data_1XRE
# 
_entry.id   1XRE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XRE         
RCSB  RCSB030677   
WWPDB D_1000030677 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XRE 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Boucher, I.W.'   1 
'Levdikov, V.M.'  2 
'Blagova, E.V.'   3 
'Fogg, M.J.'      4 
'Brannigan, J.A.' 5 
'Wilkinson, A.J.' 6 
'Wilson, K.S.'    7 
# 
_citation.id                        primary 
_citation.title                     'Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            61 
_citation.page_first                621 
_citation.page_last                 624 
_citation.year                      2005 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16511113 
_citation.pdbx_database_id_DOI      10.1107/S1744309105017380 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Boucher, I.W.'   1 
primary 'Kalliomaa, A.K.' 2 
primary 'Levdikov, V.M.'  3 
primary 'Blagova, E.V.'   4 
primary 'Fogg, M.J.'      5 
primary 'Brannigan, J.A.' 6 
primary 'Wilson, K.S.'    7 
primary 'Wilkinson, A.J.' 8 
# 
_cell.entry_id           1XRE 
_cell.length_a           54.842 
_cell.length_b           69.866 
_cell.length_c           56.574 
_cell.angle_alpha        90.00 
_cell.angle_beta         106.85 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XRE 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase' 25109.844 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'   54.938    2   ?        ? ? ? 
3 water       nat water                  18.015    374 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        sodA-2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHMSSFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETLPKEIVT
AVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGEELSVMSTPNQD
TPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRVNEKYLQAIQSQKH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHMSSFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETLPKEIVT
AVRNNGGGHYCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGEELSVMSTPNQD
TPLQEGKIPLLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRVNEKYLQAIQSQKH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  MET n 
1 11  SER n 
1 12  SER n 
1 13  PHE n 
1 14  GLN n 
1 15  LEU n 
1 16  PRO n 
1 17  LYS n 
1 18  LEU n 
1 19  SER n 
1 20  TYR n 
1 21  ASP n 
1 22  TYR n 
1 23  ASP n 
1 24  GLU n 
1 25  LEU n 
1 26  GLU n 
1 27  PRO n 
1 28  TYR n 
1 29  ILE n 
1 30  ASP n 
1 31  SER n 
1 32  ASN n 
1 33  THR n 
1 34  LEU n 
1 35  SER n 
1 36  ILE n 
1 37  HIS n 
1 38  HIS n 
1 39  GLY n 
1 40  LYS n 
1 41  HIS n 
1 42  HIS n 
1 43  ALA n 
1 44  THR n 
1 45  TYR n 
1 46  VAL n 
1 47  ASN n 
1 48  ASN n 
1 49  LEU n 
1 50  ASN n 
1 51  ALA n 
1 52  ALA n 
1 53  LEU n 
1 54  GLU n 
1 55  ASN n 
1 56  TYR n 
1 57  SER n 
1 58  GLU n 
1 59  LEU n 
1 60  HIS n 
1 61  ASN n 
1 62  LYS n 
1 63  SER n 
1 64  LEU n 
1 65  GLU n 
1 66  GLU n 
1 67  LEU n 
1 68  LEU n 
1 69  CYS n 
1 70  ASN n 
1 71  LEU n 
1 72  GLU n 
1 73  THR n 
1 74  LEU n 
1 75  PRO n 
1 76  LYS n 
1 77  GLU n 
1 78  ILE n 
1 79  VAL n 
1 80  THR n 
1 81  ALA n 
1 82  VAL n 
1 83  ARG n 
1 84  ASN n 
1 85  ASN n 
1 86  GLY n 
1 87  GLY n 
1 88  GLY n 
1 89  HIS n 
1 90  TYR n 
1 91  CYS n 
1 92  HIS n 
1 93  SER n 
1 94  LEU n 
1 95  PHE n 
1 96  TRP n 
1 97  GLU n 
1 98  VAL n 
1 99  MET n 
1 100 SER n 
1 101 PRO n 
1 102 ARG n 
1 103 GLY n 
1 104 GLY n 
1 105 GLY n 
1 106 GLU n 
1 107 PRO n 
1 108 ASN n 
1 109 GLY n 
1 110 ASP n 
1 111 VAL n 
1 112 ALA n 
1 113 LYS n 
1 114 VAL n 
1 115 ILE n 
1 116 ASP n 
1 117 TYR n 
1 118 TYR n 
1 119 PHE n 
1 120 ASN n 
1 121 THR n 
1 122 PHE n 
1 123 ASP n 
1 124 ASN n 
1 125 LEU n 
1 126 LYS n 
1 127 ASP n 
1 128 GLN n 
1 129 LEU n 
1 130 SER n 
1 131 LYS n 
1 132 ALA n 
1 133 ALA n 
1 134 ILE n 
1 135 SER n 
1 136 ARG n 
1 137 PHE n 
1 138 GLY n 
1 139 SER n 
1 140 GLY n 
1 141 TYR n 
1 142 GLY n 
1 143 TRP n 
1 144 LEU n 
1 145 VAL n 
1 146 LEU n 
1 147 ASP n 
1 148 GLY n 
1 149 GLU n 
1 150 GLU n 
1 151 LEU n 
1 152 SER n 
1 153 VAL n 
1 154 MET n 
1 155 SER n 
1 156 THR n 
1 157 PRO n 
1 158 ASN n 
1 159 GLN n 
1 160 ASP n 
1 161 THR n 
1 162 PRO n 
1 163 LEU n 
1 164 GLN n 
1 165 GLU n 
1 166 GLY n 
1 167 LYS n 
1 168 ILE n 
1 169 PRO n 
1 170 LEU n 
1 171 LEU n 
1 172 VAL n 
1 173 ILE n 
1 174 ASP n 
1 175 VAL n 
1 176 TRP n 
1 177 GLU n 
1 178 HIS n 
1 179 ALA n 
1 180 TYR n 
1 181 TYR n 
1 182 LEU n 
1 183 LYS n 
1 184 TYR n 
1 185 GLN n 
1 186 ASN n 
1 187 ARG n 
1 188 ARG n 
1 189 PRO n 
1 190 GLU n 
1 191 PHE n 
1 192 VAL n 
1 193 THR n 
1 194 ASN n 
1 195 TRP n 
1 196 TRP n 
1 197 HIS n 
1 198 THR n 
1 199 VAL n 
1 200 ASN n 
1 201 TRP n 
1 202 ASP n 
1 203 ARG n 
1 204 VAL n 
1 205 ASN n 
1 206 GLU n 
1 207 LYS n 
1 208 TYR n 
1 209 LEU n 
1 210 GLN n 
1 211 ALA n 
1 212 ILE n 
1 213 GLN n 
1 214 SER n 
1 215 GLN n 
1 216 LYS n 
1 217 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 'sodA2, sodA-2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus anthracis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1392 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-YSBLIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM2_BACAN 
_struct_ref.pdbx_db_accession          Q81JK8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSFQLPKLSYDYDELEPYIDSNTLSIHHGKHHATYVNNLNAALENYSELHNKSLEELLCNLETLPKEIVTAVRNNGGGH
YCHSLFWEVMSPRGGGEPNGDVAKVIDYYFNTFDNLKDQLSKAAISRFGSGYGWLVLDGEELSVMSTPNQDTPLQEGKIP
LLVIDVWEHAYYLKYQNRRPEFVTNWWHTVNWDRVNEKYLQAIQSQKH
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XRE A 10 ? 217 ? Q81JK8 1 ? 208 ? 1 208 
2 1 1XRE B 10 ? 217 ? Q81JK8 1 ? 208 ? 1 208 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XRE GLY A 1 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -8 1  
1 1XRE SER A 2 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -7 2  
1 1XRE SER A 3 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -6 3  
1 1XRE HIS A 4 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -5 4  
1 1XRE HIS A 5 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -4 5  
1 1XRE HIS A 6 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -3 6  
1 1XRE HIS A 7 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -2 7  
1 1XRE HIS A 8 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -1 8  
1 1XRE HIS A 9 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' 0  9  
2 1XRE GLY B 1 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -8 10 
2 1XRE SER B 2 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -7 11 
2 1XRE SER B 3 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -6 12 
2 1XRE HIS B 4 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -5 13 
2 1XRE HIS B 5 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -4 14 
2 1XRE HIS B 6 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -3 15 
2 1XRE HIS B 7 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -2 16 
2 1XRE HIS B 8 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' -1 17 
2 1XRE HIS B 9 ? UNP Q81JK8 ? ? 'EXPRESSION TAG' 0  18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XRE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.2 
_exptl_crystal.density_percent_sol   42.6 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'PEG 3350, MgCl2, TRIS, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-07-23 
_diffrn_detector.details                'Rh coated Si mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.87000 
# 
_reflns.entry_id                     1XRE 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   37730 
_reflns.number_obs                   37730 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.071 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.33 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   94.0 
_reflns_shell.Rmerge_I_obs           0.597 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.94 
_reflns_shell.pdbx_redundancy        3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3554 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XRE 
_refine.ls_number_reflns_obs                     35719 
_refine.ls_number_reflns_all                     35719 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.09 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.1617 
_refine.ls_R_factor_all                          0.1617 
_refine.ls_R_factor_R_work                       0.15872 
_refine.ls_R_factor_R_free                       0.21932 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1879 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.972 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               27.488 
_refine.aniso_B[1][1]                            -0.02 
_refine.aniso_B[2][2]                            -0.03 
_refine.aniso_B[3][3]                            0.10 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.09 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JR9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.334 
_refine.pdbx_overall_ESU_R_Free                  0.129 
_refine.overall_SU_ML                            0.093 
_refine.overall_SU_B                             6.611 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3284 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             374 
_refine_hist.number_atoms_total               3660 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        29.09 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.021  ? 3388 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 2866 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.444  1.932  ? 4606 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.910  3.000  ? 6698 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.410  5.000  ? 400  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.477 24.889 ? 180  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   15.443 15.000 ? 538  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   12.473 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.097  0.200  ? 482  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 3798 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 690  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.213  0.200  ? 713  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.182  0.200  ? 2806 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.183  0.200  ? 1649 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.084  0.200  ? 1670 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.164  0.200  ? 225  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.168  0.200  ? 12   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.227  0.200  ? 27   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.249  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.883  2.000  ? 2598 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.697  2.000  ? 816  'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.488  4.000  ? 3228 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.957  6.000  ? 1688 'X-RAY DIFFRACTION' ? 
r_scangle_it             5.077  10.000 ? 1378 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       3.293  3.000  ? 7849 'X-RAY DIFFRACTION' ? 
r_sphericity_free        6.776  3.000  ? 375  'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      2.851  3.000  ? 6152 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_R_work             2526 
_refine_ls_shell.R_factor_R_work                  0.206 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.318 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             144 
_refine_ls_shell.number_reflns_obs                2526 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1XRE 
_struct.title                     'Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.' 
_struct.pdbx_descriptor           'Superoxide dismutase (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XRE 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'SodA-2; Superoxide dismutase; Bacillus anthracis; BA5696; SPINE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 30  ? LYS A 40  ? ASP A 21  LYS A 31  1 ? 11 
HELX_P HELX_P2  2  LYS A 40  ? GLU A 54  ? LYS A 31  GLU A 45  1 ? 15 
HELX_P HELX_P3  3  TYR A 56  ? HIS A 60  ? TYR A 47  HIS A 51  5 ? 5  
HELX_P HELX_P4  4  SER A 63  ? ASN A 70  ? SER A 54  ASN A 61  1 ? 8  
HELX_P HELX_P5  5  LEU A 71  ? LEU A 74  ? LEU A 62  LEU A 65  5 ? 4  
HELX_P HELX_P6  6  ILE A 78  ? VAL A 98  ? ILE A 69  VAL A 89  1 ? 21 
HELX_P HELX_P7  7  ASN A 108 ? ASN A 120 ? ASN A 99  ASN A 111 1 ? 13 
HELX_P HELX_P8  8  THR A 121 ? SER A 135 ? THR A 112 SER A 126 1 ? 15 
HELX_P HELX_P9  9  THR A 161 ? GLY A 166 ? THR A 152 GLY A 157 5 ? 6  
HELX_P HELX_P10 10 TRP A 176 ? ALA A 179 ? TRP A 167 ALA A 170 5 ? 4  
HELX_P HELX_P11 11 TYR A 180 ? GLN A 185 ? TYR A 171 GLN A 176 1 ? 6  
HELX_P HELX_P12 12 ARG A 187 ? TRP A 196 ? ARG A 178 TRP A 187 1 ? 10 
HELX_P HELX_P13 13 HIS A 197 ? VAL A 199 ? HIS A 188 VAL A 190 5 ? 3  
HELX_P HELX_P14 14 ASN A 200 ? ILE A 212 ? ASN A 191 ILE A 203 1 ? 13 
HELX_P HELX_P15 15 ASP B 30  ? LYS B 40  ? ASP B 21  LYS B 31  1 ? 11 
HELX_P HELX_P16 16 LYS B 40  ? GLU B 54  ? LYS B 31  GLU B 45  1 ? 15 
HELX_P HELX_P17 17 TYR B 56  ? HIS B 60  ? TYR B 47  HIS B 51  5 ? 5  
HELX_P HELX_P18 18 SER B 63  ? ASN B 70  ? SER B 54  ASN B 61  1 ? 8  
HELX_P HELX_P19 19 LEU B 71  ? LEU B 74  ? LEU B 62  LEU B 65  5 ? 4  
HELX_P HELX_P20 20 ILE B 78  ? VAL B 98  ? ILE B 69  VAL B 89  1 ? 21 
HELX_P HELX_P21 21 ASN B 108 ? ASN B 120 ? ASN B 99  ASN B 111 1 ? 13 
HELX_P HELX_P22 22 THR B 121 ? ARG B 136 ? THR B 112 ARG B 127 1 ? 16 
HELX_P HELX_P23 23 THR B 161 ? GLY B 166 ? THR B 152 GLY B 157 5 ? 6  
HELX_P HELX_P24 24 TRP B 176 ? ALA B 179 ? TRP B 167 ALA B 170 5 ? 4  
HELX_P HELX_P25 25 TYR B 180 ? GLN B 185 ? TYR B 171 GLN B 176 1 ? 6  
HELX_P HELX_P26 26 ARG B 187 ? TRP B 196 ? ARG B 178 TRP B 187 1 ? 10 
HELX_P HELX_P27 27 HIS B 197 ? VAL B 199 ? HIS B 188 VAL B 190 5 ? 3  
HELX_P HELX_P28 28 ASN B 200 ? ILE B 212 ? ASN B 191 ILE B 203 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 174 OD2 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 165 A MN  209 1_555 ? ? ? ? ? ? ? 1.919 ? 
metalc2  metalc ? ? B ASP 174 OD2 ? ? ? 1_555 D MN  .   MN  ? ? B ASP 165 B MN  209 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc3  metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH .   O   ? ? A MN  209 A HOH 388 1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc4  metalc ? ? D MN  .   MN  ? ? ? 1_555 F HOH .   O   ? ? B MN  209 B HOH 212 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc5  metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 37  NE2 ? ? A MN  209 A HIS 28  1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc6  metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 92  NE2 ? ? A MN  209 A HIS 83  1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc7  metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 178 NE2 ? ? A MN  209 A HIS 169 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc8  metalc ? ? D MN  .   MN  ? ? ? 1_555 B HIS 37  NE2 ? ? B MN  209 B HIS 28  1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc9  metalc ? ? D MN  .   MN  ? ? ? 1_555 B HIS 92  NE2 ? ? B MN  209 B HIS 83  1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc10 metalc ? ? D MN  .   MN  ? ? ? 1_555 B HIS 178 NE2 ? ? B MN  209 B HIS 169 1_555 ? ? ? ? ? ? ? 2.050 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26 A . ? GLU 17 A PRO 27 A ? PRO 18 A 1 6.14  
2 GLU 26 B . ? GLU 17 B PRO 27 B ? PRO 18 B 1 -0.51 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 150 ? PRO A 157 ? GLU A 141 PRO A 148 
A 2 GLY A 140 ? ASP A 147 ? GLY A 131 ASP A 138 
A 3 ILE A 168 ? ASP A 174 ? ILE A 159 ASP A 165 
B 1 GLU B 150 ? PRO B 157 ? GLU B 141 PRO B 148 
B 2 GLY B 140 ? ASP B 147 ? GLY B 131 ASP B 138 
B 3 ILE B 168 ? ASP B 174 ? ILE B 159 ASP B 165 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 154 ? O MET A 145 N TRP A 143 ? N TRP A 134 
A 2 3 N LEU A 144 ? N LEU A 135 O LEU A 170 ? O LEU A 161 
B 1 2 O GLU B 150 ? O GLU B 141 N ASP B 147 ? N ASP B 138 
B 2 3 N LEU B 144 ? N LEU B 135 O LEU B 170 ? O LEU B 161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN A 209' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 209' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 37  ? HIS A 28  . ? 1_555 ? 
2  AC1 5 HIS A 92  ? HIS A 83  . ? 1_555 ? 
3  AC1 5 ASP A 174 ? ASP A 165 . ? 1_555 ? 
4  AC1 5 HIS A 178 ? HIS A 169 . ? 1_555 ? 
5  AC1 5 HOH E .   ? HOH A 388 . ? 1_555 ? 
6  AC2 5 HIS B 37  ? HIS B 28  . ? 1_555 ? 
7  AC2 5 HIS B 92  ? HIS B 83  . ? 1_555 ? 
8  AC2 5 ASP B 174 ? ASP B 165 . ? 1_555 ? 
9  AC2 5 HIS B 178 ? HIS B 169 . ? 1_555 ? 
10 AC2 5 HOH F .   ? HOH B 212 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XRE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XRE 
_atom_sites.fract_transf_matrix[1][1]   0.018234 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005523 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014313 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018469 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 12  ? 32.057 -11.902 3.232  1.00 38.18 ? 3   SER A N   1 
ATOM   2    C  CA  . SER A 1 12  ? 30.623 -12.077 2.798  1.00 36.02 ? 3   SER A CA  1 
ATOM   3    C  C   . SER A 1 12  ? 29.713 -10.922 3.265  1.00 33.97 ? 3   SER A C   1 
ATOM   4    O  O   . SER A 1 12  ? 29.202 -10.203 2.423  1.00 32.32 ? 3   SER A O   1 
ATOM   5    C  CB  . SER A 1 12  ? 30.077 -13.429 3.193  1.00 37.39 ? 3   SER A CB  1 
ATOM   6    O  OG  . SER A 1 12  ? 28.672 -13.524 2.938  1.00 40.56 ? 3   SER A OG  1 
ATOM   7    N  N   . PHE A 1 13  ? 29.523 -10.724 4.578  1.00 32.41 ? 4   PHE A N   1 
ATOM   8    C  CA  . PHE A 1 13  ? 28.876 -9.488  5.063  1.00 31.40 ? 4   PHE A CA  1 
ATOM   9    C  C   . PHE A 1 13  ? 29.709 -8.252  4.698  1.00 30.14 ? 4   PHE A C   1 
ATOM   10   O  O   . PHE A 1 13  ? 30.944 -8.289  4.700  1.00 28.05 ? 4   PHE A O   1 
ATOM   11   C  CB  . PHE A 1 13  ? 28.640 -9.553  6.580  1.00 29.49 ? 4   PHE A CB  1 
ATOM   12   C  CG  . PHE A 1 13  ? 27.615 -10.573 6.970  1.00 26.85 ? 4   PHE A CG  1 
ATOM   13   C  CD1 . PHE A 1 13  ? 27.997 -11.805 7.528  1.00 28.65 ? 4   PHE A CD1 1 
ATOM   14   C  CD2 . PHE A 1 13  ? 26.272 -10.336 6.724  1.00 26.73 ? 4   PHE A CD2 1 
ATOM   15   C  CE1 . PHE A 1 13  ? 27.053 -12.764 7.867  1.00 28.16 ? 4   PHE A CE1 1 
ATOM   16   C  CE2 . PHE A 1 13  ? 25.304 -11.296 7.046  1.00 30.19 ? 4   PHE A CE2 1 
ATOM   17   C  CZ  . PHE A 1 13  ? 25.688 -12.507 7.631  1.00 29.27 ? 4   PHE A CZ  1 
ATOM   18   N  N   . GLN A 1 14  ? 29.015 -7.160  4.386  1.00 29.94 ? 5   GLN A N   1 
ATOM   19   C  CA  . GLN A 1 14  ? 29.625 -5.936  3.875  1.00 30.86 ? 5   GLN A CA  1 
ATOM   20   C  C   . GLN A 1 14  ? 29.199 -4.745  4.736  1.00 28.96 ? 5   GLN A C   1 
ATOM   21   O  O   . GLN A 1 14  ? 28.056 -4.688  5.205  1.00 28.96 ? 5   GLN A O   1 
ATOM   22   C  CB  . GLN A 1 14  ? 29.166 -5.692  2.422  1.00 31.35 ? 5   GLN A CB  1 
ATOM   23   C  CG  . GLN A 1 14  ? 29.783 -6.660  1.376  1.00 33.63 ? 5   GLN A CG  1 
ATOM   24   C  CD  . GLN A 1 14  ? 29.235 -6.470  -0.052 1.00 38.39 ? 5   GLN A CD  1 
ATOM   25   O  OE1 . GLN A 1 14  ? 28.074 -6.810  -0.339 1.00 50.23 ? 5   GLN A OE1 1 
ATOM   26   N  NE2 . GLN A 1 14  ? 30.089 -5.946  -0.972 1.00 49.28 ? 5   GLN A NE2 1 
ATOM   27   N  N   . LEU A 1 15  ? 30.101 -3.783  4.915  1.00 27.79 ? 6   LEU A N   1 
ATOM   28   C  CA  . LEU A 1 15  ? 29.761 -2.499  5.529  1.00 27.87 ? 6   LEU A CA  1 
ATOM   29   C  C   . LEU A 1 15  ? 28.869 -1.664  4.613  1.00 28.35 ? 6   LEU A C   1 
ATOM   30   O  O   . LEU A 1 15  ? 29.294 -1.291  3.506  1.00 27.04 ? 6   LEU A O   1 
ATOM   31   C  CB  . LEU A 1 15  ? 31.060 -1.736  5.835  1.00 28.19 ? 6   LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 15  ? 30.909 -0.337  6.432  1.00 28.54 ? 6   LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 15  ? 30.515 -0.489  7.905  1.00 28.00 ? 6   LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 15  ? 32.156 0.482   6.295  1.00 28.79 ? 6   LEU A CD2 1 
ATOM   35   N  N   . PRO A 1 16  ? 27.639 -1.337  5.053  1.00 27.15 ? 7   PRO A N   1 
ATOM   36   C  CA  . PRO A 1 16  ? 26.762 -0.576  4.170  1.00 28.00 ? 7   PRO A CA  1 
ATOM   37   C  C   . PRO A 1 16  ? 27.239 0.848   3.971  1.00 28.14 ? 7   PRO A C   1 
ATOM   38   O  O   . PRO A 1 16  ? 27.816 1.464   4.885  1.00 27.72 ? 7   PRO A O   1 
ATOM   39   C  CB  . PRO A 1 16  ? 25.416 -0.610  4.913  1.00 28.96 ? 7   PRO A CB  1 
ATOM   40   C  CG  . PRO A 1 16  ? 25.783 -0.667  6.323  1.00 26.31 ? 7   PRO A CG  1 
ATOM   41   C  CD  . PRO A 1 16  ? 27.007 -1.567  6.359  1.00 27.39 ? 7   PRO A CD  1 
ATOM   42   N  N   . LYS A 1 17  ? 27.025 1.396   2.778  1.00 28.55 ? 8   LYS A N   1 
ATOM   43   C  CA  . LYS A 1 17  ? 27.260 2.835   2.616  1.00 29.60 ? 8   LYS A CA  1 
ATOM   44   C  C   . LYS A 1 17  ? 26.225 3.646   3.387  1.00 28.01 ? 8   LYS A C   1 
ATOM   45   O  O   . LYS A 1 17  ? 25.059 3.257   3.468  1.00 27.17 ? 8   LYS A O   1 
ATOM   46   C  CB  . LYS A 1 17  ? 27.248 3.189   1.143  1.00 31.93 ? 8   LYS A CB  1 
ATOM   47   C  CG  . LYS A 1 17  ? 28.375 2.514   0.386  1.00 34.94 ? 8   LYS A CG  1 
ATOM   48   C  CD  . LYS A 1 17  ? 28.668 3.208   -0.923 1.00 35.22 ? 8   LYS A CD  1 
ATOM   49   C  CE  . LYS A 1 17  ? 27.485 3.145   -1.870 1.00 41.37 ? 8   LYS A CE  1 
ATOM   50   N  NZ  . LYS A 1 17  ? 27.856 2.352   -3.037 1.00 45.29 ? 8   LYS A NZ  1 
ATOM   51   N  N   . LEU A 1 18  ? 26.635 4.765   3.991  1.00 28.83 ? 9   LEU A N   1 
ATOM   52   C  CA  . LEU A 1 18  ? 25.641 5.684   4.565  1.00 28.70 ? 9   LEU A CA  1 
ATOM   53   C  C   . LEU A 1 18  ? 24.861 6.336   3.427  1.00 28.85 ? 9   LEU A C   1 
ATOM   54   O  O   . LEU A 1 18  ? 25.405 6.497   2.326  1.00 30.17 ? 9   LEU A O   1 
ATOM   55   C  CB  . LEU A 1 18  ? 26.294 6.793   5.368  1.00 26.14 ? 9   LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 18  ? 27.061 6.392   6.623  1.00 27.94 ? 9   LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 18  ? 27.519 7.677   7.297  1.00 26.12 ? 9   LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 18  ? 26.170 5.569   7.513  1.00 27.42 ? 9   LEU A CD2 1 
ATOM   59   N  N   . SER A 1 19  ? 23.626 6.745   3.716  1.00 29.35 ? 10  SER A N   1 
ATOM   60   C  CA  . SER A 1 19  ? 22.778 7.511   2.766  1.00 30.59 ? 10  SER A CA  1 
ATOM   61   C  C   . SER A 1 19  ? 23.134 9.006   2.684  1.00 31.72 ? 10  SER A C   1 
ATOM   62   O  O   . SER A 1 19  ? 22.497 9.769   1.962  1.00 32.66 ? 10  SER A O   1 
ATOM   63   C  CB  . SER A 1 19  ? 21.316 7.382   3.198  1.00 30.71 ? 10  SER A CB  1 
ATOM   64   O  OG  . SER A 1 19  ? 20.881 6.075   2.949  1.00 36.78 ? 10  SER A OG  1 
ATOM   65   N  N   . TYR A 1 20  ? 24.121 9.434   3.462  1.00 31.26 ? 11  TYR A N   1 
ATOM   66   C  CA  . TYR A 1 20  ? 24.461 10.837  3.609  1.00 30.66 ? 11  TYR A CA  1 
ATOM   67   C  C   . TYR A 1 20  ? 25.968 10.909  3.932  1.00 31.01 ? 11  TYR A C   1 
ATOM   68   O  O   . TYR A 1 20  ? 26.597 9.880   4.224  1.00 30.85 ? 11  TYR A O   1 
ATOM   69   C  CB  . TYR A 1 20  ? 23.582 11.496  4.695  1.00 28.69 ? 11  TYR A CB  1 
ATOM   70   C  CG  . TYR A 1 20  ? 23.377 10.563  5.898  1.00 27.26 ? 11  TYR A CG  1 
ATOM   71   C  CD1 . TYR A 1 20  ? 24.338 10.440  6.884  1.00 26.25 ? 11  TYR A CD1 1 
ATOM   72   C  CD2 . TYR A 1 20  ? 22.241 9.777   6.000  1.00 24.56 ? 11  TYR A CD2 1 
ATOM   73   C  CE1 . TYR A 1 20  ? 24.140 9.537   7.986  1.00 28.25 ? 11  TYR A CE1 1 
ATOM   74   C  CE2 . TYR A 1 20  ? 22.042 8.880   7.082  1.00 22.54 ? 11  TYR A CE2 1 
ATOM   75   C  CZ  . TYR A 1 20  ? 22.995 8.763   8.052  1.00 24.69 ? 11  TYR A CZ  1 
ATOM   76   O  OH  . TYR A 1 20  ? 22.779 7.879   9.120  1.00 25.24 ? 11  TYR A OH  1 
ATOM   77   N  N   . ASP A 1 21  ? 26.542 12.106  3.851  1.00 31.21 ? 12  ASP A N   1 
ATOM   78   C  CA  . ASP A 1 21  ? 27.958 12.286  4.135  1.00 31.19 ? 12  ASP A CA  1 
ATOM   79   C  C   . ASP A 1 21  ? 28.198 12.389  5.636  1.00 30.07 ? 12  ASP A C   1 
ATOM   80   O  O   . ASP A 1 21  ? 27.292 12.692  6.441  1.00 27.36 ? 12  ASP A O   1 
ATOM   81   C  CB  . ASP A 1 21  ? 28.520 13.546  3.455  1.00 32.89 ? 12  ASP A CB  1 
ATOM   82   C  CG  . ASP A 1 21  ? 29.024 13.291  2.030  1.00 40.98 ? 12  ASP A CG  1 
ATOM   83   O  OD1 . ASP A 1 21  ? 28.636 12.281  1.384  1.00 42.22 ? 12  ASP A OD1 1 
ATOM   84   O  OD2 . ASP A 1 21  ? 29.841 14.113  1.567  1.00 47.17 ? 12  ASP A OD2 1 
ATOM   85   N  N   . TYR A 1 22  ? 29.454 12.211  6.003  1.00 29.84 ? 13  TYR A N   1 
ATOM   86   C  CA  . TYR A 1 22  ? 29.815 12.164  7.431  1.00 30.47 ? 13  TYR A CA  1 
ATOM   87   C  C   . TYR A 1 22  ? 29.562 13.483  8.168  1.00 31.00 ? 13  TYR A C   1 
ATOM   88   O  O   . TYR A 1 22  ? 29.479 13.477  9.389  1.00 31.43 ? 13  TYR A O   1 
ATOM   89   C  CB  . TYR A 1 22  ? 31.270 11.785  7.589  1.00 30.74 ? 13  TYR A CB  1 
ATOM   90   C  CG  . TYR A 1 22  ? 31.600 10.329  7.339  1.00 32.79 ? 13  TYR A CG  1 
ATOM   91   C  CD1 . TYR A 1 22  ? 30.684 9.297   7.602  1.00 30.09 ? 13  TYR A CD1 1 
ATOM   92   C  CD2 . TYR A 1 22  ? 32.853 9.974   6.893  1.00 33.87 ? 13  TYR A CD2 1 
ATOM   93   C  CE1 . TYR A 1 22  ? 31.030 7.962   7.399  1.00 29.26 ? 13  TYR A CE1 1 
ATOM   94   C  CE2 . TYR A 1 22  ? 33.194 8.670   6.694  1.00 32.00 ? 13  TYR A CE2 1 
ATOM   95   C  CZ  . TYR A 1 22  ? 32.279 7.651   6.945  1.00 30.82 ? 13  TYR A CZ  1 
ATOM   96   O  OH  . TYR A 1 22  ? 32.680 6.337   6.755  1.00 30.61 ? 13  TYR A OH  1 
ATOM   97   N  N   . ASP A 1 23  ? 29.452 14.602  7.435  1.00 31.35 ? 14  ASP A N   1 
ATOM   98   C  CA  . ASP A 1 23  ? 29.099 15.885  8.059  1.00 31.66 ? 14  ASP A CA  1 
ATOM   99   C  C   . ASP A 1 23  ? 27.602 16.246  7.993  1.00 32.10 ? 14  ASP A C   1 
ATOM   100  O  O   . ASP A 1 23  ? 27.207 17.326  8.447  1.00 31.82 ? 14  ASP A O   1 
ATOM   101  C  CB  . ASP A 1 23  ? 29.940 17.035  7.473  1.00 32.68 ? 14  ASP A CB  1 
ATOM   102  C  CG  . ASP A 1 23  ? 29.737 17.223  5.946  1.00 35.03 ? 14  ASP A CG  1 
ATOM   103  O  OD1 . ASP A 1 23  ? 29.062 16.388  5.283  1.00 33.85 ? 14  ASP A OD1 1 
ATOM   104  O  OD2 . ASP A 1 23  ? 30.269 18.234  5.409  1.00 35.07 ? 14  ASP A OD2 1 
ATOM   105  N  N   . GLU A 1 24  ? 26.758 15.355  7.477  1.00 32.24 ? 15  GLU A N   1 
ATOM   106  C  CA  . GLU A 1 24  ? 25.365 15.757  7.196  1.00 32.36 ? 15  GLU A CA  1 
ATOM   107  C  C   . GLU A 1 24  ? 24.348 15.530  8.327  1.00 31.85 ? 15  GLU A C   1 
ATOM   108  O  O   . GLU A 1 24  ? 23.175 15.847  8.155  1.00 33.13 ? 15  GLU A O   1 
ATOM   109  C  CB  . GLU A 1 24  ? 24.893 15.182  5.864  1.00 33.02 ? 15  GLU A CB  1 
ATOM   110  C  CG  . GLU A 1 24  ? 25.598 15.879  4.693  1.00 33.31 ? 15  GLU A CG  1 
ATOM   111  C  CD  . GLU A 1 24  ? 25.204 15.363  3.324  1.00 34.59 ? 15  GLU A CD  1 
ATOM   112  O  OE1 . GLU A 1 24  ? 24.810 14.208  3.183  1.00 32.03 ? 15  GLU A OE1 1 
ATOM   113  O  OE2 . GLU A 1 24  ? 25.327 16.130  2.360  1.00 42.59 ? 15  GLU A OE2 1 
ATOM   114  N  N   . LEU A 1 25  ? 24.792 15.027  9.482  1.00 30.19 ? 16  LEU A N   1 
ATOM   115  C  CA  . LEU A 1 25  ? 23.965 15.037  10.686 1.00 29.18 ? 16  LEU A CA  1 
ATOM   116  C  C   . LEU A 1 25  ? 24.380 16.139  11.682 1.00 28.44 ? 16  LEU A C   1 
ATOM   117  O  O   . LEU A 1 25  ? 23.884 16.191  12.815 1.00 28.69 ? 16  LEU A O   1 
ATOM   118  C  CB  . LEU A 1 25  ? 23.994 13.646  11.357 1.00 29.45 ? 16  LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 25  ? 23.569 12.420  10.506 1.00 28.65 ? 16  LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 25  ? 23.658 11.188  11.369 1.00 29.51 ? 16  LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 25  ? 22.139 12.533  9.928  1.00 26.49 ? 16  LEU A CD2 1 
ATOM   122  N  N   . GLU A 1 26  ? 25.277 17.026  11.272 1.00 28.15 ? 17  GLU A N   1 
ATOM   123  C  CA  . GLU A 1 26  ? 25.578 18.223  12.061 1.00 29.23 ? 17  GLU A CA  1 
ATOM   124  C  C   . GLU A 1 26  ? 24.341 19.106  12.191 1.00 29.52 ? 17  GLU A C   1 
ATOM   125  O  O   . GLU A 1 26  ? 23.567 19.198  11.259 1.00 30.84 ? 17  GLU A O   1 
ATOM   126  C  CB  . GLU A 1 26  ? 26.713 19.024  11.420 1.00 29.11 ? 17  GLU A CB  1 
ATOM   127  C  CG  . GLU A 1 26  ? 28.027 18.289  11.323 1.00 30.75 ? 17  GLU A CG  1 
ATOM   128  C  CD  . GLU A 1 26  ? 28.926 18.535  12.511 1.00 33.83 ? 17  GLU A CD  1 
ATOM   129  O  OE1 . GLU A 1 26  ? 28.453 19.126  13.498 1.00 33.85 ? 17  GLU A OE1 1 
ATOM   130  O  OE2 . GLU A 1 26  ? 30.102 18.127  12.453 1.00 31.99 ? 17  GLU A OE2 1 
ATOM   131  N  N   . PRO A 1 27  ? 24.141 19.738  13.342 1.00 28.48 ? 18  PRO A N   1 
ATOM   132  C  CA  . PRO A 1 27  ? 25.086 19.753  14.456 1.00 29.57 ? 18  PRO A CA  1 
ATOM   133  C  C   . PRO A 1 27  ? 24.749 18.726  15.532 1.00 30.08 ? 18  PRO A C   1 
ATOM   134  O  O   . PRO A 1 27  ? 25.269 18.795  16.635 1.00 32.25 ? 18  PRO A O   1 
ATOM   135  C  CB  . PRO A 1 27  ? 24.858 21.128  15.048 1.00 30.86 ? 18  PRO A CB  1 
ATOM   136  C  CG  . PRO A 1 27  ? 23.435 21.336  14.847 1.00 30.95 ? 18  PRO A CG  1 
ATOM   137  C  CD  . PRO A 1 27  ? 23.123 20.779  13.495 1.00 29.95 ? 18  PRO A CD  1 
ATOM   138  N  N   . TYR A 1 28  ? 23.883 17.785  15.209 1.00 28.59 ? 19  TYR A N   1 
ATOM   139  C  CA  . TYR A 1 28  ? 23.362 16.872  16.205 1.00 27.20 ? 19  TYR A CA  1 
ATOM   140  C  C   . TYR A 1 28  ? 24.363 15.773  16.544 1.00 25.96 ? 19  TYR A C   1 
ATOM   141  O  O   . TYR A 1 28  ? 24.533 15.398  17.691 1.00 25.32 ? 19  TYR A O   1 
ATOM   142  C  CB  . TYR A 1 28  ? 22.038 16.291  15.725 1.00 28.23 ? 19  TYR A CB  1 
ATOM   143  C  CG  . TYR A 1 28  ? 21.105 17.366  15.238 1.00 30.35 ? 19  TYR A CG  1 
ATOM   144  C  CD1 . TYR A 1 28  ? 20.728 17.444  13.915 1.00 30.86 ? 19  TYR A CD1 1 
ATOM   145  C  CD2 . TYR A 1 28  ? 20.636 18.323  16.102 1.00 30.14 ? 19  TYR A CD2 1 
ATOM   146  C  CE1 . TYR A 1 28  ? 19.894 18.440  13.481 1.00 29.83 ? 19  TYR A CE1 1 
ATOM   147  C  CE2 . TYR A 1 28  ? 19.808 19.314  15.677 1.00 31.09 ? 19  TYR A CE2 1 
ATOM   148  C  CZ  . TYR A 1 28  ? 19.441 19.374  14.370 1.00 30.08 ? 19  TYR A CZ  1 
ATOM   149  O  OH  . TYR A 1 28  ? 18.606 20.377  13.974 1.00 32.88 ? 19  TYR A OH  1 
ATOM   150  N  N   . ILE A 1 29  ? 24.994 15.265  15.505 1.00 24.35 ? 20  ILE A N   1 
ATOM   151  C  CA  . ILE A 1 29  ? 26.102 14.323  15.607 1.00 25.43 ? 20  ILE A CA  1 
ATOM   152  C  C   . ILE A 1 29  ? 27.254 14.937  14.799 1.00 25.86 ? 20  ILE A C   1 
ATOM   153  O  O   . ILE A 1 29  ? 27.080 15.289  13.597 1.00 26.13 ? 20  ILE A O   1 
ATOM   154  C  CB  . ILE A 1 29  ? 25.696 12.942  15.038 1.00 24.98 ? 20  ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 29  ? 24.503 12.375  15.834 1.00 26.11 ? 20  ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 29  ? 26.903 11.975  14.989 1.00 25.52 ? 20  ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 29  ? 23.916 11.078  15.264 1.00 26.82 ? 20  ILE A CD1 1 
ATOM   158  N  N   . ASP A 1 30  ? 28.404 15.080  15.455 1.00 24.29 ? 21  ASP A N   1 
ATOM   159  C  CA  . ASP A 1 30  ? 29.613 15.659  14.854 1.00 24.84 ? 21  ASP A CA  1 
ATOM   160  C  C   . ASP A 1 30  ? 30.233 14.800  13.761 1.00 25.08 ? 21  ASP A C   1 
ATOM   161  O  O   . ASP A 1 30  ? 30.177 13.569  13.833 1.00 23.20 ? 21  ASP A O   1 
ATOM   162  C  CB  . ASP A 1 30  ? 30.692 15.963  15.920 1.00 25.95 ? 21  ASP A CB  1 
ATOM   163  C  CG  . ASP A 1 30  ? 31.046 14.741  16.784 1.00 26.89 ? 21  ASP A CG  1 
ATOM   164  O  OD1 . ASP A 1 30  ? 30.151 14.293  17.527 1.00 25.69 ? 21  ASP A OD1 1 
ATOM   165  O  OD2 . ASP A 1 30  ? 32.208 14.260  16.744 1.00 25.65 ? 21  ASP A OD2 1 
ATOM   166  N  N   . SER A 1 31  ? 30.889 15.456  12.790 1.00 25.87 ? 22  SER A N   1 
ATOM   167  C  CA  . SER A 1 31  ? 31.478 14.769  11.640 1.00 25.17 ? 22  SER A CA  1 
ATOM   168  C  C   . SER A 1 31  ? 32.570 13.749  11.974 1.00 25.07 ? 22  SER A C   1 
ATOM   169  O  O   . SER A 1 31  ? 32.625 12.665  11.378 1.00 23.95 ? 22  SER A O   1 
ATOM   170  C  CB  . SER A 1 31  ? 32.011 15.803  10.637 1.00 27.66 ? 22  SER A CB  1 
ATOM   171  O  OG  . SER A 1 31  ? 31.026 16.813  10.579 1.00 34.68 ? 22  SER A OG  1 
ATOM   172  N  N   . ASN A 1 32  ? 33.438 14.078  12.917 1.00 25.01 ? 23  ASN A N   1 
ATOM   173  C  CA  . ASN A 1 32  ? 34.497 13.130  13.276 1.00 24.49 ? 23  ASN A CA  1 
ATOM   174  C  C   . ASN A 1 32  ? 33.882 11.838  13.880 1.00 23.81 ? 23  ASN A C   1 
ATOM   175  O  O   . ASN A 1 32  ? 34.257 10.717  13.484 1.00 23.69 ? 23  ASN A O   1 
ATOM   176  C  CB  . ASN A 1 32  ? 35.525 13.764  14.203 1.00 23.31 ? 23  ASN A CB  1 
ATOM   177  C  CG  . ASN A 1 32  ? 36.742 12.890  14.403 1.00 26.38 ? 23  ASN A CG  1 
ATOM   178  O  OD1 . ASN A 1 32  ? 37.158 12.133  13.514 1.00 31.87 ? 23  ASN A OD1 1 
ATOM   179  N  ND2 . ASN A 1 32  ? 37.318 12.991  15.564 1.00 28.84 ? 23  ASN A ND2 1 
ATOM   180  N  N   . THR A 1 33  ? 32.913 12.020  14.774 1.00 23.14 ? 24  THR A N   1 
ATOM   181  C  CA  . THR A 1 33  ? 32.230 10.890  15.409 1.00 23.13 ? 24  THR A CA  1 
ATOM   182  C  C   . THR A 1 33  ? 31.556 10.023  14.327 1.00 21.36 ? 24  THR A C   1 
ATOM   183  O  O   . THR A 1 33  ? 31.727 8.813   14.286 1.00 21.05 ? 24  THR A O   1 
ATOM   184  C  CB  . THR A 1 33  ? 31.240 11.312  16.485 1.00 22.73 ? 24  THR A CB  1 
ATOM   185  O  OG1 . THR A 1 33  ? 31.951 11.781  17.640 1.00 25.43 ? 24  THR A OG1 1 
ATOM   186  C  CG2 . THR A 1 33  ? 30.333 10.102  16.907 1.00 24.07 ? 24  THR A CG2 1 
ATOM   187  N  N   . LEU A 1 34  ? 30.830 10.619  13.408 1.00 21.73 ? 25  LEU A N   1 
ATOM   188  C  CA  . LEU A 1 34  ? 30.132 9.793   12.409 1.00 22.95 ? 25  LEU A CA  1 
ATOM   189  C  C   . LEU A 1 34  ? 31.109 8.977   11.558 1.00 24.42 ? 25  LEU A C   1 
ATOM   190  O  O   . LEU A 1 34  ? 30.866 7.777   11.291 1.00 24.56 ? 25  LEU A O   1 
ATOM   191  C  CB  . LEU A 1 34  ? 29.227 10.660  11.516 1.00 23.14 ? 25  LEU A CB  1 
ATOM   192  C  CG  . LEU A 1 34  ? 28.208 9.896   10.695 1.00 24.33 ? 25  LEU A CG  1 
ATOM   193  C  CD1 . LEU A 1 34  ? 27.415 8.863   11.523 1.00 28.84 ? 25  LEU A CD1 1 
ATOM   194  C  CD2 . LEU A 1 34  ? 27.291 10.889  10.000 1.00 25.03 ? 25  LEU A CD2 1 
ATOM   195  N  N   . SER A 1 35  ? 32.242 9.597   11.200 1.00 23.62 ? 26  SER A N   1 
ATOM   196  C  CA  . SER A 1 35  ? 33.265 8.930   10.403 1.00 24.24 ? 26  SER A CA  1 
ATOM   197  C  C   . SER A 1 35  ? 33.917 7.786   11.146 1.00 22.98 ? 26  SER A C   1 
ATOM   198  O  O   . SER A 1 35  ? 34.173 6.769   10.550 1.00 22.59 ? 26  SER A O   1 
ATOM   199  C  CB  . SER A 1 35  ? 34.362 9.889   9.889  1.00 27.78 ? 26  SER A CB  1 
ATOM   200  O  OG  . SER A 1 35  ? 34.926 10.608  10.932 1.00 31.97 ? 26  SER A OG  1 
ATOM   201  N  N   . ILE A 1 36  ? 34.214 7.967   12.431 1.00 22.46 ? 27  ILE A N   1 
ATOM   202  C  CA  . ILE A 1 36  ? 34.797 6.887   13.233 1.00 22.50 ? 27  ILE A CA  1 
ATOM   203  C  C   . ILE A 1 36  ? 33.751 5.801   13.561 1.00 22.48 ? 27  ILE A C   1 
ATOM   204  O  O   . ILE A 1 36  ? 34.037 4.596   13.441 1.00 23.48 ? 27  ILE A O   1 
ATOM   205  C  CB  . ILE A 1 36  ? 35.403 7.408   14.575 1.00 22.75 ? 27  ILE A CB  1 
ATOM   206  C  CG1 . ILE A 1 36  ? 36.541 8.404   14.302 1.00 24.75 ? 27  ILE A CG1 1 
ATOM   207  C  CG2 . ILE A 1 36  ? 35.931 6.204   15.387 1.00 24.06 ? 27  ILE A CG2 1 
ATOM   208  C  CD1 . ILE A 1 36  ? 36.943 9.213   15.471 1.00 24.92 ? 27  ILE A CD1 1 
ATOM   209  N  N   . HIS A 1 37  ? 32.553 6.233   13.974 1.00 20.74 ? 28  HIS A N   1 
ATOM   210  C  CA  . HIS A 1 37  ? 31.481 5.313   14.369 1.00 19.99 ? 28  HIS A CA  1 
ATOM   211  C  C   . HIS A 1 37  ? 31.125 4.352   13.200 1.00 22.23 ? 28  HIS A C   1 
ATOM   212  O  O   . HIS A 1 37  ? 30.994 3.141   13.375 1.00 21.24 ? 28  HIS A O   1 
ATOM   213  C  CB  . HIS A 1 37  ? 30.288 6.121   14.848 1.00 20.09 ? 28  HIS A CB  1 
ATOM   214  C  CG  . HIS A 1 37  ? 29.309 5.351   15.687 1.00 20.33 ? 28  HIS A CG  1 
ATOM   215  N  ND1 . HIS A 1 37  ? 28.225 5.950   16.278 1.00 19.73 ? 28  HIS A ND1 1 
ATOM   216  C  CD2 . HIS A 1 37  ? 29.246 4.031   16.025 1.00 21.93 ? 28  HIS A CD2 1 
ATOM   217  C  CE1 . HIS A 1 37  ? 27.557 5.039   16.980 1.00 18.26 ? 28  HIS A CE1 1 
ATOM   218  N  NE2 . HIS A 1 37  ? 28.163 3.863   16.860 1.00 19.32 ? 28  HIS A NE2 1 
ATOM   219  N  N   . HIS A 1 38  ? 31.021 4.903   11.991 1.00 22.17 ? 29  HIS A N   1 
ATOM   220  C  CA  . HIS A 1 38  ? 30.764 4.075   10.776 1.00 22.63 ? 29  HIS A CA  1 
ATOM   221  C  C   . HIS A 1 38  ? 32.041 3.375   10.271 1.00 23.48 ? 29  HIS A C   1 
ATOM   222  O  O   . HIS A 1 38  ? 32.062 2.164   10.091 1.00 22.84 ? 29  HIS A O   1 
ATOM   223  C  CB  . HIS A 1 38  ? 30.122 4.940   9.695  1.00 24.52 ? 29  HIS A CB  1 
ATOM   224  C  CG  . HIS A 1 38  ? 29.907 4.238   8.381  1.00 22.71 ? 29  HIS A CG  1 
ATOM   225  N  ND1 . HIS A 1 38  ? 30.769 4.394   7.317  1.00 23.30 ? 29  HIS A ND1 1 
ATOM   226  C  CD2 . HIS A 1 38  ? 28.933 3.400   7.957  1.00 24.68 ? 29  HIS A CD2 1 
ATOM   227  C  CE1 . HIS A 1 38  ? 30.340 3.673   6.294  1.00 24.87 ? 29  HIS A CE1 1 
ATOM   228  N  NE2 . HIS A 1 38  ? 29.227 3.059   6.652  1.00 24.88 ? 29  HIS A NE2 1 
ATOM   229  N  N   . GLY A 1 39  ? 33.107 4.133   10.042 1.00 24.15 ? 30  GLY A N   1 
ATOM   230  C  CA  . GLY A 1 39  ? 34.275 3.608   9.327  1.00 23.80 ? 30  GLY A CA  1 
ATOM   231  C  C   . GLY A 1 39  ? 35.293 2.856   10.171 1.00 24.28 ? 30  GLY A C   1 
ATOM   232  O  O   . GLY A 1 39  ? 36.189 2.202   9.630  1.00 24.38 ? 30  GLY A O   1 
ATOM   233  N  N   . LYS A 1 40  ? 35.191 2.967   11.499 1.00 23.12 ? 31  LYS A N   1 
ATOM   234  C  CA  . LYS A 1 40  ? 36.032 2.165   12.371 1.00 23.04 ? 31  LYS A CA  1 
ATOM   235  C  C   . LYS A 1 40  ? 35.192 1.165   13.179 1.00 22.79 ? 31  LYS A C   1 
ATOM   236  O  O   . LYS A 1 40  ? 35.441 -0.033  13.099 1.00 24.56 ? 31  LYS A O   1 
ATOM   237  C  CB  . LYS A 1 40  ? 36.889 3.049   13.294 1.00 25.64 ? 31  LYS A CB  1 
ATOM   238  C  CG  . LYS A 1 40  ? 37.816 4.041   12.535 1.00 30.62 ? 31  LYS A CG  1 
ATOM   239  C  CD  . LYS A 1 40  ? 38.977 3.310   11.970 1.00 33.68 ? 31  LYS A CD  1 
ATOM   240  C  CE  . LYS A 1 40  ? 39.935 4.207   11.149 1.00 36.21 ? 31  LYS A CE  1 
ATOM   241  N  NZ  . LYS A 1 40  ? 41.009 3.317   10.581 1.00 38.87 ? 31  LYS A NZ  1 
ATOM   242  N  N   . HIS A 1 41  ? 34.199 1.634   13.936 1.00 22.49 ? 32  HIS A N   1 
ATOM   243  C  CA  . HIS A 1 41  ? 33.456 0.733   14.857 1.00 21.80 ? 32  HIS A CA  1 
ATOM   244  C  C   . HIS A 1 41  ? 32.650 -0.304  14.044 1.00 22.32 ? 32  HIS A C   1 
ATOM   245  O  O   . HIS A 1 41  ? 32.784 -1.528  14.237 1.00 19.73 ? 32  HIS A O   1 
ATOM   246  C  CB  . HIS A 1 41  ? 32.564 1.513   15.850 1.00 20.51 ? 32  HIS A CB  1 
ATOM   247  C  CG  . HIS A 1 41  ? 33.311 2.199   16.963 1.00 21.03 ? 32  HIS A CG  1 
ATOM   248  N  ND1 . HIS A 1 41  ? 33.737 1.536   18.092 1.00 24.41 ? 32  HIS A ND1 1 
ATOM   249  C  CD2 . HIS A 1 41  ? 33.662 3.499   17.142 1.00 21.14 ? 32  HIS A CD2 1 
ATOM   250  C  CE1 . HIS A 1 41  ? 34.350 2.389   18.899 1.00 25.24 ? 32  HIS A CE1 1 
ATOM   251  N  NE2 . HIS A 1 41  ? 34.310 3.589   18.351 1.00 24.67 ? 32  HIS A NE2 1 
ATOM   252  N  N   . HIS A 1 42  ? 31.822 0.187   13.125 1.00 22.15 ? 33  HIS A N   1 
ATOM   253  C  CA  . HIS A 1 42  ? 30.948 -0.705  12.358 1.00 22.35 ? 33  HIS A CA  1 
ATOM   254  C  C   . HIS A 1 42  ? 31.784 -1.579  11.437 1.00 23.04 ? 33  HIS A C   1 
ATOM   255  O  O   . HIS A 1 42  ? 31.572 -2.772  11.384 1.00 23.48 ? 33  HIS A O   1 
ATOM   256  C  CB  . HIS A 1 42  ? 29.868 0.083   11.635 1.00 22.52 ? 33  HIS A CB  1 
ATOM   257  C  CG  . HIS A 1 42  ? 28.796 -0.761  10.990 1.00 21.96 ? 33  HIS A CG  1 
ATOM   258  N  ND1 . HIS A 1 42  ? 27.772 -0.211  10.242 1.00 22.50 ? 33  HIS A ND1 1 
ATOM   259  C  CD2 . HIS A 1 42  ? 28.610 -2.100  10.954 1.00 19.37 ? 33  HIS A CD2 1 
ATOM   260  C  CE1 . HIS A 1 42  ? 26.989 -1.182  9.796  1.00 21.43 ? 33  HIS A CE1 1 
ATOM   261  N  NE2 . HIS A 1 42  ? 27.475 -2.339  10.221 1.00 20.89 ? 33  HIS A NE2 1 
ATOM   262  N  N   . ALA A 1 43  ? 32.777 -0.996  10.779 1.00 22.29 ? 34  ALA A N   1 
ATOM   263  C  CA  . ALA A 1 43  ? 33.678 -1.765  9.934  1.00 23.00 ? 34  ALA A CA  1 
ATOM   264  C  C   . ALA A 1 43  ? 34.324 -2.939  10.706 1.00 23.52 ? 34  ALA A C   1 
ATOM   265  O  O   . ALA A 1 43  ? 34.476 -4.054  10.183 1.00 23.47 ? 34  ALA A O   1 
ATOM   266  C  CB  . ALA A 1 43  ? 34.741 -0.842  9.378  1.00 24.39 ? 34  ALA A CB  1 
ATOM   267  N  N   . THR A 1 44  ? 34.687 -2.679  11.952 1.00 22.86 ? 35  THR A N   1 
ATOM   268  C  CA  . THR A 1 44  ? 35.316 -3.709  12.811 1.00 23.52 ? 35  THR A CA  1 
ATOM   269  C  C   . THR A 1 44  ? 34.391 -4.879  13.169 1.00 23.62 ? 35  THR A C   1 
ATOM   270  O  O   . THR A 1 44  ? 34.832 -6.050  13.156 1.00 25.66 ? 35  THR A O   1 
ATOM   271  C  CB  . THR A 1 44  ? 35.928 -3.064  14.074 1.00 24.44 ? 35  THR A CB  1 
ATOM   272  O  OG1 . THR A 1 44  ? 37.085 -2.294  13.689 1.00 25.59 ? 35  THR A OG1 1 
ATOM   273  C  CG2 . THR A 1 44  ? 36.324 -4.122  15.094 1.00 24.90 ? 35  THR A CG2 1 
ATOM   274  N  N   . TYR A 1 45  ? 33.131 -4.587  13.489 1.00 21.94 ? 36  TYR A N   1 
ATOM   275  C  CA  . TYR A 1 45  ? 32.111 -5.627  13.672 1.00 21.91 ? 36  TYR A CA  1 
ATOM   276  C  C   . TYR A 1 45  ? 31.932 -6.491  12.415 1.00 22.68 ? 36  TYR A C   1 
ATOM   277  O  O   . TYR A 1 45  ? 31.851 -7.707  12.497 1.00 22.49 ? 36  TYR A O   1 
ATOM   278  C  CB  . TYR A 1 45  ? 30.778 -4.981  14.076 1.00 21.38 ? 36  TYR A CB  1 
ATOM   279  C  CG  . TYR A 1 45  ? 30.853 -4.359  15.474 1.00 21.60 ? 36  TYR A CG  1 
ATOM   280  C  CD1 . TYR A 1 45  ? 30.467 -3.057  15.696 1.00 22.64 ? 36  TYR A CD1 1 
ATOM   281  C  CD2 . TYR A 1 45  ? 31.309 -5.099  16.576 1.00 22.42 ? 36  TYR A CD2 1 
ATOM   282  C  CE1 . TYR A 1 45  ? 30.538 -2.476  17.007 1.00 21.56 ? 36  TYR A CE1 1 
ATOM   283  C  CE2 . TYR A 1 45  ? 31.360 -4.540  17.858 1.00 23.82 ? 36  TYR A CE2 1 
ATOM   284  C  CZ  . TYR A 1 45  ? 30.991 -3.231  18.061 1.00 23.20 ? 36  TYR A CZ  1 
ATOM   285  O  OH  . TYR A 1 45  ? 31.034 -2.670  19.337 1.00 30.29 ? 36  TYR A OH  1 
ATOM   286  N  N   . VAL A 1 46  ? 31.865 -5.853  11.251 1.00 21.62 ? 37  VAL A N   1 
ATOM   287  C  CA  . VAL A 1 46  ? 31.750 -6.633  10.017 1.00 22.96 ? 37  VAL A CA  1 
ATOM   288  C  C   . VAL A 1 46  ? 32.961 -7.559  9.789  1.00 22.11 ? 37  VAL A C   1 
ATOM   289  O  O   . VAL A 1 46  ? 32.811 -8.738  9.450  1.00 24.88 ? 37  VAL A O   1 
ATOM   290  C  CB  . VAL A 1 46  ? 31.532 -5.718  8.771  1.00 23.77 ? 37  VAL A CB  1 
ATOM   291  C  CG1 . VAL A 1 46  ? 31.600 -6.567  7.496  1.00 26.04 ? 37  VAL A CG1 1 
ATOM   292  C  CG2 . VAL A 1 46  ? 30.199 -5.014  8.866  1.00 23.52 ? 37  VAL A CG2 1 
ATOM   293  N  N   . ASN A 1 47  ? 34.158 -7.037  9.960  1.00 22.83 ? 38  ASN A N   1 
ATOM   294  C  CA  . ASN A 1 47  ? 35.362 -7.810  9.712  1.00 24.23 ? 38  ASN A CA  1 
ATOM   295  C  C   . ASN A 1 47  ? 35.479 -8.967  10.707 1.00 24.80 ? 38  ASN A C   1 
ATOM   296  O  O   . ASN A 1 47  ? 35.817 -10.100 10.344 1.00 23.65 ? 38  ASN A O   1 
ATOM   297  C  CB  . ASN A 1 47  ? 36.608 -6.904  9.791  1.00 26.17 ? 38  ASN A CB  1 
ATOM   298  C  CG  . ASN A 1 47  ? 36.663 -5.852  8.683  1.00 29.76 ? 38  ASN A CG  1 
ATOM   299  O  OD1 . ASN A 1 47  ? 36.122 -6.023  7.587  1.00 32.94 ? 38  ASN A OD1 1 
ATOM   300  N  ND2 . ASN A 1 47  ? 37.367 -4.776  8.961  1.00 33.59 ? 38  ASN A ND2 1 
ATOM   301  N  N   . ASN A 1 48  ? 35.192 -8.704  11.972 1.00 24.23 ? 39  ASN A N   1 
ATOM   302  C  CA  . ASN A 1 48  ? 35.236 -9.761  12.991 1.00 24.78 ? 39  ASN A CA  1 
ATOM   303  C  C   . ASN A 1 48  ? 34.158 -10.839 12.819 1.00 26.72 ? 39  ASN A C   1 
ATOM   304  O  O   . ASN A 1 48  ? 34.419 -12.034 13.084 1.00 27.25 ? 39  ASN A O   1 
ATOM   305  C  CB  . ASN A 1 48  ? 35.191 -9.129  14.387 1.00 24.22 ? 39  ASN A CB  1 
ATOM   306  C  CG  . ASN A 1 48  ? 36.457 -8.356  14.705 1.00 25.55 ? 39  ASN A CG  1 
ATOM   307  O  OD1 . ASN A 1 48  ? 37.433 -8.421  13.960 1.00 28.07 ? 39  ASN A OD1 1 
ATOM   308  N  ND2 . ASN A 1 48  ? 36.462 -7.647  15.814 1.00 25.72 ? 39  ASN A ND2 1 
ATOM   309  N  N   . LEU A 1 49  ? 32.977 -10.424 12.336 1.00 27.31 ? 40  LEU A N   1 
ATOM   310  C  CA  . LEU A 1 49  ? 31.872 -11.350 12.020 1.00 25.42 ? 40  LEU A CA  1 
ATOM   311  C  C   . LEU A 1 49  ? 32.315 -12.301 10.923 1.00 25.45 ? 40  LEU A C   1 
ATOM   312  O  O   . LEU A 1 49  ? 32.223 -13.530 11.090 1.00 24.56 ? 40  LEU A O   1 
ATOM   313  C  CB  . LEU A 1 49  ? 30.598 -10.573 11.617 1.00 25.45 ? 40  LEU A CB  1 
ATOM   314  C  CG  . LEU A 1 49  ? 29.393 -11.357 11.104 1.00 26.46 ? 40  LEU A CG  1 
ATOM   315  C  CD1 . LEU A 1 49  ? 28.973 -12.381 12.205 1.00 22.69 ? 40  LEU A CD1 1 
ATOM   316  C  CD2 . LEU A 1 49  ? 28.280 -10.428 10.706 1.00 26.97 ? 40  LEU A CD2 1 
ATOM   317  N  N   . ASN A 1 50  ? 32.807 -11.731 9.818  1.00 25.27 ? 41  ASN A N   1 
ATOM   318  C  CA  . ASN A 1 50  ? 33.373 -12.513 8.700  1.00 27.11 ? 41  ASN A CA  1 
ATOM   319  C  C   . ASN A 1 50  ? 34.541 -13.439 9.124  1.00 27.65 ? 41  ASN A C   1 
ATOM   320  O  O   . ASN A 1 50  ? 34.593 -14.599 8.715  1.00 28.22 ? 41  ASN A O   1 
ATOM   321  C  CB  . ASN A 1 50  ? 33.791 -11.578 7.537  1.00 26.99 ? 41  ASN A CB  1 
ATOM   322  C  CG  . ASN A 1 50  ? 32.599 -10.986 6.792  1.00 27.77 ? 41  ASN A CG  1 
ATOM   323  O  OD1 . ASN A 1 50  ? 31.540 -11.631 6.675  1.00 26.73 ? 41  ASN A OD1 1 
ATOM   324  N  ND2 . ASN A 1 50  ? 32.783 -9.791  6.227  1.00 26.47 ? 41  ASN A ND2 1 
ATOM   325  N  N   . ALA A 1 51  ? 35.430 -12.966 9.997  1.00 28.24 ? 42  ALA A N   1 
ATOM   326  C  CA  . ALA A 1 51  ? 36.499 -13.844 10.551 1.00 29.82 ? 42  ALA A CA  1 
ATOM   327  C  C   . ALA A 1 51  ? 35.965 -15.027 11.343 1.00 29.49 ? 42  ALA A C   1 
ATOM   328  O  O   . ALA A 1 51  ? 36.478 -16.130 11.208 1.00 29.87 ? 42  ALA A O   1 
ATOM   329  C  CB  . ALA A 1 51  ? 37.490 -13.071 11.412 1.00 31.22 ? 42  ALA A CB  1 
ATOM   330  N  N   . ALA A 1 52  ? 34.973 -14.797 12.198 1.00 29.84 ? 43  ALA A N   1 
ATOM   331  C  CA  . ALA A 1 52  ? 34.345 -15.857 12.986 1.00 31.18 ? 43  ALA A CA  1 
ATOM   332  C  C   . ALA A 1 52  ? 33.744 -16.973 12.091 1.00 32.54 ? 43  ALA A C   1 
ATOM   333  O  O   . ALA A 1 52  ? 33.856 -18.168 12.402 1.00 33.39 ? 43  ALA A O   1 
ATOM   334  C  CB  . ALA A 1 52  ? 33.271 -15.265 13.893 1.00 30.50 ? 43  ALA A CB  1 
ATOM   335  N  N   . LEU A 1 53  ? 33.163 -16.573 10.961 1.00 32.20 ? 44  LEU A N   1 
ATOM   336  C  CA  . LEU A 1 53  ? 32.420 -17.482 10.095 1.00 33.11 ? 44  LEU A CA  1 
ATOM   337  C  C   . LEU A 1 53  ? 33.241 -18.097 8.949  1.00 33.78 ? 44  LEU A C   1 
ATOM   338  O  O   . LEU A 1 53  ? 32.794 -19.061 8.320  1.00 32.88 ? 44  LEU A O   1 
ATOM   339  C  CB  . LEU A 1 53  ? 31.221 -16.754 9.514  1.00 31.42 ? 44  LEU A CB  1 
ATOM   340  C  CG  . LEU A 1 53  ? 30.103 -16.355 10.487 1.00 29.91 ? 44  LEU A CG  1 
ATOM   341  C  CD1 . LEU A 1 53  ? 29.234 -15.368 9.772  1.00 31.06 ? 44  LEU A CD1 1 
ATOM   342  C  CD2 . LEU A 1 53  ? 29.287 -17.534 10.966 1.00 30.79 ? 44  LEU A CD2 1 
ATOM   343  N  N   . GLU A 1 54  ? 34.415 -17.530 8.675  1.00 35.89 ? 45  GLU A N   1 
ATOM   344  C  CA  . GLU A 1 54  ? 35.319 -17.983 7.593  1.00 38.30 ? 45  GLU A CA  1 
ATOM   345  C  C   . GLU A 1 54  ? 35.268 -19.494 7.342  1.00 38.29 ? 45  GLU A C   1 
ATOM   346  O  O   . GLU A 1 54  ? 35.045 -19.948 6.221  1.00 36.73 ? 45  GLU A O   1 
ATOM   347  C  CB  . GLU A 1 54  ? 36.786 -17.662 7.966  1.00 39.95 ? 45  GLU A CB  1 
ATOM   348  C  CG  . GLU A 1 54  ? 37.416 -16.431 7.337  1.00 43.68 ? 45  GLU A CG  1 
ATOM   349  C  CD  . GLU A 1 54  ? 38.590 -15.858 8.171  1.00 44.53 ? 45  GLU A CD  1 
ATOM   350  O  OE1 . GLU A 1 54  ? 38.935 -16.434 9.235  1.00 50.23 ? 45  GLU A OE1 1 
ATOM   351  O  OE2 . GLU A 1 54  ? 39.143 -14.791 7.785  1.00 53.89 ? 45  GLU A OE2 1 
ATOM   352  N  N   . ASN A 1 55  ? 35.522 -20.246 8.408  1.00 38.52 ? 46  ASN A N   1 
ATOM   353  C  CA  . ASN A 1 55  ? 35.824 -21.661 8.319  1.00 39.81 ? 46  ASN A CA  1 
ATOM   354  C  C   . ASN A 1 55  ? 34.631 -22.560 8.687  1.00 39.79 ? 46  ASN A C   1 
ATOM   355  O  O   . ASN A 1 55  ? 34.800 -23.760 8.929  1.00 40.74 ? 46  ASN A O   1 
ATOM   356  C  CB  . ASN A 1 55  ? 37.027 -21.968 9.212  1.00 41.12 ? 46  ASN A CB  1 
ATOM   357  C  CG  . ASN A 1 55  ? 38.304 -21.330 8.708  1.00 45.99 ? 46  ASN A CG  1 
ATOM   358  O  OD1 . ASN A 1 55  ? 38.613 -21.391 7.518  1.00 50.91 ? 46  ASN A OD1 1 
ATOM   359  N  ND2 . ASN A 1 55  ? 39.056 -20.720 9.609  1.00 51.20 ? 46  ASN A ND2 1 
ATOM   360  N  N   . TYR A 1 56  ? 33.434 -21.979 8.716  1.00 38.14 ? 47  TYR A N   1 
ATOM   361  C  CA  . TYR A 1 56  ? 32.200 -22.727 8.987  1.00 38.08 ? 47  TYR A CA  1 
ATOM   362  C  C   . TYR A 1 56  ? 31.267 -22.532 7.798  1.00 38.04 ? 47  TYR A C   1 
ATOM   363  O  O   . TYR A 1 56  ? 30.281 -21.798 7.869  1.00 38.13 ? 47  TYR A O   1 
ATOM   364  C  CB  . TYR A 1 56  ? 31.526 -22.258 10.293 1.00 37.48 ? 47  TYR A CB  1 
ATOM   365  C  CG  . TYR A 1 56  ? 32.372 -22.364 11.553 1.00 37.97 ? 47  TYR A CG  1 
ATOM   366  C  CD1 . TYR A 1 56  ? 33.334 -21.409 11.859 1.00 36.43 ? 47  TYR A CD1 1 
ATOM   367  C  CD2 . TYR A 1 56  ? 32.203 -23.420 12.431 1.00 36.52 ? 47  TYR A CD2 1 
ATOM   368  C  CE1 . TYR A 1 56  ? 34.110 -21.520 13.019 1.00 37.42 ? 47  TYR A CE1 1 
ATOM   369  C  CE2 . TYR A 1 56  ? 32.950 -23.529 13.570 1.00 37.76 ? 47  TYR A CE2 1 
ATOM   370  C  CZ  . TYR A 1 56  ? 33.903 -22.578 13.871 1.00 36.60 ? 47  TYR A CZ  1 
ATOM   371  O  OH  . TYR A 1 56  ? 34.640 -22.719 15.028 1.00 38.10 ? 47  TYR A OH  1 
ATOM   372  N  N   . SER A 1 57  ? 31.578 -23.203 6.688  1.00 38.65 ? 48  SER A N   1 
ATOM   373  C  CA  . SER A 1 57  ? 30.847 -22.979 5.448  1.00 38.30 ? 48  SER A CA  1 
ATOM   374  C  C   . SER A 1 57  ? 29.397 -23.453 5.500  1.00 37.56 ? 48  SER A C   1 
ATOM   375  O  O   . SER A 1 57  ? 28.607 -23.045 4.661  1.00 37.53 ? 48  SER A O   1 
ATOM   376  C  CB  . SER A 1 57  ? 31.562 -23.636 4.276  1.00 39.73 ? 48  SER A CB  1 
ATOM   377  O  OG  . SER A 1 57  ? 31.697 -25.008 4.532  1.00 41.61 ? 48  SER A OG  1 
ATOM   378  N  N   . GLU A 1 58  ? 29.053 -24.295 6.480  1.00 36.83 ? 49  GLU A N   1 
ATOM   379  C  CA  . GLU A 1 58  ? 27.655 -24.660 6.730  1.00 37.34 ? 49  GLU A CA  1 
ATOM   380  C  C   . GLU A 1 58  ? 26.777 -23.476 7.160  1.00 36.63 ? 49  GLU A C   1 
ATOM   381  O  O   . GLU A 1 58  ? 25.542 -23.593 7.144  1.00 36.77 ? 49  GLU A O   1 
ATOM   382  C  CB  . GLU A 1 58  ? 27.529 -25.814 7.756  1.00 38.76 ? 49  GLU A CB  1 
ATOM   383  C  CG  . GLU A 1 58  ? 27.671 -25.459 9.269  1.00 42.19 ? 49  GLU A CG  1 
ATOM   384  C  CD  . GLU A 1 58  ? 29.121 -25.502 9.788  1.00 46.41 ? 49  GLU A CD  1 
ATOM   385  O  OE1 . GLU A 1 58  ? 30.072 -25.565 8.959  1.00 44.17 ? 49  GLU A OE1 1 
ATOM   386  O  OE2 . GLU A 1 58  ? 29.302 -25.477 11.037 1.00 50.25 ? 49  GLU A OE2 1 
ATOM   387  N  N   . LEU A 1 59  ? 27.398 -22.339 7.508  1.00 35.49 ? 50  LEU A N   1 
ATOM   388  C  CA  . LEU A 1 59  ? 26.661 -21.149 7.960  1.00 34.47 ? 50  LEU A CA  1 
ATOM   389  C  C   . LEU A 1 59  ? 26.675 -20.007 6.941  1.00 34.28 ? 50  LEU A C   1 
ATOM   390  O  O   . LEU A 1 59  ? 26.073 -18.942 7.176  1.00 33.31 ? 50  LEU A O   1 
ATOM   391  C  CB  . LEU A 1 59  ? 27.275 -20.645 9.276  1.00 33.02 ? 50  LEU A CB  1 
ATOM   392  C  CG  . LEU A 1 59  ? 27.325 -21.641 10.444 1.00 33.66 ? 50  LEU A CG  1 
ATOM   393  C  CD1 . LEU A 1 59  ? 28.045 -21.049 11.629 1.00 33.96 ? 50  LEU A CD1 1 
ATOM   394  C  CD2 . LEU A 1 59  ? 25.901 -22.040 10.831 1.00 35.89 ? 50  LEU A CD2 1 
ATOM   395  N  N   . HIS A 1 60  ? 27.324 -20.217 5.797  1.00 34.39 ? 51  HIS A N   1 
ATOM   396  C  CA  . HIS A 1 60  ? 27.573 -19.112 4.877  1.00 35.35 ? 51  HIS A CA  1 
ATOM   397  C  C   . HIS A 1 60  ? 26.326 -18.559 4.196  1.00 36.73 ? 51  HIS A C   1 
ATOM   398  O  O   . HIS A 1 60  ? 26.362 -17.448 3.681  1.00 39.02 ? 51  HIS A O   1 
ATOM   399  C  CB  . HIS A 1 60  ? 28.626 -19.461 3.816  1.00 35.96 ? 51  HIS A CB  1 
ATOM   400  C  CG  . HIS A 1 60  ? 30.026 -19.565 4.349  1.00 35.73 ? 51  HIS A CG  1 
ATOM   401  N  ND1 . HIS A 1 60  ? 30.362 -19.262 5.652  1.00 35.25 ? 51  HIS A ND1 1 
ATOM   402  C  CD2 . HIS A 1 60  ? 31.183 -19.902 3.733  1.00 36.11 ? 51  HIS A CD2 1 
ATOM   403  C  CE1 . HIS A 1 60  ? 31.661 -19.437 5.819  1.00 35.64 ? 51  HIS A CE1 1 
ATOM   404  N  NE2 . HIS A 1 60  ? 32.184 -19.822 4.668  1.00 37.57 ? 51  HIS A NE2 1 
ATOM   405  N  N   . ASN A 1 61  ? 25.222 -19.292 4.206  1.00 36.53 ? 52  ASN A N   1 
ATOM   406  C  CA  . ASN A 1 61  ? 23.996 -18.795 3.571  1.00 37.09 ? 52  ASN A CA  1 
ATOM   407  C  C   . ASN A 1 61  ? 22.951 -18.273 4.571  1.00 37.76 ? 52  ASN A C   1 
ATOM   408  O  O   . ASN A 1 61  ? 21.877 -17.836 4.167  1.00 37.41 ? 52  ASN A O   1 
ATOM   409  C  CB  . ASN A 1 61  ? 23.387 -19.878 2.693  1.00 38.88 ? 52  ASN A CB  1 
ATOM   410  C  CG  . ASN A 1 61  ? 24.152 -20.079 1.390  1.00 44.12 ? 52  ASN A CG  1 
ATOM   411  O  OD1 . ASN A 1 61  ? 24.523 -19.119 0.704  1.00 48.37 ? 52  ASN A OD1 1 
ATOM   412  N  ND2 . ASN A 1 61  ? 24.372 -21.343 1.032  1.00 51.40 ? 52  ASN A ND2 1 
ATOM   413  N  N   . LYS A 1 62  ? 23.277 -18.312 5.866  1.00 37.41 ? 53  LYS A N   1 
ATOM   414  C  CA  . LYS A 1 62  ? 22.387 -17.761 6.896  1.00 35.70 ? 53  LYS A CA  1 
ATOM   415  C  C   . LYS A 1 62  ? 22.359 -16.250 6.750  1.00 33.43 ? 53  LYS A C   1 
ATOM   416  O  O   . LYS A 1 62  ? 23.392 -15.612 6.546  1.00 31.98 ? 53  LYS A O   1 
ATOM   417  C  CB  . LYS A 1 62  ? 22.867 -18.103 8.318  1.00 36.49 ? 53  LYS A CB  1 
ATOM   418  C  CG  . LYS A 1 62  ? 23.020 -19.574 8.649  1.00 38.60 ? 53  LYS A CG  1 
ATOM   419  C  CD  . LYS A 1 62  ? 21.706 -20.308 8.524  1.00 40.35 ? 53  LYS A CD  1 
ATOM   420  C  CE  . LYS A 1 62  ? 21.680 -21.614 9.290  1.00 42.34 ? 53  LYS A CE  1 
ATOM   421  N  NZ  . LYS A 1 62  ? 20.710 -22.579 8.687  1.00 43.39 ? 53  LYS A NZ  1 
ATOM   422  N  N   . SER A 1 63  ? 21.179 -15.673 6.873  1.00 32.69 ? 54  SER A N   1 
ATOM   423  C  CA  . SER A 1 63  ? 21.065 -14.238 6.898  1.00 32.68 ? 54  SER A CA  1 
ATOM   424  C  C   . SER A 1 63  ? 21.440 -13.747 8.302  1.00 31.20 ? 54  SER A C   1 
ATOM   425  O  O   . SER A 1 63  ? 21.516 -14.505 9.273  1.00 29.45 ? 54  SER A O   1 
ATOM   426  C  CB  . SER A 1 63  ? 19.654 -13.785 6.548  1.00 32.33 ? 54  SER A CB  1 
ATOM   427  O  OG  . SER A 1 63  ? 18.751 -14.135 7.568  1.00 29.45 ? 54  SER A OG  1 
ATOM   428  N  N   . LEU A 1 64  ? 21.689 -12.466 8.400  1.00 31.34 ? 55  LEU A N   1 
ATOM   429  C  CA  . LEU A 1 64  ? 22.043 -11.888 9.691  1.00 31.29 ? 55  LEU A CA  1 
ATOM   430  C  C   . LEU A 1 64  ? 20.953 -12.171 10.766 1.00 31.15 ? 55  LEU A C   1 
ATOM   431  O  O   . LEU A 1 64  ? 21.253 -12.559 11.899 1.00 32.48 ? 55  LEU A O   1 
ATOM   432  C  CB  . LEU A 1 64  ? 22.249 -10.392 9.510  1.00 32.07 ? 55  LEU A CB  1 
ATOM   433  C  CG  . LEU A 1 64  ? 22.762 -9.612  10.705 1.00 29.73 ? 55  LEU A CG  1 
ATOM   434  C  CD1 . LEU A 1 64  ? 24.060 -10.195 11.241 1.00 24.69 ? 55  LEU A CD1 1 
ATOM   435  C  CD2 . LEU A 1 64  ? 22.942 -8.187  10.239 1.00 30.57 ? 55  LEU A CD2 1 
ATOM   436  N  N   . GLU A 1 65  ? 19.691 -12.005 10.382 1.00 30.61 ? 56  GLU A N   1 
ATOM   437  C  CA  . GLU A 1 65  ? 18.553 -12.328 11.249 1.00 31.93 ? 56  GLU A CA  1 
ATOM   438  C  C   . GLU A 1 65  ? 18.538 -13.771 11.703 1.00 32.10 ? 56  GLU A C   1 
ATOM   439  O  O   . GLU A 1 65  ? 18.279 -14.022 12.867 1.00 34.06 ? 56  GLU A O   1 
ATOM   440  C  CB  . GLU A 1 65  ? 17.229 -12.003 10.554 1.00 34.06 ? 56  GLU A CB  1 
ATOM   441  C  CG  . GLU A 1 65  ? 17.000 -10.501 10.322 1.00 38.47 ? 56  GLU A CG  1 
ATOM   442  C  CD  . GLU A 1 65  ? 18.024 -9.858  9.390  1.00 47.78 ? 56  GLU A CD  1 
ATOM   443  O  OE1 . GLU A 1 65  ? 18.493 -10.523 8.402  1.00 50.09 ? 56  GLU A OE1 1 
ATOM   444  O  OE2 . GLU A 1 65  ? 18.374 -8.673  9.658  1.00 53.71 ? 56  GLU A OE2 1 
ATOM   445  N  N   . GLU A 1 66  ? 18.821 -14.722 10.802 1.00 31.75 ? 57  GLU A N   1 
ATOM   446  C  CA  . GLU A 1 66  ? 18.795 -16.148 11.162 1.00 31.67 ? 57  GLU A CA  1 
ATOM   447  C  C   . GLU A 1 66  ? 19.855 -16.446 12.218 1.00 31.02 ? 57  GLU A C   1 
ATOM   448  O  O   . GLU A 1 66  ? 19.607 -17.164 13.196 1.00 32.56 ? 57  GLU A O   1 
ATOM   449  C  CB  . GLU A 1 66  ? 18.990 -17.055 9.923  1.00 32.19 ? 57  GLU A CB  1 
ATOM   450  C  CG  . GLU A 1 66  ? 17.731 -17.296 9.099  1.00 32.54 ? 57  GLU A CG  1 
ATOM   451  C  CD  . GLU A 1 66  ? 18.004 -17.879 7.693  1.00 35.02 ? 57  GLU A CD  1 
ATOM   452  O  OE1 . GLU A 1 66  ? 19.045 -17.553 7.076  1.00 34.71 ? 57  GLU A OE1 1 
ATOM   453  O  OE2 . GLU A 1 66  ? 17.144 -18.657 7.195  1.00 40.38 ? 57  GLU A OE2 1 
ATOM   454  N  N   . LEU A 1 67  ? 21.045 -15.892 12.018 1.00 29.07 ? 58  LEU A N   1 
ATOM   455  C  CA  . LEU A 1 67  ? 22.129 -16.053 12.981 1.00 30.10 ? 58  LEU A CA  1 
ATOM   456  C  C   . LEU A 1 67  ? 21.654 -15.560 14.351 1.00 28.42 ? 58  LEU A C   1 
ATOM   457  O  O   . LEU A 1 67  ? 21.761 -16.295 15.353 1.00 29.93 ? 58  LEU A O   1 
ATOM   458  C  CB  . LEU A 1 67  ? 23.381 -15.277 12.539 1.00 29.87 ? 58  LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 67  ? 24.564 -15.925 11.786 1.00 33.45 ? 58  LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 67  ? 24.326 -17.303 11.258 1.00 33.97 ? 58  LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 67  ? 25.115 -14.972 10.709 1.00 32.38 ? 58  LEU A CD2 1 
ATOM   462  N  N   . LEU A 1 68  ? 21.110 -14.349 14.387 1.00 27.15 ? 59  LEU A N   1 
ATOM   463  C  CA  . LEU A 1 68  ? 20.779 -13.690 15.673 1.00 30.18 ? 59  LEU A CA  1 
ATOM   464  C  C   . LEU A 1 68  ? 19.528 -14.284 16.347 1.00 31.98 ? 59  LEU A C   1 
ATOM   465  O  O   . LEU A 1 68  ? 19.363 -14.184 17.563 1.00 32.96 ? 59  LEU A O   1 
ATOM   466  C  CB  . LEU A 1 68  ? 20.639 -12.176 15.459 1.00 29.31 ? 59  LEU A CB  1 
ATOM   467  C  CG  . LEU A 1 68  ? 21.962 -11.495 15.056 1.00 27.69 ? 59  LEU A CG  1 
ATOM   468  C  CD1 . LEU A 1 68  ? 21.742 -9.973  14.841 1.00 30.79 ? 59  LEU A CD1 1 
ATOM   469  C  CD2 . LEU A 1 68  ? 23.083 -11.741 16.082 1.00 29.09 ? 59  LEU A CD2 1 
ATOM   470  N  N   . CYS A 1 69  ? 18.683 -14.939 15.550 1.00 32.47 ? 60  CYS A N   1 
ATOM   471  C  CA  . CYS A 1 69  ? 17.519 -15.671 16.061 1.00 34.60 ? 60  CYS A CA  1 
ATOM   472  C  C   . CYS A 1 69  ? 17.812 -17.081 16.580 1.00 36.55 ? 60  CYS A C   1 
ATOM   473  O  O   . CYS A 1 69  ? 16.940 -17.672 17.234 1.00 37.91 ? 60  CYS A O   1 
ATOM   474  C  CB  . CYS A 1 69  ? 16.455 -15.761 14.970 1.00 34.96 ? 60  CYS A CB  1 
ATOM   475  S  SG  . CYS A 1 69  ? 15.604 -14.187 14.740 1.00 38.55 ? 60  CYS A SG  1 
ATOM   476  N  N   . ASN A 1 70  ? 19.009 -17.617 16.297 1.00 36.23 ? 61  ASN A N   1 
ATOM   477  C  CA  . ASN A 1 70  ? 19.342 -19.026 16.560 1.00 37.18 ? 61  ASN A CA  1 
ATOM   478  C  C   . ASN A 1 70  ? 20.735 -19.219 17.181 1.00 36.05 ? 61  ASN A C   1 
ATOM   479  O  O   . ASN A 1 70  ? 21.461 -20.153 16.830 1.00 35.40 ? 61  ASN A O   1 
ATOM   480  C  CB  . ASN A 1 70  ? 19.203 -19.844 15.257 1.00 39.00 ? 61  ASN A CB  1 
ATOM   481  C  CG  . ASN A 1 70  ? 17.784 -19.742 14.638 1.00 42.98 ? 61  ASN A CG  1 
ATOM   482  O  OD1 . ASN A 1 70  ? 17.538 -18.963 13.693 1.00 44.28 ? 61  ASN A OD1 1 
ATOM   483  N  ND2 . ASN A 1 70  ? 16.850 -20.508 15.193 1.00 44.62 ? 61  ASN A ND2 1 
ATOM   484  N  N   . LEU A 1 71  ? 21.096 -18.345 18.124 1.00 34.79 ? 62  LEU A N   1 
ATOM   485  C  CA  . LEU A 1 71  ? 22.470 -18.300 18.627 1.00 35.85 ? 62  LEU A CA  1 
ATOM   486  C  C   . LEU A 1 71  ? 22.905 -19.561 19.356 1.00 34.91 ? 62  LEU A C   1 
ATOM   487  O  O   . LEU A 1 71  ? 24.065 -19.925 19.300 1.00 33.94 ? 62  LEU A O   1 
ATOM   488  C  CB  . LEU A 1 71  ? 22.719 -17.039 19.511 1.00 34.82 ? 62  LEU A CB  1 
ATOM   489  C  CG  . LEU A 1 71  ? 22.726 -15.684 18.775 1.00 34.17 ? 62  LEU A CG  1 
ATOM   490  C  CD1 . LEU A 1 71  ? 22.535 -14.512 19.734 1.00 33.53 ? 62  LEU A CD1 1 
ATOM   491  C  CD2 . LEU A 1 71  ? 23.999 -15.524 17.926 1.00 30.88 ? 62  LEU A CD2 1 
ATOM   492  N  N   . GLU A 1 72  ? 21.972 -20.234 20.025 1.00 36.90 ? 63  GLU A N   1 
ATOM   493  C  CA  . GLU A 1 72  ? 22.263 -21.500 20.757 1.00 38.09 ? 63  GLU A CA  1 
ATOM   494  C  C   . GLU A 1 72  ? 22.770 -22.617 19.867 1.00 38.28 ? 63  GLU A C   1 
ATOM   495  O  O   . GLU A 1 72  ? 23.449 -23.530 20.346 1.00 38.57 ? 63  GLU A O   1 
ATOM   496  C  CB  . GLU A 1 72  ? 21.029 -22.101 21.454 1.00 38.83 ? 63  GLU A CB  1 
ATOM   497  C  CG  . GLU A 1 72  ? 19.874 -21.194 21.665 1.00 43.52 ? 63  GLU A CG  1 
ATOM   498  C  CD  . GLU A 1 72  ? 19.057 -20.901 20.400 1.00 46.42 ? 63  GLU A CD  1 
ATOM   499  O  OE1 . GLU A 1 72  ? 18.331 -21.794 19.884 1.00 42.67 ? 63  GLU A OE1 1 
ATOM   500  O  OE2 . GLU A 1 72  ? 19.135 -19.739 19.952 1.00 51.79 ? 63  GLU A OE2 1 
ATOM   501  N  N   . THR A 1 73  ? 22.384 -22.594 18.598 1.00 38.73 ? 64  THR A N   1 
ATOM   502  C  CA  . THR A 1 73  ? 22.653 -23.723 17.725 1.00 39.12 ? 64  THR A CA  1 
ATOM   503  C  C   . THR A 1 73  ? 24.016 -23.612 17.043 1.00 39.60 ? 64  THR A C   1 
ATOM   504  O  O   . THR A 1 73  ? 24.435 -24.532 16.330 1.00 40.00 ? 64  THR A O   1 
ATOM   505  C  CB  . THR A 1 73  ? 21.560 -23.834 16.661 1.00 40.22 ? 64  THR A CB  1 
ATOM   506  O  OG1 . THR A 1 73  ? 21.712 -22.765 15.734 1.00 41.36 ? 64  THR A OG1 1 
ATOM   507  C  CG2 . THR A 1 73  ? 20.188 -23.734 17.302 1.00 41.64 ? 64  THR A CG2 1 
ATOM   508  N  N   . LEU A 1 74  ? 24.710 -22.492 17.261 1.00 39.49 ? 65  LEU A N   1 
ATOM   509  C  CA  . LEU A 1 74  ? 26.039 -22.273 16.681 1.00 38.63 ? 65  LEU A CA  1 
ATOM   510  C  C   . LEU A 1 74  ? 27.067 -23.055 17.463 1.00 39.05 ? 65  LEU A C   1 
ATOM   511  O  O   . LEU A 1 74  ? 26.876 -23.301 18.652 1.00 39.98 ? 65  LEU A O   1 
ATOM   512  C  CB  . LEU A 1 74  ? 26.408 -20.781 16.691 1.00 37.05 ? 65  LEU A CB  1 
ATOM   513  C  CG  . LEU A 1 74  ? 25.494 -19.860 15.874 1.00 36.22 ? 65  LEU A CG  1 
ATOM   514  C  CD1 . LEU A 1 74  ? 25.854 -18.382 16.070 1.00 37.29 ? 65  LEU A CD1 1 
ATOM   515  C  CD2 . LEU A 1 74  ? 25.579 -20.236 14.393 1.00 37.56 ? 65  LEU A CD2 1 
ATOM   516  N  N   . PRO A 1 75  ? 28.166 -23.447 16.806 1.00 39.71 ? 66  PRO A N   1 
ATOM   517  C  CA  . PRO A 1 75  ? 29.358 -23.973 17.477 1.00 39.21 ? 66  PRO A CA  1 
ATOM   518  C  C   . PRO A 1 75  ? 29.810 -23.079 18.655 1.00 39.96 ? 66  PRO A C   1 
ATOM   519  O  O   . PRO A 1 75  ? 29.857 -21.842 18.515 1.00 38.97 ? 66  PRO A O   1 
ATOM   520  C  CB  . PRO A 1 75  ? 30.396 -23.962 16.359 1.00 39.10 ? 66  PRO A CB  1 
ATOM   521  C  CG  . PRO A 1 75  ? 29.621 -24.147 15.131 1.00 39.99 ? 66  PRO A CG  1 
ATOM   522  C  CD  . PRO A 1 75  ? 28.331 -23.427 15.338 1.00 40.30 ? 66  PRO A CD  1 
ATOM   523  N  N   . LYS A 1 76  ? 30.107 -23.688 19.809 1.00 40.26 ? 67  LYS A N   1 
ATOM   524  C  CA  . LYS A 1 76  ? 30.470 -22.903 21.005 1.00 39.43 ? 67  LYS A CA  1 
ATOM   525  C  C   . LYS A 1 76  ? 31.701 -22.031 20.846 1.00 38.45 ? 67  LYS A C   1 
ATOM   526  O  O   . LYS A 1 76  ? 31.795 -20.978 21.460 1.00 39.03 ? 67  LYS A O   1 
ATOM   527  C  CB  . LYS A 1 76  ? 30.663 -23.827 22.214 1.00 40.92 ? 67  LYS A CB  1 
ATOM   528  C  CG  . LYS A 1 76  ? 29.360 -24.420 22.729 1.00 44.00 ? 67  LYS A CG  1 
ATOM   529  C  CD  . LYS A 1 76  ? 28.270 -23.343 22.879 1.00 44.95 ? 67  LYS A CD  1 
ATOM   530  C  CE  . LYS A 1 76  ? 27.108 -23.802 23.714 1.00 45.14 ? 67  LYS A CE  1 
ATOM   531  N  NZ  . LYS A 1 76  ? 25.940 -22.955 23.416 1.00 45.17 ? 67  LYS A NZ  1 
ATOM   532  N  N   . GLU A 1 77  ? 32.657 -22.482 20.049 1.00 38.35 ? 68  GLU A N   1 
ATOM   533  C  CA  . GLU A 1 77  ? 33.837 -21.688 19.721 1.00 37.82 ? 68  GLU A CA  1 
ATOM   534  C  C   . GLU A 1 77  ? 33.475 -20.319 19.152 1.00 35.96 ? 68  GLU A C   1 
ATOM   535  O  O   . GLU A 1 77  ? 34.299 -19.416 19.245 1.00 34.82 ? 68  GLU A O   1 
ATOM   536  C  CB  . GLU A 1 77  ? 34.746 -22.352 18.652 1.00 39.11 ? 68  GLU A CB  1 
ATOM   537  C  CG  . GLU A 1 77  ? 34.792 -23.815 18.631 1.00 42.34 ? 68  GLU A CG  1 
ATOM   538  C  CD  . GLU A 1 77  ? 33.681 -24.414 17.814 1.00 43.34 ? 68  GLU A CD  1 
ATOM   539  O  OE1 . GLU A 1 77  ? 33.774 -24.417 16.547 1.00 42.46 ? 68  GLU A OE1 1 
ATOM   540  O  OE2 . GLU A 1 77  ? 32.728 -24.893 18.464 1.00 41.57 ? 68  GLU A OE2 1 
ATOM   541  N  N   . ILE A 1 78  ? 32.301 -20.174 18.518 1.00 34.82 ? 69  ILE A N   1 
ATOM   542  C  CA  . ILE A 1 78  ? 31.982 -18.888 17.821 1.00 33.68 ? 69  ILE A CA  1 
ATOM   543  C  C   . ILE A 1 78  ? 30.696 -18.151 18.222 1.00 31.93 ? 69  ILE A C   1 
ATOM   544  O  O   . ILE A 1 78  ? 30.435 -17.041 17.735 1.00 31.67 ? 69  ILE A O   1 
ATOM   545  C  CB  . ILE A 1 78  ? 31.952 -19.058 16.272 1.00 34.17 ? 69  ILE A CB  1 
ATOM   546  C  CG1 . ILE A 1 78  ? 30.754 -19.911 15.851 1.00 30.79 ? 69  ILE A CG1 1 
ATOM   547  C  CG2 . ILE A 1 78  ? 33.317 -19.567 15.752 1.00 35.79 ? 69  ILE A CG2 1 
ATOM   548  C  CD1 . ILE A 1 78  ? 30.619 -20.072 14.351 1.00 33.01 ? 69  ILE A CD1 1 
ATOM   549  N  N   . VAL A 1 79  ? 29.884 -18.752 19.071 1.00 31.86 ? 70  VAL A N   1 
ATOM   550  C  CA  . VAL A 1 79  ? 28.624 -18.144 19.497 1.00 31.49 ? 70  VAL A CA  1 
ATOM   551  C  C   . VAL A 1 79  ? 28.826 -16.693 19.995 1.00 30.85 ? 70  VAL A C   1 
ATOM   552  O  O   . VAL A 1 79  ? 28.107 -15.790 19.578 1.00 28.19 ? 70  VAL A O   1 
ATOM   553  C  CB  . VAL A 1 79  ? 27.897 -19.016 20.569 1.00 32.32 ? 70  VAL A CB  1 
ATOM   554  C  CG1 . VAL A 1 79  ? 28.763 -19.226 21.809 1.00 34.95 ? 70  VAL A CG1 1 
ATOM   555  C  CG2 . VAL A 1 79  ? 26.569 -18.404 20.961 1.00 32.67 ? 70  VAL A CG2 1 
ATOM   556  N  N   . THR A 1 80  ? 29.823 -16.473 20.855 1.00 29.46 ? 71  THR A N   1 
ATOM   557  C  CA  . THR A 1 80  ? 30.043 -15.128 21.400 1.00 28.76 ? 71  THR A CA  1 
ATOM   558  C  C   . THR A 1 80  ? 30.414 -14.137 20.293 1.00 26.64 ? 71  THR A C   1 
ATOM   559  O  O   . THR A 1 80  ? 29.820 -13.075 20.203 1.00 26.91 ? 71  THR A O   1 
ATOM   560  C  CB  . THR A 1 80  ? 31.055 -15.137 22.518 1.00 29.03 ? 71  THR A CB  1 
ATOM   561  O  OG1 . THR A 1 80  ? 30.545 -15.943 23.581 1.00 30.17 ? 71  THR A OG1 1 
ATOM   562  C  CG2 . THR A 1 80  ? 31.293 -13.733 23.106 1.00 31.43 ? 71  THR A CG2 1 
ATOM   563  N  N   . ALA A 1 81  ? 31.379 -14.501 19.461 1.00 25.69 ? 72  ALA A N   1 
ATOM   564  C  CA  . ALA A 1 81  ? 31.810 -13.678 18.331 1.00 26.08 ? 72  ALA A CA  1 
ATOM   565  C  C   . ALA A 1 81  ? 30.655 -13.338 17.431 1.00 24.35 ? 72  ALA A C   1 
ATOM   566  O  O   . ALA A 1 81  ? 30.555 -12.212 16.928 1.00 23.13 ? 72  ALA A O   1 
ATOM   567  C  CB  . ALA A 1 81  ? 32.891 -14.394 17.530 1.00 28.36 ? 72  ALA A CB  1 
ATOM   568  N  N   . VAL A 1 82  ? 29.761 -14.288 17.201 1.00 23.92 ? 73  VAL A N   1 
ATOM   569  C  CA  . VAL A 1 82  ? 28.633 -14.006 16.320 1.00 23.60 ? 73  VAL A CA  1 
ATOM   570  C  C   . VAL A 1 82  ? 27.585 -13.150 17.026 1.00 22.85 ? 73  VAL A C   1 
ATOM   571  O  O   . VAL A 1 82  ? 27.008 -12.242 16.410 1.00 22.34 ? 73  VAL A O   1 
ATOM   572  C  CB  . VAL A 1 82  ? 28.023 -15.315 15.759 1.00 25.47 ? 73  VAL A CB  1 
ATOM   573  C  CG1 . VAL A 1 82  ? 26.718 -15.051 15.032 1.00 25.96 ? 73  VAL A CG1 1 
ATOM   574  C  CG2 . VAL A 1 82  ? 29.023 -16.017 14.886 1.00 27.84 ? 73  VAL A CG2 1 
ATOM   575  N  N   . ARG A 1 83  ? 27.332 -13.429 18.313 1.00 23.43 ? 74  ARG A N   1 
ATOM   576  C  CA  . ARG A 1 83  ? 26.441 -12.611 19.116 1.00 23.46 ? 74  ARG A CA  1 
ATOM   577  C  C   . ARG A 1 83  ? 26.877 -11.132 19.090 1.00 23.70 ? 74  ARG A C   1 
ATOM   578  O  O   . ARG A 1 83  ? 26.073 -10.231 18.782 1.00 24.09 ? 74  ARG A O   1 
ATOM   579  C  CB  . ARG A 1 83  ? 26.370 -13.124 20.569 1.00 24.00 ? 74  ARG A CB  1 
ATOM   580  C  CG  . ARG A 1 83  ? 25.441 -12.315 21.456 1.00 24.03 ? 74  ARG A CG  1 
ATOM   581  C  CD  . ARG A 1 83  ? 25.434 -12.939 22.830 1.00 25.09 ? 74  ARG A CD  1 
ATOM   582  N  NE  . ARG A 1 83  ? 24.711 -12.178 23.841 1.00 30.23 ? 74  ARG A NE  1 
ATOM   583  C  CZ  . ARG A 1 83  ? 24.470 -12.650 25.063 1.00 31.11 ? 74  ARG A CZ  1 
ATOM   584  N  NH1 . ARG A 1 83  ? 24.892 -13.873 25.390 1.00 35.25 ? 74  ARG A NH1 1 
ATOM   585  N  NH2 . ARG A 1 83  ? 23.808 -11.918 25.964 1.00 30.22 ? 74  ARG A NH2 1 
ATOM   586  N  N   . ASN A 1 84  ? 28.160 -10.909 19.383 1.00 24.13 ? 75  ASN A N   1 
ATOM   587  C  CA  . ASN A 1 84  ? 28.729 -9.587  19.564 1.00 23.25 ? 75  ASN A CA  1 
ATOM   588  C  C   . ASN A 1 84  ? 28.923 -8.881  18.212 1.00 23.24 ? 75  ASN A C   1 
ATOM   589  O  O   . ASN A 1 84  ? 28.491 -7.741  18.029 1.00 22.18 ? 75  ASN A O   1 
ATOM   590  C  CB  . ASN A 1 84  ? 30.056 -9.672  20.334 1.00 22.51 ? 75  ASN A CB  1 
ATOM   591  C  CG  . ASN A 1 84  ? 29.873 -10.029 21.843 1.00 23.90 ? 75  ASN A CG  1 
ATOM   592  O  OD1 . ASN A 1 84  ? 28.768 -10.005 22.388 1.00 25.46 ? 75  ASN A OD1 1 
ATOM   593  N  ND2 . ASN A 1 84  ? 30.985 -10.378 22.501 1.00 21.80 ? 75  ASN A ND2 1 
ATOM   594  N  N   . ASN A 1 85  ? 29.542 -9.562  17.247 1.00 21.96 ? 76  ASN A N   1 
ATOM   595  C  CA  . ASN A 1 85  ? 29.845 -8.889  15.976 1.00 23.32 ? 76  ASN A CA  1 
ATOM   596  C  C   . ASN A 1 85  ? 28.671 -8.875  14.983 1.00 22.98 ? 76  ASN A C   1 
ATOM   597  O  O   . ASN A 1 85  ? 28.457 -7.881  14.247 1.00 22.91 ? 76  ASN A O   1 
ATOM   598  C  CB  . ASN A 1 85  ? 31.113 -9.469  15.375 1.00 24.70 ? 76  ASN A CB  1 
ATOM   599  C  CG  . ASN A 1 85  ? 32.317 -9.234  16.229 1.00 26.14 ? 76  ASN A CG  1 
ATOM   600  O  OD1 . ASN A 1 85  ? 32.766 -8.092  16.373 1.00 27.75 ? 76  ASN A OD1 1 
ATOM   601  N  ND2 . ASN A 1 85  ? 32.868 -10.325 16.824 1.00 29.01 ? 76  ASN A ND2 1 
ATOM   602  N  N   . GLY A 1 86  ? 27.908 -9.970  14.956 1.00 23.10 ? 77  GLY A N   1 
ATOM   603  C  CA  . GLY A 1 86  ? 26.608 -9.997  14.285 1.00 22.55 ? 77  GLY A CA  1 
ATOM   604  C  C   . GLY A 1 86  ? 25.651 -8.958  14.834 1.00 23.30 ? 77  GLY A C   1 
ATOM   605  O  O   . GLY A 1 86  ? 25.044 -8.182  14.094 1.00 24.02 ? 77  GLY A O   1 
ATOM   606  N  N   . GLY A 1 87  ? 25.566 -8.897  16.156 1.00 23.28 ? 78  GLY A N   1 
ATOM   607  C  CA  . GLY A 1 87  ? 24.791 -7.844  16.791 1.00 22.20 ? 78  GLY A CA  1 
ATOM   608  C  C   . GLY A 1 87  ? 25.277 -6.470  16.355 1.00 21.87 ? 78  GLY A C   1 
ATOM   609  O  O   . GLY A 1 87  ? 24.491 -5.595  16.070 1.00 22.89 ? 78  GLY A O   1 
ATOM   610  N  N   . GLY A 1 88  ? 26.587 -6.265  16.337 1.00 20.74 ? 79  GLY A N   1 
ATOM   611  C  CA  . GLY A 1 88  ? 27.133 -4.946  16.019 1.00 20.94 ? 79  GLY A CA  1 
ATOM   612  C  C   . GLY A 1 88  ? 26.769 -4.577  14.605 1.00 21.81 ? 79  GLY A C   1 
ATOM   613  O  O   . GLY A 1 88  ? 26.367 -3.466  14.317 1.00 22.23 ? 79  GLY A O   1 
ATOM   614  N  N   . HIS A 1 89  ? 26.879 -5.548  13.711 1.00 21.63 ? 80  HIS A N   1 
ATOM   615  C  CA  . HIS A 1 89  ? 26.504 -5.306  12.319 1.00 20.73 ? 80  HIS A CA  1 
ATOM   616  C  C   . HIS A 1 89  ? 25.008 -4.939  12.236 1.00 19.75 ? 80  HIS A C   1 
ATOM   617  O  O   . HIS A 1 89  ? 24.644 -3.931  11.615 1.00 20.91 ? 80  HIS A O   1 
ATOM   618  C  CB  . HIS A 1 89  ? 26.847 -6.521  11.456 1.00 21.12 ? 80  HIS A CB  1 
ATOM   619  C  CG  . HIS A 1 89  ? 26.675 -6.296  9.983  1.00 22.57 ? 80  HIS A CG  1 
ATOM   620  N  ND1 . HIS A 1 89  ? 26.717 -5.048  9.404  1.00 21.71 ? 80  HIS A ND1 1 
ATOM   621  C  CD2 . HIS A 1 89  ? 26.472 -7.171  8.965  1.00 24.37 ? 80  HIS A CD2 1 
ATOM   622  C  CE1 . HIS A 1 89  ? 26.542 -5.158  8.095  1.00 24.76 ? 80  HIS A CE1 1 
ATOM   623  N  NE2 . HIS A 1 89  ? 26.394 -6.435  7.802  1.00 24.53 ? 80  HIS A NE2 1 
ATOM   624  N  N   . TYR A 1 90  ? 24.161 -5.726  12.868 1.00 20.62 ? 81  TYR A N   1 
ATOM   625  C  CA  . TYR A 1 90  ? 22.702 -5.510  12.813 1.00 22.31 ? 81  TYR A CA  1 
ATOM   626  C  C   . TYR A 1 90  ? 22.308 -4.132  13.386 1.00 21.37 ? 81  TYR A C   1 
ATOM   627  O  O   . TYR A 1 90  ? 21.576 -3.362  12.753 1.00 21.87 ? 81  TYR A O   1 
ATOM   628  C  CB  . TYR A 1 90  ? 21.933 -6.638  13.547 1.00 23.96 ? 81  TYR A CB  1 
ATOM   629  C  CG  . TYR A 1 90  ? 20.437 -6.418  13.530 1.00 22.57 ? 81  TYR A CG  1 
ATOM   630  C  CD1 . TYR A 1 90  ? 19.665 -6.902  12.496 1.00 23.02 ? 81  TYR A CD1 1 
ATOM   631  C  CD2 . TYR A 1 90  ? 19.815 -5.670  14.515 1.00 22.40 ? 81  TYR A CD2 1 
ATOM   632  C  CE1 . TYR A 1 90  ? 18.316 -6.659  12.441 1.00 25.02 ? 81  TYR A CE1 1 
ATOM   633  C  CE2 . TYR A 1 90  ? 18.453 -5.426  14.477 1.00 25.57 ? 81  TYR A CE2 1 
ATOM   634  C  CZ  . TYR A 1 90  ? 17.700 -5.928  13.429 1.00 25.95 ? 81  TYR A CZ  1 
ATOM   635  O  OH  . TYR A 1 90  ? 16.331 -5.705  13.346 1.00 26.80 ? 81  TYR A OH  1 
ATOM   636  N  N   . CYS A 1 91  ? 22.781 -3.832  14.583 1.00 21.53 ? 82  CYS A N   1 
ATOM   637  C  CA  . CYS A 1 91  ? 22.358 -2.623  15.289 1.00 21.42 ? 82  CYS A CA  1 
ATOM   638  C  C   . CYS A 1 91  ? 22.785 -1.334  14.566 1.00 19.92 ? 82  CYS A C   1 
ATOM   639  O  O   . CYS A 1 91  ? 22.026 -0.390  14.495 1.00 20.56 ? 82  CYS A O   1 
ATOM   640  C  CB  . CYS A 1 91  ? 22.915 -2.632  16.717 1.00 20.15 ? 82  CYS A CB  1 
ATOM   641  S  SG  . CYS A 1 91  ? 22.237 -3.952  17.778 1.00 20.80 ? 82  CYS A SG  1 
ATOM   642  N  N   . HIS A 1 92  ? 24.014 -1.304  14.062 1.00 19.31 ? 83  HIS A N   1 
ATOM   643  C  CA  . HIS A 1 92  ? 24.552 -0.107  13.419 1.00 21.06 ? 83  HIS A CA  1 
ATOM   644  C  C   . HIS A 1 92  ? 23.895 0.093   12.065 1.00 22.25 ? 83  HIS A C   1 
ATOM   645  O  O   . HIS A 1 92  ? 23.562 1.239   11.674 1.00 21.48 ? 83  HIS A O   1 
ATOM   646  C  CB  . HIS A 1 92  ? 26.105 -0.146  13.342 1.00 21.66 ? 83  HIS A CB  1 
ATOM   647  C  CG  . HIS A 1 92  ? 26.786 0.106   14.656 1.00 20.01 ? 83  HIS A CG  1 
ATOM   648  N  ND1 . HIS A 1 92  ? 27.152 -0.919  15.503 1.00 20.84 ? 83  HIS A ND1 1 
ATOM   649  C  CD2 . HIS A 1 92  ? 27.100 1.268   15.310 1.00 21.38 ? 83  HIS A CD2 1 
ATOM   650  C  CE1 . HIS A 1 92  ? 27.708 -0.399  16.595 1.00 23.72 ? 83  HIS A CE1 1 
ATOM   651  N  NE2 . HIS A 1 92  ? 27.658 0.925   16.520 1.00 21.37 ? 83  HIS A NE2 1 
ATOM   652  N  N   . SER A 1 93  ? 23.656 -1.018  11.357 1.00 23.16 ? 84  SER A N   1 
ATOM   653  C  CA  . SER A 1 93  ? 23.000 -0.931  10.037 1.00 22.74 ? 84  SER A CA  1 
ATOM   654  C  C   . SER A 1 93  ? 21.636 -0.281  10.191 1.00 22.70 ? 84  SER A C   1 
ATOM   655  O  O   . SER A 1 93  ? 21.268 0.601   9.413  1.00 23.49 ? 84  SER A O   1 
ATOM   656  C  CB  . SER A 1 93  ? 22.875 -2.286  9.364  1.00 22.93 ? 84  SER A CB  1 
ATOM   657  O  OG  . SER A 1 93  ? 24.149 -2.867  9.081  1.00 24.45 ? 84  SER A OG  1 
ATOM   658  N  N   . LEU A 1 94  ? 20.879 -0.686  11.205 1.00 23.26 ? 85  LEU A N   1 
ATOM   659  C  CA  . LEU A 1 94  ? 19.569 -0.069  11.416 1.00 22.41 ? 85  LEU A CA  1 
ATOM   660  C  C   . LEU A 1 94  ? 19.706 1.387   11.875 1.00 22.44 ? 85  LEU A C   1 
ATOM   661  O  O   . LEU A 1 94  ? 18.952 2.272   11.405 1.00 24.49 ? 85  LEU A O   1 
ATOM   662  C  CB  . LEU A 1 94  ? 18.738 -0.915  12.399 1.00 23.45 ? 85  LEU A CB  1 
ATOM   663  C  CG  . LEU A 1 94  ? 17.211 -0.877  12.432 1.00 28.17 ? 85  LEU A CG  1 
ATOM   664  C  CD1 . LEU A 1 94  ? 16.714 -1.055  13.864 1.00 27.21 ? 85  LEU A CD1 1 
ATOM   665  C  CD2 . LEU A 1 94  ? 16.608 0.317   11.798 1.00 30.79 ? 85  LEU A CD2 1 
ATOM   666  N  N   . PHE A 1 95  ? 20.651 1.661   12.770 1.00 21.53 ? 86  PHE A N   1 
ATOM   667  C  CA  . PHE A 1 95  ? 20.894 3.017   13.284 1.00 22.06 ? 86  PHE A CA  1 
ATOM   668  C  C   . PHE A 1 95  ? 21.119 4.028   12.115 1.00 22.02 ? 86  PHE A C   1 
ATOM   669  O  O   . PHE A 1 95  ? 20.488 5.100   12.068 1.00 22.81 ? 86  PHE A O   1 
ATOM   670  C  CB  . PHE A 1 95  ? 22.099 2.966   14.220 1.00 21.13 ? 86  PHE A CB  1 
ATOM   671  C  CG  . PHE A 1 95  ? 22.359 4.234   14.995 1.00 21.92 ? 86  PHE A CG  1 
ATOM   672  C  CD1 . PHE A 1 95  ? 21.356 4.852   15.743 1.00 22.44 ? 86  PHE A CD1 1 
ATOM   673  C  CD2 . PHE A 1 95  ? 23.646 4.779   15.036 1.00 25.11 ? 86  PHE A CD2 1 
ATOM   674  C  CE1 . PHE A 1 95  ? 21.625 6.026   16.477 1.00 20.56 ? 86  PHE A CE1 1 
ATOM   675  C  CE2 . PHE A 1 95  ? 23.911 5.922   15.755 1.00 22.91 ? 86  PHE A CE2 1 
ATOM   676  C  CZ  . PHE A 1 95  ? 22.895 6.554   16.486 1.00 20.54 ? 86  PHE A CZ  1 
ATOM   677  N  N   . TRP A 1 96  ? 21.954 3.664   11.134 1.00 23.73 ? 87  TRP A N   1 
ATOM   678  C  CA  . TRP A 1 96  ? 22.227 4.595   10.019 1.00 23.47 ? 87  TRP A CA  1 
ATOM   679  C  C   . TRP A 1 96  ? 20.975 4.852   9.172  1.00 23.92 ? 87  TRP A C   1 
ATOM   680  O  O   . TRP A 1 96  ? 20.768 5.968   8.673  1.00 24.32 ? 87  TRP A O   1 
