB3  . GLU A 1 65  ? -24.973 -59.362 -93.942  1.00 1.59 ? 65  GLU A HB3  1 
ATOM   1010 H  HG2  . GLU A 1 65  ? -24.384 -59.617 -96.288  1.00 1.87 ? 65  GLU A HG2  1 
ATOM   1011 H  HG3  . GLU A 1 65  ? -22.797 -58.915 -95.974  1.00 1.37 ? 65  GLU A HG3  1 
ATOM   1012 N  N    . GLY A 1 66  ? -23.791 -57.026 -96.888  1.00 1.19 ? 66  GLY A N    1 
ATOM   1013 C  CA   . GLY A 1 66  ? -23.879 -56.851 -98.326  1.00 1.21 ? 66  GLY A CA   1 
ATOM   1014 C  C    . GLY A 1 66  ? -23.991 -55.392 -98.711  1.00 1.22 ? 66  GLY A C    1 
ATOM   1015 O  O    . GLY A 1 66  ? -24.646 -55.046 -99.695  1.00 1.43 ? 66  GLY A O    1 
ATOM   1016 H  H    . GLY A 1 66  ? -22.916 -57.012 -96.448  1.00 1.56 ? 66  GLY A H    1 
ATOM   1017 H  HA2  . GLY A 1 66  ? -22.995 -57.269 -98.785  1.00 1.24 ? 66  GLY A HA2  1 
ATOM   1018 H  HA3  . GLY A 1 66  ? -24.748 -57.378 -98.692  1.00 1.19 ? 66  GLY A HA3  1 
ATOM   1019 N  N    . TRP A 1 67  ? -23.357 -54.534 -97.921  1.00 1.04 ? 67  TRP A N    1 
ATOM   1020 C  CA   . TRP A 1 67  ? -23.386 -53.098 -98.162  1.00 1.04 ? 67  TRP A CA   1 
ATOM   1021 C  C    . TRP A 1 67  ? -22.680 -52.730 -99.462  1.00 1.09 ? 67  TRP A C    1 
ATOM   1022 O  O    . TRP A 1 67  ? -21.944 -53.534 -100.035 1.00 1.16 ? 67  TRP A O    1 
ATOM   1023 C  CB   . TRP A 1 67  ? -22.736 -52.359 -96.994  1.00 0.99 ? 67  TRP A CB   1 
ATOM   1024 C  CG   . TRP A 1 67  ? -23.502 -52.494 -95.716  1.00 0.94 ? 67  TRP A CG   1 
ATOM   1025 C  CD1  . TRP A 1 67  ? -23.528 -53.577 -94.885  1.00 0.94 ? 67  TRP A CD1  1 
ATOM   1026 C  CD2  . TRP A 1 67  ? -24.358 -51.512 -95.126  1.00 0.90 ? 67  TRP A CD2  1 
ATOM   1027 N  NE1  . TRP A 1 67  ? -24.349 -53.328 -93.813  1.00 0.91 ? 67  TRP A NE1  1 
ATOM   1028 C  CE2  . TRP A 1 67  ? -24.870 -52.065 -93.937  1.00 0.88 ? 67  TRP A CE2  1 
ATOM   1029 C  CE3  . TRP A 1 67  ? -24.739 -50.218 -95.489  1.00 0.90 ? 67  TRP A CE3  1 
ATOM   1030 C  CZ2  . TRP A 1 67  ? -25.745 -51.365 -93.110  1.00 0.85 ? 67  TRP A CZ2  1 
ATOM   1031 C  CZ3  . TRP A 1 67  ? -25.607 -49.524 -94.669  1.00 0.88 ? 67  TRP A CZ3  1 
ATOM   1032 C  CH2  . TRP A 1 67  ? -26.102 -50.098 -93.490  1.00 0.86 ? 67  TRP A CH2  1 
ATOM   1033 H  H    . TRP A 1 67  ? -22.860 -54.878 -97.148  1.00 0.96 ? 67  TRP A H    1 
ATOM   1034 H  HA   . TRP A 1 67  ? -24.420 -52.796 -98.232  1.00 1.04 ? 67  TRP A HA   1 
ATOM   1035 H  HB2  . TRP A 1 67  ? -21.745 -52.755 -96.832  1.00 0.99 ? 67  TRP A HB2  1 
ATOM   1036 H  HB3  . TRP A 1 67  ? -22.666 -51.309 -97.234  1.00 1.00 ? 67  TRP A HB3  1 
ATOM   1037 H  HD1  . TRP A 1 67  ? -22.979 -54.490 -95.060  1.00 0.98 ? 67  TRP A HD1  1 
ATOM   1038 H  HE1  . TRP A 1 67  ? -24.530 -53.953 -93.079  1.00 0.91 ? 67  TRP A HE1  1 
ATOM   1039 H  HE3  . TRP A 1 67  ? -24.368 -49.759 -96.394  1.00 0.93 ? 67  TRP A HE3  1 
ATOM   1040 H  HZ2  . TRP A 1 67  ? -26.135 -51.792 -92.198  1.00 0.85 ? 67  TRP A HZ2  1 
ATOM   1041 H  HZ3  . TRP A 1 67  ? -25.912 -48.522 -94.936  1.00 0.90 ? 67  TRP A HZ3  1 
ATOM   1042 H  HH2  . TRP A 1 67  ? -26.779 -49.520 -92.879  1.00 0.86 ? 67  TRP A HH2  1 
ATOM   1043 N  N    . GLU A 1 68  ? -22.910 -51.502 -99.912  1.00 1.08 ? 68  GLU A N    1 
ATOM   1044 C  CA   . GLU A 1 68  ? -22.301 -51.002 -101.137 1.00 1.15 ? 68  GLU A CA   1 
ATOM   1045 C  C    . GLU A 1 68  ? -21.980 -49.518 -100.999 1.00 1.07 ? 68  GLU A C    1 
ATOM   1046 O  O    . GLU A 1 68  ? -22.474 -48.850 -100.090 1.00 1.02 ? 68  GLU A O    1 
ATOM   1047 C  CB   . GLU A 1 68  ? -23.235 -51.227 -102.328 1.00 1.27 ? 68  GLU A CB   1 
ATOM   1048 C  CG   . GLU A 1 68  ? -23.143 -52.625 -102.917 1.00 1.42 ? 68  GLU A CG   1 
ATOM   1049 C  CD   . GLU A 1 68  ? -24.467 -53.113 -103.471 1.00 1.28 ? 68  GLU A CD   1 
ATOM   1050 O  OE1  . GLU A 1 68  ? -25.408 -52.297 -103.567 1.00 1.46 ? 68  GLU A OE1  1 
ATOM   1051 O  OE2  . GLU A 1 68  ? -24.563 -54.312 -103.809 1.00 1.18 ? 68  GLU A OE2  1 
ATOM   1052 H  H    . GLU A 1 68  ? -23.504 -50.913 -99.402  1.00 1.04 ? 68  GLU A H    1 
ATOM   1053 H  HA   . GLU A 1 68  ? -21.383 -51.546 -101.300 1.00 1.23 ? 68  GLU A HA   1 
ATOM   1054 H  HB2  . GLU A 1 68  ? -24.253 -51.061 -102.008 1.00 1.22 ? 68  GLU A HB2  1 
ATOM   1055 H  HB3  . GLU A 1 68  ? -22.990 -50.516 -103.103 1.00 1.74 ? 68  GLU A HB3  1 
ATOM   1056 H  HG2  . GLU A 1 68  ? -22.417 -52.618 -103.716 1.00 2.08 ? 68  GLU A HG2  1 
ATOM   1057 H  HG3  . GLU A 1 68  ? -22.819 -53.307 -102.144 1.00 1.47 ? 68  GLU A HG3  1 
ATOM   1058 N  N    . PRO A 1 69  ? -21.143 -48.981 -101.897 1.00 1.12 ? 69  PRO A N    1 
ATOM   1059 C  CA   . PRO A 1 69  ? -20.748 -47.568 -101.873 1.00 1.10 ? 69  PRO A CA   1 
ATOM   1060 C  C    . PRO A 1 69  ? -21.903 -46.631 -102.223 1.00 1.17 ? 69  PRO A C    1 
ATOM   1061 O  O    . PRO A 1 69  ? -21.798 -45.823 -103.147 1.00 1.57 ? 69  PRO A O    1 
ATOM   1062 C  CB   . PRO A 1 69  ? -19.645 -47.475 -102.940 1.00 1.21 ? 69  PRO A CB   1 
ATOM   1063 C  CG   . PRO A 1 69  ? -19.277 -48.886 -103.262 1.00 1.15 ? 69  PRO A CG   1 
ATOM   1064 C  CD   . PRO A 1 69  ? -20.506 -49.705 -103.001 1.00 1.27 ? 69  PRO A CD   1 
ATOM   1065 H  HA   . PRO A 1 69  ? -20.344 -47.289 -100.911 1.00 1.14 ? 69  PRO A HA   1 
ATOM   1066 H  HB2  . PRO A 1 69  ? -20.027 -46.962 -103.810 1.00 1.31 ? 69  PRO A HB2  1 
ATOM   1067 H  HB3  . PRO A 1 69  ? -18.802 -46.931 -102.540 1.00 1.38 ? 69  PRO A HB3  1 
ATOM   1068 H  HG2  . PRO A 1 69  ? -18.988 -48.963 -104.300 1.00 1.15 ? 69  PRO A HG2  1 
ATOM   1069 H  HG3  . PRO A 1 69  ? -18.469 -49.209 -102.622 1.00 1.18 ? 69  PRO A HG3  1 
ATOM   1070 H  HD2  . PRO A 1 69  ? -21.144 -49.721 -103.873 1.00 1.46 ? 69  PRO A HD2  1 
ATOM   1071 H  HD3  . PRO A 1 69  ? -20.240 -50.708 -102.704 1.00 1.32 ? 69  PRO A HD3  1 
ATOM   1072 N  N    . ASP A 1 70  ? -23.004 -46.741 -101.482 1.00 1.09 ? 70  ASP A N    1 
ATOM   1073 C  CA   . ASP A 1 70  ? -24.174 -45.903 -101.719 1.00 1.18 ? 70  ASP A CA   1 
ATOM   1074 C  C    . ASP A 1 70  ? -25.382 -46.409 -100.932 1.00 1.09 ? 70  ASP A C    1 
ATOM   1075 O  O    . ASP A 1 70  ? -26.501 -46.439 -101.445 1.00 1.16 ? 70  ASP A O    1 
ATOM   1076 C  CB   . ASP A 1 70  ? -24.498 -45.873 -103.212 1.00 1.50 ? 70  ASP A CB   1 
ATOM   1077 C  CG   . ASP A 1 70  ? -24.168 -44.537 -103.850 1.00 2.17 ? 70  ASP A CG   1 
ATOM   1078 O  OD1  . ASP A 1 70  ? -23.310 -43.813 -103.301 1.00 2.79 ? 70  ASP A OD1  1 
ATOM   1079 O  OD2  . ASP A 1 70  ? -24.767 -44.215 -104.897 1.00 2.71 ? 70  ASP A OD2  1 
ATOM   1080 H  H    . ASP A 1 70  ? -23.031 -47.400 -100.762 1.00 1.23 ? 70  ASP A H    1 
ATOM   1081 H  HA   . ASP A 1 70  ? -23.937 -44.902 -101.391 1.00 1.30 ? 70  ASP A HA   1 
ATOM   1082 H  HB2  . ASP A 1 70  ? -23.923 -46.639 -103.709 1.00 1.87 ? 70  ASP A HB2  1 
ATOM   1083 H  HB3  . ASP A 1 70  ? -25.549 -46.069 -103.353 1.00 1.62 ? 70  ASP A HB3  1 
ATOM   1084 N  N    . ASP A 1 71  ? -25.152 -46.805 -99.683  1.00 1.02 ? 71  ASP A N    1 
ATOM   1085 C  CA   . ASP A 1 71  ? -26.227 -47.307 -98.835  1.00 1.03 ? 71  ASP A CA   1 
ATOM   1086 C  C    . ASP A 1 71  ? -26.278 -46.546 -97.514  1.00 1.09 ? 71  ASP A C    1 
ATOM   1087 O  O    . ASP A 1 71  ? -25.645 -46.941 -96.534  1.00 1.52 ? 71  ASP A O    1 
ATOM   1088 C  CB   . ASP A 1 71  ? -26.040 -48.801 -98.569  1.00 1.02 ? 71  ASP A CB   1 
ATOM   1089 C  CG   . ASP A 1 71  ? -26.693 -49.664 -99.630  1.00 1.23 ? 71  ASP A CG   1 
ATOM   1090 O  OD1  . ASP A 1 71  ? -27.934 -49.808 -99.597  1.00 1.82 ? 71  ASP A OD1  1 
ATOM   1091 O  OD2  . ASP A 1 71  ? -25.965 -50.196 -100.494 1.00 1.57 ? 71  ASP A OD2  1 
ATOM   1092 H  H    . ASP A 1 71  ? -24.242 -46.759 -99.324  1.00 1.03 ? 71  ASP A H    1 
ATOM   1093 H  HA   . ASP A 1 71  ? -27.159 -47.158 -99.358  1.00 1.08 ? 71  ASP A HA   1 
ATOM   1094 H  HB2  . ASP A 1 71  ? -24.984 -49.028 -98.548  1.00 1.10 ? 71  ASP A HB2  1 
ATOM   1095 H  HB3  . ASP A 1 71  ? -26.475 -49.048 -97.612  1.00 0.99 ? 71  ASP A HB3  1 
ATOM   1096 N  N    . ASP A 1 72  ? -27.037 -45.455 -97.493  1.00 0.97 ? 72  ASP A N    1 
ATOM   1097 C  CA   . ASP A 1 72  ? -27.171 -44.642 -96.291  1.00 0.96 ? 72  ASP A CA   1 
ATOM   1098 C  C    . ASP A 1 72  ? -27.520 -45.513 -95.087  1.00 0.91 ? 72  ASP A C    1 
ATOM   1099 O  O    . ASP A 1 72  ? -28.527 -46.221 -95.096  1.00 0.91 ? 72  ASP A O    1 
ATOM   1100 C  CB   . ASP A 1 72  ? -28.247 -43.573 -96.488  1.00 1.05 ? 72  ASP A CB   1 
ATOM   1101 C  CG   . ASP A 1 72  ? -27.806 -42.478 -97.440  1.00 1.12 ? 72  ASP A CG   1 
ATOM   1102 O  OD1  . ASP A 1 72  ? -26.732 -42.628 -98.061  1.00 1.56 ? 72  ASP A OD1  1 
ATOM   1103 O  OD2  . ASP A 1 72  ? -28.535 -41.471 -97.566  1.00 1.29 ? 72  ASP A OD2  1 
ATOM   1104 H  H    . ASP A 1 72  ? -27.518 -45.192 -98.305  1.00 1.14 ? 72  ASP A H    1 
ATOM   1105 H  HA   . ASP A 1 72  ? -26.223 -44.158 -96.113  1.00 0.99 ? 72  ASP A HA   1 
ATOM   1106 H  HB2  . ASP A 1 72  ? -29.136 -44.035 -96.889  1.00 1.08 ? 72  ASP A HB2  1 
ATOM   1107 H  HB3  . ASP A 1 72  ? -28.478 -43.123 -95.533  1.00 1.06 ? 72  ASP A HB3  1 
ATOM   1108 N  N    . PRO A 1 73  ? -26.690 -45.477 -94.032  1.00 0.94 ? 73  PRO A N    1 
ATOM   1109 C  CA   . PRO A 1 73  ? -26.921 -46.271 -92.822  1.00 0.93 ? 73  PRO A CA   1 
ATOM   1110 C  C    . PRO A 1 73  ? -28.214 -45.885 -92.111  1.00 0.87 ? 73  PRO A C    1 
ATOM   1111 O  O    . PRO A 1 73  ? -29.087 -46.725 -91.893  1.00 0.85 ? 73  PRO A O    1 
ATOM   1112 C  CB   . PRO A 1 73  ? -25.706 -45.960 -91.941  1.00 1.03 ? 73  PRO A CB   1 
ATOM   1113 C  CG   . PRO A 1 73  ? -25.162 -44.675 -92.465  1.00 1.22 ? 73  PRO A CG   1 
ATOM   1114 C  CD   . PRO A 1 73  ? -25.467 -44.665 -93.935  1.00 1.08 ? 73  PRO A CD   1 
ATOM   1115 H  HA   . PRO A 1 73  ? -26.942 -47.328 -93.046  1.00 0.94 ? 73  PRO A HA   1 
ATOM   1116 H  HB2  . PRO A 1 73  ? -26.020 -45.865 -90.914  1.00 1.15 ? 73  PRO A HB2  1 
ATOM   1117 H  HB3  . PRO A 1 73  ? -24.982 -46.757 -92.029  1.00 1.05 ? 73  PRO A HB3  1 
ATOM   1118 H  HG2  . PRO A 1 73  ? -25.647 -43.844 -91.975  1.00 1.43 ? 73  PRO A HG2  1 
ATOM   1119 H  HG3  . PRO A 1 73  ? -24.095 -44.637 -92.304  1.00 1.48 ? 73  PRO A HG3  1 
ATOM   1120 H  HD2  . PRO A 1 73  ? -25.645 -43.655 -94.277  1.00 1.07 ? 73  PRO A HD2  1 
ATOM   1121 H  HD3  . PRO A 1 73  ? -24.659 -45.117 -94.492  1.00 1.17 ? 73  PRO A HD3  1 
ATOM   1122 N  N    . ILE A 1 74  ? -28.337 -44.610 -91.754  1.00 0.92 ? 74  ILE A N    1 
ATOM   1123 C  CA   . ILE A 1 74  ? -29.530 -44.124 -91.071  1.00 0.91 ? 74  ILE A CA   1 
ATOM   1124 C  C    . ILE A 1 74  ? -30.789 -44.521 -91.832  1.00 0.91 ? 74  ILE A C    1 
ATOM   1125 O  O    . ILE A 1 74  ? -31.782 -44.939 -91.235  1.00 0.95 ? 74  ILE A O    1 
ATOM   1126 C  CB   . ILE A 1 74  ? -29.499 -42.592 -90.900  1.00 0.92 ? 74  ILE A CB   1 
ATOM   1127 C  CG1  . ILE A 1 74  ? -29.160 -42.228 -89.454  1.00 0.96 ? 74  ILE A CG1  1 
ATOM   1128 C  CG2  . ILE A 1 74  ? -30.833 -41.982 -91.303  1.00 0.87 ? 74  ILE A CG2  1 
ATOM   1129 C  CD1  . ILE A 1 74  ? -28.997 -40.740 -89.228  1.00 0.98 ? 74  ILE A CD1  1 
ATOM   1130 H  H    . ILE A 1 74  ? -27.612 -43.983 -91.955  1.00 1.01 ? 74  ILE A H    1 
ATOM   1131 H  HA   . ILE A 1 74  ? -29.558 -44.575 -90.090  1.00 0.91 ? 74  ILE A HA   1 
ATOM   1132 H  HB   . ILE A 1 74  ? -28.737 -42.194 -91.553  1.00 0.98 ? 74  ILE A HB   1 
ATOM   1133 H  HG12 . ILE A 1 74  ? -29.951 -42.577 -88.807  1.00 1.00 ? 74  ILE A HG12 1 
ATOM   1134 H  HG13 . ILE A 1 74  ? -28.234 -42.710 -89.176  1.00 1.06 ? 74  ILE A HG13 1 
ATOM   1135 H  HG21 . ILE A 1 74  ? -30.828 -40.927 -91.076  1.00 0.88 ? 74  ILE A HG21 1 
ATOM   1136 H  HG22 . ILE A 1 74  ? -31.630 -42.464 -90.755  1.00 1.50 ? 74  ILE A HG22 1 
ATOM   1137 H  HG23 . ILE A 1 74  ? -30.988 -42.122 -92.363  1.00 1.47 ? 74  ILE A HG23 1 
ATOM   1138 H  HD11 . ILE A 1 74  ? -28.206 -40.570 -88.513  1.00 1.10 ? 74  ILE A HD11 1 
ATOM   1139 H  HD12 . ILE A 1 74  ? -29.921 -40.331 -88.847  1.00 1.51 ? 74  ILE A HD12 1 
ATOM   1140 H  HD13 . ILE A 1 74  ? -28.749 -40.259 -90.162  1.00 1.47 ? 74  ILE A HD13 1 
ATOM   1141 N  N    . GLU A 1 75  ? -30.739 -44.393 -93.153  1.00 0.90 ? 75  GLU A N    1 
ATOM   1142 C  CA   . GLU A 1 75  ? -31.873 -44.745 -93.998  1.00 0.91 ? 75  GLU A CA   1 
ATOM   1143 C  C    . GLU A 1 75  ? -32.035 -46.259 -94.078  1.00 0.84 ? 75  GLU A C    1 
ATOM   1144 O  O    . GLU A 1 75  ? -33.143 -46.767 -94.252  1.00 0.80 ? 75  GLU A O    1 
ATOM   1145 C  CB   . GLU A 1 75  ? -31.692 -44.164 -95.401  1.00 0.98 ? 75  GLU A CB   1 
ATOM   1146 C  CG   . GLU A 1 75  ? -32.883 -43.352 -95.883  1.00 1.24 ? 75  GLU A CG   1 
ATOM   1147 C  CD   . GLU A 1 75  ? -33.441 -43.860 -97.198  1.00 1.82 ? 75  GLU A CD   1 
ATOM   1148 O  OE1  . GLU A 1 75  ? -32.731 -43.760 -98.222  1.00 2.18 ? 75  GLU A OE1  1 
ATOM   1149 O  OE2  . GLU A 1 75  ? -34.586 -44.358 -97.205  1.00 2.64 ? 75  GLU A OE2  1 
ATOM   1150 H  H    . GLU A 1 75  ? -29.918 -44.059 -93.571  1.00 0.91 ? 75  GLU A H    1 
ATOM   1151 H  HA   . GLU A 1 75  ? -32.762 -44.322 -93.554  1.00 0.93 ? 75  GLU A HA   1 
ATOM   1152 H  HB2  . GLU A 1 75  ? -30.823 -43.523 -95.403  1.00 1.26 ? 75  GLU A HB2  1 
ATOM   1153 H  HB3  . GLU A 1 75  ? -31.532 -44.975 -96.097  1.00 1.04 ? 75  GLU A HB3  1 
ATOM   1154 H  HG2  . GLU A 1 75  ? -33.662 -43.403 -95.137  1.00 1.58 ? 75  GLU A HG2  1 
ATOM   1155 H  HG3  . GLU A 1 75  ? -32.575 -42.325 -96.011  1.00 1.83 ? 75  GLU A HG3  1 
ATOM   1156 N  N    . GLU A 1 76  ? -30.922 -46.976 -93.947  1.00 0.83 ? 76  GLU A N    1 
ATOM   1157 C  CA   . GLU A 1 76  ? -30.939 -48.432 -94.002  1.00 0.78 ? 76  GLU A CA   1 
ATOM   1158 C  C    . GLU A 1 76  ? -31.716 -49.011 -92.824  1.00 0.65 ? 76  GLU A C    1 
ATOM   1159 O  O    . GLU A 1 76  ? -32.752 -49.651 -93.006  1.00 0.58 ? 76  GLU A O    1 
ATOM   1160 C  CB   . GLU A 1 76  ? -29.511 -48.980 -94.005  1.00 0.90 ? 76  GLU A CB   1 
ATOM   1161 C  CG   . GLU A 1 76  ? -29.435 -50.480 -94.244  1.00 0.99 ? 76  GLU A CG   1 
ATOM   1162 C  CD   . GLU A 1 76  ? -29.938 -50.878 -95.618  1.00 1.29 ? 76  GLU A CD   1 
ATOM   1163 O  OE1  . GLU A 1 76  ? -29.142 -50.823 -96.579  1.00 1.66 ? 76  GLU A OE1  1 
ATOM   1164 O  OE2  . GLU A 1 76  ? -31.126 -51.244 -95.732  1.00 2.10 ? 76  GLU A OE2  1 
ATOM   1165 H  H    . GLU A 1 76  ? -30.070 -46.513 -93.808  1.00 0.88 ? 76  GLU A H    1 
ATOM   1166 H  HA   . GLU A 1 76  ? -31.429 -48.723 -94.919  1.00 0.77 ? 76  GLU A HA   1 
ATOM   1167 H  HB2  . GLU A 1 76  ? -28.949 -48.485 -94.783  1.00 1.14 ? 76  GLU A HB2  1 
ATOM   1168 H  HB3  . GLU A 1 76  ? -29.053 -48.766 -93.051  1.00 0.93 ? 76  GLU A HB3  1 
ATOM   1169 H  HG2  . GLU A 1 76  ? -28.407 -50.795 -94.148  1.00 1.53 ? 76  GLU A HG2  1 
ATOM   1170 H  HG3  . GLU A 1 76  ? -30.035 -50.981 -93.498  1.00 1.31 ? 76  GLU A HG3  1 
ATOM   1171 N  N    . HIS A 1 77  ? -31.212 -48.781 -91.615  1.00 0.70 ? 77  HIS A N    1 
ATOM   1172 C  CA   . HIS A 1 77  ? -31.865 -49.280 -90.412  1.00 0.63 ? 77  HIS A CA   1 
ATOM   1173 C  C    . HIS A 1 77  ? -33.331 -48.861 -90.380  1.00 0.63 ? 77  HIS A C    1 
ATOM   1174 O  O    . HIS A 1 77  ? -34.225 -49.701 -90.284  1.00 0.67 ? 77  HIS A O    1 
ATOM   1175 C  CB   . HIS A 1 77  ? -31.151 -48.770 -89.159  1.00 0.68 ? 77  HIS A CB   1 
ATOM   1176 C  CG   . HIS A 1 77  ? -31.877 -49.090 -87.889  1.00 0.66 ? 77  HIS A CG   1 
ATOM   1177 N  ND1  . HIS A 1 77  ? -31.601 -48.428 -86.719  1.00 0.55 ? 77  HIS A ND1  1 
ATOM   1178 C  CD2  . HIS A 1 77  ? -32.859 -49.997 -87.663  1.00 1.00 ? 77  HIS A CD2  1 
ATOM   1179 C  CE1  . HIS A 1 77  ? -32.413 -48.937 -85.814  1.00 0.92 ? 77  HIS A CE1  1 
ATOM   1180 N  NE2  . HIS A 1 77  ? -33.196 -49.893 -86.338  1.00 1.18 ? 77  HIS A NE2  1 
ATOM   1181 H  H    . HIS A 1 77  ? -30.384 -48.263 -91.532  1.00 0.82 ? 77  HIS A H    1 
ATOM   1182 H  HA   . HIS A 1 77  ? -31.811 -50.358 -90.430  1.00 0.63 ? 77  HIS A HA   1 
ATOM   1183 H  HB2  . HIS A 1 77  ? -30.170 -49.218 -89.104  1.00 1.09 ? 77  HIS A HB2  1 
ATOM   1184 H  HB3  . HIS A 1 77  ? -31.048 -47.696 -89.224  1.00 0.69 ? 77  HIS A HB3  1 
ATOM   1185 H  HD2  . HIS A 1 77  ? -33.295 -50.672 -88.385  1.00 1.17 ? 77  HIS A HD2  1 
ATOM   1186 H  HE1  . HIS A 1 77  ? -32.448 -48.617 -84.786  1.00 1.05 ? 77  HIS A HE1  1 
ATOM   1187 H  HE2  . HIS A 1 77  ? -33.987 -50.286 -85.915  1.00 1.52 ? 77  HIS A HE2  1 
ATOM   1188 N  N    . LYS A 1 78  ? -33.569 -47.556 -90.462  1.00 0.62 ? 78  LYS A N    1 
ATOM   1189 C  CA   . LYS A 1 78  ? -34.927 -47.023 -90.444  1.00 0.66 ? 78  LYS A CA   1 
ATOM   1190 C  C    . LYS A 1 78  ? -35.790 -47.695 -91.506  1.00 0.72 ? 78  LYS A C    1 
ATOM   1191 O  O    . LYS A 1 78  ? -36.923 -48.095 -91.237  1.00 0.87 ? 78  LYS A O    1 
ATOM   1192 C  CB   . LYS A 1 78  ? -34.905 -45.510 -90.671  1.00 0.72 ? 78  LYS A CB   1 
ATOM   1193 C  CG   . LYS A 1 78  ? -35.953 -44.759 -89.866  1.00 0.67 ? 78  LYS A CG   1 
ATOM   1194 C  CD   . LYS A 1 78  ? -36.376 -43.476 -90.562  1.00 1.00 ? 78  LYS A CD   1 
ATOM   1195 C  CE   . LYS A 1 78  ? -35.174 -42.647 -90.984  1.00 0.76 ? 78  LYS A CE   1 
ATOM   1196 N  NZ   . LYS A 1 78  ? -35.539 -41.226 -91.236  1.00 0.95 ? 78  LYS A NZ   1 
ATOM   1197 H  H    . LYS A 1 78  ? -32.814 -46.937 -90.537  1.00 0.62 ? 78  LYS A H    1 
ATOM   1198 H  HA   . LYS A 1 78  ? -35.349 -47.226 -89.471  1.00 0.64 ? 78  LYS A HA   1 
ATOM   1199 H  HB2  . LYS A 1 78  ? -33.932 -45.130 -90.397  1.00 0.93 ? 78  LYS A HB2  1 
ATOM   1200 H  HB3  . LYS A 1 78  ? -35.077 -45.312 -91.718  1.00 0.81 ? 78  LYS A HB3  1 
ATOM   1201 H  HG2  . LYS A 1 78  ? -36.819 -45.392 -89.742  1.00 0.79 ? 78  LYS A HG2  1 
ATOM   1202 H  HG3  . LYS A 1 78  ? -35.542 -44.514 -88.897  1.00 0.78 ? 78  LYS A HG3  1 
ATOM   1203 H  HD2  . LYS A 1 78  ? -36.953 -43.727 -91.440  1.00 1.35 ? 78  LYS A HD2  1 
ATOM   1204 H  HD3  . LYS A 1 78  ? -36.984 -42.894 -89.885  1.00 1.66 ? 78  LYS A HD3  1 
ATOM   1205 H  HE2  . LYS A 1 78  ? -34.433 -42.685 -90.199  1.00 1.09 ? 78  LYS A HE2  1 
ATOM   1206 H  HE3  . LYS A 1 78  ? -34.761 -43.070 -91.888  1.00 0.67 ? 78  LYS A HE3  1 
ATOM   1207 H  HZ1  . LYS A 1 78  ? -35.590 -40.705 -90.336  1.00 1.48 ? 78  LYS A HZ1  1 
ATOM   1208 H  HZ2  . LYS A 1 78  ? -36.464 -41.172 -91.707  1.00 1.60 ? 78  LYS A HZ2  1 
ATOM   1209 H  HZ3  . LYS A 1 78  ? -34.825 -40.776 -91.844  1.00 1.06 ? 78  LYS A HZ3  1 
ATOM   1210 N  N    . LYS A 1 79  ? -35.248 -47.815 -92.713  1.00 0.66 ? 79  LYS A N    1 
ATOM   1211 C  CA   . LYS A 1 79  ? -35.968 -48.438 -93.817  1.00 0.73 ? 79  LYS A CA   1 
ATOM   1212 C  C    . LYS A 1 79  ? -36.573 -49.772 -93.392  1.00 0.72 ? 79  LYS A C    1 
ATOM   1213 O  O    . LYS A 1 79  ? -37.718 -50.080 -93.722  1.00 0.79 ? 79  LYS A O    1 
ATOM   1214 C  CB   . LYS A 1 79  ? -35.033 -48.646 -95.010  1.00 0.79 ? 79  LYS A CB   1 
ATOM   1215 C  CG   . LYS A 1 79  ? -35.403 -49.843 -95.872  1.00 1.59 ? 79  LYS A CG   1 
ATOM   1216 C  CD   . LYS A 1 79  ? -34.827 -49.718 -97.273  1.00 1.53 ? 79  LYS A CD   1 
ATOM   1217 C  CE   . LYS A 1 79  ? -35.384 -48.504 -97.998  1.00 1.71 ? 79  LYS A CE   1 
ATOM   1218 N  NZ   . LYS A 1 79  ? -35.172 -48.591 -99.470  1.00 1.94 ? 79  LYS A NZ   1 
ATOM   1219 H  H    . LYS A 1 79  ? -34.341 -47.476 -92.865  1.00 0.62 ? 79  LYS A H    1 
ATOM   1220 H  HA   . LYS A 1 79  ? -36.766 -47.772 -94.110  1.00 0.78 ? 79  LYS A HA   1 
ATOM   1221 H  HB2  . LYS A 1 79  ? -35.058 -47.762 -95.630  1.00 1.20 ? 79  LYS A HB2  1 
ATOM   1222 H  HB3  . LYS A 1 79  ? -34.028 -48.790 -94.644  1.00 1.31 ? 79  LYS A HB3  1 
ATOM   1223 H  HG2  . LYS A 1 79  ? -35.013 -50.739 -95.412  1.00 2.36 ? 79  LYS A HG2  1 
ATOM   1224 H  HG3  . LYS A 1 79  ? -36.479 -49.908 -95.938  1.00 2.19 ? 79  LYS A HG3  1 
ATOM   1225 H  HD2  . LYS A 1 79  ? -33.754 -49.623 -97.204  1.00 1.83 ? 79  LYS A HD2  1 
ATOM   1226 H  HD3  . LYS A 1 79  ? -35.076 -50.608 -97.834  1.00 2.08 ? 79  LYS A HD3  1 
ATOM   1227 H  HE2  . LYS A 1 79  ? -36.443 -48.437 -97.800  1.00 2.24 ? 79  LYS A HE2  1 
ATOM   1228 H  HE3  . LYS A 1 79  ? -34.891 -47.619 -97.623  1.00 2.26 ? 79  LYS A HE3  1 
ATOM   1229 H  HZ1  . LYS A 1 79  ? -34.155 -48.641 -99.682  1.00 2.50 ? 79  LYS A HZ1  1 
ATOM   1230 H  HZ2  . LYS A 1 79  ? -35.572 -47.753 -99.938  1.00 2.06 ? 79  LYS A HZ2  1 
ATOM   1231 H  HZ3  . LYS A 1 79  ? -35.637 -49.440 -99.848  1.00 2.22 ? 79  LYS A HZ3  1 
ATOM   1232 N  N    . HIS A 1 80  ? -35.795 -50.561 -92.657  1.00 0.70 ? 80  HIS A N    1 
ATOM   1233 C  CA   . HIS A 1 80  ? -36.254 -51.863 -92.187  1.00 0.75 ? 80  HIS A CA   1 
ATOM   1234 C  C    . HIS A 1 80  ? -36.984 -51.736 -90.854  1.00 0.51 ? 80  HIS A C    1 
ATOM   1235 O  O    . HIS A 1 80  ? -37.897 -52.507 -90.559  1.00 0.60 ? 80  HIS A O    1 
ATOM   1236 C  CB   . HIS A 1 80  ? -35.071 -52.823 -92.045  1.00 0.92 ? 80  HIS A CB   1 
ATOM   1237 C  CG   . HIS A 1 80  ? -34.508 -53.276 -93.356  1.00 1.14 ? 80  HIS A CG   1 
ATOM   1238 N  ND1  . HIS A 1 80  ? -34.856 -54.470 -93.953  1.00 1.84 ? 80  HIS A ND1  1 
ATOM   1239 C  CD2  . HIS A 1 80  ? -33.616 -52.688 -94.189  1.00 1.05 ? 80  HIS A CD2  1 
ATOM   1240 C  CE1  . HIS A 1 80  ? -34.202 -54.597 -95.094  1.00 2.03 ? 80  HIS A CE1  1 
ATOM   1241 N  NE2  . HIS A 1 80  ? -33.444 -53.529 -95.260  1.00 1.54 ? 80  HIS A NE2  1 
ATOM   1242 H  H    . HIS A 1 80  ? -34.891 -50.261 -92.427  1.00 0.70 ? 80  HIS A H    1 
ATOM   1243 H  HA   . HIS A 1 80  ? -36.939 -52.257 -92.922  1.00 1.03 ? 80  HIS A HA   1 
ATOM   1244 H  HB2  . HIS A 1 80  ? -34.281 -52.331 -91.497  1.00 0.92 ? 80  HIS A HB2  1 
ATOM   1245 H  HB3  . HIS A 1 80  ? -35.391 -53.698 -91.499  1.00 1.27 ? 80  HIS A HB3  1 
ATOM   1246 H  HD1  . HIS A 1 80  ? -35.488 -55.127 -93.593  1.00 2.22 ? 80  HIS A HD1  1 
ATOM   1247 H  HD2  . HIS A 1 80  ? -33.130 -51.734 -94.037  1.00 1.00 ? 80  HIS A HD2  1 
ATOM   1248 H  HE1  . HIS A 1 80  ? -34.276 -55.432 -95.775  1.00 2.58 ? 80  HIS A HE1  1 
ATOM   1249 H  HE2  . HIS A 1 80  ? -32.925 -53.325 -96.066  1.00 1.69 ? 80  HIS A HE2  1 
ATOM   1250 N  N    . SER A 1 81  ? -36.575 -50.759 -90.051  1.00 0.63 ? 81  SER A N    1 
ATOM   1251 C  CA   . SER A 1 81  ? -37.190 -50.532 -88.749  1.00 0.52 ? 81  SER A CA   1 
ATOM   1252 C  C    . SER A 1 81  ? -36.584 -49.312 -88.064  1.00 0.66 ? 81  SER A C    1 
ATOM   1253 O  O    . SER A 1 81  ? -35.387 -49.051 -88.184  1.00 1.50 ? 81  SER A O    1 
ATOM   1254 C  CB   . SER A 1 81  ? -37.019 -51.765 -87.860  1.00 0.67 ? 81  SER A CB   1 
ATOM   1255 O  OG   . SER A 1 81  ? -38.267 -52.382 -87.597  1.00 1.06 ? 81  SER A OG   1 
ATOM   1256 H  H    . SER A 1 81  ? -35.842 -50.177 -90.341  1.00 0.93 ? 81  SER A H    1 
ATOM   1257 H  HA   . SER A 1 81  ? -38.243 -50.356 -88.906  1.00 0.76 ? 81  SER A HA   1 
ATOM   1258 H  HB2  . SER A 1 81  ? -36.377 -52.478 -88.356  1.00 0.93 ? 81  SER A HB2  1 
ATOM   1259 H  HB3  . SER A 1 81  ? -36.572 -51.470 -86.922  1.00 0.60 ? 81  SER A HB3  1 
ATOM   1260 H  HG   . SER A 1 81  ? -38.133 -53.318 -87.427  1.00 1.13 ? 81  SER A HG   1 
ATOM   1261 N  N    . SER A 1 82  ? -37.417 -48.570 -87.343  1.00 0.82 ? 82  SER A N    1 
ATOM   1262 C  CA   . SER A 1 82  ? -36.963 -47.378 -86.635  1.00 1.02 ? 82  SER A CA   1 
ATOM   1263 C  C    . SER A 1 82  ? -36.663 -47.696 -85.174  1.00 1.19 ? 82  SER A C    1 
ATOM   1264 O  O    . SER A 1 82  ? -36.939 -46.892 -84.284  1.00 1.58 ? 82  SER A O    1 
ATOM   1265 C  CB   . SER A 1 82  ? -38.018 -46.274 -86.723  1.00 1.20 ? 82  SER A CB   1 
ATOM   1266 O  OG   . SER A 1 82  ? -37.414 -45.001 -86.872  1.00 1.31 ? 82  SER A OG   1 
ATOM   1267 H  H    . SER A 1 82  ? -38.360 -48.831 -87.283  1.00 1.39 ? 82  SER A H    1 
ATOM   1268 H  HA   . SER A 1 82  ? -36.056 -47.036 -87.111  1.00 1.06 ? 82  SER A HA   1 
ATOM   1269 H  HB2  . SER A 1 82  ? -38.658 -46.457 -87.573  1.00 1.57 ? 82  SER A HB2  1 
ATOM   1270 H  HB3  . SER A 1 82  ? -38.611 -46.274 -85.820  1.00 1.94 ? 82  SER A HB3  1 
ATOM   1271 H  HG   . SER A 1 82  ? -37.813 -44.543 -87.615  1.00 1.51 ? 82  SER A HG   1 
ATOM   1272 N  N    . GLY A 1 83  ? -36.097 -48.875 -84.934  1.00 1.12 ? 83  GLY A N    1 
ATOM   1273 C  CA   . GLY A 1 83  ? -35.770 -49.279 -83.580  1.00 1.36 ? 83  GLY A CA   1 
ATOM   1274 C  C    . GLY A 1 83  ? -34.863 -48.286 -82.879  1.00 1.32 ? 83  GLY A C    1 
ATOM   1275 O  O    . GLY A 1 83  ? -34.852 -48.208 -81.650  1.00 1.55 ? 83  GLY A O    1 
ATOM   1276 H  H    . GLY A 1 83  ? -35.901 -49.475 -85.683  1.00 1.10 ? 83  GLY A H    1 
ATOM   1277 H  HA2  . GLY A 1 83  ? -36.685 -49.375 -83.014  1.00 1.49 ? 83  GLY A HA2  1 
ATOM   1278 H  HA3  . GLY A 1 83  ? -35.277 -50.239 -83.612  1.00 1.51 ? 83  GLY A HA3  1 
ATOM   1279 N  N    . CYS A 1 84  ? -34.102 -47.524 -83.658  1.00 1.09 ? 84  CYS A N    1 
ATOM   1280 C  CA   . CYS A 1 84  ? -33.191 -46.532 -83.098  1.00 1.08 ? 84  CYS A CA   1 
ATOM   1281 C  C    . CYS A 1 84  ? -33.868 -45.170 -83.014  1.00 1.09 ? 84  CYS A C    1 
ATOM   1282 O  O    . CYS A 1 84  ? -34.048 -44.492 -84.025  1.00 1.46 ? 84  CYS A O    1 
ATOM   1283 C  CB   . CYS A 1 84  ? -31.916 -46.425 -83.943  1.00 1.05 ? 84  CYS A CB   1 
ATOM   1284 S  SG   . CYS A 1 84  ? -30.588 -47.578 -83.457  1.00 1.12 ? 84  CYS A SG   1 
ATOM   1285 H  H    . CYS A 1 84  ? -34.155 -47.630 -84.631  1.00 0.98 ? 84  CYS A H    1 
ATOM   1286 H  HA   . CYS A 1 84  ? -32.927 -46.851 -82.102  1.00 1.10 ? 84  CYS A HA   1 
ATOM   1287 H  HB2  . CYS A 1 84  ? -32.160 -46.624 -84.975  1.00 1.09 ? 84  CYS A HB2  1 
ATOM   1288 H  HB3  . CYS A 1 84  ? -31.526 -45.422 -83.860  1.00 1.06 ? 84  CYS A HB3  1 
ATOM   1289 N  N    . ALA A 1 85  ? -34.234 -44.769 -81.803  1.00 0.77 ? 85  ALA A N    1 
ATOM   1290 C  CA   . ALA A 1 85  ? -34.880 -43.481 -81.593  1.00 0.81 ? 85  ALA A CA   1 
ATOM   1291 C  C    . ALA A 1 85  ? -33.859 -42.347 -81.640  1.00 0.79 ? 85  ALA A C    1 
ATOM   1292 O  O    . ALA A 1 85  ? -34.215 -41.173 -81.546  1.00 1.00 ? 85  ALA A O    1 
ATOM   1293 C  CB   . ALA A 1 85  ? -35.620 -43.472 -80.264  1.00 0.87 ? 85  ALA A CB   1 
ATOM   1294 H  H    . ALA A 1 85  ? -34.059 -45.349 -81.033  1.00 0.60 ? 85  ALA A H    1 
ATOM   1295 H  HA   . ALA A 1 85  ? -35.602 -43.336 -82.383  1.00 0.86 ? 85  ALA A HA   1 
ATOM   1296 H  HB1  . ALA A 1 85  ? -34.938 -43.198 -79.473  1.00 1.08 ? 85  ALA A HB1  1 
ATOM   1297 H  HB2  . ALA A 1 85  ? -36.021 -44.456 -80.069  1.00 1.14 ? 85  ALA A HB2  1 
ATOM   1298 H  HB3  . ALA A 1 85  ? -36.428 -42.756 -80.307  1.00 1.00 ? 85  ALA A HB3  1 
ATOM   1299 N  N    . PHE A 1 86  ? -32.585 -42.708 -81.782  1.00 0.63 ? 86  PHE A N    1 
ATOM   1300 C  CA   . PHE A 1 86  ? -31.510 -41.727 -81.835  1.00 0.61 ? 86  PHE A CA   1 
ATOM   1301 C  C    . PHE A 1 86  ? -31.238 -41.270 -83.269  1.00 0.63 ? 86  PHE A C    1 
ATOM   1302 O  O    . PHE A 1 86  ? -30.634 -40.218 -83.485  1.00 0.68 ? 86  PHE A O    1 
ATOM   1303 C  CB   . PHE A 1 86  ? -30.239 -42.314 -81.223  1.00 0.60 ? 86  PHE A CB   1 
ATOM   1304 C  CG   . PHE A 1 86  ? -29.228 -42.752 -82.242  1.00 0.68 ? 86  PHE A CG   1 
ATOM   1305 C  CD1  . PHE A 1 86  ? -29.355 -43.974 -82.888  1.00 1.27 ? 86  PHE A CD1  1 
ATOM   1306 C  CD2  . PHE A 1 86  ? -28.150 -41.941 -82.554  1.00 1.53 ? 86  PHE A CD2  1 
ATOM   1307 C  CE1  . PHE A 1 86  ? -28.422 -44.374 -83.825  1.00 1.33 ? 86  PHE A CE1  1 
ATOM   1308 C  CE2  . PHE A 1 86  ? -27.215 -42.337 -83.490  1.00 1.78 ? 86  PHE A CE2  1 
ATOM   1309 C  CZ   . PHE A 1 86  ? -27.351 -43.555 -84.126  1.00 1.19 ? 86  PHE A CZ   1 
ATOM   1310 H  H    . PHE A 1 86  ? -32.361 -43.659 -81.846  1.00 0.60 ? 86  PHE A H    1 
ATOM   1311 H  HA   . PHE A 1 86  ? -31.816 -40.872 -81.251  1.00 0.65 ? 86  PHE A HA   1 
ATOM   1312 H  HB2  . PHE A 1 86  ? -29.774 -41.569 -80.594  1.00 0.90 ? 86  PHE A HB2  1 
ATOM   1313 H  HB3  . PHE A 1 86  ? -30.501 -43.172 -80.622  1.00 0.45 ? 86  PHE A HB3  1 
ATOM   1314 H  HD1  . PHE A 1 86  ? -30.194 -44.617 -82.655  1.00 2.10 ? 86  PHE A HD1  1 
ATOM   1315 H  HD2  . PHE A 1 86  ? -28.042 -40.988 -82.057  1.00 2.29 ? 86  PHE A HD2  1 
ATOM   1316 H  HE1  . PHE A 1 86  ? -28.530 -45.327 -84.320  1.00 2.05 ? 86  PHE A HE1  1 
ATOM   1317 H  HE2  . PHE A 1 86  ? -26.379 -41.695 -83.724  1.00 2.68 ? 86  PHE A HE2  1 
ATOM   1318 H  HZ   . PHE A 1 86  ? -26.621 -43.866 -84.857  1.00 1.44 ? 86  PHE A HZ   1 
ATOM   1319 N  N    . LEU A 1 87  ? -31.683 -42.058 -84.247  1.00 0.61 ? 87  LEU A N    1 
ATOM   1320 C  CA   . LEU A 1 87  ? -31.479 -41.714 -85.653  1.00 0.65 ? 87  LEU A CA   1 
ATOM   1321 C  C    . LEU A 1 87  ? -31.854 -40.259 -85.905  1.00 0.74 ? 87  LEU A C    1 
ATOM   1322 O  O    . LEU A 1 87  ? -31.074 -39.492 -86.469  1.00 0.88 ? 87  LEU A O    1 
ATOM   1323 C  CB   . LEU A 1 87  ? -32.312 -42.622 -86.561  1.00 0.65 ? 87  LEU A CB   1 
ATOM   1324 C  CG   . LEU A 1 87  ? -32.132 -44.122 -86.331  1.00 0.59 ? 87  LEU A CG   1 
ATOM   1325 C  CD1  . LEU A 1 87  ? -33.165 -44.909 -87.121  1.00 0.66 ? 87  LEU A CD1  1 
ATOM   1326 C  CD2  . LEU A 1 87  ? -30.726 -44.559 -86.712  1.00 0.60 ? 87  LEU A CD2  1 
ATOM   1327 H  H    . LEU A 1 87  ? -32.158 -42.883 -84.020  1.00 0.58 ? 87  LEU A H    1 
ATOM   1328 H  HA   . LEU A 1 87  ? -30.433 -41.850 -85.882  1.00 0.66 ? 87  LEU A HA   1 
ATOM   1329 H  HB2  . LEU A 1 87  ? -33.355 -42.380 -86.416  1.00 0.68 ? 87  LEU A HB2  1 
ATOM   1330 H  HB3  . LEU A 1 87  ? -32.051 -42.406 -87.587  1.00 0.71 ? 87  LEU A HB3  1 
ATOM   1331 H  HG   . LEU A 1 87  ? -32.279 -44.336 -85.284  1.00 0.57 ? 87  LEU A HG   1 
ATOM   1332 H  HD11 . LEU A 1 87  ? -32.931 -44.852 -88.174  1.00 1.27 ? 87  LEU A HD11 1 
ATOM   1333 H  HD12 . LEU A 1 87  ? -34.146 -44.492 -86.947  1.00 0.94 ? 87  LEU A HD12 1 
ATOM   1334 H  HD13 . LEU A 1 87  ? -33.151 -45.941 -86.805  1.00 0.83 ? 87  LEU A HD13 1 
ATOM   1335 H  HD21 . LEU A 1 87  ? -30.172 -44.809 -85.819  1.00 0.89 ? 87  LEU A HD21 1 
ATOM   1336 H  HD22 . LEU A 1 87  ? -30.227 -43.755 -87.232  1.00 1.08 ? 87  LEU A HD22 1 
ATOM   1337 H  HD23 . LEU A 1 87  ? -30.780 -45.426 -87.356  1.00 0.82 ? 87  LEU A HD23 1 
ATOM   1338 N  N    . SER A 1 88  ? -33.057 -39.890 -85.480  1.00 0.72 ? 88  SER A N    1 
ATOM   1339 C  CA   . SER A 1 88  ? -33.547 -38.527 -85.654  1.00 0.84 ? 88  SER A CA   1 
ATOM   1340 C  C    . SER A 1 88  ? -32.776 -37.553 -84.768  1.00 0.69 ? 88  SER A C    1 
ATOM   1341 O  O    . SER A 1 88  ? -32.503 -36.420 -85.166  1.00 0.83 ? 88  SER A O    1 
ATOM   1342 C  CB   . SER A 1 88  ? -35.040 -38.455 -85.332  1.00 1.18 ? 88  SER A CB   1 
ATOM   1343 O  OG   . SER A 1 88  ? -35.812 -38.326 -86.514  1.00 2.14 ? 88  SER A OG   1 
ATOM   1344 H  H    . SER A 1 88  ? -33.629 -40.552 -85.038  1.00 0.67 ? 88  SER A H    1 
ATOM   1345 H  HA   . SER A 1 88  ? -33.397 -38.251 -86.687  1.00 0.94 ? 88  SER A HA   1 
ATOM   1346 H  HB2  . SER A 1 88  ? -35.340 -39.356 -84.819  1.00 1.55 ? 88  SER A HB2  1 
ATOM   1347 H  HB3  . SER A 1 88  ? -35.229 -37.601 -84.699  1.00 1.37 ? 88  SER A HB3  1 
ATOM   1348 H  HG   . SER A 1 88  ? -35.642 -37.471 -86.916  1.00 2.53 ? 88  SER A HG   1 
ATOM   1349 N  N    . VAL A 1 89  ? -32.430 -38.000 -83.565  1.00 1.04 ? 89  VAL A N    1 
ATOM   1350 C  CA   . VAL A 1 89  ? -31.691 -37.168 -82.622  1.00 0.98 ? 89  VAL A CA   1 
ATOM   1351 C  C    . VAL A 1 89  ? -30.506 -36.488 -83.300  1.00 1.13 ? 89  VAL A C    1 
ATOM   1352 O  O    . VAL A 1 89  ? -29.654 -37.151 -83.894  1.00 1.91 ? 89  VAL A O    1 
ATOM   1353 C  CB   . VAL A 1 89  ? -31.184 -37.992 -81.423  1.00 1.14 ? 89  VAL A CB   1 
ATOM   1354 C  CG1  . VAL A 1 89  ? -29.749 -37.621 -81.080  1.00 1.70 ? 89  VAL A CG1  1 