ATOM   681  C  CB  . TRP A 1 96  ? 23.359 4.146   9.114  1.00 23.15 ? 87  TRP A CB  1 
ATOM   682  C  CG  . TRP A 1 96  ? 24.594 3.667   9.759  1.00 20.80 ? 87  TRP A CG  1 
ATOM   683  C  CD1 . TRP A 1 96  ? 25.262 2.510   9.457  1.00 22.20 ? 87  TRP A CD1 1 
ATOM   684  C  CD2 . TRP A 1 96  ? 25.336 4.303   10.805 1.00 20.59 ? 87  TRP A CD2 1 
ATOM   685  N  NE1 . TRP A 1 96  ? 26.384 2.390   10.250 1.00 21.28 ? 87  TRP A NE1 1 
ATOM   686  C  CE2 . TRP A 1 96  ? 26.436 3.447   11.114 1.00 19.04 ? 87  TRP A CE2 1 
ATOM   687  C  CE3 . TRP A 1 96  ? 25.176 5.492   11.540 1.00 20.73 ? 87  TRP A CE3 1 
ATOM   688  C  CZ2 . TRP A 1 96  ? 27.367 3.752   12.121 1.00 19.89 ? 87  TRP A CZ2 1 
ATOM   689  C  CZ3 . TRP A 1 96  ? 26.106 5.789   12.529 1.00 22.30 ? 87  TRP A CZ3 1 
ATOM   690  C  CH2 . TRP A 1 96  ? 27.186 4.915   12.802 1.00 21.21 ? 87  TRP A CH2 1 
ATOM   691  N  N   . GLU A 1 97  ? 20.141 3.833   9.025  1.00 24.16 ? 88  GLU A N   1 
ATOM   692  C  CA  . GLU A 1 97  ? 18.944 3.933   8.187  1.00 25.73 ? 88  GLU A CA  1 
ATOM   693  C  C   . GLU A 1 97  ? 17.857 4.841   8.790  1.00 26.19 ? 88  GLU A C   1 
ATOM   694  O  O   . GLU A 1 97  ? 17.120 5.546   8.079  1.00 26.11 ? 88  GLU A O   1 
ATOM   695  C  CB  . GLU A 1 97  ? 18.378 2.538   7.888  1.00 25.79 ? 88  GLU A CB  1 
ATOM   696  C  CG  . GLU A 1 97  ? 19.319 1.661   7.120  1.00 28.08 ? 88  GLU A CG  1 
ATOM   697  C  CD  . GLU A 1 97  ? 18.731 0.298   6.746  1.00 31.70 ? 88  GLU A CD  1 
ATOM   698  O  OE1 . GLU A 1 97  ? 19.019 -0.160  5.616  1.00 40.37 ? 88  GLU A OE1 1 
ATOM   699  O  OE2 . GLU A 1 97  ? 17.998 -0.330  7.559  1.00 34.90 ? 88  GLU A OE2 1 
ATOM   700  N  N   . VAL A 1 98  ? 17.754 4.844   10.104 1.00 24.53 ? 89  VAL A N   1 
ATOM   701  C  CA  . VAL A 1 98  ? 16.728 5.625   10.772 1.00 26.27 ? 89  VAL A CA  1 
ATOM   702  C  C   . VAL A 1 98  ? 17.141 7.058   11.153 1.00 26.90 ? 89  VAL A C   1 
ATOM   703  O  O   . VAL A 1 98  ? 16.395 7.758   11.820 1.00 27.41 ? 89  VAL A O   1 
ATOM   704  C  CB  . VAL A 1 98  ? 16.185 4.865   12.002 1.00 27.12 ? 89  VAL A CB  1 
ATOM   705  C  CG1 . VAL A 1 98  ? 15.599 3.565   11.565 1.00 27.56 ? 89  VAL A CG1 1 
ATOM   706  C  CG2 . VAL A 1 98  ? 17.249 4.655   13.077 1.00 26.10 ? 89  VAL A CG2 1 
ATOM   707  N  N   . MET A 1 99  ? 18.296 7.524   10.676 1.00 27.27 ? 90  MET A N   1 
ATOM   708  C  CA  . MET A 1 99  ? 18.653 8.938   10.748 1.00 26.51 ? 90  MET A CA  1 
ATOM   709  C  C   . MET A 1 99  ? 18.783 9.511   9.336  1.00 26.58 ? 90  MET A C   1 
ATOM   710  O  O   . MET A 1 99  ? 19.012 8.752   8.368  1.00 25.16 ? 90  MET A O   1 
ATOM   711  C  CB  . MET A 1 99  ? 19.978 9.112   11.481 1.00 27.28 ? 90  MET A CB  1 
ATOM   712  C  CG  . MET A 1 99  ? 19.984 8.496   12.891 1.00 24.21 ? 90  MET A CG  1 
ATOM   713  S  SD  . MET A 1 99  ? 21.441 8.981   13.853 1.00 26.16 ? 90  MET A SD  1 
ATOM   714  C  CE  . MET A 1 99  ? 22.654 7.918   13.046 1.00 22.90 ? 90  MET A CE  1 
ATOM   715  N  N   . SER A 1 100 ? 18.631 10.837  9.242  1.00 27.56 ? 91  SER A N   1 
ATOM   716  C  CA  . SER A 1 100 ? 18.589 11.567  7.947  1.00 29.30 ? 91  SER A CA  1 
ATOM   717  C  C   . SER A 1 100 ? 19.024 13.035  8.110  1.00 30.37 ? 91  SER A C   1 
ATOM   718  O  O   . SER A 1 100 ? 18.770 13.657  9.160  1.00 29.80 ? 91  SER A O   1 
ATOM   719  C  CB  . SER A 1 100 ? 17.162 11.543  7.386  1.00 30.45 ? 91  SER A CB  1 
ATOM   720  O  OG  . SER A 1 100 ? 17.085 12.182  6.115  1.00 32.74 ? 91  SER A OG  1 
ATOM   721  N  N   . PRO A 1 101 ? 19.696 13.606  7.087  1.00 31.43 ? 92  PRO A N   1 
ATOM   722  C  CA  . PRO A 1 101 ? 19.896 15.062  7.068  1.00 32.60 ? 92  PRO A CA  1 
ATOM   723  C  C   . PRO A 1 101 ? 18.597 15.884  6.986  1.00 33.45 ? 92  PRO A C   1 
ATOM   724  O  O   . PRO A 1 101 ? 18.593 17.060  7.293  1.00 34.42 ? 92  PRO A O   1 
ATOM   725  C  CB  . PRO A 1 101 ? 20.759 15.303  5.818  1.00 33.29 ? 92  PRO A CB  1 
ATOM   726  C  CG  . PRO A 1 101 ? 20.772 14.077  5.053  1.00 33.45 ? 92  PRO A CG  1 
ATOM   727  C  CD  . PRO A 1 101 ? 20.379 12.931  5.968  1.00 30.94 ? 92  PRO A CD  1 
ATOM   728  N  N   . ARG A 1 102 ? 17.498 15.291  6.581  1.00 34.29 ? 93  ARG A N   1 
ATOM   729  C  CA  . ARG A 1 102 ? 16.233 16.025  6.644  1.00 36.40 ? 93  ARG A CA  1 
ATOM   730  C  C   . ARG A 1 102 ? 15.215 15.209  7.403  1.00 37.12 ? 93  ARG A C   1 
ATOM   731  O  O   . ARG A 1 102 ? 14.133 14.926  6.917  1.00 38.17 ? 93  ARG A O   1 
ATOM   732  C  CB  . ARG A 1 102 ? 15.762 16.437  5.237  1.00 38.40 ? 93  ARG A CB  1 
ATOM   733  C  CG  . ARG A 1 102 ? 15.618 15.317  4.255  1.00 44.03 ? 93  ARG A CG  1 
ATOM   734  C  CD  . ARG A 1 102 ? 16.439 15.593  2.996  1.00 52.94 ? 93  ARG A CD  1 
ATOM   735  N  NE  . ARG A 1 102 ? 16.364 14.484  2.042  1.00 48.43 ? 93  ARG A NE  1 
ATOM   736  C  CZ  . ARG A 1 102 ? 16.945 13.295  2.209  1.00 55.54 ? 93  ARG A CZ  1 
ATOM   737  N  NH1 . ARG A 1 102 ? 17.653 13.013  3.307  1.00 55.42 ? 93  ARG A NH1 1 
ATOM   738  N  NH2 . ARG A 1 102 ? 16.811 12.364  1.269  1.00 57.50 ? 93  ARG A NH2 1 
ATOM   739  N  N   . GLY A 1 103 ? 15.577 14.855  8.635  1.00 37.00 ? 94  GLY A N   1 
ATOM   740  C  CA  . GLY A 1 103 ? 14.666 14.131  9.515  1.00 35.49 ? 94  GLY A CA  1 
ATOM   741  C  C   . GLY A 1 103 ? 14.147 15.002  10.638 1.00 34.66 ? 94  GLY A C   1 
ATOM   742  O  O   . GLY A 1 103 ? 14.149 16.210  10.547 1.00 34.12 ? 94  GLY A O   1 
ATOM   743  N  N   . GLY A 1 104 ? 13.727 14.380  11.729 1.00 33.75 ? 95  GLY A N   1 
ATOM   744  C  CA  . GLY A 1 104 ? 13.190 15.116  12.847 1.00 35.28 ? 95  GLY A CA  1 
ATOM   745  C  C   . GLY A 1 104 ? 11.687 15.323  12.705 1.00 35.19 ? 95  GLY A C   1 
ATOM   746  O  O   . GLY A 1 104 ? 11.018 14.688  11.887 1.00 34.08 ? 95  GLY A O   1 
ATOM   747  N  N   . GLY A 1 105 ? 11.150 16.193  13.540 1.00 36.39 ? 96  GLY A N   1 
ATOM   748  C  CA  . GLY A 1 105 ? 9.701  16.419  13.534 1.00 37.01 ? 96  GLY A CA  1 
ATOM   749  C  C   . GLY A 1 105 ? 8.915  15.214  14.010 1.00 37.64 ? 96  GLY A C   1 
ATOM   750  O  O   . GLY A 1 105 ? 9.463  14.323  14.651 1.00 37.54 ? 96  GLY A O   1 
ATOM   751  N  N   . GLU A 1 106 ? 7.625  15.187  13.688 1.00 38.33 ? 97  GLU A N   1 
ATOM   752  C  CA  . GLU A 1 106 ? 6.705  14.155  14.208 1.00 38.98 ? 97  GLU A CA  1 
ATOM   753  C  C   . GLU A 1 106 ? 6.617  12.976  13.261 1.00 36.76 ? 97  GLU A C   1 
ATOM   754  O  O   . GLU A 1 106 ? 6.822  13.140  12.055 1.00 36.12 ? 97  GLU A O   1 
ATOM   755  C  CB  . GLU A 1 106 ? 5.282  14.700  14.339 1.00 39.69 ? 97  GLU A CB  1 
ATOM   756  C  CG  . GLU A 1 106 ? 5.133  15.992  15.084 1.00 43.01 ? 97  GLU A CG  1 
ATOM   757  C  CD  . GLU A 1 106 ? 3.897  16.786  14.599 1.00 44.47 ? 97  GLU A CD  1 
ATOM   758  O  OE1 . GLU A 1 106 ? 2.787  16.212  14.581 1.00 53.10 ? 97  GLU A OE1 1 
ATOM   759  O  OE2 . GLU A 1 106 ? 4.031  17.978  14.225 1.00 52.99 ? 97  GLU A OE2 1 
ATOM   760  N  N   . PRO A 1 107 ? 6.230  11.799  13.778 1.00 36.26 ? 98  PRO A N   1 
ATOM   761  C  CA  . PRO A 1 107 ? 5.951  10.696  12.870 1.00 37.19 ? 98  PRO A CA  1 
ATOM   762  C  C   . PRO A 1 107 ? 4.857  11.045  11.852 1.00 37.61 ? 98  PRO A C   1 
ATOM   763  O  O   . PRO A 1 107 ? 3.956  11.840  12.155 1.00 36.24 ? 98  PRO A O   1 
ATOM   764  C  CB  . PRO A 1 107 ? 5.466  9.580   13.797 1.00 36.79 ? 98  PRO A CB  1 
ATOM   765  C  CG  . PRO A 1 107 ? 5.980  9.954   15.191 1.00 37.13 ? 98  PRO A CG  1 
ATOM   766  C  CD  . PRO A 1 107 ? 5.997  11.448  15.192 1.00 36.19 ? 98  PRO A CD  1 
ATOM   767  N  N   . ASN A 1 108 ? 4.959  10.430  10.675 1.00 37.70 ? 99  ASN A N   1 
ATOM   768  C  CA  . ASN A 1 108 ? 3.987  10.534  9.599  1.00 38.80 ? 99  ASN A CA  1 
ATOM   769  C  C   . ASN A 1 108 ? 3.548  9.141   9.164  1.00 39.19 ? 99  ASN A C   1 
ATOM   770  O  O   . ASN A 1 108 ? 4.123  8.132   9.584  1.00 39.03 ? 99  ASN A O   1 
ATOM   771  C  CB  . ASN A 1 108 ? 4.598  11.270  8.400  1.00 39.30 ? 99  ASN A CB  1 
ATOM   772  C  CG  . ASN A 1 108 ? 5.916  10.645  7.918  1.00 42.15 ? 99  ASN A CG  1 
ATOM   773  O  OD1 . ASN A 1 108 ? 5.937  9.552   7.352  1.00 47.71 ? 99  ASN A OD1 1 
ATOM   774  N  ND2 . ASN A 1 108 ? 7.017  11.365  8.109  1.00 42.79 ? 99  ASN A ND2 1 
ATOM   775  N  N   . GLY A 1 109 ? 2.546  9.077   8.291  1.00 39.47 ? 100 GLY A N   1 
ATOM   776  C  CA  . GLY A 1 109 ? 2.140  7.805   7.705  1.00 38.71 ? 100 GLY A CA  1 
ATOM   777  C  C   . GLY A 1 109 ? 1.428  6.875   8.666  1.00 39.09 ? 100 GLY A C   1 
ATOM   778  O  O   . GLY A 1 109 ? 0.955  7.283   9.750  1.00 41.08 ? 100 GLY A O   1 
ATOM   779  N  N   . ASP A 1 110 ? 1.358  5.611   8.271  1.00 37.88 ? 101 ASP A N   1 
ATOM   780  C  CA  . ASP A 1 110 ? 0.572  4.623   8.998  1.00 37.85 ? 101 ASP A CA  1 
ATOM   781  C  C   . ASP A 1 110 ? 1.062  4.435   10.435 1.00 37.26 ? 101 ASP A C   1 
ATOM   782  O  O   . ASP A 1 110 ? 0.258  4.211   11.332 1.00 38.32 ? 101 ASP A O   1 
ATOM   783  C  CB  . ASP A 1 110 ? 0.589  3.282   8.276  1.00 38.49 ? 101 ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 110 ? -0.413 3.230   7.095  1.00 43.76 ? 101 ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 110 ? -1.245 4.160   6.972  1.00 46.18 ? 101 ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 110 ? -0.385 2.252   6.313  1.00 50.61 ? 101 ASP A OD2 1 
ATOM   787  N  N   . VAL A 1 111 ? 2.368  4.558   10.649 1.00 36.58 ? 102 VAL A N   1 
ATOM   788  C  CA  . VAL A 1 111 ? 2.947  4.273   11.959 1.00 35.45 ? 102 VAL A CA  1 
ATOM   789  C  C   . VAL A 1 111 ? 2.635  5.380   12.985 1.00 34.42 ? 102 VAL A C   1 
ATOM   790  O  O   . VAL A 1 111 ? 2.577  5.110   14.189 1.00 33.40 ? 102 VAL A O   1 
ATOM   791  C  CB  . VAL A 1 111 ? 4.485  3.935   11.857 1.00 36.02 ? 102 VAL A CB  1 
ATOM   792  C  CG1 . VAL A 1 111 ? 5.309  5.182   11.557 1.00 34.63 ? 102 VAL A CG1 1 
ATOM   793  C  CG2 . VAL A 1 111 ? 4.984  3.208   13.138 1.00 36.04 ? 102 VAL A CG2 1 
ATOM   794  N  N   . ALA A 1 112 ? 2.396  6.604   12.519 1.00 33.54 ? 103 ALA A N   1 
ATOM   795  C  CA  . ALA A 1 112 ? 1.992  7.710   13.395 1.00 34.39 ? 103 ALA A CA  1 
ATOM   796  C  C   . ALA A 1 112 ? 0.735  7.333   14.149 1.00 34.16 ? 103 ALA A C   1 
ATOM   797  O  O   . ALA A 1 112 ? 0.565  7.643   15.330 1.00 34.33 ? 103 ALA A O   1 
ATOM   798  C  CB  . ALA A 1 112 ? 1.751  8.984   12.576 1.00 34.44 ? 103 ALA A CB  1 
ATOM   799  N  N   . LYS A 1 113 ? -0.150 6.634   13.447 1.00 34.16 ? 104 LYS A N   1 
ATOM   800  C  CA  . LYS A 1 113 ? -1.421 6.247   13.984 1.00 33.76 ? 104 LYS A CA  1 
ATOM   801  C  C   . LYS A 1 113 ? -1.267 5.173   15.065 1.00 31.18 ? 104 LYS A C   1 
ATOM   802  O  O   . LYS A 1 113 ? -1.883 5.270   16.125 1.00 30.05 ? 104 LYS A O   1 
ATOM   803  C  CB  . LYS A 1 113 ? -2.297 5.724   12.841 1.00 34.97 ? 104 LYS A CB  1 
ATOM   804  C  CG  . LYS A 1 113 ? -2.457 6.682   11.664 1.00 38.13 ? 104 LYS A CG  1 
ATOM   805  C  CD  . LYS A 1 113 ? -3.252 5.995   10.525 1.00 38.35 ? 104 LYS A CD  1 
ATOM   806  C  CE  . LYS A 1 113 ? -3.797 6.988   9.543  1.00 41.75 ? 104 LYS A CE  1 
ATOM   807  N  NZ  . LYS A 1 113 ? -4.636 6.261   8.536  1.00 45.53 ? 104 LYS A NZ  1 
ATOM   808  N  N   . VAL A 1 114 ? -0.424 4.171   14.807 1.00 30.29 ? 105 VAL A N   1 
ATOM   809  C  CA  . VAL A 1 114 ? -0.217 3.088   15.756 1.00 30.77 ? 105 VAL A CA  1 
ATOM   810  C  C   . VAL A 1 114 ? 0.560  3.628   16.979 1.00 29.46 ? 105 VAL A C   1 
ATOM   811  O  O   . VAL A 1 114 ? 0.336  3.180   18.109 1.00 27.32 ? 105 VAL A O   1 
ATOM   812  C  CB  . VAL A 1 114 ? 0.420  1.808   15.063 1.00 32.24 ? 105 VAL A CB  1 
ATOM   813  C  CG1 . VAL A 1 114 ? 1.674  2.113   14.346 1.00 37.25 ? 105 VAL A CG1 1 
ATOM   814  C  CG2 . VAL A 1 114 ? 0.674  0.684   16.041 1.00 32.47 ? 105 VAL A CG2 1 
ATOM   815  N  N   . ILE A 1 115 ? 1.410  4.633   16.751 1.00 28.90 ? 106 ILE A N   1 
ATOM   816  C  CA  . ILE A 1 115 ? 2.129  5.298   17.848 1.00 29.36 ? 106 ILE A CA  1 
ATOM   817  C  C   . ILE A 1 115 ? 1.114  5.965   18.799 1.00 28.69 ? 106 ILE A C   1 
ATOM   818  O  O   . ILE A 1 115 ? 1.145  5.712   20.002 1.00 27.84 ? 106 ILE A O   1 
ATOM   819  C  CB  . ILE A 1 115 ? 3.219  6.287   17.339 1.00 28.56 ? 106 ILE A CB  1 
ATOM   820  C  CG1 . ILE A 1 115 ? 4.499  5.506   16.956 1.00 27.67 ? 106 ILE A CG1 1 
ATOM   821  C  CG2 . ILE A 1 115 ? 3.528  7.355   18.380 1.00 29.69 ? 106 ILE A CG2 1 
ATOM   822  C  CD1 . ILE A 1 115 ? 5.450  6.251   16.061 1.00 28.56 ? 106 ILE A CD1 1 
ATOM   823  N  N   . ASP A 1 116 ? 0.180  6.746   18.255 1.00 28.46 ? 107 ASP A N   1 
ATOM   824  C  CA  . ASP A 1 116 ? -0.866 7.358   19.079 1.00 28.44 ? 107 ASP A CA  1 
ATOM   825  C  C   . ASP A 1 116 ? -1.710 6.314   19.787 1.00 28.21 ? 107 ASP A C   1 
ATOM   826  O  O   . ASP A 1 116 ? -2.071 6.493   20.951 1.00 28.18 ? 107 ASP A O   1 
ATOM   827  C  CB  . ASP A 1 116 ? -1.773 8.257   18.245 1.00 29.51 ? 107 ASP A CB  1 
ATOM   828  C  CG  . ASP A 1 116 ? -1.078 9.490   17.730 1.00 32.62 ? 107 ASP A CG  1 
ATOM   829  O  OD1 . ASP A 1 116 ? 0.068  9.809   18.140 1.00 32.76 ? 107 ASP A OD1 1 
ATOM   830  O  OD2 . ASP A 1 116 ? -1.705 10.168  16.898 1.00 33.79 ? 107 ASP A OD2 1 
ATOM   831  N  N   . TYR A 1 117 ? -1.985 5.193   19.117 1.00 28.16 ? 108 TYR A N   1 
ATOM   832  C  CA  . TYR A 1 117 ? -2.769 4.148   19.725 1.00 26.95 ? 108 TYR A CA  1 
ATOM   833  C  C   . TYR A 1 117 ? -2.134 3.614   21.016 1.00 27.30 ? 108 TYR A C   1 
ATOM   834  O  O   . TYR A 1 117 ? -2.827 3.456   22.009 1.00 25.33 ? 108 TYR A O   1 
ATOM   835  C  CB  . TYR A 1 117 ? -2.994 2.988   18.760 1.00 28.47 ? 108 TYR A CB  1 
ATOM   836  C  CG  . TYR A 1 117 ? -3.968 1.940   19.266 1.00 29.94 ? 108 TYR A CG  1 
ATOM   837  C  CD1 . TYR A 1 117 ? -5.292 1.950   18.857 1.00 34.19 ? 108 TYR A CD1 1 
ATOM   838  C  CD2 . TYR A 1 117 ? -3.558 0.924   20.125 1.00 32.34 ? 108 TYR A CD2 1 
ATOM   839  C  CE1 . TYR A 1 117 ? -6.176 0.983   19.286 1.00 31.24 ? 108 TYR A CE1 1 
ATOM   840  C  CE2 . TYR A 1 117 ? -4.441 -0.050  20.558 1.00 33.07 ? 108 TYR A CE2 1 
ATOM   841  C  CZ  . TYR A 1 117 ? -5.755 -0.007  20.129 1.00 33.63 ? 108 TYR A CZ  1 
ATOM   842  O  OH  . TYR A 1 117 ? -6.656 -0.964  20.543 1.00 35.93 ? 108 TYR A OH  1 
ATOM   843  N  N   . TYR A 1 118 ? -0.824 3.327   20.972 1.00 26.20 ? 109 TYR A N   1 
ATOM   844  C  CA  . TYR A 1 118 ? -0.165 2.662   22.087 1.00 26.15 ? 109 TYR A CA  1 
ATOM   845  C  C   . TYR A 1 118 ? 0.440  3.603   23.112 1.00 25.43 ? 109 TYR A C   1 
ATOM   846  O  O   . TYR A 1 118 ? 0.620  3.200   24.271 1.00 25.88 ? 109 TYR A O   1 
ATOM   847  C  CB  . TYR A 1 118 ? 0.876  1.651   21.598 1.00 26.77 ? 109 TYR A CB  1 
ATOM   848  C  CG  . TYR A 1 118 ? 0.197  0.447   20.978 1.00 28.07 ? 109 TYR A CG  1 
ATOM   849  C  CD1 . TYR A 1 118 ? 0.169  0.275   19.617 1.00 29.55 ? 109 TYR A CD1 1 
ATOM   850  C  CD2 . TYR A 1 118 ? -0.480 -0.478  21.786 1.00 26.04 ? 109 TYR A CD2 1 
ATOM   851  C  CE1 . TYR A 1 118 ? -0.504 -0.802  19.051 1.00 29.89 ? 109 TYR A CE1 1 
ATOM   852  C  CE2 . TYR A 1 118 ? -1.170 -1.545  21.239 1.00 27.36 ? 109 TYR A CE2 1 
ATOM   853  C  CZ  . TYR A 1 118 ? -1.154 -1.714  19.872 1.00 30.07 ? 109 TYR A CZ  1 
ATOM   854  O  OH  . TYR A 1 118 ? -1.820 -2.779  19.328 1.00 32.86 ? 109 TYR A OH  1 
ATOM   855  N  N   . PHE A 1 119 ? 0.761  4.828   22.689 1.00 24.69 ? 110 PHE A N   1 
ATOM   856  C  CA  . PHE A 1 119 ? 1.424  5.803   23.562 1.00 26.24 ? 110 PHE A CA  1 
ATOM   857  C  C   . PHE A 1 119 ? 0.607  7.061   23.827 1.00 26.10 ? 110 PHE A C   1 
ATOM   858  O  O   . PHE A 1 119 ? 1.046  7.945   24.584 1.00 26.23 ? 110 PHE A O   1 
ATOM   859  C  CB  . PHE A 1 119 ? 2.792  6.179   22.992 1.00 26.90 ? 110 PHE A CB  1 
ATOM   860  C  CG  . PHE A 1 119 ? 3.734  5.034   22.924 1.00 29.20 ? 110 PHE A CG  1 
ATOM   861  C  CD1 . PHE A 1 119 ? 3.829  4.273   21.762 1.00 29.29 ? 110 PHE A CD1 1 
ATOM   862  C  CD2 . PHE A 1 119 ? 4.520  4.692   24.019 1.00 26.95 ? 110 PHE A CD2 1 
ATOM   863  C  CE1 . PHE A 1 119 ? 4.679  3.205   21.700 1.00 31.33 ? 110 PHE A CE1 1 
ATOM   864  C  CE2 . PHE A 1 119 ? 5.372  3.618   23.957 1.00 28.69 ? 110 PHE A CE2 1 
ATOM   865  C  CZ  . PHE A 1 119 ? 5.438  2.868   22.792 1.00 28.06 ? 110 PHE A CZ  1 
ATOM   866  N  N   . ASN A 1 120 ? -0.573 7.115   23.219 1.00 26.16 ? 111 ASN A N   1 
ATOM   867  C  CA  . ASN A 1 120 ? -1.469 8.266   23.256 1.00 25.79 ? 111 ASN A CA  1 
ATOM   868  C  C   . ASN A 1 120 ? -0.990 9.484   22.450 1.00 26.59 ? 111 ASN A C   1 
ATOM   869  O  O   . ASN A 1 120 ? -1.735 9.998   21.601 1.00 26.89 ? 111 ASN A O   1 
ATOM   870  C  CB  . ASN A 1 120 ? -1.879 8.664   24.691 1.00 25.89 ? 111 ASN A CB  1 
ATOM   871  C  CG  . ASN A 1 120 ? -3.020 9.690   24.678 1.00 27.37 ? 111 ASN A CG  1 
ATOM   872  O  OD1 . ASN A 1 120 ? -2.800 10.858  24.327 1.00 31.94 ? 111 ASN A OD1 1 
ATOM   873  N  ND2 . ASN A 1 120 ? -4.238 9.247   24.954 1.00 27.98 ? 111 ASN A ND2 1 
ATOM   874  N  N   . THR A 1 121 ? 0.219  9.980   22.731 1.00 25.54 ? 112 THR A N   1 
ATOM   875  C  CA  . THR A 1 121 ? 0.839  11.052  21.953 1.00 26.76 ? 112 THR A CA  1 
ATOM   876  C  C   . THR A 1 121 ? 2.265  10.661  21.560 1.00 26.61 ? 112 THR A C   1 
ATOM   877  O  O   . THR A 1 121 ? 2.881  9.829   22.228 1.00 24.75 ? 112 THR A O   1 
ATOM   878  C  CB  . THR A 1 121 ? 0.949  12.370  22.779 1.00 26.94 ? 112 THR A CB  1 
ATOM   879  O  OG1 . THR A 1 121 ? 1.778  12.146  23.934 1.00 27.63 ? 112 THR A OG1 1 
ATOM   880  C  CG2 . THR A 1 121 ? -0.461 12.887  23.231 1.00 29.49 ? 112 THR A CG2 1 
ATOM   881  N  N   . PHE A 1 122 ? 2.772  11.272  20.491 1.00 27.21 ? 113 PHE A N   1 
ATOM   882  C  CA  . PHE A 1 122 ? 4.179  11.195  20.132 1.00 27.18 ? 113 PHE A CA  1 
ATOM   883  C  C   . PHE A 1 122 ? 5.103  11.684  21.261 1.00 27.53 ? 113 PHE A C   1 
ATOM   884  O  O   . PHE A 1 122 ? 6.138  11.064  21.490 1.00 29.07 ? 113 PHE A O   1 
ATOM   885  C  CB  . PHE A 1 122 ? 4.485  11.973  18.854 1.00 28.94 ? 113 PHE A CB  1 
ATOM   886  C  CG  . PHE A 1 122 ? 5.949  12.008  18.519 1.00 28.80 ? 113 PHE A CG  1 
ATOM   887  C  CD1 . PHE A 1 122 ? 6.668  10.824  18.426 1.00 29.38 ? 113 PHE A CD1 1 
ATOM   888  C  CD2 . PHE A 1 122 ? 6.612  13.217  18.358 1.00 32.73 ? 113 PHE A CD2 1 
ATOM   889  C  CE1 . PHE A 1 122 ? 8.026  10.818  18.127 1.00 30.27 ? 113 PHE A CE1 1 
ATOM   890  C  CE2 . PHE A 1 122 ? 7.978  13.233  18.056 1.00 32.02 ? 113 PHE A CE2 1 
ATOM   891  C  CZ  . PHE A 1 122 ? 8.682  12.032  17.935 1.00 33.06 ? 113 PHE A CZ  1 
ATOM   892  N  N   . ASP A 1 123 ? 4.758  12.776  21.949 1.00 27.69 ? 114 ASP A N   1 
ATOM   893  C  CA  . ASP A 1 123 ? 5.602  13.266  23.071 1.00 28.52 ? 114 ASP A CA  1 
ATOM   894  C  C   . ASP A 1 123 ? 5.767  12.175  24.130 1.00 28.12 ? 114 ASP A C   1 
ATOM   895  O  O   . ASP A 1 123 ? 6.823  12.054  24.735 1.00 27.17 ? 114 ASP A O   1 
ATOM   896  C  CB  . ASP A 1 123 ? 5.024  14.528  23.736 1.00 30.42 ? 114 ASP A CB  1 
ATOM   897  C  CG  . ASP A 1 123 ? 5.407  15.824  23.006 1.00 39.41 ? 114 ASP A CG  1 
ATOM   898  O  OD1 . ASP A 1 123 ? 6.486  15.882  22.371 1.00 44.87 ? 114 ASP A OD1 1 
ATOM   899  O  OD2 . ASP A 1 123 ? 4.622  16.805  23.095 1.00 46.48 ? 114 ASP A OD2 1 
ATOM   900  N  N   . ASN A 1 124 ? 4.727  11.379  24.359 1.00 28.22 ? 115 ASN A N   1 
ATOM   901  C  CA  . ASN A 1 124 ? 4.842  10.300  25.348 1.00 28.17 ? 115 ASN A CA  1 
ATOM   902  C  C   . ASN A 1 124 ? 5.773  9.189   24.862 1.00 27.17 ? 115 ASN A C   1 
ATOM   903  O  O   . ASN A 1 124 ? 6.553  8.640   25.640 1.00 26.59 ? 115 ASN A O   1 
ATOM   904  C  CB  . ASN A 1 124 ? 3.477  9.717   25.712 1.00 28.55 ? 115 ASN A CB  1 
ATOM   905  C  CG  . ASN A 1 124 ? 3.553  8.772   26.878 1.00 30.82 ? 115 ASN A CG  1 
ATOM   906  O  OD1 . ASN A 1 124 ? 4.279  9.022   27.851 1.00 37.96 ? 115 ASN A OD1 1 
ATOM   907  N  ND2 . ASN A 1 124 ? 2.837  7.667   26.788 1.00 32.98 ? 115 ASN A ND2 1 
ATOM   908  N  N   . LEU A 1 125 ? 5.698  8.843   23.573 1.00 26.91 ? 116 LEU A N   1 
ATOM   909  C  CA  . LEU A 1 125 ? 6.671  7.906   23.016 1.00 26.77 ? 116 LEU A CA  1 
ATOM   910  C  C   . LEU A 1 125 ? 8.096  8.427   23.219 1.00 25.93 ? 116 LEU A C   1 
ATOM   911  O  O   . LEU A 1 125 ? 8.987  7.691   23.642 1.00 26.77 ? 116 LEU A O   1 
ATOM   912  C  CB  . LEU A 1 125 ? 6.486  7.709   21.524 1.00 26.11 ? 116 LEU A CB  1 
ATOM   913  C  CG  . LEU A 1 125 ? 7.634  6.912   20.856 1.00 26.15 ? 116 LEU A CG  1 
ATOM   914  C  CD1 . LEU A 1 125 ? 7.817  5.514   21.502 1.00 29.16 ? 116 LEU A CD1 1 
ATOM   915  C  CD2 . LEU A 1 125 ? 7.382  6.799   19.424 1.00 27.86 ? 116 LEU A CD2 1 
ATOM   916  N  N   . LYS A 1 126 ? 8.301  9.685   22.862 1.00 26.35 ? 117 LYS A N   1 
ATOM   917  C  CA  . LYS A 1 126 ? 9.625  10.307  23.022 1.00 27.04 ? 117 LYS A CA  1 
ATOM   918  C  C   . LYS A 1 126 ? 10.110 10.211  24.457 1.00 26.76 ? 117 LYS A C   1 
ATOM   919  O  O   . LYS A 1 126 ? 11.266 9.811   24.702 1.00 27.83 ? 117 LYS A O   1 
ATOM   920  C  CB  . LYS A 1 126 ? 9.625  11.743  22.579 1.00 26.56 ? 117 LYS A CB  1 
ATOM   921  C  CG  . LYS A 1 126 ? 9.476  11.951  21.082 1.00 33.32 ? 117 LYS A CG  1 
ATOM   922  C  CD  . LYS A 1 126 ? 10.263 13.190  20.569 1.00 33.17 ? 117 LYS A CD  1 
ATOM   923  C  CE  . LYS A 1 126 ? 10.261 14.397  21.490 1.00 38.92 ? 117 LYS A CE  1 
ATOM   924  N  NZ  . LYS A 1 126 ? 11.461 15.312  21.176 1.00 43.30 ? 117 LYS A NZ  1 
ATOM   925  N  N   . ASP A 1 127 ? 9.255  10.551  25.405 1.00 26.90 ? 118 ASP A N   1 
ATOM   926  C  CA  . ASP A 1 127 ? 9.619  10.380  26.839 1.00 27.73 ? 118 ASP A CA  1 
ATOM   927  C  C   . ASP A 1 127 ? 10.018 8.959   27.230 1.00 27.29 ? 118 ASP A C   1 
ATOM   928  O  O   . ASP A 1 127 ? 11.017 8.753   27.944 1.00 28.46 ? 118 ASP A O   1 
ATOM   929  C  CB  . ASP A 1 127 ? 8.466  10.803  27.752 1.00 27.73 ? 118 ASP A CB  1 
ATOM   930  C  CG  . ASP A 1 127 ? 8.226  12.298  27.734 1.00 31.78 ? 118 ASP A CG  1 
ATOM   931  O  OD1 . ASP A 1 127 ? 8.998  13.033  27.065 1.00 34.90 ? 118 ASP A OD1 1 
ATOM   932  O  OD2 . ASP A 1 127 ? 7.249  12.735  28.387 1.00 31.77 ? 118 ASP A OD2 1 
ATOM   933  N  N   . GLN A 1 128 ? 9.231  7.984   26.803 1.00 26.42 ? 119 GLN A N   1 
ATOM   934  C  CA  . GLN A 1 128 ? 9.468  6.605   27.181 1.00 28.15 ? 119 GLN A CA  1 
ATOM   935  C  C   . GLN A 1 128 ? 10.735 6.021   26.552 1.00 27.01 ? 119 GLN A C   1 
ATOM   936  O  O   . GLN A 1 128 ? 11.495 5.329   27.237 1.00 26.20 ? 119 GLN A O   1 
ATOM   937  C  CB  . GLN A 1 128 ? 8.229  5.746   26.931 1.00 28.83 ? 119 GLN A CB  1 
ATOM   938  C  CG  . GLN A 1 128 ? 7.053  6.199   27.816 1.00 32.55 ? 119 GLN A CG  1 
ATOM   939  C  CD  . GLN A 1 128 ? 5.834  5.330   27.709 1.00 33.88 ? 119 GLN A CD  1 
ATOM   940  O  OE1 . GLN A 1 128 ? 5.853  4.287   27.062 1.00 44.17 ? 119 GLN A OE1 1 
ATOM   941  N  NE2 . GLN A 1 128 ? 4.732  5.764   28.359 1.00 38.89 ? 119 GLN A NE2 1 
ATOM   942  N  N   . LEU A 1 129 ? 10.968 6.274   25.265 1.00 25.57 ? 120 LEU A N   1 
ATOM   943  C  CA  . LEU A 1 129 ? 12.150 5.740   24.618 1.00 26.17 ? 120 LEU A CA  1 
ATOM   944  C  C   . LEU A 1 129 ? 13.388 6.434   25.193 1.00 26.12 ? 120 LEU A C   1 
ATOM   945  O  O   . LEU A 1 129 ? 14.390 5.767   25.471 1.00 26.49 ? 120 LEU A O   1 
ATOM   946  C  CB  . LEU A 1 129 ? 12.077 5.952   23.110 1.00 25.08 ? 120 LEU A CB  1 
ATOM   947  C  CG  . LEU A 1 129 ? 13.241 5.396   22.279 1.00 27.92 ? 120 LEU A CG  1 
ATOM   948  C  CD1 . LEU A 1 129 ? 13.539 3.984   22.616 1.00 31.03 ? 120 LEU A CD1 1 
ATOM   949  C  CD2 . LEU A 1 129 ? 12.965 5.519   20.751 1.00 34.32 ? 120 LEU A CD2 1 
ATOM   950  N  N   . SER A 1 130 ? 13.290 7.751   25.403 1.00 26.20 ? 121 SER A N   1 
ATOM   951  C  CA  . SER A 1 130 ? 14.385 8.545   25.992 1.00 27.64 ? 121 SER A CA  1 
ATOM   952  C  C   . SER A 1 130 ? 14.812 7.979   27.354 1.00 27.49 ? 121 SER A C   1 
ATOM   953  O  O   . SER A 1 130 ? 16.008 7.873   27.638 1.00 26.72 ? 121 SER A O   1 
ATOM   954  C  CB  . SER A 1 130 ? 13.985 10.013  26.148 1.00 28.33 ? 121 SER A CB  1 
ATOM   955  O  OG  . SER A 1 130 ? 13.901 10.712  24.895 1.00 30.08 ? 121 SER A OG  1 
ATOM   956  N  N   . LYS A 1 131 ? 13.828 7.662   28.194 1.00 28.49 ? 122 LYS A N   1 
ATOM   957  C  CA  . LYS A 1 131 ? 14.065 7.081   29.555 1.00 28.48 ? 122 LYS A CA  1 
ATOM   958  C  C   . LYS A 1 131 ? 14.737 5.705   29.476 1.00 27.79 ? 122 LYS A C   1 
ATOM   959  O  O   . LYS A 1 131 ? 15.715 5.403   30.209 1.00 27.15 ? 122 LYS A O   1 
ATOM   960  C  CB  . LYS A 1 131 ? 12.741 7.006   30.348 1.00 28.66 ? 122 LYS A CB  1 
ATOM   961  C  CG  . LYS A 1 131 ? 12.819 6.371   31.738 1.00 32.08 ? 122 LYS A CG  1 
ATOM   962  C  CD  . LYS A 1 131 ? 11.408 6.085   32.266 1.00 32.32 ? 122 LYS A CD  1 
ATOM   963  C  CE  . LYS A 1 131 ? 11.347 5.120   33.512 1.00 36.72 ? 122 LYS A CE  1 
ATOM   964  N  NZ  . LYS A 1 131 ? 9.925  4.776   33.972 1.00 38.76 ? 122 LYS A NZ  1 
ATOM   965  N  N   . ALA A 1 132 ? 14.213 4.862   28.594 1.00 26.32 ? 123 ALA A N   1 
ATOM   966  C  CA  . ALA A 1 132 ? 14.789 3.540   28.349 1.00 26.64 ? 123 ALA A CA  1 
ATOM   967  C  C   . ALA A 1 132 ? 16.252 3.621   27.915 1.00 25.47 ? 123 ALA A C   1 
ATOM   968  O  O   . ALA A 1 132 ? 17.086 2.825   28.378 1.00 25.97 ? 123 ALA A O   1 
ATOM   969  C  CB  . ALA A 1 132 ? 13.983 2.820   27.299 1.00 26.37 ? 123 ALA A CB  1 
ATOM   970  N  N   . ALA A 1 133 ? 16.574 4.592   27.057 1.00 24.49 ? 124 ALA A N   1 
ATOM   971  C  CA  . ALA A 1 133 ? 17.953 4.770   26.568 1.00 25.54 ? 124 ALA A CA  1 
ATOM   972  C  C   . ALA A 1 133 ? 18.835 5.348   27.670 1.00 24.87 ? 124 ALA A C   1 
ATOM   973  O  O   . ALA A 1 133 ? 19.953 4.909   27.899 1.00 26.58 ? 124 ALA A O   1 
ATOM   974  C  CB  . ALA A 1 133 ? 17.984 5.684   25.334 1.00 25.74 ? 124 ALA A CB  1 
ATOM   975  N  N   . ILE A 1 134 ? 18.340 6.340   28.369 1.00 24.69 ? 125 ILE A N   1 
ATOM   976  C  CA  . ILE A 1 134 ? 19.176 6.973   29.393 1.00 27.25 ? 125 ILE A CA  1 
ATOM   977  C  C   . ILE A 1 134 ? 19.438 5.987   30.554 1.00 27.22 ? 125 ILE A C   1 
ATOM   978  O  O   . ILE A 1 134 ? 20.561 5.909   31.070 1.00 28.05 ? 125 ILE A O   1 
ATOM   979  C  CB  . ILE A 1 134 ? 18.531 8.287   29.828 1.00 27.63 ? 125 ILE A CB  1 
ATOM   980  C  CG1 . ILE A 1 134 ? 18.615 9.291   28.664 1.00 30.34 ? 125 ILE A CG1 1 
ATOM   981  C  CG2 . ILE A 1 134 ? 19.215 8.864   31.098 1.00 26.97 ? 125 ILE A CG2 1 
ATOM   982  C  CD1 . ILE A 1 134 ? 17.767 10.529  28.837 1.00 30.95 ? 125 ILE A CD1 1 
ATOM   983  N  N   . SER A 1 135 ? 18.422 5.202   30.896 1.00 26.27 ? 126 SER A N   1 
ATOM   984  C  CA  . SER A 1 135 ? 18.472 4.185   31.977 1.00 27.36 ? 126 SER A CA  1 
ATOM   985  C  C   . SER A 1 135 ? 19.266 2.904   31.686 1.00 26.20 ? 126 SER A C   1 
ATOM   986  O  O   . SER A 1 135 ? 19.498 2.114   32.599 1.00 25.23 ? 126 SER A O   1 
ATOM   987  C  CB  . SER A 1 135 ? 17.042 3.763   32.360 1.00 29.37 ? 126 SER A CB  1 
ATOM   988  O  OG  . SER A 1 135 ? 16.269 4.907   32.713 1.00 35.28 ? 126 SER A OG  1 
ATOM   989  N  N   . ARG A 1 136 ? 19.676 2.679   30.434 1.00 24.88 ? 127 ARG A N   1 
ATOM   990  C  CA  . ARG A 1 136 ? 20.512 1.551   30.119 1.00 24.86 ? 127 ARG A CA  1 
ATOM   991  C  C   . ARG A 1 136 ? 21.911 1.769   30.725 1.00 24.62 ? 127 ARG A C   1 
ATOM   992  O  O   . ARG A 1 136 ? 22.695 2.578   30.232 1.00 24.25 ? 127 ARG A O   1 
ATOM   993  C  CB  . ARG A 1 136 ? 20.556 1.300   28.600 1.00 25.34 ? 127 ARG A CB  1 
ATOM   994  C  CG  . ARG A 1 136 ? 21.541 0.195   28.137 1.00 26.15 ? 127 ARG A CG  1 
ATOM   995  C  CD  . ARG A 1 136 ? 21.548 -1.094  28.960 1.00 24.99 ? 127 ARG A CD  1 
ATOM   996  N  NE  . ARG A 1 136 ? 20.287 -1.815  28.873 1.00 22.65 ? 127 ARG A NE  1 
ATOM   997  C  CZ  . ARG A 1 136 ? 20.058 -3.053  29.328 1.00 26.25 ? 127 ARG A CZ  1 
ATOM   998  N  NH1 . ARG A 1 136 ? 21.023 -3.765  29.899 1.00 23.20 ? 127 ARG A NH1 1 
ATOM   999  N  NH2 . ARG A 1 136 ? 18.855 -3.618  29.176 1.00 27.14 ? 127 ARG A NH2 1 
ATOM   1000 N  N   . PHE A 1 137 ? 22.199 1.045   31.809 1.00 23.44 ? 128 PHE A N   1 
ATOM   1001 C  CA  . PHE A 1 137 ? 23.492 1.162   32.480 1.00 24.14 ? 128 PHE A CA  1 
ATOM   1002 C  C   . PHE A 1 137 ? 24.621 0.445   31.716 1.00 22.65 ? 128 PHE A C   1 
ATOM   1003 O  O   . PHE A 1 137 ? 24.517 -0.735  31.379 1.00 24.01 ? 128 PHE A O   1 
ATOM   1004 C  CB  . PHE A 1 137 ? 23.390 0.627   33.928 1.00 23.99 ? 128 PHE A CB  1 
ATOM   1005 C  CG  . PHE A 1 137 ? 24.533 1.032   34.788 1.00 22.76 ? 128 PHE A CG  1 
ATOM   1006 C  CD1 . PHE A 1 137 ? 24.623 2.338   35.277 1.00 23.25 ? 128 PHE A CD1 1 
ATOM   1007 C  CD2 . PHE A 1 137 ? 25.537 0.109   35.113 1.00 21.97 ? 128 PHE A CD2 1 
ATOM   1008 C  CE1 . PHE A 1 137 ? 25.707 2.733   36.052 1.00 24.25 ? 128 PHE A CE1 1 
ATOM   1009 C  CE2 . PHE A 1 137 ? 26.604 0.478   35.879 1.00 24.77 ? 128 PHE A CE2 1 
ATOM   1010 C  CZ  . PHE A 1 137 ? 26.695 1.801   36.373 1.00 24.31 ? 128 PHE A CZ  1 
ATOM   1011 N  N   . GLY A 1 138 ? 25.723 1.158   31.480 1.00 21.88 ? 129 GLY A N   1 
ATOM   1012 C  CA  . GLY A 1 138 ? 26.829 0.643   30.687 1.00 21.52 ? 129 GLY A CA  1 
ATOM   1013 C  C   . GLY A 1 138 ? 26.540 0.845   29.209 1.00 21.47 ? 129 GLY A C   1 
ATOM   1014 O  O   . GLY A 1 138 ? 25.878 1.811   28.814 1.00 23.25 ? 129 GLY A O   1 
ATOM   1015 N  N   . SER A 1 139 ? 26.987 -0.094  28.389 1.00 21.10 ? 130 SER A N   1 
ATOM   1016 C  CA  . SER A 1 139 ? 26.845 0.020   26.924 1.00 20.90 ? 130 SER A CA  1 
ATOM   1017 C  C   . SER A 1 139 ? 25.542 -0.637  26.448 1.00 21.01 ? 130 SER A C   1 
ATOM   1018 O  O   . SER A 1 139 ? 25.110 -1.663  26.985 1.00 21.26 ? 130 SER A O   1 
ATOM   1019 C  CB  . SER A 1 139 ? 28.038 -0.619  26.213 1.00 21.67 ? 130 SER A CB  1 
ATOM   1020 O  OG  . SER A 1 139 ? 29.274 -0.064  26.636 1.00 21.76 ? 130 SER A OG  1 
ATOM   1021 N  N   . GLY A 1 140 ? 24.903 -0.048  25.439 1.00 21.10 ? 131 GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 140 ? 23.649 -0.598  24.937 1.00 20.54 ? 131 GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 140 ? 22.859 0.275   24.000 1.00 21.23 ? 131 GLY A C   1 
ATOM   1024 O  O   . GLY A 1 140 ? 23.379 1.261   23.444 1.00 20.84 ? 131 GLY A O   1 
ATOM   1025 N  N   . TYR A 1 141 ? 21.603 -0.133  23.795 1.00 20.81 ? 132 TYR A N   1 
ATOM   1026 C  CA  . TYR A 1 141 ? 20.681 0.568   22.888 1.00 21.40 ? 132 TYR A CA  1 
ATOM   1027 C  C   . TYR A 1 141 ? 19.294 0.790   23.491 1.00 21.46 ? 132 TYR A C   1 
ATOM   1028 O  O   . TYR A 1 141 ? 18.839 0.009   24.347 1.00 22.13 ? 132 TYR A O   1 
ATOM   1029 C  CB  . TYR A 1 141 ? 20.513 -0.261  21.594 1.00 21.78 ? 132 TYR A CB  1 
ATOM   1030 C  CG  . TYR A 1 141 ? 21.752 -0.401  20.760 1.00 21.55 ? 132 TYR A CG  1 
ATOM   1031 C  CD1 . TYR A 1 141 ? 22.699 -1.392  21.029 1.00 21.43 ? 132 TYR A CD1 1 
ATOM   1032 C  CD2 . TYR A 1 141 ? 22.001 0.469   19.700 1.00 20.73 ? 132 TYR A CD2 1 
ATOM   1033 C  CE1 . TYR A 1 141 ? 23.852 -1.496  20.257 1.00 22.65 ? 132 TYR A CE1 1 
ATOM   1034 C  CE2 . TYR A 1 141 ? 23.138 0.365   18.932 1.00 20.40 ? 132 TYR A CE2 1 
ATOM   1035 C  CZ  . TYR A 1 141 ? 24.064 -0.623  19.208 1.00 22.39 ? 132 TYR A CZ  1 
ATOM   1036 O  OH  . TYR A 1 141 ? 25.211 -0.737  18.422 1.00 25.59 ? 132 TYR A OH  1 
ATOM   1037 N  N   . GLY A 1 142 ? 18.606 1.839   23.057 1.00 20.51 ? 133 GLY A N   1 
ATOM   1038 C  CA  . GLY A 1 142 ? 17.149 1.930   23.271 1.00 21.72 ? 133 GLY A CA  1 
ATOM   1039 C  C   . GLY A 1 142 ? 16.399 1.558   21.987 1.00 21.88 ? 133 GLY A C   1 
ATOM   1040 O  O   . GLY A 1 142 ? 16.840 1.928   20.873 1.00 23.24 ? 133 GLY A O   1 
ATOM   1041 N  N   . TRP A 1 143 ? 15.241 0.893   22.122 1.00 23.04 ? 134 TRP A N   1 
ATOM   1042 C  CA  . TRP A 1 143 ? 14.507 0.337   20.964 1.00 22.97 ? 134 TRP A CA  1 
ATOM   1043 C  C   . TRP A 1 143 ? 13.008 0.682   20.982 1.00 23.73 ? 134 TRP A C   1 
ATOM   1044 O  O   . TRP A 1 143 ? 12.365 0.728   22.042 1.00 22.28 ? 134 TRP A O   1 
ATOM   1045 C  CB  . TRP A 1 143 ? 14.599 -1.204  20.926 1.00 23.06 ? 134 TRP A CB  1 
ATOM   1046 C  CG  . TRP A 1 143 ? 15.961 -1.784  20.877 1.00 23.57 ? 134 TRP A CG  1 
ATOM   1047 C  CD1 . TRP A 1 143 ? 16.743 -2.068  21.951 1.00 23.46 ? 134 TRP A CD1 1 
ATOM   1048 C  CD2 . TRP A 1 143 ? 16.711 -2.176  19.711 1.00 23.59 ? 134 TRP A CD2 1 
ATOM   1049 N  NE1 . TRP A 1 143 ? 17.938 -2.592  21.545 1.00 22.36 ? 134 TRP A NE1 1 
ATOM   1050 C  CE2 . TRP A 1 143 ? 17.950 -2.681  20.172 1.00 23.55 ? 134 TRP A CE2 1 
ATOM   1051 C  CE3 . TRP A 1 143 ? 16.454 -2.176  18.330 1.00 23.40 ? 134 TRP A CE3 1 
ATOM   1052 C  CZ2 . TRP A 1 143 ? 18.935 -3.157  19.308 1.00 23.93 ? 134 TRP A CZ2 1 
ATOM   1053 C  CZ3 . TRP A 1 143 ? 17.439 -2.657  17.462 1.00 22.78 ? 134 TRP A CZ3 1 
ATOM   1054 C  CH2 . TRP A 1 143 ? 18.674 -3.129  17.952 1.00 22.47 ? 134 TRP A CH2 1 
ATOM   1055 N  N   . LEU A 1 144 ? 12.454 0.897   19.791 1.00 24.89 ? 135 LEU A N   1 
ATOM   1056 C  CA  . LEU A 1 144 ? 11.007 0.771   19.551 1.00 25.19 ? 135 LEU A CA  1 
ATOM   1057 C  C   . LEU A 1 144 ? 10.795 -0.501  18.744 1.00 25.22 ? 135 LEU A C   1 
ATOM   1058 O  O   . LEU A 1 144 ? 11.462 -0.728  17.717 1.00 25.90 ? 135 LEU A O   1 
ATOM   1059 C  CB  . LEU A 1 144 ? 10.472 1.969   18.773 1.00 25.63 ? 135 LEU A CB  1 
ATOM   1060 C  CG  . LEU A 1 144 ? 8.996  1.947   18.354 1.00 25.92 ? 135 LEU A CG  1 
ATOM   1061 C  CD1 . LEU A 1 144 ? 8.080  2.000   19.569 1.00 25.85 ? 135 LEU A CD1 1 
ATOM   1062 C  CD2 . LEU A 1 144 ? 8.673  3.077   17.327 1.00 25.09 ? 135 LEU A CD2 1 
ATOM   1063 N  N   . VAL A 1 145 ? 9.877  -1.355  19.206 1.00 25.92 ? 136 VAL A N   1 
ATOM   1064 C  CA  . VAL A 1 145 ? 9.678  -2.675  18.594 1.00 26.39 ? 136 VAL A CA  1 
ATOM   1065 C  C   . VAL A 1 145 ? 8.203  -2.994  18.387 1.00 27.25 ? 136 VAL A C   1 
ATOM   1066 O  O   . VAL A 1 145 ? 7.346  -2.422  19.011 1.00 26.58 ? 136 VAL A O   1 
ATOM   1067 C  CB  . VAL A 1 145 ? 10.317 -3.833  19.441 1.00 25.04 ? 136 VAL A CB  1 
ATOM   1068 C  CG1 . VAL A 1 145 ? 11.801 -3.626  19.643 1.00 25.43 ? 136 VAL A CG1 1 
ATOM   1069 C  CG2 . VAL A 1 145 ? 9.616  -3.982  20.781 1.00 25.75 ? 136 VAL A CG2 1 
ATOM   1070 N  N   . LEU A 1 146 ? 7.955  -3.918  17.465 1.00 29.25 ? 137 LEU A N   1 
ATOM   1071 C  CA  . LEU A 1 146 ? 6.641  -4.497  17.224 1.00 30.73 ? 137 LEU A CA  1 
ATOM   1072 C  C   . LEU A 1 146 ? 6.645  -5.879  17.827 1.00 32.32 ? 137 LEU A C   1 
ATOM   1073 O  O   . LEU A 1 146 ? 7.505  -6.722  17.508 1.00 32.83 ? 137 LEU A O   1 
ATOM   1074 C  CB  . LEU A 1 146 ? 6.384  -4.594  15.718 1.00 30.35 ? 137 LEU A CB  1 
ATOM   1075 C  CG  . LEU A 1 146 ? 4.944  -4.903  15.320 1.00 31.11 ? 137 LEU A CG  1 
ATOM   1076 C  CD1 . LEU A 1 146 ? 4.048  -3.746  15.665 1.00 31.88 ? 137 LEU A CD1 1 
ATOM   1077 C  CD2 . LEU A 1 146 ? 4.870  -5.217  13.814 1.00 33.36 ? 137 LEU A CD2 1 
ATOM   1078 N  N   . ASP A 1 147 ? 5.689  -6.100  18.718 1.00 34.94 ? 138 ASP A N   1 
ATOM   1079 C  CA  . ASP A 1 147 ? 5.540  -7.328  19.443 1.00 35.26 ? 138 ASP A CA  1 
ATOM   1080 C  C   . ASP A 1 147 ? 4.103  -7.753  19.152 1.00 37.50 ? 138 ASP A C   1 
ATOM   1081 O  O   . ASP A 1 147 ? 3.179  -7.378  19.871 1.00 37.87 ? 138 ASP A O   1 
ATOM   1082 C  CB  . ASP A 1 147 ? 5.774  -7.068  20.943 1.00 36.61 ? 138 ASP A CB  1 
ATOM   1083 C  CG  . ASP A 1 147 ? 5.760  -8.348  21.787 1.00 38.44 ? 138 ASP A CG  1 
ATOM   1084 O  OD1 . ASP A 1 147 ? 5.815  -8.220  23.031 1.00 44.15 ? 138 ASP A OD1 1 
ATOM   1085 O  OD2 . ASP A 1 147 ? 5.706  -9.478  21.233 1.00 42.07 ? 138 ASP A OD2 1 
ATOM   1086 N  N   . GLY A 1 148 ? 3.921  -8.476  18.050 1.00 38.51 ? 139 GLY A N   1 
ATOM   1087 C  CA  . GLY A 1 148 ? 2.596  -8.830  17.554 1.00 38.19 ? 139 GLY A CA  1 
ATOM   1088 C  C   . GLY A 1 148 ? 1.996  -7.655  16.833 1.00 38.95 ? 139 GLY A C   1 
ATOM   1089 O  O   . GLY A 1 148 ? 2.526  -7.214  15.819 1.00 40.79 ? 139 GLY A O   1 
ATOM   1090 N  N   . GLU A 1 149 ? 0.886  -7.143  17.360 1.00 38.28 ? 140 GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 149 ? 0.299  -5.904  16.862 1.00 38.47 ? 140 GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 149 ? 0.767  -4.683  17.687 1.00 36.48 ? 140 GLU A C   1 
ATOM   1093 O  O   . GLU A 1 149 ? 0.558  -3.549  17.273 1.00 35.73 ? 140 GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 149 ? -1.222 -6.000  16.902 1.00 39.65 ? 140 GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 149 ? -1.799 -7.208  16.143 1.00 42.69 ? 140 GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 149 ? -3.309 -7.130  15.965 1.00 44.27 ? 140 GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 149 ? -3.749 -6.789  14.839 1.00 52.27 ? 140 GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 149 ? -4.053 -7.396  16.946 1.00 53.00 ? 140 GLU A OE2 1 
ATOM   1099 N  N   . GLU A 1 150 ? 1.416  -4.935  18.829 1.00 35.17 ? 141 GLU A N   1 
ATOM   1100 C  CA  . GLU A 1 150 ? 1.719  -3.905  19.833 1.00 35.17 ? 141 GLU A CA  1 
ATOM   1101 C  C   . GLU A 1 150 ? 3.083  -3.231  19.635 1.00 32.05 ? 141 GLU A C   1 
ATOM   1102 O  O   . GLU A 1 150 ? 4.055  -3.905  19.422 1.00 29.35 ? 141 GLU A O   1 
ATOM   1103 C  CB  . GLU A 1 150 ? 1.687  -4.523  21.237 1.00 34.21 ? 141 GLU A CB  1 
ATOM   1104 C  CG  . GLU A 1 150 ? 2.092  -3.530  22.370 1.00 36.47 ? 141 GLU A CG  1 
ATOM   1105 C  CD  . GLU A 1 150 ? 1.549  -3.898  23.743 1.00 40.93 ? 141 GLU A CD  1 
ATOM   1106 O  OE1 . GLU A 1 150 ? 0.580  -4.702  23.825 1.00 46.56 ? 141 GLU A OE1 1 
ATOM   1107 O  OE2 . GLU A 1 150 ? 2.090  -3.352  24.739 1.00 46.93 ? 141 GLU A OE2 1 
ATOM   1108 N  N   . LEU A 1 151 ? 3.121  -1.910  19.750 1.00 32.39 ? 142 LEU A N   1 
ATOM   1109 C  CA  . LEU A 1 151 ? 4.370  -1.148  19.852 1.00 31.49 ? 142 LEU A CA  1 
ATOM   1110 C  C   . LEU A 1 151 ? 4.794  -1.039  21.316 1.00 30.74 ? 142 LEU A C   1 
ATOM   1111 O  O   . LEU A 1 151 ? 3.983  -0.702  22.185 1.00 30.16 ? 142 LEU A O   1 
ATOM   1112 C  CB  . LEU A 1 151 ? 4.204  0.261   19.261 1.00 31.12 ? 142 LEU A CB  1 
ATOM   1113 C  CG  . LEU A 1 151 ? 4.580  0.564   17.799 1.00 35.72 ? 142 LEU A CG  1 
ATOM   1114 C  CD1 . LEU A 1 151 ? 4.542  -0.616  16.903 1.00 37.13 ? 142 LEU A CD1 1 
ATOM   1115 C  CD2 . LEU A 1 151 ? 3.751  1.694   17.244 1.00 32.65 ? 142 LEU A CD2 1 
ATOM   1116 N  N   . SER A 1 152 ? 6.058  -1.359  21.581 1.00 29.97 ? 143 SER A N   1 
ATOM   1117 C  CA  . SER A 1 152 ? 6.646  -1.191  22.902 1.00 28.42 ? 143 SER A CA  1 
ATOM   1118 C  C   . SER A 1 152 ? 8.077  -0.650  22.810 1.00 26.68 ? 143 SER A C   1 
ATOM   1119 O  O   . SER A 1 152 ? 8.708  -0.678  21.759 1.00 24.87 ? 143 SER A O   1 
ATOM   1120 C  CB  . SER A 1 152 ? 6.595  -2.495  23.718 1.00 29.86 ? 143 SER A CB  1 
ATOM   1121 O  OG  . SER A 1 152 ? 7.261  -3.569  23.080 1.00 31.45 ? 143 SER A OG  1 
ATOM   1122 N  N   . VAL A 1 153 ? 8.537  -0.111  23.929 1.00 26.42 ? 144 VAL A N   1 
ATOM   1123 C  CA  . VAL A 1 153 ? 9.903  0.415   24.084 1.00 26.17 ? 144 VAL A CA  1 
ATOM   1124 C  C   . VAL A 1 153 ? 10.667 -0.557  24.963 1.00 25.00 ? 144 VAL A C   1 
ATOM   1125 O  O   . VAL A 1 153 ? 10.105 -1.148  25.903 1.00 24.96 ? 144 VAL A O   1 
ATOM   1126 C  CB  . VAL A 1 153 ? 9.876  1.837   24.698 1.00 27.47 ? 144 VAL A CB  1 
ATOM   1127 C  CG1 . VAL A 1 153 ? 11.139 2.203   25.334 1.00 32.70 ? 144 VAL A CG1 1 
ATOM   1128 C  CG2 . VAL A 1 153 ? 9.527  2.856   23.603 1.00 29.31 ? 144 VAL A CG2 1 
ATOM   1129 N  N   . MET A 1 154 ? 11.939 -0.755  24.652 1.00 23.87 ? 145 MET A N   1 
ATOM   1130 C  CA  . MET A 1 154 ? 12.828 -1.541  25.517 1.00 24.60 ? 145 MET A CA  1 
ATOM   1131 C  C   . MET A 1 154 ? 14.279 -1.122  25.317 1.00 22.59 ? 145 MET A C   1 
ATOM   1132 O  O   . MET A 1 154 ? 14.585 -0.309  24.462 1.00 22.86 ? 145 MET A O   1 
ATOM   1133 C  CB  . MET A 1 154 ? 12.679 -3.036  25.231 1.00 24.45 ? 145 MET A CB  1 
ATOM   1134 C  CG  . MET A 1 154 ? 12.888 -3.403  23.759 1.00 25.69 ? 145 MET A CG  1 
ATOM   1135 S  SD  . MET A 1 154 ? 12.837 -5.155  23.464 1.00 28.98 ? 145 MET A SD  1 
ATOM   1136 C  CE  . MET A 1 154 ? 14.307 -5.737  24.318 1.00 31.94 ? 145 MET A CE  1 
ATOM   1137 N  N   . SER A 1 155 ? 15.155 -1.687  26.138 1.00 23.15 ? 146 SER A N   1 
ATOM   1138 C  CA  . SER A 1 155 ? 16.613 -1.542  25.969 1.00 22.36 ? 146 SER A CA  1 
ATOM   1139 C  C   . SER A 1 155 ? 17.309 -2.930  25.951 1.00 23.31 ? 146 SER A C   1 
ATOM   1140 O  O   . SER A 1 155 ? 16.750 -3.956  26.414 1.00 22.77 ? 146 SER A O   1 
ATOM   1141 C  CB  . SER A 1 155 ? 17.228 -0.594  27.040 1.00 22.71 ? 146 SER A CB  1 
ATOM   1142 O  OG  . SER A 1 155 ? 17.371 -1.200  28.334 1.00 21.39 ? 146 SER A OG  1 
ATOM   1143 N  N   . THR A 1 156 ? 18.516 -2.949  25.387 1.00 21.81 ? 147 THR A N   1 
ATOM   1144 C  CA  . THR A 1 156 ? 19.412 -4.095  25.395 1.00 21.23 ? 147 THR A CA  1 
ATOM   1145 C  C   . THR A 1 156 ? 20.815 -3.667  25.816 1.00 21.33 ? 147 THR A C   1 
ATOM   1146 O  O   . THR A 1 156 ? 21.196 -2.509  25.593 1.00 21.44 ? 147 THR A O   1 
ATOM   1147 C  CB  . THR A 1 156 ? 19.489 -4.806  23.996 1.00 20.75 ? 147 THR A CB  1 
ATOM   1148 O  OG1 . THR A 1 156 ? 20.038 -3.913  22.998 1.00 21.56 ? 147 THR A OG1 1 
ATOM   1149 C  CG2 . THR A 1 156 ? 18.132 -5.247  23.542 1.00 24.57 ? 147 THR A CG2 1 
ATOM   1150 N  N   . PRO A 1 157 ? 21.584 -4.591  26.441 1.00 21.96 ? 148 PRO A N   1 
ATOM   1151 C  CA  . PRO A 1 157 ? 22.994 -4.405  26.726 1.00 21.12 ? 148 PRO A CA  1 
ATOM   1152 C  C   . PRO A 1 157 ? 23.886 -4.688  25.508 1.00 21.65 ? 148 PRO A C   1 
ATOM   1153 O  O   . PRO A 1 157 ? 23.526 -5.528  24.633 1.00 20.33 ? 148 PRO A O   1 
ATOM   1154 C  CB  . PRO A 1 157 ? 23.251 -5.460  27.810 1.00 23.08 ? 148 PRO A CB  1 
ATOM   1155 C  CG  . PRO A 1 157 ? 22.361 -6.573  27.398 1.00 21.42 ? 148 PRO A CG  1 
ATOM   1156 C  CD  . PRO A 1 157 ? 21.118 -5.899  26.923 1.00 22.92 ? 148 PRO A CD  1 
ATOM   1157 N  N   . ASN A 1 158 ? 25.010 -3.961  25.417 1.00 20.24 ? 149 ASN A N   1 
ATOM   1158 C  CA  . ASN A 1 158 ? 26.093 -4.304  24.458 1.00 20.96 ? 149 ASN A CA  1 
ATOM   1159 C  C   . ASN A 1 158 ? 25.568 -4.337  23.020 1.00 20.81 ? 149 ASN A C   1 
ATOM   1160 O  O   . ASN A 1 158 ? 24.956 -3.342  22.605 1.00 22.07 ? 149 ASN A O   1 
ATOM   1161 C  CB  . ASN A 1 158 ? 26.800 -5.603  24.899 1.00 20.81 ? 149 ASN A CB  1 
ATOM   1162 C  CG  . ASN A 1 158 ? 27.263 -5.547  26.353 1.00 23.29 ? 149 ASN A CG  1 
ATOM   1163 O  OD1 . ASN A 1 158 ? 27.152 -6.533  27.108 1.00 27.38 ? 149 ASN A OD1 1 
ATOM   1164 N  ND2 . ASN A 1 158 ? 27.762 -4.393  26.761 1.00 18.94 ? 149 ASN A ND2 1 
ATOM   1165 N  N   . GLN A 1 159 ? 25.771 -5.422  22.248 1.00 20.92 ? 150 GLN A N   1 
ATOM   1166 C  CA  . GLN A 1 159 ? 25.189 -5.475  20.880 1.00 21.72 ? 150 GLN A CA  1 
ATOM   1167 C  C   . GLN A 1 159 ? 24.050 -6.496  20.794 1.00 23.20 ? 150 GLN A C   1 
ATOM   1168 O  O   . GLN A 1 159 ? 23.746 -7.026  19.713 1.00 24.58 ? 150 GLN A O   1 
ATOM   1169 C  CB  . GLN A 1 159 ? 26.260 -5.780  19.827 1.00 22.97 ? 150 GLN A CB  1 
ATOM   1170 C  CG  . GLN A 1 159 ? 27.513 -4.803  19.837 1.00 23.96 ? 150 GLN A CG  1 
ATOM   1171 C  CD  . GLN A 1 159 ? 27.234 -3.354  19.372 1.00 19.01 ? 150 GLN A CD  1 
ATOM   1172 O  OE1 . GLN A 1 159 ? 28.071 -2.402  19.613 1.00 21.30 ? 150 GLN A OE1 1 
ATOM   1173 N  NE2 . GLN A 1 159 ? 26.157 -3.183  18.655 1.00 14.79 ? 150 GLN A NE2 1 
ATOM   1174 N  N   . ASP A 1 160 ? 23.424 -6.782  21.937 1.00 22.40 ? 151 ASP A N   1 
ATOM   1175 C  CA  . ASP A 1 160 ? 22.281 -7.678  21.954 1.00 22.38 ? 151 ASP A CA  1 
ATOM   1176 C  C   . ASP A 1 160 ? 21.071 -7.016  21.289 1.00 22.64 ? 151 ASP A C   1 
ATOM   1177 O  O   . ASP A 1 160 ? 20.931 -5.781  21.306 1.00 22.29 ? 151 ASP A O   1 
ATOM   1178 C  CB  . ASP A 1 160 ? 21.943 -8.104  23.396 1.00 22.83 ? 151 ASP A CB  1 
ATOM   1179 C  CG  . ASP A 1 160 ? 23.017 -8.996  24.021 1.00 24.44 ? 151 ASP A CG  1 
ATOM   1180 O  OD1 . ASP A 1 160 ? 23.985 -9.400  23.346 1.00 27.01 ? 151 ASP A OD1 1 
ATOM   1181 O  OD2 . ASP A 1 160 ? 22.858 -9.335  25.207 1.00 28.80 ? 151 ASP A OD2 1 
ATOM   1182 N  N   . THR A 1 161 ? 20.181 -7.824  20.693 1.00 22.42 ? 152 THR A N   1 
ATOM   1183 C  CA  . THR A 1 161 ? 19.047 -7.267  19.951 1.00 24.02 ? 152 THR A CA  1 
ATOM   1184 C  C   . THR A 1 161 ? 17.739 -7.893  20.412 1.00 25.03 ? 152 THR A C   1 
ATOM   1185 O  O   . THR A 1 161 ? 17.754 -8.946  21.041 1.00 25.27 ? 152 THR A O   1 
ATOM   1186 C  CB  . THR A 1 161 ? 19.160 -7.516  18.405 1.00 25.03 ? 152 THR A CB  1 
ATOM   1187 O  OG1 . THR A 1 161 ? 18.540 -8.752  18.074 1.00 26.02 ? 152 THR A OG1 1 
ATOM   1188 C  CG2 . THR A 1 161 ? 20.621 -7.557  17.937 1.00 26.62 ? 152 THR A CG2 1 
ATOM   1189 N  N   . PRO A 1 162 ? 16.610 -7.255  20.098 1.00 25.57 ? 153 PRO A N   1 
ATOM   1190 C  CA  . PRO A 1 162 ? 15.282 -7.863  20.412 1.00 27.09 ? 153 PRO A CA  1 
ATOM   1191 C  C   . PRO A 1 162 ? 14.875 -9.103  19.616 1.00 27.91 ? 153 PRO A C   1 
ATOM   1192 O  O   . PRO A 1 162 ? 13.860 -9.713  19.959 1.00 27.01 ? 153 PRO A O   1 
ATOM   1193 C  CB  . PRO A 1 162 ? 14.290 -6.718  20.110 1.00 26.31 ? 153 PRO A CB  1 
ATOM   1194 C  CG  . PRO A 1 162 ? 15.132 -5.457  20.052 1.00 26.39 ? 153 PRO A CG  1 
ATOM   1195 C  CD  . PRO A 1 162 ? 16.454 -5.905  19.518 1.00 26.15 ? 153 PRO A CD  1 
ATOM   1196 N  N   . LEU A 1 163 ? 15.644 -9.466  18.586 1.00 28.74 ? 154 LEU A N   1 
ATOM   1197 C  CA  . LEU A 1 163 ? 15.258 -10.570 17.684 1.00 32.27 ? 154 LEU A CA  1 
ATOM   1198 C  C   . LEU A 1 163 ? 15.262 -11.867 18.461 1.00 35.70 ? 154 LEU A C   1 
ATOM   1199 O  O   . LEU A 1 163 ? 14.387 -12.688 18.274 1.00 37.62 ? 154 LEU A O   1 
ATOM   1200 C  CB  . LEU A 1 163 ? 16.193 -10.683 16.487 1.00 31.27 ? 154 LEU A CB  1 
ATOM   1201 C  CG  . LEU A 1 163 ? 16.388 -9.467  15.594 1.00 30.92 ? 154 LEU A CG  1 
ATOM   1202 C  CD1 . LEU A 1 163 ? 17.450 -9.819  14.530 1.00 30.56 ? 154 LEU A CD1 1 
ATOM   1203 C  CD2 . LEU A 1 163 ? 15.102 -8.966  14.947 1.00 34.05 ? 154 LEU A CD2 1 
ATOM   1204 N  N   . GLN A 1 164 ? 16.238 -12.019 19.356 1.00 39.67 ? 155 GLN A N   1 
ATOM   1205 C  CA  . GLN A 1 164 ? 16.336 -13.184 20.256 1.00 40.24 ? 155 GLN A CA  1 
ATOM   1206 C  C   . GLN A 1 164 ? 15.007 -13.415 20.998 1.00 40.89 ? 155 GLN A C   1 
ATOM   1207 O  O   . GLN A 1 164 ? 14.685 -14.560 21.326 1.00 41.58 ? 155 GLN A O   1 
ATOM   1208 C  CB  . GLN A 1 164 ? 17.543 -12.997 21.219 1.00 40.80 ? 155 GLN A CB  1 
ATOM   1209 C  CG  . GLN A 1 164 ? 17.426 -13.575 22.672 1.00 42.40 ? 155 GLN A CG  1 
ATOM   1210 C  CD  . GLN A 1 164 ? 18.373 -14.759 23.018 1.00 45.17 ? 155 GLN A CD  1 
ATOM   1211 O  OE1 . GLN A 1 164 ? 18.273 -15.316 24.122 1.00 52.65 ? 155 GLN A OE1 1 
ATOM   1212 N  NE2 . GLN A 1 164 ? 19.288 -15.135 22.099 1.00 49.56 ? 155 GLN A NE2 1 
ATOM   1213 N  N   . GLU A 1 165 ? 14.244 -12.337 21.235 1.00 40.54 ? 156 GLU A N   1 
ATOM   1214 C  CA  . GLU A 1 165 ? 12.937 -12.380 21.926 1.00 41.15 ? 156 GLU A CA  1 
ATOM   1215 C  C   . GLU A 1 165 ? 11.691 -12.413 21.045 1.00 41.46 ? 156 GLU A C   1 
ATOM   1216 O  O   . GLU A 1 165 ? 10.570 -12.271 21.556 1.00 42.95 ? 156 GLU A O   1 
ATOM   1217 C  CB  . GLU A 1 165 ? 12.769 -11.130 22.788 1.00 42.26 ? 156 GLU A CB  1 
ATOM   1218 C  CG  . GLU A 1 165 ? 13.922 -10.846 23.688 1.00 42.14 ? 156 GLU A CG  1 
ATOM   1219 C  CD  . GLU A 1 165 ? 13.616 -9.733  24.644 1.00 43.74 ? 156 GLU A CD  1 
ATOM   1220 O  OE1 . GLU A 1 165 ? 14.580 -9.079  25.088 1.00 50.79 ? 156 GLU A OE1 1 
ATOM   1221 O  OE2 . GLU A 1 165 ? 12.418 -9.502  24.941 1.00 45.65 ? 156 GLU A OE2 1 
ATOM   1222 N  N   . GLY A 1 166 ? 11.856 -12.547 19.744 1.00 40.49 ? 157 GLY A N   1 
ATOM   1223 C  CA  . GLY A 1 166 ? 10.718 -12.463 18.827 1.00 38.87 ? 157 GLY A CA  1 
ATOM   1224 C  C   . GLY A 1 166 ? 10.094 -11.104 18.535 1.00 38.85 ? 157 GLY A C   1 
ATOM   1225 O  O   . GLY A 1 166 ? 9.022  -11.055 17.921 1.00 40.93 ? 157 GLY A O   1 
ATOM   1226 N  N   . LYS A 1 167 ? 10.733 -9.995  18.936 1.00 36.14 ? 158 LYS A N   1 
ATOM   1227 C  CA  . LYS A 1 167 ? 10.205 -8.637  18.672 1.00 34.29 ? 158 LYS A CA  1 
ATOM   1228 C  C   . LYS A 1 167 ? 10.918 -8.038  17.476 1.00 32.25 ? 158 LYS A C   1 
ATOM   1229 O  O   . LYS A 1 167 ? 12.065 -8.386  17.240 1.00 32.79 ? 158 LYS A O   1 
ATOM   1230 C  CB  . LYS A 1 167 ? 10.401 -7.746  19.889 1.00 34.52 ? 158 LYS A CB  1 
ATOM   1231 C  CG  . LYS A 1 167 ? 9.759  -8.313  21.152 1.00 36.17 ? 158 LYS A CG  1 
ATOM   1232 C  CD  . LYS A 1 167 ? 10.154 -7.502  22.339 1.00 35.75 ? 158 LYS A CD  1 
ATOM   1233 C  CE  . LYS A 1 167 ? 9.649  -8.085  23.649 1.00 41.11 ? 158 LYS A CE  1 
ATOM   1234 N  NZ  . LYS A 1 167 ? 10.081 -7.194  24.813 1.00 42.30 ? 158 LYS A NZ  1 
ATOM   1235 N  N   . ILE A 1 168 ? 10.242 -7.166  16.728 1.00 30.81 ? 159 ILE A N   1 
ATOM   1236 C  CA  . ILE A 1 168 ? 10.774 -6.615  15.445 1.00 31.03 ? 159 ILE A CA  1 
ATOM   1237 C  C   . ILE A 1 168 ? 11.142 -5.124  15.610 1.00 28.58 ? 159 ILE A C   1 
ATOM   1238 O  O   . ILE A 1 168 ? 10.283 -4.319  15.899 1.00 25.20 ? 159 ILE A O   1 
ATOM   1239 C  CB  . ILE A 1 168 ? 9.782  -6.708  14.286 1.00 31.22 ? 159 ILE A CB  1 
ATOM   1240 C  CG1 . ILE A 1 168 ? 9.351  -8.149  14.008 1.00 33.38 ? 159 ILE A CG1 1 
ATOM   1241 C  CG2 . ILE A 1 168 ? 10.394 -6.134  13.017 1.00 31.40 ? 159 ILE A CG2 1 
ATOM   1242 C  CD1 . ILE A 1 168 ? 8.130  -8.233  13.028 1.00 33.64 ? 159 ILE A CD1 1 
ATOM   1243 N  N   . PRO A 1 169 ? 12.443 -4.783  15.519 1.00 28.45 ? 160 PRO A N   1 
ATOM   1244 C  CA  . PRO A 1 169 ? 12.864 -3.373  15.583 1.00 27.66 ? 160 PRO A CA  1 
ATOM   1245 C  C   . PRO A 1 169 ? 12.363 -2.457  14.464 1.00 27.11 ? 160 PRO A C   1 
ATOM   1246 O  O   . PRO A 1 169 ? 12.451 -2.807  13.252 1.00 27.37 ? 160 PRO A O   1 
ATOM   1247 C  CB  . PRO A 1 169 ? 14.392 -3.471  15.562 1.00 27.46 ? 160 PRO A CB  1 
ATOM   1248 C  CG  . PRO A 1 169 ? 14.673 -4.860  16.107 1.00 28.67 ? 160 PRO A CG  1 
ATOM   1249 C  CD  . PRO A 1 169 ? 13.601 -5.703  15.524 1.00 28.30 ? 160 PRO A CD  1 
ATOM   1250 N  N   . LEU A 1 170 ? 11.826 -1.309  14.876 1.00 24.65 ? 161 LEU A N   1 
ATOM   1251 C  CA  . LEU A 1 170 ? 11.448 -0.223  13.988 1.00 26.11 ? 161 LEU A CA  1 
ATOM   1252 C  C   . LEU A 1 170 ? 12.405 0.981   14.098 1.00 25.47 ? 161 LEU A C   1 
ATOM   1253 O  O   . LEU A 1 170 ? 12.575 1.747   13.162 1.00 26.06 ? 161 LEU A O   1 
ATOM   1254 C  CB  . LEU A 1 170 ? 10.031 0.222   14.362 1.00 25.06 ? 161 LEU A CB  1 
ATOM   1255 C  CG  . LEU A 1 170 ? 9.047  -0.951  14.455 1.00 28.30 ? 161 LEU A CG  1 
ATOM   1256 C  CD1 . LEU A 1 170 ? 7.678  -0.459  14.742 1.00 30.41 ? 161 LEU A CD1 1 
ATOM   1257 C  CD2 . LEU A 1 170 ? 9.077  -1.759  13.156 1.00 28.37 ? 161 LEU A CD2 1 
ATOM   1258 N  N   . LEU A 1 171 ? 12.975 1.183   15.289 1.00 24.69 ? 162 LEU A N   1 
ATOM   1259 C  CA  . LEU A 1 171 ? 13.750 2.391   15.577 1.00 24.09 ? 162 LEU A CA  1 
ATOM   1260 C  C   . LEU A 1 171 ? 14.705 2.062   16.699 1.00 23.31 ? 162 LEU A C   1 
ATOM   1261 O  O   . LEU A 1 171 ? 14.329 1.303   17.574 1.00 23.81 ? 162 LEU A O   1 
ATOM   1262 C  CB  . LEU A 1 171 ? 12.804 3.538   15.982 1.00 22.53 ? 162 LEU A CB  1 
ATOM   1263 C  CG  . LEU A 1 171 ? 13.429 4.888   16.338 1.00 23.72 ? 162 LEU A CG  1 
ATOM   1264 C  CD1 . LEU A 1 171 ? 14.128 5.513   15.144 1.00 23.48 ? 162 LEU A CD1 1 
ATOM   1265 C  CD2 . LEU A 1 171 ? 12.380 5.840   16.892 1.00 25.99 ? 162 LEU A CD2 1 
ATOM   1266 N  N   . VAL A 1 172 ? 15.932 2.583   16.632 1.00 23.29 ? 163 VAL A N   1 
ATOM   1267 C  CA  . VAL A 1 172 ? 16.978 2.319   17.639 1.00 23.61 ? 163 VAL A CA  1 
ATOM   1268 C  C   . VAL A 1 172 ? 17.849 3.572   17.869 1.00 23.33 ? 163 VAL A C   1 
ATOM   1269 O  O   . VAL A 1 172 ? 18.128 4.358   16.932 1.00 23.76 ? 163 VAL A O   1 
ATOM   1270 C  CB  . VAL A 1 172 ? 17.872 1.088   17.214 1.00 24.59 ? 163 VAL A CB  1 
ATOM   1271 C  CG1 . VAL A 1 172 ? 18.715 1.399   15.911 1.00 24.93 ? 163 VAL A CG1 1 
ATOM   1272 C  CG2 . VAL A 1 172 ? 18.736 0.548   18.405 1.00 24.65 ? 163 VAL A CG2 1 
ATOM   1273 N  N   . ILE A 1 173 ? 18.252 3.756   19.126 1.00 21.37 ? 164 ILE A N   1 
ATOM   1274 C  CA  . ILE A 1 173 ? 19.268 4.730   19.505 1.00 22.50 ? 164 ILE A CA  1 
ATOM   1275 C  C   . ILE A 1 173 ? 20.450 4.032   20.216 1.00 22.40 ? 164 ILE A C   1 
ATOM   1276 O  O   . ILE A 1 173 ? 20.255 3.262   21.147 1.00 21.28 ? 164 ILE A O   1 
ATOM   1277 C  CB  . ILE A 1 173 ? 18.665 5.890   20.367 1.00 22.63 ? 164 ILE A CB  1 
ATOM   1278 C  CG1 . ILE A 1 173 ? 19.760 6.901   20.719 1.00 25.16 ? 164 ILE A CG1 1 
ATOM   1279 C  CG2 . ILE A 1 173 ? 18.003 5.360   21.562 1.00 23.81 ? 164 ILE A CG2 1 
ATOM   1280 C  CD1 . ILE A 1 173 ? 19.287 8.145   21.399 1.00 24.62 ? 164 ILE A CD1 1 
ATOM   1281 N  N   . ASP A 1 174 ? 21.659 4.308   19.724 1.00 22.07 ? 165 ASP A N   1 
ATOM   1282 C  CA  . ASP A 1 174 ? 22.926 3.816   20.264 1.00 22.20 ? 165 ASP A CA  1 
ATOM   1283 C  C   . ASP A 1 174 ? 23.353 4.688   21.469 1.00 20.42 ? 165 ASP A C   1 
ATOM   1284 O  O   . ASP A 1 174 ? 23.619 5.879   21.326 1.00 19.36 ? 165 ASP A O   1 
ATOM   1285 C  CB  . ASP A 1 174 ? 23.986 3.844   19.144 1.00 22.76 ? 165 ASP A CB  1 
ATOM   1286 C  CG  . ASP A 1 174 ? 25.315 3.170   19.508 1.00 22.07 ? 165 ASP A CG  1 
ATOM   1287 O  OD1 . ASP A 1 174 ? 25.569 2.796   20.696 1.00 20.06 ? 165 ASP A OD1 1 
ATOM   1288 O  OD2 . ASP A 1 174 ? 26.137 2.990   18.568 1.00 22.48 ? 165 ASP A OD2 1 
ATOM   1289 N  N   . VAL A 1 175 ? 23.418 4.094   22.660 1.00 21.03 ? 166 VAL A N   1 
ATOM   1290 C  CA  . VAL A 1 175 ? 23.960 4.808   23.817 1.00 21.20 ? 166 VAL A CA  1 
ATOM   1291 C  C   . VAL A 1 175 ? 25.288 4.203   24.337 1.00 20.32 ? 166 VAL A C   1 
ATOM   1292 O  O   . VAL A 1 175 ? 25.697 4.471   25.459 1.00 21.15 ? 166 VAL A O   1 
ATOM   1293 C  CB  . VAL A 1 175 ? 22.936 5.003   24.943 1.00 23.63 ? 166 VAL A CB  1 
ATOM   1294 C  CG1 . VAL A 1 175 ? 21.817 5.983   24.502 1.00 25.10 ? 166 VAL A CG1 1 
ATOM   1295 C  CG2 . VAL A 1 175 ? 22.372 3.682   25.439 1.00 25.93 ? 166 VAL A CG2 1 
ATOM   1296 N  N   . TRP A 1 176 ? 26.001 3.468   23.482 1.00 19.56 ? 167 TRP A N   1 
ATOM   1297 C  CA  . TRP A 1 176 ? 27.442 3.266   23.740 1.00 19.67 ? 167 TRP A CA  1 
ATOM   1298 C  C   . TRP A 1 176 ? 28.070 4.654   23.849 1.00 19.20 ? 167 TRP A C   1 
ATOM   1299 O  O   . TRP A 1 176 ? 27.682 5.559   23.083 1.00 18.55 ? 167 TRP A O   1 
ATOM   1300 C  CB  . TRP A 1 176 ? 28.135 2.489   22.644 1.00 18.56 ? 167 TRP A CB  1 
ATOM   1301 C  CG  . TRP A 1 176 ? 27.841 1.010   22.625 1.00 18.64 ? 167 TRP A CG  1 
ATOM   1302 C  CD1 . TRP A 1 176 ? 26.618 0.409   22.575 1.00 19.53 ? 167 TRP A CD1 1 
ATOM   1303 C  CD2 . TRP A 1 176 ? 28.798 -0.027  22.714 1.00 19.42 ? 167 TRP A CD2 1 
ATOM   1304 N  NE1 . TRP A 1 176 ? 26.756 -0.959  22.568 1.00 19.53 ? 167 TRP A NE1 1 
ATOM   1305 C  CE2 . TRP A 1 176 ? 28.091 -1.256  22.693 1.00 18.84 ? 167 TRP A CE2 1 
ATOM   1306 C  CE3 . TRP A 1 176 ? 30.200 -0.050  22.815 1.00 21.13 ? 167 TRP A CE3 1 
ATOM   1307 C  CZ2 . TRP A 1 176 ? 28.729 -2.472  22.740 1.00 20.13 ? 167 TRP A CZ2 1 
ATOM   1308 C  CZ3 . TRP A 1 176 ? 30.833 -1.303  22.899 1.00 20.89 ? 167 TRP A CZ3 1 
ATOM   1309 C  CH2 . TRP A 1 176 ? 30.094 -2.474  22.826 1.00 19.43 ? 167 TRP A CH2 1 
ATOM   1310 N  N   . GLU A 1 177 ? 29.039 4.824   24.749 1.00 18.56 ? 168 GLU A N   1 
ATOM   1311 C  CA  . GLU A 1 177 ? 29.743 6.128   24.892 1.00 19.53 ? 168 GLU A CA  1 
ATOM   1312 C  C   . GLU A 1 177 ? 30.398 6.626   23.581 1.00 19.60 ? 168 GLU A C   1 
ATOM   1313 O  O   . GLU A 1 177 ? 30.399 7.812   23.305 1.00 19.74 ? 168 GLU A O   1 
ATOM   1314 C  CB  . GLU A 1 177 ? 30.706 6.148   26.107 1.00 19.55 ? 168 GLU A CB  1 
ATOM   1315 C  CG  . GLU A 1 177 ? 29.926 6.222   27.443 1.00 17.66 ? 168 GLU A CG  1 
ATOM   1316 C  CD  . GLU A 1 177 ? 30.740 5.998   28.688 1.00 20.06 ? 168 GLU A CD  1 
ATOM   1317 O  OE1 . GLU A 1 177 ? 31.724 5.244   28.633 1.00 20.59 ? 168 GLU A OE1 1 
ATOM   1318 O  OE2 . GLU A 1 177 ? 30.357 6.581   29.739 1.00 22.63 ? 168 GLU A OE2 1 
ATOM   1319 N  N   . HIS A 1 178 ? 30.878 5.724   22.735 1.00 19.92 ? 169 HIS A N   1 
ATOM   1320 C  CA  . HIS A 1 178 ? 31.425 6.113   21.444 1.00 19.80 ? 169 HIS A CA  1 
ATOM   1321 C  C   . HIS A 1 178 ? 30.443 6.884   20.560 1.00 19.96 ? 169 HIS A C   1 
ATOM   1322 O  O   . HIS A 1 178 ? 30.871 7.667   19.690 1.00 20.45 ? 169 HIS A O   1 
ATOM   1323 C  CB  . HIS A 1 178 ? 32.057 4.920   20.685 1.00 20.27 ? 169 HIS A CB  1 
ATOM   1324 C  CG  . HIS A 1 178 ? 31.099 3.857   20.201 1.00 21.18 ? 169 HIS A CG  1 
ATOM   1325 N  ND1 . HIS A 1 178 ? 31.201 2.536   20.589 1.00 21.42 ? 169 HIS A ND1 1 
ATOM   1326 C  CD2 . HIS A 1 178 ? 30.074 3.908   19.302 1.00 20.77 ? 169 HIS A CD2 1 
ATOM   1327 C  CE1 . HIS A 1 178 ? 30.267 1.833   19.961 1.00 22.35 ? 169 HIS A CE1 1 
ATOM   1328 N  NE2 . HIS A 1 178 ? 29.544 2.644   19.190 1.00 20.01 ? 169 HIS A NE2 1 
ATOM   1329 N  N   . ALA A 1 179 ? 29.149 6.652   20.753 1.00 18.59 ? 170 ALA A N   1 
ATOM   1330 C  CA  . ALA A 1 179 ? 28.134 7.325   19.952 1.00 19.51 ? 170 ALA A CA  1 
ATOM   1331 C  C   . ALA A 1 179 ? 28.050 8.816   20.192 1.00 20.30 ? 170 ALA A C   1 
ATOM   1332 O  O   . ALA A 1 179 ? 27.646 9.565   19.288 1.00 22.13 ? 170 ALA A O   1 
ATOM   1333 C  CB  . ALA A 1 179 ? 26.797 6.697   20.128 1.00 19.93 ? 170 ALA A CB  1 
ATOM   1334 N  N   . TYR A 1 180 ? 28.441 9.248   21.376 1.00 19.57 ? 171 TYR A N   1 
ATOM   1335 C  CA  . TYR A 1 180 ? 28.242 10.634  21.840 1.00 19.90 ? 171 TYR A CA  1 
ATOM   1336 C  C   . TYR A 1 180 ? 29.381 11.312  22.612 1.00 20.40 ? 171 TYR A C   1 
ATOM   1337 O  O   . TYR A 1 180 ? 29.252 12.477  22.922 1.00 21.50 ? 171 TYR A O   1 
ATOM   1338 C  CB  . TYR A 1 180 ? 26.955 10.713  22.674 1.00 19.11 ? 171 TYR A CB  1 
ATOM   1339 C  CG  . TYR A 1 180 ? 26.958 9.920   23.985 1.00 21.00 ? 171 TYR A CG  1 
ATOM   1340 C  CD1 . TYR A 1 180 ? 27.467 10.486  25.162 1.00 19.25 ? 171 TYR A CD1 1 
ATOM   1341 C  CD2 . TYR A 1 180 ? 26.371 8.658   24.057 1.00 17.65 ? 171 TYR A CD2 1 
ATOM   1342 C  CE1 . TYR A 1 180 ? 27.428 9.796   26.395 1.00 21.11 ? 171 TYR A CE1 1 
ATOM   1343 C  CE2 . TYR A 1 180 ? 26.348 7.923   25.298 1.00 19.53 ? 171 TYR A CE2 1 
ATOM   1344 C  CZ  . TYR A 1 180 ? 26.863 8.508   26.442 1.00 19.89 ? 171 TYR A CZ  1 
ATOM   1345 O  OH  . TYR A 1 180 ? 26.821 7.799   27.638 1.00 20.61 ? 171 TYR A OH  1 
ATOM   1346 N  N   . TYR A 1 181 ? 30.491 10.639  22.915 1.00 19.55 ? 172 TYR A N   1 
ATOM   1347 C  CA  . TYR A 1 181 ? 31.452 11.223  23.878 1.00 20.05 ? 172 TYR A CA  1 
ATOM   1348 C  C   . TYR A 1 181 ? 32.233 12.433  23.354 1.00 21.05 ? 172 TYR A C   1 
ATOM   1349 O  O   . TYR A 1 181 ? 32.553 13.335  24.140 1.00 22.95 ? 172 TYR A O   1 
ATOM   1350 C  CB  . TYR A 1 181 ? 32.424 10.155  24.460 1.00 18.88 ? 172 TYR A CB  1 
ATOM   1351 C  CG  . TYR A 1 181 ? 32.786 10.471  25.892 1.00 19.82 ? 172 TYR A CG  1 
ATOM   1352 C  CD1 . TYR A 1 181 ? 33.964 11.135  26.216 1.00 20.43 ? 172 TYR A CD1 1 
ATOM   1353 C  CD2 . TYR A 1 181 ? 31.896 10.187  26.896 1.00 20.73 ? 172 TYR A CD2 1 
ATOM   1354 C  CE1 . TYR A 1 181 ? 34.253 11.490  27.564 1.00 20.25 ? 172 TYR A CE1 1 
ATOM   1355 C  CE2 . TYR A 1 181 ? 32.137 10.548  28.228 1.00 20.43 ? 172 TYR A CE2 1 
ATOM   1356 C  CZ  . TYR A 1 181 ? 33.340 11.171  28.554 1.00 18.94 ? 172 TYR A CZ  1 
ATOM   1357 O  OH  . TYR A 1 181 ? 33.533 11.497  29.852 1.00 21.53 ? 172 TYR A OH  1 
ATOM   1358 N  N   . LEU A 1 182 ? 32.545 12.489  22.061 1.00 21.33 ? 173 LEU A N   1 
ATOM   1359 C  CA  . LEU A 1 182 ? 33.404 13.581  21.547 1.00 22.72 ? 173 LEU A CA  1 
ATOM   1360 C  C   . LEU A 1 182 ? 32.685 14.922  21.661 1.00 23.98 ? 173 LEU A C   1 
ATOM   1361 O  O   . LEU A 1 182 ? 33.308 15.923  22.062 1.00 24.71 ? 173 LEU A O   1 
ATOM   1362 C  CB  . LEU A 1 182 ? 33.901 13.329  20.112 1.00 23.32 ? 173 LEU A CB  1 
ATOM   1363 C  CG  . LEU A 1 182 ? 34.873 12.141  19.924 1.00 22.69 ? 173 LEU A CG  1 
ATOM   1364 C  CD1 . LEU A 1 182 ? 35.412 12.066  18.552 1.00 23.48 ? 173 LEU A CD1 1 
ATOM   1365 C  CD2 . LEU A 1 182 ? 36.060 12.144  20.957 1.00 24.49 ? 173 LEU A CD2 1 
ATOM   1366 N  N   . LYS A 1 183 ? 31.380 14.925  21.400 1.00 24.54 ? 174 LYS A N   1 
ATOM   1367 C  CA  . LYS A 1 183 ? 30.583 16.159  21.407 1.00 26.06 ? 174 LYS A CA  1 
ATOM   1368 C  C   . LYS A 1 183 ? 29.920 16.423  22.754 1.00 25.93 ? 174 LYS A C   1 
ATOM   1369 O  O   . LYS A 1 183 ? 29.880 17.564  23.192 1.00 26.39 ? 174 LYS A O   1 
ATOM   1370 C  CB  . LYS A 1 183 ? 29.523 16.139  20.308 1.00 26.69 ? 174 LYS A CB  1 
ATOM   1371 C  CG  . LYS A 1 183 ? 28.720 17.451  20.212 1.00 28.04 ? 174 LYS A CG  1 
ATOM   1372 C  CD  . LYS A 1 183 ? 27.836 17.423  18.988 1.00 30.72 ? 174 LYS A CD  1 
ATOM   1373 C  CE  . LYS A 1 183 ? 27.026 18.694  18.878 1.00 35.82 ? 174 LYS A CE  1 
ATOM   1374 N  NZ  . LYS A 1 183 ? 27.849 19.863  18.511 1.00 40.54 ? 174 LYS A NZ  1 
ATOM   1375 N  N   . TYR A 1 184 ? 29.426 15.373  23.415 1.00 25.35 ? 175 TYR A N   1 
ATOM   1376 C  CA  . TYR A 1 184 ? 28.584 15.517  24.570 1.00 24.49 ? 175 TYR A CA  1 
ATOM   1377 C  C   . TYR A 1 184 ? 29.213 15.050  25.892 1.00 23.81 ? 175 TYR A C   1 
ATOM   1378 O  O   . TYR A 1 184 ? 28.647 15.279  26.957 1.00 23.68 ? 175 TYR A O   1 
ATOM   1379 C  CB  . TYR A 1 184 ? 27.249 14.773  24.329 1.00 24.47 ? 175 TYR A CB  1 
ATOM   1380 C  CG  . TYR A 1 184 ? 26.442 15.296  23.144 1.00 23.68 ? 175 TYR A CG  1 
ATOM   1381 C  CD1 . TYR A 1 184 ? 25.666 16.442  23.266 1.00 26.55 ? 175 TYR A CD1 1 
ATOM   1382 C  CD2 . TYR A 1 184 ? 26.481 14.652  21.888 1.00 23.86 ? 175 TYR A CD2 1 
ATOM   1383 C  CE1 . TYR A 1 184 ? 24.949 16.943  22.184 1.00 25.84 ? 175 TYR A CE1 1 
ATOM   1384 C  CE2 . TYR A 1 184 ? 25.771 15.156  20.783 1.00 22.97 ? 175 TYR A CE2 1 
ATOM   1385 C  CZ  . TYR A 1 184 ? 25.000 16.299  20.939 1.00 25.61 ? 175 TYR A CZ  1 
ATOM   1386 O  OH  . TYR A 1 184 ? 24.287 16.778  19.846 1.00 26.90 ? 175 TYR A OH  1 
ATOM   1387 N  N   . GLN A 1 185 ? 30.359 14.385  25.819 1.00 23.26 ? 176 GLN A N   1 
ATOM   1388 C  CA  . GLN A 1 185 ? 31.026 13.845  26.988 1.00 23.92 ? 176 GLN A CA  1 
ATOM   1389 C  C   . GLN A 1 185 ? 30.076 13.056  27.873 1.00 23.06 ? 176 GLN A C   1 
ATOM   1390 O  O   . GLN A 1 185 ? 29.424 12.156  27.382 1.00 24.10 ? 176 GLN A O   1 
ATOM   1391 C  CB  . GLN A 1 185 ? 31.758 14.973  27.725 1.00 23.45 ? 176 GLN A CB  1 
ATOM   1392 C  CG  . GLN A 1 185 ? 32.931 15.460  26.927 1.00 30.14 ? 176 GLN A CG  1 
ATOM   1393 C  CD  . GLN A 1 185 ? 32.590 16.593  26.000 1.00 38.84 ? 176 GLN A CD  1 
ATOM   1394 O  OE1 . GLN A 1 185 ? 32.170 17.659  26.446 1.00 45.17 ? 176 GLN A OE1 1 
ATOM   1395 N  NE2 . GLN A 1 185 ? 32.792 16.388  24.695 1.00 42.80 ? 176 GLN A NE2 1 
ATOM   1396 N  N   . ASN A 1 186 ? 30.021 13.332  29.181 1.00 23.40 ? 177 ASN A N   1 
ATOM   1397 C  CA  . ASN A 1 186 ? 29.139 12.587  30.066 1.00 23.88 ? 177 ASN A CA  1 
ATOM   1398 C  C   . ASN A 1 186 ? 27.624 12.859  29.905 1.00 24.98 ? 177 ASN A C   1 
ATOM   1399 O  O   . ASN A 1 186 ? 26.839 12.174  30.571 1.00 25.61 ? 177 ASN A O   1 
ATOM   1400 C  CB  . ASN A 1 186 ? 29.524 12.879  31.539 1.00 25.01 ? 177 ASN A CB  1 
ATOM   1401 C  CG  . ASN A 1 186 ? 29.321 14.339  31.895 1.00 23.89 ? 177 ASN A CG  1 
ATOM   1402 O  OD1 . ASN A 1 186 ? 28.527 14.688  32.779 1.00 34.84 ? 177 ASN A OD1 1 
ATOM   1403 N  ND2 . ASN A 1 186 ? 30.003 15.202  31.181 1.00 25.64 ? 177 ASN A ND2 1 
ATOM   1404 N  N   . ARG A 1 187 ? 27.227 13.819  29.048 1.00 23.99 ? 178 ARG A N   1 
ATOM   1405 C  CA  . ARG A 1 187 ? 25.854 14.319  28.970 1.00 24.62 ? 178 ARG A CA  1 
ATOM   1406 C  C   . ARG A 1 187 ? 25.014 13.509  27.953 1.00 23.60 ? 178 ARG A C   1 
ATOM   1407 O  O   . ARG A 1 187 ? 24.537 14.028  26.923 1.00 22.11 ? 178 ARG A O   1 
ATOM   1408 C  CB  . ARG A 1 187 ? 25.850 15.810  28.639 1.00 26.14 ? 178 ARG A CB  1 
ATOM   1409 C  CG  . ARG A 1 187 ? 26.650 16.646  29.635 1.00 27.47 ? 178 ARG A CG  1 
ATOM   1410 C  CD  . ARG A 1 187 ? 26.652 18.143  29.264 1.00 31.72 ? 178 ARG A CD  1 
ATOM   1411 N  NE  . ARG A 1 187 ? 27.327 18.453  27.989 1.00 40.21 ? 178 ARG A NE  1 
ATOM   1412 C  CZ  . ARG A 1 187 ? 28.646 18.358  27.766 1.00 41.40 ? 178 ARG A CZ  1 
ATOM   1413 N  NH1 . ARG A 1 187 ? 29.469 17.954  28.708 1.00 45.42 ? 178 ARG A NH1 1 
ATOM   1414 N  NH2 . ARG A 1 187 ? 29.141 18.676  26.584 1.00 39.05 ? 178 ARG A NH2 1 
ATOM   1415 N  N   . ARG A 1 188 ? 24.854 12.230  28.272 1.00 23.23 ? 179 ARG A N   1 
ATOM   1416 C  CA  . ARG A 1 188 ? 23.995 11.327  27.486 1.00 23.24 ? 179 ARG A CA  1 
ATOM   1417 C  C   . ARG A 1 188 ? 22.584 11.895  27.246 1.00 23.28 ? 179 ARG A C   1 
ATOM   1418 O  O   . ARG A 1 188 ? 22.071 11.801  26.121 1.00 23.14 ? 179 ARG A O   1 
ATOM   1419 C  CB  . ARG A 1 188 ? 23.908 9.947   28.146 1.00 22.99 ? 179 ARG A CB  1 
ATOM   1420 C  CG  . ARG A 1 188 ? 23.311 8.903   27.239 1.00 21.85 ? 179 ARG A CG  1 
ATOM   1421 C  CD  . ARG A 1 188 ? 22.912 7.618   27.953 1.00 22.29 ? 179 ARG A CD  1 
ATOM   1422 N  NE  . ARG A 1 188 ? 24.038 6.723   28.190 1.00 21.92 ? 179 ARG A NE  1 
ATOM   1423 C  CZ  . ARG A 1 188 ? 23.913 5.492   28.670 1.00 22.92 ? 179 ARG A CZ  1 
ATOM   1424 N  NH1 . ARG A 1 188 ? 22.715 4.971   28.886 1.00 24.62 ? 179 ARG A NH1 1 
ATOM   1425 N  NH2 . ARG A 1 188 ? 24.995 4.746   28.875 1.00 25.30 ? 179 ARG A NH2 1 
ATOM   1426 N  N   . PRO A 1 189 ? 21.920 12.453  28.280 1.00 24.98 ? 180 PRO A N   1 
ATOM   1427 C  CA  . PRO A 1 189 ? 20.574 13.016  27.985 1.00 25.39 ? 180 PRO A CA  1 
ATOM   1428 C  C   . PRO A 1 189 ? 20.544 14.122  26.926 1.00 25.68 ? 180 PRO A C   1 
ATOM   1429 O  O   . PRO A 1 189 ? 19.577 14.212  26.153 1.00 27.67 ? 180 PRO A O   1 
ATOM   1430 C  CB  . PRO A 1 189 ? 20.157 13.599  29.346 1.00 27.32 ? 180 PRO A CB  1 
ATOM   1431 C  CG  . PRO A 1 189 ? 20.943 12.793  30.339 1.00 27.20 ? 180 PRO A CG  1 
ATOM   1432 C  CD  . PRO A 1 189 ? 22.249 12.586  29.710 1.00 25.64 ? 180 PRO A CD  1 
ATOM   1433 N  N   . GLU A 1 190 ? 21.569 14.965  26.875 1.00 25.94 ? 181 GLU A N   1 
ATOM   1434 C  CA  . GLU A 1 190 ? 21.656 16.029  25.868 1.00 25.41 ? 181 GLU A CA  1 
ATOM   1435 C  C   . GLU A 1 190 ? 21.823 15.415  24.467 1.00 24.77 ? 181 GLU A C   1 
ATOM   1436 O  O   . GLU A 1 190 ? 21.225 15.859  23.481 1.00 23.34 ? 181 GLU A O   1 
ATOM   1437 C  CB  . GLU A 1 190 ? 22.810 17.006  26.190 1.00 25.65 ? 181 GLU A CB  1 
ATOM   1438 C  CG  . GLU A 1 190 ? 23.012 18.081  25.115 1.00 26.27 ? 181 GLU A CG  1 
ATOM   1439 C  CD  . GLU A 1 190 ? 24.151 19.054  25.392 1.00 29.18 ? 181 GLU A CD  1 
ATOM   1440 O  OE1 . GLU A 1 190 ? 24.945 18.843  26.340 1.00 33.35 ? 181 GLU A OE1 1 
ATOM   1441 O  OE2 . GLU A 1 190 ? 24.234 20.050  24.625 1.00 37.91 ? 181 GLU A OE2 1 
ATOM   1442 N  N   . PHE A 1 191 ? 22.624 14.362  24.393 1.00 23.89 ? 182 PHE A N   1 
ATOM   1443 C  CA  . PHE A 1 191 ? 22.750 13.596  23.158 1.00 24.42 ? 182 PHE A CA  1 
ATOM   1444 C  C   . PHE A 1 191 ? 21.398 13.033  22.718 1.00 24.46 ? 182 PHE A C   1 
ATOM   1445 O  O   . PHE A 1 191 ? 21.014 13.141  21.538 1.00 26.16 ? 182 PHE A O   1 
ATOM   1446 C  CB  . PHE A 1 191 ? 23.762 12.447  23.329 1.00 23.56 ? 182 PHE A CB  1 
ATOM   1447 C  CG  . PHE A 1 191 ? 23.708 11.435  22.225 1.00 22.41 ? 182 PHE A CG  1 
ATOM   1448 C  CD1 . PHE A 1 191 ? 24.038 11.796  20.905 1.00 22.99 ? 182 PHE A CD1 1 
ATOM   1449 C  CD2 . PHE A 1 191 ? 23.273 10.147  22.471 1.00 24.93 ? 182 PHE A CD2 1 
ATOM   1450 C  CE1 . PHE A 1 191 ? 23.983 10.865  19.865 1.00 25.21 ? 182 PHE A CE1 1 
ATOM   1451 C  CE2 . PHE A 1 191 ? 23.218 9.204   21.427 1.00 25.49 ? 182 PHE A CE2 1 
ATOM   1452 C  CZ  . PHE A 1 191 ? 23.556 9.576   20.126 1.00 24.68 ? 182 PHE A CZ  1 
ATOM   1453 N  N   . VAL A 1 192 ? 20.682 12.407  23.638 1.00 24.23 ? 183 VAL A N   1 
ATOM   1454 C  CA  . VAL A 1 192 ? 19.368 11.826  23.298 1.00 25.35 ? 183 VAL A CA  1 
ATOM   1455 C  C   . VAL A 1 192 ? 18.391 12.902  22.808 1.00 26.66 ? 183 VAL A C   1 
ATOM   1456 O  O   . VAL A 1 192 ? 17.701 12.692  21.804 1.00 26.36 ? 183 VAL A O   1 
ATOM   1457 C  CB  . VAL A 1 192 ? 18.782 11.043  24.488 1.00 25.94 ? 183 VAL A CB  1 
ATOM   1458 C  CG1 . VAL A 1 192 ? 17.372 10.490  24.165 1.00 25.97 ? 183 VAL A CG1 1 
ATOM   1459 C  CG2 . VAL A 1 192 ? 19.709 9.914   24.908 1.00 23.46 ? 183 VAL A CG2 1 
ATOM   1460 N  N   . THR A 1 193 ? 18.373 14.064  23.475 1.00 27.89 ? 184 THR A N   1 
ATOM   1461 C  CA  . THR A 1 193 ? 17.509 15.193  23.053 1.00 27.17 ? 184 THR A CA  1 
ATOM   1462 C  C   . THR A 1 193 ? 17.821 15.658  21.629 1.00 27.15 ? 184 THR A C   1 
ATOM   1463 O  O   . THR A 1 193 ? 16.917 15.868  20.815 1.00 28.29 ? 184 THR A O   1 
ATOM   1464 C  CB  . THR A 1 193 ? 17.664 16.378  23.982 1.00 27.17 ? 184 THR A CB  1 
ATOM   1465 O  OG1 . THR A 1 193 ? 17.247 16.023  25.304 1.00 26.57 ? 184 THR A OG1 1 
ATOM   1466 C  CG2 . THR A 1 193 ? 16.826 17.553  23.500 1.00 29.48 ? 184 THR A CG2 1 
ATOM   1467 N  N   . ASN A 1 194 ? 19.102 15.761  21.318 1.00 25.87 ? 185 ASN A N   1 
ATOM   1468 C  CA  . ASN A 1 194 ? 19.538 16.070  19.968 1.00 26.74 ? 185 ASN A CA  1 
ATOM   1469 C  C   . ASN A 1 194 ? 19.230 15.009  18.903 1.00 26.61 ? 185 ASN A C   1 
ATOM   1470 O  O   . ASN A 1 194 ? 18.877 15.337  17.746 1.00 27.10 ? 185 ASN A O   1 
ATOM   1471 C  CB  . ASN A 1 194 ? 21.034 16.414  19.981 1.00 26.08 ? 185 ASN A CB  1 
ATOM   1472 C  CG  . ASN A 1 194 ? 21.279 17.851  20.347 1.00 30.02 ? 185 ASN A CG  1 
ATOM   1473 O  OD1 . ASN A 1 194 ? 21.222 18.732  19.490 1.00 36.85 ? 185 ASN A OD1 1 
ATOM   1474 N  ND2 . ASN A 1 194 ? 21.527 18.105  21.615 1.00 31.40 ? 185 ASN A ND2 1 
ATOM   1475 N  N   . TRP A 1 195 ? 19.362 13.745  19.296 1.00 24.84 ? 186 TRP A N   1 
ATOM   1476 C  CA  . TRP A 1 195 ? 19.186 12.629  18.373 1.00 25.86 ? 186 TRP A CA  1 
ATOM   1477 C  C   . TRP A 1 195 ? 17.778 12.632  17.725 1.00 24.66 ? 186 TRP A C   1 
ATOM   1478 O  O   . TRP A 1 195 ? 17.633 12.279  16.586 1.00 24.43 ? 186 TRP A O   1 
ATOM   1479 C  CB  . TRP A 1 195 ? 19.427 11.315  19.099 1.00 25.50 ? 186 TRP A CB  1 
ATOM   1480 C  CG  . TRP A 1 195 ? 19.129 10.141  18.246 1.00 23.79 ? 186 TRP A CG  1 
ATOM   1481 C  CD1 . TRP A 1 195 ? 19.918 9.607   17.265 1.00 24.99 ? 186 TRP A CD1 1 
ATOM   1482 C  CD2 . TRP A 1 195 ? 17.926 9.374   18.269 1.00 26.52 ? 186 TRP A CD2 1 
ATOM   1483 N  NE1 . TRP A 1 195 ? 19.273 8.535   16.678 1.00 25.43 ? 186 TRP A NE1 1 
ATOM   1484 C  CE2 . TRP A 1 195 ? 18.052 8.369   17.285 1.00 24.17 ? 186 TRP A CE2 1 
ATOM   1485 C  CE3 . TRP A 1 195 ? 16.755 9.423   19.047 1.00 25.61 ? 186 TRP A CE3 1 
ATOM   1486 C  CZ2 . TRP A 1 195 ? 17.054 7.430   17.049 1.00 22.71 ? 186 TRP A CZ2 1 
ATOM   1487 C  CZ3 . TRP A 1 195 ? 15.755 8.477   18.804 1.00 23.73 ? 186 TRP A CZ3 1 
ATOM   1488 C  CH2 . TRP A 1 195 ? 15.912 7.506   17.797 1.00 25.73 ? 186 TRP A CH2 1 
ATOM   1489 N  N   . TRP A 1 196 ? 16.753 13.046  18.456 1.00 25.96 ? 187 TRP A N   1 
ATOM   1490 C  CA  . TRP A 1 196 ? 15.383 13.110  17.889 1.00 26.13 ? 187 TRP A CA  1 
ATOM   1491 C  C   . TRP A 1 196 ? 15.279 14.017  16.649 1.00 26.56 ? 187 TRP A C   1 
ATOM   1492 O  O   . TRP A 1 196 ? 14.465 13.761  15.755 1.00 28.06 ? 187 TRP A O   1 
ATOM   1493 C  CB  . TRP A 1 196 ? 14.374 13.565  18.950 1.00 24.50 ? 187 TRP A CB  1 
ATOM   1494 C  CG  . TRP A 1 196 ? 14.155 12.529  19.991 1.00 23.34 ? 187 TRP A CG  1 
ATOM   1495 C  CD1 . TRP A 1 196 ? 14.657 12.524  21.239 1.00 25.07 ? 187 TRP A CD1 1 
ATOM   1496 C  CD2 . TRP A 1 196 ? 13.363 11.348  19.864 1.00 25.07 ? 187 TRP A CD2 1 
ATOM   1497 N  NE1 . TRP A 1 196 ? 14.252 11.401  21.913 1.00 23.35 ? 187 TRP A NE1 1 
ATOM   1498 C  CE2 . TRP A 1 196 ? 13.440 10.668  21.090 1.00 25.88 ? 187 TRP A CE2 1 
ATOM   1499 C  CE3 . TRP A 1 196 ? 12.592 10.796  18.827 1.00 25.72 ? 187 TRP A CE3 1 
ATOM   1500 C  CZ2 . TRP A 1 196 ? 12.780 9.475   21.314 1.00 25.97 ? 187 TRP A CZ2 1 
ATOM   1501 C  CZ3 . TRP A 1 196 ? 11.936 9.632   19.052 1.00 28.50 ? 187 TRP A CZ3 1 
ATOM   1502 C  CH2 . TRP A 1 196 ? 12.043 8.960   20.277 1.00 27.48 ? 187 TRP A CH2 1 
ATOM   1503 N  N   . HIS A 1 197 ? 16.141 15.015  16.568 1.00 25.84 ? 188 HIS A N   1 
ATOM   1504 C  CA  . HIS A 1 197 ? 16.193 15.873  15.401 1.00 26.36 ? 188 HIS A CA  1 
ATOM   1505 C  C   . HIS A 1 197 ? 16.679 15.215  14.104 1.00 26.77 ? 188 HIS A C   1 
ATOM   1506 O  O   . HIS A 1 197 ? 16.560 15.801  13.038 1.00 26.81 ? 188 HIS A O   1 
ATOM   1507 C  CB  . HIS A 1 197 ? 16.990 17.121  15.720 1.00 27.87 ? 188 HIS A CB  1 
ATOM   1508 C  CG  . HIS A 1 197 ? 16.407 17.926  16.832 1.00 30.27 ? 188 HIS A CG  1 
ATOM   1509 N  ND1 . HIS A 1 197 ? 17.150 18.377  17.897 1.00 29.87 ? 188 HIS A ND1 1 
ATOM   1510 C  CD2 . HIS A 1 197 ? 15.141 18.340  17.054 1.00 34.84 ? 188 HIS A CD2 1 
ATOM   1511 C  CE1 . HIS A 1 197 ? 16.372 19.051  18.719 1.00 33.15 ? 188 HIS A CE1 1 
ATOM   1512 N  NE2 . HIS A 1 197 ? 15.148 19.042  18.232 1.00 36.90 ? 188 HIS A NE2 1 
ATOM   1513 N  N   . THR A 1 198 ? 17.219 14.005  14.198 1.00 25.11 ? 189 THR A N   1 
ATOM   1514 C  CA  . THR A 1 198 ? 17.764 13.313  13.037 1.00 25.46 ? 189 THR A CA  1 
ATOM   1515 C  C   . THR A 1 198 ? 16.831 12.247  12.489 1.00 24.24 ? 189 THR A C   1 
ATOM   1516 O  O   . THR A 1 198 ? 17.095 11.681  11.454 1.00 24.22 ? 189 THR A O   1 
ATOM   1517 C  CB  . THR A 1 198 ? 19.105 12.621  13.362 1.00 26.88 ? 189 THR A CB  1 
ATOM   1518 O  OG1 . THR A 1 198 ? 18.870 11.509  14.217 1.00 34.10 ? 189 THR A OG1 1 
ATOM   1519 C  CG2 . THR A 1 198 ? 20.044 13.503  14.116 1.00 20.80 ? 189 THR A CG2 1 
ATOM   1520 N  N   . VAL A 1 199 ? 15.777 11.929  13.225 1.00 25.27 ? 190 VAL A N   1 
ATOM   1521 C  CA  . VAL A 1 199 ? 15.038 10.705  12.965 1.00 26.00 ? 190 VAL A CA  1 
ATOM   1522 C  C   . VAL A 1 199 ? 14.350 10.686  11.608 1.00 26.19 ? 190 VAL A C   1 
ATOM   1523 O  O   . VAL A 1 199 ? 13.679 11.623  11.237 1.00 25.75 ? 190 VAL A O   1 
ATOM   1524 C  CB  . VAL A 1 199 ? 14.032 10.359  14.068 1.00 26.78 ? 190 VAL A CB  1 
ATOM   1525 C  CG1 . VAL A 1 199 ? 13.159 9.217   13.627 1.00 28.75 ? 190 VAL A CG1 1 
ATOM   1526 C  CG2 . VAL A 1 199 ? 14.754 10.000  15.344 1.00 25.98 ? 190 VAL A CG2 1 
ATOM   1527 N  N   . ASN A 1 200 ? 14.535 9.586   10.903 1.00 25.95 ? 191 ASN A N   1 
ATOM   1528 C  CA  . ASN A 1 200 ? 13.974 9.378   9.557  1.00 27.20 ? 191 ASN A CA  1 
ATOM   1529 C  C   . ASN A 1 200 ? 12.630 8.622   9.644  1.00 27.91 ? 191 ASN A C   1 
ATOM   1530 O  O   . ASN A 1 200 ? 12.584 7.384   9.590  1.00 26.67 ? 191 ASN A O   1 
ATOM   1531 C  CB  . ASN A 1 200 ? 14.986 8.581   8.732  1.00 27.91 ? 191 ASN A CB  1 
ATOM   1532 C  CG  . ASN A 1 200 ? 14.603 8.465   7.261  1.00 28.00 ? 191 ASN A CG  1 
ATOM   1533 O  OD1 . ASN A 1 200 ? 13.455 8.691   6.886  1.00 28.67 ? 191 ASN A OD1 1 
ATOM   1534 N  ND2 . ASN A 1 200 ? 15.573 8.083   6.426  1.00 30.72 ? 191 ASN A ND2 1 
ATOM   1535 N  N   . TRP A 1 201 ? 11.541 9.379   9.799  1.00 29.72 ? 192 TRP A N   1 
ATOM   1536 C  CA  . TRP A 1 201 ? 10.216 8.783   10.031 1.00 30.18 ? 192 TRP A CA  1 
ATOM   1537 C  C   . TRP A 1 201 ? 9.702  8.103   8.793  1.00 31.32 ? 192 TRP A C   1 
ATOM   1538 O  O   . TRP A 1 201 ? 8.900  7.177   8.890  1.00 33.30 ? 192 TRP A O   1 
ATOM   1539 C  CB  . TRP A 1 201 ? 9.216  9.811   10.566 1.00 30.34 ? 192 TRP A CB  1 
ATOM   1540 C  CG  . TRP A 1 201 ? 9.512  10.217  11.958 1.00 27.44 ? 192 TRP A CG  1 
ATOM   1541 C  CD1 . TRP A 1 201 ? 9.955  11.433  12.389 1.00 30.46 ? 192 TRP A CD1 1 
ATOM   1542 C  CD2 . TRP A 1 201 ? 9.427  9.386   13.132 1.00 30.50 ? 192 TRP A CD2 1 
ATOM   1543 N  NE1 . TRP A 1 201 ? 10.130 11.423  13.767 1.00 30.70 ? 192 TRP A NE1 1 
ATOM   1544 C  CE2 . TRP A 1 201 ? 9.827  10.176  14.242 1.00 28.61 ? 192 TRP A CE2 1 
ATOM   1545 C  CE3 . TRP A 1 201 ? 9.060  8.057   13.351 1.00 29.81 ? 192 TRP A CE3 1 
ATOM   1546 C  CZ2 . TRP A 1 201 ? 9.865  9.679   15.533 1.00 30.71 ? 192 TRP A CZ2 1 
ATOM   1547 C  CZ3 . TRP A 1 201 ? 9.107  7.560   14.648 1.00 29.92 ? 192 TRP A CZ3 1 
ATOM   1548 C  CH2 . TRP A 1 201 ? 9.502  8.382   15.720 1.00 29.84 ? 192 TRP A CH2 1 
ATOM   1549 N  N   . ASP A 1 202 ? 10.175 8.531   7.627  1.00 32.14 ? 193 ASP A N   1 
ATOM   1550 C  CA  . ASP A 1 202 ? 9.850  7.828   6.392  1.00 31.91 ? 193 ASP A CA  1 
ATOM   1551 C  C   . ASP A 1 202 ? 10.345 6.396   6.468  1.00 31.66 ? 193 ASP A C   1 
ATOM   1552 O  O   . ASP A 1 202 ? 9.615  5.471   6.133  1.00 32.14 ? 193 ASP A O   1 
ATOM   1553 C  CB  . ASP A 1 202 ? 10.474 8.510   5.169  1.00 33.39 ? 193 ASP A CB  1 
ATOM   1554 C  CG  . ASP A 1 202 ? 9.671  9.700   4.685  1.00 39.58 ? 193 ASP A CG  1 
ATOM   1555 O  OD1 . ASP A 1 202 ? 8.530  9.915   5.175  1.00 38.81 ? 193 ASP A OD1 1 
ATOM   1556 O  OD2 . ASP A 1 202 ? 10.201 10.429  3.800  1.00 46.30 ? 193 ASP A OD2 1 
ATOM   1557 N  N   . ARG A 1 203 ? 11.596 6.216   6.895  1.00 30.61 ? 194 ARG A N   1 
ATOM   1558 C  CA  . ARG A 1 203 ? 12.192 4.879   6.960  1.00 30.41 ? 194 ARG A CA  1 
ATOM   1559 C  C   . ARG A 1 203 ? 11.534 4.033   8.060  1.00 30.01 ? 194 ARG A C   1 
ATOM   1560 O  O   . ARG A 1 203 ? 11.265 2.838   7.866  1.00 30.49 ? 194 ARG A O   1 
ATOM   1561 C  CB  . ARG A 1 203 ? 13.693 4.975   7.187  1.00 30.28 ? 194 ARG A CB  1 
ATOM   1562 C  CG  . ARG A 1 203 ? 14.420 3.634   7.175  1.00 31.94 ? 194 ARG A CG  1 
ATOM   1563 C  CD  . ARG A 1 203 ? 15.120 3.324   5.846  1.00 39.08 ? 194 ARG A CD  1 
ATOM   1564 N  NE  . ARG A 1 203 ? 16.242 4.243   5.631  1.00 38.80 ? 194 ARG A NE  1 
ATOM   1565 C  CZ  . ARG A 1 203 ? 17.116 4.160   4.639  1.00 42.18 ? 194 ARG A CZ  1 
ATOM   1566 N  NH1 . ARG A 1 203 ? 17.008 3.202   3.717  1.00 43.26 ? 194 ARG A NH1 1 
ATOM   1567 N  NH2 . ARG A 1 203 ? 18.098 5.063   4.561  1.00 42.14 ? 194 ARG A NH2 1 
ATOM   1568 N  N   . VAL A 1 204 ? 11.264 4.642   9.211  1.00 30.00 ? 195 VAL A N   1 
ATOM   1569 C  CA  . VAL A 1 204 ? 10.563 3.928   10.290 1.00 30.53 ? 195 VAL A CA  1 
ATOM   1570 C  C   . VAL A 1 204 ? 9.228  3.383   9.776  1.00 30.31 ? 195 VAL A C   1 
ATOM   1571 O  O   . VAL A 1 204 ? 8.892  2.234   10.016 1.00 28.09 ? 195 VAL A O   1 
ATOM   1572 C  CB  . VAL A 1 204 ? 10.342 4.820   11.543 1.00 29.56 ? 195 VAL A CB  1 
ATOM   1573 C  CG1 . VAL A 1 204 ? 9.567  4.080   12.631 1.00 28.40 ? 195 VAL A CG1 1 
ATOM   1574 C  CG2 . VAL A 1 204 ? 11.673 5.290   12.095 1.00 31.39 ? 195 VAL A CG2 1 
ATOM   1575 N  N   . ASN A 1 205 ? 8.493  4.216   9.045  1.00 32.76 ? 196 ASN A N   1 
ATOM   1576 C  CA  . ASN A 1 205 ? 7.193  3.806   8.515  1.00 34.23 ? 196 ASN A CA  1 
ATOM   1577 C  C   . ASN A 1 205 ? 7.353  2.610   7.562  1.00 35.94 ? 196 ASN A C   1 
ATOM   1578 O  O   . ASN A 1 205 ? 6.540  1.688   7.586  1.00 38.45 ? 196 ASN A O   1 
ATOM   1579 C  CB  . ASN A 1 205 ? 6.496  4.996   7.844  1.00 34.76 ? 196 ASN A CB  1 
ATOM   1580 C  CG  . ASN A 1 205 ? 5.082  4.682   7.435  1.00 37.27 ? 196 ASN A CG  1 
ATOM   1581 O  OD1 . ASN A 1 205 ? 4.716  4.822   6.258  1.00 46.94 ? 196 ASN A OD1 1 
ATOM   1582 N  ND2 . ASN A 1 205 ? 4.277  4.232   8.384  1.00 41.27 ? 196 ASN A ND2 1 
ATOM   1583 N  N   . GLU A 1 206 ? 8.427  2.608   6.764  1.00 36.57 ? 197 GLU A N   1 
ATOM   1584 C  CA  . GLU A 1 206 ? 8.768  1.480   5.879  1.00 36.89 ? 197 GLU A CA  1 
ATOM   1585 C  C   . GLU A 1 206 ? 9.096  0.220   6.672  1.00 35.29 ? 197 GLU A C   1 
ATOM   1586 O  O   . GLU A 1 206 ? 8.700  -0.865  6.313  1.00 34.51 ? 197 GLU A O   1 
ATOM   1587 C  CB  . GLU A 1 206 ? 9.991  1.817   5.000  1.00 38.14 ? 197 GLU A CB  1 
ATOM   1588 C  CG  . GLU A 1 206 ? 9.741  2.877   3.931  1.00 40.30 ? 197 GLU A CG  1 
ATOM   1589 C  CD  . GLU A 1 206 ? 11.033 3.359   3.223  1.00 41.42 ? 197 GLU A CD  1 
ATOM   1590 O  OE1 . GLU A 1 206 ? 11.090 4.551   2.851  1.00 49.83 ? 197 GLU A OE1 1 
ATOM   1591 O  OE2 . GLU A 1 206 ? 11.984 2.557   3.043  1.00 46.26 ? 197 GLU A OE2 1 
ATOM   1592 N  N   . LYS A 1 207 ? 9.843  0.367   7.755  1.00 35.73 ? 198 LYS A N   1 
ATOM   1593 C  CA  . LYS A 1 207 ? 10.141 -0.781  8.636  1.00 35.94 ? 198 LYS A CA  1 
ATOM   1594 C  C   . LYS A 1 207 ? 8.868  -1.382  9.268  1.00 34.33 ? 198 LYS A C   1 
ATOM   1595 O  O   . LYS A 1 207 ? 8.755  -2.608  9.458  1.00 32.04 ? 198 LYS A O   1 
ATOM   1596 C  CB  . LYS A 1 207 ? 11.116 -0.364  9.744  1.00 36.82 ? 198 LYS A CB  1 
ATOM   1597 C  CG  . LYS A 1 207 ? 12.476 0.093   9.270  1.00 38.43 ? 198 LYS A CG  1 
ATOM   1598 C  CD  . LYS A 1 207 ? 13.328 -1.082  8.834  1.00 39.60 ? 198 LYS A CD  1 
ATOM   1599 C  CE  . LYS A 1 207 ? 14.742 -0.621  8.432  1.00 39.98 ? 198 LYS A CE  1 
ATOM   1600 N  NZ  . LYS A 1 207 ? 15.549 -1.717  7.793  1.00 41.76 ? 198 LYS A NZ  1 
ATOM   1601 N  N   . TYR A 1 208 ? 7.918  -0.517  9.616  1.00 34.66 ? 199 TYR A N   1 
ATOM   1602 C  CA  . TYR A 1 208 ? 6.679  -0.956  10.248 1.00 36.16 ? 199 TYR A CA  1 
ATOM   1603 C  C   . TYR A 1 208 ? 5.836  -1.771  9.239  1.00 37.37 ? 199 TYR A C   1 
ATOM   1604 O  O   . TYR A 1 208 ? 5.361  -2.866  9.533  1.00 36.75 ? 199 TYR A O   1 
ATOM   1605 C  CB  . TYR A 1 208 ? 5.892  0.248   10.790 1.00 35.42 ? 199 TYR A CB  1 
ATOM   1606 C  CG  . TYR A 1 208 ? 4.540  -0.153  11.315 1.00 34.98 ? 199 TYR A CG  1 
ATOM   1607 C  CD1 . TYR A 1 208 ? 4.430  -0.918  12.459 1.00 32.52 ? 199 TYR A CD1 1 
ATOM   1608 C  CD2 . TYR A 1 208 ? 3.379  0.188   10.638 1.00 36.41 ? 199 TYR A CD2 1 
ATOM   1609 C  CE1 . TYR A 1 208 ? 3.206  -1.325  12.927 1.00 34.86 ? 199 TYR A CE1 1 
ATOM   1610 C  CE2 . TYR A 1 208 ? 2.139  -0.214  11.105 1.00 35.98 ? 199 TYR A CE2 1 
ATOM   1611 C  CZ  . TYR A 1 208 ? 2.058  -0.974  12.243 1.00 36.91 ? 199 TYR A CZ  1 
ATOM   1612 O  OH  . TYR A 1 208 ? 0.837  -1.379  12.722 1.00 37.28 ? 199 TYR A OH  1 
ATOM   1613 N  N   . LEU A 1 209 ? 5.686  -1.248  8.037  1.00 38.80 ? 200 LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 209 ? 4.965  -1.985  6.987  1.00 40.91 ? 200 LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 209 ? 5.604  -3.347  6.691  1.00 42.59 ? 200 LEU A C   1 
ATOM   1616 O  O   . LEU A 1 209 ? 4.925  -4.376  6.653  1.00 43.98 ? 200 LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 209 ? 4.863  -1.143  5.715  1.00 40.94 ? 200 LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 209 ? 4.123  0.186   5.912  1.00 43.85 ? 200 LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 209 ? 4.333  1.095   4.719  1.00 45.74 ? 200 LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 209 ? 2.618  0.008   6.208  1.00 43.81 ? 200 LEU A CD2 1 
ATOM   1621 N  N   . GLN A 1 210 ? 6.912  -3.352  6.495  1.00 44.04 ? 201 GLN A N   1 
ATOM   1622 C  CA  . GLN A 1 210 ? 7.663  -4.581  6.343  1.00 45.34 ? 201 GLN A CA  1 
ATOM   1623 C  C   . GLN A 1 210 ? 7.315  -5.533  7.489  1.00 46.26 ? 201 GLN A C   1 
ATOM   1624 O  O   . GLN A 1 210 ? 7.001  -6.700  7.265  1.00 46.80 ? 201 GLN A O   1 
ATOM   1625 C  CB  . GLN A 1 210 ? 9.162  -4.247  6.337  1.00 45.77 ? 201 GLN A CB  1 
ATOM   1626 C  CG  . GLN A 1 210 ? 10.118 -5.404  6.094  1.00 46.04 ? 201 GLN A CG  1 
ATOM   1627 C  CD  . GLN A 1 210 ? 11.574 -4.936  5.979  1.00 49.90 ? 201 GLN A CD  1 
ATOM   1628 O  OE1 . GLN A 1 210 ? 12.134 -4.324  6.910  1.00 57.04 ? 201 GLN A OE1 1 
ATOM   1629 N  NE2 . GLN A 1 210 ? 12.196 -5.224  4.834  1.00 55.52 ? 201 GLN A NE2 1 
ATOM   1630 N  N   . ALA A 1 211 ? 7.356  -5.021  8.718  1.00 45.58 ? 202 ALA A N   1 
ATOM   1631 C  CA  . ALA A 1 211 ? 7.119  -5.836  9.899  1.00 46.21 ? 202 ALA A CA  1 
ATOM   1632 C  C   . ALA A 1 211 ? 5.768  -6.555  9.866  1.00 46.53 ? 202 ALA A C   1 
ATOM   1633 O  O   . ALA A 1 211 ? 5.694  -7.736  10.214 1.00 45.68 ? 202 ALA A O   1 
ATOM   1634 C  CB  . ALA A 1 211 ? 7.241  -4.995  11.170 1.00 46.02 ? 202 ALA A CB  1 
ATOM   1635 N  N   . ILE A 1 212 ? 4.712  -5.848  9.459  1.00 47.62 ? 203 ILE A N   1 
ATOM   1636 C  CA  . ILE A 1 212 ? 3.373  -6.459  9.347  1.00 48.96 ? 203 ILE A CA  1 
ATOM   1637 C  C   . ILE A 1 212 ? 3.198  -7.191  8.017  1.00 50.27 ? 203 ILE A C   1 
ATOM   1638 O  O   . ILE A 1 212 ? 3.660  -8.316  7.859  1.00 51.89 ? 203 ILE A O   1 
ATOM   1639 C  CB  . ILE A 1 212 ? 2.230  -5.430  9.497  1.00 49.23 ? 203 ILE A CB  1 
ATOM   1640 C  CG1 . ILE A 1 212 ? 2.235  -4.429  8.350  1.00 50.64 ? 203 ILE A CG1 1 
ATOM   1641 C  CG2 . ILE A 1 212 ? 2.329  -4.696  10.828 1.00 49.46 ? 203 ILE A CG2 1 
ATOM   1642 C  CD1 . ILE A 1 212 ? 1.015  -3.487  8.348  1.00 51.00 ? 203 ILE A CD1 1 
ATOM   1643 N  N   . SER B 1 12  ? 27.103 8.833   53.800 1.00 40.98 ? 3   SER B N   1 
ATOM   1644 C  CA  . SER B 1 12  ? 28.015 9.998   53.542 1.00 39.11 ? 3   SER B CA  1 
ATOM   1645 C  C   . SER B 1 12  ? 29.346 9.592   52.894 1.00 37.46 ? 3   SER B C   1 
ATOM   1646 O  O   . SER B 1 12  ? 30.417 10.083  53.267 1.00 36.65 ? 3   SER B O   1 
ATOM   1647 C  CB  . SER B 1 12  ? 28.288 10.710  54.849 1.00 40.86 ? 3   SER B CB  1 
ATOM   1648 O  OG  . SER B 1 12  ? 28.726 9.751   55.786 1.00 48.79 ? 3   SER B OG  1 
ATOM   1649 N  N   . PHE B 1 13  ? 29.288 8.720   51.898 1.00 35.66 ? 4   PHE B N   1 
ATOM   1650 C  CA  . PHE B 1 13  ? 30.466 8.494   51.063 1.00 34.33 ? 4   PHE B CA  1 
ATOM   1651 C  C   . PHE B 1 13  ? 30.898 9.814   50.399 1.00 32.10 ? 4   PHE B C   1 
ATOM   1652 O  O   . PHE B 1 13  ? 30.058 10.672  50.126 1.00 32.49 ? 4   PHE B O   1 
ATOM   1653 C  CB  . PHE B 1 13  ? 30.179 7.388   50.028 1.00 32.79 ? 4   PHE B CB  1 
ATOM   1654 C  CG  . PHE B 1 13  ? 30.001 6.036   50.650 1.00 29.69 ? 4   PHE B CG  1 
ATOM   1655 C  CD1 . PHE B 1 13  ? 28.731 5.494   50.834 1.00 27.71 ? 4   PHE B CD1 1 
ATOM   1656 C  CD2 . PHE B 1 13  ? 31.108 5.312   51.069 1.00 31.26 ? 4   PHE B CD2 1 
ATOM   1657 C  CE1 . PHE B 1 13  ? 28.570 4.256   51.431 1.00 29.03 ? 4   PHE B CE1 1 
ATOM   1658 C  CE2 . PHE B 1 13  ? 30.963 4.075   51.666 1.00 32.61 ? 4   PHE B CE2 1 
ATOM   1659 C  CZ  . PHE B 1 13  ? 29.678 3.539   51.841 1.00 32.24 ? 4   PHE B CZ  1 
ATOM   1660 N  N   . GLN B 1 14  ? 32.204 9.962   50.163 1.00 30.02 ? 5   GLN B N   1 
ATOM   1661 C  CA  . GLN B 1 14  ? 32.789 11.144  49.561 1.00 32.04 ? 5   GLN B CA  1 
ATOM   1662 C  C   . GLN B 1 14  ? 33.665 10.862  48.342 1.00 30.58 ? 5   GLN B C   1 
ATOM   1663 O  O   . GLN B 1 14  ? 34.376 9.858   48.302 1.00 30.82 ? 5   GLN B O   1 
ATOM   1664 C  CB  . GLN B 1 14  ? 33.703 11.835  50.570 1.00 33.14 ? 5   GLN B CB  1 
ATOM   1665 C  CG  . GLN B 1 14  ? 33.233 11.785  52.023 1.00 39.79 ? 5   GLN B CG  1 
ATOM   1666 C  CD  . GLN B 1 14  ? 33.457 13.105  52.699 1.00 51.67 ? 5   GLN B CD  1 
ATOM   1667 O  OE1 . GLN B 1 14  ? 33.828 13.167  53.884 1.00 58.74 ? 5   GLN B OE1 1 
ATOM   1668 N  NE2 . GLN B 1 14  ? 33.231 14.195  51.947 1.00 55.12 ? 5   GLN B NE2 1 
ATOM   1669 N  N   . LEU B 1 15  ? 33.684 11.793  47.393 1.00 29.89 ? 6   LEU B N   1 
ATOM   1670 C  CA  . LEU B 1 15  ? 34.602 11.730  46.271 1.00 30.53 ? 6   LEU B CA  1 
ATOM   1671 C  C   . LEU B 1 15  ? 36.009 11.974  46.788 1.00 29.60 ? 6   LEU B C   1 
ATOM   1672 O  O   . LEU B 1 15  ? 36.262 13.001  47.444 1.00 27.71 ? 6   LEU B O   1 
ATOM   1673 C  CB  . LEU B 1 15  ? 34.218 12.766  45.192 1.00 29.99 ? 6   LEU B CB  1 
ATOM   1674 C  CG  . LEU B 1 15  ? 35.147 12.899  43.980 1.00 29.47 ? 6   LEU B CG  1 
ATOM   1675 C  CD1 . LEU B 1 15  ? 34.993 11.753  43.038 1.00 31.04 ? 6   LEU B CD1 1 
ATOM   1676 C  CD2 . LEU B 1 15  ? 34.902 14.239  43.252 1.00 31.08 ? 6   LEU B CD2 1 
ATOM   1677 N  N   . PRO B 1 16  ? 36.932 11.027  46.534 1.00 30.44 ? 7   PRO B N   1 
ATOM   1678 C  CA  . PRO B 1 16  ? 38.287 11.242  47.041 1.00 31.14 ? 7   PRO B CA  1 
ATOM   1679 C  C   . PRO B 1 16  ? 39.052 12.305  46.259 1.00 32.30 ? 7   PRO B C   1 
ATOM   1680 O  O   . PRO B 1 16  ? 38.810 12.517  45.051 1.00 30.67 ? 7   PRO B O   1 
ATOM   1681 C  CB  . PRO B 1 16  ? 38.948 9.860   46.892 1.00 31.48 ? 7   PRO B CB  1 
ATOM   1682 C  CG  . PRO B 1 16  ? 38.224 9.207   45.759 1.00 28.77 ? 7   PRO B CG  1 
ATOM   1683 C  CD  . PRO B 1 16  ? 36.824 9.778   45.749 1.00 30.28 ? 7   PRO B CD  1 
ATOM   1684 N  N   . LYS B 1 17  ? 39.974 12.962  46.957 1.00 33.08 ? 8   LYS B N   1 
ATOM   1685 C  CA  . LYS B 1 17  ? 40.953 13.856  46.341 1.00 35.25 ? 8   LYS B CA  1 
ATOM   1686 C  C   . LYS B 1 17  ? 41.946 13.025  45.552 1.00 35.40 ? 8   LYS B C   1 
ATOM   1687 O  O   . LYS B 1 17  ? 42.357 11.946  45.993 1.00 36.92 ? 8   LYS B O   1 
ATOM   1688 C  CB  . LYS B 1 17  ? 41.721 14.593  47.446 1.00 38.24 ? 8   LYS B CB  1 
ATOM   1689 C  CG  . LYS B 1 17  ? 42.030 16.052  47.180 1.00 42.00 ? 8   LYS B CG  1 
ATOM   1690 C  CD  . LYS B 1 17  ? 42.525 16.683  48.502 1.00 40.57 ? 8   LYS B CD  1 
ATOM   1691 C  CE  . LYS B 1 17  ? 42.706 18.201  48.453 1.00 45.14 ? 8   LYS B CE  1 
ATOM   1692 N  NZ  . LYS B 1 17  ? 43.318 18.751  49.737 1.00 47.69 ? 8   LYS B NZ  1 
ATOM   1693 N  N   . LEU B 1 18  ? 42.348 13.514  44.390 1.00 34.93 ? 9   LEU B N   1 
ATOM   1694 C  CA  . LEU B 1 18  ? 43.417 12.861  43.651 1.00 35.35 ? 9   LEU B CA  1 
ATOM   1695 C  C   . LEU B 1 18  ? 44.746 13.193  44.340 1.00 35.18 ? 9   LEU B C   1 
ATOM   1696 O  O   . LEU B 1 18  ? 44.853 14.237  44.978 1.00 35.80 ? 9   LEU B O   1 
ATOM   1697 C  CB  . LEU B 1 18  ? 43.425 13.334  42.190 1.00 35.86 ? 9   LEU B CB  1 
ATOM   1698 C  CG  . LEU B 1 18  ? 42.884 12.451  41.059 1.00 37.51 ? 9   LEU B CG  1 
ATOM   1699 C  CD1 . LEU B 1 18  ? 41.833 11.480  41.507 1.00 37.03 ? 9   LEU B CD1 1 
ATOM   1700 C  CD2 . LEU B 1 18  ? 42.409 13.330  39.927 1.00 35.79 ? 9   LEU B CD2 1 
ATOM   1701 N  N   . SER B 1 19  ? 45.736 12.308  44.197 1.00 35.04 ? 10  SER B N   1 
ATOM   1702 C  CA  . SER B 1 19  ? 47.099 12.551  44.692 1.00 34.56 ? 10  SER B CA  1 
ATOM   1703 C  C   . SER B 1 19  ? 47.915 13.466  43.766 1.00 33.58 ? 10  SER B C   1 
ATOM   1704 O  O   . SER B 1 19  ? 49.100 13.675  43.979 1.00 34.40 ? 10  SER B O   1 
ATOM   1705 C  CB  . SER B 1 19  ? 47.866 11.231  44.856 1.00 34.49 ? 10  SER B CB  1 
ATOM   1706 O  OG  . SER B 1 19  ? 47.346 10.451  45.911 1.00 37.70 ? 10  SER B OG  1 
ATOM   1707 N  N   . TYR B 1 20  ? 47.284 13.974  42.728 1.00 31.55 ? 11  TYR B N   1 
ATOM   1708 C  CA  . TYR B 1 20  ? 47.973 14.668  41.652 1.00 32.25 ? 11  TYR B CA  1 
ATOM   1709 C  C   . TYR B 1 20  ? 46.941 15.561  40.998 1.00 32.25 ? 11  TYR B C   1 
ATOM   1710 O  O   . TYR B 1 20  ? 45.722 15.335  41.133 1.00 32.24 ? 11  TYR B O   1 
ATOM   1711 C  CB  . TYR B 1 20  ? 48.617 13.681  40.643 1.00 30.14 ? 11  TYR B CB  1 
ATOM   1712 C  CG  . TYR B 1 20  ? 47.776 12.438  40.304 1.00 30.49 ? 11  TYR B CG  1 
ATOM   1713 C  CD1 . TYR B 1 20  ? 46.797 12.468  39.329 1.00 30.75 ? 11  TYR B CD1 1 
ATOM   1714 C  CD2 . TYR B 1 20  ? 47.946 11.257  41.001 1.00 29.58 ? 11  TYR B CD2 1 
ATOM   1715 C  CE1 . TYR B 1 20  ? 46.015 11.342  39.049 1.00 30.03 ? 11  TYR B CE1 1 
ATOM   1716 C  CE2 . TYR B 1 20  ? 47.174 10.112  40.715 1.00 27.14 ? 11  TYR B CE2 1 
ATOM   1717 C  CZ  . TYR B 1 20  ? 46.215 10.161  39.745 1.00 29.23 ? 11  TYR B CZ  1 
ATOM   1718 O  OH  . TYR B 1 20  ? 45.456 9.026   39.465 1.00 27.28 ? 11  TYR B OH  1 
ATOM   1719 N  N   . ASP B 1 21  ? 47.428 16.598  40.337 1.00 32.91 ? 12  ASP B N   1 
ATOM   1720 C  CA  . ASP B 1 21  ? 46.582 17.531  39.624 1.00 32.71 ? 12  ASP B CA  1 
ATOM   1721 C  C   . ASP B 1 21  ? 46.067 16.878  38.354 1.00 32.67 ? 12  ASP B C   1 
ATOM   1722 O  O   . ASP B 1 21  ? 46.637 15.905  37.850 1.00 30.38 ? 12  ASP B O   1 
ATOM   1723 C  CB  . ASP B 1 21  ? 47.342 18.801  39.236 1.00 33.77 ? 12  ASP B CB  1 
ATOM   1724 C  CG  . ASP B 1 21  ? 47.914 19.516  40.436 1.00 38.60 ? 12  ASP B CG  1 
ATOM   1725 O  OD1 . ASP B 1 21  ? 47.431 19.234  41.546 1.00 37.23 ? 12  ASP B OD1 1 
ATOM   1726 O  OD2 . ASP B 1 21  ? 48.842 20.326  40.263 1.00 44.62 ? 12  ASP B OD2 1 
ATOM   1727 N  N   . TYR B 1 22  ? 45.014 17.473  37.813 1.00 33.31 ? 13  TYR B N   1 
ATOM   1728 C  CA  . TYR B 1 22  ? 44.392 16.934  36.609 1.00 32.66 ? 13  TYR B CA  1 
ATOM   1729 C  C   . TYR B 1 22  ? 45.284 16.867  35.346 1.00 32.17 ? 13  TYR B C   1 
ATOM   1730 O  O   . TYR B 1 22  ? 44.941 16.134  34.394 1.00 31.37 ? 13  TYR B O   1 
ATOM   1731 C  CB  . TYR B 1 22  ? 43.086 17.688  36.320 1.00 33.01 ? 13  TYR B CB  1 
ATOM   1732 C  CG  . TYR B 1 22  ? 41.910 17.418  37.235 1.00 31.81 ? 13  TYR B CG  1 
ATOM   1733 C  CD1 . TYR B 1 22  ? 41.666 16.164  37.795 1.00 30.69 ? 13  TYR B CD1 1 
ATOM   1734 C  CD2 . TYR B 1 22  ? 40.998 18.425  37.507 1.00 35.09 ? 13  TYR B CD2 1 
ATOM   1735 C  CE1 . TYR B 1 22  ? 40.551 15.941  38.604 1.00 32.22 ? 13  TYR B CE1 1 
ATOM   1736 C  CE2 . TYR B 1 22  ? 39.881 18.200  38.285 1.00 34.51 ? 13  TYR B CE2 1 
ATOM   1737 C  CZ  . TYR B 1 22  ? 39.670 16.978  38.853 1.00 33.19 ? 13  TYR B CZ  1 
ATOM   1738 O  OH  . TYR B 1 22  ? 38.544 16.803  39.622 1.00 31.27 ? 13  TYR B OH  1 
ATOM   1739 N  N   . ASP B 1 23  ? 46.401 17.600  35.294 1.00 31.07 ? 14  ASP B N   1 
ATOM   1740 C  CA  . ASP B 1 23  ? 47.299 17.521  34.128 1.00 31.55 ? 14  ASP B CA  1 
ATOM   1741 C  C   . ASP B 1 23  ? 48.511 16.598  34.311 1.00 31.83 ? 14  ASP B C   1 
ATOM   1742 O  O   . ASP B 1 23  ? 49.372 16.481  33.420 1.00 31.70 ? 14  ASP B O   1 
ATOM   1743 C  CB  . ASP B 1 23  ? 47.762 18.916  33.708 1.00 31.70 ? 14  ASP B CB  1 
ATOM   1744 C  CG  . ASP B 1 23  ? 48.664 19.591  34.745 1.00 34.17 ? 14  ASP B CG  1 
ATOM   1745 O  OD1 . ASP B 1 23  ? 48.812 19.094  35.886 1.00 30.19 ? 14  ASP B OD1 1 
ATOM   1746 O  OD2 . ASP B 1 23  ? 49.212 20.641  34.403 1.00 38.89 ? 14  ASP B OD2 1 
ATOM   1747 N  N   . GLU B 1 24  ? 48.565 15.911  35.446 1.00 31.91 ? 15  GLU B N   1 
ATOM   1748 C  CA  . GLU B 1 24  ? 49.795 15.218  35.845 1.00 31.63 ? 15  GLU B CA  1 
ATOM   1749 C  C   . GLU B 1 24  ? 49.983 13.822  35.275 1.00 31.61 ? 15  GLU B C   1 
ATOM   1750 O  O   . GLU B 1 24  ? 51.077 13.269  35.407 1.00 31.97 ? 15  GLU B O   1 
ATOM   1751 C  CB  . GLU B 1 24  ? 49.949 15.197  37.375 1.00 31.85 ? 15  GLU B CB  1 
ATOM   1752 C  CG  . GLU B 1 24  ? 50.300 16.560  37.947 1.00 34.53 ? 15  GLU B CG  1 
ATOM   1753 C  CD  . GLU B 1 24  ? 50.908 16.486  39.337 1.00 32.84 ? 15  GLU B CD  1 
ATOM   1754 O  OE1 . GLU B 1 24  ? 50.190 16.727  40.320 1.00 32.76 ? 15  GLU B OE1 1 
ATOM   1755 O  OE2 . GLU B 1 24  ? 52.100 16.155  39.445 1.00 38.57 ? 15  GLU B OE2 1 
ATOM   1756 N  N   . LEU B 1 25  ? 48.943 13.255  34.651 1.00 30.18 ? 16  LEU B N   1 
ATOM   1757 C  CA  . LEU B 1 25  ? 49.068 11.981  33.918 1.00 30.03 ? 16  LEU B CA  1 
ATOM   1758 C  C   . LEU B 1 25  ? 49.329 12.184  32.405 1.00 29.51 ? 16  LEU B C   1 
ATOM   1759 O  O   . LEU B 1 25  ? 49.480 11.229  31.643 1.00 28.66 ? 16  LEU B O   1 
ATOM   1760 C  CB  . LEU B 1 25  ? 47.842 11.092  34.195 1.00 29.16 ? 16  LEU B CB  1 
ATOM   1761 C  CG  . LEU B 1 25  ? 47.633 10.687  35.680 1.00 28.12 ? 16  LEU B CG  1 
ATOM   1762 C  CD1 . LEU B 1 25  ? 46.449 9.768   35.808 1.00 29.18 ? 16  LEU B CD1 1 
ATOM   1763 C  CD2 . LEU B 1 25  ? 48.912 10.029  36.259 1.00 29.17 ? 16  LEU B CD2 1 
ATOM   1764 N  N   . GLU B 1 26  ? 49.426 13.444  31.984 1.00 30.92 ? 17  GLU B N   1 
ATOM   1765 C  CA  . GLU B 1 26  ? 49.882 13.773  30.634 1.00 29.81 ? 17  GLU B CA  1 
ATOM   1766 C  C   . GLU B 1 26  ? 51.295 13.230  30.400 1.00 28.91 ? 17  GLU B C   1 
ATOM   1767 O  O   . GLU B 1 26  ? 52.105 13.172  31.331 1.00 30.19 ? 17  GLU B O   1 
ATOM   1768 C  CB  . GLU B 1 26  ? 49.874 15.282  30.409 1.00 29.93 ? 17  GLU B CB  1 
ATOM   1769 C  CG  . GLU B 1 26  ? 48.493 15.936  30.487 1.00 31.74 ? 17  GLU B CG  1 
ATOM   1770 C  CD  . GLU B 1 26  ? 47.808 16.030  29.137 1.00 34.27 ? 17  GLU B CD  1 
ATOM   1771 O  OE1 . GLU B 1 26  ? 48.259 15.330  28.194 1.00 34.82 ? 17  GLU B OE1 1 
ATOM   1772 O  OE2 . GLU B 1 26  ? 46.804 16.796  29.024 1.00 33.00 ? 17  GLU B OE2 1 
ATOM   1773 N  N   . PRO B 1 27  ? 51.611 12.827  29.163 1.00 28.43 ? 18  PRO B N   1 
ATOM   1774 C  CA  . PRO B 1 27  ? 50.764 12.825  27.972 1.00 28.22 ? 18  PRO B CA  1 
ATOM   1775 C  C   . PRO B 1 27  ? 49.938 11.540  27.770 1.00 27.83 ? 18  PRO B C   1 
ATOM   1776 O  O   . PRO B 1 27  ? 49.331 11.383  26.727 1.00 27.66 ? 18  PRO B O   1 
ATOM   1777 C  CB  . PRO B 1 27  ? 51.781 12.987  26.863 1.00 29.35 ? 18  PRO B CB  1 
ATOM   1778 C  CG  . PRO B 1 27  ? 52.971 12.239  27.385 1.00 30.58 ? 18  PRO B CG  1 
ATOM   1779 C  CD  . PRO B 1 27  ? 52.969 12.334  28.855 1.00 29.05 ? 18  PRO B CD  1 
ATOM   1780 N  N   . TYR B 1 28  ? 49.907 10.656  28.770 1.00 27.87 ? 19  TYR B N   1 
ATOM   1781 C  CA  . TYR B 1 28  ? 49.278 9.330   28.655 1.00 26.14 ? 19  TYR B CA  1 
ATOM   1782 C  C   . TYR B 1 28  ? 47.740 9.410   28.756 1.00 24.89 ? 19  TYR B C   1 
ATOM   1783 O  O   . TYR B 1 28  ? 47.013 8.744   27.983 1.00 27.15 ? 19  TYR B O   1 
ATOM   1784 C  CB  . TYR B 1 28  ? 49.875 8.372   29.707 1.00 25.95 ? 19  TYR B CB  1 
ATOM   1785 C  CG  . TYR B 1 28  ? 51.372 8.416   29.717 1.00 24.95 ? 19  TYR B CG  1 
ATOM   1786 C  CD1 . TYR B 1 28  ? 52.096 8.054   28.582 1.00 26.83 ? 19  TYR B CD1 1 
ATOM   1787 C  CD2 . TYR B 1 28  ? 52.060 8.882   30.817 1.00 27.49 ? 19  TYR B CD2 1 
ATOM   1788 C  CE1 . TYR B 1 28  ? 53.495 8.134   28.560 1.00 27.93 ? 19  TYR B CE1 1 
ATOM   1789 C  CE2 . TYR B 1 28  ? 53.462 8.957   30.807 1.00 27.77 ? 19  TYR B CE2 1 
ATOM   1790 C  CZ  . TYR B 1 28  ? 54.163 8.580   29.685 1.00 28.79 ? 19  TYR B CZ  1 
ATOM   1791 O  OH  . TYR B 1 28  ? 55.537 8.634   29.663 1.00 29.01 ? 19  TYR B OH  1 
ATOM   1792 N  N   . ILE B 1 29  ? 47.258 10.205  29.713 1.00 24.49 ? 20  ILE B N   1 
ATOM   1793 C  CA  . ILE B 1 29  ? 45.835 10.517  29.894 1.00 25.05 ? 20  ILE B CA  1 
ATOM   1794 C  C   . ILE B 1 29  ? 45.710 12.054  29.900 1.00 24.68 ? 20  ILE B C   1 
ATOM   1795 O  O   . ILE B 1 29  ? 46.350 12.741  30.713 1.00 23.42 ? 20  ILE B O   1 
ATOM   1796 C  CB  . ILE B 1 29  ? 45.262 9.860   31.185 1.00 24.65 ? 20  ILE B CB  1 
ATOM   1797 C  CG1 . ILE B 1 29  ? 45.391 8.341   31.110 1.00 26.08 ? 20  ILE B CG1 1 
ATOM   1798 C  CG2 . ILE B 1 29  ? 43.818 10.294  31.485 1.00 23.34 ? 20  ILE B CG2 1 
ATOM   1799 C  CD1 . ILE B 1 29  ? 44.938 7.656   32.271 1.00 26.98 ? 20  ILE B CD1 1 
ATOM   1800 N  N   . ASP B 1 30  ? 44.916 12.577  28.959 1.00 23.21 ? 21  ASP B N   1 
ATOM   1801 C  CA  . ASP B 1 30  ? 44.647 14.032  28.819 1.00 24.45 ? 21  ASP B CA  1 
ATOM   1802 C  C   . ASP B 1 30  ? 43.968 14.636  30.042 1.00 25.63 ? 21  ASP B C   1 
ATOM   1803 O  O   . ASP B 1 30  ? 43.154 13.982  30.730 1.00 23.69 ? 21  ASP B O   1 
ATOM   1804 C  CB  . ASP B 1 30  ? 43.808 14.329  27.569 1.00 25.61 ? 21  ASP B CB  1 
ATOM   1805 C  CG  . ASP B 1 30  ? 42.520 13.517  27.510 1.00 26.92 ? 21  ASP B CG  1 
ATOM   1806 O  OD1 . ASP B 1 30  ? 42.644 12.264  27.509 1.00 27.37 ? 21  ASP B OD1 1 
ATOM   1807 O  OD2 . ASP B 1 30  ? 41.402 14.122  27.469 1.00 25.97 ? 21  ASP B OD2 1 
ATOM   1808 N  N   . SER B 1 31  ? 44.265 15.910  30.305 1.00 27.61 ? 22  SER B N   1 
ATOM   1809 C  CA  . SER B 1 31  ? 43.694 16.594  31.467 1.00 27.72 ? 22  SER B CA  1 
ATOM   1810 C  C   . SER B 1 31  ? 42.183 16.760  31.378 1.00 27.61 ? 22  SER B C   1 
ATOM   1811 O  O   . SER B 1 31  ? 41.483 16.606  32.378 1.00 27.18 ? 22  SER B O   1 
ATOM   1812 C  CB  . SER B 1 31  ? 44.366 17.954  31.710 1.00 29.63 ? 22  SER B CB  1 
ATOM   1813 O  OG  . SER B 1 31  ? 44.239 18.797  30.595 1.00 30.87 ? 22  SER B OG  1 
ATOM   1814 N  N   . ASN B 1 32  ? 41.653 17.050  30.194 1.00 28.18 ? 23  ASN B N   1 
ATOM   1815 C  CA  . ASN B 1 32  ? 40.201 17.152  30.083 1.00 27.78 ? 23  ASN B CA  1 
ATOM   1816 C  C   . ASN B 1 32  ? 39.487 15.880  30.560 1.00 26.54 ? 23  ASN B C   1 
ATOM   1817 O  O   . ASN B 1 32  ? 38.525 15.940  31.318 1.00 26.99 ? 23  ASN B O   1 
ATOM   1818 C  CB  . ASN B 1 32  ? 39.752 17.466  28.655 1.00 27.95 ? 23  ASN B CB  1 
ATOM   1819 C  CG  . ASN B 1 32  ? 38.377 18.092  28.613 1.00 32.14 ? 23  ASN B CG  1 
ATOM   1820 O  OD1 . ASN B 1 32  ? 37.974 18.827  29.543 1.00 38.10 ? 23  ASN B OD1 1 
ATOM   1821 N  ND2 . ASN B 1 32  ? 37.643 17.840  27.522 1.00 37.11 ? 23  ASN B ND2 1 
ATOM   1822 N  N   . THR B 1 33  ? 39.981 14.741  30.094 1.00 26.00 ? 24  THR B N   1 
ATOM   1823 C  CA  . THR B 1 33  ? 39.457 13.444  30.472 1.00 25.59 ? 24  THR B CA  1 
ATOM   1824 C  C   . THR B 1 33  ? 39.568 13.266  31.989 1.00 25.08 ? 24  THR B C   1 
ATOM   1825 O  O   . THR B 1 33  ? 38.584 12.949  32.648 1.00 24.01 ? 24  THR B O   1 
ATOM   1826 C  CB  . THR B 1 33  ? 40.170 12.313  29.716 1.00 25.85 ? 24  THR B CB  1 
ATOM   1827 O  OG1 . THR B 1 33  ? 39.766 12.326  28.325 1.00 24.56 ? 24  THR B OG1 1 
ATOM   1828 C  CG2 . THR B 1 33  ? 39.862 10.947  30.342 1.00 26.38 ? 24  THR B CG2 1 
ATOM   1829 N  N   . LEU B 1 34  ? 40.755 13.486  32.537 1.00 24.30 ? 25  LEU B N   1 
ATOM   1830 C  CA  . LEU B 1 34  ? 40.948 13.273  33.978 1.00 25.40 ? 25  LEU B CA  1 
ATOM   1831 C  C   . LEU B 1 34  ? 39.956 14.137  34.779 1.00 26.26 ? 25  LEU B C   1 
ATOM   1832 O  O   . LEU B 1 34  ? 39.314 13.664  35.736 1.00 26.94 ? 25  LEU B O   1 
ATOM   1833 C  CB  . LEU B 1 34  ? 42.390 13.604  34.386 1.00 26.66 ? 25  LEU B CB  1 
ATOM   1834 C  CG  . LEU B 1 34  ? 43.174 12.548  35.145 1.00 31.48 ? 25  LEU B CG  1 
ATOM   1835 C  CD1 . LEU B 1 34  ? 44.397 13.154  35.855 1.00 28.86 ? 25  LEU B CD1 1 
ATOM   1836 C  CD2 . LEU B 1 34  ? 42.308 11.680  36.104 1.00 31.55 ? 25  LEU B CD2 1 
ATOM   1837 N  N   . SER B 1 35  ? 39.773 15.392  34.351 1.00 27.28 ? 26  SER B N   1 
ATOM   1838 C  CA  . SER B 1 35  ? 38.883 16.309  35.062 1.00 26.83 ? 26  SER B CA  1 
ATOM   1839 C  C   . SER B 1 35  ? 37.430 15.845  35.023 1.00 26.09 ? 26  SER B C   1 
ATOM   1840 O  O   . SER B 1 35  ? 36.757 15.852  36.045 1.00 25.79 ? 26  SER B O   1 
ATOM   1841 C  CB  . SER B 1 35  ? 39.016 17.751  34.535 1.00 29.38 ? 26  SER B CB  1 
ATOM   1842 O  OG  . SER B 1 35  ? 38.573 17.817  33.182 1.00 32.37 ? 26  SER B OG  1 
ATOM   1843 N  N   . ILE B 1 36  ? 36.961 15.425  33.852 1.00 26.30 ? 27  ILE B N   1 
ATOM   1844 C  CA  . ILE B 1 36  ? 35.575 14.943  33.682 1.00 25.76 ? 27  ILE B CA  1 
ATOM   1845 C  C   . ILE B 1 36  ? 35.389 13.573  34.358 1.00 23.51 ? 27  ILE B C   1 
ATOM   1846 O  O   . ILE B 1 36  ? 34.398 13.318  35.018 1.00 24.78 ? 27  ILE B O   1 
ATOM   1847 C  CB  . ILE B 1 36  ? 35.217 14.788  32.192 1.00 25.69 ? 27  ILE B CB  1 
ATOM   1848 C  CG1 . ILE B 1 36  ? 35.323 16.143  31.481 1.00 29.51 ? 27  ILE B CG1 1 
ATOM   1849 C  CG2 . ILE B 1 36  ? 33.784 14.248  32.023 1.00 27.57 ? 27  ILE B CG2 1 
ATOM   1850 C  CD1 . ILE B 1 36  ? 35.047 16.061  29.999 1.00 31.09 ? 27  ILE B CD1 1 
ATOM   1851 N  N   . HIS B 1 37  ? 36.353 12.691  34.167 1.00 23.19 ? 28  HIS B N   1 
ATOM   1852 C  CA  . HIS B 1 37  ? 36.256 11.318  34.659 1.00 22.51 ? 28  HIS B CA  1 
ATOM   1853 C  C   . HIS B 1 37  ? 36.148 11.288  36.203 1.00 22.21 ? 28  HIS B C   1 
ATOM   1854 O  O   . HIS B 1 37  ? 35.258 10.670  36.752 1.00 21.73 ? 28  HIS B O   1 
ATOM   1855 C  CB  . HIS B 1 37  ? 37.408 10.496  34.068 1.00 22.56 ? 28  HIS B CB  1 
ATOM   1856 C  CG  . HIS B 1 37  ? 37.239 9.008   34.185 1.00 21.34 ? 28  HIS B CG  1 
ATOM   1857 N  ND1 . HIS B 1 37  ? 38.227 8.144   33.785 1.00 20.72 ? 28  HIS B ND1 1 
ATOM   1858 C  CD2 . HIS B 1 37  ? 36.207 8.227   34.627 1.00 20.24 ? 28  HIS B CD2 1 
ATOM   1859 C  CE1 . HIS B 1 37  ? 37.826 6.893   33.997 1.00 18.29 ? 28  HIS B CE1 1 
ATOM   1860 N  NE2 . HIS B 1 37  ? 36.594 6.902   34.493 1.00 19.73 ? 28  HIS B NE2 1 
ATOM   1861 N  N   . HIS B 1 38  ? 36.961 12.075  36.882 1.00 22.98 ? 29  HIS B N   1 
ATOM   1862 C  CA  . HIS B 1 38  ? 36.924 12.211  38.350 1.00 23.71 ? 29  HIS B CA  1 
ATOM   1863 C  C   . HIS B 1 38  ? 35.768 13.126  38.775 1.00 23.66 ? 29  HIS B C   1 
ATOM   1864 O  O   . HIS B 1 38  ? 34.943 12.746  39.581 1.00 22.33 ? 29  HIS B O   1 
ATOM   1865 C  CB  . HIS B 1 38  ? 38.281 12.784  38.820 1.00 23.38 ? 29  HIS B CB  1 
ATOM   1866 C  CG  . HIS B 1 38  ? 38.352 13.072  40.287 1.00 23.20 ? 29  HIS B CG  1 
ATOM   1867 N  ND1 . HIS B 1 38  ? 38.246 14.347  40.799 1.00 24.54 ? 29  HIS B ND1 1 
ATOM   1868 C  CD2 . HIS B 1 38  ? 38.538 12.252  41.348 1.00 24.16 ? 29  HIS B CD2 1 
ATOM   1869 C  CE1 . HIS B 1 38  ? 38.357 14.299  42.119 1.00 28.10 ? 29  HIS B CE1 1 
ATOM   1870 N  NE2 . HIS B 1 38  ? 38.519 13.038  42.484 1.00 26.55 ? 29  HIS B NE2 1 
ATOM   1871 N  N   . GLY B 1 39  ? 35.686 14.319  38.170 1.00 25.20 ? 30  GLY B N   1 
ATOM   1872 C  CA  . GLY B 1 39  ? 34.811 15.378  38.663 1.00 24.23 ? 30  GLY B CA  1 
ATOM   1873 C  C   . GLY B 1 39  ? 33.365 15.260  38.263 1.00 25.11 ? 30  GLY B C   1 
ATOM   1874 O  O   . GLY B 1 39  ? 32.506 15.860  38.898 1.00 24.40 ? 30  GLY B O   1 
ATOM   1875 N  N   . LYS B 1 40  ? 33.087 14.511  37.189 1.00 25.07 ? 31  LYS B N   1 
ATOM   1876 C  CA  . LYS B 1 40  ? 31.727 14.280  36.762 1.00 25.41 ? 31  LYS B CA  1 
ATOM   1877 C  C   . LYS B 1 40  ? 31.323 12.820  36.956 1.00 24.41 ? 31  LYS B C   1 
ATOM   1878 O  O   . LYS B 1 40  ? 30.388 12.561  37.707 1.00 22.88 ? 31  LYS B O   1 
ATOM   1879 C  CB  . LYS B 1 40  ? 31.522 14.761  35.304 1.00 25.87 ? 31  LYS B CB  1 
ATOM   1880 C  CG  . LYS B 1 40  ? 31.468 16.274  35.245 1.00 30.55 ? 31  LYS B CG  1 
ATOM   1881 C  CD  . LYS B 1 40  ? 31.726 16.812  33.846 1.00 30.68 ? 31  LYS B CD  1 
ATOM   1882 C  CE  . LYS B 1 40  ? 31.285 18.284  33.667 1.00 35.71 ? 31  LYS B CE  1 
ATOM   1883 N  NZ  . LYS B 1 40  ? 31.121 18.988  34.950 1.00 41.31 ? 31  LYS B NZ  1 
ATOM   1884 N  N   . HIS B 1 41  ? 32.040 11.871  36.331 1.00 23.73 ? 32  HIS B N   1 
ATOM   1885 C  CA  . HIS B 1 41  ? 31.616 10.454  36.377 1.00 23.54 ? 32  HIS B CA  1 
ATOM   1886 C  C   . HIS B 1 41  ? 31.663 9.877   37.781 1.00 21.45 ? 32  HIS B C   1 
ATOM   1887 O  O   . HIS B 1 41  ? 30.686 9.332   38.258 1.00 20.57 ? 32  HIS B O   1 
ATOM   1888 C  CB  . HIS B 1 41  ? 32.432 9.570   35.427 1.00 21.80 ? 32  HIS B CB  1 
ATOM   1889 C  CG  . HIS B 1 41  ? 32.148 9.813   33.965 1.00 23.48 ? 32  HIS B CG  1 
ATOM   1890 N  ND1 . HIS B 1 41  ? 31.214 9.080   33.256 1.00 25.56 ? 32  HIS B ND1 1 
ATOM   1891 C  CD2 . HIS B 1 41  ? 32.678 10.694  33.084 1.00 22.61 ? 32  HIS B CD2 1 
ATOM   1892 C  CE1 . HIS B 1 41  ? 31.173 9.515   32.005 1.00 23.58 ? 32  HIS B CE1 1 
ATOM   1893 N  NE2 . HIS B 1 41  ? 32.063 10.479  31.865 1.00 21.85 ? 32  HIS B NE2 1 
ATOM   1894 N  N   . HIS B 1 42  ? 32.820 9.958   38.410 1.00 22.71 ? 33  HIS B N   1 
ATOM   1895 C  CA  . HIS B 1 42  ? 33.012 9.390   39.749 1.00 23.29 ? 33  HIS B CA  1 
ATOM   1896 C  C   . HIS B 1 42  ? 32.093 10.090  40.761 1.00 23.54 ? 33  HIS B C   1 
ATOM   1897 O  O   . HIS B 1 42  ? 31.407 9.424   41.543 1.00 24.03 ? 33  HIS B O   1 
ATOM   1898 C  CB  . HIS B 1 42  ? 34.484 9.484   40.163 1.00 23.04 ? 33  HIS B CB  1 
ATOM   1899 C  CG  . HIS B 1 42  ? 34.819 8.697   41.400 1.00 22.69 ? 33  HIS B CG  1 
ATOM   1900 N  ND1 . HIS B 1 42  ? 36.101 8.571   41.876 1.00 24.14 ? 33  HIS B ND1 1 
ATOM   1901 C  CD2 . HIS B 1 42  ? 34.036 7.992   42.248 1.00 21.33 ? 33  HIS B CD2 1 
ATOM   1902 C  CE1 . HIS B 1 42  ? 36.095 7.841   42.979 1.00 24.94 ? 33  HIS B CE1 1 
ATOM   1903 N  NE2 . HIS B 1 42  ? 34.856 7.462   43.219 1.00 24.64 ? 33  HIS B NE2 1 
ATOM   1904 N  N   . ALA B 1 43  ? 32.067 11.422  40.721 1.00 24.50 ? 34  ALA B N   1 
ATOM   1905 C  CA  . ALA B 1 43  ? 31.148 12.240  41.540 1.00 23.88 ? 34  ALA B CA  1 
ATOM   1906 C  C   . ALA B 1 43  ? 29.691 11.787  41.419 1.00 24.83 ? 34  ALA B C   1 
ATOM   1907 O  O   . ALA B 1 43  ? 28.990 11.658  42.412 1.00 26.23 ? 34  ALA B O   1 
ATOM   1908 C  CB  . ALA B 1 43  ? 31.276 13.736  41.160 1.00 25.88 ? 34  ALA B CB  1 
ATOM   1909 N  N   . THR B 1 44  ? 29.231 11.503  40.201 1.00 23.24 ? 35  THR B N   1 
ATOM   1910 C  CA  . THR B 1 44  ? 27.866 10.996  40.028 1.00 23.91 ? 35  THR B CA  1 
ATOM   1911 C  C   . THR B 1 44  ? 27.593 9.673   40.713 1.00 23.74 ? 35  THR B C   1 
ATOM   1912 O  O   . THR B 1 44  ? 26.510 9.502   41.314 1.00 25.05 ? 35  THR B O   1 
ATOM   1913 C  CB  . THR B 1 44  ? 27.529 10.884  38.567 1.00 23.20 ? 35  THR B CB  1 
ATOM   1914 O  OG1 . THR B 1 44  ? 27.536 12.192  38.006 1.00 28.03 ? 35  THR B OG1 1 
ATOM   1915 C  CG2 . THR B 1 44  ? 26.184 10.180  38.336 1.00 25.39 ? 35  THR B CG2 1 
ATOM   1916 N  N   . TYR B 1 45  ? 28.539 8.736   40.649 1.00 23.64 ? 36  TYR B N   1 
ATOM   1917 C  CA  . TYR B 1 45  ? 28.364 7.447   41.334 1.00 24.23 ? 36  TYR B CA  1 
ATOM   1918 C  C   . TYR B 1 45  ? 28.259 7.633   42.874 1.00 25.21 ? 36  TYR B C   1 
ATOM   1919 O  O   . TYR B 1 45  ? 27.427 7.008   43.543 1.00 26.11 ? 36  TYR B O   1 
ATOM   1920 C  CB  . TYR B 1 45  ? 29.503 6.490   40.983 1.00 25.07 ? 36  TYR B CB  1 
ATOM   1921 C  CG  . TYR B 1 45  ? 29.530 6.008   39.543 1.00 24.73 ? 36  TYR B CG  1 
ATOM   1922 C  CD1 . TYR B 1 45  ? 28.432 5.380   38.985 1.00 24.42 ? 36  TYR B CD1 1 
ATOM   1923 C  CD2 . TYR B 1 45  ? 30.661 6.176   38.741 1.00 25.46 ? 36  TYR B CD2 1 
ATOM   1924 C  CE1 . TYR B 1 45  ? 28.440 4.936   37.703 1.00 28.01 ? 36  TYR B CE1 1 
ATOM   1925 C  CE2 . TYR B 1 45  ? 30.681 5.717   37.443 1.00 26.43 ? 36  TYR B CE2 1 
ATOM   1926 C  CZ  . TYR B 1 45  ? 29.556 5.103   36.922 1.00 27.85 ? 36  TYR B CZ  1 
ATOM   1927 O  OH  . TYR B 1 45  ? 29.535 4.645   35.616 1.00 29.10 ? 36  TYR B OH  1 
ATOM   1928 N  N   . VAL B 1 46  ? 29.113 8.492   43.421 1.00 24.66 ? 37  VAL B N   1 
ATOM   1929 C  CA  . VAL B 1 46  ? 29.089 8.793   44.837 1.00 25.59 ? 37  VAL B CA  1 
ATOM   1930 C  C   . VAL B 1 46  ? 27.724 9.404   45.209 1.00 25.66 ? 37  VAL B C   1 
ATOM   1931 O  O   . VAL B 1 46  ? 27.102 8.995   46.188 1.00 25.09 ? 37  VAL B O   1 
ATOM   1932 C  CB  . VAL B 1 46  ? 30.243 9.737   45.234 1.00 27.00 ? 37  VAL B CB  1 
ATOM   1933 C  CG1 . VAL B 1 46  ? 30.022 10.306  46.618 1.00 26.92 ? 37  VAL B CG1 1 
ATOM   1934 C  CG2 . VAL B 1 46  ? 31.606 9.025   45.131 1.00 29.70 ? 37  VAL B CG2 1 
ATOM   1935 N  N   . ASN B 1 47  ? 27.284 10.402  44.447 1.00 26.24 ? 38  ASN B N   1 
ATOM   1936 C  CA  . ASN B 1 47  ? 26.006 11.077  44.730 1.00 27.38 ? 38  ASN B CA  1 
ATOM   1937 C  C   . ASN B 1 47  ? 24.833 10.091  44.625 1.00 27.46 ? 38  ASN B C   1 
ATOM   1938 O  O   . ASN B 1 47  ? 23.922 10.104  45.471 1.00 29.83 ? 38  ASN B O   1 
ATOM   1939 C  CB  . ASN B 1 47  ? 25.796 12.295  43.793 1.00 27.57 ? 38  ASN B CB  1 
ATOM   1940 C  CG  . ASN B 1 47  ? 26.838 13.392  44.007 1.00 28.79 ? 38  ASN B CG  1 
ATOM   1941 O  OD1 . ASN B 1 47  ? 27.516 13.421  45.039 1.00 31.32 ? 38  ASN B OD1 1 
ATOM   1942 N  ND2 . ASN B 1 47  ? 27.006 14.283  43.007 1.00 29.94 ? 38  ASN B ND2 1 
ATOM   1943 N  N   . ASN B 1 48  ? 24.833 9.240   43.595 1.00 26.44 ? 39  ASN B N   1 
ATOM   1944 C  CA  . ASN B 1 48  ? 23.761 8.244   43.464 1.00 27.15 ? 39  ASN B CA  1 
ATOM   1945 C  C   . ASN B 1 48  ? 23.814 7.145   44.530 1.00 27.82 ? 39  ASN B C   1 
ATOM   1946 O  O   . ASN B 1 48  ? 22.767 6.692   45.001 1.00 28.74 ? 39  ASN B O   1 
ATOM   1947 C  CB  . ASN B 1 48  ? 23.717 7.670   42.046 1.00 27.50 ? 39  ASN B CB  1 
ATOM   1948 C  CG  . ASN B 1 48  ? 23.321 8.709   41.029 1.00 27.09 ? 39  ASN B CG  1 
ATOM   1949 O  OD1 . ASN B 1 48  ? 22.839 9.776   41.403 1.00 25.11 ? 39  ASN B OD1 1 
ATOM   1950 N  ND2 . ASN B 1 48  ? 23.481 8.407   39.748 1.00 27.53 ? 39  ASN B ND2 1 
ATOM   1951 N  N   . LEU B 1 49  ? 25.023 6.768   44.951 1.00 27.24 ? 40  LEU B N   1 
ATOM   1952 C  CA  . LEU B 1 49  ? 25.184 5.819   46.059 1.00 28.40 ? 40  LEU B CA  1 
ATOM   1953 C  C   . LEU B 1 49  ? 24.554 6.391   47.337 1.00 28.43 ? 40  LEU B C   1 
ATOM   1954 O  O   . LEU B 1 49  ? 23.761 5.720   48.013 1.00 29.68 ? 40  LEU B O   1 
ATOM   1955 C  CB  . LEU B 1 49  ? 26.667 5.513   46.304 1.00 27.84 ? 40  LEU B CB  1 
ATOM   1956 C  CG  . LEU B 1 49  ? 27.004 4.561   47.487 1.00 27.08 ? 40  LEU B CG  1 
ATOM   1957 C  CD1 . LEU B 1 49  ? 26.323 3.229   47.462 1.00 27.58 ? 40  LEU B CD1 1 
ATOM   1958 C  CD2 . LEU B 1 49  ? 28.490 4.412   47.549 1.00 26.72 ? 40  LEU B CD2 1 
ATOM   1959 N  N   . ASN B 1 50  ? 24.923 7.614   47.674 1.00 29.40 ? 41  ASN B N   1 
ATOM   1960 C  CA  . ASN B 1 50  ? 24.383 8.246   48.876 1.00 29.90 ? 41  ASN B CA  1 
ATOM   1961 C  C   . ASN B 1 50  ? 22.851 8.368   48.788 1.00 30.73 ? 41  ASN B C   1 
ATOM   1962 O  O   . ASN B 1 50  ? 22.140 8.057   49.745 1.00 31.40 ? 41  ASN B O   1 
ATOM   1963 C  CB  . ASN B 1 50  ? 25.035 9.599   49.125 1.00 29.58 ? 41  ASN B CB  1 
ATOM   1964 C  CG  . ASN B 1 50  ? 26.476 9.490   49.612 1.00 28.58 ? 41  ASN B CG  1 
ATOM   1965 O  OD1 . ASN B 1 50  ? 26.858 8.547   50.331 1.00 29.06 ? 41  ASN B OD1 1 
ATOM   1966 N  ND2 . ASN B 1 50  ? 27.287 10.448  49.214 1.00 24.96 ? 41  ASN B ND2 1 
ATOM   1967 N  N   . ALA B 1 51  ? 22.341 8.754   47.621 1.00 31.67 ? 42  ALA B N   1 
ATOM   1968 C  CA  . ALA B 1 51  ? 20.893 8.820   47.393 1.00 31.95 ? 42  ALA B CA  1 
ATOM   1969 C  C   . ALA B 1 51  ? 20.164 7.476   47.622 1.00 32.73 ? 42  ALA B C   1 
ATOM   1970 O  O   . ALA B 1 51  ? 19.052 7.433   48.174 1.00 31.52 ? 42  ALA B O   1 
ATOM   1971 C  CB  . ALA B 1 51  ? 20.619 9.364   45.982 1.00 33.33 ? 42  ALA B CB  1 
ATOM   1972 N  N   . ALA B 1 52  ? 20.781 6.368   47.214 1.00 32.74 ? 43  ALA B N   1 
ATOM   1973 C  CA  . ALA B 1 52  ? 20.150 5.041   47.384 1.00 34.23 ? 43  ALA B CA  1 
ATOM   1974 C  C   . ALA B 1 52  ? 20.101 4.583   48.839 1.00 35.13 ? 43  ALA B C   1 
ATOM   1975 O  O   . ALA B 1 52  ? 19.169 3.892   49.240 1.00 36.38 ? 43  ALA B O   1 
ATOM   1976 C  CB  . ALA B 1 52  ? 20.856 4.004   46.562 1.00 34.39 ? 43  ALA B CB  1 
ATOM   1977 N  N   . LEU B 1 53  ? 21.095 4.991   49.614 1.00 34.87 ? 44  LEU B N   1 
ATOM   1978 C  CA  . LEU B 1 53  ? 21.247 4.517   50.990 1.00 36.79 ? 44  LEU B CA  1 
ATOM   1979 C  C   . LEU B 1 53  ? 20.467 5.360   51.994 1.00 38.52 ? 44  LEU B C   1 
ATOM   1980 O  O   . LEU B 1 53  ? 20.153 4.882   53.094 1.00 37.96 ? 44  LEU B O   1 
ATOM   1981 C  CB  . LEU B 1 53  ? 22.743 4.492   51.377 1.00 34.80 ? 44  LEU B CB  1 
ATOM   1982 C  CG  . LEU B 1 53  ? 23.571 3.436   50.631 1.00 34.20 ? 44  LEU B CG  1 
ATOM   1983 C  CD1 . LEU B 1 53  ? 25.042 3.647   50.931 1.00 33.03 ? 44  LEU B CD1 1 
ATOM   1984 C  CD2 . LEU B 1 53  ? 23.157 2.008   50.975 1.00 35.41 ? 44  LEU B CD2 1 
ATOM   1985 N  N   . GLU B 1 54  ? 20.155 6.593   51.596 1.00 40.40 ? 45  GLU B N   1 
ATOM   1986 C  CA  . GLU B 1 54  ? 19.574 7.618   52.475 1.00 42.29 ? 45  GLU B CA  1 
ATOM   1987 C  C   . GLU B 1 54  ? 18.392 7.155   53.336 1.00 42.93 ? 45  GLU B C   1 
ATOM   1988 O  O   . GLU B 1 54  ? 18.325 7.508   54.527 1.00 42.57 ? 45  GLU B O   1 
ATOM   1989 C  CB  . GLU B 1 54  ? 19.136 8.828   51.637 1.00 42.60 ? 45  GLU B CB  1 
ATOM   1990 C  CG  . GLU B 1 54  ? 19.617 10.144  52.197 1.00 46.24 ? 45  GLU B CG  1 
ATOM   1991 C  CD  . GLU B 1 54  ? 19.896 11.175  51.119 1.00 47.97 ? 45  GLU B CD  1 
ATOM   1992 O  OE1 . GLU B 1 54  ? 19.262 11.088  50.030 1.00 55.12 ? 45  GLU B OE1 1 
ATOM   1993 O  OE2 . GLU B 1 54  ? 20.758 12.066  51.361 1.00 53.09 ? 45  GLU B OE2 1 
ATOM   1994 N  N   . ASN B 1 55  ? 17.475 6.387   52.735 1.00 43.40 ? 46  ASN B N   1 
ATOM   1995 C  CA  . ASN B 1 55  ? 16.246 5.925   53.416 1.00 45.09 ? 46  ASN B CA  1 
ATOM   1996 C  C   . ASN B 1 55  ? 16.382 4.597   54.182 1.00 45.76 ? 46  ASN B C   1 
ATOM   1997 O  O   . ASN B 1 55  ? 15.389 4.094   54.739 1.00 46.46 ? 46  ASN B O   1 
ATOM   1998 C  CB  . ASN B 1 55  ? 15.096 5.771   52.404 1.00 46.41 ? 46  ASN B CB  1 
ATOM   1999 C  CG  . ASN B 1 55  ? 14.755 7.084   51.666 1.00 49.67 ? 46  ASN B CG  1 
ATOM   2000 O  OD1 . ASN B 1 55  ? 14.697 7.121   50.429 1.00 55.11 ? 46  ASN B OD1 1 
ATOM   2001 N  ND2 . ASN B 1 55  ? 14.527 8.148   52.422 1.00 49.58 ? 46  ASN B ND2 1 
ATOM   2002 N  N   . TYR B 1 56  ? 17.577 4.005   54.190 1.00 45.69 ? 47  TYR B N   1 
ATOM   2003 C  CA  . TYR B 1 56  ? 17.787 2.733   54.879 1.00 46.03 ? 47  TYR B CA  1 
ATOM   2004 C  C   . TYR B 1 56  ? 18.792 2.905   56.002 1.00 45.41 ? 47  TYR B C   1 
ATOM   2005 O  O   . TYR B 1 56  ? 19.995 2.764   55.816 1.00 43.93 ? 47  TYR B O   1 
ATOM   2006 C  CB  . TYR B 1 56  ? 18.197 1.643   53.891 1.00 45.20 ? 47  TYR B CB  1 
ATOM   2007 C  CG  . TYR B 1 56  ? 17.134 1.429   52.848 1.00 49.06 ? 47  TYR B CG  1 
ATOM   2008 C  CD1 . TYR B 1 56  ? 17.108 2.193   51.698 1.00 43.15 ? 47  TYR B CD1 1 
ATOM   2009 C  CD2 . TYR B 1 56  ? 16.139 0.492   53.033 1.00 49.16 ? 47  TYR B CD2 1 
ATOM   2010 C  CE1 . TYR B 1 56  ? 16.122 2.018   50.751 1.00 46.28 ? 47  TYR B CE1 1 
ATOM   2011 C  CE2 . TYR B 1 56  ? 15.156 0.302   52.087 1.00 50.95 ? 47  TYR B CE2 1 
ATOM   2012 C  CZ  . TYR B 1 56  ? 15.149 1.079   50.946 1.00 49.25 ? 47  TYR B CZ  1 
ATOM   2013 O  OH  . TYR B 1 56  ? 14.167 0.893   49.987 1.00 48.95 ? 47  TYR B OH  1 
ATOM   2014 N  N   . SER B 1 57  ? 18.263 3.230   57.179 1.00 46.21 ? 48  SER B N   1 
ATOM   2015 C  CA  . SER B 1 57  ? 19.099 3.605   58.323 1.00 46.18 ? 48  SER B CA  1 
ATOM   2016 C  C   . SER B 1 57  ? 19.937 2.425   58.784 1.00 45.11 ? 48  SER B C   1 
ATOM   2017 O  O   . SER B 1 57  ? 21.036 2.635   59.267 1.00 43.91 ? 48  SER B O   1 
ATOM   2018 C  CB  . SER B 1 57  ? 18.246 4.158   59.468 1.00 46.96 ? 48  SER B CB  1 
ATOM   2019 O  OG  . SER B 1 57  ? 17.612 5.367   59.068 1.00 48.33 ? 48  SER B OG  1 
ATOM   2020 N  N   . GLU B 1 58  ? 19.422 1.197   58.590 1.00 46.24 ? 49  GLU B N   1 
ATOM   2021 C  CA  . GLU B 1 58  ? 20.168 -0.040  58.885 1.00 46.78 ? 49  GLU B CA  1 
ATOM   2022 C  C   . GLU B 1 58  ? 21.571 0.003   58.311 1.00 47.25 ? 49  GLU B C   1 
ATOM   2023 O  O   . GLU B 1 58  ? 22.501 -0.573  58.885 1.00 47.88 ? 49  GLU B O   1 
ATOM   2024 C  CB  . GLU B 1 58  ? 19.564 -1.304  58.236 1.00 47.60 ? 49  GLU B CB  1 
ATOM   2025 C  CG  . GLU B 1 58  ? 18.099 -1.522  58.273 1.00 48.27 ? 49  GLU B CG  1 
ATOM   2026 C  CD  . GLU B 1 58  ? 17.424 -1.043  57.018 1.00 44.84 ? 49  GLU B CD  1 
ATOM   2027 O  OE1 . GLU B 1 58  ? 17.100 -1.879  56.146 1.00 43.81 ? 49  GLU B OE1 1 
ATOM   2028 O  OE2 . GLU B 1 58  ? 17.225 0.174   56.915 1.00 43.23 ? 49  GLU B OE2 1 
ATOM   2029 N  N   . LEU B 1 59  ? 21.699 0.630   57.141 1.00 46.82 ? 50  LEU B N   1 
ATOM   2030 C  CA  . LEU B 1 59  ? 22.899 0.488   56.305 1.00 46.58 ? 50  LEU B CA  1 
ATOM   2031 C  C   . LEU B 1 59  ? 23.922 1.604   56.463 1.00 45.83 ? 50  LEU B C   1 
ATOM   2032 O  O   . LEU B 1 59  ? 25.003 1.522   55.900 1.00 43.72 ? 50  LEU B O   1 
ATOM   2033 C  CB  . LEU B 1 59  ? 22.490 0.387   54.825 1.00 46.46 ? 50  LEU B CB  1 
ATOM   2034 C  CG  . LEU B 1 59  ? 21.508 -0.742  54.490 1.00 47.39 ? 50  LEU B CG  1 
ATOM   2035 C  CD1 . LEU B 1 59  ? 21.123 -0.704  53.027 1.00 48.13 ? 50  LEU B CD1 1 
ATOM   2036 C  CD2 . LEU B 1 59  ? 22.104 -2.102  54.873 1.00 47.54 ? 50  LEU B CD2 1 
ATOM   2037 N  N   . HIS B 1 60  ? 23.596 2.634   57.239 1.00 46.77 ? 51  HIS B N   1 
ATOM   2038 C  CA  . HIS B 1 60  ? 24.429 3.836   57.283 1.00 47.77 ? 51  HIS B CA  1 
ATOM   2039 C  C   . HIS B 1 60  ? 25.834 3.653   57.869 1.00 48.62 ? 51  HIS B C   1 
ATOM   2040 O  O   . HIS B 1 60  ? 26.664 4.554   57.758 1.00 49.51 ? 51  HIS B O   1 
ATOM   2041 C  CB  . HIS B 1 60  ? 23.702 4.964   58.018 1.00 49.01 ? 51  HIS B CB  1 
ATOM   2042 C  CG  . HIS B 1 60  ? 22.619 5.611   57.208 1.00 52.51 ? 51  HIS B CG  1 
ATOM   2043 N  ND1 . HIS B 1 60  ? 22.754 5.872   55.860 1.00 55.71 ? 51  HIS B ND1 1 
ATOM   2044 C  CD2 . HIS B 1 60  ? 21.390 6.062   57.557 1.00 53.35 ? 51  HIS B CD2 1 
ATOM   2045 C  CE1 . HIS B 1 60  ? 21.647 6.439   55.412 1.00 55.98 ? 51  HIS B CE1 1 
ATOM   2046 N  NE2 . HIS B 1 60  ? 20.802 6.566   56.421 1.00 54.52 ? 51  HIS B NE2 1 
ATOM   2047 N  N   . ASN B 1 61  ? 26.109 2.508   58.494 1.00 48.60 ? 52  ASN B N   1 
ATOM   2048 C  CA  . ASN B 1 61  ? 27.423 2.274   59.092 1.00 48.19 ? 52  ASN B CA  1 
ATOM   2049 C  C   . ASN B 1 61  ? 28.210 1.209   58.349 1.00 47.51 ? 52  ASN B C   1 
ATOM   2050 O  O   . ASN B 1 61  ? 29.358 0.941   58.691 1.00 48.42 ? 52  ASN B O   1 
ATOM   2051 C  CB  . ASN B 1 61  ? 27.264 1.907   60.567 1.00 50.00 ? 52  ASN B CB  1 
ATOM   2052 C  CG  . ASN B 1 61  ? 26.285 2.839   61.285 1.00 56.61 ? 52  ASN B CG  1 
ATOM   2053 O  OD1 . ASN B 1 61  ? 26.580 4.025   61.496 1.00 62.33 ? 52  ASN B OD1 1 
ATOM   2054 N  ND2 . ASN B 1 61  ? 25.099 2.315   61.629 1.00 61.11 ? 52  ASN B ND2 1 
ATOM   2055 N  N   . LYS B 1 62  ? 27.605 0.627   57.315 1.00 45.57 ? 53  LYS B N   1 
ATOM   2056 C  CA  . LYS B 1 62  ? 28.266 -0.396  56.516 1.00 44.29 ? 53  LYS B CA  1 
ATOM   2057 C  C   . LYS B 1 62  ? 29.351 0.248   55.671 1.00 42.63 ? 53  LYS B C   1 
ATOM   2058 O  O   . LYS B 1 62  ? 29.137 1.326   55.090 1.00 42.26 ? 53  LYS B O   1 
ATOM   2059 C  CB  . LYS B 1 62  ? 27.258 -1.112  55.608 1.00 44.74 ? 53  LYS B CB  1 
ATOM   2060 C  CG  . LYS B 1 62  ? 26.158 -1.876  56.343 1.00 45.59 ? 53  LYS B CG  1 
ATOM   2061 C  CD  . LYS B 1 62  ? 26.708 -3.129  56.993 1.00 46.38 ? 53  LYS B CD  1 
ATOM   2062 C  CE  . LYS B 1 62  ? 25.631 -4.015  57.606 1.00 47.35 ? 53  LYS B CE  1 
ATOM   2063 N  NZ  . LYS B 1 62  ? 26.281 -5.018  58.502 1.00 48.54 ? 53  LYS B NZ  1 
ATOM   2064 N  N   . SER B 1 63  ? 30.512 -0.397  55.594 1.00 40.52 ? 54  SER B N   1 
ATOM   2065 C  CA  . SER B 1 63  ? 31.602 0.108   54.739 1.00 40.75 ? 54  SER B CA  1 
ATOM   2066 C  C   . SER B 1 63  ? 31.299 -0.222  53.280 1.00 38.27 ? 54  SER B C   1 
ATOM   2067 O  O   . SER B 1 63  ? 30.427 -1.043  52.997 1.00 36.46 ? 54  SER B O   1 
ATOM   2068 C  CB  . SER B 1 63  ? 32.924 -0.546  55.110 1.00 40.31 ? 54  SER B CB  1 
ATOM   2069 O  OG  . SER B 1 63  ? 32.855 -1.926  54.801 1.00 37.89 ? 54  SER B OG  1 
ATOM   2070 N  N   . LEU B 1 64  ? 32.041 0.397   52.368 1.00 38.59 ? 55  LEU B N   1 
ATOM   2071 C  CA  . LEU B 1 64  ? 31.860 0.147   50.939 1.00 38.88 ? 55  LEU B CA  1 
ATOM   2072 C  C   . LEU B 1 64  ? 32.134 -1.315  50.622 1.00 39.74 ? 55  LEU B C   1 
ATOM   2073 O  O   . LEU B 1 64  ? 31.359 -1.966  49.913 1.00 38.50 ? 55  LEU B O   1 
ATOM   2074 C  CB  . LEU B 1 64  ? 32.802 1.025   50.113 1.00 38.97 ? 55  LEU B CB  1 
ATOM   2075 C  CG  . LEU B 1 64  ? 32.593 1.046   48.593 1.00 38.09 ? 55  LEU B CG  1 
ATOM   2076 C  CD1 . LEU B 1 64  ? 31.192 1.515   48.251 1.00 39.16 ? 55  LEU B CD1 1 
ATOM   2077 C  CD2 . LEU B 1 64  ? 33.628 1.921   47.910 1.00 37.76 ? 55  LEU B CD2 1 
ATOM   2078 N  N   . GLU B 1 65  ? 33.249 -1.828  51.155 1.00 40.77 ? 56  GLU B N   1 
ATOM   2079 C  CA  . GLU B 1 65  ? 33.620 -3.222  50.970 1.00 40.75 ? 56  GLU B CA  1 
ATOM   2080 C  C   . GLU B 1 65  ? 32.503 -4.133  51.497 1.00 39.48 ? 56  GLU B C   1 
ATOM   2081 O  O   . GLU B 1 65  ? 32.141 -5.093  50.841 1.00 38.92 ? 56  GLU B O   1 
ATOM   2082 C  CB  . GLU B 1 65  ? 34.972 -3.504  51.643 1.00 41.11 ? 56  GLU B CB  1 
ATOM   2083 C  CG  . GLU B 1 65  ? 35.467 -4.934  51.484 1.00 42.71 ? 56  GLU B CG  1 
ATOM   2084 C  CD  . GLU B 1 65  ? 36.874 -5.168  52.066 1.00 46.02 ? 56  GLU B CD  1 
ATOM   2085 O  OE1 . GLU B 1 65  ? 37.384 -4.321  52.842 1.00 53.07 ? 56  GLU B OE1 1 
ATOM   2086 O  OE2 . GLU B 1 65  ? 37.473 -6.216  51.735 1.00 53.83 ? 56  GLU B OE2 1 
ATOM   2087 N  N   . GLU B 1 66  ? 31.928 -3.809  52.659 1.00 39.32 ? 57  GLU B N   1 
ATOM   2088 C  CA  . GLU B 1 66  ? 30.831 -4.606  53.208 1.00 40.18 ? 57  GLU B CA  1 
ATOM   2089 C  C   . GLU B 1 66  ? 29.606 -4.654  52.306 1.00 39.39 ? 57  GLU B C   1 
ATOM   2090 O  O   . GLU B 1 66  ? 29.030 -5.727  52.051 1.00 39.76 ? 57  GLU B O   1 
ATOM   2091 C  CB  . GLU B 1 66  ? 30.430 -4.071  54.590 1.00 40.19 ? 57  GLU B CB  1 
ATOM   2092 C  CG  . GLU B 1 66  ? 31.311 -4.605  55.684 1.00 42.76 ? 57  GLU B CG  1 
ATOM   2093 C  CD  . GLU B 1 66  ? 31.039 -3.969  57.021 1.00 43.20 ? 57  GLU B CD  1 
ATOM   2094 O  OE1 . GLU B 1 66  ? 30.601 -2.797  57.058 1.00 45.29 ? 57  GLU B OE1 1 
ATOM   2095 O  OE2 . GLU B 1 66  ? 31.284 -4.649  58.039 1.00 48.57 ? 57  GLU B OE2 1 
ATOM   2096 N  N   . LEU B 1 67  ? 29.200 -3.481  51.836 1.00 38.64 ? 58  LEU B N   1 
ATOM   2097 C  CA  . LEU B 1 67  ? 28.103 -3.365  50.874 1.00 38.62 ? 58  LEU B CA  1 
ATOM   2098 C  C   . LEU B 1 67  ? 28.284 -4.296  49.667 1.00 36.69 ? 58  LEU B C   1 
ATOM   2099 O  O   . LEU B 1 67  ? 27.411 -5.106  49.354 1.00 34.14 ? 58  LEU B O   1 
ATOM   2100 C  CB  . LEU B 1 67  ? 28.003 -1.912  50.394 1.00 38.55 ? 58  LEU B CB  1 
ATOM   2101 C  CG  . LEU B 1 67  ? 26.892 -0.987  50.912 1.00 39.13 ? 58  LEU B CG  1 
ATOM   2102 C  CD1 . LEU B 1 67  ? 26.285 -1.380  52.234 1.00 38.05 ? 58  LEU B CD1 1 
ATOM   2103 C  CD2 . LEU B 1 67  ? 27.373 0.437   50.952 1.00 38.84 ? 58  LEU B CD2 1 
ATOM   2104 N  N   . LEU B 1 68  ? 29.450 -4.194  49.039 1.00 37.15 ? 59  LEU B N   1 
ATOM   2105 C  CA  . LEU B 1 68  ? 29.747 -4.903  47.788 1.00 38.36 ? 59  LEU B CA  1 
ATOM   2106 C  C   . LEU B 1 68  ? 30.044 -6.396  47.940 1.00 39.85 ? 59  LEU B C   1 
ATOM   2107 O  O   . LEU B 1 68  ? 30.039 -7.135  46.936 1.00 38.51 ? 59  LEU B O   1 
ATOM   2108 C  CB  . LEU B 1 68  ? 30.918 -4.216  47.069 1.00 37.65 ? 59  LEU B CB  1 
ATOM   2109 C  CG  . LEU B 1 68  ? 30.645 -2.750  46.678 1.00 33.14 ? 59  LEU B CG  1 
ATOM   2110 C  CD1 . LEU B 1 68  ? 31.914 -2.096  46.172 1.00 33.56 ? 59  LEU B CD1 1 
ATOM   2111 C  CD2 . LEU B 1 68  ? 29.547 -2.655  45.659 1.00 31.89 ? 59  LEU B CD2 1 
ATOM   2112 N  N   . CYS B 1 69  ? 30.308 -6.835  49.176 1.00 41.48 ? 60  CYS B N   1 
ATOM   2113 C  CA  . CYS B 1 69  ? 30.546 -8.255  49.452 1.00 42.16 ? 60  CYS B CA  1 
ATOM   2114 C  C   . CYS B 1 69  ? 29.236 -8.952  49.802 1.00 42.86 ? 60  CYS B C   1 
ATOM   2115 O  O   . CYS B 1 69  ? 29.187 -10.177 49.781 1.00 44.90 ? 60  CYS B O   1 
ATOM   2116 C  CB  . CYS B 1 69  ? 31.557 -8.444  50.597 1.00 43.43 ? 60  CYS B CB  1 
ATOM   2117 S  SG  . CYS B 1 69  ? 33.282 -8.126  50.168 1.00 44.78 ? 60  CYS B SG  1 
ATOM   2118 N  N   . ASN B 1 70  ? 28.180 -8.181  50.096 1.00 43.11 ? 61  ASN B N   1 
ATOM   2119 C  CA  . ASN B 1 70  ? 26.890 -8.706  50.593 1.00 44.54 ? 61  ASN B CA  1 
ATOM   2120 C  C   . ASN B 1 70  ? 25.664 -8.068  49.929 1.00 44.58 ? 61  ASN B C   1 
ATOM   2121 O  O   . ASN B 1 70  ? 24.664 -7.757  50.592 1.00 42.47 ? 61  ASN B O   1 
ATOM   2122 C  CB  . ASN B 1 70  ? 26.803 -8.488  52.103 1.00 44.62 ? 61  ASN B CB  1 
ATOM   2123 C  CG  . ASN B 1 70  ? 27.954 -9.135  52.843 1.00 45.68 ? 61  ASN B CG  1 
ATOM   2124 O  OD1 . ASN B 1 70  ? 28.923 -8.474  53.211 1.00 43.83 ? 61  ASN B OD1 1 
ATOM   2125 N  ND2 . ASN B 1 70  ? 27.871 -10.453 53.020 1.00 47.71 ? 61  ASN B ND2 1 
ATOM   2126 N  N   . LEU B 1 71  ? 25.760 -7.866  48.615 1.00 45.90 ? 62  LEU B N   1 
ATOM   2127 C  CA  . LEU B 1 71  ? 24.655 -7.331  47.810 1.00 47.23 ? 62  LEU B CA  1 
ATOM   2128 C  C   . LEU B 1 71  ? 23.378 -8.152  48.013 1.00 48.01 ? 62  LEU B C   1 
ATOM   2129 O  O   . LEU B 1 71  ? 22.290 -7.586  48.195 1.00 46.62 ? 62  LEU B O   1 
ATOM   2130 C  CB  . LEU B 1 71  ? 25.042 -7.312  46.316 1.00 46.80 ? 62  LEU B CB  1 
ATOM   2131 C  CG  . LEU B 1 71  ? 25.586 -6.054  45.598 1.00 47.63 ? 62  LEU B CG  1 
ATOM   2132 C  CD1 . LEU B 1 71  ? 25.762 -4.809  46.463 1.00 45.72 ? 62  LEU B CD1 1 
ATOM   2133 C  CD2 . LEU B 1 71  ? 26.887 -6.402  44.855 1.00 47.54 ? 62  LEU B CD2 1 
ATOM   2134 N  N   . GLU B 1 72  ? 23.536 -9.483  48.012 1.00 49.66 ? 63  GLU B N   1 
ATOM   2135 C  CA  . GLU B 1 72  ? 22.424 -10.453 48.166 1.00 50.73 ? 63  GLU B CA  1 
ATOM   2136 C  C   . GLU B 1 72  ? 21.459 -10.160 49.337 1.00 51.83 ? 63  GLU B C   1 
ATOM   2137 O  O   . GLU B 1 72  ? 20.332 -10.662 49.346 1.00 53.04 ? 63  GLU B O   1 
ATOM   2138 C  CB  . GLU B 1 72  ? 22.983 -11.877 48.362 1.00 51.89 ? 63  GLU B CB  1 
ATOM   2139 C  CG  . GLU B 1 72  ? 23.878 -12.442 47.230 1.00 57.42 ? 63  GLU B CG  1 
ATOM   2140 C  CD  . GLU B 1 72  ? 23.222 -13.596 46.433 1.00 64.78 ? 63  GLU B CD  1 
ATOM   2141 O  OE1 . GLU B 1 72  ? 23.720 -14.752 46.498 1.00 65.37 ? 63  GLU B OE1 1 
ATOM   2142 O  OE2 . GLU B 1 72  ? 22.202 -13.350 45.741 1.00 70.74 ? 63  GLU B OE2 1 
ATOM   2143 N  N   . THR B 1 73  ? 21.904 -9.364  50.311 1.00 51.71 ? 64  THR B N   1 
ATOM   2144 C  CA  . THR B 1 73  ? 21.153 -9.103  51.539 1.00 51.50 ? 64  THR B CA  1 
ATOM   2145 C  C   . THR B 1 73  ? 20.493 -7.726  51.633 1.00 51.27 ? 64  THR B C   1 
ATOM   2146 O  O   . THR B 1 73  ? 19.734 -7.473  52.563 1.00 51.10 ? 64  THR B O   1 
ATOM   2147 C  CB  . THR B 1 73  ? 22.076 -9.212  52.769 1.00 52.63 ? 64  THR B CB  1 
ATOM   2148 O  OG1 . THR B 1 73  ? 22.716 -7.948  53.016 1.00 54.91 ? 64  THR B OG1 1 
ATOM   2149 C  CG2 . THR B 1 73  ? 23.134 -10.317 52.568 1.00 54.73 ? 64  THR B CG2 1 
ATOM   2150 N  N   . LEU B 1 74  ? 20.784 -6.828  50.696 1.00 50.44 ? 65  LEU B N   1 
ATOM   2151 C  CA  . LEU B 1 74  ? 20.237 -5.473  50.744 1.00 49.80 ? 65  LEU B CA  1 
ATOM   2152 C  C   . LEU B 1 74  ? 18.767 -5.491  50.311 1.00 49.29 ? 65  LEU B C   1 
ATOM   2153 O  O   . LEU B 1 74  ? 18.342 -6.423  49.617 1.00 50.26 ? 65  LEU B O   1 
ATOM   2154 C  CB  . LEU B 1 74  ? 21.056 -4.541  49.828 1.00 49.27 ? 65  LEU B CB  1 
ATOM   2155 C  CG  . LEU B 1 74  ? 22.579 -4.531  50.061 1.00 48.49 ? 65  LEU B CG  1 
ATOM   2156 C  CD1 . LEU B 1 74  ? 23.314 -3.766  48.966 1.00 47.66 ? 65  LEU B CD1 1 
ATOM   2157 C  CD2 . LEU B 1 74  ? 22.924 -3.963  51.422 1.00 48.39 ? 65  LEU B CD2 1 
ATOM   2158 N  N   . PRO B 1 75  ? 17.987 -4.463  50.693 1.00 48.77 ? 66  PRO B N   1 
ATOM   2159 C  CA  . PRO B 1 75  ? 16.618 -4.363  50.160 1.00 49.04 ? 66  PRO B CA  1 
ATOM   2160 C  C   . PRO B 1 75  ? 16.579 -4.443  48.625 1.00 49.29 ? 66  PRO B C   1 
ATOM   2161 O  O   . PRO B 1 75  ? 17.425 -3.852  47.946 1.00 49.77 ? 66  PRO B O   1 
ATOM   2162 C  CB  . PRO B 1 75  ? 16.130 -2.982  50.647 1.00 48.60 ? 66  PRO B CB  1 
ATOM   2163 C  CG  . PRO B 1 75  ? 17.012 -2.595  51.729 1.00 48.69 ? 66  PRO B CG  1 
ATOM   2164 C  CD  . PRO B 1 75  ? 18.306 -3.359  51.613 1.00 48.63 ? 66  PRO B CD  1 
ATOM   2165 N  N   . LYS B 1 76  ? 15.607 -5.174  48.088 1.00 48.86 ? 67  LYS B N   1 
ATOM   2166 C  CA  . LYS B 1 76  ? 15.505 -5.353  46.652 1.00 47.95 ? 67  LYS B CA  1 
ATOM   2167 C  C   . LYS B 1 76  ? 15.278 -4.032  45.927 1.00 47.44 ? 67  LYS B C   1 
ATOM   2168 O  O   . LYS B 1 76  ? 15.665 -3.890  44.778 1.00 48.52 ? 67  LYS B O   1 
ATOM   2169 C  CB  . LYS B 1 76  ? 14.384 -6.334  46.306 1.00 49.01 ? 67  LYS B CB  1 
ATOM   2170 C  CG  . LYS B 1 76  ? 14.666 -7.775  46.694 1.00 50.68 ? 67  LYS B CG  1 
ATOM   2171 C  CD  . LYS B 1 76  ? 15.980 -8.298  46.111 1.00 51.67 ? 67  LYS B CD  1 
ATOM   2172 C  CE  . LYS B 1 76  ? 15.908 -9.787  45.777 1.00 52.19 ? 67  LYS B CE  1 
ATOM   2173 N  NZ  . LYS B 1 76  ? 17.276 -10.404 45.626 1.00 53.77 ? 67  LYS B NZ  1 
ATOM   2174 N  N   . GLU B 1 77  ? 14.688 -3.064  46.617 1.00 46.21 ? 68  GLU B N   1 
ATOM   2175 C  CA  . GLU B 1 77  ? 14.371 -1.762  46.030 1.00 44.94 ? 68  GLU B CA  1 
ATOM   2176 C  C   . GLU B 1 77  ? 15.634 -0.962  45.708 1.00 43.78 ? 68  GLU B C   1 
ATOM   2177 O  O   . GLU B 1 77  ? 15.567 -0.003  44.930 1.00 44.16 ? 68  GLU B O   1 
ATOM   2178 C  CB  . GLU B 1 77  ? 13.493 -0.916  46.960 1.00 45.79 ? 68  GLU B CB  1 
ATOM   2179 C  CG  . GLU B 1 77  ? 12.255 -1.631  47.512 1.00 50.50 ? 68  GLU B CG  1 
ATOM   2180 C  CD  . GLU B 1 77  ? 12.579 -2.590  48.652 1.00 55.36 ? 68  GLU B CD  1 
ATOM   2181 O  OE1 . GLU B 1 77  ? 13.408 -2.230  49.518 1.00 57.73 ? 68  GLU B OE1 1 
ATOM   2182 O  OE2 . GLU B 1 77  ? 12.016 -3.712  48.669 1.00 61.07 ? 68  GLU B OE2 1 
ATOM   2183 N  N   . ILE B 1 78  ? 16.765 -1.329  46.313 1.00 41.55 ? 69  ILE B N   1 
ATOM   2184 C  CA  . ILE B 1 78  ? 18.017 -0.599  46.081 1.00 40.05 ? 69  ILE B CA  1 
ATOM   2185 C  C   . ILE B 1 78  ? 19.244 -1.437  45.713 1.00 37.87 ? 69  ILE B C   1 
ATOM   2186 O  O   . ILE B 1 78  ? 20.318 -0.886  45.552 1.00 37.04 ? 69  ILE B O   1 
ATOM   2187 C  CB  . ILE B 1 78  ? 18.375 0.267   47.291 1.00 39.93 ? 69  ILE B CB  1 
ATOM   2188 C  CG1 . ILE B 1 78  ? 18.742 -0.593  48.499 1.00 40.44 ? 69  ILE B CG1 1 
ATOM   2189 C  CG2 . ILE B 1 78  ? 17.227 1.212   47.615 1.00 43.63 ? 69  ILE B CG2 1 
ATOM   2190 C  CD1 . ILE B 1 78  ? 19.426 0.192   49.596 1.00 40.55 ? 69  ILE B CD1 1 
ATOM   2191 N  N   . VAL B 1 79  ? 19.109 -2.747  45.590 1.00 37.22 ? 70  VAL B N   1 
ATOM   2192 C  CA  . VAL B 1 79  ? 20.293 -3.580  45.344 1.00 37.35 ? 70  VAL B CA  1 
ATOM   2193 C  C   . VAL B 1 79  ? 21.024 -3.183  44.037 1.00 36.11 ? 70  VAL B C   1 
ATOM   2194 O  O   . VAL B 1 79  ? 22.255 -3.099  44.009 1.00 35.17 ? 70  VAL B O   1 
ATOM   2195 C  CB  . VAL B 1 79  ? 19.980 -5.113  45.362 1.00 38.76 ? 70  VAL B CB  1 
ATOM   2196 C  CG1 . VAL B 1 79  ? 18.997 -5.497  44.301 1.00 39.26 ? 70  VAL B CG1 1 
ATOM   2197 C  CG2 . VAL B 1 79  ? 21.259 -5.936  45.188 1.00 38.26 ? 70  VAL B CG2 1 
ATOM   2198 N  N   . THR B 1 80  ? 20.275 -2.953  42.963 1.00 35.07 ? 71  THR B N   1 
ATOM   2199 C  CA  . THR B 1 80  ? 20.925 -2.587  41.700 1.00 33.85 ? 71  THR B CA  1 
ATOM   2200 C  C   . THR B 1 80  ? 21.646 -1.243  41.828 1.00 32.34 ? 71  THR B C   1 
ATOM   2201 O  O   . THR B 1 80  ? 22.773 -1.093  41.353 1.00 32.69 ? 71  THR B O   1 
ATOM   2202 C  CB  . THR B 1 80  ? 19.944 -2.588  40.550 1.00 34.35 ? 71  THR B CB  1 
ATOM   2203 O  OG1 . THR B 1 80  ? 19.367 -3.903  40.430 1.00 33.72 ? 71  THR B OG1 1 
ATOM   2204 C  CG2 . THR B 1 80  ? 20.651 -2.237  39.228 1.00 34.50 ? 71  THR B CG2 1 
ATOM   2205 N  N   . ALA B 1 81  ? 21.013 -0.280  42.494 1.00 31.16 ? 72  ALA B N   1 
ATOM   2206 C  CA  . ALA B 1 81  ? 21.606 1.029   42.736 1.00 31.54 ? 72  ALA B CA  1 
ATOM   2207 C  C   . ALA B 1 81  ? 22.913 0.947   43.528 1.00 30.14 ? 72  ALA B C   1 
ATOM   2208 O  O   . ALA B 1 81  ? 23.875 1.689   43.291 1.00 28.51 ? 72  ALA B O   1 
ATOM   2209 C  CB  . ALA B 1 81  ? 20.612 1.940   43.436 1.00 31.76 ? 72  ALA B CB  1 
ATOM   2210 N  N   . VAL B 1 82  ? 22.973 0.021   44.463 1.00 30.47 ? 73  VAL B N   1 
ATOM   2211 C  CA  . VAL B 1 82  ? 24.154 -0.119  45.274 1.00 28.98 ? 73  VAL B CA  1 
ATOM   2212 C  C   . VAL B 1 82  ? 25.259 -0.849  44.491 1.00 27.83 ? 73  VAL B C   1 
ATOM   2213 O  O   . VAL B 1 82  ? 26.428 -0.469  44.563 1.00 29.09 ? 73  VAL B O   1 
ATOM   2214 C  CB  . VAL B 1 82  ? 23.809 -0.827  46.613 1.00 28.88 ? 73  VAL B CB  1 
ATOM   2215 C  CG1 . VAL B 1 82  ? 25.063 -1.193  47.336 1.00 30.04 ? 73  VAL B CG1 1 
ATOM   2216 C  CG2 . VAL B 1 82  ? 22.888 0.112   47.472 1.00 27.87 ? 73  VAL B CG2 1 
ATOM   2217 N  N   . ARG B 1 83  ? 24.885 -1.897  43.770 1.00 27.86 ? 74  ARG B N   1 
ATOM   2218 C  CA  . ARG B 1 83  ? 25.801 -2.658  42.947 1.00 27.40 ? 74  ARG B CA  1 
ATOM   2219 C  C   . ARG B 1 83  ? 26.463 -1.728  41.954 1.00 25.80 ? 74  ARG B C   1 
ATOM   2220 O  O   . ARG B 1 83  ? 27.686 -1.743  41.795 1.00 26.01 ? 74  ARG B O   1 
ATOM   2221 C  CB  . ARG B 1 83  ? 25.046 -3.738  42.176 1.00 27.72 ? 74  ARG B CB  1 
ATOM   2222 C  CG  . ARG B 1 83  ? 25.897 -4.550  41.203 1.00 28.71 ? 74  ARG B CG  1 
ATOM   2223 C  CD  . ARG B 1 83  ? 24.978 -5.425  40.359 1.00 30.79 ? 74  ARG B CD  1 
ATOM   2224 N  NE  . ARG B 1 83  ? 25.679 -6.371  39.503 1.00 32.66 ? 74  ARG B NE  1 
ATOM   2225 C  CZ  . ARG B 1 83  ? 25.094 -7.396  38.884 1.00 35.59 ? 74  ARG B CZ  1 
ATOM   2226 N  NH1 . ARG B 1 83  ? 23.792 -7.627  39.019 1.00 38.93 ? 74  ARG B NH1 1 
ATOM   2227 N  NH2 . ARG B 1 83  ? 25.808 -8.208  38.133 1.00 34.90 ? 74  ARG B NH2 1 
ATOM   2228 N  N   . ASN B 1 84  ? 25.636 -0.915  41.296 1.00 25.55 ? 75  ASN B N   1 
ATOM   2229 C  CA  . ASN B 1 84  ? 26.127 -0.047  40.201 1.00 25.27 ? 75  ASN B CA  1 
ATOM   2230 C  C   . ASN B 1 84  ? 26.925 1.172   40.669 1.00 24.72 ? 75  ASN B C   1 
ATOM   2231 O  O   . ASN B 1 84  ? 27.973 1.489   40.107 1.00 24.64 ? 75  ASN B O   1 
ATOM   2232 C  CB  . ASN B 1 84  ? 24.934 0.379   39.344 1.00 25.26 ? 75  ASN B CB  1 
ATOM   2233 C  CG  . ASN B 1 84  ? 24.406 -0.748  38.455 1.00 26.38 ? 75  ASN B CG  1 
ATOM   2234 O  OD1 . ASN B 1 84  ? 25.023 -1.808  38.335 1.00 26.17 ? 75  ASN B OD1 1 
ATOM   2235 N  ND2 . ASN B 1 84  ? 23.253 -0.507  37.803 1.00 26.82 ? 75  ASN B ND2 1 
ATOM   2236 N  N   . ASN B 1 85  ? 26.417 1.875   41.689 1.00 25.11 ? 76  ASN B N   1 
ATOM   2237 C  CA  . ASN B 1 85  ? 27.027 3.101   42.181 1.00 24.90 ? 76  ASN B CA  1 
ATOM   2238 C  C   . ASN B 1 85  ? 28.063 2.854   43.259 1.00 24.34 ? 76  ASN B C   1 
ATOM   2239 O  O   . ASN B 1 85  ? 29.096 3.491   43.274 1.00 22.13 ? 76  ASN B O   1 
ATOM   2240 C  CB  . ASN B 1 85  ? 25.951 4.048   42.670 1.00 26.22 ? 76  ASN B CB  1 
ATOM   2241 C  CG  . ASN B 1 85  ? 25.048 4.502   41.536 1.00 25.17 ? 76  ASN B CG  1 
ATOM   2242 O  OD1 . ASN B 1 85  ? 25.506 5.189   40.646 1.00 28.18 ? 76  ASN B OD1 1 
ATOM   2243 N  ND2 . ASN B 1 85  ? 23.767 4.111   41.567 1.00 24.64 ? 76  ASN B ND2 1 
ATOM   2244 N  N   . GLY B 1 86  ? 27.791 1.905   44.142 1.00 24.95 ? 77  GLY B N   1 
ATOM   2245 C  CA  . GLY B 1 86  ? 28.841 1.421   45.037 1.00 25.19 ? 77  GLY B CA  1 
ATOM   2246 C  C   . GLY B 1 86  ? 30.007 0.866   44.239 1.00 24.25 ? 77  GLY B C   1 
ATOM   2247 O  O   . GLY B 1 86  ? 31.176 1.173   44.492 1.00 23.38 ? 77  GLY B O   1 
ATOM   2248 N  N   . GLY B 1 87  ? 29.693 0.043   43.256 1.00 25.14 ? 78  GLY B N   1 
ATOM   2249 C  CA  . GLY B 1 87  ? 30.706 -0.392  42.294 1.00 24.37 ? 78  GLY B CA  1 
ATOM   2250 C  C   . GLY B 1 87  ? 31.466 0.775   41.684 1.00 23.36 ? 78  GLY B C   1 
ATOM   2251 O  O   . GLY B 1 87  ? 32.670 0.785   41.657 1.00 23.54 ? 78  GLY B O   1 
ATOM   2252 N  N   . GLY B 1 88  ? 30.765 1.764   41.154 1.00 23.13 ? 79  GLY B N   1 
ATOM   2253 C  CA  . GLY B 1 88  ? 31.449 2.886   40.546 1.00 23.35 ? 79  GLY B CA  1 
ATOM   2254 C  C   . GLY B 1 88  ? 32.417 3.607   41.476 1.00 23.82 ? 79  GLY B C   1 
ATOM   2255 O  O   . GLY B 1 88  ? 33.514 3.962   41.070 1.00 22.14 ? 79  GLY B O   1 
ATOM   2256 N  N   . HIS B 1 89  ? 32.022 3.818   42.734 1.00 24.47 ? 80  HIS B N   1 
ATOM   2257 C  CA  . HIS B 1 89  ? 32.879 4.486   43.731 1.00 24.37 ? 80  HIS B CA  1 
ATOM   2258 C  C   . HIS B 1 89  ? 34.108 3.604   44.036 1.00 24.50 ? 80  HIS B C   1 
ATOM   2259 O  O   . HIS B 1 89  ? 35.251 4.091   44.110 1.00 24.34 ? 80  HIS B O   1 
ATOM   2260 C  CB  . HIS B 1 89  ? 32.041 4.747   44.991 1.00 24.39 ? 80  HIS B CB  1 
ATOM   2261 C  CG  . HIS B 1 89  ? 32.740 5.502   46.081 1.00 24.25 ? 80  HIS B CG  1 
ATOM   2262 N  ND1 . HIS B 1 89  ? 33.761 6.397   45.843 1.00 26.36 ? 80  HIS B ND1 1 
ATOM   2263 C  CD2 . HIS B 1 89  ? 32.515 5.538   47.419 1.00 24.27 ? 80  HIS B CD2 1 
ATOM   2264 C  CE1 . HIS B 1 89  ? 34.150 6.939   46.984 1.00 26.43 ? 80  HIS B CE1 1 
ATOM   2265 N  NE2 . HIS B 1 89  ? 33.416 6.431   47.961 1.00 24.35 ? 80  HIS B NE2 1 
ATOM   2266 N  N   . TYR B 1 90  ? 33.874 2.308   44.206 1.00 25.59 ? 81  TYR B N   1 
ATOM   2267 C  CA  . TYR B 1 90  ? 34.976 1.376   44.512 1.00 25.07 ? 81  TYR B CA  1 
ATOM   2268 C  C   . TYR B 1 90  ? 35.984 1.339   43.366 1.00 24.78 ? 81  TYR B C   1 
ATOM   2269 O  O   . TYR B 1 90  ? 37.209 1.499   43.569 1.00 23.64 ? 81  TYR B O   1 
ATOM   2270 C  CB  . TYR B 1 90  ? 34.467 -0.025  44.812 1.00 25.79 ? 81  TYR B CB  1 
ATOM   2271 C  CG  . TYR B 1 90  ? 35.615 -0.969  45.111 1.00 26.02 ? 81  TYR B CG  1 
ATOM   2272 C  CD1 . TYR B 1 90  ? 36.120 -1.092  46.396 1.00 26.33 ? 81  TYR B CD1 1 
ATOM   2273 C  CD2 . TYR B 1 90  ? 36.197 -1.711  44.099 1.00 24.66 ? 81  TYR B CD2 1 
ATOM   2274 C  CE1 . TYR B 1 90  ? 37.189 -1.942  46.672 1.00 27.00 ? 81  TYR B CE1 1 
ATOM   2275 C  CE2 . TYR B 1 90  ? 37.262 -2.556  44.342 1.00 29.05 ? 81  TYR B CE2 1 
ATOM   2276 C  CZ  . TYR B 1 90  ? 37.761 -2.669  45.624 1.00 28.93 ? 81  TYR B CZ  1 
ATOM   2277 O  OH  . TYR B 1 90  ? 38.822 -3.510  45.817 1.00 30.03 ? 81  TYR B OH  1 
ATOM   2278 N  N   . CYS B 1 91  ? 35.476 1.148   42.151 1.00 24.75 ? 82  CYS B N   1 
ATOM   2279 C  CA  . CYS B 1 91  ? 36.364 0.931   41.003 1.00 25.25 ? 82  CYS B CA  1 
ATOM   2280 C  C   . CYS B 1 91  ? 37.143 2.174   40.637 1.00 24.61 ? 82  CYS B C   1 
ATOM   2281 O  O   . CYS B 1 91  ? 38.340 2.085   40.338 1.00 25.41 ? 82  CYS B O   1 
ATOM   2282 C  CB  . CYS B 1 91  ? 35.603 0.415   39.768 1.00 25.05 ? 82  CYS B CB  1 
ATOM   2283 S  SG  . CYS B 1 91  ? 34.840 -1.180  39.920 1.00 25.11 ? 82  CYS B SG  1 
ATOM   2284 N  N   . HIS B 1 92  ? 36.497 3.332   40.661 1.00 23.81 ? 83  HIS B N   1 
ATOM   2285 C  CA  . HIS B 1 92  ? 37.205 4.571   40.339 1.00 23.81 ? 83  HIS B CA  1 
ATOM   2286 C  C   . HIS B 1 92  ? 38.202 4.951   41.449 1.00 24.02 ? 83  HIS B C   1 
ATOM   2287 O  O   . HIS B 1 92  ? 39.274 5.450   41.136 1.00 23.42 ? 83  HIS B O   1 
ATOM   2288 C  CB  . HIS B 1 92  ? 36.235 5.734   39.994 1.00 22.93 ? 83  HIS B CB  1 
ATOM   2289 C  CG  . HIS B 1 92  ? 35.528 5.555   38.683 1.00 21.24 ? 83  HIS B CG  1 
ATOM   2290 N  ND1 . HIS B 1 92  ? 34.305 4.927   38.581 1.00 20.68 ? 83  HIS B ND1 1 
ATOM   2291 C  CD2 . HIS B 1 92  ? 35.890 5.906   37.417 1.00 20.37 ? 83  HIS B CD2 1 
ATOM   2292 C  CE1 . HIS B 1 92  ? 33.967 4.874   37.288 1.00 18.76 ? 83  HIS B CE1 1 
ATOM   2293 N  NE2 . HIS B 1 92  ? 34.921 5.445   36.562 1.00 18.87 ? 83  HIS B NE2 1 
ATOM   2294 N  N   . SER B 1 93  ? 37.864 4.696   42.714 1.00 25.05 ? 84  SER B N   1 
ATOM   2295 C  CA  . SER B 1 93  ? 38.757 5.016   43.833 1.00 24.95 ? 84  SER B CA  1 
ATOM   2296 C  C   . SER B 1 93  ? 40.082 4.230   43.722 1.00 25.99 ? 84  SER B C   1 
ATOM   2297 O  O   . SER B 1 93  ? 41.172 4.816   43.839 1.00 24.64 ? 84  SER B O   1 
ATOM   2298 C  CB  . SER B 1 93  ? 38.065 4.751   45.185 1.00 26.18 ? 84  SER B CB  1 
ATOM   2299 O  OG  . SER B 1 93  ? 37.022 5.706   45.439 1.00 26.60 ? 84  SER B OG  1 
ATOM   2300 N  N   . LEU B 1 94  ? 39.989 2.935   43.393 1.00 26.02 ? 85  LEU B N   1 
ATOM   2301 C  CA  . LEU B 1 94  ? 41.203 2.136   43.133 1.00 25.58 ? 85  LEU B CA  1 
ATOM   2302 C  C   . LEU B 1 94  ? 41.952 2.643   41.876 1.00 25.49 ? 85  LEU B C   1 
ATOM   2303 O  O   . LEU B 1 94  ? 43.187 2.785   41.882 1.00 25.28 ? 85  LEU B O   1 
ATOM   2304 C  CB  . LEU B 1 94  ? 40.853 0.659   42.938 1.00 26.59 ? 85  LEU B CB  1 
ATOM   2305 C  CG  . LEU B 1 94  ? 41.774 -0.484  43.405 1.00 29.57 ? 85  LEU B CG  1 
ATOM   2306 C  CD1 . LEU B 1 94  ? 41.760 -1.638  42.449 1.00 27.34 ? 85  LEU B CD1 1 
ATOM   2307 C  CD2 . LEU B 1 94  ? 43.190 -0.065  43.799 1.00 28.70 ? 85  LEU B CD2 1 
ATOM   2308 N  N   . PHE B 1 95  ? 41.221 2.887   40.793 1.00 24.02 ? 86  PHE B N   1 
ATOM   2309 C  CA  . PHE B 1 95  ? 41.840 3.342   39.541 1.00 23.71 ? 86  PHE B CA  1 
ATOM   2310 C  C   . PHE B 1 95  ? 42.766 4.546   39.765 1.00 23.34 ? 86  PHE B C   1 
ATOM   2311 O  O   . PHE B 1 95  ? 43.924 4.556   39.311 1.00 24.10 ? 86  PHE B O   1 
ATOM   2312 C  CB  . PHE B 1 95  ? 40.724 3.641   38.535 1.00 22.97 ? 86  PHE B CB  1 
ATOM   2313 C  CG  . PHE B 1 95  ? 41.192 3.922   37.138 1.00 22.92 ? 86  PHE B CG  1 
ATOM   2314 C  CD1 . PHE B 1 95  ? 42.007 3.032   36.449 1.00 20.68 ? 86  PHE B CD1 1 
ATOM   2315 C  CD2 . PHE B 1 95  ? 40.752 5.059   36.481 1.00 21.27 ? 86  PHE B CD2 1 
ATOM   2316 C  CE1 . PHE B 1 95  ? 42.402 3.305   35.131 1.00 22.11 ? 86  PHE B CE1 1 
ATOM   2317 C  CE2 . PHE B 1 95  ? 41.137 5.325   35.200 1.00 23.06 ? 86  PHE B CE2 1 
ATOM   2318 C  CZ  . PHE B 1 95  ? 41.979 4.445   34.518 1.00 23.20 ? 86  PHE B CZ  1 
ATOM   2319 N  N   . TRP B 1 96  ? 42.292 5.548   40.509 1.00 23.43 ? 87  TRP B N   1 
ATOM   2320 C  CA  . TRP B 1 96  ? 43.125 6.734   40.772 1.00 25.01 ? 87  TRP B CA  1 
ATOM   2321 C  C   . TRP B 1 96  ? 44.380 6.413   41.620 1.00 25.79 ? 87  TRP B C   1 
ATOM   2322 O  O   . TRP B 1 96  ? 45.422 7.027   41.452 1.00 26.16 ? 87  TRP B O   1 
ATOM   2323 C  CB  . TRP B 1 96  ? 42.343 7.823   41.519 1.00 25.02 ? 87  TRP B CB  1 
ATOM   2324 C  CG  . TRP B 1 96  ? 40.985 8.159   40.977 1.00 23.78 ? 87  TRP B CG  1 
ATOM   2325 C  CD1 . TRP B 1 96  ? 39.854 8.367   41.707 1.00 23.75 ? 87  TRP B CD1 1 
ATOM   2326 C  CD2 . TRP B 1 96  ? 40.626 8.375   39.612 1.00 24.44 ? 87  TRP B CD2 1 
ATOM   2327 N  NE1 . TRP B 1 96  ? 38.810 8.672   40.893 1.00 22.51 ? 87  TRP B NE1 1 
ATOM   2328 C  CE2 . TRP B 1 96  ? 39.248 8.695   39.594 1.00 22.25 ? 87  TRP B CE2 1 
ATOM   2329 C  CE3 . TRP B 1 96  ? 41.323 8.320   38.401 1.00 25.17 ? 87  TRP B CE3 1 
ATOM   2330 C  CZ2 . TRP B 1 96  ? 38.544 8.912   38.405 1.00 23.93 ? 87  TRP B CZ2 1 
ATOM   2331 C  CZ3 . TRP B 1 96  ? 40.635 8.560   37.229 1.00 25.28 ? 87  TRP B CZ3 1 
ATOM   2332 C  CH2 . TRP B 1 96  ? 39.256 8.842   37.236 1.00 22.69 ? 87  TRP B CH2 1 
ATOM   2333 N  N   . GLU B 1 97  ? 44.263 5.499   42.568 1.00 27.13 ? 88  GLU B N   1 
ATOM   2334 C  CA  . GLU B 1 97  ? 45.422 5.271   43.440 1.00 29.30 ? 88  GLU B CA  1 
ATOM   2335 C  C   . GLU B 1 97  ? 46.491 4.377   42.812 1.00 28.17 ? 88  GLU B C   1 
ATOM   2336 O  O   . GLU B 1 97  ? 47.642 4.413   43.218 1.00 27.88 ? 88  GLU B O   1 
ATOM   2337 C  CB  . GLU B 1 97  ? 45.016 4.831   44.847 1.00 31.34 ? 88  GLU B CB  1 
ATOM   2338 C  CG  . GLU B 1 97  ? 44.223 3.637   44.963 1.00 36.03 ? 88  GLU B CG  1 
ATOM   2339 C  CD  . GLU B 1 97  ? 43.549 3.552   46.351 1.00 35.63 ? 88  GLU B CD  1 
ATOM   2340 O  OE1 . GLU B 1 97  ? 43.607 4.516   47.150 1.00 45.94 ? 88  GLU B OE1 1 
ATOM   2341 O  OE2 . GLU B 1 97  ? 42.928 2.534   46.606 1.00 41.08 ? 88  GLU B OE2 1 
ATOM   2342 N  N   . VAL B 1 98  ? 46.137 3.637   41.769 1.00 28.08 ? 89  VAL B N   1 
ATOM   2343 C  CA  . VAL B 1 98  ? 47.129 2.813   41.070 1.00 27.72 ? 89  VAL B CA  1 
ATOM   2344 C  C   . VAL B 1 98  ? 47.816 3.522   39.883 1.00 27.60 ? 89  VAL B C   1 
ATOM   2345 O  O   . VAL B 1 98  ? 48.606 2.875   39.170 1.00 28.65 ? 89  VAL B O   1 
ATOM   2346 C  CB  . VAL B 1 98  ? 46.571 1.402   40.678 1.00 28.08 ? 89  VAL B CB  1 
ATOM   2347 C  CG1 . VAL B 1 98  ? 46.165 0.618   41.945 1.00 30.11 ? 89  VAL B CG1 1 
ATOM   2348 C  CG2 . VAL B 1 98  ? 45.430 1.480   39.663 1.00 28.79 ? 89  VAL B CG2 1 
ATOM   2349 N  N   . MET B 1 99  ? 47.529 4.826   39.670 1.00 25.60 ? 90  MET B N   1 
ATOM   2350 C  CA  . MET B 1 99  ? 48.240 5.621   38.673 1.00 27.27 ? 90  MET B CA  1 
ATOM   2351 C  C   . MET B 1 99  ? 48.982 6.767   39.339 1.00 28.91 ? 90  MET B C   1 
ATOM   2352 O  O   . MET B 1 99  ? 48.620 7.206   40.435 1.00 29.69 ? 90  MET B O   1 
ATOM   2353 C  CB  . MET B 1 99  ? 47.289 6.178   37.604 1.00 24.78 ? 90  MET B CB  1 
ATOM   2354 C  CG  . MET B 1 99  ? 46.506 5.102   36.819 1.00 26.23 ? 90  MET B CG  1 
ATOM   2355 S  SD  . MET B 1 99  ? 45.503 5.808   35.485 1.00 26.02 ? 90  MET B SD  1 
ATOM   2356 C  CE  . MET B 1 99  ? 44.246 6.663   36.425 1.00 26.52 ? 90  MET B CE  1 
ATOM   2357 N  N   . SER B 1 100 ? 50.008 7.258   38.655 1.00 30.61 ? 91  SER B N   1 
ATOM   2358 C  CA  . SER B 1 100 ? 50.915 8.261   39.224 1.00 31.83 ? 91  SER B CA  1 
ATOM   2359 C  C   . SER B 1 100 ? 51.740 8.953   38.150 1.00 32.60 ? 91  SER B C   1 
ATOM   2360 O  O   . SER B 1 100 ? 52.188 8.299   37.181 1.00 30.93 ? 91  SER B O   1 
ATOM   2361 C  CB  . SER B 1 100 ? 51.898 7.598   40.199 1.00 32.76 ? 91  SER B CB  1 
ATOM   2362 O  OG  . SER B 1 100 ? 52.731 8.563   40.852 1.00 34.99 ? 91  SER B OG  1 
ATOM   2363 N  N   . PRO B 1 101 ? 52.008 10.259  38.342 1.00 33.48 ? 92  PRO B N   1 
ATOM   2364 C  CA  . PRO B 1 101 ? 53.034 10.905  37.516 1.00 33.87 ? 92  PRO B CA  1 
ATOM   2365 C  C   . PRO B 1 101 ? 54.427 10.248  37.582 1.00 33.53 ? 92  PRO B C   1 
ATOM   2366 O  O   . PRO B 1 101 ? 55.215 10.423  36.646 1.00 32.34 ? 92  PRO B O   1 
ATOM   2367 C  CB  . PRO B 1 101 ? 53.093 12.334  38.053 1.00 34.04 ? 92  PRO B CB  1 
ATOM   2368 C  CG  . PRO B 1 101 ? 52.228 12.403  39.247 1.00 33.67 ? 92  PRO B CG  1 
ATOM   2369 C  CD  . PRO B 1 101 ? 51.380 11.191  39.305 1.00 35.24 ? 92  PRO B CD  1 
ATOM   2370 N  N   . ARG B 1 102 ? 54.724 9.524   38.666 1.00 33.81 ? 93  ARG B N   1 
ATOM   2371 C  CA  . ARG B 1 102 ? 55.992 8.770   38.792 1.00 36.49 ? 93  ARG B CA  1 
ATOM   2372 C  C   . ARG B 1 102 ? 55.911 7.301   38.356 1.00 37.28 ? 93  ARG B C   1 
ATOM   2373 O  O   . ARG B 1 102 ? 56.881 6.547   38.490 1.00 37.82 ? 93  ARG B O   1 
ATOM   2374 C  CB  . ARG B 1 102 ? 56.511 8.831   40.238 1.00 38.13 ? 93  ARG B CB  1 
ATOM   2375 C  CG  . ARG B 1 102 ? 56.610 10.215  40.763 1.00 39.17 ? 93  ARG B CG  1 
ATOM   2376 C  CD  . ARG B 1 102 ? 57.077 10.267  42.241 1.00 41.05 ? 93  ARG B CD  1 
ATOM   2377 N  NE  . ARG B 1 102 ? 56.092 9.698   43.154 1.00 47.03 ? 93  ARG B NE  1 
ATOM   2378 C  CZ  . ARG B 1 102 ? 54.894 10.227  43.421 1.00 49.12 ? 93  ARG B CZ  1 
ATOM   2379 N  NH1 . ARG B 1 102 ? 54.504 11.374  42.866 1.00 51.04 ? 93  ARG B NH1 1 
ATOM   2380 N  NH2 . ARG B 1 102 ? 54.071 9.596   44.251 1.00 49.72 ? 93  ARG B NH2 1 
ATOM   2381 N  N   . GLY B 1 103 ? 54.787 6.889   37.783 1.00 36.51 ? 94  GLY B N   1 
ATOM   2382 C  CA  . GLY B 1 103 ? 54.549 5.479   37.568 1.00 36.00 ? 94  GLY B CA  1 
ATOM   2383 C  C   . GLY B 1 103 ? 55.264 4.895   36.373 1.00 35.08 ? 94  GLY B C   1 
ATOM   2384 O  O   . GLY B 1 103 ? 56.124 5.539   35.759 1.00 34.42 ? 94  GLY B O   1 
ATOM   2385 N  N   . GLY B 1 104 ? 54.900 3.664   36.040 1.00 35.52 ? 95  GLY B N   1 
ATOM   2386 C  CA  . GLY B 1 104 ? 55.311 3.063   34.781 1.00 36.69 ? 95  GLY B CA  1 
ATOM   2387 C  C   . GLY B 1 104 ? 56.471 2.109   34.918 1.00 37.81 ? 95  GLY B C   1 
ATOM   2388 O  O   . GLY B 1 104 ? 56.954 1.852   36.023 1.00 37.40 ? 95  GLY B O   1 
ATOM   2389 N  N   . GLY B 1 105 ? 56.907 1.563   33.789 1.00 38.50 ? 96  GLY B N   1 
ATOM   2390 C  CA  . GLY B 1 105 ? 58.043 0.633   33.802 1.00 39.19 ? 96  GLY B CA  1 
ATOM   2391 C  C   . GLY B 1 105 ? 57.728 -0.736  34.382 1.00 39.13 ? 96  GLY B C   1 
ATOM   2392 O  O   . GLY B 1 105 ? 56.577 -1.164  34.425 1.00 37.57 ? 96  GLY B O   1 
ATOM   2393 N  N   . GLU B 1 106 ? 58.784 -1.421  34.812 1.00 40.16 ? 97  GLU B N   1 
ATOM   2394 C  CA  . GLU B 1 106 ? 58.712 -2.782  35.355 1.00 40.61 ? 97  GLU B CA  1 
ATOM   2395 C  C   . GLU B 1 106 ? 58.333 -2.733  36.834 1.00 39.86 ? 97  GLU B C   1 
ATOM   2396 O  O   . GLU B 1 106 ? 58.673 -1.782  37.511 1.00 40.21 ? 97  GLU B O   1 
ATOM   2397 C  CB  . GLU B 1 106 ? 60.081 -3.476  35.221 1.00 40.54 ? 97  GLU B CB  1 
ATOM   2398 C  CG  . GLU B 1 106 ? 60.713 -3.405  33.845 1.00 46.36 ? 97  GLU B CG  1 
ATOM   2399 C  CD  . GLU B 1 106 ? 60.145 -4.426  32.857 1.00 50.95 ? 97  GLU B CD  1 
ATOM   2400 O  OE1 . GLU B 1 106 ? 60.356 -5.644  33.063 1.00 55.23 ? 97  GLU B OE1 1 
ATOM   2401 O  OE2 . GLU B 1 106 ? 59.506 -4.012  31.859 1.00 54.45 ? 97  GLU B OE2 1 
ATOM   2402 N  N   . PRO B 1 107 ? 57.645 -3.765  37.352 1.00 40.52 ? 98  PRO B N   1 
ATOM   2403 C  CA  . PRO B 1 107 ? 57.295 -3.721  38.778 1.00 41.94 ? 98  PRO B CA  1 
ATOM   2404 C  C   . PRO B 1 107 ? 58.516 -3.765  39.691 1.00 42.87 ? 98  PRO B C   1 
ATOM   2405 O  O   . PRO B 1 107 ? 59.573 -4.220  39.264 1.00 42.31 ? 98  PRO B O   1 
ATOM   2406 C  CB  . PRO B 1 107 ? 56.438 -4.980  38.988 1.00 41.57 ? 98  PRO B CB  1 
ATOM   2407 C  CG  . PRO B 1 107 ? 56.164 -5.532  37.666 1.00 41.57 ? 98  PRO B CG  1 
ATOM   2408 C  CD  . PRO B 1 107 ? 57.156 -4.990  36.701 1.00 40.69 ? 98  PRO B CD  1 
ATOM   2409 N  N   . ASN B 1 108 ? 58.349 -3.298  40.925 1.00 44.68 ? 99  ASN B N   1 
ATOM   2410 C  CA  . ASN B 1 108 ? 59.392 -3.364  41.969 1.00 45.93 ? 99  ASN B CA  1 
ATOM   2411 C  C   . ASN B 1 108 ? 58.871 -4.080  43.208 1.00 46.51 ? 99  ASN B C   1 
ATOM   2412 O  O   . ASN B 1 108 ? 57.778 -4.645  43.182 1.00 46.30 ? 99  ASN B O   1 
ATOM   2413 C  CB  . ASN B 1 108 ? 59.917 -1.955  42.314 1.00 47.61 ? 99  ASN B CB  1 
ATOM   2414 C  CG  . ASN B 1 108 ? 58.829 -0.997  42.801 1.00 52.80 ? 99  ASN B CG  1 
ATOM   2415 O  OD1 . ASN B 1 108 ? 58.101 -1.269  43.765 1.00 57.53 ? 99  ASN B OD1 1 
ATOM   2416 N  ND2 . ASN B 1 108 ? 58.751 0.165   42.153 1.00 56.51 ? 99  ASN B ND2 1 
ATOM   2417 N  N   . GLY B 1 109 ? 59.665 -4.075  44.283 1.00 47.04 ? 100 GLY B N   1 
ATOM   2418 C  CA  . GLY B 1 109 ? 59.234 -4.585  45.591 1.00 46.21 ? 100 GLY B CA  1 
ATOM   2419 C  C   . GLY B 1 109 ? 58.877 -6.061  45.583 1.00 45.79 ? 100 GLY B C   1 
ATOM   2420 O  O   . GLY B 1 109 ? 59.264 -6.809  44.694 1.00 45.09 ? 100 GLY B O   1 
ATOM   2421 N  N   . ASP B 1 110 ? 58.097 -6.464  46.573 1.00 45.87 ? 101 ASP B N   1 
ATOM   2422 C  CA  . ASP B 1 110 ? 57.758 -7.872  46.778 1.00 45.93 ? 101 ASP B CA  1 
ATOM   2423 C  C   . ASP B 1 110 ? 56.815 -8.438  45.716 1.00 45.53 ? 101 ASP B C   1 
ATOM   2424 O  O   . ASP B 1 110 ? 56.887 -9.618  45.373 1.00 45.62 ? 101 ASP B O   1 
ATOM   2425 C  CB  . ASP B 1 110 ? 57.168 -8.058  48.178 1.00 46.81 ? 101 ASP B CB  1 
ATOM   2426 C  CG  . ASP B 1 110 ? 58.205 -7.859  49.278 1.00 51.80 ? 101 ASP B CG  1 
ATOM   2427 O  OD1 . ASP B 1 110 ? 57.830 -7.418  50.392 1.00 55.77 ? 101 ASP B OD1 1 
ATOM   2428 O  OD2 . ASP B 1 110 ? 59.401 -8.138  49.018 1.00 55.70 ? 101 ASP B OD2 1 
ATOM   2429 N  N   . VAL B 1 111 ? 55.955 -7.581  45.173 1.00 44.59 ? 102 VAL B N   1 
ATOM   2430 C  CA  . VAL B 1 111 ? 54.935 -8.008  44.236 1.00 43.76 ? 102 VAL B CA  1 
ATOM   2431 C  C   . VAL B 1 111 ? 55.557 -8.492  42.911 1.00 42.87 ? 102 VAL B C   1 
ATOM   2432 O  O   . VAL B 1 111 ? 54.986 -9.365  42.237 1.00 42.30 ? 102 VAL B O   1 
ATOM   2433 C  CB  . VAL B 1 111 ? 53.871 -6.878  44.012 1.00 43.22 ? 102 VAL B CB  1 
ATOM   2434 C  CG1 . VAL B 1 111 ? 54.329 -5.880  42.964 1.00 42.78 ? 102 VAL B CG1 1 
ATOM   2435 C  CG2 . VAL B 1 111 ? 52.528 -7.481  43.645 1.00 44.15 ? 102 VAL B CG2 1 