ATOM   1355 C  CG2  . VAL A 1 89  ? -32.094 -37.798 -80.220  1.00 1.47 ? 89  VAL A CG2  1 
ATOM   1356 H  H    . VAL A 1 89  ? -32.677 -38.912 -83.305  1.00 1.51 ? 89  VAL A H    1 
ATOM   1357 H  HA   . VAL A 1 89  ? -32.364 -36.408 -82.251  1.00 0.94 ? 89  VAL A HA   1 
ATOM   1358 H  HB   . VAL A 1 89  ? -31.205 -39.037 -81.696  1.00 0.89 ? 89  VAL A HB   1 
ATOM   1359 H  HG11 . VAL A 1 89  ? -29.093 -37.943 -81.875  1.00 2.10 ? 89  VAL A HG11 1 
ATOM   1360 H  HG12 . VAL A 1 89  ? -29.463 -38.106 -80.158  1.00 1.60 ? 89  VAL A HG12 1 
ATOM   1361 H  HG13 . VAL A 1 89  ? -29.673 -36.550 -80.961  1.00 2.38 ? 89  VAL A HG13 1 
ATOM   1362 H  HG21 . VAL A 1 89  ? -32.837 -38.581 -80.200  1.00 1.73 ? 89  VAL A HG21 1 
ATOM   1363 H  HG22 . VAL A 1 89  ? -32.584 -36.838 -80.291  1.00 1.59 ? 89  VAL A HG22 1 
ATOM   1364 H  HG23 . VAL A 1 89  ? -31.507 -37.836 -79.314  1.00 2.13 ? 89  VAL A HG23 1 
ATOM   1365 N  N    . LYS A 1 90  ? -30.458 -35.163 -83.209  1.00 1.02 ? 90  LYS A N    1 
ATOM   1366 C  CA   . LYS A 1 90  ? -29.377 -34.394 -83.816  1.00 1.18 ? 90  LYS A CA   1 
ATOM   1367 C  C    . LYS A 1 90  ? -28.771 -33.419 -82.811  1.00 1.11 ? 90  LYS A C    1 
ATOM   1368 O  O    . LYS A 1 90  ? -28.460 -32.277 -83.149  1.00 1.24 ? 90  LYS A O    1 
ATOM   1369 C  CB   . LYS A 1 90  ? -29.890 -33.630 -85.038  1.00 1.36 ? 90  LYS A CB   1 
ATOM   1370 C  CG   . LYS A 1 90  ? -29.874 -34.450 -86.318  1.00 1.56 ? 90  LYS A CG   1 
ATOM   1371 C  CD   . LYS A 1 90  ? -30.387 -33.644 -87.501  1.00 1.74 ? 90  LYS A CD   1 
ATOM   1372 C  CE   . LYS A 1 90  ? -29.270 -33.320 -88.480  1.00 2.14 ? 90  LYS A CE   1 
ATOM   1373 N  NZ   . LYS A 1 90  ? -29.087 -34.397 -89.491  1.00 1.95 ? 90  LYS A NZ   1 
ATOM   1374 H  H    . LYS A 1 90  ? -31.166 -34.691 -82.724  1.00 1.40 ? 90  LYS A H    1 
ATOM   1375 H  HA   . LYS A 1 90  ? -28.613 -35.088 -84.131  1.00 1.37 ? 90  LYS A HA   1 
ATOM   1376 H  HB2  . LYS A 1 90  ? -30.905 -33.314 -84.851  1.00 1.48 ? 90  LYS A HB2  1 
ATOM   1377 H  HB3  . LYS A 1 90  ? -29.272 -32.757 -85.187  1.00 1.93 ? 90  LYS A HB3  1 
ATOM   1378 H  HG2  . LYS A 1 90  ? -28.860 -34.762 -86.521  1.00 1.99 ? 90  LYS A HG2  1 
ATOM   1379 H  HG3  . LYS A 1 90  ? -30.501 -35.319 -86.186  1.00 1.92 ? 90  LYS A HG3  1 
ATOM   1380 H  HD2  . LYS A 1 90  ? -31.145 -34.218 -88.013  1.00 1.96 ? 90  LYS A HD2  1 
ATOM   1381 H  HD3  . LYS A 1 90  ? -30.815 -32.722 -87.137  1.00 2.17 ? 90  LYS A HD3  1 
ATOM   1382 H  HE2  . LYS A 1 90  ? -29.511 -32.399 -88.989  1.00 2.70 ? 90  LYS A HE2  1 
ATOM   1383 H  HE3  . LYS A 1 90  ? -28.350 -33.195 -87.928  1.00 2.75 ? 90  LYS A HE3  1 
ATOM   1384 H  HZ1  . LYS A 1 90  ? -29.692 -35.211 -89.259  1.00 1.94 ? 90  LYS A HZ1  1 
ATOM   1385 H  HZ2  . LYS A 1 90  ? -28.096 -34.710 -89.506  1.00 2.09 ? 90  LYS A HZ2  1 
ATOM   1386 H  HZ3  . LYS A 1 90  ? -29.343 -34.047 -90.437  1.00 2.51 ? 90  LYS A HZ3  1 
ATOM   1387 N  N    . LYS A 1 91  ? -28.605 -33.878 -81.575  1.00 0.99 ? 91  LYS A N    1 
ATOM   1388 C  CA   . LYS A 1 91  ? -28.036 -33.048 -80.520  1.00 0.97 ? 91  LYS A CA   1 
ATOM   1389 C  C    . LYS A 1 91  ? -26.910 -33.783 -79.801  1.00 0.87 ? 91  LYS A C    1 
ATOM   1390 O  O    . LYS A 1 91  ? -27.099 -34.891 -79.300  1.00 0.83 ? 91  LYS A O    1 
ATOM   1391 C  CB   . LYS A 1 91  ? -29.119 -32.645 -79.518  1.00 1.08 ? 91  LYS A CB   1 
ATOM   1392 C  CG   . LYS A 1 91  ? -30.523 -33.036 -79.948  1.00 0.94 ? 91  LYS A CG   1 
ATOM   1393 C  CD   . LYS A 1 91  ? -30.773 -34.522 -79.748  1.00 1.31 ? 91  LYS A CD   1 
ATOM   1394 C  CE   . LYS A 1 91  ? -31.972 -34.767 -78.846  1.00 1.51 ? 91  LYS A CE   1 
ATOM   1395 N  NZ   . LYS A 1 91  ? -33.259 -34.503 -79.547  1.00 1.94 ? 91  LYS A NZ   1 
ATOM   1396 H  H    . LYS A 1 91  ? -28.872 -34.798 -81.367  1.00 0.97 ? 91  LYS A H    1 
ATOM   1397 H  HA   . LYS A 1 91  ? -27.633 -32.158 -80.980  1.00 1.03 ? 91  LYS A HA   1 
ATOM   1398 H  HB2  . LYS A 1 91  ? -28.911 -33.120 -78.570  1.00 1.35 ? 91  LYS A HB2  1 
ATOM   1399 H  HB3  . LYS A 1 91  ? -29.091 -31.573 -79.387  1.00 1.25 ? 91  LYS A HB3  1 
ATOM   1400 H  HG2  . LYS A 1 91  ? -31.237 -32.479 -79.361  1.00 1.18 ? 91  LYS A HG2  1 
ATOM   1401 H  HG3  . LYS A 1 91  ? -30.648 -32.796 -80.994  1.00 1.35 ? 91  LYS A HG3  1 
ATOM   1402 H  HD2  . LYS A 1 91  ? -30.959 -34.979 -80.708  1.00 2.09 ? 91  LYS A HD2  1 
ATOM   1403 H  HD3  . LYS A 1 91  ? -29.898 -34.967 -79.298  1.00 1.64 ? 91  LYS A HD3  1 
ATOM   1404 H  HE2  . LYS A 1 91  ? -31.956 -35.796 -78.519  1.00 1.78 ? 91  LYS A HE2  1 
ATOM   1405 H  HE3  . LYS A 1 91  ? -31.900 -34.117 -77.987  1.00 1.75 ? 91  LYS A HE3  1 
ATOM   1406 H  HZ1  . LYS A 1 91  ? -33.076 -34.106 -80.491  1.00 2.07 ? 91  LYS A HZ1  1 
ATOM   1407 H  HZ2  . LYS A 1 91  ? -33.829 -33.825 -79.004  1.00 2.27 ? 91  LYS A HZ2  1 
ATOM   1408 H  HZ3  . LYS A 1 91  ? -33.797 -35.386 -79.652  1.00 2.40 ? 91  LYS A HZ3  1 
ATOM   1409 N  N    . GLN A 1 92  ? -25.737 -33.158 -79.753  1.00 0.88 ? 92  GLN A N    1 
ATOM   1410 C  CA   . GLN A 1 92  ? -24.581 -33.753 -79.093  1.00 0.85 ? 92  GLN A CA   1 
ATOM   1411 C  C    . GLN A 1 92  ? -24.955 -34.278 -77.711  1.00 0.82 ? 92  GLN A C    1 
ATOM   1412 O  O    . GLN A 1 92  ? -25.951 -33.854 -77.125  1.00 0.84 ? 92  GLN A O    1 
ATOM   1413 C  CB   . GLN A 1 92  ? -23.451 -32.729 -78.975  1.00 0.95 ? 92  GLN A CB   1 
ATOM   1414 C  CG   . GLN A 1 92  ? -22.979 -32.187 -80.314  1.00 0.93 ? 92  GLN A CG   1 
ATOM   1415 C  CD   . GLN A 1 92  ? -21.929 -33.068 -80.961  1.00 1.62 ? 92  GLN A CD   1 
ATOM   1416 O  OE1  . GLN A 1 92  ? -22.242 -34.121 -81.516  1.00 2.23 ? 92  GLN A OE1  1 
ATOM   1417 N  NE2  . GLN A 1 92  ? -20.673 -32.641 -80.893  1.00 2.29 ? 92  GLN A NE2  1 
ATOM   1418 H  H    . GLN A 1 92  ? -25.648 -32.276 -80.170  1.00 0.95 ? 92  GLN A H    1 
ATOM   1419 H  HA   . GLN A 1 92  ? -24.243 -34.580 -79.700  1.00 0.83 ? 92  GLN A HA   1 
ATOM   1420 H  HB2  . GLN A 1 92  ? -23.795 -31.898 -78.376  1.00 1.09 ? 92  GLN A HB2  1 
ATOM   1421 H  HB3  . GLN A 1 92  ? -22.610 -33.193 -78.481  1.00 1.08 ? 92  GLN A HB3  1 
ATOM   1422 H  HG2  . GLN A 1 92  ? -23.827 -32.116 -80.979  1.00 1.07 ? 92  GLN A HG2  1 
ATOM   1423 H  HG3  . GLN A 1 92  ? -22.559 -31.204 -80.162  1.00 1.18 ? 92  GLN A HG3  1 
ATOM   1424 H  HE21 . GLN A 1 92  ? -20.498 -31.792 -80.435  1.00 2.58 ? 92  GLN A HE21 1 
ATOM   1425 H  HE22 . GLN A 1 92  ? -19.974 -33.191 -81.304  1.00 2.81 ? 92  GLN A HE22 1 
ATOM   1426 N  N    . PHE A 1 93  ? -24.151 -35.202 -77.197  1.00 0.82 ? 93  PHE A N    1 
ATOM   1427 C  CA   . PHE A 1 93  ? -24.399 -35.785 -75.883  1.00 0.82 ? 93  PHE A CA   1 
ATOM   1428 C  C    . PHE A 1 93  ? -24.685 -34.700 -74.851  1.00 0.77 ? 93  PHE A C    1 
ATOM   1429 O  O    . PHE A 1 93  ? -25.617 -34.817 -74.055  1.00 0.71 ? 93  PHE A O    1 
ATOM   1430 C  CB   . PHE A 1 93  ? -23.199 -36.624 -75.439  1.00 0.84 ? 93  PHE A CB   1 
ATOM   1431 C  CG   . PHE A 1 93  ? -23.512 -37.571 -74.316  1.00 0.94 ? 93  PHE A CG   1 
ATOM   1432 C  CD1  . PHE A 1 93  ? -23.728 -37.096 -73.032  1.00 0.99 ? 93  PHE A CD1  1 
ATOM   1433 C  CD2  . PHE A 1 93  ? -23.591 -38.935 -74.545  1.00 1.66 ? 93  PHE A CD2  1 
ATOM   1434 C  CE1  . PHE A 1 93  ? -24.017 -37.965 -71.997  1.00 1.00 ? 93  PHE A CE1  1 
ATOM   1435 C  CE2  . PHE A 1 93  ? -23.879 -39.809 -73.513  1.00 1.83 ? 93  PHE A CE2  1 
ATOM   1436 C  CZ   . PHE A 1 93  ? -24.093 -39.323 -72.238  1.00 1.23 ? 93  PHE A CZ   1 
ATOM   1437 H  H    . PHE A 1 93  ? -23.373 -35.500 -77.713  1.00 0.83 ? 93  PHE A H    1 
ATOM   1438 H  HA   . PHE A 1 93  ? -25.264 -36.426 -75.963  1.00 0.86 ? 93  PHE A HA   1 
ATOM   1439 H  HB2  . PHE A 1 93  ? -22.846 -37.207 -76.276  1.00 0.88 ? 93  PHE A HB2  1 
ATOM   1440 H  HB3  . PHE A 1 93  ? -22.410 -35.963 -75.108  1.00 0.81 ? 93  PHE A HB3  1 
ATOM   1441 H  HD1  . PHE A 1 93  ? -23.669 -36.035 -72.843  1.00 1.51 ? 93  PHE A HD1  1 
ATOM   1442 H  HD2  . PHE A 1 93  ? -23.424 -39.316 -75.541  1.00 2.24 ? 93  PHE A HD2  1 
ATOM   1443 H  HE1  . PHE A 1 93  ? -24.183 -37.582 -71.001  1.00 1.39 ? 93  PHE A HE1  1 
ATOM   1444 H  HE2  . PHE A 1 93  ? -23.938 -40.870 -73.704  1.00 2.55 ? 93  PHE A HE2  1 
ATOM   1445 H  HZ   . PHE A 1 93  ? -24.318 -40.004 -71.431  1.00 1.36 ? 93  PHE A HZ   1 
ATOM   1446 N  N    . GLU A 1 94  ? -23.877 -33.644 -74.869  1.00 0.81 ? 94  GLU A N    1 
ATOM   1447 C  CA   . GLU A 1 94  ? -24.043 -32.536 -73.934  1.00 0.79 ? 94  GLU A CA   1 
ATOM   1448 C  C    . GLU A 1 94  ? -24.971 -31.461 -74.500  1.00 0.88 ? 94  GLU A C    1 
ATOM   1449 O  O    . GLU A 1 94  ? -24.963 -30.321 -74.037  1.00 1.29 ? 94  GLU A O    1 
ATOM   1450 C  CB   . GLU A 1 94  ? -22.684 -31.923 -73.595  1.00 0.68 ? 94  GLU A CB   1 
ATOM   1451 C  CG   . GLU A 1 94  ? -21.812 -32.818 -72.729  1.00 0.77 ? 94  GLU A CG   1 
ATOM   1452 C  CD   . GLU A 1 94  ? -20.654 -33.424 -73.497  1.00 0.90 ? 94  GLU A CD   1 
ATOM   1453 O  OE1  . GLU A 1 94  ? -20.867 -33.858 -74.648  1.00 1.08 ? 94  GLU A OE1  1 
ATOM   1454 O  OE2  . GLU A 1 94  ? -19.533 -33.464 -72.946  1.00 1.83 ? 94  GLU A OE2  1 
ATOM   1455 H  H    . GLU A 1 94  ? -23.152 -33.609 -75.528  1.00 0.87 ? 94  GLU A H    1 
ATOM   1456 H  HA   . GLU A 1 94  ? -24.482 -32.932 -73.031  1.00 0.87 ? 94  GLU A HA   1 
ATOM   1457 H  HB2  . GLU A 1 94  ? -22.153 -31.721 -74.514  1.00 0.65 ? 94  GLU A HB2  1 
ATOM   1458 H  HB3  . GLU A 1 94  ? -22.842 -30.993 -73.069  1.00 0.75 ? 94  GLU A HB3  1 
ATOM   1459 H  HG2  . GLU A 1 94  ? -21.416 -32.232 -71.913  1.00 1.04 ? 94  GLU A HG2  1 
ATOM   1460 H  HG3  . GLU A 1 94  ? -22.421 -33.618 -72.334  1.00 1.07 ? 94  GLU A HG3  1 
ATOM   1461 N  N    . GLU A 1 95  ? -25.770 -31.826 -75.500  1.00 0.84 ? 95  GLU A N    1 
ATOM   1462 C  CA   . GLU A 1 95  ? -26.696 -30.883 -76.117  1.00 0.88 ? 95  GLU A CA   1 
ATOM   1463 C  C    . GLU A 1 95  ? -28.141 -31.250 -75.795  1.00 1.03 ? 95  GLU A C    1 
ATOM   1464 O  O    . GLU A 1 95  ? -28.940 -30.392 -75.417  1.00 1.32 ? 95  GLU A O    1 
ATOM   1465 C  CB   . GLU A 1 95  ? -26.492 -30.852 -77.633  1.00 0.86 ? 95  GLU A CB   1 
ATOM   1466 C  CG   . GLU A 1 95  ? -25.908 -29.544 -78.141  1.00 1.53 ? 95  GLU A CG   1 
ATOM   1467 C  CD   . GLU A 1 95  ? -26.453 -29.151 -79.499  1.00 1.84 ? 95  GLU A CD   1 
ATOM   1468 O  OE1  . GLU A 1 95  ? -26.192 -29.883 -80.478  1.00 2.59 ? 95  GLU A OE1  1 
ATOM   1469 O  OE2  . GLU A 1 95  ? -27.143 -28.113 -79.585  1.00 2.18 ? 95  GLU A OE2  1 
ATOM   1470 H  H    . GLU A 1 95  ? -25.737 -32.746 -75.831  1.00 1.04 ? 95  GLU A H    1 
ATOM   1471 H  HA   . GLU A 1 95  ? -26.489 -29.903 -75.714  1.00 0.90 ? 95  GLU A HA   1 
ATOM   1472 H  HB2  . GLU A 1 95  ? -25.822 -31.652 -77.910  1.00 0.88 ? 95  GLU A HB2  1 
ATOM   1473 H  HB3  . GLU A 1 95  ? -27.445 -31.007 -78.116  1.00 0.95 ? 95  GLU A HB3  1 
ATOM   1474 H  HG2  . GLU A 1 95  ? -26.144 -28.761 -77.436  1.00 2.10 ? 95  GLU A HG2  1 
ATOM   1475 H  HG3  . GLU A 1 95  ? -24.835 -29.649 -78.216  1.00 2.16 ? 95  GLU A HG3  1 
ATOM   1476 N  N    . LEU A 1 96  ? -28.471 -32.528 -75.947  1.00 1.16 ? 96  LEU A N    1 
ATOM   1477 C  CA   . LEU A 1 96  ? -29.822 -33.004 -75.671  1.00 1.32 ? 96  LEU A CA   1 
ATOM   1478 C  C    . LEU A 1 96  ? -30.158 -32.848 -74.191  1.00 1.17 ? 96  LEU A C    1 
ATOM   1479 O  O    . LEU A 1 96  ? -29.299 -32.493 -73.384  1.00 1.11 ? 96  LEU A O    1 
ATOM   1480 C  CB   . LEU A 1 96  ? -29.975 -34.468 -76.094  1.00 1.57 ? 96  LEU A CB   1 
ATOM   1481 C  CG   . LEU A 1 96  ? -28.790 -35.378 -75.760  1.00 1.08 ? 96  LEU A CG   1 
ATOM   1482 C  CD1  . LEU A 1 96  ? -28.414 -35.254 -74.292  1.00 1.49 ? 96  LEU A CD1  1 
ATOM   1483 C  CD2  . LEU A 1 96  ? -29.117 -36.822 -76.108  1.00 0.93 ? 96  LEU A CD2  1 
ATOM   1484 H  H    . LEU A 1 96  ? -27.791 -33.163 -76.252  1.00 1.35 ? 96  LEU A H    1 
ATOM   1485 H  HA   . LEU A 1 96  ? -30.508 -32.400 -76.246  1.00 1.46 ? 96  LEU A HA   1 
ATOM   1486 H  HB2  . LEU A 1 96  ? -30.855 -34.869 -75.611  1.00 1.98 ? 96  LEU A HB2  1 
ATOM   1487 H  HB3  . LEU A 1 96  ? -30.130 -34.496 -77.162  1.00 2.18 ? 96  LEU A HB3  1 
ATOM   1488 H  HG   . LEU A 1 96  ? -27.936 -35.077 -76.350  1.00 1.15 ? 96  LEU A HG   1 
ATOM   1489 H  HD11 . LEU A 1 96  ? -29.309 -35.274 -73.688  1.00 1.86 ? 96  LEU A HD11 1 
ATOM   1490 H  HD12 . LEU A 1 96  ? -27.892 -34.322 -74.131  1.00 2.15 ? 96  LEU A HD12 1 
ATOM   1491 H  HD13 . LEU A 1 96  ? -27.773 -36.077 -74.014  1.00 1.63 ? 96  LEU A HD13 1 
ATOM   1492 H  HD21 . LEU A 1 96  ? -29.663 -36.852 -77.040  1.00 1.26 ? 96  LEU A HD21 1 
ATOM   1493 H  HD22 . LEU A 1 96  ? -29.719 -37.254 -75.323  1.00 1.26 ? 96  LEU A HD22 1 
ATOM   1494 H  HD23 . LEU A 1 96  ? -28.200 -37.384 -76.210  1.00 1.55 ? 96  LEU A HD23 1 
ATOM   1495 N  N    . THR A 1 97  ? -31.413 -33.112 -73.842  1.00 1.18 ? 97  THR A N    1 
ATOM   1496 C  CA   . THR A 1 97  ? -31.859 -32.996 -72.459  1.00 1.10 ? 97  THR A CA   1 
ATOM   1497 C  C    . THR A 1 97  ? -31.865 -34.353 -71.761  1.00 1.03 ? 97  THR A C    1 
ATOM   1498 O  O    . THR A 1 97  ? -32.045 -35.390 -72.399  1.00 0.99 ? 97  THR A O    1 
ATOM   1499 C  CB   . THR A 1 97  ? -33.268 -32.382 -72.372  1.00 1.15 ? 97  THR A CB   1 
ATOM   1500 O  OG1  . THR A 1 97  ? -33.664 -31.881 -73.655  1.00 2.07 ? 97  THR A OG1  1 
ATOM   1501 C  CG2  . THR A 1 97  ? -33.305 -31.256 -71.350  1.00 1.10 ? 97  THR A CG2  1 
ATOM   1502 H  H    . THR A 1 97  ? -32.054 -33.389 -74.530  1.00 1.29 ? 97  THR A H    1 
ATOM   1503 H  HA   . THR A 1 97  ? -31.173 -32.342 -71.942  1.00 1.10 ? 97  THR A HA   1 
ATOM   1504 H  HB   . THR A 1 97  ? -33.961 -33.150 -72.064  1.00 1.34 ? 97  THR A HB   1 
ATOM   1505 H  HG1  . THR A 1 97  ? -33.242 -31.033 -73.812  1.00 2.43 ? 97  THR A HG1  1 
ATOM   1506 H  HG21 . THR A 1 97  ? -32.305 -30.876 -71.196  1.00 1.37 ? 97  THR A HG21 1 
ATOM   1507 H  HG22 . THR A 1 97  ? -33.695 -31.632 -70.415  1.00 1.39 ? 97  THR A HG22 1 
ATOM   1508 H  HG23 . THR A 1 97  ? -33.940 -30.462 -71.711  1.00 1.67 ? 97  THR A HG23 1 
ATOM   1509 N  N    . LEU A 1 98  ? -31.668 -34.334 -70.446  1.00 1.07 ? 98  LEU A N    1 
ATOM   1510 C  CA   . LEU A 1 98  ? -31.652 -35.561 -69.656  1.00 1.03 ? 98  LEU A CA   1 
ATOM   1511 C  C    . LEU A 1 98  ? -32.905 -36.391 -69.914  1.00 0.98 ? 98  LEU A C    1 
ATOM   1512 O  O    . LEU A 1 98  ? -32.827 -37.599 -70.134  1.00 1.02 ? 98  LEU A O    1 
ATOM   1513 C  CB   . LEU A 1 98  ? -31.545 -35.229 -68.166  1.00 1.05 ? 98  LEU A CB   1 
ATOM   1514 C  CG   . LEU A 1 98  ? -30.195 -35.555 -67.523  1.00 1.03 ? 98  LEU A CG   1 
ATOM   1515 C  CD1  . LEU A 1 98  ? -29.872 -37.032 -67.677  1.00 1.05 ? 98  LEU A CD1  1 
ATOM   1516 C  CD2  . LEU A 1 98  ? -29.094 -34.700 -68.133  1.00 1.06 ? 98  LEU A CD2  1 
ATOM   1517 H  H    . LEU A 1 98  ? -31.532 -33.475 -69.996  1.00 1.14 ? 98  LEU A H    1 
ATOM   1518 H  HA   . LEU A 1 98  ? -30.786 -36.135 -69.952  1.00 1.05 ? 98  LEU A HA   1 
ATOM   1519 H  HB2  . LEU A 1 98  ? -31.735 -34.173 -68.040  1.00 1.09 ? 98  LEU A HB2  1 
ATOM   1520 H  HB3  . LEU A 1 98  ? -32.310 -35.781 -67.641  1.00 1.06 ? 98  LEU A HB3  1 
ATOM   1521 H  HG   . LEU A 1 98  ? -30.245 -35.333 -66.467  1.00 1.00 ? 98  LEU A HG   1 
ATOM   1522 H  HD11 . LEU A 1 98  ? -29.671 -37.251 -68.715  1.00 1.46 ? 98  LEU A HD11 1 
ATOM   1523 H  HD12 . LEU A 1 98  ? -30.713 -37.621 -67.342  1.00 1.54 ? 98  LEU A HD12 1 
ATOM   1524 H  HD13 . LEU A 1 98  ? -29.003 -37.275 -67.083  1.00 1.35 ? 98  LEU A HD13 1 
ATOM   1525 H  HD21 . LEU A 1 98  ? -29.453 -34.250 -69.047  1.00 1.13 ? 98  LEU A HD21 1 
ATOM   1526 H  HD22 . LEU A 1 98  ? -28.236 -35.319 -68.349  1.00 1.11 ? 98  LEU A HD22 1 
ATOM   1527 H  HD23 . LEU A 1 98  ? -28.813 -33.925 -67.436  1.00 1.28 ? 98  LEU A HD23 1 
ATOM   1528 N  N    . GLY A 1 99  ? -34.060 -35.733 -69.885  1.00 0.90 ? 99  GLY A N    1 
ATOM   1529 C  CA   . GLY A 1 99  ? -35.314 -36.425 -70.116  1.00 0.85 ? 99  GLY A CA   1 
ATOM   1530 C  C    . GLY A 1 99  ? -35.266 -37.317 -71.341  1.00 0.93 ? 99  GLY A C    1 
ATOM   1531 O  O    . GLY A 1 99  ? -35.798 -38.427 -71.331  1.00 1.00 ? 99  GLY A O    1 
ATOM   1532 H  H    . GLY A 1 99  ? -34.060 -34.770 -69.704  1.00 0.88 ? 99  GLY A H    1 
ATOM   1533 H  HA2  . GLY A 1 99  ? -35.543 -37.031 -69.252  1.00 0.79 ? 99  GLY A HA2  1 
ATOM   1534 H  HA3  . GLY A 1 99  ? -36.097 -35.694 -70.247  1.00 0.82 ? 99  GLY A HA3  1 
ATOM   1535 N  N    . GLU A 1 100 ? -34.625 -36.830 -72.399  1.00 0.94 ? 100 GLU A N    1 
ATOM   1536 C  CA   . GLU A 1 100 ? -34.509 -37.591 -73.638  1.00 1.02 ? 100 GLU A CA   1 
ATOM   1537 C  C    . GLU A 1 100 ? -33.488 -38.715 -73.491  1.00 1.04 ? 100 GLU A C    1 
ATOM   1538 O  O    . GLU A 1 100 ? -33.615 -39.767 -74.116  1.00 1.11 ? 100 GLU A O    1 
ATOM   1539 C  CB   . GLU A 1 100 ? -34.107 -36.670 -74.791  1.00 1.08 ? 100 GLU A CB   1 
ATOM   1540 C  CG   . GLU A 1 100 ? -34.088 -37.362 -76.144  1.00 1.15 ? 100 GLU A CG   1 
ATOM   1541 C  CD   . GLU A 1 100 ? -35.072 -36.753 -77.124  1.00 1.67 ? 100 GLU A CD   1 
ATOM   1542 O  OE1  . GLU A 1 100 ? -35.145 -35.508 -77.195  1.00 2.17 ? 100 GLU A OE1  1 
ATOM   1543 O  OE2  . GLU A 1 100 ? -35.769 -37.520 -77.820  1.00 2.36 ? 100 GLU A OE2  1 
ATOM   1544 H  H    . GLU A 1 100 ? -34.221 -35.939 -72.346  1.00 0.90 ? 100 GLU A H    1 
ATOM   1545 H  HA   . GLU A 1 100 ? -35.474 -38.023 -73.853  1.00 1.03 ? 100 GLU A HA   1 
ATOM   1546 H  HB2  . GLU A 1 100 ? -34.807 -35.848 -74.841  1.00 1.49 ? 100 GLU A HB2  1 
ATOM   1547 H  HB3  . GLU A 1 100 ? -33.120 -36.278 -74.597  1.00 1.25 ? 100 GLU A HB3  1 
ATOM   1548 H  HG2  . GLU A 1 100 ? -33.095 -37.284 -76.560  1.00 1.78 ? 100 GLU A HG2  1 
ATOM   1549 H  HG3  . GLU A 1 100 ? -34.339 -38.403 -76.005  1.00 1.53 ? 100 GLU A HG3  1 
ATOM   1550 N  N    . PHE A 1 101 ? -32.477 -38.484 -72.660  1.00 0.99 ? 101 PHE A N    1 
ATOM   1551 C  CA   . PHE A 1 101 ? -31.434 -39.478 -72.431  1.00 1.02 ? 101 PHE A CA   1 
ATOM   1552 C  C    . PHE A 1 101 ? -32.006 -40.720 -71.755  1.00 0.99 ? 101 PHE A C    1 
ATOM   1553 O  O    . PHE A 1 101 ? -31.843 -41.837 -72.246  1.00 1.03 ? 101 PHE A O    1 
ATOM   1554 C  CB   . PHE A 1 101 ? -30.314 -38.887 -71.574  1.00 1.06 ? 101 PHE A CB   1 
ATOM   1555 C  CG   . PHE A 1 101 ? -29.250 -39.882 -71.209  1.00 1.01 ? 101 PHE A CG   1 
ATOM   1556 C  CD1  . PHE A 1 101 ? -28.687 -40.698 -72.176  1.00 1.39 ? 101 PHE A CD1  1 
ATOM   1557 C  CD2  . PHE A 1 101 ? -28.815 -40.002 -69.899  1.00 1.68 ? 101 PHE A CD2  1 
ATOM   1558 C  CE1  . PHE A 1 101 ? -27.708 -41.616 -71.844  1.00 1.37 ? 101 PHE A CE1  1 
ATOM   1559 C  CE2  . PHE A 1 101 ? -27.837 -40.918 -69.561  1.00 1.71 ? 101 PHE A CE2  1 
ATOM   1560 C  CZ   . PHE A 1 101 ? -27.283 -41.726 -70.535  1.00 1.04 ? 101 PHE A CZ   1 
ATOM   1561 H  H    . PHE A 1 101 ? -32.430 -37.626 -72.189  1.00 0.95 ? 101 PHE A H    1 
ATOM   1562 H  HA   . PHE A 1 101 ? -31.029 -39.760 -73.391  1.00 1.06 ? 101 PHE A HA   1 
ATOM   1563 H  HB2  . PHE A 1 101 ? -29.843 -38.080 -72.115  1.00 1.05 ? 101 PHE A HB2  1 
ATOM   1564 H  HB3  . PHE A 1 101 ? -30.737 -38.500 -70.658  1.00 1.19 ? 101 PHE A HB3  1 
ATOM   1565 H  HD1  . PHE A 1 101 ? -29.018 -40.613 -73.200  1.00 2.15 ? 101 PHE A HD1  1 
ATOM   1566 H  HD2  . PHE A 1 101 ? -29.247 -39.371 -69.137  1.00 2.47 ? 101 PHE A HD2  1 
ATOM   1567 H  HE1  . PHE A 1 101 ? -27.277 -42.246 -72.607  1.00 2.10 ? 101 PHE A HE1  1 
ATOM   1568 H  HE2  . PHE A 1 101 ? -27.506 -41.002 -68.536  1.00 2.53 ? 101 PHE A HE2  1 
ATOM   1569 H  HZ   . PHE A 1 101 ? -26.518 -42.442 -70.273  1.00 1.08 ? 101 PHE A HZ   1 
ATOM   1570 N  N    . LEU A 1 102 ? -32.675 -40.518 -70.624  1.00 0.96 ? 102 LEU A N    1 
ATOM   1571 C  CA   . LEU A 1 102 ? -33.270 -41.622 -69.881  1.00 0.96 ? 102 LEU A CA   1 
ATOM   1572 C  C    . LEU A 1 102 ? -34.330 -42.332 -70.717  1.00 0.87 ? 102 LEU A C    1 
ATOM   1573 O  O    . LEU A 1 102 ? -34.397 -43.561 -70.736  1.00 0.85 ? 102 LEU A O    1 
ATOM   1574 C  CB   . LEU A 1 102 ? -33.888 -41.112 -68.577  1.00 1.03 ? 102 LEU A CB   1 
ATOM   1575 C  CG   . LEU A 1 102 ? -32.921 -41.020 -67.395  1.00 0.94 ? 102 LEU A CG   1 
ATOM   1576 C  CD1  . LEU A 1 102 ? -32.508 -42.409 -66.934  1.00 1.41 ? 102 LEU A CD1  1 
ATOM   1577 C  CD2  . LEU A 1 102 ? -31.698 -40.197 -67.772  1.00 0.87 ? 102 LEU A CD2  1 
ATOM   1578 H  H    . LEU A 1 102 ? -32.771 -39.604 -70.283  1.00 0.95 ? 102 LEU A H    1 
ATOM   1579 H  HA   . LEU A 1 102 ? -32.485 -42.324 -69.646  1.00 1.01 ? 102 LEU A HA   1 
ATOM   1580 H  HB2  . LEU A 1 102 ? -34.298 -40.129 -68.758  1.00 1.17 ? 102 LEU A HB2  1 
ATOM   1581 H  HB3  . LEU A 1 102 ? -34.694 -41.775 -68.302  1.00 1.16 ? 102 LEU A HB3  1 
ATOM   1582 H  HG   . LEU A 1 102 ? -33.416 -40.528 -66.571  1.00 1.22 ? 102 LEU A HG   1 
ATOM   1583 H  HD11 . LEU A 1 102 ? -33.367 -42.924 -66.529  1.00 1.95 ? 102 LEU A HD11 1 
ATOM   1584 H  HD12 . LEU A 1 102 ? -31.748 -42.325 -66.171  1.00 1.87 ? 102 LEU A HD12 1 
ATOM   1585 H  HD13 . LEU A 1 102 ? -32.117 -42.966 -67.772  1.00 1.62 ? 102 LEU A HD13 1 
ATOM   1586 H  HD21 . LEU A 1 102 ? -31.006 -40.813 -68.326  1.00 1.07 ? 102 LEU A HD21 1 
ATOM   1587 H  HD22 . LEU A 1 102 ? -31.218 -39.834 -66.875  1.00 1.59 ? 102 LEU A HD22 1 
ATOM   1588 H  HD23 . LEU A 1 102 ? -32.002 -39.359 -68.382  1.00 1.39 ? 102 LEU A HD23 1 
ATOM   1589 N  N    . LYS A 1 103 ? -35.154 -41.552 -71.408  1.00 0.84 ? 103 LYS A N    1 
ATOM   1590 C  CA   . LYS A 1 103 ? -36.208 -42.110 -72.247  1.00 0.77 ? 103 LYS A CA   1 
ATOM   1591 C  C    . LYS A 1 103 ? -35.647 -43.171 -73.188  1.00 0.71 ? 103 LYS A C    1 
ATOM   1592 O  O    . LYS A 1 103 ? -36.341 -44.118 -73.556  1.00 0.70 ? 103 LYS A O    1 
ATOM   1593 C  CB   . LYS A 1 103 ? -36.887 -41.002 -73.054  1.00 0.78 ? 103 LYS A CB   1 
ATOM   1594 C  CG   . LYS A 1 103 ? -38.403 -41.021 -72.959  1.00 0.96 ? 103 LYS A CG   1 
ATOM   1595 C  CD   . LYS A 1 103 ? -39.038 -40.102 -73.990  1.00 1.26 ? 103 LYS A CD   1 
ATOM   1596 C  CE   . LYS A 1 103 ? -39.854 -40.885 -75.006  1.00 1.62 ? 103 LYS A CE   1 
ATOM   1597 N  NZ   . LYS A 1 103 ? -41.139 -41.370 -74.431  1.00 1.76 ? 103 LYS A NZ   1 
ATOM   1598 H  H    . LYS A 1 103 ? -35.050 -40.579 -71.353  1.00 0.88 ? 103 LYS A H    1 
ATOM   1599 H  HA   . LYS A 1 103 ? -36.939 -42.570 -71.599  1.00 0.80 ? 103 LYS A HA   1 
ATOM   1600 H  HB2  . LYS A 1 103 ? -36.537 -40.045 -72.696  1.00 1.00 ? 103 LYS A HB2  1 
ATOM   1601 H  HB3  . LYS A 1 103 ? -36.612 -41.109 -74.093  1.00 1.00 ? 103 LYS A HB3  1 
ATOM   1602 H  HG2  . LYS A 1 103 ? -38.753 -42.028 -73.126  1.00 1.47 ? 103 LYS A HG2  1 
ATOM   1603 H  HG3  . LYS A 1 103 ? -38.696 -40.695 -71.971  1.00 1.69 ? 103 LYS A HG3  1 
ATOM   1604 H  HD2  . LYS A 1 103 ? -39.687 -39.402 -73.485  1.00 1.89 ? 103 LYS A HD2  1 
ATOM   1605 H  HD3  . LYS A 1 103 ? -38.257 -39.563 -74.507  1.00 1.76 ? 103 LYS A HD3  1 
ATOM   1606 H  HE2  . LYS A 1 103 ? -40.067 -40.244 -75.849  1.00 2.37 ? 103 LYS A HE2  1 
ATOM   1607 H  HE3  . LYS A 1 103 ? -39.274 -41.733 -75.338  1.00 1.99 ? 103 LYS A HE3  1 
ATOM   1608 H  HZ1  . LYS A 1 103 ? -41.432 -40.758 -73.644  1.00 1.88 ? 103 LYS A HZ1  1 
ATOM   1609 H  HZ2  . LYS A 1 103 ? -41.027 -42.342 -74.077  1.00 2.04 ? 103 LYS A HZ2  1 
ATOM   1610 H  HZ3  . LYS A 1 103 ? -41.882 -41.362 -75.159  1.00 2.35 ? 103 LYS A HZ3  1 
ATOM   1611 N  N    . LEU A 1 104 ? -34.386 -43.004 -73.573  1.00 0.68 ? 104 LEU A N    1 
ATOM   1612 C  CA   . LEU A 1 104 ? -33.728 -43.946 -74.471  1.00 0.65 ? 104 LEU A CA   1 
ATOM   1613 C  C    . LEU A 1 104 ? -33.513 -45.292 -73.785  1.00 0.67 ? 104 LEU A C    1 
ATOM   1614 O  O    . LEU A 1 104 ? -33.754 -46.345 -74.374  1.00 0.64 ? 104 LEU A O    1 
ATOM   1615 C  CB   . LEU A 1 104 ? -32.386 -43.382 -74.941  1.00 0.71 ? 104 LEU A CB   1 
ATOM   1616 C  CG   . LEU A 1 104 ? -32.470 -42.086 -75.751  1.00 0.71 ? 104 LEU A CG   1 
ATOM   1617 C  CD1  . LEU A 1 104 ? -31.443 -42.091 -76.873  1.00 0.79 ? 104 LEU A CD1  1 
ATOM   1618 C  CD2  . LEU A 1 104 ? -33.871 -41.894 -76.312  1.00 0.68 ? 104 LEU A CD2  1 
ATOM   1619 H  H    . LEU A 1 104 ? -33.884 -42.229 -73.245  1.00 0.71 ? 104 LEU A H    1 
ATOM   1620 H  HA   . LEU A 1 104 ? -34.369 -44.092 -75.327  1.00 0.60 ? 104 LEU A HA   1 
ATOM   1621 H  HB2  . LEU A 1 104 ? -31.774 -43.197 -74.070  1.00 0.74 ? 104 LEU A HB2  1 
ATOM   1622 H  HB3  . LEU A 1 104 ? -31.898 -44.129 -75.550  1.00 0.73 ? 104 LEU A HB3  1 
ATOM   1623 H  HG   . LEU A 1 104 ? -32.250 -41.251 -75.103  1.00 0.75 ? 104 LEU A HG   1 
ATOM   1624 H  HD11 . LEU A 1 104 ? -31.847 -42.612 -77.729  1.00 1.02 ? 104 LEU A HD11 1 
ATOM   1625 H  HD12 . LEU A 1 104 ? -30.546 -42.591 -76.538  1.00 1.43 ? 104 LEU A HD12 1 
ATOM   1626 H  HD13 . LEU A 1 104 ? -31.206 -41.074 -77.149  1.00 1.35 ? 104 LEU A HD13 1 
ATOM   1627 H  HD21 . LEU A 1 104 ? -33.871 -41.064 -77.003  1.00 1.39 ? 104 LEU A HD21 1 
ATOM   1628 H  HD22 . LEU A 1 104 ? -34.557 -41.688 -75.503  1.00 1.02 ? 104 LEU A HD22 1 
ATOM   1629 H  HD23 . LEU A 1 104 ? -34.180 -42.791 -76.827  1.00 1.00 ? 104 LEU A HD23 1 
ATOM   1630 N  N    . ASP A 1 105 ? -33.057 -45.248 -72.537  1.00 0.76 ? 105 ASP A N    1 
ATOM   1631 C  CA   . ASP A 1 105 ? -32.809 -46.464 -71.771  1.00 0.82 ? 105 ASP A CA   1 
ATOM   1632 C  C    . ASP A 1 105 ? -33.994 -47.419 -71.866  1.00 0.77 ? 105 ASP A C    1 
ATOM   1633 O  O    . ASP A 1 105 ? -33.819 -48.634 -71.953  1.00 0.81 ? 105 ASP A O    1 
ATOM   1634 C  CB   . ASP A 1 105 ? -32.531 -46.122 -70.306  1.00 0.93 ? 105 ASP A CB   1 
ATOM   1635 C  CG   . ASP A 1 105 ? -31.051 -45.968 -70.019  1.00 1.37 ? 105 ASP A CG   1 
ATOM   1636 O  OD1  . ASP A 1 105 ? -30.390 -46.993 -69.746  1.00 1.70 ? 105 ASP A OD1  1 
ATOM   1637 O  OD2  . ASP A 1 105 ? -30.552 -44.824 -70.068  1.00 1.88 ? 105 ASP A OD2  1 
ATOM   1638 H  H    . ASP A 1 105 ? -32.884 -44.377 -72.122  1.00 0.81 ? 105 ASP A H    1 
ATOM   1639 H  HA   . ASP A 1 105 ? -31.939 -46.946 -72.190  1.00 0.84 ? 105 ASP A HA   1 
ATOM   1640 H  HB2  . ASP A 1 105 ? -33.024 -45.193 -70.060  1.00 0.96 ? 105 ASP A HB2  1 
ATOM   1641 H  HB3  . ASP A 1 105 ? -32.922 -46.909 -69.679  1.00 1.09 ? 105 ASP A HB3  1 
ATOM   1642 N  N    . ARG A 1 106 ? -35.200 -46.860 -71.851  1.00 0.71 ? 106 ARG A N    1 
ATOM   1643 C  CA   . ARG A 1 106 ? -36.414 -47.663 -71.937  1.00 0.67 ? 106 ARG A CA   1 
ATOM   1644 C  C    . ARG A 1 106 ? -36.520 -48.347 -73.296  1.00 0.59 ? 106 ARG A C    1 
ATOM   1645 O  O    . ARG A 1 106 ? -36.934 -49.502 -73.391  1.00 0.60 ? 106 ARG A O    1 
ATOM   1646 C  CB   . ARG A 1 106 ? -37.646 -46.789 -71.695  1.00 0.67 ? 106 ARG A CB   1 
ATOM   1647 C  CG   . ARG A 1 106 ? -38.377 -47.114 -70.402  1.00 1.37 ? 106 ARG A CG   1 
ATOM   1648 C  CD   . ARG A 1 106 ? -37.572 -46.688 -69.185  1.00 1.44 ? 106 ARG A CD   1 
ATOM   1649 N  NE   . ARG A 1 106 ? -38.066 -47.306 -67.958  1.00 2.29 ? 106 ARG A NE   1 
ATOM   1650 C  CZ   . ARG A 1 106 ? -39.157 -46.901 -67.313  1.00 2.91 ? 106 ARG A CZ   1 
ATOM   1651 N  NH1  . ARG A 1 106 ? -39.867 -45.881 -67.777  1.00 2.99 ? 106 ARG A NH1  1 
ATOM   1652 N  NH2  . ARG A 1 106 ? -39.539 -47.517 -66.203  1.00 3.90 ? 106 ARG A NH2  1 
ATOM   1653 H  H    . ARG A 1 106 ? -35.275 -45.886 -71.781  1.00 0.73 ? 106 ARG A H    1 
ATOM   1654 H  HA   . ARG A 1 106 ? -36.365 -48.421 -71.169  1.00 0.72 ? 106 ARG A HA   1 
ATOM   1655 H  HB2  . ARG A 1 106 ? -37.339 -45.755 -71.659  1.00 0.65 ? 106 ARG A HB2  1 
ATOM   1656 H  HB3  . ARG A 1 106 ? -38.335 -46.923 -72.516  1.00 0.87 ? 106 ARG A HB3  1 
ATOM   1657 H  HG2  . ARG A 1 106 ? -39.323 -46.594 -70.395  1.00 1.91 ? 106 ARG A HG2  1 
ATOM   1658 H  HG3  . ARG A 1 106 ? -38.549 -48.179 -70.355  1.00 1.97 ? 106 ARG A HG3  1 
ATOM   1659 H  HD2  . ARG A 1 106 ? -36.542 -46.977 -69.332  1.00 1.56 ? 106 ARG A HD2  1 
ATOM   1660 H  HD3  . ARG A 1 106 ? -37.633 -45.614 -69.087  1.00 1.73 ? 106 ARG A HD3  1 
ATOM   1661 H  HE   . ARG A 1 106 ? -37.559 -48.062 -67.595  1.00 2.81 ? 106 ARG A HE   1 
ATOM   1662 H  HH11 . ARG A 1 106 ? -39.585 -45.412 -68.614  1.00 2.66 ? 106 ARG A HH11 1 
ATOM   1663 H  HH12 . ARG A 1 106 ? -40.687 -45.580 -67.289  1.00 3.72 ? 106 ARG A HH12 1 
ATOM   1664 H  HH21 . ARG A 1 106 ? -39.006 -48.287 -65.850  1.00 4.28 ? 106 ARG A HH21 1 
ATOM   1665 H  HH22 . ARG A 1 106 ? -40.359 -47.212 -65.719  1.00 4.46 ? 106 ARG A HH22 1 
ATOM   1666 N  N    . GLU A 1 107 ? -36.142 -47.625 -74.346  1.00 0.54 ? 107 GLU A N    1 
ATOM   1667 C  CA   . GLU A 1 107 ? -36.193 -48.162 -75.701  1.00 0.49 ? 107 GLU A CA   1 
ATOM   1668 C  C    . GLU A 1 107 ? -35.231 -49.335 -75.859  1.00 0.47 ? 107 GLU A C    1 
ATOM   1669 O  O    . GLU A 1 107 ? -35.623 -50.418 -76.295  1.00 0.47 ? 107 GLU A O    1 
ATOM   1670 C  CB   . GLU A 1 107 ? -35.855 -47.071 -76.718  1.00 0.49 ? 107 GLU A CB   1 
ATOM   1671 C  CG   . GLU A 1 107 ? -36.714 -45.824 -76.582  1.00 0.57 ? 107 GLU A CG   1 
ATOM   1672 C  CD   . GLU A 1 107 ? -38.007 -45.919 -77.366  1.00 0.55 ? 107 GLU A CD   1 
ATOM   1673 O  OE1  . GLU A 1 107 ? -37.941 -46.051 -78.606  1.00 1.19 ? 107 GLU A OE1  1 
ATOM   1674 O  OE2  . GLU A 1 107 ? -39.087 -45.862 -76.740  1.00 1.30 ? 107 GLU A OE2  1 
ATOM   1675 H  H    . GLU A 1 107 ? -35.820 -46.710 -74.207  1.00 0.56 ? 107 GLU A H    1 
ATOM   1676 H  HA   . GLU A 1 107 ? -37.199 -48.510 -75.882  1.00 0.51 ? 107 GLU A HA   1 
ATOM   1677 H  HB2  . GLU A 1 107 ? -34.822 -46.785 -76.590  1.00 0.57 ? 107 GLU A HB2  1 
ATOM   1678 H  HB3  . GLU A 1 107 ? -35.990 -47.468 -77.713  1.00 0.50 ? 107 GLU A HB3  1 
ATOM   1679 H  HG2  . GLU A 1 107 ? -36.953 -45.680 -75.539  1.00 0.68 ? 107 GLU A HG2  1 
ATOM   1680 H  HG3  . GLU A 1 107 ? -36.152 -44.975 -76.943  1.00 0.75 ? 107 GLU A HG3  1 
ATOM   1681 N  N    . ARG A 1 108 ? -33.971 -49.113 -75.500  1.00 0.48 ? 108 ARG A N    1 
ATOM   1682 C  CA   . ARG A 1 108 ? -32.952 -50.152 -75.602  1.00 0.52 ? 108 ARG A CA   1 
ATOM   1683 C  C    . ARG A 1 108 ? -33.419 -51.439 -74.930  1.00 0.58 ? 108 ARG A C    1 
ATOM   1684 O  O    . ARG A 1 108 ? -33.503 -52.489 -75.566  1.00 0.60 ? 108 ARG A O    1 
ATOM   1685 C  CB   . ARG A 1 108 ? -31.645 -49.677 -74.966  1.00 0.59 ? 108 ARG A CB   1 
ATOM   1686 C  CG   . ARG A 1 108 ? -30.598 -50.772 -74.838  1.00 0.54 ? 108 ARG A CG   1 
ATOM   1687 C  CD   . ARG A 1 108 ? -29.238 -50.201 -74.471  1.00 0.89 ? 108 ARG A CD   1 
ATOM   1688 N  NE   . ARG A 1 108 ? -28.517 -51.062 -73.538  1.00 1.31 ? 108 ARG A NE   1 
ATOM   1689 C  CZ   . ARG A 1 108 ? -27.923 -52.199 -73.890  1.00 1.55 ? 108 ARG A CZ   1 
ATOM   1690 N  NH1  . ARG A 1 108 ? -27.962 -52.612 -75.150  1.00 1.99 ? 108 ARG A NH1  1 
ATOM   1691 N  NH2  . ARG A 1 108 ? -27.287 -52.925 -72.980  1.00 2.19 ? 108 ARG A NH2  1 
ATOM   1692 H  H    . ARG A 1 108 ? -33.720 -48.229 -75.159  1.00 0.49 ? 108 ARG A H    1 
ATOM   1693 H  HA   . ARG A 1 108 ? -32.782 -50.348 -76.650  1.00 0.51 ? 108 ARG A HA   1 
ATOM   1694 H  HB2  . ARG A 1 108 ? -31.232 -48.883 -75.569  1.00 0.72 ? 108 ARG A HB2  1 
ATOM   1695 H  HB3  . ARG A 1 108 ? -31.856 -49.294 -73.978  1.00 0.70 ? 108 ARG A HB3  1 
ATOM   1696 H  HG2  . ARG A 1 108 ? -30.906 -51.463 -74.068  1.00 0.75 ? 108 ARG A HG2  1 
ATOM   1697 H  HG3  . ARG A 1 108 ? -30.518 -51.293 -75.781  1.00 1.01 ? 108 ARG A HG3  1 
ATOM   1698 H  HD2  . ARG A 1 108 ? -28.652 -50.094 -75.372  1.00 1.53 ? 108 ARG A HD2  1 
ATOM   1699 H  HD3  . ARG A 1 108 ? -29.379 -49.232 -74.017  1.00 1.32 ? 108 ARG A HD3  1 
ATOM   1700 H  HE   . ARG A 1 108 ? -28.473 -50.779 -72.601  1.00 2.00 ? 108 ARG A HE   1 