ATOM   2436 N  N   . ALA B 1 112 ? 56.721 -7.935  42.559 1.00 42.11 ? 103 ALA B N   1 
ATOM   2437 C  CA  . ALA B 1 112 ? 57.440 -8.295  41.325 1.00 41.73 ? 103 ALA B CA  1 
ATOM   2438 C  C   . ALA B 1 112 ? 57.863 -9.758  41.352 1.00 40.66 ? 103 ALA B C   1 
ATOM   2439 O  O   . ALA B 1 112 ? 57.876 -10.441 40.336 1.00 38.41 ? 103 ALA B O   1 
ATOM   2440 C  CB  . ALA B 1 112 ? 58.654 -7.413  41.154 1.00 41.93 ? 103 ALA B CB  1 
ATOM   2441 N  N   . LYS B 1 113 ? 58.168 -10.241 42.547 1.00 41.20 ? 104 LYS B N   1 
ATOM   2442 C  CA  . LYS B 1 113 ? 58.600 -11.615 42.738 1.00 40.82 ? 104 LYS B CA  1 
ATOM   2443 C  C   . LYS B 1 113 ? 57.397 -12.531 42.622 1.00 40.18 ? 104 LYS B C   1 
ATOM   2444 O  O   . LYS B 1 113 ? 57.484 -13.596 42.007 1.00 39.79 ? 104 LYS B O   1 
ATOM   2445 C  CB  . LYS B 1 113 ? 59.275 -11.785 44.105 1.00 42.57 ? 104 LYS B CB  1 
ATOM   2446 C  CG  . LYS B 1 113 ? 60.593 -11.025 44.261 1.00 45.81 ? 104 LYS B CG  1 
ATOM   2447 C  CD  . LYS B 1 113 ? 60.449 -9.529  43.932 1.00 48.98 ? 104 LYS B CD  1 
ATOM   2448 C  CE  . LYS B 1 113 ? 61.554 -8.668  44.507 1.00 48.64 ? 104 LYS B CE  1 
ATOM   2449 N  NZ  . LYS B 1 113 ? 61.744 -7.405  43.706 1.00 48.51 ? 104 LYS B NZ  1 
ATOM   2450 N  N   . VAL B 1 114 ? 56.260 -12.089 43.160 1.00 38.31 ? 105 VAL B N   1 
ATOM   2451 C  CA  . VAL B 1 114 ? 55.040 -12.876 43.077 1.00 37.89 ? 105 VAL B CA  1 
ATOM   2452 C  C   . VAL B 1 114 ? 54.515 -12.895 41.644 1.00 35.47 ? 105 VAL B C   1 
ATOM   2453 O  O   . VAL B 1 114 ? 53.997 -13.924 41.201 1.00 34.84 ? 105 VAL B O   1 
ATOM   2454 C  CB  . VAL B 1 114 ? 53.943 -12.376 44.022 1.00 38.61 ? 105 VAL B CB  1 
ATOM   2455 C  CG1 . VAL B 1 114 ? 52.816 -13.404 44.093 1.00 40.17 ? 105 VAL B CG1 1 
ATOM   2456 C  CG2 . VAL B 1 114 ? 54.514 -12.139 45.418 1.00 40.10 ? 105 VAL B CG2 1 
ATOM   2457 N  N   . ILE B 1 115 ? 54.665 -11.782 40.926 1.00 35.51 ? 106 ILE B N   1 
ATOM   2458 C  CA  . ILE B 1 115 ? 54.324 -11.736 39.484 1.00 35.76 ? 106 ILE B CA  1 
ATOM   2459 C  C   . ILE B 1 115 ? 55.158 -12.768 38.689 1.00 35.19 ? 106 ILE B C   1 
ATOM   2460 O  O   . ILE B 1 115 ? 54.609 -13.562 37.937 1.00 34.65 ? 106 ILE B O   1 
ATOM   2461 C  CB  . ILE B 1 115 ? 54.459 -10.302 38.908 1.00 35.02 ? 106 ILE B CB  1 
ATOM   2462 C  CG1 . ILE B 1 115 ? 53.312 -9.428  39.437 1.00 33.62 ? 106 ILE B CG1 1 
ATOM   2463 C  CG2 . ILE B 1 115 ? 54.464 -10.303 37.373 1.00 35.95 ? 106 ILE B CG2 1 
ATOM   2464 C  CD1 . ILE B 1 115 ? 53.495 -7.936  39.174 1.00 35.87 ? 106 ILE B CD1 1 
ATOM   2465 N  N   . ASP B 1 116 ? 56.472 -12.782 38.895 1.00 36.21 ? 107 ASP B N   1 
ATOM   2466 C  CA  . ASP B 1 116 ? 57.351 -13.780 38.235 1.00 37.33 ? 107 ASP B CA  1 
ATOM   2467 C  C   . ASP B 1 116 ? 56.966 -15.189 38.599 1.00 35.92 ? 107 ASP B C   1 
ATOM   2468 O  O   . ASP B 1 116 ? 56.922 -16.079 37.744 1.00 37.29 ? 107 ASP B O   1 
ATOM   2469 C  CB  . ASP B 1 116 ? 58.825 -13.522 38.555 1.00 38.06 ? 107 ASP B CB  1 
ATOM   2470 C  CG  . ASP B 1 116 ? 59.379 -12.343 37.778 1.00 45.78 ? 107 ASP B CG  1 
ATOM   2471 O  OD1 . ASP B 1 116 ? 58.740 -11.936 36.778 1.00 48.38 ? 107 ASP B OD1 1 
ATOM   2472 O  OD2 . ASP B 1 116 ? 60.432 -11.790 38.170 1.00 50.77 ? 107 ASP B OD2 1 
ATOM   2473 N  N   . TYR B 1 117 ? 56.612 -15.402 39.853 1.00 35.61 ? 108 TYR B N   1 
ATOM   2474 C  CA  . TYR B 1 117 ? 56.204 -16.722 40.274 1.00 35.22 ? 108 TYR B CA  1 
ATOM   2475 C  C   . TYR B 1 117 ? 54.980 -17.222 39.520 1.00 35.26 ? 108 TYR B C   1 
ATOM   2476 O  O   . TYR B 1 117 ? 54.938 -18.366 39.101 1.00 34.28 ? 108 TYR B O   1 
ATOM   2477 C  CB  . TYR B 1 117 ? 55.947 -16.753 41.783 1.00 36.57 ? 108 TYR B CB  1 
ATOM   2478 C  CG  . TYR B 1 117 ? 55.660 -18.127 42.326 1.00 35.94 ? 108 TYR B CG  1 
ATOM   2479 C  CD1 . TYR B 1 117 ? 56.699 -18.979 42.733 1.00 36.07 ? 108 TYR B CD1 1 
ATOM   2480 C  CD2 . TYR B 1 117 ? 54.351 -18.584 42.441 1.00 38.12 ? 108 TYR B CD2 1 
ATOM   2481 C  CE1 . TYR B 1 117 ? 56.424 -20.255 43.235 1.00 37.10 ? 108 TYR B CE1 1 
ATOM   2482 C  CE2 . TYR B 1 117 ? 54.067 -19.847 42.929 1.00 38.78 ? 108 TYR B CE2 1 
ATOM   2483 C  CZ  . TYR B 1 117 ? 55.112 -20.682 43.327 1.00 39.29 ? 108 TYR B CZ  1 
ATOM   2484 O  OH  . TYR B 1 117 ? 54.798 -21.933 43.824 1.00 39.38 ? 108 TYR B OH  1 
ATOM   2485 N  N   . TYR B 1 118 ? 53.953 -16.392 39.367 1.00 35.38 ? 109 TYR B N   1 
ATOM   2486 C  CA  . TYR B 1 118 ? 52.735 -16.863 38.706 1.00 36.06 ? 109 TYR B CA  1 
ATOM   2487 C  C   . TYR B 1 118 ? 52.689 -16.629 37.187 1.00 35.58 ? 109 TYR B C   1 
ATOM   2488 O  O   . TYR B 1 118 ? 51.900 -17.259 36.502 1.00 34.35 ? 109 TYR B O   1 
ATOM   2489 C  CB  . TYR B 1 118 ? 51.492 -16.274 39.383 1.00 37.70 ? 109 TYR B CB  1 
ATOM   2490 C  CG  . TYR B 1 118 ? 51.227 -16.863 40.756 1.00 37.06 ? 109 TYR B CG  1 
ATOM   2491 C  CD1 . TYR B 1 118 ? 51.591 -16.183 41.917 1.00 34.83 ? 109 TYR B CD1 1 
ATOM   2492 C  CD2 . TYR B 1 118 ? 50.623 -18.104 40.886 1.00 38.51 ? 109 TYR B CD2 1 
ATOM   2493 C  CE1 . TYR B 1 118 ? 51.364 -16.749 43.192 1.00 38.11 ? 109 TYR B CE1 1 
ATOM   2494 C  CE2 . TYR B 1 118 ? 50.390 -18.667 42.129 1.00 38.46 ? 109 TYR B CE2 1 
ATOM   2495 C  CZ  . TYR B 1 118 ? 50.764 -17.984 43.278 1.00 38.38 ? 109 TYR B CZ  1 
ATOM   2496 O  OH  . TYR B 1 118 ? 50.493 -18.559 44.502 1.00 40.67 ? 109 TYR B OH  1 
ATOM   2497 N  N   . PHE B 1 119 ? 53.504 -15.737 36.652 1.00 36.05 ? 110 PHE B N   1 
ATOM   2498 C  CA  . PHE B 1 119 ? 53.398 -15.454 35.200 1.00 37.46 ? 110 PHE B CA  1 
ATOM   2499 C  C   . PHE B 1 119 ? 54.658 -15.755 34.414 1.00 39.14 ? 110 PHE B C   1 
ATOM   2500 O  O   . PHE B 1 119 ? 54.691 -15.557 33.195 1.00 39.06 ? 110 PHE B O   1 
ATOM   2501 C  CB  . PHE B 1 119 ? 52.927 -14.017 34.983 1.00 35.74 ? 110 PHE B CB  1 
ATOM   2502 C  CG  . PHE B 1 119 ? 51.509 -13.804 35.429 1.00 33.98 ? 110 PHE B CG  1 
ATOM   2503 C  CD1 . PHE B 1 119 ? 51.228 -13.410 36.717 1.00 33.41 ? 110 PHE B CD1 1 
ATOM   2504 C  CD2 . PHE B 1 119 ? 50.451 -14.064 34.567 1.00 36.17 ? 110 PHE B CD2 1 
ATOM   2505 C  CE1 . PHE B 1 119 ? 49.911 -13.243 37.122 1.00 34.83 ? 110 PHE B CE1 1 
ATOM   2506 C  CE2 . PHE B 1 119 ? 49.145 -13.890 34.965 1.00 35.80 ? 110 PHE B CE2 1 
ATOM   2507 C  CZ  . PHE B 1 119 ? 48.873 -13.474 36.253 1.00 35.90 ? 110 PHE B CZ  1 
ATOM   2508 N  N   . ASN B 1 120 ? 55.686 -16.241 35.117 1.00 39.89 ? 111 ASN B N   1 
ATOM   2509 C  CA  . ASN B 1 120 ? 57.033 -16.461 34.564 1.00 39.90 ? 111 ASN B CA  1 
ATOM   2510 C  C   . ASN B 1 120 ? 57.828 -15.150 34.427 1.00 40.54 ? 111 ASN B C   1 
ATOM   2511 O  O   . ASN B 1 120 ? 58.941 -15.041 34.954 1.00 40.62 ? 111 ASN B O   1 
ATOM   2512 C  CB  . ASN B 1 120 ? 56.988 -17.270 33.243 1.00 39.85 ? 111 ASN B CB  1 
ATOM   2513 C  CG  . ASN B 1 120 ? 56.155 -18.558 33.336 1.00 40.54 ? 111 ASN B CG  1 
ATOM   2514 O  OD1 . ASN B 1 120 ? 55.611 -19.023 32.332 1.00 46.20 ? 111 ASN B OD1 1 
ATOM   2515 N  ND2 . ASN B 1 120 ? 56.074 -19.152 34.519 1.00 43.48 ? 111 ASN B ND2 1 
ATOM   2516 N  N   . THR B 1 121 ? 57.260 -14.142 33.741 1.00 40.97 ? 112 THR B N   1 
ATOM   2517 C  CA  . THR B 1 121 ? 57.850 -12.790 33.669 1.00 40.08 ? 112 THR B CA  1 
ATOM   2518 C  C   . THR B 1 121 ? 56.771 -11.705 33.736 1.00 38.93 ? 112 THR B C   1 
ATOM   2519 O  O   . THR B 1 121 ? 55.587 -11.981 33.511 1.00 37.09 ? 112 THR B O   1 
ATOM   2520 C  CB  . THR B 1 121 ? 58.532 -12.512 32.331 1.00 40.76 ? 112 THR B CB  1 
ATOM   2521 O  OG1 . THR B 1 121 ? 57.550 -12.608 31.292 1.00 39.74 ? 112 THR B OG1 1 
ATOM   2522 C  CG2 . THR B 1 121 ? 59.661 -13.486 32.075 1.00 40.51 ? 112 THR B CG2 1 
ATOM   2523 N  N   . PHE B 1 122 ? 57.208 -10.477 33.989 1.00 39.36 ? 113 PHE B N   1 
ATOM   2524 C  CA  . PHE B 1 122 ? 56.306 -9.325  33.960 1.00 40.02 ? 113 PHE B CA  1 
ATOM   2525 C  C   . PHE B 1 122 ? 55.764 -9.073  32.544 1.00 39.89 ? 113 PHE B C   1 
ATOM   2526 O  O   . PHE B 1 122 ? 54.582 -8.775  32.375 1.00 40.03 ? 113 PHE B O   1 
ATOM   2527 C  CB  . PHE B 1 122 ? 56.947 -8.039  34.480 1.00 40.37 ? 113 PHE B CB  1 
ATOM   2528 C  CG  . PHE B 1 122 ? 56.153 -6.816  34.107 1.00 40.03 ? 113 PHE B CG  1 
ATOM   2529 C  CD1 . PHE B 1 122 ? 54.861 -6.650  34.597 1.00 38.24 ? 113 PHE B CD1 1 
ATOM   2530 C  CD2 . PHE B 1 122 ? 56.646 -5.895  33.213 1.00 40.46 ? 113 PHE B CD2 1 
ATOM   2531 C  CE1 . PHE B 1 122 ? 54.094 -5.568  34.225 1.00 38.43 ? 113 PHE B CE1 1 
ATOM   2532 C  CE2 . PHE B 1 122 ? 55.877 -4.807  32.828 1.00 41.48 ? 113 PHE B CE2 1 
ATOM   2533 C  CZ  . PHE B 1 122 ? 54.609 -4.639  33.341 1.00 39.36 ? 113 PHE B CZ  1 
ATOM   2534 N  N   . ASP B 1 123 ? 56.599 -9.185  31.524 1.00 39.54 ? 114 ASP B N   1 
ATOM   2535 C  CA  . ASP B 1 123 ? 56.069 -9.001  30.163 1.00 39.44 ? 114 ASP B CA  1 
ATOM   2536 C  C   . ASP B 1 123 ? 54.869 -9.928  29.880 1.00 38.38 ? 114 ASP B C   1 
ATOM   2537 O  O   . ASP B 1 123 ? 53.881 -9.517  29.225 1.00 37.78 ? 114 ASP B O   1 
ATOM   2538 C  CB  . ASP B 1 123 ? 57.178 -9.120  29.102 1.00 41.17 ? 114 ASP B CB  1 
ATOM   2539 C  CG  . ASP B 1 123 ? 57.873 -7.792  28.831 1.00 47.33 ? 114 ASP B CG  1 
ATOM   2540 O  OD1 . ASP B 1 123 ? 57.175 -6.749  28.670 1.00 53.49 ? 114 ASP B OD1 1 
ATOM   2541 O  OD2 . ASP B 1 123 ? 59.118 -7.783  28.752 1.00 53.30 ? 114 ASP B OD2 1 
ATOM   2542 N  N   . ASN B 1 124 ? 54.905 -11.151 30.416 1.00 37.56 ? 115 ASN B N   1 
ATOM   2543 C  CA  . ASN B 1 124 ? 53.785 -12.077 30.293 1.00 35.90 ? 115 ASN B CA  1 
ATOM   2544 C  C   . ASN B 1 124 ? 52.521 -11.690 31.095 1.00 34.35 ? 115 ASN B C   1 
ATOM   2545 O  O   . ASN B 1 124 ? 51.394 -11.874 30.605 1.00 32.50 ? 115 ASN B O   1 
ATOM   2546 C  CB  . ASN B 1 124 ? 54.198 -13.485 30.698 1.00 38.15 ? 115 ASN B CB  1 
ATOM   2547 C  CG  . ASN B 1 124 ? 53.129 -14.492 30.392 1.00 39.60 ? 115 ASN B CG  1 
ATOM   2548 O  OD1 . ASN B 1 124 ? 52.760 -15.324 31.230 1.00 48.06 ? 115 ASN B OD1 1 
ATOM   2549 N  ND2 . ASN B 1 124 ? 52.580 -14.400 29.195 1.00 41.31 ? 115 ASN B ND2 1 
ATOM   2550 N  N   . LEU B 1 125 ? 52.693 -11.194 32.329 1.00 33.14 ? 116 LEU B N   1 
ATOM   2551 C  CA  . LEU B 1 125 ? 51.575 -10.576 33.040 1.00 33.17 ? 116 LEU B CA  1 
ATOM   2552 C  C   . LEU B 1 125 ? 50.957 -9.477  32.166 1.00 31.54 ? 116 LEU B C   1 
ATOM   2553 O  O   . LEU B 1 125 ? 49.751 -9.442  31.974 1.00 32.12 ? 116 LEU B O   1 
ATOM   2554 C  CB  . LEU B 1 125 ? 52.001 -9.924  34.360 1.00 34.44 ? 116 LEU B CB  1 
ATOM   2555 C  CG  . LEU B 1 125 ? 50.873 -9.094  35.039 1.00 34.10 ? 116 LEU B CG  1 
ATOM   2556 C  CD1 . LEU B 1 125 ? 49.679 -9.979  35.353 1.00 34.09 ? 116 LEU B CD1 1 
ATOM   2557 C  CD2 . LEU B 1 125 ? 51.325 -8.335  36.286 1.00 35.18 ? 116 LEU B CD2 1 
ATOM   2558 N  N   . LYS B 1 126 ? 51.803 -8.592  31.651 1.00 30.77 ? 117 LYS B N   1 
ATOM   2559 C  CA  . LYS B 1 126 ? 51.336 -7.434  30.874 1.00 31.06 ? 117 LYS B CA  1 
ATOM   2560 C  C   . LYS B 1 126 ? 50.489 -7.864  29.675 1.00 30.04 ? 117 LYS B C   1 
ATOM   2561 O  O   . LYS B 1 126 ? 49.435 -7.299  29.436 1.00 28.78 ? 117 LYS B O   1 
ATOM   2562 C  CB  . LYS B 1 126 ? 52.531 -6.567  30.460 1.00 30.51 ? 117 LYS B CB  1 
ATOM   2563 C  CG  . LYS B 1 126 ? 52.202 -5.358  29.671 1.00 31.80 ? 117 LYS B CG  1 
ATOM   2564 C  CD  . LYS B 1 126 ? 53.381 -4.398  29.546 1.00 32.39 ? 117 LYS B CD  1 
ATOM   2565 C  CE  . LYS B 1 126 ? 53.094 -3.378  28.428 1.00 33.86 ? 117 LYS B CE  1 
ATOM   2566 N  NZ  . LYS B 1 126 ? 54.191 -2.409  28.236 1.00 31.95 ? 117 LYS B NZ  1 
ATOM   2567 N  N   . ASP B 1 127 ? 50.948 -8.862  28.926 1.00 30.64 ? 118 ASP B N   1 
ATOM   2568 C  CA  . ASP B 1 127 ? 50.175 -9.431  27.817 1.00 30.81 ? 118 ASP B CA  1 
ATOM   2569 C  C   . ASP B 1 127 ? 48.827 -9.969  28.257 1.00 29.30 ? 118 ASP B C   1 
ATOM   2570 O  O   . ASP B 1 127 ? 47.807 -9.786  27.581 1.00 28.12 ? 118 ASP B O   1 
ATOM   2571 C  CB  . ASP B 1 127 ? 50.959 -10.568 27.114 1.00 32.43 ? 118 ASP B CB  1 
ATOM   2572 C  CG  . ASP B 1 127 ? 50.118 -11.307 26.048 1.00 37.36 ? 118 ASP B CG  1 
ATOM   2573 O  OD1 . ASP B 1 127 ? 49.694 -10.649 25.064 1.00 47.57 ? 118 ASP B OD1 1 
ATOM   2574 O  OD2 . ASP B 1 127 ? 49.853 -12.542 26.177 1.00 48.03 ? 118 ASP B OD2 1 
ATOM   2575 N  N   . GLN B 1 128 ? 48.824 -10.683 29.375 1.00 28.75 ? 119 GLN B N   1 
ATOM   2576 C  CA  . GLN B 1 128 ? 47.602 -11.352 29.815 1.00 30.05 ? 119 GLN B CA  1 
ATOM   2577 C  C   . GLN B 1 128 ? 46.556 -10.346 30.284 1.00 27.73 ? 119 GLN B C   1 
ATOM   2578 O  O   . GLN B 1 128 ? 45.364 -10.457 29.947 1.00 26.23 ? 119 GLN B O   1 
ATOM   2579 C  CB  . GLN B 1 128 ? 47.892 -12.377 30.927 1.00 30.99 ? 119 GLN B CB  1 
ATOM   2580 C  CG  . GLN B 1 128 ? 48.197 -13.773 30.386 1.00 35.10 ? 119 GLN B CG  1 
ATOM   2581 C  CD  . GLN B 1 128 ? 48.212 -14.837 31.497 1.00 36.34 ? 119 GLN B CD  1 
ATOM   2582 O  OE1 . GLN B 1 128 ? 49.188 -15.577 31.629 1.00 48.31 ? 119 GLN B OE1 1 
ATOM   2583 N  NE2 . GLN B 1 128 ? 47.125 -14.901 32.308 1.00 42.09 ? 119 GLN B NE2 1 
ATOM   2584 N  N   . LEU B 1 129 ? 46.991 -9.386  31.086 1.00 27.08 ? 120 LEU B N   1 
ATOM   2585 C  CA  . LEU B 1 129 ? 46.054 -8.371  31.564 1.00 26.76 ? 120 LEU B CA  1 
ATOM   2586 C  C   . LEU B 1 129 ? 45.589 -7.468  30.411 1.00 24.30 ? 120 LEU B C   1 
ATOM   2587 O  O   . LEU B 1 129 ? 44.426 -7.110  30.349 1.00 23.18 ? 120 LEU B O   1 
ATOM   2588 C  CB  . LEU B 1 129 ? 46.653 -7.542  32.699 1.00 26.17 ? 120 LEU B CB  1 
ATOM   2589 C  CG  . LEU B 1 129 ? 45.772 -6.440  33.303 1.00 27.12 ? 120 LEU B CG  1 
ATOM   2590 C  CD1 . LEU B 1 129 ? 44.375 -6.926  33.655 1.00 26.72 ? 120 LEU B CD1 1 
ATOM   2591 C  CD2 . LEU B 1 129 ? 46.462 -5.856  34.551 1.00 29.68 ? 120 LEU B CD2 1 
ATOM   2592 N  N   . SER B 1 130 ? 46.488 -7.125  29.500 1.00 25.51 ? 121 SER B N   1 
ATOM   2593 C  CA  . SER B 1 130 ? 46.116 -6.274  28.363 1.00 25.30 ? 121 SER B CA  1 
ATOM   2594 C  C   . SER B 1 130 ? 45.038 -6.952  27.534 1.00 27.17 ? 121 SER B C   1 
ATOM   2595 O  O   . SER B 1 130 ? 44.045 -6.309  27.167 1.00 26.61 ? 121 SER B O   1 
ATOM   2596 C  CB  . SER B 1 130 ? 47.310 -5.948  27.465 1.00 24.18 ? 121 SER B CB  1 
ATOM   2597 O  OG  . SER B 1 130 ? 48.277 -5.139  28.118 1.00 22.40 ? 121 SER B OG  1 
ATOM   2598 N  N   . LYS B 1 131 ? 45.247 -8.240  27.237 1.00 27.92 ? 122 LYS B N   1 
ATOM   2599 C  CA  . LYS B 1 131 ? 44.271 -9.060  26.509 1.00 27.82 ? 122 LYS B CA  1 
ATOM   2600 C  C   . LYS B 1 131 ? 42.889 -9.088  27.188 1.00 27.21 ? 122 LYS B C   1 
ATOM   2601 O  O   . LYS B 1 131 ? 41.859 -8.934  26.501 1.00 26.97 ? 122 LYS B O   1 
ATOM   2602 C  CB  . LYS B 1 131 ? 44.806 -10.505 26.269 1.00 29.54 ? 122 LYS B CB  1 
ATOM   2603 C  CG  . LYS B 1 131 ? 45.931 -10.591 25.255 1.00 34.43 ? 122 LYS B CG  1 
ATOM   2604 C  CD  . LYS B 1 131 ? 46.089 -11.996 24.612 1.00 32.65 ? 122 LYS B CD  1 
ATOM   2605 C  CE  . LYS B 1 131 ? 47.161 -12.008 23.495 1.00 36.74 ? 122 LYS B CE  1 
ATOM   2606 N  NZ  . LYS B 1 131 ? 46.966 -13.094 22.441 1.00 42.43 ? 122 LYS B NZ  1 
ATOM   2607 N  N   . ALA B 1 132 ? 42.879 -9.278  28.517 1.00 26.73 ? 123 ALA B N   1 
ATOM   2608 C  CA  . ALA B 1 132 ? 41.655 -9.308  29.332 1.00 26.64 ? 123 ALA B CA  1 
ATOM   2609 C  C   . ALA B 1 132 ? 40.909 -8.002  29.269 1.00 26.13 ? 123 ALA B C   1 
ATOM   2610 O  O   . ALA B 1 132 ? 39.691 -8.004  29.189 1.00 24.99 ? 123 ALA B O   1 
ATOM   2611 C  CB  . ALA B 1 132 ? 41.954 -9.634  30.790 1.00 26.00 ? 123 ALA B CB  1 
ATOM   2612 N  N   . ALA B 1 133 ? 41.639 -6.894  29.369 1.00 26.20 ? 124 ALA B N   1 
ATOM   2613 C  CA  . ALA B 1 133 ? 41.051 -5.564  29.232 1.00 26.79 ? 124 ALA B CA  1 
ATOM   2614 C  C   . ALA B 1 133 ? 40.480 -5.301  27.822 1.00 26.93 ? 124 ALA B C   1 
ATOM   2615 O  O   . ALA B 1 133 ? 39.423 -4.699  27.676 1.00 25.70 ? 124 ALA B O   1 
ATOM   2616 C  CB  . ALA B 1 133 ? 42.091 -4.495  29.604 1.00 26.36 ? 124 ALA B CB  1 
ATOM   2617 N  N   . ILE B 1 134 ? 41.180 -5.760  26.787 1.00 26.97 ? 125 ILE B N   1 
ATOM   2618 C  CA  . ILE B 1 134 ? 40.805 -5.466  25.401 1.00 26.48 ? 125 ILE B CA  1 
ATOM   2619 C  C   . ILE B 1 134 ? 39.583 -6.304  25.002 1.00 25.95 ? 125 ILE B C   1 
ATOM   2620 O  O   . ILE B 1 134 ? 38.666 -5.813  24.326 1.00 25.46 ? 125 ILE B O   1 
ATOM   2621 C  CB  . ILE B 1 134 ? 42.011 -5.686  24.476 1.00 26.63 ? 125 ILE B CB  1 
ATOM   2622 C  CG1 . ILE B 1 134 ? 43.001 -4.531  24.681 1.00 26.81 ? 125 ILE B CG1 1 
ATOM   2623 C  CG2 . ILE B 1 134 ? 41.599 -5.815  23.011 1.00 26.17 ? 125 ILE B CG2 1 
ATOM   2624 C  CD1 . ILE B 1 134 ? 44.325 -4.778  24.075 1.00 29.09 ? 125 ILE B CD1 1 
ATOM   2625 N  N   . SER B 1 135 ? 39.545 -7.531  25.502 1.00 24.66 ? 126 SER B N   1 
ATOM   2626 C  CA  . SER B 1 135 ? 38.499 -8.486  25.195 1.00 25.21 ? 126 SER B CA  1 
ATOM   2627 C  C   . SER B 1 135 ? 37.190 -8.310  26.007 1.00 24.11 ? 126 SER B C   1 
ATOM   2628 O  O   . SER B 1 135 ? 36.196 -8.962  25.733 1.00 25.05 ? 126 SER B O   1 
ATOM   2629 C  CB  . SER B 1 135 ? 39.057 -9.929  25.306 1.00 27.17 ? 126 SER B CB  1 
ATOM   2630 O  OG  . SER B 1 135 ? 39.188 -10.330 26.663 1.00 32.57 ? 126 SER B OG  1 
ATOM   2631 N  N   . ARG B 1 136 ? 37.195 -7.451  27.020 1.00 23.64 ? 127 ARG B N   1 
ATOM   2632 C  CA  . ARG B 1 136 ? 35.993 -7.117  27.769 1.00 23.82 ? 127 ARG B CA  1 
ATOM   2633 C  C   . ARG B 1 136 ? 35.031 -6.299  26.917 1.00 24.27 ? 127 ARG B C   1 
ATOM   2634 O  O   . ARG B 1 136 ? 35.214 -5.081  26.742 1.00 24.81 ? 127 ARG B O   1 
ATOM   2635 C  CB  . ARG B 1 136 ? 36.376 -6.366  29.043 1.00 23.41 ? 127 ARG B CB  1 
ATOM   2636 C  CG  . ARG B 1 136 ? 35.239 -5.730  29.848 1.00 25.13 ? 127 ARG B CG  1 
ATOM   2637 C  CD  . ARG B 1 136 ? 34.012 -6.592  30.040 1.00 24.61 ? 127 ARG B CD  1 
ATOM   2638 N  NE  . ARG B 1 136 ? 34.258 -7.822  30.770 1.00 25.57 ? 127 ARG B NE  1 
ATOM   2639 C  CZ  . ARG B 1 136 ? 33.313 -8.700  31.119 1.00 26.05 ? 127 ARG B CZ  1 
ATOM   2640 N  NH1 . ARG B 1 136 ? 32.045 -8.486  30.826 1.00 27.90 ? 127 ARG B NH1 1 
ATOM   2641 N  NH2 . ARG B 1 136 ? 33.631 -9.800  31.807 1.00 27.25 ? 127 ARG B NH2 1 
ATOM   2642 N  N   . PHE B 1 137 ? 34.011 -6.975  26.377 1.00 24.66 ? 128 PHE B N   1 
ATOM   2643 C  CA  . PHE B 1 137 ? 33.132 -6.408  25.354 1.00 23.98 ? 128 PHE B CA  1 
ATOM   2644 C  C   . PHE B 1 137 ? 32.095 -5.522  26.039 1.00 23.47 ? 128 PHE B C   1 
ATOM   2645 O  O   . PHE B 1 137 ? 31.409 -5.978  26.979 1.00 22.54 ? 128 PHE B O   1 
ATOM   2646 C  CB  . PHE B 1 137 ? 32.469 -7.539  24.540 1.00 24.07 ? 128 PHE B CB  1 
ATOM   2647 C  CG  . PHE B 1 137 ? 31.770 -7.069  23.307 1.00 25.30 ? 128 PHE B CG  1 
ATOM   2648 C  CD1 . PHE B 1 137 ? 32.499 -6.733  22.183 1.00 21.45 ? 128 PHE B CD1 1 
ATOM   2649 C  CD2 . PHE B 1 137 ? 30.392 -6.953  23.265 1.00 23.06 ? 128 PHE B CD2 1 
ATOM   2650 C  CE1 . PHE B 1 137 ? 31.854 -6.288  21.062 1.00 24.96 ? 128 PHE B CE1 1 
ATOM   2651 C  CE2 . PHE B 1 137 ? 29.759 -6.483  22.140 1.00 24.38 ? 128 PHE B CE2 1 
ATOM   2652 C  CZ  . PHE B 1 137 ? 30.476 -6.160  21.059 1.00 23.73 ? 128 PHE B CZ  1 
ATOM   2653 N  N   . GLY B 1 138 ? 31.941 -4.282  25.555 1.00 22.11 ? 129 GLY B N   1 
ATOM   2654 C  CA  . GLY B 1 138 ? 31.061 -3.342  26.225 1.00 20.45 ? 129 GLY B CA  1 
ATOM   2655 C  C   . GLY B 1 138 ? 31.852 -2.577  27.268 1.00 19.99 ? 129 GLY B C   1 
ATOM   2656 O  O   . GLY B 1 138 ? 33.075 -2.381  27.148 1.00 20.43 ? 129 GLY B O   1 
ATOM   2657 N  N   . SER B 1 139 ? 31.169 -2.157  28.312 1.00 19.70 ? 130 SER B N   1 
ATOM   2658 C  CA  . SER B 1 139 ? 31.790 -1.429  29.415 1.00 19.84 ? 130 SER B CA  1 
ATOM   2659 C  C   . SER B 1 139 ? 32.328 -2.394  30.484 1.00 20.91 ? 130 SER B C   1 
ATOM   2660 O  O   . SER B 1 139 ? 31.739 -3.439  30.741 1.00 21.28 ? 130 SER B O   1 
ATOM   2661 C  CB  . SER B 1 139 ? 30.766 -0.492  30.055 1.00 18.02 ? 130 SER B CB  1 
ATOM   2662 O  OG  . SER B 1 139 ? 30.182 0.403   29.105 1.00 18.45 ? 130 SER B OG  1 
ATOM   2663 N  N   . GLY B 1 140 ? 33.411 -2.003  31.135 1.00 20.31 ? 131 GLY B N   1 
ATOM   2664 C  CA  . GLY B 1 140 ? 33.986 -2.799  32.232 1.00 19.80 ? 131 GLY B CA  1 
ATOM   2665 C  C   . GLY B 1 140 ? 35.427 -2.498  32.624 1.00 19.42 ? 131 GLY B C   1 
ATOM   2666 O  O   . GLY B 1 140 ? 35.982 -1.430  32.334 1.00 18.65 ? 131 GLY B O   1 
ATOM   2667 N  N   . TYR B 1 141 ? 36.034 -3.447  33.317 1.00 19.70 ? 132 TYR B N   1 
ATOM   2668 C  CA  . TYR B 1 141 ? 37.384 -3.271  33.853 1.00 21.37 ? 132 TYR B CA  1 
ATOM   2669 C  C   . TYR B 1 141 ? 38.222 -4.528  33.673 1.00 22.57 ? 132 TYR B C   1 
ATOM   2670 O  O   . TYR B 1 141 ? 37.677 -5.641  33.637 1.00 23.55 ? 132 TYR B O   1 
ATOM   2671 C  CB  . TYR B 1 141 ? 37.326 -2.960  35.364 1.00 22.47 ? 132 TYR B CB  1 
ATOM   2672 C  CG  . TYR B 1 141 ? 36.655 -1.675  35.722 1.00 21.87 ? 132 TYR B CG  1 
ATOM   2673 C  CD1 . TYR B 1 141 ? 35.286 -1.611  35.878 1.00 22.37 ? 132 TYR B CD1 1 
ATOM   2674 C  CD2 . TYR B 1 141 ? 37.402 -0.533  35.975 1.00 22.32 ? 132 TYR B CD2 1 
ATOM   2675 C  CE1 . TYR B 1 141 ? 34.659 -0.408  36.236 1.00 23.98 ? 132 TYR B CE1 1 
ATOM   2676 C  CE2 . TYR B 1 141 ? 36.796 0.673   36.320 1.00 21.29 ? 132 TYR B CE2 1 
ATOM   2677 C  CZ  . TYR B 1 141 ? 35.426 0.741   36.437 1.00 22.48 ? 132 TYR B CZ  1 
ATOM   2678 O  OH  . TYR B 1 141 ? 34.822 1.937   36.817 1.00 22.90 ? 132 TYR B OH  1 
ATOM   2679 N  N   . GLY B 1 142 ? 39.542 -4.337  33.566 1.00 22.33 ? 133 GLY B N   1 
ATOM   2680 C  CA  . GLY B 1 142 ? 40.514 -5.430  33.684 1.00 23.36 ? 133 GLY B CA  1 
ATOM   2681 C  C   . GLY B 1 142 ? 41.161 -5.389  35.055 1.00 23.87 ? 133 GLY B C   1 
ATOM   2682 O  O   . GLY B 1 142 ? 41.432 -4.320  35.584 1.00 22.26 ? 133 GLY B O   1 
ATOM   2683 N  N   . TRP B 1 143 ? 41.422 -6.560  35.637 1.00 26.35 ? 134 TRP B N   1 
ATOM   2684 C  CA  . TRP B 1 143 ? 41.903 -6.654  37.029 1.00 25.63 ? 134 TRP B CA  1 
ATOM   2685 C  C   . TRP B 1 143 ? 43.088 -7.629  37.164 1.00 27.10 ? 134 TRP B C   1 
ATOM   2686 O  O   . TRP B 1 143 ? 43.168 -8.614  36.418 1.00 26.31 ? 134 TRP B O   1 
ATOM   2687 C  CB  . TRP B 1 143 ? 40.809 -7.208  37.923 1.00 24.35 ? 134 TRP B CB  1 
ATOM   2688 C  CG  . TRP B 1 143 ? 39.503 -6.460  37.913 1.00 23.29 ? 134 TRP B CG  1 
ATOM   2689 C  CD1 . TRP B 1 143 ? 38.459 -6.657  37.062 1.00 22.73 ? 134 TRP B CD1 1 
ATOM   2690 C  CD2 . TRP B 1 143 ? 39.081 -5.442  38.844 1.00 22.99 ? 134 TRP B CD2 1 
ATOM   2691 N  NE1 . TRP B 1 143 ? 37.429 -5.814  37.374 1.00 22.42 ? 134 TRP B NE1 1 
ATOM   2692 C  CE2 . TRP B 1 143 ? 37.773 -5.060  38.468 1.00 23.28 ? 134 TRP B CE2 1 
ATOM   2693 C  CE3 . TRP B 1 143 ? 39.672 -4.829  39.965 1.00 22.60 ? 134 TRP B CE3 1 
ATOM   2694 C  CZ2 . TRP B 1 143 ? 37.040 -4.091  39.175 1.00 23.84 ? 134 TRP B CZ2 1 
ATOM   2695 C  CZ3 . TRP B 1 143 ? 38.948 -3.875  40.660 1.00 22.70 ? 134 TRP B CZ3 1 
ATOM   2696 C  CH2 . TRP B 1 143 ? 37.648 -3.502  40.258 1.00 24.41 ? 134 TRP B CH2 1 
ATOM   2697 N  N   . LEU B 1 144 ? 43.977 -7.312  38.103 1.00 26.86 ? 135 LEU B N   1 
ATOM   2698 C  CA  . LEU B 1 144 ? 44.896 -8.260  38.740 1.00 28.44 ? 135 LEU B CA  1 
ATOM   2699 C  C   . LEU B 1 144 ? 44.370 -8.462  40.147 1.00 27.94 ? 135 LEU B C   1 
ATOM   2700 O  O   . LEU B 1 144 ? 44.142 -7.469  40.873 1.00 27.37 ? 135 LEU B O   1 
ATOM   2701 C  CB  . LEU B 1 144 ? 46.324 -7.712  38.819 1.00 28.07 ? 135 LEU B CB  1 
ATOM   2702 C  CG  . LEU B 1 144 ? 47.356 -8.663  39.486 1.00 28.18 ? 135 LEU B CG  1 
ATOM   2703 C  CD1 . LEU B 1 144 ? 47.501 -9.982  38.680 1.00 29.83 ? 135 LEU B CD1 1 
ATOM   2704 C  CD2 . LEU B 1 144 ? 48.690 -7.968  39.656 1.00 30.78 ? 135 LEU B CD2 1 
ATOM   2705 N  N   . VAL B 1 145 ? 44.160 -9.724  40.523 1.00 28.84 ? 136 VAL B N   1 
ATOM   2706 C  CA  . VAL B 1 145 ? 43.534 -10.052 41.810 1.00 31.10 ? 136 VAL B CA  1 
ATOM   2707 C  C   . VAL B 1 145 ? 44.342 -11.118 42.542 1.00 32.89 ? 136 VAL B C   1 
ATOM   2708 O  O   . VAL B 1 145 ? 45.182 -11.775 41.953 1.00 30.28 ? 136 VAL B O   1 
ATOM   2709 C  CB  . VAL B 1 145 ? 42.069 -10.555 41.674 1.00 31.30 ? 136 VAL B CB  1 
ATOM   2710 C  CG1 . VAL B 1 145 ? 41.178 -9.483  41.045 1.00 29.46 ? 136 VAL B CG1 1 
ATOM   2711 C  CG2 . VAL B 1 145 ? 41.966 -11.884 40.889 1.00 31.76 ? 136 VAL B CG2 1 
ATOM   2712 N  N   . LEU B 1 146 ? 44.088 -11.224 43.838 1.00 35.29 ? 137 LEU B N   1 
ATOM   2713 C  CA  . LEU B 1 146 ? 44.609 -12.308 44.658 1.00 38.18 ? 137 LEU B CA  1 
ATOM   2714 C  C   . LEU B 1 146 ? 43.451 -13.234 44.976 1.00 39.94 ? 137 LEU B C   1 
ATOM   2715 O  O   . LEU B 1 146 ? 42.458 -12.811 45.573 1.00 38.31 ? 137 LEU B O   1 
ATOM   2716 C  CB  . LEU B 1 146 ? 45.179 -11.742 45.942 1.00 38.28 ? 137 LEU B CB  1 
ATOM   2717 C  CG  . LEU B 1 146 ? 45.786 -12.727 46.932 1.00 38.12 ? 137 LEU B CG  1 
ATOM   2718 C  CD1 . LEU B 1 146 ? 46.926 -13.516 46.276 1.00 39.92 ? 137 LEU B CD1 1 
ATOM   2719 C  CD2 . LEU B 1 146 ? 46.262 -11.874 48.110 1.00 40.71 ? 137 LEU B CD2 1 
ATOM   2720 N  N   . ASP B 1 147 ? 43.585 -14.484 44.539 1.00 43.07 ? 138 ASP B N   1 
ATOM   2721 C  CA  . ASP B 1 147 ? 42.545 -15.495 44.639 1.00 44.16 ? 138 ASP B CA  1 
ATOM   2722 C  C   . ASP B 1 147 ? 43.082 -16.643 45.511 1.00 46.65 ? 138 ASP B C   1 
ATOM   2723 O  O   . ASP B 1 147 ? 43.477 -17.705 44.999 1.00 47.03 ? 138 ASP B O   1 
ATOM   2724 C  CB  . ASP B 1 147 ? 42.191 -15.994 43.226 1.00 45.07 ? 138 ASP B CB  1 
ATOM   2725 C  CG  . ASP B 1 147 ? 41.058 -17.014 43.223 1.00 45.76 ? 138 ASP B CG  1 
ATOM   2726 O  OD1 . ASP B 1 147 ? 40.745 -17.547 42.122 1.00 51.80 ? 138 ASP B OD1 1 
ATOM   2727 O  OD2 . ASP B 1 147 ? 40.486 -17.281 44.311 1.00 50.27 ? 138 ASP B OD2 1 
ATOM   2728 N  N   . GLY B 1 148 ? 43.129 -16.404 46.823 1.00 47.76 ? 139 GLY B N   1 
ATOM   2729 C  CA  . GLY B 1 148 ? 43.717 -17.352 47.767 1.00 47.43 ? 139 GLY B CA  1 
ATOM   2730 C  C   . GLY B 1 148 ? 45.112 -16.870 48.101 1.00 48.75 ? 139 GLY B C   1 
ATOM   2731 O  O   . GLY B 1 148 ? 45.273 -15.888 48.819 1.00 50.50 ? 139 GLY B O   1 
ATOM   2732 N  N   . GLU B 1 149 ? 46.124 -17.572 47.598 1.00 48.33 ? 140 GLU B N   1 
ATOM   2733 C  CA  . GLU B 1 149 ? 47.501 -17.063 47.607 1.00 47.96 ? 140 GLU B CA  1 
ATOM   2734 C  C   . GLU B 1 149 ? 47.929 -16.692 46.177 1.00 46.66 ? 140 GLU B C   1 
ATOM   2735 O  O   . GLU B 1 149 ? 48.968 -16.063 45.961 1.00 46.56 ? 140 GLU B O   1 
ATOM   2736 C  CB  . GLU B 1 149 ? 48.446 -18.126 48.181 1.00 48.75 ? 140 GLU B CB  1 
ATOM   2737 C  CG  . GLU B 1 149 ? 49.576 -17.549 49.041 1.00 51.74 ? 140 GLU B CG  1 
ATOM   2738 C  CD  . GLU B 1 149 ? 50.543 -18.611 49.582 1.00 52.59 ? 140 GLU B CD  1 
ATOM   2739 O  OE1 . GLU B 1 149 ? 51.526 -18.232 50.270 1.00 59.88 ? 140 GLU B OE1 1 
ATOM   2740 O  OE2 . GLU B 1 149 ? 50.331 -19.814 49.308 1.00 60.52 ? 140 GLU B OE2 1 
ATOM   2741 N  N   . GLU B 1 150 ? 47.095 -17.065 45.223 1.00 45.45 ? 141 GLU B N   1 
ATOM   2742 C  CA  . GLU B 1 150 ? 47.479 -17.059 43.833 1.00 44.30 ? 141 GLU B CA  1 
ATOM   2743 C  C   . GLU B 1 150 ? 47.015 -15.768 43.185 1.00 41.92 ? 141 GLU B C   1 
ATOM   2744 O  O   . GLU B 1 150 ? 45.886 -15.340 43.373 1.00 40.90 ? 141 GLU B O   1 
ATOM   2745 C  CB  . GLU B 1 150 ? 46.890 -18.275 43.141 1.00 44.30 ? 141 GLU B CB  1 
ATOM   2746 C  CG  . GLU B 1 150 ? 46.766 -18.187 41.639 1.00 46.20 ? 141 GLU B CG  1 
ATOM   2747 C  CD  . GLU B 1 150 ? 45.717 -19.144 41.118 1.00 49.34 ? 141 GLU B CD  1 
ATOM   2748 O  OE1 . GLU B 1 150 ? 45.361 -20.074 41.861 1.00 56.90 ? 141 GLU B OE1 1 
ATOM   2749 O  OE2 . GLU B 1 150 ? 45.246 -18.969 39.979 1.00 56.97 ? 141 GLU B OE2 1 
ATOM   2750 N  N   . LEU B 1 151 ? 47.897 -15.132 42.439 1.00 39.64 ? 142 LEU B N   1 
ATOM   2751 C  CA  . LEU B 1 151 ? 47.461 -13.991 41.678 1.00 38.85 ? 142 LEU B CA  1 
ATOM   2752 C  C   . LEU B 1 151 ? 47.025 -14.309 40.270 1.00 36.79 ? 142 LEU B C   1 
ATOM   2753 O  O   . LEU B 1 151 ? 47.575 -15.181 39.612 1.00 35.09 ? 142 LEU B O   1 
ATOM   2754 C  CB  . LEU B 1 151 ? 48.391 -12.786 41.797 1.00 40.71 ? 142 LEU B CB  1 
ATOM   2755 C  CG  . LEU B 1 151 ? 49.787 -12.785 41.218 1.00 42.87 ? 142 LEU B CG  1 
ATOM   2756 C  CD1 . LEU B 1 151 ? 49.725 -12.785 39.716 1.00 48.54 ? 142 LEU B CD1 1 
ATOM   2757 C  CD2 . LEU B 1 151 ? 50.551 -11.584 41.711 1.00 40.79 ? 142 LEU B CD2 1 
ATOM   2758 N  N   . SER B 1 152 ? 45.975 -13.622 39.843 1.00 34.37 ? 143 SER B N   1 
ATOM   2759 C  CA  . SER B 1 152 ? 45.328 -13.945 38.597 1.00 32.97 ? 143 SER B CA  1 
ATOM   2760 C  C   . SER B 1 152 ? 44.768 -12.707 37.897 1.00 31.07 ? 143 SER B C   1 
ATOM   2761 O  O   . SER B 1 152 ? 44.600 -11.666 38.505 1.00 27.77 ? 143 SER B O   1 
ATOM   2762 C  CB  . SER B 1 152 ? 44.263 -15.020 38.793 1.00 33.45 ? 143 SER B CB  1 
ATOM   2763 O  OG  . SER B 1 152 ? 43.121 -14.515 39.433 1.00 34.38 ? 143 SER B OG  1 
ATOM   2764 N  N   . VAL B 1 153 ? 44.520 -12.859 36.604 1.00 30.70 ? 144 VAL B N   1 
ATOM   2765 C  CA  . VAL B 1 153 ? 43.956 -11.799 35.731 1.00 30.30 ? 144 VAL B CA  1 
ATOM   2766 C  C   . VAL B 1 153 ? 42.482 -12.143 35.411 1.00 29.48 ? 144 VAL B C   1 
ATOM   2767 O  O   . VAL B 1 153 ? 42.144 -13.311 35.175 1.00 30.40 ? 144 VAL B O   1 
ATOM   2768 C  CB  . VAL B 1 153 ? 44.850 -11.704 34.433 1.00 29.64 ? 144 VAL B CB  1 
ATOM   2769 C  CG1 . VAL B 1 153 ? 44.111 -11.190 33.259 1.00 32.41 ? 144 VAL B CG1 1 
ATOM   2770 C  CG2 . VAL B 1 153 ? 46.100 -10.887 34.705 1.00 29.72 ? 144 VAL B CG2 1 
ATOM   2771 N  N   . MET B 1 154 ? 41.594 -11.138 35.423 1.00 28.26 ? 145 MET B N   1 
ATOM   2772 C  CA  . MET B 1 154 ? 40.207 -11.311 35.013 1.00 28.24 ? 145 MET B CA  1 
ATOM   2773 C  C   . MET B 1 154 ? 39.621 -9.949  34.588 1.00 26.41 ? 145 MET B C   1 
ATOM   2774 O  O   . MET B 1 154 ? 40.274 -8.928  34.739 1.00 26.42 ? 145 MET B O   1 
ATOM   2775 C  CB  . MET B 1 154 ? 39.364 -11.864 36.165 1.00 28.82 ? 145 MET B CB  1 
ATOM   2776 C  CG  . MET B 1 154 ? 39.418 -10.999 37.436 1.00 31.56 ? 145 MET B CG  1 
ATOM   2777 S  SD  . MET B 1 154 ? 38.319 -11.605 38.723 1.00 33.74 ? 145 MET B SD  1 
ATOM   2778 C  CE  . MET B 1 154 ? 36.721 -11.080 38.111 1.00 34.17 ? 145 MET B CE  1 
ATOM   2779 N  N   . SER B 1 155 ? 38.404 -9.973  34.048 1.00 26.20 ? 146 SER B N   1 
ATOM   2780 C  CA  . SER B 1 155 ? 37.648 -8.757  33.754 1.00 25.04 ? 146 SER B CA  1 
ATOM   2781 C  C   . SER B 1 155 ? 36.254 -8.863  34.313 1.00 24.61 ? 146 SER B C   1 
ATOM   2782 O  O   . SER B 1 155 ? 35.769 -9.980  34.600 1.00 25.04 ? 146 SER B O   1 
ATOM   2783 C  CB  . SER B 1 155 ? 37.611 -8.467  32.251 1.00 25.35 ? 146 SER B CB  1 
ATOM   2784 O  OG  . SER B 1 155 ? 36.805 -9.373  31.498 1.00 27.20 ? 146 SER B OG  1 
ATOM   2785 N  N   . THR B 1 156 ? 35.618 -7.701  34.487 1.00 24.92 ? 147 THR B N   1 
ATOM   2786 C  CA  . THR B 1 156 ? 34.246 -7.578  34.931 1.00 24.22 ? 147 THR B CA  1 
ATOM   2787 C  C   . THR B 1 156 ? 33.457 -6.618  34.032 1.00 24.85 ? 147 THR B C   1 
ATOM   2788 O  O   . THR B 1 156 ? 34.027 -5.725  33.445 1.00 24.30 ? 147 THR B O   1 
ATOM   2789 C  CB  . THR B 1 156 ? 34.168 -7.077  36.391 1.00 24.12 ? 147 THR B CB  1 
ATOM   2790 O  OG1 . THR B 1 156 ? 34.743 -5.753  36.529 1.00 24.64 ? 147 THR B OG1 1 
ATOM   2791 C  CG2 . THR B 1 156 ? 34.904 -8.073  37.344 1.00 25.19 ? 147 THR B CG2 1 
ATOM   2792 N  N   . PRO B 1 157 ? 32.130 -6.809  33.952 1.00 24.05 ? 148 PRO B N   1 
ATOM   2793 C  CA  . PRO B 1 157 ? 31.263 -5.901  33.202 1.00 23.34 ? 148 PRO B CA  1 
ATOM   2794 C  C   . PRO B 1 157 ? 30.867 -4.682  34.034 1.00 22.41 ? 148 PRO B C   1 
ATOM   2795 O  O   . PRO B 1 157 ? 30.769 -4.761  35.234 1.00 21.17 ? 148 PRO B O   1 
ATOM   2796 C  CB  . PRO B 1 157 ? 30.028 -6.728  32.958 1.00 23.58 ? 148 PRO B CB  1 
ATOM   2797 C  CG  . PRO B 1 157 ? 29.920 -7.641  34.133 1.00 22.65 ? 148 PRO B CG  1 
ATOM   2798 C  CD  . PRO B 1 157 ? 31.365 -7.917  34.569 1.00 24.04 ? 148 PRO B CD  1 
ATOM   2799 N  N   . ASN B 1 158 ? 30.620 -3.570  33.373 1.00 22.22 ? 149 ASN B N   1 
ATOM   2800 C  CA  . ASN B 1 158 ? 29.992 -2.418  33.984 1.00 23.15 ? 149 ASN B CA  1 
ATOM   2801 C  C   . ASN B 1 158 ? 30.761 -1.939  35.213 1.00 22.93 ? 149 ASN B C   1 
ATOM   2802 O  O   . ASN B 1 158 ? 31.969 -1.678  35.099 1.00 23.08 ? 149 ASN B O   1 
ATOM   2803 C  CB  . ASN B 1 158 ? 28.488 -2.705  34.228 1.00 23.76 ? 149 ASN B CB  1 
ATOM   2804 C  CG  . ASN B 1 158 ? 27.755 -3.090  32.939 1.00 25.03 ? 149 ASN B CG  1 
ATOM   2805 O  OD1 . ASN B 1 158 ? 26.887 -3.961  32.936 1.00 27.09 ? 149 ASN B OD1 1 
ATOM   2806 N  ND2 . ASN B 1 158 ? 28.133 -2.465  31.836 1.00 18.28 ? 149 ASN B ND2 1 
ATOM   2807 N  N   . GLN B 1 159 ? 30.112 -1.832  36.374 1.00 23.13 ? 150 GLN B N   1 
ATOM   2808 C  CA  . GLN B 1 159 ? 30.802 -1.421  37.605 1.00 22.34 ? 150 GLN B CA  1 
ATOM   2809 C  C   . GLN B 1 159 ? 30.914 -2.585  38.597 1.00 24.23 ? 150 GLN B C   1 
ATOM   2810 O  O   . GLN B 1 159 ? 31.071 -2.371  39.797 1.00 24.90 ? 150 GLN B O   1 
ATOM   2811 C  CB  . GLN B 1 159 ? 30.110 -0.224  38.250 1.00 21.45 ? 150 GLN B CB  1 
ATOM   2812 C  CG  . GLN B 1 159 ? 30.081 1.090   37.372 1.00 22.67 ? 150 GLN B CG  1 
ATOM   2813 C  CD  . GLN B 1 159 ? 31.463 1.704   37.049 1.00 22.95 ? 150 GLN B CD  1 
ATOM   2814 O  OE1 . GLN B 1 159 ? 32.487 1.419   37.684 1.00 21.51 ? 150 GLN B OE1 1 
ATOM   2815 N  NE2 . GLN B 1 159 ? 31.478 2.578   36.029 1.00 20.73 ? 150 GLN B NE2 1 
ATOM   2816 N  N   . ASP B 1 160 ? 30.885 -3.813  38.070 1.00 24.59 ? 151 ASP B N   1 
ATOM   2817 C  CA  . ASP B 1 160 ? 31.026 -5.014  38.907 1.00 25.32 ? 151 ASP B CA  1 
ATOM   2818 C  C   . ASP B 1 160 ? 32.478 -5.191  39.373 1.00 25.86 ? 151 ASP B C   1 
ATOM   2819 O  O   . ASP B 1 160 ? 33.418 -4.784  38.677 1.00 25.26 ? 151 ASP B O   1 
ATOM   2820 C  CB  . ASP B 1 160 ? 30.487 -6.261  38.179 1.00 25.73 ? 151 ASP B CB  1 
ATOM   2821 C  CG  . ASP B 1 160 ? 28.968 -6.217  37.996 1.00 27.97 ? 151 ASP B CG  1 
ATOM   2822 O  OD1 . ASP B 1 160 ? 28.318 -5.283  38.504 1.00 30.58 ? 151 ASP B OD1 1 
ATOM   2823 O  OD2 . ASP B 1 160 ? 28.408 -7.115  37.338 1.00 33.40 ? 151 ASP B OD2 1 
ATOM   2824 N  N   . THR B 1 161 ? 32.644 -5.792  40.566 1.00 25.69 ? 152 THR B N   1 
ATOM   2825 C  CA  . THR B 1 161 ? 33.962 -5.995  41.164 1.00 27.42 ? 152 THR B CA  1 
ATOM   2826 C  C   . THR B 1 161 ? 34.223 -7.477  41.489 1.00 27.97 ? 152 THR B C   1 
ATOM   2827 O  O   . THR B 1 161 ? 33.293 -8.293  41.545 1.00 26.99 ? 152 THR B O   1 
ATOM   2828 C  CB  . THR B 1 161 ? 34.137 -5.123  42.463 1.00 28.36 ? 152 THR B CB  1 
ATOM   2829 O  OG1 . THR B 1 161 ? 33.761 -5.852  43.654 1.00 30.11 ? 152 THR B OG1 1 
ATOM   2830 C  CG2 . THR B 1 161 ? 33.308 -3.848  42.387 1.00 27.76 ? 152 THR B CG2 1 
ATOM   2831 N  N   . PRO B 1 162 ? 35.498 -7.841  41.675 1.00 28.63 ? 153 PRO B N   1 
ATOM   2832 C  CA  . PRO B 1 162 ? 35.827 -9.202  42.075 1.00 30.11 ? 153 PRO B CA  1 
ATOM   2833 C  C   . PRO B 1 162 ? 35.446 -9.551  43.536 1.00 31.24 ? 153 PRO B C   1 
ATOM   2834 O  O   . PRO B 1 162 ? 35.525 -10.728 43.909 1.00 32.18 ? 153 PRO B O   1 
ATOM   2835 C  CB  . PRO B 1 162 ? 37.351 -9.266  41.881 1.00 30.12 ? 153 PRO B CB  1 
ATOM   2836 C  CG  . PRO B 1 162 ? 37.693 -8.014  41.031 1.00 30.64 ? 153 PRO B CG  1 
ATOM   2837 C  CD  . PRO B 1 162 ? 36.703 -7.019  41.460 1.00 29.49 ? 153 PRO B CD  1 
ATOM   2838 N  N   . LEU B 1 163 ? 35.057 -8.558  44.334 1.00 32.32 ? 154 LEU B N   1 
ATOM   2839 C  CA  . LEU B 1 163 ? 34.691 -8.768  45.757 1.00 34.55 ? 154 LEU B CA  1 
ATOM   2840 C  C   . LEU B 1 163 ? 33.566 -9.787  45.928 1.00 37.56 ? 154 LEU B C   1 
ATOM   2841 O  O   . LEU B 1 163 ? 33.642 -10.714 46.762 1.00 38.41 ? 154 LEU B O   1 
ATOM   2842 C  CB  . LEU B 1 163 ? 34.303 -7.433  46.419 1.00 33.56 ? 154 LEU B CB  1 
ATOM   2843 C  CG  . LEU B 1 163 ? 35.420 -6.404  46.428 1.00 35.80 ? 154 LEU B CG  1 
ATOM   2844 C  CD1 . LEU B 1 163 ? 34.974 -5.110  47.119 1.00 36.46 ? 154 LEU B CD1 1 
ATOM   2845 C  CD2 . LEU B 1 163 ? 36.652 -6.975  47.093 1.00 39.54 ? 154 LEU B CD2 1 
ATOM   2846 N  N   . GLN B 1 164 ? 32.520 -9.580  45.136 1.00 41.21 ? 155 GLN B N   1 
ATOM   2847 C  CA  . GLN B 1 164 ? 31.426 -10.539 44.900 1.00 41.82 ? 155 GLN B CA  1 
ATOM   2848 C  C   . GLN B 1 164 ? 31.885 -12.014 44.985 1.00 42.90 ? 155 GLN B C   1 
ATOM   2849 O  O   . GLN B 1 164 ? 31.211 -12.839 45.614 1.00 43.89 ? 155 GLN B O   1 
ATOM   2850 C  CB  . GLN B 1 164 ? 30.823 -10.255 43.497 1.00 43.05 ? 155 GLN B CB  1 
ATOM   2851 C  CG  . GLN B 1 164 ? 29.434 -10.859 43.231 1.00 44.67 ? 155 GLN B CG  1 
ATOM   2852 C  CD  . GLN B 1 164 ? 28.290 -9.912  43.593 1.00 52.04 ? 155 GLN B CD  1 
ATOM   2853 O  OE1 . GLN B 1 164 ? 27.432 -10.234 44.422 1.00 53.42 ? 155 GLN B OE1 1 
ATOM   2854 N  NE2 . GLN B 1 164 ? 28.269 -8.734  42.955 1.00 59.33 ? 155 GLN B NE2 1 
ATOM   2855 N  N   . GLU B 1 165 ? 33.046 -12.300 44.380 1.00 43.49 ? 156 GLU B N   1 
ATOM   2856 C  CA  . GLU B 1 165 ? 33.585 -13.651 44.207 1.00 43.88 ? 156 GLU B CA  1 
ATOM   2857 C  C   . GLU B 1 165 ? 34.672 -14.015 45.222 1.00 43.67 ? 156 GLU B C   1 
ATOM   2858 O  O   . GLU B 1 165 ? 35.315 -15.048 45.070 1.00 45.64 ? 156 GLU B O   1 
ATOM   2859 C  CB  . GLU B 1 165 ? 34.210 -13.782 42.806 1.00 45.03 ? 156 GLU B CB  1 
ATOM   2860 C  CG  . GLU B 1 165 ? 33.405 -13.156 41.669 1.00 46.12 ? 156 GLU B CG  1 
ATOM   2861 C  CD  . GLU B 1 165 ? 34.223 -12.944 40.403 1.00 47.91 ? 156 GLU B CD  1 
ATOM   2862 O  OE1 . GLU B 1 165 ? 35.124 -13.775 40.108 1.00 54.28 ? 156 GLU B OE1 1 
ATOM   2863 O  OE2 . GLU B 1 165 ? 33.949 -11.944 39.699 1.00 51.45 ? 156 GLU B OE2 1 
ATOM   2864 N  N   . GLY B 1 166 ? 34.899 -13.172 46.228 1.00 42.36 ? 157 GLY B N   1 
ATOM   2865 C  CA  . GLY B 1 166 ? 35.936 -13.405 47.221 1.00 41.67 ? 157 GLY B CA  1 
ATOM   2866 C  C   . GLY B 1 166 ? 37.370 -13.135 46.799 1.00 41.87 ? 157 GLY B C   1 
ATOM   2867 O  O   . GLY B 1 166 ? 38.308 -13.517 47.504 1.00 42.38 ? 157 GLY B O   1 
ATOM   2868 N  N   . LYS B 1 167 ? 37.572 -12.495 45.650 1.00 40.37 ? 158 LYS B N   1 
ATOM   2869 C  CA  . LYS B 1 167 ? 38.925 -12.158 45.200 1.00 39.82 ? 158 LYS B CA  1 
ATOM   2870 C  C   . LYS B 1 167 ? 39.237 -10.711 45.550 1.00 38.97 ? 158 LYS B C   1 
ATOM   2871 O  O   . LYS B 1 167 ? 38.333 -9.865  45.567 1.00 40.18 ? 158 LYS B O   1 
ATOM   2872 C  CB  . LYS B 1 167 ? 39.056 -12.383 43.695 1.00 40.28 ? 158 LYS B CB  1 
ATOM   2873 C  CG  . LYS B 1 167 ? 38.808 -13.820 43.270 1.00 41.58 ? 158 LYS B CG  1 
ATOM   2874 C  CD  . LYS B 1 167 ? 38.973 -13.965 41.777 1.00 41.83 ? 158 LYS B CD  1 
ATOM   2875 C  CE  . LYS B 1 167 ? 38.423 -15.260 41.250 1.00 41.77 ? 158 LYS B CE  1 
ATOM   2876 N  NZ  . LYS B 1 167 ? 36.942 -15.259 41.254 1.00 44.40 ? 158 LYS B NZ  1 
ATOM   2877 N  N   . ILE B 1 168 ? 40.518 -10.444 45.816 1.00 37.60 ? 159 ILE B N   1 
ATOM   2878 C  CA  . ILE B 1 168 ? 41.026 -9.142  46.252 1.00 35.51 ? 159 ILE B CA  1 
ATOM   2879 C  C   . ILE B 1 168 ? 41.787 -8.373  45.149 1.00 32.63 ? 159 ILE B C   1 
ATOM   2880 O  O   . ILE B 1 168 ? 42.899 -8.745  44.777 1.00 30.10 ? 159 ILE B O   1 
ATOM   2881 C  CB  . ILE B 1 168 ? 41.999 -9.293  47.435 1.00 35.83 ? 159 ILE B CB  1 
ATOM   2882 C  CG1 . ILE B 1 168 ? 41.342 -10.035 48.600 1.00 37.17 ? 159 ILE B CG1 1 
ATOM   2883 C  CG2 . ILE B 1 168 ? 42.504 -7.920  47.917 1.00 36.92 ? 159 ILE B CG2 1 
ATOM   2884 C  CD1 . ILE B 1 168 ? 42.256 -10.092 49.866 1.00 37.63 ? 159 ILE B CD1 1 
ATOM   2885 N  N   . PRO B 1 169 ? 41.207 -7.257  44.656 1.00 32.46 ? 160 PRO B N   1 
ATOM   2886 C  CA  . PRO B 1 169 ? 41.869 -6.389  43.682 1.00 31.62 ? 160 PRO B CA  1 
ATOM   2887 C  C   . PRO B 1 169 ? 43.231 -5.815  44.111 1.00 30.18 ? 160 PRO B C   1 
ATOM   2888 O  O   . PRO B 1 169 ? 43.364 -5.320  45.205 1.00 32.17 ? 160 PRO B O   1 
ATOM   2889 C  CB  . PRO B 1 169 ? 40.858 -5.250  43.507 1.00 31.75 ? 160 PRO B CB  1 
ATOM   2890 C  CG  . PRO B 1 169 ? 39.561 -5.869  43.793 1.00 31.10 ? 160 PRO B CG  1 
ATOM   2891 C  CD  . PRO B 1 169 ? 39.861 -6.753  44.980 1.00 31.92 ? 160 PRO B CD  1 
ATOM   2892 N  N   . LEU B 1 170 ? 44.222 -5.866  43.232 1.00 29.19 ? 161 LEU B N   1 
ATOM   2893 C  CA  . LEU B 1 170 ? 45.509 -5.225  43.445 1.00 29.63 ? 161 LEU B CA  1 
ATOM   2894 C  C   . LEU B 1 170 ? 45.775 -4.107  42.417 1.00 29.89 ? 161 LEU B C   1 
ATOM   2895 O  O   . LEU B 1 170 ? 46.543 -3.190  42.663 1.00 29.61 ? 161 LEU B O   1 
ATOM   2896 C  CB  . LEU B 1 170 ? 46.612 -6.278  43.335 1.00 30.21 ? 161 LEU B CB  1 
ATOM   2897 C  CG  . LEU B 1 170 ? 46.453 -7.528  44.216 1.00 30.55 ? 161 LEU B CG  1 
ATOM   2898 C  CD1 . LEU B 1 170 ? 47.532 -8.591  43.880 1.00 32.81 ? 161 LEU B CD1 1 
ATOM   2899 C  CD2 . LEU B 1 170 ? 46.565 -7.108  45.667 1.00 33.87 ? 161 LEU B CD2 1 
ATOM   2900 N  N   . LEU B 1 171 ? 45.144 -4.221  41.249 1.00 28.54 ? 162 LEU B N   1 
ATOM   2901 C  CA  . LEU B 1 171 ? 45.383 -3.316  40.155 1.00 27.06 ? 162 LEU B CA  1 
ATOM   2902 C  C   . LEU B 1 171 ? 44.164 -3.390  39.223 1.00 25.35 ? 162 LEU B C   1 
ATOM   2903 O  O   . LEU B 1 171 ? 43.528 -4.448  39.076 1.00 22.93 ? 162 LEU B O   1 
ATOM   2904 C  CB  . LEU B 1 171 ? 46.673 -3.705  39.441 1.00 27.59 ? 162 LEU B CB  1 
ATOM   2905 C  CG  . LEU B 1 171 ? 47.132 -3.034  38.158 1.00 27.88 ? 162 LEU B CG  1 
ATOM   2906 C  CD1 . LEU B 1 171 ? 47.468 -1.577  38.432 1.00 28.10 ? 162 LEU B CD1 1 
ATOM   2907 C  CD2 . LEU B 1 171 ? 48.351 -3.774  37.582 1.00 29.13 ? 162 LEU B CD2 1 
ATOM   2908 N  N   . VAL B 1 172 ? 43.835 -2.256  38.619 1.00 25.03 ? 163 VAL B N   1 
ATOM   2909 C  CA  . VAL B 1 172 ? 42.644 -2.159  37.780 1.00 24.27 ? 163 VAL B CA  1 
ATOM   2910 C  C   . VAL B 1 172 ? 42.875 -1.178  36.649 1.00 23.71 ? 163 VAL B C   1 
ATOM   2911 O  O   . VAL B 1 172 ? 43.510 -0.123  36.842 1.00 22.25 ? 163 VAL B O   1 
ATOM   2912 C  CB  . VAL B 1 172 ? 41.376 -1.782  38.617 1.00 24.72 ? 163 VAL B CB  1 
ATOM   2913 C  CG1 . VAL B 1 172 ? 41.456 -0.360  39.135 1.00 25.60 ? 163 VAL B CG1 1 
ATOM   2914 C  CG2 . VAL B 1 172 ? 40.095 -2.012  37.833 1.00 25.39 ? 163 VAL B CG2 1 
ATOM   2915 N  N   . ILE B 1 173 ? 42.340 -1.545  35.474 1.00 22.51 ? 164 ILE B N   1 
ATOM   2916 C  CA  . ILE B 1 173 ? 42.222 -0.645  34.328 1.00 22.32 ? 164 ILE B CA  1 
ATOM   2917 C  C   . ILE B 1 173 ? 40.724 -0.480  33.910 1.00 22.02 ? 164 ILE B C   1 
ATOM   2918 O  O   . ILE B 1 173 ? 39.985 -1.464  33.697 1.00 22.18 ? 164 ILE B O   1 
ATOM   2919 C  CB  . ILE B 1 173 ? 43.119 -1.080  33.140 1.00 21.39 ? 164 ILE B CB  1 
ATOM   2920 C  CG1 . ILE B 1 173 ? 42.984 -0.040  31.988 1.00 23.58 ? 164 ILE B CG1 1 
ATOM   2921 C  CG2 . ILE B 1 173 ? 42.723 -2.426  32.675 1.00 20.63 ? 164 ILE B CG2 1 
ATOM   2922 C  CD1 . ILE B 1 173 ? 43.898 -0.184  30.839 1.00 22.00 ? 164 ILE B CD1 1 
ATOM   2923 N  N   . ASP B 1 174 ? 40.306 0.777   33.781 1.00 22.20 ? 165 ASP B N   1 
ATOM   2924 C  CA  . ASP B 1 174 ? 38.968 1.165   33.361 1.00 21.24 ? 165 ASP B CA  1 
ATOM   2925 C  C   . ASP B 1 174 ? 38.983 1.165   31.828 1.00 19.93 ? 165 ASP B C   1 
ATOM   2926 O  O   . ASP B 1 174 ? 39.736 1.924   31.219 1.00 19.75 ? 165 ASP B O   1 
ATOM   2927 C  CB  . ASP B 1 174 ? 38.649 2.561   33.938 1.00 21.53 ? 165 ASP B CB  1 
ATOM   2928 C  CG  . ASP B 1 174 ? 37.200 3.035   33.701 1.00 21.49 ? 165 ASP B CG  1 
ATOM   2929 O  OD1 . ASP B 1 174 ? 36.444 2.428   32.889 1.00 19.92 ? 165 ASP B OD1 1 
ATOM   2930 O  OD2 . ASP B 1 174 ? 36.831 4.068   34.361 1.00 21.45 ? 165 ASP B OD2 1 
ATOM   2931 N  N   . VAL B 1 175 ? 38.163 0.301   31.233 1.00 19.48 ? 166 VAL B N   1 
ATOM   2932 C  CA  . VAL B 1 175 ? 37.919 0.289   29.793 1.00 19.48 ? 166 VAL B CA  1 
ATOM   2933 C  C   . VAL B 1 175 ? 36.473 0.668   29.368 1.00 19.23 ? 166 VAL B C   1 
ATOM   2934 O  O   . VAL B 1 175 ? 36.049 0.350   28.257 1.00 20.13 ? 166 VAL B O   1 
ATOM   2935 C  CB  . VAL B 1 175 ? 38.389 -1.036  29.174 1.00 20.36 ? 166 VAL B CB  1 
ATOM   2936 C  CG1 . VAL B 1 175 ? 39.942 -1.168  29.417 1.00 22.41 ? 166 VAL B CG1 1 
ATOM   2937 C  CG2 . VAL B 1 175 ? 37.574 -2.226  29.697 1.00 21.89 ? 166 VAL B CG2 1 
ATOM   2938 N  N   . TRP B 1 176 ? 35.742 1.393   30.218 1.00 19.49 ? 167 TRP B N   1 
ATOM   2939 C  CA  . TRP B 1 176 ? 34.575 2.146   29.751 1.00 18.98 ? 167 TRP B CA  1 
ATOM   2940 C  C   . TRP B 1 176 ? 35.142 3.114   28.724 1.00 19.29 ? 167 TRP B C   1 
ATOM   2941 O  O   . TRP B 1 176 ? 36.217 3.673   28.934 1.00 19.18 ? 167 TRP B O   1 
ATOM   2942 C  CB  . TRP B 1 176 ? 33.909 2.921   30.889 1.00 18.94 ? 167 TRP B CB  1 
ATOM   2943 C  CG  . TRP B 1 176 ? 33.077 2.135   31.834 1.00 19.93 ? 167 TRP B CG  1 
ATOM   2944 C  CD1 . TRP B 1 176 ? 33.477 1.092   32.612 1.00 20.81 ? 167 TRP B CD1 1 
ATOM   2945 C  CD2 . TRP B 1 176 ? 31.694 2.327   32.096 1.00 21.44 ? 167 TRP B CD2 1 
ATOM   2946 N  NE1 . TRP B 1 176 ? 32.424 0.608   33.344 1.00 20.90 ? 167 TRP B NE1 1 
ATOM   2947 C  CE2 . TRP B 1 176 ? 31.311 1.362   33.061 1.00 17.29 ? 167 TRP B CE2 1 
ATOM   2948 C  CE3 . TRP B 1 176 ? 30.734 3.216   31.609 1.00 20.77 ? 167 TRP B CE3 1 
ATOM   2949 C  CZ2 . TRP B 1 176 ? 30.017 1.284   33.563 1.00 19.80 ? 167 TRP B CZ2 1 
ATOM   2950 C  CZ3 . TRP B 1 176 ? 29.449 3.153   32.108 1.00 21.06 ? 167 TRP B CZ3 1 
ATOM   2951 C  CH2 . TRP B 1 176 ? 29.085 2.174   33.060 1.00 21.73 ? 167 TRP B CH2 1 
ATOM   2952 N  N   . GLU B 1 177 ? 34.417 3.346   27.642 1.00 18.51 ? 168 GLU B N   1 
ATOM   2953 C  CA  . GLU B 1 177 ? 34.832 4.311   26.614 1.00 19.26 ? 168 GLU B CA  1 
ATOM   2954 C  C   . GLU B 1 177 ? 35.112 5.739   27.141 1.00 18.92 ? 168 GLU B C   1 
ATOM   2955 O  O   . GLU B 1 177 ? 36.049 6.383   26.672 1.00 18.67 ? 168 GLU B O   1 
ATOM   2956 C  CB  . GLU B 1 177 ? 33.834 4.308   25.467 1.00 19.51 ? 168 GLU B CB  1 
ATOM   2957 C  CG  . GLU B 1 177 ? 34.145 3.179   24.451 1.00 19.30 ? 168 GLU B CG  1 
ATOM   2958 C  CD  . GLU B 1 177 ? 33.029 2.782   23.492 1.00 18.98 ? 168 GLU B CD  1 
ATOM   2959 O  OE1 . GLU B 1 177 ? 31.856 3.153   23.722 1.00 19.49 ? 168 GLU B OE1 1 
ATOM   2960 O  OE2 . GLU B 1 177 ? 33.378 2.084   22.483 1.00 18.56 ? 168 GLU B OE2 1 
ATOM   2961 N  N   . HIS B 1 178 ? 34.360 6.199   28.137 1.00 19.70 ? 169 HIS B N   1 
ATOM   2962 C  CA  . HIS B 1 178 ? 34.652 7.474   28.768 1.00 20.61 ? 169 HIS B CA  1 
ATOM   2963 C  C   . HIS B 1 178 ? 36.088 7.591   29.282 1.00 21.92 ? 169 HIS B C   1 
ATOM   2964 O  O   . HIS B 1 178 ? 36.562 8.708   29.385 1.00 22.92 ? 169 HIS B O   1 
ATOM   2965 C  CB  . HIS B 1 178 ? 33.648 7.862   29.876 1.00 20.93 ? 169 HIS B CB  1 
ATOM   2966 C  CG  . HIS B 1 178 ? 33.698 7.025   31.124 1.00 20.48 ? 169 HIS B CG  1 
ATOM   2967 N  ND1 . HIS B 1 178 ? 32.605 6.314   31.578 1.00 18.52 ? 169 HIS B ND1 1 
ATOM   2968 C  CD2 . HIS B 1 178 ? 34.671 6.858   32.055 1.00 22.20 ? 169 HIS B CD2 1 
ATOM   2969 C  CE1 . HIS B 1 178 ? 32.930 5.721   32.730 1.00 21.50 ? 169 HIS B CE1 1 
ATOM   2970 N  NE2 . HIS B 1 178 ? 34.183 6.024   33.036 1.00 20.50 ? 169 HIS B NE2 1 
ATOM   2971 N  N   . ALA B 1 179 ? 36.755 6.467   29.615 1.00 21.69 ? 170 ALA B N   1 
ATOM   2972 C  CA  . ALA B 1 179 ? 38.145 6.522   30.148 1.00 20.73 ? 170 ALA B CA  1 
ATOM   2973 C  C   . ALA B 1 179 ? 39.169 6.991   29.129 1.00 20.46 ? 170 ALA B C   1 
ATOM   2974 O  O   . ALA B 1 179 ? 40.258 7.454   29.520 1.00 20.55 ? 170 ALA B O   1 
ATOM   2975 C  CB  . ALA B 1 179 ? 38.598 5.159   30.687 1.00 20.92 ? 170 ALA B CB  1 
ATOM   2976 N  N   . TYR B 1 180 ? 38.848 6.819   27.828 1.00 20.81 ? 171 TYR B N   1 
ATOM   2977 C  CA  . TYR B 1 180 ? 39.829 6.911   26.764 1.00 20.27 ? 171 TYR B CA  1 
ATOM   2978 C  C   . TYR B 1 180 ? 39.380 7.530   25.416 1.00 20.48 ? 171 TYR B C   1 
ATOM   2979 O  O   . TYR B 1 180 ? 40.210 7.675   24.513 1.00 21.99 ? 171 TYR B O   1 
ATOM   2980 C  CB  . TYR B 1 180 ? 40.427 5.523   26.481 1.00 20.40 ? 171 TYR B CB  1 
ATOM   2981 C  CG  . TYR B 1 180 ? 39.481 4.465   25.889 1.00 19.01 ? 171 TYR B CG  1 
ATOM   2982 C  CD1 . TYR B 1 180 ? 39.235 4.389   24.532 1.00 19.80 ? 171 TYR B CD1 1 
ATOM   2983 C  CD2 . TYR B 1 180 ? 38.947 3.467   26.704 1.00 18.77 ? 171 TYR B CD2 1 
ATOM   2984 C  CE1 . TYR B 1 180 ? 38.434 3.377   24.014 1.00 19.78 ? 171 TYR B CE1 1 
ATOM   2985 C  CE2 . TYR B 1 180 ? 38.119 2.444   26.194 1.00 19.46 ? 171 TYR B CE2 1 
ATOM   2986 C  CZ  . TYR B 1 180 ? 37.885 2.401   24.840 1.00 21.70 ? 171 TYR B CZ  1 
ATOM   2987 O  OH  . TYR B 1 180 ? 37.083 1.398   24.298 1.00 19.63 ? 171 TYR B OH  1 
ATOM   2988 N  N   . TYR B 1 181 ? 38.097 7.872   25.270 1.00 20.12 ? 172 TYR B N   1 
ATOM   2989 C  CA  . TYR B 1 181 ? 37.583 8.228   23.935 1.00 20.96 ? 172 TYR B CA  1 
ATOM   2990 C  C   . TYR B 1 181 ? 38.143 9.598   23.473 1.00 20.64 ? 172 TYR B C   1 
ATOM   2991 O  O   . TYR B 1 181 ? 38.409 9.801   22.290 1.00 20.86 ? 172 TYR B O   1 
ATOM   2992 C  CB  . TYR B 1 181 ? 36.032 8.197   23.881 1.00 20.64 ? 172 TYR B CB  1 
ATOM   2993 C  CG  . TYR B 1 181 ? 35.584 7.706   22.538 1.00 20.54 ? 172 TYR B CG  1 
ATOM   2994 C  CD1 . TYR B 1 181 ? 35.711 6.382   22.217 1.00 21.07 ? 172 TYR B CD1 1 
ATOM   2995 C  CD2 . TYR B 1 181 ? 35.192 8.586   21.533 1.00 20.80 ? 172 TYR B CD2 1 
ATOM   2996 C  CE1 . TYR B 1 181 ? 35.403 5.914   20.971 1.00 18.28 ? 172 TYR B CE1 1 
ATOM   2997 C  CE2 . TYR B 1 181 ? 34.889 8.123   20.271 1.00 20.83 ? 172 TYR B CE2 1 
ATOM   2998 C  CZ  . TYR B 1 181 ? 34.988 6.803   19.993 1.00 17.84 ? 172 TYR B CZ  1 
ATOM   2999 O  OH  . TYR B 1 181 ? 34.715 6.307   18.746 1.00 23.19 ? 172 TYR B OH  1 
ATOM   3000 N  N   . LEU B 1 182 ? 38.297 10.561  24.386 1.00 22.22 ? 173 LEU B N   1 
ATOM   3001 C  CA  . LEU B 1 182 ? 38.679 11.920  23.905 1.00 22.38 ? 173 LEU B CA  1 
ATOM   3002 C  C   . LEU B 1 182 ? 40.053 11.919  23.233 1.00 22.02 ? 173 LEU B C   1 
ATOM   3003 O  O   . LEU B 1 182 ? 40.278 12.646  22.262 1.00 22.93 ? 173 LEU B O   1 
ATOM   3004 C  CB  . LEU B 1 182 ? 38.618 12.963  25.058 1.00 22.16 ? 173 LEU B CB  1 
ATOM   3005 C  CG  . LEU B 1 182 ? 37.227 13.263  25.637 1.00 23.26 ? 173 LEU B CG  1 
ATOM   3006 C  CD1 . LEU B 1 182 ? 37.236 14.361  26.715 1.00 26.61 ? 173 LEU B CD1 1 
ATOM   3007 C  CD2 . LEU B 1 182 ? 36.225 13.656  24.582 1.00 25.09 ? 173 LEU B CD2 1 
ATOM   3008 N  N   . LYS B 1 183 ? 40.971 11.113  23.751 1.00 21.83 ? 174 LYS B N   1 
ATOM   3009 C  CA  . LYS B 1 183 ? 42.339 11.046  23.273 1.00 23.55 ? 174 LYS B CA  1 
ATOM   3010 C  C   . LYS B 1 183 ? 42.550 9.906   22.267 1.00 22.65 ? 174 LYS B C   1 
ATOM   3011 O  O   . LYS B 1 183 ? 43.230 10.103  21.272 1.00 22.21 ? 174 LYS B O   1 
ATOM   3012 C  CB  . LYS B 1 183 ? 43.309 10.901  24.451 1.00 24.71 ? 174 LYS B CB  1 
ATOM   3013 C  CG  . LYS B 1 183 ? 44.775 10.900  24.033 1.00 25.23 ? 174 LYS B CG  1 
ATOM   3014 C  CD  . LYS B 1 183 ? 45.707 11.028  25.156 1.00 27.08 ? 174 LYS B CD  1 
ATOM   3015 C  CE  . LYS B 1 183 ? 47.153 10.917  24.658 1.00 31.90 ? 174 LYS B CE  1 
ATOM   3016 N  NZ  . LYS B 1 183 ? 47.632 12.178  24.022 1.00 36.55 ? 174 LYS B NZ  1 
ATOM   3017 N  N   . TYR B 1 184 ? 41.969 8.729   22.520 1.00 22.38 ? 175 TYR B N   1 
ATOM   3018 C  CA  . TYR B 1 184 ? 42.267 7.501   21.753 1.00 21.60 ? 175 TYR B CA  1 
ATOM   3019 C  C   . TYR B 1 184 ? 41.116 7.011   20.879 1.00 21.38 ? 175 TYR B C   1 
ATOM   3020 O  O   . TYR B 1 184 ? 41.307 6.091   20.085 1.00 21.54 ? 175 TYR B O   1 
ATOM   3021 C  CB  . TYR B 1 184 ? 42.781 6.362   22.696 1.00 21.10 ? 175 TYR B CB  1 
ATOM   3022 C  CG  . TYR B 1 184 ? 44.038 6.751   23.478 1.00 23.25 ? 175 TYR B CG  1 
ATOM   3023 C  CD1 . TYR B 1 184 ? 43.972 7.148   24.821 1.00 24.27 ? 175 TYR B CD1 1 
ATOM   3024 C  CD2 . TYR B 1 184 ? 45.276 6.726   22.868 1.00 21.73 ? 175 TYR B CD2 1 
ATOM   3025 C  CE1 . TYR B 1 184 ? 45.123 7.522   25.516 1.00 19.43 ? 175 TYR B CE1 1 
ATOM   3026 C  CE2 . TYR B 1 184 ? 46.442 7.095   23.555 1.00 22.46 ? 175 TYR B CE2 1 
ATOM   3027 C  CZ  . TYR B 1 184 ? 46.347 7.473   24.893 1.00 20.17 ? 175 TYR B CZ  1 
ATOM   3028 O  OH  . TYR B 1 184 ? 47.488 7.835   25.550 1.00 24.12 ? 175 TYR B OH  1 
ATOM   3029 N  N   . GLN B 1 185 ? 39.933 7.623   21.007 1.00 21.77 ? 176 GLN B N   1 
ATOM   3030 C  CA  . GLN B 1 185 ? 38.733 7.194   20.258 1.00 21.88 ? 176 GLN B CA  1 
ATOM   3031 C  C   . GLN B 1 185 ? 38.554 5.652   20.304 1.00 21.47 ? 176 GLN B C   1 
ATOM   3032 O  O   . GLN B 1 185 ? 38.548 5.059   21.414 1.00 20.70 ? 176 GLN B O   1 
ATOM   3033 C  CB  . GLN B 1 185 ? 38.713 7.830   18.838 1.00 21.43 ? 176 GLN B CB  1 
ATOM   3034 C  CG  . GLN B 1 185 ? 38.694 9.353   18.911 1.00 25.76 ? 176 GLN B CG  1 
ATOM   3035 C  CD  . GLN B 1 185 ? 40.074 9.966   19.013 1.00 27.07 ? 176 GLN B CD  1 
ATOM   3036 O  OE1 . GLN B 1 185 ? 40.947 9.624   18.211 1.00 28.05 ? 176 GLN B OE1 1 
ATOM   3037 N  NE2 . GLN B 1 185 ? 40.288 10.873  19.992 1.00 24.89 ? 176 GLN B NE2 1 
ATOM   3038 N  N   . ASN B 1 186 ? 38.384 4.995   19.153 1.00 21.93 ? 177 ASN B N   1 
ATOM   3039 C  CA  . ASN B 1 186 ? 38.181 3.539   19.109 1.00 22.19 ? 177 ASN B CA  1 
ATOM   3040 C  C   . ASN B 1 186 ? 39.406 2.707   19.472 1.00 21.50 ? 177 ASN B C   1 
ATOM   3041 O  O   . ASN B 1 186 ? 39.289 1.492   19.610 1.00 22.54 ? 177 ASN B O   1 
ATOM   3042 C  CB  . ASN B 1 186 ? 37.711 3.094   17.708 1.00 23.22 ? 177 ASN B CB  1 
ATOM   3043 C  CG  . ASN B 1 186 ? 38.765 3.328   16.642 1.00 25.87 ? 177 ASN B CG  1 
ATOM   3044 O  OD1 . ASN B 1 186 ? 39.315 2.370   16.053 1.00 31.15 ? 177 ASN B OD1 1 
ATOM   3045 N  ND2 . ASN B 1 186 ? 39.046 4.587   16.377 1.00 24.36 ? 177 ASN B ND2 1 
ATOM   3046 N  N   . ARG B 1 187 ? 40.576 3.346   19.604 1.00 22.06 ? 178 ARG B N   1 
ATOM   3047 C  CA  . ARG B 1 187 ? 41.853 2.616   19.720 1.00 22.44 ? 178 ARG B CA  1 
ATOM   3048 C  C   . ARG B 1 187 ? 42.149 2.160   21.163 1.00 22.77 ? 178 ARG B C   1 
ATOM   3049 O  O   . ARG B 1 187 ? 43.152 2.552   21.798 1.00 22.73 ? 178 ARG B O   1 
ATOM   3050 C  CB  . ARG B 1 187 ? 42.985 3.442   19.089 1.00 22.73 ? 178 ARG B CB  1 
ATOM   3051 C  CG  . ARG B 1 187 ? 42.680 3.932   17.646 1.00 24.14 ? 178 ARG B CG  1 
ATOM   3052 C  CD  . ARG B 1 187 ? 43.804 4.809   17.023 1.00 24.88 ? 178 ARG B CD  1 
ATOM   3053 N  NE  . ARG B 1 187 ? 44.110 5.949   17.870 1.00 26.10 ? 178 ARG B NE  1 
ATOM   3054 C  CZ  . ARG B 1 187 ? 43.405 7.066   17.880 1.00 27.92 ? 178 ARG B CZ  1 
ATOM   3055 N  NH1 . ARG B 1 187 ? 42.372 7.195   17.067 1.00 32.66 ? 178 ARG B NH1 1 
ATOM   3056 N  NH2 . ARG B 1 187 ? 43.710 8.040   18.718 1.00 30.15 ? 178 ARG B NH2 1 
ATOM   3057 N  N   . ARG B 1 188 ? 41.277 1.298   21.667 1.00 21.95 ? 179 ARG B N   1 
ATOM   3058 C  CA  . ARG B 1 188 ? 41.394 0.813   23.037 1.00 22.10 ? 179 ARG B CA  1 
ATOM   3059 C  C   . ARG B 1 188 ? 42.764 0.140   23.279 1.00 22.36 ? 179 ARG B C   1 
ATOM   3060 O  O   . ARG B 1 188 ? 43.377 0.402   24.311 1.00 21.57 ? 179 ARG B O   1 
ATOM   3061 C  CB  . ARG B 1 188 ? 40.244 -0.139  23.435 1.00 22.45 ? 179 ARG B CB  1 
ATOM   3062 C  CG  . ARG B 1 188 ? 40.316 -0.489  24.945 1.00 22.84 ? 179 ARG B CG  1 
ATOM   3063 C  CD  . ARG B 1 188 ? 39.428 -1.644  25.320 1.00 23.36 ? 179 ARG B CD  1 
ATOM   3064 N  NE  . ARG B 1 188 ? 38.000 -1.327  25.286 1.00 22.09 ? 179 ARG B NE  1 
ATOM   3065 C  CZ  . ARG B 1 188 ? 37.059 -2.145  25.728 1.00 19.22 ? 179 ARG B CZ  1 
ATOM   3066 N  NH1 . ARG B 1 188 ? 37.391 -3.322  26.218 1.00 22.67 ? 179 ARG B NH1 1 
ATOM   3067 N  NH2 . ARG B 1 188 ? 35.810 -1.782  25.717 1.00 23.62 ? 179 ARG B NH2 1 
ATOM   3068 N  N   . PRO B 1 189 ? 43.260 -0.695  22.331 1.00 21.52 ? 180 PRO B N   1 
ATOM   3069 C  CA  . PRO B 1 189 ? 44.615 -1.239  22.548 1.00 22.50 ? 180 PRO B CA  1 
ATOM   3070 C  C   . PRO B 1 189 ? 45.728 -0.183  22.777 1.00 22.86 ? 180 PRO B C   1 
ATOM   3071 O  O   . PRO B 1 189 ? 46.600 -0.390  23.640 1.00 23.19 ? 180 PRO B O   1 
ATOM   3072 C  CB  . PRO B 1 189 ? 44.868 -2.053  21.272 1.00 22.17 ? 180 PRO B CB  1 
ATOM   3073 C  CG  . PRO B 1 189 ? 43.519 -2.496  20.863 1.00 23.13 ? 180 PRO B CG  1 
ATOM   3074 C  CD  . PRO B 1 189 ? 42.676 -1.252  21.091 1.00 22.71 ? 180 PRO B CD  1 
ATOM   3075 N  N   . GLU B 1 190 ? 45.691 0.922   22.023 1.00 22.49 ? 181 GLU B N   1 
ATOM   3076 C  CA  . GLU B 1 190 ? 46.625 2.031   22.197 1.00 22.18 ? 181 GLU B CA  1 
ATOM   3077 C  C   . GLU B 1 190 ? 46.495 2.676   23.598 1.00 22.07 ? 181 GLU B C   1 
ATOM   3078 O  O   . GLU B 1 190 ? 47.499 2.935   24.257 1.00 21.75 ? 181 GLU B O   1 
ATOM   3079 C  CB  . GLU B 1 190 ? 46.440 3.086   21.097 1.00 22.85 ? 181 GLU B CB  1 
ATOM   3080 C  CG  . GLU B 1 190 ? 47.544 4.115   21.067 1.00 23.83 ? 181 GLU B CG  1 
ATOM   3081 C  CD  . GLU B 1 190 ? 47.445 5.093   19.945 1.00 24.04 ? 181 GLU B CD  1 
ATOM   3082 O  OE1 . GLU B 1 190 ? 46.676 4.854   18.988 1.00 24.83 ? 181 GLU B OE1 1 
ATOM   3083 O  OE2 . GLU B 1 190 ? 48.174 6.117   19.999 1.00 31.24 ? 181 GLU B OE2 1 
ATOM   3084 N  N   . PHE B 1 191 ? 45.261 2.931   24.040 1.00 21.53 ? 182 PHE B N   1 
ATOM   3085 C  CA  . PHE B 1 191 ? 44.996 3.398   25.391 1.00 21.50 ? 182 PHE B CA  1 
ATOM   3086 C  C   . PHE B 1 191 ? 45.624 2.426   26.440 1.00 22.16 ? 182 PHE B C   1 
ATOM   3087 O  O   . PHE B 1 191 ? 46.325 2.881   27.348 1.00 23.44 ? 182 PHE B O   1 
ATOM   3088 C  CB  . PHE B 1 191 ? 43.501 3.536   25.669 1.00 20.64 ? 182 PHE B CB  1 
ATOM   3089 C  CG  . PHE B 1 191 ? 43.166 3.709   27.176 1.00 20.45 ? 182 PHE B CG  1 
ATOM   3090 C  CD1 . PHE B 1 191 ? 43.612 4.814   27.877 1.00 22.21 ? 182 PHE B CD1 1 
ATOM   3091 C  CD2 . PHE B 1 191 ? 42.405 2.767   27.854 1.00 21.22 ? 182 PHE B CD2 1 
ATOM   3092 C  CE1 . PHE B 1 191 ? 43.333 4.961   29.246 1.00 21.06 ? 182 PHE B CE1 1 
ATOM   3093 C  CE2 . PHE B 1 191 ? 42.097 2.929   29.205 1.00 18.84 ? 182 PHE B CE2 1 
ATOM   3094 C  CZ  . PHE B 1 191 ? 42.568 4.009   29.897 1.00 22.38 ? 182 PHE B CZ  1 
ATOM   3095 N  N   . VAL B 1 192 ? 45.363 1.123   26.313 1.00 22.56 ? 183 VAL B N   1 
ATOM   3096 C  CA  . VAL B 1 192 ? 45.904 0.117   27.277 1.00 21.61 ? 183 VAL B CA  1 
ATOM   3097 C  C   . VAL B 1 192 ? 47.442 0.184   27.324 1.00 23.45 ? 183 VAL B C   1 
ATOM   3098 O  O   . VAL B 1 192 ? 48.061 0.174   28.422 1.00 24.89 ? 183 VAL B O   1 
ATOM   3099 C  CB  . VAL B 1 192 ? 45.415 -1.323  26.950 1.00 20.68 ? 183 VAL B CB  1 
ATOM   3100 C  CG1 . VAL B 1 192 ? 46.132 -2.385  27.845 1.00 24.66 ? 183 VAL B CG1 1 
ATOM   3101 C  CG2 . VAL B 1 192 ? 43.896 -1.432  27.146 1.00 19.11 ? 183 VAL B CG2 1 
ATOM   3102 N  N   . THR B 1 193 ? 48.060 0.253   26.146 1.00 23.04 ? 184 THR B N   1 
ATOM   3103 C  CA  . THR B 1 193 ? 49.542 0.394   26.026 1.00 23.00 ? 184 THR B CA  1 
ATOM   3104 C  C   . THR B 1 193 ? 50.070 1.618   26.797 1.00 24.19 ? 184 THR B C   1 
ATOM   3105 O  O   . THR B 1 193 ? 51.071 1.523   27.489 1.00 24.37 ? 184 THR B O   1 
ATOM   3106 C  CB  . THR B 1 193 ? 49.932 0.514   24.542 1.00 23.20 ? 184 THR B CB  1 
ATOM   3107 O  OG1 . THR B 1 193 ? 49.565 -0.695  23.870 1.00 24.19 ? 184 THR B OG1 1 
ATOM   3108 C  CG2 . THR B 1 193 ? 51.413 0.770   24.343 1.00 24.54 ? 184 THR B CG2 1 
ATOM   3109 N  N   . ASN B 1 194 ? 49.390 2.759   26.654 1.00 22.82 ? 185 ASN B N   1 
ATOM   3110 C  CA  . ASN B 1 194 ? 49.749 3.971   27.382 1.00 23.93 ? 185 ASN B CA  1 
ATOM   3111 C  C   . ASN B 1 194 ? 49.467 3.933   28.865 1.00 24.67 ? 185 ASN B C   1 
ATOM   3112 O  O   . ASN B 1 194 ? 50.185 4.573   29.699 1.00 23.71 ? 185 ASN B O   1 
ATOM   3113 C  CB  . ASN B 1 194 ? 49.025 5.150   26.754 1.00 24.69 ? 185 ASN B CB  1 
ATOM   3114 C  CG  . ASN B 1 194 ? 49.707 5.631   25.505 1.00 24.01 ? 185 ASN B CG  1 
ATOM   3115 O  OD1 . ASN B 1 194 ? 49.361 5.228   24.381 1.00 23.42 ? 185 ASN B OD1 1 
ATOM   3116 N  ND2 . ASN B 1 194 ? 50.699 6.490   25.690 1.00 19.57 ? 185 ASN B ND2 1 
ATOM   3117 N  N   . TRP B 1 195 ? 48.401 3.237   29.231 1.00 24.98 ? 186 TRP B N   1 
ATOM   3118 C  CA  . TRP B 1 195 ? 48.043 3.151   30.656 1.00 25.36 ? 186 TRP B CA  1 
ATOM   3119 C  C   . TRP B 1 195 ? 49.182 2.505   31.477 1.00 24.84 ? 186 TRP B C   1 
ATOM   3120 O  O   . TRP B 1 195 ? 49.482 2.921   32.611 1.00 24.77 ? 186 TRP B O   1 
ATOM   3121 C  CB  . TRP B 1 195 ? 46.698 2.452   30.845 1.00 26.03 ? 186 TRP B CB  1 
ATOM   3122 C  CG  . TRP B 1 195 ? 46.389 2.095   32.323 1.00 26.44 ? 186 TRP B CG  1 
ATOM   3123 C  CD1 . TRP B 1 195 ? 45.841 2.895   33.284 1.00 25.16 ? 186 TRP B CD1 1 
ATOM   3124 C  CD2 . TRP B 1 195 ? 46.662 0.840   32.941 1.00 25.01 ? 186 TRP B CD2 1 
ATOM   3125 N  NE1 . TRP B 1 195 ? 45.736 2.189   34.481 1.00 25.71 ? 186 TRP B NE1 1 
ATOM   3126 C  CE2 . TRP B 1 195 ? 46.240 0.927   34.290 1.00 26.26 ? 186 TRP B CE2 1 
ATOM   3127 C  CE3 . TRP B 1 195 ? 47.208 -0.363  32.479 1.00 28.97 ? 186 TRP B CE3 1 
ATOM   3128 C  CZ2 . TRP B 1 195 ? 46.353 -0.152  35.180 1.00 27.57 ? 186 TRP B CZ2 1 
ATOM   3129 C  CZ3 . TRP B 1 195 ? 47.322 -1.435  33.370 1.00 28.70 ? 186 TRP B CZ3 1 
ATOM   3130 C  CH2 . TRP B 1 195 ? 46.898 -1.318  34.697 1.00 27.84 ? 186 TRP B CH2 1 
ATOM   3131 N  N   . TRP B 1 196 ? 49.865 1.541   30.881 1.00 24.70 ? 187 TRP B N   1 
ATOM   3132 C  CA  . TRP B 1 196 ? 51.034 0.946   31.534 1.00 25.75 ? 187 TRP B CA  1 
ATOM   3133 C  C   . TRP B 1 196 ? 52.144 1.943   31.955 1.00 26.61 ? 187 TRP B C   1 
ATOM   3134 O  O   . TRP B 1 196 ? 52.800 1.740   32.998 1.00 27.33 ? 187 TRP B O   1 
ATOM   3135 C  CB  . TRP B 1 196 ? 51.605 -0.201  30.684 1.00 25.59 ? 187 TRP B CB  1 
ATOM   3136 C  CG  . TRP B 1 196 ? 50.736 -1.411  30.630 1.00 25.37 ? 187 TRP B CG  1 
ATOM   3137 C  CD1 . TRP B 1 196 ? 49.976 -1.814  29.567 1.00 26.62 ? 187 TRP B CD1 1 
ATOM   3138 C  CD2 . TRP B 1 196 ? 50.553 -2.405  31.643 1.00 27.42 ? 187 TRP B CD2 1 
ATOM   3139 N  NE1 . TRP B 1 196 ? 49.350 -2.982  29.844 1.00 26.22 ? 187 TRP B NE1 1 
ATOM   3140 C  CE2 . TRP B 1 196 ? 49.665 -3.368  31.120 1.00 27.53 ? 187 TRP B CE2 1 
ATOM   3141 C  CE3 . TRP B 1 196 ? 51.084 -2.604  32.928 1.00 26.99 ? 187 TRP B CE3 1 
ATOM   3142 C  CZ2 . TRP B 1 196 ? 49.272 -4.495  31.845 1.00 27.12 ? 187 TRP B CZ2 1 
ATOM   3143 C  CZ3 . TRP B 1 196 ? 50.670 -3.703  33.660 1.00 25.29 ? 187 TRP B CZ3 1 
ATOM   3144 C  CH2 . TRP B 1 196 ? 49.801 -4.645  33.116 1.00 26.59 ? 187 TRP B CH2 1 
ATOM   3145 N  N   . HIS B 1 197 ? 52.318 3.034   31.210 1.00 25.00 ? 188 HIS B N   1 
ATOM   3146 C  CA  . HIS B 1 197 ? 53.283 4.090   31.585 1.00 25.79 ? 188 HIS B CA  1 
ATOM   3147 C  C   . HIS B 1 197 ? 52.913 4.871   32.856 1.00 25.94 ? 188 HIS B C   1 
ATOM   3148 O  O   . HIS B 1 197 ? 53.698 5.719   33.303 1.00 26.56 ? 188 HIS B O   1 
ATOM   3149 C  CB  . HIS B 1 197 ? 53.426 5.077   30.441 1.00 26.10 ? 188 HIS B CB  1 
ATOM   3150 C  CG  . HIS B 1 197 ? 53.868 4.446   29.156 1.00 25.89 ? 188 HIS B CG  1 
ATOM   3151 N  ND1 . HIS B 1 197 ? 53.353 4.785   27.923 1.00 29.27 ? 188 HIS B ND1 1 
ATOM   3152 C  CD2 . HIS B 1 197 ? 54.780 3.473   28.929 1.00 27.64 ? 188 HIS B CD2 1 
ATOM   3153 C  CE1 . HIS B 1 197 ? 53.949 4.060   26.991 1.00 24.55 ? 188 HIS B CE1 1 
ATOM   3154 N  NE2 . HIS B 1 197 ? 54.807 3.249   27.575 1.00 28.23 ? 188 HIS B NE2 1 
ATOM   3155 N  N   . THR B 1 198 ? 51.722 4.628   33.404 1.00 26.61 ? 189 THR B N   1 
ATOM   3156 C  CA  . THR B 1 198 ? 51.207 5.371   34.556 1.00 26.55 ? 189 THR B CA  1 
ATOM   3157 C  C   . THR B 1 198 ? 51.189 4.589   35.841 1.00 26.83 ? 189 THR B C   1 
ATOM   3158 O  O   . THR B 1 198 ? 50.959 5.170   36.896 1.00 27.13 ? 189 THR B O   1 
ATOM   3159 C  CB  . THR B 1 198 ? 49.758 5.914   34.338 1.00 25.95 ? 189 THR B CB  1 
ATOM   3160 O  OG1 . THR B 1 198 ? 48.805 4.836   34.356 1.00 26.42 ? 189 THR B OG1 1 
ATOM   3161 C  CG2 . THR B 1 198 ? 49.648 6.693   33.040 1.00 25.89 ? 189 THR B CG2 1 
ATOM   3162 N  N   . VAL B 1 199 ? 51.448 3.289   35.774 1.00 28.04 ? 190 VAL B N   1 
ATOM   3163 C  CA  . VAL B 1 199 ? 51.152 2.383   36.912 1.00 29.22 ? 190 VAL B CA  1 
ATOM   3164 C  C   . VAL B 1 199 ? 52.046 2.672   38.122 1.00 30.28 ? 190 VAL B C   1 
ATOM   3165 O  O   . VAL B 1 199 ? 53.267 2.740   37.994 1.00 31.23 ? 190 VAL B O   1 
ATOM   3166 C  CB  . VAL B 1 199 ? 51.282 0.878   36.535 1.00 28.71 ? 190 VAL B CB  1 
ATOM   3167 C  CG1 . VAL B 1 199 ? 51.116 -0.003  37.764 1.00 29.59 ? 190 VAL B CG1 1 
ATOM   3168 C  CG2 . VAL B 1 199 ? 50.282 0.474   35.471 1.00 30.91 ? 190 VAL B CG2 1 
ATOM   3169 N  N   . ASN B 1 200 ? 51.403 2.860   39.275 1.00 30.61 ? 191 ASN B N   1 
ATOM   3170 C  CA  . ASN B 1 200 ? 52.057 3.150   40.548 1.00 30.67 ? 191 ASN B CA  1 
ATOM   3171 C  C   . ASN B 1 200 ? 52.375 1.837   41.242 1.00 30.31 ? 191 ASN B C   1 
ATOM   3172 O  O   . ASN B 1 200 ? 51.557 1.311   42.027 1.00 27.53 ? 191 ASN B O   1 
ATOM   3173 C  CB  . ASN B 1 200 ? 51.145 4.003   41.434 1.00 30.80 ? 191 ASN B CB  1 
ATOM   3174 C  CG  . ASN B 1 200 ? 51.850 4.517   42.689 1.00 31.07 ? 191 ASN B CG  1 
ATOM   3175 O  OD1 . ASN B 1 200 ? 52.939 4.054   43.023 1.00 33.45 ? 191 ASN B OD1 1 
ATOM   3176 N  ND2 . ASN B 1 200 ? 51.225 5.468   43.384 1.00 29.88 ? 191 ASN B ND2 1 
ATOM   3177 N  N   . TRP B 1 201 ? 53.577 1.318   40.977 1.00 31.40 ? 192 TRP B N   1 
ATOM   3178 C  CA  . TRP B 1 201 ? 53.966 -0.005  41.526 1.00 33.10 ? 192 TRP B CA  1 
ATOM   3179 C  C   . TRP B 1 201 ? 54.158 0.035   43.039 1.00 34.42 ? 192 TRP B C   1 
ATOM   3180 O  O   . TRP B 1 201 ? 54.002 -0.984  43.707 1.00 35.38 ? 192 TRP B O   1 
ATOM   3181 C  CB  . TRP B 1 201 ? 55.222 -0.559  40.827 1.00 34.36 ? 192 TRP B CB  1 
ATOM   3182 C  CG  . TRP B 1 201 ? 54.928 -1.036  39.436 1.00 34.76 ? 192 TRP B CG  1 
ATOM   3183 C  CD1 . TRP B 1 201 ? 55.379 -0.505  38.280 1.00 34.16 ? 192 TRP B CD1 1 
ATOM   3184 C  CD2 . TRP B 1 201 ? 54.045 -2.096  39.080 1.00 31.79 ? 192 TRP B CD2 1 
ATOM   3185 N  NE1 . TRP B 1 201 ? 54.848 -1.185  37.206 1.00 35.30 ? 192 TRP B NE1 1 
ATOM   3186 C  CE2 . TRP B 1 201 ? 54.028 -2.170  37.669 1.00 32.55 ? 192 TRP B CE2 1 
ATOM   3187 C  CE3 . TRP B 1 201 ? 53.290 -3.011  39.812 1.00 27.73 ? 192 TRP B CE3 1 
ATOM   3188 C  CZ2 . TRP B 1 201 ? 53.281 -3.119  36.976 1.00 31.21 ? 192 TRP B CZ2 1 
ATOM   3189 C  CZ3 . TRP B 1 201 ? 52.535 -3.955  39.120 1.00 27.96 ? 192 TRP B CZ3 1 
ATOM   3190 C  CH2 . TRP B 1 201 ? 52.528 -3.991  37.719 1.00 28.04 ? 192 TRP B CH2 1 
ATOM   3191 N  N   . ASP B 1 202 ? 54.471 1.204   43.585 1.00 35.61 ? 193 ASP B N   1 
ATOM   3192 C  CA  . ASP B 1 202 ? 54.498 1.352   45.043 1.00 36.99 ? 193 ASP B CA  1 
ATOM   3193 C  C   . ASP B 1 202 ? 53.124 1.043   45.656 1.00 37.96 ? 193 ASP B C   1 
ATOM   3194 O  O   . ASP B 1 202 ? 53.008 0.273   46.614 1.00 38.40 ? 193 ASP B O   1 
ATOM   3195 C  CB  . ASP B 1 202 ? 54.942 2.761   45.416 1.00 39.25 ? 193 ASP B CB  1 
ATOM   3196 C  CG  . ASP B 1 202 ? 56.432 3.021   45.138 1.00 43.26 ? 193 ASP B CG  1 
ATOM   3197 O  OD1 . ASP B 1 202 ? 57.197 2.063   44.881 1.00 48.62 ? 193 ASP B OD1 1 
ATOM   3198 O  OD2 . ASP B 1 202 ? 56.835 4.203   45.194 1.00 45.48 ? 193 ASP B OD2 1 
ATOM   3199 N  N   . ARG B 1 203 ? 52.069 1.598   45.072 1.00 37.87 ? 194 ARG B N   1 
ATOM   3200 C  CA  . ARG B 1 203 ? 50.729 1.361   45.581 1.00 37.26 ? 194 ARG B CA  1 
ATOM   3201 C  C   . ARG B 1 203 ? 50.267 -0.080  45.363 1.00 36.21 ? 194 ARG B C   1 
ATOM   3202 O  O   . ARG B 1 203 ? 49.521 -0.611  46.169 1.00 34.60 ? 194 ARG B O   1 
ATOM   3203 C  CB  . ARG B 1 203 ? 49.732 2.321   44.928 1.00 37.73 ? 194 ARG B CB  1 
ATOM   3204 C  CG  . ARG B 1 203 ? 48.331 2.265   45.557 1.00 39.46 ? 194 ARG B CG  1 
ATOM   3205 C  CD  . ARG B 1 203 ? 48.174 3.329   46.623 1.00 46.00 ? 194 ARG B CD  1 
ATOM   3206 N  NE  . ARG B 1 203 ? 48.150 4.643   45.985 1.00 48.14 ? 194 ARG B NE  1 
ATOM   3207 C  CZ  . ARG B 1 203 ? 48.026 5.796   46.628 1.00 51.22 ? 194 ARG B CZ  1 
ATOM   3208 N  NH1 . ARG B 1 203 ? 47.910 5.829   47.956 1.00 51.37 ? 194 ARG B NH1 1 
ATOM   3209 N  NH2 . ARG B 1 203 ? 48.013 6.928   45.925 1.00 50.60 ? 194 ARG B NH2 1 
ATOM   3210 N  N   . VAL B 1 204 ? 50.679 -0.704  44.258 1.00 36.18 ? 195 VAL B N   1 
ATOM   3211 C  CA  . VAL B 1 204 ? 50.288 -2.084  43.995 1.00 36.44 ? 195 VAL B CA  1 
ATOM   3212 C  C   . VAL B 1 204 ? 50.880 -2.977  45.090 1.00 35.99 ? 195 VAL B C   1 
ATOM   3213 O  O   . VAL B 1 204 ? 50.249 -3.919  45.554 1.00 33.55 ? 195 VAL B O   1 
ATOM   3214 C  CB  . VAL B 1 204 ? 50.756 -2.573  42.590 1.00 35.37 ? 195 VAL B CB  1 
ATOM   3215 C  CG1 . VAL B 1 204 ? 50.306 -3.986  42.347 1.00 34.98 ? 195 VAL B CG1 1 
ATOM   3216 C  CG2 . VAL B 1 204 ? 50.209 -1.664  41.504 1.00 36.12 ? 195 VAL B CG2 1 
ATOM   3217 N  N   . ASN B 1 205 ? 52.097 -2.654  45.483 1.00 37.63 ? 196 ASN B N   1 
ATOM   3218 C  CA  . ASN B 1 205 ? 52.803 -3.384  46.536 1.00 39.46 ? 196 ASN B CA  1 
ATOM   3219 C  C   . ASN B 1 205 ? 52.128 -3.266  47.884 1.00 41.02 ? 196 ASN B C   1 
ATOM   3220 O  O   . ASN B 1 205 ? 52.035 -4.249  48.630 1.00 42.12 ? 196 ASN B O   1 
ATOM   3221 C  CB  . ASN B 1 205 ? 54.241 -2.877  46.662 1.00 40.61 ? 196 ASN B CB  1 
ATOM   3222 C  CG  . ASN B 1 205 ? 55.201 -3.726  45.910 1.00 42.73 ? 196 ASN B CG  1 
ATOM   3223 O  OD1 . ASN B 1 205 ? 55.811 -3.286  44.933 1.00 44.44 ? 196 ASN B OD1 1 
ATOM   3224 N  ND2 . ASN B 1 205 ? 55.314 -4.983  46.331 1.00 44.69 ? 196 ASN B ND2 1 
ATOM   3225 N  N   . GLU B 1 206 ? 51.685 -2.053  48.203 1.00 41.43 ? 197 GLU B N   1 
ATOM   3226 C  CA  . GLU B 1 206 ? 50.988 -1.807  49.467 1.00 42.94 ? 197 GLU B CA  1 
ATOM   3227 C  C   . GLU B 1 206 ? 49.665 -2.589  49.512 1.00 42.45 ? 197 GLU B C   1 
ATOM   3228 O  O   . GLU B 1 206 ? 49.326 -3.223  50.518 1.00 42.07 ? 197 GLU B O   1 
ATOM   3229 C  CB  . GLU B 1 206 ? 50.878 -0.284  49.692 1.00 43.37 ? 197 GLU B CB  1 
ATOM   3230 C  CG  . GLU B 1 206 ? 49.556 0.283   50.181 1.00 47.25 ? 197 GLU B CG  1 
ATOM   3231 C  CD  . GLU B 1 206 ? 49.517 1.821   50.024 1.00 48.50 ? 197 GLU B CD  1 
ATOM   3232 O  OE1 . GLU B 1 206 ? 48.404 2.393   49.848 1.00 55.26 ? 197 GLU B OE1 1 
ATOM   3233 O  OE2 . GLU B 1 206 ? 50.613 2.444   50.046 1.00 54.98 ? 197 GLU B OE2 1 
ATOM   3234 N  N   . LYS B 1 207 ? 48.964 -2.627  48.391 1.00 42.67 ? 198 LYS B N   1 
ATOM   3235 C  CA  . LYS B 1 207 ? 47.703 -3.363  48.291 1.00 43.61 ? 198 LYS B CA  1 
ATOM   3236 C  C   . LYS B 1 207 ? 47.934 -4.862  48.407 1.00 43.22 ? 198 LYS B C   1 
ATOM   3237 O  O   . LYS B 1 207 ? 47.108 -5.580  48.963 1.00 42.09 ? 198 LYS B O   1 
ATOM   3238 C  CB  . LYS B 1 207 ? 47.000 -3.069  46.966 1.00 44.46 ? 198 LYS B CB  1 
ATOM   3239 C  CG  . LYS B 1 207 ? 46.614 -1.603  46.743 1.00 44.80 ? 198 LYS B CG  1 
ATOM   3240 C  CD  . LYS B 1 207 ? 45.256 -1.296  47.303 1.00 45.08 ? 198 LYS B CD  1 
ATOM   3241 C  CE  . LYS B 1 207 ? 44.945 0.185   47.161 1.00 46.38 ? 198 LYS B CE  1 
ATOM   3242 N  NZ  . LYS B 1 207 ? 43.748 0.561   47.945 1.00 43.64 ? 198 LYS B NZ  1 
ATOM   3243 N  N   . TYR B 1 208 ? 49.058 -5.332  47.874 1.00 43.43 ? 199 TYR B N   1 
ATOM   3244 C  CA  . TYR B 1 208 ? 49.442 -6.727  48.026 1.00 44.81 ? 199 TYR B CA  1 
ATOM   3245 C  C   . TYR B 1 208 ? 49.738 -7.086  49.499 1.00 45.32 ? 199 TYR B C   1 
ATOM   3246 O  O   . TYR B 1 208 ? 49.180 -8.046  50.038 1.00 44.57 ? 199 TYR B O   1 
ATOM   3247 C  CB  . TYR B 1 208 ? 50.672 -7.034  47.179 1.00 43.91 ? 199 TYR B CB  1 
ATOM   3248 C  CG  . TYR B 1 208 ? 51.131 -8.454  47.354 1.00 44.30 ? 199 TYR B CG  1 
ATOM   3249 C  CD1 . TYR B 1 208 ? 50.322 -9.508  46.944 1.00 42.02 ? 199 TYR B CD1 1 
ATOM   3250 C  CD2 . TYR B 1 208 ? 52.359 -8.749  47.950 1.00 46.11 ? 199 TYR B CD2 1 
ATOM   3251 C  CE1 . TYR B 1 208 ? 50.715 -10.807 47.103 1.00 44.09 ? 199 TYR B CE1 1 
ATOM   3252 C  CE2 . TYR B 1 208 ? 52.759 -10.070 48.126 1.00 46.52 ? 199 TYR B CE2 1 
ATOM   3253 C  CZ  . TYR B 1 208 ? 51.924 -11.085 47.704 1.00 44.98 ? 199 TYR B CZ  1 
ATOM   3254 O  OH  . TYR B 1 208 ? 52.289 -12.395 47.849 1.00 44.40 ? 199 TYR B OH  1 
ATOM   3255 N  N   . LEU B 1 209 ? 50.619 -6.315  50.132 1.00 46.52 ? 200 LEU B N   1 
ATOM   3256 C  CA  . LEU B 1 209 ? 50.972 -6.552  51.540 1.00 47.85 ? 200 LEU B CA  1 
ATOM   3257 C  C   . LEU B 1 209 ? 49.710 -6.595  52.379 1.00 48.77 ? 200 LEU B C   1 
ATOM   3258 O  O   . LEU B 1 209 ? 49.542 -7.510  53.180 1.00 50.19 ? 200 LEU B O   1 
ATOM   3259 C  CB  . LEU B 1 209 ? 51.943 -5.489  52.090 1.00 48.66 ? 200 LEU B CB  1 
ATOM   3260 C  CG  . LEU B 1 209 ? 53.376 -5.439  51.522 1.00 51.00 ? 200 LEU B CG  1 
ATOM   3261 C  CD1 . LEU B 1 209 ? 54.212 -4.353  52.228 1.00 52.52 ? 200 LEU B CD1 1 
ATOM   3262 C  CD2 . LEU B 1 209 ? 54.094 -6.811  51.592 1.00 51.21 ? 200 LEU B CD2 1 
ATOM   3263 N  N   . GLN B 1 210 ? 48.809 -5.631  52.178 1.00 48.93 ? 201 GLN B N   1 
ATOM   3264 C  CA  . GLN B 1 210 ? 47.536 -5.608  52.902 1.00 50.00 ? 201 GLN B CA  1 
ATOM   3265 C  C   . GLN B 1 210 ? 46.627 -6.799  52.578 1.00 50.94 ? 201 GLN B C   1 
ATOM   3266 O  O   . GLN B 1 210 ? 45.984 -7.343  53.478 1.00 52.20 ? 201 GLN B O   1 
ATOM   3267 C  CB  . GLN B 1 210 ? 46.797 -4.288  52.656 1.00 50.15 ? 201 GLN B CB  1 
ATOM   3268 C  CG  . GLN B 1 210 ? 47.461 -3.083  53.340 1.00 51.13 ? 201 GLN B CG  1 
ATOM   3269 C  CD  . GLN B 1 210 ? 47.023 -1.744  52.780 1.00 51.72 ? 201 GLN B CD  1 
ATOM   3270 O  OE1 . GLN B 1 210 ? 47.670 -0.723  53.032 1.00 55.66 ? 201 GLN B OE1 1 
ATOM   3271 N  NE2 . GLN B 1 210 ? 45.933 -1.734  52.003 1.00 54.83 ? 201 GLN B NE2 1 
ATOM   3272 N  N   . ALA B 1 211 ? 46.586 -7.211  51.309 1.00 50.62 ? 202 ALA B N   1 
ATOM   3273 C  CA  . ALA B 1 211 ? 45.796 -8.365  50.884 1.00 51.28 ? 202 ALA B CA  1 
ATOM   3274 C  C   . ALA B 1 211 ? 46.160 -9.643  51.665 1.00 52.50 ? 202 ALA B C   1 
ATOM   3275 O  O   . ALA B 1 211 ? 45.302 -10.509 51.877 1.00 52.40 ? 202 ALA B O   1 
ATOM   3276 C  CB  . ALA B 1 211 ? 45.940 -8.592  49.376 1.00 50.72 ? 202 ALA B CB  1 
ATOM   3277 N  N   . ILE B 1 212 ? 47.418 -9.741  52.097 1.00 53.33 ? 203 ILE B N   1 
ATOM   3278 C  CA  . ILE B 1 212 ? 47.822 -10.731 53.108 1.00 53.58 ? 203 ILE B CA  1 
ATOM   3279 C  C   . ILE B 1 212 ? 47.504 -10.202 54.523 1.00 54.50 ? 203 ILE B C   1 
ATOM   3280 O  O   . ILE B 1 212 ? 46.359 -10.237 54.991 1.00 55.21 ? 203 ILE B O   1 
ATOM   3281 C  CB  . ILE B 1 212 ? 49.348 -11.024 53.086 1.00 53.90 ? 203 ILE B CB  1 
ATOM   3282 C  CG1 . ILE B 1 212 ? 49.963 -10.974 51.673 1.00 53.09 ? 203 ILE B CG1 1 
ATOM   3283 C  CG2 . ILE B 1 212 ? 49.626 -12.362 53.771 1.00 54.19 ? 203 ILE B CG2 1 
ATOM   3284 C  CD1 . ILE B 1 212 ? 49.420 -11.978 50.688 1.00 53.84 ? 203 ILE B CD1 1 
HETATM 3285 MN MN  . MN  C 2 .   ? 27.822 2.204   18.093 1.00 18.73 ? 209 MN  A MN  1 
HETATM 3286 MN MN  . MN  D 2 .   ? 35.324 5.239   34.547 1.00 20.34 ? 209 MN  B MN  1 
HETATM 3287 O  O   . HOH E 3 .   ? 27.026 8.711   16.749 1.00 18.27 ? 210 HOH A O   1 
HETATM 3288 O  O   . HOH E 3 .   ? 30.176 2.284   25.713 1.00 18.90 ? 211 HOH A O   1 
HETATM 3289 O  O   . HOH E 3 .   ? 31.784 10.489  19.954 1.00 21.83 ? 212 HOH A O   1 
HETATM 3290 O  O   . HOH E 3 .   ? 28.249 -2.678  28.952 1.00 21.18 ? 213 HOH A O   1 
HETATM 3291 O  O   . HOH E 3 .   ? 30.064 12.843  19.785 1.00 21.96 ? 214 HOH A O   1 
HETATM 3292 O  O   . HOH E 3 .   ? 25.827 4.071   32.195 1.00 23.72 ? 215 HOH A O   1 
HETATM 3293 O  O   . HOH E 3 .   ? 28.437 8.577   29.532 1.00 21.88 ? 216 HOH A O   1 
HETATM 3294 O  O   . HOH E 3 .   ? 16.664 0.786   30.128 1.00 23.60 ? 217 HOH A O   1 
HETATM 3295 O  O   . HOH E 3 .   ? 35.960 10.858  31.157 1.00 25.13 ? 218 HOH A O   1 
HETATM 3296 O  O   . HOH E 3 .   ? 27.376 14.727  10.858 1.00 24.34 ? 219 HOH A O   1 
HETATM 3297 O  O   . HOH E 3 .   ? 27.965 -6.376  29.985 1.00 23.83 ? 220 HOH A O   1 
HETATM 3298 O  O   . HOH E 3 .   ? 24.715 -2.592  29.487 1.00 23.80 ? 221 HOH A O   1 
HETATM 3299 O  O   . HOH E 3 .   ? 23.372 -9.824  19.247 1.00 25.07 ? 222 HOH A O   1 
HETATM 3300 O  O   . HOH E 3 .   ? 22.906 0.819   7.075  1.00 24.87 ? 223 HOH A O   1 
HETATM 3301 O  O   . HOH E 3 .   ? 20.401 -1.154  32.705 1.00 25.88 ? 224 HOH A O   1 
HETATM 3302 O  O   . HOH E 3 .   ? 26.543 -8.166  22.489 1.00 24.56 ? 225 HOH A O   1 
HETATM 3303 O  O   . HOH E 3 .   ? 14.115 -3.023  28.660 1.00 27.19 ? 226 HOH A O   1 
HETATM 3304 O  O   . HOH E 3 .   ? 19.731 -3.903  10.632 1.00 25.20 ? 227 HOH A O   1 
HETATM 3305 O  O   . HOH E 3 .   ? 22.723 -2.624  32.187 1.00 26.96 ? 228 HOH A O   1 
HETATM 3306 O  O   . HOH E 3 .   ? 11.702 13.268  16.096 1.00 25.84 ? 229 HOH A O   1 
HETATM 3307 O  O   . HOH E 3 .   ? 25.793 -7.375  4.873  1.00 26.44 ? 230 HOH A O   1 
HETATM 3308 O  O   . HOH E 3 .   ? 33.468 -16.589 19.907 1.00 26.57 ? 231 HOH A O   1 
HETATM 3309 O  O   . HOH E 3 .   ? 21.178 -10.669 20.533 1.00 25.97 ? 232 HOH A O   1 
HETATM 3310 O  O   . HOH E 3 .   ? 33.963 16.328  16.818 1.00 28.86 ? 233 HOH A O   1 
HETATM 3311 O  O   . HOH E 3 .   ? 27.246 12.538  18.819 1.00 25.26 ? 234 HOH A O   1 
HETATM 3312 O  O   . HOH E 3 .   ? 22.543 16.118  30.034 1.00 28.75 ? 235 HOH A O   1 
HETATM 3313 O  O   . HOH E 3 .   ? 34.434 -6.781  17.935 1.00 27.01 ? 236 HOH A O   1 
HETATM 3314 O  O   . HOH E 3 .   ? 0.839  12.583  18.753 1.00 29.11 ? 237 HOH A O   1 
HETATM 3315 O  O   . HOH E 3 .   ? 33.893 16.842  14.216 1.00 28.66 ? 238 HOH A O   1 
HETATM 3316 O  O   . HOH E 3 .   ? 6.503  0.243   26.066 1.00 26.20 ? 239 HOH A O   1 
HETATM 3317 O  O   . HOH E 3 .   ? 27.597 5.592   30.319 1.00 30.70 ? 240 HOH A O   1 
HETATM 3318 O  O   . HOH E 3 .   ? 23.587 -3.797  6.433  1.00 29.04 ? 241 HOH A O   1 
HETATM 3319 O  O   . HOH E 3 .   ? 22.873 3.071   5.426  1.00 28.12 ? 242 HOH A O   1 
HETATM 3320 O  O   . HOH E 3 .   ? 27.500 3.669   27.375 1.00 31.70 ? 243 HOH A O   1 
HETATM 3321 O  O   . HOH E 3 .   ? 27.414 9.670   31.587 1.00 28.32 ? 244 HOH A O   1 
HETATM 3322 O  O   . HOH E 3 .   ? 25.536 -8.921  26.062 1.00 29.92 ? 245 HOH A O   1 
HETATM 3323 O  O   . HOH E 3 .   ? 22.144 5.563   5.801  1.00 28.51 ? 246 HOH A O   1 
HETATM 3324 O  O   . HOH E 3 .   ? 14.920 13.137  24.839 1.00 30.41 ? 247 HOH A O   1 
HETATM 3325 O  O   . HOH E 3 .   ? 32.744 -4.292  4.151  1.00 32.56 ? 248 HOH A O   1 
HETATM 3326 O  O   . HOH E 3 .   ? 20.531 -9.540  26.433 1.00 32.36 ? 249 HOH A O   1 
HETATM 3327 O  O   . HOH E 3 .   ? -4.402 12.506  23.279 1.00 30.76 ? 250 HOH A O   1 
HETATM 3328 O  O   . HOH E 3 .   ? 19.223 -11.300 18.842 1.00 32.87 ? 251 HOH A O   1 
HETATM 3329 O  O   . HOH E 3 .   ? 26.084 -16.181 7.128  1.00 32.77 ? 252 HOH A O   1 
HETATM 3330 O  O   . HOH E 3 .   ? 2.905  14.815  20.919 1.00 34.51 ? 253 HOH A O   1 
HETATM 3331 O  O   . HOH E 3 .   ? 35.179 -8.239  6.269  1.00 29.88 ? 254 HOH A O   1 
HETATM 3332 O  O   . HOH E 3 .   ? 34.987 -4.190  18.594 1.00 31.80 ? 255 HOH A O   1 
HETATM 3333 O  O   . HOH E 3 .   ? 2.189  9.821   16.212 1.00 32.74 ? 256 HOH A O   1 
HETATM 3334 O  O   . HOH E 3 .   ? 36.011 -12.714 15.166 1.00 32.64 ? 257 HOH A O   1 
HETATM 3335 O  O   . HOH E 3 .   ? 22.009 -1.168  5.596  1.00 33.68 ? 258 HOH A O   1 
HETATM 3336 O  O   . HOH E 3 .   ? 16.914 13.324  26.690 1.00 34.18 ? 259 HOH A O   1 
HETATM 3337 O  O   . HOH E 3 .   ? 19.350 -16.163 19.568 1.00 32.74 ? 260 HOH A O   1 
HETATM 3338 O  O   . HOH E 3 .   ? 19.740 15.694  11.009 1.00 32.72 ? 261 HOH A O   1 
HETATM 3339 O  O   . HOH E 3 .   ? 33.667 -10.245 21.482 1.00 33.31 ? 262 HOH A O   1 
HETATM 3340 O  O   . HOH E 3 .   ? 10.960 -4.366  9.362  1.00 33.59 ? 263 HOH A O   1 
HETATM 3341 O  O   . HOH E 3 .   ? 21.569 -10.356 6.166  1.00 31.07 ? 264 HOH A O   1 
HETATM 3342 O  O   . HOH E 3 .   ? 31.912 -18.338 21.731 1.00 34.10 ? 265 HOH A O   1 
HETATM 3343 O  O   . HOH E 3 .   ? 18.451 7.675   6.029  1.00 39.08 ? 266 HOH A O   1 
HETATM 3344 O  O   . HOH E 3 .   ? 21.462 -12.115 22.755 1.00 35.55 ? 267 HOH A O   1 
HETATM 3345 O  O   . HOH E 3 .   ? 19.976 -6.086  8.887  1.00 34.10 ? 268 HOH A O   1 
HETATM 3346 O  O   . HOH E 3 .   ? 33.288 -3.086  20.737 1.00 35.58 ? 269 HOH A O   1 
HETATM 3347 O  O   . HOH E 3 .   ? 10.830 3.782   29.244 1.00 34.24 ? 270 HOH A O   1 
HETATM 3348 O  O   . HOH E 3 .   ? 35.712 -11.289 17.740 1.00 35.71 ? 271 HOH A O   1 
HETATM 3349 O  O   . HOH E 3 .   ? 32.697 -0.913  19.317 1.00 34.78 ? 272 HOH A O   1 
HETATM 3350 O  O   . HOH E 3 .   ? 0.124  0.497   25.139 1.00 34.32 ? 273 HOH A O   1 
HETATM 3351 O  O   . HOH E 3 .   ? 23.094 20.624  18.237 1.00 37.70 ? 274 HOH A O   1 
HETATM 3352 O  O   . HOH E 3 .   ? 16.844 -6.492  27.175 1.00 36.27 ? 275 HOH A O   1 
HETATM 3353 O  O   . HOH E 3 .   ? 33.839 -2.004  16.752 1.00 32.79 ? 276 HOH A O   1 
HETATM 3354 O  O   . HOH E 3 .   ? 27.345 -15.697 24.065 1.00 33.61 ? 277 HOH A O   1 
HETATM 3355 O  O   . HOH E 3 .   ? 21.011 -6.292  31.037 1.00 34.35 ? 278 HOH A O   1 
HETATM 3356 O  O   . HOH E 3 .   ? 30.888 19.939  22.258 1.00 36.97 ? 279 HOH A O   1 
HETATM 3357 O  O   . HOH E 3 .   ? 10.811 15.341  17.368 1.00 37.01 ? 280 HOH A O   1 
HETATM 3358 O  O   . HOH E 3 .   ? 24.497 12.675  32.328 1.00 34.36 ? 281 HOH A O   1 
HETATM 3359 O  O   . HOH E 3 .   ? 37.505 -4.869  18.970 1.00 39.09 ? 282 HOH A O   1 
HETATM 3360 O  O   . HOH E 3 .   ? 22.043 20.686  22.931 1.00 38.43 ? 283 HOH A O   1 
HETATM 3361 O  O   . HOH E 3 .   ? 35.926 -0.833  17.454 1.00 38.35 ? 284 HOH A O   1 
HETATM 3362 O  O   . HOH E 3 .   ? 21.711 17.309  9.908  1.00 36.40 ? 285 HOH A O   1 
HETATM 3363 O  O   . HOH E 3 .   ? 13.112 -4.276  10.894 1.00 38.11 ? 286 HOH A O   1 
HETATM 3364 O  O   . HOH E 3 .   ? 29.327 5.545   3.386  1.00 36.41 ? 287 HOH A O   1 
HETATM 3365 O  O   . HOH E 3 .   ? 13.690 15.621  24.044 1.00 42.91 ? 288 HOH A O   1 
HETATM 3366 O  O   . HOH E 3 .   ? 14.027 11.814  6.588  1.00 42.76 ? 289 HOH A O   1 
HETATM 3367 O  O   . HOH E 3 .   ? 14.294 16.750  21.193 1.00 36.33 ? 290 HOH A O   1 
HETATM 3368 O  O   . HOH E 3 .   ? 28.790 19.097  15.932 1.00 38.75 ? 291 HOH A O   1 
HETATM 3369 O  O   . HOH E 3 .   ? 34.303 -3.523  7.084  1.00 39.25 ? 292 HOH A O   1 
HETATM 3370 O  O   . HOH E 3 .   ? 38.072 0.354   9.406  1.00 38.86 ? 293 HOH A O   1 
HETATM 3371 O  O   . HOH E 3 .   ? 12.966 2.732   31.275 1.00 40.58 ? 294 HOH A O   1 
HETATM 3372 O  O   . HOH E 3 .   ? 14.296 19.452  21.686 1.00 40.99 ? 295 HOH A O   1 
HETATM 3373 O  O   . HOH E 3 .   ? 24.538 -16.431 22.807 1.00 41.72 ? 296 HOH A O   1 
HETATM 3374 O  O   . HOH E 3 .   ? 23.235 5.131   32.408 1.00 37.38 ? 297 HOH A O   1 
HETATM 3375 O  O   . HOH E 3 .   ? 27.785 -10.558 24.898 1.00 38.72 ? 298 HOH A O   1 
HETATM 3376 O  O   . HOH E 3 .   ? 3.159  -0.833  24.564 1.00 40.07 ? 299 HOH A O   1 
HETATM 3377 O  O   . HOH E 3 .   ? 23.509 15.084  32.332 1.00 40.39 ? 300 HOH A O   1 
HETATM 3378 O  O   . HOH E 3 .   ? 25.426 -4.202  4.234  1.00 42.89 ? 301 HOH A O   1 
HETATM 3379 O  O   . HOH E 3 .   ? 28.661 16.767  2.630  1.00 40.33 ? 302 HOH A O   1 
HETATM 3380 O  O   . HOH E 3 .   ? 15.185 18.507  12.772 1.00 40.92 ? 303 HOH A O   1 
HETATM 3381 O  O   . HOH E 3 .   ? 23.696 19.717  29.155 1.00 40.50 ? 304 HOH A O   1 
HETATM 3382 O  O   . HOH E 3 .   ? -4.567 6.308   16.055 1.00 41.92 ? 305 HOH A O   1 
HETATM 3383 O  O   . HOH E 3 .   ? 25.908 -0.056  0.780  1.00 43.68 ? 306 HOH A O   1 
HETATM 3384 O  O   . HOH E 3 .   ? 2.207  5.725   29.243 1.00 51.23 ? 307 HOH A O   1 
HETATM 3385 O  O   . HOH E 3 .   ? 36.605 -21.015 15.071 1.00 39.22 ? 308 HOH A O   1 
HETATM 3386 O  O   . HOH E 3 .   ? 2.498  12.145  14.880 1.00 41.22 ? 309 HOH A O   1 
HETATM 3387 O  O   . HOH E 3 .   ? 3.753  2.945   27.610 1.00 47.22 ? 310 HOH A O   1 
HETATM 3388 O  O   . HOH E 3 .   ? 5.110  11.352  29.065 1.00 40.79 ? 311 HOH A O   1 
HETATM 3389 O  O   . HOH E 3 .   ? 6.248  -9.660  7.508  1.00 49.73 ? 312 HOH A O   1 
HETATM 3390 O  O   . HOH E 3 .   ? 18.510 17.854  26.891 1.00 39.87 ? 313 HOH A O   1 
HETATM 3391 O  O   . HOH E 3 .   ? 38.441 -0.458  11.837 1.00 43.04 ? 314 HOH A O   1 
HETATM 3392 O  O   . HOH E 3 .   ? 18.360 -8.198  25.726 1.00 42.58 ? 315 HOH A O   1 
HETATM 3393 O  O   . HOH E 3 .   ? 23.455 13.312  1.326  1.00 43.05 ? 316 HOH A O   1 
HETATM 3394 O  O   . HOH E 3 .   ? 29.064 8.772   3.446  1.00 43.57 ? 317 HOH A O   1 
HETATM 3395 O  O   . HOH E 3 .   ? 9.224  -4.666  24.662 1.00 41.15 ? 318 HOH A O   1 
HETATM 3396 O  O   . HOH E 3 .   ? 20.105 -18.427 22.895 1.00 44.74 ? 319 HOH A O   1 
HETATM 3397 O  O   . HOH E 3 .   ? 6.523  7.885   10.664 1.00 44.29 ? 320 HOH A O   1 
HETATM 3398 O  O   . HOH E 3 .   ? 17.141 -9.769  23.584 1.00 50.84 ? 321 HOH A O   1 
HETATM 3399 O  O   . HOH E 3 .   ? 31.291 11.991  3.700  1.00 48.20 ? 322 HOH A O   1 
HETATM 3400 O  O   . HOH E 3 .   ? 36.165 -19.359 11.335 1.00 45.98 ? 323 HOH A O   1 
HETATM 3401 O  O   . HOH E 3 .   ? 4.061  -8.121  5.393  1.00 58.27 ? 324 HOH A O   1 
HETATM 3402 O  O   . HOH E 3 .   ? 4.127  -10.631 9.751  1.00 59.36 ? 325 HOH A O   1 
HETATM 3403 O  O   . HOH E 3 .   ? 29.404 -15.170 0.784  1.00 55.39 ? 326 HOH A O   1 
HETATM 3404 O  O   . HOH E 3 .   ? 29.526 -26.875 19.750 1.00 43.16 ? 327 HOH A O   1 
HETATM 3405 O  O   . HOH E 3 .   ? 24.462 12.469  -0.509 1.00 41.37 ? 328 HOH A O   1 
HETATM 3406 O  O   . HOH E 3 .   ? 9.012  6.039   31.072 1.00 43.98 ? 329 HOH A O   1 
HETATM 3407 O  O   . HOH E 3 .   ? 21.755 -14.760 26.328 1.00 42.82 ? 330 HOH A O   1 
HETATM 3408 O  O   . HOH E 3 .   ? 37.660 -10.629 8.328  1.00 37.42 ? 331 HOH A O   1 
HETATM 3409 O  O   . HOH E 3 .   ? 38.604 -6.190  16.918 1.00 35.95 ? 332 HOH A O   1 
HETATM 3410 O  O   . HOH E 3 .   ? -4.362 9.359   21.250 1.00 36.30 ? 333 HOH A O   1 
HETATM 3411 O  O   . HOH E 3 .   ? 12.637 17.030  16.182 1.00 47.61 ? 334 HOH A O   1 
HETATM 3412 O  O   . HOH E 3 .   ? 19.959 2.813   35.200 1.00 46.09 ? 335 HOH A O   1 
HETATM 3413 O  O   . HOH E 3 .   ? 27.271 19.965  7.721  1.00 38.89 ? 336 HOH A O   1 
HETATM 3414 O  O   . HOH E 3 .   ? 10.769 13.511  9.502  1.00 47.76 ? 337 HOH A O   1 
HETATM 3415 O  O   . HOH E 3 .   ? 35.155 -8.466  20.250 1.00 44.15 ? 338 HOH A O   1 
HETATM 3416 O  O   . HOH E 3 .   ? 17.736 -0.917  31.797 1.00 43.56 ? 339 HOH A O   1 
HETATM 3417 O  O   . HOH E 3 .   ? 19.554 19.631  25.284 1.00 46.63 ? 340 HOH A O   1 
HETATM 3418 O  O   . HOH E 3 .   ? -1.833 2.591   10.776 1.00 45.99 ? 341 HOH A O   1 
HETATM 3419 O  O   . HOH E 3 .   ? 11.429 11.708  7.935  1.00 42.25 ? 342 HOH A O   1 
HETATM 3420 O  O   . HOH E 3 .   ? 32.794 17.623  28.799 1.00 44.10 ? 343 HOH A O   1 
HETATM 3421 O  O   . HOH E 3 .   ? 21.109 -10.141 29.013 1.00 45.88 ? 344 HOH A O   1 
HETATM 3422 O  O   . HOH E 3 .   ? 6.820  18.095  12.921 1.00 50.20 ? 345 HOH A O   1 
HETATM 3423 O  O   . HOH E 3 .   ? 19.159 -2.304  8.525  1.00 44.60 ? 346 HOH A O   1 
HETATM 3424 O  O   . HOH E 3 .   ? 27.976 21.833  14.295 1.00 36.19 ? 347 HOH A O   1 
HETATM 3425 O  O   . HOH E 3 .   ? 18.716 9.826   4.433  1.00 40.52 ? 348 HOH A O   1 
HETATM 3426 O  O   . HOH E 3 .   ? 0.063  -3.091  14.846 1.00 47.00 ? 349 HOH A O   1 
HETATM 3427 O  O   . HOH E 3 .   ? 14.682 -6.820  11.685 1.00 36.63 ? 350 HOH A O   1 
HETATM 3428 O  O   . HOH E 3 .   ? 13.364 0.008   29.525 1.00 45.95 ? 351 HOH A O   1 
HETATM 3429 O  O   . HOH E 3 .   ? 31.952 -11.219 25.179 1.00 40.38 ? 352 HOH A O   1 
HETATM 3430 O  O   . HOH E 3 .   ? 32.211 19.078  13.926 1.00 41.63 ? 353 HOH A O   1 
HETATM 3431 O  O   . HOH E 3 .   ? 30.573 -14.005 -1.150 1.00 58.40 ? 354 HOH A O   1 
HETATM 3432 O  O   . HOH E 3 .   ? 27.925 18.226  32.871 1.00 44.83 ? 355 HOH A O   1 
HETATM 3433 O  O   . HOH E 3 .   ? 2.068  4.721   5.375  1.00 54.22 ? 356 HOH A O   1 
HETATM 3434 O  O   . HOH E 3 .   ? 33.714 -18.306 23.870 1.00 52.75 ? 357 HOH A O   1 
HETATM 3435 O  O   . HOH E 3 .   ? 11.882 -11.348 15.716 1.00 45.25 ? 358 HOH A O   1 
HETATM 3436 O  O   . HOH E 3 .   ? 22.494 -14.931 23.539 1.00 44.50 ? 359 HOH A O   1 
HETATM 3437 O  O   . HOH E 3 .   ? 24.032 -21.592 5.963  1.00 47.39 ? 360 HOH A O   1 
HETATM 3438 O  O   . HOH E 3 .   ? 38.990 -11.177 13.943 1.00 47.71 ? 361 HOH A O   1 
HETATM 3439 O  O   . HOH E 3 .   ? 22.675 10.182  32.139 1.00 41.95 ? 362 HOH A O   1 
HETATM 3440 O  O   . HOH E 3 .   ? 36.230 -15.515 15.963 1.00 47.88 ? 363 HOH A O   1 
HETATM 3441 O  O   . HOH E 3 .   ? 10.841 -16.275 18.594 1.00 46.71 ? 364 HOH A O   1 
HETATM 3442 O  O   . HOH E 3 .   ? 27.126 -19.642 0.422  1.00 55.23 ? 365 HOH A O   1 
HETATM 3443 O  O   . HOH E 3 .   ? 34.810 -14.430 21.090 1.00 49.76 ? 366 HOH A O   1 
HETATM 3444 O  O   . HOH E 3 .   ? 25.664 -10.057 28.506 1.00 47.38 ? 367 HOH A O   1 
HETATM 3445 O  O   . HOH E 3 .   ? 26.660 -13.196 28.739 1.00 52.98 ? 368 HOH A O   1 
HETATM 3446 O  O   . HOH E 3 .   ? 27.958 7.757   1.296  1.00 60.27 ? 369 HOH A O   1 
HETATM 3447 O  O   . HOH E 3 .   ? 21.915 -23.817 2.429  1.00 61.70 ? 370 HOH A O   1 
HETATM 3448 O  O   . HOH E 3 .   ? 35.373 -16.930 17.985 1.00 55.03 ? 371 HOH A O   1 
HETATM 3449 O  O   . HOH E 3 .   ? 25.930 10.888  0.455  1.00 43.58 ? 372 HOH A O   1 
HETATM 3450 O  O   . HOH E 3 .   ? 10.276 -6.944  9.145  1.00 47.55 ? 373 HOH A O   1 
HETATM 3451 O  O   . HOH E 3 .   ? 30.651 -2.134  1.235  1.00 57.99 ? 374 HOH A O   1 
HETATM 3452 O  O   . HOH E 3 .   ? 8.429  14.597  24.660 1.00 45.42 ? 375 HOH A O   1 
HETATM 3453 O  O   . HOH E 3 .   ? 26.127 20.371  22.198 1.00 61.58 ? 376 HOH A O   1 
HETATM 3454 O  O   . HOH E 3 .   ? 23.496 -17.127 -0.977 1.00 58.68 ? 377 HOH A O   1 
HETATM 3455 O  O   . HOH E 3 .   ? 12.954 -8.981  12.109 1.00 52.63 ? 378 HOH A O   1 
HETATM 3456 O  O   . HOH E 3 .   ? 43.523 5.062   10.378 1.00 54.95 ? 379 HOH A O   1 
HETATM 3457 O  O   . HOH E 3 .   ? 5.937  -10.805 18.936 1.00 53.89 ? 380 HOH A O   1 
HETATM 3458 O  O   . HOH E 3 .   ? 2.268  -12.415 9.393  1.00 62.54 ? 381 HOH A O   1 
HETATM 3459 O  O   . HOH E 3 .   ? 8.154  14.442  30.132 1.00 58.44 ? 382 HOH A O   1 
HETATM 3460 O  O   . HOH E 3 .   ? 28.167 -12.819 25.510 1.00 43.75 ? 383 HOH A O   1 
HETATM 3461 O  O   . HOH E 3 .   ? -0.522 -2.140  25.396 1.00 42.33 ? 384 HOH A O   1 
HETATM 3462 O  O   . HOH E 3 .   ? 34.547 -15.593 24.005 1.00 48.29 ? 385 HOH A O   1 
HETATM 3463 O  O   . HOH E 3 .   ? 28.489 -15.340 5.900  1.00 40.49 ? 386 HOH A O   1 
HETATM 3464 O  O   . HOH E 3 .   ? -1.860 6.871   6.736  1.00 60.37 ? 387 HOH A O   1 
HETATM 3465 O  O   . HOH E 3 .   ? 27.384 0.569   19.484 1.00 18.04 ? 388 HOH A O   1 
HETATM 3466 O  O   . HOH E 3 .   ? 1.551  13.115  26.352 1.00 45.66 ? 389 HOH A O   1 
HETATM 3467 O  O   . HOH E 3 .   ? 30.214 17.654  30.991 1.00 44.32 ? 390 HOH A O   1 
HETATM 3468 O  O   . HOH E 3 .   ? 14.310 6.620   3.284  1.00 46.33 ? 391 HOH A O   1 
HETATM 3469 O  O   . HOH E 3 .   ? 13.810 0.007   5.073  1.00 44.84 ? 392 HOH A O   1 
HETATM 3470 O  O   . HOH E 3 .   ? 36.959 6.443   9.802  1.00 45.30 ? 393 HOH A O   1 
HETATM 3471 O  O   . HOH E 3 .   ? 14.758 -19.614 8.941  1.00 47.42 ? 394 HOH A O   1 
HETATM 3472 O  O   . HOH F 3 .   ? 44.865 0.433   18.608 1.00 17.95 ? 210 HOH B O   1 
HETATM 3473 O  O   . HOH F 3 .   ? 38.039 10.346  27.370 1.00 19.28 ? 211 HOH B O   1 
HETATM 3474 O  O   . HOH F 3 .   ? 33.948 3.425   34.681 1.00 21.65 ? 212 HOH B O   1 
HETATM 3475 O  O   . HOH F 3 .   ? 31.533 2.478   28.137 1.00 19.98 ? 213 HOH B O   1 
HETATM 3476 O  O   . HOH F 3 .   ? 36.118 1.737   22.013 1.00 20.82 ? 214 HOH B O   1 
HETATM 3477 O  O   . HOH F 3 .   ? 33.697 -3.417  23.376 1.00 21.53 ? 215 HOH B O   1 
HETATM 3478 O  O   . HOH F 3 .   ? 30.659 -5.594  29.610 1.00 22.84 ? 216 HOH B O   1 
HETATM 3479 O  O   . HOH F 3 .   ? 25.641 -5.054  30.419 1.00 22.70 ? 217 HOH B O   1 
HETATM 3480 O  O   . HOH F 3 .   ? 41.004 10.265  26.672 1.00 24.10 ? 218 HOH B O   1 
HETATM 3481 O  O   . HOH F 3 .   ? 40.741 8.065   32.140 1.00 24.52 ? 219 HOH B O   1 
HETATM 3482 O  O   . HOH F 3 .   ? 32.294 6.876   17.315 1.00 22.52 ? 220 HOH B O   1 
HETATM 3483 O  O   . HOH F 3 .   ? 33.877 0.346   26.603 1.00 23.91 ? 221 HOH B O   1 
HETATM 3484 O  O   . HOH F 3 .   ? 37.011 -0.043  20.001 1.00 25.99 ? 222 HOH B O   1 
HETATM 3485 O  O   . HOH F 3 .   ? 40.970 7.293   45.146 1.00 25.08 ? 223 HOH B O   1 
HETATM 3486 O  O   . HOH F 3 .   ? 27.686 -2.717  37.765 1.00 24.91 ? 224 HOH B O   1 
HETATM 3487 O  O   . HOH F 3 .   ? 50.158 6.618   21.849 1.00 25.18 ? 225 HOH B O   1 
HETATM 3488 O  O   . HOH F 3 .   ? 29.673 -3.599  41.920 1.00 25.90 ? 226 HOH B O   1 
HETATM 3489 O  O   . HOH F 3 .   ? 42.831 8.575   28.242 1.00 25.51 ? 227 HOH B O   1 
HETATM 3490 O  O   . HOH F 3 .   ? 33.978 7.476   50.718 1.00 27.03 ? 228 HOH B O   1 
HETATM 3491 O  O   . HOH F 3 .   ? 47.354 -2.989  24.540 1.00 28.78 ? 229 HOH B O   1 
HETATM 3492 O  O   . HOH F 3 .   ? 33.359 -9.686  27.569 1.00 28.52 ? 230 HOH B O   1 
HETATM 3493 O  O   . HOH F 3 .   ? 29.373 -9.543  37.004 1.00 28.01 ? 231 HOH B O   1 
HETATM 3494 O  O   . HOH F 3 .   ? 26.227 6.989   36.002 1.00 28.85 ? 232 HOH B O   1 
HETATM 3495 O  O   . HOH F 3 .   ? 42.782 17.929  27.610 1.00 28.09 ? 233 HOH B O   1 
HETATM 3496 O  O   . HOH F 3 .   ? 46.650 14.135  33.081 1.00 28.77 ? 234 HOH B O   1 
HETATM 3497 O  O   . HOH F 3 .   ? 20.338 6.348   43.320 1.00 28.41 ? 235 HOH B O   1 
HETATM 3498 O  O   . HOH F 3 .   ? 49.368 -3.234  26.374 1.00 28.63 ? 236 HOH B O   1 
HETATM 3499 O  O   . HOH F 3 .   ? 27.127 5.128   34.342 1.00 31.21 ? 237 HOH B O   1 
HETATM 3500 O  O   . HOH F 3 .   ? 38.094 -10.159 29.450 1.00 28.29 ? 238 HOH B O   1 
HETATM 3501 O  O   . HOH F 3 .   ? 24.680 6.105   38.227 1.00 29.92 ? 239 HOH B O   1 
HETATM 3502 O  O   . HOH F 3 .   ? 52.705 4.552   24.532 1.00 27.43 ? 240 HOH B O   1 
HETATM 3503 O  O   . HOH F 3 .   ? 28.868 8.491   36.234 1.00 29.35 ? 241 HOH B O   1 
HETATM 3504 O  O   . HOH F 3 .   ? 40.857 5.773   15.052 1.00 29.41 ? 242 HOH B O   1 
HETATM 3505 O  O   . HOH F 3 .   ? 31.422 13.747  47.407 1.00 32.55 ? 243 HOH B O   1 
HETATM 3506 O  O   . HOH F 3 .   ? 37.453 -12.638 33.251 1.00 32.29 ? 244 HOH B O   1 
HETATM 3507 O  O   . HOH F 3 .   ? 39.940 -3.490  20.245 1.00 29.64 ? 245 HOH B O   1 
HETATM 3508 O  O   . HOH F 3 .   ? 36.008 -5.464  23.403 1.00 31.87 ? 246 HOH B O   1 
HETATM 3509 O  O   . HOH F 3 .   ? 23.867 -7.145  30.888 1.00 33.73 ? 247 HOH B O   1 
HETATM 3510 O  O   . HOH F 3 .   ? 38.958 -3.465  22.606 1.00 31.56 ? 248 HOH B O   1 
HETATM 3511 O  O   . HOH F 3 .   ? 36.626 8.573   49.380 1.00 32.66 ? 249 HOH B O   1 
HETATM 3512 O  O   . HOH F 3 .   ? 38.728 1.188   46.067 1.00 30.27 ? 250 HOH B O   1 
HETATM 3513 O  O   . HOH F 3 .   ? 53.336 0.066   27.354 1.00 32.28 ? 251 HOH B O   1 
HETATM 3514 O  O   . HOH F 3 .   ? 41.486 15.967  43.277 1.00 33.22 ? 252 HOH B O   1 
HETATM 3515 O  O   . HOH F 3 .   ? 41.816 -5.436  19.390 1.00 32.73 ? 253 HOH B O   1 
HETATM 3516 O  O   . HOH F 3 .   ? 30.005 -6.321  42.130 1.00 31.28 ? 254 HOH B O   1 
HETATM 3517 O  O   . HOH F 3 .   ? 26.619 -5.590  35.493 1.00 31.26 ? 255 HOH B O   1 
HETATM 3518 O  O   . HOH F 3 .   ? 31.411 -6.771  44.333 1.00 32.12 ? 256 HOH B O   1 
HETATM 3519 O  O   . HOH F 3 .   ? 34.268 -0.464  23.464 1.00 31.48 ? 257 HOH B O   1 
HETATM 3520 O  O   . HOH F 3 .   ? 38.805 17.171  24.722 1.00 33.70 ? 258 HOH B O   1 
HETATM 3521 O  O   . HOH F 3 .   ? 41.317 16.088  25.772 1.00 33.11 ? 259 HOH B O   1 
HETATM 3522 O  O   . HOH F 3 .   ? 55.409 -1.494  31.201 1.00 34.32 ? 260 HOH B O   1 
HETATM 3523 O  O   . HOH F 3 .   ? 45.308 9.544   43.324 1.00 35.45 ? 261 HOH B O   1 
HETATM 3524 O  O   . HOH F 3 .   ? 28.170 10.819  34.548 1.00 35.37 ? 262 HOH B O   1 
HETATM 3525 O  O   . HOH F 3 .   ? 44.447 -4.913  49.535 1.00 35.46 ? 263 HOH B O   1 
HETATM 3526 O  O   . HOH F 3 .   ? 30.498 13.734  44.767 1.00 35.28 ? 264 HOH B O   1 
HETATM 3527 O  O   . HOH F 3 .   ? 18.138 -0.293  42.865 1.00 36.13 ? 265 HOH B O   1 
HETATM 3528 O  O   . HOH F 3 .   ? 34.203 2.691   53.063 1.00 35.94 ? 266 HOH B O   1 
HETATM 3529 O  O   . HOH F 3 .   ? 44.142 -12.803 29.233 1.00 33.59 ? 267 HOH B O   1 
HETATM 3530 O  O   . HOH F 3 .   ? 29.793 6.840   33.971 1.00 36.98 ? 268 HOH B O   1 
HETATM 3531 O  O   . HOH F 3 .   ? 29.891 -10.321 31.557 1.00 36.82 ? 269 HOH B O   1 
HETATM 3532 O  O   . HOH F 3 .   ? 17.178 -2.738  42.720 1.00 34.79 ? 270 HOH B O   1 
HETATM 3533 O  O   . HOH F 3 .   ? 48.929 7.393   42.985 1.00 36.57 ? 271 HOH B O   1 
HETATM 3534 O  O   . HOH F 3 .   ? 43.006 9.251   45.154 1.00 32.93 ? 272 HOH B O   1 
HETATM 3535 O  O   . HOH F 3 .   ? 32.733 16.869  41.479 1.00 38.61 ? 273 HOH B O   1 
HETATM 3536 O  O   . HOH F 3 .   ? 54.080 -0.942  33.519 1.00 33.46 ? 274 HOH B O   1 
HETATM 3537 O  O   . HOH F 3 .   ? 56.402 -19.412 36.860 1.00 34.89 ? 275 HOH B O   1 
HETATM 3538 O  O   . HOH F 3 .   ? 44.545 -8.257  22.049 1.00 35.12 ? 276 HOH B O   1 
HETATM 3539 O  O   . HOH F 3 .   ? 44.553 -6.222  20.341 1.00 37.56 ? 277 HOH B O   1 
HETATM 3540 O  O   . HOH F 3 .   ? 25.139 6.957   52.354 1.00 47.46 ? 278 HOH B O   1 
HETATM 3541 O  O   . HOH F 3 .   ? 45.272 -15.330 35.098 1.00 36.62 ? 279 HOH B O   1 
HETATM 3542 O  O   . HOH F 3 .   ? 42.422 -0.572  17.340 1.00 35.50 ? 280 HOH B O   1 
HETATM 3543 O  O   . HOH F 3 .   ? 35.746 -11.138 28.386 1.00 34.69 ? 281 HOH B O   1 
HETATM 3544 O  O   . HOH F 3 .   ? 56.030 1.678   30.942 1.00 37.81 ? 282 HOH B O   1 
HETATM 3545 O  O   . HOH F 3 .   ? 40.421 6.640   47.685 1.00 36.56 ? 283 HOH B O   1 
HETATM 3546 O  O   . HOH F 3 .   ? 40.269 -1.227  18.300 1.00 35.19 ? 284 HOH B O   1 
HETATM 3547 O  O   . HOH F 3 .   ? 23.144 12.304  46.948 1.00 39.72 ? 285 HOH B O   1 
HETATM 3548 O  O   . HOH F 3 .   ? 39.580 -4.168  48.134 1.00 37.81 ? 286 HOH B O   1 
HETATM 3549 O  O   . HOH F 3 .   ? 21.548 -6.011  40.717 1.00 37.06 ? 287 HOH B O   1 
HETATM 3550 O  O   . HOH F 3 .   ? 23.105 12.431  40.568 1.00 43.59 ? 288 HOH B O   1 
HETATM 3551 O  O   . HOH F 3 .   ? 27.164 12.899  47.543 1.00 39.28 ? 289 HOH B O   1 
HETATM 3552 O  O   . HOH F 3 .   ? 40.631 3.172   46.998 1.00 39.27 ? 290 HOH B O   1 
HETATM 3553 O  O   . HOH F 3 .   ? 22.019 -5.500  38.200 1.00 36.24 ? 291 HOH B O   1 
HETATM 3554 O  O   . HOH F 3 .   ? 47.348 14.197  26.236 1.00 37.78 ? 292 HOH B O   1 
HETATM 3555 O  O   . HOH F 3 .   ? 49.692 7.411   18.088 1.00 38.08 ? 293 HOH B O   1 
HETATM 3556 O  O   . HOH F 3 .   ? 41.847 2.465   14.101 1.00 39.91 ? 294 HOH B O   1 
HETATM 3557 O  O   . HOH F 3 .   ? 55.144 13.704  41.405 1.00 39.20 ? 295 HOH B O   1 
HETATM 3558 O  O   . HOH F 3 .   ? 30.698 -8.444  27.870 1.00 38.91 ? 296 HOH B O   1 
HETATM 3559 O  O   . HOH F 3 .   ? 26.912 2.784   54.171 1.00 33.40 ? 297 HOH B O   1 
HETATM 3560 O  O   . HOH F 3 .   ? 15.230 3.389   57.272 1.00 39.37 ? 298 HOH B O   1 
HETATM 3561 O  O   . HOH F 3 .   ? 33.692 -11.103 35.530 1.00 43.79 ? 299 HOH B O   1 
HETATM 3562 O  O   . HOH F 3 .   ? 50.438 20.291  37.243 1.00 38.85 ? 300 HOH B O   1 
HETATM 3563 O  O   . HOH F 3 .   ? 14.413 0.832   56.769 1.00 41.42 ? 301 HOH B O   1 
HETATM 3564 O  O   . HOH F 3 .   ? 46.547 8.386   19.602 1.00 37.45 ? 302 HOH B O   1 
HETATM 3565 O  O   . HOH F 3 .   ? 57.978 -9.136  37.626 1.00 39.30 ? 303 HOH B O   1 
HETATM 3566 O  O   . HOH F 3 .   ? 25.580 13.698  40.329 1.00 38.75 ? 304 HOH B O   1 
HETATM 3567 O  O   . HOH F 3 .   ? 60.856 -16.633 35.889 1.00 42.56 ? 305 HOH B O   1 
HETATM 3568 O  O   . HOH F 3 .   ? 40.330 12.138  49.788 1.00 44.44 ? 306 HOH B O   1 
HETATM 3569 O  O   . HOH F 3 .   ? 42.141 -9.200  23.250 1.00 43.86 ? 307 HOH B O   1 
HETATM 3570 O  O   . HOH F 3 .   ? 54.292 7.660   34.944 1.00 46.13 ? 308 HOH B O   1 
HETATM 3571 O  O   . HOH F 3 .   ? 59.763 -8.866  31.835 1.00 42.41 ? 309 HOH B O   1 
HETATM 3572 O  O   . HOH F 3 .   ? 52.405 8.983   34.374 1.00 42.00 ? 310 HOH B O   1 
HETATM 3573 O  O   . HOH F 3 .   ? 21.480 -1.923  35.788 1.00 41.15 ? 311 HOH B O   1 
HETATM 3574 O  O   . HOH F 3 .   ? 48.830 -14.154 20.209 1.00 40.81 ? 312 HOH B O   1 
HETATM 3575 O  O   . HOH F 3 .   ? 34.719 18.094  36.083 1.00 48.15 ? 313 HOH B O   1 
HETATM 3576 O  O   . HOH F 3 .   ? 39.464 -12.215 30.354 1.00 45.91 ? 314 HOH B O   1 
HETATM 3577 O  O   . HOH F 3 .   ? 40.703 -14.893 38.568 1.00 45.86 ? 315 HOH B O   1 
HETATM 3578 O  O   . HOH F 3 .   ? 56.418 -16.251 30.020 1.00 48.62 ? 316 HOH B O   1 
HETATM 3579 O  O   . HOH F 3 .   ? 55.769 2.770   40.301 1.00 44.01 ? 317 HOH B O   1 
HETATM 3580 O  O   . HOH F 3 .   ? 45.532 20.724  36.451 1.00 48.71 ? 318 HOH B O   1 
HETATM 3581 O  O   . HOH F 3 .   ? 21.517 1.849   38.516 1.00 48.97 ? 319 HOH B O   1 
HETATM 3582 O  O   . HOH F 3 .   ? 35.311 -0.509  52.345 1.00 48.05 ? 320 HOH B O   1 
HETATM 3583 O  O   . HOH F 3 .   ? 38.050 10.534  50.663 1.00 52.76 ? 321 HOH B O   1 
HETATM 3584 O  O   . HOH F 3 .   ? 46.804 -14.190 27.075 1.00 56.74 ? 322 HOH B O   1 
HETATM 3585 O  O   . HOH F 3 .   ? 50.760 10.050  42.826 1.00 49.39 ? 323 HOH B O   1 
HETATM 3586 O  O   . HOH F 3 .   ? 56.347 5.967   32.071 1.00 43.98 ? 324 HOH B O   1 
HETATM 3587 O  O   . HOH F 3 .   ? 31.546 16.183  43.852 1.00 38.19 ? 325 HOH B O   1 
HETATM 3588 O  O   . HOH F 3 .   ? 36.941 -1.629  22.303 1.00 37.66 ? 326 HOH B O   1 
HETATM 3589 O  O   . HOH F 3 .   ? 43.853 19.726  39.499 1.00 46.10 ? 327 HOH B O   1 
HETATM 3590 O  O   . HOH F 3 .   ? 22.238 10.167  37.585 1.00 37.51 ? 328 HOH B O   1 
HETATM 3591 O  O   . HOH F 3 .   ? 27.671 -8.868  31.145 1.00 37.50 ? 329 HOH B O   1 
HETATM 3592 O  O   . HOH F 3 .   ? 53.549 -13.266 26.644 1.00 43.75 ? 330 HOH B O   1 
HETATM 3593 O  O   . HOH F 3 .   ? 44.227 -9.676  55.665 1.00 57.76 ? 331 HOH B O   1 
HETATM 3594 O  O   . HOH F 3 .   ? 21.473 -1.903  61.442 1.00 54.24 ? 332 HOH B O   1 
HETATM 3595 O  O   . HOH F 3 .   ? 22.913 8.391   52.450 1.00 49.98 ? 333 HOH B O   1 
HETATM 3596 O  O   . HOH F 3 .   ? 50.596 17.237  43.072 1.00 44.74 ? 334 HOH B O   1 
HETATM 3597 O  O   . HOH F 3 .   ? 45.550 17.765  26.937 1.00 36.69 ? 335 HOH B O   1 
HETATM 3598 O  O   . HOH F 3 .   ? 42.697 -4.317  47.506 1.00 35.18 ? 336 HOH B O   1 
HETATM 3599 O  O   . HOH F 3 .   ? 54.003 -20.620 33.028 1.00 40.63 ? 337 HOH B O   1 
HETATM 3600 O  O   . HOH F 3 .   ? 58.946 2.712   31.445 1.00 55.38 ? 338 HOH B O   1 
HETATM 3601 O  O   . HOH F 3 .   ? 53.535 -8.469  26.864 1.00 44.72 ? 339 HOH B O   1 
HETATM 3602 O  O   . HOH F 3 .   ? 62.011 -15.207 37.568 1.00 41.86 ? 340 HOH B O   1 
HETATM 3603 O  O   . HOH F 3 .   ? 50.965 15.231  23.984 1.00 37.37 ? 341 HOH B O   1 
HETATM 3604 O  O   . HOH F 3 .   ? 24.891 -0.118  59.292 1.00 56.73 ? 342 HOH B O   1 
HETATM 3605 O  O   . HOH F 3 .   ? 35.439 -10.373 23.735 1.00 43.94 ? 343 HOH B O   1 
HETATM 3606 O  O   . HOH F 3 .   ? 40.637 8.121   13.859 1.00 45.17 ? 344 HOH B O   1 
HETATM 3607 O  O   . HOH F 3 .   ? 39.650 11.165  16.289 1.00 48.74 ? 345 HOH B O   1 
HETATM 3608 O  O   . HOH F 3 .   ? 51.381 -6.300  26.340 1.00 43.69 ? 346 HOH B O   1 
HETATM 3609 O  O   . HOH F 3 .   ? 53.839 16.475  37.930 1.00 47.05 ? 347 HOH B O   1 
HETATM 3610 O  O   . HOH F 3 .   ? 51.562 18.015  32.945 1.00 49.54 ? 348 HOH B O   1 
HETATM 3611 O  O   . HOH F 3 .   ? 41.478 8.672   49.690 1.00 44.34 ? 349 HOH B O   1 
HETATM 3612 O  O   . HOH F 3 .   ? 38.308 17.096  44.582 1.00 46.45 ? 350 HOH B O   1 
HETATM 3613 O  O   . HOH F 3 .   ? 42.824 -4.469  16.904 1.00 43.03 ? 351 HOH B O   1 
HETATM 3614 O  O   . HOH F 3 .   ? 37.483 6.365   47.928 1.00 32.17 ? 352 HOH B O   1 
HETATM 3615 O  O   . HOH F 3 .   ? 36.645 18.303  39.239 1.00 48.02 ? 353 HOH B O   1 
HETATM 3616 O  O   . HOH F 3 .   ? 54.768 0.025   48.599 1.00 47.39 ? 354 HOH B O   1 
HETATM 3617 O  O   . HOH F 3 .   ? 37.902 -0.467  16.335 1.00 38.20 ? 355 HOH B O   1 
HETATM 3618 O  O   . HOH F 3 .   ? 38.365 -11.007 21.993 1.00 46.99 ? 356 HOH B O   1 
HETATM 3619 O  O   . HOH F 3 .   ? 43.470 17.019  41.473 1.00 44.38 ? 357 HOH B O   1 
HETATM 3620 O  O   . HOH F 3 .   ? 41.846 -12.420 27.572 1.00 48.32 ? 358 HOH B O   1 
HETATM 3621 O  O   . HOH F 3 .   ? 24.476 8.968   35.006 1.00 38.98 ? 359 HOH B O   1 
HETATM 3622 O  O   . HOH F 3 .   ? 28.210 -9.160  46.943 1.00 46.73 ? 360 HOH B O   1 
HETATM 3623 O  O   . HOH F 3 .   ? 57.282 8.291   35.733 1.00 50.59 ? 361 HOH B O   1 
HETATM 3624 O  O   . HOH F 3 .   ? 49.875 16.161  26.291 1.00 42.62 ? 362 HOH B O   1 
HETATM 3625 O  O   . HOH F 3 .   ? 53.542 -10.596 25.900 1.00 41.24 ? 363 HOH B O   1 
HETATM 3626 O  O   . HOH F 3 .   ? 57.424 3.258   38.413 1.00 38.95 ? 364 HOH B O   1 
HETATM 3627 O  O   . HOH F 3 .   ? 60.031 -6.623  37.992 1.00 53.79 ? 365 HOH B O   1 
HETATM 3628 O  O   . HOH F 3 .   ? 52.622 11.432  33.547 1.00 36.75 ? 366 HOH B O   1 
HETATM 3629 O  O   . HOH F 3 .   ? 52.104 5.633   46.293 1.00 53.42 ? 367 HOH B O   1 
HETATM 3630 O  O   . HOH F 3 .   ? 47.192 5.625   16.436 1.00 40.61 ? 368 HOH B O   1 
HETATM 3631 O  O   . HOH F 3 .   ? 26.646 -1.634  60.509 1.00 57.42 ? 369 HOH B O   1 
HETATM 3632 O  O   . HOH F 3 .   ? 24.456 -4.086  36.928 1.00 45.29 ? 370 HOH B O   1 
HETATM 3633 O  O   . HOH F 3 .   ? 34.989 17.488  26.919 1.00 50.19 ? 371 HOH B O   1 
HETATM 3634 O  O   . HOH F 3 .   ? 58.018 -2.025  31.290 1.00 43.97 ? 372 HOH B O   1 
HETATM 3635 O  O   . HOH F 3 .   ? 48.908 -8.016  56.473 1.00 50.45 ? 373 HOH B O   1 
HETATM 3636 O  O   . HOH F 3 .   ? 59.255 0.602   36.942 1.00 50.61 ? 374 HOH B O   1 
HETATM 3637 O  O   . HOH F 3 .   ? 47.676 10.642  21.501 1.00 61.97 ? 375 HOH B O   1 
HETATM 3638 O  O   . HOH F 3 .   ? 47.172 19.318  29.829 1.00 35.03 ? 376 HOH B O   1 
HETATM 3639 O  O   . HOH F 3 .   ? 36.731 -1.750  54.312 1.00 50.86 ? 377 HOH B O   1 
HETATM 3640 O  O   . HOH F 3 .   ? 16.409 4.835   48.527 1.00 49.52 ? 378 HOH B O   1 
HETATM 3641 O  O   . HOH F 3 .   ? 37.572 1.747   48.249 1.00 41.88 ? 379 HOH B O   1 
HETATM 3642 O  O   . HOH F 3 .   ? 59.945 -10.069 35.471 1.00 43.11 ? 380 HOH B O   1 
HETATM 3643 O  O   . HOH F 3 .   ? 15.988 -6.510  42.991 1.00 43.93 ? 381 HOH B O   1 
HETATM 3644 O  O   . HOH F 3 .   ? 18.523 -4.313  54.851 1.00 56.76 ? 382 HOH B O   1 
HETATM 3645 O  O   . HOH F 3 .   ? 35.804 -10.208 49.020 1.00 55.70 ? 383 HOH B O   1 
HETATM 3646 O  O   . HOH F 3 .   ? 31.890 -10.018 37.365 1.00 49.47 ? 384 HOH B O   1 
HETATM 3647 O  O   . HOH F 3 .   ? 42.938 -11.086 54.265 1.00 64.12 ? 385 HOH B O   1 
HETATM 3648 O  O   . HOH F 3 .   ? 28.351 15.025  38.167 1.00 41.97 ? 386 HOH B O   1 
HETATM 3649 O  O   . HOH F 3 .   ? 43.324 14.854  23.607 1.00 53.47 ? 387 HOH B O   1 
HETATM 3650 O  O   . HOH F 3 .   ? 17.503 9.798   48.466 1.00 52.61 ? 388 HOH B O   1 
HETATM 3651 O  O   . HOH F 3 .   ? 44.309 12.315  20.116 1.00 48.22 ? 389 HOH B O   1 
HETATM 3652 O  O   . HOH F 3 .   ? 51.627 12.871  42.685 1.00 66.12 ? 390 HOH B O   1 
HETATM 3653 O  O   . HOH F 3 .   ? 24.276 8.731   56.719 1.00 57.01 ? 391 HOH B O   1 
HETATM 3654 O  O   . HOH F 3 .   ? 28.603 16.561  42.126 1.00 41.67 ? 392 HOH B O   1 
HETATM 3655 O  O   . HOH F 3 .   ? 23.036 -7.568  42.255 1.00 53.60 ? 393 HOH B O   1 
HETATM 3656 O  O   . HOH F 3 .   ? 60.664 -7.168  34.959 1.00 51.06 ? 394 HOH B O   1 
HETATM 3657 O  O   . HOH F 3 .   ? 22.535 -15.600 48.734 1.00 55.66 ? 395 HOH B O   1 
HETATM 3658 O  O   . HOH F 3 .   ? 19.860 15.283  51.085 1.00 66.38 ? 396 HOH B O   1 
HETATM 3659 O  O   . HOH F 3 .   ? 21.751 11.743  49.108 1.00 53.33 ? 397 HOH B O   1 
HETATM 3660 O  O   . HOH F 3 .   ? 59.706 8.514   41.884 1.00 69.51 ? 398 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 12  ? 0.4801 0.4925 0.4777 0.0065  -0.0222 -0.0085 3   SER A N   
2    C  CA  . SER A 12  ? 0.4524 0.4642 0.4520 0.0100  0.0003  -0.0039 3   SER A CA  
3    C  C   . SER A 12  ? 0.4439 0.4410 0.4055 0.0097  -0.0021 -0.0106 3   SER A C   
4    O  O   . SER A 12  ? 0.4632 0.4311 0.3337 0.0098  -0.0005 -0.0181 3   SER A O   
5    C  CB  . SER A 12  ? 0.4686 0.4753 0.4767 0.0124  -0.0074 0.0065  3   SER A CB  
6    O  OG  . SER A 12  ? 0.4951 0.5319 0.5137 -0.0030 -0.0395 -0.0056 3   SER A OG  
7    N  N   . PHE A 13  ? 0.4220 0.4149 0.3943 0.0073  0.0064  -0.0009 4   PHE A N   
8    C  CA  . PHE A 13  ? 0.4063 0.4053 0.3812 0.0005  0.0025  0.0032  4   PHE A CA  
9    C  C   . PHE A 13  ? 0.3959 0.3896 0.3595 0.0078  0.0017  0.0020  4   PHE A C   
10   O  O   . PHE A 13  ? 0.3746 0.3521 0.3390 0.0208  0.0025  0.0107  4   PHE A O   
11   C  CB  . PHE A 13  ? 0.3798 0.3748 0.3659 0.0070  0.0051  -0.0054 4   PHE A CB  
12   C  CG  . PHE A 13  ? 0.3699 0.3757 0.2744 -0.0050 -0.0123 -0.0101 4   PHE A CG  
13   C  CD1 . PHE A 13  ? 0.3493 0.3562 0.3827 0.0135  -0.0019 -0.0145 4   PHE A CD1 
14   C  CD2 . PHE A 13  ? 0.3638 0.3578 0.2937 0.0199  0.0236  -0.0118 4   PHE A CD2 
15   C  CE1 . PHE A 13  ? 0.3642 0.3676 0.3380 0.0144  0.0149  -0.0162 4   PHE A CE1 
16   C  CE2 . PHE A 13  ? 0.3839 0.3853 0.3778 -0.0017 0.0014  -0.0036 4   PHE A CE2 
17   C  CZ  . PHE A 13  ? 0.3761 0.3821 0.3538 0.0057  -0.0083 -0.0032 4   PHE A CZ  
18   N  N   . GLN A 14  ? 0.3819 0.3947 0.3611 0.0122  -0.0027 -0.0032 5   GLN A N   
19   C  CA  . GLN A 14  ? 0.4013 0.3920 0.3791 0.0037  0.0012  -0.0021 5   GLN A CA  
20   C  C   . GLN A 14  ? 0.3806 0.3788 0.3408 -0.0054 0.0075  -0.0043 5   GLN A C   
21   O  O   . GLN A 14  ? 0.3888 0.3719 0.3395 -0.0214 0.0248  -0.0103 5   GLN A O   
22   C  CB  . GLN A 14  ? 0.4229 0.3944 0.3735 0.0063  0.0096  0.0012  5   GLN A CB  
23   C  CG  . GLN A 14  ? 0.4777 0.4078 0.3921 0.0073  -0.0035 -0.0146 5   GLN A CG  
24   C  CD  . GLN A 14  ? 0.5074 0.4990 0.4519 0.0082  -0.0154 -0.0003 5   GLN A CD  
25   O  OE1 . GLN A 14  ? 0.5644 0.6649 0.6789 -0.0350 -0.0046 -0.0018 5   GLN A OE1 
26   N  NE2 . GLN A 14  ? 0.6157 0.6423 0.6142 -0.0393 0.0290  0.0122  5   GLN A NE2 
27   N  N   . LEU A 15  ? 0.3633 0.3774 0.3150 0.0007  0.0102  0.0016  6   LEU A N   
28   C  CA  . LEU A 15  ? 0.3693 0.3755 0.3142 0.0000  0.0065  0.0002  6   LEU A CA  
29   C  C   . LEU A 15  ? 0.3799 0.3761 0.3208 0.0077  0.0210  -0.0009 6   LEU A C   
30   O  O   . LEU A 15  ? 0.3984 0.3831 0.2455 0.0116  0.0008  0.0155  6   LEU A O   
31   C  CB  . LEU A 15  ? 0.3815 0.3836 0.3058 -0.0037 0.0204  -0.0076 6   LEU A CB  
32   C  CG  . LEU A 15  ? 0.3679 0.3786 0.3377 0.0014  0.0086  -0.0011 6   LEU A CG  
33   C  CD1 . LEU A 15  ? 0.3666 0.3805 0.3168 0.0162  0.0020  0.0217  6   LEU A CD1 
34   C  CD2 . LEU A 15  ? 0.3896 0.3741 0.3299 -0.0044 0.0038  0.0116  6   LEU A CD2 
35   N  N   . PRO A 16  ? 0.3415 0.3696 0.3204 0.0077  -0.0043 -0.0034 7   PRO A N   
36   C  CA  . PRO A 16  ? 0.3684 0.3692 0.3263 0.0052  0.0047  0.0030  7   PRO A CA  
37   C  C   . PRO A 16  ? 0.3745 0.3661 0.3284 0.0040  -0.0073 0.0094  7   PRO A C   
38   O  O   . PRO A 16  ? 0.3975 0.3493 0.3064 0.0124  -0.0079 0.0209  7   PRO A O   
39   C  CB  . PRO A 16  ? 0.3606 0.3842 0.3555 0.0036  -0.0117 0.0080  7   PRO A CB  
40   C  CG  . PRO A 16  ? 0.3479 0.3651 0.2864 0.0178  0.0232  0.0099  7   PRO A CG  
41   C  CD  . PRO A 16  ? 0.3423 0.3542 0.3442 0.0092  0.0065  0.0096  7   PRO A CD  
42   N  N   . LYS A 17  ? 0.3953 0.3756 0.3138 -0.0083 -0.0097 0.0025  8   LYS A N   
43   C  CA  . LYS A 17  ? 0.3973 0.3824 0.3449 -0.0017 -0.0085 0.0137  8   LYS A CA  
44   C  C   . LYS A 17  ? 0.3889 0.3638 0.3115 -0.0058 -0.0196 0.0174  8   LYS A C   
45   O  O   . LYS A 17  ? 0.3825 0.3748 0.2749 -0.0111 -0.0264 0.0051  8   LYS A O   
46   C  CB  . LYS A 17  ? 0.4266 0.4060 0.3805 -0.0024 -0.0051 0.0132  8   LYS A CB  
47   C  CG  . LYS A 17  ? 0.4567 0.4382 0.4326 0.0059  0.0178  0.0133  8   LYS A CG  
48   C  CD  . LYS A 17  ? 0.4725 0.4535 0.4121 -0.0069 0.0055  0.0126  8   LYS A CD  
49   C  CE  . LYS A 17  ? 0.5239 0.5318 0.5160 -0.0056 -0.0282 0.0050  8   LYS A CE  
50   N  NZ  . LYS A 17  ? 0.5993 0.5654 0.5560 0.0258  -0.0075 -0.0042 8   LYS A NZ  
51   N  N   . LEU A 18  ? 0.3948 0.3689 0.3315 0.0000  -0.0065 0.0239  9   LEU A N   
52   C  CA  . LEU A 18  ? 0.3758 0.3703 0.3444 0.0002  -0.0055 0.0146  9   LEU A CA  
53   C  C   . LEU A 18  ? 0.3778 0.3827 0.3356 -0.0004 -0.0096 0.0189  9   LEU A C   
54   O  O   . LEU A 18  ? 0.4002 0.4131 0.3329 -0.0075 -0.0098 0.0247  9   LEU A O   
55   C  CB  . LEU A 18  ? 0.3533 0.3434 0.2964 0.0148  -0.0031 0.0110  9   LEU A CB  
56   C  CG  . LEU A 18  ? 0.3541 0.3726 0.3346 -0.0152 -0.0058 -0.0024 9   LEU A CG  
57   C  CD1 . LEU A 18  ? 0.3458 0.3280 0.3186 0.0060  0.0099  -0.0195 9   LEU A CD1 
58   C  CD2 . LEU A 18  ? 0.3611 0.3378 0.3426 -0.0095 -0.0115 0.0253  9   LEU A CD2 
59   N  N   . SER A 19  ? 0.3925 0.3701 0.3523 0.0012  -0.0144 0.0233  10  SER A N   
60   C  CA  . SER A 19  ? 0.3956 0.3955 0.3711 0.0052  -0.0161 0.0129  10  SER A CA  
61   C  C   . SER A 19  ? 0.4162 0.4056 0.3832 0.0001  -0.0242 0.0317  10  SER A C   
62   O  O   . SER A 19  ? 0.4327 0.4268 0.3815 0.0103  -0.0414 0.0359  10  SER A O   
63   C  CB  . SER A 19  ? 0.4045 0.3990 0.3632 -0.0051 -0.0260 0.0272  10  SER A CB  
64   O  OG  . SER A 19  ? 0.4817 0.4456 0.4701 0.0045  -0.0150 -0.0012 10  SER A OG  
65   N  N   . TYR A 20  ? 0.4099 0.3969 0.3807 -0.0075 -0.0201 0.0307  11  TYR A N   
66   C  CA  . TYR A 20  ? 0.4026 0.3941 0.3678 -0.0015 -0.0048 0.0198  11  TYR A CA  
67   C  C   . TYR A 20  ? 0.4075 0.4035 0.3670 -0.0022 -0.0082 0.0174  11  TYR A C   
68   O  O   . TYR A 20  ? 0.3995 0.4108 0.3617 0.0059  0.0121  0.0118  11  TYR A O   
69   C  CB  . TYR A 20  ? 0.3755 0.3663 0.3482 -0.0182 0.0103  0.0433  11  TYR A CB  
70   C  CG  . TYR A 20  ? 0.3440 0.3587 0.3329 -0.0022 -0.0104 0.0556  11  TYR A CG  
71   C  CD1 . TYR A 20  ? 0.3444 0.3462 0.3067 -0.0230 -0.0055 0.0175  11  TYR A CD1 
72   C  CD2 . TYR A 20  ? 0.3040 0.3035 0.3256 0.0116  -0.0208 0.0482  11  TYR A CD2 
73   C  CE1 . TYR A 20  ? 0.3594 0.3578 0.3561 -0.0005 -0.0008 0.0322  11  TYR A CE1 
74   C  CE2 . TYR A 20  ? 0.2655 0.3236 0.2670 0.0203  0.0173  0.0247  11  TYR A CE2 
75   C  CZ  . TYR A 20  ? 0.2995 0.3328 0.3056 0.0040  0.0093  0.0243  11  TYR A CZ  
76   O  OH  . TYR A 20  ? 0.3155 0.3113 0.3322 0.0239  -0.0098 0.0494  11  TYR A OH  
77   N  N   . ASP A 21  ? 0.4090 0.3964 0.3803 -0.0088 -0.0149 0.0260  12  ASP A N   
78   C  CA  . ASP A 21  ? 0.4111 0.3949 0.3791 -0.0037 -0.0080 0.0156  12  ASP A CA  
79   C  C   . ASP A 21  ? 0.4001 0.3830 0.3592 0.0030  -0.0032 0.0296  12  ASP A C   
80   O  O   . ASP A 21  ? 0.3990 0.3630 0.2775 0.0113  -0.0251 0.0569  12  ASP A O   
81   C  CB  . ASP A 21  ? 0.4330 0.4052 0.4111 -0.0111 -0.0051 0.0150  12  ASP A CB  
82   C  CG  . ASP A 21  ? 0.5416 0.5250 0.4904 -0.0031 0.0130  -0.0053 12  ASP A CG  
83   O  OD1 . ASP A 21  ? 0.5763 0.5439 0.4840 0.0038  -0.0224 0.0121  12  ASP A OD1 
84   O  OD2 . ASP A 21  ? 0.5887 0.6004 0.6029 -0.0065 0.0437  0.0196  12  ASP A OD2 
85   N  N   . TYR A 22  ? 0.3917 0.3769 0.3650 -0.0004 -0.0054 0.0142  13  TYR A N   
86   C  CA  . TYR A 22  ? 0.4001 0.3822 0.3751 -0.0031 -0.0009 0.0124  13  TYR A CA  
87   C  C   . TYR A 22  ? 0.4034 0.3880 0.3864 -0.0047 -0.0010 0.0055  13  TYR A C   
88   O  O   . TYR A 22  ? 0.4069 0.3832 0.4040 -0.0212 -0.0037 0.0091  13  TYR A O   
89   C  CB  . TYR A 22  ? 0.4006 0.3898 0.3775 -0.0089 0.0052  0.0089  13  TYR A CB  
90   C  CG  . TYR A 22  ? 0.4040 0.4053 0.4365 -0.0100 0.0133  0.0059  13  TYR A CG  
91   C  CD1 . TYR A 22  ? 0.4027 0.3690 0.3713 -0.0139 -0.0010 0.0038  13  TYR A CD1 
92   C  CD2 . TYR A 22  ? 0.4322 0.4207 0.4340 0.0022  0.0197  0.0018  13  TYR A CD2 
93   C  CE1 . TYR A 22  ? 0.3518 0.3783 0.3815 0.0058  -0.0167 0.0012  13  TYR A CE1 
94   C  CE2 . TYR A 22  ? 0.4255 0.3926 0.3974 -0.0144 0.0159  0.0047  13  TYR A CE2 
95   C  CZ  . TYR A 22  ? 0.3857 0.4033 0.3820 -0.0237 0.0206  -0.0099 13  TYR A CZ  
96   O  OH  . TYR A 22  ? 0.3515 0.4147 0.3968 -0.0126 0.0475  -0.0030 13  TYR A OH  
97   N  N   . ASP A 23  ? 0.4028 0.3891 0.3993 -0.0082 0.0075  0.0095  14  ASP A N   
98   C  CA  . ASP A 23  ? 0.4069 0.3907 0.4052 -0.0008 0.0082  0.0172  14  ASP A CA  
99   C  C   . ASP A 23  ? 0.4123 0.3964 0.4108 -0.0049 0.0050  0.0187  14  ASP A C   
100  O  O   . ASP A 23  ? 0.3995 0.3684 0.4409 0.0042  0.0217  0.0340  14  ASP A O   
101  C  CB  . ASP A 23  ? 0.4120 0.3968 0.4328 -0.0001 0.0124  0.0166  14  ASP A CB  
102  C  CG  . ASP A 23  ? 0.4674 0.4342 0.4294 -0.0161 -0.0019 0.0125  14  ASP A CG  
103  O  OD1 . ASP A 23  ? 0.4771 0.4056 0.4033 -0.0301 0.0165  0.0472  14  ASP A OD1 
104  O  OD2 . ASP A 23  ? 0.4771 0.4483 0.4071 -0.0061 -0.0003 0.0493  14  ASP A OD2 
105  N  N   . GLU A 24  ? 0.4210 0.4088 0.3949 0.0011  -0.0062 0.0159  15  GLU A N   
106  C  CA  . GLU A 24  ? 0.4103 0.4146 0.4044 0.0019  0.0046  0.0066  15  GLU A CA  
107  C  C   . GLU A 24  ? 0.3979 0.4194 0.3926 0.0005  -0.0021 0.0192  15  GLU A C   
108  O  O   . GLU A 24  ? 0.4146 0.4378 0.4061 0.0222  -0.0026 0.0383  15  GLU A O   
109  C  CB  . GLU A 24  ? 0.4160 0.4256 0.4127 0.0042  -0.0047 0.0082  15  GLU A CB  
110  C  CG  . GLU A 24  ? 0.4299 0.4244 0.4112 -0.0009 -0.0015 0.0062  15  GLU A CG  
111  C  CD  . GLU A 24  ? 0.4616 0.4267 0.4258 -0.0035 0.0001  -0.0057 15  GLU A CD  
112  O  OE1 . GLU A 24  ? 0.4575 0.4085 0.3508 -0.0100 0.0092  0.0113  15  GLU A OE1 
113  O  OE2 . GLU A 24  ? 0.6091 0.5344 0.4744 -0.0009 -0.0180 0.0098  15  GLU A OE2 
114  N  N   . LEU A 25  ? 0.3787 0.3885 0.3798 0.0084  -0.0095 0.0194  16  LEU A N   
115  C  CA  . LEU A 25  ? 0.3640 0.3684 0.3763 0.0028  -0.0049 0.0090  16  LEU A CA  
116  C  C   . LEU A 25  ? 0.3512 0.3662 0.3629 0.0078  -0.0056 0.0137  16  LEU A C   
117  O  O   . LEU A 25  ? 0.3386 0.3650 0.3865 0.0177  0.0040  -0.0058 16  LEU A O   
118  C  CB  . LEU A 25  ? 0.3721 0.3824 0.3642 -0.0058 -0.0180 0.0051  16  LEU A CB  
119  C  CG  . LEU A 25  ? 0.3591 0.3467 0.3826 0.0240  0.0061  -0.0129 16  LEU A CG  
120  C  CD1 . LEU A 25  ? 0.3803 0.3653 0.3755 -0.0012 0.0089  0.0009  16  LEU A CD1 
121  C  CD2 . LEU A 25  ? 0.3814 0.3607 0.2641 0.0022  -0.0221 -0.0004 16  LEU A CD2 
122  N  N   . GLU A 26  ? 0.3557 0.3616 0.3522 0.0052  -0.0001 0.0074  17  GLU A N   
123  C  CA  . GLU A 26  ? 0.3711 0.3685 0.3709 -0.0002 0.0021  0.0052  17  GLU A CA  
124  C  C   . GLU A 26  ? 0.3813 0.3617 0.3785 0.0031  -0.0035 0.0073  17  GLU A C   
125  O  O   . GLU A 26  ? 0.3892 0.3764 0.4059 0.0107  0.0005  0.0081  17  GLU A O   
126  C  CB  . GLU A 26  ? 0.3705 0.3682 0.3671 -0.0062 -0.0017 -0.0001 17  GLU A CB  
127  C  CG  . GLU A 26  ? 0.3971 0.3772 0.3939 0.0021  0.0034  0.0074  17  GLU A CG  
128  C  CD  . GLU A 26  ? 0.4366 0.4124 0.4364 0.0027  -0.0090 0.0048  17  GLU A CD  
129  O  OE1 . GLU A 26  ? 0.4552 0.3744 0.4562 0.0210  0.0027  0.0579  17  GLU A OE1 
130  O  OE2 . GLU A 26  ? 0.4028 0.3571 0.4556 -0.0050 -0.0139 0.0077  17  GLU A OE2 
131  N  N   . PRO A 27  ? 0.3677 0.3517 0.3624 0.0011  0.0045  0.0066  18  PRO A N   
132  C  CA  . PRO A 27  ? 0.3773 0.3652 0.3808 -0.0023 0.0042  0.0018  18  PRO A CA  
133  C  C   . PRO A 27  ? 0.3875 0.3820 0.3733 -0.0108 0.0017  0.0023  18  PRO A C   
134  O  O   . PRO A 27  ? 0.4182 0.4153 0.3919 -0.0252 -0.0002 -0.0016 18  PRO A O   
135  C  CB  . PRO A 27  ? 0.3931 0.3845 0.3948 -0.0032 0.0079  -0.0044 18  PRO A CB  
136  C  CG  . PRO A 27  ? 0.3900 0.3741 0.4116 -0.0036 -0.0089 -0.0061 18  PRO A CG  
137  C  CD  . PRO A 27  ? 0.3811 0.3703 0.3864 -0.0053 0.0006  0.0125  18  PRO A CD  
138  N  N   . TYR A 28  ? 0.3532 0.3792 0.3539 -0.0058 -0.0090 -0.0004 19  TYR A N   
139  C  CA  . TYR A 28  ? 0.3553 0.3396 0.3385 0.0000  -0.0101 0.0034  19  TYR A CA  
140  C  C   . TYR A 28  ? 0.3330 0.3312 0.3221 0.0009  -0.0132 -0.0014 19  TYR A C   
141  O  O   . TYR A 28  ? 0.3417 0.3228 0.2972 0.0176  -0.0436 0.0005  19  TYR A O   
142  C  CB  . TYR A 28  ? 0.3615 0.3609 0.3500 -0.0016 -0.0052 0.0087  19  TYR A CB  
143  C  CG  . TYR A 28  ? 0.3851 0.3861 0.3820 0.0100  -0.0072 0.0010  19  TYR A CG  
144  C  CD1 . TYR A 28  ? 0.4013 0.3790 0.3921 0.0108  -0.0034 0.0213  19  TYR A CD1 
145  C  CD2 . TYR A 28  ? 0.3865 0.3544 0.4040 0.0270  -0.0240 0.0185  19  TYR A CD2 
146  C  CE1 . TYR A 28  ? 0.3527 0.3809 0.3996 0.0042  -0.0173 0.0087  19  TYR A CE1 
147  C  CE2 . TYR A 28  ? 0.3674 0.4001 0.4135 0.0209  -0.0151 0.0085  19  TYR A CE2 
148  C  CZ  . TYR A 28  ? 0.3515 0.3934 0.3980 0.0119  0.0094  0.0117  19  TYR A CZ  
149  O  OH  . TYR A 28  ? 0.4020 0.4248 0.4222 0.0212  -0.0193 0.0567  19  TYR A OH  
150  N  N   . ILE A 29  ? 0.3143 0.3133 0.2974 -0.0047 -0.0058 0.0091  20  ILE A N   
151  C  CA  . ILE A 29  ? 0.3342 0.3241 0.3077 -0.0014 -0.0082 0.0072  20  ILE A CA  
152  C  C   . ILE A 29  ? 0.3422 0.3130 0.3271 -0.0018 -0.0126 0.0114  20  ILE A C   
153  O  O   . ILE A 29  ? 0.3555 0.3316 0.3056 -0.0049 -0.0204 0.0095  20  ILE A O   
154  C  CB  . ILE A 29  ? 0.3270 0.3198 0.3022 0.0060  -0.0020 0.0253  20  ILE A CB  
155  C  CG1 . ILE A 29  ? 0.3186 0.3437 0.3294 -0.0176 -0.0135 -0.0018 20  ILE A CG1 
156  C  CG2 . ILE A 29  ? 0.3304 0.3154 0.3238 -0.0011 0.0029  0.0197  20  ILE A CG2 
157  C  CD1 . ILE A 29  ? 0.3587 0.3391 0.3211 -0.0090 -0.0117 -0.0020 20  ILE A CD1 
158  N  N   . ASP A 30  ? 0.3379 0.2714 0.3136 0.0018  -0.0233 0.0086  21  ASP A N   
159  C  CA  . ASP A 30  ? 0.3307 0.3098 0.3033 0.0020  -0.0070 0.0104  21  ASP A CA  
160  C  C   . ASP A 30  ? 0.3397 0.3002 0.3130 -0.0048 -0.0061 0.0090  21  ASP A C   
161  O  O   . ASP A 30  ? 0.3410 0.2758 0.2646 -0.0011 -0.0149 0.0281  21  ASP A O   
162  C  CB  . ASP A 30  ? 0.3387 0.3258 0.3214 -0.0029 -0.0069 0.0095  21  ASP A CB  
163  C  CG  . ASP A 30  ? 0.3409 0.3263 0.3544 0.0038  0.0013  0.0060  21  ASP A CG  
164  O  OD1 . ASP A 30  ? 0.3755 0.2865 0.3139 -0.0141 -0.0188 0.0241  21  ASP A OD1 
165  O  OD2 . ASP A 30  ? 0.3633 0.2837 0.3275 0.0216  -0.0015 -0.0043 21  ASP A OD2 
166  N  N   . SER A 31  ? 0.3798 0.2910 0.3120 -0.0041 -0.0020 0.0244  22  SER A N   
167  C  CA  . SER A 31  ? 0.3440 0.3046 0.3076 -0.0049 0.0099  0.0304  22  SER A CA  
168  C  C   . SER A 31  ? 0.3439 0.3033 0.3053 -0.0100 0.0027  0.0260  22  SER A C   
169  O  O   . SER A 31  ? 0.3543 0.2791 0.2766 -0.0123 0.0084  0.0367  22  SER A O   
170  C  CB  . SER A 31  ? 0.3882 0.3235 0.3392 -0.0177 -0.0120 0.0293  22  SER A CB  
171  O  OG  . SER A 31  ? 0.4860 0.4134 0.4182 0.0029  -0.0088 0.0600  22  SER A OG  
172  N  N   . ASN A 32  ? 0.3364 0.2877 0.3261 -0.0081 -0.0053 0.0148  23  ASN A N   
173  C  CA  . ASN A 32  ? 0.3273 0.2862 0.3170 -0.0121 0.0002  0.0166  23  ASN A CA  
174  C  C   . ASN A 32  ? 0.3204 0.2724 0.3117 -0.0091 0.0053  0.0247  23  ASN A C   
175  O  O   . ASN A 32  ? 0.3286 0.2883 0.2831 -0.0233 -0.0059 0.0193  23  ASN A O   
176  C  CB  . ASN A 32  ? 0.3153 0.2630 0.3073 -0.0145 -0.0029 0.0120  23  ASN A CB  
177  C  CG  . ASN A 32  ? 0.3298 0.3218 0.3507 -0.0123 -0.0033 0.0059  23  ASN A CG  
178  O  OD1 . ASN A 32  ? 0.3779 0.3634 0.4694 0.0156  0.0121  -0.0208 23  ASN A OD1 
179  N  ND2 . ASN A 32  ? 0.3816 0.3620 0.3520 -0.0022 -0.0223 0.0118  23  ASN A ND2 
180  N  N   . THR A 33  ? 0.3132 0.2619 0.3041 -0.0082 0.0010  0.0244  24  THR A N   
181  C  CA  . THR A 33  ? 0.2974 0.2738 0.3075 -0.0106 -0.0031 0.0127  24  THR A CA  
182  C  C   . THR A 33  ? 0.2665 0.2575 0.2876 -0.0115 -0.0060 0.0148  24  THR A C   
183  O  O   . THR A 33  ? 0.2905 0.2265 0.2825 0.0057  -0.0016 0.0609  24  THR A O   
184  C  CB  . THR A 33  ? 0.3094 0.2551 0.2990 -0.0247 -0.0088 0.0016  24  THR A CB  
185  O  OG1 . THR A 33  ? 0.3384 0.3277 0.3000 -0.0005 -0.0245 0.0296  24  THR A OG1 
186  C  CG2 . THR A 33  ? 0.2968 0.3020 0.3155 -0.0227 -0.0015 0.0143  24  THR A CG2 
187  N  N   . LEU A 34  ? 0.2979 0.2514 0.2761 -0.0136 0.0043  0.0301  25  LEU A N   
188  C  CA  . LEU A 34  ? 0.3049 0.2752 0.2917 -0.0065 -0.0075 0.0162  25  LEU A CA  
189  C  C   . LEU A 34  ? 0.3302 0.2978 0.2997 -0.0103 -0.0113 0.0150  25  LEU A C   
190  O  O   . LEU A 34  ? 0.3526 0.2918 0.2887 -0.0186 -0.0240 0.0178  25  LEU A O   
191  C  CB  . LEU A 34  ? 0.3221 0.2742 0.2829 -0.0087 -0.0114 0.0161  25  LEU A CB  
192  C  CG  . LEU A 34  ? 0.3205 0.3093 0.2944 -0.0132 -0.0056 0.0075  25  LEU A CG  
193  C  CD1 . LEU A 34  ? 0.3928 0.3680 0.3346 -0.0130 0.0004  0.0061  25  LEU A CD1 
194  C  CD2 . LEU A 34  ? 0.3301 0.3179 0.3027 0.0016  -0.0126 -0.0035 25  LEU A CD2 
195  N  N   . SER A 35  ? 0.3203 0.2769 0.2999 -0.0197 -0.0020 0.0204  26  SER A N   
196  C  CA  . SER A 35  ? 0.3177 0.3037 0.2996 -0.0145 -0.0028 0.0137  26  SER A CA  
197  C  C   . SER A 35  ? 0.2968 0.2954 0.2808 -0.0145 0.0020  0.0106  26  SER A C   
198  O  O   . SER A 35  ? 0.2895 0.3018 0.2668 -0.0201 0.0157  0.0009  26  SER A O   
199  C  CB  . SER A 35  ? 0.3697 0.3487 0.3371 -0.0322 -0.0056 0.0020  26  SER A CB  
200  O  OG  . SER A 35  ? 0.3828 0.4576 0.3742 -0.0348 -0.0495 0.0217  26  SER A OG  
201  N  N   . ILE A 36  ? 0.2844 0.2903 0.2786 -0.0130 -0.0070 0.0063  27  ILE A N   
202  C  CA  . ILE A 36  ? 0.2964 0.2904 0.2680 -0.0071 -0.0056 0.0090  27  ILE A CA  
203  C  C   . ILE A 36  ? 0.2931 0.2863 0.2746 0.0002  -0.0066 0.0133  27  ILE A C   
204  O  O   . ILE A 36  ? 0.3173 0.2688 0.3059 -0.0087 -0.0073 0.0446  27  ILE A O   
205  C  CB  . ILE A 36  ? 0.2907 0.3009 0.2726 -0.0091 -0.0199 0.0179  27  ILE A CB  
206  C  CG1 . ILE A 36  ? 0.3235 0.3169 0.2998 -0.0157 -0.0225 -0.0016 27  ILE A CG1 
207  C  CG2 . ILE A 36  ? 0.3098 0.3059 0.2984 0.0068  -0.0056 0.0122  27  ILE A CG2 
208  C  CD1 . ILE A 36  ? 0.3349 0.3235 0.2882 -0.0138 0.0028  -0.0002 27  ILE A CD1 
209  N  N   . HIS A 37  ? 0.2838 0.2753 0.2289 0.0116  -0.0221 0.0267  28  HIS A N   
210  C  CA  . HIS A 37  ? 0.2611 0.2740 0.2243 0.0015  -0.0198 0.0077  28  HIS A CA  
211  C  C   . HIS A 37  ? 0.2954 0.2834 0.2657 -0.0061 -0.0072 0.0037  28  HIS A C   
212  O  O   . HIS A 37  ? 0.2927 0.2704 0.2437 0.0321  -0.0095 0.0106  28  HIS A O   
213  C  CB  . HIS A 37  ? 0.2824 0.2465 0.2341 -0.0149 -0.0261 0.0035  28  HIS A CB  
214  C  CG  . HIS A 37  ? 0.2921 0.2833 0.1968 -0.0029 -0.0016 0.0143  28  HIS A CG  
215  N  ND1 . HIS A 37  ? 0.2636 0.2754 0.2106 -0.0120 -0.0041 -0.0033 28  HIS A ND1 
216  C  CD2 . HIS A 37  ? 0.2994 0.2724 0.2613 -0.0018 0.0186  0.0082  28  HIS A CD2 
217  C  CE1 . HIS A 37  ? 0.3020 0.1723 0.2195 -0.0150 -0.0015 0.0345  28  HIS A CE1 
218  N  NE2 . HIS A 37  ? 0.2607 0.2579 0.2153 0.0174  0.0400  -0.0055 28  HIS A NE2 
219  N  N   . HIS A 38  ? 0.3110 0.2778 0.2535 -0.0084 -0.0176 0.0013  29  HIS A N   
220  C  CA  . HIS A 38  ? 0.3034 0.2911 0.2652 -0.0054 -0.0008 -0.0001 29  HIS A CA  
221  C  C   . HIS A 38  ? 0.2976 0.2941 0.3001 -0.0034 0.0000  0.0104  29  HIS A C   
222  O  O   . HIS A 38  ? 0.2758 0.2898 0.3021 -0.0318 0.0184  0.0148  29  HIS A O   
223  C  CB  . HIS A 38  ? 0.3260 0.3232 0.2822 -0.0044 0.0027  -0.0049 29  HIS A CB  
224  C  CG  . HIS A 38  ? 0.3132 0.2971 0.2523 -0.0057 -0.0105 -0.0072 29  HIS A CG  
225  N  ND1 . HIS A 38  ? 0.3113 0.2955 0.2783 0.0071  0.0103  -0.0371 29  HIS A ND1 
226  C  CD2 . HIS A 38  ? 0.3374 0.3209 0.2794 -0.0068 0.0089  0.0028  29  HIS A CD2 
227  C  CE1 . HIS A 38  ? 0.3389 0.3252 0.2808 -0.0216 -0.0026 -0.0170 29  HIS A CE1 
228  N  NE2 . HIS A 38  ? 0.3218 0.3383 0.2849 -0.0041 0.0203  -0.0294 29  HIS A NE2 
229  N  N   . GLY A 39  ? 0.2968 0.3110 0.3099 0.0072  -0.0057 0.0123  30  GLY A N   
230  C  CA  . GLY A 39  ? 0.3129 0.3114 0.2800 0.0021  0.0006  0.0046  30  GLY A CA  
231  C  C   . GLY A 39  ? 0.3202 0.3076 0.2944 0.0112  0.0070  0.0023  30  GLY A C   
232  O  O   . GLY A 39  ? 0.3457 0.3154 0.2651 0.0007  0.0203  -0.0123 30  GLY A O   
233  N  N   . LYS A 40  ? 0.3300 0.2776 0.2707 0.0015  0.0026  0.0016  31  LYS A N   
234  C  CA  . LYS A 40  ? 0.2935 0.2986 0.2832 0.0021  0.0028  -0.0017 31  LYS A CA  
235  C  C   . LYS A 40  ? 0.2935 0.2817 0.2905 -0.0042 -0.0029 -0.0020 31  LYS A C   
236  O  O   . LYS A 40  ? 0.3144 0.3014 0.3174 -0.0161 0.0212  0.0162  31  LYS A O   
237  C  CB  . LYS A 40  ? 0.3454 0.2949 0.3337 0.0016  -0.0098 -0.0133 31  LYS A CB  
238  C  CG  . LYS A 40  ? 0.3831 0.3839 0.3962 -0.0129 0.0000  0.0024  31  LYS A CG  
239  C  CD  . LYS A 40  ? 0.4127 0.4505 0.4162 -0.0149 0.0067  -0.0057 31  LYS A CD  
240  C  CE  . LYS A 40  ? 0.4358 0.4791 0.4607 -0.0115 0.0156  0.0161  31  LYS A CE  
241  N  NZ  . LYS A 40  ? 0.4529 0.5484 0.4756 0.0052  0.0274  -0.0196 31  LYS A NZ  
242  N  N   . HIS A 41  ? 0.2966 0.2821 0.2757 -0.0053 0.0010  0.0164  32  HIS A N   
243  C  CA  . HIS A 41  ? 0.2793 0.2702 0.2786 -0.0040 -0.0044 0.0038  32  HIS A CA  
244  C  C   . HIS A 41  ? 0.2928 0.2740 0.2812 0.0023  -0.0139 0.0013  32  HIS A C   
245  O  O   . HIS A 41  ? 0.2754 0.2442 0.2299 0.0172  -0.0367 0.0019  32  HIS A O   
246  C  CB  . HIS A 41  ? 0.2784 0.2454 0.2555 -0.0107 -0.0068 0.0072  32  HIS A CB  
247  C  CG  . HIS A 41  ? 0.2843 0.2658 0.2487 -0.0045 -0.0052 0.0127  32  HIS A CG  
248  N  ND1 . HIS A 41  ? 0.3675 0.3123 0.2476 -0.0166 -0.0262 0.0087  32  HIS A ND1 
249  C  CD2 . HIS A 41  ? 0.3140 0.2439 0.2452 0.0152  -0.0206 0.0349  32  HIS A CD2 
250  C  CE1 . HIS A 41  ? 0.3565 0.3101 0.2922 -0.0023 -0.0287 0.0110  32  HIS A CE1 
251  N  NE2 . HIS A 41  ? 0.3095 0.3201 0.3077 -0.0219 0.0086  0.0067  32  HIS A NE2 
252  N  N   . HIS A 42  ? 0.2942 0.2779 0.2695 -0.0019 -0.0136 0.0070  33  HIS A N   
253  C  CA  . HIS A 42  ? 0.2924 0.2786 0.2780 -0.0035 0.0010  0.0042  33  HIS A CA  
254  C  C   . HIS A 42  ? 0.3086 0.2799 0.2868 -0.0012 0.0014  0.0050  33  HIS A C   
255  O  O   . HIS A 42  ? 0.3302 0.2570 0.3048 0.0248  -0.0002 0.0041  33  HIS A O   
256  C  CB  . HIS A 42  ? 0.2910 0.3022 0.2623 -0.0054 -0.0113 0.0084  33  HIS A CB  
257  C  CG  . HIS A 42  ? 0.2927 0.2772 0.2642 -0.0188 0.0017  0.0057  33  HIS A CG  
258  N  ND1 . HIS A 42  ? 0.2855 0.2830 0.2863 -0.0141 0.0009  0.0053  33  HIS A ND1 
259  C  CD2 . HIS A 42  ? 0.2609 0.2531 0.2218 0.0257  -0.0030 -0.0041 33  HIS A CD2 
260  C  CE1 . HIS A 42  ? 0.2819 0.2674 0.2648 0.0104  -0.0026 -0.0125 33  HIS A CE1 
261  N  NE2 . HIS A 42  ? 0.2824 0.2899 0.2211 0.0207  -0.0207 -0.0104 33  HIS A NE2 
262  N  N   . ALA A 43  ? 0.2879 0.2820 0.2770 0.0082  -0.0041 0.0116  34  ALA A N   
263  C  CA  . ALA A 43  ? 0.2923 0.2986 0.2827 0.0045  -0.0049 0.0099  34  ALA A CA  
264  C  C   . ALA A 43  ? 0.3091 0.2879 0.2964 0.0012  0.0104  0.0114  34  ALA A C   
265  O  O   . ALA A 43  ? 0.3011 0.2733 0.3171 -0.0143 0.0175  0.0180  34  ALA A O   
266  C  CB  . ALA A 43  ? 0.3028 0.3231 0.3007 -0.0025 -0.0074 0.0112  34  ALA A CB  
267  N  N   . THR A 44  ? 0.2945 0.2828 0.2910 0.0036  0.0012  0.0054  35  THR A N   
268  C  CA  . THR A 44  ? 0.3009 0.2965 0.2963 0.0065  -0.0045 0.0040  35  THR A CA  
269  C  C   . THR A 44  ? 0.2961 0.2984 0.3029 0.0035  0.0061  -0.0006 35  THR A C   
270  O  O   . THR A 44  ? 0.3041 0.3169 0.3539 -0.0080 0.0231  0.0078  35  THR A O   
271  C  CB  . THR A 44  ? 0.3185 0.3082 0.3019 0.0144  0.0058  -0.0006 35  THR A CB  
272  O  OG1 . THR A 44  ? 0.3033 0.3011 0.3678 -0.0082 -0.0270 -0.0109 35  THR A OG1 
273  C  CG2 . THR A 44  ? 0.3139 0.3250 0.3071 0.0056  -0.0034 0.0106  35  THR A CG2 
274  N  N   . TYR A 45  ? 0.3001 0.2895 0.2437 -0.0016 -0.0023 -0.0132 36  TYR A N   
275  C  CA  . TYR A 45  ? 0.2988 0.2876 0.2460 0.0024  0.0029  -0.0074 36  TYR A CA  
276  C  C   . TYR A 45  ? 0.3124 0.2823 0.2667 -0.0039 0.0002  -0.0048 36  TYR A C   
277  O  O   . TYR A 45  ? 0.3283 0.2652 0.2610 0.0391  0.0030  -0.0047 36  TYR A O   
278  C  CB  . TYR A 45  ? 0.2821 0.2664 0.2638 -0.0072 -0.0080 -0.0057 36  TYR A CB  
279  C  CG  . TYR A 45  ? 0.3022 0.2820 0.2363 -0.0008 0.0161  0.0089  36  TYR A CG  
280  C  CD1 . TYR A 45  ? 0.2894 0.2996 0.2712 -0.0113 -0.0052 -0.0259 36  TYR A CD1 
281  C  CD2 . TYR A 45  ? 0.3272 0.2407 0.2837 0.0233  -0.0427 -0.0399 36  TYR A CD2 
282  C  CE1 . TYR A 45  ? 0.2554 0.3064 0.2572 0.0010  0.0371  -0.0041 36  TYR A CE1 
283  C  CE2 . TYR A 45  ? 0.3002 0.3454 0.2594 0.0263  -0.0260 0.0147  36  TYR A CE2 
284  C  CZ  . TYR A 45  ? 0.2814 0.3394 0.2605 -0.0033 -0.0256 -0.0355 36  TYR A CZ  
285  O  OH  . TYR A 45  ? 0.3724 0.4550 0.3232 -0.0055 0.0044  -0.0775 36  TYR A OH  
286  N  N   . VAL A 46  ? 0.2884 0.2872 0.2457 0.0028  -0.0103 0.0007  37  VAL A N   
287  C  CA  . VAL A 46  ? 0.3119 0.2941 0.2661 0.0033  0.0033  -0.0049 37  VAL A CA  
288  C  C   . VAL A 46  ? 0.2891 0.2884 0.2625 -0.0021 -0.0007 0.0025  37  VAL A C   
289  O  O   . VAL A 46  ? 0.2986 0.3147 0.3319 0.0066  -0.0022 -0.0138 37  VAL A O   
290  C  CB  . VAL A 46  ? 0.3102 0.3152 0.2775 0.0129  -0.0063 -0.0009 37  VAL A CB  
291  C  CG1 . VAL A 46  ? 0.3442 0.3358 0.3092 0.0147  0.0204  -0.0270 37  VAL A CG1 
292  C  CG2 . VAL A 46  ? 0.3167 0.2714 0.3054 -0.0069 -0.0047 -0.0092 37  VAL A CG2 
293  N  N   . ASN A 47  ? 0.3159 0.2927 0.2587 -0.0075 -0.0035 -0.0246 38  ASN A N   
294  C  CA  . ASN A 47  ? 0.3142 0.3069 0.2996 -0.0043 -0.0086 -0.0143 38  ASN A CA  
295  C  C   . ASN A 47  ? 0.3299 0.3075 0.3049 -0.0075 0.0013  -0.0159 38  ASN A C   
296  O  O   . ASN A 47  ? 0.3140 0.3004 0.2840 -0.0022 -0.0035 -0.0513 38  ASN A O   
297  C  CB  . ASN A 47  ? 0.3408 0.3239 0.3297 -0.0068 0.0102  -0.0047 38  ASN A CB  
298  C  CG  . ASN A 47  ? 0.3825 0.3755 0.3724 -0.0216 0.0083  0.0092  38  ASN A CG  
299  O  OD1 . ASN A 47  ? 0.3924 0.4532 0.4058 -0.0232 -0.0069 0.0188  38  ASN A OD1 
300  N  ND2 . ASN A 47  ? 0.4586 0.3530 0.4646 -0.0290 0.0094  -0.0086 38  ASN A ND2 
301  N  N   . ASN A 48  ? 0.3262 0.2976 0.2965 0.0139  -0.0057 -0.0236 39  ASN A N   
302  C  CA  . ASN A 48  ? 0.3336 0.3089 0.2988 -0.0003 0.0023  -0.0117 39  ASN A CA  
303  C  C   . ASN A 48  ? 0.3503 0.3303 0.3344 0.0023  -0.0110 -0.0041 39  ASN A C   
304  O  O   . ASN A 48  ? 0.3926 0.3232 0.3195 0.0002  -0.0322 0.0017  39  ASN A O   
305  C  CB  . ASN A 48  ? 0.3333 0.3132 0.2737 -0.0039 -0.0072 -0.0028 39  ASN A CB  
306  C  CG  . ASN A 48  ? 0.3572 0.3273 0.2863 -0.0030 -0.0005 0.0017  39  ASN A CG  
307  O  OD1 . ASN A 48  ? 0.3635 0.3790 0.3238 -0.0234 0.0008  0.0057  39  ASN A OD1 
308  N  ND2 . ASN A 48  ? 0.4207 0.3097 0.2467 0.0071  -0.0314 -0.0110 39  ASN A ND2 
309  N  N   . LEU A 49  ? 0.3496 0.3500 0.3379 0.0010  0.0024  -0.0005 40  LEU A N   
310  C  CA  . LEU A 49  ? 0.3381 0.3190 0.3088 0.0021  -0.0037 -0.0053 40  LEU A CA  
311  C  C   . LEU A 49  ? 0.3468 0.3089 0.3109 0.0024  -0.0032 -0.0042 40  LEU A C   
312  O  O   . LEU A 49  ? 0.3561 0.2846 0.2925 0.0072  0.0148  -0.0032 40  LEU A O   
313  C  CB  . LEU A 49  ? 0.3525 0.3147 0.2996 -0.0077 0.0001  -0.0103 40  LEU A CB  
314  C  CG  . LEU A 49  ? 0.3308 0.3323 0.3421 0.0059  0.0109  0.0051  40  LEU A CG  
315  C  CD1 . LEU A 49  ? 0.3099 0.3111 0.2411 -0.0213 -0.0104 -0.0225 40  LEU A CD1 
316  C  CD2 . LEU A 49  ? 0.3479 0.3481 0.3285 -0.0056 -0.0153 -0.0067 40  LEU A CD2 
317  N  N   . ASN A 50  ? 0.3464 0.3015 0.3119 0.0014  0.0015  -0.0110 41  ASN A N   
318  C  CA  . ASN A 50  ? 0.3577 0.3389 0.3333 0.0010  -0.0016 -0.0117 41  ASN A CA  
319  C  C   . ASN A 50  ? 0.3681 0.3384 0.3439 0.0113  -0.0029 -0.0128 41  ASN A C   
320  O  O   . ASN A 50  ? 0.3931 0.3392 0.3396 0.0044  -0.0107 -0.0332 41  ASN A O   
321  C  CB  . ASN A 50  ? 0.3569 0.3492 0.3193 -0.0032 -0.0109 -0.0186 41  ASN A CB  
322  C  CG  . ASN A 50  ? 0.3614 0.3434 0.3504 0.0070  0.0012  -0.0034 41  ASN A CG  
323  O  OD1 . ASN A 50  ? 0.3444 0.3485 0.3227 -0.0058 -0.0031 -0.0272 41  ASN A OD1 
324  N  ND2 . ASN A 50  ? 0.3851 0.3247 0.2957 -0.0192 -0.0059 -0.0620 41  ASN A ND2 
325  N  N   . ALA A 51  ? 0.3582 0.3315 0.3833 0.0060  -0.0021 -0.0159 42  ALA A N   
326  C  CA  . ALA A 51  ? 0.3768 0.3718 0.3841 0.0045  -0.0100 -0.0148 42  ALA A CA  
327  C  C   . ALA A 51  ? 0.3722 0.3640 0.3842 0.0045  -0.0164 -0.0156 42  ALA A C   
328  O  O   . ALA A 51  ? 0.3778 0.3580 0.3990 0.0187  -0.0301 -0.0263 42  ALA A O   
329  C  CB  . ALA A 51  ? 0.3776 0.3971 0.4113 -0.0080 0.0020  -0.0258 42  ALA A CB  
330  N  N   . ALA A 52  ? 0.3755 0.3626 0.3956 0.0000  -0.0149 -0.0196 43  ALA A N   
331  C  CA  . ALA A 52  ? 0.4058 0.3821 0.3967 0.0061  -0.0046 -0.0010 43  ALA A CA  
332  C  C   . ALA A 52  ? 0.4227 0.3888 0.4246 -0.0022 -0.0068 0.0006  43  ALA A C   
333  O  O   . ALA A 52  ? 0.4362 0.3880 0.4445 -0.0012 0.0004  0.0186  43  ALA A O   
334  C  CB  . ALA A 52  ? 0.4012 0.3720 0.3856 0.0074  0.0024  0.0106  43  ALA A CB  
335  N  N   . LEU A 53  ? 0.4219 0.3859 0.4153 0.0020  -0.0028 -0.0100 44  LEU A N   
336  C  CA  . LEU A 53  ? 0.4262 0.4059 0.4257 -0.0045 -0.0042 -0.0070 44  LEU A CA  
337  C  C   . LEU A 53  ? 0.4370 0.4083 0.4381 0.0045  -0.0005 -0.0086 44  LEU A C   
338  O  O   . LEU A 53  ? 0.4347 0.3772 0.4371 0.0122  -0.0001 -0.0147 44  LEU A O   
339  C  CB  . LEU A 53  ? 0.4112 0.3801 0.4023 -0.0037 0.0036  -0.0158 44  LEU A CB  
340  C  CG  . LEU A 53  ? 0.3903 0.3690 0.3769 -0.0175 -0.0095 -0.0227 44  LEU A CG  
341  C  CD1 . LEU A 53  ? 0.3958 0.3715 0.4129 -0.0003 -0.0088 -0.0314 44  LEU A CD1 
342  C  CD2 . LEU A 53  ? 0.4234 0.4040 0.3424 0.0040  0.0166  -0.0023 44  LEU A CD2 
343  N  N   . GLU A 54  ? 0.4527 0.4325 0.4783 -0.0005 0.0055  -0.0071 45  GLU A N   
344  C  CA  . GLU A 54  ? 0.4871 0.4825 0.4855 0.0059  0.0081  -0.0050 45  GLU A CA  
345  C  C   . GLU A 54  ? 0.4837 0.4833 0.4876 -0.0039 0.0030  -0.0083 45  GLU A C   
346  O  O   . GLU A 54  ? 0.4485 0.4625 0.4845 0.0118  0.0095  -0.0137 45  GLU A O   
347  C  CB  . GLU A 54  ? 0.5034 0.5023 0.5119 -0.0050 0.0111  -0.0042 45  GLU A CB  
348  C  CG  . GLU A 54  ? 0.5672 0.5362 0.5561 -0.0114 0.0021  0.0081  45  GLU A CG  
349  C  CD  . GLU A 54  ? 0.5403 0.5760 0.5753 -0.0028 0.0004  -0.0053 45  GLU A CD  
350  O  OE1 . GLU A 54  ? 0.6403 0.6144 0.6537 0.0367  -0.0068 0.0272  45  GLU A OE1 
351  O  OE2 . GLU A 54  ? 0.6935 0.6569 0.6971 -0.0361 0.0298  0.0138  45  GLU A OE2 
352  N  N   . ASN A 55  ? 0.4944 0.4683 0.5005 -0.0037 -0.0011 -0.0006 46  ASN A N   
353  C  CA  . ASN A 55  ? 0.5041 0.4948 0.5136 0.0017  0.0027  -0.0015 46  ASN A CA  
354  C  C   . ASN A 55  ? 0.5032 0.4900 0.5186 0.0002  0.0030  0.0009  46  ASN A C   
355  O  O   . ASN A 55  ? 0.5213 0.4954 0.5312 0.0115  -0.0035 -0.0011 46  ASN A O   
356  C  CB  . ASN A 55  ? 0.5291 0.5077 0.5255 0.0026  -0.0035 -0.0004 46  ASN A CB  
357  C  CG  . ASN A 55  ? 0.5667 0.5848 0.5959 -0.0071 0.0060  0.0054  46  ASN A CG  
358  O  OD1 . ASN A 55  ? 0.6273 0.6719 0.6350 0.0065  0.0136  0.0090  46  ASN A OD1 
359  N  ND2 . ASN A 55  ? 0.6496 0.6634 0.6324 -0.0076 -0.0170 -0.0122 46  ASN A ND2 
360  N  N   . TYR A 56  ? 0.4872 0.4750 0.4867 0.0062  0.0045  -0.0038 47  TYR A N   
361  C  CA  . TYR A 56  ? 0.4864 0.4731 0.4873 0.0055  0.0020  -0.0087 47  TYR A CA  
362  C  C   . TYR A 56  ? 0.4821 0.4778 0.4852 0.0068  0.0049  -0.0126 47  TYR A C   
363  O  O   . TYR A 56  ? 0.4867 0.4638 0.4980 0.0093  -0.0006 -0.0097 47  TYR A O   
364  C  CB  . TYR A 56  ? 0.4745 0.4741 0.4752 0.0039  0.0076  0.0020  47  TYR A CB  
365  C  CG  . TYR A 56  ? 0.4763 0.4785 0.4878 -0.0006 0.0004  -0.0021 47  TYR A CG  
366  C  CD1 . TYR A 56  ? 0.4661 0.4605 0.4575 0.0146  -0.0093 -0.0270 47  TYR A CD1 
367  C  CD2 . TYR A 56  ? 0.4636 0.4728 0.4510 -0.0162 -0.0048 0.0003  47  TYR A CD2 
368  C  CE1 . TYR A 56  ? 0.4856 0.4720 0.4641 0.0224  0.0061  -0.0110 47  TYR A CE1 
369  C  CE2 . TYR A 56  ? 0.4856 0.4626 0.4865 -0.0015 -0.0140 0.0162  47  TYR A CE2 
370  C  CZ  . TYR A 56  ? 0.4688 0.4503 0.4713 0.0095  -0.0072 0.0038  47  TYR A CZ  
371  O  OH  . TYR A 56  ? 0.4865 0.4848 0.4763 0.0065  -0.0075 -0.0428 47  TYR A OH  
372  N  N   . SER A 57  ? 0.4890 0.4880 0.4915 0.0019  0.0043  -0.0092 48  SER A N   
373  C  CA  . SER A 57  ? 0.4911 0.4804 0.4835 0.0012  0.0037  -0.0114 48  SER A CA  
374  C  C   . SER A 57  ? 0.4860 0.4692 0.4716 0.0011  0.0004  -0.0170 48  SER A C   
375  O  O   . SER A 57  ? 0.4937 0.4773 0.4548 -0.0110 -0.0065 -0.0311 48  SER A O   
376  C  CB  . SER A 57  ? 0.5114 0.5050 0.4929 0.0011  0.0075  -0.0048 48  SER A CB  
377  O  OG  . SER A 57  ? 0.5667 0.5094 0.5048 0.0185  0.0102  -0.0336 48  SER A OG  
378  N  N   . GLU A 58  ? 0.4767 0.4614 0.4610 -0.0040 0.0010  -0.0235 49  GLU A N   
379  C  CA  . GLU A 58  ? 0.4811 0.4645 0.4728 -0.0026 0.0001  -0.0138 49  GLU A CA  
380  C  C   . GLU A 58  ? 0.4673 0.4599 0.4644 -0.0071 0.0032  -0.0186 49  GLU A C   
381  O  O   . GLU A 58  ? 0.4683 0.4633 0.4654 -0.0325 0.0088  -0.0340 49  GLU A O   
382  C  CB  . GLU A 58  ? 0.5082 0.4745 0.4899 -0.0007 -0.0021 -0.0069 49  GLU A CB  
383  C  CG  . GLU A 58  ? 0.5520 0.5292 0.5219 -0.0049 0.0006  -0.0037 49  GLU A CG  
384  C  CD  . GLU A 58  ? 0.5762 0.5898 0.5972 0.0087  -0.0039 0.0048  49  GLU A CD  
385  O  OE1 . GLU A 58  ? 0.5703 0.5387 0.5692 -0.0014 0.0067  0.0171  49  GLU A OE1 
386  O  OE2 . GLU A 58  ? 0.6598 0.6453 0.6041 -0.0082 0.0039  -0.0047 49  GLU A OE2 
387  N  N   . LEU A 59  ? 0.4521 0.4561 0.4401 -0.0106 0.0021  -0.0214 50  LEU A N   
388  C  CA  . LEU A 59  ? 0.4429 0.4357 0.4309 -0.0065 -0.0056 -0.0100 50  LEU A CA  
389  C  C   . LEU A 59  ? 0.4377 0.4417 0.4228 -0.0069 -0.0039 -0.0131 50  LEU A C   
390  O  O   . LEU A 59  ? 0.4324 0.4350 0.3981 -0.0113 0.0081  -0.0165 50  LEU A O   
391  C  CB  . LEU A 59  ? 0.4284 0.4174 0.4085 -0.0049 -0.0020 -0.0036 50  LEU A CB  
392  C  CG  . LEU A 59  ? 0.4420 0.4269 0.4101 -0.0197 -0.0022 -0.0029 50  LEU A CG  
393  C  CD1 . LEU A 59  ? 0.4421 0.4337 0.4143 -0.0071 -0.0037 0.0056  50  LEU A CD1 
394  C  CD2 . LEU A 59  ? 0.4568 0.4786 0.4281 -0.0073 0.0028  -0.0028 50  LEU A CD2 
395  N  N   . HIS A 60  ? 0.4288 0.4416 0.4363 -0.0066 0.0003  -0.0220 51  HIS A N   
396  C  CA  . HIS A 60  ? 0.4560 0.4505 0.4364 -0.0021 0.0006  -0.0122 51  HIS A CA  
397  C  C   . HIS A 60  ? 0.4732 0.4710 0.4511 -0.0009 0.0032  -0.0068 51  HIS A C   
398  O  O   . HIS A 60  ? 0.5092 0.5056 0.4678 0.0033  0.0193  0.0120  51  HIS A O   
399  C  CB  . HIS A 60  ? 0.4519 0.4518 0.4624 -0.0041 0.0019  -0.0110 51  HIS A CB  
400  C  CG  . HIS A 60  ? 0.4631 0.4574 0.4368 -0.0060 -0.0159 -0.0097 51  HIS A CG  
401  N  ND1 . HIS A 60  ? 0.4640 0.4436 0.4315 0.0069  0.0037  -0.0260 51  HIS A ND1 
402  C  CD2 . HIS A 60  ? 0.4795 0.4798 0.4126 0.0008  -0.0003 -0.0137 51  HIS A CD2 
403  C  CE1 . HIS A 60  ? 0.4618 0.4406 0.4515 -0.0134 -0.0053 -0.0257 51  HIS A CE1 
404  N  NE2 . HIS A 60  ? 0.4774 0.4661 0.4837 -0.0092 0.0087  0.0062  51  HIS A NE2 
405  N  N   . ASN A 61  ? 0.4732 0.4727 0.4421 -0.0007 0.0023  -0.0109 52  ASN A N   
406  C  CA  . ASN A 61  ? 0.4718 0.4796 0.4577 0.0044  0.0035  -0.0126 52  ASN A CA  
407  C  C   . ASN A 61  ? 0.4769 0.4986 0.4592 0.0073  0.0023  -0.0113 52  ASN A C   
408  O  O   . ASN A 61  ? 0.4743 0.5015 0.4457 0.0201  0.0000  -0.0252 52  ASN A O   
409  C  CB  . ASN A 61  ? 0.4980 0.4893 0.4899 0.0022  -0.0057 -0.0150 52  ASN A CB  
410  C  CG  . ASN A 61  ? 0.5534 0.5788 0.5441 -0.0024 0.0159  -0.0076 52  ASN A CG  
411  O  OD1 . ASN A 61  ? 0.6351 0.5871 0.6156 0.0005  -0.0077 0.0083  52  ASN A OD1 
412  N  ND2 . ASN A 61  ? 0.6799 0.6260 0.6470 0.0149  -0.0013 -0.0222 52  ASN A ND2 
413  N  N   . LYS A 62  ? 0.4780 0.4860 0.4574 -0.0017 0.0058  -0.0165 53  LYS A N   
414  C  CA  . LYS A 62  ? 0.4520 0.4639 0.4404 -0.0028 0.0019  -0.0085 53  LYS A CA  
415  C  C   . LYS A 62  ? 0.4257 0.4419 0.4024 -0.0058 0.0015  -0.0124 53  LYS A C   
416  O  O   . LYS A 62  ? 0.4252 0.4213 0.3684 -0.0238 0.0110  -0.0235 53  LYS A O   
417  C  CB  . LYS A 62  ? 0.4586 0.4937 0.4340 -0.0034 0.0031  -0.0035 53  LYS A CB  
418  C  CG  . LYS A 62  ? 0.4931 0.5033 0.4702 -0.0032 -0.0026 -0.0087 53  LYS A CG  
419  C  CD  . LYS A 62  ? 0.5045 0.5244 0.5039 -0.0077 -0.0049 0.0103  53  LYS A CD  
420  C  CE  . LYS A 62  ? 0.5355 0.5180 0.5552 -0.0004 -0.0122 0.0078  53  LYS A CE  
421  N  NZ  . LYS A 62  ? 0.5485 0.5072 0.5927 -0.0185 -0.0096 -0.0006 53  LYS A NZ  
422  N  N   . SER A 63  ? 0.4152 0.4284 0.3982 -0.0141 -0.0131 -0.0074 54  SER A N   
423  C  CA  . SER A 63  ? 0.4118 0.4278 0.4020 -0.0076 -0.0097 -0.0113 54  SER A CA  
424  C  C   . SER A 63  ? 0.3959 0.4030 0.3863 -0.0085 -0.0086 -0.0159 54  SER A C   
425  O  O   . SER A 63  ? 0.3646 0.3859 0.3681 -0.0192 -0.0167 -0.0308 54  SER A O   
426  C  CB  . SER A 63  ? 0.4093 0.4260 0.3929 -0.0125 -0.0068 -0.0119 54  SER A CB  
427  O  OG  . SER A 63  ? 0.3553 0.4064 0.3571 -0.0192 -0.0202 -0.0372 54  SER A OG  
428  N  N   . LEU A 64  ? 0.3977 0.4029 0.3899 -0.0019 0.0020  -0.0143 55  LEU A N   
429  C  CA  . LEU A 64  ? 0.3960 0.4051 0.3876 -0.0070 -0.0097 -0.0084 55  LEU A CA  
430  C  C   . LEU A 64  ? 0.4013 0.3991 0.3828 -0.0121 -0.0077 -0.0024 55  LEU A C   
431  O  O   . LEU A 64  ? 0.4215 0.4092 0.4033 -0.0150 -0.0280 -0.0022 55  LEU A O   
432  C  CB  . LEU A 64  ? 0.4123 0.4204 0.3855 -0.0013 -0.0093 -0.0024 55  LEU A CB  
433  C  CG  . LEU A 64  ? 0.3830 0.3732 0.3733 0.0081  -0.0060 -0.0222 55  LEU A CG  
434  C  CD1 . LEU A 64  ? 0.3622 0.2876 0.2883 -0.0018 -0.0125 -0.0297 55  LEU A CD1 
435  C  CD2 . LEU A 64  ? 0.3807 0.3969 0.3836 -0.0132 -0.0104 -0.0004 55  LEU A CD2 
436  N  N   . GLU A 65  ? 0.3960 0.3963 0.3706 0.0028  -0.0040 0.0009  56  GLU A N   
437  C  CA  . GLU A 65  ? 0.3964 0.4131 0.4036 0.0003  -0.0069 -0.0085 56  GLU A CA  
438  C  C   . GLU A 65  ? 0.3897 0.4285 0.4013 -0.0127 -0.0050 -0.0021 56  GLU A C   
439  O  O   . GLU A 65  ? 0.3913 0.4685 0.4343 -0.0262 -0.0015 -0.0191 56  GLU A O   
440  C  CB  . GLU A 65  ? 0.4221 0.4468 0.4251 0.0013  -0.0092 -0.0076 56  GLU A CB  
441  C  CG  . GLU A 65  ? 0.4982 0.4657 0.4976 0.0052  -0.0295 -0.0102 56  GLU A CG  
442  C  CD  . GLU A 65  ? 0.5897 0.6160 0.6097 -0.0124 0.0058  0.0085  56  GLU A CD  
443  O  OE1 . GLU A 65  ? 0.6581 0.6056 0.6393 0.0040  -0.0275 -0.0303 56  GLU A OE1 
444  O  OE2 . GLU A 65  ? 0.6990 0.6117 0.7300 0.0093  0.0017  -0.0176 56  GLU A OE2 
445  N  N   . GLU A 66  ? 0.3931 0.4115 0.4016 -0.0100 -0.0050 -0.0001 57  GLU A N   
446  C  CA  . GLU A 66  ? 0.3947 0.4111 0.3974 -0.0085 -0.0020 -0.0040 57  GLU A CA  
447  C  C   . GLU A 66  ? 0.3921 0.4069 0.3793 -0.0171 0.0007  0.0018  57  GLU A C   
448  O  O   . GLU A 66  ? 0.4096 0.4307 0.3967 -0.0519 -0.0097 0.0038  57  GLU A O   
449  C  CB  . GLU A 66  ? 0.3905 0.4288 0.4035 0.0010  0.0074  -0.0005 57  GLU A CB  
450  C  CG  . GLU A 66  ? 0.4184 0.4345 0.3832 0.0001  0.0083  -0.0192 57  GLU A CG  
451  C  CD  . GLU A 66  ? 0.4566 0.4553 0.4187 -0.0115 0.0079  -0.0127 57  GLU A CD  
452  O  OE1 . GLU A 66  ? 0.3933 0.4521 0.4735 -0.0261 -0.0045 -0.0553 57  GLU A OE1 
453  O  OE2 . GLU A 66  ? 0.5268 0.5304 0.4768 -0.0329 -0.0338 -0.0055 57  GLU A OE2 
454  N  N   . LEU A 67  ? 0.3745 0.3811 0.3486 -0.0159 0.0001  -0.0084 58  LEU A N   
455  C  CA  . LEU A 67  ? 0.3866 0.3853 0.3716 -0.0069 0.0021  -0.0038 58  LEU A CA  
456  C  C   . LEU A 67  ? 0.3544 0.3721 0.3530 -0.0189 -0.0031 -0.0102 58  LEU A C   
457  O  O   . LEU A 67  ? 0.3834 0.3656 0.3881 -0.0209 0.0046  -0.0102 58  LEU A O   
458  C  CB  . LEU A 67  ? 0.3666 0.3841 0.3841 -0.0130 0.0035  -0.0073 58  LEU A CB  
459  C  CG  . LEU A 67  ? 0.4424 0.4211 0.4073 -0.0037 0.0112  -0.0041 58  LEU A CG  
460  C  CD1 . LEU A 67  ? 0.4580 0.4439 0.3888 -0.0197 0.0055  -0.0040 58  LEU A CD1 
461  C  CD2 . LEU A 67  ? 0.4323 0.4080 0.3897 0.0053  0.0104  -0.0017 58  LEU A CD2 
462  N  N   . LEU A 68  ? 0.3361 0.3663 0.3291 -0.0226 -0.0008 -0.0133 59  LEU A N   
463  C  CA  . LEU A 68  ? 0.3819 0.3935 0.3712 -0.0115 0.0045  -0.0084 59  LEU A CA  
464  C  C   . LEU A 68  ? 0.3979 0.4310 0.3861 -0.0135 0.0090  -0.0057 59  LEU A C   
465  O  O   . LEU A 68  ? 0.3926 0.4610 0.3985 -0.0194 0.0083  -0.0414 59  LEU A O   
466  C  CB  . LEU A 68  ? 0.3752 0.3907 0.3478 -0.0083 0.0071  -0.0186 59  LEU A CB  
467  C  CG  . LEU A 68  ? 0.3647 0.3697 0.3176 -0.0015 0.0080  0.0046  59  LEU A CG  
468  C  CD1 . LEU A 68  ? 0.4171 0.3739 0.3786 -0.0176 0.0103  -0.0148 59  LEU A CD1 
469  C  CD2 . LEU A 68  ? 0.3448 0.3889 0.3717 -0.0350 0.0020  0.0096  59  LEU A CD2 
470  N  N   . CYS A 69  ? 0.4024 0.4250 0.4061 -0.0277 0.0045  -0.0037 60  CYS A N   
471  C  CA  . CYS A 69  ? 0.4280 0.4492 0.4374 -0.0169 0.0055  0.0001  60  CYS A CA  
472  C  C   . CYS A 69  ? 0.4587 0.4671 0.4627 -0.0150 0.0077  0.0101  60  CYS A C   
473  O  O   . CYS A 69  ? 0.4751 0.4865 0.4788 -0.0211 0.0127  0.0209  60  CYS A O   
474  C  CB  . CYS A 69  ? 0.4195 0.4558 0.4529 -0.0215 0.0004  0.0104  60  CYS A CB  
475  S  SG  . CYS A 69  ? 0.4782 0.4406 0.5457 -0.0310 0.0135  -0.0387 60  CYS A SG  
476  N  N   . ASN A 70  ? 0.4580 0.4565 0.4620 -0.0093 0.0053  0.0163  61  ASN A N   
477  C  CA  . ASN A 70  ? 0.4746 0.4686 0.4693 -0.0089 -0.0021 -0.0006 61  ASN A CA  
478  C  C   . ASN A 70  ? 0.4653 0.4463 0.4581 -0.0053 0.0011  -0.0016 61  ASN A C   
479  O  O   . ASN A 70  ? 0.4855 0.4167 0.4427 -0.0293 0.0065  -0.0107 61  ASN A O   
480  C  CB  . ASN A 70  ? 0.5091 0.4960 0.4765 -0.0028 -0.0009 0.0000  61  ASN A CB  
481  C  CG  . ASN A 70  ? 0.5263 0.5703 0.5365 -0.0129 -0.0069 -0.0036 61  ASN A CG  
482  O  OD1 . ASN A 70  ? 0.5493 0.5580 0.5751 -0.0182 -0.0153 0.0093  61  ASN A OD1 
483  N  ND2 . ASN A 70  ? 0.5701 0.5707 0.5545 -0.0344 0.0031  0.0081  61  ASN A ND2 
484  N  N   . LEU A 71  ? 0.4541 0.4357 0.4320 -0.0121 -0.0022 -0.0039 62  LEU A N   
485  C  CA  . LEU A 71  ? 0.4618 0.4485 0.4519 -0.0072 0.0040  -0.0056 62  LEU A CA  
486  C  C   . LEU A 71  ? 0.4517 0.4293 0.4452 -0.0115 0.0010  -0.0102 62  LEU A C   
487  O  O   . LEU A 71  ? 0.4401 0.4125 0.4370 -0.0172 0.0192  -0.0149 62  LEU A O   
488  C  CB  . LEU A 71  ? 0.4570 0.4441 0.4218 -0.0070 0.0071  -0.0065 62  LEU A CB  
489  C  CG  . LEU A 71  ? 0.4274 0.4276 0.4431 -0.0013 0.0106  -0.0108 62  LEU A CG  
490  C  CD1 . LEU A 71  ? 0.4044 0.4309 0.4385 -0.0062 -0.0125 -0.0055 62  LEU A CD1 
491  C  CD2 . LEU A 71  ? 0.3906 0.3885 0.3942 -0.0073 -0.0246 0.0015  62  LEU A CD2 
492  N  N   . GLU A 72  ? 0.4656 0.4725 0.4636 -0.0018 0.0097  0.0013  63  GLU A N   
493  C  CA  . GLU A 72  ? 0.4805 0.4797 0.4868 -0.0016 0.0007  0.0074  63  GLU A CA  
494  C  C   . GLU A 72  ? 0.4856 0.4774 0.4913 -0.0055 -0.0017 0.0025  63  GLU A C   
495  O  O   . GLU A 72  ? 0.4821 0.4687 0.5147 -0.0045 0.0008  0.0104  63  GLU A O   
496  C  CB  . GLU A 72  ? 0.5029 0.4999 0.4725 0.0035  0.0143  0.0233  63  GLU A CB  
497  C  CG  . GLU A 72  ? 0.5385 0.5698 0.5451 0.0102  0.0146  0.0157  63  GLU A CG  
498  C  CD  . GLU A 72  ? 0.5951 0.6130 0.5554 -0.0089 -0.0100 0.0032  63  GLU A CD  
499  O  OE1 . GLU A 72  ? 0.5774 0.5442 0.4997 -0.0028 0.0158  0.0005  63  GLU A OE1 
500  O  OE2 . GLU A 72  ? 0.6736 0.6274 0.6667 0.0042  0.0024  0.0097  63  GLU A OE2 
501  N  N   . THR A 73  ? 0.5050 0.4782 0.4881 -0.0105 0.0006  0.0054  64  THR A N   
502  C  CA  . THR A 73  ? 0.5076 0.4874 0.4911 -0.0032 -0.0008 0.0027  64  THR A CA  
503  C  C   . THR A 73  ? 0.5223 0.4886 0.4934 -0.0056 0.0019  0.0042  64  THR A C   
504  O  O   . THR A 73  ? 0.5449 0.4816 0.4932 -0.0046 0.0092  0.0059  64  THR A O   
505  C  CB  . THR A 73  ? 0.5183 0.4978 0.5121 -0.0058 -0.0036 -0.0013 64  THR A CB  
506  O  OG1 . THR A 73  ? 0.5753 0.5458 0.4503 0.0036  -0.0127 -0.0093 64  THR A OG1 
507  C  CG2 . THR A 73  ? 0.5321 0.5201 0.5297 0.0008  0.0062  -0.0026 64  THR A CG2 
508  N  N   . LEU A 74  ? 0.5222 0.4902 0.4877 -0.0105 0.0055  -0.0031 65  LEU A N   
509  C  CA  . LEU A 74  ? 0.5025 0.4796 0.4856 -0.0052 -0.0020 -0.0033 65  LEU A CA  
510  C  C   . LEU A 74  ? 0.5161 0.4768 0.4908 -0.0082 0.0000  -0.0015 65  LEU A C   
511  O  O   . LEU A 74  ? 0.5529 0.4682 0.4978 -0.0120 0.0010  0.0160  65  LEU A O   
512  C  CB  . LEU A 74  ? 0.4729 0.4675 0.4671 -0.0069 -0.0014 -0.0045 65  LEU A CB  
513  C  CG  . LEU A 74  ? 0.4917 0.4374 0.4470 -0.0173 0.0082  0.0023  65  LEU A CG  
514  C  CD1 . LEU A 74  ? 0.5012 0.4554 0.4601 -0.0033 0.0000  -0.0105 65  LEU A CD1 
515  C  CD2 . LEU A 74  ? 0.5140 0.4612 0.4518 0.0006  -0.0090 0.0085  65  LEU A CD2 
516  N  N   . PRO A 75  ? 0.5208 0.4914 0.4964 -0.0018 -0.0034 0.0000  66  PRO A N   
517  C  CA  . PRO A 75  ? 0.5135 0.4821 0.4941 -0.0004 -0.0028 -0.0003 66  PRO A CA  
518  C  C   . PRO A 75  ? 0.5303 0.5007 0.4873 -0.0019 -0.0141 0.0048  66  PRO A C   
519  O  O   . PRO A 75  ? 0.5220 0.4805 0.4779 0.0047  -0.0224 -0.0097 66  PRO A O   
520  C  CB  . PRO A 75  ? 0.5200 0.4726 0.4928 0.0007  -0.0002 -0.0015 66  PRO A CB  
521  C  CG  . PRO A 75  ? 0.5035 0.5045 0.5114 0.0014  -0.0001 0.0043  66  PRO A CG  
522  C  CD  . PRO A 75  ? 0.5208 0.5056 0.5047 0.0046  0.0002  -0.0051 66  PRO A CD  
523  N  N   . LYS A 76  ? 0.5283 0.5059 0.4955 0.0065  -0.0153 0.0059  67  LYS A N   
524  C  CA  . LYS A 76  ? 0.5189 0.4928 0.4861 0.0066  -0.0065 0.0049  67  LYS A CA  
525  C  C   . LYS A 76  ? 0.5206 0.4747 0.4657 0.0132  -0.0083 0.0141  67  LYS A C   
526  O  O   . LYS A 76  ? 0.5408 0.4731 0.4688 0.0266  -0.0161 0.0284  67  LYS A O   
527  C  CB  . LYS A 76  ? 0.5442 0.5056 0.5050 0.0061  -0.0096 0.0011  67  LYS A CB  
528  C  CG  . LYS A 76  ? 0.5643 0.5495 0.5581 -0.0020 0.0039  0.0058  67  LYS A CG  
529  C  CD  . LYS A 76  ? 0.5767 0.5560 0.5750 0.0044  0.0063  0.0003  67  LYS A CD  
530  C  CE  . LYS A 76  ? 0.5535 0.5651 0.5965 0.0014  -0.0034 -0.0140 67  LYS A CE  
531  N  NZ  . LYS A 76  ? 0.5820 0.5435 0.5908 0.0149  -0.0071 0.0095  67  LYS A NZ  
532  N  N   . GLU A 77  ? 0.5129 0.4632 0.4809 0.0077  0.0001  0.0138  68  GLU A N   
533  C  CA  . GLU A 77  ? 0.4981 0.4632 0.4757 0.0110  -0.0059 0.0062  68  GLU A CA  
534  C  C   . GLU A 77  ? 0.4774 0.4390 0.4497 0.0140  -0.0071 0.0052  68  GLU A C   
535  O  O   . GLU A 77  ? 0.4729 0.4341 0.4159 0.0229  -0.0224 0.0019  68  GLU A O   
536  C  CB  . GLU A 77  ? 0.5104 0.4760 0.4993 0.0119  0.0062  0.0099  68  GLU A CB  
537  C  CG  . GLU A 77  ? 0.5498 0.5188 0.5399 0.0120  0.0042  -0.0119 68  GLU A CG  
538  C  CD  . GLU A 77  ? 0.5395 0.5652 0.5420 0.0061  0.0015  -0.0068 68  GLU A CD  