ATOM   1701 H  HH11 . ARG A 1 108 ? -28.439 -52.069 -75.841  1.00 2.12 ? 108 ARG A HH11 1 
ATOM   1702 H  HH12 . ARG A 1 108 ? -27.513 -53.467 -75.410  1.00 2.60 ? 108 ARG A HH12 1 
ATOM   1703 H  HH21 . ARG A 1 108 ? -27.255 -52.617 -72.029  1.00 2.67 ? 108 ARG A HH21 1 
ATOM   1704 H  HH22 . ARG A 1 108 ? -26.841 -53.780 -73.245  1.00 2.51 ? 108 ARG A HH22 1 
ATOM   1705 N  N    . ALA A 1 109 ? -33.721 -51.349 -73.639  1.00 0.64 ? 109 ALA A N    1 
ATOM   1706 C  CA   . ALA A 1 109 ? -34.180 -52.506 -72.879  1.00 0.74 ? 109 ALA A CA   1 
ATOM   1707 C  C    . ALA A 1 109 ? -35.419 -53.125 -73.517  1.00 0.75 ? 109 ALA A C    1 
ATOM   1708 O  O    . ALA A 1 109 ? -35.618 -54.339 -73.460  1.00 0.84 ? 109 ALA A O    1 
ATOM   1709 C  CB   . ALA A 1 109 ? -34.467 -52.110 -71.439  1.00 0.79 ? 109 ALA A CB   1 
ATOM   1710 H  H    . ALA A 1 109 ? -33.634 -50.484 -73.186  1.00 0.64 ? 109 ALA A H    1 
ATOM   1711 H  HA   . ALA A 1 109 ? -33.385 -53.238 -72.875  1.00 0.78 ? 109 ALA A HA   1 
ATOM   1712 H  HB1  . ALA A 1 109 ? -35.024 -51.185 -71.424  1.00 1.34 ? 109 ALA A HB1  1 
ATOM   1713 H  HB2  . ALA A 1 109 ? -33.535 -51.979 -70.909  1.00 1.16 ? 109 ALA A HB2  1 
ATOM   1714 H  HB3  . ALA A 1 109 ? -35.046 -52.887 -70.961  1.00 1.28 ? 109 ALA A HB3  1 
ATOM   1715 N  N    . LYS A 1 110 ? -36.250 -52.283 -74.122  1.00 0.69 ? 110 LYS A N    1 
ATOM   1716 C  CA   . LYS A 1 110 ? -37.471 -52.748 -74.770  1.00 0.73 ? 110 LYS A CA   1 
ATOM   1717 C  C    . LYS A 1 110 ? -37.149 -53.618 -75.981  1.00 0.71 ? 110 LYS A C    1 
ATOM   1718 O  O    . LYS A 1 110 ? -37.717 -54.697 -76.151  1.00 0.82 ? 110 LYS A O    1 
ATOM   1719 C  CB   . LYS A 1 110 ? -38.331 -51.557 -75.198  1.00 0.69 ? 110 LYS A CB   1 
ATOM   1720 C  CG   . LYS A 1 110 ? -39.389 -51.173 -74.177  1.00 0.76 ? 110 LYS A CG   1 
ATOM   1721 C  CD   . LYS A 1 110 ? -40.366 -50.156 -74.743  1.00 1.02 ? 110 LYS A CD   1 
ATOM   1722 C  CE   . LYS A 1 110 ? -41.780 -50.713 -74.796  1.00 1.44 ? 110 LYS A CE   1 
ATOM   1723 N  NZ   . LYS A 1 110 ? -42.700 -49.821 -75.556  1.00 2.43 ? 110 LYS A NZ   1 
ATOM   1724 H  H    . LYS A 1 110 ? -36.038 -51.327 -74.133  1.00 0.64 ? 110 LYS A H    1 
ATOM   1725 H  HA   . LYS A 1 110 ? -38.022 -53.338 -74.054  1.00 0.81 ? 110 LYS A HA   1 
ATOM   1726 H  HB2  . LYS A 1 110 ? -37.689 -50.704 -75.358  1.00 0.63 ? 110 LYS A HB2  1 
ATOM   1727 H  HB3  . LYS A 1 110 ? -38.828 -51.801 -76.125  1.00 0.68 ? 110 LYS A HB3  1 
ATOM   1728 H  HG2  . LYS A 1 110 ? -39.934 -52.059 -73.887  1.00 0.99 ? 110 LYS A HG2  1 
ATOM   1729 H  HG3  . LYS A 1 110 ? -38.902 -50.748 -73.311  1.00 1.20 ? 110 LYS A HG3  1 
ATOM   1730 H  HD2  . LYS A 1 110 ? -40.360 -49.277 -74.117  1.00 1.44 ? 110 LYS A HD2  1 
ATOM   1731 H  HD3  . LYS A 1 110 ? -40.055 -49.891 -75.743  1.00 1.05 ? 110 LYS A HD3  1 
ATOM   1732 H  HE2  . LYS A 1 110 ? -41.755 -51.680 -75.275  1.00 1.66 ? 110 LYS A HE2  1 
ATOM   1733 H  HE3  . LYS A 1 110 ? -42.148 -50.821 -73.787  1.00 1.56 ? 110 LYS A HE3  1 
ATOM   1734 H  HZ1  . LYS A 1 110 ? -43.297 -50.385 -76.195  1.00 2.87 ? 110 LYS A HZ1  1 
ATOM   1735 H  HZ2  . LYS A 1 110 ? -42.153 -49.141 -76.121  1.00 2.99 ? 110 LYS A HZ2  1 
ATOM   1736 H  HZ3  . LYS A 1 110 ? -43.312 -49.296 -74.899  1.00 2.70 ? 110 LYS A HZ3  1 
ATOM   1737 N  N    . ASN A 1 111 ? -36.235 -53.142 -76.819  1.00 0.63 ? 111 ASN A N    1 
ATOM   1738 C  CA   . ASN A 1 111 ? -35.837 -53.876 -78.014  1.00 0.63 ? 111 ASN A CA   1 
ATOM   1739 C  C    . ASN A 1 111 ? -35.231 -55.227 -77.647  1.00 0.75 ? 111 ASN A C    1 
ATOM   1740 O  O    . ASN A 1 111 ? -35.452 -56.225 -78.334  1.00 0.84 ? 111 ASN A O    1 
ATOM   1741 C  CB   . ASN A 1 111 ? -34.833 -53.059 -78.830  1.00 0.54 ? 111 ASN A CB   1 
ATOM   1742 C  CG   . ASN A 1 111 ? -35.505 -51.994 -79.674  1.00 0.49 ? 111 ASN A CG   1 
ATOM   1743 O  OD1  . ASN A 1 111 ? -35.559 -50.825 -79.293  1.00 1.04 ? 111 ASN A OD1  1 
ATOM   1744 N  ND2  . ASN A 1 111 ? -36.024 -52.395 -80.829  1.00 1.12 ? 111 ASN A ND2  1 
ATOM   1745 H  H    . ASN A 1 111 ? -35.817 -52.276 -76.629  1.00 0.60 ? 111 ASN A H    1 
ATOM   1746 H  HA   . ASN A 1 111 ? -36.721 -54.042 -78.611  1.00 0.66 ? 111 ASN A HA   1 
ATOM   1747 H  HB2  . ASN A 1 111 ? -34.142 -52.574 -78.157  1.00 0.67 ? 111 ASN A HB2  1 
ATOM   1748 H  HB3  . ASN A 1 111 ? -34.287 -53.721 -79.485  1.00 0.66 ? 111 ASN A HB3  1 
ATOM   1749 H  HD21 . ASN A 1 111 ? -35.944 -53.342 -81.069  1.00 1.69 ? 111 ASN A HD21 1 
ATOM   1750 H  HD22 . ASN A 1 111 ? -36.464 -51.727 -81.395  1.00 1.26 ? 111 ASN A HD22 1 
ATOM   1751 N  N    . LYS A 1 112 ? -34.467 -55.252 -76.561  1.00 0.78 ? 112 LYS A N    1 
ATOM   1752 C  CA   . LYS A 1 112 ? -33.829 -56.481 -76.103  1.00 0.95 ? 112 LYS A CA   1 
ATOM   1753 C  C    . LYS A 1 112 ? -34.868 -57.563 -75.828  1.00 1.08 ? 112 LYS A C    1 
ATOM   1754 O  O    . LYS A 1 112 ? -34.685 -58.722 -76.203  1.00 1.20 ? 112 LYS A O    1 
ATOM   1755 C  CB   . LYS A 1 112 ? -33.007 -56.214 -74.841  1.00 1.02 ? 112 LYS A CB   1 
ATOM   1756 C  CG   . LYS A 1 112 ? -32.081 -57.359 -74.464  1.00 1.42 ? 112 LYS A CG   1 
ATOM   1757 C  CD   . LYS A 1 112 ? -30.678 -57.141 -75.005  1.00 0.75 ? 112 LYS A CD   1 
ATOM   1758 C  CE   . LYS A 1 112 ? -30.288 -58.226 -75.996  1.00 1.33 ? 112 LYS A CE   1 
ATOM   1759 N  NZ   . LYS A 1 112 ? -29.485 -59.303 -75.353  1.00 1.81 ? 112 LYS A NZ   1 
ATOM   1760 H  H    . LYS A 1 112 ? -34.328 -54.424 -76.055  1.00 0.72 ? 112 LYS A H    1 
ATOM   1761 H  HA   . LYS A 1 112 ? -33.169 -56.823 -76.886  1.00 0.96 ? 112 LYS A HA   1 
ATOM   1762 H  HB2  . LYS A 1 112 ? -32.406 -55.330 -74.997  1.00 0.79 ? 112 LYS A HB2  1 
ATOM   1763 H  HB3  . LYS A 1 112 ? -33.682 -56.039 -74.016  1.00 1.18 ? 112 LYS A HB3  1 
ATOM   1764 H  HG2  . LYS A 1 112 ? -32.034 -57.432 -73.388  1.00 2.13 ? 112 LYS A HG2  1 
ATOM   1765 H  HG3  . LYS A 1 112 ? -32.477 -58.277 -74.873  1.00 2.08 ? 112 LYS A HG3  1 
ATOM   1766 H  HD2  . LYS A 1 112 ? -30.638 -56.183 -75.502  1.00 1.15 ? 112 LYS A HD2  1 
ATOM   1767 H  HD3  . LYS A 1 112 ? -29.979 -57.150 -74.181  1.00 1.22 ? 112 LYS A HD3  1 
ATOM   1768 H  HE2  . LYS A 1 112 ? -31.187 -58.658 -76.410  1.00 1.86 ? 112 LYS A HE2  1 
ATOM   1769 H  HE3  . LYS A 1 112 ? -29.706 -57.779 -76.789  1.00 1.29 ? 112 LYS A HE3  1 
ATOM   1770 H  HZ1  . LYS A 1 112 ? -29.760 -60.230 -75.736  1.00 2.30 ? 112 LYS A HZ1  1 
ATOM   1771 H  HZ2  . LYS A 1 112 ? -29.646 -59.303 -74.326  1.00 1.95 ? 112 LYS A HZ2  1 
ATOM   1772 H  HZ3  . LYS A 1 112 ? -28.473 -59.151 -75.534  1.00 2.20 ? 112 LYS A HZ3  1 
ATOM   1773 N  N    . ILE A 1 113 ? -35.957 -57.178 -75.171  1.00 1.08 ? 113 ILE A N    1 
ATOM   1774 C  CA   . ILE A 1 113 ? -37.025 -58.117 -74.847  1.00 1.25 ? 113 ILE A CA   1 
ATOM   1775 C  C    . ILE A 1 113 ? -37.715 -58.622 -76.109  1.00 1.28 ? 113 ILE A C    1 
ATOM   1776 O  O    . ILE A 1 113 ? -38.069 -59.797 -76.207  1.00 1.46 ? 113 ILE A O    1 
ATOM   1777 C  CB   . ILE A 1 113 ? -38.077 -57.474 -73.923  1.00 1.24 ? 113 ILE A CB   1 
ATOM   1778 C  CG1  . ILE A 1 113 ? -37.581 -57.467 -72.476  1.00 1.32 ? 113 ILE A CG1  1 
ATOM   1779 C  CG2  . ILE A 1 113 ? -39.401 -58.215 -74.032  1.00 1.38 ? 113 ILE A CG2  1 
ATOM   1780 C  CD1  . ILE A 1 113 ? -37.933 -56.202 -71.723  1.00 1.08 ? 113 ILE A CD1  1 
ATOM   1781 H  H    . ILE A 1 113 ? -36.045 -56.241 -74.899  1.00 1.00 ? 113 ILE A H    1 
ATOM   1782 H  HA   . ILE A 1 113 ? -36.585 -58.956 -74.328  1.00 1.40 ? 113 ILE A HA   1 
ATOM   1783 H  HB   . ILE A 1 113 ? -38.235 -56.457 -74.247  1.00 1.10 ? 113 ILE A HB   1 
ATOM   1784 H  HG12 . ILE A 1 113 ? -38.020 -58.299 -71.947  1.00 1.67 ? 113 ILE A HG12 1 
ATOM   1785 H  HG13 . ILE A 1 113 ? -36.505 -57.569 -72.470  1.00 1.37 ? 113 ILE A HG13 1 
ATOM   1786 H  HG21 . ILE A 1 113 ? -39.217 -59.280 -74.050  1.00 1.09 ? 113 ILE A HG21 1 
ATOM   1787 H  HG22 . ILE A 1 113 ? -39.904 -57.922 -74.941  1.00 1.64 ? 113 ILE A HG22 1 
ATOM   1788 H  HG23 . ILE A 1 113 ? -40.021 -57.971 -73.182  1.00 2.28 ? 113 ILE A HG23 1 
ATOM   1789 H  HD11 . ILE A 1 113 ? -37.631 -56.302 -70.691  1.00 1.42 ? 113 ILE A HD11 1 
ATOM   1790 H  HD12 . ILE A 1 113 ? -38.999 -56.039 -71.772  1.00 1.31 ? 113 ILE A HD12 1 
ATOM   1791 H  HD13 . ILE A 1 113 ? -37.419 -55.363 -72.168  1.00 1.21 ? 113 ILE A HD13 1 
ATOM   1792 N  N    . ALA A 1 114 ? -37.903 -57.726 -77.073  1.00 1.12 ? 114 ALA A N    1 
ATOM   1793 C  CA   . ALA A 1 114 ? -38.551 -58.082 -78.330  1.00 1.18 ? 114 ALA A CA   1 
ATOM   1794 C  C    . ALA A 1 114 ? -37.865 -59.277 -78.982  1.00 1.31 ? 114 ALA A C    1 
ATOM   1795 O  O    . ALA A 1 114 ? -38.523 -60.158 -79.534  1.00 1.46 ? 114 ALA A O    1 
ATOM   1796 C  CB   . ALA A 1 114 ? -38.553 -56.891 -79.276  1.00 1.03 ? 114 ALA A CB   1 
ATOM   1797 H  H    . ALA A 1 114 ? -37.598 -56.805 -76.936  1.00 0.99 ? 114 ALA A H    1 
ATOM   1798 H  HA   . ALA A 1 114 ? -39.577 -58.342 -78.114  1.00 1.28 ? 114 ALA A HA   1 
ATOM   1799 H  HB1  . ALA A 1 114 ? -38.944 -57.195 -80.236  1.00 1.17 ? 114 ALA A HB1  1 
ATOM   1800 H  HB2  . ALA A 1 114 ? -37.544 -56.526 -79.398  1.00 1.24 ? 114 ALA A HB2  1 
ATOM   1801 H  HB3  . ALA A 1 114 ? -39.173 -56.107 -78.867  1.00 1.34 ? 114 ALA A HB3  1 
ATOM   1802 N  N    . LYS A 1 115 ? -36.538 -59.300 -78.915  1.00 1.28 ? 115 LYS A N    1 
ATOM   1803 C  CA   . LYS A 1 115 ? -35.762 -60.388 -79.499  1.00 1.43 ? 115 LYS A CA   1 
ATOM   1804 C  C    . LYS A 1 115 ? -36.225 -61.738 -78.959  1.00 1.72 ? 115 LYS A C    1 
ATOM   1805 O  O    . LYS A 1 115 ? -36.462 -62.674 -79.722  1.00 1.87 ? 115 LYS A O    1 
ATOM   1806 C  CB   . LYS A 1 115 ? -34.272 -60.194 -79.208  1.00 1.44 ? 115 LYS A CB   1 
ATOM   1807 C  CG   . LYS A 1 115 ? -33.515 -59.516 -80.338  1.00 1.37 ? 115 LYS A CG   1 
ATOM   1808 C  CD   . LYS A 1 115 ? -32.162 -60.167 -80.572  1.00 1.67 ? 115 LYS A CD   1 
ATOM   1809 C  CE   . LYS A 1 115 ? -31.100 -59.137 -80.919  1.00 1.24 ? 115 LYS A CE   1 
ATOM   1810 N  NZ   . LYS A 1 115 ? -29.747 -59.557 -80.461  1.00 1.63 ? 115 LYS A NZ   1 
ATOM   1811 H  H    . LYS A 1 115 ? -36.069 -58.569 -78.461  1.00 1.19 ? 115 LYS A H    1 
ATOM   1812 H  HA   . LYS A 1 115 ? -35.916 -60.369 -80.567  1.00 1.39 ? 115 LYS A HA   1 
ATOM   1813 H  HB2  . LYS A 1 115 ? -34.167 -59.589 -78.319  1.00 1.47 ? 115 LYS A HB2  1 
ATOM   1814 H  HB3  . LYS A 1 115 ? -33.823 -61.160 -79.031  1.00 1.59 ? 115 LYS A HB3  1 
ATOM   1815 H  HG2  . LYS A 1 115 ? -34.099 -59.587 -81.243  1.00 1.22 ? 115 LYS A HG2  1 
ATOM   1816 H  HG3  . LYS A 1 115 ? -33.366 -58.476 -80.085  1.00 1.63 ? 115 LYS A HG3  1 
ATOM   1817 H  HD2  . LYS A 1 115 ? -31.864 -60.687 -79.674  1.00 2.25 ? 115 LYS A HD2  1 
ATOM   1818 H  HD3  . LYS A 1 115 ? -32.249 -60.872 -81.386  1.00 2.17 ? 115 LYS A HD3  1 
ATOM   1819 H  HE2  . LYS A 1 115 ? -31.082 -59.004 -81.991  1.00 1.79 ? 115 LYS A HE2  1 
ATOM   1820 H  HE3  . LYS A 1 115 ? -31.357 -58.201 -80.446  1.00 1.29 ? 115 LYS A HE3  1 
ATOM   1821 H  HZ1  . LYS A 1 115 ? -29.710 -59.573 -79.422  1.00 2.00 ? 115 LYS A HZ1  1 
ATOM   1822 H  HZ2  . LYS A 1 115 ? -29.028 -58.893 -80.812  1.00 1.81 ? 115 LYS A HZ2  1 
ATOM   1823 H  HZ3  . LYS A 1 115 ? -29.528 -60.509 -80.820  1.00 2.17 ? 115 LYS A HZ3  1 
ATOM   1824 N  N    . GLU A 1 116 ? -36.352 -61.829 -77.640  1.00 1.82 ? 116 GLU A N    1 
ATOM   1825 C  CA   . GLU A 1 116 ? -36.787 -63.064 -76.998  1.00 2.11 ? 116 GLU A CA   1 
ATOM   1826 C  C    . GLU A 1 116 ? -38.236 -63.381 -77.353  1.00 2.29 ? 116 GLU A C    1 
ATOM   1827 O  O    . GLU A 1 116 ? -38.513 -64.337 -78.077  1.00 2.53 ? 116 GLU A O    1 
ATOM   1828 C  CB   . GLU A 1 116 ? -36.633 -62.956 -75.479  1.00 2.24 ? 116 GLU A CB   1 
ATOM   1829 C  CG   . GLU A 1 116 ? -35.296 -63.464 -74.965  1.00 2.58 ? 116 GLU A CG   1 
ATOM   1830 C  CD   . GLU A 1 116 ? -35.100 -63.195 -73.486  1.00 3.06 ? 116 GLU A CD   1 
ATOM   1831 O  OE1  . GLU A 1 116 ? -34.925 -62.015 -73.115  1.00 3.53 ? 116 GLU A OE1  1 
ATOM   1832 O  OE2  . GLU A 1 116 ? -35.123 -64.164 -72.699  1.00 3.49 ? 116 GLU A OE2  1 
ATOM   1833 H  H    . GLU A 1 116 ? -36.148 -61.048 -77.084  1.00 1.71 ? 116 GLU A H    1 
ATOM   1834 H  HA   . GLU A 1 116 ? -36.157 -63.864 -77.358  1.00 2.21 ? 116 GLU A HA   1 
ATOM   1835 H  HB2  . GLU A 1 116 ? -36.735 -61.920 -75.192  1.00 2.14 ? 116 GLU A HB2  1 
ATOM   1836 H  HB3  . GLU A 1 116 ? -37.417 -63.530 -75.008  1.00 2.61 ? 116 GLU A HB3  1 
ATOM   1837 H  HG2  . GLU A 1 116 ? -35.242 -64.529 -75.132  1.00 2.65 ? 116 GLU A HG2  1 
ATOM   1838 H  HG3  . GLU A 1 116 ? -34.505 -62.974 -75.514  1.00 3.09 ? 116 GLU A HG3  1 
ATOM   1839 N  N    . THR A 1 117 ? -39.156 -62.572 -76.838  1.00 2.46 ? 117 THR A N    1 
ATOM   1840 C  CA   . THR A 1 117 ? -40.577 -62.766 -77.100  1.00 2.77 ? 117 THR A CA   1 
ATOM   1841 C  C    . THR A 1 117 ? -40.960 -62.228 -78.474  1.00 3.25 ? 117 THR A C    1 
ATOM   1842 O  O    . THR A 1 117 ? -41.021 -60.990 -78.628  1.00 3.80 ? 117 THR A O    1 
ATOM   1843 C  CB   . THR A 1 117 ? -41.445 -62.077 -76.032  1.00 3.18 ? 117 THR A CB   1 
ATOM   1844 O  OG1  . THR A 1 117 ? -40.641 -61.196 -75.239  1.00 3.96 ? 117 THR A OG1  1 
ATOM   1845 C  CG2  . THR A 1 117 ? -42.115 -63.106 -75.133  1.00 3.57 ? 117 THR A CG2  1 
ATOM   1846 O  OXT  . THR A 1 117 ? -41.196 -63.049 -79.386  1.00 3.56 ? 117 THR A OXT  1 
ATOM   1847 H  H    . THR A 1 117 ? -38.873 -61.827 -76.268  1.00 2.58 ? 117 THR A H    1 
ATOM   1848 H  HA   . THR A 1 117 ? -40.780 -63.827 -77.070  1.00 2.79 ? 117 THR A HA   1 
ATOM   1849 H  HB   . THR A 1 117 ? -42.213 -61.502 -76.529  1.00 3.25 ? 117 THR A HB   1 
ATOM   1850 H  HG1  . THR A 1 117 ? -41.141 -60.908 -74.472  1.00 4.45 ? 117 THR A HG1  1 
ATOM   1851 H  HG21 . THR A 1 117 ? -42.610 -63.848 -75.741  1.00 3.65 ? 117 THR A HG21 1 
ATOM   1852 H  HG22 . THR A 1 117 ? -42.840 -62.614 -74.501  1.00 3.85 ? 117 THR A HG22 1 
ATOM   1853 H  HG23 . THR A 1 117 ? -41.368 -63.586 -74.517  1.00 4.03 ? 117 THR A HG23 1 
ATOM   1854 N  N    . MET B 1 1   ? -39.595 -49.148 -52.540  1.00 5.25 ? 1   MET B N    1 
ATOM   1855 C  CA   . MET B 1 1   ? -38.576 -48.075 -52.679  1.00 4.86 ? 1   MET B CA   1 
ATOM   1856 C  C    . MET B 1 1   ? -39.068 -46.964 -53.601  1.00 4.32 ? 1   MET B C    1 
ATOM   1857 O  O    . MET B 1 1   ? -39.246 -45.823 -53.174  1.00 4.79 ? 1   MET B O    1 
ATOM   1858 C  CB   . MET B 1 1   ? -37.291 -48.691 -53.234  1.00 5.35 ? 1   MET B CB   1 
ATOM   1859 C  CG   . MET B 1 1   ? -37.500 -50.044 -53.895  1.00 5.76 ? 1   MET B CG   1 
ATOM   1860 S  SD   . MET B 1 1   ? -36.051 -50.600 -54.813  1.00 6.57 ? 1   MET B SD   1 
ATOM   1861 C  CE   . MET B 1 1   ? -36.727 -52.005 -55.694  1.00 7.24 ? 1   MET B CE   1 
ATOM   1862 H  H1   . MET B 1 1   ? -39.920 -49.456 -53.478  1.00 5.35 ? 1   MET B H1   1 
ATOM   1863 H  H2   . MET B 1 1   ? -40.412 -48.798 -52.000  1.00 5.52 ? 1   MET B H2   1 
ATOM   1864 H  H3   . MET B 1 1   ? -39.188 -49.964 -52.040  1.00 5.47 ? 1   MET B H3   1 
ATOM   1865 H  HA   . MET B 1 1   ? -38.378 -47.660 -51.702  1.00 5.01 ? 1   MET B HA   1 
ATOM   1866 H  HB2  . MET B 1 1   ? -36.870 -48.018 -53.967  1.00 5.65 ? 1   MET B HB2  1 
ATOM   1867 H  HB3  . MET B 1 1   ? -36.586 -48.815 -52.426  1.00 5.45 ? 1   MET B HB3  1 
ATOM   1868 H  HG2  . MET B 1 1   ? -37.724 -50.772 -53.130  1.00 5.55 ? 1   MET B HG2  1 
ATOM   1869 H  HG3  . MET B 1 1   ? -38.335 -49.971 -54.577  1.00 6.12 ? 1   MET B HG3  1 
ATOM   1870 H  HE1  . MET B 1 1   ? -35.934 -52.515 -56.220  1.00 7.38 ? 1   MET B HE1  1 
ATOM   1871 H  HE2  . MET B 1 1   ? -37.468 -51.664 -56.402  1.00 7.21 ? 1   MET B HE2  1 
ATOM   1872 H  HE3  . MET B 1 1   ? -37.187 -52.683 -54.991  1.00 7.79 ? 1   MET B HE3  1 
ATOM   1873 N  N    . GLY B 1 2   ? -39.287 -47.305 -54.866  1.00 3.73 ? 2   GLY B N    1 
ATOM   1874 C  CA   . GLY B 1 2   ? -39.757 -46.325 -55.828  1.00 3.65 ? 2   GLY B CA   1 
ATOM   1875 C  C    . GLY B 1 2   ? -38.701 -45.291 -56.165  1.00 3.50 ? 2   GLY B C    1 
ATOM   1876 O  O    . GLY B 1 2   ? -38.932 -44.090 -56.023  1.00 3.75 ? 2   GLY B O    1 
ATOM   1877 H  H    . GLY B 1 2   ? -39.128 -48.230 -55.149  1.00 3.69 ? 2   GLY B H    1 
ATOM   1878 H  HA2  . GLY B 1 2   ? -40.046 -46.837 -56.734  1.00 4.18 ? 2   GLY B HA2  1 
ATOM   1879 H  HA3  . GLY B 1 2   ? -40.621 -45.822 -55.420  1.00 3.59 ? 2   GLY B HA3  1 
ATOM   1880 N  N    . ALA B 1 3   ? -37.540 -45.757 -56.613  1.00 3.30 ? 3   ALA B N    1 
ATOM   1881 C  CA   . ALA B 1 3   ? -36.445 -44.863 -56.971  1.00 3.27 ? 3   ALA B CA   1 
ATOM   1882 C  C    . ALA B 1 3   ? -35.878 -45.213 -58.343  1.00 2.87 ? 3   ALA B C    1 
ATOM   1883 O  O    . ALA B 1 3   ? -35.918 -46.368 -58.767  1.00 2.57 ? 3   ALA B O    1 
ATOM   1884 C  CB   . ALA B 1 3   ? -35.351 -44.920 -55.916  1.00 3.46 ? 3   ALA B CB   1 
ATOM   1885 H  H    . ALA B 1 3   ? -37.417 -46.725 -56.704  1.00 3.31 ? 3   ALA B H    1 
ATOM   1886 H  HA   . ALA B 1 3   ? -36.834 -43.856 -56.999  1.00 3.64 ? 3   ALA B HA   1 
ATOM   1887 H  HB1  . ALA B 1 3   ? -35.179 -43.930 -55.522  1.00 3.49 ? 3   ALA B HB1  1 
ATOM   1888 H  HB2  . ALA B 1 3   ? -34.441 -45.294 -56.360  1.00 3.92 ? 3   ALA B HB2  1 
ATOM   1889 H  HB3  . ALA B 1 3   ? -35.657 -45.577 -55.115  1.00 3.57 ? 3   ALA B HB3  1 
ATOM   1890 N  N    . PRO B 1 4   ? -35.341 -44.212 -59.055  1.00 3.11 ? 4   PRO B N    1 
ATOM   1891 C  CA   . PRO B 1 4   ? -34.761 -44.409 -60.387  1.00 3.10 ? 4   PRO B CA   1 
ATOM   1892 C  C    . PRO B 1 4   ? -33.750 -45.550 -60.415  1.00 2.72 ? 4   PRO B C    1 
ATOM   1893 O  O    . PRO B 1 4   ? -33.460 -46.161 -59.386  1.00 2.89 ? 4   PRO B O    1 
ATOM   1894 C  CB   . PRO B 1 4   ? -34.070 -43.074 -60.673  1.00 3.61 ? 4   PRO B CB   1 
ATOM   1895 C  CG   . PRO B 1 4   ? -34.816 -42.079 -59.855  1.00 3.92 ? 4   PRO B CG   1 
ATOM   1896 C  CD   . PRO B 1 4   ? -35.258 -42.808 -58.615  1.00 3.68 ? 4   PRO B CD   1 
ATOM   1897 H  HA   . PRO B 1 4   ? -35.525 -44.589 -61.129  1.00 3.27 ? 4   PRO B HA   1 
ATOM   1898 H  HB2  . PRO B 1 4   ? -33.032 -43.132 -60.378  1.00 3.45 ? 4   PRO B HB2  1 
ATOM   1899 H  HB3  . PRO B 1 4   ? -34.139 -42.849 -61.727  1.00 4.12 ? 4   PRO B HB3  1 
ATOM   1900 H  HG2  . PRO B 1 4   ? -34.166 -41.256 -59.595  1.00 4.12 ? 4   PRO B HG2  1 
ATOM   1901 H  HG3  . PRO B 1 4   ? -35.674 -41.721 -60.404  1.00 4.31 ? 4   PRO B HG3  1 
ATOM   1902 H  HD2  . PRO B 1 4   ? -34.526 -42.693 -57.829  1.00 3.82 ? 4   PRO B HD2  1 
ATOM   1903 H  HD3  . PRO B 1 4   ? -36.222 -42.448 -58.289  1.00 3.90 ? 4   PRO B HD3  1 
ATOM   1904 N  N    . THR B 1 5   ? -33.217 -45.833 -61.599  1.00 2.64 ? 5   THR B N    1 
ATOM   1905 C  CA   . THR B 1 5   ? -32.239 -46.901 -61.761  1.00 2.46 ? 5   THR B CA   1 
ATOM   1906 C  C    . THR B 1 5   ? -30.858 -46.339 -62.081  1.00 2.30 ? 5   THR B C    1 
ATOM   1907 O  O    . THR B 1 5   ? -30.201 -46.779 -63.024  1.00 2.94 ? 5   THR B O    1 
ATOM   1908 C  CB   . THR B 1 5   ? -32.653 -47.878 -62.876  1.00 2.93 ? 5   THR B CB   1 
ATOM   1909 O  OG1  . THR B 1 5   ? -33.169 -47.152 -63.998  1.00 3.37 ? 5   THR B OG1  1 
ATOM   1910 C  CG2  . THR B 1 5   ? -33.703 -48.858 -62.375  1.00 2.95 ? 5   THR B CG2  1 
ATOM   1911 H  H    . THR B 1 5   ? -33.488 -45.311 -62.383  1.00 2.98 ? 5   THR B H    1 
ATOM   1912 H  HA   . THR B 1 5   ? -32.187 -47.450 -60.831  1.00 2.30 ? 5   THR B HA   1 
ATOM   1913 H  HB   . THR B 1 5   ? -31.781 -48.436 -63.188  1.00 3.14 ? 5   THR B HB   1 
ATOM   1914 H  HG1  . THR B 1 5   ? -32.497 -46.549 -64.326  1.00 3.83 ? 5   THR B HG1  1 
ATOM   1915 H  HG21 . THR B 1 5   ? -33.562 -49.027 -61.317  1.00 3.24 ? 5   THR B HG21 1 
ATOM   1916 H  HG22 . THR B 1 5   ? -33.604 -49.794 -62.905  1.00 2.68 ? 5   THR B HG22 1 
ATOM   1917 H  HG23 . THR B 1 5   ? -34.688 -48.450 -62.546  1.00 3.40 ? 5   THR B HG23 1 
ATOM   1918 N  N    . LEU B 1 6   ? -30.422 -45.365 -61.289  1.00 1.77 ? 6   LEU B N    1 
ATOM   1919 C  CA   . LEU B 1 6   ? -29.118 -44.744 -61.488  1.00 1.63 ? 6   LEU B CA   1 
ATOM   1920 C  C    . LEU B 1 6   ? -28.071 -45.374 -60.575  1.00 1.68 ? 6   LEU B C    1 
ATOM   1921 O  O    . LEU B 1 6   ? -28.371 -45.761 -59.445  1.00 1.71 ? 6   LEU B O    1 
ATOM   1922 C  CB   . LEU B 1 6   ? -29.201 -43.238 -61.226  1.00 1.41 ? 6   LEU B CB   1 
ATOM   1923 C  CG   . LEU B 1 6   ? -29.384 -42.373 -62.474  1.00 1.15 ? 6   LEU B CG   1 
ATOM   1924 C  CD1  . LEU B 1 6   ? -30.164 -41.111 -62.139  1.00 1.17 ? 6   LEU B CD1  1 
ATOM   1925 C  CD2  . LEU B 1 6   ? -28.034 -42.021 -63.079  1.00 0.75 ? 6   LEU B CD2  1 
ATOM   1926 H  H    . LEU B 1 6   ? -30.991 -45.057 -60.552  1.00 1.80 ? 6   LEU B H    1 
ATOM   1927 H  HA   . LEU B 1 6   ? -28.830 -44.906 -62.516  1.00 1.71 ? 6   LEU B HA   1 
ATOM   1928 H  HB2  . LEU B 1 6   ? -30.033 -43.056 -60.561  1.00 1.66 ? 6   LEU B HB2  1 
ATOM   1929 H  HB3  . LEU B 1 6   ? -28.293 -42.930 -60.732  1.00 1.32 ? 6   LEU B HB3  1 
ATOM   1930 H  HG   . LEU B 1 6   ? -29.947 -42.928 -63.210  1.00 1.39 ? 6   LEU B HG   1 
ATOM   1931 H  HD11 . LEU B 1 6   ? -31.026 -41.038 -62.786  1.00 1.65 ? 6   LEU B HD11 1 
ATOM   1932 H  HD12 . LEU B 1 6   ? -29.531 -40.248 -62.283  1.00 1.37 ? 6   LEU B HD12 1 
ATOM   1933 H  HD13 . LEU B 1 6   ? -30.489 -41.151 -61.110  1.00 1.57 ? 6   LEU B HD13 1 
ATOM   1934 H  HD21 . LEU B 1 6   ? -27.761 -42.768 -63.810  1.00 1.15 ? 6   LEU B HD21 1 
ATOM   1935 H  HD22 . LEU B 1 6   ? -27.287 -41.991 -62.299  1.00 1.15 ? 6   LEU B HD22 1 
ATOM   1936 H  HD23 . LEU B 1 6   ? -28.094 -41.054 -63.557  1.00 0.72 ? 6   LEU B HD23 1 
ATOM   1937 N  N    . PRO B 1 7   ? -26.823 -45.486 -61.057  1.00 1.82 ? 7   PRO B N    1 
ATOM   1938 C  CA   . PRO B 1 7   ? -25.726 -46.073 -60.283  1.00 2.00 ? 7   PRO B CA   1 
ATOM   1939 C  C    . PRO B 1 7   ? -25.242 -45.151 -59.168  1.00 1.77 ? 7   PRO B C    1 
ATOM   1940 O  O    . PRO B 1 7   ? -25.621 -43.981 -59.106  1.00 1.50 ? 7   PRO B O    1 
ATOM   1941 C  CB   . PRO B 1 7   ? -24.627 -46.272 -61.327  1.00 2.22 ? 7   PRO B CB   1 
ATOM   1942 C  CG   . PRO B 1 7   ? -24.892 -45.226 -62.354  1.00 2.38 ? 7   PRO B CG   1 
ATOM   1943 C  CD   . PRO B 1 7   ? -26.386 -45.049 -62.395  1.00 1.95 ? 7   PRO B CD   1 
ATOM   1944 H  HA   . PRO B 1 7   ? -26.005 -47.028 -59.863  1.00 2.20 ? 7   PRO B HA   1 
ATOM   1945 H  HB2  . PRO B 1 7   ? -23.660 -46.139 -60.865  1.00 2.31 ? 7   PRO B HB2  1 
ATOM   1946 H  HB3  . PRO B 1 7   ? -24.700 -47.264 -61.747  1.00 2.30 ? 7   PRO B HB3  1 
ATOM   1947 H  HG2  . PRO B 1 7   ? -24.413 -44.301 -62.068  1.00 2.60 ? 7   PRO B HG2  1 
ATOM   1948 H  HG3  . PRO B 1 7   ? -24.527 -45.556 -63.316  1.00 2.79 ? 7   PRO B HG3  1 
ATOM   1949 H  HD2  . PRO B 1 7   ? -26.638 -44.013 -62.563  1.00 1.68 ? 7   PRO B HD2  1 
ATOM   1950 H  HD3  . PRO B 1 7   ? -26.818 -45.673 -63.164  1.00 2.18 ? 7   PRO B HD3  1 
ATOM   1951 N  N    . PRO B 1 8   ? -24.394 -45.674 -58.271  1.00 1.91 ? 8   PRO B N    1 
ATOM   1952 C  CA   . PRO B 1 8   ? -23.849 -44.904 -57.147  1.00 1.78 ? 8   PRO B CA   1 
ATOM   1953 C  C    . PRO B 1 8   ? -23.085 -43.664 -57.602  1.00 1.72 ? 8   PRO B C    1 
ATOM   1954 O  O    . PRO B 1 8   ? -22.862 -42.741 -56.818  1.00 1.62 ? 8   PRO B O    1 
ATOM   1955 C  CB   . PRO B 1 8   ? -22.899 -45.890 -56.458  1.00 2.01 ? 8   PRO B CB   1 
ATOM   1956 C  CG   . PRO B 1 8   ? -23.360 -47.239 -56.893  1.00 2.39 ? 8   PRO B CG   1 
ATOM   1957 C  CD   . PRO B 1 8   ? -23.902 -47.061 -58.282  1.00 2.24 ? 8   PRO B CD   1 
ATOM   1958 H  HA   . PRO B 1 8   ? -24.627 -44.611 -56.457  1.00 1.62 ? 8   PRO B HA   1 
ATOM   1959 H  HB2  . PRO B 1 8   ? -21.885 -45.698 -56.778  1.00 2.27 ? 8   PRO B HB2  1 
ATOM   1960 H  HB3  . PRO B 1 8   ? -22.972 -45.776 -55.387  1.00 1.80 ? 8   PRO B HB3  1 
ATOM   1961 H  HG2  . PRO B 1 8   ? -22.528 -47.928 -56.900  1.00 2.67 ? 8   PRO B HG2  1 
ATOM   1962 H  HG3  . PRO B 1 8   ? -24.136 -47.593 -56.230  1.00 2.64 ? 8   PRO B HG3  1 
ATOM   1963 H  HD2  . PRO B 1 8   ? -23.117 -47.187 -59.013  1.00 2.22 ? 8   PRO B HD2  1 
ATOM   1964 H  HD3  . PRO B 1 8   ? -24.708 -47.755 -58.466  1.00 2.43 ? 8   PRO B HD3  1 
ATOM   1965 N  N    . ALA B 1 9   ? -22.683 -43.649 -58.872  1.00 1.84 ? 9   ALA B N    1 
ATOM   1966 C  CA   . ALA B 1 9   ? -21.941 -42.522 -59.428  1.00 1.85 ? 9   ALA B CA   1 
ATOM   1967 C  C    . ALA B 1 9   ? -22.554 -41.191 -59.004  1.00 1.34 ? 9   ALA B C    1 
ATOM   1968 O  O    . ALA B 1 9   ? -22.083 -40.553 -58.062  1.00 1.95 ? 9   ALA B O    1 
ATOM   1969 C  CB   . ALA B 1 9   ? -21.891 -42.623 -60.946  1.00 2.28 ? 9   ALA B CB   1 
ATOM   1970 H  H    . ALA B 1 9   ? -22.887 -44.415 -59.447  1.00 1.97 ? 9   ALA B H    1 
ATOM   1971 H  HA   . ALA B 1 9   ? -20.929 -42.575 -59.055  1.00 2.07 ? 9   ALA B HA   1 
ATOM   1972 H  HB1  . ALA B 1 9   ? -21.852 -41.632 -61.371  1.00 2.19 ? 9   ALA B HB1  1 
ATOM   1973 H  HB2  . ALA B 1 9   ? -22.774 -43.133 -61.302  1.00 3.02 ? 9   ALA B HB2  1 
ATOM   1974 H  HB3  . ALA B 1 9   ? -21.012 -43.177 -61.241  1.00 2.41 ? 9   ALA B HB3  1 
ATOM   1975 N  N    . TRP B 1 10  ? -23.607 -40.777 -59.702  1.00 1.14 ? 10  TRP B N    1 
ATOM   1976 C  CA   . TRP B 1 10  ? -24.281 -39.521 -59.392  1.00 0.82 ? 10  TRP B CA   1 
ATOM   1977 C  C    . TRP B 1 10  ? -25.638 -39.777 -58.746  1.00 0.72 ? 10  TRP B C    1 
ATOM   1978 O  O    . TRP B 1 10  ? -26.674 -39.370 -59.274  1.00 0.73 ? 10  TRP B O    1 
ATOM   1979 C  CB   . TRP B 1 10  ? -24.458 -38.683 -60.659  1.00 1.13 ? 10  TRP B CB   1 
ATOM   1980 C  CG   . TRP B 1 10  ? -23.410 -38.942 -61.698  1.00 1.04 ? 10  TRP B CG   1 
ATOM   1981 C  CD1  . TRP B 1 10  ? -22.148 -38.424 -61.737  1.00 1.25 ? 10  TRP B CD1  1 
ATOM   1982 C  CD2  . TRP B 1 10  ? -23.536 -39.780 -62.852  1.00 1.10 ? 10  TRP B CD2  1 
ATOM   1983 N  NE1  . TRP B 1 10  ? -21.481 -38.889 -62.844  1.00 1.24 ? 10  TRP B NE1  1 
ATOM   1984 C  CE2  . TRP B 1 10  ? -22.312 -39.724 -63.545  1.00 1.18 ? 10  TRP B CE2  1 
ATOM   1985 C  CE3  . TRP B 1 10  ? -24.565 -40.574 -63.367  1.00 1.44 ? 10  TRP B CE3  1 
ATOM   1986 C  CZ2  . TRP B 1 10  ? -22.090 -40.430 -64.724  1.00 1.50 ? 10  TRP B CZ2  1 
ATOM   1987 C  CZ3  . TRP B 1 10  ? -24.344 -41.274 -64.538  1.00 1.86 ? 10  TRP B CZ3  1 
ATOM   1988 C  CH2  . TRP B 1 10  ? -23.115 -41.199 -65.205  1.00 1.85 ? 10  TRP B CH2  1 
ATOM   1989 H  H    . TRP B 1 10  ? -23.939 -41.327 -60.441  1.00 1.83 ? 10  TRP B H    1 
ATOM   1990 H  HA   . TRP B 1 10  ? -23.661 -38.977 -58.695  1.00 0.88 ? 10  TRP B HA   1 
ATOM   1991 H  HB2  . TRP B 1 10  ? -25.420 -38.902 -61.096  1.00 1.58 ? 10  TRP B HB2  1 
ATOM   1992 H  HB3  . TRP B 1 10  ? -24.417 -37.635 -60.398  1.00 1.40 ? 10  TRP B HB3  1 
ATOM   1993 H  HD1  . TRP B 1 10  ? -21.745 -37.747 -60.997  1.00 1.59 ? 10  TRP B HD1  1 
ATOM   1994 H  HE1  . TRP B 1 10  ? -20.561 -38.661 -63.092  1.00 1.44 ? 10  TRP B HE1  1 
ATOM   1995 H  HE3  . TRP B 1 10  ? -25.520 -40.645 -62.866  1.00 1.54 ? 10  TRP B HE3  1 
ATOM   1996 H  HZ2  . TRP B 1 10  ? -21.148 -40.383 -65.251  1.00 1.62 ? 10  TRP B HZ2  1 
ATOM   1997 H  HZ3  . TRP B 1 10  ? -25.127 -41.892 -64.950  1.00 2.27 ? 10  TRP B HZ3  1 
ATOM   1998 H  HH2  . TRP B 1 10  ? -22.987 -41.762 -66.117  1.00 2.23 ? 10  TRP B HH2  1 
ATOM   1999 N  N    . GLN B 1 11  ? -25.628 -40.453 -57.602  1.00 0.74 ? 11  GLN B N    1 
ATOM   2000 C  CA   . GLN B 1 11  ? -26.860 -40.761 -56.887  1.00 0.69 ? 11  GLN B CA   1 
ATOM   2001 C  C    . GLN B 1 11  ? -27.376 -39.536 -56.138  1.00 0.59 ? 11  GLN B C    1 
ATOM   2002 O  O    . GLN B 1 11  ? -28.524 -39.128 -56.313  1.00 0.57 ? 11  GLN B O    1 
ATOM   2003 C  CB   . GLN B 1 11  ? -26.636 -41.917 -55.911  1.00 0.76 ? 11  GLN B CB   1 
ATOM   2004 C  CG   . GLN B 1 11  ? -27.523 -43.122 -56.182  1.00 1.21 ? 11  GLN B CG   1 
ATOM   2005 C  CD   . GLN B 1 11  ? -28.424 -43.458 -55.010  1.00 2.09 ? 11  GLN B CD   1 
ATOM   2006 O  OE1  . GLN B 1 11  ? -29.607 -43.118 -55.004  1.00 2.70 ? 11  GLN B OE1  1 
ATOM   2007 N  NE2  . GLN B 1 11  ? -27.867 -44.128 -54.008  1.00 2.81 ? 11  GLN B NE2  1 
ATOM   2008 H  H    . GLN B 1 11  ? -24.771 -40.751 -57.230  1.00 0.84 ? 11  GLN B H    1 
ATOM   2009 H  HA   . GLN B 1 11  ? -27.599 -41.057 -57.617  1.00 0.74 ? 11  GLN B HA   1 
ATOM   2010 H  HB2  . GLN B 1 11  ? -25.606 -42.233 -55.976  1.00 0.98 ? 11  GLN B HB2  1 
ATOM   2011 H  HB3  . GLN B 1 11  ? -26.835 -41.570 -54.908  1.00 0.87 ? 11  GLN B HB3  1 
ATOM   2012 H  HG2  . GLN B 1 11  ? -28.140 -42.912 -57.042  1.00 1.58 ? 11  GLN B HG2  1 
ATOM   2013 H  HG3  . GLN B 1 11  ? -26.894 -43.975 -56.390  1.00 1.59 ? 11  GLN B HG3  1 
ATOM   2014 H  HE21 . GLN B 1 11  ? -26.919 -44.366 -54.081  1.00 2.82 ? 11  GLN B HE21 1 
ATOM   2015 H  HE22 . GLN B 1 11  ? -28.427 -44.359 -53.238  1.00 3.58 ? 11  GLN B HE22 1 
ATOM   2016 N  N    . PRO B 1 12  ? -26.527 -38.928 -55.293  1.00 0.57 ? 12  PRO B N    1 
ATOM   2017 C  CA   . PRO B 1 12  ? -26.900 -37.741 -54.519  1.00 0.54 ? 12  PRO B CA   1 
ATOM   2018 C  C    . PRO B 1 12  ? -27.530 -36.659 -55.388  1.00 0.50 ? 12  PRO B C    1 
ATOM   2019 O  O    . PRO B 1 12  ? -28.313 -35.839 -54.909  1.00 0.50 ? 12  PRO B O    1 
ATOM   2020 C  CB   . PRO B 1 12  ? -25.565 -37.258 -53.949  1.00 0.61 ? 12  PRO B CB   1 
ATOM   2021 C  CG   . PRO B 1 12  ? -24.723 -38.483 -53.872  1.00 0.64 ? 12  PRO B CG   1 
ATOM   2022 C  CD   . PRO B 1 12  ? -25.139 -39.348 -55.031  1.00 0.66 ? 12  PRO B CD   1 
ATOM   2023 H  HA   . PRO B 1 12  ? -27.572 -37.989 -53.711  1.00 0.56 ? 12  PRO B HA   1 
ATOM   2024 H  HB2  . PRO B 1 12  ? -25.134 -36.521 -54.610  1.00 0.67 ? 12  PRO B HB2  1 
ATOM   2025 H  HB3  . PRO B 1 12  ? -25.723 -36.826 -52.972  1.00 0.64 ? 12  PRO B HB3  1 
ATOM   2026 H  HG2  . PRO B 1 12  ? -23.680 -38.217 -53.958  1.00 0.73 ? 12  PRO B HG2  1 
ATOM   2027 H  HG3  . PRO B 1 12  ? -24.905 -38.995 -52.938  1.00 0.62 ? 12  PRO B HG3  1 
ATOM   2028 H  HD2  . PRO B 1 12  ? -24.510 -39.158 -55.889  1.00 0.75 ? 12  PRO B HD2  1 
ATOM   2029 H  HD3  . PRO B 1 12  ? -25.097 -40.391 -54.755  1.00 0.68 ? 12  PRO B HD3  1 
ATOM   2030 N  N    . PHE B 1 13  ? -27.183 -36.663 -56.671  1.00 0.49 ? 13  PHE B N    1 
ATOM   2031 C  CA   . PHE B 1 13  ? -27.714 -35.684 -57.611  1.00 0.46 ? 13  PHE B CA   1 
ATOM   2032 C  C    . PHE B 1 13  ? -29.240 -35.671 -57.579  1.00 0.50 ? 13  PHE B C    1 
ATOM   2033 O  O    . PHE B 1 13  ? -29.868 -34.656 -57.880  1.00 0.51 ? 13  PHE B O    1 
ATOM   2034 C  CB   . PHE B 1 13  ? -27.227 -35.991 -59.028  1.00 0.46 ? 13  PHE B CB   1 
ATOM   2035 C  CG   . PHE B 1 13  ? -25.840 -35.485 -59.312  1.00 0.46 ? 13  PHE B CG   1 
ATOM   2036 C  CD1  . PHE B 1 13  ? -24.755 -35.952 -58.587  1.00 1.04 ? 13  PHE B CD1  1 
ATOM   2037 C  CD2  . PHE B 1 13  ? -25.623 -34.545 -60.306  1.00 1.37 ? 13  PHE B CD2  1 
ATOM   2038 C  CE1  . PHE B 1 13  ? -23.479 -35.489 -58.849  1.00 1.15 ? 13  PHE B CE1  1 
ATOM   2039 C  CE2  . PHE B 1 13  ? -24.350 -34.079 -60.572  1.00 1.37 ? 13  PHE B CE2  1 
ATOM   2040 C  CZ   . PHE B 1 13  ? -23.276 -34.552 -59.843  1.00 0.64 ? 13  PHE B CZ   1 
ATOM   2041 H  H    . PHE B 1 13  ? -26.555 -37.343 -56.994  1.00 0.50 ? 13  PHE B H    1 
ATOM   2042 H  HA   . PHE B 1 13  ? -27.351 -34.711 -57.317  1.00 0.43 ? 13  PHE B HA   1 
ATOM   2043 H  HB2  . PHE B 1 13  ? -27.226 -37.060 -59.177  1.00 0.47 ? 13  PHE B HB2  1 
ATOM   2044 H  HB3  . PHE B 1 13  ? -27.900 -35.534 -59.739  1.00 0.55 ? 13  PHE B HB3  1 
ATOM   2045 H  HD1  . PHE B 1 13  ? -24.911 -36.685 -57.811  1.00 1.84 ? 13  PHE B HD1  1 
ATOM   2046 H  HD2  . PHE B 1 13  ? -26.462 -34.175 -60.877  1.00 2.23 ? 13  PHE B HD2  1 