539  O  OE1 . GLU A 77  ? 0.5756 0.5349 0.5027 0.0467  -0.0253 0.0207  68  GLU A OE1 
540  O  OE2 . GLU A 77  ? 0.5645 0.4598 0.5551 0.0138  0.0126  -0.0165 68  GLU A OE2 
541  N  N   . ILE A 78  ? 0.4734 0.4181 0.4315 0.0087  -0.0087 -0.0113 69  ILE A N   
542  C  CA  . ILE A 78  ? 0.4483 0.4243 0.4071 0.0037  -0.0078 0.0007  69  ILE A CA  
543  C  C   . ILE A 78  ? 0.4364 0.3968 0.3800 -0.0002 -0.0052 -0.0076 69  ILE A C   
544  O  O   . ILE A 78  ? 0.4304 0.4018 0.3708 0.0186  -0.0129 -0.0056 69  ILE A O   
545  C  CB  . ILE A 78  ? 0.4420 0.4437 0.4124 0.0015  -0.0007 -0.0110 69  ILE A CB  
546  C  CG1 . ILE A 78  ? 0.4386 0.3593 0.3717 -0.0016 -0.0074 0.0038  69  ILE A CG1 
547  C  CG2 . ILE A 78  ? 0.4604 0.4616 0.4378 0.0228  -0.0176 -0.0007 69  ILE A CG2 
548  C  CD1 . ILE A 78  ? 0.4420 0.4214 0.3908 -0.0023 0.0105  -0.0006 69  ILE A CD1 
549  N  N   . VAL A 79  ? 0.4234 0.3917 0.3952 -0.0019 -0.0090 -0.0062 70  VAL A N   
550  C  CA  . VAL A 79  ? 0.4218 0.3833 0.3913 -0.0010 -0.0148 -0.0055 70  VAL A CA  
551  C  C   . VAL A 79  ? 0.4109 0.3713 0.3897 0.0066  -0.0160 -0.0011 70  VAL A C   
552  O  O   . VAL A 79  ? 0.3897 0.3452 0.3359 0.0233  -0.0394 -0.0089 70  VAL A O   
553  C  CB  . VAL A 79  ? 0.4171 0.4012 0.4097 -0.0023 -0.0095 0.0002  70  VAL A CB  
554  C  CG1 . VAL A 79  ? 0.4710 0.4186 0.4382 -0.0016 -0.0128 0.0081  70  VAL A CG1 
555  C  CG2 . VAL A 79  ? 0.4232 0.4101 0.4081 -0.0093 -0.0003 0.0017  70  VAL A CG2 
556  N  N   . THR A 80  ? 0.4039 0.3445 0.3706 -0.0003 -0.0097 -0.0031 71  THR A N   
557  C  CA  . THR A 80  ? 0.3894 0.3451 0.3581 -0.0022 -0.0004 0.0055  71  THR A CA  
558  C  C   . THR A 80  ? 0.3628 0.3313 0.3179 0.0056  -0.0126 0.0035  71  THR A C   
559  O  O   . THR A 80  ? 0.3716 0.3384 0.3122 0.0104  -0.0158 0.0126  71  THR A O   
560  C  CB  . THR A 80  ? 0.3945 0.3354 0.3731 -0.0099 -0.0074 0.0062  71  THR A CB  
561  O  OG1 . THR A 80  ? 0.4572 0.3763 0.3128 -0.0191 -0.0108 0.0385  71  THR A OG1 
562  C  CG2 . THR A 80  ? 0.4411 0.3541 0.3990 0.0028  -0.0111 -0.0087 71  THR A CG2 
563  N  N   . ALA A 81  ? 0.3350 0.3293 0.3115 0.0054  -0.0175 0.0170  72  ALA A N   
564  C  CA  . ALA A 81  ? 0.3444 0.3179 0.3285 0.0032  -0.0035 0.0043  72  ALA A CA  
565  C  C   . ALA A 81  ? 0.3219 0.2995 0.3035 -0.0028 0.0045  -0.0024 72  ALA A C   
566  O  O   . ALA A 81  ? 0.3042 0.2808 0.2937 0.0022  0.0240  -0.0031 72  ALA A O   
567  C  CB  . ALA A 81  ? 0.3660 0.3499 0.3615 0.0145  -0.0012 0.0179  72  ALA A CB  
568  N  N   . VAL A 82  ? 0.3235 0.2849 0.3004 0.0070  0.0094  -0.0045 73  VAL A N   
569  C  CA  . VAL A 82  ? 0.3204 0.2914 0.2845 -0.0002 0.0000  0.0016  73  VAL A CA  
570  C  C   . VAL A 82  ? 0.3132 0.2875 0.2673 0.0018  -0.0068 0.0024  73  VAL A C   
571  O  O   . VAL A 82  ? 0.3145 0.2904 0.2437 0.0072  -0.0205 -0.0327 73  VAL A O   
572  C  CB  . VAL A 82  ? 0.3278 0.3190 0.3207 -0.0121 0.0060  0.0027  73  VAL A CB  
573  C  CG1 . VAL A 82  ? 0.3698 0.3347 0.2818 -0.0123 -0.0105 0.0192  73  VAL A CG1 
574  C  CG2 . VAL A 82  ? 0.3759 0.3406 0.3412 -0.0186 0.0066  -0.0358 73  VAL A CG2 
575  N  N   . ARG A 83  ? 0.3179 0.3002 0.2720 0.0070  -0.0213 0.0044  74  ARG A N   
576  C  CA  . ARG A 83  ? 0.3133 0.3008 0.2771 0.0047  -0.0069 0.0124  74  ARG A CA  
577  C  C   . ARG A 83  ? 0.3117 0.3013 0.2872 0.0012  -0.0118 -0.0021 74  ARG A C   
578  O  O   . ARG A 83  ? 0.3301 0.2975 0.2874 0.0017  -0.0035 0.0077  74  ARG A O   
579  C  CB  . ARG A 83  ? 0.3332 0.2936 0.2849 0.0048  -0.0150 0.0003  74  ARG A CB  
580  C  CG  . ARG A 83  ? 0.3047 0.3232 0.2850 -0.0066 -0.0096 0.0128  74  ARG A CG  
581  C  CD  . ARG A 83  ? 0.3487 0.3205 0.2841 -0.0003 -0.0072 0.0099  74  ARG A CD  
582  N  NE  . ARG A 83  ? 0.4014 0.3770 0.3700 0.0141  0.0173  -0.0169 74  ARG A NE  
583  C  CZ  . ARG A 83  ? 0.4401 0.3792 0.3625 0.0000  0.0055  -0.0015 74  ARG A CZ  
584  N  NH1 . ARG A 83  ? 0.4890 0.4415 0.4087 0.0285  0.0108  0.0233  74  ARG A NH1 
585  N  NH2 . ARG A 83  ? 0.4205 0.3901 0.3373 0.0163  -0.0005 0.0307  74  ARG A NH2 
586  N  N   . ASN A 84  ? 0.3212 0.2937 0.3018 0.0097  0.0008  0.0089  75  ASN A N   
587  C  CA  . ASN A 84  ? 0.3090 0.2869 0.2873 0.0018  -0.0037 0.0000  75  ASN A CA  
588  C  C   . ASN A 84  ? 0.3150 0.2871 0.2809 0.0060  0.0000  -0.0067 75  ASN A C   
589  O  O   . ASN A 84  ? 0.3097 0.2691 0.2639 0.0130  -0.0076 -0.0362 75  ASN A O   
590  C  CB  . ASN A 84  ? 0.3046 0.2704 0.2802 0.0073  -0.0116 0.0060  75  ASN A CB  
591  C  CG  . ASN A 84  ? 0.3181 0.2802 0.3095 -0.0077 -0.0098 -0.0017 75  ASN A CG  
592  O  OD1 . ASN A 84  ? 0.3555 0.3263 0.2855 0.0062  0.0010  0.0259  75  ASN A OD1 
593  N  ND2 . ASN A 84  ? 0.2989 0.2249 0.3044 0.0017  -0.0258 -0.0184 75  ASN A ND2 
594  N  N   . ASN A 85  ? 0.2995 0.2799 0.2549 0.0011  0.0058  -0.0116 76  ASN A N   
595  C  CA  . ASN A 85  ? 0.3109 0.2916 0.2835 0.0032  0.0065  -0.0045 76  ASN A CA  
596  C  C   . ASN A 85  ? 0.3139 0.2902 0.2687 -0.0017 0.0104  -0.0085 76  ASN A C   
597  O  O   . ASN A 85  ? 0.3223 0.2902 0.2577 0.0091  0.0099  -0.0158 76  ASN A O   
598  C  CB  . ASN A 85  ? 0.3230 0.3120 0.3034 0.0096  0.0140  -0.0084 76  ASN A CB  
599  C  CG  . ASN A 85  ? 0.3442 0.3330 0.3159 0.0063  0.0073  -0.0155 76  ASN A CG  
600  O  OD1 . ASN A 85  ? 0.3617 0.3329 0.3597 0.0065  0.0045  0.0228  76  ASN A OD1 
601  N  ND2 . ASN A 85  ? 0.3645 0.3449 0.3927 -0.0019 -0.0049 -0.0051 76  ASN A ND2 
602  N  N   . GLY A 86  ? 0.3151 0.2965 0.2659 0.0070  0.0098  0.0030  77  GLY A N   
603  C  CA  . GLY A 86  ? 0.3065 0.2847 0.2653 -0.0087 0.0077  -0.0075 77  GLY A CA  
604  C  C   . GLY A 86  ? 0.3046 0.3025 0.2781 -0.0050 -0.0041 -0.0046 77  GLY A C   
605  O  O   . GLY A 86  ? 0.3195 0.3058 0.2873 -0.0040 -0.0102 0.0079  77  GLY A O   
606  N  N   . GLY A 87  ? 0.3119 0.2995 0.2729 -0.0051 0.0108  -0.0035 78  GLY A N   
607  C  CA  . GLY A 87  ? 0.2972 0.2885 0.2578 -0.0052 0.0016  -0.0134 78  GLY A CA  
608  C  C   . GLY A 87  ? 0.2989 0.2972 0.2347 0.0039  0.0000  -0.0108 78  GLY A C   
609  O  O   . GLY A 87  ? 0.3106 0.3111 0.2477 0.0154  -0.0141 0.0094  78  GLY A O   
610  N  N   . GLY A 88  ? 0.2884 0.2804 0.2189 0.0077  0.0065  -0.0241 79  GLY A N   
611  C  CA  . GLY A 88  ? 0.2835 0.2802 0.2317 -0.0007 0.0068  -0.0086 79  GLY A CA  
612  C  C   . GLY A 88  ? 0.2932 0.2805 0.2548 0.0078  0.0079  -0.0058 79  GLY A C   
613  O  O   . GLY A 88  ? 0.3195 0.2594 0.2656 0.0087  0.0136  -0.0110 79  GLY A O   
614  N  N   . HIS A 89  ? 0.2999 0.2728 0.2491 -0.0041 -0.0015 -0.0120 80  HIS A N   
615  C  CA  . HIS A 89  ? 0.2909 0.2628 0.2336 0.0068  -0.0033 0.0028  80  HIS A CA  
616  C  C   . HIS A 89  ? 0.2764 0.2525 0.2212 0.0002  -0.0088 -0.0157 80  HIS A C   
617  O  O   . HIS A 89  ? 0.2864 0.2738 0.2340 0.0266  0.0045  0.0011  80  HIS A O   
618  C  CB  . HIS A 89  ? 0.3067 0.2557 0.2401 -0.0083 0.0002  -0.0069 80  HIS A CB  
619  C  CG  . HIS A 89  ? 0.3147 0.2929 0.2500 -0.0055 -0.0111 -0.0012 80  HIS A CG  
620  N  ND1 . HIS A 89  ? 0.3006 0.2794 0.2449 0.0033  -0.0017 -0.0329 80  HIS A ND1 
621  C  CD2 . HIS A 89  ? 0.3339 0.2911 0.3009 -0.0141 0.0110  -0.0125 80  HIS A CD2 
622  C  CE1 . HIS A 89  ? 0.3514 0.3152 0.2739 -0.0057 -0.0075 0.0042  80  HIS A CE1 
623  N  NE2 . HIS A 89  ? 0.3238 0.3276 0.2806 -0.0064 -0.0214 -0.0187 80  HIS A NE2 
624  N  N   . TYR A 90  ? 0.2728 0.2764 0.2342 0.0067  -0.0132 -0.0043 81  TYR A N   
625  C  CA  . TYR A 90  ? 0.2925 0.2816 0.2735 0.0062  0.0000  0.0021  81  TYR A CA  
626  C  C   . TYR A 90  ? 0.2912 0.2596 0.2610 -0.0132 -0.0088 -0.0049 81  TYR A C   
627  O  O   . TYR A 90  ? 0.3340 0.2432 0.2537 -0.0308 0.0150  0.0013  81  TYR A O   
628  C  CB  . TYR A 90  ? 0.3053 0.3042 0.3008 0.0109  0.0036  -0.0006 81  TYR A CB  
629  C  CG  . TYR A 90  ? 0.2828 0.2986 0.2762 -0.0018 -0.0083 -0.0054 81  TYR A CG  
630  C  CD1 . TYR A 90  ? 0.2943 0.2896 0.2904 -0.0036 -0.0069 0.0072  81  TYR A CD1 
631  C  CD2 . TYR A 90  ? 0.2809 0.3201 0.2500 -0.0085 -0.0028 0.0120  81  TYR A CD2 
632  C  CE1 . TYR A 90  ? 0.3152 0.3110 0.3243 -0.0026 0.0030  -0.0044 81  TYR A CE1 
633  C  CE2 . TYR A 90  ? 0.3045 0.3271 0.3399 0.0018  0.0025  -0.0101 81  TYR A CE2 
634  C  CZ  . TYR A 90  ? 0.3175 0.3683 0.3001 0.0171  -0.0066 -0.0139 81  TYR A CZ  
635  O  OH  . TYR A 90  ? 0.2923 0.4145 0.3115 -0.0069 -0.0144 -0.0317 81  TYR A OH  
636  N  N   . CYS A 91  ? 0.3095 0.2606 0.2479 -0.0098 0.0079  0.0121  82  CYS A N   
637  C  CA  . CYS A 91  ? 0.2948 0.2719 0.2471 -0.0062 0.0009  0.0014  82  CYS A CA  
638  C  C   . CYS A 91  ? 0.2817 0.2536 0.2215 -0.0076 -0.0111 -0.0107 82  CYS A C   
639  O  O   . CYS A 91  ? 0.2793 0.2811 0.2205 -0.0149 -0.0145 0.0132  82  CYS A O   
640  C  CB  . CYS A 91  ? 0.2731 0.2581 0.2342 -0.0096 0.0016  -0.0092 82  CYS A CB  
641  S  SG  . CYS A 91  ? 0.2798 0.2623 0.2481 -0.0496 -0.0132 -0.0024 82  CYS A SG  
642  N  N   . HIS A 92  ? 0.2794 0.2532 0.2009 -0.0121 -0.0052 -0.0229 83  HIS A N   
643  C  CA  . HIS A 92  ? 0.2904 0.2641 0.2455 -0.0027 -0.0001 -0.0061 83  HIS A CA  
644  C  C   . HIS A 92  ? 0.3113 0.2803 0.2538 0.0068  0.0003  -0.0100 83  HIS A C   
645  O  O   . HIS A 92  ? 0.2807 0.3014 0.2339 0.0195  0.0040  -0.0067 83  HIS A O   
646  C  CB  . HIS A 92  ? 0.3019 0.2608 0.2600 0.0014  0.0142  0.0056  83  HIS A CB  
647  C  CG  . HIS A 92  ? 0.2767 0.2328 0.2508 -0.0239 0.0134  0.0060  83  HIS A CG  
648  N  ND1 . HIS A 92  ? 0.2314 0.3107 0.2496 0.0236  -0.0184 0.0099  83  HIS A ND1 
649  C  CD2 . HIS A 92  ? 0.2753 0.2773 0.2595 -0.0147 0.0215  -0.0071 83  HIS A CD2 
650  C  CE1 . HIS A 92  ? 0.3701 0.2960 0.2350 -0.0038 -0.0030 -0.0137 83  HIS A CE1 
651  N  NE2 . HIS A 92  ? 0.3050 0.2552 0.2516 -0.0028 0.0005  -0.0207 83  HIS A NE2 
652  N  N   . SER A 93  ? 0.3195 0.2855 0.2747 0.0092  -0.0195 -0.0129 84  SER A N   
653  C  CA  . SER A 93  ? 0.2998 0.2950 0.2691 0.0031  -0.0096 -0.0025 84  SER A CA  
654  C  C   . SER A 93  ? 0.3000 0.2924 0.2699 -0.0117 -0.0023 -0.0092 84  SER A C   
655  O  O   . SER A 93  ? 0.3265 0.3044 0.2616 -0.0020 0.0048  0.0097  84  SER A O   
656  C  CB  . SER A 93  ? 0.2854 0.2958 0.2899 -0.0034 -0.0070 -0.0104 84  SER A CB  
657  O  OG  . SER A 93  ? 0.2723 0.3483 0.3081 -0.0197 0.0174  -0.0127 84  SER A OG  
658  N  N   . LEU A 94  ? 0.3127 0.3039 0.2671 -0.0146 0.0000  0.0010  85  LEU A N   
659  C  CA  . LEU A 94  ? 0.2926 0.2996 0.2592 0.0001  -0.0001 0.0106  85  LEU A CA  
660  C  C   . LEU A 94  ? 0.2768 0.3046 0.2712 0.0061  0.0013  0.0129  85  LEU A C   
661  O  O   . LEU A 94  ? 0.3323 0.3112 0.2867 0.0112  -0.0114 0.0242  85  LEU A O   
662  C  CB  . LEU A 94  ? 0.2811 0.3156 0.2940 -0.0078 -0.0010 0.0112  85  LEU A CB  
663  C  CG  . LEU A 94  ? 0.3490 0.3703 0.3509 -0.0015 0.0193  0.0144  85  LEU A CG  
664  C  CD1 . LEU A 94  ? 0.3423 0.3828 0.3088 0.0090  -0.0067 -0.0070 85  LEU A CD1 
665  C  CD2 . LEU A 94  ? 0.4022 0.3733 0.3944 0.0397  0.0210  0.0048  85  LEU A CD2 
666  N  N   . PHE A 95  ? 0.2715 0.2862 0.2599 0.0179  -0.0001 0.0194  86  PHE A N   
667  C  CA  . PHE A 95  ? 0.2750 0.2999 0.2632 -0.0040 -0.0078 0.0147  86  PHE A CA  
668  C  C   . PHE A 95  ? 0.2835 0.2881 0.2651 0.0004  -0.0010 0.0206  86  PHE A C   
669  O  O   . PHE A 95  ? 0.2769 0.3298 0.2596 -0.0055 0.0105  -0.0118 86  PHE A O   
670  C  CB  . PHE A 95  ? 0.2708 0.2804 0.2515 0.0129  -0.0068 0.0209  86  PHE A CB  
671  C  CG  . PHE A 95  ? 0.2722 0.2731 0.2874 0.0092  -0.0020 0.0224  86  PHE A CG  
672  C  CD1 . PHE A 95  ? 0.3305 0.2753 0.2467 0.0162  -0.0081 0.0033  86  PHE A CD1 
673  C  CD2 . PHE A 95  ? 0.3066 0.3234 0.3239 -0.0026 0.0123  -0.0074 86  PHE A CD2 
674  C  CE1 . PHE A 95  ? 0.2603 0.2685 0.2524 0.0003  -0.0284 0.0018  86  PHE A CE1 
675  C  CE2 . PHE A 95  ? 0.3083 0.2890 0.2729 -0.0115 0.0193  0.0399  86  PHE A CE2 
676  C  CZ  . PHE A 95  ? 0.2969 0.2281 0.2552 0.0215  0.0082  0.0463  86  PHE A CZ  
677  N  N   . TRP A 96  ? 0.3049 0.2907 0.3059 0.0026  -0.0071 0.0287  87  TRP A N   
678  C  CA  . TRP A 96  ? 0.3042 0.3124 0.2750 -0.0047 -0.0029 0.0136  87  TRP A CA  
679  C  C   . TRP A 96  ? 0.2959 0.3112 0.3014 -0.0001 -0.0036 0.0105  87  TRP A C   
680  O  O   . TRP A 96  ? 0.3034 0.3229 0.2974 0.0034  -0.0153 0.0150  87  TRP A O   
681  C  CB  . TRP A 96  ? 0.2749 0.3123 0.2922 -0.0062 -0.0099 0.0128  87  TRP A CB  
682  C  CG  . TRP A 96  ? 0.2624 0.2944 0.2335 0.0011  0.0051  0.0372  87  TRP A CG  
683  C  CD1 . TRP A 96  ? 0.2809 0.3016 0.2609 -0.0080 0.0069  0.0039  87  TRP A CD1 
684  C  CD2 . TRP A 96  ? 0.2825 0.2824 0.2171 0.0278  0.0150  0.0129  87  TRP A CD2 
685  N  NE1 . TRP A 96  ? 0.2903 0.2724 0.2456 0.0171  0.0029  0.0329  87  TRP A NE1 
686  C  CE2 . TRP A 96  ? 0.2262 0.2697 0.2273 -0.0139 0.0187  0.0237  87  TRP A CE2 
687  C  CE3 . TRP A 96  ? 0.2683 0.2883 0.2308 0.0027  -0.0132 0.0155  87  TRP A CE3 
688  C  CZ2 . TRP A 96  ? 0.2574 0.2655 0.2327 -0.0136 0.0154  0.0334  87  TRP A CZ2 
689  C  CZ3 . TRP A 96  ? 0.2889 0.3032 0.2552 -0.0056 0.0085  0.0132  87  TRP A CZ3 
690  C  CH2 . TRP A 96  ? 0.2676 0.3162 0.2221 0.0016  0.0070  0.0082  87  TRP A CH2 
691  N  N   . GLU A 97  ? 0.3103 0.3070 0.3006 -0.0079 0.0096  0.0150  88  GLU A N   
692  C  CA  . GLU A 97  ? 0.3293 0.3405 0.3076 -0.0063 -0.0041 0.0150  88  GLU A CA  
693  C  C   . GLU A 97  ? 0.3462 0.3447 0.3042 -0.0017 -0.0077 0.0120  88  GLU A C   
694  O  O   . GLU A 97  ? 0.3443 0.3815 0.2661 0.0127  -0.0324 0.0097  88  GLU A O   
695  C  CB  . GLU A 97  ? 0.3462 0.3341 0.2995 0.0033  -0.0011 0.0095  88  GLU A CB  
696  C  CG  . GLU A 97  ? 0.3617 0.3797 0.3253 0.0040  -0.0133 -0.0085 88  GLU A CG  
697  C  CD  . GLU A 97  ? 0.4122 0.3926 0.3998 -0.0178 0.0031  -0.0077 88  GLU A CD  
698  O  OE1 . GLU A 97  ? 0.5159 0.5614 0.4566 -0.0160 0.0200  -0.0317 88  GLU A OE1 
699  O  OE2 . GLU A 97  ? 0.4495 0.4699 0.4065 -0.0421 0.0098  -0.0154 88  GLU A OE2 
700  N  N   . VAL A 98  ? 0.3184 0.3349 0.2788 -0.0108 -0.0182 0.0052  89  VAL A N   
701  C  CA  . VAL A 98  ? 0.3292 0.3517 0.3170 -0.0001 -0.0046 0.0122  89  VAL A CA  
702  C  C   . VAL A 98  ? 0.3343 0.3672 0.3205 -0.0013 -0.0012 0.0050  89  VAL A C   
703  O  O   . VAL A 98  ? 0.3150 0.3858 0.3404 0.0053  0.0031  0.0168  89  VAL A O   
704  C  CB  . VAL A 98  ? 0.3397 0.3538 0.3368 0.0003  0.0063  0.0136  89  VAL A CB  
705  C  CG1 . VAL A 98  ? 0.3454 0.3616 0.3400 0.0056  0.0038  0.0016  89  VAL A CG1 
706  C  CG2 . VAL A 98  ? 0.3201 0.3289 0.3427 0.0007  0.0054  -0.0003 89  VAL A CG2 
707  N  N   . MET A 99  ? 0.3303 0.3774 0.3283 -0.0002 -0.0097 -0.0007 90  MET A N   
708  C  CA  . MET A 99  ? 0.3331 0.3600 0.3141 -0.0011 -0.0068 0.0148  90  MET A CA  
709  C  C   . MET A 99  ? 0.3401 0.3621 0.3076 -0.0020 -0.0011 0.0088  90  MET A C   
710  O  O   . MET A 99  ? 0.3237 0.3496 0.2825 -0.0066 0.0330  0.0228  90  MET A O   
711  C  CB  . MET A 99  ? 0.3502 0.3708 0.3154 -0.0032 -0.0070 0.0165  90  MET A CB  
712  C  CG  . MET A 99  ? 0.3153 0.3107 0.2939 0.0036  -0.0128 0.0301  90  MET A CG  
713  S  SD  . MET A 99  ? 0.3203 0.3635 0.3099 -0.0060 -0.0246 0.0259  90  MET A SD  
714  C  CE  . MET A 99  ? 0.2718 0.3000 0.2980 -0.0251 0.0067  0.0320  90  MET A CE  
715  N  N   . SER A 100 ? 0.3645 0.3681 0.3145 0.0016  0.0049  0.0203  91  SER A N   
716  C  CA  . SER A 100 ? 0.3835 0.3902 0.3393 0.0082  -0.0052 0.0184  91  SER A CA  
717  C  C   . SER A 100 ? 0.3931 0.4003 0.3604 0.0086  -0.0011 0.0208  91  SER A C   
718  O  O   . SER A 100 ? 0.4014 0.3938 0.3370 0.0228  -0.0038 0.0388  91  SER A O   
719  C  CB  . SER A 100 ? 0.4045 0.3957 0.3566 -0.0019 0.0034  0.0192  91  SER A CB  
720  O  OG  . SER A 100 ? 0.4735 0.4331 0.3371 0.0041  -0.0549 0.0125  91  SER A OG  
721  N  N   . PRO A 101 ? 0.4075 0.4148 0.3719 0.0084  -0.0059 0.0167  92  PRO A N   
722  C  CA  . PRO A 101 ? 0.4260 0.4163 0.3962 0.0052  -0.0038 0.0146  92  PRO A CA  
723  C  C   . PRO A 101 ? 0.4488 0.4274 0.3947 0.0072  0.0002  0.0134  92  PRO A C   
724  O  O   . PRO A 101 ? 0.4909 0.4197 0.3972 0.0246  -0.0088 0.0324  92  PRO A O   
725  C  CB  . PRO A 101 ? 0.4330 0.4190 0.4128 0.0064  -0.0019 0.0038  92  PRO A CB  
726  C  CG  . PRO A 101 ? 0.4433 0.4104 0.4169 -0.0082 -0.0001 0.0087  92  PRO A CG  
727  C  CD  . PRO A 101 ? 0.4025 0.3980 0.3749 0.0043  0.0094  0.0188  92  PRO A CD  
728  N  N   . ARG A 102 ? 0.4427 0.4428 0.4173 0.0080  0.0003  0.0205  93  ARG A N   
729  C  CA  . ARG A 102 ? 0.4608 0.4696 0.4523 0.0076  -0.0051 0.0170  93  ARG A CA  
730  C  C   . ARG A 102 ? 0.4620 0.4935 0.4546 -0.0028 -0.0055 0.0178  93  ARG A C   
731  O  O   . ARG A 102 ? 0.4730 0.5079 0.4691 -0.0067 -0.0285 0.0210  93  ARG A O   
732  C  CB  . ARG A 102 ? 0.4823 0.4954 0.4810 0.0112  -0.0195 0.0286  93  ARG A CB  
733  C  CG  . ARG A 102 ? 0.5641 0.5507 0.5579 0.0067  -0.0046 -0.0118 93  ARG A CG  
734  C  CD  . ARG A 102 ? 0.6442 0.7113 0.6556 -0.0150 0.0077  0.0496  93  ARG A CD  
735  N  NE  . ARG A 102 ? 0.6735 0.6049 0.5614 0.0180  -0.0033 -0.0350 93  ARG A NE  
736  C  CZ  . ARG A 102 ? 0.7274 0.6850 0.6977 0.0123  -0.0101 -0.0069 93  ARG A CZ  
737  N  NH1 . ARG A 102 ? 0.7376 0.6807 0.6872 0.0060  -0.0247 -0.0151 93  ARG A NH1 
738  N  NH2 . ARG A 102 ? 0.7389 0.7190 0.7268 0.0055  -0.0121 -0.0139 93  ARG A NH2 
739  N  N   . GLY A 103 ? 0.4600 0.4739 0.4719 0.0066  -0.0107 0.0220  94  GLY A N   
740  C  CA  . GLY A 103 ? 0.4468 0.4550 0.4464 0.0027  -0.0050 0.0176  94  GLY A CA  
741  C  C   . GLY A 103 ? 0.4316 0.4252 0.4599 0.0024  -0.0083 0.0176  94  GLY A C   
742  O  O   . GLY A 103 ? 0.4302 0.4054 0.4608 0.0048  -0.0055 0.0487  94  GLY A O   
743  N  N   . GLY A 104 ? 0.4241 0.4269 0.4313 0.0054  -0.0022 0.0114  95  GLY A N   
744  C  CA  . GLY A 104 ? 0.4377 0.4514 0.4513 0.0056  -0.0052 0.0088  95  GLY A CA  
745  C  C   . GLY A 104 ? 0.4368 0.4487 0.4513 0.0059  0.0001  0.0100  95  GLY A C   
746  O  O   . GLY A 104 ? 0.4305 0.4257 0.4387 0.0049  -0.0055 0.0197  95  GLY A O   
747  N  N   . GLY A 105 ? 0.4527 0.4548 0.4751 0.0098  0.0083  0.0094  96  GLY A N   
748  C  CA  . GLY A 105 ? 0.4546 0.4727 0.4788 0.0076  -0.0034 0.0073  96  GLY A CA  
749  C  C   . GLY A 105 ? 0.4531 0.4826 0.4945 -0.0018 -0.0012 0.0114  96  GLY A C   
750  O  O   . GLY A 105 ? 0.4285 0.4986 0.4990 0.0033  -0.0087 0.0090  96  GLY A O   
751  N  N   . GLU A 106 ? 0.4622 0.4919 0.5022 0.0030  -0.0098 0.0071  97  GLU A N   
752  C  CA  . GLU A 106 ? 0.4731 0.5049 0.5029 0.0025  -0.0029 0.0081  97  GLU A CA  
753  C  C   . GLU A 106 ? 0.4261 0.4843 0.4860 0.0187  0.0020  0.0098  97  GLU A C   
754  O  O   . GLU A 106 ? 0.4195 0.4822 0.4703 0.0333  -0.0014 0.0090  97  GLU A O   
755  C  CB  . GLU A 106 ? 0.4802 0.5085 0.5192 0.0081  0.0078  0.0095  97  GLU A CB  
756  C  CG  . GLU A 106 ? 0.5320 0.5380 0.5641 0.0003  0.0086  -0.0084 97  GLU A CG  
757  C  CD  . GLU A 106 ? 0.5435 0.5733 0.5729 0.0179  -0.0049 0.0047  97  GLU A CD  
758  O  OE1 . GLU A 106 ? 0.6312 0.6841 0.7023 -0.0281 0.0075  0.0048  97  GLU A OE1 
759  O  OE2 . GLU A 106 ? 0.6922 0.6119 0.7090 -0.0012 -0.0030 0.0019  97  GLU A OE2 
760  N  N   . PRO A 107 ? 0.4233 0.4750 0.4793 0.0212  -0.0005 0.0093  98  PRO A N   
761  C  CA  . PRO A 107 ? 0.4503 0.4863 0.4763 0.0107  -0.0042 0.0075  98  PRO A CA  
762  C  C   . PRO A 107 ? 0.4681 0.4842 0.4767 0.0136  -0.0003 0.0098  98  PRO A C   
763  O  O   . PRO A 107 ? 0.4514 0.4657 0.4596 0.0259  -0.0174 0.0250  98  PRO A O   
764  C  CB  . PRO A 107 ? 0.4387 0.4855 0.4734 -0.0006 -0.0043 0.0057  98  PRO A CB  
765  C  CG  . PRO A 107 ? 0.4557 0.4787 0.4761 -0.0113 0.0116  -0.0058 98  PRO A CG  
766  C  CD  . PRO A 107 ? 0.4259 0.4732 0.4759 0.0171  -0.0052 0.0056  98  PRO A CD  
767  N  N   . ASN A 108 ? 0.4737 0.4901 0.4684 0.0042  -0.0020 0.0115  99  ASN A N   
768  C  CA  . ASN A 108 ? 0.4845 0.5031 0.4865 0.0041  -0.0042 0.0083  99  ASN A CA  
769  C  C   . ASN A 108 ? 0.4932 0.5123 0.4834 0.0020  -0.0069 0.0012  99  ASN A C   
770  O  O   . ASN A 108 ? 0.4920 0.5205 0.4704 0.0125  -0.0211 0.0018  99  ASN A O   
771  C  CB  . ASN A 108 ? 0.4995 0.5074 0.4862 0.0010  -0.0014 0.0178  99  ASN A CB  
772  C  CG  . ASN A 108 ? 0.5361 0.5465 0.5188 -0.0003 0.0038  0.0122  99  ASN A CG  
773  O  OD1 . ASN A 108 ? 0.6163 0.5664 0.6301 -0.0095 -0.0023 0.0020  99  ASN A OD1 
774  N  ND2 . ASN A 108 ? 0.5499 0.5454 0.5302 -0.0035 -0.0318 0.0164  99  ASN A ND2 
775  N  N   . GLY A 109 ? 0.4920 0.5189 0.4885 0.0104  -0.0104 0.0094  100 GLY A N   
776  C  CA  . GLY A 109 ? 0.4836 0.5086 0.4783 0.0039  -0.0126 0.0060  100 GLY A CA  
777  C  C   . GLY A 109 ? 0.4855 0.5187 0.4809 0.0039  -0.0156 0.0003  100 GLY A C   
778  O  O   . GLY A 109 ? 0.5059 0.5591 0.4957 0.0129  -0.0066 0.0007  100 GLY A O   
779  N  N   . ASP A 110 ? 0.4740 0.5087 0.4562 0.0065  -0.0207 0.0087  101 ASP A N   
780  C  CA  . ASP A 110 ? 0.4713 0.5077 0.4589 -0.0014 -0.0173 0.0036  101 ASP A CA  
781  C  C   . ASP A 110 ? 0.4635 0.5031 0.4491 -0.0072 -0.0133 0.0039  101 ASP A C   
782  O  O   . ASP A 110 ? 0.4705 0.5288 0.4563 -0.0157 -0.0130 -0.0080 101 ASP A O   
783  C  CB  . ASP A 110 ? 0.4850 0.5059 0.4715 0.0011  -0.0152 -0.0025 101 ASP A CB  
784  C  CG  . ASP A 110 ? 0.5531 0.5809 0.5284 0.0079  -0.0396 0.0027  101 ASP A CG  
785  O  OD1 . ASP A 110 ? 0.5816 0.6166 0.5561 0.0121  -0.0608 -0.0217 101 ASP A OD1 
786  O  OD2 . ASP A 110 ? 0.6680 0.6327 0.6219 0.0217  -0.0147 -0.0245 101 ASP A OD2 
787  N  N   . VAL A 111 ? 0.4548 0.4849 0.4502 0.0051  -0.0096 0.0050  102 VAL A N   
788  C  CA  . VAL A 111 ? 0.4377 0.4722 0.4370 0.0014  -0.0102 -0.0026 102 VAL A CA  
789  C  C   . VAL A 111 ? 0.4140 0.4633 0.4303 -0.0035 -0.0077 0.0002  102 VAL A C   
790  O  O   . VAL A 111 ? 0.3991 0.4631 0.4065 -0.0065 -0.0113 -0.0104 102 VAL A O   
791  C  CB  . VAL A 111 ? 0.4543 0.4753 0.4387 0.0022  0.0007  0.0038  102 VAL A CB  
792  C  CG1 . VAL A 111 ? 0.4137 0.4604 0.4416 0.0006  -0.0148 -0.0098 102 VAL A CG1 
793  C  CG2 . VAL A 111 ? 0.4462 0.4642 0.4587 0.0144  -0.0106 0.0047  102 VAL A CG2 
794  N  N   . ALA A 112 ? 0.4096 0.4588 0.4058 -0.0035 -0.0097 -0.0020 103 ALA A N   
795  C  CA  . ALA A 112 ? 0.4203 0.4577 0.4285 -0.0024 -0.0098 -0.0018 103 ALA A CA  
796  C  C   . ALA A 112 ? 0.4218 0.4550 0.4209 -0.0057 -0.0120 -0.0085 103 ALA A C   
797  O  O   . ALA A 112 ? 0.4107 0.4568 0.4368 -0.0078 -0.0297 -0.0285 103 ALA A O   
798  C  CB  . ALA A 112 ? 0.4359 0.4663 0.4061 -0.0115 0.0016  -0.0059 103 ALA A CB  
799  N  N   . LYS A 113 ? 0.4128 0.4666 0.4183 -0.0087 -0.0155 -0.0039 104 LYS A N   
800  C  CA  . LYS A 113 ? 0.4139 0.4482 0.4203 -0.0074 -0.0142 -0.0002 104 LYS A CA  
801  C  C   . LYS A 113 ? 0.3709 0.4189 0.3946 -0.0133 -0.0137 -0.0106 104 LYS A C   
802  O  O   . LYS A 113 ? 0.3445 0.4283 0.3688 -0.0059 -0.0310 -0.0148 104 LYS A O   
803  C  CB  . LYS A 113 ? 0.4356 0.4515 0.4416 -0.0146 -0.0083 -0.0142 104 LYS A CB  
804  C  CG  . LYS A 113 ? 0.4939 0.4687 0.4859 -0.0129 -0.0139 -0.0088 104 LYS A CG  
805  C  CD  . LYS A 113 ? 0.4918 0.5035 0.4617 -0.0029 -0.0291 -0.0013 104 LYS A CD  
806  C  CE  . LYS A 113 ? 0.5403 0.5314 0.5145 0.0079  -0.0288 0.0196  104 LYS A CE  
807  N  NZ  . LYS A 113 ? 0.5888 0.5791 0.5620 -0.0028 -0.0499 -0.0188 104 LYS A NZ  
808  N  N   . VAL A 114 ? 0.3626 0.4064 0.3818 -0.0155 -0.0131 -0.0085 105 VAL A N   
809  C  CA  . VAL A 114 ? 0.3766 0.4081 0.3843 -0.0068 -0.0129 -0.0101 105 VAL A CA  
810  C  C   . VAL A 114 ? 0.3668 0.3857 0.3665 -0.0046 -0.0083 -0.0062 105 VAL A C   
811  O  O   . VAL A 114 ? 0.3408 0.3636 0.3333 -0.0130 -0.0209 -0.0276 105 VAL A O   
812  C  CB  . VAL A 114 ? 0.3991 0.4125 0.4133 0.0018  -0.0076 -0.0008 105 VAL A CB  
813  C  CG1 . VAL A 114 ? 0.4712 0.4657 0.4781 0.0001  -0.0025 0.0206  105 VAL A CG1 
814  C  CG2 . VAL A 114 ? 0.4110 0.4283 0.3943 -0.0029 0.0018  -0.0018 105 VAL A CG2 
815  N  N   . ILE A 115 ? 0.3593 0.3885 0.3500 -0.0108 -0.0160 -0.0051 106 ILE A N   
816  C  CA  . ILE A 115 ? 0.3685 0.3858 0.3610 -0.0002 -0.0030 -0.0037 106 ILE A CA  
817  C  C   . ILE A 115 ? 0.3464 0.3900 0.3535 0.0150  -0.0008 -0.0009 106 ILE A C   
818  O  O   . ILE A 115 ? 0.3168 0.3940 0.3467 0.0184  -0.0178 -0.0084 106 ILE A O   
819  C  CB  . ILE A 115 ? 0.3526 0.3752 0.3571 -0.0055 0.0013  -0.0081 106 ILE A CB  
820  C  CG1 . ILE A 115 ? 0.3450 0.3625 0.3439 -0.0022 -0.0227 0.0077  106 ILE A CG1 
821  C  CG2 . ILE A 115 ? 0.3673 0.3961 0.3645 -0.0181 0.0058  -0.0028 106 ILE A CG2 
822  C  CD1 . ILE A 115 ? 0.3541 0.3698 0.3612 0.0008  -0.0053 -0.0140 106 ILE A CD1 
823  N  N   . ASP A 116 ? 0.3533 0.3840 0.3440 0.0052  -0.0065 0.0044  107 ASP A N   
824  C  CA  . ASP A 116 ? 0.3519 0.3714 0.3570 0.0050  -0.0107 -0.0028 107 ASP A CA  
825  C  C   . ASP A 116 ? 0.3427 0.3719 0.3573 0.0066  -0.0093 -0.0093 107 ASP A C   
826  O  O   . ASP A 116 ? 0.3382 0.3722 0.3600 -0.0039 -0.0053 -0.0028 107 ASP A O   
827  C  CB  . ASP A 116 ? 0.3667 0.3828 0.3718 0.0053  -0.0134 -0.0088 107 ASP A CB  
828  C  CG  . ASP A 116 ? 0.4071 0.4255 0.4066 -0.0088 -0.0098 0.0115  107 ASP A CG  
829  O  OD1 . ASP A 116 ? 0.4026 0.4459 0.3960 0.0095  -0.0180 -0.0031 107 ASP A OD1 
830  O  OD2 . ASP A 116 ? 0.3978 0.4233 0.4625 0.0050  -0.0319 0.0154  107 ASP A OD2 
831  N  N   . TYR A 117 ? 0.3416 0.3810 0.3471 0.0131  -0.0099 -0.0111 108 TYR A N   
832  C  CA  . TYR A 117 ? 0.3283 0.3574 0.3382 0.0147  -0.0135 0.0004  108 TYR A CA  
833  C  C   . TYR A 117 ? 0.3258 0.3753 0.3360 0.0137  -0.0058 0.0025  108 TYR A C   
834  O  O   . TYR A 117 ? 0.2865 0.3520 0.3236 0.0270  -0.0042 0.0205  108 TYR A O   
835  C  CB  . TYR A 117 ? 0.3493 0.3869 0.3454 0.0220  -0.0129 -0.0091 108 TYR A CB  
836  C  CG  . TYR A 117 ? 0.3706 0.3868 0.3800 0.0166  -0.0092 -0.0152 108 TYR A CG  
837  C  CD1 . TYR A 117 ? 0.4048 0.4487 0.4453 -0.0170 0.0010  -0.0119 108 TYR A CD1 
838  C  CD2 . TYR A 117 ? 0.4095 0.4240 0.3953 -0.0147 0.0063  0.0154  108 TYR A CD2 
839  C  CE1 . TYR A 117 ? 0.3855 0.4227 0.3788 -0.0011 0.0221  -0.0138 108 TYR A CE1 
840  C  CE2 . TYR A 117 ? 0.4080 0.4232 0.4250 -0.0015 0.0104  -0.0014 108 TYR A CE2 
841  C  CZ  . TYR A 117 ? 0.4074 0.4366 0.4335 -0.0054 0.0100  -0.0018 108 TYR A CZ  
842  O  OH  . TYR A 117 ? 0.4262 0.4443 0.4944 -0.0245 0.0336  -0.0211 108 TYR A OH  
843  N  N   . TYR A 118 ? 0.3136 0.3551 0.3266 0.0095  -0.0095 -0.0019 109 TYR A N   
844  C  CA  . TYR A 118 ? 0.3273 0.3308 0.3352 0.0022  -0.0107 -0.0039 109 TYR A CA  
845  C  C   . TYR A 118 ? 0.3213 0.3252 0.3195 -0.0007 -0.0164 -0.0088 109 TYR A C   
846  O  O   . TYR A 118 ? 0.3338 0.3088 0.3406 -0.0057 -0.0121 -0.0026 109 TYR A O   
847  C  CB  . TYR A 118 ? 0.3239 0.3474 0.3456 -0.0018 0.0069  -0.0067 109 TYR A CB  
848  C  CG  . TYR A 118 ? 0.3272 0.3804 0.3589 -0.0072 -0.0048 -0.0062 109 TYR A CG  
849  C  CD1 . TYR A 118 ? 0.3501 0.3977 0.3748 -0.0056 0.0084  -0.0184 109 TYR A CD1 
850  C  CD2 . TYR A 118 ? 0.3248 0.3189 0.3456 -0.0136 0.0085  -0.0329 109 TYR A CD2 
851  C  CE1 . TYR A 118 ? 0.3662 0.3835 0.3860 -0.0053 0.0151  -0.0312 109 TYR A CE1 
852  C  CE2 . TYR A 118 ? 0.3480 0.3308 0.3607 -0.0046 -0.0110 -0.0026 109 TYR A CE2 
853  C  CZ  . TYR A 118 ? 0.3973 0.3775 0.3675 -0.0251 0.0047  -0.0197 109 TYR A CZ  
854  O  OH  . TYR A 118 ? 0.4073 0.4233 0.4179 -0.0370 0.0216  -0.0534 109 TYR A OH  
855  N  N   . PHE A 119 ? 0.3123 0.3217 0.3038 0.0056  -0.0281 -0.0072 110 PHE A N   
856  C  CA  . PHE A 119 ? 0.3319 0.3301 0.3348 0.0011  -0.0090 -0.0103 110 PHE A CA  
857  C  C   . PHE A 119 ? 0.3196 0.3293 0.3427 0.0039  -0.0104 -0.0074 110 PHE A C   
858  O  O   . PHE A 119 ? 0.3072 0.3589 0.3304 0.0185  -0.0234 -0.0337 110 PHE A O   
859  C  CB  . PHE A 119 ? 0.3435 0.3482 0.3303 0.0008  -0.0055 -0.0063 110 PHE A CB  
860  C  CG  . PHE A 119 ? 0.3685 0.3721 0.3688 0.0033  -0.0124 -0.0117 110 PHE A CG  
861  C  CD1 . PHE A 119 ? 0.3438 0.3745 0.3943 -0.0156 0.0060  -0.0219 110 PHE A CD1 
862  C  CD2 . PHE A 119 ? 0.3663 0.3236 0.3337 0.0012  -0.0112 -0.0159 110 PHE A CD2 
863  C  CE1 . PHE A 119 ? 0.3723 0.4087 0.4091 0.0086  -0.0046 -0.0039 110 PHE A CE1 
864  C  CE2 . PHE A 119 ? 0.3466 0.3646 0.3789 0.0014  -0.0027 -0.0134 110 PHE A CE2 
865  C  CZ  . PHE A 119 ? 0.3426 0.3820 0.3413 0.0279  -0.0034 -0.0133 110 PHE A CZ  
866  N  N   . ASN A 120 ? 0.3273 0.3351 0.3312 -0.0005 -0.0096 0.0006  111 ASN A N   
867  C  CA  . ASN A 120 ? 0.3155 0.3338 0.3306 0.0044  -0.0126 -0.0080 111 ASN A CA  
868  C  C   . ASN A 120 ? 0.3150 0.3543 0.3410 0.0018  -0.0203 0.0026  111 ASN A C   
869  O  O   . ASN A 120 ? 0.2850 0.3681 0.3684 0.0098  -0.0468 0.0188  111 ASN A O   
870  C  CB  . ASN A 120 ? 0.3191 0.3240 0.3405 -0.0089 -0.0003 -0.0064 111 ASN A CB  
871  C  CG  . ASN A 120 ? 0.3459 0.3311 0.3626 0.0048  0.0030  -0.0096 111 ASN A CG  
872  O  OD1 . ASN A 120 ? 0.4502 0.3483 0.4151 0.0121  0.0226  0.0147  111 ASN A OD1 
873  N  ND2 . ASN A 120 ? 0.3926 0.3449 0.3254 -0.0005 0.0159  0.0079  111 ASN A ND2 
874  N  N   . THR A 121 ? 0.2847 0.3512 0.3344 0.0124  -0.0204 0.0099  112 THR A N   
875  C  CA  . THR A 121 ? 0.3118 0.3537 0.3510 0.0107  -0.0168 0.0006  112 THR A CA  
876  C  C   . THR A 121 ? 0.3237 0.3411 0.3461 0.0099  -0.0090 0.0006  112 THR A C   
877  O  O   . THR A 121 ? 0.3028 0.3097 0.3276 0.0088  -0.0370 -0.0015 112 THR A O   
878  C  CB  . THR A 121 ? 0.3166 0.3578 0.3491 0.0166  -0.0126 -0.0042 112 THR A CB  
879  O  OG1 . THR A 121 ? 0.3130 0.3903 0.3462 0.0183  -0.0102 -0.0175 112 THR A OG1 
880  C  CG2 . THR A 121 ? 0.3495 0.3967 0.3743 0.0182  0.0020  -0.0045 112 THR A CG2 
881  N  N   . PHE A 122 ? 0.3359 0.3514 0.3463 0.0112  -0.0106 0.0045  113 PHE A N   
882  C  CA  . PHE A 122 ? 0.3301 0.3544 0.3481 0.0062  -0.0091 -0.0016 113 PHE A CA  
883  C  C   . PHE A 122 ? 0.3353 0.3634 0.3472 0.0036  -0.0111 -0.0019 113 PHE A C   
884  O  O   . PHE A 122 ? 0.3478 0.3844 0.3723 0.0068  -0.0052 -0.0059 113 PHE A O   
885  C  CB  . PHE A 122 ? 0.3565 0.3752 0.3679 0.0054  -0.0091 -0.0087 113 PHE A CB  
886  C  CG  . PHE A 122 ? 0.3549 0.3819 0.3572 -0.0098 -0.0017 -0.0048 113 PHE A CG  
887  C  CD1 . PHE A 122 ? 0.3479 0.3768 0.3916 -0.0173 0.0025  0.0046  113 PHE A CD1 
888  C  CD2 . PHE A 122 ? 0.4000 0.4004 0.4429 -0.0012 0.0166  0.0147  113 PHE A CD2 
889  C  CE1 . PHE A 122 ? 0.3621 0.4032 0.3846 0.0006  0.0068  -0.0022 113 PHE A CE1 
890  C  CE2 . PHE A 122 ? 0.3839 0.4056 0.4268 -0.0112 -0.0242 0.0186  113 PHE A CE2 
891  C  CZ  . PHE A 122 ? 0.3851 0.4240 0.4467 -0.0034 0.0164  -0.0199 113 PHE A CZ  
892  N  N   . ASP A 123 ? 0.3355 0.3744 0.3419 0.0062  -0.0136 0.0008  114 ASP A N   
893  C  CA  . ASP A 123 ? 0.3601 0.3714 0.3521 0.0023  -0.0090 -0.0040 114 ASP A CA  
894  C  C   . ASP A 123 ? 0.3523 0.3731 0.3429 -0.0011 -0.0054 -0.0037 114 ASP A C   
895  O  O   . ASP A 123 ? 0.3306 0.3843 0.3174 0.0147  -0.0059 0.0000  114 ASP A O   
896  C  CB  . ASP A 123 ? 0.3843 0.3927 0.3787 0.0139  -0.0054 0.0034  114 ASP A CB  
897  C  CG  . ASP A 123 ? 0.5236 0.4645 0.5090 -0.0098 0.0098  0.0186  114 ASP A CG  
898  O  OD1 . ASP A 123 ? 0.5543 0.5524 0.5978 0.0166  0.0209  0.0174  114 ASP A OD1 
899  O  OD2 . ASP A 123 ? 0.5895 0.5557 0.6208 0.0271  -0.0038 0.0127  114 ASP A OD2 
900  N  N   . ASN A 124 ? 0.3573 0.3702 0.3445 -0.0040 -0.0020 -0.0081 115 ASN A N   
901  C  CA  . ASN A 124 ? 0.3526 0.3673 0.3503 -0.0026 -0.0087 -0.0037 115 ASN A CA  
902  C  C   . ASN A 124 ? 0.3407 0.3652 0.3264 -0.0033 -0.0058 -0.0099 115 ASN A C   
903  O  O   . ASN A 124 ? 0.3674 0.3595 0.2833 -0.0023 -0.0062 -0.0084 115 ASN A O   
904  C  CB  . ASN A 124 ? 0.3576 0.3650 0.3621 -0.0046 -0.0165 -0.0005 115 ASN A CB  
905  C  CG  . ASN A 124 ? 0.3868 0.4091 0.3749 -0.0066 0.0080  0.0073  115 ASN A CG  
906  O  OD1 . ASN A 124 ? 0.4379 0.5487 0.4554 0.0019  -0.0101 -0.0177 115 ASN A OD1 
907  N  ND2 . ASN A 124 ? 0.4059 0.4064 0.4408 0.0091  -0.0163 -0.0030 115 ASN A ND2 
908  N  N   . LEU A 125 ? 0.3280 0.3654 0.3291 -0.0074 -0.0038 -0.0056 116 LEU A N   
909  C  CA  . LEU A 125 ? 0.3320 0.3486 0.3363 -0.0065 -0.0051 -0.0036 116 LEU A CA  
910  C  C   . LEU A 125 ? 0.3162 0.3533 0.3156 -0.0026 -0.0114 -0.0100 116 LEU A C   
911  O  O   . LEU A 125 ? 0.3074 0.3958 0.3139 0.0002  -0.0023 -0.0003 116 LEU A O   
912  C  CB  . LEU A 125 ? 0.3222 0.3473 0.3224 0.0011  -0.0084 0.0198  116 LEU A CB  
913  C  CG  . LEU A 125 ? 0.3283 0.3354 0.3296 -0.0015 0.0042  -0.0027 116 LEU A CG  
914  C  CD1 . LEU A 125 ? 0.3485 0.3764 0.3831 0.0094  0.0071  -0.0034 116 LEU A CD1 
915  C  CD2 . LEU A 125 ? 0.3462 0.3552 0.3572 0.0036  -0.0009 -0.0071 116 LEU A CD2 
916  N  N   . LYS A 126 ? 0.3249 0.3721 0.3039 -0.0075 -0.0144 0.0032  117 LYS A N   
917  C  CA  . LYS A 126 ? 0.3269 0.3663 0.3341 -0.0046 -0.0101 -0.0020 117 LYS A CA  
918  C  C   . LYS A 126 ? 0.3247 0.3605 0.3315 -0.0058 -0.0114 -0.0123 117 LYS A C   
919  O  O   . LYS A 126 ? 0.3139 0.3951 0.3484 -0.0156 -0.0343 -0.0108 117 LYS A O   
920  C  CB  . LYS A 126 ? 0.3178 0.3636 0.3275 0.0193  -0.0144 0.0028  117 LYS A CB  
921  C  CG  . LYS A 126 ? 0.4256 0.4603 0.3801 0.0059  0.0065  -0.0079 117 LYS A CG  
922  C  CD  . LYS A 126 ? 0.4175 0.4264 0.4162 0.0015  -0.0021 0.0213  117 LYS A CD  
923  C  CE  . LYS A 126 ? 0.5244 0.4656 0.4886 -0.0161 -0.0002 -0.0041 117 LYS A CE  
924  N  NZ  . LYS A 126 ? 0.5204 0.5693 0.5554 -0.0339 0.0003  0.0042  117 LYS A NZ  
925  N  N   . ASP A 127 ? 0.3232 0.3654 0.3332 -0.0038 -0.0078 -0.0052 118 ASP A N   
926  C  CA  . ASP A 127 ? 0.3421 0.3716 0.3398 0.0059  -0.0108 -0.0067 118 ASP A CA  
927  C  C   . ASP A 127 ? 0.3440 0.3585 0.3341 0.0080  -0.0086 -0.0141 118 ASP A C   
928  O  O   . ASP A 127 ? 0.3609 0.3673 0.3530 0.0151  -0.0173 -0.0430 118 ASP A O   
929  C  CB  . ASP A 127 ? 0.3453 0.3677 0.3406 -0.0043 -0.0079 -0.0128 118 ASP A CB  
930  C  CG  . ASP A 127 ? 0.4036 0.3999 0.4037 0.0116  -0.0019 0.0038  118 ASP A CG  
931  O  OD1 . ASP A 127 ? 0.4047 0.4669 0.4543 -0.0335 0.0095  -0.0162 118 ASP A OD1 
932  O  OD2 . ASP A 127 ? 0.4154 0.4342 0.3574 0.0107  -0.0165 -0.0269 118 ASP A OD2 
933  N  N   . GLN A 128 ? 0.3203 0.3628 0.3205 0.0120  -0.0086 -0.0003 119 GLN A N   
934  C  CA  . GLN A 128 ? 0.3538 0.3715 0.3442 0.0067  -0.0070 -0.0051 119 GLN A CA  
935  C  C   . GLN A 128 ? 0.3348 0.3667 0.3245 0.0000  -0.0120 0.0012  119 GLN A C   
936  O  O   . GLN A 128 ? 0.3531 0.3519 0.2904 0.0056  -0.0069 0.0138  119 GLN A O   
937  C  CB  . GLN A 128 ? 0.3849 0.3736 0.3368 0.0128  -0.0147 -0.0051 119 GLN A CB  
938  C  CG  . GLN A 128 ? 0.3842 0.4181 0.4344 0.0102  -0.0008 0.0108  119 GLN A CG  
939  C  CD  . GLN A 128 ? 0.3995 0.4411 0.4466 -0.0060 0.0028  0.0018  119 GLN A CD  
940  O  OE1 . GLN A 128 ? 0.5767 0.5542 0.5471 0.0033  0.0120  -0.0471 119 GLN A OE1 
941  N  NE2 . GLN A 128 ? 0.4722 0.5122 0.4933 0.0018  0.0353  -0.0126 119 GLN A NE2 
942  N  N   . LEU A 129 ? 0.3022 0.3536 0.3157 -0.0055 -0.0086 0.0039  120 LEU A N   
943  C  CA  . LEU A 129 ? 0.3253 0.3489 0.3202 -0.0083 -0.0064 -0.0017 120 LEU A CA  
944  C  C   . LEU A 129 ? 0.3101 0.3662 0.3160 0.0016  -0.0072 -0.0019 120 LEU A C   
945  O  O   . LEU A 129 ? 0.2965 0.3780 0.3319 0.0109  0.0077  -0.0157 120 LEU A O   
946  C  CB  . LEU A 129 ? 0.3127 0.3433 0.2966 -0.0137 -0.0103 -0.0079 120 LEU A CB  
947  C  CG  . LEU A 129 ? 0.3411 0.3760 0.3437 0.0071  0.0022  0.0054  120 LEU A CG  
948  C  CD1 . LEU A 129 ? 0.4144 0.3738 0.3908 0.0042  0.0269  0.0019  120 LEU A CD1 
949  C  CD2 . LEU A 129 ? 0.4670 0.4498 0.3871 0.0171  -0.0006 -0.0104 120 LEU A CD2 
950  N  N   . SER A 130 ? 0.3111 0.3626 0.3218 -0.0022 -0.0112 0.0058  121 SER A N   
951  C  CA  . SER A 130 ? 0.3465 0.3626 0.3411 -0.0050 -0.0036 -0.0011 121 SER A CA  
952  C  C   . SER A 130 ? 0.3441 0.3612 0.3391 0.0044  -0.0080 0.0047  121 SER A C   
953  O  O   . SER A 130 ? 0.3142 0.3581 0.3428 0.0003  0.0056  0.0088  121 SER A O   
954  C  CB  . SER A 130 ? 0.3580 0.3683 0.3500 0.0033  0.0071  -0.0057 121 SER A CB  
955  O  OG  . SER A 130 ? 0.3681 0.4039 0.3709 -0.0121 -0.0164 -0.0014 121 SER A OG  
956  N  N   . LYS A 131 ? 0.3501 0.3772 0.3551 -0.0021 -0.0058 0.0106  122 LYS A N   
957  C  CA  . LYS A 131 ? 0.3619 0.3732 0.3469 0.0022  -0.0130 0.0008  122 LYS A CA  
958  C  C   . LYS A 131 ? 0.3564 0.3702 0.3293 -0.0024 -0.0066 -0.0018 122 LYS A C   
959  O  O   . LYS A 131 ? 0.3323 0.3871 0.3119 0.0032  0.0041  -0.0161 122 LYS A O   
960  C  CB  . LYS A 131 ? 0.3786 0.3650 0.3453 0.0066  -0.0206 0.0031  122 LYS A CB  
961  C  CG  . LYS A 131 ? 0.4262 0.4140 0.3787 0.0137  0.0081  -0.0037 122 LYS A CG  
962  C  CD  . LYS A 131 ? 0.4201 0.4162 0.3917 -0.0118 -0.0028 -0.0053 122 LYS A CD  
963  C  CE  . LYS A 131 ? 0.4768 0.4809 0.4373 -0.0090 0.0156  0.0191  122 LYS A CE  
964  N  NZ  . LYS A 131 ? 0.4770 0.5295 0.4659 -0.0051 0.0242  -0.0128 122 LYS A NZ  
965  N  N   . ALA A 132 ? 0.3422 0.3462 0.3114 -0.0063 0.0021  -0.0024 123 ALA A N   
966  C  CA  . ALA A 132 ? 0.3367 0.3508 0.3244 0.0000  -0.0088 0.0094  123 ALA A CA  
967  C  C   . ALA A 132 ? 0.3212 0.3418 0.3046 0.0074  -0.0067 0.0078  123 ALA A C   
968  O  O   . ALA A 132 ? 0.3341 0.3365 0.3159 0.0160  -0.0118 0.0091  123 ALA A O   
969  C  CB  . ALA A 132 ? 0.3373 0.3355 0.3288 -0.0011 0.0000  -0.0004 123 ALA A CB  
970  N  N   . ALA A 133 ? 0.3020 0.3369 0.2916 -0.0020 -0.0251 -0.0075 124 ALA A N   
971  C  CA  . ALA A 133 ? 0.3204 0.3349 0.3148 -0.0038 -0.0062 -0.0030 124 ALA A CA  
972  C  C   . ALA A 133 ? 0.3063 0.3358 0.3026 -0.0016 -0.0001 0.0016  124 ALA A C   
973  O  O   . ALA A 133 ? 0.3410 0.3597 0.3092 0.0182  -0.0015 -0.0003 124 ALA A O   
974  C  CB  . ALA A 133 ? 0.3248 0.3396 0.3134 -0.0076 -0.0096 -0.0108 124 ALA A CB  
975  N  N   . ILE A 134 ? 0.3158 0.3174 0.3046 -0.0083 -0.0163 -0.0221 125 ILE A N   
976  C  CA  . ILE A 134 ? 0.3489 0.3536 0.3328 0.0005  -0.0071 -0.0127 125 ILE A CA  
977  C  C   . ILE A 134 ? 0.3519 0.3373 0.3448 0.0119  -0.0091 -0.0154 125 ILE A C   
978  O  O   . ILE A 134 ? 0.3481 0.3489 0.3688 0.0202  -0.0143 -0.0083 125 ILE A O   
979  C  CB  . ILE A 134 ? 0.3687 0.3324 0.3485 -0.0038 -0.0194 -0.0168 125 ILE A CB  
980  C  CG1 . ILE A 134 ? 0.3728 0.4090 0.3707 0.0174  -0.0076 0.0059  125 ILE A CG1 
981  C  CG2 . ILE A 134 ? 0.3532 0.3380 0.3335 -0.0030 -0.0224 -0.0287 125 ILE A CG2 
982  C  CD1 . ILE A 134 ? 0.4219 0.3708 0.3831 -0.0015 -0.0004 -0.0147 125 ILE A CD1 
983  N  N   . SER A 135 ? 0.3396 0.3341 0.3241 0.0093  -0.0033 -0.0095 126 SER A N   
984  C  CA  . SER A 135 ? 0.3581 0.3531 0.3281 0.0106  -0.0014 -0.0030 126 SER A CA  
985  C  C   . SER A 135 ? 0.3400 0.3473 0.3083 0.0148  0.0031  0.0132  126 SER A C   
986  O  O   . SER A 135 ? 0.3466 0.3497 0.2622 0.0200  0.0200  0.0166  126 SER A O   
987  C  CB  . SER A 135 ? 0.3845 0.3844 0.3467 0.0175  0.0075  0.0112  126 SER A CB  
988  O  OG  . SER A 135 ? 0.4828 0.4510 0.4066 0.0202  0.0123  -0.0099 126 SER A OG  
989  N  N   . ARG A 136 ? 0.3312 0.3305 0.2835 0.0117  -0.0148 0.0039  127 ARG A N   
990  C  CA  . ARG A 136 ? 0.3159 0.3410 0.2875 0.0010  -0.0054 0.0024  127 ARG A CA  
991  C  C   . ARG A 136 ? 0.3046 0.3350 0.2956 0.0015  -0.0019 0.0057  127 ARG A C   
992  O  O   . ARG A 136 ? 0.2905 0.3265 0.3044 0.0190  -0.0082 0.0264  127 ARG A O   
993  C  CB  . ARG A 136 ? 0.3230 0.3494 0.2905 0.0036  -0.0084 -0.0052 127 ARG A CB  
994  C  CG  . ARG A 136 ? 0.3361 0.3512 0.3064 0.0055  -0.0097 -0.0086 127 ARG A CG  
995  C  CD  . ARG A 136 ? 0.3194 0.3112 0.3187 0.0191  0.0065  -0.0096 127 ARG A CD  
996  N  NE  . ARG A 136 ? 0.3284 0.3293 0.2026 0.0017  -0.0373 -0.0164 127 ARG A NE  
997  C  CZ  . ARG A 136 ? 0.3239 0.3387 0.3348 0.0196  -0.0165 -0.0073 127 ARG A CZ  
998  N  NH1 . ARG A 136 ? 0.3353 0.3212 0.2249 0.0259  -0.0154 0.0061  127 ARG A NH1 
999  N  NH2 . ARG A 136 ? 0.3143 0.3385 0.3781 0.0171  0.0160  0.0101  127 ARG A NH2 
1000 N  N   . PHE A 137 ? 0.2926 0.3219 0.2757 0.0008  -0.0091 0.0002  128 PHE A N   
1001 C  CA  . PHE A 137 ? 0.3080 0.3284 0.2806 0.0012  -0.0078 0.0107  128 PHE A CA  
1002 C  C   . PHE A 137 ? 0.3052 0.3066 0.2484 0.0000  -0.0144 0.0143  128 PHE A C   
1003 O  O   . PHE A 137 ? 0.3316 0.3481 0.2326 -0.0204 -0.0433 0.0168  128 PHE A O   
1004 C  CB  . PHE A 137 ? 0.3123 0.3267 0.2723 0.0065  0.0026  0.0023  128 PHE A CB  
1005 C  CG  . PHE A 137 ? 0.2866 0.2962 0.2820 -0.0024 -0.0042 0.0017  128 PHE A CG  
1006 C  CD1 . PHE A 137 ? 0.2769 0.2900 0.3165 0.0372  -0.0415 0.0160  128 PHE A CD1 
1007 C  CD2 . PHE A 137 ? 0.2974 0.2963 0.2410 0.0012  0.0008  0.0014  128 PHE A CD2 
1008 C  CE1 . PHE A 137 ? 0.3171 0.3085 0.2955 0.0080  -0.0095 0.0001  128 PHE A CE1 
1009 C  CE2 . PHE A 137 ? 0.3136 0.3135 0.3138 -0.0040 -0.0146 -0.0105 128 PHE A CE2 
1010 C  CZ  . PHE A 137 ? 0.3188 0.2803 0.3246 0.0147  -0.0200 0.0042  128 PHE A CZ  
1011 N  N   . GLY A 138 ? 0.2910 0.2896 0.2507 0.0105  -0.0138 0.0126  129 GLY A N   
1012 C  CA  . GLY A 138 ? 0.2910 0.2747 0.2519 -0.0007 -0.0056 -0.0005 129 GLY A CA  
1013 C  C   . GLY A 138 ? 0.2814 0.2758 0.2584 0.0046  -0.0049 -0.0001 129 GLY A C   
1014 O  O   . GLY A 138 ? 0.3097 0.3040 0.2696 0.0113  0.0016  -0.0026 129 GLY A O   
1015 N  N   . SER A 139 ? 0.2586 0.2909 0.2521 0.0026  0.0068  0.0006  130 SER A N   
1016 C  CA  . SER A 139 ? 0.2760 0.2747 0.2431 0.0063  -0.0092 0.0119  130 SER A CA  
1017 C  C   . SER A 139 ? 0.2756 0.2641 0.2583 -0.0006 0.0046  0.0126  130 SER A C   
1018 O  O   . SER A 139 ? 0.2829 0.2791 0.2457 -0.0011 0.0259  0.0032  130 SER A O   
1019 C  CB  . SER A 139 ? 0.2740 0.2840 0.2653 -0.0257 -0.0036 0.0142  130 SER A CB  
1020 O  OG  . SER A 139 ? 0.2681 0.2999 0.2586 -0.0048 -0.0192 -0.0211 130 SER A OG  
1021 N  N   . GLY A 140 ? 0.2655 0.2792 0.2570 -0.0070 0.0008  0.0093  131 GLY A N   
1022 C  CA  . GLY A 140 ? 0.2674 0.2641 0.2487 -0.0010 -0.0077 0.0106  131 GLY A CA  
1023 C  C   . GLY A 140 ? 0.2730 0.2627 0.2707 -0.0095 -0.0099 0.0122  131 GLY A C   
1024 O  O   . GLY A 140 ? 0.2782 0.2722 0.2414 -0.0088 0.0050  0.0469  131 GLY A O   
1025 N  N   . TYR A 141 ? 0.2603 0.2589 0.2714 -0.0006 -0.0061 0.0088  132 TYR A N   
1026 C  CA  . TYR A 141 ? 0.2790 0.2825 0.2515 -0.0129 -0.0139 0.0033  132 TYR A CA  
1027 C  C   . TYR A 141 ? 0.2908 0.2847 0.2399 -0.0082 -0.0053 -0.0018 132 TYR A C   
1028 O  O   . TYR A 141 ? 0.3152 0.3088 0.2168 -0.0384 0.0010  0.0091  132 TYR A O   
1029 C  CB  . TYR A 141 ? 0.3001 0.2649 0.2626 -0.0048 -0.0029 -0.0161 132 TYR A CB  
1030 C  CG  . TYR A 141 ? 0.2641 0.2699 0.2847 -0.0122 -0.0249 -0.0056 132 TYR A CG  
1031 C  CD1 . TYR A 141 ? 0.3088 0.2497 0.2557 0.0060  0.0057  -0.0122 132 TYR A CD1 
1032 C  CD2 . TYR A 141 ? 0.2963 0.2447 0.2465 -0.0051 0.0095  -0.0138 132 TYR A CD2 
1033 C  CE1 . TYR A 141 ? 0.2832 0.2917 0.2855 -0.0020 -0.0091 -0.0238 132 TYR A CE1 
1034 C  CE2 . TYR A 141 ? 0.2434 0.2383 0.2933 -0.0177 -0.0104 -0.0162 132 TYR A CE2 
1035 C  CZ  . TYR A 141 ? 0.2789 0.2754 0.2963 0.0108  -0.0023 -0.0011 132 TYR A CZ  
1036 O  OH  . TYR A 141 ? 0.3150 0.3536 0.3034 -0.0075 0.0157  0.0332  132 TYR A OH  
1037 N  N   . GLY A 142 ? 0.2692 0.2851 0.2250 -0.0144 -0.0177 -0.0017 133 GLY A N   
1038 C  CA  . GLY A 142 ? 0.2788 0.2930 0.2533 -0.0071 -0.0019 0.0024  133 GLY A CA  
1039 C  C   . GLY A 142 ? 0.2745 0.2924 0.2642 -0.0129 0.0003  -0.0109 133 GLY A C   
1040 O  O   . GLY A 142 ? 0.2794 0.3284 0.2751 -0.0084 0.0068  -0.0044 133 GLY A O   
1041 N  N   . TRP A 143 ? 0.2909 0.3034 0.2808 -0.0106 -0.0038 -0.0045 134 TRP A N   
1042 C  CA  . TRP A 143 ? 0.2834 0.3113 0.2781 -0.0076 -0.0087 -0.0018 134 TRP A CA  
1043 C  C   . TRP A 143 ? 0.2770 0.3437 0.2808 -0.0050 -0.0057 -0.0042 134 TRP A C   
1044 O  O   . TRP A 143 ? 0.2404 0.3617 0.2443 -0.0190 -0.0247 -0.0021 134 TRP A O   
1045 C  CB  . TRP A 143 ? 0.2842 0.3167 0.2752 0.0000  -0.0112 -0.0079 134 TRP A CB  
1046 C  CG  . TRP A 143 ? 0.2744 0.3264 0.2948 -0.0058 -0.0044 -0.0013 134 TRP A CG  
1047 C  CD1 . TRP A 143 ? 0.2833 0.3172 0.2906 0.0028  0.0016  0.0001  134 TRP A CD1 
1048 C  CD2 . TRP A 143 ? 0.2953 0.3175 0.2833 -0.0009 -0.0283 -0.0287 134 TRP A CD2 
1049 N  NE1 . TRP A 143 ? 0.2795 0.2780 0.2918 -0.0159 -0.0105 -0.0265 134 TRP A NE1 
1050 C  CE2 . TRP A 143 ? 0.3127 0.2838 0.2983 -0.0043 -0.0125 -0.0050 134 TRP A CE2 
1051 C  CE3 . TRP A 143 ? 0.2789 0.3142 0.2960 -0.0039 0.0041  0.0217  134 TRP A CE3 
1052 C  CZ2 . TRP A 143 ? 0.2830 0.3239 0.3022 -0.0148 -0.0051 -0.0032 134 TRP A CZ2 
1053 C  CZ3 . TRP A 143 ? 0.2994 0.2730 0.2929 0.0040  -0.0178 -0.0255 134 TRP A CZ3 
1054 C  CH2 . TRP A 143 ? 0.2680 0.3082 0.2773 -0.0148 -0.0153 -0.0053 134 TRP A CH2 
1055 N  N   . LEU A 144 ? 0.3026 0.3515 0.2914 0.0004  0.0034  0.0102  135 LEU A N   
1056 C  CA  . LEU A 144 ? 0.3057 0.3377 0.3136 -0.0101 -0.0066 0.0046  135 LEU A CA  
1057 C  C   . LEU A 144 ? 0.3152 0.3438 0.2991 -0.0079 0.0017  0.0006  135 LEU A C   
1058 O  O   . LEU A 144 ? 0.3099 0.3673 0.3066 -0.0297 0.0082  0.0152  135 LEU A O   
1059 C  CB  . LEU A 144 ? 0.3270 0.3426 0.3041 -0.0048 -0.0126 -0.0035 135 LEU A CB  
1060 C  CG  . LEU A 144 ? 0.3210 0.3420 0.3217 0.0090  0.0027  -0.0095 135 LEU A CG  
1061 C  CD1 . LEU A 144 ? 0.2801 0.3741 0.3279 -0.0085 -0.0022 -0.0014 135 LEU A CD1 
1062 C  CD2 . LEU A 144 ? 0.3151 0.3421 0.2958 -0.0107 -0.0139 -0.0169 135 LEU A CD2 
1063 N  N   . VAL A 145 ? 0.3256 0.3520 0.3071 -0.0037 0.0054  -0.0080 136 VAL A N   
1064 C  CA  . VAL A 145 ? 0.3261 0.3496 0.3267 -0.0129 -0.0021 -0.0014 136 VAL A CA  
1065 C  C   . VAL A 145 ? 0.3262 0.3700 0.3389 -0.0077 0.0010  -0.0111 136 VAL A C   
1066 O  O   . VAL A 145 ? 0.3168 0.3728 0.3200 -0.0280 -0.0047 -0.0283 136 VAL A O   
1067 C  CB  . VAL A 145 ? 0.3102 0.3308 0.3102 -0.0025 0.0089  -0.0006 136 VAL A CB  
1068 C  CG1 . VAL A 145 ? 0.3372 0.3436 0.2852 -0.0059 -0.0044 -0.0012 136 VAL A CG1 
1069 C  CG2 . VAL A 145 ? 0.3214 0.3550 0.3019 -0.0177 0.0046  0.0088  136 VAL A CG2 
1070 N  N   . LEU A 146 ? 0.3466 0.3925 0.3724 -0.0163 -0.0076 -0.0196 137 LEU A N   
1071 C  CA  . LEU A 146 ? 0.3638 0.4159 0.3876 -0.0155 -0.0063 -0.0147 137 LEU A CA  
1072 C  C   . LEU A 146 ? 0.3858 0.4276 0.4145 -0.0162 -0.0084 -0.0123 137 LEU A C   
1073 O  O   . LEU A 146 ? 0.3744 0.4370 0.4357 -0.0487 0.0052  -0.0190 137 LEU A O   
1074 C  CB  . LEU A 146 ? 0.3494 0.4191 0.3844 -0.0133 -0.0096 -0.0171 137 LEU A CB  
1075 C  CG  . LEU A 146 ? 0.3715 0.4166 0.3938 -0.0246 -0.0143 -0.0242 137 LEU A CG  
1076 C  CD1 . LEU A 146 ? 0.3719 0.4244 0.4150 -0.0026 -0.0155 -0.0097 137 LEU A CD1 
1077 C  CD2 . LEU A 146 ? 0.4110 0.4617 0.3946 -0.0130 -0.0107 -0.0058 137 LEU A CD2 
1078 N  N   . ASP A 147 ? 0.4178 0.4568 0.4528 -0.0044 0.0033  -0.0146 138 ASP A N   
1079 C  CA  . ASP A 147 ? 0.4291 0.4606 0.4498 -0.0051 0.0044  -0.0041 138 ASP A CA  
1080 C  C   . ASP A 147 ? 0.4530 0.4886 0.4833 -0.0088 0.0052  -0.0137 138 ASP A C   
1081 O  O   . ASP A 147 ? 0.4395 0.4988 0.5005 -0.0114 0.0096  -0.0125 138 ASP A O   
1082 C  CB  . ASP A 147 ? 0.4407 0.4763 0.4738 -0.0039 0.0009  -0.0131 138 ASP A CB  
1083 C  CG  . ASP A 147 ? 0.4758 0.5003 0.4844 -0.0034 0.0036  0.0040  138 ASP A CG  
1084 O  OD1 . ASP A 147 ? 0.5549 0.5951 0.5272 -0.0137 0.0032  0.0048  138 ASP A OD1 
1085 O  OD2 . ASP A 147 ? 0.5545 0.5275 0.5164 -0.0175 0.0044  -0.0018 138 ASP A OD2 
1086 N  N   . GLY A 148 ? 0.4668 0.4967 0.4997 -0.0096 0.0025  -0.0155 139 GLY A N   
1087 C  CA  . GLY A 148 ? 0.4688 0.4876 0.4946 -0.0077 -0.0033 -0.0078 139 GLY A CA  
1088 C  C   . GLY A 148 ? 0.4856 0.4949 0.4994 -0.0093 -0.0001 -0.0088 139 GLY A C   
1089 O  O   . GLY A 148 ? 0.5017 0.5264 0.5216 -0.0120 0.0141  -0.0152 139 GLY A O   
1090 N  N   . GLU A 149 ? 0.4731 0.4812 0.5001 -0.0122 -0.0019 -0.0121 140 GLU A N   
1091 C  CA  . GLU A 149 ? 0.4796 0.4876 0.4943 -0.0077 -0.0029 -0.0052 140 GLU A CA  
1092 C  C   . GLU A 149 ? 0.4566 0.4643 0.4651 -0.0059 -0.0015 -0.0036 140 GLU A C   
1093 O  O   . GLU A 149 ? 0.4487 0.4630 0.4458 -0.0088 -0.0072 -0.0117 140 GLU A O   
1094 C  CB  . GLU A 149 ? 0.4911 0.5009 0.5144 0.0005  -0.0060 -0.0007 140 GLU A CB  
1095 C  CG  . GLU A 149 ? 0.5329 0.5357 0.5532 -0.0015 0.0030  -0.0125 140 GLU A CG  
1096 C  CD  . GLU A 149 ? 0.5389 0.5679 0.5752 -0.0183 -0.0156 -0.0109 140 GLU A CD  
1097 O  OE1 . GLU A 149 ? 0.6868 0.6849 0.6142 0.0077  -0.0259 0.0154  140 GLU A OE1 
1098 O  OE2 . GLU A 149 ? 0.6581 0.7171 0.6384 -0.0158 0.0359  -0.0018 140 GLU A OE2 
1099 N  N   . GLU A 150 ? 0.4361 0.4481 0.4517 -0.0148 0.0034  -0.0065 141 GLU A N   
1100 C  CA  . GLU A 150 ? 0.4303 0.4578 0.4479 -0.0126 0.0041  0.0002  141 GLU A CA  
1101 C  C   . GLU A 150 ? 0.3963 0.4258 0.3958 -0.0084 0.0042  -0.0021 141 GLU A C   
1102 O  O   . GLU A 150 ? 0.3562 0.4254 0.3336 -0.0180 0.0030  -0.0028 141 GLU A O   
1103 C  CB  . GLU A 150 ? 0.4121 0.4465 0.4410 -0.0178 0.0023  -0.0033 141 GLU A CB  
1104 C  CG  . GLU A 150 ? 0.4566 0.4779 0.4510 -0.0148 0.0051  -0.0079 141 GLU A CG  
1105 C  CD  . GLU A 150 ? 0.5362 0.5365 0.4822 -0.0120 0.0088  0.0019  141 GLU A CD  
1106 O  OE1 . GLU A 150 ? 0.5786 0.6185 0.5720 -0.0329 0.0220  0.0164  141 GLU A OE1 
1107 O  OE2 . GLU A 150 ? 0.6154 0.6343 0.5335 -0.0271 -0.0330 -0.0033 141 GLU A OE2 
1108 N  N   . LEU A 151 ? 0.4005 0.4330 0.3967 -0.0143 0.0106  0.0006  142 LEU A N   
1109 C  CA  . LEU A 151 ? 0.3846 0.4208 0.3911 -0.0036 -0.0023 -0.0051 142 LEU A CA  
1110 C  C   . LEU A 151 ? 0.3678 0.4142 0.3858 -0.0061 0.0021  -0.0073 142 LEU A C   
1111 O  O   . LEU A 151 ? 0.3437 0.4172 0.3850 -0.0139 -0.0161 -0.0397 142 LEU A O   
1112 C  CB  . LEU A 151 ? 0.3720 0.4077 0.4026 -0.0145 0.0000  -0.0033 142 LEU A CB  
1113 C  CG  . LEU A 151 ? 0.4532 0.4473 0.4565 -0.0023 -0.0102 0.0046  142 LEU A CG  
1114 C  CD1 . LEU A 151 ? 0.4980 0.4763 0.4364 -0.0010 -0.0282 -0.0074 142 LEU A CD1 
1115 C  CD2 . LEU A 151 ? 0.4077 0.4334 0.3992 0.0062  0.0014  0.0011  142 LEU A CD2 
1116 N  N   . SER A 152 ? 0.3569 0.4135 0.3684 -0.0133 0.0033  0.0001  143 SER A N   
1117 C  CA  . SER A 152 ? 0.3428 0.3748 0.3621 -0.0122 0.0028  -0.0029 143 SER A CA  
1118 C  C   . SER A 152 ? 0.3171 0.3573 0.3390 -0.0089 0.0025  -0.0060 143 SER A C   
1119 O  O   . SER A 152 ? 0.2932 0.3316 0.3202 -0.0253 -0.0129 -0.0272 143 SER A O   
1120 C  CB  . SER A 152 ? 0.3664 0.3962 0.3717 -0.0106 0.0051  -0.0010 143 SER A CB  
1121 O  OG  . SER A 152 ? 0.4581 0.3364 0.4003 0.0028  -0.0014 0.0629  143 SER A OG  
1122 N  N   . VAL A 153 ? 0.3116 0.3566 0.3357 -0.0122 0.0084  -0.0095 144 VAL A N   
1123 C  CA  . VAL A 153 ? 0.3130 0.3438 0.3375 -0.0040 0.0072  0.0023  144 VAL A CA  
1124 C  C   . VAL A 153 ? 0.3059 0.3225 0.3211 -0.0062 0.0127  0.0014  144 VAL A C   
1125 O  O   . VAL A 153 ? 0.3007 0.3204 0.3272 -0.0205 0.0153  -0.0045 144 VAL A O   
1126 C  CB  . VAL A 153 ? 0.3196 0.3628 0.3613 -0.0015 0.0048  0.0109  144 VAL A CB  
1127 C  CG1 . VAL A 153 ? 0.4115 0.4178 0.4129 -0.0054 -0.0154 -0.0084 144 VAL A CG1 
1128 C  CG2 . VAL A 153 ? 0.3739 0.3231 0.4165 0.0043  0.0182  0.0269  144 VAL A CG2 
1129 N  N   . MET A 154 ? 0.2871 0.3059 0.3139 -0.0143 0.0104  0.0150  145 MET A N   
1130 C  CA  . MET A 154 ? 0.3007 0.3315 0.3024 -0.0152 0.0033  0.0051  145 MET A CA  
1131 C  C   . MET A 154 ? 0.2649 0.3087 0.2845 -0.0022 0.0009  0.0049  145 MET A C   
1132 O  O   . MET A 154 ? 0.2656 0.3350 0.2679 0.0060  -0.0148 0.0153  145 MET A O   
1133 C  CB  . MET A 154 ? 0.3049 0.3231 0.3010 -0.0149 0.0101  0.0091  145 MET A CB  
1134 C  CG  . MET A 154 ? 0.3412 0.3515 0.2831 -0.0162 0.0011  0.0052  145 MET A CG  
1135 S  SD  . MET A 154 ? 0.3726 0.4046 0.3237 -0.0377 -0.0202 0.0037  145 MET A SD  
1136 C  CE  . MET A 154 ? 0.3941 0.4082 0.4110 0.0161  -0.0008 -0.0034 145 MET A CE  
1137 N  N   . SER A 155 ? 0.2853 0.3272 0.2670 -0.0055 -0.0012 0.0102  146 SER A N   
1138 C  CA  . SER A 155 ? 0.2809 0.3023 0.2662 -0.0157 0.0081  0.0104  146 SER A CA  
1139 C  C   . SER A 155 ? 0.2973 0.3020 0.2862 -0.0205 0.0100  0.0122  146 SER A C   
1140 O  O   . SER A 155 ? 0.3116 0.2790 0.2743 -0.0262 0.0100  0.0347  146 SER A O   
1141 C  CB  . SER A 155 ? 0.2923 0.3085 0.2619 -0.0124 0.0167  0.0130  146 SER A CB  
1142 O  OG  . SER A 155 ? 0.2651 0.2989 0.2485 -0.0348 -0.0294 0.0132  146 SER A OG  
1143 N  N   . THR A 156 ? 0.2717 0.2919 0.2648 -0.0238 -0.0049 0.0112  147 THR A N   
1144 C  CA  . THR A 156 ? 0.2783 0.2759 0.2522 -0.0202 0.0025  -0.0014 147 THR A CA  
1145 C  C   . THR A 156 ? 0.2676 0.2902 0.2526 -0.0006 0.0061  0.0035  147 THR A C   
1146 O  O   . THR A 156 ? 0.2641 0.3026 0.2477 -0.0241 -0.0190 0.0074  147 THR A O   
1147 C  CB  . THR A 156 ? 0.2789 0.2970 0.2123 -0.0117 0.0107  0.0124  147 THR A CB  
1148 O  OG1 . THR A 156 ? 0.2817 0.2521 0.2852 -0.0637 0.0086  0.0345  147 THR A OG1 
1149 C  CG2 . THR A 156 ? 0.3266 0.2863 0.3206 -0.0405 0.0208  -0.0013 147 THR A CG2 
1150 N  N   . PRO A 157 ? 0.2943 0.2892 0.2509 -0.0062 0.0014  0.0152  148 PRO A N   
1151 C  CA  . PRO A 157 ? 0.2807 0.2728 0.2488 -0.0102 -0.0020 0.0132  148 PRO A CA  
1152 C  C   . PRO A 157 ? 0.2790 0.2749 0.2687 -0.0082 -0.0037 0.0038  148 PRO A C   
1153 O  O   . PRO A 157 ? 0.2933 0.2329 0.2461 -0.0152 -0.0028 0.0161  148 PRO A O   
1154 C  CB  . PRO A 157 ? 0.3008 0.2785 0.2977 -0.0082 -0.0013 0.0090  148 PRO A CB  
1155 C  CG  . PRO A 157 ? 0.2638 0.2861 0.2639 -0.0111 -0.0040 -0.0083 148 PRO A CG  
1156 C  CD  . PRO A 157 ? 0.2906 0.3061 0.2738 -0.0090 0.0017  0.0068  148 PRO A CD  
1157 N  N   . ASN A 158 ? 0.2544 0.2672 0.2474 -0.0147 -0.0092 0.0009  149 ASN A N   
1158 C  CA  . ASN A 158 ? 0.2659 0.2673 0.2631 -0.0122 -0.0052 0.0008  149 ASN A CA  
1159 C  C   . ASN A 158 ? 0.2629 0.2660 0.2618 -0.0137 0.0016  0.0046  149 ASN A C   
1160 O  O   . ASN A 158 ? 0.2778 0.2700 0.2905 -0.0171 0.0097  -0.0033 149 ASN A O   
1161 C  CB  . ASN A 158 ? 0.2611 0.2665 0.2629 -0.0198 -0.0012 -0.0016 149 ASN A CB  
1162 C  CG  . ASN A 158 ? 0.3308 0.2828 0.2711 -0.0168 -0.0203 0.0029  149 ASN A CG  
1163 O  OD1 . ASN A 158 ? 0.4097 0.3038 0.3266 -0.0037 0.0249  -0.0042 149 ASN A OD1 
1164 N  ND2 . ASN A 158 ? 0.2743 0.2151 0.2301 -0.0081 0.0181  0.0347  149 ASN A ND2 
1165 N  N   . GLN A 159 ? 0.2744 0.2632 0.2571 -0.0047 -0.0106 0.0095  150 GLN A N   
1166 C  CA  . GLN A 159 ? 0.2823 0.2762 0.2666 -0.0125 -0.0055 0.0063  150 GLN A CA  
1167 C  C   . GLN A 159 ? 0.3042 0.2942 0.2831 -0.0075 -0.0009 0.0030  150 GLN A C   
1168 O  O   . GLN A 159 ? 0.3123 0.3245 0.2968 -0.0155 -0.0013 -0.0015 150 GLN A O   
1169 C  CB  . GLN A 159 ? 0.3125 0.2816 0.2787 -0.0125 -0.0005 0.0049  150 GLN A CB  
1170 C  CG  . GLN A 159 ? 0.3447 0.2930 0.2725 -0.0290 -0.0016 -0.0036 150 GLN A CG  
1171 C  CD  . GLN A 159 ? 0.2607 0.2598 0.2018 -0.0007 -0.0163 -0.0040 150 GLN A CD  
1172 O  OE1 . GLN A 159 ? 0.3124 0.2690 0.2279 -0.0162 -0.0190 0.0087  150 GLN A OE1 
1173 N  NE2 . GLN A 159 ? 0.2312 0.1897 0.1409 -0.0307 -0.0074 -0.0202 150 GLN A NE2 
1174 N  N   . ASP A 160 ? 0.2910 0.2792 0.2809 -0.0071 0.0071  0.0017  151 ASP A N   
1175 C  CA  . ASP A 160 ? 0.2895 0.2797 0.2810 -0.0142 0.0045  -0.0028 151 ASP A CA  
1176 C  C   . ASP A 160 ? 0.2987 0.2772 0.2842 -0.0131 -0.0075 0.0050  151 ASP A C   
1177 O  O   . ASP A 160 ? 0.2650 0.2876 0.2943 -0.0050 0.0040  -0.0141 151 ASP A O   
1178 C  CB  . ASP A 160 ? 0.3066 0.2951 0.2657 -0.0119 -0.0150 0.0061  151 ASP A CB  
1179 C  CG  . ASP A 160 ? 0.3200 0.3029 0.3058 -0.0032 0.0067  -0.0015 151 ASP A CG  
1180 O  OD1 . ASP A 160 ? 0.3448 0.3437 0.3376 0.0091  0.0337  0.0463  151 ASP A OD1 
1181 O  OD2 . ASP A 160 ? 0.4108 0.3655 0.3178 0.0018  -0.0115 0.0261  151 ASP A OD2 
1182 N  N   . THR A 161 ? 0.3148 0.2634 0.2736 -0.0049 -0.0018 -0.0061 152 THR A N   
1183 C  CA  . THR A 161 ? 0.3157 0.3046 0.2923 -0.0072 -0.0023 -0.0047 152 THR A CA  
1184 C  C   . THR A 161 ? 0.3216 0.3198 0.3096 -0.0118 0.0032  -0.0017 152 THR A C   
1185 O  O   . THR A 161 ? 0.3216 0.3286 0.3096 -0.0250 -0.0038 0.0177  152 THR A O   
1186 C  CB  . THR A 161 ? 0.3344 0.3262 0.2902 -0.0092 0.0052  0.0058  152 THR A CB  
1187 O  OG1 . THR A 161 ? 0.3726 0.3227 0.2933 0.0157  -0.0287 -0.0094 152 THR A OG1 
1188 C  CG2 . THR A 161 ? 0.3381 0.3315 0.3419 0.0084  0.0133  -0.0105 152 THR A CG2 
1189 N  N   . PRO A 162 ? 0.3147 0.3339 0.3228 -0.0096 0.0010  -0.0022 153 PRO A N   
1190 C  CA  . PRO A 162 ? 0.3423 0.3507 0.3362 -0.0109 0.0028  -0.0080 153 PRO A CA  
1191 C  C   . PRO A 162 ? 0.3526 0.3597 0.3481 -0.0238 -0.0037 -0.0092 153 PRO A C   
1192 O  O   . PRO A 162 ? 0.3520 0.3561 0.3181 -0.0329 -0.0005 -0.0189 153 PRO A O   
1193 C  CB  . PRO A 162 ? 0.3201 0.3536 0.3259 -0.0027 -0.0145 -0.0053 153 PRO A CB  
1194 C  CG  . PRO A 162 ? 0.3266 0.3482 0.3279 -0.0033 0.0049  0.0034  153 PRO A CG  
1195 C  CD  . PRO A 162 ? 0.3198 0.3370 0.3364 -0.0096 0.0108  -0.0002 153 PRO A CD  
1196 N  N   . LEU A 163 ? 0.3773 0.3679 0.3466 -0.0191 0.0000  -0.0117 154 LEU A N   
1197 C  CA  . LEU A 163 ? 0.4131 0.4100 0.4028 -0.0165 0.0035  -0.0223 154 LEU A CA  
1198 C  C   . LEU A 163 ? 0.4607 0.4411 0.4544 -0.0064 0.0030  -0.0120 154 LEU A C   
1199 O  O   . LEU A 163 ? 0.5011 0.4521 0.4759 -0.0218 0.0125  -0.0140 154 LEU A O   
1200 C  CB  . LEU A 163 ? 0.3943 0.3985 0.3952 -0.0227 -0.0069 -0.0301 154 LEU A CB  
1201 C  CG  . LEU A 163 ? 0.3807 0.4098 0.3843 -0.0102 -0.0133 -0.0171 154 LEU A CG  
1202 C  CD1 . LEU A 163 ? 0.4200 0.3899 0.3511 -0.0102 -0.0087 0.0067  154 LEU A CD1 
1203 C  CD2 . LEU A 163 ? 0.4313 0.4175 0.4448 0.0141  -0.0002 0.0043  154 LEU A CD2 
1204 N  N   . GLN A 164 ? 0.5125 0.5012 0.4935 0.0016  0.0017  0.0030  155 GLN A N   
1205 C  CA  . GLN A 164 ? 0.5200 0.5018 0.5070 -0.0009 0.0003  0.0036  155 GLN A CA  
1206 C  C   . GLN A 164 ? 0.5308 0.5100 0.5128 -0.0031 0.0058  0.0074  155 GLN A C   
1207 O  O   . GLN A 164 ? 0.5584 0.5020 0.5193 -0.0115 -0.0015 0.0030  155 GLN A O   
1208 C  CB  . GLN A 164 ? 0.5192 0.5177 0.5133 0.0041  -0.0050 0.0073  155 GLN A CB  
1209 C  CG  . GLN A 164 ? 0.5524 0.5384 0.5199 0.0096  0.0011  0.0051  155 GLN A CG  
1210 C  CD  . GLN A 164 ? 0.5749 0.5724 0.5688 0.0127  -0.0099 0.0068  155 GLN A CD  
1211 O  OE1 . GLN A 164 ? 0.6790 0.6929 0.6283 0.0063  -0.0052 0.0297  155 GLN A OE1 
1212 N  NE2 . GLN A 164 ? 0.6218 0.6552 0.6059 -0.0101 0.0291  0.0007  155 GLN A NE2 
1213 N  N   . GLU A 165 ? 0.5300 0.5009 0.5091 0.0037  0.0058  0.0137  156 GLU A N   
1214 C  CA  . GLU A 165 ? 0.5225 0.5180 0.5230 -0.0005 -0.0001 0.0025  156 GLU A CA  
1215 C  C   . GLU A 165 ? 0.5250 0.5281 0.5222 0.0000  0.0012  0.0094  156 GLU A C   
1216 O  O   . GLU A 165 ? 0.5324 0.5530 0.5463 -0.0058 0.0039  0.0111  156 GLU A O   
1217 C  CB  . GLU A 165 ? 0.5374 0.5330 0.5353 -0.0037 0.0039  0.0006  156 GLU A CB  
1218 C  CG  . GLU A 165 ? 0.5296 0.5392 0.5323 0.0015  -0.0091 -0.0013 156 GLU A CG  
1219 C  CD  . GLU A 165 ? 0.5657 0.5469 0.5490 0.0094  -0.0002 -0.0065 156 GLU A CD  
1220 O  OE1 . GLU A 165 ? 0.6240 0.6512 0.6545 -0.0078 -0.0177 -0.0006 156 GLU A OE1 
1221 O  OE2 . GLU A 165 ? 0.5597 0.6099 0.5646 -0.0266 0.0082  -0.0200 156 GLU A OE2 
1222 N  N   . GLY A 166 ? 0.5125 0.5107 0.5153 -0.0037 0.0028  0.0001  157 GLY A N   
1223 C  CA  . GLY A 166 ? 0.4914 0.4876 0.4975 -0.0080 0.0006  -0.0017 157 GLY A CA  
1224 C  C   . GLY A 166 ? 0.4793 0.4941 0.5024 -0.0080 -0.0065 -0.0098 157 GLY A C   
1225 O  O   . GLY A 166 ? 0.4922 0.5342 0.5287 -0.0197 -0.0190 -0.0133 157 GLY A O   
1226 N  N   . LYS A 167 ? 0.4409 0.4756 0.4566 -0.0093 -0.0026 0.0000  158 LYS A N   
1227 C  CA  . LYS A 167 ? 0.4229 0.4477 0.4322 -0.0119 0.0068  -0.0001 158 LYS A CA  
1228 C  C   . LYS A 167 ? 0.4064 0.4134 0.4053 -0.0131 -0.0028 -0.0045 158 LYS A C   
1229 O  O   . LYS A 167 ? 0.3984 0.4442 0.4029 -0.0328 0.0130  0.0135  158 LYS A O   
1230 C  CB  . LYS A 167 ? 0.4104 0.4501 0.4509 -0.0017 0.0084  -0.0011 158 LYS A CB  
1231 C  CG  . LYS A 167 ? 0.4679 0.4653 0.4410 -0.0077 -0.0001 0.0188  158 LYS A CG  
1232 C  CD  . LYS A 167 ? 0.4710 0.4352 0.4520 -0.0081 0.0115  0.0047  158 LYS A CD  
1233 C  CE  . LYS A 167 ? 0.5490 0.5447 0.4683 0.0006  0.0088  0.0127  158 LYS A CE  
1234 N  NZ  . LYS A 167 ? 0.5431 0.5604 0.5035 -0.0227 -0.0071 -0.0183 158 LYS A NZ  
1235 N  N   . ILE A 168 ? 0.3792 0.4088 0.3825 -0.0075 -0.0003 0.0000  159 ILE A N   
1236 C  CA  . ILE A 168 ? 0.3845 0.3991 0.3954 -0.0091 0.0043  -0.0045 159 ILE A CA  
1237 C  C   . ILE A 168 ? 0.3530 0.3735 0.3592 -0.0048 -0.0055 -0.0050 159 ILE A C   
1238 O  O   . ILE A 168 ? 0.2871 0.3368 0.3336 -0.0253 -0.0163 -0.0120 159 ILE A O   
1239 C  CB  . ILE A 168 ? 0.3810 0.4037 0.4015 -0.0115 0.0101  0.0003  159 ILE A CB  
1240 C  CG1 . ILE A 168 ? 0.4168 0.4159 0.4354 0.0060  -0.0125 0.0043  159 ILE A CG1 
1241 C  CG2 . ILE A 168 ? 0.4041 0.4285 0.3603 -0.0035 -0.0040 -0.0080 159 ILE A CG2 
1242 C  CD1 . ILE A 168 ? 0.4253 0.4309 0.4219 -0.0163 -0.0025 -0.0109 159 ILE A CD1 
1243 N  N   . PRO A 169 ? 0.3566 0.3733 0.3509 -0.0038 0.0074  -0.0099 160 PRO A N   
1244 C  CA  . PRO A 169 ? 0.3461 0.3701 0.3346 -0.0062 0.0020  -0.0026 160 PRO A CA  
1245 C  C   . PRO A 169 ? 0.3305 0.3679 0.3315 -0.0075 0.0032  -0.0098 160 PRO A C   
1246 O  O   . PRO A 169 ? 0.3339 0.4049 0.3010 -0.0125 -0.0008 -0.0053 160 PRO A O   
1247 C  CB  . PRO A 169 ? 0.3427 0.3680 0.3326 0.0069  0.0138  -0.0037 160 PRO A CB  
1248 C  CG  . PRO A 169 ? 0.3431 0.3738 0.3722 -0.0010 0.0069  -0.0021 160 PRO A CG  
1249 C  CD  . PRO A 169 ? 0.3600 0.3871 0.3281 -0.0009 0.0043  -0.0030 160 PRO A CD  
1250 N  N   . LEU A 170 ? 0.3195 0.3267 0.2904 -0.0228 -0.0046 -0.0058 161 LEU A N   
1251 C  CA  . LEU A 170 ? 0.3339 0.3466 0.3112 -0.0103 -0.0130 -0.0108 161 LEU A CA  
1252 C  C   . LEU A 170 ? 0.3372 0.3374 0.2931 -0.0140 -0.0142 0.0039  161 LEU A C   
1253 O  O   . LEU A 170 ? 0.3560 0.3626 0.2715 -0.0211 -0.0289 0.0160  161 LEU A O   
1254 C  CB  . LEU A 170 ? 0.3210 0.3409 0.2902 -0.0086 -0.0250 -0.0065 161 LEU A CB  
1255 C  CG  . LEU A 170 ? 0.3553 0.3725 0.3473 -0.0073 -0.0041 -0.0087 161 LEU A CG  
1256 C  CD1 . LEU A 170 ? 0.3611 0.4148 0.3793 -0.0133 -0.0216 -0.0226 161 LEU A CD1 
1257 C  CD2 . LEU A 170 ? 0.3114 0.4036 0.3627 0.0019  0.0083  -0.0155 161 LEU A CD2 
1258 N  N   . LEU A 171 ? 0.3348 0.3239 0.2792 -0.0011 -0.0236 0.0113  162 LEU A N   
1259 C  CA  . LEU A 171 ? 0.3097 0.3272 0.2784 -0.0055 -0.0113 0.0124  162 LEU A CA  
1260 C  C   . LEU A 171 ? 0.3023 0.3220 0.2614 -0.0090 -0.0121 0.0120  162 LEU A C   
1261 O  O   . LEU A 171 ? 0.3150 0.3399 0.2497 -0.0114 -0.0146 0.0029  162 LEU A O   
1262 C  CB  . LEU A 171 ? 0.3138 0.3172 0.2248 -0.0020 -0.0118 0.0180  162 LEU A CB  
1263 C  CG  . LEU A 171 ? 0.3103 0.3178 0.2728 0.0009  -0.0102 0.0115  162 LEU A CG  
1264 C  CD1 . LEU A 171 ? 0.2886 0.3158 0.2876 -0.0116 -0.0211 0.0089  162 LEU A CD1 
1265 C  CD2 . LEU A 171 ? 0.3240 0.3481 0.3152 0.0101  -0.0146 0.0163  162 LEU A CD2 
1266 N  N   . VAL A 172 ? 0.2949 0.3195 0.2703 -0.0095 -0.0162 0.0129  163 VAL A N   
1267 C  CA  . VAL A 172 ? 0.2957 0.3130 0.2881 -0.0015 -0.0037 0.0008  163 VAL A CA  
1268 C  C   . VAL A 172 ? 0.2850 0.3193 0.2822 0.0008  -0.0030 0.0144  163 VAL A C   
1269 O  O   . VAL A 172 ? 0.2818 0.3624 0.2585 0.0000  0.0011  0.0297  163 VAL A O   
1270 C  CB  . VAL A 172 ? 0.2888 0.3244 0.3207 0.0048  -0.0004 0.0154  163 VAL A CB  
1271 C  CG1 . VAL A 172 ? 0.3076 0.3254 0.3140 0.0188  -0.0037 -0.0063 163 VAL A CG1 
1272 C  CG2 . VAL A 172 ? 0.3012 0.3211 0.3143 -0.0096 -0.0084 0.0032  163 VAL A CG2 
1273 N  N   . ILE A 173 ? 0.2738 0.2949 0.2431 -0.0018 0.0022  -0.0098 164 ILE A N   
1274 C  CA  . ILE A 173 ? 0.2883 0.2885 0.2782 0.0048  -0.0009 -0.0011 164 ILE A CA  
1275 C  C   . ILE A 173 ? 0.2855 0.2904 0.2750 -0.0070 -0.0034 -0.0006 164 ILE A C   
1276 O  O   . ILE A 173 ? 0.2469 0.2714 0.2900 -0.0205 -0.0032 0.0095  164 ILE A O   
1277 C  CB  . ILE A 173 ? 0.2852 0.3080 0.2664 -0.0045 0.0015  -0.0136 164 ILE A CB  
1278 C  CG1 . ILE A 173 ? 0.3178 0.3107 0.3273 0.0088  -0.0044 -0.0258 164 ILE A CG1 
1279 C  CG2 . ILE A 173 ? 0.3219 0.2851 0.2977 -0.0018 -0.0023 -0.0031 164 ILE A CG2 
1280 C  CD1 . ILE A 173 ? 0.3040 0.3086 0.3227 0.0047  0.0100  -0.0177 164 ILE A CD1 
1281 N  N   . ASP A 174 ? 0.2799 0.2978 0.2609 -0.0081 0.0010  0.0082  165 ASP A N   
1282 C  CA  . ASP A 174 ? 0.2852 0.2856 0.2724 -0.0005 -0.0044 0.0036  165 ASP A CA  
1283 C  C   . ASP A 174 ? 0.2706 0.2633 0.2420 0.0055  -0.0035 0.0034  165 ASP A C   
1284 O  O   . ASP A 174 ? 0.2575 0.2688 0.2093 0.0132  -0.0330 0.0098  165 ASP A O   
1285 C  CB  . ASP A 174 ? 0.2981 0.2938 0.2728 -0.0161 -0.0138 0.0142  165 ASP A CB  
1286 C  CG  . ASP A 174 ? 0.2739 0.3123 0.2521 0.0046  0.0079  0.0053  165 ASP A CG  
1287 O  OD1 . ASP A 174 ? 0.2459 0.2820 0.2342 -0.0123 -0.0280 -0.0097 165 ASP A OD1 
1288 O  OD2 . ASP A 174 ? 0.3106 0.3268 0.2167 -0.0362 0.0010  0.0752  165 ASP A OD2 
1289 N  N   . VAL A 175 ? 0.2830 0.2473 0.2687 0.0094  -0.0123 0.0146  166 VAL A N   
1290 C  CA  . VAL A 175 ? 0.2826 0.2536 0.2691 0.0014  -0.0046 0.0166  166 VAL A CA  
1291 C  C   . VAL A 175 ? 0.2706 0.2440 0.2573 -0.0090 -0.0027 0.0212  166 VAL A C   
1292 O  O   . VAL A 175 ? 0.3077 0.2537 0.2422 0.0014  -0.0054 0.0325  166 VAL A O   
1293 C  CB  . VAL A 175 ? 0.3207 0.2849 0.2920 -0.0001 -0.0041 -0.0068 166 VAL A CB  
1294 C  CG1 . VAL A 175 ? 0.3154 0.3385 0.2997 0.0101  0.0141  0.0055  166 VAL A CG1 
1295 C  CG2 . VAL A 175 ? 0.3437 0.3325 0.3091 -0.0206 -0.0064 0.0135  166 VAL A CG2 
1296 N  N   . TRP A 176 ? 0.2578 0.2258 0.2593 -0.0063 -0.0120 0.0124  167 TRP A N   
1297 C  CA  . TRP A 176 ? 0.2604 0.2376 0.2490 -0.0031 -0.0053 0.0241  167 TRP A CA  
1298 C  C   . TRP A 176 ? 0.2504 0.2277 0.2511 0.0076  -0.0091 0.0011  167 TRP A C   
1299 O  O   . TRP A 176 ? 0.2396 0.2407 0.2242 0.0107  -0.0075 0.0233  167 TRP A O   
1300 C  CB  . TRP A 176 ? 0.2452 0.2278 0.2319 -0.0084 -0.0050 0.0242  167 TRP A CB  
1301 C  CG  . TRP A 176 ? 0.2476 0.2465 0.2138 -0.0026 -0.0061 -0.0108 167 TRP A CG  
1302 C  CD1 . TRP A 176 ? 0.2561 0.2470 0.2388 -0.0036 -0.0165 -0.0033 167 TRP A CD1 
1303 C  CD2 . TRP A 176 ? 0.2661 0.2877 0.1839 -0.0026 -0.0044 -0.0222 167 TRP A CD2 
1304 N  NE1 . TRP A 176 ? 0.2614 0.2668 0.2139 -0.0023 0.0033  0.0036  167 TRP A NE1 
1305 C  CE2 . TRP A 176 ? 0.2596 0.2480 0.2081 0.0105  0.0052  -0.0302 167 TRP A CE2 
1306 C  CE3 . TRP A 176 ? 0.2553 0.2809 0.2663 0.0045  -0.0046 -0.0335 167 TRP A CE3 
1307 C  CZ2 . TRP A 176 ? 0.2822 0.2545 0.2279 0.0077  -0.0008 0.0284  167 TRP A CZ2 
1308 C  CZ3 . TRP A 176 ? 0.2632 0.2629 0.2673 0.0057  -0.0189 0.0093  167 TRP A CZ3 
1309 C  CH2 . TRP A 176 ? 0.2692 0.2556 0.2132 0.0052  -0.0208 0.0243  167 TRP A CH2 
1310 N  N   . GLU A 177 ? 0.2391 0.2242 0.2416 0.0281  -0.0161 0.0069  168 GLU A N   
1311 C  CA  . GLU A 177 ? 0.2475 0.2501 0.2443 0.0088  -0.0112 0.0059  168 GLU A CA  
1312 C  C   . GLU A 177 ? 0.2580 0.2452 0.2415 0.0008  -0.0123 -0.0012 168 GLU A C   
1313 O  O   . GLU A 177 ? 0.2640 0.2612 0.2247 0.0055  -0.0294 -0.0154 168 GLU A O   
1314 C  CB  . GLU A 177 ? 0.2364 0.2546 0.2516 0.0120  0.0049  0.0107  168 GLU A CB  
1315 C  CG  . GLU A 177 ? 0.2363 0.2331 0.2017 0.0070  -0.0174 -0.0302 168 GLU A CG  
1316 C  CD  . GLU A 177 ? 0.2556 0.2615 0.2451 0.0220  -0.0097 0.0171  168 GLU A CD  
1317 O  OE1 . GLU A 177 ? 0.2528 0.2708 0.2586 0.0129  -0.0219 0.0145  168 GLU A OE1 
1318 O  OE2 . GLU A 177 ? 0.2532 0.3229 0.2836 0.0236  -0.0531 0.0242  168 GLU A OE2 
1319 N  N   . HIS A 178 ? 0.2725 0.2397 0.2447 0.0000  0.0005  0.0006  169 HIS A N   
1320 C  CA  . HIS A 178 ? 0.2566 0.2447 0.2509 -0.0033 -0.0040 0.0082  169 HIS A CA  
1321 C  C   . HIS A 178 ? 0.2504 0.2548 0.2532 -0.0019 -0.0020 0.0157  169 HIS A C   
1322 O  O   . HIS A 178 ? 0.2615 0.2489 0.2663 -0.0012 0.0003  0.0249  169 HIS A O   
1323 C  CB  . HIS A 178 ? 0.2503 0.2668 0.2529 0.0025  0.0061  0.0034  169 HIS A CB  
1324 C  CG  . HIS A 178 ? 0.2688 0.2542 0.2815 -0.0050 -0.0123 -0.0023 169 HIS A CG  
1325 N  ND1 . HIS A 178 ? 0.2905 0.2977 0.2253 -0.0098 0.0103  0.0011  169 HIS A ND1 
1326 C  CD2 . HIS A 178 ? 0.2783 0.2822 0.2286 -0.0271 -0.0003 0.0144  169 HIS A CD2 
1327 C  CE1 . HIS A 178 ? 0.2514 0.2786 0.3190 -0.0394 -0.0101 0.0199  169 HIS A CE1 
1328 N  NE2 . HIS A 178 ? 0.3072 0.2261 0.2270 -0.0131 -0.0250 0.0178  169 HIS A NE2 
1329 N  N   . ALA A 179 ? 0.2602 0.2297 0.2162 -0.0063 0.0033  0.0053  170 ALA A N   
1330 C  CA  . ALA A 179 ? 0.2506 0.2474 0.2430 0.0026  -0.0021 0.0102  170 ALA A CA  
1331 C  C   . ALA A 179 ? 0.2519 0.2613 0.2579 0.0059  -0.0037 0.0076  170 ALA A C   
1332 O  O   . ALA A 179 ? 0.2574 0.2900 0.2933 0.0099  -0.0082 0.0311  170 ALA A O   
1333 C  CB  . ALA A 179 ? 0.2589 0.2472 0.2510 0.0071  0.0022  -0.0035 170 ALA A CB  
1334 N  N   . TYR A 180 ? 0.2698 0.2463 0.2275 0.0091  -0.0071 0.0182  171 TYR A N   
1335 C  CA  . TYR A 180 ? 0.2650 0.2471 0.2440 0.0073  -0.0100 0.0092  171 TYR A CA  
1336 C  C   . TYR A 180 ? 0.2662 0.2465 0.2624 0.0066  0.0007  0.0050  171 TYR A C   
1337 O  O   . TYR A 180 ? 0.2725 0.2396 0.3048 0.0125  -0.0157 -0.0257 171 TYR A O   
1338 C  CB  . TYR A 180 ? 0.2872 0.2329 0.2060 -0.0004 -0.0123 -0.0041 171 TYR A CB  
1339 C  CG  . TYR A 180 ? 0.3117 0.2488 0.2371 0.0050  -0.0194 0.0168  171 TYR A CG  
1340 C  CD1 . TYR A 180 ? 0.2797 0.2046 0.2467 0.0214  0.0014  0.0042  171 TYR A CD1 
1341 C  CD2 . TYR A 180 ? 0.2726 0.2330 0.1649 0.0164  0.0028  0.0311  171 TYR A CD2 
1342 C  CE1 . TYR A 180 ? 0.2891 0.2799 0.2331 0.0037  0.0101  0.0192  171 TYR A CE1 
1343 C  CE2 . TYR A 180 ? 0.2803 0.2307 0.2309 0.0425  -0.0082 0.0359  171 TYR A CE2 
1344 C  CZ  . TYR A 180 ? 0.2744 0.2292 0.2521 0.0406  0.0104  0.0148  171 TYR A CZ  
1345 O  OH  . TYR A 180 ? 0.2757 0.2785 0.2288 0.0466  0.0120  0.0141  171 TYR A OH  
1346 N  N   . TYR A 181 ? 0.2597 0.2382 0.2447 0.0219  -0.0099 0.0099  172 TYR A N   
1347 C  CA  . TYR A 181 ? 0.2638 0.2312 0.2668 0.0064  -0.0095 -0.0023 172 TYR A CA  
1348 C  C   . TYR A 181 ? 0.2832 0.2420 0.2747 0.0088  -0.0107 -0.0040 172 TYR A C   
1349 O  O   . TYR A 181 ? 0.2984 0.2827 0.2908 0.0178  -0.0403 -0.0137 172 TYR A O   
1350 C  CB  . TYR A 181 ? 0.2413 0.2285 0.2475 -0.0005 -0.0250 -0.0051 172 TYR A CB  
1351 C  CG  . TYR A 181 ? 0.2610 0.2391 0.2528 0.0153  -0.0077 -0.0086 172 TYR A CG  
1352 C  CD1 . TYR A 181 ? 0.2826 0.2408 0.2526 0.0106  -0.0146 0.0084  172 TYR A CD1 
1353 C  CD2 . TYR A 181 ? 0.2970 0.2599 0.2308 -0.0192 -0.0086 0.0081  172 TYR A CD2 
1354 C  CE1 . TYR A 181 ? 0.2455 0.2868 0.2367 -0.0030 -0.0349 0.0010  172 TYR A CE1 
1355 C  CE2 . TYR A 181 ? 0.2730 0.2626 0.2405 -0.0174 -0.0303 0.0074  172 TYR A CE2 
1356 C  CZ  . TYR A 181 ? 0.2515 0.2325 0.2356 -0.0046 -0.0330 0.0121  172 TYR A CZ  
1357 O  OH  . TYR A 181 ? 0.3330 0.2293 0.2555 0.0407  -0.0348 -0.0074 172 TYR A OH  
1358 N  N   . LEU A 182 ? 0.2963 0.2344 0.2796 0.0077  -0.0020 -0.0062 173 LEU A N   
1359 C  CA  . LEU A 182 ? 0.3093 0.2631 0.2908 -0.0009 -0.0004 -0.0048 173 LEU A CA  
1360 C  C   . LEU A 182 ? 0.3218 0.2729 0.3165 0.0037  -0.0101 0.0081  173 LEU A C   
1361 O  O   . LEU A 182 ? 0.3057 0.2520 0.3810 0.0264  -0.0333 0.0028  173 LEU A O   
1362 C  CB  . LEU A 182 ? 0.3135 0.2760 0.2965 -0.0017 0.0027  0.0089  173 LEU A CB  
1363 C  CG  . LEU A 182 ? 0.2946 0.2605 0.3069 -0.0044 -0.0050 0.0121  173 LEU A CG  
1364 C  CD1 . LEU A 182 ? 0.3065 0.2771 0.3085 0.0253  -0.0264 0.0088  173 LEU A CD1 
1365 C  CD2 . LEU A 182 ? 0.3253 0.2904 0.3148 0.0103  -0.0089 0.0175  173 LEU A CD2 
1366 N  N   . LYS A 183 ? 0.3280 0.2901 0.3140 0.0076  -0.0081 0.0022  174 LYS A N   
1367 C  CA  . LYS A 183 ? 0.3451 0.3117 0.3335 0.0083  -0.0051 -0.0038 174 LYS A CA  
1368 C  C   . LYS A 183 ? 0.3438 0.3062 0.3351 0.0108  0.0021  0.0009  174 LYS A C   
1369 O  O   . LYS A 183 ? 0.3962 0.2973 0.3091 0.0114  -0.0021 0.0081  174 LYS A O   
1370 C  CB  . LYS A 183 ? 0.3542 0.3079 0.3517 0.0072  -0.0084 -0.0040 174 LYS A CB  
1371 C  CG  . LYS A 183 ? 0.3641 0.3393 0.3618 0.0205  -0.0112 0.0056  174 LYS A CG  
1372 C  CD  . LYS A 183 ? 0.3871 0.3901 0.3897 0.0298  -0.0209 -0.0153 174 LYS A CD  
1373 C  CE  . LYS A 183 ? 0.4631 0.4349 0.4630 0.0340  -0.0243 0.0202  174 LYS A CE  
1374 N  NZ  . LYS A 183 ? 0.5187 0.4869 0.5347 -0.0098 0.0135  0.0138  174 LYS A NZ  
1375 N  N   . TYR A 184 ? 0.3364 0.2937 0.3328 0.0179  -0.0125 -0.0040 175 TYR A N   
1376 C  CA  . TYR A 184 ? 0.3166 0.2999 0.3137 0.0176  -0.0112 0.0037  175 TYR A CA  
1377 C  C   . TYR A 184 ? 0.3041 0.3036 0.2969 0.0111  -0.0138 -0.0070 175 TYR A C   
1378 O  O   . TYR A 184 ? 0.2960 0.2913 0.3124 0.0184  -0.0384 -0.0253 175 TYR A O   
1379 C  CB  . TYR A 184 ? 0.3455 0.2566 0.3274 0.0085  -0.0166 -0.0104 175 TYR A CB  
1380 C  CG  . TYR A 184 ? 0.3327 0.2664 0.3005 0.0235  -0.0171 -0.0270 175 TYR A CG  
1381 C  CD1 . TYR A 184 ? 0.3694 0.3196 0.3197 0.0312  0.0079  0.0048  175 TYR A CD1 
1382 C  CD2 . TYR A 184 ? 0.3088 0.3274 0.2703 0.0014  -0.0159 0.0027  175 TYR A CD2 
1383 C  CE1 . TYR A 184 ? 0.3297 0.3104 0.3417 0.0304  -0.0313 -0.0108 175 TYR A CE1 
1384 C  CE2 . TYR A 184 ? 0.2814 0.2586 0.3327 -0.0034 -0.0116 -0.0043 175 TYR A CE2 
1385 C  CZ  . TYR A 184 ? 0.3289 0.3152 0.3286 0.0277  -0.0109 0.0036  175 TYR A CZ  
1386 O  OH  . TYR A 184 ? 0.3307 0.3174 0.3740 0.0169  -0.0165 0.0428  175 TYR A OH  
1387 N  N   . GLN A 185 ? 0.3063 0.3033 0.2740 0.0075  -0.0165 -0.0103 176 GLN A N   
1388 C  CA  . GLN A 185 ? 0.3169 0.2988 0.2931 0.0062  -0.0140 -0.0066 176 GLN A CA  
1389 C  C   . GLN A 185 ? 0.2915 0.2922 0.2922 0.0170  -0.0179 -0.0094 176 GLN A C   
1390 O  O   . GLN A 185 ? 0.2683 0.3254 0.3218 0.0140  -0.0434 -0.0192 176 GLN A O   
1391 C  CB  . GLN A 185 ? 0.3138 0.2948 0.2823 -0.0013 -0.0230 -0.0058 176 GLN A CB  
1392 C  CG  . GLN A 185 ? 0.3747 0.4152 0.3552 -0.0153 -0.0011 -0.0257 176 GLN A CG  
1393 C  CD  . GLN A 185 ? 0.4968 0.4828 0.4961 0.0010  -0.0049 0.0195  176 GLN A CD  
1394 O  OE1 . GLN A 185 ? 0.5839 0.5701 0.5622 0.0005  0.0147  -0.0291 176 GLN A OE1 
1395 N  NE2 . GLN A 185 ? 0.5590 0.5421 0.5250 0.0108  0.0043  -0.0202 176 GLN A NE2 
1396 N  N   . ASN A 186 ? 0.3100 0.2958 0.2832 0.0165  -0.0229 -0.0061 177 ASN A N   
1397 C  CA  . ASN A 186 ? 0.3039 0.3242 0.2790 0.0030  -0.0108 -0.0175 177 ASN A CA  
1398 C  C   . ASN A 186 ? 0.3212 0.3328 0.2951 0.0001  -0.0013 -0.0156 177 ASN A C   
1399 O  O   . ASN A 186 ? 0.3297 0.3400 0.3033 -0.0170 -0.0116 -0.0256 177 ASN A O   
1400 C  CB  . ASN A 186 ? 0.2972 0.3597 0.2934 0.0003  -0.0172 -0.0014 177 ASN A CB  
1401 C  CG  . ASN A 186 ? 0.2915 0.3650 0.2511 -0.0384 -0.0433 -0.0292 177 ASN A CG  
1402 O  OD1 . ASN A 186 ? 0.3838 0.4976 0.4421 0.0197  0.0198  -0.0725 177 ASN A OD1 
1403 N  ND2 . ASN A 186 ? 0.3795 0.2831 0.3115 -0.0264 -0.0489 -0.0014 177 ASN A ND2 
1404 N  N   . ARG A 187 ? 0.2986 0.3228 0.2901 0.0071  -0.0018 -0.0291 178 ARG A N   
1405 C  CA  . ARG A 187 ? 0.3131 0.3191 0.3031 0.0015  -0.0175 -0.0157 178 ARG A CA  
1406 C  C   . ARG A 187 ? 0.2893 0.3066 0.3008 0.0047  -0.0165 -0.0068 178 ARG A C   
1407 O  O   . ARG A 187 ? 0.2968 0.2851 0.2579 0.0061  -0.0035 -0.0007 178 ARG A O   
1408 C  CB  . ARG A 187 ? 0.3201 0.3458 0.3272 0.0011  -0.0083 -0.0215 178 ARG A CB  
1409 C  CG  . ARG A 187 ? 0.3568 0.3202 0.3665 -0.0059 -0.0222 -0.0197 178 ARG A CG  
1410 C  CD  . ARG A 187 ? 0.4198 0.3622 0.4229 -0.0147 -0.0162 -0.0086 178 ARG A CD  
1411 N  NE  . ARG A 187 ? 0.5017 0.5334 0.4926 -0.0178 0.0110  -0.0029 178 ARG A NE  
1412 C  CZ  . ARG A 187 ? 0.5118 0.5378 0.5232 0.0059  0.0125  0.0061  178 ARG A CZ  
1413 N  NH1 . ARG A 187 ? 0.5329 0.6115 0.5811 0.0012  -0.0014 0.0101  178 ARG A NH1 
1414 N  NH2 . ARG A 187 ? 0.4693 0.4993 0.5151 0.0133  0.0177  -0.0083 178 ARG A NH2 
1415 N  N   . ARG A 188 ? 0.2744 0.3048 0.3033 0.0030  -0.0047 -0.0110 179 ARG A N   
1416 C  CA  . ARG A 188 ? 0.2904 0.3018 0.2906 0.0036  -0.0094 -0.0117 179 ARG A CA  
1417 C  C   . ARG A 188 ? 0.2915 0.3054 0.2874 0.0026  -0.0139 -0.0016 179 ARG A C   
1418 O  O   . ARG A 188 ? 0.2750 0.3202 0.2840 -0.0089 -0.0588 -0.0067 179 ARG A O   
1419 C  CB  . ARG A 188 ? 0.2921 0.2993 0.2818 0.0121  -0.0071 -0.0148 179 ARG A CB  
1420 C  CG  . ARG A 188 ? 0.2582 0.2890 0.2829 0.0042  -0.0136 0.0009  179 ARG A CG  
1421 C  CD  . ARG A 188 ? 0.2868 0.2838 0.2760 0.0105  -0.0054 -0.0092 179 ARG A CD  
1422 N  NE  . ARG A 188 ? 0.2847 0.2826 0.2654 -0.0007 -0.0166 0.0144  179 ARG A NE  
1423 C  CZ  . ARG A 188 ? 0.2984 0.2607 0.3117 -0.0013 -0.0140 -0.0083 179 ARG A CZ  
1424 N  NH1 . ARG A 188 ? 0.3122 0.3148 0.3082 0.0413  -0.0071 0.0244  179 ARG A NH1 
1425 N  NH2 . ARG A 188 ? 0.3293 0.2995 0.3321 0.0092  -0.0193 0.0040  179 ARG A NH2 
1426 N  N   . PRO A 189 ? 0.3062 0.3347 0.3081 0.0203  -0.0165 -0.0091 180 PRO A N   
1427 C  CA  . PRO A 189 ? 0.3108 0.3358 0.3179 0.0141  -0.0067 -0.0137 180 PRO A CA  