ATOM   2047 H  HE1  . PHE B 1 13  ? -22.642 -35.860 -58.277  1.00 1.99 ? 13  PHE B HE1  1 
ATOM   2048 H  HE2  . PHE B 1 13  ? -24.194 -33.346 -61.349  1.00 2.19 ? 13  PHE B HE2  1 
ATOM   2049 H  HZ   . PHE B 1 13  ? -22.280 -34.190 -60.050  1.00 0.75 ? 13  PHE B HZ   1 
ATOM   2050 N  N    . LEU B 1 14  ? -29.830 -36.805 -57.213  1.00 0.55 ? 14  LEU B N    1 
ATOM   2051 C  CA   . LEU B 1 14  ? -31.282 -36.923 -57.143  1.00 0.62 ? 14  LEU B CA   1 
ATOM   2052 C  C    . LEU B 1 14  ? -31.828 -36.213 -55.909  1.00 0.57 ? 14  LEU B C    1 
ATOM   2053 O  O    . LEU B 1 14  ? -31.220 -36.248 -54.840  1.00 0.62 ? 14  LEU B O    1 
ATOM   2054 C  CB   . LEU B 1 14  ? -31.694 -38.396 -57.123  1.00 0.68 ? 14  LEU B CB   1 
ATOM   2055 C  CG   . LEU B 1 14  ? -31.083 -39.254 -58.232  1.00 0.72 ? 14  LEU B CG   1 
ATOM   2056 C  CD1  . LEU B 1 14  ? -31.852 -40.557 -58.384  1.00 0.94 ? 14  LEU B CD1  1 
ATOM   2057 C  CD2  . LEU B 1 14  ? -31.063 -38.488 -59.547  1.00 0.80 ? 14  LEU B CD2  1 
ATOM   2058 H  H    . LEU B 1 14  ? -29.277 -37.581 -56.985  1.00 0.56 ? 14  LEU B H    1 
ATOM   2059 H  HA   . LEU B 1 14  ? -31.694 -36.456 -58.025  1.00 0.70 ? 14  LEU B HA   1 
ATOM   2060 H  HB2  . LEU B 1 14  ? -31.404 -38.816 -56.170  1.00 0.70 ? 14  LEU B HB2  1 
ATOM   2061 H  HB3  . LEU B 1 14  ? -32.769 -38.449 -57.209  1.00 0.73 ? 14  LEU B HB3  1 
ATOM   2062 H  HG   . LEU B 1 14  ? -30.063 -39.497 -57.970  1.00 0.96 ? 14  LEU B HG   1 
ATOM   2063 H  HD11 . LEU B 1 14  ? -32.190 -40.659 -59.405  1.00 1.28 ? 14  LEU B HD11 1 
ATOM   2064 H  HD12 . LEU B 1 14  ? -32.705 -40.551 -57.721  1.00 1.20 ? 14  LEU B HD12 1 
ATOM   2065 H  HD13 . LEU B 1 14  ? -31.208 -41.387 -58.133  1.00 1.58 ? 14  LEU B HD13 1 
ATOM   2066 H  HD21 . LEU B 1 14  ? -30.981 -39.184 -60.368  1.00 1.19 ? 14  LEU B HD21 1 
ATOM   2067 H  HD22 . LEU B 1 14  ? -30.218 -37.816 -59.558  1.00 1.69 ? 14  LEU B HD22 1 
ATOM   2068 H  HD23 . LEU B 1 14  ? -31.977 -37.920 -59.646  1.00 0.97 ? 14  LEU B HD23 1 
ATOM   2069 N  N    . LYS B 1 15  ? -32.981 -35.570 -56.066  1.00 0.79 ? 15  LYS B N    1 
ATOM   2070 C  CA   . LYS B 1 15  ? -33.612 -34.851 -54.965  1.00 0.78 ? 15  LYS B CA   1 
ATOM   2071 C  C    . LYS B 1 15  ? -34.177 -35.823 -53.934  1.00 0.73 ? 15  LYS B C    1 
ATOM   2072 O  O    . LYS B 1 15  ? -33.921 -35.693 -52.737  1.00 0.65 ? 15  LYS B O    1 
ATOM   2073 C  CB   . LYS B 1 15  ? -34.724 -33.943 -55.493  1.00 0.96 ? 15  LYS B CB   1 
ATOM   2074 C  CG   . LYS B 1 15  ? -35.485 -33.208 -54.401  1.00 1.29 ? 15  LYS B CG   1 
ATOM   2075 C  CD   . LYS B 1 15  ? -35.151 -31.725 -54.386  1.00 1.04 ? 15  LYS B CD   1 
ATOM   2076 C  CE   . LYS B 1 15  ? -36.401 -30.871 -54.237  1.00 1.40 ? 15  LYS B CE   1 
ATOM   2077 N  NZ   . LYS B 1 15  ? -37.432 -31.535 -53.393  1.00 2.30 ? 15  LYS B NZ   1 
ATOM   2078 H  H    . LYS B 1 15  ? -33.418 -35.579 -56.943  1.00 1.06 ? 15  LYS B H    1 
ATOM   2079 H  HA   . LYS B 1 15  ? -32.856 -34.242 -54.491  1.00 0.73 ? 15  LYS B HA   1 
ATOM   2080 H  HB2  . LYS B 1 15  ? -34.289 -33.209 -56.155  1.00 1.43 ? 15  LYS B HB2  1 
ATOM   2081 H  HB3  . LYS B 1 15  ? -35.428 -34.543 -56.051  1.00 0.78 ? 15  LYS B HB3  1 
ATOM   2082 H  HG2  . LYS B 1 15  ? -36.544 -33.327 -54.573  1.00 1.68 ? 15  LYS B HG2  1 
ATOM   2083 H  HG3  . LYS B 1 15  ? -35.225 -33.636 -53.444  1.00 1.99 ? 15  LYS B HG3  1 
ATOM   2084 H  HD2  . LYS B 1 15  ? -34.490 -31.522 -53.557  1.00 1.24 ? 15  LYS B HD2  1 
ATOM   2085 H  HD3  . LYS B 1 15  ? -34.659 -31.467 -55.313  1.00 1.29 ? 15  LYS B HD3  1 
ATOM   2086 H  HE2  . LYS B 1 15  ? -36.127 -29.932 -53.781  1.00 1.91 ? 15  LYS B HE2  1 
ATOM   2087 H  HE3  . LYS B 1 15  ? -36.814 -30.687 -55.218  1.00 1.66 ? 15  LYS B HE3  1 
ATOM   2088 H  HZ1  . LYS B 1 15  ? -38.069 -32.104 -53.987  1.00 2.37 ? 15  LYS B HZ1  1 
ATOM   2089 H  HZ2  . LYS B 1 15  ? -37.994 -30.821 -52.887  1.00 2.89 ? 15  LYS B HZ2  1 
ATOM   2090 H  HZ3  . LYS B 1 15  ? -36.977 -32.159 -52.696  1.00 2.91 ? 15  LYS B HZ3  1 
ATOM   2091 N  N    . ASP B 1 16  ? -34.947 -36.798 -54.408  1.00 0.79 ? 16  ASP B N    1 
ATOM   2092 C  CA   . ASP B 1 16  ? -35.549 -37.792 -53.527  1.00 0.79 ? 16  ASP B CA   1 
ATOM   2093 C  C    . ASP B 1 16  ? -34.495 -38.438 -52.633  1.00 0.78 ? 16  ASP B C    1 
ATOM   2094 O  O    . ASP B 1 16  ? -34.730 -38.670 -51.447  1.00 0.83 ? 16  ASP B O    1 
ATOM   2095 C  CB   . ASP B 1 16  ? -36.263 -38.866 -54.350  1.00 0.85 ? 16  ASP B CB   1 
ATOM   2096 C  CG   . ASP B 1 16  ? -35.296 -39.729 -55.137  1.00 1.92 ? 16  ASP B CG   1 
ATOM   2097 O  OD1  . ASP B 1 16  ? -34.844 -39.285 -56.212  1.00 2.47 ? 16  ASP B OD1  1 
ATOM   2098 O  OD2  . ASP B 1 16  ? -34.991 -40.850 -54.677  1.00 2.73 ? 16  ASP B OD2  1 
ATOM   2099 H  H    . ASP B 1 16  ? -35.114 -36.850 -55.372  1.00 0.86 ? 16  ASP B H    1 
ATOM   2100 H  HA   . ASP B 1 16  ? -36.272 -37.288 -52.904  1.00 0.78 ? 16  ASP B HA   1 
ATOM   2101 H  HB2  . ASP B 1 16  ? -36.827 -39.504 -53.686  1.00 1.02 ? 16  ASP B HB2  1 
ATOM   2102 H  HB3  . ASP B 1 16  ? -36.939 -38.389 -55.044  1.00 1.24 ? 16  ASP B HB3  1 
ATOM   2103 N  N    . HIS B 1 17  ? -33.333 -38.726 -53.209  1.00 0.76 ? 17  HIS B N    1 
ATOM   2104 C  CA   . HIS B 1 17  ? -32.243 -39.346 -52.465  1.00 0.79 ? 17  HIS B CA   1 
ATOM   2105 C  C    . HIS B 1 17  ? -31.814 -38.469 -51.293  1.00 0.79 ? 17  HIS B C    1 
ATOM   2106 O  O    . HIS B 1 17  ? -31.851 -38.896 -50.139  1.00 0.83 ? 17  HIS B O    1 
ATOM   2107 C  CB   . HIS B 1 17  ? -31.050 -39.606 -53.386  1.00 0.80 ? 17  HIS B CB   1 
ATOM   2108 C  CG   . HIS B 1 17  ? -29.847 -40.138 -52.672  1.00 1.03 ? 17  HIS B CG   1 
ATOM   2109 N  ND1  . HIS B 1 17  ? -29.631 -41.483 -52.461  1.00 1.49 ? 17  HIS B ND1  1 
ATOM   2110 C  CD2  . HIS B 1 17  ? -28.791 -39.497 -52.118  1.00 1.24 ? 17  HIS B CD2  1 
ATOM   2111 C  CE1  . HIS B 1 17  ? -28.494 -41.647 -51.807  1.00 1.73 ? 17  HIS B CE1  1 
ATOM   2112 N  NE2  . HIS B 1 17  ? -27.965 -40.458 -51.588  1.00 1.62 ? 17  HIS B NE2  1 
ATOM   2113 H  H    . HIS B 1 17  ? -33.205 -38.518 -54.158  1.00 0.76 ? 17  HIS B H    1 
ATOM   2114 H  HA   . HIS B 1 17  ? -32.600 -40.290 -52.080  1.00 0.85 ? 17  HIS B HA   1 
ATOM   2115 H  HB2  . HIS B 1 17  ? -31.335 -40.326 -54.138  1.00 0.98 ? 17  HIS B HB2  1 
ATOM   2116 H  HB3  . HIS B 1 17  ? -30.769 -38.681 -53.869  1.00 0.79 ? 17  HIS B HB3  1 
ATOM   2117 H  HD1  . HIS B 1 17  ? -30.223 -42.210 -52.747  1.00 1.76 ? 17  HIS B HD1  1 
ATOM   2118 H  HD2  . HIS B 1 17  ? -28.629 -38.429 -52.097  1.00 1.36 ? 17  HIS B HD2  1 
ATOM   2119 H  HE1  . HIS B 1 17  ? -28.070 -42.593 -51.505  1.00 2.11 ? 17  HIS B HE1  1 
ATOM   2120 H  HE2  . HIS B 1 17  ? -27.080 -40.296 -51.201  1.00 1.91 ? 17  HIS B HE2  1 
ATOM   2121 N  N    . ARG B 1 18  ? -31.406 -37.241 -51.596  1.00 0.75 ? 18  ARG B N    1 
ATOM   2122 C  CA   . ARG B 1 18  ? -30.970 -36.304 -50.567  1.00 0.76 ? 18  ARG B CA   1 
ATOM   2123 C  C    . ARG B 1 18  ? -32.014 -36.186 -49.462  1.00 0.77 ? 18  ARG B C    1 
ATOM   2124 O  O    . ARG B 1 18  ? -31.680 -35.957 -48.300  1.00 0.85 ? 18  ARG B O    1 
ATOM   2125 C  CB   . ARG B 1 18  ? -30.703 -34.929 -51.181  1.00 0.75 ? 18  ARG B CB   1 
ATOM   2126 C  CG   . ARG B 1 18  ? -29.377 -34.836 -51.917  1.00 0.85 ? 18  ARG B CG   1 
ATOM   2127 C  CD   . ARG B 1 18  ? -29.226 -33.500 -52.627  1.00 0.82 ? 18  ARG B CD   1 
ATOM   2128 N  NE   . ARG B 1 18  ? -29.740 -33.545 -53.993  1.00 0.95 ? 18  ARG B NE   1 
ATOM   2129 C  CZ   . ARG B 1 18  ? -29.466 -32.627 -54.916  1.00 0.82 ? 18  ARG B CZ   1 
ATOM   2130 N  NH1  . ARG B 1 18  ? -28.688 -31.593 -54.620  1.00 1.43 ? 18  ARG B NH1  1 
ATOM   2131 N  NH2  . ARG B 1 18  ? -29.970 -32.740 -56.136  1.00 1.39 ? 18  ARG B NH2  1 
ATOM   2132 H  H    . ARG B 1 18  ? -31.398 -36.958 -52.535  1.00 0.74 ? 18  ARG B H    1 
ATOM   2133 H  HA   . ARG B 1 18  ? -30.053 -36.683 -50.141  1.00 0.79 ? 18  ARG B HA   1 
ATOM   2134 H  HB2  . ARG B 1 18  ? -31.495 -34.699 -51.879  1.00 0.74 ? 18  ARG B HB2  1 
ATOM   2135 H  HB3  . ARG B 1 18  ? -30.705 -34.190 -50.393  1.00 0.77 ? 18  ARG B HB3  1 
ATOM   2136 H  HG2  . ARG B 1 18  ? -28.573 -34.947 -51.206  1.00 1.20 ? 18  ARG B HG2  1 
ATOM   2137 H  HG3  . ARG B 1 18  ? -29.327 -35.630 -52.648  1.00 1.34 ? 18  ARG B HG3  1 
ATOM   2138 H  HD2  . ARG B 1 18  ? -29.771 -32.750 -52.073  1.00 1.37 ? 18  ARG B HD2  1 
ATOM   2139 H  HD3  . ARG B 1 18  ? -28.179 -33.238 -52.653  1.00 1.46 ? 18  ARG B HD3  1 
ATOM   2140 H  HE   . ARG B 1 18  ? -30.318 -34.298 -54.236  1.00 1.77 ? 18  ARG B HE   1 
ATOM   2141 H  HH11 . ARG B 1 18  ? -28.306 -31.501 -53.701  1.00 1.85 ? 18  ARG B HH11 1 
ATOM   2142 H  HH12 . ARG B 1 18  ? -28.484 -30.906 -55.317  1.00 1.91 ? 18  ARG B HH12 1 
ATOM   2143 H  HH21 . ARG B 1 18  ? -30.557 -33.517 -56.364  1.00 2.11 ? 18  ARG B HH21 1 
ATOM   2144 H  HH22 . ARG B 1 18  ? -29.764 -32.049 -56.829  1.00 1.45 ? 18  ARG B HH22 1 
ATOM   2145 N  N    . ILE B 1 19  ? -33.281 -36.345 -49.833  1.00 0.73 ? 19  ILE B N    1 
ATOM   2146 C  CA   . ILE B 1 19  ? -34.374 -36.257 -48.874  1.00 0.76 ? 19  ILE B CA   1 
ATOM   2147 C  C    . ILE B 1 19  ? -34.490 -37.537 -48.054  1.00 0.76 ? 19  ILE B C    1 
ATOM   2148 O  O    . ILE B 1 19  ? -34.801 -37.497 -46.863  1.00 0.80 ? 19  ILE B O    1 
ATOM   2149 C  CB   . ILE B 1 19  ? -35.718 -35.988 -49.577  1.00 0.79 ? 19  ILE B CB   1 
ATOM   2150 C  CG1  . ILE B 1 19  ? -35.998 -34.486 -49.634  1.00 0.81 ? 19  ILE B CG1  1 
ATOM   2151 C  CG2  . ILE B 1 19  ? -36.845 -36.717 -48.861  1.00 0.80 ? 19  ILE B CG2  1 
ATOM   2152 C  CD1  . ILE B 1 19  ? -35.731 -33.871 -50.991  1.00 0.90 ? 19  ILE B CD1  1 
ATOM   2153 H  H    . ILE B 1 19  ? -33.484 -36.526 -50.775  1.00 0.71 ? 19  ILE B H    1 
ATOM   2154 H  HA   . ILE B 1 19  ? -34.168 -35.431 -48.208  1.00 0.77 ? 19  ILE B HA   1 
ATOM   2155 H  HB   . ILE B 1 19  ? -35.656 -36.374 -50.584  1.00 0.82 ? 19  ILE B HB   1 
ATOM   2156 H  HG12 . ILE B 1 19  ? -37.034 -34.310 -49.389  1.00 0.76 ? 19  ILE B HG12 1 
ATOM   2157 H  HG13 . ILE B 1 19  ? -35.371 -33.982 -48.912  1.00 0.85 ? 19  ILE B HG13 1 
ATOM   2158 H  HG21 . ILE B 1 19  ? -37.796 -36.353 -49.222  1.00 1.44 ? 19  ILE B HG21 1 
ATOM   2159 H  HG22 . ILE B 1 19  ? -36.771 -36.538 -47.798  1.00 1.19 ? 19  ILE B HG22 1 
ATOM   2160 H  HG23 . ILE B 1 19  ? -36.768 -37.777 -49.054  1.00 0.83 ? 19  ILE B HG23 1 
ATOM   2161 H  HD11 . ILE B 1 19  ? -36.183 -32.892 -51.038  1.00 1.39 ? 19  ILE B HD11 1 
ATOM   2162 H  HD12 . ILE B 1 19  ? -36.153 -34.501 -51.760  1.00 1.32 ? 19  ILE B HD12 1 
ATOM   2163 H  HD13 . ILE B 1 19  ? -34.665 -33.783 -51.143  1.00 1.18 ? 19  ILE B HD13 1 
ATOM   2164 N  N    . SER B 1 20  ? -34.237 -38.671 -48.698  1.00 0.76 ? 20  SER B N    1 
ATOM   2165 C  CA   . SER B 1 20  ? -34.313 -39.964 -48.028  1.00 0.80 ? 20  SER B CA   1 
ATOM   2166 C  C    . SER B 1 20  ? -33.283 -40.057 -46.907  1.00 0.76 ? 20  SER B C    1 
ATOM   2167 O  O    . SER B 1 20  ? -33.508 -40.724 -45.897  1.00 0.78 ? 20  SER B O    1 
ATOM   2168 C  CB   . SER B 1 20  ? -34.094 -41.097 -49.032  1.00 0.87 ? 20  SER B CB   1 
ATOM   2169 O  OG   . SER B 1 20  ? -34.452 -42.350 -48.474  1.00 1.47 ? 20  SER B OG   1 
ATOM   2170 H  H    . SER B 1 20  ? -33.994 -38.639 -49.647  1.00 0.76 ? 20  SER B H    1 
ATOM   2171 H  HA   . SER B 1 20  ? -35.301 -40.059 -47.602  1.00 0.84 ? 20  SER B HA   1 
ATOM   2172 H  HB2  . SER B 1 20  ? -34.700 -40.921 -49.908  1.00 1.05 ? 20  SER B HB2  1 
ATOM   2173 H  HB3  . SER B 1 20  ? -33.052 -41.127 -49.315  1.00 1.18 ? 20  SER B HB3  1 
ATOM   2174 H  HG   . SER B 1 20  ? -33.810 -43.013 -48.738  1.00 2.23 ? 20  SER B HG   1 
ATOM   2175 N  N    . THR B 1 21  ? -32.153 -39.383 -47.091  1.00 0.72 ? 21  THR B N    1 
ATOM   2176 C  CA   . THR B 1 21  ? -31.089 -39.389 -46.095  1.00 0.70 ? 21  THR B CA   1 
ATOM   2177 C  C    . THR B 1 21  ? -31.602 -38.911 -44.741  1.00 0.63 ? 21  THR B C    1 
ATOM   2178 O  O    . THR B 1 21  ? -31.187 -39.413 -43.697  1.00 0.74 ? 21  THR B O    1 
ATOM   2179 C  CB   . THR B 1 21  ? -29.907 -38.501 -46.528  1.00 0.75 ? 21  THR B CB   1 
ATOM   2180 O  OG1  . THR B 1 21  ? -30.151 -37.961 -47.832  1.00 1.23 ? 21  THR B OG1  1 
ATOM   2181 C  CG2  . THR B 1 21  ? -28.609 -39.294 -46.538  1.00 1.15 ? 21  THR B CG2  1 
ATOM   2182 H  H    . THR B 1 21  ? -32.031 -38.869 -47.917  1.00 0.71 ? 21  THR B H    1 
ATOM   2183 H  HA   . THR B 1 21  ? -30.732 -40.404 -45.995  1.00 0.75 ? 21  THR B HA   1 
ATOM   2184 H  HB   . THR B 1 21  ? -29.809 -37.688 -45.823  1.00 0.54 ? 21  THR B HB   1 
ATOM   2185 H  HG1  . THR B 1 21  ? -29.562 -37.220 -47.988  1.00 1.51 ? 21  THR B HG1  1 
ATOM   2186 H  HG21 . THR B 1 21  ? -28.060 -39.098 -45.629  1.00 1.47 ? 21  THR B HG21 1 
ATOM   2187 H  HG22 . THR B 1 21  ? -28.013 -38.999 -47.389  1.00 1.74 ? 21  THR B HG22 1 
ATOM   2188 H  HG23 . THR B 1 21  ? -28.832 -40.349 -46.603  1.00 1.19 ? 21  THR B HG23 1 
ATOM   2189 N  N    . PHE B 1 22  ? -32.508 -37.939 -44.767  1.00 0.60 ? 22  PHE B N    1 
ATOM   2190 C  CA   . PHE B 1 22  ? -33.078 -37.394 -43.540  1.00 0.61 ? 22  PHE B CA   1 
ATOM   2191 C  C    . PHE B 1 22  ? -33.902 -38.450 -42.810  1.00 0.65 ? 22  PHE B C    1 
ATOM   2192 O  O    . PHE B 1 22  ? -34.941 -38.890 -43.302  1.00 0.81 ? 22  PHE B O    1 
ATOM   2193 C  CB   . PHE B 1 22  ? -33.951 -36.177 -43.855  1.00 0.73 ? 22  PHE B CB   1 
ATOM   2194 C  CG   . PHE B 1 22  ? -33.167 -34.977 -44.304  1.00 0.67 ? 22  PHE B CG   1 
ATOM   2195 C  CD1  . PHE B 1 22  ? -32.233 -34.389 -43.466  1.00 1.44 ? 22  PHE B CD1  1 
ATOM   2196 C  CD2  . PHE B 1 22  ? -33.365 -34.436 -45.564  1.00 0.81 ? 22  PHE B CD2  1 
ATOM   2197 C  CE1  . PHE B 1 22  ? -31.510 -33.285 -43.877  1.00 1.44 ? 22  PHE B CE1  1 
ATOM   2198 C  CE2  . PHE B 1 22  ? -32.646 -33.331 -45.980  1.00 0.83 ? 22  PHE B CE2  1 
ATOM   2199 C  CZ   . PHE B 1 22  ? -31.718 -32.755 -45.136  1.00 0.69 ? 22  PHE B CZ   1 
ATOM   2200 H  H    . PHE B 1 22  ? -32.800 -37.580 -45.631  1.00 0.66 ? 22  PHE B H    1 
ATOM   2201 H  HA   . PHE B 1 22  ? -32.263 -37.087 -42.903  1.00 0.59 ? 22  PHE B HA   1 
ATOM   2202 H  HB2  . PHE B 1 22  ? -34.644 -36.434 -44.641  1.00 0.83 ? 22  PHE B HB2  1 
ATOM   2203 H  HB3  . PHE B 1 22  ? -34.504 -35.902 -42.969  1.00 0.82 ? 22  PHE B HB3  1 
ATOM   2204 H  HD1  . PHE B 1 22  ? -32.070 -34.803 -42.482  1.00 2.17 ? 22  PHE B HD1  1 
ATOM   2205 H  HD2  . PHE B 1 22  ? -34.092 -34.885 -46.225  1.00 1.45 ? 22  PHE B HD2  1 
ATOM   2206 H  HE1  . PHE B 1 22  ? -30.785 -32.836 -43.214  1.00 2.16 ? 22  PHE B HE1  1 
ATOM   2207 H  HE2  . PHE B 1 22  ? -32.810 -32.919 -46.965  1.00 1.49 ? 22  PHE B HE2  1 
ATOM   2208 H  HZ   . PHE B 1 22  ? -31.154 -31.892 -45.459  1.00 0.73 ? 22  PHE B HZ   1 
ATOM   2209 N  N    . LYS B 1 23  ? -33.429 -38.855 -41.636  1.00 0.70 ? 23  LYS B N    1 
ATOM   2210 C  CA   . LYS B 1 23  ? -34.121 -39.861 -40.840  1.00 0.79 ? 23  LYS B CA   1 
ATOM   2211 C  C    . LYS B 1 23  ? -35.231 -39.231 -40.005  1.00 0.98 ? 23  LYS B C    1 
ATOM   2212 O  O    . LYS B 1 23  ? -36.403 -39.580 -40.149  1.00 1.89 ? 23  LYS B O    1 
ATOM   2213 C  CB   . LYS B 1 23  ? -33.132 -40.588 -39.927  1.00 0.83 ? 23  LYS B CB   1 
ATOM   2214 C  CG   . LYS B 1 23  ? -33.352 -42.091 -39.866  1.00 1.18 ? 23  LYS B CG   1 
ATOM   2215 C  CD   . LYS B 1 23  ? -32.757 -42.790 -41.077  1.00 1.92 ? 23  LYS B CD   1 
ATOM   2216 C  CE   . LYS B 1 23  ? -33.837 -43.218 -42.058  1.00 2.46 ? 23  LYS B CE   1 
ATOM   2217 N  NZ   . LYS B 1 23  ? -33.478 -42.878 -43.463  1.00 2.96 ? 23  LYS B NZ   1 
ATOM   2218 H  H    . LYS B 1 23  ? -32.595 -38.468 -41.298  1.00 0.80 ? 23  LYS B H    1 
ATOM   2219 H  HA   . LYS B 1 23  ? -34.560 -40.576 -41.519  1.00 1.00 ? 23  LYS B HA   1 
ATOM   2220 H  HB2  . LYS B 1 23  ? -32.129 -40.407 -40.285  1.00 0.83 ? 23  LYS B HB2  1 
ATOM   2221 H  HB3  . LYS B 1 23  ? -33.225 -40.192 -38.927  1.00 0.86 ? 23  LYS B HB3  1 
ATOM   2222 H  HG2  . LYS B 1 23  ? -32.883 -42.478 -38.974  1.00 1.27 ? 23  LYS B HG2  1 
ATOM   2223 H  HG3  . LYS B 1 23  ? -34.413 -42.288 -39.832  1.00 1.46 ? 23  LYS B HG3  1 
ATOM   2224 H  HD2  . LYS B 1 23  ? -32.080 -42.113 -41.576  1.00 2.20 ? 23  LYS B HD2  1 
ATOM   2225 H  HD3  . LYS B 1 23  ? -32.216 -43.665 -40.746  1.00 2.22 ? 23  LYS B HD3  1 
ATOM   2226 H  HE2  . LYS B 1 23  ? -33.973 -44.287 -41.980  1.00 2.76 ? 23  LYS B HE2  1 
ATOM   2227 H  HE3  . LYS B 1 23  ? -34.759 -42.718 -41.800  1.00 2.45 ? 23  LYS B HE3  1 
ATOM   2228 H  HZ1  . LYS B 1 23  ? -34.330 -42.875 -44.059  1.00 3.39 ? 23  LYS B HZ1  1 
ATOM   2229 H  HZ2  . LYS B 1 23  ? -32.807 -43.578 -43.840  1.00 3.52 ? 23  LYS B HZ2  1 
ATOM   2230 H  HZ3  . LYS B 1 23  ? -33.037 -41.937 -43.501  1.00 2.59 ? 23  LYS B HZ3  1 
ATOM   2231 N  N    . ASN B 1 24  ? -34.855 -38.303 -39.131  1.00 0.82 ? 24  ASN B N    1 
ATOM   2232 C  CA   . ASN B 1 24  ? -35.822 -37.628 -38.272  1.00 1.11 ? 24  ASN B CA   1 
ATOM   2233 C  C    . ASN B 1 24  ? -35.770 -36.117 -38.472  1.00 1.03 ? 24  ASN B C    1 
ATOM   2234 O  O    . ASN B 1 24  ? -36.663 -35.531 -39.084  1.00 1.08 ? 24  ASN B O    1 
ATOM   2235 C  CB   . ASN B 1 24  ? -35.555 -37.969 -36.805  1.00 1.30 ? 24  ASN B CB   1 
ATOM   2236 C  CG   . ASN B 1 24  ? -36.539 -38.986 -36.259  1.00 2.02 ? 24  ASN B CG   1 
ATOM   2237 O  OD1  . ASN B 1 24  ? -37.146 -39.746 -37.014  1.00 2.85 ? 24  ASN B OD1  1 
ATOM   2238 N  ND2  . ASN B 1 24  ? -36.702 -39.004 -34.941  1.00 2.12 ? 24  ASN B ND2  1 
ATOM   2239 H  H    . ASN B 1 24  ? -33.907 -38.069 -39.060  1.00 1.26 ? 24  ASN B H    1 
ATOM   2240 H  HA   . ASN B 1 24  ? -36.806 -37.981 -38.540  1.00 1.38 ? 24  ASN B HA   1 
ATOM   2241 H  HB2  . ASN B 1 24  ? -34.559 -38.375 -36.711  1.00 1.31 ? 24  ASN B HB2  1 
ATOM   2242 H  HB3  . ASN B 1 24  ? -35.631 -37.069 -36.213  1.00 1.40 ? 24  ASN B HB3  1 
ATOM   2243 H  HD21 . ASN B 1 24  ? -36.186 -38.369 -34.402  1.00 2.02 ? 24  ASN B HD21 1 
ATOM   2244 H  HD22 . ASN B 1 24  ? -37.332 -39.651 -34.562  1.00 2.62 ? 24  ASN B HD22 1 
ATOM   2245 N  N    . TRP B 1 25  ? -34.722 -35.491 -37.948  1.00 0.94 ? 25  TRP B N    1 
ATOM   2246 C  CA   . TRP B 1 25  ? -34.556 -34.048 -38.065  1.00 0.86 ? 25  TRP B CA   1 
ATOM   2247 C  C    . TRP B 1 25  ? -35.770 -33.312 -37.503  1.00 0.91 ? 25  TRP B C    1 
ATOM   2248 O  O    . TRP B 1 25  ? -36.812 -33.227 -38.153  1.00 0.92 ? 25  TRP B O    1 
ATOM   2249 C  CB   . TRP B 1 25  ? -34.339 -33.653 -39.526  1.00 0.77 ? 25  TRP B CB   1 
ATOM   2250 C  CG   . TRP B 1 25  ? -33.720 -32.299 -39.680  1.00 0.66 ? 25  TRP B CG   1 
ATOM   2251 C  CD1  . TRP B 1 25  ? -34.317 -31.176 -40.172  1.00 0.58 ? 25  TRP B CD1  1 
ATOM   2252 C  CD2  . TRP B 1 25  ? -32.383 -31.925 -39.333  1.00 0.66 ? 25  TRP B CD2  1 
ATOM   2253 N  NE1  . TRP B 1 25  ? -33.434 -30.125 -40.151  1.00 0.52 ? 25  TRP B NE1  1 
ATOM   2254 C  CE2  . TRP B 1 25  ? -32.238 -30.559 -39.642  1.00 0.56 ? 25  TRP B CE2  1 
ATOM   2255 C  CE3  . TRP B 1 25  ? -31.293 -32.612 -38.791  1.00 0.75 ? 25  TRP B CE3  1 
ATOM   2256 C  CZ2  . TRP B 1 25  ? -31.048 -29.869 -39.425  1.00 0.56 ? 25  TRP B CZ2  1 
ATOM   2257 C  CZ3  . TRP B 1 25  ? -30.113 -31.927 -38.577  1.00 0.75 ? 25  TRP B CZ3  1 
ATOM   2258 C  CH2  . TRP B 1 25  ? -29.998 -30.567 -38.893  1.00 0.66 ? 25  TRP B CH2  1 
ATOM   2259 H  H    . TRP B 1 25  ? -34.044 -36.012 -37.469  1.00 0.96 ? 25  TRP B H    1 
ATOM   2260 H  HA   . TRP B 1 25  ? -33.682 -33.769 -37.496  1.00 0.87 ? 25  TRP B HA   1 
ATOM   2261 H  HB2  . TRP B 1 25  ? -33.687 -34.374 -39.996  1.00 0.79 ? 25  TRP B HB2  1 
ATOM   2262 H  HB3  . TRP B 1 25  ? -35.291 -33.647 -40.037  1.00 0.79 ? 25  TRP B HB3  1 
ATOM   2263 H  HD1  . TRP B 1 25  ? -35.337 -31.135 -40.523  1.00 0.60 ? 25  TRP B HD1  1 
ATOM   2264 H  HE1  . TRP B 1 25  ? -33.629 -29.213 -40.451  1.00 0.47 ? 25  TRP B HE1  1 
ATOM   2265 H  HE3  . TRP B 1 25  ? -31.362 -33.661 -38.542  1.00 0.84 ? 25  TRP B HE3  1 
ATOM   2266 H  HZ2  . TRP B 1 25  ? -30.944 -28.821 -39.663  1.00 0.50 ? 25  TRP B HZ2  1 
ATOM   2267 H  HZ3  . TRP B 1 25  ? -29.261 -32.442 -38.160  1.00 0.84 ? 25  TRP B HZ3  1 
ATOM   2268 H  HH2  . TRP B 1 25  ? -29.057 -30.071 -38.710  1.00 0.68 ? 25  TRP B HH2  1 
ATOM   2269 N  N    . PRO B 1 26  ? -35.651 -32.773 -36.278  1.00 1.08 ? 26  PRO B N    1 
ATOM   2270 C  CA   . PRO B 1 26  ? -36.743 -32.046 -35.622  1.00 1.16 ? 26  PRO B CA   1 
ATOM   2271 C  C    . PRO B 1 26  ? -37.331 -30.942 -36.497  1.00 1.10 ? 26  PRO B C    1 
ATOM   2272 O  O    . PRO B 1 26  ? -38.547 -30.763 -36.548  1.00 1.15 ? 26  PRO B O    1 
ATOM   2273 C  CB   . PRO B 1 26  ? -36.075 -31.444 -34.384  1.00 1.26 ? 26  PRO B CB   1 
ATOM   2274 C  CG   . PRO B 1 26  ? -34.925 -32.345 -34.099  1.00 1.70 ? 26  PRO B CG   1 
ATOM   2275 C  CD   . PRO B 1 26  ? -34.444 -32.836 -35.436  1.00 1.32 ? 26  PRO B CD   1 
ATOM   2276 H  HA   . PRO B 1 26  ? -37.533 -32.716 -35.315  1.00 1.24 ? 26  PRO B HA   1 
ATOM   2277 H  HB2  . PRO B 1 26  ? -35.746 -30.438 -34.602  1.00 1.20 ? 26  PRO B HB2  1 
ATOM   2278 H  HB3  . PRO B 1 26  ? -36.777 -31.429 -33.563  1.00 1.34 ? 26  PRO B HB3  1 
ATOM   2279 H  HG2  . PRO B 1 26  ? -34.143 -31.795 -33.597  1.00 2.10 ? 26  PRO B HG2  1 
ATOM   2280 H  HG3  . PRO B 1 26  ? -35.251 -33.176 -33.490  1.00 2.11 ? 26  PRO B HG3  1 
ATOM   2281 H  HD2  . PRO B 1 26  ? -33.671 -32.186 -35.820  1.00 1.35 ? 26  PRO B HD2  1 
ATOM   2282 H  HD3  . PRO B 1 26  ? -34.081 -33.850 -35.357  1.00 1.33 ? 26  PRO B HD3  1 
ATOM   2283 N  N    . PHE B 1 27  ? -36.464 -30.202 -37.181  1.00 1.05 ? 27  PHE B N    1 
ATOM   2284 C  CA   . PHE B 1 27  ? -36.910 -29.114 -38.046  1.00 1.03 ? 27  PHE B CA   1 
ATOM   2285 C  C    . PHE B 1 27  ? -37.659 -29.652 -39.259  1.00 1.01 ? 27  PHE B C    1 
ATOM   2286 O  O    . PHE B 1 27  ? -37.084 -29.815 -40.336  1.00 1.24 ? 27  PHE B O    1 
ATOM   2287 C  CB   . PHE B 1 27  ? -35.717 -28.270 -38.496  1.00 1.00 ? 27  PHE B CB   1 
ATOM   2288 C  CG   . PHE B 1 27  ? -35.153 -27.404 -37.406  1.00 1.09 ? 27  PHE B CG   1 
ATOM   2289 C  CD1  . PHE B 1 27  ? -35.993 -26.709 -36.551  1.00 1.16 ? 27  PHE B CD1  1 
ATOM   2290 C  CD2  . PHE B 1 27  ? -33.783 -27.286 -37.237  1.00 1.21 ? 27  PHE B CD2  1 
ATOM   2291 C  CE1  . PHE B 1 27  ? -35.477 -25.913 -35.547  1.00 1.28 ? 27  PHE B CE1  1 
ATOM   2292 C  CE2  . PHE B 1 27  ? -33.261 -26.491 -36.234  1.00 1.32 ? 27  PHE B CE2  1 
ATOM   2293 C  CZ   . PHE B 1 27  ? -34.109 -25.804 -35.388  1.00 1.32 ? 27  PHE B CZ   1 
ATOM   2294 H  H    . PHE B 1 27  ? -35.504 -30.387 -37.101  1.00 1.08 ? 27  PHE B H    1 
ATOM   2295 H  HA   . PHE B 1 27  ? -37.581 -28.494 -37.473  1.00 1.07 ? 27  PHE B HA   1 
ATOM   2296 H  HB2  . PHE B 1 27  ? -34.931 -28.924 -38.841  1.00 0.94 ? 27  PHE B HB2  1 
ATOM   2297 H  HB3  . PHE B 1 27  ? -36.026 -27.627 -39.307  1.00 1.04 ? 27  PHE B HB3  1 
ATOM   2298 H  HD1  . PHE B 1 27  ? -37.063 -26.794 -36.675  1.00 1.19 ? 27  PHE B HD1  1 
ATOM   2299 H  HD2  . PHE B 1 27  ? -33.119 -27.823 -37.898  1.00 1.27 ? 27  PHE B HD2  1 
ATOM   2300 H  HE1  . PHE B 1 27  ? -36.143 -25.377 -34.886  1.00 1.39 ? 27  PHE B HE1  1 
ATOM   2301 H  HE2  . PHE B 1 27  ? -32.191 -26.408 -36.112  1.00 1.46 ? 27  PHE B HE2  1 
ATOM   2302 H  HZ   . PHE B 1 27  ? -33.704 -25.182 -34.604  1.00 1.43 ? 27  PHE B HZ   1 
ATOM   2303 N  N    . LEU B 1 28  ? -38.946 -29.923 -39.078  1.00 0.89 ? 28  LEU B N    1 
ATOM   2304 C  CA   . LEU B 1 28  ? -39.778 -30.442 -40.157  1.00 0.89 ? 28  LEU B CA   1 
ATOM   2305 C  C    . LEU B 1 28  ? -40.873 -29.450 -40.527  1.00 0.98 ? 28  LEU B C    1 
ATOM   2306 O  O    . LEU B 1 28  ? -40.765 -28.729 -41.518  1.00 1.13 ? 28  LEU B O    1 
ATOM   2307 C  CB   . LEU B 1 28  ? -40.397 -31.782 -39.752  1.00 0.92 ? 28  LEU B CB   1 
ATOM   2308 C  CG   . LEU B 1 28  ? -39.434 -32.971 -39.767  1.00 0.96 ? 28  LEU B CG   1 
ATOM   2309 C  CD1  . LEU B 1 28  ? -39.506 -33.733 -38.453  1.00 2.04 ? 28  LEU B CD1  1 
ATOM   2310 C  CD2  . LEU B 1 28  ? -39.745 -33.891 -40.938  1.00 0.88 ? 28  LEU B CD2  1 
ATOM   2311 H  H    . LEU B 1 28  ? -39.346 -29.770 -38.196  1.00 0.94 ? 28  LEU B H    1 
ATOM   2312 H  HA   . LEU B 1 28  ? -39.147 -30.595 -41.016  1.00 0.86 ? 28  LEU B HA   1 
ATOM   2313 H  HB2  . LEU B 1 28  ? -40.798 -31.681 -38.753  1.00 0.97 ? 28  LEU B HB2  1 
ATOM   2314 H  HB3  . LEU B 1 28  ? -41.211 -31.998 -40.428  1.00 0.99 ? 28  LEU B HB3  1 
ATOM   2315 H  HG   . LEU B 1 28  ? -38.424 -32.606 -39.886  1.00 1.53 ? 28  LEU B HG   1 
ATOM   2316 H  HD11 . LEU B 1 28  ? -38.686 -34.434 -38.399  1.00 2.62 ? 28  LEU B HD11 1 
ATOM   2317 H  HD12 . LEU B 1 28  ? -40.442 -34.269 -38.398  1.00 2.58 ? 28  LEU B HD12 1 
ATOM   2318 H  HD13 . LEU B 1 28  ? -39.440 -33.038 -37.629  1.00 2.45 ? 28  LEU B HD13 1 
ATOM   2319 H  HD21 . LEU B 1 28  ? -40.293 -34.752 -40.583  1.00 1.53 ? 28  LEU B HD21 1 
ATOM   2320 H  HD22 . LEU B 1 28  ? -38.822 -34.215 -41.395  1.00 1.60 ? 28  LEU B HD22 1 
ATOM   2321 H  HD23 . LEU B 1 28  ? -40.340 -33.360 -41.665  1.00 1.15 ? 28  LEU B HD23 1 
ATOM   2322 N  N    . GLU B 1 29  ? -41.928 -29.420 -39.723  1.00 1.04 ? 29  GLU B N    1 
ATOM   2323 C  CA   . GLU B 1 29  ? -43.048 -28.517 -39.962  1.00 1.14 ? 29  GLU B CA   1 
ATOM   2324 C  C    . GLU B 1 29  ? -42.836 -27.184 -39.249  1.00 1.13 ? 29  GLU B C    1 
ATOM   2325 O  O    . GLU B 1 29  ? -42.194 -27.125 -38.201  1.00 1.13 ? 29  GLU B O    1 
ATOM   2326 C  CB   . GLU B 1 29  ? -44.355 -29.156 -39.492  1.00 1.34 ? 29  GLU B CB   1 
ATOM   2327 C  CG   . GLU B 1 29  ? -44.575 -30.559 -40.033  1.00 1.31 ? 29  GLU B CG   1 
ATOM   2328 C  CD   . GLU B 1 29  ? -45.443 -30.575 -41.276  1.00 2.02 ? 29  GLU B CD   1 
ATOM   2329 O  OE1  . GLU B 1 29  ? -46.630 -30.200 -41.176  1.00 2.35 ? 29  GLU B OE1  1 
ATOM   2330 O  OE2  . GLU B 1 29  ? -44.936 -30.962 -42.350  1.00 2.85 ? 29  GLU B OE2  1 
ATOM   2331 H  H    . GLU B 1 29  ? -41.953 -30.020 -38.950  1.00 1.12 ? 29  GLU B H    1 
ATOM   2332 H  HA   . GLU B 1 29  ? -43.107 -28.337 -41.025  1.00 1.13 ? 29  GLU B HA   1 
ATOM   2333 H  HB2  . GLU B 1 29  ? -44.351 -29.207 -38.413  1.00 1.63 ? 29  GLU B HB2  1 
ATOM   2334 H  HB3  . GLU B 1 29  ? -45.181 -28.537 -39.811  1.00 1.73 ? 29  GLU B HB3  1 
ATOM   2335 H  HG2  . GLU B 1 29  ? -43.616 -30.992 -40.277  1.00 1.45 ? 29  GLU B HG2  1 
ATOM   2336 H  HG3  . GLU B 1 29  ? -45.054 -31.155 -39.270  1.00 1.79 ? 29  GLU B HG3  1 
ATOM   2337 N  N    . GLY B 1 30  ? -43.381 -26.118 -39.826  1.00 1.16 ? 30  GLY B N    1 
ATOM   2338 C  CA   . GLY B 1 30  ? -43.242 -24.801 -39.233  1.00 1.17 ? 30  GLY B CA   1 
ATOM   2339 C  C    . GLY B 1 30  ? -41.795 -24.362 -39.125  1.00 1.13 ? 30  GLY B C    1 
ATOM   2340 O  O    . GLY B 1 30  ? -41.421 -23.662 -38.183  1.00 1.15 ? 30  GLY B O    1 
ATOM   2341 H  H    . GLY B 1 30  ? -43.882 -26.227 -40.662  1.00 1.19 ? 30  GLY B H    1 
ATOM   2342 H  HA2  . GLY B 1 30  ? -43.778 -24.087 -39.841  1.00 1.20 ? 30  GLY B HA2  1 
ATOM   2343 H  HA3  . GLY B 1 30  ? -43.677 -24.816 -38.245  1.00 1.21 ? 30  GLY B HA3  1 
ATOM   2344 N  N    . CYS B 1 31  ? -40.979 -24.772 -40.090  1.00 1.09 ? 31  CYS B N    1 
ATOM   2345 C  CA   . CYS B 1 31  ? -39.565 -24.416 -40.098  1.00 1.05 ? 31  CYS B CA   1 
ATOM   2346 C  C    . CYS B 1 31  ? -39.034 -24.326 -41.525  1.00 1.03 ? 31  CYS B C    1 
ATOM   2347 O  O    . CYS B 1 31  ? -39.568 -24.957 -42.437  1.00 1.08 ? 31  CYS B O    1 
ATOM   2348 C  CB   . CYS B 1 31  ? -38.754 -25.441 -39.304  1.00 0.99 ? 31  CYS B CB   1 
ATOM   2349 S  SG   . CYS B 1 31  ? -39.340 -25.696 -37.612  1.00 1.71 ? 31  CYS B SG   1 
ATOM   2350 H  H    . CYS B 1 31  ? -41.336 -25.327 -40.814  1.00 1.09 ? 31  CYS B H    1 
ATOM   2351 H  HA   . CYS B 1 31  ? -39.464 -23.449 -39.628  1.00 1.12 ? 31  CYS B HA   1 
ATOM   2352 H  HB2  . CYS B 1 31  ? -38.796 -26.393 -39.812  1.00 1.45 ? 31  CYS B HB2  1 
ATOM   2353 H  HB3  . CYS B 1 31  ? -37.726 -25.113 -39.250  1.00 1.41 ? 31  CYS B HB3  1 
ATOM   2354 H  HG   . CYS B 1 31  ? -39.643 -26.979 -37.474  1.00 2.35 ? 31  CYS B HG   1 
ATOM   2355 N  N    . ALA B 1 32  ? -37.979 -23.539 -41.711  1.00 1.01 ? 32  ALA B N    1 
ATOM   2356 C  CA   . ALA B 1 32  ? -37.376 -23.368 -43.027  1.00 1.00 ? 32  ALA B CA   1 
ATOM   2357 C  C    . ALA B 1 32  ? -36.222 -24.345 -43.242  1.00 0.90 ? 32  ALA B C    1 
ATOM   2358 O  O    . ALA B 1 32  ? -35.402 -24.160 -44.141  1.00 0.98 ? 32  ALA B O    1 
ATOM   2359 C  CB   . ALA B 1 32  ? -36.893 -21.937 -43.201  1.00 1.09 ? 32  ALA B CB   1 
ATOM   2360 H  H    . ALA B 1 32  ? -37.597 -23.062 -40.944  1.00 1.06 ? 32  ALA B H    1 
ATOM   2361 H  HA   . ALA B 1 32  ? -38.137 -23.558 -43.770  1.00 1.04 ? 32  ALA B HA   1 
ATOM   2362 H  HB1  . ALA B 1 32  ? -36.617 -21.773 -44.232  1.00 0.91 ? 32  ALA B HB1  1 
ATOM   2363 H  HB2  . ALA B 1 32  ? -36.035 -21.768 -42.567  1.00 1.73 ? 32  ALA B HB2  1 
ATOM   2364 H  HB3  . ALA B 1 32  ? -37.683 -21.255 -42.926  1.00 1.17 ? 32  ALA B HB3  1 
ATOM   2365 N  N    . CYS B 1 33  ? -36.164 -25.384 -42.414  1.00 0.85 ? 33  CYS B N    1 
ATOM   2366 C  CA   . CYS B 1 33  ? -35.109 -26.386 -42.520  1.00 0.76 ? 33  CYS B CA   1 
ATOM   2367 C  C    . CYS B 1 33  ? -35.699 -27.788 -42.626  1.00 0.70 ? 33  CYS B C    1 
ATOM   2368 O  O    . CYS B 1 33  ? -35.220 -28.724 -41.986  1.00 0.63 ? 33  CYS B O    1 
ATOM   2369 C  CB   . CYS B 1 33  ? -34.176 -26.303 -41.311  1.00 0.79 ? 33  CYS B CB   1 
ATOM   2370 S  SG   . CYS B 1 33  ? -33.847 -24.616 -40.746  1.00 1.31 ? 33  CYS B SG   1 
ATOM   2371 H  H    . CYS B 1 33  ? -36.844 -25.481 -41.717  1.00 0.95 ? 33  CYS B H    1 
ATOM   2372 H  HA   . CYS B 1 33  ? -34.543 -26.177 -43.415  1.00 0.76 ? 33  CYS B HA   1 
ATOM   2373 H  HB2  . CYS B 1 33  ? -34.617 -26.843 -40.487  1.00 0.96 ? 33  CYS B HB2  1 
ATOM   2374 H  HB3  . CYS B 1 33  ? -33.228 -26.755 -41.565  1.00 1.09 ? 33  CYS B HB3  1 
ATOM   2375 H  HG   . CYS B 1 33  ? -33.328 -23.940 -41.761  1.00 1.44 ? 33  CYS B HG   1 
ATOM   2376 N  N    . THR B 1 34  ? -36.741 -27.926 -43.439  1.00 0.79 ? 34  THR B N    1 
ATOM   2377 C  CA   . THR B 1 34  ? -37.397 -29.214 -43.630  1.00 0.76 ? 34  THR B CA   1 
ATOM   2378 C  C    . THR B 1 34  ? -36.552 -30.134 -44.505  1.00 0.73 ? 34  THR B C    1 
ATOM   2379 O  O    . THR B 1 34  ? -35.649 -29.683 -45.210  1.00 0.74 ? 34  THR B O    1 
ATOM   2380 C  CB   . THR B 1 34  ? -38.787 -29.048 -44.272  1.00 0.81 ? 34  THR B CB   1 
ATOM   2381 O  OG1  . THR B 1 34  ? -38.666 -28.987 -45.698  1.00 1.20 ? 34  THR B OG1  1 
ATOM   2382 C  CG2  . THR B 1 34  ? -39.472 -27.789 -43.763  1.00 1.04 ? 34  THR B CG2  1 
ATOM   2383 H  H    . THR B 1 34  ? -37.076 -27.142 -43.923  1.00 0.89 ? 34  THR B H    1 
ATOM   2384 H  HA   . THR B 1 34  ? -37.523 -29.671 -42.660  1.00 0.74 ? 34  THR B HA   1 
ATOM   2385 H  HB   . THR B 1 34  ? -39.394 -29.902 -44.006  1.00 0.73 ? 34  THR B HB   1 
ATOM   2386 H  HG1  . THR B 1 34  ? -39.534 -29.075 -46.098  1.00 1.22 ? 34  THR B HG1  1 
ATOM   2387 H  HG21 . THR B 1 34  ? -40.525 -27.983 -43.622  1.00 1.58 ? 34  THR B HG21 1 
ATOM   2388 H  HG22 . THR B 1 34  ? -39.346 -26.994 -44.483  1.00 1.56 ? 34  THR B HG22 1 
ATOM   2389 H  HG23 . THR B 1 34  ? -39.031 -27.494 -42.822  1.00 1.42 ? 34  THR B HG23 1 
ATOM   2390 N  N    . PRO B 1 35  ? -36.840 -31.444 -44.470  1.00 0.72 ? 35  PRO B N    1 
ATOM   2391 C  CA   . PRO B 1 35  ? -36.107 -32.437 -45.261  1.00 0.71 ? 35  PRO B CA   1 
ATOM   2392 C  C    . PRO B 1 35  ? -36.014 -32.049 -46.733  1.00 0.77 ? 35  PRO B C    1 