1428 C  C   . PRO A 189 ? 0.3169 0.3441 0.3147 0.0064  -0.0047 -0.0165 180 PRO A C   
1429 O  O   . PRO A 189 ? 0.3325 0.3696 0.3489 0.0233  -0.0206 -0.0066 180 PRO A O   
1430 C  CB  . PRO A 189 ? 0.3357 0.3556 0.3466 0.0124  0.0135  -0.0064 180 PRO A CB  
1431 C  CG  . PRO A 189 ? 0.3070 0.3817 0.3444 -0.0034 -0.0105 -0.0063 180 PRO A CG  
1432 C  CD  . PRO A 189 ? 0.3164 0.3428 0.3150 0.0234  0.0120  -0.0167 180 PRO A CD  
1433 N  N   . GLU A 190 ? 0.3251 0.3351 0.3252 0.0083  -0.0079 -0.0189 181 GLU A N   
1434 C  CA  . GLU A 190 ? 0.3226 0.3196 0.3234 0.0145  -0.0099 -0.0116 181 GLU A CA  
1435 C  C   . GLU A 190 ? 0.3213 0.3017 0.3180 0.0169  -0.0065 -0.0070 181 GLU A C   
1436 O  O   . GLU A 190 ? 0.3080 0.2548 0.3239 0.0217  -0.0176 -0.0181 181 GLU A O   
1437 C  CB  . GLU A 190 ? 0.3156 0.3233 0.3356 0.0212  0.0056  0.0029  181 GLU A CB  
1438 C  CG  . GLU A 190 ? 0.3297 0.3234 0.3451 0.0177  -0.0049 0.0008  181 GLU A CG  
1439 C  CD  . GLU A 190 ? 0.3871 0.3432 0.3782 -0.0025 -0.0167 -0.0100 181 GLU A CD  
1440 O  OE1 . GLU A 190 ? 0.4354 0.3799 0.4518 -0.0138 -0.0644 -0.0277 181 GLU A OE1 
1441 O  OE2 . GLU A 190 ? 0.5165 0.4341 0.4897 -0.0335 0.0107  0.0090  181 GLU A OE2 
1442 N  N   . PHE A 191 ? 0.2980 0.3005 0.3092 0.0193  -0.0079 -0.0071 182 PHE A N   
1443 C  CA  . PHE A 191 ? 0.3146 0.3045 0.3086 0.0152  -0.0099 -0.0038 182 PHE A CA  
1444 C  C   . PHE A 191 ? 0.3102 0.3051 0.3138 0.0146  -0.0053 -0.0038 182 PHE A C   
1445 O  O   . PHE A 191 ? 0.3362 0.3443 0.3133 0.0099  -0.0152 0.0066  182 PHE A O   
1446 C  CB  . PHE A 191 ? 0.2804 0.3043 0.3101 0.0130  -0.0121 -0.0022 182 PHE A CB  
1447 C  CG  . PHE A 191 ? 0.2552 0.2891 0.3070 0.0262  -0.0038 0.0033  182 PHE A CG  
1448 C  CD1 . PHE A 191 ? 0.2945 0.2938 0.2852 -0.0010 -0.0010 0.0038  182 PHE A CD1 
1449 C  CD2 . PHE A 191 ? 0.3034 0.3163 0.3272 0.0104  -0.0038 -0.0074 182 PHE A CD2 
1450 C  CE1 . PHE A 191 ? 0.3349 0.3054 0.3173 0.0048  -0.0031 0.0080  182 PHE A CE1 
1451 C  CE2 . PHE A 191 ? 0.3298 0.3062 0.3322 0.0055  -0.0100 -0.0150 182 PHE A CE2 
1452 C  CZ  . PHE A 191 ? 0.2862 0.3076 0.3439 0.0092  0.0125  -0.0154 182 PHE A CZ  
1453 N  N   . VAL A 192 ? 0.3096 0.2924 0.3184 0.0141  -0.0058 -0.0180 183 VAL A N   
1454 C  CA  . VAL A 192 ? 0.3203 0.3162 0.3264 0.0112  -0.0102 -0.0078 183 VAL A CA  
1455 C  C   . VAL A 192 ? 0.3292 0.3383 0.3454 0.0117  -0.0080 -0.0072 183 VAL A C   
1456 O  O   . VAL A 192 ? 0.3060 0.3580 0.3374 0.0238  -0.0249 0.0188  183 VAL A O   
1457 C  CB  . VAL A 192 ? 0.3202 0.3047 0.3607 0.0016  0.0126  -0.0166 183 VAL A CB  
1458 C  CG1 . VAL A 192 ? 0.3173 0.3360 0.3334 0.0052  -0.0169 -0.0104 183 VAL A CG1 
1459 C  CG2 . VAL A 192 ? 0.2745 0.3457 0.2710 -0.0007 -0.0184 0.0227  183 VAL A CG2 
1460 N  N   . THR A 193 ? 0.3507 0.3510 0.3578 0.0249  -0.0083 -0.0025 184 THR A N   
1461 C  CA  . THR A 193 ? 0.3463 0.3403 0.3455 0.0181  -0.0089 0.0016  184 THR A CA  
1462 C  C   . THR A 193 ? 0.3380 0.3400 0.3533 0.0179  -0.0088 0.0038  184 THR A C   
1463 O  O   . THR A 193 ? 0.3553 0.3647 0.3548 0.0537  -0.0245 0.0022  184 THR A O   
1464 C  CB  . THR A 193 ? 0.3440 0.3324 0.3558 0.0138  0.0027  0.0000  184 THR A CB  
1465 O  OG1 . THR A 193 ? 0.3439 0.3297 0.3357 0.0021  -0.0174 0.0130  184 THR A OG1 
1466 C  CG2 . THR A 193 ? 0.3889 0.3554 0.3755 0.0292  -0.0156 0.0087  184 THR A CG2 
1467 N  N   . ASN A 194 ? 0.3166 0.3207 0.3456 0.0032  -0.0158 0.0135  185 ASN A N   
1468 C  CA  . ASN A 194 ? 0.3367 0.3335 0.3456 0.0067  -0.0101 0.0008  185 ASN A CA  
1469 C  C   . ASN A 194 ? 0.3244 0.3405 0.3460 -0.0030 -0.0181 0.0043  185 ASN A C   
1470 O  O   . ASN A 194 ? 0.3344 0.3446 0.3507 -0.0003 -0.0163 0.0190  185 ASN A O   
1471 C  CB  . ASN A 194 ? 0.3383 0.3297 0.3228 -0.0074 -0.0148 0.0000  185 ASN A CB  
1472 C  CG  . ASN A 194 ? 0.3991 0.3496 0.3917 0.0108  -0.0120 -0.0125 185 ASN A CG  
1473 O  OD1 . ASN A 194 ? 0.5565 0.4108 0.4327 -0.0243 -0.0234 -0.0137 185 ASN A OD1 
1474 N  ND2 . ASN A 194 ? 0.3700 0.4136 0.4094 0.0040  -0.0115 -0.0082 185 ASN A ND2 
1475 N  N   . TRP A 195 ? 0.2987 0.3285 0.3166 -0.0092 -0.0277 -0.0002 186 TRP A N   
1476 C  CA  . TRP A 195 ? 0.3165 0.3278 0.3382 0.0035  -0.0138 0.0059  186 TRP A CA  
1477 C  C   . TRP A 195 ? 0.3012 0.3154 0.3203 -0.0057 -0.0156 0.0075  186 TRP A C   
1478 O  O   . TRP A 195 ? 0.2971 0.3076 0.3235 0.0000  -0.0240 0.0006  186 TRP A O   
1479 C  CB  . TRP A 195 ? 0.3160 0.3285 0.3241 0.0068  -0.0207 0.0070  186 TRP A CB  
1480 C  CG  . TRP A 195 ? 0.3042 0.3168 0.2827 0.0139  -0.0289 0.0104  186 TRP A CG  
1481 C  CD1 . TRP A 195 ? 0.3252 0.3115 0.3126 0.0052  -0.0101 0.0311  186 TRP A CD1 
1482 C  CD2 . TRP A 195 ? 0.3415 0.3429 0.3229 0.0024  -0.0046 0.0001  186 TRP A CD2 
1483 N  NE1 . TRP A 195 ? 0.3309 0.3278 0.3075 0.0000  0.0003  0.0041  186 TRP A NE1 
1484 C  CE2 . TRP A 195 ? 0.3205 0.3027 0.2951 0.0220  -0.0114 0.0142  186 TRP A CE2 
1485 C  CE3 . TRP A 195 ? 0.3188 0.3531 0.3011 -0.0072 -0.0123 0.0006  186 TRP A CE3 
1486 C  CZ2 . TRP A 195 ? 0.2932 0.3083 0.2614 0.0211  -0.0121 0.0094  186 TRP A CZ2 
1487 C  CZ3 . TRP A 195 ? 0.3080 0.3023 0.2911 0.0191  -0.0188 0.0208  186 TRP A CZ3 
1488 C  CH2 . TRP A 195 ? 0.3174 0.3479 0.3123 -0.0014 -0.0125 0.0044  186 TRP A CH2 
1489 N  N   . TRP A 196 ? 0.3315 0.3300 0.3245 -0.0024 -0.0118 0.0018  187 TRP A N   
1490 C  CA  . TRP A 196 ? 0.3243 0.3392 0.3293 0.0004  -0.0057 0.0154  187 TRP A CA  
1491 C  C   . TRP A 196 ? 0.3346 0.3490 0.3254 -0.0005 -0.0137 0.0169  187 TRP A C   
1492 O  O   . TRP A 196 ? 0.3597 0.3606 0.3457 -0.0141 -0.0337 0.0088  187 TRP A O   
1493 C  CB  . TRP A 196 ? 0.3234 0.2803 0.3271 -0.0166 -0.0005 0.0074  187 TRP A CB  
1494 C  CG  . TRP A 196 ? 0.2936 0.2843 0.3086 -0.0428 -0.0132 -0.0037 187 TRP A CG  
1495 C  CD1 . TRP A 196 ? 0.3195 0.3249 0.3077 -0.0052 -0.0110 -0.0070 187 TRP A CD1 
1496 C  CD2 . TRP A 196 ? 0.3368 0.3263 0.2895 0.0153  -0.0140 0.0070  187 TRP A CD2 
1497 N  NE1 . TRP A 196 ? 0.2857 0.3060 0.2952 -0.0215 -0.0084 -0.0248 187 TRP A NE1 
1498 C  CE2 . TRP A 196 ? 0.3157 0.3430 0.3243 0.0051  0.0079  0.0090  187 TRP A CE2 
1499 C  CE3 . TRP A 196 ? 0.3528 0.2843 0.3398 0.0251  0.0220  -0.0040 187 TRP A CE3 
1500 C  CZ2 . TRP A 196 ? 0.3267 0.3130 0.3467 0.0271  -0.0151 -0.0081 187 TRP A CZ2 
1501 C  CZ3 . TRP A 196 ? 0.3649 0.3796 0.3384 0.0114  0.0110  0.0116  187 TRP A CZ3 
1502 C  CH2 . TRP A 196 ? 0.3538 0.3588 0.3314 0.0305  0.0075  0.0250  187 TRP A CH2 
1503 N  N   . HIS A 197 ? 0.3367 0.3278 0.3172 0.0092  -0.0252 0.0121  188 HIS A N   
1504 C  CA  . HIS A 197 ? 0.3380 0.3387 0.3246 0.0014  -0.0010 0.0164  188 HIS A CA  
1505 C  C   . HIS A 197 ? 0.3582 0.3329 0.3259 0.0109  -0.0093 0.0224  188 HIS A C   
1506 O  O   . HIS A 197 ? 0.3744 0.3323 0.3119 0.0318  0.0031  0.0571  188 HIS A O   
1507 C  CB  . HIS A 197 ? 0.3581 0.3523 0.3485 -0.0010 0.0059  0.0101  188 HIS A CB  
1508 C  CG  . HIS A 197 ? 0.3941 0.3781 0.3777 0.0027  0.0007  -0.0146 188 HIS A CG  
1509 N  ND1 . HIS A 197 ? 0.4283 0.3820 0.3246 0.0419  -0.0161 -0.0021 188 HIS A ND1 
1510 C  CD2 . HIS A 197 ? 0.4347 0.4555 0.4335 0.0245  -0.0064 -0.0114 188 HIS A CD2 
1511 C  CE1 . HIS A 197 ? 0.4186 0.4398 0.4010 0.0049  0.0099  -0.0186 188 HIS A CE1 
1512 N  NE2 . HIS A 197 ? 0.4673 0.4890 0.4455 0.0323  -0.0084 -0.0116 188 HIS A NE2 
1513 N  N   . THR A 198 ? 0.3231 0.3255 0.3054 0.0143  -0.0130 0.0254  189 THR A N   
1514 C  CA  . THR A 198 ? 0.3227 0.3311 0.3133 0.0110  -0.0132 0.0263  189 THR A CA  
1515 C  C   . THR A 198 ? 0.3151 0.3221 0.2838 0.0239  -0.0106 0.0197  189 THR A C   
1516 O  O   . THR A 198 ? 0.3384 0.3298 0.2518 0.0011  -0.0112 0.0261  189 THR A O   
1517 C  CB  . THR A 198 ? 0.3237 0.3441 0.3533 0.0229  -0.0010 0.0187  189 THR A CB  
1518 O  OG1 . THR A 198 ? 0.3712 0.4816 0.4426 0.0242  0.0133  0.0475  189 THR A OG1 
1519 C  CG2 . THR A 198 ? 0.2397 0.2918 0.2588 0.0489  -0.0233 -0.0158 189 THR A CG2 
1520 N  N   . VAL A 199 ? 0.3313 0.3233 0.3056 0.0139  -0.0068 0.0080  190 VAL A N   
1521 C  CA  . VAL A 199 ? 0.3305 0.3457 0.3117 0.0143  -0.0129 0.0106  190 VAL A CA  
1522 C  C   . VAL A 199 ? 0.3371 0.3534 0.3043 0.0165  -0.0209 0.0069  190 VAL A C   
1523 O  O   . VAL A 199 ? 0.3430 0.3508 0.2846 0.0217  -0.0374 0.0216  190 VAL A O   
1524 C  CB  . VAL A 199 ? 0.3365 0.3515 0.3295 0.0011  -0.0175 0.0100  190 VAL A CB  
1525 C  CG1 . VAL A 199 ? 0.3648 0.3773 0.3503 0.0067  -0.0086 -0.0041 190 VAL A CG1 
1526 C  CG2 . VAL A 199 ? 0.3660 0.3492 0.2716 0.0010  0.0061  0.0361  190 VAL A CG2 
1527 N  N   . ASN A 200 ? 0.3311 0.3385 0.3162 0.0090  -0.0228 0.0080  191 ASN A N   
1528 C  CA  . ASN A 200 ? 0.3488 0.3653 0.3191 0.0043  -0.0106 0.0062  191 ASN A CA  
1529 C  C   . ASN A 200 ? 0.3587 0.3722 0.3293 0.0054  -0.0134 -0.0017 191 ASN A C   
1530 O  O   . ASN A 200 ? 0.3451 0.3740 0.2940 0.0182  -0.0273 0.0046  191 ASN A O   
1531 C  CB  . ASN A 200 ? 0.3613 0.3685 0.3303 0.0092  -0.0161 0.0096  191 ASN A CB  
1532 C  CG  . ASN A 200 ? 0.3558 0.3773 0.3308 0.0033  -0.0129 0.0016  191 ASN A CG  
1533 O  OD1 . ASN A 200 ? 0.3444 0.4168 0.3280 0.0328  -0.0261 0.0503  191 ASN A OD1 
1534 N  ND2 . ASN A 200 ? 0.3896 0.4024 0.3749 0.0008  0.0152  0.0052  191 ASN A ND2 
1535 N  N   . TRP A 201 ? 0.3685 0.3869 0.3736 0.0072  -0.0062 0.0155  192 TRP A N   
1536 C  CA  . TRP A 201 ? 0.3729 0.3917 0.3818 0.0037  -0.0010 0.0097  192 TRP A CA  
1537 C  C   . TRP A 201 ? 0.3867 0.4077 0.3955 0.0002  -0.0033 0.0074  192 TRP A C   
1538 O  O   . TRP A 201 ? 0.4167 0.4300 0.4184 -0.0099 0.0012  0.0111  192 TRP A O   
1539 C  CB  . TRP A 201 ? 0.3669 0.3998 0.3861 0.0042  0.0074  0.0082  192 TRP A CB  
1540 C  CG  . TRP A 201 ? 0.3107 0.3721 0.3596 0.0230  -0.0002 -0.0027 192 TRP A CG  
1541 C  CD1 . TRP A 201 ? 0.3803 0.3893 0.3877 0.0122  0.0000  0.0185  192 TRP A CD1 
1542 C  CD2 . TRP A 201 ? 0.3758 0.3800 0.4029 -0.0007 -0.0074 -0.0052 192 TRP A CD2 
1543 N  NE1 . TRP A 201 ? 0.3790 0.3906 0.3968 -0.0030 0.0164  -0.0185 192 TRP A NE1 
1544 C  CE2 . TRP A 201 ? 0.3463 0.3919 0.3488 0.0301  0.0066  0.0046  192 TRP A CE2 
1545 C  CE3 . TRP A 201 ? 0.3674 0.3883 0.3769 0.0101  -0.0119 0.0138  192 TRP A CE3 
1546 C  CZ2 . TRP A 201 ? 0.3710 0.4125 0.3831 -0.0056 0.0087  -0.0005 192 TRP A CZ2 
1547 C  CZ3 . TRP A 201 ? 0.3718 0.3989 0.3659 -0.0061 0.0118  0.0052  192 TRP A CZ3 
1548 C  CH2 . TRP A 201 ? 0.3808 0.3791 0.3738 0.0139  0.0084  0.0058  192 TRP A CH2 
1549 N  N   . ASP A 202 ? 0.4004 0.4161 0.4044 -0.0142 0.0029  0.0058  193 ASP A N   
1550 C  CA  . ASP A 202 ? 0.3990 0.4195 0.3937 -0.0030 -0.0003 0.0040  193 ASP A CA  
1551 C  C   . ASP A 202 ? 0.4015 0.4139 0.3875 -0.0065 -0.0051 0.0021  193 ASP A C   
1552 O  O   . ASP A 202 ? 0.3808 0.4543 0.3860 -0.0296 -0.0151 0.0237  193 ASP A O   
1553 C  CB  . ASP A 202 ? 0.4181 0.4360 0.4145 -0.0103 -0.0020 0.0069  193 ASP A CB  
1554 C  CG  . ASP A 202 ? 0.4923 0.5022 0.5091 0.0207  -0.0127 0.0143  193 ASP A CG  
1555 O  OD1 . ASP A 202 ? 0.5083 0.5222 0.4438 0.0028  0.0036  0.0367  193 ASP A OD1 
1556 O  OD2 . ASP A 202 ? 0.5720 0.6100 0.5769 -0.0177 0.0066  0.0191  193 ASP A OD2 
1557 N  N   . ARG A 203 ? 0.3971 0.4064 0.3592 -0.0036 -0.0028 -0.0063 194 ARG A N   
1558 C  CA  . ARG A 203 ? 0.3908 0.4015 0.3630 -0.0022 -0.0028 0.0014  194 ARG A CA  
1559 C  C   . ARG A 203 ? 0.3807 0.3902 0.3692 -0.0005 -0.0034 -0.0032 194 ARG A C   
1560 O  O   . ARG A 203 ? 0.3852 0.3992 0.3740 0.0024  -0.0051 -0.0179 194 ARG A O   
1561 C  CB  . ARG A 203 ? 0.3973 0.3999 0.3531 -0.0047 0.0113  0.0016  194 ARG A CB  
1562 C  CG  . ARG A 203 ? 0.4084 0.4161 0.3889 0.0056  -0.0031 -0.0035 194 ARG A CG  
1563 C  CD  . ARG A 203 ? 0.5168 0.5031 0.4649 0.0224  0.0061  -0.0050 194 ARG A CD  
1564 N  NE  . ARG A 203 ? 0.4845 0.5039 0.4857 -0.0088 0.0041  -0.0048 194 ARG A NE  
1565 C  CZ  . ARG A 203 ? 0.5258 0.5575 0.5192 -0.0100 0.0108  -0.0052 194 ARG A CZ  
1566 N  NH1 . ARG A 203 ? 0.5488 0.5340 0.5608 -0.0180 0.0183  -0.0173 194 ARG A NH1 
1567 N  NH2 . ARG A 203 ? 0.5437 0.5453 0.5120 -0.0063 0.0041  -0.0024 194 ARG A NH2 
1568 N  N   . VAL A 204 ? 0.3752 0.3930 0.3716 0.0022  -0.0007 -0.0022 195 VAL A N   
1569 C  CA  . VAL A 204 ? 0.3825 0.4023 0.3749 -0.0040 -0.0005 0.0040  195 VAL A CA  
1570 C  C   . VAL A 204 ? 0.3827 0.3987 0.3702 -0.0014 0.0014  -0.0087 195 VAL A C   
1571 O  O   . VAL A 204 ? 0.3406 0.4053 0.3211 -0.0088 -0.0033 -0.0014 195 VAL A O   
1572 C  CB  . VAL A 204 ? 0.3674 0.3804 0.3751 -0.0067 0.0026  0.0038  195 VAL A CB  
1573 C  CG1 . VAL A 204 ? 0.3487 0.3797 0.3505 -0.0089 -0.0167 -0.0092 195 VAL A CG1 
1574 C  CG2 . VAL A 204 ? 0.4034 0.4327 0.3564 0.0057  -0.0041 0.0011  195 VAL A CG2 
1575 N  N   . ASN A 205 ? 0.4178 0.4346 0.3923 -0.0013 -0.0111 -0.0057 196 ASN A N   
1576 C  CA  . ASN A 205 ? 0.4235 0.4510 0.4257 -0.0039 -0.0002 0.0045  196 ASN A CA  
1577 C  C   . ASN A 205 ? 0.4566 0.4773 0.4315 -0.0168 -0.0048 -0.0022 196 ASN A C   
1578 O  O   . ASN A 205 ? 0.4982 0.5076 0.4549 -0.0313 0.0105  0.0120  196 ASN A O   
1579 C  CB  . ASN A 205 ? 0.4355 0.4591 0.4261 -0.0052 -0.0153 0.0101  196 ASN A CB  
1580 C  CG  . ASN A 205 ? 0.4471 0.4886 0.4804 0.0028  -0.0099 0.0081  196 ASN A CG  
1581 O  OD1 . ASN A 205 ? 0.6226 0.6245 0.5363 -0.0096 -0.0106 0.0030  196 ASN A OD1 
1582 N  ND2 . ASN A 205 ? 0.5143 0.5574 0.4963 0.0091  0.0062  0.0193  196 ASN A ND2 
1583 N  N   . GLU A 206 ? 0.4531 0.4815 0.4547 -0.0088 0.0046  -0.0026 197 GLU A N   
1584 C  CA  . GLU A 206 ? 0.4662 0.4786 0.4565 -0.0022 0.0038  -0.0024 197 GLU A CA  
1585 C  C   . GLU A 206 ? 0.4438 0.4636 0.4334 -0.0025 0.0026  -0.0028 197 GLU A C   
1586 O  O   . GLU A 206 ? 0.4361 0.4760 0.3991 0.0000  0.0039  -0.0167 197 GLU A O   
1587 C  CB  . GLU A 206 ? 0.4799 0.4917 0.4773 -0.0031 0.0061  -0.0019 197 GLU A CB  
1588 C  CG  . GLU A 206 ? 0.5242 0.5204 0.4864 0.0101  0.0129  0.0104  197 GLU A CG  
1589 C  CD  . GLU A 206 ? 0.5173 0.5342 0.5221 -0.0111 0.0093  0.0104  197 GLU A CD  
1590 O  OE1 . GLU A 206 ? 0.6735 0.5707 0.6491 -0.0132 0.0210  0.0219  197 GLU A OE1 
1591 O  OE2 . GLU A 206 ? 0.5733 0.6008 0.5834 0.0129  0.0468  -0.0054 197 GLU A OE2 
1592 N  N   . LYS A 207 ? 0.4520 0.4668 0.4387 -0.0066 0.0059  -0.0029 198 LYS A N   
1593 C  CA  . LYS A 207 ? 0.4580 0.4645 0.4431 -0.0013 -0.0055 -0.0081 198 LYS A CA  
1594 C  C   . LYS A 207 ? 0.4453 0.4459 0.4131 -0.0054 -0.0170 -0.0104 198 LYS A C   
1595 O  O   . LYS A 207 ? 0.4157 0.4352 0.3664 -0.0189 -0.0413 -0.0328 198 LYS A O   
1596 C  CB  . LYS A 207 ? 0.4736 0.4822 0.4431 -0.0003 -0.0084 -0.0060 198 LYS A CB  
1597 C  CG  . LYS A 207 ? 0.4827 0.5053 0.4719 -0.0027 -0.0057 -0.0055 198 LYS A CG  
1598 C  CD  . LYS A 207 ? 0.5043 0.5075 0.4926 0.0021  -0.0016 0.0027  198 LYS A CD  
1599 C  CE  . LYS A 207 ? 0.4878 0.5236 0.5076 0.0016  0.0000  0.0001  198 LYS A CE  
1600 N  NZ  . LYS A 207 ? 0.5149 0.5292 0.5425 0.0004  0.0118  -0.0151 198 LYS A NZ  
1601 N  N   . TYR A 208 ? 0.4441 0.4559 0.4168 -0.0053 -0.0199 -0.0080 199 TYR A N   
1602 C  CA  . TYR A 208 ? 0.4577 0.4661 0.4500 -0.0092 -0.0082 -0.0042 199 TYR A CA  
1603 C  C   . TYR A 208 ? 0.4765 0.4782 0.4649 -0.0156 -0.0073 -0.0046 199 TYR A C   
1604 O  O   . TYR A 208 ? 0.4774 0.4576 0.4611 -0.0198 -0.0088 -0.0119 199 TYR A O   
1605 C  CB  . TYR A 208 ? 0.4439 0.4634 0.4383 -0.0167 -0.0101 -0.0069 199 TYR A CB  
1606 C  CG  . TYR A 208 ? 0.4437 0.4566 0.4287 -0.0083 -0.0095 -0.0084 199 TYR A CG  
1607 C  CD1 . TYR A 208 ? 0.4048 0.4131 0.4176 -0.0153 -0.0081 -0.0113 199 TYR A CD1 
1608 C  CD2 . TYR A 208 ? 0.4441 0.4807 0.4583 0.0068  0.0056  -0.0082 199 TYR A CD2 
1609 C  CE1 . TYR A 208 ? 0.4340 0.4552 0.4353 0.0132  0.0042  -0.0038 199 TYR A CE1 
1610 C  CE2 . TYR A 208 ? 0.4473 0.4637 0.4557 -0.0156 -0.0140 -0.0027 199 TYR A CE2 
1611 C  CZ  . TYR A 208 ? 0.4508 0.4830 0.4683 -0.0101 -0.0084 -0.0020 199 TYR A CZ  
1612 O  OH  . TYR A 208 ? 0.4401 0.4774 0.4989 -0.0148 0.0045  -0.0086 199 TYR A OH  
1613 N  N   . LEU A 209 ? 0.4959 0.5081 0.4700 -0.0163 -0.0094 -0.0009 200 LEU A N   
1614 C  CA  . LEU A 209 ? 0.5193 0.5311 0.5039 -0.0186 -0.0120 -0.0065 200 LEU A CA  
1615 C  C   . LEU A 209 ? 0.5498 0.5503 0.5179 -0.0125 -0.0067 -0.0049 200 LEU A C   
1616 O  O   . LEU A 209 ? 0.5850 0.5709 0.5150 -0.0228 -0.0072 -0.0100 200 LEU A O   
1617 C  CB  . LEU A 209 ? 0.5160 0.5331 0.5063 -0.0170 -0.0091 -0.0030 200 LEU A CB  
1618 C  CG  . LEU A 209 ? 0.5445 0.5610 0.5604 -0.0029 -0.0039 0.0000  200 LEU A CG  
1619 C  CD1 . LEU A 209 ? 0.5703 0.6073 0.5603 -0.0071 0.0022  0.0022  200 LEU A CD1 
1620 C  CD2 . LEU A 209 ? 0.5411 0.5605 0.5629 -0.0169 -0.0040 -0.0061 200 LEU A CD2 
1621 N  N   . GLN A 210 ? 0.5633 0.5655 0.5446 -0.0077 -0.0072 -0.0059 201 GLN A N   
1622 C  CA  . GLN A 210 ? 0.5770 0.5780 0.5674 -0.0036 -0.0056 -0.0069 201 GLN A CA  
1623 C  C   . GLN A 210 ? 0.5927 0.5844 0.5806 -0.0084 -0.0036 -0.0084 201 GLN A C   
1624 O  O   . GLN A 210 ? 0.6117 0.5909 0.5755 -0.0141 -0.0149 -0.0166 201 GLN A O   
1625 C  CB  . GLN A 210 ? 0.5807 0.5789 0.5793 -0.0048 -0.0016 -0.0092 201 GLN A CB  
1626 C  CG  . GLN A 210 ? 0.5789 0.5903 0.5799 -0.0024 -0.0048 -0.0060 201 GLN A CG  
1627 C  CD  . GLN A 210 ? 0.6045 0.6493 0.6418 -0.0057 0.0042  -0.0012 201 GLN A CD  
1628 O  OE1 . GLN A 210 ? 0.7238 0.7412 0.7022 -0.0190 -0.0027 -0.0315 201 GLN A OE1 
1629 N  NE2 . GLN A 210 ? 0.7088 0.7232 0.6772 -0.0018 0.0190  -0.0113 201 GLN A NE2 
1630 N  N   . ALA A 211 ? 0.5834 0.5800 0.5684 -0.0086 0.0014  -0.0124 202 ALA A N   
1631 C  CA  . ALA A 211 ? 0.5887 0.5854 0.5816 -0.0034 -0.0007 -0.0033 202 ALA A CA  
1632 C  C   . ALA A 211 ? 0.5873 0.5940 0.5866 -0.0052 -0.0023 -0.0028 202 ALA A C   
1633 O  O   . ALA A 211 ? 0.5683 0.5871 0.5800 -0.0033 -0.0059 -0.0031 202 ALA A O   
1634 C  CB  . ALA A 211 ? 0.5833 0.5845 0.5808 -0.0051 0.0048  -0.0014 202 ALA A CB  
1635 N  N   . ILE A 212 ? 0.5992 0.6080 0.6023 -0.0022 0.0008  -0.0021 203 ILE A N   
1636 C  CA  . ILE A 212 ? 0.6123 0.6250 0.6226 -0.0027 -0.0008 -0.0042 203 ILE A CA  
1637 C  C   . ILE A 212 ? 0.6368 0.6343 0.6388 0.0000  -0.0075 -0.0103 203 ILE A C   
1638 O  O   . ILE A 212 ? 0.6579 0.6430 0.6705 0.0004  -0.0097 -0.0139 203 ILE A O   
1639 C  CB  . ILE A 212 ? 0.6177 0.6249 0.6279 0.0035  -0.0012 -0.0010 203 ILE A CB  
1640 C  CG1 . ILE A 212 ? 0.6316 0.6498 0.6426 0.0006  0.0000  0.0080  203 ILE A CG1 
1641 C  CG2 . ILE A 212 ? 0.6230 0.6268 0.6291 -0.0033 0.0000  -0.0024 203 ILE A CG2 
1642 C  CD1 . ILE A 212 ? 0.6300 0.6475 0.6602 0.0057  0.0066  -0.0025 203 ILE A CD1 
1643 N  N   . SER B 12  ? 0.5336 0.5166 0.5067 -0.0003 0.0057  -0.0035 3   SER B N   
1644 C  CA  . SER B 12  ? 0.4976 0.5057 0.4828 -0.0011 0.0042  -0.0104 3   SER B CA  
1645 C  C   . SER B 12  ? 0.4795 0.4850 0.4587 -0.0009 -0.0045 -0.0117 3   SER B C   
1646 O  O   . SER B 12  ? 0.4654 0.4870 0.4401 -0.0046 -0.0066 -0.0226 3   SER B O   
1647 C  CB  . SER B 12  ? 0.5194 0.5262 0.5067 -0.0064 -0.0029 -0.0187 3   SER B CB  
1648 O  OG  . SER B 12  ? 0.6176 0.6107 0.6253 0.0110  -0.0070 0.0280  3   SER B OG  
1649 N  N   . PHE B 13  ? 0.4574 0.4507 0.4466 0.0018  -0.0014 -0.0081 4   PHE B N   
1650 C  CA  . PHE B 13  ? 0.4472 0.4340 0.4233 -0.0034 -0.0039 -0.0093 4   PHE B CA  
1651 C  C   . PHE B 13  ? 0.4284 0.4030 0.3882 0.0128  -0.0064 -0.0106 4   PHE B C   
1652 O  O   . PHE B 13  ? 0.4397 0.4030 0.3918 0.0237  -0.0037 -0.0177 4   PHE B O   
1653 C  CB  . PHE B 13  ? 0.4353 0.4112 0.3992 -0.0095 -0.0021 -0.0061 4   PHE B CB  
1654 C  CG  . PHE B 13  ? 0.3843 0.3981 0.3454 -0.0053 0.0046  -0.0147 4   PHE B CG  
1655 C  CD1 . PHE B 13  ? 0.3808 0.3649 0.3069 0.0119  0.0032  -0.0098 4   PHE B CD1 
1656 C  CD2 . PHE B 13  ? 0.4133 0.3963 0.3781 -0.0079 0.0061  -0.0022 4   PHE B CD2 
1657 C  CE1 . PHE B 13  ? 0.3733 0.3755 0.3540 -0.0024 -0.0004 -0.0148 4   PHE B CE1 
1658 C  CE2 . PHE B 13  ? 0.4208 0.4081 0.4100 -0.0121 -0.0020 -0.0029 4   PHE B CE2 
1659 C  CZ  . PHE B 13  ? 0.4008 0.4205 0.4036 -0.0021 0.0096  0.0076  4   PHE B CZ  
1660 N  N   . GLN B 14  ? 0.4088 0.3772 0.3544 0.0103  -0.0218 -0.0064 5   GLN B N   
1661 C  CA  . GLN B 14  ? 0.4157 0.4070 0.3944 0.0057  -0.0090 -0.0107 5   GLN B CA  
1662 C  C   . GLN B 14  ? 0.4053 0.3872 0.3693 0.0077  -0.0151 -0.0142 5   GLN B C   
1663 O  O   . GLN B 14  ? 0.4263 0.3800 0.3645 0.0171  -0.0106 -0.0233 5   GLN B O   
1664 C  CB  . GLN B 14  ? 0.4361 0.4282 0.3946 0.0092  -0.0132 -0.0152 5   GLN B CB  
1665 C  CG  . GLN B 14  ? 0.5123 0.5299 0.4696 0.0023  0.0156  0.0086  5   GLN B CG  
1666 C  CD  . GLN B 14  ? 0.6899 0.6114 0.6620 -0.0124 0.0005  -0.0289 5   GLN B CD  
1667 O  OE1 . GLN B 14  ? 0.7631 0.7645 0.7042 -0.0023 -0.0215 0.0167  5   GLN B OE1 
1668 N  NE2 . GLN B 14  ? 0.7293 0.6742 0.6908 0.0036  -0.0001 0.0067  5   GLN B NE2 
1669 N  N   . LEU B 15  ? 0.3865 0.3712 0.3777 0.0080  -0.0069 -0.0178 6   LEU B N   
1670 C  CA  . LEU B 15  ? 0.3969 0.3828 0.3801 0.0031  -0.0102 -0.0057 6   LEU B CA  
1671 C  C   . LEU B 15  ? 0.3841 0.3733 0.3672 -0.0002 -0.0016 -0.0058 6   LEU B C   
1672 O  O   . LEU B 15  ? 0.3618 0.3534 0.3374 0.0130  -0.0197 -0.0128 6   LEU B O   
1673 C  CB  . LEU B 15  ? 0.3927 0.3604 0.3863 -0.0136 -0.0139 -0.0066 6   LEU B CB  
1674 C  CG  . LEU B 15  ? 0.3716 0.3716 0.3765 -0.0042 -0.0187 -0.0044 6   LEU B CG  
1675 C  CD1 . LEU B 15  ? 0.4205 0.3861 0.3726 0.0039  0.0075  -0.0161 6   LEU B CD1 
1676 C  CD2 . LEU B 15  ? 0.4079 0.3749 0.3979 0.0107  -0.0054 0.0010  6   LEU B CD2 
1677 N  N   . PRO B 16  ? 0.4021 0.3751 0.3795 0.0044  -0.0042 -0.0104 7   PRO B N   
1678 C  CA  . PRO B 16  ? 0.4043 0.3975 0.3813 0.0080  -0.0060 -0.0079 7   PRO B CA  
1679 C  C   . PRO B 16  ? 0.4137 0.4100 0.4035 0.0014  -0.0128 -0.0047 7   PRO B C   
1680 O  O   . PRO B 16  ? 0.4047 0.3994 0.3609 -0.0187 -0.0309 -0.0218 7   PRO B O   
1681 C  CB  . PRO B 16  ? 0.4177 0.4002 0.3781 0.0066  -0.0090 0.0024  7   PRO B CB  
1682 C  CG  . PRO B 16  ? 0.3641 0.3443 0.3847 -0.0039 -0.0120 -0.0101 7   PRO B CG  
1683 C  CD  . PRO B 16  ? 0.3846 0.3810 0.3849 0.0014  -0.0090 -0.0169 7   PRO B CD  
1684 N  N   . LYS B 17  ? 0.4305 0.4157 0.4104 -0.0015 -0.0163 -0.0166 8   LYS B N   
1685 C  CA  . LYS B 17  ? 0.4491 0.4519 0.4380 -0.0039 -0.0074 -0.0025 8   LYS B CA  
1686 C  C   . LYS B 17  ? 0.4514 0.4520 0.4417 -0.0116 -0.0113 -0.0051 8   LYS B C   
1687 O  O   . LYS B 17  ? 0.4601 0.4814 0.4610 0.0027  -0.0162 -0.0160 8   LYS B O   
1688 C  CB  . LYS B 17  ? 0.4857 0.4962 0.4710 -0.0127 -0.0067 -0.0074 8   LYS B CB  
1689 C  CG  . LYS B 17  ? 0.5515 0.5196 0.5247 0.0020  -0.0053 0.0019  8   LYS B CG  
1690 C  CD  . LYS B 17  ? 0.5238 0.5049 0.5126 -0.0013 -0.0081 -0.0149 8   LYS B CD  
1691 C  CE  . LYS B 17  ? 0.5997 0.5281 0.5870 -0.0137 -0.0039 -0.0062 8   LYS B CE  
1692 N  NZ  . LYS B 17  ? 0.6240 0.5963 0.5913 -0.0081 -0.0166 -0.0219 8   LYS B NZ  
1693 N  N   . LEU B 18  ? 0.4452 0.4499 0.4321 -0.0070 -0.0063 -0.0114 9   LEU B N   
1694 C  CA  . LEU B 18  ? 0.4452 0.4487 0.4490 -0.0044 -0.0069 -0.0039 9   LEU B CA  
1695 C  C   . LEU B 18  ? 0.4414 0.4482 0.4471 -0.0068 -0.0114 -0.0060 9   LEU B C   
1696 O  O   . LEU B 18  ? 0.4423 0.4684 0.4494 -0.0099 -0.0108 -0.0066 9   LEU B O   
1697 C  CB  . LEU B 18  ? 0.4636 0.4461 0.4528 -0.0017 -0.0064 -0.0089 9   LEU B CB  
1698 C  CG  . LEU B 18  ? 0.4781 0.4863 0.4608 -0.0078 -0.0111 -0.0081 9   LEU B CG  
1699 C  CD1 . LEU B 18  ? 0.4551 0.4829 0.4688 -0.0022 -0.0039 -0.0097 9   LEU B CD1 
1700 C  CD2 . LEU B 18  ? 0.4576 0.4396 0.4624 0.0058  -0.0194 -0.0180 9   LEU B CD2 
1701 N  N   . SER B 19  ? 0.4321 0.4520 0.4471 -0.0124 -0.0091 -0.0034 10  SER B N   
1702 C  CA  . SER B 19  ? 0.4331 0.4477 0.4321 -0.0065 -0.0031 0.0021  10  SER B CA  
1703 C  C   . SER B 19  ? 0.4173 0.4291 0.4293 -0.0084 -0.0076 -0.0033 10  SER B C   
1704 O  O   . SER B 19  ? 0.4178 0.4515 0.4377 -0.0333 -0.0197 -0.0112 10  SER B O   
1705 C  CB  . SER B 19  ? 0.4355 0.4386 0.4361 -0.0042 0.0002  -0.0037 10  SER B CB  
1706 O  OG  . SER B 19  ? 0.4632 0.5025 0.4666 0.0103  -0.0268 0.0269  10  SER B OG  
1707 N  N   . TYR B 20  ? 0.3953 0.4061 0.3973 -0.0054 -0.0121 -0.0039 11  TYR B N   
1708 C  CA  . TYR B 20  ? 0.4057 0.4118 0.4077 -0.0054 -0.0094 -0.0042 11  TYR B CA  
1709 C  C   . TYR B 20  ? 0.4143 0.4218 0.3889 -0.0102 -0.0159 -0.0010 11  TYR B C   
1710 O  O   . TYR B 20  ? 0.4181 0.4380 0.3688 0.0034  -0.0161 0.0024  11  TYR B O   
1711 C  CB  . TYR B 20  ? 0.3835 0.3763 0.3852 -0.0126 -0.0119 0.0087  11  TYR B CB  
1712 C  CG  . TYR B 20  ? 0.4048 0.3723 0.3814 -0.0032 -0.0179 0.0076  11  TYR B CG  
1713 C  CD1 . TYR B 20  ? 0.4008 0.3782 0.3892 -0.0120 -0.0122 -0.0010 11  TYR B CD1 
1714 C  CD2 . TYR B 20  ? 0.3762 0.3365 0.4111 0.0023  -0.0092 0.0121  11  TYR B CD2 
1715 C  CE1 . TYR B 20  ? 0.3999 0.3716 0.3693 -0.0121 -0.0198 0.0115  11  TYR B CE1 
1716 C  CE2 . TYR B 20  ? 0.3576 0.3539 0.3193 -0.0057 -0.0098 -0.0132 11  TYR B CE2 
1717 C  CZ  . TYR B 20  ? 0.3525 0.3534 0.4044 0.0043  -0.0308 0.0178  11  TYR B CZ  
1718 O  OH  . TYR B 20  ? 0.3527 0.3491 0.3344 0.0216  -0.0331 -0.0099 11  TYR B OH  
1719 N  N   . ASP B 21  ? 0.4242 0.4319 0.3941 -0.0149 -0.0174 -0.0080 12  ASP B N   
1720 C  CA  . ASP B 21  ? 0.4211 0.4190 0.4025 -0.0046 -0.0156 -0.0092 12  ASP B CA  
1721 C  C   . ASP B 21  ? 0.4206 0.4174 0.4031 -0.0021 -0.0223 -0.0085 12  ASP B C   
1722 O  O   . ASP B 21  ? 0.4095 0.3675 0.3771 -0.0068 -0.0429 0.0079  12  ASP B O   
1723 C  CB  . ASP B 21  ? 0.4365 0.4338 0.4125 -0.0039 -0.0118 -0.0063 12  ASP B CB  
1724 C  CG  . ASP B 21  ? 0.5228 0.4829 0.4607 -0.0181 0.0007  -0.0203 12  ASP B CG  
1725 O  OD1 . ASP B 21  ? 0.5857 0.4787 0.3499 -0.0353 -0.0413 -0.0513 12  ASP B OD1 
1726 O  OD2 . ASP B 21  ? 0.5415 0.5330 0.6208 -0.0293 -0.0105 0.0061  12  ASP B OD2 
1727 N  N   . TYR B 22  ? 0.4255 0.4177 0.4223 -0.0035 -0.0294 -0.0092 13  TYR B N   
1728 C  CA  . TYR B 22  ? 0.4232 0.4156 0.4018 -0.0025 -0.0180 -0.0054 13  TYR B CA  
1729 C  C   . TYR B 22  ? 0.4173 0.3967 0.4083 -0.0035 -0.0204 -0.0040 13  TYR B C   
1730 O  O   . TYR B 22  ? 0.4447 0.3526 0.3944 -0.0116 -0.0289 -0.0114 13  TYR B O   
1731 C  CB  . TYR B 22  ? 0.4296 0.4174 0.4070 0.0012  -0.0116 0.0027  13  TYR B CB  
1732 C  CG  . TYR B 22  ? 0.3962 0.3969 0.4153 -0.0023 -0.0318 -0.0032 13  TYR B CG  
1733 C  CD1 . TYR B 22  ? 0.3858 0.4050 0.3751 0.0097  -0.0232 0.0025  13  TYR B CD1 
1734 C  CD2 . TYR B 22  ? 0.4535 0.4362 0.4434 0.0138  -0.0012 -0.0027 13  TYR B CD2 
1735 C  CE1 . TYR B 22  ? 0.4074 0.4096 0.4070 0.0130  -0.0126 0.0159  13  TYR B CE1 
1736 C  CE2 . TYR B 22  ? 0.4542 0.4120 0.4449 0.0069  0.0006  -0.0052 13  TYR B CE2 
1737 C  CZ  . TYR B 22  ? 0.4373 0.4122 0.4116 0.0019  0.0005  -0.0080 13  TYR B CZ  
1738 O  OH  . TYR B 22  ? 0.4425 0.3824 0.3629 0.0161  -0.0128 -0.0102 13  TYR B OH  
1739 N  N   . ASP B 23  ? 0.4055 0.3750 0.3999 -0.0083 -0.0232 -0.0146 14  ASP B N   
1740 C  CA  . ASP B 23  ? 0.4088 0.3978 0.3920 -0.0080 -0.0213 -0.0065 14  ASP B CA  
1741 C  C   . ASP B 23  ? 0.4079 0.4046 0.3969 -0.0130 -0.0174 -0.0108 14  ASP B C   
1742 O  O   . ASP B 23  ? 0.4127 0.4161 0.3756 -0.0142 -0.0265 -0.0192 14  ASP B O   
1743 C  CB  . ASP B 23  ? 0.4151 0.4195 0.3698 -0.0068 -0.0206 -0.0053 14  ASP B CB  
1744 C  CG  . ASP B 23  ? 0.4489 0.4277 0.4216 -0.0251 -0.0297 0.0006  14  ASP B CG  
1745 O  OD1 . ASP B 23  ? 0.4689 0.3496 0.3284 -0.0416 -0.0424 -0.0371 14  ASP B OD1 
1746 O  OD2 . ASP B 23  ? 0.5020 0.4857 0.4898 -0.0293 -0.0139 0.0472  14  ASP B OD2 
1747 N  N   . GLU B 24  ? 0.4137 0.3988 0.4000 -0.0169 -0.0198 -0.0177 15  GLU B N   
1748 C  CA  . GLU B 24  ? 0.4012 0.3944 0.4061 -0.0053 -0.0121 -0.0110 15  GLU B CA  
1749 C  C   . GLU B 24  ? 0.3944 0.3988 0.4075 -0.0029 -0.0134 -0.0120 15  GLU B C   
1750 O  O   . GLU B 24  ? 0.3879 0.4044 0.4224 -0.0059 -0.0311 -0.0110 15  GLU B O   
1751 C  CB  . GLU B 24  ? 0.4057 0.3981 0.4064 -0.0121 -0.0093 -0.0023 15  GLU B CB  
1752 C  CG  . GLU B 24  ? 0.4582 0.4200 0.4336 0.0048  -0.0243 -0.0027 15  GLU B CG  
1753 C  CD  . GLU B 24  ? 0.4196 0.4189 0.4093 -0.0146 -0.0085 -0.0196 15  GLU B CD  
1754 O  OE1 . GLU B 24  ? 0.4035 0.4485 0.3926 -0.0230 -0.0334 -0.0346 15  GLU B OE1 
1755 O  OE2 . GLU B 24  ? 0.4598 0.5216 0.4837 0.0047  -0.0145 -0.0292 15  GLU B OE2 
1756 N  N   . LEU B 25  ? 0.3687 0.3730 0.4049 -0.0063 -0.0081 -0.0136 16  LEU B N   
1757 C  CA  . LEU B 25  ? 0.3760 0.3760 0.3887 -0.0060 -0.0062 -0.0060 16  LEU B CA  
1758 C  C   . LEU B 25  ? 0.3735 0.3596 0.3881 -0.0049 -0.0108 0.0023  16  LEU B C   
1759 O  O   . LEU B 25  ? 0.3644 0.3586 0.3657 0.0054  -0.0118 0.0043  16  LEU B O   
1760 C  CB  . LEU B 25  ? 0.3735 0.3765 0.3581 -0.0143 -0.0132 -0.0132 16  LEU B CB  
1761 C  CG  . LEU B 25  ? 0.3540 0.3380 0.3761 0.0041  -0.0076 0.0065  16  LEU B CG  
1762 C  CD1 . LEU B 25  ? 0.3595 0.3606 0.3884 0.0095  0.0019  0.0204  16  LEU B CD1 
1763 C  CD2 . LEU B 25  ? 0.3932 0.3409 0.3740 0.0032  -0.0291 0.0035  16  LEU B CD2 
1764 N  N   . GLU B 26  ? 0.3875 0.3794 0.4078 -0.0043 -0.0092 0.0031  17  GLU B N   
1765 C  CA  . GLU B 26  ? 0.3809 0.3663 0.3852 -0.0095 -0.0086 -0.0052 17  GLU B CA  
1766 C  C   . GLU B 26  ? 0.3702 0.3471 0.3810 -0.0101 -0.0174 0.0038  17  GLU B C   
1767 O  O   . GLU B 26  ? 0.3558 0.3743 0.4170 -0.0184 -0.0347 0.0118  17  GLU B O   
1768 C  CB  . GLU B 26  ? 0.3878 0.3695 0.3798 0.0024  -0.0044 0.0071  17  GLU B CB  
1769 C  CG  . GLU B 26  ? 0.3707 0.4048 0.4303 -0.0115 -0.0012 0.0124  17  GLU B CG  
1770 C  CD  . GLU B 26  ? 0.4245 0.4332 0.4442 -0.0138 0.0051  0.0142  17  GLU B CD  
1771 O  OE1 . GLU B 26  ? 0.4043 0.4017 0.5170 -0.0247 0.0177  0.0116  17  GLU B OE1 
1772 O  OE2 . GLU B 26  ? 0.3860 0.3822 0.4855 -0.0333 -0.0150 0.0255  17  GLU B OE2 
1773 N  N   . PRO B 27  ? 0.3582 0.3466 0.3754 -0.0058 -0.0104 0.0073  18  PRO B N   
1774 C  CA  . PRO B 27  ? 0.3538 0.3491 0.3691 -0.0045 -0.0048 0.0038  18  PRO B CA  
1775 C  C   . PRO B 27  ? 0.3428 0.3571 0.3575 0.0034  -0.0116 0.0000  18  PRO B C   
1776 O  O   . PRO B 27  ? 0.3256 0.3771 0.3479 0.0015  -0.0283 0.0099  18  PRO B O   
1777 C  CB  . PRO B 27  ? 0.3709 0.3566 0.3876 -0.0047 0.0003  -0.0029 18  PRO B CB  
1778 C  CG  . PRO B 27  ? 0.3778 0.3866 0.3972 0.0016  0.0128  -0.0032 18  PRO B CG  
1779 C  CD  . PRO B 27  ? 0.3675 0.3583 0.3777 -0.0153 -0.0073 0.0107  18  PRO B CD  
1780 N  N   . TYR B 28  ? 0.3404 0.3538 0.3644 -0.0161 -0.0067 0.0095  19  TYR B N   
1781 C  CA  . TYR B 28  ? 0.3264 0.3341 0.3327 -0.0043 -0.0106 0.0028  19  TYR B CA  
1782 C  C   . TYR B 28  ? 0.3117 0.3163 0.3175 0.0005  -0.0141 0.0056  19  TYR B C   
1783 O  O   . TYR B 28  ? 0.3287 0.3239 0.3789 0.0046  -0.0230 0.0052  19  TYR B O   
1784 C  CB  . TYR B 28  ? 0.3073 0.3322 0.3464 -0.0167 -0.0113 0.0031  19  TYR B CB  
1785 C  CG  . TYR B 28  ? 0.3077 0.3388 0.3013 0.0047  -0.0072 0.0156  19  TYR B CG  
1786 C  CD1 . TYR B 28  ? 0.2903 0.3504 0.3785 0.0299  -0.0030 -0.0013 19  TYR B CD1 
1787 C  CD2 . TYR B 28  ? 0.3265 0.3664 0.3513 -0.0042 -0.0180 0.0190  19  TYR B CD2 
1788 C  CE1 . TYR B 28  ? 0.3147 0.3546 0.3917 -0.0033 -0.0057 -0.0247 19  TYR B CE1 
1789 C  CE2 . TYR B 28  ? 0.3140 0.3978 0.3433 -0.0006 -0.0226 0.0033  19  TYR B CE2 
1790 C  CZ  . TYR B 28  ? 0.3155 0.4255 0.3527 -0.0010 -0.0103 0.0097  19  TYR B CZ  
1791 O  OH  . TYR B 28  ? 0.3051 0.4328 0.3642 -0.0117 -0.0285 0.0388  19  TYR B OH  
1792 N  N   . ILE B 29  ? 0.2995 0.3146 0.3162 -0.0148 -0.0312 -0.0158 20  ILE B N   
1793 C  CA  . ILE B 29  ? 0.3239 0.3158 0.3118 0.0002  -0.0166 -0.0021 20  ILE B CA  
1794 C  C   . ILE B 29  ? 0.3268 0.3064 0.3046 -0.0187 -0.0169 -0.0033 20  ILE B C   
1795 O  O   . ILE B 29  ? 0.3300 0.2718 0.2877 -0.0434 -0.0282 0.0128  20  ILE B O   
1796 C  CB  . ILE B 29  ? 0.3122 0.3140 0.3104 -0.0092 -0.0158 -0.0207 20  ILE B CB  
1797 C  CG1 . ILE B 29  ? 0.3242 0.3442 0.3222 -0.0097 -0.0008 0.0066  20  ILE B CG1 
1798 C  CG2 . ILE B 29  ? 0.2973 0.2996 0.2895 -0.0157 -0.0398 -0.0102 20  ILE B CG2 
1799 C  CD1 . ILE B 29  ? 0.3535 0.3479 0.3237 0.0092  -0.0139 0.0165  20  ILE B CD1 
1800 N  N   . ASP B 30  ? 0.3052 0.2956 0.2808 -0.0128 -0.0228 -0.0036 21  ASP B N   
1801 C  CA  . ASP B 30  ? 0.3190 0.3029 0.3069 -0.0061 -0.0156 0.0045  21  ASP B CA  
1802 C  C   . ASP B 30  ? 0.3332 0.3067 0.3340 -0.0029 -0.0126 -0.0023 21  ASP B C   
1803 O  O   . ASP B 30  ? 0.3453 0.2602 0.2944 -0.0065 -0.0111 -0.0140 21  ASP B O   
1804 C  CB  . ASP B 30  ? 0.3342 0.3225 0.3161 -0.0069 -0.0078 -0.0080 21  ASP B CB  
1805 C  CG  . ASP B 30  ? 0.3539 0.3432 0.3258 -0.0108 -0.0089 -0.0060 21  ASP B CG  
1806 O  OD1 . ASP B 30  ? 0.3674 0.3721 0.3002 -0.0130 -0.0517 -0.0023 21  ASP B OD1 
1807 O  OD2 . ASP B 30  ? 0.3651 0.3108 0.3106 -0.0212 0.0086  0.0488  21  ASP B OD2 
1808 N  N   . SER B 31  ? 0.3586 0.3324 0.3579 -0.0167 -0.0007 0.0067  22  SER B N   
1809 C  CA  . SER B 31  ? 0.3674 0.3303 0.3556 -0.0035 -0.0043 -0.0043 22  SER B CA  
1810 C  C   . SER B 31  ? 0.3703 0.3259 0.3528 -0.0041 -0.0052 -0.0045 22  SER B C   
1811 O  O   . SER B 31  ? 0.3788 0.3148 0.3388 0.0045  -0.0114 0.0063  22  SER B O   
1812 C  CB  . SER B 31  ? 0.3795 0.3547 0.3913 -0.0078 -0.0020 0.0029  22  SER B CB  
1813 O  OG  . SER B 31  ? 0.4196 0.3465 0.4067 -0.0095 0.0077  -0.0120 22  SER B OG  
1814 N  N   . ASN B 32  ? 0.3757 0.3481 0.3468 0.0007  0.0016  0.0129  23  ASN B N   
1815 C  CA  . ASN B 32  ? 0.3687 0.3425 0.3441 -0.0028 -0.0045 0.0096  23  ASN B CA  
1816 C  C   . ASN B 32  ? 0.3513 0.3305 0.3263 -0.0029 0.0056  0.0138  23  ASN B C   
1817 O  O   . ASN B 32  ? 0.3468 0.3383 0.3404 0.0181  -0.0105 0.0044  23  ASN B O   
1818 C  CB  . ASN B 32  ? 0.3749 0.3613 0.3257 -0.0092 -0.0018 0.0150  23  ASN B CB  
1819 C  CG  . ASN B 32  ? 0.4161 0.4203 0.3845 0.0190  -0.0024 0.0102  23  ASN B CG  
1820 O  OD1 . ASN B 32  ? 0.5493 0.4136 0.4845 0.0422  -0.0116 -0.0212 23  ASN B OD1 
1821 N  ND2 . ASN B 32  ? 0.4610 0.4753 0.4736 -0.0008 -0.0485 -0.0118 23  ASN B ND2 
1822 N  N   . THR B 33  ? 0.3366 0.3327 0.3184 -0.0099 -0.0011 0.0106  24  THR B N   
1823 C  CA  . THR B 33  ? 0.3358 0.3239 0.3124 -0.0036 -0.0127 0.0069  24  THR B CA  
1824 C  C   . THR B 33  ? 0.3340 0.3054 0.3134 0.0053  -0.0088 0.0080  24  THR B C   
1825 O  O   . THR B 33  ? 0.3454 0.2717 0.2952 0.0130  -0.0113 0.0312  24  THR B O   
1826 C  CB  . THR B 33  ? 0.3305 0.3421 0.3095 -0.0139 -0.0102 0.0075  24  THR B CB  
1827 O  OG1 . THR B 33  ? 0.3373 0.2843 0.3114 -0.0146 -0.0355 0.0137  24  THR B OG1 
1828 C  CG2 . THR B 33  ? 0.3446 0.3293 0.3283 -0.0064 -0.0150 -0.0046 24  THR B CG2 
1829 N  N   . LEU B 34  ? 0.3334 0.2812 0.3086 -0.0025 -0.0133 -0.0097 25  LEU B N   
1830 C  CA  . LEU B 34  ? 0.3420 0.3077 0.3153 -0.0088 -0.0136 0.0015  25  LEU B CA  
1831 C  C   . LEU B 34  ? 0.3500 0.3259 0.3216 -0.0017 -0.0173 0.0072  25  LEU B C   
1832 O  O   . LEU B 34  ? 0.3654 0.3252 0.3327 -0.0011 -0.0156 0.0213  25  LEU B O   
1833 C  CB  . LEU B 34  ? 0.3466 0.3266 0.3394 0.0045  -0.0040 -0.0162 25  LEU B CB  
1834 C  CG  . LEU B 34  ? 0.3997 0.3951 0.4012 -0.0142 -0.0251 0.0130  25  LEU B CG  
1835 C  CD1 . LEU B 34  ? 0.3565 0.3565 0.3835 -0.0204 -0.0077 -0.0108 25  LEU B CD1 
1836 C  CD2 . LEU B 34  ? 0.3862 0.4628 0.3498 0.0014  -0.0083 -0.0083 25  LEU B CD2 
1837 N  N   . SER B 35  ? 0.3784 0.3324 0.3255 -0.0139 -0.0164 -0.0076 26  SER B N   
1838 C  CA  . SER B 35  ? 0.3545 0.3280 0.3366 0.0015  -0.0065 0.0058  26  SER B CA  
1839 C  C   . SER B 35  ? 0.3501 0.3130 0.3281 0.0052  -0.0097 0.0087  26  SER B C   
1840 O  O   . SER B 35  ? 0.3644 0.2856 0.3299 0.0113  0.0000  -0.0135 26  SER B O   
1841 C  CB  . SER B 35  ? 0.4002 0.3590 0.3568 0.0080  -0.0060 0.0038  26  SER B CB  
1842 O  OG  . SER B 35  ? 0.4797 0.3793 0.3708 0.0261  -0.0226 0.0399  26  SER B OG  
1843 N  N   . ILE B 36  ? 0.3514 0.3093 0.3384 -0.0028 0.0005  -0.0074 27  ILE B N   
1844 C  CA  . ILE B 36  ? 0.3309 0.3178 0.3300 0.0026  0.0008  -0.0001 27  ILE B CA  
1845 C  C   . ILE B 36  ? 0.2987 0.2943 0.3002 0.0001  0.0004  -0.0070 27  ILE B C   
1846 O  O   . ILE B 36  ? 0.3127 0.3144 0.3144 -0.0205 -0.0084 -0.0046 27  ILE B O   
1847 C  CB  . ILE B 36  ? 0.3286 0.3144 0.3329 -0.0057 -0.0062 0.0089  27  ILE B CB  
1848 C  CG1 . ILE B 36  ? 0.3798 0.3824 0.3589 0.0083  -0.0272 0.0266  27  ILE B CG1 
1849 C  CG2 . ILE B 36  ? 0.3626 0.3342 0.3507 0.0055  -0.0115 0.0053  27  ILE B CG2 
1850 C  CD1 . ILE B 36  ? 0.3819 0.4312 0.3679 0.0056  0.0000  0.0067  27  ILE B CD1 
1851 N  N   . HIS B 37  ? 0.2948 0.2874 0.2988 -0.0110 -0.0140 -0.0125 28  HIS B N   
1852 C  CA  . HIS B 37  ? 0.2831 0.2864 0.2857 0.0048  -0.0056 0.0011  28  HIS B CA  
1853 C  C   . HIS B 37  ? 0.2807 0.2694 0.2938 0.0057  -0.0079 0.0027  28  HIS B C   
1854 O  O   . HIS B 37  ? 0.2575 0.2643 0.3037 0.0130  -0.0137 0.0034  28  HIS B O   
1855 C  CB  . HIS B 37  ? 0.2901 0.2853 0.2817 0.0097  -0.0085 0.0075  28  HIS B CB  
1856 C  CG  . HIS B 37  ? 0.2765 0.2613 0.2729 -0.0162 -0.0178 -0.0211 28  HIS B CG  
1857 N  ND1 . HIS B 37  ? 0.2648 0.2681 0.2545 -0.0021 -0.0109 0.0035  28  HIS B ND1 
1858 C  CD2 . HIS B 37  ? 0.2923 0.2395 0.2369 -0.0082 0.0197  -0.0078 28  HIS B CD2 
1859 C  CE1 . HIS B 37  ? 0.2312 0.2167 0.2468 -0.0294 -0.0216 -0.0015 28  HIS B CE1 
1860 N  NE2 . HIS B 37  ? 0.2177 0.2551 0.2769 0.0287  -0.0066 -0.0105 28  HIS B NE2 
1861 N  N   . HIS B 38  ? 0.2896 0.2998 0.2836 0.0023  -0.0102 -0.0026 29  HIS B N   
1862 C  CA  . HIS B 38  ? 0.3000 0.3053 0.2955 -0.0004 -0.0067 -0.0008 29  HIS B CA  
1863 C  C   . HIS B 38  ? 0.3087 0.3009 0.2891 -0.0005 -0.0046 0.0064  29  HIS B C   
1864 O  O   . HIS B 38  ? 0.3088 0.2975 0.2419 0.0100  -0.0333 0.0306  29  HIS B O   
1865 C  CB  . HIS B 38  ? 0.2914 0.3104 0.2865 -0.0058 -0.0057 -0.0015 29  HIS B CB  
1866 C  CG  . HIS B 38  ? 0.2850 0.3071 0.2891 0.0071  -0.0161 -0.0187 29  HIS B CG  
1867 N  ND1 . HIS B 38  ? 0.3260 0.2980 0.3084 0.0489  -0.0714 0.0042  29  HIS B ND1 
1868 C  CD2 . HIS B 38  ? 0.3373 0.2901 0.2902 -0.0072 0.0017  -0.0129 29  HIS B CD2 
1869 C  CE1 . HIS B 38  ? 0.4009 0.3534 0.3133 0.0072  0.0037  -0.0295 29  HIS B CE1 
1870 N  NE2 . HIS B 38  ? 0.3493 0.3527 0.3065 0.0314  -0.0232 -0.0372 29  HIS B NE2 
1871 N  N   . GLY B 39  ? 0.3346 0.3198 0.3031 0.0091  -0.0116 0.0146  30  GLY B N   
1872 C  CA  . GLY B 39  ? 0.3250 0.3149 0.2807 0.0028  -0.0078 0.0014  30  GLY B CA  
1873 C  C   . GLY B 39  ? 0.3378 0.3178 0.2985 0.0137  -0.0009 -0.0034 30  GLY B C   
1874 O  O   . GLY B 39  ? 0.3454 0.3279 0.2536 0.0232  -0.0126 -0.0270 30  GLY B O   
1875 N  N   . LYS B 40  ? 0.3422 0.3226 0.2875 0.0045  -0.0118 -0.0013 31  LYS B N   
1876 C  CA  . LYS B 40  ? 0.3299 0.3181 0.3173 0.0051  -0.0001 -0.0019 31  LYS B CA  
1877 C  C   . LYS B 40  ? 0.3172 0.3072 0.3030 -0.0004 0.0066  -0.0063 31  LYS B C   
1878 O  O   . LYS B 40  ? 0.3195 0.2982 0.2514 0.0060  -0.0045 -0.0044 31  LYS B O   
1879 C  CB  . LYS B 40  ? 0.3199 0.3420 0.3208 0.0125  -0.0026 -0.0133 31  LYS B CB  
1880 C  CG  . LYS B 40  ? 0.4072 0.3831 0.3703 -0.0110 -0.0116 0.0146  31  LYS B CG  
1881 C  CD  . LYS B 40  ? 0.3967 0.3784 0.3904 -0.0069 0.0013  0.0203  31  LYS B CD  
1882 C  CE  . LYS B 40  ? 0.4575 0.4054 0.4938 0.0169  -0.0012 0.0064  31  LYS B CE  
1883 N  NZ  . LYS B 40  ? 0.5450 0.5077 0.5167 -0.0175 -0.0003 -0.0249 31  LYS B NZ  
1884 N  N   . HIS B 41  ? 0.3131 0.2867 0.3018 -0.0077 0.0083  -0.0150 32  HIS B N   
1885 C  CA  . HIS B 41  ? 0.3136 0.2938 0.2868 0.0021  0.0017  0.0009  32  HIS B CA  
1886 C  C   . HIS B 41  ? 0.2909 0.2625 0.2617 0.0140  -0.0052 -0.0018 32  HIS B C   
1887 O  O   . HIS B 41  ? 0.3158 0.2453 0.2202 0.0294  -0.0081 0.0112  32  HIS B O   
1888 C  CB  . HIS B 41  ? 0.2899 0.2650 0.2733 0.0089  -0.0088 -0.0031 32  HIS B CB  
1889 C  CG  . HIS B 41  ? 0.3067 0.3160 0.2692 -0.0063 -0.0205 0.0104  32  HIS B CG  
1890 N  ND1 . HIS B 41  ? 0.3572 0.3076 0.3063 0.0020  -0.0218 0.0031  32  HIS B ND1 
1891 C  CD2 . HIS B 41  ? 0.2738 0.3055 0.2798 -0.0044 -0.0127 -0.0120 32  HIS B CD2 
1892 C  CE1 . HIS B 41  ? 0.2808 0.3206 0.2945 -0.0004 -0.0151 -0.0368 32  HIS B CE1 
1893 N  NE2 . HIS B 41  ? 0.3058 0.2364 0.2877 0.0037  -0.0228 -0.0213 32  HIS B NE2 
1894 N  N   . HIS B 42  ? 0.3094 0.2749 0.2784 0.0001  -0.0003 -0.0035 33  HIS B N   
1895 C  CA  . HIS B 42  ? 0.3136 0.2861 0.2850 0.0057  -0.0040 0.0027  33  HIS B CA  
1896 C  C   . HIS B 42  ? 0.3243 0.2937 0.2760 -0.0023 -0.0063 -0.0104 33  HIS B C   
1897 O  O   . HIS B 42  ? 0.3299 0.2977 0.2851 -0.0123 -0.0116 -0.0330 33  HIS B O   
1898 C  CB  . HIS B 42  ? 0.3236 0.2764 0.2751 0.0018  0.0010  -0.0052 33  HIS B CB  
1899 C  CG  . HIS B 42  ? 0.3065 0.2697 0.2859 0.0093  -0.0060 0.0059  33  HIS B CG  
1900 N  ND1 . HIS B 42  ? 0.3325 0.2760 0.3085 0.0054  -0.0132 -0.0022 33  HIS B ND1 
1901 C  CD2 . HIS B 42  ? 0.3095 0.2492 0.2517 0.0135  0.0018  -0.0063 33  HIS B CD2 
1902 C  CE1 . HIS B 42  ? 0.3121 0.3240 0.3112 0.0136  0.0106  0.0132  33  HIS B CE1 
1903 N  NE2 . HIS B 42  ? 0.2731 0.3231 0.3399 0.0318  -0.0374 0.0021  33  HIS B NE2 
1904 N  N   . ALA B 43  ? 0.3291 0.3083 0.2932 0.0022  -0.0035 0.0038  34  ALA B N   
1905 C  CA  . ALA B 43  ? 0.3296 0.2907 0.2869 0.0053  -0.0042 -0.0017 34  ALA B CA  
1906 C  C   . ALA B 43  ? 0.3423 0.3055 0.2954 0.0163  0.0082  -0.0021 34  ALA B C   
1907 O  O   . ALA B 43  ? 0.3941 0.3336 0.2686 0.0163  0.0251  0.0091  34  ALA B O   
1908 C  CB  . ALA B 43  ? 0.3548 0.3162 0.3122 0.0105  0.0150  0.0054  34  ALA B CB  
1909 N  N   . THR B 44  ? 0.3104 0.2983 0.2740 0.0170  -0.0088 -0.0017 35  THR B N   
1910 C  CA  . THR B 44  ? 0.3154 0.3097 0.2833 0.0078  0.0030  -0.0094 35  THR B CA  
1911 C  C   . THR B 44  ? 0.3091 0.3110 0.2818 0.0048  0.0000  -0.0110 35  THR B C   
1912 O  O   . THR B 44  ? 0.2956 0.3215 0.3347 -0.0022 0.0090  0.0020  35  THR B O   
1913 C  CB  . THR B 44  ? 0.2943 0.3147 0.2722 0.0055  -0.0125 -0.0106 35  THR B CB  
1914 O  OG1 . THR B 44  ? 0.3655 0.3765 0.3230 0.0145  -0.0484 -0.0104 35  THR B OG1 
1915 C  CG2 . THR B 44  ? 0.3147 0.3408 0.3091 0.0084  -0.0096 0.0061  35  THR B CG2 
1916 N  N   . TYR B 45  ? 0.3074 0.3243 0.2664 0.0076  0.0009  -0.0065 36  TYR B N   
1917 C  CA  . TYR B 45  ? 0.3113 0.3116 0.2975 0.0024  -0.0007 0.0002  36  TYR B CA  
1918 C  C   . TYR B 45  ? 0.3275 0.3172 0.3129 -0.0001 0.0089  0.0027  36  TYR B C   
1919 O  O   . TYR B 45  ? 0.3458 0.3544 0.2919 0.0011  0.0137  0.0127  36  TYR B O   
1920 C  CB  . TYR B 45  ? 0.3218 0.3122 0.3186 0.0067  -0.0027 0.0103  36  TYR B CB  
1921 C  CG  . TYR B 45  ? 0.3172 0.2873 0.3349 0.0094  0.0000  0.0020  36  TYR B CG  
1922 C  CD1 . TYR B 45  ? 0.3061 0.2959 0.3258 0.0218  0.0106  0.0034  36  TYR B CD1 
1923 C  CD2 . TYR B 45  ? 0.3145 0.3063 0.3464 0.0268  -0.0097 -0.0118 36  TYR B CD2 
1924 C  CE1 . TYR B 45  ? 0.3513 0.3530 0.3597 -0.0079 -0.0098 -0.0158 36  TYR B CE1 
1925 C  CE2 . TYR B 45  ? 0.3340 0.3342 0.3358 0.0228  -0.0006 0.0080  36  TYR B CE2 
1926 C  CZ  . TYR B 45  ? 0.3570 0.3474 0.3537 0.0171  0.0065  -0.0213 36  TYR B CZ  
1927 O  OH  . TYR B 45  ? 0.3839 0.3826 0.3392 0.0395  -0.0604 -0.0189 36  TYR B OH  
1928 N  N   . VAL B 46  ? 0.3288 0.3123 0.2956 0.0105  -0.0064 0.0091  37  VAL B N   
1929 C  CA  . VAL B 46  ? 0.3416 0.3182 0.3121 0.0065  0.0066  0.0003  37  VAL B CA  
1930 C  C   . VAL B 46  ? 0.3439 0.3116 0.3192 0.0073  0.0037  0.0022  37  VAL B C   
1931 O  O   . VAL B 46  ? 0.3382 0.3189 0.2959 0.0069  0.0096  -0.0058 37  VAL B O   
1932 C  CB  . VAL B 46  ? 0.3525 0.3466 0.3267 0.0115  0.0005  -0.0003 37  VAL B CB  
1933 C  CG1 . VAL B 46  ? 0.3823 0.3424 0.2982 0.0165  0.0007  0.0040  37  VAL B CG1 
1934 C  CG2 . VAL B 46  ? 0.3577 0.3843 0.3863 0.0046  -0.0040 0.0033  37  VAL B CG2 
1935 N  N   . ASN B 47  ? 0.3485 0.3463 0.3021 0.0224  -0.0125 0.0033  38  ASN B N   
1936 C  CA  . ASN B 47  ? 0.3576 0.3559 0.3268 0.0208  0.0033  0.0082  38  ASN B CA  
1937 C  C   . ASN B 47  ? 0.3583 0.3632 0.3218 0.0235  -0.0091 0.0130  38  ASN B C   
1938 O  O   . ASN B 47  ? 0.3985 0.4145 0.3201 0.0390  -0.0044 0.0055  38  ASN B O   
1939 C  CB  . ASN B 47  ? 0.3495 0.3569 0.3412 0.0253  0.0047  0.0166  38  ASN B CB  
1940 C  CG  . ASN B 47  ? 0.3972 0.3381 0.3586 0.0250  -0.0043 0.0022  38  ASN B CG  
1941 O  OD1 . ASN B 47  ? 0.4267 0.4083 0.3549 0.0261  -0.0122 -0.0127 38  ASN B OD1 
1942 N  ND2 . ASN B 47  ? 0.3962 0.3863 0.3551 0.0312  0.0216  0.0112  38  ASN B ND2 
1943 N  N   . ASN B 48  ? 0.3452 0.3266 0.3326 0.0350  -0.0062 0.0095  39  ASN B N   
1944 C  CA  . ASN B 48  ? 0.3514 0.3478 0.3322 0.0185  0.0011  0.0024  39  ASN B CA  
1945 C  C   . ASN B 48  ? 0.3545 0.3529 0.3494 0.0112  0.0009  0.0061  39  ASN B C   
1946 O  O   . ASN B 48  ? 0.3714 0.3454 0.3751 0.0124  0.0059  0.0345  39  ASN B O   
1947 C  CB  . ASN B 48  ? 0.3526 0.3411 0.3511 0.0218  -0.0021 -0.0089 39  ASN B CB  
1948 C  CG  . ASN B 48  ? 0.3703 0.3408 0.3181 0.0089  0.0142  -0.0001 39  ASN B CG  
1949 O  OD1 . ASN B 48  ? 0.3779 0.3307 0.2454 0.0357  -0.0060 0.0015  39  ASN B OD1 
1950 N  ND2 . ASN B 48  ? 0.3668 0.3609 0.3181 -0.0007 -0.0007 -0.0431 39  ASN B ND2 
1951 N  N   . LEU B 49  ? 0.3611 0.3497 0.3241 0.0276  0.0029  0.0068  40  LEU B N   
1952 C  CA  . LEU B 49  ? 0.3649 0.3719 0.3420 0.0152  0.0042  0.0100  40  LEU B CA  
1953 C  C   . LEU B 49  ? 0.3654 0.3724 0.3424 0.0119  0.0050  0.0058  40  LEU B C   
1954 O  O   . LEU B 49  ? 0.3553 0.4074 0.3646 0.0148  0.0139  0.0117  40  LEU B O   
1955 C  CB  . LEU B 49  ? 0.3638 0.3698 0.3242 0.0263  -0.0037 0.0212  40  LEU B CB  
1956 C  CG  . LEU B 49  ? 0.3692 0.3598 0.2999 0.0216  0.0007  -0.0062 40  LEU B CG  
1957 C  CD1 . LEU B 49  ? 0.3447 0.3786 0.3246 0.0329  -0.0077 0.0036  40  LEU B CD1 
1958 C  CD2 . LEU B 49  ? 0.3526 0.3354 0.3271 0.0272  0.0032  -0.0069 40  LEU B CD2 
1959 N  N   . ASN B 50  ? 0.3827 0.3804 0.3537 0.0172  0.0054  0.0081  41  ASN B N   
1960 C  CA  . ASN B 50  ? 0.3870 0.3964 0.3527 0.0122  0.0095  0.0029  41  ASN B CA  
1961 C  C   . ASN B 50  ? 0.3910 0.4118 0.3649 0.0161  0.0043  0.0038  41  ASN B C   
1962 O  O   . ASN B 50  ? 0.4041 0.4203 0.3685 0.0149  0.0109  0.0094  41  ASN B O   
1963 C  CB  . ASN B 50  ? 0.3831 0.3959 0.3447 0.0132  0.0136  0.0044  41  ASN B CB  
1964 C  CG  . ASN B 50  ? 0.3892 0.3555 0.3410 0.0134  0.0178  0.0046  41  ASN B CG  
1965 O  OD1 . ASN B 50  ? 0.4479 0.4049 0.2514 0.0266  -0.0184 0.0090  41  ASN B OD1 
1966 N  ND2 . ASN B 50  ? 0.3301 0.2979 0.3203 0.0187  -0.0056 0.0029  41  ASN B ND2 
1967 N  N   . ALA B 51  ? 0.4074 0.4209 0.3749 0.0134  0.0106  0.0095  42  ALA B N   
1968 C  CA  . ALA B 51  ? 0.4058 0.4256 0.3824 0.0116  -0.0020 0.0081  42  ALA B CA  
1969 C  C   . ALA B 51  ? 0.4185 0.4325 0.3925 0.0185  -0.0022 0.0102  42  ALA B C   
1970 O  O   . ALA B 51  ? 0.4086 0.4143 0.3746 0.0375  0.0156  0.0264  42  ALA B O   
1971 C  CB  . ALA B 51  ? 0.4166 0.4445 0.4053 0.0102  0.0029  0.0137  42  ALA B CB  
1972 N  N   . ALA B 52  ? 0.4282 0.4250 0.3905 0.0201  0.0007  0.0040  43  ALA B N   
1973 C  CA  . ALA B 52  ? 0.4394 0.4436 0.4176 0.0078  0.0010  0.0057  43  ALA B CA  
1974 C  C   . ALA B 52  ? 0.4536 0.4512 0.4297 0.0034  -0.0002 0.0139  43  ALA B C   
1975 O  O   . ALA B 52  ? 0.4621 0.4640 0.4560 -0.0012 -0.0120 0.0187  43  ALA B O   
1976 C  CB  . ALA B 52  ? 0.4453 0.4397 0.4217 0.0146  0.0061  0.0091  43  ALA B CB  
1977 N  N   . LEU B 53  ? 0.4415 0.4541 0.4293 0.0069  -0.0035 0.0109  44  LEU B N   
1978 C  CA  . LEU B 53  ? 0.4698 0.4848 0.4432 0.0073  0.0021  0.0041  44  LEU B CA  
1979 C  C   . LEU B 53  ? 0.4859 0.4989 0.4788 0.0160  0.0121  0.0015  44  LEU B C   
1980 O  O   . LEU B 53  ? 0.4872 0.4974 0.4576 0.0271  0.0322  -0.0127 44  LEU B O   
1981 C  CB  . LEU B 53  ? 0.4410 0.4626 0.4184 0.0117  0.0099  0.0062  44  LEU B CB  
1982 C  CG  . LEU B 53  ? 0.4353 0.4393 0.4248 -0.0037 0.0071  0.0081  44  LEU B CG  
1983 C  CD1 . LEU B 53  ? 0.4152 0.4216 0.4179 0.0332  0.0047  0.0113  44  LEU B CD1 
1984 C  CD2 . LEU B 53  ? 0.4494 0.4564 0.4396 -0.0008 0.0278  -0.0088 44  LEU B CD2 
1985 N  N   . GLU B 54  ? 0.5109 0.5165 0.5074 0.0088  0.0136  0.0100  45  GLU B N   
1986 C  CA  . GLU B 54  ? 0.5456 0.5355 0.5255 0.0074  0.0064  -0.0038 45  GLU B CA  
1987 C  C   . GLU B 54  ? 0.5560 0.5402 0.5349 0.0043  0.0075  0.0026  45  GLU B C   
1988 O  O   . GLU B 54  ? 0.5649 0.5324 0.5202 0.0021  0.0227  0.0038  45  GLU B O   
1989 C  CB  . GLU B 54  ? 0.5527 0.5374 0.5283 0.0080  0.0079  -0.0049 45  GLU B CB  
1990 C  CG  . GLU B 54  ? 0.5949 0.5743 0.5876 -0.0016 -0.0006 0.0067  45  GLU B CG  
1991 C  CD  . GLU B 54  ? 0.6253 0.5894 0.6079 0.0020  0.0070  0.0150  45  GLU B CD  
1992 O  OE1 . GLU B 54  ? 0.7250 0.7049 0.6645 -0.0034 -0.0355 -0.0147 45  GLU B OE1 
1993 O  OE2 . GLU B 54  ? 0.6680 0.6541 0.6949 -0.0215 -0.0161 -0.0167 45  GLU B OE2 
1994 N  N   . ASN B 55  ? 0.5542 0.5479 0.5468 0.0037  -0.0002 0.0106  46  ASN B N   
1995 C  CA  . ASN B 55  ? 0.5701 0.5746 0.5681 0.0018  0.0031  0.0057  46  ASN B CA  
1996 C  C   . ASN B 55  ? 0.5794 0.5866 0.5726 0.0009  0.0026  0.0089  46  ASN B C   
1997 O  O   . ASN B 55  ? 0.5834 0.6115 0.5702 0.0071  0.0065  0.0072  46  ASN B O   
1998 C  CB  . ASN B 55  ? 0.5892 0.5916 0.5824 0.0004  0.0001  0.0019  46  ASN B CB  
1999 C  CG  . ASN B 55  ? 0.6409 0.6098 0.6362 0.0074  0.0010  0.0117  46  ASN B CG  
2000 O  OD1 . ASN B 55  ? 0.7090 0.7128 0.6721 0.0027  -0.0130 -0.0092 46  ASN B OD1 
2001 N  ND2 . ASN B 55  ? 0.6423 0.6070 0.6342 0.0128  0.0183  0.0069  46  ASN B ND2 
2002 N  N   . TYR B 56  ? 0.5842 0.5826 0.5692 0.0005  0.0053  0.0067  47  TYR B N   
2003 C  CA  . TYR B 56  ? 0.5892 0.5870 0.5726 0.0078  0.0004  0.0008  47  TYR B CA  
2004 C  C   . TYR B 56  ? 0.5806 0.5838 0.5607 0.0104  -0.0016 -0.0001 47  TYR B C   
2005 O  O   . TYR B 56  ? 0.5690 0.5775 0.5224 0.0118  0.0044  0.0078  47  TYR B O   
2006 C  CB  . TYR B 56  ? 0.5673 0.5966 0.5535 0.0036  -0.0268 -0.0025 47  TYR B CB  
2007 C  CG  . TYR B 56  ? 0.6381 0.6070 0.6189 0.0047  0.0073  0.0000  47  TYR B CG  
2008 C  CD1 . TYR B 56  ? 0.5413 0.5371 0.5611 -0.0235 0.0003  0.0153  47  TYR B CD1 
2009 C  CD2 . TYR B 56  ? 0.6101 0.6483 0.6092 -0.0140 -0.0095 0.0013  47  TYR B CD2 
2010 C  CE1 . TYR B 56  ? 0.6092 0.5692 0.5799 -0.0091 0.0110  0.0096  47  TYR B CE1 
2011 C  CE2 . TYR B 56  ? 0.6495 0.6639 0.6224 0.0165  -0.0018 0.0067  47  TYR B CE2 
2012 C  CZ  . TYR B 56  ? 0.6250 0.6225 0.6238 -0.0003 0.0161  0.0048  47  TYR B CZ  
2013 O  OH  . TYR B 56  ? 0.5950 0.6480 0.6169 -0.0128 -0.0351 0.0004  47  TYR B OH  
2014 N  N   . SER B 57  ? 0.5878 0.5980 0.5699 0.0136  -0.0001 0.0025  48  SER B N   
2015 C  CA  . SER B 57  ? 0.5919 0.5941 0.5685 0.0089  0.0032  -0.0023 48  SER B CA  
2016 C  C   . SER B 57  ? 0.5785 0.5975 0.5378 0.0059  0.0089  -0.0010 48  SER B C   
2017 O  O   . SER B 57  ? 0.5680 0.6061 0.4939 0.0095  0.0180  -0.0092 48  SER B O   
2018 C  CB  . SER B 57  ? 0.6068 0.5989 0.5783 0.0085  0.0023  -0.0037 48  SER B CB  
2019 O  OG  . SER B 57  ? 0.6198 0.6066 0.6097 0.0098  0.0094  -0.0071 48  SER B OG  
2020 N  N   . GLU B 58  ? 0.5941 0.5973 0.5653 0.0058  0.0139  0.0033  49  GLU B N   
2021 C  CA  . GLU B 58  ? 0.5926 0.5982 0.5865 0.0076  0.0033  0.0033  49  GLU B CA  
2022 C  C   . GLU B 58  ? 0.5947 0.6121 0.5885 0.0046  0.0061  0.0091  49  GLU B C   
2023 O  O   . GLU B 58  ? 0.6067 0.6249 0.5874 0.0168  0.0033  0.0242  49  GLU B O   
2024 C  CB  . GLU B 58  ? 0.5956 0.6067 0.6062 0.0063  0.0036  0.0044  49  GLU B CB  
2025 C  CG  . GLU B 58  ? 0.6007 0.6209 0.6124 0.0027  -0.0012 0.0037  49  GLU B CG  
2026 C  CD  . GLU B 58  ? 0.5700 0.5718 0.5616 -0.0105 0.0144  -0.0023 49  GLU B CD  
2027 O  OE1 . GLU B 58  ? 0.5594 0.5872 0.5177 0.0075  0.0174  -0.0067 49  GLU B OE1 
2028 O  OE2 . GLU B 58  ? 0.5270 0.5621 0.5532 -0.0026 0.0361  0.0164  49  GLU B OE2 
2029 N  N   . LEU B 59  ? 0.5966 0.6004 0.5819 0.0085  -0.0020 0.0076  50  LEU B N   
2030 C  CA  . LEU B 59  ? 0.5923 0.5946 0.5827 0.0043  0.0019  0.0047  50  LEU B CA  
2031 C  C   . LEU B 59  ? 0.5834 0.5879 0.5698 0.0068  -0.0023 0.0073  50  LEU B C   
2032 O  O   . LEU B 59  ? 0.5648 0.5621 0.5340 0.0144  -0.0015 0.0197  50  LEU B O   
2033 C  CB  . LEU B 59  ? 0.5907 0.5931 0.5813 -0.0007 0.0021  0.0048  50  LEU B CB  
2034 C  CG  . LEU B 59  ? 0.6071 0.6006 0.5926 -0.0005 0.0022  -0.0017 50  LEU B CG  
2035 C  CD1 . LEU B 59  ? 0.6164 0.6019 0.6103 -0.0011 -0.0020 -0.0036 50  LEU B CD1 
2036 C  CD2 . LEU B 59  ? 0.6110 0.5953 0.5999 0.0032  0.0098  -0.0077 50  LEU B CD2 
2037 N  N   . HIS B 60  ? 0.6001 0.6030 0.5737 0.0062  0.0009  0.0006  51  HIS B N   
2038 C  CA  . HIS B 60  ? 0.6118 0.6095 0.5934 0.0007  0.0017  -0.0006 51  HIS B CA  
2039 C  C   . HIS B 60  ? 0.6258 0.6201 0.6013 0.0004  0.0062  -0.0020 51  HIS B C   
2040 O  O   . HIS B 60  ? 0.6421 0.6293 0.6097 -0.0089 0.0113  -0.0075 51  HIS B O   
2041 C  CB  . HIS B 60  ? 0.6236 0.6288 0.6094 0.0013  0.0040  -0.0071 51  HIS B CB  
2042 C  CG  . HIS B 60  ? 0.6600 0.6841 0.6508 0.0107  -0.0071 0.0067  51  HIS B CG  
2043 N  ND1 . HIS B 60  ? 0.7022 0.7372 0.6771 0.0159  0.0078  0.0114  51  HIS B ND1 
2044 C  CD2 . HIS B 60  ? 0.6794 0.6862 0.6616 0.0093  -0.0010 -0.0017 51  HIS B CD2 
2045 C  CE1 . HIS B 60  ? 0.7250 0.7319 0.6699 0.0164  -0.0018 0.0119  51  HIS B CE1 
2046 N  NE2 . HIS B 60  ? 0.6991 0.6890 0.6832 0.0067  0.0035  0.0177  51  HIS B NE2 
2047 N  N   . ASN B 61  ? 0.6205 0.6223 0.6037 0.0063  0.0027  -0.0027 52  ASN B N   
2048 C  CA  . ASN B 61  ? 0.6138 0.6136 0.6035 0.0037  0.0028  -0.0047 52  ASN B CA  
2049 C  C   . ASN B 61  ? 0.5995 0.6096 0.5958 0.0025  -0.0018 -0.0027 52  ASN B C   
2050 O  O   . ASN B 61  ? 0.6124 0.6271 0.6002 0.0041  -0.0164 0.0008  52  ASN B O   
2051 C  CB  . ASN B 61  ? 0.6382 0.6372 0.6244 -0.0013 0.0010  0.0037  52  ASN B CB  
2052 C  CG  . ASN B 61  ? 0.7250 0.7228 0.7031 0.0158  0.0129  -0.0108 52  ASN B CG  
2053 O  OD1 . ASN B 61  ? 0.8157 0.7573 0.7951 -0.0072 -0.0067 -0.0127 52  ASN B OD1 
2054 N  ND2 . ASN B 61  ? 0.7513 0.8017 0.7687 -0.0095 -0.0002 0.0010  52  ASN B ND2 
2055 N  N   . LYS B 62  ? 0.5778 0.5845 0.5689 0.0014  0.0004  0.0034  53  LYS B N   
2056 C  CA  . LYS B 62  ? 0.5591 0.5702 0.5533 0.0009  -0.0005 0.0077  53  LYS B CA  
2057 C  C   . LYS B 62  ? 0.5416 0.5504 0.5275 0.0074  0.0012  0.0024  53  LYS B C   
2058 O  O   . LYS B 62  ? 0.5371 0.5453 0.5232 0.0199  0.0118  0.0007  53  LYS B O   
2059 C  CB  . LYS B 62  ? 0.5649 0.5691 0.5659 0.0067  -0.0039 0.0000  53  LYS B CB  
2060 C  CG  . LYS B 62  ? 0.5766 0.5842 0.5713 0.0000  -0.0011 0.0030  53  LYS B CG  
2061 C  CD  . LYS B 62  ? 0.5863 0.5883 0.5873 -0.0027 0.0018  0.0055  53  LYS B CD  
2062 C  CE  . LYS B 62  ? 0.6004 0.6028 0.5957 -0.0011 0.0000  0.0076  53  LYS B CE  
2063 N  NZ  . LYS B 62  ? 0.6399 0.5787 0.6256 -0.0081 -0.0026 0.0125  53  LYS B NZ  
2064 N  N   . SER B 63  ? 0.5252 0.5261 0.4881 0.0042  -0.0104 0.0138  54  SER B N   
2065 C  CA  . SER B 63  ? 0.5236 0.5295 0.4952 0.0085  -0.0086 0.0051  54  SER B CA  
2066 C  C   . SER B 63  ? 0.4992 0.4932 0.4617 0.0112  -0.0081 0.0091  54  SER B C   
2067 O  O   . SER B 63  ? 0.5097 0.4730 0.4026 0.0229  -0.0191 0.0310  54  SER B O   
2068 C  CB  . SER B 63  ? 0.5276 0.5215 0.4823 0.0113  -0.0133 0.0097  54  SER B CB  
2069 O  OG  . SER B 63  ? 0.5124 0.5038 0.4233 0.0207  -0.0309 0.0204  54  SER B OG  
2070 N  N   . LEU B 64  ? 0.4959 0.4883 0.4819 0.0105  0.0002  0.0003  55  LEU B N   
2071 C  CA  . LEU B 64  ? 0.4927 0.5007 0.4837 0.0047  -0.0054 0.0046  55  LEU B CA  
2072 C  C   . LEU B 64  ? 0.5013 0.5122 0.4962 0.0007  -0.0045 0.0044  55  LEU B C   
2073 O  O   . LEU B 64  ? 0.4921 0.4987 0.4719 0.0126  -0.0129 0.0084  55  LEU B O   
2074 C  CB  . LEU B 64  ? 0.4895 0.5033 0.4875 0.0034  -0.0052 -0.0052 55  LEU B CB  
2075 C  CG  . LEU B 64  ? 0.4851 0.4849 0.4771 0.0047  -0.0036 -0.0042 55  LEU B CG  
2076 C  CD1 . LEU B 64  ? 0.4833 0.5125 0.4920 0.0071  -0.0055 0.0033  55  LEU B CD1 
2077 C  CD2 . LEU B 64  ? 0.4754 0.4856 0.4735 0.0139  -0.0068 0.0026  55  LEU B CD2 
2078 N  N   . GLU B 65  ? 0.5142 0.5218 0.5130 0.0040  -0.0020 0.0065  56  GLU B N   
2079 C  CA  . GLU B 65  ? 0.5187 0.5223 0.5073 0.0075  0.0000  0.0037  56  GLU B CA  
2080 C  C   . GLU B 65  ? 0.5056 0.4985 0.4956 0.0139  -0.0057 0.0046  56  GLU B C   
2081 O  O   . GLU B 65  ? 0.4946 0.5160 0.4681 0.0286  -0.0197 0.0149  56  GLU B O   
2082 C  CB  . GLU B 65  ? 0.5228 0.5263 0.5128 0.0147  -0.0014 0.0041  56  GLU B CB  
2083 C  CG  . GLU B 65  ? 0.5382 0.5449 0.5397 0.0102  -0.0059 -0.0012 56  GLU B CG  
2084 C  CD  . GLU B 65  ? 0.5627 0.5944 0.5913 0.0146  -0.0097 0.0086  56  GLU B CD  
2085 O  OE1 . GLU B 65  ? 0.6857 0.6687 0.6621 -0.0058 -0.0322 -0.0236 56  GLU B OE1 
2086 O  OE2 . GLU B 65  ? 0.6890 0.6360 0.7201 0.0335  0.0049  -0.0097 56  GLU B OE2 
2087 N  N   . GLU B 66  ? 0.5054 0.4987 0.4897 0.0051  -0.0054 0.0118  57  GLU B N   
2088 C  CA  . GLU B 66  ? 0.5141 0.5164 0.4961 0.0076  0.0009  0.0041  57  GLU B CA  
2089 C  C   . GLU B 66  ? 0.5138 0.5003 0.4823 0.0062  0.0008  0.0069  57  GLU B C   
2090 O  O   . GLU B 66  ? 0.5239 0.5022 0.4844 0.0086  0.0084  0.0330  57  GLU B O   
2091 C  CB  . GLU B 66  ? 0.5118 0.5184 0.4969 0.0077  -0.0031 -0.0089 57  GLU B CB  
2092 C  CG  . GLU B 66  ? 0.5496 0.5580 0.5168 0.0107  0.0057  0.0010  57  GLU B CG  
2093 C  CD  . GLU B 66  ? 0.5664 0.5571 0.5177 0.0080  -0.0029 -0.0117 57  GLU B CD  
2094 O  OE1 . GLU B 66  ? 0.6307 0.5702 0.5197 0.0218  -0.0174 0.0249  57  GLU B OE1 
2095 O  OE2 . GLU B 66  ? 0.6674 0.6131 0.5648 0.0142  0.0042  0.0149  57  GLU B OE2 
2096 N  N   . LEU B 67  ? 0.5030 0.4936 0.4716 0.0062  0.0014  0.0035  58  LEU B N   
2097 C  CA  . LEU B 67  ? 0.4989 0.4898 0.4787 0.0057  0.0017  0.0012  58  LEU B CA  
2098 C  C   . LEU B 67  ? 0.4839 0.4687 0.4412 0.0092  -0.0064 0.0131  58  LEU B C   
2099 O  O   . LEU B 67  ? 0.4733 0.4492 0.3743 0.0258  -0.0132 0.0185  58  LEU B O   
2100 C  CB  . LEU B 67  ? 0.5030 0.4898 0.4717 0.0048  -0.0026 0.0113  58  LEU B CB  
2101 C  CG  . LEU B 67  ? 0.4957 0.5006 0.4905 0.0006  0.0033  -0.0007 58  LEU B CG  
2102 C  CD1 . LEU B 67  ? 0.5400 0.4555 0.4500 0.0115  -0.0142 0.0029  58  LEU B CD1 
2103 C  CD2 . LEU B 67  ? 0.4885 0.4908 0.4961 -0.0003 0.0029  -0.0039 58  LEU B CD2 
2104 N  N   . LEU B 68  ? 0.4954 0.4660 0.4499 0.0111  -0.0061 0.0178  59  LEU B N   
2105 C  CA  . LEU B 68  ? 0.5103 0.4764 0.4707 0.0039  -0.0018 0.0027  59  LEU B CA  
2106 C  C   . LEU B 68  ? 0.5388 0.4853 0.4899 0.0017  -0.0044 0.0071  59  LEU B C   
2107 O  O   . LEU B 68  ? 0.5482 0.4482 0.4665 0.0049  0.0090  0.0189  59  LEU B O   
2108 C  CB  . LEU B 68  ? 0.4969 0.4592 0.4742 0.0041  -0.0069 -0.0002 59  LEU B CB  
2109 C  CG  . LEU B 68  ? 0.4202 0.4228 0.4158 -0.0023 -0.0080 -0.0015 59  LEU B CG  
2110 C  CD1 . LEU B 68  ? 0.4469 0.4312 0.3967 0.0120  0.0020  0.0295  59  LEU B CD1 
2111 C  CD2 . LEU B 68  ? 0.4220 0.4172 0.3723 0.0075  0.0176  0.0014  59  LEU B CD2 
2112 N  N   . CYS B 69  ? 0.5670 0.5083 0.5007 -0.0002 -0.0041 0.0076  60  CYS B N   
2113 C  CA  . CYS B 69  ? 0.5678 0.5173 0.5166 0.0063  -0.0064 0.0068  60  CYS B CA  
2114 C  C   . CYS B 69  ? 0.5699 0.5324 0.5259 -0.0016 -0.0112 0.0019  60  CYS B C   
2115 O  O   . CYS B 69  ? 0.6051 0.5522 0.5486 0.0017  -0.0097 0.0071  60  CYS B O   
2116 C  CB  . CYS B 69  ? 0.5775 0.5252 0.5474 0.0022  -0.0110 0.0026  60  CYS B CB  
2117 S  SG  . CYS B 69  ? 0.6252 0.5764 0.4995 0.0425  0.0033  0.0394  60  CYS B SG  
2118 N  N   . ASN B 70  ? 0.5642 0.5370 0.5365 -0.0005 -0.0064 0.0005  61  ASN B N   
2119 C  CA  . ASN B 70  ? 0.5787 0.5577 0.5557 0.0018  -0.0032 0.0035  61  ASN B CA  
2120 C  C   . ASN B 70  ? 0.5775 0.5569 0.5593 0.0021  -0.0018 0.0052  61  ASN B C   
2121 O  O   . ASN B 70  ? 0.5598 0.5264 0.5274 -0.0032 -0.0084 0.0276  61  ASN B O   
2122 C  CB  . ASN B 70  ? 0.5804 0.5552 0.5596 0.0057  0.0009  0.0062  61  ASN B CB  
2123 C  CG  . ASN B 70  ? 0.5836 0.5803 0.5716 -0.0026 -0.0167 0.0097  61  ASN B CG  
2124 O  OD1 . ASN B 70  ? 0.5985 0.5572 0.5095 0.0048  -0.0313 0.0441  61  ASN B OD1 
2125 N  ND2 . ASN B 70  ? 0.6223 0.5841 0.6062 0.0048  -0.0270 0.0122  61  ASN B ND2 
2126 N  N   . LEU B 71  ? 0.5950 0.5789 0.5698 0.0028  0.0001  0.0080  62  LEU B N   
2127 C  CA  . LEU B 71  ? 0.6063 0.5941 0.5940 0.0039  -0.0030 0.0047  62  LEU B CA  
2128 C  C   . LEU B 71  ? 0.6152 0.6026 0.6063 -0.0017 -0.0009 0.0036  62  LEU B C   
2129 O  O   . LEU B 71  ? 0.6215 0.5682 0.5813 0.0033  0.0012  -0.0008 62  LEU B O   
2130 C  CB  . LEU B 71  ? 0.6062 0.5871 0.5848 0.0031  -0.0032 0.0030  62  LEU B CB  
2131 C  CG  . LEU B 71  ? 0.6031 0.6004 0.6062 -0.0037 0.0047  -0.0015 62  LEU B CG  
2132 C  CD1 . LEU B 71  ? 0.5796 0.5876 0.5699 0.0012  -0.0032 0.0033  62  LEU B CD1 
2133 C  CD2 . LEU B 71  ? 0.6039 0.5901 0.6123 0.0012  0.0028  0.0092  62  LEU B CD2 
2134 N  N   . GLU B 72  ? 0.6382 0.6195 0.6290 0.0023  0.0013  0.0044  63  GLU B N   
2135 C  CA  . GLU B 72  ? 0.6481 0.6343 0.6451 -0.0046 -0.0003 0.0039  63  GLU B CA  
2136 C  C   . GLU B 72  ? 0.6600 0.6501 0.6590 -0.0045 0.0024  0.0053  63  GLU B C   
2137 O  O   . GLU B 72  ? 0.6730 0.6694 0.6726 -0.0027 -0.0010 0.0104  63  GLU B O   
2138 C  CB  . GLU B 72  ? 0.6684 0.6401 0.6629 -0.0040 -0.0052 0.0037  63  GLU B CB  
2139 C  CG  . GLU B 72  ? 0.7197 0.7397 0.7222 0.0092  0.0112  0.0036  63  GLU B CG  
2140 C  CD  . GLU B 72  ? 0.8328 0.8025 0.8257 -0.0065 -0.0035 -0.0176 63  GLU B CD  
2141 O  OE1 . GLU B 72  ? 0.8317 0.8230 0.8289 0.0183  -0.0109 0.0039  63  GLU B OE1 
2142 O  OE2 . GLU B 72  ? 0.8844 0.9172 0.8862 0.0052  -0.0251 0.0056  63  GLU B OE2 
2143 N  N   . THR B 73  ? 0.6672 0.6502 0.6471 -0.0045 0.0041  0.0050  64  THR B N   
2144 C  CA  . THR B 73  ? 0.6597 0.6468 0.6501 -0.0014 0.0053  0.0069  64  THR B CA  
2145 C  C   . THR B 73  ? 0.6605 0.6456 0.6419 -0.0018 0.0086  0.0089  64  THR B C   
2146 O  O   . THR B 73  ? 0.6663 0.6411 0.6341 -0.0054 0.0117  0.0178  64  THR B O   
2147 C  CB  . THR B 73  ? 0.6685 0.6677 0.6633 -0.0032 0.0003  0.0034  64  THR B CB  
2148 O  OG1 . THR B 73  ? 0.7079 0.6749 0.7034 -0.0053 0.0085  0.0052  64  THR B OG1 
2149 C  CG2 . THR B 73  ? 0.6912 0.6878 0.7005 0.0061  -0.0010 0.0008  64  THR B CG2 
2150 N  N   . LEU B 74  ? 0.6509 0.6342 0.6312 -0.0029 0.0137  0.0100  65  LEU B N   
2151 C  CA  . LEU B 74  ? 0.6369 0.6314 0.6237 -0.0053 0.0069  0.0059  65  LEU B CA  
2152 C  C   . LEU B 74  ? 0.6313 0.6227 0.6188 -0.0086 0.0067  0.0079  65  LEU B C   
2153 O  O   . LEU B 74  ? 0.6461 0.6272 0.6364 -0.0267 0.0077  0.0097  65  LEU B O   
2154 C  CB  . LEU B 74  ? 0.6288 0.6198 0.6234 -0.0045 0.0085  0.0067  65  LEU B CB  
2155 C  CG  . LEU B 74  ? 0.6210 0.6100 0.6113 -0.0025 0.0042  0.0053  65  LEU B CG  
2156 C  CD1 . LEU B 74  ? 0.6054 0.5962 0.6092 0.0027  0.0070  -0.0019 65  LEU B CD1 
2157 C  CD2 . LEU B 74  ? 0.6104 0.6109 0.6172 -0.0071 -0.0022 0.0082  65  LEU B CD2 
2158 N  N   . PRO B 75  ? 0.6214 0.6234 0.6080 -0.0089 0.0044  0.0057  66  PRO B N   
2159 C  CA  . PRO B 75  ? 0.6236 0.6244 0.6152 -0.0067 0.0059  0.0059  66  PRO B CA  
2160 C  C   . PRO B 75  ? 0.6233 0.6276 0.6216 -0.0092 0.0044  0.0019  66  PRO B C   
2161 O  O   . PRO B 75  ? 0.6284 0.6258 0.6366 -0.0107 0.0134  0.0106  66  PRO B O   
2162 C  CB  . PRO B 75  ? 0.6163 0.6181 0.6120 -0.0097 0.0051  0.0060  66  PRO B CB  
2163 C  CG  . PRO B 75  ? 0.6240 0.6237 0.6021 -0.0087 0.0107  0.0105  66  PRO B CG  
2164 C  CD  . PRO B 75  ? 0.6199 0.6204 0.6073 -0.0035 0.0056  0.0063  66  PRO B CD  
2165 N  N   . LYS B 76  ? 0.6220 0.6195 0.6148 -0.0077 0.0048  0.0040  67  LYS B N   
2166 C  CA  . LYS B 76  ? 0.6091 0.6054 0.6074 -0.0042 0.0008  0.0073  67  LYS B CA  
2167 C  C   . LYS B 76  ? 0.6026 0.6020 0.5977 -0.0037 0.0016  0.0037  67  LYS B C   
2168 O  O   . LYS B 76  ? 0.6201 0.6208 0.6024 -0.0073 0.0036  0.0201  67  LYS B O   
2169 C  CB  . LYS B 76  ? 0.6173 0.6255 0.6193 -0.0065 -0.0037 0.0114  67  LYS B CB  
2170 C  CG  . LYS B 76  ? 0.6467 0.6331 0.6457 -0.0045 0.0021  0.0041  67  LYS B CG  
2171 C  CD  . LYS B 76  ? 0.6581 0.6509 0.6542 0.0054  -0.0008 0.0056  67  LYS B CD  
2172 C  CE  . LYS B 76  ? 0.6626 0.6471 0.6730 0.0044  0.0018  0.0006  67  LYS B CE  
2173 N  NZ  . LYS B 76  ? 0.6604 0.6662 0.7163 0.0080  0.0044  -0.0054 67  LYS B NZ  
2174 N  N   . GLU B 77  ? 0.5804 0.5883 0.5870 -0.0049 0.0055  0.0081  68  GLU B N   
2175 C  CA  . GLU B 77  ? 0.5587 0.5797 0.5689 -0.0088 0.0031  0.0071  68  GLU B CA  
2176 C  C   . GLU B 77  ? 0.5431 0.5640 0.5563 -0.0063 0.0036  0.0115  68  GLU B C   
2177 O  O   . GLU B 77  ? 0.5402 0.5657 0.5718 -0.0063 0.0080  0.0219  68  GLU B O   
2178 C  CB  . GLU B 77  ? 0.5736 0.5898 0.5763 0.0008  -0.0011 0.0036  68  GLU B CB  
2179 C  CG  . GLU B 77  ? 0.6235 0.6439 0.6513 -0.0097 0.0051  -0.0020 68  GLU B CG  
2180 C  CD  . GLU B 77  ? 0.7145 0.7106 0.6780 0.0037  0.0059  0.0121  68  GLU B CD  
2181 O  OE1 . GLU B 77  ? 0.7271 0.7401 0.7261 -0.0154 -0.0016 -0.0054 68  GLU B OE1 
2182 O  OE2 . GLU B 77  ? 0.7940 0.7434 0.7827 -0.0211 0.0051  0.0005  68  GLU B OE2 
2183 N  N   . ILE B 78  ? 0.5289 0.5332 0.5164 -0.0037 0.0114  0.0126  69  ILE B N   
2184 C  CA  . ILE B 78  ? 0.5091 0.5126 0.4998 0.0018  0.0044  0.0068  69  ILE B CA  
2185 C  C   . ILE B 78  ? 0.4871 0.4915 0.4603 -0.0052 0.0072  0.0064  69  ILE B C   
2186 O  O   . ILE B 78  ? 0.4646 0.5045 0.4380 -0.0035 0.0122  0.0130  69  ILE B O   
2187 C  CB  . ILE B 78  ? 0.5070 0.5102 0.4998 0.0054  0.0061  0.0069  69  ILE B CB  
2188 C  CG1 . ILE B 78  ? 0.5046 0.5192 0.5125 -0.0101 0.0032  0.0045  69  ILE B CG1 
2189 C  CG2 . ILE B 78  ? 0.5460 0.5636 0.5482 0.0131  0.0095  -0.0001 69  ILE B CG2 
2190 C  CD1 . ILE B 78  ? 0.5280 0.5196 0.4928 -0.0020 0.0109  -0.0031 69  ILE B CD1 
2191 N  N   . VAL B 79  ? 0.4720 0.4821 0.4601 -0.0042 0.0106  0.0111  70  VAL B N   
2192 C  CA  . VAL B 79  ? 0.4781 0.4830 0.4581 -0.0051 0.0106  0.0119  70  VAL B CA  
2193 C  C   . VAL B 79  ? 0.4591 0.4706 0.4423 -0.0072 0.0059  0.0221  70  VAL B C   
2194 O  O   . VAL B 79  ? 0.4572 0.4594 0.4197 -0.0205 0.0111  0.0286  70  VAL B O   
2195 C  CB  . VAL B 79  ? 0.4901 0.4882 0.4943 -0.0043 0.0063  0.0109  70  VAL B CB  
2196 C  CG1 . VAL B 79  ? 0.5198 0.4950 0.4769 -0.0069 0.0023  0.0015  70  VAL B CG1 
2197 C  CG2 . VAL B 79  ? 0.4843 0.4824 0.4870 0.0008  0.0084  0.0137  70  VAL B CG2 
2198 N  N   . THR B 80  ? 0.4332 0.4597 0.4394 -0.0048 0.0092  0.0172  71  THR B N   
2199 C  CA  . THR B 80  ? 0.4307 0.4352 0.4200 -0.0051 0.0051  0.0081  71  THR B CA  
2200 C  C   . THR B 80  ? 0.4035 0.4214 0.4037 -0.0009 0.0103  0.0066  71  THR B C   
2201 O  O   . THR B 80  ? 0.4122 0.4265 0.4034 0.0129  0.0337  -0.0060 71  THR B O   
2202 C  CB  . THR B 80  ? 0.4285 0.4427 0.4336 -0.0084 0.0003  0.0065  71  THR B CB  
2203 O  OG1 . THR B 80  ? 0.4469 0.4408 0.3936 -0.0446 -0.0072 0.0406  71  THR B OG1 
2204 C  CG2 . THR B 80  ? 0.4176 0.4568 0.4364 -0.0083 -0.0013 0.0129  71  THR B CG2 
2205 N  N   . ALA B 81  ? 0.3851 0.4086 0.3902 -0.0122 0.0097  0.0084  72  ALA B N   
2206 C  CA  . ALA B 81  ? 0.3963 0.4049 0.3970 -0.0035 0.0060  0.0108  72  ALA B CA  
2207 C  C   . ALA B 81  ? 0.3963 0.3815 0.3671 -0.0073 -0.0031 0.0215  72  ALA B C   
2208 O  O   . ALA B 81  ? 0.3773 0.3657 0.3401 -0.0068 0.0082  0.0420  72  ALA B O   
2209 C  CB  . ALA B 81  ? 0.3970 0.4154 0.3940 -0.0033 0.0090  0.0050  72  ALA B CB  
2210 N  N   . VAL B 82  ? 0.3941 0.3889 0.3746 -0.0194 0.0101  0.0155  73  VAL B N   
2211 C  CA  . VAL B 82  ? 0.3773 0.3690 0.3547 -0.0026 0.0093  0.0202  73  VAL B CA  
2212 C  C   . VAL B 82  ? 0.3738 0.3584 0.3249 -0.0096 0.0064  0.0280  73  VAL B C   
2213 O  O   . VAL B 82  ? 0.3879 0.3913 0.3261 -0.0089 0.0061  0.0297  73  VAL B O   
2214 C  CB  . VAL B 82  ? 0.3752 0.3718 0.3503 -0.0026 0.0098  0.0094  73  VAL B CB  
2215 C  CG1 . VAL B 82  ? 0.3972 0.3605 0.3836 -0.0038 0.0066  0.0248  73  VAL B CG1 
2216 C  CG2 . VAL B 82  ? 0.3846 0.3677 0.3065 0.0001  0.0120  0.0181  73  VAL B CG2 
2217 N  N   . ARG B 83  ? 0.3610 0.3668 0.3308 -0.0063 0.0052  0.0287  74  ARG B N   
2218 C  CA  . ARG B 83  ? 0.3599 0.3489 0.3322 -0.0024 0.0009  0.0197  74  ARG B CA  
2219 C  C   . ARG B 83  ? 0.3417 0.3339 0.3047 -0.0010 0.0003  0.0125  74  ARG B C   
2220 O  O   . ARG B 83  ? 0.3474 0.3330 0.3078 -0.0014 -0.0106 0.0039  74  ARG B O   
2221 C  CB  . ARG B 83  ? 0.3568 0.3555 0.3406 -0.0046 0.0019  0.0365  74  ARG B CB  
2222 C  CG  . ARG B 83  ? 0.3612 0.3697 0.3599 -0.0091 0.0065  0.0110  74  ARG B CG  
2223 C  CD  . ARG B 83  ? 0.3955 0.3978 0.3765 -0.0078 -0.0081 0.0035  74  ARG B CD  
2224 N  NE  . ARG B 83  ? 0.3617 0.4397 0.4393 -0.0129 0.0157  -0.0111 74  ARG B NE  
2225 C  CZ  . ARG B 83  ? 0.4530 0.4617 0.4377 -0.0079 0.0078  -0.0168 74  ARG B CZ  
2226 N  NH1 . ARG B 83  ? 0.4611 0.5190 0.4990 -0.0187 0.0077  -0.0226 74  ARG B NH1 
2227 N  NH2 . ARG B 83  ? 0.4256 0.4487 0.4514 -0.0151 0.0194  -0.0046 74  ARG B NH2 
2228 N  N   . ASN B 84  ? 0.3410 0.3268 0.3030 0.0032  0.0087  0.0147  75  ASN B N   
2229 C  CA  . ASN B 84  ? 0.3301 0.3289 0.3009 0.0089  0.0015  0.0110  75  ASN B CA  
2230 C  C   . ASN B 84  ? 0.3203 0.3301 0.2887 0.0127  0.0057  0.0106  75  ASN B C   
2231 O  O   . ASN B 84  ? 0.3248 0.3253 0.2859 0.0176  -0.0034 -0.0113 75  ASN B O   
2232 C  CB  . ASN B 84  ? 0.3371 0.3271 0.2953 0.0203  0.0043  0.0143  75  ASN B CB  
2233 C  CG  . ASN B 84  ? 0.3157 0.3423 0.3444 0.0013  -0.0186 0.0104  75  ASN B CG  
2234 O  OD1 . ASN B 84  ? 0.3575 0.3532 0.2833 -0.0047 0.0034  -0.0139 75  ASN B OD1 
2235 N  ND2 . ASN B 84  ? 0.3230 0.3735 0.3223 0.0125  -0.0060 0.0040  75  ASN B ND2 
2236 N  N   . ASN B 85  ? 0.3296 0.3365 0.2876 0.0036  0.0071  0.0091  76  ASN B N   
2237 C  CA  . ASN B 85  ? 0.3234 0.3252 0.2974 0.0077  -0.0016 0.0135  76  ASN B CA  
2238 C  C   . ASN B 85  ? 0.3111 0.3100 0.3034 0.0076  -0.0039 0.0084  76  ASN B C   
2239 O  O   . ASN B 85  ? 0.2819 0.2856 0.2732 0.0186  -0.0170 -0.0005 76  ASN B O   
2240 C  CB  . ASN B 85  ? 0.3245 0.3476 0.3241 0.0014  -0.0055 0.0183  76  ASN B CB  
2241 C  CG  . ASN B 85  ? 0.3177 0.3353 0.3033 0.0107  -0.0066 0.0154  76  ASN B CG  
2242 O  OD1 . ASN B 85  ? 0.3696 0.3434 0.3576 0.0176  0.0029  0.0312  76  ASN B OD1 
2243 N  ND2 . ASN B 85  ? 0.3253 0.2477 0.3632 0.0156  -0.0185 0.0322  76  ASN B ND2 
2244 N  N   . GLY B 86  ? 0.3222 0.3345 0.2909 0.0119  -0.0005 0.0048  77  GLY B N   
2245 C  CA  . GLY B 86  ? 0.3270 0.3324 0.2977 0.0084  -0.0022 0.0142  77  GLY B CA  
2246 C  C   . GLY B 86  ? 0.3210 0.3284 0.2719 -0.0001 0.0014  0.0082  77  GLY B C   
2247 O  O   . GLY B 86  ? 0.3209 0.3317 0.2355 -0.0117 -0.0136 0.0056  77  GLY B O   
2248 N  N   . GLY B 87  ? 0.3179 0.3284 0.3087 -0.0100 0.0016  0.0033  78  GLY B N   
2249 C  CA  . GLY B 87  ? 0.3146 0.3130 0.2984 0.0012  -0.0014 0.0031  78  GLY B CA  
2250 C  C   . GLY B 87  ? 0.2982 0.2947 0.2946 0.0056  -0.0089 -0.0036 78  GLY B C   
2251 O  O   . GLY B 87  ? 0.2965 0.3027 0.2952 0.0323  -0.0111 0.0126  78  GLY B O   
2252 N  N   . GLY B 88  ? 0.2870 0.2931 0.2986 0.0170  -0.0038 0.0019  79  GLY B N   
2253 C  CA  . GLY B 88  ? 0.2949 0.2966 0.2956 0.0074  -0.0059 0.0072  79  GLY B CA  
2254 C  C   . GLY B 88  ? 0.3033 0.3268 0.2746 0.0105  -0.0077 0.0127  79  GLY B C   
2255 O  O   . GLY B 88  ? 0.3136 0.3273 0.2001 -0.0206 -0.0036 0.0368  79  GLY B O   
2256 N  N   . HIS B 89  ? 0.3092 0.3275 0.2932 0.0182  -0.0039 0.0132  80  HIS B N   
2257 C  CA  . HIS B 89  ? 0.3115 0.3077 0.3067 0.0065  -0.0053 0.0059  80  HIS B CA  
2258 C  C   . HIS B 89  ? 0.3078 0.3193 0.3037 0.0064  -0.0060 0.0046  80  HIS B C   
2259 O  O   . HIS B 89  ? 0.2995 0.3398 0.2854 0.0227  -0.0132 0.0045  80  HIS B O   
2260 C  CB  . HIS B 89  ? 0.3154 0.3023 0.3090 0.0183  -0.0037 0.0076  80  HIS B CB  
2261 C  CG  . HIS B 89  ? 0.3080 0.3053 0.3078 0.0170  -0.0009 0.0009  80  HIS B CG  
2262 N  ND1 . HIS B 89  ? 0.3418 0.3448 0.3149 0.0044  0.0041  -0.0044 80  HIS B ND1 
2263 C  CD2 . HIS B 89  ? 0.3249 0.3010 0.2961 -0.0067 -0.0081 0.0165  80  HIS B CD2 
2264 C  CE1 . HIS B 89  ? 0.3125 0.3612 0.3304 -0.0107 -0.0087 0.0083  80  HIS B CE1 
2265 N  NE2 . HIS B 89  ? 0.2825 0.3774 0.2654 -0.0073 0.0097  0.0009  80  HIS B NE2 
2266 N  N   . TYR B 90  ? 0.3226 0.3289 0.3206 0.0132  -0.0196 -0.0009 81  TYR B N   
2267 C  CA  . TYR B 90  ? 0.3165 0.3225 0.3134 0.0095  -0.0142 -0.0024 81  TYR B CA  
2268 C  C   . TYR B 90  ? 0.3278 0.3187 0.2950 0.0046  -0.0130 -0.0083 81  TYR B C   
2269 O  O   . TYR B 90  ? 0.3304 0.3199 0.2477 -0.0025 -0.0088 -0.0003 81  TYR B O   
2270 C  CB  . TYR B 90  ? 0.3229 0.3457 0.3110 0.0088  -0.0104 0.0094  81  TYR B CB  
2271 C  CG  . TYR B 90  ? 0.3352 0.3317 0.3218 0.0195  -0.0037 0.0073  81  TYR B CG  
2272 C  CD1 . TYR B 90  ? 0.3094 0.3684 0.3223 0.0205  -0.0011 -0.0324 81  TYR B CD1 
2273 C  CD2 . TYR B 90  ? 0.3284 0.3107 0.2979 0.0242  -0.0042 0.0076  81  TYR B CD2 
2274 C  CE1 . TYR B 90  ? 0.3620 0.3459 0.3179 0.0305  -0.0176 0.0134  81  TYR B CE1 
2275 C  CE2 . TYR B 90  ? 0.3817 0.3904 0.3314 0.0410  -0.0269 -0.0002 81  TYR B CE2 
2276 C  CZ  . TYR B 90  ? 0.3837 0.3819 0.3335 0.0452  -0.0253 -0.0123 81  TYR B CZ  
2277 O  OH  . TYR B 90  ? 0.3821 0.4062 0.3526 0.0619  -0.0262 -0.0052 81  TYR B OH  
2278 N  N   . CYS B 91  ? 0.3230 0.3316 0.2858 0.0144  -0.0225 0.0048  82  CYS B N   
2279 C  CA  . CYS B 91  ? 0.3227 0.3323 0.3044 0.0039  -0.0154 -0.0015 82  CYS B CA  
2280 C  C   . CYS B 91  ? 0.3187 0.3231 0.2931 0.0065  -0.0155 -0.0032 82  CYS B C   
2281 O  O   . CYS B 91  ? 0.3279 0.3146 0.3229 0.0066  -0.0012 -0.0043 82  CYS B O   
2282 C  CB  . CYS B 91  ? 0.3167 0.3362 0.2987 0.0052  -0.0197 0.0047  82  CYS B CB  
2283 S  SG  . CYS B 91  ? 0.3720 0.3183 0.2638 -0.0020 -0.0081 -0.0170 82  CYS B SG  
2284 N  N   . HIS B 92  ? 0.3173 0.3082 0.2791 0.0084  -0.0132 -0.0034 83  HIS B N   
2285 C  CA  . HIS B 92  ? 0.2998 0.3158 0.2891 0.0041  -0.0083 -0.0099 83  HIS B CA  
2286 C  C   . HIS B 92  ? 0.3010 0.3234 0.2882 0.0072  -0.0085 -0.0019 83  HIS B C   
2287 O  O   . HIS B 92  ? 0.2972 0.2978 0.2947 -0.0027 -0.0295 0.0026  83  HIS B O   
2288 C  CB  . HIS B 92  ? 0.3010 0.2926 0.2774 -0.0008 -0.0105 -0.0038 83  HIS B CB  
2289 C  CG  . HIS B 92  ? 0.2744 0.2772 0.2551 -0.0015 0.0001  -0.0145 83  HIS B CG  
2290 N  ND1 . HIS B 92  ? 0.2702 0.2999 0.2156 0.0182  -0.0396 -0.0214 83  HIS B ND1 
2291 C  CD2 . HIS B 92  ? 0.2722 0.2696 0.2320 0.0040  -0.0133 -0.0007 83  HIS B CD2 
2292 C  CE1 . HIS B 92  ? 0.3042 0.2718 0.1367 0.0191  -0.0290 -0.0057 83  HIS B CE1 
2293 N  NE2 . HIS B 92  ? 0.2503 0.2496 0.2168 -0.0023 -0.0267 0.0024  83  HIS B NE2 
2294 N  N   . SER B 93  ? 0.3076 0.3403 0.3036 0.0163  -0.0008 0.0053  84  SER B N   
2295 C  CA  . SER B 93  ? 0.3203 0.3328 0.2945 0.0046  0.0027  -0.0078 84  SER B CA  
2296 C  C   . SER B 93  ? 0.3356 0.3486 0.3030 0.0070  -0.0028 -0.0085 84  SER B C   
2297 O  O   . SER B 93  ? 0.3367 0.3600 0.2394 0.0083  -0.0017 -0.0333 84  SER B O   
2298 C  CB  . SER B 93  ? 0.3373 0.3550 0.3024 0.0069  -0.0007 -0.0099 84  SER B CB  
2299 O  OG  . SER B 93  ? 0.3514 0.3582 0.3009 0.0083  0.0001  0.0043  84  SER B OG  
2300 N  N   . LEU B 94  ? 0.3420 0.3491 0.2974 0.0085  0.0006  0.0061  85  LEU B N   
2301 C  CA  . LEU B 94  ? 0.3315 0.3377 0.3026 0.0056  0.0033  0.0002  85  LEU B CA  
2302 C  C   . LEU B 94  ? 0.3215 0.3438 0.3031 0.0048  -0.0020 0.0106  85  LEU B C   
2303 O  O   . LEU B 94  ? 0.3162 0.3478 0.2963 -0.0065 -0.0115 0.0101  85  LEU B O   
2304 C  CB  . LEU B 94  ? 0.3532 0.3520 0.3049 -0.0016 -0.0089 0.0133  85  LEU B CB  
2305 C  CG  . LEU B 94  ? 0.3669 0.3894 0.3672 0.0133  0.0071  -0.0011 85  LEU B CG  
2306 C  CD1 . LEU B 94  ? 0.3250 0.3632 0.3504 0.0103  -0.0066 0.0124  85  LEU B CD1 
2307 C  CD2 . LEU B 94  ? 0.3536 0.3657 0.3712 0.0070  0.0143  0.0108  85  LEU B CD2 
2308 N  N   . PHE B 95  ? 0.2943 0.3282 0.2899 0.0102  0.0034  -0.0095 86  PHE B N   
2309 C  CA  . PHE B 95  ? 0.3071 0.3050 0.2885 0.0136  -0.0152 0.0058  86  PHE B CA  
2310 C  C   . PHE B 95  ? 0.3039 0.3095 0.2733 0.0164  -0.0199 0.0037  86  PHE B C   
2311 O  O   . PHE B 95  ? 0.3280 0.3072 0.2801 0.0174  -0.0186 -0.0055 86  PHE B O   
2312 C  CB  . PHE B 95  ? 0.2909 0.2966 0.2850 0.0097  -0.0096 -0.0037 86  PHE B CB  
2313 C  CG  . PHE B 95  ? 0.2860 0.3017 0.2830 0.0100  -0.0102 -0.0100 86  PHE B CG  
2314 C  CD1 . PHE B 95  ? 0.2689 0.2577 0.2589 0.0232  -0.0043 0.0187  86  PHE B CD1 
2315 C  CD2 . PHE B 95  ? 0.3044 0.2517 0.2519 -0.0165 -0.0347 -0.0027 86  PHE B CD2 
2316 C  CE1 . PHE B 95  ? 0.2854 0.2806 0.2738 0.0299  -0.0085 -0.0294 86  PHE B CE1 