ATOM   2393 O  O    . PRO B 1 35  ? -34.928 -32.031 -47.313  1.00 0.81 ? 35  PRO B O    1 
ATOM   2394 C  CB   . PRO B 1 35  ? -36.941 -33.708 -45.094  1.00 0.73 ? 35  PRO B CB   1 
ATOM   2395 C  CG   . PRO B 1 35  ? -37.637 -33.532 -43.789  1.00 0.70 ? 35  PRO B CG   1 
ATOM   2396 C  CD   . PRO B 1 35  ? -37.903 -32.058 -43.656  1.00 0.72 ? 35  PRO B CD   1 
ATOM   2397 H  HA   . PRO B 1 35  ? -35.114 -32.600 -44.870  1.00 0.68 ? 35  PRO B HA   1 
ATOM   2398 H  HB2  . PRO B 1 35  ? -37.644 -33.791 -45.910  1.00 0.79 ? 35  PRO B HB2  1 
ATOM   2399 H  HB3  . PRO B 1 35  ? -36.291 -34.570 -45.081  1.00 0.72 ? 35  PRO B HB3  1 
ATOM   2400 H  HG2  . PRO B 1 35  ? -38.567 -34.083 -43.791  1.00 0.73 ? 35  PRO B HG2  1 
ATOM   2401 H  HG3  . PRO B 1 35  ? -37.002 -33.872 -42.984  1.00 0.66 ? 35  PRO B HG3  1 
ATOM   2402 H  HD2  . PRO B 1 35  ? -38.879 -31.814 -44.049  1.00 0.78 ? 35  PRO B HD2  1 
ATOM   2403 H  HD3  . PRO B 1 35  ? -37.823 -31.751 -42.623  1.00 0.69 ? 35  PRO B HD3  1 
ATOM   2404 N  N    . GLU B 1 36  ? -37.158 -31.737 -47.332  1.00 0.81 ? 36  GLU B N    1 
ATOM   2405 C  CA   . GLU B 1 36  ? -37.205 -31.348 -48.736  1.00 0.88 ? 36  GLU B CA   1 
ATOM   2406 C  C    . GLU B 1 36  ? -36.680 -29.928 -48.925  1.00 0.90 ? 36  GLU B C    1 
ATOM   2407 O  O    . GLU B 1 36  ? -36.121 -29.596 -49.970  1.00 0.90 ? 36  GLU B O    1 
ATOM   2408 C  CB   . GLU B 1 36  ? -38.637 -31.448 -49.267  1.00 0.98 ? 36  GLU B CB   1 
ATOM   2409 C  CG   . GLU B 1 36  ? -39.009 -32.839 -49.753  1.00 1.29 ? 36  GLU B CG   1 
ATOM   2410 C  CD   . GLU B 1 36  ? -40.402 -32.895 -50.349  1.00 1.45 ? 36  GLU B CD   1 
ATOM   2411 O  OE1  . GLU B 1 36  ? -40.771 -31.956 -51.085  1.00 1.92 ? 36  GLU B OE1  1 
ATOM   2412 O  OE2  . GLU B 1 36  ? -41.124 -33.878 -50.079  1.00 1.86 ? 36  GLU B OE2  1 
ATOM   2413 H  H    . GLU B 1 36  ? -37.992 -31.769 -46.816  1.00 0.81 ? 36  GLU B H    1 
ATOM   2414 H  HA   . GLU B 1 36  ? -36.577 -32.028 -49.290  1.00 0.88 ? 36  GLU B HA   1 
ATOM   2415 H  HB2  . GLU B 1 36  ? -39.321 -31.170 -48.479  1.00 1.67 ? 36  GLU B HB2  1 
ATOM   2416 H  HB3  . GLU B 1 36  ? -38.751 -30.760 -50.092  1.00 1.07 ? 36  GLU B HB3  1 
ATOM   2417 H  HG2  . GLU B 1 36  ? -38.300 -33.146 -50.507  1.00 1.49 ? 36  GLU B HG2  1 
ATOM   2418 H  HG3  . GLU B 1 36  ? -38.963 -33.523 -48.918  1.00 2.03 ? 36  GLU B HG3  1 
ATOM   2419 N  N    . ARG B 1 37  ? -36.866 -29.094 -47.907  1.00 0.93 ? 37  ARG B N    1 
ATOM   2420 C  CA   . ARG B 1 37  ? -36.413 -27.709 -47.959  1.00 0.97 ? 37  ARG B CA   1 
ATOM   2421 C  C    . ARG B 1 37  ? -34.889 -27.630 -47.919  1.00 0.91 ? 37  ARG B C    1 
ATOM   2422 O  O    . ARG B 1 37  ? -34.282 -26.819 -48.619  1.00 0.90 ? 37  ARG B O    1 
ATOM   2423 C  CB   . ARG B 1 37  ? -37.010 -26.916 -46.795  1.00 1.01 ? 37  ARG B CB   1 
ATOM   2424 C  CG   . ARG B 1 37  ? -36.460 -25.504 -46.671  1.00 1.12 ? 37  ARG B CG   1 
ATOM   2425 C  CD   . ARG B 1 37  ? -36.898 -24.630 -47.834  1.00 0.83 ? 37  ARG B CD   1 
ATOM   2426 N  NE   . ARG B 1 37  ? -38.335 -24.722 -48.078  1.00 1.25 ? 37  ARG B NE   1 
ATOM   2427 C  CZ   . ARG B 1 37  ? -38.917 -24.349 -49.215  1.00 1.82 ? 37  ARG B CZ   1 
ATOM   2428 N  NH1  . ARG B 1 37  ? -38.189 -23.861 -50.211  1.00 2.25 ? 37  ARG B NH1  1 
ATOM   2429 N  NH2  . ARG B 1 37  ? -40.231 -24.466 -49.356  1.00 2.67 ? 37  ARG B NH2  1 
ATOM   2430 H  H    . ARG B 1 37  ? -37.319 -29.418 -47.101  1.00 0.93 ? 37  ARG B H    1 
ATOM   2431 H  HA   . ARG B 1 37  ? -36.759 -27.282 -48.888  1.00 1.04 ? 37  ARG B HA   1 
ATOM   2432 H  HB2  . ARG B 1 37  ? -38.079 -26.851 -46.929  1.00 1.38 ? 37  ARG B HB2  1 
ATOM   2433 H  HB3  . ARG B 1 37  ? -36.803 -27.441 -45.874  1.00 1.14 ? 37  ARG B HB3  1 
ATOM   2434 H  HG2  . ARG B 1 37  ? -36.821 -25.067 -45.751  1.00 1.44 ? 37  ARG B HG2  1 
ATOM   2435 H  HG3  . ARG B 1 37  ? -35.381 -25.548 -46.651  1.00 1.90 ? 37  ARG B HG3  1 
ATOM   2436 H  HD2  . ARG B 1 37  ? -36.646 -23.603 -47.612  1.00 1.19 ? 37  ARG B HD2  1 
ATOM   2437 H  HD3  . ARG B 1 37  ? -36.370 -24.944 -48.723  1.00 1.57 ? 37  ARG B HD3  1 
ATOM   2438 H  HE   . ARG B 1 37  ? -38.895 -25.079 -47.358  1.00 1.87 ? 37  ARG B HE   1 
ATOM   2439 H  HH11 . ARG B 1 37  ? -37.199 -23.770 -50.110  1.00 2.31 ? 37  ARG B HH11 1 
ATOM   2440 H  HH12 . ARG B 1 37  ? -38.632 -23.582 -51.063  1.00 2.93 ? 37  ARG B HH12 1 
ATOM   2441 H  HH21 . ARG B 1 37  ? -40.784 -24.834 -48.609  1.00 3.10 ? 37  ARG B HH21 1 
ATOM   2442 H  HH22 . ARG B 1 37  ? -40.668 -24.185 -50.211  1.00 3.16 ? 37  ARG B HH22 1 
ATOM   2443 N  N    . MET B 1 38  ? -34.278 -28.474 -47.094  1.00 0.91 ? 38  MET B N    1 
ATOM   2444 C  CA   . MET B 1 38  ? -32.825 -28.496 -46.961  1.00 0.88 ? 38  MET B CA   1 
ATOM   2445 C  C    . MET B 1 38  ? -32.178 -29.267 -48.107  1.00 0.88 ? 38  MET B C    1 
ATOM   2446 O  O    . MET B 1 38  ? -31.263 -28.770 -48.764  1.00 0.94 ? 38  MET B O    1 
ATOM   2447 C  CB   . MET B 1 38  ? -32.425 -29.121 -45.623  1.00 0.88 ? 38  MET B CB   1 
ATOM   2448 C  CG   . MET B 1 38  ? -32.608 -28.189 -44.437  1.00 1.02 ? 38  MET B CG   1 
ATOM   2449 S  SD   . MET B 1 38  ? -32.282 -28.999 -42.859  1.00 1.38 ? 38  MET B SD   1 
ATOM   2450 C  CE   . MET B 1 38  ? -30.590 -28.493 -42.561  1.00 0.85 ? 38  MET B CE   1 
ATOM   2451 H  H    . MET B 1 38  ? -34.816 -29.095 -46.561  1.00 0.94 ? 38  MET B H    1 
ATOM   2452 H  HA   . MET B 1 38  ? -32.475 -27.475 -46.988  1.00 0.90 ? 38  MET B HA   1 
ATOM   2453 H  HB2  . MET B 1 38  ? -33.027 -30.003 -45.456  1.00 0.78 ? 38  MET B HB2  1 
ATOM   2454 H  HB3  . MET B 1 38  ? -31.385 -29.410 -45.670  1.00 1.14 ? 38  MET B HB3  1 
ATOM   2455 H  HG2  . MET B 1 38  ? -31.929 -27.356 -44.543  1.00 1.59 ? 38  MET B HG2  1 
ATOM   2456 H  HG3  . MET B 1 38  ? -33.625 -27.825 -44.436  1.00 1.64 ? 38  MET B HG3  1 
ATOM   2457 H  HE1  . MET B 1 38  ? -30.183 -29.065 -41.740  1.00 1.21 ? 38  MET B HE1  1 
ATOM   2458 H  HE2  . MET B 1 38  ? -30.568 -27.442 -42.313  1.00 1.12 ? 38  MET B HE2  1 
ATOM   2459 H  HE3  . MET B 1 38  ? -30.000 -28.666 -43.449  1.00 1.41 ? 38  MET B HE3  1 
ATOM   2460 N  N    . ALA B 1 39  ? -32.656 -30.485 -48.342  1.00 0.86 ? 39  ALA B N    1 
ATOM   2461 C  CA   . ALA B 1 39  ? -32.120 -31.325 -49.408  1.00 0.86 ? 39  ALA B CA   1 
ATOM   2462 C  C    . ALA B 1 39  ? -32.059 -30.567 -50.730  1.00 0.90 ? 39  ALA B C    1 
ATOM   2463 O  O    . ALA B 1 39  ? -31.214 -30.850 -51.580  1.00 0.90 ? 39  ALA B O    1 
ATOM   2464 C  CB   . ALA B 1 39  ? -32.959 -32.584 -49.559  1.00 0.89 ? 39  ALA B CB   1 
ATOM   2465 H  H    . ALA B 1 39  ? -33.384 -30.829 -47.783  1.00 0.89 ? 39  ALA B H    1 
ATOM   2466 H  HA   . ALA B 1 39  ? -31.119 -31.619 -49.127  1.00 0.84 ? 39  ALA B HA   1 
ATOM   2467 H  HB1  . ALA B 1 39  ? -33.987 -32.364 -49.313  1.00 1.45 ? 39  ALA B HB1  1 
ATOM   2468 H  HB2  . ALA B 1 39  ? -32.585 -33.349 -48.894  1.00 1.33 ? 39  ALA B HB2  1 
ATOM   2469 H  HB3  . ALA B 1 39  ? -32.901 -32.935 -50.579  1.00 1.07 ? 39  ALA B HB3  1 
ATOM   2470 N  N    . GLU B 1 40  ? -32.960 -29.605 -50.899  1.00 0.97 ? 40  GLU B N    1 
ATOM   2471 C  CA   . GLU B 1 40  ? -33.009 -28.809 -52.120  1.00 1.05 ? 40  GLU B CA   1 
ATOM   2472 C  C    . GLU B 1 40  ? -31.798 -27.883 -52.231  1.00 1.06 ? 40  GLU B C    1 
ATOM   2473 O  O    . GLU B 1 40  ? -31.547 -27.305 -53.288  1.00 1.17 ? 40  GLU B O    1 
ATOM   2474 C  CB   . GLU B 1 40  ? -34.298 -27.987 -52.164  1.00 1.16 ? 40  GLU B CB   1 
ATOM   2475 C  CG   . GLU B 1 40  ? -34.256 -26.840 -53.160  1.00 1.14 ? 40  GLU B CG   1 
ATOM   2476 C  CD   . GLU B 1 40  ? -33.981 -27.307 -54.576  1.00 1.17 ? 40  GLU B CD   1 
ATOM   2477 O  OE1  . GLU B 1 40  ? -34.382 -28.440 -54.916  1.00 1.97 ? 40  GLU B OE1  1 
ATOM   2478 O  OE2  . GLU B 1 40  ? -33.364 -26.540 -55.345  1.00 1.72 ? 40  GLU B OE2  1 
ATOM   2479 H  H    . GLU B 1 40  ? -33.609 -29.427 -50.187  1.00 0.99 ? 40  GLU B H    1 
ATOM   2480 H  HA   . GLU B 1 40  ? -33.001 -29.490 -52.958  1.00 1.06 ? 40  GLU B HA   1 
ATOM   2481 H  HB2  . GLU B 1 40  ? -35.117 -28.638 -52.433  1.00 1.24 ? 40  GLU B HB2  1 
ATOM   2482 H  HB3  . GLU B 1 40  ? -34.483 -27.577 -51.182  1.00 1.24 ? 40  GLU B HB3  1 
ATOM   2483 H  HG2  . GLU B 1 40  ? -35.209 -26.331 -53.145  1.00 1.75 ? 40  GLU B HG2  1 
ATOM   2484 H  HG3  . GLU B 1 40  ? -33.478 -26.152 -52.866  1.00 1.73 ? 40  GLU B HG3  1 
ATOM   2485 N  N    . ALA B 1 41  ? -31.050 -27.745 -51.139  1.00 1.00 ? 41  ALA B N    1 
ATOM   2486 C  CA   . ALA B 1 41  ? -29.870 -26.887 -51.126  1.00 1.04 ? 41  ALA B CA   1 
ATOM   2487 C  C    . ALA B 1 41  ? -28.580 -27.703 -51.154  1.00 0.93 ? 41  ALA B C    1 
ATOM   2488 O  O    . ALA B 1 41  ? -27.486 -27.143 -51.235  1.00 1.13 ? 41  ALA B O    1 
ATOM   2489 C  CB   . ALA B 1 41  ? -29.892 -25.982 -49.905  1.00 1.14 ? 41  ALA B CB   1 
ATOM   2490 H  H    . ALA B 1 41  ? -31.296 -28.228 -50.324  1.00 0.96 ? 41  ALA B H    1 
ATOM   2491 H  HA   . ALA B 1 41  ? -29.906 -26.261 -52.006  1.00 1.15 ? 41  ALA B HA   1 
ATOM   2492 H  HB1  . ALA B 1 41  ? -29.061 -25.294 -49.952  1.00 1.41 ? 41  ALA B HB1  1 
ATOM   2493 H  HB2  . ALA B 1 41  ? -29.810 -26.584 -49.012  1.00 1.32 ? 41  ALA B HB2  1 
ATOM   2494 H  HB3  . ALA B 1 41  ? -30.818 -25.428 -49.883  1.00 1.51 ? 41  ALA B HB3  1 
ATOM   2495 N  N    . GLY B 1 42  ? -28.708 -29.025 -51.084  1.00 0.67 ? 42  GLY B N    1 
ATOM   2496 C  CA   . GLY B 1 42  ? -27.537 -29.882 -51.102  1.00 0.56 ? 42  GLY B CA   1 
ATOM   2497 C  C    . GLY B 1 42  ? -27.263 -30.526 -49.755  1.00 0.56 ? 42  GLY B C    1 
ATOM   2498 O  O    . GLY B 1 42  ? -26.459 -31.453 -49.656  1.00 0.99 ? 42  GLY B O    1 
ATOM   2499 H  H    . GLY B 1 42  ? -29.600 -29.422 -51.019  1.00 0.62 ? 42  GLY B H    1 
ATOM   2500 H  HA2  . GLY B 1 42  ? -27.686 -30.660 -51.837  1.00 0.47 ? 42  GLY B HA2  1 
ATOM   2501 H  HA3  . GLY B 1 42  ? -26.677 -29.292 -51.389  1.00 0.69 ? 42  GLY B HA3  1 
ATOM   2502 N  N    . PHE B 1 43  ? -27.930 -30.034 -48.714  1.00 0.63 ? 43  PHE B N    1 
ATOM   2503 C  CA   . PHE B 1 43  ? -27.749 -30.566 -47.369  1.00 0.59 ? 43  PHE B CA   1 
ATOM   2504 C  C    . PHE B 1 43  ? -28.269 -31.997 -47.269  1.00 0.45 ? 43  PHE B C    1 
ATOM   2505 O  O    . PHE B 1 43  ? -29.394 -32.290 -47.671  1.00 0.36 ? 43  PHE B O    1 
ATOM   2506 C  CB   . PHE B 1 43  ? -28.463 -29.679 -46.349  1.00 0.72 ? 43  PHE B CB   1 
ATOM   2507 C  CG   . PHE B 1 43  ? -27.838 -28.321 -46.198  1.00 0.86 ? 43  PHE B CG   1 
ATOM   2508 C  CD1  . PHE B 1 43  ? -26.525 -28.192 -45.774  1.00 1.11 ? 43  PHE B CD1  1 
ATOM   2509 C  CD2  . PHE B 1 43  ? -28.563 -27.175 -46.481  1.00 1.81 ? 43  PHE B CD2  1 
ATOM   2510 C  CE1  . PHE B 1 43  ? -25.947 -26.945 -45.635  1.00 1.22 ? 43  PHE B CE1  1 
ATOM   2511 C  CE2  . PHE B 1 43  ? -27.989 -25.926 -46.344  1.00 1.95 ? 43  PHE B CE2  1 
ATOM   2512 C  CZ   . PHE B 1 43  ? -26.680 -25.810 -45.921  1.00 1.22 ? 43  PHE B CZ   1 
ATOM   2513 H  H    . PHE B 1 43  ? -28.556 -29.293 -48.853  1.00 0.99 ? 43  PHE B H    1 
ATOM   2514 H  HA   . PHE B 1 43  ? -26.693 -30.566 -47.153  1.00 0.67 ? 43  PHE B HA   1 
ATOM   2515 H  HB2  . PHE B 1 43  ? -29.489 -29.540 -46.657  1.00 0.75 ? 43  PHE B HB2  1 
ATOM   2516 H  HB3  . PHE B 1 43  ? -28.445 -30.164 -45.384  1.00 0.80 ? 43  PHE B HB3  1 
ATOM   2517 H  HD1  . PHE B 1 43  ? -25.951 -29.080 -45.551  1.00 1.85 ? 43  PHE B HD1  1 
ATOM   2518 H  HD2  . PHE B 1 43  ? -29.587 -27.264 -46.813  1.00 2.62 ? 43  PHE B HD2  1 
ATOM   2519 H  HE1  . PHE B 1 43  ? -24.922 -26.857 -45.304  1.00 1.92 ? 43  PHE B HE1  1 
ATOM   2520 H  HE2  . PHE B 1 43  ? -28.564 -25.040 -46.568  1.00 2.83 ? 43  PHE B HE2  1 
ATOM   2521 H  HZ   . PHE B 1 43  ? -26.230 -24.834 -45.813  1.00 1.38 ? 43  PHE B HZ   1 
ATOM   2522 N  N    . ILE B 1 44  ? -27.439 -32.882 -46.726  1.00 0.63 ? 44  ILE B N    1 
ATOM   2523 C  CA   . ILE B 1 44  ? -27.810 -34.283 -46.567  1.00 0.57 ? 44  ILE B CA   1 
ATOM   2524 C  C    . ILE B 1 44  ? -27.634 -34.733 -45.121  1.00 0.67 ? 44  ILE B C    1 
ATOM   2525 O  O    . ILE B 1 44  ? -26.686 -34.331 -44.447  1.00 1.57 ? 44  ILE B O    1 
ATOM   2526 C  CB   . ILE B 1 44  ? -26.971 -35.196 -47.482  1.00 0.53 ? 44  ILE B CB   1 
ATOM   2527 C  CG1  . ILE B 1 44  ? -27.379 -35.007 -48.944  1.00 0.52 ? 44  ILE B CG1  1 
ATOM   2528 C  CG2  . ILE B 1 44  ? -27.127 -36.650 -47.066  1.00 0.64 ? 44  ILE B CG2  1 
ATOM   2529 C  CD1  . ILE B 1 44  ? -26.488 -35.743 -49.921  1.00 0.51 ? 44  ILE B CD1  1 
ATOM   2530 H  H    . ILE B 1 44  ? -26.556 -32.585 -46.423  1.00 0.86 ? 44  ILE B H    1 
ATOM   2531 H  HA   . ILE B 1 44  ? -28.849 -34.387 -46.844  1.00 0.57 ? 44  ILE B HA   1 
ATOM   2532 H  HB   . ILE B 1 44  ? -25.932 -34.925 -47.367  1.00 0.61 ? 44  ILE B HB   1 
ATOM   2533 H  HG12 . ILE B 1 44  ? -28.388 -35.368 -49.079  1.00 0.63 ? 44  ILE B HG12 1 
ATOM   2534 H  HG13 . ILE B 1 44  ? -27.342 -33.955 -49.188  1.00 0.60 ? 44  ILE B HG13 1 
ATOM   2535 H  HG21 . ILE B 1 44  ? -28.092 -36.790 -46.601  1.00 1.33 ? 44  ILE B HG21 1 
ATOM   2536 H  HG22 . ILE B 1 44  ? -26.348 -36.910 -46.364  1.00 0.87 ? 44  ILE B HG22 1 
ATOM   2537 H  HG23 . ILE B 1 44  ? -27.052 -37.284 -47.937  1.00 1.14 ? 44  ILE B HG23 1 
ATOM   2538 H  HD11 . ILE B 1 44  ? -27.097 -36.206 -50.685  1.00 1.23 ? 44  ILE B HD11 1 
ATOM   2539 H  HD12 . ILE B 1 44  ? -25.930 -36.504 -49.396  1.00 0.92 ? 44  ILE B HD12 1 
ATOM   2540 H  HD13 . ILE B 1 44  ? -25.803 -35.046 -50.380  1.00 0.77 ? 44  ILE B HD13 1 
ATOM   2541 N  N    . HIS B 1 45  ? -28.555 -35.568 -44.650  1.00 0.84 ? 45  HIS B N    1 
ATOM   2542 C  CA   . HIS B 1 45  ? -28.501 -36.072 -43.283  1.00 0.86 ? 45  HIS B CA   1 
ATOM   2543 C  C    . HIS B 1 45  ? -27.103 -36.577 -42.942  1.00 0.92 ? 45  HIS B C    1 
ATOM   2544 O  O    . HIS B 1 45  ? -26.559 -37.441 -43.631  1.00 1.52 ? 45  HIS B O    1 
ATOM   2545 C  CB   . HIS B 1 45  ? -29.522 -37.195 -43.092  1.00 0.99 ? 45  HIS B CB   1 
ATOM   2546 C  CG   . HIS B 1 45  ? -29.991 -37.344 -41.678  1.00 0.84 ? 45  HIS B CG   1 
ATOM   2547 N  ND1  . HIS B 1 45  ? -30.153 -38.569 -41.064  1.00 0.80 ? 45  HIS B ND1  1 
ATOM   2548 C  CD2  . HIS B 1 45  ? -30.335 -36.415 -40.755  1.00 0.82 ? 45  HIS B CD2  1 
ATOM   2549 C  CE1  . HIS B 1 45  ? -30.577 -38.385 -39.826  1.00 0.76 ? 45  HIS B CE1  1 
ATOM   2550 N  NE2  . HIS B 1 45  ? -30.695 -37.088 -39.614  1.00 0.75 ? 45  HIS B NE2  1 
ATOM   2551 H  H    . HIS B 1 45  ? -29.287 -35.852 -45.236  1.00 1.55 ? 45  HIS B H    1 
ATOM   2552 H  HA   . HIS B 1 45  ? -28.748 -35.257 -42.619  1.00 0.86 ? 45  HIS B HA   1 
ATOM   2553 H  HB2  . HIS B 1 45  ? -30.386 -36.995 -43.708  1.00 1.20 ? 45  HIS B HB2  1 
ATOM   2554 H  HB3  . HIS B 1 45  ? -29.077 -38.132 -43.396  1.00 1.10 ? 45  HIS B HB3  1 
ATOM   2555 H  HD1  . HIS B 1 45  ? -29.983 -39.442 -41.475  1.00 0.87 ? 45  HIS B HD1  1 
ATOM   2556 H  HD2  . HIS B 1 45  ? -30.328 -35.342 -40.892  1.00 0.93 ? 45  HIS B HD2  1 
ATOM   2557 H  HE1  . HIS B 1 45  ? -30.789 -39.165 -39.109  1.00 0.83 ? 45  HIS B HE1  1 
ATOM   2558 H  HE2  . HIS B 1 45  ? -31.078 -36.680 -38.809  1.00 0.77 ? 45  HIS B HE2  1 
ATOM   2559 N  N    . CYS B 1 46  ? -26.526 -36.033 -41.875  1.00 1.05 ? 46  CYS B N    1 
ATOM   2560 C  CA   . CYS B 1 46  ? -25.191 -36.427 -41.442  1.00 1.06 ? 46  CYS B CA   1 
ATOM   2561 C  C    . CYS B 1 46  ? -24.938 -35.996 -40.001  1.00 0.97 ? 46  CYS B C    1 
ATOM   2562 O  O    . CYS B 1 46  ? -24.021 -35.223 -39.725  1.00 0.86 ? 46  CYS B O    1 
ATOM   2563 C  CB   . CYS B 1 46  ? -24.132 -35.817 -42.362  1.00 1.06 ? 46  CYS B CB   1 
ATOM   2564 S  SG   . CYS B 1 46  ? -22.617 -36.795 -42.494  1.00 2.01 ? 46  CYS B SG   1 
ATOM   2565 H  H    . CYS B 1 46  ? -27.011 -35.349 -41.367  1.00 1.54 ? 46  CYS B H    1 
ATOM   2566 H  HA   . CYS B 1 46  ? -25.128 -37.503 -41.500  1.00 1.26 ? 46  CYS B HA   1 
ATOM   2567 H  HB2  . CYS B 1 46  ? -24.544 -35.716 -43.355  1.00 1.01 ? 46  CYS B HB2  1 
ATOM   2568 H  HB3  . CYS B 1 46  ? -23.862 -34.840 -41.989  1.00 0.94 ? 46  CYS B HB3  1 
ATOM   2569 H  HG   . CYS B 1 46  ? -22.306 -36.897 -43.778  1.00 2.48 ? 46  CYS B HG   1 
ATOM   2570 N  N    . PRO B 1 47  ? -25.755 -36.497 -39.063  1.00 1.09 ? 47  PRO B N    1 
ATOM   2571 C  CA   . PRO B 1 47  ? -25.625 -36.167 -37.640  1.00 1.10 ? 47  PRO B CA   1 
ATOM   2572 C  C    . PRO B 1 47  ? -24.369 -36.768 -37.019  1.00 1.09 ? 47  PRO B C    1 
ATOM   2573 O  O    . PRO B 1 47  ? -23.968 -37.881 -37.359  1.00 1.14 ? 47  PRO B O    1 
ATOM   2574 C  CB   . PRO B 1 47  ? -26.878 -36.784 -37.016  1.00 1.28 ? 47  PRO B CB   1 
ATOM   2575 C  CG   . PRO B 1 47  ? -27.261 -37.886 -37.942  1.00 1.54 ? 47  PRO B CG   1 
ATOM   2576 C  CD   . PRO B 1 47  ? -26.870 -37.424 -39.319  1.00 1.29 ? 47  PRO B CD   1 
ATOM   2577 H  HA   . PRO B 1 47  ? -25.628 -35.098 -37.481  1.00 1.07 ? 47  PRO B HA   1 
ATOM   2578 H  HB2  . PRO B 1 47  ? -26.645 -37.158 -36.030  1.00 1.22 ? 47  PRO B HB2  1 
ATOM   2579 H  HB3  . PRO B 1 47  ? -27.656 -36.038 -36.949  1.00 1.53 ? 47  PRO B HB3  1 
ATOM   2580 H  HG2  . PRO B 1 47  ? -26.724 -38.787 -37.682  1.00 1.85 ? 47  PRO B HG2  1 
ATOM   2581 H  HG3  . PRO B 1 47  ? -28.326 -38.055 -37.892  1.00 1.83 ? 47  PRO B HG3  1 
ATOM   2582 H  HD2  . PRO B 1 47  ? -26.546 -38.261 -39.920  1.00 1.45 ? 47  PRO B HD2  1 
ATOM   2583 H  HD3  . PRO B 1 47  ? -27.695 -36.913 -39.794  1.00 1.18 ? 47  PRO B HD3  1 
ATOM   2584 N  N    . THR B 1 48  ? -23.753 -36.024 -36.106  1.00 1.10 ? 48  THR B N    1 
ATOM   2585 C  CA   . THR B 1 48  ? -22.542 -36.484 -35.437  1.00 1.17 ? 48  THR B CA   1 
ATOM   2586 C  C    . THR B 1 48  ? -22.876 -37.412 -34.274  1.00 1.07 ? 48  THR B C    1 
ATOM   2587 O  O    . THR B 1 48  ? -24.032 -37.790 -34.081  1.00 1.49 ? 48  THR B O    1 
ATOM   2588 C  CB   . THR B 1 48  ? -21.707 -35.302 -34.911  1.00 1.41 ? 48  THR B CB   1 
ATOM   2589 O  OG1  . THR B 1 48  ? -22.284 -34.063 -35.342  1.00 1.51 ? 48  THR B OG1  1 
ATOM   2590 C  CG2  . THR B 1 48  ? -20.270 -35.394 -35.401  1.00 1.63 ? 48  THR B CG2  1 
ATOM   2591 H  H    . THR B 1 48  ? -24.121 -35.145 -35.877  1.00 1.09 ? 48  THR B H    1 
ATOM   2592 H  HA   . THR B 1 48  ? -21.947 -37.026 -36.158  1.00 1.25 ? 48  THR B HA   1 
ATOM   2593 H  HB   . THR B 1 48  ? -21.707 -35.333 -33.831  1.00 1.44 ? 48  THR B HB   1 
ATOM   2594 H  HG1  . THR B 1 48  ? -21.677 -33.344 -35.153  1.00 1.67 ? 48  THR B HG1  1 
ATOM   2595 H  HG21 . THR B 1 48  ? -19.848 -34.402 -35.466  1.00 2.23 ? 48  THR B HG21 1 
ATOM   2596 H  HG22 . THR B 1 48  ? -20.251 -35.859 -36.375  1.00 1.17 ? 48  THR B HG22 1 
ATOM   2597 H  HG23 . THR B 1 48  ? -19.691 -35.987 -34.708  1.00 2.14 ? 48  THR B HG23 1 
ATOM   2598 N  N    . GLU B 1 49  ? -21.858 -37.775 -33.502  1.00 1.17 ? 49  GLU B N    1 
ATOM   2599 C  CA   . GLU B 1 49  ? -22.044 -38.658 -32.357  1.00 1.21 ? 49  GLU B CA   1 
ATOM   2600 C  C    . GLU B 1 49  ? -22.611 -37.892 -31.167  1.00 1.38 ? 49  GLU B C    1 
ATOM   2601 O  O    . GLU B 1 49  ? -23.386 -38.435 -30.379  1.00 1.70 ? 49  GLU B O    1 
ATOM   2602 C  CB   . GLU B 1 49  ? -20.717 -39.314 -31.971  1.00 1.29 ? 49  GLU B CB   1 
ATOM   2603 C  CG   . GLU B 1 49  ? -20.848 -40.783 -31.606  1.00 1.92 ? 49  GLU B CG   1 
ATOM   2604 C  CD   . GLU B 1 49  ? -19.523 -41.519 -31.664  1.00 2.63 ? 49  GLU B CD   1 
ATOM   2605 O  OE1  . GLU B 1 49  ? -18.560 -41.058 -31.016  1.00 3.44 ? 49  GLU B OE1  1 
ATOM   2606 O  OE2  . GLU B 1 49  ? -19.449 -42.555 -32.357  1.00 2.97 ? 49  GLU B OE2  1 
ATOM   2607 H  H    . GLU B 1 49  ? -20.960 -37.440 -33.707  1.00 1.59 ? 49  GLU B H    1 
ATOM   2608 H  HA   . GLU B 1 49  ? -22.746 -39.427 -32.643  1.00 1.15 ? 49  GLU B HA   1 
ATOM   2609 H  HB2  . GLU B 1 49  ? -20.033 -39.231 -32.803  1.00 1.59 ? 49  GLU B HB2  1 
ATOM   2610 H  HB3  . GLU B 1 49  ? -20.303 -38.790 -31.123  1.00 1.40 ? 49  GLU B HB3  1 
ATOM   2611 H  HG2  . GLU B 1 49  ? -21.240 -40.859 -30.603  1.00 2.30 ? 49  GLU B HG2  1 
ATOM   2612 H  HG3  . GLU B 1 49  ? -21.534 -41.253 -32.296  1.00 2.25 ? 49  GLU B HG3  1 
ATOM   2613 N  N    . ASN B 1 50  ? -22.220 -36.629 -31.042  1.00 1.53 ? 50  ASN B N    1 
ATOM   2614 C  CA   . ASN B 1 50  ? -22.689 -35.787 -29.947  1.00 1.79 ? 50  ASN B CA   1 
ATOM   2615 C  C    . ASN B 1 50  ? -23.610 -34.686 -30.461  1.00 1.84 ? 50  ASN B C    1 
ATOM   2616 O  O    . ASN B 1 50  ? -24.523 -34.249 -29.760  1.00 2.11 ? 50  ASN B O    1 
ATOM   2617 C  CB   . ASN B 1 50  ? -21.501 -35.170 -29.206  1.00 2.04 ? 50  ASN B CB   1 
ATOM   2618 C  CG   . ASN B 1 50  ? -20.688 -36.206 -28.455  1.00 2.36 ? 50  ASN B CG   1 
ATOM   2619 O  OD1  . ASN B 1 50  ? -20.943 -37.406 -28.555  1.00 2.48 ? 50  ASN B OD1  1 
ATOM   2620 N  ND2  . ASN B 1 50  ? -19.701 -35.745 -27.695  1.00 3.04 ? 50  ASN B ND2  1 
ATOM   2621 H  H    . ASN B 1 50  ? -21.600 -36.253 -31.702  1.00 1.69 ? 50  ASN B H    1 
ATOM   2622 H  HA   . ASN B 1 50  ? -23.242 -36.413 -29.263  1.00 1.84 ? 50  ASN B HA   1 
ATOM   2623 H  HB2  . ASN B 1 50  ? -20.855 -34.681 -29.919  1.00 1.99 ? 50  ASN B HB2  1 
ATOM   2624 H  HB3  . ASN B 1 50  ? -21.867 -34.442 -28.497  1.00 2.38 ? 50  ASN B HB3  1 
ATOM   2625 H  HD21 . ASN B 1 50  ? -19.555 -34.776 -27.663  1.00 3.36 ? 50  ASN B HD21 1 
ATOM   2626 H  HD22 . ASN B 1 50  ? -19.158 -36.392 -27.198  1.00 3.42 ? 50  ASN B HD22 1 
ATOM   2627 N  N    . GLU B 1 51  ? -23.366 -34.240 -31.689  1.00 1.68 ? 51  GLU B N    1 
ATOM   2628 C  CA   . GLU B 1 51  ? -24.175 -33.189 -32.295  1.00 1.77 ? 51  GLU B CA   1 
ATOM   2629 C  C    . GLU B 1 51  ? -25.061 -33.753 -33.401  1.00 1.45 ? 51  GLU B C    1 
ATOM   2630 O  O    . GLU B 1 51  ? -24.715 -33.693 -34.581  1.00 1.35 ? 51  GLU B O    1 
ATOM   2631 C  CB   . GLU B 1 51  ? -23.276 -32.086 -32.859  1.00 2.14 ? 51  GLU B CB   1 
ATOM   2632 C  CG   . GLU B 1 51  ? -22.211 -31.612 -31.884  1.00 2.56 ? 51  GLU B CG   1 
ATOM   2633 C  CD   . GLU B 1 51  ? -22.746 -31.434 -30.477  1.00 2.85 ? 51  GLU B CD   1 
ATOM   2634 O  OE1  . GLU B 1 51  ? -23.847 -30.865 -30.328  1.00 2.87 ? 51  GLU B OE1  1 
ATOM   2635 O  OE2  . GLU B 1 51  ? -22.062 -31.864 -29.524  1.00 3.45 ? 51  GLU B OE2  1 
ATOM   2636 H  H    . GLU B 1 51  ? -22.625 -34.627 -32.200  1.00 1.58 ? 51  GLU B H    1 
ATOM   2637 H  HA   . GLU B 1 51  ? -24.804 -32.769 -31.525  1.00 1.94 ? 51  GLU B HA   1 
ATOM   2638 H  HB2  . GLU B 1 51  ? -22.784 -32.457 -33.745  1.00 2.62 ? 51  GLU B HB2  1 
ATOM   2639 H  HB3  . GLU B 1 51  ? -23.891 -31.239 -33.127  1.00 2.38 ? 51  GLU B HB3  1 
ATOM   2640 H  HG2  . GLU B 1 51  ? -21.413 -32.340 -31.861  1.00 2.97 ? 51  GLU B HG2  1 
ATOM   2641 H  HG3  . GLU B 1 51  ? -21.822 -30.665 -32.229  1.00 2.98 ? 51  GLU B HG3  1 
ATOM   2642 N  N    . PRO B 1 52  ? -26.221 -34.311 -33.026  1.00 1.46 ? 52  PRO B N    1 
ATOM   2643 C  CA   . PRO B 1 52  ? -27.168 -34.891 -33.984  1.00 1.40 ? 52  PRO B CA   1 
ATOM   2644 C  C    . PRO B 1 52  ? -27.828 -33.834 -34.865  1.00 1.52 ? 52  PRO B C    1 
ATOM   2645 O  O    . PRO B 1 52  ? -28.369 -34.148 -35.925  1.00 2.04 ? 52  PRO B O    1 
ATOM   2646 C  CB   . PRO B 1 52  ? -28.211 -35.567 -33.090  1.00 1.67 ? 52  PRO B CB   1 
ATOM   2647 C  CG   . PRO B 1 52  ? -28.137 -34.832 -31.797  1.00 1.91 ? 52  PRO B CG   1 
ATOM   2648 C  CD   . PRO B 1 52  ? -26.700 -34.417 -31.637  1.00 1.77 ? 52  PRO B CD   1 
ATOM   2649 H  HA   . PRO B 1 52  ? -26.692 -35.632 -34.609  1.00 1.31 ? 52  PRO B HA   1 
ATOM   2650 H  HB2  . PRO B 1 52  ? -29.188 -35.477 -33.542  1.00 1.75 ? 52  PRO B HB2  1 
ATOM   2651 H  HB3  . PRO B 1 52  ? -27.960 -36.610 -32.965  1.00 1.75 ? 52  PRO B HB3  1 
ATOM   2652 H  HG2  . PRO B 1 52  ? -28.776 -33.962 -31.832  1.00 1.92 ? 52  PRO B HG2  1 
ATOM   2653 H  HG3  . PRO B 1 52  ? -28.431 -35.483 -30.987  1.00 2.30 ? 52  PRO B HG3  1 
ATOM   2654 H  HD2  . PRO B 1 52  ? -26.636 -33.464 -31.133  1.00 1.83 ? 52  PRO B HD2  1 
ATOM   2655 H  HD3  . PRO B 1 52  ? -26.148 -35.171 -31.096  1.00 1.97 ? 52  PRO B HD3  1 
ATOM   2656 N  N    . ASP B 1 53  ? -27.780 -32.581 -34.422  1.00 1.21 ? 53  ASP B N    1 
ATOM   2657 C  CA   . ASP B 1 53  ? -28.375 -31.482 -35.174  1.00 1.42 ? 53  ASP B CA   1 
ATOM   2658 C  C    . ASP B 1 53  ? -27.352 -30.837 -36.104  1.00 1.20 ? 53  ASP B C    1 
ATOM   2659 O  O    . ASP B 1 53  ? -27.226 -29.614 -36.153  1.00 1.06 ? 53  ASP B O    1 
ATOM   2660 C  CB   . ASP B 1 53  ? -28.946 -30.433 -34.218  1.00 1.69 ? 53  ASP B CB   1 
ATOM   2661 C  CG   . ASP B 1 53  ? -30.313 -29.939 -34.651  1.00 2.36 ? 53  ASP B CG   1 
ATOM   2662 O  OD1  . ASP B 1 53  ? -31.157 -30.781 -35.024  1.00 3.13 ? 53  ASP B OD1  1 
ATOM   2663 O  OD2  . ASP B 1 53  ? -30.540 -28.712 -34.616  1.00 2.65 ? 53  ASP B OD2  1 
ATOM   2664 H  H    . ASP B 1 53  ? -27.336 -32.390 -33.570  1.00 1.03 ? 53  ASP B H    1 
ATOM   2665 H  HA   . ASP B 1 53  ? -29.180 -31.887 -35.770  1.00 1.67 ? 53  ASP B HA   1 
ATOM   2666 H  HB2  . ASP B 1 53  ? -29.036 -30.864 -33.232  1.00 1.56 ? 53  ASP B HB2  1 
ATOM   2667 H  HB3  . ASP B 1 53  ? -28.275 -29.588 -34.178  1.00 2.21 ? 53  ASP B HB3  1 
ATOM   2668 N  N    . LEU B 1 54  ? -26.624 -31.668 -36.844  1.00 1.25 ? 54  LEU B N    1 
ATOM   2669 C  CA   . LEU B 1 54  ? -25.614 -31.180 -37.775  1.00 1.07 ? 54  LEU B CA   1 
ATOM   2670 C  C    . LEU B 1 54  ? -25.935 -31.621 -39.198  1.00 1.06 ? 54  LEU B C    1 
ATOM   2671 O  O    . LEU B 1 54  ? -25.893 -32.810 -39.515  1.00 1.48 ? 54  LEU B O    1 
ATOM   2672 C  CB   . LEU B 1 54  ? -24.227 -31.685 -37.370  1.00 1.04 ? 54  LEU B CB   1 
ATOM   2673 C  CG   . LEU B 1 54  ? -23.063 -30.781 -37.778  1.00 1.26 ? 54  LEU B CG   1 
ATOM   2674 C  CD1  . LEU B 1 54  ? -21.745 -31.536 -37.691  1.00 1.88 ? 54  LEU B CD1  1 
ATOM   2675 C  CD2  . LEU B 1 54  ? -23.276 -30.240 -39.184  1.00 0.96 ? 54  LEU B CD2  1 
ATOM   2676 H  H    . LEU B 1 54  ? -26.771 -32.634 -36.763  1.00 1.45 ? 54  LEU B H    1 
ATOM   2677 H  HA   . LEU B 1 54  ? -25.621 -30.100 -37.736  1.00 1.00 ? 54  LEU B HA   1 
ATOM   2678 H  HB2  . LEU B 1 54  ? -24.209 -31.799 -36.296  1.00 1.17 ? 54  LEU B HB2  1 
ATOM   2679 H  HB3  . LEU B 1 54  ? -24.075 -32.655 -37.820  1.00 0.99 ? 54  LEU B HB3  1 
ATOM   2680 H  HG   . LEU B 1 54  ? -23.012 -29.942 -37.100  1.00 1.47 ? 54  LEU B HG   1 
ATOM   2681 H  HD11 . LEU B 1 54  ? -21.627 -32.156 -38.567  1.00 2.17 ? 54  LEU B HD11 1 
ATOM   2682 H  HD12 . LEU B 1 54  ? -21.745 -32.158 -36.807  1.00 2.52 ? 54  LEU B HD12 1 
ATOM   2683 H  HD13 . LEU B 1 54  ? -20.929 -30.831 -37.635  1.00 2.09 ? 54  LEU B HD13 1 
ATOM   2684 H  HD21 . LEU B 1 54  ? -22.439 -29.616 -39.460  1.00 1.59 ? 54  LEU B HD21 1 
ATOM   2685 H  HD22 . LEU B 1 54  ? -24.185 -29.657 -39.211  1.00 0.97 ? 54  LEU B HD22 1 
ATOM   2686 H  HD23 . LEU B 1 54  ? -23.356 -31.063 -39.878  1.00 1.08 ? 54  LEU B HD23 1 
ATOM   2687 N  N    . ALA B 1 55  ? -26.259 -30.656 -40.051  1.00 1.07 ? 55  ALA B N    1 
ATOM   2688 C  CA   . ALA B 1 55  ? -26.593 -30.945 -41.440  1.00 1.03 ? 55  ALA B CA   1 
ATOM   2689 C  C    . ALA B 1 55  ? -25.525 -30.412 -42.389  1.00 0.99 ? 55  ALA B C    1 
ATOM   2690 O  O    . ALA B 1 55  ? -25.396 -29.203 -42.579  1.00 1.05 ? 55  ALA B O    1 
ATOM   2691 C  CB   . ALA B 1 55  ? -27.951 -30.354 -41.785  1.00 1.00 ? 55  ALA B CB   1 
ATOM   2692 H  H    . ALA B 1 55  ? -26.278 -29.728 -39.739  1.00 1.42 ? 55  ALA B H    1 
ATOM   2693 H  HA   . ALA B 1 55  ? -26.656 -32.018 -41.551  1.00 1.09 ? 55  ALA B HA   1 
ATOM   2694 H  HB1  . ALA B 1 55  ? -28.120 -29.469 -41.189  1.00 1.47 ? 55  ALA B HB1  1 
ATOM   2695 H  HB2  . ALA B 1 55  ? -28.723 -31.080 -41.578  1.00 1.62 ? 55  ALA B HB2  1 
ATOM   2696 H  HB3  . ALA B 1 55  ? -27.974 -30.092 -42.833  1.00 0.95 ? 55  ALA B HB3  1 
ATOM   2697 N  N    . GLN B 1 56  ? -24.763 -31.324 -42.987  1.00 0.92 ? 56  GLN B N    1 
ATOM   2698 C  CA   . GLN B 1 56  ? -23.709 -30.945 -43.921  1.00 0.92 ? 56  GLN B CA   1 
ATOM   2699 C  C    . GLN B 1 56  ? -24.243 -30.917 -45.349  1.00 0.82 ? 56  GLN B C    1 
ATOM   2700 O  O    . GLN B 1 56  ? -25.329 -31.426 -45.623  1.00 0.93 ? 56  GLN B O    1 
ATOM   2701 C  CB   . GLN B 1 56  ? -22.533 -31.918 -43.821  1.00 0.97 ? 56  GLN B CB   1 
ATOM   2702 C  CG   . GLN B 1 56  ? -22.848 -33.310 -44.345  1.00 1.73 ? 56  GLN B CG   1 
ATOM   2703 C  CD   . GLN B 1 56  ? -21.620 -34.195 -44.424  1.00 1.97 ? 56  GLN B CD   1 
ATOM   2704 O  OE1  . GLN B 1 56  ? -21.354 -34.818 -45.452  1.00 1.52 ? 56  GLN B OE1  1 
ATOM   2705 N  NE2  . GLN B 1 56  ? -20.864 -34.256 -43.334  1.00 3.05 ? 56  GLN B NE2  1 
ATOM   2706 H  H    . GLN B 1 56  ? -24.916 -32.273 -42.798  1.00 0.91 ? 56  GLN B H    1 
ATOM   2707 H  HA   . GLN B 1 56  ? -23.370 -29.955 -43.656  1.00 1.06 ? 56  GLN B HA   1 
ATOM   2708 H  HB2  . GLN B 1 56  ? -21.704 -31.522 -44.389  1.00 1.40 ? 56  GLN B HB2  1 
ATOM   2709 H  HB3  . GLN B 1 56  ? -22.239 -32.005 -42.785  1.00 1.23 ? 56  GLN B HB3  1 
ATOM   2710 H  HG2  . GLN B 1 56  ? -23.566 -33.774 -43.687  1.00 2.05 ? 56  GLN B HG2  1 
ATOM   2711 H  HG3  . GLN B 1 56  ? -23.273 -33.220 -45.334  1.00 2.49 ? 56  GLN B HG3  1 
ATOM   2712 H  HE21 . GLN B 1 56  ? -21.137 -33.734 -42.551  1.00 3.51 ? 56  GLN B HE21 1 
ATOM   2713 H  HE22 . GLN B 1 56  ? -20.063 -34.821 -43.357  1.00 3.42 ? 56  GLN B HE22 1 
ATOM   2714 N  N    . CYS B 1 57  ? -23.478 -30.316 -46.254  1.00 0.78 ? 57  CYS B N    1 
ATOM   2715 C  CA   . CYS B 1 57  ? -23.887 -30.223 -47.651  1.00 0.71 ? 57  CYS B CA   1 
ATOM   2716 C  C    . CYS B 1 57  ? -22.894 -30.926 -48.569  1.00 0.51 ? 57  CYS B C    1 
ATOM   2717 O  O    . CYS B 1 57  ? -21.681 -30.800 -48.405  1.00 0.53 ? 57  CYS B O    1 
ATOM   2718 C  CB   . CYS B 1 57  ? -24.025 -28.758 -48.068  1.00 0.82 ? 57  CYS B CB   1 
ATOM   2719 S  SG   . CYS B 1 57  ? -24.828 -28.522 -49.687  1.00 1.01 ? 57  CYS B SG   1 
ATOM   2720 H  H    . CYS B 1 57  ? -22.623 -29.925 -45.977  1.00 0.89 ? 57  CYS B H    1 
ATOM   2721 H  HA   . CYS B 1 57  ? -24.847 -30.704 -47.746  1.00 0.78 ? 57  CYS B HA   1 
ATOM   2722 H  HB2  . CYS B 1 57  ? -24.613 -28.234 -47.330  1.00 1.00 ? 57  CYS B HB2  1 
ATOM   2723 H  HB3  . CYS B 1 57  ? -23.043 -28.312 -48.120  1.00 0.70 ? 57  CYS B HB3  1 
ATOM   2724 N  N    . PHE B 1 58  ? -23.423 -31.658 -49.543  1.00 0.38 ? 58  PHE B N    1 
ATOM   2725 C  CA   . PHE B 1 58  ? -22.590 -32.375 -50.500  1.00 0.39 ? 58  PHE B CA   1 
ATOM   2726 C  C    . PHE B 1 58  ? -22.281 -31.488 -51.701  1.00 0.62 ? 58  PHE B C    1 
ATOM   2727 O  O    . PHE B 1 58  ? -22.682 -30.325 -51.742  1.00 1.48 ? 58  PHE B O    1 
ATOM   2728 C  CB   . PHE B 1 58  ? -23.287 -33.658 -50.957  1.00 0.38 ? 58  PHE B CB   1 
ATOM   2729 C  CG   . PHE B 1 58  ? -23.930 -33.546 -52.310  1.00 0.48 ? 58  PHE B CG   1 
ATOM   2730 C  CD1  . PHE B 1 58  ? -24.966 -32.652 -52.528  1.00 1.22 ? 58  PHE B CD1  1 
ATOM   2731 C  CD2  . PHE B 1 58  ? -23.498 -34.335 -53.364  1.00 1.36 ? 58  PHE B CD2  1 
ATOM   2732 C  CE1  . PHE B 1 58  ? -25.558 -32.547 -53.772  1.00 1.24 ? 58  PHE B CE1  1 
ATOM   2733 C  CE2  . PHE B 1 58  ? -24.087 -34.234 -54.610  1.00 1.49 ? 58  PHE B CE2  1 
ATOM   2734 C  CZ   . PHE B 1 58  ? -25.119 -33.339 -54.814  1.00 0.80 ? 58  PHE B CZ   1 
ATOM   2735 H  H    . PHE B 1 58  ? -24.398 -31.711 -49.625  1.00 0.39 ? 58  PHE B H    1 
ATOM   2736 H  HA   . PHE B 1 58  ? -21.664 -32.632 -50.008  1.00 0.43 ? 58  PHE B HA   1 
ATOM   2737 H  HB2  . PHE B 1 58  ? -22.562 -34.457 -51.001  1.00 0.44 ? 58  PHE B HB2  1 
ATOM   2738 H  HB3  . PHE B 1 58  ? -24.055 -33.915 -50.243  1.00 0.34 ? 58  PHE B HB3  1 
ATOM   2739 H  HD1  . PHE B 1 58  ? -25.310 -32.031 -51.714  1.00 2.10 ? 58  PHE B HD1  1 
ATOM   2740 H  HD2  . PHE B 1 58  ? -22.691 -35.036 -53.206  1.00 2.19 ? 58  PHE B HD2  1 
ATOM   2741 H  HE1  . PHE B 1 58  ? -26.365 -31.846 -53.929  1.00 2.06 ? 58  PHE B HE1  1 
ATOM   2742 H  HE2  . PHE B 1 58  ? -23.741 -34.855 -55.423  1.00 2.39 ? 58  PHE B HE2  1 
ATOM   2743 H  HZ   . PHE B 1 58  ? -25.581 -33.258 -55.787  1.00 0.94 ? 58  PHE B HZ   1 
ATOM   2744 N  N    . PHE B 1 59  ? -21.566 -32.036 -52.678  1.00 0.54 ? 59  PHE B N    1 
ATOM   2745 C  CA   . PHE B 1 59  ? -21.210 -31.280 -53.872  1.00 0.52 ? 59  PHE B CA   1 
ATOM   2746 C  C    . PHE B 1 59  ? -20.540 -29.959 -53.500  1.00 0.65 ? 59  PHE B C    1 
ATOM   2747 O  O    . PHE B 1 59  ? -20.578 -28.998 -54.267  1.00 1.37 ? 59  PHE B O    1 
ATOM   2748 C  CB   . PHE B 1 59  ? -22.457 -31.011 -54.714  1.00 0.56 ? 59  PHE B CB   1 
ATOM   2749 C  CG   . PHE B 1 59  ? -22.168 -30.825 -56.176  1.00 0.40 ? 59  PHE B CG   1 
ATOM   2750 C  CD1  . PHE B 1 59  ? -22.054 -31.919 -57.016  1.00 0.49 ? 59  PHE B CD1  1 
ATOM   2751 C  CD2  . PHE B 1 59  ? -22.012 -29.555 -56.708  1.00 0.52 ? 59  PHE B CD2  1 
ATOM   2752 C  CE1  . PHE B 1 59  ? -21.790 -31.751 -58.362  1.00 0.54 ? 59  PHE B CE1  1 
ATOM   2753 C  CE2  . PHE B 1 59  ? -21.748 -29.381 -58.052  1.00 0.56 ? 59  PHE B CE2  1 
ATOM   2754 C  CZ   . PHE B 1 59  ? -21.637 -30.480 -58.881  1.00 0.50 ? 59  PHE B CZ   1 
ATOM   2755 H  H    . PHE B 1 59  ? -21.271 -32.967 -52.594  1.00 1.13 ? 59  PHE B H    1 
ATOM   2756 H  HA   . PHE B 1 59  ? -20.517 -31.874 -54.448  1.00 0.57 ? 59  PHE B HA   1 
ATOM   2757 H  HB2  . PHE B 1 59  ? -23.137 -31.844 -54.615  1.00 0.75 ? 59  PHE B HB2  1 
ATOM   2758 H  HB3  . PHE B 1 59  ? -22.940 -30.114 -54.353  1.00 0.75 ? 59  PHE B HB3  1 
ATOM   2759 H  HD1  . PHE B 1 59  ? -22.174 -32.913 -56.610  1.00 0.70 ? 59  PHE B HD1  1 
ATOM   2760 H  HD2  . PHE B 1 59  ? -22.098 -28.696 -56.061  1.00 0.74 ? 59  PHE B HD2  1 
ATOM   2761 H  HE1  . PHE B 1 59  ? -21.704 -32.612 -59.009  1.00 0.77 ? 59  PHE B HE1  1 
ATOM   2762 H  HE2  . PHE B 1 59  ? -21.629 -28.386 -58.455  1.00 0.78 ? 59  PHE B HE2  1 
ATOM   2763 H  HZ   . PHE B 1 59  ? -21.430 -30.346 -59.932  1.00 0.64 ? 59  PHE B HZ   1 
ATOM   2764 N  N    . CYS B 1 60  ? -19.929 -29.920 -52.319  1.00 0.67 ? 60  CYS B N    1 
ATOM   2765 C  CA   . CYS B 1 60  ? -19.253 -28.717 -51.846  1.00 0.63 ? 60  CYS B CA   1 
ATOM   2766 C  C    . CYS B 1 60  ? -18.625 -28.951 -50.476  1.00 0.67 ? 60  CYS B C    1 
ATOM   2767 O  O    . CYS B 1 60  ? -17.524 -28.478 -50.198  1.00 0.76 ? 60  CYS B O    1 
ATOM   2768 C  CB   . CYS B 1 60  ? -20.236 -27.546 -51.774  1.00 0.67 ? 60  CYS B CB   1 
ATOM   2769 S  SG   . CYS B 1 60  ? -21.629 -27.810 -50.629  1.00 0.77 ? 60  CYS B SG   1 
ATOM   2770 H  H    . CYS B 1 60  ? -19.933 -30.718 -51.752  1.00 1.20 ? 60  CYS B H    1 
ATOM   2771 H  HA   . CYS B 1 60  ? -18.472 -28.477 -52.551  1.00 0.64 ? 60  CYS B HA   1 
ATOM   2772 H  HB2  . CYS B 1 60  ? -19.707 -26.664 -51.446  1.00 0.68 ? 60  CYS B HB2  1 
ATOM   2773 H  HB3  . CYS B 1 60  ? -20.646 -27.368 -52.757  1.00 0.71 ? 60  CYS B HB3  1 
ATOM   2774 N  N    . PHE B 1 61  ? -19.335 -29.684 -49.624  1.00 0.62 ? 61  PHE B N    1 
ATOM   2775 C  CA   . PHE B 1 61  ? -18.849 -29.982 -48.281  1.00 0.68 ? 61  PHE B CA   1 
ATOM   2776 C  C    . PHE B 1 61  ? -18.871 -28.732 -47.406  1.00 0.66 ? 61  PHE B C    1 
ATOM   2777 O  O    . PHE B 1 61  ? -18.170 -27.759 -47.680  1.00 0.68 ? 61  PHE B O    1 
ATOM   2778 C  CB   . PHE B 1 61  ? -17.431 -30.552 -48.343  1.00 0.75 ? 61  PHE B CB   1 
ATOM   2779 C  CG   . PHE B 1 61  ? -17.251 -31.600 -49.404  1.00 0.82 ? 61  PHE B CG   1 
ATOM   2780 C  CD1  . PHE B 1 61  ? -17.764 -32.875 -49.229  1.00 1.63 ? 61  PHE B CD1  1 
ATOM   2781 C  CD2  . PHE B 1 61  ? -16.569 -31.310 -50.575  1.00 1.24 ? 61  PHE B CD2  1 
ATOM   2782 C  CE1  . PHE B 1 61  ? -17.601 -33.842 -50.203  1.00 1.79 ? 61  PHE B CE1  1 
ATOM   2783 C  CE2  . PHE B 1 61  ? -16.402 -32.273 -51.552  1.00 1.24 ? 61  PHE B CE2  1 
ATOM   2784 C  CZ   . PHE B 1 61  ? -16.919 -33.541 -51.366  1.00 1.10 ? 61  PHE B CZ   1 
ATOM   2785 H  H    . PHE B 1 61  ? -20.207 -30.033 -49.904  1.00 0.57 ? 61  PHE B H    1 
ATOM   2786 H  HA   . PHE B 1 61  ? -19.506 -30.721 -47.848  1.00 0.71 ? 61  PHE B HA   1 
ATOM   2787 H  HB2  . PHE B 1 61  ? -16.737 -29.751 -48.546  1.00 0.67 ? 61  PHE B HB2  1 
ATOM   2788 H  HB3  . PHE B 1 61  ? -17.189 -30.998 -47.389  1.00 0.88 ? 61  PHE B HB3  1 
ATOM   2789 H  HD1  . PHE B 1 61  ? -18.298 -33.112 -48.320  1.00 2.40 ? 61  PHE B HD1  1 
ATOM   2790 H  HD2  . PHE B 1 61  ? -16.164 -30.320 -50.721  1.00 2.03 ? 61  PHE B HD2  1 
ATOM   2791 H  HE1  . PHE B 1 61  ? -18.006 -34.832 -50.055  1.00 2.67 ? 61  PHE B HE1  1 
ATOM   2792 H  HE2  . PHE B 1 61  ? -15.869 -32.035 -52.460  1.00 1.93 ? 61  PHE B HE2  1 
ATOM   2793 H  HZ   . PHE B 1 61  ? -16.790 -34.295 -52.128  1.00 1.23 ? 61  PHE B HZ   1 
ATOM   2794 N  N    . LYS B 1 62  ? -19.681 -28.768 -46.353  1.00 0.89 ? 62  LYS B N    1 
ATOM   2795 C  CA   . LYS B 1 62  ? -19.794 -27.638 -45.438  1.00 0.94 ? 62  LYS B CA   1 
ATOM   2796 C  C    . LYS B 1 62  ? -20.681 -27.987 -44.247  1.00 0.94 ? 62  LYS B C    1 
ATOM   2797 O  O    . LYS B 1 62  ? -21.907 -27.921 -44.334  1.00 1.09 ? 62  LYS B O    1 
ATOM   2798 C  CB   . LYS B 1 62  ? -20.357 -26.417 -46.168  1.00 0.92 ? 62  LYS B CB   1 
ATOM   2799 C  CG   . LYS B 1 62  ? -19.559 -25.145 -45.932  1.00 1.05 ? 62  LYS B CG   1 
ATOM   2800 C  CD   . LYS B 1 62  ? -19.868 -24.538 -44.573  1.00 1.31 ? 62  LYS B CD   1 
ATOM   2801 C  CE   . LYS B 1 62  ? -18.947 -23.369 -44.263  1.00 1.53 ? 62  LYS B CE   1 
ATOM   2802 N  NZ   . LYS B 1 62  ? -17.704 -23.810 -43.571  1.00 1.64 ? 62  LYS B NZ   1 
ATOM   2803 H  H    . LYS B 1 62  ? -20.215 -29.572 -46.187  1.00 1.13 ? 62  LYS B H    1 
ATOM   2804 H  HA   . LYS B 1 62  ? -18.803 -27.404 -45.077  1.00 1.01 ? 62  LYS B HA   1 
ATOM   2805 H  HB2  . LYS B 1 62  ? -20.367 -26.619 -47.229  1.00 1.07 ? 62  LYS B HB2  1 
ATOM   2806 H  HB3  . LYS B 1 62  ? -21.370 -26.248 -45.833  1.00 1.06 ? 62  LYS B HB3  1 
ATOM   2807 H  HG2  . LYS B 1 62  ? -18.506 -25.379 -45.980  1.00 1.19 ? 62  LYS B HG2  1 
ATOM   2808 H  HG3  . LYS B 1 62  ? -19.806 -24.429 -46.702  1.00 1.63 ? 62  LYS B HG3  1 
ATOM   2809 H  HD2  . LYS B 1 62  ? -20.889 -24.189 -44.570  1.00 1.89 ? 62  LYS B HD2  1 
ATOM   2810 H  HD3  . LYS B 1 62  ? -19.742 -25.296 -43.814  1.00 1.81 ? 62  LYS B HD3  1 
ATOM   2811 H  HE2  . LYS B 1 62  ? -18.679 -22.882 -45.188  1.00 2.03 ? 62  LYS B HE2  1 
ATOM   2812 H  HE3  . LYS B 1 62  ? -19.474 -22.671 -43.629  1.00 2.12 ? 62  LYS B HE3  1 
ATOM   2813 H  HZ1  . LYS B 1 62  ? -17.842 -23.789 -42.540  1.00 1.76 ? 62  LYS B HZ1  1 
ATOM   2814 H  HZ2  . LYS B 1 62  ? -16.915 -23.178 -43.817  1.00 2.20 ? 62  LYS B HZ2  1 
ATOM   2815 H  HZ3  . LYS B 1 62  ? -17.459 -24.779 -43.858  1.00 1.99 ? 62  LYS B HZ3  1 
ATOM   2816 N  N    . GLU B 1 63  ? -20.053 -28.360 -43.137  1.00 0.84 ? 63  GLU B N    1 
ATOM   2817 C  CA   . GLU B 1 63  ? -20.785 -28.720 -41.928  1.00 0.83 ? 63  GLU B CA   1 
ATOM   2818 C  C    . GLU B 1 63  ? -21.463 -27.497 -41.318  1.00 0.82 ? 63  GLU B C    1 
ATOM   2819 O  O    . GLU B 1 63  ? -20.829 -26.463 -41.109  1.00 0.84 ? 63  GLU B O    1 
ATOM   2820 C  CB   . GLU B 1 63  ? -19.841 -29.358 -40.907  1.00 0.91 ? 63  GLU B CB   1 
ATOM   2821 C  CG   . GLU B 1 63  ? -19.393 -30.760 -41.285  1.00 0.91 ? 63  GLU B CG   1 
ATOM   2822 C  CD   . GLU B 1 63  ? -18.072 -31.141 -40.647  1.00 1.00 ? 63  GLU B CD   1 
ATOM   2823 O  OE1  . GLU B 1 63  ? -17.889 -30.858 -39.445  1.00 1.80 ? 63  GLU B OE1  1 
ATOM   2824 O  OE2  . GLU B 1 63  ? -17.219 -31.724 -41.351  1.00 0.97 ? 63  GLU B OE2  1 
ATOM   2825 H  H    . GLU B 1 63  ? -19.073 -28.393 -43.130  1.00 0.83 ? 63  GLU B H    1 
ATOM   2826 H  HA   . GLU B 1 63  ? -21.543 -29.438 -42.202  1.00 0.78 ? 63  GLU B HA   1 
ATOM   2827 H  HB2  . GLU B 1 63  ? -18.963 -28.737 -40.809  1.00 1.52 ? 63  GLU B HB2  1 
ATOM   2828 H  HB3  . GLU B 1 63  ? -20.344 -29.408 -39.952  1.00 1.58 ? 63  GLU B HB3  1 
ATOM   2829 H  HG2  . GLU B 1 63  ? -20.146 -31.464 -40.963  1.00 1.50 ? 63  GLU B HG2  1 
ATOM   2830 H  HG3  . GLU B 1 63  ? -19.287 -30.813 -42.359  1.00 1.64 ? 63  GLU B HG3  1 
ATOM   2831 N  N    . LEU B 1 64  ? -22.755 -27.625 -41.033  1.00 0.84 ? 64  LEU B N    1 
ATOM   2832 C  CA   . LEU B 1 64  ? -23.520 -26.531 -40.445  1.00 0.85 ? 64  LEU B CA   1 
ATOM   2833 C  C    . LEU B 1 64  ? -24.499 -27.054 -39.400  1.00 0.88 ? 64  LEU B C    1 
ATOM   2834 O  O    . LEU B 1 64  ? -25.438 -27.782 -39.723  1.00 1.17 ? 64  LEU B O    1 
ATOM   2835 C  CB   . LEU B 1 64  ? -24.278 -25.768 -41.534  1.00 0.81 ? 64  LEU B CB   1 
ATOM   2836 C  CG   . LEU B 1 64  ? -23.410 -24.881 -42.428  1.00 0.82 ? 64  LEU B CG   1 
ATOM   2837 C  CD1  . LEU B 1 64  ? -23.873 -24.965 -43.874  1.00 0.72 ? 64  LEU B CD1  1 
ATOM   2838 C  CD2  . LEU B 1 64  ? -23.442 -23.441 -41.939  1.00 1.15 ? 64  LEU B CD2  1 
ATOM   2839 H  H    . LEU B 1 64  ? -23.204 -28.474 -41.222  1.00 0.88 ? 64  LEU B H    1 
ATOM   2840 H  HA   . LEU B 1 64  ? -22.824 -25.859 -39.966  1.00 0.87 ? 64  LEU B HA   1 
ATOM   2841 H  HB2  . LEU B 1 64  ? -24.786 -26.487 -42.160  1.00 0.88 ? 64  LEU B HB2  1 
ATOM   2842 H  HB3  . LEU B 1 64  ? -25.019 -25.144 -41.057  1.00 0.91 ? 64  LEU B HB3  1 
ATOM   2843 H  HG   . LEU B 1 64  ? -22.388 -25.227 -42.384  1.00 0.83 ? 64  LEU B HG   1 
ATOM   2844 H  HD11 . LEU B 1 64  ? -23.603 -24.057 -44.392  1.00 1.34 ? 64  LEU B HD11 1 
ATOM   2845 H  HD12 . LEU B 1 64  ? -24.946 -25.090 -43.901  1.00 0.80 ? 64  LEU B HD12 1 
ATOM   2846 H  HD13 . LEU B 1 64  ? -23.400 -25.808 -44.355  1.00 1.30 ? 64  LEU B HD13 1 
ATOM   2847 H  HD21 . LEU B 1 64  ? -23.170 -23.409 -40.894  1.00 1.73 ? 64  LEU B HD21 1 
ATOM   2848 H  HD22 . LEU B 1 64  ? -24.437 -23.040 -42.064  1.00 1.75 ? 64  LEU B HD22 1 
ATOM   2849 H  HD23 . LEU B 1 64  ? -22.741 -22.851 -42.511  1.00 1.06 ? 64  LEU B HD23 1 
ATOM   2850 N  N    . GLU B 1 65  ? -24.274 -26.679 -38.145  1.00 0.92 ? 65  GLU B N    1 
ATOM   2851 C  CA   . GLU B 1 65  ? -25.138 -27.113 -37.052  1.00 1.02 ? 65  GLU B CA   1 
ATOM   2852 C  C    . GLU B 1 65  ? -25.671 -25.914 -36.273  1.00 1.09 ? 65  GLU B C    1 
ATOM   2853 O  O    . GLU B 1 65  ? -25.126 -24.813 -36.359  1.00 1.54 ? 65  GLU B O    1 
ATOM   2854 C  CB   . GLU B 1 65  ? -24.375 -28.056 -36.117  1.00 1.08 ? 65  GLU B CB   1 
ATOM   2855 C  CG   . GLU B 1 65  ? -24.664 -27.826 -34.642  1.00 1.18 ? 65  GLU B CG   1 
ATOM   2856 C  CD   . GLU B 1 65  ? -23.924 -28.800 -33.745  1.00 1.56 ? 65  GLU B CD   1 
ATOM   2857 O  OE1  . GLU B 1 65  ? -22.999 -29.478 -34.241  1.00 2.08 ? 65  GLU B OE1  1 
ATOM   2858 O  OE2  . GLU B 1 65  ? -24.270 -28.885 -32.548  1.00 2.05 ? 65  GLU B OE2  1 
ATOM   2859 H  H    . GLU B 1 65  ? -23.510 -26.099 -37.948  1.00 1.11 ? 65  GLU B H    1 
ATOM   2860 H  HA   . GLU B 1 65  ? -25.973 -27.646 -37.485  1.00 1.04 ? 65  GLU B HA   1 
ATOM   2861 H  HB2  . GLU B 1 65  ? -24.641 -29.074 -36.358  1.00 1.52 ? 65  GLU B HB2  1 
ATOM   2862 H  HB3  . GLU B 1 65  ? -23.315 -27.923 -36.279  1.00 1.59 ? 65  GLU B HB3  1 
ATOM   2863 H  HG2  . GLU B 1 65  ? -24.364 -26.823 -34.380  1.00 1.87 ? 65  GLU B HG2  1 
ATOM   2864 H  HG3  . GLU B 1 65  ? -25.725 -27.941 -34.474  1.00 1.37 ? 65  GLU B HG3  1 
ATOM   2865 N  N    . GLY B 1 66  ? -26.742 -26.133 -35.517  1.00 1.19 ? 66  GLY B N    1 
ATOM   2866 C  CA   . GLY B 1 66  ? -27.334 -25.060 -34.740  1.00 1.21 ? 66  GLY B CA   1 
ATOM   2867 C  C    . GLY B 1 66  ? -28.413 -24.332 -35.513  1.00 1.22 ? 66  GLY B C    1 
ATOM   2868 O  O    . GLY B 1 66  ? -28.603 -23.126 -35.351  1.00 1.43 ? 66  GLY B O    1 
ATOM   2869 H  H    . GLY B 1 66  ? -27.138 -27.029 -35.491  1.00 1.56 ? 66  GLY B H    1 
ATOM   2870 H  HA2  . GLY B 1 66  ? -27.765 -25.474 -33.840  1.00 1.24 ? 66  GLY B HA2  1 
ATOM   2871 H  HA3  . GLY B 1 66  ? -26.562 -24.355 -34.468  1.00 1.19 ? 66  GLY B HA3  1 
ATOM   2872 N  N    . TRP B 1 67  ? -29.112 -25.070 -36.366  1.00 1.04 ? 67  TRP B N    1 
ATOM   2873 C  CA   . TRP B 1 67  ? -30.173 -24.503 -37.187  1.00 1.04 ? 67  TRP B CA   1 
ATOM   2874 C  C    . TRP B 1 67  ? -31.343 -24.019 -36.338  1.00 1.09 ? 67  TRP B C    1 
ATOM   2875 O  O    . TRP B 1 67  ? -31.458 -24.358 -35.160  1.00 1.16 ? 67  TRP B O    1 
ATOM   2876 C  CB   . TRP B 1 67  ? -30.662 -25.538 -38.198  1.00 0.99 ? 67  TRP B CB   1 
ATOM   2877 C  CG   . TRP B 1 67  ? -29.624 -25.904 -39.211  1.00 0.94 ? 67  TRP B CG   1 
ATOM   2878 C  CD1  . TRP B 1 67  ? -28.556 -26.734 -39.028  1.00 0.94 ? 67  TRP B CD1  1 
ATOM   2879 C  CD2  . TRP B 1 67  ? -29.552 -25.445 -40.563  1.00 0.90 ? 67  TRP B CD2  1 
ATOM   2880 N  NE1  . TRP B 1 67  ? -27.824 -26.822 -40.186  1.00 0.91 ? 67  TRP B NE1  1 
ATOM   2881 C  CE2  . TRP B 1 67  ? -28.416 -26.038 -41.145  1.00 0.88 ? 67  TRP B CE2  1 
ATOM   2882 C  CE3  . TRP B 1 67  ? -30.340 -24.591 -41.338  1.00 0.90 ? 67  TRP B CE3  1 
ATOM   2883 C  CZ2  . TRP B 1 67  ? -28.051 -25.802 -42.469  1.00 0.85 ? 67  TRP B CZ2  1 
ATOM   2884 C  CZ3  . TRP B 1 67  ? -29.978 -24.357 -42.650  1.00 0.88 ? 67  TRP B CZ3  1 
ATOM   2885 C  CH2  . TRP B 1 67  ? -28.842 -24.961 -43.205  1.00 0.86 ? 67  TRP B CH2  1 
ATOM   2886 H  H    . TRP B 1 67  ? -28.902 -26.025 -36.452  1.00 0.96 ? 67  TRP B H    1 
ATOM   2887 H  HA   . TRP B 1 67  ? -29.762 -23.661 -37.722  1.00 1.04 ? 67  TRP B HA   1 
ATOM   2888 H  HB2  . TRP B 1 67  ? -30.949 -26.437 -37.674  1.00 0.99 ? 67  TRP B HB2  1 
ATOM   2889 H  HB3  . TRP B 1 67  ? -31.519 -25.143 -38.723  1.00 1.00 ? 67  TRP B HB3  1 
ATOM   2890 H  HD1  . TRP B 1 67  ? -28.332 -27.242 -38.101  1.00 0.98 ? 67  TRP B HD1  1 
ATOM   2891 H  HE1  . TRP B 1 67  ? -27.011 -27.357 -40.305  1.00 0.91 ? 67  TRP B HE1  1 
ATOM   2892 H  HE3  . TRP B 1 67  ? -31.219 -24.116 -40.927  1.00 0.93 ? 67  TRP B HE3  1 
ATOM   2893 H  HZ2  . TRP B 1 67  ? -27.179 -26.260 -42.912  1.00 0.85 ? 67  TRP B HZ2  1 
ATOM   2894 H  HZ3  . TRP B 1 67  ? -30.577 -23.698 -43.263  1.00 0.90 ? 67  TRP B HZ3  1 
ATOM   2895 H  HH2  . TRP B 1 67  ? -28.595 -24.749 -44.234  1.00 0.86 ? 67  TRP B HH2  1 
ATOM   2896 N  N    . GLU B 1 68  ? -32.213 -23.228 -36.956  1.00 1.08 ? 68  GLU B N    1 
ATOM   2897 C  CA   . GLU B 1 68  ? -33.386 -22.691 -36.281  1.00 1.15 ? 68  GLU B CA   1 
ATOM   2898 C  C    . GLU B 1 68  ? -34.561 -22.607 -37.249  1.00 1.07 ? 68  GLU B C    1 
ATOM   2899 O  O    . GLU B 1 68  ? -34.381 -22.698 -38.464  1.00 1.02 ? 68  GLU B O    1 
ATOM   2900 C  CB   . GLU B 1 68  ? -33.083 -21.307 -35.704  1.00 1.27 ? 68  GLU B CB   1 
ATOM   2901 C  CG   . GLU B 1 68  ? -32.390 -21.350 -34.352  1.00 1.42 ? 68  GLU B CG   1 
ATOM   2902 C  CD   . GLU B 1 68  ? -31.429 -20.195 -34.151  1.00 1.28 ? 68  GLU B CD   1 
ATOM   2903 O  OE1  . GLU B 1 68  ? -31.441 -19.261 -34.981  1.00 1.46 ? 68  GLU B OE1  1 
ATOM   2904 O  OE2  . GLU B 1 68  ? -30.665 -20.222 -33.163  1.00 1.18 ? 68  GLU B OE2  1 
ATOM   2905 H  H    . GLU B 1 68  ? -32.063 -23.002 -37.898  1.00 1.04 ? 68  GLU B H    1 
ATOM   2906 H  HA   . GLU B 1 68  ? -33.643 -23.362 -35.475  1.00 1.23 ? 68  GLU B HA   1 
ATOM   2907 H  HB2  . GLU B 1 68  ? -32.445 -20.774 -36.394  1.00 1.22 ? 68  GLU B HB2  1 
ATOM   2908 H  HB3  . GLU B 1 68  ? -34.010 -20.765 -35.592  1.00 1.74 ? 68  GLU B HB3  1 
ATOM   2909 H  HG2  . GLU B 1 68  ? -33.140 -21.313 -33.576  1.00 2.08 ? 68  GLU B HG2  1 
ATOM   2910 H  HG3  . GLU B 1 68  ? -31.839 -22.276 -34.274  1.00 1.47 ? 68  GLU B HG3  1 
ATOM   2911 N  N    . PRO B 1 69  ? -35.783 -22.438 -36.725  1.00 1.12 ? 69  PRO B N    1 
ATOM   2912 C  CA   . PRO B 1 69  ? -36.995 -22.347 -37.546  1.00 1.10 ? 69  PRO B CA   1 
ATOM   2913 C  C    . PRO B 1 69  ? -37.050 -21.063 -38.372  1.00 1.17 ? 69  PRO B C    1 
ATOM   2914 O  O    . PRO B 1 69  ? -38.011 -20.299 -38.281  1.00 1.57 ? 69  PRO B O    1 
ATOM   2915 C  CB   . PRO B 1 69  ? -38.138 -22.367 -36.517  1.00 1.21 ? 69  PRO B CB   1 
ATOM   2916 C  CG   . PRO B 1 69  ? -37.511 -22.784 -35.227  1.00 1.15 ? 69  PRO B CG   1 
ATOM   2917 C  CD   . PRO B 1 69  ? -36.083 -22.330 -35.295  1.00 1.26 ? 69  PRO B CD   1 
ATOM   2918 H  HA   . PRO B 1 69  ? -37.089 -23.198 -38.205  1.00 1.14 ? 69  PRO B HA   1 
ATOM   2919 H  HB2  . PRO B 1 69  ? -38.572 -21.381 -36.441  1.00 1.31 ? 69  PRO B HB2  1 
ATOM   2920 H  HB3  . PRO B 1 69  ? -38.893 -23.072 -36.832  1.00 1.38 ? 69  PRO B HB3  1 
ATOM   2921 H  HG2  . PRO B 1 69  ? -38.018 -22.307 -34.402  1.00 1.15 ? 69  PRO B HG2  1 
ATOM   2922 H  HG3  . PRO B 1 69  ? -37.559 -23.859 -35.127  1.00 1.18 ? 69  PRO B HG3  1 
ATOM   2923 H  HD2  . PRO B 1 69  ? -35.993 -21.309 -34.955  1.00 1.46 ? 69  PRO B HD2  1 
ATOM   2924 H  HD3  . PRO B 1 69  ? -35.448 -22.983 -34.715  1.00 1.32 ? 69  PRO B HD3  1 
ATOM   2925 N  N    . ASP B 1 70  ? -36.015 -20.830 -39.178  1.00 1.09 ? 70  ASP B N    1 
ATOM   2926 C  CA   . ASP B 1 70  ? -35.951 -19.639 -40.016  1.00 1.18 ? 70  ASP B CA   1 
ATOM   2927 C  C    . ASP B 1 70  ? -34.560 -19.469 -40.625  1.00 1.09 ? 70  ASP B C    1 
ATOM   2928 O  O    . ASP B 1 70  ? -34.028 -18.360 -40.683  1.00 1.16 ? 70  ASP B O    1 
ATOM   2929 C  CB   . ASP B 1 70  ? -36.316 -18.404 -39.192  1.00 1.50 ? 70  ASP B CB   1 
ATOM   2930 C  CG   . ASP B 1 70  ? -37.677 -17.845 -39.558  1.00 2.17 ? 70  ASP B CG   1 
ATOM   2931 O  OD1  . ASP B 1 70  ? -38.511 -18.611 -40.084  1.00 2.79 ? 70  ASP B OD1  1 
ATOM   2932 O  OD2  . ASP B 1 70  ? -37.908 -16.641 -39.319  1.00 2.71 ? 70  ASP B OD2  1 
ATOM   2933 H  H    . ASP B 1 70  ? -35.280 -21.472 -39.209  1.00 1.22 ? 70  ASP B H    1 
ATOM   2934 H  HA   . ASP B 1 70  ? -36.669 -19.754 -40.813  1.00 1.30 ? 70  ASP B HA   1 
ATOM   2935 H  HB2  . ASP B 1 70  ? -36.327 -18.673 -38.147  1.00 1.87 ? 70  ASP B HB2  1 
ATOM   2936 H  HB3  . ASP B 1 70  ? -35.575 -17.636 -39.354  1.00 1.62 ? 70  ASP B HB3  1 
ATOM   2937 N  N    . ASP B 1 71  ? -33.973 -20.572 -41.079  1.00 1.02 ? 71  ASP B N    1 
ATOM   2938 C  CA   . ASP B 1 71  ? -32.645 -20.535 -41.682  1.00 1.03 ? 71  ASP B CA   1 
ATOM   2939 C  C    . ASP B 1 71  ? -32.655 -21.183 -43.062  1.00 1.09 ? 71  ASP B C    1 
ATOM   2940 O  O    . ASP B 1 71  ? -32.420 -22.384 -43.197  1.00 1.52 ? 71  ASP B O    1 
ATOM   2941 C  CB   . ASP B 1 71  ? -31.633 -21.244 -40.781  1.00 1.02 ? 71  ASP B CB   1 
ATOM   2942 C  CG   . ASP B 1 71  ? -31.018 -20.311 -39.756  1.00 1.23 ? 71  ASP B CG   1 
ATOM   2943 O  OD1  . ASP B 1 71  ? -30.132 -19.516 -40.134  1.00 1.82 ? 71  ASP B OD1  1 
ATOM   2944 O  OD2  . ASP B 1 71  ? -31.421 -20.377 -38.576  1.00 1.57 ? 71  ASP B OD2  1 
ATOM   2945 H  H    . ASP B 1 71  ? -34.442 -21.430 -41.009  1.00 1.03 ? 71  ASP B H    1 
ATOM   2946 H  HA   . ASP B 1 71  ? -32.358 -19.500 -41.786  1.00 1.08 ? 71  ASP B HA   1 
ATOM   2947 H  HB2  . ASP B 1 71  ? -32.128 -22.048 -40.256  1.00 1.10 ? 71  ASP B HB2  1 
ATOM   2948 H  HB3  . ASP B 1 71  ? -30.841 -21.652 -41.391  1.00 0.99 ? 71  ASP B HB3  1 
ATOM   2949 N  N    . ASP B 1 72  ? -32.928 -20.380 -44.086  1.00 0.97 ? 72  ASP B N    1 
ATOM   2950 C  CA   . ASP B 1 72  ? -32.966 -20.877 -45.456  1.00 0.97 ? 72  ASP B CA   1 
ATOM   2951 C  C    . ASP B 1 72  ? -31.706 -21.678 -45.774  1.00 0.91 ? 72  ASP B C    1 
ATOM   2952 O  O    . ASP B 1 72  ? -30.592 -21.167 -45.661  1.00 0.92 ? 72  ASP B O    1 
ATOM   2953 C  CB   . ASP B 1 72  ? -33.105 -19.714 -46.440  1.00 1.05 ? 72  ASP B CB   1 
ATOM   2954 C  CG   . ASP B 1 72  ? -34.484 -19.085 -46.401  1.00 1.12 ? 72  ASP B CG   1 
ATOM   2955 O  OD1  . ASP B 1 72  ? -35.278 -19.450 -45.508  1.00 1.56 ? 72  ASP B OD1  1 
ATOM   2956 O  OD2  . ASP B 1 72  ? -34.771 -18.228 -47.263  1.00 1.29 ? 72  ASP B OD2  1 
ATOM   2957 H  H    . ASP B 1 72  ? -33.106 -19.432 -43.916  1.00 1.14 ? 72  ASP B H    1 
ATOM   2958 H  HA   . ASP B 1 72  ? -33.827 -21.520 -45.549  1.00 0.99 ? 72  ASP B HA   1 
ATOM   2959 H  HB2  . ASP B 1 72  ? -32.377 -18.955 -46.197  1.00 1.08 ? 72  ASP B HB2  1 
ATOM   2960 H  HB3  . ASP B 1 72  ? -32.922 -20.075 -47.442  1.00 1.06 ? 72  ASP B HB3  1 
ATOM   2961 N  N    . PRO B 1 73  ? -31.864 -22.950 -46.175  1.00 0.94 ? 73  PRO B N    1 
ATOM   2962 C  CA   . PRO B 1 73  ? -30.729 -23.817 -46.505  1.00 0.93 ? 73  PRO B CA   1 
ATOM   2963 C  C    . PRO B 1 73  ? -29.929 -23.297 -47.696  1.00 0.87 ? 73  PRO B C    1 
ATOM   2964 O  O    . PRO B 1 73  ? -28.724 -23.067 -47.591  1.00 0.85 ? 73  PRO B O    1 
ATOM   2965 C  CB   . PRO B 1 73  ? -31.380 -25.164 -46.837  1.00 1.03 ? 73  PRO B CB   1 
ATOM   2966 C  CG   . PRO B 1 73  ? -32.798 -24.842 -47.164  1.00 1.22 ? 73  PRO B CG   1 
ATOM   2967 C  CD   . PRO B 1 73  ? -33.153 -23.642 -46.335  1.00 1.08 ? 73  PRO B CD   1 
ATOM   2968 H  HA   . PRO B 1 73  ? -30.068 -23.935 -45.659  1.00 0.94 ? 73  PRO B HA   1 
ATOM   2969 H  HB2  . PRO B 1 73  ? -30.874 -25.612 -47.678  1.00 1.15 ? 73  PRO B HB2  1 
ATOM   2970 H  HB3  . PRO B 1 73  ? -31.313 -25.818 -45.981  1.00 1.05 ? 73  PRO B HB3  1 
ATOM   2971 H  HG2  . PRO B 1 73  ? -32.890 -24.614 -48.215  1.00 1.43 ? 73  PRO B HG2  1 
ATOM   2972 H  HG3  . PRO B 1 73  ? -33.431 -25.677 -46.904  1.00 1.48 ? 73  PRO B HG3  1 
ATOM   2973 H  HD2  . PRO B 1 73  ? -33.863 -23.018 -46.858  1.00 1.07 ? 73  PRO B HD2  1 
ATOM   2974 H  HD3  . PRO B 1 73  ? -33.548 -23.947 -45.378  1.00 1.17 ? 73  PRO B HD3  1 
ATOM   2975 N  N    . ILE B 1 74  ? -30.602 -23.111 -48.827  1.00 0.92 ? 74  ILE B N    1 
ATOM   2976 C  CA   . ILE B 1 74  ? -29.943 -22.615 -50.029  1.00 0.91 ? 74  ILE B CA   1 
ATOM   2977 C  C    . ILE B 1 74  ? -29.161 -21.341 -49.733  1.00 0.91 ? 74  ILE B C    1 
ATOM   2978 O  O    . ILE B 1 74  ? -28.035 -21.169 -50.200  1.00 0.95 ? 74  ILE B O    1 
ATOM   2979 C  CB   . ILE B 1 74  ? -30.957 -22.340 -51.157  1.00 0.92 ? 74  ILE B CB   1 
ATOM   2980 C  CG1  . ILE B 1 74  ? -30.892 -23.447 -52.210  1.00 0.96 ? 74  ILE B CG1  1 
ATOM   2981 C  CG2  . ILE B 1 74  ? -30.693 -20.984 -51.795  1.00 0.87 ? 74  ILE B CG2  1 
ATOM   2982 C  CD1  . ILE B 1 74  ? -31.938 -23.313 -53.295  1.00 0.98 ? 74  ILE B CD1  1 
ATOM   2983 H  H    . ILE B 1 74  ? -31.561 -23.307 -48.853  1.00 1.01 ? 74  ILE B H    1 
ATOM   2984 H  HA   . ILE B 1 74  ? -29.255 -23.376 -50.370  1.00 0.91 ? 74  ILE B HA   1 
ATOM   2985 H  HB   . ILE B 1 74  ? -31.946 -22.320 -50.725  1.00 0.98 ? 74  ILE B HB   1 
ATOM   2986 H  HG12 . ILE B 1 74  ? -29.920 -23.429 -52.682  1.00 1.00 ? 74  ILE B HG12 1 
ATOM   2987 H  HG13 . ILE B 1 74  ? -31.035 -24.403 -51.726  1.00 1.06 ? 74  ILE B HG13 1 
ATOM   2988 H  HG21 . ILE B 1 74  ? -31.342 -20.857 -52.649  1.00 0.88 ? 74  ILE B HG21 1 
ATOM   2989 H  HG22 . ILE B 1 74  ? -29.663 -20.931 -52.116  1.00 1.50 ? 74  ILE B HG22 1 
ATOM   2990 H  HG23 . ILE B 1 74  ? -30.888 -20.203 -51.076  1.00 1.47 ? 74  ILE B HG23 1 
ATOM   2991 H  HD11 . ILE B 1 74  ? -32.288 -24.293 -53.581  1.00 1.10 ? 74  ILE B HD11 1 
ATOM   2992 H  HD12 . ILE B 1 74  ? -31.504 -22.821 -54.153  1.00 1.51 ? 74  ILE B HD12 1 
ATOM   2993 H  HD13 . ILE B 1 74  ? -32.767 -22.728 -52.925  1.00 1.47 ? 74  ILE B HD13 1 
ATOM   2994 N  N    . GLU B 1 75  ? -29.764 -20.454 -48.949  1.00 0.90 ? 75  GLU B N    1 
ATOM   2995 C  CA   . GLU B 1 75  ? -29.122 -19.198 -48.584  1.00 0.91 ? 75  GLU B CA   1 
ATOM   2996 C  C    . GLU B 1 75  ? -28.004 -19.438 -47.574  1.00 0.84 ? 75  GLU B C    1 
ATOM   2997 O  O    . GLU B 1 75  ? -27.026 -18.693 -47.525  1.00 0.80 ? 75  GLU B O    1 
ATOM   2998 C  CB   . GLU B 1 75  ? -30.150 -18.224 -48.003  1.00 0.98 ? 75  GLU B CB   1 
ATOM   2999 C  CG   . GLU B 1 75  ? -30.142 -16.860 -48.674  1.00 1.24 ? 75  GLU B CG   1 
ATOM   3000 C  CD   . GLU B 1 75  ? -29.925 -15.728 -47.689  1.00 1.82 ? 75  GLU B CD   1 
ATOM   3001 O  OE1  . GLU B 1 75  ? -30.811 -15.504 -46.838  1.00 2.18 ? 75  GLU B OE1  1 
ATOM   3002 O  OE2  . GLU B 1 75  ? -28.869 -15.066 -47.769  1.00 2.64 ? 75  GLU B OE2  1 
ATOM   3003 H  H    . GLU B 1 75  ? -30.660 -20.651 -48.605  1.00 0.91 ? 75  GLU B H    1 
ATOM   3004 H  HA   . GLU B 1 75  ? -28.697 -18.769 -49.479  1.00 0.93 ? 75  GLU B HA   1 
ATOM   3005 H  HB2  . GLU B 1 75  ? -31.136 -18.651 -48.115  1.00 1.26 ? 75  GLU B HB2  1 
ATOM   3006 H  HB3  . GLU B 1 75  ? -29.944 -18.086 -46.952  1.00 1.04 ? 75  GLU B HB3  1 
ATOM   3007 H  HG2  . GLU B 1 75  ? -29.348 -16.837 -49.406  1.00 1.58 ? 75  GLU B HG2  1 
ATOM   3008 H  HG3  . GLU B 1 75  ? -31.091 -16.711 -49.169  1.00 1.83 ? 75  GLU B HG3  1 
ATOM   3009 N  N    . GLU B 1 76  ? -28.156 -20.487 -46.771  1.00 0.83 ? 76  GLU B N    1 
ATOM   3010 C  CA   . GLU B 1 76  ? -27.160 -20.830 -45.763  1.00 0.78 ? 76  GLU B CA   1 
ATOM   3011 C  C    . GLU B 1 76  ? -25.845 -21.239 -46.417  1.00 0.65 ? 76  GLU B C    1 
ATOM   3012 O  O    . GLU B 1 76  ? -24.824 -20.574 -46.248  1.00 0.58 ? 76  GLU B O    1 
ATOM   3013 C  CB   . GLU B 1 76  ? -27.674 -21.961 -44.870  1.00 0.90 ? 76  GLU B CB   1 
ATOM   3014 C  CG   . GLU B 1 76  ? -26.773 -22.255 -43.682  1.00 0.99 ? 76  GLU B CG   1 
ATOM   3015 C  CD   . GLU B 1 76  ? -26.688 -21.092 -42.713  1.00 1.29 ? 76  GLU B CD   1 
ATOM   3016 O  OE1  . GLU B 1 76  ? -27.573 -20.981 -41.839  1.00 1.66 ? 76  GLU B OE1  1 
ATOM   3017 O  OE2  . GLU B 1 76  ? -25.735 -20.293 -42.828  1.00 2.10 ? 76  GLU B OE2  1 
ATOM   3018 H  H    . GLU B 1 76  ? -28.957 -21.045 -46.858  1.00 0.88 ? 76  GLU B H    1 
ATOM   3019 H  HA   . GLU B 1 76  ? -26.989 -19.953 -45.156  1.00 0.77 ? 76  GLU B HA   1 
ATOM   3020 H  HB2  . GLU B 1 76  ? -28.651 -21.693 -44.496  1.00 1.14 ? 76  GLU B HB2  1 
ATOM   3021 H  HB3  . GLU B 1 76  ? -27.759 -22.860 -45.462  1.00 0.93 ? 76  GLU B HB3  1 
ATOM   3022 H  HG2  . GLU B 1 76  ? -27.162 -23.114 -43.155  1.00 1.53 ? 76  GLU B HG2  1 
ATOM   3023 H  HG3  . GLU B 1 76  ? -25.780 -22.476 -44.045  1.00 1.31 ? 76  GLU B HG3  1 
ATOM   3024 N  N    . HIS B 1 77  ? -25.877 -22.338 -47.166  1.00 0.70 ? 77  HIS B N    1 
ATOM   3025 C  CA   . HIS B 1 77  ? -24.684 -22.829 -47.845  1.00 0.63 ? 77  HIS B CA   1 
ATOM   3026 C  C    . HIS B 1 77  ? -24.047 -21.726 -48.683  1.00 0.63 ? 77  HIS B C    1 
ATOM   3027 O  O    . HIS B 1 77  ? -22.873 -21.398 -48.507  1.00 0.67 ? 77  HIS B O    1 
ATOM   3028 C  CB   . HIS B 1 77  ? -25.024 -24.027 -48.733  1.00 0.68 ? 77  HIS B CB   1 
ATOM   3029 C  CG   . HIS B 1 77  ? -23.886 -24.464 -49.602  1.00 0.66 ? 77  HIS B CG   1 
ATOM   3030 N  ND1  . HIS B 1 77  ? -24.087 -25.264 -50.700  1.00 0.55 ? 77  HIS B ND1  1 
ATOM   3031 C  CD2  . HIS B 1 77  ? -22.564 -24.181 -49.498  1.00 1.00 ? 77  HIS B CD2  1 
ATOM   3032 C  CE1  . HIS B 1 77  ? -22.898 -25.447 -51.238  1.00 0.92 ? 77  HIS B CE1  1 
ATOM   3033 N  NE2  . HIS B 1 77  ? -21.941 -24.811 -50.545  1.00 1.18 ? 77  HIS B NE2  1 
ATOM   3034 H  H    . HIS B 1 77  ? -26.720 -22.827 -47.265  1.00 0.82 ? 77  HIS B H    1 
ATOM   3035 H  HA   . HIS B 1 77  ? -23.980 -23.144 -47.090  1.00 0.63 ? 77  HIS B HA   1 
ATOM   3036 H  HB2  . HIS B 1 77  ? -25.307 -24.861 -48.109  1.00 1.09 ? 77  HIS B HB2  1 
ATOM   3037 H  HB3  . HIS B 1 77  ? -25.853 -23.766 -49.375  1.00 0.69 ? 77  HIS B HB3  1 
ATOM   3038 H  HD2  . HIS B 1 77  ? -22.089 -23.577 -48.739  1.00 1.17 ? 77  HIS B HD2  1 
ATOM   3039 H  HE1  . HIS B 1 77  ? -22.721 -26.028 -52.128  1.00 1.05 ? 77  HIS B HE1  1 
ATOM   3040 H  HE2  . HIS B 1 77  ? -21.021 -24.654 -50.843  1.00 1.51 ? 77  HIS B HE2  1 
ATOM   3041 N  N    . LYS B 1 78  ? -24.829 -21.156 -49.594  1.00 0.62 ? 78  LYS B N    1 
ATOM   3042 C  CA   . LYS B 1 78  ? -24.344 -20.088 -50.460  1.00 0.66 ? 78  LYS B CA   1 
ATOM   3043 C  C    . LYS B 1 78  ? -23.729 -18.958 -49.640  1.00 0.72 ? 78  LYS B C    1 
ATOM   3044 O  O    . LYS B 1 78  ? -22.648 -18.464 -49.959  1.00 0.87 ? 78  LYS B O    1 
ATOM   3045 C  CB   . LYS B 1 78  ? -25.485 -19.544 -51.322  1.00 0.72 ? 78  LYS B CB   1 
ATOM   3046 C  CG   . LYS B 1 78  ? -25.055 -19.160 -52.728  1.00 0.67 ? 78  LYS B CG   1 
ATOM   3047 C  CD   . LYS B 1 78  ? -25.932 -18.055 -53.296  1.00 1.00 ? 78  LYS B CD   1 
ATOM   3048 C  CE   . LYS B 1 78  ? -27.409 -18.380 -53.141  1.00 0.76 ? 78  LYS B CE   1 
ATOM   3049 N  NZ   . LYS B 1 78  ? -28.254 -17.577 -54.068  1.00 0.95 ? 78  LYS B NZ   1 
ATOM   3050 H  H    . LYS B 1 78  ? -25.756 -21.461 -49.685  1.00 0.62 ? 78  LYS B H    1 
ATOM   3051 H  HA   . LYS B 1 78  ? -23.584 -20.504 -51.105  1.00 0.64 ? 78  LYS B HA   1 
ATOM   3052 H  HB2  . LYS B 1 78  ? -26.254 -20.298 -51.398  1.00 0.93 ? 78  LYS B HB2  1 
ATOM   3053 H  HB3  . LYS B 1 78  ? -25.897 -18.669 -50.843  1.00 0.81 ? 78  LYS B HB3  1 
ATOM   3054 H  HG2  . LYS B 1 78  ? -24.032 -18.815 -52.700  1.00 0.79 ? 78  LYS B HG2  1 
ATOM   3055 H  HG3  . LYS B 1 78  ? -25.127 -20.028 -53.367  1.00 0.78 ? 78  LYS B HG3  1 
ATOM   3056 H  HD2  . LYS B 1 78  ? -25.719 -17.135 -52.773  1.00 1.35 ? 78  LYS B HD2  1 
ATOM   3057 H  HD3  . LYS B 1 78  ? -25.707 -17.934 -54.346  1.00 1.66 ? 78  LYS B HD3  1 
ATOM   3058 H  HE2  . LYS B 1 78  ? -27.557 -19.429 -53.351  1.00 1.09 ? 78  LYS B HE2  1 
ATOM   3059 H  HE3  . LYS B 1 78  ? -27.705 -18.171 -52.124  1.00 0.67 ? 78  LYS B HE3  1 
ATOM   3060 H  HZ1  . LYS B 1 78  ? -28.253 -18.006 -55.015  1.00 1.48 ? 78  LYS B HZ1  1 
ATOM   3061 H  HZ2  . LYS B 1 78  ? -27.887 -16.607 -54.138  1.00 1.60 ? 78  LYS B HZ2  1 
ATOM   3062 H  HZ3  . LYS B 1 78  ? -29.233 -17.540 -53.717  1.00 1.06 ? 78  LYS B HZ3  1 
ATOM   3063 N  N    . LYS B 1 79  ? -24.426 -18.555 -48.583  1.00 0.66 ? 79  LYS B N    1 
ATOM   3064 C  CA   . LYS B 1 79  ? -23.950 -17.482 -47.717  1.00 0.73 ? 79  LYS B CA   1 
ATOM   3065 C  C    . LYS B 1 79  ? -22.496 -17.709 -47.316  1.00 0.72 ? 79  LYS B C    1 
ATOM   3066 O  O    . LYS B 1 79  ? -21.690 -16.779 -47.315  1.00 0.79 ? 79  LYS B O    1 
ATOM   3067 C  CB   . LYS B 1 79  ? -24.826 -17.383 -46.467  1.00 0.79 ? 79  LYS B CB   1 
ATOM   3068 C  CG   . LYS B 1 79  ? -24.084 -16.870 -45.243  1.00 1.59 ? 79  LYS B CG   1 
ATOM   3069 C  CD   . LYS B 1 79  ? -25.042 -16.293 -44.213  1.00 1.53 ? 79  LYS B CD   1 
ATOM   3070 C  CE   . LYS B 1 79  ? -25.798 -15.095 -44.765  1.00 1.71 ? 79  LYS B CE   1 
ATOM   3071 N  NZ   . LYS B 1 79  ? -26.408 -14.276 -43.682  1.00 1.94 ? 79  LYS B NZ   1 
ATOM   3072 H  H    . LYS B 1 79  ? -25.282 -18.988 -48.381  1.00 0.62 ? 79  LYS B H    1 
ATOM   3073 H  HA   . LYS B 1 79  ? -24.019 -16.556 -48.268  1.00 0.78 ? 79  LYS B HA   1 
ATOM   3074 H  HB2  . LYS B 1 79  ? -25.648 -16.712 -46.669  1.00 1.20 ? 79  LYS B HB2  1 
ATOM   3075 H  HB3  . LYS B 1 79  ? -25.220 -18.362 -46.238  1.00 1.31 ? 79  LYS B HB3  1 
ATOM   3076 H  HG2  . LYS B 1 79  ? -23.541 -17.688 -44.795  1.00 2.36 ? 79  LYS B HG2  1 
ATOM   3077 H  HG3  . LYS B 1 79  ? -23.392 -16.100 -45.550  1.00 2.19 ? 79  LYS B HG3  1 
ATOM   3078 H  HD2  . LYS B 1 79  ? -25.752 -17.054 -43.929  1.00 1.83 ? 79  LYS B HD2  1 
ATOM   3079 H  HD3  . LYS B 1 79  ? -24.477 -15.983 -43.345  1.00 2.08 ? 79  LYS B HD3  1 
ATOM   3080 H  HE2  . LYS B 1 79  ? -25.111 -14.479 -45.326  1.00 2.24 ? 79  LYS B HE2  1 
ATOM   3081 H  HE3  . LYS B 1 79  ? -26.579 -15.450 -45.421  1.00 2.26 ? 79  LYS B HE3  1 
ATOM   3082 H  HZ1  . LYS B 1 79  ? -27.086 -14.849 -43.139  1.00 2.50 ? 79  LYS B HZ1  1 
ATOM   3083 H  HZ2  . LYS B 1 79  ? -26.909 -13.461 -44.088  1.00 2.06 ? 79  LYS B HZ2  1 
ATOM   3084 H  HZ3  . LYS B 1 79  ? -25.670 -13.929 -43.037  1.00 2.22 ? 79  LYS B HZ3  1 
ATOM   3085 N  N    . HIS B 1 80  ? -22.168 -18.951 -46.975  1.00 0.70 ? 80  HIS B N    1 
ATOM   3086 C  CA   . HIS B 1 80  ? -20.811 -19.299 -46.571  1.00 0.75 ? 80  HIS B CA   1 
ATOM   3087 C  C    . HIS B 1 80  ? -19.956 -19.657 -47.782  1.00 0.51 ? 80  HIS B C    1 
ATOM   3088 O  O    . HIS B 1 80  ? -18.745 -19.431 -47.788  1.00 0.60 ? 80  HIS B O    1 
ATOM   3089 C  CB   . HIS B 1 80  ? -20.835 -20.469 -45.585  1.00 0.92 ? 80  HIS B CB   1 
ATOM   3090 C  CG   . HIS B 1 80  ? -21.352 -20.099 -44.230  1.00 1.14 ? 80  HIS B CG   1 
ATOM   3091 N  ND1  . HIS B 1 80  ? -20.529 -19.778 -43.171  1.00 1.84 ? 80  HIS B ND1  1 
ATOM   3092 C  CD2  . HIS B 1 80  ? -22.619 -19.998 -43.763  1.00 1.05 ? 80  HIS B CD2  1 
ATOM   3093 C  CE1  . HIS B 1 80  ? -21.266 -19.498 -42.112  1.00 2.03 ? 80  HIS B CE1  1 
ATOM   3094 N  NE2  . HIS B 1 80  ? -22.538 -19.623 -42.444  1.00 1.54 ? 80  HIS B NE2  1 
ATOM   3095 H  H    . HIS B 1 80  ? -22.855 -19.649 -46.995  1.00 0.70 ? 80  HIS B H    1 
ATOM   3096 H  HA   . HIS B 1 80  ? -20.380 -18.438 -46.083  1.00 1.03 ? 80  HIS B HA   1 
ATOM   3097 H  HB2  . HIS B 1 80  ? -21.467 -21.251 -45.980  1.00 0.92 ? 80  HIS B HB2  1 
ATOM   3098 H  HB3  . HIS B 1 80  ? -19.831 -20.850 -45.466  1.00 1.27 ? 80  HIS B HB3  1 
ATOM   3099 H  HD1  . HIS B 1 80  ? -19.549 -19.760 -43.193  1.00 2.22 ? 80  HIS B HD1  1 
ATOM   3100 H  HD2  . HIS B 1 80  ? -23.526 -20.179 -44.323  1.00 1.00 ? 80  HIS B HD2  1 
ATOM   3101 H  HE1  . HIS B 1 80  ? -20.893 -19.213 -41.139  1.00 2.58 ? 80  HIS B HE1  1 
ATOM   3102 H  HE2  . HIS B 1 80  ? -23.297 -19.385 -41.872  1.00 1.69 ? 80  HIS B HE2  1 
ATOM   3103 N  N    . SER B 1 81  ? -20.592 -20.216 -48.806  1.00 0.63 ? 81  SER B N    1 
ATOM   3104 C  CA   . SER B 1 81  ? -19.888 -20.605 -50.022  1.00 0.52 ? 81  SER B CA   1 
ATOM   3105 C  C    . SER B 1 81  ? -20.858 -21.157 -51.062  1.00 0.66 ? 81  SER B C    1 
ATOM   3106 O  O    . SER B 1 81  ? -21.830 -21.832 -50.722  1.00 1.50 ? 81  SER B O    1 
ATOM   3107 C  CB   . SER B 1 81  ? -18.818 -21.651 -49.705  1.00 0.67 ? 81  SER B CB   1 
ATOM   3108 O  OG   . SER B 1 81  ? -17.517 -21.132 -49.916  1.00 1.06 ? 81  SER B OG   1 
ATOM   3109 H  H    . SER B 1 81  ? -21.557 -20.371 -48.742  1.00 0.93 ? 81  SER B H    1 
ATOM   3110 H  HA   . SER B 1 81  ? -19.410 -19.725 -50.425  1.00 0.76 ? 81  SER B HA   1 
ATOM   3111 H  HB2  . SER B 1 81  ? -18.908 -21.953 -48.672  1.00 0.93 ? 81  SER B HB2  1 
ATOM   3112 H  HB3  . SER B 1 81  ? -18.958 -22.511 -50.344  1.00 0.60 ? 81  SER B HB3  1 
ATOM   3113 H  HG   . SER B 1 81  ? -16.893 -21.589 -49.348  1.00 1.13 ? 81  SER B HG   1 
ATOM   3114 N  N    . SER B 1 82  ? -20.587 -20.866 -52.330  1.00 0.82 ? 82  SER B N    1 
ATOM   3115 C  CA   . SER B 1 82  ? -21.435 -21.335 -53.420  1.00 1.02 ? 82  SER B CA   1 
ATOM   3116 C  C    . SER B 1 82  ? -20.868 -22.609 -54.038  1.00 1.19 ? 82  SER B C    1 
ATOM   3117 O  O    . SER B 1 82  ? -20.926 -22.801 -55.253  1.00 1.58 ? 82  SER B O    1 
ATOM   3118 C  CB   . SER B 1 82  ? -21.570 -20.252 -54.491  1.00 1.20 ? 82  SER B CB   1 
ATOM   3119 O  OG   . SER B 1 82  ? -22.881 -20.227 -55.028  1.00 1.31 ? 82  SER B OG   1 
ATOM   3120 H  H    . SER B 1 82  ? -19.797 -20.325 -52.538  1.00 1.39 ? 82  SER B H    1 
ATOM   3121 H  HA   . SER B 1 82  ? -22.411 -21.550 -53.012  1.00 1.06 ? 82  SER B HA   1 
ATOM   3122 H  HB2  . SER B 1 82  ? -21.356 -19.288 -54.054  1.00 1.57 ? 82  SER B HB2  1 
ATOM   3123 H  HB3  . SER B 1 82  ? -20.870 -20.448 -55.289  1.00 1.94 ? 82  SER B HB3  1 
ATOM   3124 H  HG   . SER B 1 82  ? -23.221 -19.329 -55.004  1.00 1.51 ? 82  SER B HG   1 
ATOM   3125 N  N    . GLY B 1 83  ? -20.320 -23.477 -53.194  1.00 1.12 ? 83  GLY B N    1 
ATOM   3126 C  CA   . GLY B 1 83  ? -19.750 -24.721 -53.675  1.00 1.36 ? 83  GLY B CA   1 
ATOM   3127 C  C    . GLY B 1 83  ? -20.745 -25.552 -54.462  1.00 1.32 ? 83  GLY B C    1 
ATOM   3128 O  O    . GLY B 1 83  ? -20.356 -26.364 -55.302  1.00 1.55 ? 83  GLY B O    1 
ATOM   3129 H  H    . GLY B 1 83  ? -20.302 -23.271 -52.236  1.00 1.10 ? 83  GLY B H    1 
ATOM   3130 H  HA2  . GLY B 1 83  ? -18.906 -24.496 -54.310  1.00 1.49 ? 83  GLY B HA2  1 
ATOM   3131 H  HA3  . GLY B 1 83  ? -19.406 -25.297 -52.829  1.00 1.51 ? 83  GLY B HA3  1 
ATOM   3132 N  N    . CYS B 1 84  ? -22.031 -25.350 -54.193  1.00 1.09 ? 84  CYS B N    1 
ATOM   3133 C  CA   . CYS B 1 84  ? -23.079 -26.088 -54.888  1.00 1.08 ? 84  CYS B CA   1 
ATOM   3134 C  C    . CYS B 1 84  ? -23.568 -25.312 -56.104  1.00 1.09 ? 84  CYS B C    1 
ATOM   3135 O  O    . CYS B 1 84  ? -24.293 -24.327 -55.974  1.00 1.46 ? 84  CYS B O    1 
ATOM   3136 C  CB   . CYS B 1 84  ? -24.258 -26.372 -53.949  1.00 1.05 ? 84  CYS B CB   1 
ATOM   3137 S  SG   . CYS B 1 84  ? -24.113 -27.926 -53.002  1.00 1.12 ? 84  CYS B SG   1 
ATOM   3138 H  H    . CYS B 1 84  ? -22.281 -24.688 -53.515  1.00 0.98 ? 84  CYS B H    1 
ATOM   3139 H  HA   . CYS B 1 84  ? -22.660 -27.026 -55.218  1.00 1.10 ? 84  CYS B HA   1 
ATOM   3140 H  HB2  . CYS B 1 84  ? -24.346 -25.564 -53.240  1.00 1.09 ? 84  CYS B HB2  1 
ATOM   3141 H  HB3  . CYS B 1 84  ? -25.164 -26.429 -54.534  1.00 1.06 ? 84  CYS B HB3  1 
ATOM   3142 N  N    . ALA B 1 85  ? -23.173 -25.765 -57.288  1.00 0.77 ? 85  ALA B N    1 
ATOM   3143 C  CA   . ALA B 1 85  ? -23.582 -25.115 -58.525  1.00 0.81 ? 85  ALA B CA   1 
ATOM   3144 C  C    . ALA B 1 85  ? -25.020 -25.484 -58.882  1.00 0.79 ? 85  ALA B C    1 
ATOM   3145 O  O    . ALA B 1 85  ? -25.573 -24.986 -59.862  1.00 1.00 ? 85  ALA B O    1 
ATOM   3146 C  CB   . ALA B 1 85  ? -22.640 -25.494 -59.658  1.00 0.87 ? 85  ALA B CB   1 
ATOM   3147 H  H    . ALA B 1 85  ? -22.599 -26.559 -57.331  1.00 0.60 ? 85  ALA B H    1 
ATOM   3148 H  HA   . ALA B 1 85  ? -23.520 -24.046 -58.377  1.00 0.86 ? 85  ALA B HA   1 
ATOM   3149 H  HB1  . ALA B 1 85  ? -22.966 -26.423 -60.102  1.00 1.08 ? 85  ALA B HB1  1 
ATOM   3150 H  HB2  . ALA B 1 85  ? -21.639 -25.612 -59.269  1.00 1.14 ? 85  ALA B HB2  1 
ATOM   3151 H  HB3  . ALA B 1 85  ? -22.646 -24.715 -60.406  1.00 1.00 ? 85  ALA B HB3  1 
ATOM   3152 N  N    . PHE B 1 86  ? -25.617 -26.365 -58.083  1.00 0.63 ? 86  PHE B N    1 
ATOM   3153 C  CA   . PHE B 1 86  ? -26.985 -26.808 -58.315  1.00 0.61 ? 86  PHE B CA   1 
ATOM   3154 C  C    . PHE B 1 86  ? -27.995 -25.910 -57.598  1.00 0.63 ? 86  PHE B C    1 
ATOM   3155 O  O    . PHE B 1 86  ? -29.176 -25.900 -57.945  1.00 0.68 ? 86  PHE B O    1 
ATOM   3156 C  CB   . PHE B 1 86  ? -27.149 -28.254 -57.850  1.00 0.60 ? 86  PHE B CB   1 
ATOM   3157 C  CG   . PHE B 1 86  ? -27.850 -28.385 -56.529  1.00 0.68 ? 86  PHE B CG   1 
ATOM   3158 C  CD1  . PHE B 1 86  ? -27.164 -28.192 -55.339  1.00 1.27 ? 86  PHE B CD1  1 
ATOM   3159 C  CD2  . PHE B 1 86  ? -29.197 -28.703 -56.479  1.00 1.53 ? 86  PHE B CD2  1 
ATOM   3160 C  CE1  . PHE B 1 86  ? -27.812 -28.314 -54.125  1.00 1.33 ? 86  PHE B CE1  1 
ATOM   3161 C  CE2  . PHE B 1 86  ? -29.849 -28.826 -55.268  1.00 1.78 ? 86  PHE B CE2  1 
ATOM   3162 C  CZ   . PHE B 1 86  ? -29.156 -28.632 -54.090  1.00 1.19 ? 86  PHE B CZ   1 
ATOM   3163 H  H    . PHE B 1 86  ? -25.124 -26.732 -57.321  1.00 0.60 ? 86  PHE B H    1 
ATOM   3164 H  HA   . PHE B 1 86  ? -27.171 -26.760 -59.377  1.00 0.65 ? 86  PHE B HA   1 
ATOM   3165 H  HB2  . PHE B 1 86  ? -27.723 -28.798 -58.585  1.00 0.90 ? 86  PHE B HB2  1 
ATOM   3166 H  HB3  . PHE B 1 86  ? -26.173 -28.708 -57.756  1.00 0.45 ? 86  PHE B HB3  1 
ATOM   3167 H  HD1  . PHE B 1 86  ? -26.111 -27.942 -55.363  1.00 2.10 ? 86  PHE B HD1  1 
ATOM   3168 H  HD2  . PHE B 1 86  ? -29.740 -28.855 -57.400  1.00 2.29 ? 86  PHE B HD2  1 
ATOM   3169 H  HE1  . PHE B 1 86  ? -27.268 -28.163 -53.205  1.00 2.05 ? 86  PHE B HE1  1 
ATOM   3170 H  HE2  . PHE B 1 86  ? -30.900 -29.074 -55.242  1.00 2.68 ? 86  PHE B HE2  1 
ATOM   3171 H  HZ   . PHE B 1 86  ? -29.664 -28.728 -53.144  1.00 1.44 ? 86  PHE B HZ   1 
ATOM   3172 N  N    . LEU B 1 87  ? -27.530 -25.157 -56.601  1.00 0.61 ? 87  LEU B N    1 
ATOM   3173 C  CA   . LEU B 1 87  ? -28.410 -24.261 -55.852  1.00 0.65 ? 87  LEU B CA   1 
ATOM   3174 C  C    . LEU B 1 87  ? -29.272 -23.442 -56.804  1.00 0.74 ? 87  LEU B C    1 
ATOM   3175 O  O    . LEU B 1 87  ? -30.495 -23.396 -56.671  1.00 0.88 ? 87  LEU B O    1 
ATOM   3176 C  CB   . LEU B 1 87  ? -27.595 -23.320 -54.961  1.00 0.65 ? 87  LEU B CB   1 
ATOM   3177 C  CG   . LEU B 1 87  ? -26.587 -24.002 -54.037  1.00 0.59 ? 87  LEU B CG   1 
ATOM   3178 C  CD1  . LEU B 1 87  ? -25.688 -22.968 -53.377  1.00 0.66 ? 87  LEU B CD1  1 
ATOM   3179 C  CD2  . LEU B 1 87  ? -27.302 -24.834 -52.983  1.00 0.60 ? 87  LEU B CD2  1 
ATOM   3180 H  H    . LEU B 1 87  ? -26.581 -25.203 -56.367  1.00 0.58 ? 87  LEU B H    1 
ATOM   3181 H  HA   . LEU B 1 87  ? -29.053 -24.866 -55.230  1.00 0.66 ? 87  LEU B HA   1 
ATOM   3182 H  HB2  . LEU B 1 87  ? -27.057 -22.633 -55.599  1.00 0.68 ? 87  LEU B HB2  1 
ATOM   3183 H  HB3  . LEU B 1 87  ? -28.282 -22.753 -54.351  1.00 0.71 ? 87  LEU B HB3  1 
ATOM   3184 H  HG   . LEU B 1 87  ? -25.965 -24.661 -54.621  1.00 0.57 ? 87  LEU B HG   1 
ATOM   3185 H  HD11 . LEU B 1 87  ? -26.259 -22.408 -52.651  1.00 1.27 ? 87  LEU B HD11 1 
ATOM   3186 H  HD12 . LEU B 1 87  ? -25.300 -22.296 -54.127  1.00 0.94 ? 87  LEU B HD12 1 
ATOM   3187 H  HD13 . LEU B 1 87  ? -24.868 -23.468 -52.882  1.00 0.83 ? 87  LEU B HD13 1 
ATOM   3188 H  HD21 . LEU B 1 87  ? -27.149 -25.883 -53.188  1.00 0.89 ? 87  LEU B HD21 1 
ATOM   3189 H  HD22 . LEU B 1 87  ? -28.359 -24.613 -53.005  1.00 1.08 ? 87  LEU B HD22 1 
ATOM   3190 H  HD23 . LEU B 1 87  ? -26.905 -24.597 -52.006  1.00 0.82 ? 87  LEU B HD23 1 
ATOM   3191 N  N    . SER B 1 88  ? -28.621 -22.799 -57.765  1.00 0.72 ? 88  SER B N    1 
ATOM   3192 C  CA   . SER B 1 88  ? -29.320 -21.978 -58.748  1.00 0.84 ? 88  SER B CA   1 
ATOM   3193 C  C    . SER B 1 88  ? -30.150 -22.843 -59.692  1.00 0.69 ? 88  SER B C    1 
ATOM   3194 O  O    . SER B 1 88  ? -31.248 -22.460 -60.096  1.00 0.83 ? 88  SER B O    1 
ATOM   3195 C  CB   . SER B 1 88  ? -28.320 -21.143 -59.550  1.00 1.18 ? 88  SER B CB   1 
ATOM   3196 O  OG   . SER B 1 88  ? -28.360 -19.782 -59.157  1.00 2.14 ? 88  SER B OG   1 
ATOM   3197 H  H    . SER B 1 88  ? -27.644 -22.878 -57.815  1.00 0.67 ? 88  SER B H    1 
ATOM   3198 H  HA   . SER B 1 88  ? -29.982 -21.313 -58.213  1.00 0.94 ? 88  SER B HA   1 
ATOM   3199 H  HB2  . SER B 1 88  ? -27.323 -21.523 -59.385  1.00 1.55 ? 88  SER B HB2  1 
ATOM   3200 H  HB3  . SER B 1 88  ? -28.561 -21.209 -60.601  1.00 1.37 ? 88  SER B HB3  1 
ATOM   3201 H  HG   . SER B 1 88  ? -29.203 -19.400 -59.410  1.00 2.53 ? 88  SER B HG   1 
ATOM   3202 N  N    . VAL B 1 89  ? -29.617 -24.011 -60.039  1.00 1.04 ? 89  VAL B N    1 
ATOM   3203 C  CA   . VAL B 1 89  ? -30.308 -24.931 -60.936  1.00 0.98 ? 89  VAL B CA   1 
ATOM   3204 C  C    . VAL B 1 89  ? -31.765 -25.111 -60.522  1.00 1.13 ? 89  VAL B C    1 
ATOM   3205 O  O    . VAL B 1 89  ? -32.056 -25.478 -59.383  1.00 1.91 ? 89  VAL B O    1 
ATOM   3206 C  CB   . VAL B 1 89  ? -29.617 -26.308 -60.969  1.00 1.14 ? 89  VAL B CB   1 
ATOM   3207 C  CG1  . VAL B 1 89  ? -30.643 -27.429 -60.916  1.00 1.70 ? 89  VAL B CG1  1 
ATOM   3208 C  CG2  . VAL B 1 89  ? -28.743 -26.435 -62.208  1.00 1.47 ? 89  VAL B CG2  1 
ATOM   3209 H  H    . VAL B 1 89  ? -28.738 -24.260 -59.685  1.00 1.51 ? 89  VAL B H    1 
ATOM   3210 H  HA   . VAL B 1 89  ? -30.277 -24.512 -61.932  1.00 0.94 ? 89  VAL B HA   1 
ATOM   3211 H  HB   . VAL B 1 89  ? -28.982 -26.390 -60.099  1.00 0.89 ? 89  VAL B HB   1 
ATOM   3212 H  HG11 . VAL B 1 89  ? -31.121 -27.435 -59.947  1.00 2.10 ? 89  VAL B HG11 1 
ATOM   3213 H  HG12 . VAL B 1 89  ? -30.150 -28.376 -61.079  1.00 1.60 ? 89  VAL B HG12 1 
ATOM   3214 H  HG13 . VAL B 1 89  ? -31.386 -27.274 -61.683  1.00 2.38 ? 89  VAL B HG13 1 
ATOM   3215 H  HG21 . VAL B 1 89  ? -27.731 -26.145 -61.966  1.00 1.73 ? 89  VAL B HG21 1 
ATOM   3216 H  HG22 . VAL B 1 89  ? -29.126 -25.792 -62.986  1.00 1.59 ? 89  VAL B HG22 1 
ATOM   3217 H  HG23 . VAL B 1 89  ? -28.752 -27.459 -62.551  1.00 2.13 ? 89  VAL B HG23 1 
ATOM   3218 N  N    . LYS B 1 90  ? -32.677 -24.850 -61.453  1.00 1.02 ? 90  LYS B N    1 
ATOM   3219 C  CA   . LYS B 1 90  ? -34.104 -24.982 -61.184  1.00 1.18 ? 90  LYS B CA   1 
ATOM   3220 C  C    . LYS B 1 90  ? -34.788 -25.814 -62.265  1.00 1.11 ? 90  LYS B C    1 
ATOM   3221 O  O    . LYS B 1 90  ? -35.894 -25.495 -62.700  1.00 1.24 ? 90  LYS B O    1 
ATOM   3222 C  CB   . LYS B 1 90  ? -34.758 -23.602 -61.097  1.00 1.36 ? 90  LYS B CB   1 
ATOM   3223 C  CG   . LYS B 1 90  ? -34.671 -22.974 -59.716  1.00 1.56 ? 90  LYS B CG   1 
ATOM   3224 C  CD   . LYS B 1 90  ? -35.339 -21.609 -59.682  1.00 1.74 ? 90  LYS B CD   1 
ATOM   3225 C  CE   . LYS B 1 90  ? -36.618 -21.635 -58.861  1.00 2.14 ? 90  LYS B CE   1 
ATOM   3226 N  NZ   . LYS B 1 90  ? -36.358 -21.371 -57.419  1.00 1.95 ? 90  LYS B NZ   1 
ATOM   3227 H  H    . LYS B 1 90  ? -32.383 -24.560 -62.342  1.00 1.40 ? 90  LYS B H    1 
ATOM   3228 H  HA   . LYS B 1 90  ? -34.217 -25.485 -60.235  1.00 1.37 ? 90  LYS B HA   1 
ATOM   3229 H  HB2  . LYS B 1 90  ? -34.274 -22.942 -61.801  1.00 1.48 ? 90  LYS B HB2  1 
ATOM   3230 H  HB3  . LYS B 1 90  ? -35.801 -23.694 -61.361  1.00 1.93 ? 90  LYS B HB3  1 
ATOM   3231 H  HG2  . LYS B 1 90  ? -35.161 -23.621 -59.004  1.00 1.99 ? 90  LYS B HG2  1 
ATOM   3232 H  HG3  . LYS B 1 90  ? -33.630 -22.862 -59.447  1.00 1.92 ? 90  LYS B HG3  1 
ATOM   3233 H  HD2  . LYS B 1 90  ? -34.657 -20.895 -59.245  1.00 1.96 ? 90  LYS B HD2  1 
ATOM   3234 H  HD3  . LYS B 1 90  ? -35.576 -21.310 -60.693  1.00 2.17 ? 90  LYS B HD3  1 
ATOM   3235 H  HE2  . LYS B 1 90  ? -37.290 -20.879 -59.240  1.00 2.70 ? 90  LYS B HE2  1 
ATOM   3236 H  HE3  . LYS B 1 90  ? -37.076 -22.608 -58.964  1.00 2.75 ? 90  LYS B HE3  1 
ATOM   3237 H  HZ1  . LYS B 1 90  ? -35.333 -21.328 -57.243  1.00 1.94 ? 90  LYS B HZ1  1 
ATOM   3238 H  HZ2  . LYS B 1 90  ? -36.766 -22.130 -56.837  1.00 2.09 ? 90  LYS B HZ2  1 
ATOM   3239 H  HZ3  . LYS B 1 90  ? -36.786 -20.466 -57.138  1.00 2.51 ? 90  LYS B HZ3  1 
ATOM   3240 N  N    . LYS B 1 91  ? -34.122 -26.882 -62.692  1.00 0.99 ? 91  LYS B N    1 
ATOM   3241 C  CA   . LYS B 1 91  ? -34.665 -27.761 -63.721  1.00 0.97 ? 91  LYS B CA   1 
ATOM   3242 C  C    . LYS B 1 91  ? -34.598 -29.219 -63.279  1.00 0.87 ? 91  LYS B C    1 
ATOM   3243 O  O    . LYS B 1 91  ? -33.531 -29.722 -62.927  1.00 0.83 ? 91  LYS B O    1 
ATOM   3244 C  CB   . LYS B 1 91  ? -33.901 -27.578 -65.033  1.00 1.08 ? 91  LYS B CB   1 
ATOM   3245 C  CG   . LYS B 1 91  ? -32.912 -26.424 -65.007  1.00 0.94 ? 91  LYS B CG   1 
ATOM   3246 C  CD   . LYS B 1 91  ? -31.657 -26.785 -64.230  1.00 1.31 ? 91  LYS B CD   1 
ATOM   3247 C  CE   . LYS B 1 91  ? -30.409 -26.629 -65.084  1.00 1.51 ? 91  LYS B CE   1 
ATOM   3248 N  NZ   . LYS B 1 91  ? -30.045 -25.198 -65.280  1.00 1.94 ? 91  LYS B NZ   1 
ATOM   3249 H  H    . LYS B 1 91  ? -33.245 -27.084 -62.306  1.00 0.97 ? 91  LYS B H    1 
ATOM   3250 H  HA   . LYS B 1 91  ? -35.699 -27.491 -63.875  1.00 1.03 ? 91  LYS B HA   1 
ATOM   3251 H  HB2  . LYS B 1 91  ? -33.357 -28.486 -65.249  1.00 1.35 ? 91  LYS B HB2  1 
ATOM   3252 H  HB3  . LYS B 1 91  ? -34.611 -27.397 -65.827  1.00 1.25 ? 91  LYS B HB3  1 
ATOM   3253 H  HG2  . LYS B 1 91  ? -32.636 -26.176 -66.021  1.00 1.18 ? 91  LYS B HG2  1 
ATOM   3254 H  HG3  . LYS B 1 91  ? -33.382 -25.571 -64.540  1.00 1.35 ? 91  LYS B HG3  1 
ATOM   3255 H  HD2  . LYS B 1 91  ? -31.577 -26.134 -63.372  1.00 2.09 ? 91  LYS B HD2  1 
ATOM   3256 H  HD3  . LYS B 1 91  ? -31.731 -27.811 -63.900  1.00 1.64 ? 91  LYS B HD3  1 
ATOM   3257 H  HE2  . LYS B 1 91  ? -29.589 -27.135 -64.597  1.00 1.78 ? 91  LYS B HE2  1 
ATOM   3258 H  HE3  . LYS B 1 91  ? -30.590 -27.081 -66.048  1.00 1.75 ? 91  LYS B HE3  1 
ATOM   3259 H  HZ1  . LYS B 1 91  ? -30.778 -24.584 -64.872  1.00 2.07 ? 91  LYS B HZ1  1 
ATOM   3260 H  HZ2  . LYS B 1 91  ? -29.959 -24.987 -66.295  1.00 2.27 ? 91  LYS B HZ2  1 
ATOM   3261 H  HZ3  . LYS B 1 91  ? -29.137 -24.993 -64.817  1.00 2.40 ? 91  LYS B HZ3  1 
ATOM   3262 N  N    . GLN B 1 92  ? -35.743 -29.893 -63.301  1.00 0.88 ? 92  GLN B N    1 
ATOM   3263 C  CA   . GLN B 1 92  ? -35.813 -31.294 -62.903  1.00 0.85 ? 92  GLN B CA   1 
ATOM   3264 C  C    . GLN B 1 92  ? -34.712 -32.105 -63.578  1.00 0.82 ? 92  GLN B C    1 
ATOM   3265 O  O    . GLN B 1 92  ? -34.168 -31.697 -64.605  1.00 0.84 ? 92  GLN B O    1 
ATOM   3266 C  CB   . GLN B 1 92  ? -37.182 -31.879 -63.255  1.00 0.95 ? 92  GLN B CB   1 
ATOM   3267 C  CG   . GLN B 1 92  ? -38.340 -31.160 -62.583  1.00 0.93 ? 92  GLN B CG   1 
ATOM   3268 C  CD   . GLN B 1 92  ? -38.624 -31.687 -61.190  1.00 1.62 ? 92  GLN B CD   1 
ATOM   3269 O  OE1  . GLN B 1 92  ? -37.904 -31.380 -60.239  1.00 2.23 ? 92  GLN B OE1  1 
ATOM   3270 N  NE2  . GLN B 1 92  ? -39.678 -32.485 -61.062  1.00 2.29 ? 92  GLN B NE2  1 
ATOM   3271 H  H    . GLN B 1 92  ? -36.561 -29.437 -63.592  1.00 0.95 ? 92  GLN B H    1 
ATOM   3272 H  HA   . GLN B 1 92  ? -35.674 -31.342 -61.833  1.00 0.83 ? 92  GLN B HA   1 
ATOM   3273 H  HB2  . GLN B 1 92  ? -37.321 -31.821 -64.324  1.00 1.09 ? 92  GLN B HB2  1 
ATOM   3274 H  HB3  . GLN B 1 92  ? -37.206 -32.915 -62.953  1.00 1.08 ? 92  GLN B HB3  1 
ATOM   3275 H  HG2  . GLN B 1 92  ? -38.103 -30.109 -62.512  1.00 1.07 ? 92  GLN B HG2  1 
ATOM   3276 H  HG3  . GLN B 1 92  ? -39.226 -31.288 -63.188  1.00 1.18 ? 92  GLN B HG3  1 
ATOM   3277 H  HE21 . GLN B 1 92  ? -40.206 -32.686 -61.863  1.00 2.58 ? 92  GLN B HE21 1 
ATOM   3278 H  HE22 . GLN B 1 92  ? -39.885 -32.840 -60.172  1.00 2.81 ? 92  GLN B HE22 1 
ATOM   3279 N  N    . PHE B 1 93  ? -34.387 -33.254 -62.994  1.00 0.82 ? 93  PHE B N    1 
ATOM   3280 C  CA   . PHE B 1 93  ? -33.350 -34.122 -63.540  1.00 0.82 ? 93  PHE B CA   1 
ATOM   3281 C  C    . PHE B 1 93  ? -33.543 -34.326 -65.039  1.00 0.76 ? 93  PHE B C    1 
ATOM   3282 O  O    . PHE B 1 93  ? -32.589 -34.248 -65.814  1.00 0.71 ? 93  PHE B O    1 
ATOM   3283 C  CB   . PHE B 1 93  ? -33.357 -35.474 -62.824  1.00 0.84 ? 93  PHE B CB   1 
ATOM   3284 C  CG   . PHE B 1 93  ? -32.097 -36.266 -63.026  1.00 0.94 ? 93  PHE B CG   1 
ATOM   3285 C  CD1  . PHE B 1 93  ? -31.821 -36.852 -64.251  1.00 0.99 ? 93  PHE B CD1  1 
ATOM   3286 C  CD2  . PHE B 1 93  ? -31.189 -36.424 -61.991  1.00 1.66 ? 93  PHE B CD2  1 
ATOM   3287 C  CE1  . PHE B 1 93  ? -30.662 -37.580 -64.440  1.00 1.00 ? 93  PHE B CE1  1 
ATOM   3288 C  CE2  . PHE B 1 93  ? -30.029 -37.152 -62.174  1.00 1.83 ? 93  PHE B CE2  1 
ATOM   3289 C  CZ   . PHE B 1 93  ? -29.765 -37.731 -63.400  1.00 1.23 ? 93  PHE B CZ   1 
ATOM   3290 H  H    . PHE B 1 93  ? -34.856 -33.524 -62.177  1.00 0.83 ? 93  PHE B H    1 
ATOM   3291 H  HA   . PHE B 1 93  ? -32.396 -33.642 -63.374  1.00 0.86 ? 93  PHE B HA   1 
ATOM   3292 H  HB2  . PHE B 1 93  ? -33.481 -35.311 -61.764  1.00 0.88 ? 93  PHE B HB2  1 
ATOM   3293 H  HB3  . PHE B 1 93  ? -34.184 -36.063 -63.192  1.00 0.81 ? 93  PHE B HB3  1 
ATOM   3294 H  HD1  . PHE B 1 93  ? -32.521 -36.734 -65.064  1.00 1.51 ? 93  PHE B HD1  1 
ATOM   3295 H  HD2  . PHE B 1 93  ? -31.395 -35.972 -61.032  1.00 2.24 ? 93  PHE B HD2  1 
ATOM   3296 H  HE1  . PHE B 1 93  ? -30.458 -38.032 -65.399  1.00 1.39 ? 93  PHE B HE1  1 
ATOM   3297 H  HE2  . PHE B 1 93  ? -29.329 -37.268 -61.360  1.00 2.55 ? 93  PHE B HE2  1 
ATOM   3298 H  HZ   . PHE B 1 93  ? -28.859 -38.300 -63.546  1.00 1.36 ? 93  PHE B HZ   1 
ATOM   3299 N  N    . GLU B 1 94  ? -34.783 -34.588 -65.441  1.00 0.81 ? 94  GLU B N    1 
ATOM   3300 C  CA   . GLU B 1 94  ? -35.102 -34.804 -66.848  1.00 0.79 ? 94  GLU B CA   1 
ATOM   3301 C  C    . GLU B 1 94  ? -35.472 -33.495 -67.545  1.00 0.88 ? 94  GLU B C    1 
ATOM   3302 O  O    . GLU B 1 94  ? -36.095 -33.506 -68.607  1.00 1.29 ? 94  GLU B O    1 
ATOM   3303 C  CB   . GLU B 1 94  ? -36.250 -35.806 -66.981  1.00 0.68 ? 94  GLU B CB   1 
ATOM   3304 C  CG   . GLU B 1 94  ? -35.859 -37.230 -66.620  1.00 0.77 ? 94  GLU B CG   1 
ATOM   3305 C  CD   . GLU B 1 94  ? -36.445 -37.677 -65.295  1.00 0.90 ? 94  GLU B CD   1 
ATOM   3306 O  OE1  . GLU B 1 94  ? -36.433 -36.873 -64.339  1.00 1.08 ? 94  GLU B OE1  1 
ATOM   3307 O  OE2  . GLU B 1 94  ? -36.915 -38.831 -65.212  1.00 1.83 ? 94  GLU B OE2  1 
ATOM   3308 H  H    . GLU B 1 94  ? -35.500 -34.637 -64.775  1.00 0.87 ? 94  GLU B H    1 
ATOM   3309 H  HA   . GLU B 1 94  ? -34.225 -35.214 -67.325  1.00 0.87 ? 94  GLU B HA   1 
ATOM   3310 H  HB2  . GLU B 1 94  ? -37.056 -35.501 -66.331  1.00 0.65 ? 94  GLU B HB2  1 
ATOM   3311 H  HB3  . GLU B 1 94  ? -36.601 -35.800 -68.002  1.00 0.75 ? 94  GLU B HB3  1 
ATOM   3312 H  HG2  . GLU B 1 94  ? -36.213 -37.894 -67.394  1.00 1.04 ? 94  GLU B HG2  1 
ATOM   3313 H  HG3  . GLU B 1 94  ? -34.783 -37.289 -66.560  1.00 1.07 ? 94  GLU B HG3  1 
ATOM   3314 N  N    . GLU B 1 95  ? -35.088 -32.369 -66.948  1.00 0.84 ? 95  GLU B N    1 
ATOM   3315 C  CA   . GLU B 1 95  ? -35.386 -31.062 -67.522  1.00 0.88 ? 95  GLU B CA   1 
ATOM   3316 C  C    . GLU B 1 95  ? -34.113 -30.379 -68.012  1.00 1.03 ? 95  GLU B C    1 
ATOM   3317 O  O    . GLU B 1 95  ? -34.069 -29.851 -69.123  1.00 1.32 ? 95  GLU B O    1 
ATOM   3318 C  CB   . GLU B 1 95  ? -36.090 -30.177 -66.492  1.00 0.86 ? 95  GLU B CB   1 
ATOM   3319 C  CG   . GLU B 1 95  ? -37.543 -29.888 -66.830  1.00 1.53 ? 95  GLU B CG   1 
ATOM   3320 C  CD   . GLU B 1 95  ? -37.970 -28.493 -66.417  1.00 1.84 ? 95  GLU B CD   1 
ATOM   3321 O  OE1  . GLU B 1 95  ? -37.986 -28.213 -65.200  1.00 2.59 ? 95  GLU B OE1  1 
ATOM   3322 O  OE2  . GLU B 1 95  ? -38.288 -27.681 -67.311  1.00 2.18 ? 95  GLU B OE2  1 
ATOM   3323 H  H    . GLU B 1 95  ? -34.594 -32.417 -66.104  1.00 1.04 ? 95  GLU B H    1 
ATOM   3324 H  HA   . GLU B 1 95  ? -36.045 -31.213 -68.364  1.00 0.90 ? 95  GLU B HA   1 
ATOM   3325 H  HB2  . GLU B 1 95  ? -36.056 -30.668 -65.531  1.00 0.88 ? 95  GLU B HB2  1 
ATOM   3326 H  HB3  . GLU B 1 95  ? -35.564 -29.236 -66.424  1.00 0.95 ? 95  GLU B HB3  1 
ATOM   3327 H  HG2  . GLU B 1 95  ? -37.678 -29.989 -67.896  1.00 2.10 ? 95  GLU B HG2  1 
ATOM   3328 H  HG3  . GLU B 1 95  ? -38.167 -30.606 -66.319  1.00 2.16 ? 95  GLU B HG3  1 
ATOM   3329 N  N    . LEU B 1 96  ? -33.081 -30.392 -67.176  1.00 1.16 ? 96  LEU B N    1 
ATOM   3330 C  CA   . LEU B 1 96  ? -31.808 -29.773 -67.528  1.00 1.32 ? 96  LEU B CA   1 
ATOM   3331 C  C    . LEU B 1 96  ? -31.164 -30.493 -68.709  1.00 1.17 ? 96  LEU B C    1 
ATOM   3332 O  O    . LEU B 1 96  ? -31.650 -31.533 -69.153  1.00 1.11 ? 96  LEU B O    1 
ATOM   3333 C  CB   . LEU B 1 96  ? -30.856 -29.776 -66.328  1.00 1.57 ? 96  LEU B CB   1 
ATOM   3334 C  CG   . LEU B 1 96  ? -30.846 -31.063 -65.498  1.00 1.08 ? 96  LEU B CG   1 
ATOM   3335 C  CD1  . LEU B 1 96  ? -30.629 -32.275 -66.390  1.00 1.49 ? 96  LEU B CD1  1 
ATOM   3336 C  CD2  . LEU B 1 96  ? -29.772 -30.990 -64.424  1.00 0.93 ? 96  LEU B CD2  1 
ATOM   3337 H  H    . LEU B 1 96  ? -33.177 -30.828 -66.304  1.00 1.35 ? 96  LEU B H    1 
ATOM   3338 H  HA   . LEU B 1 96  ? -32.007 -28.751 -67.814  1.00 1.46 ? 96  LEU B HA   1 
ATOM   3339 H  HB2  . LEU B 1 96  ? -29.854 -29.601 -66.692  1.00 1.98 ? 96  LEU B HB2  1 
ATOM   3340 H  HB3  . LEU B 1 96  ? -31.130 -28.959 -65.677  1.00 2.18 ? 96  LEU B HB3  1 
ATOM   3341 H  HG   . LEU B 1 96  ? -31.802 -31.175 -65.008  1.00 1.15 ? 96  LEU B HG   1 
ATOM   3342 H  HD11 . LEU B 1 96  ? -29.836 -32.068 -67.093  1.00 1.86 ? 96  LEU B HD11 1 
ATOM   3343 H  HD12 . LEU B 1 96  ? -31.539 -32.493 -66.929  1.00 2.15 ? 96  LEU B HD12 1 
ATOM   3344 H  HD13 . LEU B 1 96  ? -30.359 -33.126 -65.782  1.00 1.63 ? 96  LEU B HD13 1 
ATOM   3345 H  HD21 . LEU B 1 96  ? -29.750 -29.996 -64.003  1.00 1.26 ? 96  LEU B HD21 1 
ATOM   3346 H  HD22 . LEU B 1 96  ? -28.810 -31.218 -64.860  1.00 1.26 ? 96  LEU B HD22 1 
ATOM   3347 H  HD23 . LEU B 1 96  ? -29.992 -31.706 -63.646  1.00 1.55 ? 96  LEU B HD23 1 
ATOM   3348 N  N    . THR B 1 97  ? -30.071 -29.932 -69.216  1.00 1.18 ? 97  THR B N    1 
ATOM   3349 C  CA   . THR B 1 97  ? -29.367 -30.522 -70.348  1.00 1.10 ? 97  THR B CA   1 
ATOM   3350 C  C    . THR B 1 97  ? -28.172 -31.350 -69.888  1.00 1.03 ? 97  THR B C    1 
ATOM   3351 O  O    . THR B 1 97  ? -27.576 -31.076 -68.846  1.00 0.99 ? 97  THR B O    1 
ATOM   3352 C  CB   . THR B 1 97  ? -28.881 -29.442 -71.331  1.00 1.15 ? 97  THR B CB   1 
ATOM   3353 O  OG1  . THR B 1 97  ? -29.448 -28.172 -70.987  1.00 2.07 ? 97  THR B OG1  1 
ATOM   3354 C  CG2  . THR B 1 97  ? -29.261 -29.801 -72.760  1.00 1.10 ? 97  THR B CG2  1 
ATOM   3355 H  H    . THR B 1 97  ? -29.732 -29.102 -68.821  1.00 1.29 ? 97  THR B H    1 
ATOM   3356 H  HA   . THR B 1 97  ? -30.058 -31.167 -70.869  1.00 1.10 ? 97  THR B HA   1 
ATOM   3357 H  HB   . THR B 1 97  ? -27.805 -29.376 -71.267  1.00 1.34 ? 97  THR B HB   1 
ATOM   3358 H  HG1  . THR B 1 97  ? -30.355 -28.131 -71.300  1.00 2.43 ? 97  THR B HG1  1 
ATOM   3359 H  HG21 . THR B 1 97  ? -30.091 -30.493 -72.748  1.00 1.37 ? 97  THR B HG21 1 
ATOM   3360 H  HG22 . THR B 1 97  ? -28.416 -30.261 -73.252  1.00 1.39 ? 97  THR B HG22 1 
ATOM   3361 H  HG23 . THR B 1 97  ? -29.545 -28.906 -73.293  1.00 1.67 ? 97  THR B HG23 1 
ATOM   3362 N  N    . LEU B 1 98  ? -27.826 -32.364 -70.676  1.00 1.07 ? 98  LEU B N    1 
ATOM   3363 C  CA   . LEU B 1 98  ? -26.701 -33.236 -70.355  1.00 1.03 ? 98  LEU B CA   1 
ATOM   3364 C  C    . LEU B 1 98  ? -25.440 -32.420 -70.090  1.00 0.98 ? 98  LEU B C    1 
ATOM   3365 O  O    . LEU B 1 98  ? -24.735 -32.651 -69.107  1.00 1.02 ? 98  LEU B O    1 
ATOM   3366 C  CB   . LEU B 1 98  ? -26.452 -34.222 -71.498  1.00 1.05 ? 98  LEU B CB   1 
ATOM   3367 C  CG   . LEU B 1 98  ? -26.834 -35.673 -71.201  1.00 1.03 ? 98  LEU B CG   1 
ATOM   3368 C  CD1  . LEU B 1 98  ? -26.072 -36.189 -69.991  1.00 1.05 ? 98  LEU B CD1  1 
ATOM   3369 C  CD2  . LEU B 1 98  ? -28.334 -35.793 -70.979  1.00 1.06 ? 98  LEU B CD2  1 
ATOM   3370 H  H    . LEU B 1 98  ? -28.340 -32.530 -71.493  1.00 1.14 ? 98  LEU B H    1 
ATOM   3371 H  HA   . LEU B 1 98  ? -26.953 -33.788 -69.462  1.00 1.05 ? 98  LEU B HA   1 
ATOM   3372 H  HB2  . LEU B 1 98  ? -27.016 -33.892 -72.359  1.00 1.09 ? 98  LEU B HB2  1 
ATOM   3373 H  HB3  . LEU B 1 98  ? -25.401 -34.194 -71.746  1.00 1.06 ? 98  LEU B HB3  1 
ATOM   3374 H  HG   . LEU B 1 98  ? -26.570 -36.288 -72.048  1.00 1.00 ? 98  LEU B HG   1 
ATOM   3375 H  HD11 . LEU B 1 98  ? -26.426 -35.689 -69.102  1.00 1.46 ? 98  LEU B HD11 1 
ATOM   3376 H  HD12 . LEU B 1 98  ? -25.018 -35.991 -70.119  1.00 1.54 ? 98  LEU B HD12 1 
ATOM   3377 H  HD13 . LEU B 1 98  ? -26.230 -37.253 -69.893  1.00 1.35 ? 98  LEU B HD13 1 
ATOM   3378 H  HD21 . LEU B 1 98  ? -28.756 -34.811 -70.824  1.00 1.13 ? 98  LEU B HD21 1 
ATOM   3379 H  HD22 . LEU B 1 98  ? -28.522 -36.407 -70.110  1.00 1.11 ? 98  LEU B HD22 1 
ATOM   3380 H  HD23 . LEU B 1 98  ? -28.791 -36.248 -71.846  1.00 1.28 ? 98  LEU B HD23 1 
ATOM   3381 N  N    . GLY B 1 99  ? -25.163 -31.466 -70.972  1.00 0.90 ? 99  GLY B N    1 
ATOM   3382 C  CA   . GLY B 1 99  ? -23.987 -30.630 -70.817  1.00 0.85 ? 99  GLY B CA   1 
ATOM   3383 C  C    . GLY B 1 99  ? -23.849 -30.079 -69.411  1.00 0.93 ? 99  GLY B C    1 
ATOM   3384 O  O    . GLY B 1 99  ? -22.747 -30.017 -68.867  1.00 1.00 ? 99  GLY B O    1 
ATOM   3385 H  H    . GLY B 1 99  ? -25.761 -31.328 -71.736  1.00 0.88 ? 99  GLY B H    1 
ATOM   3386 H  HA2  . GLY B 1 99  ? -23.109 -31.215 -71.050  1.00 0.79 ? 99  GLY B HA2  1 
ATOM   3387 H  HA3  . GLY B 1 99  ? -24.051 -29.804 -71.510  1.00 0.82 ? 99  GLY B HA3  1 
ATOM   3388 N  N    . GLU B 1 100 ? -24.971 -29.680 -68.822  1.00 0.94 ? 100 GLU B N    1 
ATOM   3389 C  CA   . GLU B 1 100 ? -24.972 -29.133 -67.470  1.00 1.02 ? 100 GLU B CA   1 
ATOM   3390 C  C    . GLU B 1 100 ? -24.779 -30.238 -66.437  1.00 1.04 ? 100 GLU B C    1 
ATOM   3391 O  O    . GLU B 1 100 ? -24.202 -30.013 -65.373  1.00 1.11 ? 100 GLU B O    1 
ATOM   3392 C  CB   . GLU B 1 100 ? -26.280 -28.388 -67.200  1.00 1.08 ? 100 GLU B CB   1 
ATOM   3393 C  CG   . GLU B 1 100 ? -26.309 -27.679 -65.856  1.00 1.15 ? 100 GLU B CG   1 
ATOM   3394 C  CD   . GLU B 1 100 ? -26.474 -26.178 -65.993  1.00 1.67 ? 100 GLU B CD   1 
ATOM   3395 O  OE1  . GLU B 1 100 ? -27.314 -25.745 -66.810  1.00 2.17 ? 100 GLU B OE1  1 
ATOM   3396 O  OE2  . GLU B 1 100 ? -25.763 -25.435 -65.284  1.00 2.36 ? 100 GLU B OE2  1 
ATOM   3397 H  H    . GLU B 1 100 ? -25.819 -29.757 -69.307  1.00 0.90 ? 100 GLU B H    1 
ATOM   3398 H  HA   . GLU B 1 100 ? -24.150 -28.438 -67.394  1.00 1.03 ? 100 GLU B HA   1 
ATOM   3399 H  HB2  . GLU B 1 100 ? -26.429 -27.652 -67.975  1.00 1.49 ? 100 GLU B HB2  1 
ATOM   3400 H  HB3  . GLU B 1 100 ? -27.096 -29.096 -67.226  1.00 1.25 ? 100 GLU B HB3  1 
ATOM   3401 H  HG2  . GLU B 1 100 ? -27.135 -28.064 -65.277  1.00 1.78 ? 100 GLU B HG2  1 
ATOM   3402 H  HG3  . GLU B 1 100 ? -25.383 -27.878 -65.338  1.00 1.53 ? 100 GLU B HG3  1 
ATOM   3403 N  N    . PHE B 1 101 ? -25.266 -31.433 -66.758  1.00 0.99 ? 101 PHE B N    1 
ATOM   3404 C  CA   . PHE B 1 101 ? -25.146 -32.573 -65.856  1.00 1.02 ? 101 PHE B CA   1 
ATOM   3405 C  C    . PHE B 1 101 ? -23.685 -32.966 -65.667  1.00 0.99 ? 101 PHE B C    1 
ATOM   3406 O  O    . PHE B 1 101 ? -23.195 -33.048 -64.541  1.00 1.03 ? 101 PHE B O    1 
ATOM   3407 C  CB   . PHE B 1 101 ? -25.940 -33.764 -66.397  1.00 1.06 ? 101 PHE B CB   1 
ATOM   3408 C  CG   . PHE B 1 101 ? -25.784 -35.011 -65.574  1.00 1.01 ? 101 PHE B CG   1 
ATOM   3409 C  CD1  . PHE B 1 101 ? -25.926 -34.969 -64.196  1.00 1.39 ? 101 PHE B CD1  1 
ATOM   3410 C  CD2  . PHE B 1 101 ? -25.494 -36.224 -66.178  1.00 1.67 ? 101 PHE B CD2  1 
ATOM   3411 C  CE1  . PHE B 1 101 ? -25.781 -36.114 -63.436  1.00 1.37 ? 101 PHE B CE1  1 
ATOM   3412 C  CE2  . PHE B 1 101 ? -25.348 -37.372 -65.423  1.00 1.71 ? 101 PHE B CE2  1 
ATOM   3413 C  CZ   . PHE B 1 101 ? -25.492 -37.317 -64.050  1.00 1.04 ? 101 PHE B CZ   1 
ATOM   3414 H  H    . PHE B 1 101 ? -25.716 -31.551 -67.620  1.00 0.95 ? 101 PHE B H    1 
ATOM   3415 H  HA   . PHE B 1 101 ? -25.556 -32.284 -64.900  1.00 1.06 ? 101 PHE B HA   1 
ATOM   3416 H  HB2  . PHE B 1 101 ? -26.989 -33.509 -66.417  1.00 1.05 ? 101 PHE B HB2  1 
ATOM   3417 H  HB3  . PHE B 1 101 ? -25.609 -33.983 -67.401  1.00 1.19 ? 101 PHE B HB3  1 
ATOM   3418 H  HD1  . PHE B 1 101 ? -26.152 -34.030 -63.715  1.00 2.15 ? 101 PHE B HD1  1 
ATOM   3419 H  HD2  . PHE B 1 101 ? -25.381 -36.268 -67.251  1.00 2.47 ? 101 PHE B HD2  1 
ATOM   3420 H  HE1  . PHE B 1 101 ? -25.894 -36.069 -62.363  1.00 2.10 ? 101 PHE B HE1  1 
ATOM   3421 H  HE2  . PHE B 1 101 ? -25.122 -38.312 -65.906  1.00 2.53 ? 101 PHE B HE2  1 
ATOM   3422 H  HZ   . PHE B 1 101 ? -25.379 -38.213 -63.458  1.00 1.08 ? 101 PHE B HZ   1 
ATOM   3423 N  N    . LEU B 1 102 ? -22.994 -33.209 -66.776  1.00 0.96 ? 102 LEU B N    1 
ATOM   3424 C  CA   . LEU B 1 102 ? -21.588 -33.594 -66.731  1.00 0.96 ? 102 LEU B CA   1 
ATOM   3425 C  C    . LEU B 1 102 ? -20.741 -32.492 -66.102  1.00 0.87 ? 102 LEU B C    1 
ATOM   3426 O  O    . LEU B 1 102 ? -19.858 -32.762 -65.289  1.00 0.85 ? 102 LEU B O    1 
ATOM   3427 C  CB   . LEU B 1 102 ? -21.077 -33.907 -68.139  1.00 1.03 ? 102 LEU B CB   1 
ATOM   3428 C  CG   . LEU B 1 102 ? -21.312 -35.343 -68.608  1.00 0.94 ? 102 LEU B CG   1 
ATOM   3429 C  CD1  . LEU B 1 102 ? -20.442 -36.311 -67.822  1.00 1.41 ? 102 LEU B CD1  1 
ATOM   3430 C  CD2  . LEU B 1 102 ? -22.782 -35.714 -68.472  1.00 0.86 ? 102 LEU B CD2  1 
ATOM   3431 H  H    . LEU B 1 102 ? -23.439 -33.127 -67.645  1.00 0.95 ? 102 LEU B H    1 
ATOM   3432 H  HA   . LEU B 1 102 ? -21.507 -34.483 -66.123  1.00 1.01 ? 102 LEU B HA   1 
ATOM   3433 H  HB2  . LEU B 1 102 ? -21.566 -33.238 -68.833  1.00 1.17 ? 102 LEU B HB2  1 
ATOM   3434 H  HB3  . LEU B 1 102 ? -20.016 -33.713 -68.166  1.00 1.16 ? 102 LEU B HB3  1 
ATOM   3435 H  HG   . LEU B 1 102 ? -21.042 -35.423 -69.651  1.00 1.22 ? 102 LEU B HG   1 
ATOM   3436 H  HD11 . LEU B 1 102 ? -19.402 -36.127 -68.051  1.00 1.95 ? 102 LEU B HD11 1 
ATOM   3437 H  HD12 . LEU B 1 102 ? -20.696 -37.325 -68.092  1.00 1.87 ? 102 LEU B HD12 1 
ATOM   3438 H  HD13 . LEU B 1 102 ? -20.608 -36.168 -66.765  1.00 1.62 ? 102 LEU B HD13 1 
ATOM   3439 H  HD21 . LEU B 1 102 ? -22.991 -35.985 -67.447  1.00 1.07 ? 102 LEU B HD21 1 
ATOM   3440 H  HD22 . LEU B 1 102 ? -23.004 -36.550 -69.118  1.00 1.58 ? 102 LEU B HD22 1 
ATOM   3441 H  HD23 . LEU B 1 102 ? -23.394 -34.869 -68.753  1.00 1.38 ? 102 LEU B HD23 1 
ATOM   3442 N  N    . LYS B 1 103 ? -21.019 -31.249 -66.483  1.00 0.84 ? 103 LYS B N    1 
ATOM   3443 C  CA   . LYS B 1 103 ? -20.282 -30.107 -65.953  1.00 0.77 ? 103 LYS B CA   1 
ATOM   3444 C  C    . LYS B 1 103 ? -20.244 -30.147 -64.429  1.00 0.71 ? 103 LYS B C    1 
ATOM   3445 O  O    . LYS B 1 103 ? -19.292 -29.675 -63.809  1.00 0.70 ? 103 LYS B O    1 
ATOM   3446 C  CB   . LYS B 1 103 ? -20.919 -28.799 -66.425  1.00 0.78 ? 103 LYS B CB   1 
ATOM   3447 C  CG   . LYS B 1 103 ? -19.925 -27.821 -67.029  1.00 0.96 ? 103 LYS B CG   1 
ATOM   3448 C  CD   . LYS B 1 103 ? -20.540 -26.443 -67.213  1.00 1.26 ? 103 LYS B CD   1 
ATOM   3449 C  CE   . LYS B 1 103 ? -19.862 -25.407 -66.331  1.00 1.62 ? 103 LYS B CE   1 
ATOM   3450 N  NZ   . LYS B 1 103 ? -18.515 -25.037 -66.845  1.00 1.76 ? 103 LYS B NZ   1 
ATOM   3451 H  H    . LYS B 1 103 ? -21.735 -31.096 -67.133  1.00 0.88 ? 103 LYS B H    1 
ATOM   3452 H  HA   . LYS B 1 103 ? -19.272 -30.161 -66.328  1.00 0.80 ? 103 LYS B HA   1 
ATOM   3453 H  HB2  . LYS B 1 103 ? -21.667 -29.024 -67.171  1.00 1.00 ? 103 LYS B HB2  1 
ATOM   3454 H  HB3  . LYS B 1 103 ? -21.397 -28.320 -65.583  1.00 1.00 ? 103 LYS B HB3  1 
ATOM   3455 H  HG2  . LYS B 1 103 ? -19.072 -27.737 -66.371  1.00 1.47 ? 103 LYS B HG2  1 
ATOM   3456 H  HG3  . LYS B 1 103 ? -19.606 -28.195 -67.990  1.00 1.69 ? 103 LYS B HG3  1 
ATOM   3457 H  HD2  . LYS B 1 103 ? -20.433 -26.147 -68.246  1.00 1.89 ? 103 LYS B HD2  1 
ATOM   3458 H  HD3  . LYS B 1 103 ? -21.589 -26.491 -66.957  1.00 1.76 ? 103 LYS B HD3  1 
ATOM   3459 H  HE2  . LYS B 1 103 ? -20.480 -24.522 -66.297  1.00 2.37 ? 103 LYS B HE2  1 
ATOM   3460 H  HE3  . LYS B 1 103 ? -19.760 -25.813 -65.335  1.00 1.99 ? 103 LYS B HE3  1 
ATOM   3461 H  HZ1  . LYS B 1 103 ? -18.467 -25.199 -67.871  1.00 1.88 ? 103 LYS B HZ1  1 
ATOM   3462 H  HZ2  . LYS B 1 103 ? -17.784 -25.613 -66.380  1.00 2.04 ? 103 LYS B HZ2  1 
ATOM   3463 H  HZ3  . LYS B 1 103 ? -18.323 -24.033 -66.653  1.00 2.35 ? 103 LYS B HZ3  1 
ATOM   3464 N  N    . LEU B 1 104 ? -21.287 -30.715 -63.831  1.00 0.68 ? 104 LEU B N    1 
ATOM   3465 C  CA   . LEU B 1 104 ? -21.375 -30.818 -62.380  1.00 0.65 ? 104 LEU B CA   1 
ATOM   3466 C  C    . LEU B 1 104 ? -20.330 -31.789 -61.839  1.00 0.67 ? 104 LEU B C    1 
ATOM   3467 O  O    . LEU B 1 104 ? -19.668 -31.510 -60.840  1.00 0.64 ? 104 LEU B O    1 
ATOM   3468 C  CB   . LEU B 1 104 ? -22.775 -31.278 -61.965  1.00 0.71 ? 104 LEU B CB   1 
ATOM   3469 C  CG   . LEU B 1 104 ? -23.913 -30.328 -62.344  1.00 0.71 ? 104 LEU B CG   1 
ATOM   3470 C  CD1  . LEU B 1 104 ? -24.961 -30.285 -61.242  1.00 0.79 ? 104 LEU B CD1  1 
ATOM   3471 C  CD2  . LEU B 1 104 ? -23.377 -28.932 -62.625  1.00 0.68 ? 104 LEU B CD2  1 
ATOM   3472 H  H    . LEU B 1 104 ? -22.016 -31.073 -64.380  1.00 0.70 ? 104 LEU B H    1 
ATOM   3473 H  HA   . LEU B 1 104 ? -21.188 -29.840 -61.964  1.00 0.60 ? 104 LEU B HA   1 
ATOM   3474 H  HB2  . LEU B 1 104 ? -22.965 -32.236 -62.426  1.00 0.74 ? 104 LEU B HB2  1 
ATOM   3475 H  HB3  . LEU B 1 104 ? -22.786 -31.406 -60.893  1.00 0.73 ? 104 LEU B HB3  1 
ATOM   3476 H  HG   . LEU B 1 104 ? -24.390 -30.691 -63.242  1.00 0.75 ? 104 LEU B HG   1 
ATOM   3477 H  HD11 . LEU B 1 104 ? -24.662 -29.572 -60.489  1.00 1.02 ? 104 LEU B HD11 1 
ATOM   3478 H  HD12 . LEU B 1 104 ? -25.053 -31.264 -60.795  1.00 1.43 ? 104 LEU B HD12 1 
ATOM   3479 H  HD13 . LEU B 1 104 ? -25.912 -29.990 -61.661  1.00 1.35 ? 104 LEU B HD13 1 
ATOM   3480 H  HD21 . LEU B 1 104 ? -24.202 -28.245 -62.736  1.00 1.39 ? 104 LEU B HD21 1 
ATOM   3481 H  HD22 . LEU B 1 104 ? -22.795 -28.947 -63.534  1.00 1.02 ? 104 LEU B HD22 1 
ATOM   3482 H  HD23 . LEU B 1 104 ? -22.752 -28.615 -61.803  1.00 1.00 ? 104 LEU B HD23 1 
ATOM   3483 N  N    . ASP B 1 105 ? -20.188 -32.930 -62.506  1.00 0.76 ? 105 ASP B N    1 
ATOM   3484 C  CA   . ASP B 1 105 ? -19.224 -33.942 -62.092  1.00 0.82 ? 105 ASP B CA   1 
ATOM   3485 C  C    . ASP B 1 105 ? -17.860 -33.316 -61.822  1.00 0.77 ? 105 ASP B C    1 
ATOM   3486 O  O    . ASP B 1 105 ? -17.161 -33.705 -60.887  1.00 0.81 ? 105 ASP B O    1 
ATOM   3487 C  CB   . ASP B 1 105 ? -19.098 -35.026 -63.164  1.00 0.93 ? 105 ASP B CB   1 
ATOM   3488 C  CG   . ASP B 1 105 ? -20.022 -36.200 -62.911  1.00 1.37 ? 105 ASP B CG   1 
ATOM   3489 O  OD1  . ASP B 1 105 ? -19.628 -37.115 -62.157  1.00 1.71 ? 105 ASP B OD1  1 
ATOM   3490 O  OD2  . ASP B 1 105 ? -21.141 -36.205 -63.465  1.00 1.88 ? 105 ASP B OD2  1 
ATOM   3491 H  H    . ASP B 1 105 ? -20.746 -33.095 -63.295  1.00 0.81 ? 105 ASP B H    1 
ATOM   3492 H  HA   . ASP B 1 105 ? -19.587 -34.392 -61.180  1.00 0.84 ? 105 ASP B HA   1 
ATOM   3493 H  HB2  . ASP B 1 105 ? -19.341 -34.602 -64.127  1.00 0.96 ? 105 ASP B HB2  1 
ATOM   3494 H  HB3  . ASP B 1 105 ? -18.080 -35.389 -63.182  1.00 1.09 ? 105 ASP B HB3  1 
ATOM   3495 N  N    . ARG B 1 106 ? -17.487 -32.344 -62.648  1.00 0.71 ? 106 ARG B N    1 
ATOM   3496 C  CA   . ARG B 1 106 ? -16.206 -31.664 -62.498  1.00 0.67 ? 106 ARG B CA   1 
ATOM   3497 C  C    . ARG B 1 106 ? -16.165 -30.861 -61.202  1.00 0.59 ? 106 ARG B C    1 
ATOM   3498 O  O    . ARG B 1 106 ? -15.143 -30.822 -60.516  1.00 0.60 ? 106 ARG B O    1 
ATOM   3499 C  CB   . ARG B 1 106 ? -15.952 -30.741 -63.691  1.00 0.67 ? 106 ARG B CB   1 
ATOM   3500 C  CG   . ARG B 1 106 ? -14.799 -31.191 -64.574  1.00 1.37 ? 106 ARG B CG   1 
ATOM   3501 C  CD   . ARG B 1 106 ? -15.151 -32.451 -65.349  1.00 1.44 ? 106 ARG B CD   1 
ATOM   3502 N  NE   . ARG B 1 106 ? -13.967 -33.100 -65.905  1.00 2.29 ? 106 ARG B NE   1 
ATOM   3503 C  CZ   . ARG B 1 106 ? -13.330 -32.671 -66.991  1.00 2.90 ? 106 ARG B CZ   1 
ATOM   3504 N  NH1  . ARG B 1 106 ? -13.760 -31.595 -67.638  1.00 2.99 ? 106 ARG B NH1  1 
ATOM   3505 N  NH2  . ARG B 1 106 ? -12.260 -33.318 -67.433  1.00 3.90 ? 106 ARG B NH2  1 
ATOM   3506 H  H    . ARG B 1 106 ? -18.088 -32.078 -63.376  1.00 0.72 ? 106 ARG B H    1 
ATOM   3507 H  HA   . ARG B 1 106 ? -15.433 -32.417 -62.466  1.00 0.71 ? 106 ARG B HA   1 
ATOM   3508 H  HB2  . ARG B 1 106 ? -16.845 -30.699 -64.296  1.00 0.65 ? 106 ARG B HB2  1 
ATOM   3509 H  HB3  . ARG B 1 106 ? -15.730 -29.750 -63.324  1.00 0.87 ? 106 ARG B HB3  1 
ATOM   3510 H  HG2  . ARG B 1 106 ? -14.565 -30.404 -65.274  1.00 1.90 ? 106 ARG B HG2  1 
ATOM   3511 H  HG3  . ARG B 1 106 ? -13.939 -31.391 -63.951  1.00 1.97 ? 106 ARG B HG3  1 
ATOM   3512 H  HD2  . ARG B 1 106 ? -15.648 -33.141 -64.684  1.00 1.56 ? 106 ARG B HD2  1 
ATOM   3513 H  HD3  . ARG B 1 106 ? -15.818 -32.186 -66.156  1.00 1.73 ? 106 ARG B HD3  1 
ATOM   3514 H  HE   . ARG B 1 106 ? -13.629 -33.897 -65.446  1.00 2.81 ? 106 ARG B HE   1 
ATOM   3515 H  HH11 . ARG B 1 106 ? -14.566 -31.102 -67.310  1.00 2.66 ? 106 ARG B HH11 1 
ATOM   3516 H  HH12 . ARG B 1 106 ? -13.278 -31.276 -68.454  1.00 3.72 ? 106 ARG B HH12 1 
ATOM   3517 H  HH21 . ARG B 1 106 ? -11.932 -34.129 -66.949  1.00 4.28 ? 106 ARG B HH21 1 
ATOM   3518 H  HH22 . ARG B 1 106 ? -11.782 -32.996 -68.249  1.00 4.46 ? 106 ARG B HH22 1 
ATOM   3519 N  N    . GLU B 1 107 ? -17.283 -30.223 -60.871  1.00 0.54 ? 107 GLU B N    1 
ATOM   3520 C  CA   . GLU B 1 107 ? -17.376 -29.421 -59.656  1.00 0.49 ? 107 GLU B CA   1 
ATOM   3521 C  C    . GLU B 1 107 ? -17.224 -30.295 -58.415  1.00 0.47 ? 107 GLU B C    1 
ATOM   3522 O  O    . GLU B 1 107 ? -16.391 -30.022 -57.550  1.00 0.47 ? 107 GLU B O    1 
ATOM   3523 C  CB   . GLU B 1 107 ? -18.712 -28.679 -59.611  1.00 0.49 ? 107 GLU B CB   1 
ATOM   3524 C  CG   . GLU B 1 107 ? -18.987 -27.843 -60.850  1.00 0.57 ? 107 GLU B CG   1 
ATOM   3525 C  CD   . GLU B 1 107 ? -18.401 -26.449 -60.754  1.00 0.55 ? 107 GLU B CD   1 
ATOM   3526 O  OE1  . GLU B 1 107 ? -18.805 -25.696 -59.842  1.00 1.19 ? 107 GLU B OE1  1 
ATOM   3527 O  OE2  . GLU B 1 107 ? -17.539 -26.108 -61.590  1.00 1.30 ? 107 GLU B OE2  1 
ATOM   3528 H  H    . GLU B 1 107 ? -18.065 -30.293 -61.458  1.00 0.56 ? 107 GLU B H    1 
ATOM   3529 H  HA   . GLU B 1 107 ? -16.574 -28.699 -59.674  1.00 0.51 ? 107 GLU B HA   1 
ATOM   3530 H  HB2  . GLU B 1 107 ? -19.508 -29.402 -59.507  1.00 0.57 ? 107 GLU B HB2  1 
ATOM   3531 H  HB3  . GLU B 1 107 ? -18.718 -28.024 -58.752  1.00 0.50 ? 107 GLU B HB3  1 
ATOM   3532 H  HG2  . GLU B 1 107 ? -18.556 -28.340 -61.706  1.00 0.68 ? 107 GLU B HG2  1 
ATOM   3533 H  HG3  . GLU B 1 107 ? -20.056 -27.761 -60.982  1.00 0.75 ? 107 GLU B HG3  1 
ATOM   3534 N  N    . ARG B 1 108 ? -18.033 -31.346 -58.335  1.00 0.48 ? 108 ARG B N    1 
ATOM   3535 C  CA   . ARG B 1 108 ? -17.988 -32.260 -57.199  1.00 0.52 ? 108 ARG B CA   1 
ATOM   3536 C  C    . ARG B 1 108 ? -16.563 -32.735 -56.939  1.00 0.58 ? 108 ARG B C    1 
ATOM   3537 O  O    . ARG B 1 108 ? -16.018 -32.531 -55.854  1.00 0.60 ? 108 ARG B O    1 
ATOM   3538 C  CB   . ARG B 1 108 ? -18.899 -33.463 -57.449  1.00 0.59 ? 108 ARG B CB   1 
ATOM   3539 C  CG   . ARG B 1 108 ? -18.750 -34.566 -56.414  1.00 0.53 ? 108 ARG B CG   1 
ATOM   3540 C  CD   . ARG B 1 108 ? -19.859 -35.598 -56.536  1.00 0.89 ? 108 ARG B CD   1 
ATOM   3541 N  NE   . ARG B 1 108 ? -19.373 -36.954 -56.295  1.00 1.31 ? 108 ARG B NE   1 
ATOM   3542 C  CZ   . ARG B 1 108 ? -19.088 -37.433 -55.088  1.00 1.55 ? 108 ARG B CZ   1 
ATOM   3543 N  NH1  . ARG B 1 108 ? -19.239 -36.670 -54.013  1.00 1.99 ? 108 ARG B NH1  1 
ATOM   3544 N  NH2  . ARG B 1 108 ? -18.650 -38.677 -54.954  1.00 2.19 ? 108 ARG B NH2  1 
ATOM   3545 H  H    . ARG B 1 108 ? -18.675 -31.511 -59.056  1.00 0.49 ? 108 ARG B H    1 
ATOM   3546 H  HA   . ARG B 1 108 ? -18.342 -31.727 -56.330  1.00 0.51 ? 108 ARG B HA   1 
ATOM   3547 H  HB2  . ARG B 1 108 ? -19.926 -33.130 -57.443  1.00 0.72 ? 108 ARG B HB2  1 
ATOM   3548 H  HB3  . ARG B 1 108 ? -18.671 -33.877 -58.420  1.00 0.70 ? 108 ARG B HB3  1 
ATOM   3549 H  HG2  . ARG B 1 108 ? -17.799 -35.056 -56.558  1.00 0.75 ? 108 ARG B HG2  1 
ATOM   3550 H  HG3  . ARG B 1 108 ? -18.785 -34.127 -55.427  1.00 1.01 ? 108 ARG B HG3  1 
ATOM   3551 H  HD2  . ARG B 1 108 ? -20.628 -35.368 -55.814  1.00 1.53 ? 108 ARG B HD2  1 
ATOM   3552 H  HD3  . ARG B 1 108 ? -20.274 -35.545 -57.532  1.00 1.32 ? 108 ARG B HD3  1 
ATOM   3553 H  HE   . ARG B 1 108 ? -19.253 -37.537 -57.073  1.00 2.00 ? 108 ARG B HE   1 
ATOM   3554 H  HH11 . ARG B 1 108 ? -19.569 -35.731 -54.107  1.00 2.12 ? 108 ARG B HH11 1 
ATOM   3555 H  HH12 . ARG B 1 108 ? -19.023 -37.035 -53.107  1.00 2.60 ? 108 ARG B HH12 1 
ATOM   3556 H  HH21 . ARG B 1 108 ? -18.535 -39.256 -55.761  1.00 2.67 ? 108 ARG B HH21 1 
ATOM   3557 H  HH22 . ARG B 1 108 ? -18.436 -39.037 -54.046  1.00 2.51 ? 108 ARG B HH22 1 
ATOM   3558 N  N    . ALA B 1 109 ? -15.964 -33.369 -57.941  1.00 0.64 ? 109 ALA B N    1 
ATOM   3559 C  CA   . ALA B 1 109 ? -14.601 -33.873 -57.821  1.00 0.74 ? 109 ALA B CA   1 
ATOM   3560 C  C    . ALA B 1 109 ? -13.633 -32.755 -57.447  1.00 0.75 ? 109 ALA B C    1 
ATOM   3561 O  O    . ALA B 1 109 ? -12.651 -32.982 -56.741  1.00 0.84 ? 109 ALA B O    1 
ATOM   3562 C  CB   . ALA B 1 109 ? -14.169 -34.536 -59.119  1.00 0.79 ? 109 ALA B CB   1 
ATOM   3563 H  H    . ALA B 1 109 ? -16.451 -33.501 -58.782  1.00 0.64 ? 109 ALA B H    1 
ATOM   3564 H  HA   . ALA B 1 109 ? -14.590 -34.621 -57.041  1.00 0.78 ? 109 ALA B HA   1 
ATOM   3565 H  HB1  . ALA B 1 109 ? -14.454 -33.914 -59.954  1.00 1.34 ? 109 ALA B HB1  1 
ATOM   3566 H  HB2  . ALA B 1 109 ? -14.647 -35.500 -59.208  1.00 1.16 ? 109 ALA B HB2  1 
ATOM   3567 H  HB3  . ALA B 1 109 ? -13.096 -34.666 -59.118  1.00 1.28 ? 109 ALA B HB3  1 
ATOM   3568 N  N    . LYS B 1 110 ? -13.917 -31.549 -57.927  1.00 0.69 ? 110 LYS B N    1 
ATOM   3569 C  CA   . LYS B 1 110 ? -13.071 -30.395 -57.643  1.00 0.73 ? 110 LYS B CA   1 
ATOM   3570 C  C    . LYS B 1 110 ? -13.114 -30.038 -56.161  1.00 0.71 ? 110 LYS B C    1 
ATOM   3571 O  O    . LYS B 1 110 ? -12.077 -29.821 -55.534  1.00 0.82 ? 110 LYS B O    1 
ATOM   3572 C  CB   . LYS B 1 110 ? -13.514 -29.195 -58.482  1.00 0.69 ? 110 LYS B CB   1 
ATOM   3573 C  CG   . LYS B 1 110 ? -12.745 -29.047 -59.785  1.00 0.76 ? 110 LYS B CG   1 
ATOM   3574 C  CD   . LYS B 1 110 ? -13.044 -27.719 -60.460  1.00 1.02 ? 110 LYS B CD   1 
ATOM   3575 C  CE   . LYS B 1 110 ? -11.797 -26.856 -60.569  1.00 1.44 ? 110 LYS B CE   1 
ATOM   3576 N  NZ   . LYS B 1 110 ? -12.116 -25.472 -61.015  1.00 2.43 ? 110 LYS B NZ   1 
ATOM   3577 H  H    . LYS B 1 110 ? -14.714 -31.431 -58.484  1.00 0.64 ? 110 LYS B H    1 
ATOM   3578 H  HA   . LYS B 1 110 ? -12.058 -30.654 -57.910  1.00 0.81 ? 110 LYS B HA   1 
ATOM   3579 H  HB2  . LYS B 1 110 ? -14.562 -29.301 -58.717  1.00 0.63 ? 110 LYS B HB2  1 
ATOM   3580 H  HB3  . LYS B 1 110 ? -13.374 -28.294 -57.902  1.00 0.68 ? 110 LYS B HB3  1 
ATOM   3581 H  HG2  . LYS B 1 110 ? -11.687 -29.103 -59.576  1.00 0.99 ? 110 LYS B HG2  1 
ATOM   3582 H  HG3  . LYS B 1 110 ? -13.026 -29.851 -60.450  1.00 1.20 ? 110 LYS B HG3  1 
ATOM   3583 H  HD2  . LYS B 1 110 ? -13.426 -27.908 -61.452  1.00 1.44 ? 110 LYS B HD2  1 
ATOM   3584 H  HD3  . LYS B 1 110 ? -13.787 -27.191 -59.880  1.00 1.05 ? 110 LYS B HD3  1 
ATOM   3585 H  HE2  . LYS B 1 110 ? -11.320 -26.812 -59.602  1.00 1.66 ? 110 LYS B HE2  1 
ATOM   3586 H  HE3  . LYS B 1 110 ? -11.123 -27.309 -61.282  1.00 1.56 ? 110 LYS B HE3  1 
ATOM   3587 H  HZ1  . LYS B 1 110 ? -11.588 -24.782 -60.443  1.00 2.87 ? 110 LYS B HZ1  1 
ATOM   3588 H  HZ2  . LYS B 1 110 ? -13.134 -25.287 -60.908  1.00 2.99 ? 110 LYS B HZ2  1 
ATOM   3589 H  HZ3  . LYS B 1 110 ? -11.856 -25.349 -62.015  1.00 2.70 ? 110 LYS B HZ3  1 
ATOM   3590 N  N    . ASN B 1 111 ? -14.320 -29.979 -55.607  1.00 0.63 ? 111 ASN B N    1 
ATOM   3591 C  CA   . ASN B 1 111 ? -14.499 -29.648 -54.198  1.00 0.63 ? 111 ASN B CA   1 
ATOM   3592 C  C    . ASN B 1 111 ? -13.809 -30.675 -53.305  1.00 0.75 ? 111 ASN B C    1 
ATOM   3593 O  O    . ASN B 1 111 ? -13.234 -30.329 -52.274  1.00 0.85 ? 111 ASN B O    1 
ATOM   3594 C  CB   . ASN B 1 111 ? -15.987 -29.573 -53.854  1.00 0.54 ? 111 ASN B CB   1 
ATOM   3595 C  CG   . ASN B 1 111 ? -16.612 -28.256 -54.271  1.00 0.49 ? 111 ASN B CG   1 
ATOM   3596 O  OD1  . ASN B 1 111 ? -17.246 -28.162 -55.322  1.00 1.04 ? 111 ASN B OD1  1 
ATOM   3597 N  ND2  . ASN B 1 111 ? -16.434 -27.230 -53.447  1.00 1.12 ? 111 ASN B ND2  1 
ATOM   3598 H  H    . ASN B 1 111 ? -15.109 -30.162 -56.158  1.00 0.60 ? 111 ASN B H    1 
ATOM   3599 H  HA   . ASN B 1 111 ? -14.050 -28.681 -54.026  1.00 0.66 ? 111 ASN B HA   1 
ATOM   3600 H  HB2  . ASN B 1 111 ? -16.508 -30.373 -54.360  1.00 0.67 ? 111 ASN B HB2  1 
ATOM   3601 H  HB3  . ASN B 1 111 ? -16.110 -29.688 -52.787  1.00 0.66 ? 111 ASN B HB3  1 
ATOM   3602 H  HD21 . ASN B 1 111 ? -15.917 -27.378 -52.628  1.00 1.69 ? 111 ASN B HD21 1 
ATOM   3603 H  HD22 . ASN B 1 111 ? -16.827 -26.366 -53.692  1.00 1.26 ? 111 ASN B HD22 1 
ATOM   3604 N  N    . LYS B 1 112 ? -13.872 -31.939 -53.709  1.00 0.78 ? 112 LYS B N    1 
ATOM   3605 C  CA   . LYS B 1 112 ? -13.254 -33.017 -52.946  1.00 0.95 ? 112 LYS B CA   1 
ATOM   3606 C  C    . LYS B 1 112 ? -11.758 -32.775 -52.775  1.00 1.08 ? 112 LYS B C    1 
ATOM   3607 O  O    . LYS B 1 112 ? -11.209 -32.960 -51.689  1.00 1.20 ? 112 LYS B O    1 
ATOM   3608 C  CB   . LYS B 1 112 ? -13.490 -34.361 -53.638  1.00 1.02 ? 112 LYS B CB   1 
ATOM   3609 C  CG   . LYS B 1 112 ? -13.140 -35.560 -52.773  1.00 1.42 ? 112 LYS B CG   1 
ATOM   3610 C  CD   . LYS B 1 112 ? -14.364 -36.107 -52.057  1.00 0.75 ? 112 LYS B CD   1 
ATOM   3611 C  CE   . LYS B 1 112 ? -14.220 -36.002 -50.548  1.00 1.33 ? 112 LYS B CE   1 
ATOM   3612 N  NZ   . LYS B 1 112 ? -13.742 -37.277 -49.945  1.00 1.81 ? 112 LYS B NZ   1 
ATOM   3613 H  H    . LYS B 1 112 ? -14.346 -32.153 -54.540  1.00 0.72 ? 112 LYS B H    1 
ATOM   3614 H  HA   . LYS B 1 112 ? -13.716 -33.039 -51.970  1.00 0.96 ? 112 LYS B HA   1 
ATOM   3615 H  HB2  . LYS B 1 112 ? -14.532 -34.433 -53.911  1.00 0.79 ? 112 LYS B HB2  1 
ATOM   3616 H  HB3  . LYS B 1 112 ? -12.888 -34.402 -54.533  1.00 1.18 ? 112 LYS B HB3  1 
ATOM   3617 H  HG2  . LYS B 1 112 ? -12.725 -36.335 -53.399  1.00 2.13 ? 112 LYS B HG2  1 
ATOM   3618 H  HG3  . LYS B 1 112 ? -12.408 -35.259 -52.037  1.00 2.08 ? 112 LYS B HG3  1 
ATOM   3619 H  HD2  . LYS B 1 112 ? -15.232 -35.543 -52.366  1.00 1.15 ? 112 LYS B HD2  1 
ATOM   3620 H  HD3  . LYS B 1 112 ? -14.492 -37.145 -52.327  1.00 1.22 ? 112 LYS B HD3  1 
ATOM   3621 H  HE2  . LYS B 1 112 ? -13.512 -35.220 -50.320  1.00 1.86 ? 112 LYS B HE2  1 
ATOM   3622 H  HE3  . LYS B 1 112 ? -15.182 -35.751 -50.124  1.00 1.29 ? 112 LYS B HE3  1 
ATOM   3623 H  HZ1  . LYS B 1 112 ? -13.070 -37.079 -49.176  1.00 2.30 ? 112 LYS B HZ1  1 
ATOM   3624 H  HZ2  . LYS B 1 112 ? -13.266 -37.857 -50.665  1.00 1.95 ? 112 LYS B HZ2  1 
ATOM   3625 H  HZ3  . LYS B 1 112 ? -14.546 -37.814 -49.560  1.00 2.20 ? 112 LYS B HZ3  1 
ATOM   3626 N  N    . ILE B 1 113 ? -11.104 -32.360 -53.855  1.00 1.08 ? 113 ILE B N    1 
ATOM   3627 C  CA   . ILE B 1 113 ? -9.671  -32.093 -53.825  1.00 1.25 ? 113 ILE B CA   1 
ATOM   3628 C  C    . ILE B 1 113 ? -9.353  -30.904 -52.924  1.00 1.28 ? 113 ILE B C    1 
ATOM   3629 O  O    . ILE B 1 113 ? -8.357  -30.909 -52.202  1.00 1.46 ? 113 ILE B O    1 
ATOM   3630 C  CB   . ILE B 1 113 ? -9.120  -31.815 -55.236  1.00 1.24 ? 113 ILE B CB   1 
ATOM   3631 C  CG1  . ILE B 1 113 ? -8.906  -33.127 -55.992  1.00 1.32 ? 113 ILE B CG1  1 
ATOM   3632 C  CG2  . ILE B 1 113 ? -7.822  -31.026 -55.152  1.00 1.38 ? 113 ILE B CG2  1 
ATOM   3633 C  CD1  . ILE B 1 113 ? -9.284  -33.050 -57.455  1.00 1.08 ? 113 ILE B CD1  1 
ATOM   3634 H  H    . ILE B 1 113 ? -11.596 -32.231 -54.693  1.00 1.00 ? 113 ILE B H    1 
ATOM   3635 H  HA   . ILE B 1 113 ? -9.176  -32.971 -53.434  1.00 1.40 ? 113 ILE B HA   1 
ATOM   3636 H  HB   . ILE B 1 113 ? -9.843  -31.215 -55.769  1.00 1.10 ? 113 ILE B HB   1 
ATOM   3637 H  HG12 . ILE B 1 113 ? -7.863  -33.403 -55.934  1.00 1.67 ? 113 ILE B HG12 1 
ATOM   3638 H  HG13 . ILE B 1 113 ? -9.504  -33.901 -55.534  1.00 1.37 ? 113 ILE B HG13 1 
ATOM   3639 H  HG21 . ILE B 1 113 ? -7.208  -31.427 -54.359  1.00 1.09 ? 113 ILE B HG21 1 
ATOM   3640 H  HG22 . ILE B 1 113 ? -8.043  -29.989 -54.948  1.00 1.64 ? 113 ILE B HG22 1 
ATOM   3641 H  HG23 . ILE B 1 113 ? -7.292  -31.104 -56.091  1.00 2.28 ? 113 ILE B HG23 1 
ATOM   3642 H  HD11 . ILE B 1 113 ? -9.025  -33.979 -57.943  1.00 1.42 ? 113 ILE B HD11 1 
ATOM   3643 H  HD12 . ILE B 1 113 ? -8.749  -32.237 -57.923  1.00 1.31 ? 113 ILE B HD12 1 
ATOM   3644 H  HD13 . ILE B 1 113 ? -10.346 -32.881 -57.544  1.00 1.21 ? 113 ILE B HD13 1 
ATOM   3645 N  N    . ALA B 1 114 ? -10.206 -29.887 -52.973  1.00 1.13 ? 114 ALA B N    1 
ATOM   3646 C  CA   . ALA B 1 114 ? -10.016 -28.691 -52.162  1.00 1.18 ? 114 ALA B CA   1 
ATOM   3647 C  C    . ALA B 1 114 ? -9.858  -29.047 -50.688  1.00 1.31 ? 114 ALA B C    1 
ATOM   3648 O  O    . ALA B 1 114 ? -9.040  -28.458 -49.981  1.00 1.46 ? 114 ALA B O    1 
ATOM   3649 C  CB   . ALA B 1 114 ? -11.183 -27.734 -52.353  1.00 1.03 ? 114 ALA B CB   1 
ATOM   3650 H  H    . ALA B 1 114 ? -10.982 -29.942 -53.569  1.00 0.99 ? 114 ALA B H    1 
ATOM   3651 H  HA   . ALA B 1 114 ? -9.117  -28.197 -52.502  1.00 1.28 ? 114 ALA B HA   1 
ATOM   3652 H  HB1  . ALA B 1 114 ? -11.080 -26.900 -51.674  1.00 1.17 ? 114 ALA B HB1  1 
ATOM   3653 H  HB2  . ALA B 1 114 ? -12.110 -28.251 -52.151  1.00 1.24 ? 114 ALA B HB2  1 
ATOM   3654 H  HB3  . ALA B 1 114 ? -11.188 -27.370 -53.370  1.00 1.34 ? 114 ALA B HB3  1 
ATOM   3655 N  N    . LYS B 1 115 ? -10.645 -30.015 -50.230  1.00 1.29 ? 115 LYS B N    1 
ATOM   3656 C  CA   . LYS B 1 115 ? -10.592 -30.450 -48.840  1.00 1.43 ? 115 LYS B CA   1 
ATOM   3657 C  C    . LYS B 1 115 ? -9.174  -30.855 -48.450  1.00 1.72 ? 115 LYS B C    1 
ATOM   3658 O  O    . LYS B 1 115 ? -8.658  -30.430 -47.416  1.00 1.87 ? 115 LYS B O    1 
ATOM   3659 C  CB   . LYS B 1 115 ? -11.549 -31.622 -48.613  1.00 1.44 ? 115 LYS B CB   1 
ATOM   3660 C  CG   . LYS B 1 115 ? -12.903 -31.203 -48.064  1.00 1.37 ? 115 LYS B CG   1 
ATOM   3661 C  CD   . LYS B 1 115 ? -13.383 -32.156 -46.981  1.00 1.67 ? 115 LYS B CD   1 
ATOM   3662 C  CE   . LYS B 1 115 ? -14.884 -32.379 -47.061  1.00 1.24 ? 115 LYS B CE   1 
ATOM   3663 N  NZ   . LYS B 1 115 ? -15.271 -33.734 -46.579  1.00 1.63 ? 115 LYS B NZ   1 
ATOM   3664 H  H    . LYS B 1 115 ? -11.277 -30.447 -50.843  1.00 1.19 ? 115 LYS B H    1 
ATOM   3665 H  HA   . LYS B 1 115 ? -10.899 -29.621 -48.221  1.00 1.39 ? 115 LYS B HA   1 
ATOM   3666 H  HB2  . LYS B 1 115 ? -11.707 -32.129 -49.553  1.00 1.47 ? 115 LYS B HB2  1 
ATOM   3667 H  HB3  . LYS B 1 115 ? -11.098 -32.310 -47.914  1.00 1.59 ? 115 LYS B HB3  1 
ATOM   3668 H  HG2  . LYS B 1 115 ? -12.820 -30.211 -47.646  1.00 1.22 ? 115 LYS B HG2  1 
ATOM   3669 H  HG3  . LYS B 1 115 ? -13.622 -31.197 -48.870  1.00 1.63 ? 115 LYS B HG3  1 
ATOM   3670 H  HD2  . LYS B 1 115 ? -12.882 -33.104 -47.101  1.00 2.25 ? 115 LYS B HD2  1 
ATOM   3671 H  HD3  . LYS B 1 115 ? -13.141 -31.738 -46.014  1.00 2.17 ? 115 LYS B HD3  1 
ATOM   3672 H  HE2  . LYS B 1 115 ? -15.379 -31.636 -46.453  1.00 1.79 ? 115 LYS B HE2  1 
ATOM   3673 H  HE3  . LYS B 1 115 ? -15.198 -32.268 -48.088  1.00 1.29 ? 115 LYS B HE3  1 
ATOM   3674 H  HZ1  . LYS B 1 115 ? -14.903 -34.461 -47.224  1.00 2.00 ? 115 LYS B HZ1  1 
ATOM   3675 H  HZ2  . LYS B 1 115 ? -16.307 -33.816 -46.536  1.00 1.81 ? 115 LYS B HZ2  1 
ATOM   3676 H  HZ3  . LYS B 1 115 ? -14.882 -33.899 -45.628  1.00 2.17 ? 115 LYS B HZ3  1 
ATOM   3677 N  N    . GLU B 1 116 ? -8.548  -31.678 -49.285  1.00 1.82 ? 116 GLU B N    1 
ATOM   3678 C  CA   . GLU B 1 116 ? -7.189  -32.141 -49.028  1.00 2.11 ? 116 GLU B CA   1 
ATOM   3679 C  C    . GLU B 1 116 ? -6.196  -30.987 -49.117  1.00 2.28 ? 116 GLU B C    1 
ATOM   3680 O  O    . GLU B 1 116 ? -5.628  -30.565 -48.110  1.00 2.53 ? 116 GLU B O    1 
ATOM   3681 C  CB   . GLU B 1 116 ? -6.805  -33.237 -50.023  1.00 2.24 ? 116 GLU B CB   1 
ATOM   3682 C  CG   . GLU B 1 116 ? -7.101  -34.642 -49.525  1.00 2.58 ? 116 GLU B CG   1 
ATOM   3683 C  CD   . GLU B 1 116 ? -6.868  -35.699 -50.587  1.00 3.06 ? 116 GLU B CD   1 
ATOM   3684 O  OE1  . GLU B 1 116 ? -7.656  -35.752 -51.554  1.00 3.53 ? 116 GLU B OE1  1 
ATOM   3685 O  OE2  . GLU B 1 116 ? -5.896  -36.472 -50.451  1.00 3.49 ? 116 GLU B OE2  1 
ATOM   3686 H  H    . GLU B 1 116 ? -9.012  -31.982 -50.094  1.00 1.71 ? 116 GLU B H    1 
ATOM   3687 H  HA   . GLU B 1 116 ? -7.161  -32.548 -48.029  1.00 2.21 ? 116 GLU B HA   1 
ATOM   3688 H  HB2  . GLU B 1 116 ? -7.352  -33.082 -50.942  1.00 2.14 ? 116 GLU B HB2  1 
ATOM   3689 H  HB3  . GLU B 1 116 ? -5.747  -33.166 -50.228  1.00 2.61 ? 116 GLU B HB3  1 
ATOM   3690 H  HG2  . GLU B 1 116 ? -6.460  -34.854 -48.682  1.00 2.65 ? 116 GLU B HG2  1 
ATOM   3691 H  HG3  . GLU B 1 116 ? -8.133  -34.689 -49.211  1.00 3.09 ? 116 GLU B HG3  1 
ATOM   3692 N  N    . THR B 1 117 ? -5.992  -30.480 -50.328  1.00 2.46 ? 117 THR B N    1 
ATOM   3693 C  CA   . THR B 1 117 ? -5.067  -29.374 -50.548  1.00 2.77 ? 117 THR B CA   1 
ATOM   3694 C  C    . THR B 1 117 ? -5.702  -28.042 -50.165  1.00 3.25 ? 117 THR B C    1 
ATOM   3695 O  O    . THR B 1 117 ? -6.575  -27.565 -50.920  1.00 3.80 ? 117 THR B O    1 
ATOM   3696 C  CB   . THR B 1 117 ? -4.611  -29.308 -52.017  1.00 3.18 ? 117 THR B CB   1 
ATOM   3697 O  OG1  . THR B 1 117 ? -5.432  -30.159 -52.826  1.00 3.96 ? 117 THR B OG1  1 
ATOM   3698 C  CG2  . THR B 1 117 ? -3.154  -29.726 -52.151  1.00 3.57 ? 117 THR B CG2  1 
ATOM   3699 O  OXT  . THR B 1 117 ? -5.322  -27.487 -49.113  1.00 3.56 ? 117 THR B OXT  1 
ATOM   3700 H  H    . THR B 1 117 ? -6.475  -30.858 -51.093  1.00 2.58 ? 117 THR B H    1 
ATOM   3701 H  HA   . THR B 1 117 ? -4.197  -29.539 -49.930  1.00 2.79 ? 117 THR B HA   1 
ATOM   3702 H  HB   . THR B 1 117 ? -4.710  -28.289 -52.364  1.00 3.25 ? 117 THR B HB   1 
ATOM   3703 H  HG1  . THR B 1 117 ? -5.037  -30.252 -53.696  1.00 4.45 ? 117 THR B HG1  1 
ATOM   3704 H  HG21 . THR B 1 117 ? -2.555  -29.174 -51.441  1.00 3.65 ? 117 THR B HG21 1 
ATOM   3705 H  HG22 . THR B 1 117 ? -2.809  -29.517 -53.153  1.00 3.85 ? 117 THR B HG22 1 
ATOM   3706 H  HG23 . THR B 1 117 ? -3.063  -30.783 -51.952  1.00 4.03 ? 117 THR B HG23 1 
HETATM 3707 ZN ZN   . ZN  C 2 .   ? -30.512 -49.087 -84.921  1.00 0.72 ? 999 ZN  A ZN   1 
HETATM 3708 ZN ZN   . ZN  D 2 .   ? -23.655 -27.400 -51.017  1.00 0.72 ? 998 ZN  B ZN   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  TRP 10  10  10  TRP TRP A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  ASP 16  16  16  ASP ASP A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TRP 25  25  25  TRP TRP A . n 
A 1 26  PRO 26  26  26  PRO PRO A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  CYS 33  33  33  CYS CYS A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  CYS 57  57  57  CYS CYS A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  CYS 60  60  60  CYS CYS A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TRP 67  67  67  TRP TRP A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  HIS 77  77  77  HIS HIS A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  HIS 80  80  80  HIS HIS A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 THR 117 117 117 THR THR A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   ALA 3   3   3   ALA ALA B . n 
B 1 4   PRO 4   4   4   PRO PRO B . n 
B 1 5   THR 5   5   5   THR THR B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   ALA 9   9   9   ALA ALA B . n 
B 1 10  TRP 10  10  10  TRP TRP B . n 
B 1 11  GLN 11  11  11  GLN GLN B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  PHE 13  13  13  PHE PHE B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  LYS 15  15  15  LYS LYS B . n 
B 1 16  ASP 16  16  16  ASP ASP B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  THR 21  21  21  THR THR B . n 
B 1 22  PHE 22  22  22  PHE PHE B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ASN 24  24  24  ASN ASN B . n 
B 1 25  TRP 25  25  25  TRP TRP B . n 
B 1 26  PRO 26  26  26  PRO PRO B . n 
B 1 27  PHE 27  27  27  PHE PHE B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  GLY 30  30  30  GLY GLY B . n 
B 1 31  CYS 31  31  31  CYS CYS B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  CYS 33  33  33  CYS CYS B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  ARG 37  37  37  ARG ARG B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  HIS 45  45  45  HIS HIS B . n 
B 1 46  CYS 46  46  46  CYS CYS B . n 
B 1 47  PRO 47  47  47  PRO PRO B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  GLN 56  56  56  GLN GLN B . n 
B 1 57  CYS 57  57  57  CYS CYS B . n 
B 1 58  PHE 58  58  58  PHE PHE B . n 
B 1 59  PHE 59  59  59  PHE PHE B . n 
B 1 60  CYS 60  60  60  CYS CYS B . n 
B 1 61  PHE 61  61  61  PHE PHE B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  GLU 63  63  63  GLU GLU B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  TRP 67  67  67  TRP TRP B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  ASP 70  70  70  ASP ASP B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  PRO 73  73  73  PRO PRO B . n 
B 1 74  ILE 74  74  74  ILE ILE B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  HIS 77  77  77  HIS HIS B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  HIS 80  80  80  HIS HIS B . n 
B 1 81  SER 81  81  81  SER SER B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  CYS 84  84  84  CYS CYS B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  PHE 86  86  86  PHE PHE B . n 
B 1 87  LEU 87  87  87  LEU LEU B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  GLN 92  92  92  GLN GLN B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 GLU 107 107 107 GLU GLU B . n 
B 1 108 ARG 108 108 108 ARG ARG B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 THR 117 117 117 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN 1 999 999 ZN ZN A . 
D 2 ZN 1 998 998 ZN ZN B . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG  ? A CYS 84 ? A CYS 84 ? 1_555 110.0 ? 
2  SG  ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 ND1 ? A HIS 77 ? A HIS 77 ? 1_555 108.5 ? 
3  SG  ? A CYS 84 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 ND1 ? A HIS 77 ? A HIS 77 ? 1_555 109.6 ? 
4  SG  ? A CYS 57 ? A CYS 57 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG  ? A CYS 60 ? A CYS 60 ? 1_555 108.5 ? 
5  SG  ? A CYS 84 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG  ? A CYS 60 ? A CYS 60 ? 1_555 109.6 ? 
6  ND1 ? A HIS 77 ? A HIS 77 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG  ? A CYS 60 ? A CYS 60 ? 1_555 110.6 ? 
7  SG  ? B CYS 84 ? B CYS 84 ? 1_555 ZN ? D ZN . ? B ZN 998 ? 1_555 ND1 ? B HIS 77 ? B HIS 77 ? 1_555 109.6 ? 
8  SG  ? B CYS 84 ? B CYS 84 ? 1_555 ZN ? D ZN . ? B ZN 998 ? 1_555 SG  ? B CYS 60 ? B CYS 60 ? 1_555 109.6 ? 
9  ND1 ? B HIS 77 ? B HIS 77 ? 1_555 ZN ? D ZN . ? B ZN 998 ? 1_555 SG  ? B CYS 60 ? B CYS 60 ? 1_555 110.6 ? 
10 SG  ? B CYS 84 ? B CYS 84 ? 1_555 ZN ? D ZN . ? B ZN 998 ? 1_555 SG  ? B CYS 57 ? B CYS 57 ? 1_555 110.0 ? 
11 ND1 ? B HIS 77 ? B HIS 77 ? 1_555 ZN ? D ZN . ? B ZN 998 ? 1_555 SG  ? B CYS 57 ? B CYS 57 ? 1_555 108.5 ? 
12 SG  ? B CYS 60 ? B CYS 60 ? 1_555 ZN ? D ZN . ? B ZN 998 ? 1_555 SG  ? B CYS 57 ? B CYS 57 ? 1_555 108.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-01-18 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 4  ? ? -51.11  177.26 
2  1 ALA A 9  ? ? -44.22  -81.52 
3  1 TRP A 10 ? ? -107.84 60.23  
4  1 ASN A 24 ? ? -122.53 -73.98 
5  1 TRP A 25 ? ? 56.17   101.85 
6  1 PHE A 27 ? ? -68.28  83.47  
7  1 LEU A 28 ? ? -115.53 -79.01 
8  1 CYS A 46 ? ? -162.59 60.46  
9  1 ASP A 53 ? ? -92.32  47.51  
10 1 CYS A 60 ? ? -179.28 -39.08 
11 1 PHE A 61 ? ? 70.66   116.60 
12 1 LYS A 62 ? ? -174.50 97.81  
13 1 PRO A 69 ? ? -68.75  55.81  
14 1 ASP A 70 ? ? 168.69  41.78  
15 1 SER A 81 ? ? -177.16 144.06 
16 1 SER A 82 ? ? -96.75  37.92  
17 1 GLN A 92 ? ? -48.06  158.80 
18 1 PRO B 4  ? ? -51.11  177.28 
19 1 ALA B 9  ? ? -44.29  -81.48 
20 1 TRP B 10 ? ? -107.83 60.15  
21 1 ASN B 24 ? ? -122.51 -73.98 
22 1 TRP B 25 ? ? 56.19   101.84 
23 1 PHE B 27 ? ? -68.33  83.52  
24 1 LEU B 28 ? ? -115.56 -79.00 
25 1 CYS B 46 ? ? -162.62 60.42  
26 1 ASP B 53 ? ? -92.26  47.44  
27 1 CYS B 60 ? ? -179.30 -39.12 
28 1 PHE B 61 ? ? 70.69   116.56 
29 1 LYS B 62 ? ? -174.45 97.69  
30 1 PRO B 69 ? ? -68.75  55.83  
31 1 ASP B 70 ? ? 168.73  41.79  
32 1 SER B 81 ? ? -177.20 144.00 
33 1 SER B 82 ? ? -96.73  37.97  
34 1 GLN B 92 ? ? -48.12  158.78 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#