2317 C  CE2 . PHE B 95  ? 0.2805 0.2993 0.2961 -0.0117 0.0139  -0.0048 86  PHE B CE2 
2318 C  CZ  . PHE B 95  ? 0.3177 0.3023 0.2613 0.0046  -0.0102 -0.0081 86  PHE B CZ  
2319 N  N   . TRP B 96  ? 0.3009 0.3128 0.2764 0.0196  -0.0262 0.0061  87  TRP B N   
2320 C  CA  . TRP B 96  ? 0.3256 0.3229 0.3018 0.0084  -0.0157 0.0046  87  TRP B CA  
2321 C  C   . TRP B 96  ? 0.3196 0.3409 0.3193 0.0135  -0.0154 -0.0012 87  TRP B C   
2322 O  O   . TRP B 96  ? 0.3314 0.3488 0.3137 0.0270  -0.0296 -0.0114 87  TRP B O   
2323 C  CB  . TRP B 96  ? 0.3175 0.3248 0.3082 0.0150  -0.0172 0.0082  87  TRP B CB  
2324 C  CG  . TRP B 96  ? 0.2910 0.3191 0.2933 0.0224  -0.0174 -0.0136 87  TRP B CG  
2325 C  CD1 . TRP B 96  ? 0.3092 0.3048 0.2882 -0.0074 -0.0104 0.0259  87  TRP B CD1 
2326 C  CD2 . TRP B 96  ? 0.2997 0.3381 0.2906 0.0197  0.0073  0.0093  87  TRP B CD2 
2327 N  NE1 . TRP B 96  ? 0.2966 0.2633 0.2954 0.0165  -0.0106 -0.0371 87  TRP B NE1 
2328 C  CE2 . TRP B 96  ? 0.2818 0.2971 0.2663 0.0000  0.0025  0.0366  87  TRP B CE2 
2329 C  CE3 . TRP B 96  ? 0.3011 0.3432 0.3121 0.0162  -0.0009 -0.0051 87  TRP B CE3 
2330 C  CZ2 . TRP B 96  ? 0.2826 0.3159 0.3105 -0.0069 -0.0162 0.0001  87  TRP B CZ2 
2331 C  CZ3 . TRP B 96  ? 0.3132 0.3494 0.2977 0.0111  0.0028  0.0067  87  TRP B CZ3 
2332 C  CH2 . TRP B 96  ? 0.2938 0.2769 0.2911 0.0175  -0.0152 0.0139  87  TRP B CH2 
2333 N  N   . GLU B 97  ? 0.3462 0.3463 0.3379 0.0157  -0.0192 -0.0095 88  GLU B N   
2334 C  CA  . GLU B 97  ? 0.3723 0.3888 0.3519 0.0150  -0.0149 0.0025  88  GLU B CA  
2335 C  C   . GLU B 97  ? 0.3601 0.3655 0.3445 0.0114  -0.0137 -0.0038 88  GLU B C   
2336 O  O   . GLU B 97  ? 0.3715 0.3748 0.3130 0.0059  -0.0311 -0.0100 88  GLU B O   
2337 C  CB  . GLU B 97  ? 0.4050 0.4122 0.3735 0.0046  -0.0187 0.0194  88  GLU B CB  
2338 C  CG  . GLU B 97  ? 0.4577 0.4673 0.4439 -0.0073 -0.0005 0.0051  88  GLU B CG  
2339 C  CD  . GLU B 97  ? 0.4480 0.4798 0.4258 -0.0004 0.0062  0.0068  88  GLU B CD  
2340 O  OE1 . GLU B 97  ? 0.6330 0.5780 0.5343 0.0086  -0.0267 -0.0390 88  GLU B OE1 
2341 O  OE2 . GLU B 97  ? 0.5652 0.4928 0.5025 -0.0108 0.0131  0.0308  88  GLU B OE2 
2342 N  N   . VAL B 98  ? 0.3520 0.3704 0.3445 0.0136  -0.0186 -0.0030 89  VAL B N   
2343 C  CA  . VAL B 98  ? 0.3419 0.3659 0.3453 0.0136  -0.0135 0.0028  89  VAL B CA  
2344 C  C   . VAL B 98  ? 0.3525 0.3675 0.3286 0.0185  -0.0226 0.0025  89  VAL B C   
2345 O  O   . VAL B 98  ? 0.3323 0.3955 0.3605 0.0319  -0.0293 0.0339  89  VAL B O   
2346 C  CB  . VAL B 98  ? 0.3453 0.3710 0.3504 0.0168  -0.0047 0.0049  89  VAL B CB  
2347 C  CG1 . VAL B 98  ? 0.3676 0.3660 0.4104 0.0141  0.0235  0.0089  89  VAL B CG1 
2348 C  CG2 . VAL B 98  ? 0.3659 0.3464 0.3815 0.0024  -0.0080 0.0052  89  VAL B CG2 
2349 N  N   . MET B 99  ? 0.3438 0.3515 0.2773 0.0060  -0.0287 -0.0107 90  MET B N   
2350 C  CA  . MET B 99  ? 0.3436 0.3488 0.3434 0.0083  -0.0208 -0.0027 90  MET B CA  
2351 C  C   . MET B 99  ? 0.3597 0.3887 0.3498 -0.0065 -0.0204 -0.0094 90  MET B C   
2352 O  O   . MET B 99  ? 0.3404 0.3944 0.3933 -0.0077 0.0021  -0.0039 90  MET B O   
2353 C  CB  . MET B 99  ? 0.3415 0.3077 0.2923 0.0106  -0.0136 -0.0017 90  MET B CB  
2354 C  CG  . MET B 99  ? 0.3056 0.3370 0.3540 0.0029  -0.0215 0.0085  90  MET B CG  
2355 S  SD  . MET B 99  ? 0.3322 0.3300 0.3262 0.0158  -0.0310 -0.0245 90  MET B SD  
2356 C  CE  . MET B 99  ? 0.3365 0.3288 0.3422 0.0074  -0.0013 0.0001  90  MET B CE  
2357 N  N   . SER B 100 ? 0.3728 0.4170 0.3732 -0.0093 -0.0201 -0.0058 91  SER B N   
2358 C  CA  . SER B 100 ? 0.3968 0.4110 0.4014 -0.0083 -0.0111 -0.0067 91  SER B CA  
2359 C  C   . SER B 100 ? 0.4108 0.4275 0.4001 -0.0003 -0.0108 -0.0007 91  SER B C   
2360 O  O   . SER B 100 ? 0.3920 0.4217 0.3615 -0.0016 -0.0397 -0.0072 91  SER B O   
2361 C  CB  . SER B 100 ? 0.4212 0.4165 0.4067 -0.0111 -0.0091 -0.0024 91  SER B CB  
2362 O  OG  . SER B 100 ? 0.4143 0.4831 0.4318 -0.0349 -0.0265 0.0022  91  SER B OG  
2363 N  N   . PRO B 101 ? 0.4183 0.4369 0.4166 0.0021  -0.0053 -0.0063 92  PRO B N   
2364 C  CA  . PRO B 101 ? 0.4258 0.4411 0.4199 -0.0037 -0.0091 0.0019  92  PRO B CA  
2365 C  C   . PRO B 101 ? 0.4145 0.4409 0.4182 -0.0050 -0.0055 -0.0040 92  PRO B C   
2366 O  O   . PRO B 101 ? 0.4160 0.4442 0.3686 -0.0118 -0.0306 -0.0077 92  PRO B O   
2367 C  CB  . PRO B 101 ? 0.4199 0.4431 0.4302 -0.0015 -0.0123 0.0053  92  PRO B CB  
2368 C  CG  . PRO B 101 ? 0.4320 0.4471 0.3998 -0.0023 -0.0117 0.0073  92  PRO B CG  
2369 C  CD  . PRO B 101 ? 0.4404 0.4548 0.4436 -0.0018 -0.0021 -0.0069 92  PRO B CD  
2370 N  N   . ARG B 102 ? 0.4197 0.4481 0.4168 -0.0064 -0.0072 0.0000  93  ARG B N   
2371 C  CA  . ARG B 102 ? 0.4519 0.4772 0.4571 0.0009  -0.0088 0.0024  93  ARG B CA  
2372 C  C   . ARG B 102 ? 0.4532 0.4867 0.4762 0.0042  -0.0082 0.0065  93  ARG B C   
2373 O  O   . ARG B 102 ? 0.4603 0.5042 0.4725 0.0114  -0.0246 0.0274  93  ARG B O   
2374 C  CB  . ARG B 102 ? 0.4721 0.5013 0.4751 -0.0002 -0.0097 0.0008  93  ARG B CB  
2375 C  CG  . ARG B 102 ? 0.4788 0.5114 0.4977 -0.0057 -0.0162 -0.0035 93  ARG B CG  
2376 C  CD  . ARG B 102 ? 0.5257 0.5353 0.4988 -0.0029 -0.0240 -0.0106 93  ARG B CD  
2377 N  NE  . ARG B 102 ? 0.5880 0.6052 0.5934 -0.0114 -0.0012 0.0114  93  ARG B NE  
2378 C  CZ  . ARG B 102 ? 0.6259 0.6205 0.6199 0.0080  0.0147  -0.0072 93  ARG B CZ  
2379 N  NH1 . ARG B 102 ? 0.6435 0.6358 0.6598 0.0022  0.0109  0.0124  93  ARG B NH1 
2380 N  NH2 . ARG B 102 ? 0.6317 0.6196 0.6378 0.0165  0.0261  -0.0077 93  ARG B NH2 
2381 N  N   . GLY B 103 ? 0.4481 0.4768 0.4622 0.0041  -0.0101 0.0001  94  GLY B N   
2382 C  CA  . GLY B 103 ? 0.4446 0.4686 0.4545 0.0031  -0.0091 0.0042  94  GLY B CA  
2383 C  C   . GLY B 103 ? 0.4297 0.4670 0.4359 -0.0028 -0.0128 0.0048  94  GLY B C   
2384 O  O   . GLY B 103 ? 0.4064 0.4780 0.4232 -0.0194 -0.0167 -0.0113 94  GLY B O   
2385 N  N   . GLY B 104 ? 0.4384 0.4608 0.4502 0.0029  -0.0064 0.0047  95  GLY B N   
2386 C  CA  . GLY B 104 ? 0.4560 0.4745 0.4636 0.0057  -0.0109 0.0006  95  GLY B CA  
2387 C  C   . GLY B 104 ? 0.4698 0.4869 0.4799 0.0116  -0.0080 -0.0025 95  GLY B C   
2388 O  O   . GLY B 104 ? 0.4560 0.4913 0.4735 0.0110  -0.0276 0.0062  95  GLY B O   
2389 N  N   . GLY B 105 ? 0.4739 0.5005 0.4884 0.0152  -0.0008 -0.0001 96  GLY B N   
2390 C  CA  . GLY B 105 ? 0.4889 0.4945 0.5056 0.0116  0.0005  0.0002  96  GLY B CA  
2391 C  C   . GLY B 105 ? 0.4838 0.4948 0.5080 0.0082  0.0006  0.0120  96  GLY B C   
2392 O  O   . GLY B 105 ? 0.4641 0.4630 0.5000 0.0186  -0.0089 0.0101  96  GLY B O   
2393 N  N   . GLU B 106 ? 0.4860 0.5152 0.5246 0.0070  -0.0077 0.0124  97  GLU B N   
2394 C  CA  . GLU B 106 ? 0.5012 0.5112 0.5306 0.0100  -0.0084 0.0012  97  GLU B CA  
2395 C  C   . GLU B 106 ? 0.4791 0.5081 0.5272 0.0233  -0.0125 0.0032  97  GLU B C   
2396 O  O   . GLU B 106 ? 0.4564 0.5167 0.5545 0.0321  -0.0327 0.0003  97  GLU B O   
2397 C  CB  . GLU B 106 ? 0.5002 0.5160 0.5240 0.0118  -0.0150 0.0017  97  GLU B CB  
2398 C  CG  . GLU B 106 ? 0.5647 0.6056 0.5908 0.0081  0.0147  0.0067  97  GLU B CG  
2399 C  CD  . GLU B 106 ? 0.6374 0.6447 0.6534 -0.0099 -0.0012 -0.0167 97  GLU B CD  
2400 O  OE1 . GLU B 106 ? 0.6827 0.6784 0.7372 0.0132  -0.0014 0.0170  97  GLU B OE1 
2401 O  OE2 . GLU B 106 ? 0.7015 0.6807 0.6866 0.0019  0.0020  0.0226  97  GLU B OE2 
2402 N  N   . PRO B 107 ? 0.4905 0.5183 0.5306 0.0198  -0.0144 0.0051  98  PRO B N   
2403 C  CA  . PRO B 107 ? 0.5158 0.5345 0.5429 0.0155  -0.0044 0.0043  98  PRO B CA  
2404 C  C   . PRO B 107 ? 0.5246 0.5538 0.5505 0.0105  -0.0057 0.0049  98  PRO B C   
2405 O  O   . PRO B 107 ? 0.4912 0.5601 0.5562 0.0175  -0.0139 0.0261  98  PRO B O   
2406 C  CB  . PRO B 107 ? 0.5138 0.5289 0.5366 0.0156  -0.0087 0.0042  98  PRO B CB  
2407 C  CG  . PRO B 107 ? 0.5190 0.5207 0.5397 0.0086  0.0002  0.0009  98  PRO B CG  
2408 C  CD  . PRO B 107 ? 0.5063 0.5132 0.5264 0.0197  -0.0083 0.0089  98  PRO B CD  
2409 N  N   . ASN B 108 ? 0.5533 0.5757 0.5686 0.0086  -0.0090 -0.0012 99  ASN B N   
2410 C  CA  . ASN B 108 ? 0.5732 0.5884 0.5834 0.0018  -0.0097 -0.0007 99  ASN B CA  
2411 C  C   . ASN B 108 ? 0.5816 0.5918 0.5938 -0.0003 -0.0069 -0.0014 99  ASN B C   
2412 O  O   . ASN B 108 ? 0.5737 0.5630 0.6225 -0.0059 -0.0137 -0.0184 99  ASN B O   
2413 C  CB  . ASN B 108 ? 0.6054 0.6033 0.6001 -0.0049 -0.0101 0.0018  99  ASN B CB  
2414 C  CG  . ASN B 108 ? 0.6529 0.6722 0.6810 0.0133  -0.0007 -0.0082 99  ASN B CG  
2415 O  OD1 . ASN B 108 ? 0.7204 0.7403 0.7250 -0.0214 0.0039  0.0229  99  ASN B OD1 
2416 N  ND2 . ASN B 108 ? 0.7083 0.7119 0.7266 -0.0001 0.0014  0.0180  99  ASN B ND2 
2417 N  N   . GLY B 109 ? 0.5861 0.5999 0.6012 -0.0012 -0.0060 0.0025  100 GLY B N   
2418 C  CA  . GLY B 109 ? 0.5777 0.5897 0.5881 0.0029  -0.0061 0.0000  100 GLY B CA  
2419 C  C   . GLY B 109 ? 0.5709 0.5879 0.5809 0.0062  -0.0056 0.0035  100 GLY B C   
2420 O  O   . GLY B 109 ? 0.5590 0.5848 0.5690 0.0152  -0.0079 -0.0022 100 GLY B O   
2421 N  N   . ASP B 110 ? 0.5794 0.5890 0.5741 0.0051  -0.0087 0.0009  101 ASP B N   
2422 C  CA  . ASP B 110 ? 0.5761 0.5842 0.5845 0.0062  -0.0103 0.0019  101 ASP B CA  
2423 C  C   . ASP B 110 ? 0.5760 0.5701 0.5838 0.0046  -0.0124 0.0018  101 ASP B C   
2424 O  O   . ASP B 110 ? 0.5824 0.5714 0.5794 0.0134  -0.0150 0.0121  101 ASP B O   
2425 C  CB  . ASP B 110 ? 0.5871 0.5986 0.5929 0.0026  -0.0024 0.0030  101 ASP B CB  
2426 C  CG  . ASP B 110 ? 0.6494 0.6725 0.6462 -0.0030 -0.0183 0.0003  101 ASP B CG  
2427 O  OD1 . ASP B 110 ? 0.7135 0.7250 0.6805 0.0041  0.0000  -0.0102 101 ASP B OD1 
2428 O  OD2 . ASP B 110 ? 0.6761 0.7450 0.6949 0.0105  -0.0226 -0.0010 101 ASP B OD2 
2429 N  N   . VAL B 111 ? 0.5606 0.5529 0.5808 0.0030  -0.0102 0.0000  102 VAL B N   
2430 C  CA  . VAL B 111 ? 0.5518 0.5530 0.5578 0.0070  -0.0024 0.0015  102 VAL B CA  
2431 C  C   . VAL B 111 ? 0.5385 0.5348 0.5555 0.0112  -0.0011 -0.0004 102 VAL B C   
2432 O  O   . VAL B 111 ? 0.5146 0.5309 0.5617 0.0260  -0.0151 0.0063  102 VAL B O   
2433 C  CB  . VAL B 111 ? 0.5485 0.5418 0.5517 0.0027  -0.0016 -0.0027 102 VAL B CB  
2434 C  CG1 . VAL B 111 ? 0.5388 0.5404 0.5463 0.0102  -0.0159 -0.0060 102 VAL B CG1 
2435 C  CG2 . VAL B 111 ? 0.5588 0.5751 0.5435 0.0085  -0.0086 0.0002  102 VAL B CG2 
2436 N  N   . ALA B 112 ? 0.5272 0.5312 0.5413 0.0104  -0.0061 -0.0042 103 ALA B N   
2437 C  CA  . ALA B 112 ? 0.5254 0.5244 0.5357 0.0079  -0.0034 0.0031  103 ALA B CA  
2438 C  C   . ALA B 112 ? 0.5044 0.5262 0.5143 0.0153  -0.0012 0.0015  103 ALA B C   
2439 O  O   . ALA B 112 ? 0.4680 0.5047 0.4865 0.0359  -0.0118 0.0054  103 ALA B O   
2440 C  CB  . ALA B 112 ? 0.5234 0.5328 0.5368 0.0123  -0.0034 0.0041  103 ALA B CB  
2441 N  N   . LYS B 113 ? 0.5151 0.5300 0.5200 0.0150  -0.0008 0.0024  104 LYS B N   
2442 C  CA  . LYS B 113 ? 0.5120 0.5189 0.5198 0.0069  -0.0054 0.0024  104 LYS B CA  
2443 C  C   . LYS B 113 ? 0.5086 0.5095 0.5086 0.0117  -0.0076 0.0025  104 LYS B C   
2444 O  O   . LYS B 113 ? 0.5005 0.4899 0.5213 0.0311  -0.0145 0.0104  104 LYS B O   
2445 C  CB  . LYS B 113 ? 0.5516 0.5453 0.5206 0.0071  -0.0053 0.0049  104 LYS B CB  
2446 C  CG  . LYS B 113 ? 0.5656 0.5866 0.5882 0.0046  0.0005  0.0008  104 LYS B CG  
2447 C  CD  . LYS B 113 ? 0.6207 0.6089 0.6314 0.0011  -0.0001 0.0019  104 LYS B CD  
2448 C  CE  . LYS B 113 ? 0.6107 0.5990 0.6381 -0.0137 -0.0009 -0.0010 104 LYS B CE  
2449 N  NZ  . LYS B 113 ? 0.6040 0.5957 0.6432 0.0131  -0.0102 0.0097  104 LYS B NZ  
2450 N  N   . VAL B 114 ? 0.4900 0.4908 0.4749 0.0087  -0.0103 0.0040  105 VAL B N   
2451 C  CA  . VAL B 114 ? 0.4848 0.4870 0.4678 0.0109  -0.0066 0.0021  105 VAL B CA  
2452 C  C   . VAL B 114 ? 0.4460 0.4621 0.4394 0.0123  -0.0067 -0.0007 105 VAL B C   
2453 O  O   . VAL B 114 ? 0.4433 0.4664 0.4140 0.0268  -0.0228 0.0017  105 VAL B O   
2454 C  CB  . VAL B 114 ? 0.4914 0.5005 0.4750 0.0095  -0.0032 -0.0004 105 VAL B CB  
2455 C  CG1 . VAL B 114 ? 0.5199 0.5070 0.4991 0.0110  -0.0092 0.0075  105 VAL B CG1 
2456 C  CG2 . VAL B 114 ? 0.5055 0.5177 0.5003 0.0039  -0.0112 -0.0043 105 VAL B CG2 
2457 N  N   . ILE B 115 ? 0.4483 0.4657 0.4349 0.0124  -0.0039 -0.0125 106 ILE B N   
2458 C  CA  . ILE B 115 ? 0.4492 0.4604 0.4491 0.0084  -0.0075 -0.0033 106 ILE B CA  
2459 C  C   . ILE B 115 ? 0.4470 0.4486 0.4414 0.0116  -0.0050 -0.0044 106 ILE B C   
2460 O  O   . ILE B 115 ? 0.4517 0.4314 0.4333 0.0406  -0.0066 -0.0021 106 ILE B O   
2461 C  CB  . ILE B 115 ? 0.4426 0.4583 0.4296 0.0128  -0.0071 -0.0078 106 ILE B CB  
2462 C  CG1 . ILE B 115 ? 0.4260 0.4360 0.4151 0.0206  -0.0197 0.0200  106 ILE B CG1 
2463 C  CG2 . ILE B 115 ? 0.4601 0.4623 0.4433 0.0215  -0.0072 -0.0017 106 ILE B CG2 
2464 C  CD1 . ILE B 115 ? 0.4474 0.4520 0.4634 -0.0029 -0.0094 -0.0062 106 ILE B CD1 
2465 N  N   . ASP B 116 ? 0.4580 0.4602 0.4575 0.0171  0.0016  -0.0045 107 ASP B N   
2466 C  CA  . ASP B 116 ? 0.4705 0.4787 0.4691 0.0127  -0.0003 -0.0039 107 ASP B CA  
2467 C  C   . ASP B 116 ? 0.4570 0.4600 0.4479 0.0284  -0.0036 0.0038  107 ASP B C   
2468 O  O   . ASP B 116 ? 0.4867 0.4765 0.4537 0.0463  0.0052  0.0140  107 ASP B O   
2469 C  CB  . ASP B 116 ? 0.4674 0.4914 0.4873 0.0221  -0.0112 0.0057  107 ASP B CB  
2470 C  CG  . ASP B 116 ? 0.5785 0.5827 0.5779 -0.0069 0.0046  0.0189  107 ASP B CG  
2471 O  OD1 . ASP B 116 ? 0.6012 0.6620 0.5750 0.0103  -0.0104 0.0008  107 ASP B OD1 
2472 O  OD2 . ASP B 116 ? 0.5973 0.6656 0.6660 0.0117  -0.0317 0.0133  107 ASP B OD2 
2473 N  N   . TYR B 117 ? 0.4483 0.4610 0.4435 0.0274  0.0008  -0.0069 108 TYR B N   
2474 C  CA  . TYR B 117 ? 0.4474 0.4475 0.4433 0.0214  0.0054  -0.0022 108 TYR B CA  
2475 C  C   . TYR B 117 ? 0.4680 0.4433 0.4282 0.0254  0.0007  -0.0023 108 TYR B C   
2476 O  O   . TYR B 117 ? 0.4738 0.4199 0.4087 0.0502  0.0094  0.0039  108 TYR B O   
2477 C  CB  . TYR B 117 ? 0.4631 0.4707 0.4556 0.0167  -0.0018 -0.0071 108 TYR B CB  
2478 C  CG  . TYR B 117 ? 0.4677 0.4586 0.4391 0.0183  -0.0011 -0.0185 108 TYR B CG  
2479 C  CD1 . TYR B 117 ? 0.4802 0.4761 0.4142 0.0213  -0.0013 -0.0182 108 TYR B CD1 
2480 C  CD2 . TYR B 117 ? 0.4890 0.4723 0.4870 0.0171  0.0160  -0.0152 108 TYR B CD2 
2481 C  CE1 . TYR B 117 ? 0.4782 0.4728 0.4583 0.0183  0.0003  -0.0085 108 TYR B CE1 
2482 C  CE2 . TYR B 117 ? 0.5085 0.4862 0.4785 0.0047  0.0017  -0.0026 108 TYR B CE2 
2483 C  CZ  . TYR B 117 ? 0.5103 0.4837 0.4986 0.0013  -0.0013 -0.0069 108 TYR B CZ  
2484 O  OH  . TYR B 117 ? 0.5278 0.4807 0.4877 0.0264  -0.0031 0.0028  108 TYR B OH  
2485 N  N   . TYR B 118 ? 0.4729 0.4363 0.4349 0.0249  -0.0042 0.0021  109 TYR B N   
2486 C  CA  . TYR B 118 ? 0.4673 0.4539 0.4487 0.0166  0.0015  0.0054  109 TYR B CA  
2487 C  C   . TYR B 118 ? 0.4650 0.4503 0.4364 0.0200  -0.0027 0.0002  109 TYR B C   
2488 O  O   . TYR B 118 ? 0.4732 0.4470 0.3846 0.0404  0.0005  -0.0009 109 TYR B O   
2489 C  CB  . TYR B 118 ? 0.4803 0.4685 0.4834 0.0181  0.0034  -0.0035 109 TYR B CB  
2490 C  CG  . TYR B 118 ? 0.4798 0.4588 0.4694 0.0128  0.0049  0.0002  109 TYR B CG  
2491 C  CD1 . TYR B 118 ? 0.4409 0.4579 0.4246 0.0296  0.0008  0.0143  109 TYR B CD1 
2492 C  CD2 . TYR B 118 ? 0.4911 0.4942 0.4780 0.0050  0.0249  -0.0041 109 TYR B CD2 
2493 C  CE1 . TYR B 118 ? 0.4752 0.4942 0.4786 0.0087  0.0202  0.0112  109 TYR B CE1 
2494 C  CE2 . TYR B 118 ? 0.5027 0.4972 0.4615 0.0101  -0.0028 0.0099  109 TYR B CE2 
2495 C  CZ  . TYR B 118 ? 0.5067 0.4747 0.4766 -0.0015 0.0022  0.0012  109 TYR B CZ  
2496 O  OH  . TYR B 118 ? 0.5402 0.5197 0.4851 -0.0016 -0.0092 0.0152  109 TYR B OH  
2497 N  N   . PHE B 119 ? 0.4710 0.4698 0.4288 0.0230  -0.0036 0.0090  110 PHE B N   
2498 C  CA  . PHE B 119 ? 0.4868 0.4827 0.4536 0.0196  -0.0010 0.0091  110 PHE B CA  
2499 C  C   . PHE B 119 ? 0.5026 0.5164 0.4679 0.0305  0.0038  0.0110  110 PHE B C   
2500 O  O   . PHE B 119 ? 0.5159 0.5167 0.4511 0.0576  -0.0182 0.0278  110 PHE B O   
2501 C  CB  . PHE B 119 ? 0.4694 0.4604 0.4280 0.0126  -0.0027 0.0041  110 PHE B CB  
2502 C  CG  . PHE B 119 ? 0.4499 0.4267 0.4141 0.0109  -0.0060 0.0143  110 PHE B CG  
2503 C  CD1 . PHE B 119 ? 0.4191 0.4238 0.4262 0.0124  -0.0103 0.0071  110 PHE B CD1 
2504 C  CD2 . PHE B 119 ? 0.4531 0.4641 0.4570 0.0069  0.0042  0.0084  110 PHE B CD2 
2505 C  CE1 . PHE B 119 ? 0.4464 0.4289 0.4478 0.0205  -0.0033 0.0184  110 PHE B CE1 
2506 C  CE2 . PHE B 119 ? 0.4684 0.4505 0.4411 0.0054  0.0082  0.0173  110 PHE B CE2 
2507 C  CZ  . PHE B 119 ? 0.4644 0.4478 0.4516 -0.0070 -0.0050 -0.0113 110 PHE B CZ  
2508 N  N   . ASN B 120 ? 0.5130 0.5301 0.4724 0.0293  -0.0028 0.0210  111 ASN B N   
2509 C  CA  . ASN B 120 ? 0.5045 0.5213 0.4898 0.0257  -0.0014 0.0111  111 ASN B CA  
2510 C  C   . ASN B 120 ? 0.5097 0.5294 0.5013 0.0237  -0.0039 0.0110  111 ASN B C   
2511 O  O   . ASN B 120 ? 0.5035 0.5394 0.5002 0.0512  -0.0105 0.0191  111 ASN B O   
2512 C  CB  . ASN B 120 ? 0.5099 0.5215 0.4823 0.0294  0.0023  0.0114  111 ASN B CB  
2513 C  CG  . ASN B 120 ? 0.4954 0.5285 0.5162 0.0414  -0.0009 0.0008  111 ASN B CG  
2514 O  OD1 . ASN B 120 ? 0.5919 0.5892 0.5742 0.0474  0.0024  -0.0143 111 ASN B OD1 
2515 N  ND2 . ASN B 120 ? 0.5811 0.5482 0.5225 0.0479  0.0247  -0.0033 111 ASN B ND2 
2516 N  N   . THR B 121 ? 0.5155 0.5266 0.5143 0.0290  -0.0013 0.0082  112 THR B N   
2517 C  CA  . THR B 121 ? 0.5039 0.5204 0.4985 0.0228  0.0030  0.0060  112 THR B CA  
2518 C  C   . THR B 121 ? 0.4935 0.5024 0.4831 0.0207  0.0000  0.0114  112 THR B C   
2519 O  O   . THR B 121 ? 0.4677 0.4771 0.4645 0.0432  0.0076  0.0254  112 THR B O   
2520 C  CB  . THR B 121 ? 0.5070 0.5322 0.5094 0.0156  0.0058  0.0002  112 THR B CB  
2521 O  OG1 . THR B 121 ? 0.5083 0.5339 0.4677 0.0381  0.0181  0.0000  112 THR B OG1 
2522 C  CG2 . THR B 121 ? 0.5277 0.5171 0.4943 0.0224  0.0125  0.0126  112 THR B CG2 
2523 N  N   . PHE B 122 ? 0.4959 0.5140 0.4856 0.0191  -0.0004 0.0122  113 PHE B N   
2524 C  CA  . PHE B 122 ? 0.5056 0.5170 0.4978 0.0163  0.0000  0.0070  113 PHE B CA  
2525 C  C   . PHE B 122 ? 0.5039 0.5204 0.4912 0.0140  0.0018  0.0117  113 PHE B C   
2526 O  O   . PHE B 122 ? 0.4971 0.5169 0.5068 0.0194  0.0078  0.0133  113 PHE B O   
2527 C  CB  . PHE B 122 ? 0.5042 0.5274 0.5023 0.0092  0.0026  -0.0014 113 PHE B CB  
2528 C  CG  . PHE B 122 ? 0.5074 0.5149 0.4985 0.0133  0.0008  0.0129  113 PHE B CG  
2529 C  CD1 . PHE B 122 ? 0.4955 0.4752 0.4819 0.0098  0.0090  0.0216  113 PHE B CD1 
2530 C  CD2 . PHE B 122 ? 0.5103 0.4936 0.5332 0.0119  0.0122  0.0104  113 PHE B CD2 
2531 C  CE1 . PHE B 122 ? 0.4983 0.4764 0.4853 0.0041  0.0004  0.0021  113 PHE B CE1 
2532 C  CE2 . PHE B 122 ? 0.5158 0.5380 0.5221 0.0181  0.0029  0.0101  113 PHE B CE2 
2533 C  CZ  . PHE B 122 ? 0.4809 0.5255 0.4891 0.0019  -0.0065 0.0080  113 PHE B CZ  
2534 N  N   . ASP B 123 ? 0.4967 0.5128 0.4927 0.0214  0.0018  0.0052  114 ASP B N   
2535 C  CA  . ASP B 123 ? 0.5003 0.5081 0.4900 0.0142  0.0033  0.0071  114 ASP B CA  
2536 C  C   . ASP B 123 ? 0.4911 0.4989 0.4680 0.0195  0.0065  0.0109  114 ASP B C   
2537 O  O   . ASP B 123 ? 0.4956 0.4989 0.4407 0.0431  0.0145  0.0397  114 ASP B O   
2538 C  CB  . ASP B 123 ? 0.5194 0.5353 0.5093 0.0195  -0.0017 0.0068  114 ASP B CB  
2539 C  CG  . ASP B 123 ? 0.6009 0.5951 0.6024 -0.0124 -0.0002 0.0047  114 ASP B CG  
2540 O  OD1 . ASP B 123 ? 0.6847 0.6510 0.6965 0.0166  0.0031  -0.0002 114 ASP B OD1 
2541 O  OD2 . ASP B 123 ? 0.6363 0.6871 0.7017 0.0067  -0.0023 0.0058  114 ASP B OD2 
2542 N  N   . ASN B 124 ? 0.4742 0.4899 0.4627 0.0325  0.0051  0.0077  115 ASN B N   
2543 C  CA  . ASN B 124 ? 0.4653 0.4555 0.4430 0.0243  0.0023  0.0037  115 ASN B CA  
2544 C  C   . ASN B 124 ? 0.4454 0.4273 0.4324 0.0150  -0.0048 0.0078  115 ASN B C   
2545 O  O   . ASN B 124 ? 0.4158 0.4005 0.4183 0.0238  0.0040  0.0024  115 ASN B O   
2546 C  CB  . ASN B 124 ? 0.4912 0.4804 0.4779 0.0220  0.0112  0.0016  115 ASN B CB  
2547 C  CG  . ASN B 124 ? 0.5030 0.4998 0.5018 0.0211  -0.0070 -0.0135 115 ASN B CG  
2548 O  OD1 . ASN B 124 ? 0.6108 0.6094 0.6058 0.0219  0.0338  0.0135  115 ASN B OD1 
2549 N  ND2 . ASN B 124 ? 0.5996 0.4706 0.4991 0.0493  -0.0057 0.0059  115 ASN B ND2 
2550 N  N   . LEU B 125 ? 0.4292 0.4075 0.4224 0.0210  -0.0085 0.0077  116 LEU B N   
2551 C  CA  . LEU B 125 ? 0.4277 0.4197 0.4128 0.0120  -0.0003 0.0097  116 LEU B CA  
2552 C  C   . LEU B 125 ? 0.4068 0.3924 0.3990 0.0145  0.0012  -0.0020 116 LEU B C   
2553 O  O   . LEU B 125 ? 0.4111 0.4004 0.4089 0.0240  0.0016  -0.0020 116 LEU B O   
2554 C  CB  . LEU B 125 ? 0.4332 0.4451 0.4300 0.0135  -0.0061 0.0053  116 LEU B CB  
2555 C  CG  . LEU B 125 ? 0.4317 0.4329 0.4308 0.0131  -0.0082 -0.0045 116 LEU B CG  
2556 C  CD1 . LEU B 125 ? 0.4438 0.4347 0.4167 0.0204  0.0100  0.0079  116 LEU B CD1 
2557 C  CD2 . LEU B 125 ? 0.4488 0.4620 0.4257 0.0163  0.0045  0.0052  116 LEU B CD2 
2558 N  N   . LYS B 126 ? 0.3977 0.3849 0.3864 0.0219  0.0051  0.0007  117 LYS B N   
2559 C  CA  . LYS B 126 ? 0.3982 0.3914 0.3903 0.0084  0.0030  0.0049  117 LYS B CA  
2560 C  C   . LYS B 126 ? 0.3874 0.3751 0.3787 0.0086  0.0076  0.0093  117 LYS B C   
2561 O  O   . LYS B 126 ? 0.3679 0.3580 0.3674 0.0358  0.0286  -0.0152 117 LYS B O   
2562 C  CB  . LYS B 126 ? 0.3915 0.3886 0.3791 0.0138  0.0013  0.0067  117 LYS B CB  
2563 C  CG  . LYS B 126 ? 0.4054 0.3916 0.4110 0.0090  0.0054  -0.0033 117 LYS B CG  
2564 C  CD  . LYS B 126 ? 0.4163 0.4094 0.4047 -0.0059 0.0165  0.0094  117 LYS B CD  
2565 C  CE  . LYS B 126 ? 0.4319 0.3916 0.4628 0.0070  0.0033  0.0118  117 LYS B CE  
2566 N  NZ  . LYS B 126 ? 0.3696 0.3905 0.4538 0.0064  -0.0028 -0.0044 117 LYS B NZ  
2567 N  N   . ASP B 127 ? 0.3893 0.3839 0.3909 0.0234  0.0042  0.0081  118 ASP B N   
2568 C  CA  . ASP B 127 ? 0.4059 0.3775 0.3872 0.0160  0.0055  0.0023  118 ASP B CA  
2569 C  C   . ASP B 127 ? 0.3955 0.3535 0.3641 0.0234  0.0075  -0.0099 118 ASP B C   
2570 O  O   . ASP B 127 ? 0.4018 0.3261 0.3406 0.0585  0.0049  -0.0200 118 ASP B O   
2571 C  CB  . ASP B 127 ? 0.4238 0.4078 0.4005 0.0234  0.0022  -0.0010 118 ASP B CB  
2572 C  CG  . ASP B 127 ? 0.4857 0.4751 0.4585 -0.0015 -0.0008 -0.0172 118 ASP B CG  
2573 O  OD1 . ASP B 127 ? 0.6170 0.6188 0.5715 0.0192  -0.0119 0.0482  118 ASP B OD1 
2574 O  OD2 . ASP B 127 ? 0.6800 0.5379 0.6069 0.0232  -0.0014 0.0375  118 ASP B OD2 
2575 N  N   . GLN B 128 ? 0.3932 0.3392 0.3597 0.0302  -0.0032 -0.0012 119 GLN B N   
2576 C  CA  . GLN B 128 ? 0.4041 0.3644 0.3731 0.0152  0.0021  0.0028  119 GLN B CA  
2577 C  C   . GLN B 128 ? 0.3815 0.3289 0.3431 0.0100  -0.0017 0.0108  119 GLN B C   
2578 O  O   . GLN B 128 ? 0.3890 0.3061 0.3015 0.0216  -0.0029 0.0007  119 GLN B O   
2579 C  CB  . GLN B 128 ? 0.4283 0.3731 0.3757 0.0115  -0.0046 0.0055  119 GLN B CB  
2580 C  CG  . GLN B 128 ? 0.4891 0.3975 0.4471 0.0337  -0.0016 0.0256  119 GLN B CG  
2581 C  CD  . GLN B 128 ? 0.5107 0.4209 0.4490 0.0057  0.0000  0.0216  119 GLN B CD  
2582 O  OE1 . GLN B 128 ? 0.5618 0.5996 0.6739 0.0314  -0.0017 0.0096  119 GLN B OE1 
2583 N  NE2 . GLN B 128 ? 0.5511 0.5014 0.5464 -0.0051 0.0277  0.0197  119 GLN B NE2 
2584 N  N   . LEU B 129 ? 0.3626 0.3262 0.3401 0.0075  -0.0028 0.0072  120 LEU B N   
2585 C  CA  . LEU B 129 ? 0.3530 0.3272 0.3363 0.0059  -0.0048 0.0014  120 LEU B CA  
2586 C  C   . LEU B 129 ? 0.3294 0.2882 0.3054 0.0011  -0.0091 -0.0100 120 LEU B C   
2587 O  O   . LEU B 129 ? 0.3207 0.2647 0.2951 -0.0044 -0.0205 -0.0040 120 LEU B O   
2588 C  CB  . LEU B 129 ? 0.3280 0.3346 0.3317 0.0057  -0.0178 -0.0013 120 LEU B CB  
2589 C  CG  . LEU B 129 ? 0.3543 0.3413 0.3347 -0.0047 -0.0063 0.0075  120 LEU B CG  
2590 C  CD1 . LEU B 129 ? 0.3318 0.3375 0.3460 0.0220  -0.0088 0.0176  120 LEU B CD1 
2591 C  CD2 . LEU B 129 ? 0.3788 0.3999 0.3489 0.0027  -0.0147 -0.0115 120 LEU B CD2 
2592 N  N   . SER B 130 ? 0.3442 0.3008 0.3243 0.0067  -0.0062 -0.0046 121 SER B N   
2593 C  CA  . SER B 130 ? 0.3336 0.3058 0.3218 0.0112  -0.0118 -0.0006 121 SER B CA  
2594 C  C   . SER B 130 ? 0.3452 0.3259 0.3612 0.0064  -0.0058 0.0052  121 SER B C   
2595 O  O   . SER B 130 ? 0.3238 0.3241 0.3631 0.0356  0.0028  -0.0009 121 SER B O   
2596 C  CB  . SER B 130 ? 0.3259 0.2670 0.3256 0.0074  -0.0189 -0.0027 121 SER B CB  
2597 O  OG  . SER B 130 ? 0.3103 0.2528 0.2878 -0.0062 -0.0524 0.0403  121 SER B OG  
2598 N  N   . LYS B 131 ? 0.3592 0.3405 0.3609 0.0202  -0.0011 -0.0095 122 LYS B N   
2599 C  CA  . LYS B 131 ? 0.3608 0.3342 0.3620 0.0017  -0.0059 -0.0024 122 LYS B CA  
2600 C  C   . LYS B 131 ? 0.3560 0.3239 0.3538 0.0070  -0.0079 -0.0128 122 LYS B C   
2601 O  O   . LYS B 131 ? 0.3610 0.3097 0.3537 0.0227  -0.0078 -0.0292 122 LYS B O   
2602 C  CB  . LYS B 131 ? 0.3726 0.3556 0.3938 0.0108  -0.0109 0.0047  122 LYS B CB  
2603 C  CG  . LYS B 131 ? 0.4507 0.4118 0.4455 0.0030  -0.0028 0.0108  122 LYS B CG  
2604 C  CD  . LYS B 131 ? 0.4209 0.3950 0.4244 0.0153  0.0078  -0.0075 122 LYS B CD  
2605 C  CE  . LYS B 131 ? 0.4802 0.4756 0.4400 0.0161  0.0206  0.0023  122 LYS B CE  
2606 N  NZ  . LYS B 131 ? 0.5773 0.5170 0.5177 -0.0008 -0.0058 -0.0284 122 LYS B NZ  
2607 N  N   . ALA B 132 ? 0.3448 0.3154 0.3554 -0.0007 -0.0048 0.0071  123 ALA B N   
2608 C  CA  . ALA B 132 ? 0.3410 0.3215 0.3494 0.0056  -0.0069 -0.0006 123 ALA B CA  
2609 C  C   . ALA B 132 ? 0.3339 0.3107 0.3481 0.0018  -0.0054 -0.0013 123 ALA B C   
2610 O  O   . ALA B 132 ? 0.3354 0.2976 0.3163 0.0059  -0.0147 -0.0022 123 ALA B O   
2611 C  CB  . ALA B 132 ? 0.3249 0.3149 0.3481 -0.0034 0.0074  0.0056  123 ALA B CB  
2612 N  N   . ALA B 133 ? 0.3307 0.3108 0.3538 0.0039  -0.0002 -0.0096 124 ALA B N   
2613 C  CA  . ALA B 133 ? 0.3401 0.3231 0.3546 0.0036  -0.0059 -0.0005 124 ALA B CA  
2614 C  C   . ALA B 133 ? 0.3461 0.3246 0.3522 0.0026  -0.0037 -0.0118 124 ALA B C   
2615 O  O   . ALA B 133 ? 0.3308 0.2984 0.3470 0.0075  -0.0140 -0.0117 124 ALA B O   
2616 C  CB  . ALA B 133 ? 0.3348 0.2986 0.3679 0.0100  0.0047  -0.0029 124 ALA B CB  
2617 N  N   . ILE B 134 ? 0.3386 0.3353 0.3508 0.0009  -0.0003 0.0014  125 ILE B N   
2618 C  CA  . ILE B 134 ? 0.3400 0.3257 0.3401 0.0033  -0.0087 0.0019  125 ILE B CA  
2619 C  C   . ILE B 134 ? 0.3376 0.3219 0.3264 0.0072  -0.0116 0.0021  125 ILE B C   
2620 O  O   . ILE B 134 ? 0.3551 0.3042 0.3081 0.0024  -0.0180 0.0236  125 ILE B O   
2621 C  CB  . ILE B 134 ? 0.3299 0.3325 0.3494 -0.0052 -0.0170 0.0173  125 ILE B CB  
2622 C  CG1 . ILE B 134 ? 0.3583 0.2950 0.3651 -0.0017 -0.0180 0.0134  125 ILE B CG1 
2623 C  CG2 . ILE B 134 ? 0.2990 0.3628 0.3323 0.0039  0.0051  -0.0062 125 ILE B CG2 
2624 C  CD1 . ILE B 134 ? 0.3747 0.3806 0.3497 -0.0085 0.0000  0.0080  125 ILE B CD1 
2625 N  N   . SER B 135 ? 0.3234 0.3012 0.3121 0.0109  -0.0110 0.0109  126 SER B N   
2626 C  CA  . SER B 135 ? 0.3290 0.3109 0.3179 0.0040  -0.0131 0.0062  126 SER B CA  
2627 C  C   . SER B 135 ? 0.3204 0.2910 0.3045 0.0004  -0.0187 0.0003  126 SER B C   
2628 O  O   . SER B 135 ? 0.3418 0.2798 0.3300 -0.0070 -0.0276 -0.0162 126 SER B O   
2629 C  CB  . SER B 135 ? 0.3361 0.3339 0.3623 0.0004  -0.0121 0.0041  126 SER B CB  
2630 O  OG  . SER B 135 ? 0.4534 0.3629 0.4211 0.0112  -0.0127 0.0162  126 SER B OG  
2631 N  N   . ARG B 136 ? 0.3189 0.2797 0.2994 0.0017  -0.0150 -0.0023 127 ARG B N   
2632 C  CA  . ARG B 136 ? 0.3151 0.2862 0.3036 -0.0103 -0.0091 0.0071  127 ARG B CA  
2633 C  C   . ARG B 136 ? 0.3246 0.2856 0.3116 -0.0062 -0.0186 0.0029  127 ARG B C   
2634 O  O   . ARG B 136 ? 0.3404 0.3027 0.2994 -0.0059 -0.0425 0.0081  127 ARG B O   
2635 C  CB  . ARG B 136 ? 0.3001 0.2964 0.2930 -0.0073 -0.0105 0.0125  127 ARG B CB  
2636 C  CG  . ARG B 136 ? 0.3353 0.3219 0.2976 0.0039  -0.0098 -0.0136 127 ARG B CG  
2637 C  CD  . ARG B 136 ? 0.2950 0.3516 0.2883 -0.0060 -0.0068 0.0029  127 ARG B CD  
2638 N  NE  . ARG B 136 ? 0.3413 0.3314 0.2988 0.0009  -0.0275 -0.0262 127 ARG B NE  
2639 C  CZ  . ARG B 136 ? 0.3577 0.3297 0.3021 0.0080  -0.0089 -0.0018 127 ARG B CZ  
2640 N  NH1 . ARG B 136 ? 0.3613 0.3681 0.3304 -0.0125 -0.0038 -0.0301 127 ARG B NH1 
2641 N  NH2 . ARG B 136 ? 0.3666 0.3067 0.3621 0.0144  -0.0139 -0.0068 127 ARG B NH2 
2642 N  N   . PHE B 137 ? 0.3288 0.2934 0.3146 0.0007  -0.0086 0.0092  128 PHE B N   
2643 C  CA  . PHE B 137 ? 0.3174 0.2872 0.3064 -0.0021 -0.0012 0.0036  128 PHE B CA  
2644 C  C   . PHE B 137 ? 0.3254 0.2632 0.3030 0.0074  0.0045  0.0072  128 PHE B C   
2645 O  O   . PHE B 137 ? 0.3481 0.2583 0.2498 0.0281  0.0094  0.0114  128 PHE B O   
2646 C  CB  . PHE B 137 ? 0.3227 0.2795 0.3122 -0.0053 -0.0098 0.0146  128 PHE B CB  
2647 C  CG  . PHE B 137 ? 0.3248 0.3304 0.3057 -0.0048 0.0017  0.0013  128 PHE B CG  
2648 C  CD1 . PHE B 137 ? 0.3014 0.2469 0.2666 0.0047  -0.0018 -0.0026 128 PHE B CD1 
2649 C  CD2 . PHE B 137 ? 0.3097 0.3134 0.2531 0.0227  -0.0083 0.0040  128 PHE B CD2 
2650 C  CE1 . PHE B 137 ? 0.3264 0.3323 0.2895 -0.0020 -0.0182 -0.0141 128 PHE B CE1 
2651 C  CE2 . PHE B 137 ? 0.3143 0.3340 0.2777 -0.0092 -0.0115 -0.0207 128 PHE B CE2 
2652 C  CZ  . PHE B 137 ? 0.3029 0.3422 0.2563 -0.0151 -0.0099 -0.0060 128 PHE B CZ  
2653 N  N   . GLY B 138 ? 0.3171 0.2623 0.2606 -0.0098 0.0008  0.0061  129 GLY B N   
2654 C  CA  . GLY B 138 ? 0.2820 0.2419 0.2531 -0.0041 -0.0066 0.0222  129 GLY B CA  
2655 C  C   . GLY B 138 ? 0.2724 0.2506 0.2362 -0.0050 0.0040  0.0119  129 GLY B C   
2656 O  O   . GLY B 138 ? 0.2791 0.2777 0.2194 -0.0120 -0.0143 -0.0042 129 GLY B O   
2657 N  N   . SER B 139 ? 0.2590 0.2353 0.2541 0.0018  0.0011  0.0012  130 SER B N   
2658 C  CA  . SER B 139 ? 0.2593 0.2437 0.2508 0.0009  -0.0046 0.0044  130 SER B CA  
2659 C  C   . SER B 139 ? 0.2683 0.2564 0.2696 0.0060  -0.0072 0.0100  130 SER B C   
2660 O  O   . SER B 139 ? 0.2947 0.2545 0.2592 0.0140  -0.0096 0.0057  130 SER B O   
2661 C  CB  . SER B 139 ? 0.2365 0.2274 0.2204 -0.0022 -0.0005 0.0059  130 SER B CB  
2662 O  OG  . SER B 139 ? 0.2500 0.2805 0.1705 0.0021  -0.0118 0.0190  130 SER B OG  
2663 N  N   . GLY B 140 ? 0.2572 0.2637 0.2505 0.0009  -0.0068 0.0054  131 GLY B N   
2664 C  CA  . GLY B 140 ? 0.2628 0.2409 0.2483 0.0048  -0.0044 -0.0013 131 GLY B CA  
2665 C  C   . GLY B 140 ? 0.2763 0.2381 0.2234 -0.0088 -0.0230 -0.0053 131 GLY B C   
2666 O  O   . GLY B 140 ? 0.2517 0.2461 0.2108 -0.0188 -0.0411 0.0092  131 GLY B O   
2667 N  N   . TYR B 141 ? 0.2754 0.2338 0.2391 -0.0011 -0.0291 -0.0040 132 TYR B N   
2668 C  CA  . TYR B 141 ? 0.2751 0.2798 0.2571 -0.0043 -0.0057 0.0013  132 TYR B CA  
2669 C  C   . TYR B 141 ? 0.2980 0.2837 0.2758 -0.0029 -0.0055 -0.0105 132 TYR B C   
2670 O  O   . TYR B 141 ? 0.3159 0.2855 0.2932 -0.0010 -0.0079 0.0155  132 TYR B O   
2671 C  CB  . TYR B 141 ? 0.2788 0.2951 0.2796 -0.0104 -0.0077 -0.0211 132 TYR B CB  
2672 C  CG  . TYR B 141 ? 0.2947 0.2671 0.2689 0.0090  -0.0017 0.0224  132 TYR B CG  
2673 C  CD1 . TYR B 141 ? 0.2967 0.2629 0.2902 -0.0107 -0.0027 0.0461  132 TYR B CD1 
2674 C  CD2 . TYR B 141 ? 0.2839 0.3072 0.2568 0.0001  -0.0288 -0.0186 132 TYR B CD2 
2675 C  CE1 . TYR B 141 ? 0.3045 0.3081 0.2984 -0.0078 0.0231  -0.0302 132 TYR B CE1 
2676 C  CE2 . TYR B 141 ? 0.2911 0.2876 0.2300 -0.0037 0.0051  -0.0074 132 TYR B CE2 
2677 C  CZ  . TYR B 141 ? 0.2957 0.2919 0.2664 -0.0004 0.0002  -0.0036 132 TYR B CZ  
2678 O  OH  . TYR B 141 ? 0.3247 0.2840 0.2613 0.0028  -0.0170 -0.0051 132 TYR B OH  
2679 N  N   . GLY B 142 ? 0.2875 0.2895 0.2714 -0.0025 -0.0006 -0.0054 133 GLY B N   
2680 C  CA  . GLY B 142 ? 0.3028 0.2893 0.2954 -0.0025 -0.0004 0.0073  133 GLY B CA  
2681 C  C   . GLY B 142 ? 0.3183 0.2844 0.3042 -0.0007 -0.0098 0.0147  133 GLY B C   
2682 O  O   . GLY B 142 ? 0.3375 0.2498 0.2582 0.0151  -0.0293 0.0247  133 GLY B O   
2683 N  N   . TRP B 143 ? 0.3373 0.3242 0.3395 0.0160  -0.0098 0.0133  134 TRP B N   
2684 C  CA  . TRP B 143 ? 0.3285 0.3182 0.3271 0.0139  -0.0053 0.0033  134 TRP B CA  
2685 C  C   . TRP B 143 ? 0.3556 0.3205 0.3533 0.0255  -0.0164 0.0077  134 TRP B C   
2686 O  O   . TRP B 143 ? 0.3625 0.3225 0.3146 0.0536  -0.0291 0.0318  134 TRP B O   
2687 C  CB  . TRP B 143 ? 0.3189 0.3025 0.3036 0.0139  -0.0101 -0.0147 134 TRP B CB  
2688 C  CG  . TRP B 143 ? 0.2968 0.2906 0.2974 0.0113  -0.0009 0.0025  134 TRP B CG  
2689 C  CD1 . TRP B 143 ? 0.3066 0.3023 0.2547 0.0057  0.0010  -0.0066 134 TRP B CD1 
2690 C  CD2 . TRP B 143 ? 0.3413 0.2692 0.2629 0.0127  -0.0228 -0.0059 134 TRP B CD2 
2691 N  NE1 . TRP B 143 ? 0.2812 0.3159 0.2545 0.0008  -0.0099 0.0177  134 TRP B NE1 
2692 C  CE2 . TRP B 143 ? 0.2956 0.2723 0.3166 -0.0081 0.0050  -0.0151 134 TRP B CE2 
2693 C  CE3 . TRP B 143 ? 0.2919 0.2645 0.3023 -0.0077 -0.0187 0.0238  134 TRP B CE3 
2694 C  CZ2 . TRP B 143 ? 0.3083 0.2770 0.3203 0.0045  -0.0137 0.0064  134 TRP B CZ2 
2695 C  CZ3 . TRP B 143 ? 0.3132 0.3101 0.2391 0.0000  -0.0241 0.0101  134 TRP B CZ3 
2696 C  CH2 . TRP B 143 ? 0.3078 0.2988 0.3206 0.0085  0.0050  -0.0180 134 TRP B CH2 
2697 N  N   . LEU B 144 ? 0.3515 0.3238 0.3450 0.0219  -0.0110 0.0081  135 LEU B N   
2698 C  CA  . LEU B 144 ? 0.3583 0.3558 0.3663 0.0171  -0.0082 0.0075  135 LEU B CA  
2699 C  C   . LEU B 144 ? 0.3576 0.3569 0.3471 0.0108  -0.0089 0.0005  135 LEU B C   
2700 O  O   . LEU B 144 ? 0.3527 0.3571 0.3300 0.0054  -0.0220 0.0115  135 LEU B O   
2701 C  CB  . LEU B 144 ? 0.3525 0.3531 0.3607 0.0121  -0.0185 -0.0002 135 LEU B CB  
2702 C  CG  . LEU B 144 ? 0.3559 0.3505 0.3642 0.0102  -0.0058 -0.0001 135 LEU B CG  
2703 C  CD1 . LEU B 144 ? 0.3775 0.3695 0.3862 0.0245  -0.0049 -0.0098 135 LEU B CD1 
2704 C  CD2 . LEU B 144 ? 0.3699 0.3995 0.3998 0.0194  -0.0205 -0.0084 135 LEU B CD2 
2705 N  N   . VAL B 145 ? 0.3656 0.3689 0.3611 0.0223  -0.0033 0.0169  136 VAL B N   
2706 C  CA  . VAL B 145 ? 0.4044 0.3955 0.3817 0.0198  -0.0039 0.0107  136 VAL B CA  
2707 C  C   . VAL B 145 ? 0.4357 0.4122 0.4016 0.0298  -0.0028 0.0124  136 VAL B C   
2708 O  O   . VAL B 145 ? 0.4130 0.3882 0.3492 0.0534  -0.0170 0.0312  136 VAL B O   
2709 C  CB  . VAL B 145 ? 0.4105 0.3921 0.3864 0.0173  0.0015  0.0126  136 VAL B CB  
2710 C  CG1 . VAL B 145 ? 0.3710 0.3865 0.3619 0.0078  -0.0108 -0.0029 136 VAL B CG1 
2711 C  CG2 . VAL B 145 ? 0.3977 0.4098 0.3992 0.0093  -0.0040 0.0073  136 VAL B CG2 
2712 N  N   . LEU B 146 ? 0.4766 0.4509 0.4132 0.0223  -0.0009 0.0180  137 LEU B N   
2713 C  CA  . LEU B 146 ? 0.5031 0.4825 0.4648 0.0215  -0.0105 0.0122  137 LEU B CA  
2714 C  C   . LEU B 146 ? 0.5218 0.5059 0.4897 0.0105  -0.0021 0.0158  137 LEU B C   
2715 O  O   . LEU B 146 ? 0.5041 0.4931 0.4581 0.0193  -0.0109 0.0349  137 LEU B O   
2716 C  CB  . LEU B 146 ? 0.5113 0.4815 0.4614 0.0210  -0.0136 0.0142  137 LEU B CB  
2717 C  CG  . LEU B 146 ? 0.5064 0.4867 0.4551 0.0167  -0.0166 0.0115  137 LEU B CG  
2718 C  CD1 . LEU B 146 ? 0.5045 0.5085 0.5036 0.0105  -0.0172 0.0098  137 LEU B CD1 
2719 C  CD2 . LEU B 146 ? 0.5333 0.5260 0.4874 0.0081  -0.0125 -0.0019 137 LEU B CD2 
2720 N  N   . ASP B 147 ? 0.5592 0.5326 0.5446 0.0105  -0.0016 0.0065  138 ASP B N   
2721 C  CA  . ASP B 147 ? 0.5685 0.5510 0.5581 0.0050  -0.0033 0.0017  138 ASP B CA  
2722 C  C   . ASP B 147 ? 0.6150 0.5790 0.5781 0.0082  -0.0010 0.0060  138 ASP B C   
2723 O  O   . ASP B 147 ? 0.6300 0.5724 0.5844 0.0053  -0.0087 -0.0001 138 ASP B O   
2724 C  CB  . ASP B 147 ? 0.5760 0.5658 0.5707 0.0042  -0.0080 0.0017  138 ASP B CB  
2725 C  CG  . ASP B 147 ? 0.5834 0.5597 0.5954 0.0036  -0.0032 -0.0002 138 ASP B CG  
2726 O  OD1 . ASP B 147 ? 0.6789 0.6605 0.6285 0.0097  -0.0211 -0.0105 138 ASP B OD1 
2727 O  OD2 . ASP B 147 ? 0.6628 0.6202 0.6267 0.0056  0.0169  0.0098  138 ASP B OD2 
2728 N  N   . GLY B 148 ? 0.6239 0.6015 0.5890 0.0094  -0.0002 0.0061  139 GLY B N   
2729 C  CA  . GLY B 148 ? 0.6106 0.6018 0.5895 0.0051  -0.0034 0.0101  139 GLY B CA  
2730 C  C   . GLY B 148 ? 0.6261 0.6166 0.6094 0.0011  0.0017  0.0049  139 GLY B C   
2731 O  O   . GLY B 148 ? 0.6692 0.6252 0.6243 0.0032  0.0029  -0.0009 139 GLY B O   
2732 N  N   . GLU B 149 ? 0.6155 0.6180 0.6028 0.0056  0.0008  0.0088  140 GLU B N   
2733 C  CA  . GLU B 149 ? 0.6115 0.6103 0.6005 0.0028  0.0025  0.0090  140 GLU B CA  
2734 C  C   . GLU B 149 ? 0.5911 0.5904 0.5913 0.0057  -0.0023 0.0109  140 GLU B C   
2735 O  O   . GLU B 149 ? 0.5927 0.5828 0.5933 0.0110  0.0080  0.0185  140 GLU B O   
2736 C  CB  . GLU B 149 ? 0.6123 0.6182 0.6216 0.0050  0.0031  0.0080  140 GLU B CB  
2737 C  CG  . GLU B 149 ? 0.6456 0.6594 0.6609 0.0031  -0.0081 0.0008  140 GLU B CG  
2738 C  CD  . GLU B 149 ? 0.6662 0.6703 0.6617 0.0136  -0.0034 0.0171  140 GLU B CD  
2739 O  OE1 . GLU B 149 ? 0.7400 0.7693 0.7657 -0.0062 -0.0294 -0.0110 140 GLU B OE1 
2740 O  OE2 . GLU B 149 ? 0.7979 0.7239 0.7778 -0.0104 -0.0123 -0.0028 140 GLU B OE2 
2741 N  N   . GLU B 150 ? 0.5824 0.5681 0.5763 0.0093  0.0031  0.0100  141 GLU B N   
2742 C  CA  . GLU B 150 ? 0.5624 0.5518 0.5688 0.0091  0.0002  0.0176  141 GLU B CA  
2743 C  C   . GLU B 150 ? 0.5284 0.5246 0.5397 0.0099  0.0042  0.0220  141 GLU B C   
2744 O  O   . GLU B 150 ? 0.5283 0.5000 0.5255 0.0279  0.0095  0.0373  141 GLU B O   
2745 C  CB  . GLU B 150 ? 0.5603 0.5500 0.5726 0.0036  0.0034  0.0154  141 GLU B CB  
2746 C  CG  . GLU B 150 ? 0.5957 0.5746 0.5849 0.0084  -0.0062 0.0002  141 GLU B CG  
2747 C  CD  . GLU B 150 ? 0.6167 0.6191 0.6389 -0.0047 -0.0055 -0.0058 141 GLU B CD  
2748 O  OE1 . GLU B 150 ? 0.7361 0.6997 0.7261 -0.0139 0.0156  0.0262  141 GLU B OE1 
2749 O  OE2 . GLU B 150 ? 0.7364 0.7432 0.6847 0.0019  -0.0275 0.0134  141 GLU B OE2 
2750 N  N   . LEU B 151 ? 0.5068 0.4913 0.5081 0.0149  -0.0057 0.0136  142 LEU B N   
2751 C  CA  . LEU B 151 ? 0.4981 0.4914 0.4865 0.0134  -0.0175 0.0082  142 LEU B CA  
2752 C  C   . LEU B 151 ? 0.4734 0.4631 0.4611 0.0272  -0.0088 0.0106  142 LEU B C   
2753 O  O   . LEU B 151 ? 0.4501 0.4511 0.4320 0.0371  -0.0264 0.0242  142 LEU B O   
2754 C  CB  . LEU B 151 ? 0.5234 0.5074 0.5157 0.0106  -0.0103 0.0225  142 LEU B CB  
2755 C  CG  . LEU B 151 ? 0.5471 0.5234 0.5583 0.0083  -0.0039 0.0036  142 LEU B CG  
2756 C  CD1 . LEU B 151 ? 0.6357 0.6205 0.5879 0.0005  -0.0091 -0.0018 142 LEU B CD1 
2757 C  CD2 . LEU B 151 ? 0.5153 0.5148 0.5195 0.0111  -0.0126 0.0012  142 LEU B CD2 
2758 N  N   . SER B 152 ? 0.4510 0.4353 0.4195 0.0323  -0.0098 0.0081  143 SER B N   
2759 C  CA  . SER B 152 ? 0.4305 0.4033 0.4187 0.0232  -0.0098 0.0160  143 SER B CA  
2760 C  C   . SER B 152 ? 0.4178 0.3716 0.3911 0.0306  -0.0166 0.0165  143 SER B C   
2761 O  O   . SER B 152 ? 0.3858 0.3126 0.3568 0.0416  -0.0265 0.0469  143 SER B O   
2762 C  CB  . SER B 152 ? 0.4412 0.4180 0.4116 0.0257  -0.0074 0.0196  143 SER B CB  
2763 O  OG  . SER B 152 ? 0.4558 0.4268 0.4236 -0.0195 0.0180  0.0050  143 SER B OG  
2764 N  N   . VAL B 153 ? 0.4082 0.3648 0.3933 0.0253  -0.0112 0.0191  144 VAL B N   
2765 C  CA  . VAL B 153 ? 0.3972 0.3604 0.3934 0.0162  -0.0037 0.0139  144 VAL B CA  
2766 C  C   . VAL B 153 ? 0.3955 0.3445 0.3799 0.0218  -0.0083 0.0092  144 VAL B C   
2767 O  O   . VAL B 153 ? 0.4017 0.3273 0.4258 0.0243  -0.0099 0.0334  144 VAL B O   
2768 C  CB  . VAL B 153 ? 0.3931 0.3444 0.3887 0.0059  -0.0070 0.0223  144 VAL B CB  
2769 C  CG1 . VAL B 153 ? 0.4388 0.3990 0.3933 0.0045  -0.0049 0.0068  144 VAL B CG1 
2770 C  CG2 . VAL B 153 ? 0.3987 0.3742 0.3562 0.0033  -0.0005 0.0159  144 VAL B CG2 
2771 N  N   . MET B 154 ? 0.3839 0.3321 0.3577 0.0182  -0.0024 0.0192  145 MET B N   
2772 C  CA  . MET B 154 ? 0.3768 0.3275 0.3685 0.0170  -0.0020 0.0188  145 MET B CA  
2773 C  C   . MET B 154 ? 0.3423 0.3037 0.3573 0.0136  -0.0144 0.0179  145 MET B C   
2774 O  O   . MET B 154 ? 0.3308 0.3251 0.3479 0.0345  -0.0413 0.0248  145 MET B O   
2775 C  CB  . MET B 154 ? 0.3810 0.3306 0.3834 0.0106  0.0073  0.0111  145 MET B CB  
2776 C  CG  . MET B 154 ? 0.4266 0.3878 0.3845 0.0057  0.0025  0.0123  145 MET B CG  
2777 S  SD  . MET B 154 ? 0.4529 0.3933 0.4357 0.0213  0.0359  0.0308  145 MET B SD  
2778 C  CE  . MET B 154 ? 0.4548 0.4408 0.4026 0.0051  0.0049  0.0064  145 MET B CE  
2779 N  N   . SER B 155 ? 0.3530 0.3016 0.3405 0.0088  -0.0108 0.0103  146 SER B N   
2780 C  CA  . SER B 155 ? 0.3338 0.2907 0.3268 0.0047  -0.0100 0.0076  146 SER B CA  
2781 C  C   . SER B 155 ? 0.3380 0.2888 0.3084 0.0014  -0.0100 0.0105  146 SER B C   
2782 O  O   . SER B 155 ? 0.3413 0.2971 0.3127 0.0090  -0.0120 0.0192  146 SER B O   
2783 C  CB  . SER B 155 ? 0.3398 0.2943 0.3290 -0.0006 0.0038  -0.0084 146 SER B CB  
2784 O  OG  . SER B 155 ? 0.3459 0.3262 0.3613 -0.0137 -0.0241 0.0000  146 SER B OG  
2785 N  N   . THR B 156 ? 0.3451 0.3114 0.2904 -0.0051 -0.0068 0.0167  147 THR B N   
2786 C  CA  . THR B 156 ? 0.3211 0.2968 0.3021 0.0061  -0.0150 0.0137  147 THR B CA  
2787 C  C   . THR B 156 ? 0.3251 0.3163 0.3026 -0.0079 -0.0069 0.0159  147 THR B C   
2788 O  O   . THR B 156 ? 0.3336 0.2905 0.2989 -0.0097 -0.0178 0.0215  147 THR B O   
2789 C  CB  . THR B 156 ? 0.3241 0.2887 0.3035 0.0180  -0.0012 0.0076  147 THR B CB  
2790 O  OG1 . THR B 156 ? 0.3344 0.3145 0.2871 -0.0151 -0.0281 0.0224  147 THR B OG1 
2791 C  CG2 . THR B 156 ? 0.3601 0.2908 0.3061 -0.0141 -0.0363 0.0135  147 THR B CG2 
2792 N  N   . PRO B 157 ? 0.3023 0.3172 0.2942 -0.0043 -0.0101 0.0133  148 PRO B N   
2793 C  CA  . PRO B 157 ? 0.2992 0.2910 0.2966 -0.0060 -0.0035 0.0137  148 PRO B CA  
2794 C  C   . PRO B 157 ? 0.2857 0.2941 0.2716 -0.0082 -0.0027 0.0089  148 PRO B C   
2795 O  O   . PRO B 157 ? 0.2930 0.2769 0.2344 0.0072  -0.0155 0.0239  148 PRO B O   
2796 C  CB  . PRO B 157 ? 0.3105 0.3060 0.2791 -0.0156 -0.0204 0.0086  148 PRO B CB  
2797 C  CG  . PRO B 157 ? 0.3117 0.2736 0.2751 -0.0119 -0.0279 -0.0037 148 PRO B CG  
2798 C  CD  . PRO B 157 ? 0.3105 0.2794 0.3235 -0.0064 -0.0211 0.0117  148 PRO B CD  
2799 N  N   . ASN B 158 ? 0.2994 0.2907 0.2541 -0.0024 0.0007  0.0230  149 ASN B N   
2800 C  CA  . ASN B 158 ? 0.3005 0.2957 0.2831 0.0000  -0.0030 0.0140  149 ASN B CA  
2801 C  C   . ASN B 158 ? 0.2979 0.2971 0.2761 0.0062  -0.0021 0.0219  149 ASN B C   
2802 O  O   . ASN B 158 ? 0.3051 0.2995 0.2722 0.0089  -0.0084 0.0447  149 ASN B O   
2803 C  CB  . ASN B 158 ? 0.3118 0.3197 0.2713 -0.0006 -0.0070 0.0171  149 ASN B CB  
2804 C  CG  . ASN B 158 ? 0.3177 0.3255 0.3076 -0.0107 0.0033  0.0077  149 ASN B CG  
2805 O  OD1 . ASN B 158 ? 0.3306 0.3453 0.3531 -0.0073 0.0019  -0.0112 149 ASN B OD1 
2806 N  ND2 . ASN B 158 ? 0.2290 0.2146 0.2508 -0.0081 -0.0020 0.0070  149 ASN B ND2 
2807 N  N   . GLN B 159 ? 0.2911 0.2916 0.2958 0.0183  -0.0018 0.0152  150 GLN B N   
2808 C  CA  . GLN B 159 ? 0.2889 0.2752 0.2846 -0.0053 -0.0074 0.0119  150 GLN B CA  
2809 C  C   . GLN B 159 ? 0.3212 0.2985 0.3006 0.0019  -0.0091 0.0099  150 GLN B C   
2810 O  O   . GLN B 159 ? 0.3554 0.2970 0.2935 0.0090  -0.0036 0.0160  150 GLN B O   
2811 C  CB  . GLN B 159 ? 0.2754 0.2738 0.2657 -0.0099 -0.0055 0.0203  150 GLN B CB  
2812 C  CG  . GLN B 159 ? 0.3103 0.2737 0.2773 0.0103  0.0020  0.0250  150 GLN B CG  
2813 C  CD  . GLN B 159 ? 0.3231 0.2966 0.2521 0.0133  0.0054  0.0094  150 GLN B CD  
2814 O  OE1 . GLN B 159 ? 0.3130 0.2901 0.2139 0.0520  0.0084  -0.0199 150 GLN B OE1 
2815 N  NE2 . GLN B 159 ? 0.3268 0.2236 0.2371 0.0011  -0.0206 0.0207  150 GLN B NE2 
2816 N  N   . ASP B 160 ? 0.3311 0.2879 0.3151 -0.0083 -0.0141 0.0104  151 ASP B N   
2817 C  CA  . ASP B 160 ? 0.3393 0.3078 0.3148 -0.0020 -0.0107 0.0099  151 ASP B CA  
2818 C  C   . ASP B 160 ? 0.3396 0.3170 0.3258 0.0045  -0.0037 0.0191  151 ASP B C   
2819 O  O   . ASP B 160 ? 0.3237 0.3156 0.3203 0.0127  -0.0102 0.0363  151 ASP B O   
2820 C  CB  . ASP B 160 ? 0.3455 0.2988 0.3332 0.0094  -0.0068 0.0054  151 ASP B CB  
2821 C  CG  . ASP B 160 ? 0.3647 0.3617 0.3364 -0.0153 0.0025  -0.0030 151 ASP B CG  
2822 O  OD1 . ASP B 160 ? 0.3485 0.3868 0.4265 0.0084  0.0023  0.0115  151 ASP B OD1 
2823 O  OD2 . ASP B 160 ? 0.4633 0.3798 0.4259 -0.0464 0.0167  0.0016  151 ASP B OD2 
2824 N  N   . THR B 161 ? 0.3500 0.3369 0.2892 -0.0014 -0.0091 0.0064  152 THR B N   
2825 C  CA  . THR B 161 ? 0.3582 0.3456 0.3380 -0.0013 -0.0038 0.0109  152 THR B CA  
2826 C  C   . THR B 161 ? 0.3620 0.3584 0.3422 0.0012  0.0013  0.0169  152 THR B C   
2827 O  O   . THR B 161 ? 0.3665 0.3334 0.3254 0.0058  -0.0062 0.0377  152 THR B O   
2828 C  CB  . THR B 161 ? 0.3744 0.3615 0.3414 0.0039  0.0020  0.0052  152 THR B CB  
2829 O  OG1 . THR B 161 ? 0.4264 0.3243 0.3932 0.0115  -0.0002 0.0556  152 THR B OG1 
2830 C  CG2 . THR B 161 ? 0.3791 0.3530 0.3226 0.0151  -0.0109 0.0209  152 THR B CG2 
2831 N  N   . PRO B 162 ? 0.3755 0.3697 0.3424 -0.0003 0.0010  0.0135  153 PRO B N   
2832 C  CA  . PRO B 162 ? 0.4043 0.3772 0.3624 0.0036  -0.0009 0.0151  153 PRO B CA  
2833 C  C   . PRO B 162 ? 0.4347 0.3892 0.3629 0.0027  0.0114  0.0150  153 PRO B C   
2834 O  O   . PRO B 162 ? 0.4771 0.3914 0.3538 0.0134  -0.0058 0.0221  153 PRO B O   
2835 C  CB  . PRO B 162 ? 0.4127 0.3801 0.3514 0.0000  0.0108  0.0168  153 PRO B CB  
2836 C  CG  . PRO B 162 ? 0.4045 0.3576 0.4019 -0.0049 0.0261  0.0109  153 PRO B CG  
2837 C  CD  . PRO B 162 ? 0.3607 0.3875 0.3720 0.0011  -0.0014 0.0173  153 PRO B CD  
2838 N  N   . LEU B 163 ? 0.4382 0.3955 0.3942 0.0066  0.0044  0.0112  154 LEU B N   
2839 C  CA  . LEU B 163 ? 0.4630 0.4374 0.4121 0.0141  0.0046  0.0053  154 LEU B CA  
2840 C  C   . LEU B 163 ? 0.4856 0.4760 0.4652 0.0089  0.0118  0.0063  154 LEU B C   
2841 O  O   . LEU B 163 ? 0.5043 0.4950 0.4598 0.0159  0.0329  0.0084  154 LEU B O   
2842 C  CB  . LEU B 163 ? 0.4561 0.4284 0.3905 0.0055  -0.0034 0.0101  154 LEU B CB  
2843 C  CG  . LEU B 163 ? 0.4705 0.4640 0.4257 -0.0032 -0.0044 -0.0036 154 LEU B CG  
2844 C  CD1 . LEU B 163 ? 0.4706 0.4577 0.4567 0.0103  0.0081  -0.0006 154 LEU B CD1 
2845 C  CD2 . LEU B 163 ? 0.5023 0.4923 0.5077 0.0171  -0.0020 0.0109  154 LEU B CD2 
2846 N  N   . GLN B 164 ? 0.5237 0.5254 0.5164 -0.0015 -0.0042 0.0038  155 GLN B N   
2847 C  CA  . GLN B 164 ? 0.5318 0.5276 0.5293 -0.0033 -0.0023 0.0022  155 GLN B CA  
2848 C  C   . GLN B 164 ? 0.5499 0.5313 0.5487 -0.0004 -0.0029 0.0050  155 GLN B C   
2849 O  O   . GLN B 164 ? 0.5658 0.5444 0.5574 0.0049  -0.0021 0.0067  155 GLN B O   
2850 C  CB  . GLN B 164 ? 0.5419 0.5447 0.5490 0.0021  -0.0073 0.0079  155 GLN B CB  
2851 C  CG  . GLN B 164 ? 0.5665 0.5751 0.5554 -0.0075 -0.0192 0.0015  155 GLN B CG  
2852 C  CD  . GLN B 164 ? 0.6431 0.6731 0.6610 0.0192  0.0045  -0.0076 155 GLN B CD  
2853 O  OE1 . GLN B 164 ? 0.6903 0.6914 0.6479 -0.0190 0.0051  0.0171  155 GLN B OE1 
2854 N  NE2 . GLN B 164 ? 0.7787 0.7083 0.7670 0.0017  0.0070  0.0161  155 GLN B NE2 
2855 N  N   . GLU B 165 ? 0.5589 0.5426 0.5506 0.0051  0.0009  0.0005  156 GLU B N   
2856 C  CA  . GLU B 165 ? 0.5581 0.5516 0.5574 0.0027  0.0015  0.0035  156 GLU B CA  
2857 C  C   . GLU B 165 ? 0.5630 0.5457 0.5504 0.0003  0.0098  0.0094  156 GLU B C   
2858 O  O   . GLU B 165 ? 0.5967 0.5612 0.5763 0.0076  0.0127  0.0220  156 GLU B O   
2859 C  CB  . GLU B 165 ? 0.5689 0.5746 0.5674 0.0032  -0.0051 0.0002  156 GLU B CB  
2860 C  CG  . GLU B 165 ? 0.5940 0.5860 0.5723 0.0076  0.0037  0.0059  156 GLU B CG  
2861 C  CD  . GLU B 165 ? 0.6089 0.6124 0.5988 -0.0057 0.0087  0.0091  156 GLU B CD  
2862 O  OE1 . GLU B 165 ? 0.6665 0.6874 0.7084 0.0173  0.0248  -0.0095 156 GLU B OE1 
2863 O  OE2 . GLU B 165 ? 0.6792 0.6316 0.6438 -0.0094 -0.0010 0.0160  156 GLU B OE2 
2864 N  N   . GLY B 166 ? 0.5471 0.5331 0.5291 -0.0072 0.0085  0.0123  157 GLY B N   
2865 C  CA  . GLY B 166 ? 0.5342 0.5240 0.5249 0.0016  0.0093  0.0125  157 GLY B CA  
2866 C  C   . GLY B 166 ? 0.5420 0.5303 0.5183 0.0015  -0.0033 0.0141  157 GLY B C   
2867 O  O   . GLY B 166 ? 0.5617 0.5463 0.5021 0.0098  -0.0155 0.0322  157 GLY B O   
2868 N  N   . LYS B 167 ? 0.5223 0.5037 0.5078 -0.0013 -0.0015 0.0210  158 LYS B N   
2869 C  CA  . LYS B 167 ? 0.5121 0.4984 0.5024 0.0027  -0.0001 0.0078  158 LYS B CA  
2870 C  C   . LYS B 167 ? 0.4983 0.4942 0.4883 -0.0014 0.0021  0.0139  158 LYS B C   
2871 O  O   . LYS B 167 ? 0.5338 0.4953 0.4976 0.0003  0.0122  0.0174  158 LYS B O   
2872 C  CB  . LYS B 167 ? 0.5142 0.5079 0.5084 0.0008  0.0028  0.0081  158 LYS B CB  
2873 C  CG  . LYS B 167 ? 0.5323 0.5185 0.5288 -0.0042 0.0063  0.0075  158 LYS B CG  
2874 C  CD  . LYS B 167 ? 0.5341 0.5309 0.5240 -0.0032 0.0001  -0.0053 158 LYS B CD  
2875 C  CE  . LYS B 167 ? 0.5367 0.5013 0.5491 -0.0061 0.0137  0.0093  158 LYS B CE  
2876 N  NZ  . LYS B 167 ? 0.5567 0.5481 0.5820 0.0012  -0.0121 0.0030  158 LYS B NZ  
2877 N  N   . ILE B 168 ? 0.4880 0.4772 0.4633 0.0083  0.0001  0.0162  159 ILE B N   
2878 C  CA  . ILE B 168 ? 0.4598 0.4513 0.4379 0.0101  0.0004  0.0134  159 ILE B CA  
2879 C  C   . ILE B 168 ? 0.4214 0.4174 0.4008 0.0201  -0.0004 0.0073  159 ILE B C   
2880 O  O   . ILE B 168 ? 0.4021 0.3832 0.3582 0.0270  -0.0081 0.0171  159 ILE B O   
2881 C  CB  . ILE B 168 ? 0.4528 0.4594 0.4490 0.0107  0.0024  0.0198  159 ILE B CB  
2882 C  CG1 . ILE B 168 ? 0.4658 0.5007 0.4455 0.0026  -0.0039 0.0171  159 ILE B CG1 
2883 C  CG2 . ILE B 168 ? 0.4832 0.4690 0.4504 0.0074  0.0014  0.0091  159 ILE B CG2 
2884 C  CD1 . ILE B 168 ? 0.4712 0.5019 0.4564 0.0072  -0.0062 0.0049  159 ILE B CD1 
2885 N  N   . PRO B 169 ? 0.4176 0.4188 0.3968 0.0194  0.0023  0.0094  160 PRO B N   
2886 C  CA  . PRO B 169 ? 0.4075 0.3981 0.3958 0.0139  -0.0044 0.0091  160 PRO B CA  
2887 C  C   . PRO B 169 ? 0.4099 0.3693 0.3672 0.0219  -0.0113 0.0102  160 PRO B C   
2888 O  O   . PRO B 169 ? 0.4465 0.3969 0.3788 0.0401  -0.0191 0.0129  160 PRO B O   
2889 C  CB  . PRO B 169 ? 0.4083 0.4022 0.3957 0.0131  0.0025  -0.0020 160 PRO B CB  
2890 C  CG  . PRO B 169 ? 0.4098 0.3716 0.4003 0.0081  -0.0063 0.0167  160 PRO B CG  
2891 C  CD  . PRO B 169 ? 0.3992 0.4127 0.4006 0.0189  -0.0062 0.0242  160 PRO B CD  
2892 N  N   . LEU B 170 ? 0.3841 0.3587 0.3660 0.0192  -0.0217 0.0099  161 LEU B N   
2893 C  CA  . LEU B 170 ? 0.3902 0.3722 0.3632 0.0101  -0.0114 0.0125  161 LEU B CA  
2894 C  C   . LEU B 170 ? 0.3945 0.3806 0.3604 0.0061  -0.0155 0.0063  161 LEU B C   
2895 O  O   . LEU B 170 ? 0.4129 0.3750 0.3371 0.0126  -0.0118 0.0012  161 LEU B O   
2896 C  CB  . LEU B 170 ? 0.3924 0.3845 0.3708 0.0081  -0.0151 0.0062  161 LEU B CB  
2897 C  CG  . LEU B 170 ? 0.3982 0.3767 0.3857 0.0014  -0.0068 0.0003  161 LEU B CG  
2898 C  CD1 . LEU B 170 ? 0.4250 0.4364 0.3849 0.0252  -0.0084 -0.0018 161 LEU B CD1 
2899 C  CD2 . LEU B 170 ? 0.4414 0.4661 0.3791 0.0140  0.0038  0.0059  161 LEU B CD2 
2900 N  N   . LEU B 171 ? 0.3704 0.3627 0.3513 0.0136  -0.0117 0.0089  162 LEU B N   
2901 C  CA  . LEU B 171 ? 0.3464 0.3434 0.3382 0.0090  -0.0173 0.0105  162 LEU B CA  
2902 C  C   . LEU B 171 ? 0.3140 0.3207 0.3283 -0.0003 -0.0191 0.0160  162 LEU B C   
2903 O  O   . LEU B 171 ? 0.3106 0.2899 0.2707 0.0086  -0.0404 0.0550  162 LEU B O   
2904 C  CB  . LEU B 171 ? 0.3462 0.3558 0.3464 0.0023  -0.0176 0.0086  162 LEU B CB  
2905 C  CG  . LEU B 171 ? 0.3562 0.3552 0.3477 0.0124  -0.0034 0.0056  162 LEU B CG  
2906 C  CD1 . LEU B 171 ? 0.3825 0.3775 0.3076 0.0089  -0.0138 -0.0077 162 LEU B CD1 
2907 C  CD2 . LEU B 171 ? 0.3511 0.3823 0.3733 0.0079  -0.0080 0.0231  162 LEU B CD2 
2908 N  N   . VAL B 172 ? 0.3115 0.3201 0.3192 -0.0026 -0.0124 0.0132  163 VAL B N   
2909 C  CA  . VAL B 172 ? 0.3099 0.3099 0.3021 0.0048  -0.0077 0.0090  163 VAL B CA  
2910 C  C   . VAL B 172 ? 0.2960 0.2929 0.3117 0.0058  -0.0156 0.0057  163 VAL B C   
2911 O  O   . VAL B 172 ? 0.2731 0.2773 0.2950 0.0130  -0.0259 -0.0009 163 VAL B O   
2912 C  CB  . VAL B 172 ? 0.3239 0.3106 0.3045 -0.0025 -0.0054 0.0031  163 VAL B CB  
2913 C  CG1 . VAL B 172 ? 0.3341 0.2983 0.3400 0.0151  0.0151  0.0241  163 VAL B CG1 
2914 C  CG2 . VAL B 172 ? 0.3188 0.3195 0.3264 0.0205  -0.0011 -0.0008 163 VAL B CG2 
2915 N  N   . ILE B 173 ? 0.3038 0.2681 0.2833 0.0127  -0.0109 -0.0015 164 ILE B N   
2916 C  CA  . ILE B 173 ? 0.2869 0.2801 0.2811 0.0056  -0.0040 0.0053  164 ILE B CA  
2917 C  C   . ILE B 173 ? 0.2919 0.2709 0.2738 0.0038  -0.0201 0.0057  164 ILE B C   
2918 O  O   . ILE B 173 ? 0.2749 0.2750 0.2928 -0.0080 -0.0205 0.0325  164 ILE B O   
2919 C  CB  . ILE B 173 ? 0.2702 0.2740 0.2685 0.0132  -0.0180 0.0050  164 ILE B CB  
2920 C  CG1 . ILE B 173 ? 0.3074 0.3172 0.2713 0.0067  0.0014  0.0069  164 ILE B CG1 
2921 C  CG2 . ILE B 173 ? 0.2465 0.2738 0.2635 0.0272  -0.0208 0.0153  164 ILE B CG2 
2922 C  CD1 . ILE B 173 ? 0.2812 0.2620 0.2926 0.0201  0.0013  0.0240  164 ILE B CD1 
2923 N  N   . ASP B 174 ? 0.2816 0.2886 0.2733 0.0010  -0.0145 -0.0096 165 ASP B N   
2924 C  CA  . ASP B 174 ? 0.2766 0.2741 0.2561 0.0056  -0.0073 0.0044  165 ASP B CA  
2925 C  C   . ASP B 174 ? 0.2539 0.2616 0.2415 0.0096  -0.0106 0.0129  165 ASP B C   
2926 O  O   . ASP B 174 ? 0.2507 0.2779 0.2215 0.0022  -0.0204 0.0055  165 ASP B O   
2927 C  CB  . ASP B 174 ? 0.2740 0.2894 0.2545 0.0016  0.0000  0.0006  165 ASP B CB  
2928 C  CG  . ASP B 174 ? 0.2624 0.2764 0.2774 0.0123  -0.0057 -0.0157 165 ASP B CG  
2929 O  OD1 . ASP B 174 ? 0.2610 0.2701 0.2256 0.0391  -0.0200 0.0146  165 ASP B OD1 
2930 O  OD2 . ASP B 174 ? 0.2796 0.2836 0.2517 -0.0073 -0.0534 -0.0195 165 ASP B OD2 
2931 N  N   . VAL B 175 ? 0.2646 0.2373 0.2380 0.0201  -0.0099 0.0221  166 VAL B N   
2932 C  CA  . VAL B 175 ? 0.2579 0.2464 0.2358 0.0073  -0.0028 0.0014  166 VAL B CA  
2933 C  C   . VAL B 175 ? 0.2639 0.2272 0.2393 0.0047  -0.0063 -0.0018 166 VAL B C   
2934 O  O   . VAL B 175 ? 0.2568 0.2339 0.2738 0.0062  -0.0258 0.0105  166 VAL B O   
2935 C  CB  . VAL B 175 ? 0.2686 0.2780 0.2270 0.0083  -0.0032 0.0078  166 VAL B CB  
2936 C  CG1 . VAL B 175 ? 0.3072 0.2817 0.2625 0.0310  -0.0127 -0.0053 166 VAL B CG1 
2937 C  CG2 . VAL B 175 ? 0.2993 0.2948 0.2375 -0.0095 -0.0418 -0.0283 166 VAL B CG2 
2938 N  N   . TRP B 176 ? 0.2315 0.2668 0.2420 -0.0007 0.0067  0.0185  167 TRP B N   
2939 C  CA  . TRP B 176 ? 0.2524 0.2275 0.2414 0.0029  -0.0039 -0.0011 167 TRP B CA  
2940 C  C   . TRP B 176 ? 0.2464 0.2346 0.2519 0.0049  -0.0044 -0.0003 167 TRP B C   
2941 O  O   . TRP B 176 ? 0.2440 0.2318 0.2529 0.0101  -0.0098 0.0117  167 TRP B O   
2942 C  CB  . TRP B 176 ? 0.2530 0.2309 0.2358 0.0008  -0.0246 0.0011  167 TRP B CB  
2943 C  CG  . TRP B 176 ? 0.2601 0.2653 0.2317 -0.0064 -0.0277 -0.0090 167 TRP B CG  
2944 C  CD1 . TRP B 176 ? 0.2811 0.2701 0.2393 0.0054  -0.0128 -0.0071 167 TRP B CD1 
2945 C  CD2 . TRP B 176 ? 0.2908 0.2816 0.2420 0.0112  0.0140  -0.0043 167 TRP B CD2 
2946 N  NE1 . TRP B 176 ? 0.2811 0.2622 0.2506 0.0105  -0.0027 -0.0080 167 TRP B NE1 
2947 C  CE2 . TRP B 176 ? 0.2358 0.2626 0.1585 -0.0092 -0.0606 -0.0063 167 TRP B CE2 
2948 C  CE3 . TRP B 176 ? 0.2975 0.2570 0.2347 0.0018  0.0071  0.0149  167 TRP B CE3 
2949 C  CZ2 . TRP B 176 ? 0.2686 0.2597 0.2239 0.0004  -0.0277 -0.0108 167 TRP B CZ2 
2950 C  CZ3 . TRP B 176 ? 0.2598 0.2903 0.2498 -0.0115 -0.0283 -0.0044 167 TRP B CZ3 
2951 C  CH2 . TRP B 176 ? 0.2827 0.2794 0.2634 0.0029  -0.0111 0.0014  167 TRP B CH2 
2952 N  N   . GLU B 177 ? 0.2359 0.2327 0.2347 -0.0107 -0.0087 -0.0097 168 GLU B N   
2953 C  CA  . GLU B 177 ? 0.2470 0.2359 0.2487 -0.0023 0.0003  -0.0034 168 GLU B CA  
2954 C  C   . GLU B 177 ? 0.2479 0.2287 0.2422 -0.0069 -0.0035 0.0121  168 GLU B C   
2955 O  O   . GLU B 177 ? 0.2623 0.2086 0.2384 -0.0316 -0.0149 0.0031  168 GLU B O   
2956 C  CB  . GLU B 177 ? 0.2400 0.2516 0.2493 0.0009  0.0158  -0.0015 168 GLU B CB  
2957 C  CG  . GLU B 177 ? 0.2562 0.2191 0.2577 -0.0022 -0.0077 -0.0178 168 GLU B CG  
2958 C  CD  . GLU B 177 ? 0.2421 0.2331 0.2460 -0.0072 -0.0035 0.0000  168 GLU B CD  
2959 O  OE1 . GLU B 177 ? 0.2687 0.2362 0.2353 -0.0035 -0.0058 0.0369  168 GLU B OE1 
2960 O  OE2 . GLU B 177 ? 0.2554 0.2118 0.2377 0.0072  0.0056  0.0241  168 GLU B OE2 
2961 N  N   . HIS B 178 ? 0.2589 0.2232 0.2663 -0.0068 -0.0052 0.0126  169 HIS B N   
2962 C  CA  . HIS B 178 ? 0.2656 0.2583 0.2591 0.0006  -0.0067 -0.0013 169 HIS B CA  
2963 C  C   . HIS B 178 ? 0.2669 0.2762 0.2896 -0.0028 -0.0116 0.0065  169 HIS B C   
2964 O  O   . HIS B 178 ? 0.2939 0.2785 0.2981 -0.0129 -0.0120 0.0031  169 HIS B O   
2965 C  CB  . HIS B 178 ? 0.2724 0.2622 0.2606 0.0098  -0.0010 0.0021  169 HIS B CB  
2966 C  CG  . HIS B 178 ? 0.3108 0.2416 0.2257 0.0140  0.0184  -0.0087 169 HIS B CG  
2967 N  ND1 . HIS B 178 ? 0.3196 0.2167 0.1672 -0.0014 -0.0006 0.0238  169 HIS B ND1 
2968 C  CD2 . HIS B 178 ? 0.2558 0.2744 0.3133 -0.0123 0.0194  0.0042  169 HIS B CD2 
2969 C  CE1 . HIS B 178 ? 0.2981 0.2948 0.2238 0.0043  -0.0347 0.0283  169 HIS B CE1 
2970 N  NE2 . HIS B 178 ? 0.3120 0.2605 0.2062 0.0024  -0.0008 0.0024  169 HIS B NE2 
2971 N  N   . ALA B 179 ? 0.2741 0.2632 0.2867 -0.0094 0.0014  -0.0070 170 ALA B N   
2972 C  CA  . ALA B 179 ? 0.2681 0.2551 0.2642 0.0054  -0.0127 -0.0029 170 ALA B CA  
2973 C  C   . ALA B 179 ? 0.2716 0.2499 0.2558 -0.0046 -0.0115 -0.0097 170 ALA B C   
2974 O  O   . ALA B 179 ? 0.2819 0.2411 0.2576 0.0055  0.0069  -0.0214 170 ALA B O   
2975 C  CB  . ALA B 179 ? 0.2837 0.2570 0.2542 -0.0090 -0.0063 -0.0026 170 ALA B CB  
2976 N  N   . TYR B 180 ? 0.2772 0.2561 0.2571 -0.0018 -0.0119 0.0021  171 TYR B N   
2977 C  CA  . TYR B 180 ? 0.2611 0.2488 0.2600 -0.0023 -0.0111 0.0014  171 TYR B CA  
2978 C  C   . TYR B 180 ? 0.2586 0.2635 0.2560 0.0016  -0.0046 0.0116  171 TYR B C   
2979 O  O   . TYR B 180 ? 0.2725 0.2961 0.2668 -0.0037 0.0049  -0.0030 171 TYR B O   
2980 C  CB  . TYR B 180 ? 0.2613 0.2499 0.2638 -0.0121 -0.0172 -0.0012 171 TYR B CB  
2981 C  CG  . TYR B 180 ? 0.2527 0.2306 0.2388 0.0065  -0.0194 0.0000  171 TYR B CG  
2982 C  CD1 . TYR B 180 ? 0.2754 0.2166 0.2601 -0.0015 0.0021  -0.0179 171 TYR B CD1 
2983 C  CD2 . TYR B 180 ? 0.2150 0.2423 0.2556 -0.0190 -0.0035 0.0000  171 TYR B CD2 
2984 C  CE1 . TYR B 180 ? 0.2554 0.2561 0.2399 -0.0102 -0.0240 -0.0053 171 TYR B CE1 
2985 C  CE2 . TYR B 180 ? 0.2650 0.2347 0.2396 -0.0091 -0.0157 -0.0127 171 TYR B CE2 
2986 C  CZ  . TYR B 180 ? 0.3028 0.2699 0.2519 -0.0153 -0.0070 -0.0168 171 TYR B CZ  
2987 O  OH  . TYR B 180 ? 0.2448 0.2410 0.2599 -0.0020 -0.0046 -0.0132 171 TYR B OH  
2988 N  N   . TYR B 181 ? 0.2552 0.2491 0.2600 0.0068  -0.0073 0.0268  172 TYR B N   
2989 C  CA  . TYR B 181 ? 0.2661 0.2614 0.2687 0.0012  -0.0048 0.0013  172 TYR B CA  
2990 C  C   . TYR B 181 ? 0.2656 0.2512 0.2672 -0.0107 0.0010  -0.0002 172 TYR B C   
2991 O  O   . TYR B 181 ? 0.2516 0.2566 0.2842 -0.0101 -0.0042 0.0085  172 TYR B O   
2992 C  CB  . TYR B 181 ? 0.2519 0.2755 0.2564 -0.0133 0.0081  -0.0113 172 TYR B CB  
2993 C  CG  . TYR B 181 ? 0.2572 0.2799 0.2431 0.0010  0.0007  0.0234  172 TYR B CG  
2994 C  CD1 . TYR B 181 ? 0.2944 0.2610 0.2452 -0.0180 -0.0082 0.0045  172 TYR B CD1 
2995 C  CD2 . TYR B 181 ? 0.2512 0.2846 0.2545 0.0193  -0.0104 0.0132  172 TYR B CD2 
2996 C  CE1 . TYR B 181 ? 0.2526 0.2486 0.1930 0.0101  -0.0059 0.0254  172 TYR B CE1 
2997 C  CE2 . TYR B 181 ? 0.2501 0.2729 0.2685 0.0060  -0.0295 -0.0024 172 TYR B CE2 
2998 C  CZ  . TYR B 181 ? 0.2069 0.2315 0.2393 0.0208  -0.0385 0.0192  172 TYR B CZ  
2999 O  OH  . TYR B 181 ? 0.2959 0.3268 0.2581 -0.0124 -0.0087 0.0180  172 TYR B OH  
3000 N  N   . LEU B 182 ? 0.2843 0.2582 0.3015 -0.0103 -0.0127 0.0019  173 LEU B N   
3001 C  CA  . LEU B 182 ? 0.2972 0.2633 0.2896 -0.0137 0.0000  0.0013  173 LEU B CA  
3002 C  C   . LEU B 182 ? 0.3084 0.2591 0.2691 -0.0228 -0.0037 0.0073  173 LEU B C   
3003 O  O   . LEU B 182 ? 0.3355 0.2494 0.2861 -0.0141 -0.0018 0.0212  173 LEU B O   
3004 C  CB  . LEU B 182 ? 0.3032 0.2551 0.2834 -0.0200 -0.0066 0.0078  173 LEU B CB  
3005 C  CG  . LEU B 182 ? 0.2952 0.2838 0.3047 0.0123  0.0018  0.0056  173 LEU B CG  
3006 C  CD1 . LEU B 182 ? 0.3386 0.3447 0.3276 0.0105  -0.0109 -0.0004 173 LEU B CD1 
3007 C  CD2 . LEU B 182 ? 0.3424 0.3109 0.2997 -0.0249 -0.0150 -0.0026 173 LEU B CD2 
3008 N  N   . LYS B 183 ? 0.2924 0.2456 0.2912 -0.0220 0.0053  0.0073  174 LYS B N   
3009 C  CA  . LYS B 183 ? 0.3083 0.2896 0.2967 -0.0096 0.0054  0.0094  174 LYS B CA  
3010 C  C   . LYS B 183 ? 0.2882 0.2865 0.2859 -0.0159 0.0017  0.0047  174 LYS B C   
3011 O  O   . LYS B 183 ? 0.3029 0.2688 0.2720 -0.0474 0.0048  0.0143  174 LYS B O   
3012 C  CB  . LYS B 183 ? 0.3167 0.3199 0.3021 -0.0192 0.0110  0.0087  174 LYS B CB  
3013 C  CG  . LYS B 183 ? 0.3170 0.3066 0.3350 -0.0010 0.0018  0.0098  174 LYS B CG  
3014 C  CD  . LYS B 183 ? 0.3343 0.3453 0.3490 -0.0076 -0.0004 0.0045  174 LYS B CD  
3015 C  CE  . LYS B 183 ? 0.3643 0.4219 0.4256 0.0024  -0.0068 0.0010  174 LYS B CE  
3016 N  NZ  . LYS B 183 ? 0.4230 0.4697 0.4958 -0.0214 -0.0020 0.0278  174 LYS B NZ  
3017 N  N   . TYR B 184 ? 0.2836 0.2922 0.2743 -0.0086 0.0019  0.0161  175 TYR B N   
3018 C  CA  . TYR B 184 ? 0.2766 0.2773 0.2667 -0.0100 -0.0083 0.0161  175 TYR B CA  
3019 C  C   . TYR B 184 ? 0.2678 0.2695 0.2748 -0.0125 0.0031  0.0114  175 TYR B C   
3020 O  O   . TYR B 184 ? 0.2556 0.2718 0.2910 -0.0163 0.0045  -0.0037 175 TYR B O   
3021 C  CB  . TYR B 184 ? 0.2665 0.2752 0.2597 -0.0132 -0.0159 0.0095  175 TYR B CB  
3022 C  CG  . TYR B 184 ? 0.2856 0.3175 0.2801 -0.0093 -0.0166 -0.0082 175 TYR B CG  
3023 C  CD1 . TYR B 184 ? 0.2700 0.3518 0.3000 -0.0057 -0.0097 -0.0035 175 TYR B CD1 
3024 C  CD2 . TYR B 184 ? 0.2606 0.2960 0.2687 0.0062  -0.0083 -0.0103 175 TYR B CD2 
3025 C  CE1 . TYR B 184 ? 0.2989 0.2505 0.1886 -0.0132 -0.0169 0.0087  175 TYR B CE1 
3026 C  CE2 . TYR B 184 ? 0.2830 0.3322 0.2379 -0.0173 -0.0113 -0.0303 175 TYR B CE2 
3027 C  CZ  . TYR B 184 ? 0.2710 0.2671 0.2281 -0.0074 -0.0161 -0.0086 175 TYR B CZ  
3028 O  OH  . TYR B 184 ? 0.2744 0.3532 0.2888 -0.0185 -0.0315 -0.0095 175 TYR B OH  
3029 N  N   . GLN B 185 ? 0.2664 0.2922 0.2683 -0.0076 -0.0133 -0.0011 176 GLN B N   
3030 C  CA  . GLN B 185 ? 0.2783 0.3025 0.2504 -0.0125 -0.0076 0.0090  176 GLN B CA  
3031 C  C   . GLN B 185 ? 0.2814 0.2908 0.2435 0.0016  -0.0163 -0.0018 176 GLN B C   
3032 O  O   . GLN B 185 ? 0.2652 0.2988 0.2225 0.0018  -0.0339 -0.0022 176 GLN B O   
3033 C  CB  . GLN B 185 ? 0.2783 0.2878 0.2481 -0.0132 -0.0090 0.0027  176 GLN B CB  
3034 C  CG  . GLN B 185 ? 0.3391 0.3497 0.2898 0.0171  -0.0065 0.0347  176 GLN B CG  
3035 C  CD  . GLN B 185 ? 0.3559 0.3475 0.3248 -0.0144 0.0067  0.0141  176 GLN B CD  
3036 O  OE1 . GLN B 185 ? 0.3537 0.3620 0.3501 -0.0126 0.0283  0.0547  176 GLN B OE1 
3037 N  NE2 . GLN B 185 ? 0.3297 0.3063 0.3095 0.0120  -0.0285 0.0575  176 GLN B NE2 
3038 N  N   . ASN B 186 ? 0.2811 0.2999 0.2522 0.0100  -0.0168 0.0110  177 ASN B N   
3039 C  CA  . ASN B 186 ? 0.2777 0.3039 0.2615 0.0017  -0.0115 -0.0036 177 ASN B CA  
3040 C  C   . ASN B 186 ? 0.2789 0.2941 0.2439 0.0005  -0.0157 0.0041  177 ASN B C   
3041 O  O   . ASN B 186 ? 0.2628 0.3136 0.2799 -0.0015 -0.0199 -0.0141 177 ASN B O   
3042 C  CB  . ASN B 186 ? 0.3104 0.3093 0.2624 0.0181  -0.0064 0.0024  177 ASN B CB  
3043 C  CG  . ASN B 186 ? 0.2996 0.3405 0.3426 -0.0039 0.0053  -0.0001 177 ASN B CG  
3044 O  OD1 . ASN B 186 ? 0.3470 0.4304 0.4061 0.0232  0.0123  -0.0282 177 ASN B OD1 
3045 N  ND2 . ASN B 186 ? 0.2732 0.3446 0.3077 0.0040  0.0045  0.0357  177 ASN B ND2 
3046 N  N   . ARG B 187 ? 0.2889 0.2862 0.2629 0.0035  -0.0110 -0.0034 178 ARG B N   
3047 C  CA  . ARG B 187 ? 0.2785 0.2957 0.2781 -0.0005 -0.0075 -0.0018 178 ARG B CA  
3048 C  C   . ARG B 187 ? 0.2830 0.2853 0.2968 -0.0035 -0.0045 0.0000  178 ARG B C   
3049 O  O   . ARG B 187 ? 0.2955 0.2719 0.2962 -0.0234 -0.0208 0.0043  178 ARG B O   
3050 C  CB  . ARG B 187 ? 0.2809 0.2897 0.2929 -0.0072 -0.0130 -0.0063 178 ARG B CB  
3051 C  CG  . ARG B 187 ? 0.2948 0.3531 0.2691 -0.0009 -0.0041 -0.0141 178 ARG B CG  
3052 C  CD  . ARG B 187 ? 0.3192 0.3358 0.2901 0.0016  -0.0008 0.0146  178 ARG B CD  
3053 N  NE  . ARG B 187 ? 0.3432 0.3408 0.3075 0.0080  0.0011  0.0334  178 ARG B NE  
3054 C  CZ  . ARG B 187 ? 0.3598 0.3379 0.3629 -0.0068 0.0241  0.0238  178 ARG B CZ  
3055 N  NH1 . ARG B 187 ? 0.4399 0.4075 0.3936 -0.0165 -0.0105 0.0133  178 ARG B NH1 
3056 N  NH2 . ARG B 187 ? 0.3792 0.3823 0.3838 -0.0240 0.0099  0.0147  178 ARG B NH2 
3057 N  N   . ARG B 188 ? 0.2730 0.2701 0.2908 -0.0023 -0.0013 -0.0004 179 ARG B N   
3058 C  CA  . ARG B 188 ? 0.2680 0.2812 0.2903 0.0016  -0.0112 0.0076  179 ARG B CA  
3059 C  C   . ARG B 188 ? 0.2611 0.2925 0.2958 0.0043  -0.0109 -0.0036 179 ARG B C   
3060 O  O   . ARG B 188 ? 0.2428 0.2800 0.2967 -0.0176 -0.0139 -0.0174 179 ARG B O   
3061 C  CB  . ARG B 188 ? 0.2603 0.2981 0.2943 0.0261  -0.0140 0.0231  179 ARG B CB  
3062 C  CG  . ARG B 188 ? 0.2789 0.3050 0.2836 -0.0115 -0.0008 0.0068  179 ARG B CG  
3063 C  CD  . ARG B 188 ? 0.2880 0.2955 0.3040 0.0083  -0.0074 0.0210  179 ARG B CD  
3064 N  NE  . ARG B 188 ? 0.2949 0.2698 0.2742 -0.0008 -0.0159 0.0188  179 ARG B NE  
3065 C  CZ  . ARG B 188 ? 0.2620 0.2578 0.2104 -0.0048 -0.0307 -0.0115 179 ARG B CZ  
3066 N  NH1 . ARG B 188 ? 0.3361 0.2669 0.2583 -0.0044 0.0182  -0.0035 179 ARG B NH1 
3067 N  NH2 . ARG B 188 ? 0.2828 0.3059 0.3088 -0.0114 -0.0035 -0.0051 179 ARG B NH2 
3068 N  N   . PRO B 189 ? 0.2582 0.2890 0.2704 0.0073  -0.0225 -0.0218 180 PRO B N   
3069 C  CA  . PRO B 189 ? 0.2784 0.2901 0.2860 0.0097  -0.0078 -0.0061 180 PRO B CA  
3070 C  C   . PRO B 189 ? 0.2805 0.2891 0.2990 0.0105  -0.0136 -0.0044 180 PRO B C   
3071 O  O   . PRO B 189 ? 0.3060 0.2733 0.3016 0.0471  -0.0243 -0.0011 180 PRO B O   
3072 C  CB  . PRO B 189 ? 0.2734 0.2897 0.2792 0.0197  -0.0189 -0.0069 180 PRO B CB  
3073 C  CG  . PRO B 189 ? 0.2987 0.3082 0.2717 0.0093  -0.0102 -0.0150 180 PRO B CG  
3074 C  CD  . PRO B 189 ? 0.2710 0.2955 0.2962 0.0154  -0.0137 -0.0115 180 PRO B CD  
3075 N  N   . GLU B 190 ? 0.2633 0.2949 0.2963 0.0156  -0.0145 0.0028  181 GLU B N   
3076 C  CA  . GLU B 190 ? 0.2660 0.2915 0.2849 0.0126  -0.0090 -0.0006 181 GLU B CA  
3077 C  C   . GLU B 190 ? 0.2567 0.3014 0.2802 0.0070  -0.0143 -0.0058 181 GLU B C   
3078 O  O   . GLU B 190 ? 0.2457 0.3174 0.2631 0.0163  -0.0109 0.0163  181 GLU B O   
3079 C  CB  . GLU B 190 ? 0.2720 0.2997 0.2963 -0.0003 -0.0085 -0.0071 181 GLU B CB  
3080 C  CG  . GLU B 190 ? 0.2880 0.2906 0.3267 0.0004  -0.0059 -0.0020 181 GLU B CG  
3081 C  CD  . GLU B 190 ? 0.2888 0.3181 0.3062 0.0042  -0.0130 -0.0031 181 GLU B CD  
3082 O  OE1 . GLU B 190 ? 0.3238 0.3711 0.2483 0.0124  -0.0055 0.0221  181 GLU B OE1 
3083 O  OE2 . GLU B 190 ? 0.3666 0.4067 0.4134 -0.0406 -0.0001 0.0311  181 GLU B OE2 
3084 N  N   . PHE B 191 ? 0.2562 0.2900 0.2716 -0.0029 -0.0084 -0.0022 182 PHE B N   
3085 C  CA  . PHE B 191 ? 0.2660 0.2859 0.2648 0.0124  -0.0092 0.0121  182 PHE B CA  
3086 C  C   . PHE B 191 ? 0.2836 0.2724 0.2859 0.0195  -0.0142 0.0209  182 PHE B C   
3087 O  O   . PHE B 191 ? 0.2648 0.2815 0.3443 0.0196  -0.0224 0.0237  182 PHE B O   
3088 C  CB  . PHE B 191 ? 0.2671 0.2589 0.2582 -0.0051 -0.0033 0.0214  182 PHE B CB  
3089 C  CG  . PHE B 191 ? 0.2478 0.2622 0.2667 0.0002  -0.0066 0.0019  182 PHE B CG  
3090 C  CD1 . PHE B 191 ? 0.2782 0.3007 0.2650 0.0240  -0.0278 -0.0162 182 PHE B CD1 
3091 C  CD2 . PHE B 191 ? 0.2794 0.2906 0.2364 0.0172  -0.0142 0.0069  182 PHE B CD2 
3092 C  CE1 . PHE B 191 ? 0.2352 0.2808 0.2839 0.0073  0.0277  0.0086  182 PHE B CE1 
3093 C  CE2 . PHE B 191 ? 0.2307 0.2397 0.2452 0.0054  0.0104  0.0159  182 PHE B CE2 
3094 C  CZ  . PHE B 191 ? 0.3106 0.2698 0.2698 -0.0039 0.0087  0.0022  182 PHE B CZ  
3095 N  N   . VAL B 192 ? 0.2778 0.3012 0.2781 0.0153  -0.0022 0.0080  183 VAL B N   
3096 C  CA  . VAL B 192 ? 0.2763 0.2801 0.2646 0.0066  -0.0040 0.0049  183 VAL B CA  
3097 C  C   . VAL B 192 ? 0.2900 0.3145 0.2863 0.0120  -0.0042 -0.0034 183 VAL B C   
3098 O  O   . VAL B 192 ? 0.3000 0.3466 0.2989 0.0053  -0.0143 0.0094  183 VAL B O   
3099 C  CB  . VAL B 192 ? 0.2617 0.2647 0.2593 0.0074  -0.0103 0.0165  183 VAL B CB  
3100 C  CG1 . VAL B 192 ? 0.3189 0.3105 0.3075 0.0012  -0.0132 0.0186  183 VAL B CG1 
3101 C  CG2 . VAL B 192 ? 0.2757 0.2088 0.2415 -0.0102 -0.0166 -0.0026 183 VAL B CG2 
3102 N  N   . THR B 193 ? 0.2859 0.3035 0.2858 -0.0049 0.0018  0.0060  184 THR B N   
3103 C  CA  . THR B 193 ? 0.2829 0.3028 0.2881 0.0010  -0.0046 -0.0056 184 THR B CA  
3104 C  C   . THR B 193 ? 0.2854 0.3235 0.3099 -0.0047 -0.0130 0.0042  184 THR B C   
3105 O  O   . THR B 193 ? 0.2701 0.3422 0.3133 -0.0039 -0.0409 -0.0100 184 THR B O   
3106 C  CB  . THR B 193 ? 0.2793 0.3032 0.2990 -0.0026 -0.0099 0.0078  184 THR B CB  
3107 O  OG1 . THR B 193 ? 0.3034 0.3165 0.2993 0.0181  -0.0095 -0.0237 184 THR B OG1 
3108 C  CG2 . THR B 193 ? 0.2970 0.3371 0.2983 -0.0037 0.0102  0.0026  184 THR B CG2 
3109 N  N   . ASN B 194 ? 0.2714 0.2945 0.3011 -0.0020 -0.0014 -0.0067 185 ASN B N   
3110 C  CA  . ASN B 194 ? 0.2884 0.3063 0.3145 0.0028  -0.0009 -0.0045 185 ASN B CA  
3111 C  C   . ASN B 194 ? 0.3030 0.3122 0.3219 0.0007  -0.0106 0.0006  185 ASN B C   
3112 O  O   . ASN B 194 ? 0.2944 0.3058 0.3005 -0.0078 -0.0264 -0.0185 185 ASN B O   
3113 C  CB  . ASN B 194 ? 0.3190 0.3180 0.3009 -0.0023 -0.0070 0.0063  185 ASN B CB  
3114 C  CG  . ASN B 194 ? 0.2897 0.3250 0.2976 -0.0252 0.0055  -0.0083 185 ASN B CG  
3115 O  OD1 . ASN B 194 ? 0.2956 0.3435 0.2506 0.0197  -0.0119 -0.0069 185 ASN B OD1 
3116 N  ND2 . ASN B 194 ? 0.2113 0.3242 0.2079 0.0104  -0.0562 -0.0036 185 ASN B ND2 
3117 N  N   . TRP B 195 ? 0.3090 0.3118 0.3281 0.0019  -0.0085 0.0022  186 TRP B N   
3118 C  CA  . TRP B 195 ? 0.3118 0.3297 0.3221 0.0075  0.0005  0.0000  186 TRP B CA  
3119 C  C   . TRP B 195 ? 0.3038 0.3267 0.3132 -0.0005 0.0017  0.0025  186 TRP B C   
3120 O  O   . TRP B 195 ? 0.2893 0.3361 0.3154 0.0060  0.0005  -0.0178 186 TRP B O   
3121 C  CB  . TRP B 195 ? 0.3297 0.3393 0.3196 0.0003  -0.0040 -0.0006 186 TRP B CB  
3122 C  CG  . TRP B 195 ? 0.3331 0.3529 0.3184 0.0037  -0.0009 0.0071  186 TRP B CG  
3123 C  CD1 . TRP B 195 ? 0.3068 0.3463 0.3028 -0.0161 -0.0169 0.0142  186 TRP B CD1 
3124 C  CD2 . TRP B 195 ? 0.3017 0.3208 0.3277 -0.0172 0.0080  0.0078  186 TRP B CD2 
3125 N  NE1 . TRP B 195 ? 0.3349 0.3513 0.2906 -0.0108 -0.0290 -0.0068 186 TRP B NE1 
3126 C  CE2 . TRP B 195 ? 0.3361 0.3473 0.3143 -0.0065 -0.0243 0.0049  186 TRP B CE2 
3127 C  CE3 . TRP B 195 ? 0.3618 0.3715 0.3673 0.0187  0.0116  0.0030  186 TRP B CE3 
3128 C  CZ2 . TRP B 195 ? 0.3487 0.3417 0.3571 -0.0003 -0.0057 0.0081  186 TRP B CZ2 
3129 C  CZ3 . TRP B 195 ? 0.3541 0.3668 0.3694 0.0342  0.0003  0.0159  186 TRP B CZ3 
3130 C  CH2 . TRP B 195 ? 0.3400 0.3688 0.3490 0.0286  -0.0088 0.0181  186 TRP B CH2 
3131 N  N   . TRP B 196 ? 0.3018 0.3215 0.3151 0.0012  0.0019  0.0027  187 TRP B N   
3132 C  CA  . TRP B 196 ? 0.3149 0.3346 0.3286 0.0061  -0.0071 -0.0017 187 TRP B CA  
3133 C  C   . TRP B 196 ? 0.3251 0.3504 0.3356 0.0039  -0.0078 0.0034  187 TRP B C   
3134 O  O   . TRP B 196 ? 0.3164 0.3859 0.3358 0.0192  -0.0257 0.0001  187 TRP B O   
3135 C  CB  . TRP B 196 ? 0.3043 0.3418 0.3262 0.0153  -0.0078 -0.0003 187 TRP B CB  
3136 C  CG  . TRP B 196 ? 0.3089 0.3129 0.3418 0.0405  -0.0134 -0.0024 187 TRP B CG  
3137 C  CD1 . TRP B 196 ? 0.3311 0.3438 0.3366 0.0126  0.0005  -0.0027 187 TRP B CD1 
3138 C  CD2 . TRP B 196 ? 0.3621 0.3705 0.3090 0.0038  0.0178  -0.0201 187 TRP B CD2 
3139 N  NE1 . TRP B 196 ? 0.3218 0.3432 0.3310 0.0176  0.0003  -0.0029 187 TRP B NE1 
3140 C  CE2 . TRP B 196 ? 0.3170 0.3678 0.3612 0.0251  -0.0310 0.0168  187 TRP B CE2 
3141 C  CE3 . TRP B 196 ? 0.3158 0.3516 0.3578 0.0112  -0.0150 0.0118  187 TRP B CE3 
3142 C  CZ2 . TRP B 196 ? 0.3172 0.3765 0.3367 -0.0046 0.0069  0.0043  187 TRP B CZ2 
3143 C  CZ3 . TRP B 196 ? 0.3005 0.3097 0.3506 0.0298  -0.0020 0.0020  187 TRP B CZ3 
3144 C  CH2 . TRP B 196 ? 0.3130 0.3554 0.3418 0.0063  -0.0045 0.0045  187 TRP B CH2 
3145 N  N   . HIS B 197 ? 0.3041 0.3365 0.3092 0.0114  -0.0058 -0.0081 188 HIS B N   
3146 C  CA  . HIS B 197 ? 0.3158 0.3352 0.3287 0.0051  -0.0044 -0.0052 188 HIS B CA  
3147 C  C   . HIS B 197 ? 0.3219 0.3400 0.3233 0.0019  -0.0126 -0.0053 188 HIS B C   
3148 O  O   . HIS B 197 ? 0.3375 0.3562 0.3152 0.0072  -0.0117 -0.0032 188 HIS B O   
3149 C  CB  . HIS B 197 ? 0.3147 0.3279 0.3491 0.0070  0.0147  -0.0123 188 HIS B CB  
3150 C  CG  . HIS B 197 ? 0.3621 0.3127 0.3087 -0.0110 0.0020  -0.0182 188 HIS B CG  
3151 N  ND1 . HIS B 197 ? 0.3576 0.3814 0.3727 0.0099  0.0107  -0.0204 188 HIS B ND1 
3152 C  CD2 . HIS B 197 ? 0.3434 0.3846 0.3221 0.0177  -0.0015 -0.0160 188 HIS B CD2 
3153 C  CE1 . HIS B 197 ? 0.3277 0.3331 0.2719 0.0021  -0.0177 -0.0239 188 HIS B CE1 
3154 N  NE2 . HIS B 197 ? 0.4077 0.3542 0.3105 0.0070  0.0000  -0.0299 188 HIS B NE2 
3155 N  N   . THR B 198 ? 0.3287 0.3423 0.3399 -0.0035 -0.0187 -0.0086 189 THR B N   
3156 C  CA  . THR B 198 ? 0.3159 0.3501 0.3427 0.0050  -0.0044 -0.0084 189 THR B CA  
3157 C  C   . THR B 198 ? 0.3068 0.3537 0.3587 -0.0013 -0.0072 -0.0046 189 THR B C   
3158 O  O   . THR B 198 ? 0.2916 0.3795 0.3594 0.0042  0.0098  -0.0016 189 THR B O   
3159 C  CB  . THR B 198 ? 0.3178 0.3325 0.3355 0.0030  -0.0084 -0.0126 189 THR B CB  
3160 O  OG1 . THR B 198 ? 0.2905 0.3735 0.3397 -0.0044 0.0182  0.0232  189 THR B OG1 
3161 C  CG2 . THR B 198 ? 0.3148 0.3329 0.3358 0.0015  0.0080  0.0024  189 THR B CG2 
3162 N  N   . VAL B 199 ? 0.3370 0.3520 0.3764 0.0066  -0.0117 0.0014  190 VAL B N   
3163 C  CA  . VAL B 199 ? 0.3600 0.3825 0.3677 0.0073  -0.0015 -0.0003 190 VAL B CA  
3164 C  C   . VAL B 199 ? 0.3685 0.4011 0.3809 0.0096  -0.0061 0.0049  190 VAL B C   
3165 O  O   . VAL B 199 ? 0.3737 0.4153 0.3975 0.0186  -0.0044 0.0124  190 VAL B O   
3166 C  CB  . VAL B 199 ? 0.3589 0.3650 0.3667 0.0015  -0.0057 0.0075  190 VAL B CB  
3167 C  CG1 . VAL B 199 ? 0.3811 0.3749 0.3680 0.0029  -0.0054 0.0090  190 VAL B CG1 
3168 C  CG2 . VAL B 199 ? 0.3804 0.3975 0.3963 -0.0102 -0.0044 0.0013  190 VAL B CG2 
3169 N  N   . ASN B 200 ? 0.3718 0.4115 0.3796 0.0122  -0.0068 -0.0024 191 ASN B N   
3170 C  CA  . ASN B 200 ? 0.3823 0.4059 0.3770 0.0077  -0.0089 -0.0028 191 ASN B CA  
3171 C  C   . ASN B 200 ? 0.3802 0.4056 0.3659 0.0106  -0.0199 -0.0022 191 ASN B C   
3172 O  O   . ASN B 200 ? 0.3362 0.3882 0.3216 0.0118  -0.0484 -0.0232 191 ASN B O   
3173 C  CB  . ASN B 200 ? 0.3831 0.4233 0.3637 0.0079  -0.0155 0.0026  191 ASN B CB  
3174 C  CG  . ASN B 200 ? 0.3802 0.4184 0.3817 0.0073  -0.0115 -0.0131 191 ASN B CG  
3175 O  OD1 . ASN B 200 ? 0.4168 0.4729 0.3811 0.0425  -0.0426 -0.0030 191 ASN B OD1 
3176 N  ND2 . ASN B 200 ? 0.4057 0.4036 0.3259 -0.0034 -0.0144 0.0003  191 ASN B ND2 
3177 N  N   . TRP B 201 ? 0.4006 0.4160 0.3764 0.0104  -0.0089 -0.0114 192 TRP B N   
3178 C  CA  . TRP B 201 ? 0.4158 0.4290 0.4127 0.0103  -0.0137 -0.0006 192 TRP B CA  
3179 C  C   . TRP B 201 ? 0.4359 0.4488 0.4231 0.0069  -0.0144 0.0068  192 TRP B C   
3180 O  O   . TRP B 201 ? 0.4398 0.4627 0.4417 0.0196  -0.0323 0.0222  192 TRP B O   
3181 C  CB  . TRP B 201 ? 0.4218 0.4575 0.4261 0.0389  -0.0027 0.0132  192 TRP B CB  
3182 C  CG  . TRP B 201 ? 0.4532 0.4537 0.4137 0.0691  0.0228  0.0141  192 TRP B CG  
3183 C  CD1 . TRP B 201 ? 0.4490 0.4348 0.4139 0.0201  -0.0020 -0.0124 192 TRP B CD1 
3184 C  CD2 . TRP B 201 ? 0.3948 0.4094 0.4035 -0.0092 -0.0115 -0.0328 192 TRP B CD2 
3185 N  NE1 . TRP B 201 ? 0.4540 0.4668 0.4203 0.0367  -0.0166 -0.0159 192 TRP B NE1 
3186 C  CE2 . TRP B 201 ? 0.4120 0.4040 0.4207 -0.0001 0.0039  0.0070  192 TRP B CE2 
3187 C  CE3 . TRP B 201 ? 0.3685 0.3316 0.3534 -0.0125 0.0178  0.0341  192 TRP B CE3 
3188 C  CZ2 . TRP B 201 ? 0.3662 0.4060 0.4135 0.0017  -0.0206 -0.0115 192 TRP B CZ2 
3189 C  CZ3 . TRP B 201 ? 0.3384 0.3428 0.3812 -0.0403 0.0120  0.0017  192 TRP B CZ3 
3190 C  CH2 . TRP B 201 ? 0.3386 0.3090 0.4176 -0.0516 -0.0123 -0.0002 192 TRP B CH2 
3191 N  N   . ASP B 202 ? 0.4493 0.4582 0.4453 0.0204  -0.0119 0.0074  193 ASP B N   
3192 C  CA  . ASP B 202 ? 0.4714 0.4786 0.4553 0.0065  -0.0097 -0.0051 193 ASP B CA  
3193 C  C   . ASP B 202 ? 0.4892 0.4886 0.4643 0.0093  -0.0077 0.0015  193 ASP B C   
3194 O  O   . ASP B 202 ? 0.4961 0.5178 0.4450 0.0187  -0.0203 0.0114  193 ASP B O   
3195 C  CB  . ASP B 202 ? 0.5112 0.4916 0.4883 0.0059  -0.0070 0.0010  193 ASP B CB  
3196 C  CG  . ASP B 202 ? 0.5358 0.5627 0.5452 -0.0016 -0.0046 -0.0005 193 ASP B CG  
3197 O  OD1 . ASP B 202 ? 0.5939 0.6302 0.6230 0.0295  -0.0088 -0.0127 193 ASP B OD1 
3198 O  OD2 . ASP B 202 ? 0.5704 0.5695 0.5878 -0.0119 -0.0178 0.0158  193 ASP B OD2 
3199 N  N   . ARG B 203 ? 0.4765 0.4897 0.4726 0.0090  -0.0074 0.0001  194 ARG B N   
3200 C  CA  . ARG B 203 ? 0.4714 0.4821 0.4622 0.0070  -0.0087 -0.0004 194 ARG B CA  
3201 C  C   . ARG B 203 ? 0.4559 0.4711 0.4487 0.0136  -0.0061 0.0055  194 ARG B C   
3202 O  O   . ARG B 203 ? 0.4405 0.4600 0.4143 0.0312  -0.0030 0.0095  194 ARG B O   
3203 C  CB  . ARG B 203 ? 0.4803 0.4839 0.4692 0.0084  -0.0065 0.0004  194 ARG B CB  
3204 C  CG  . ARG B 203 ? 0.4838 0.5136 0.5017 0.0077  -0.0042 0.0026  194 ARG B CG  
3205 C  CD  . ARG B 203 ? 0.5790 0.5933 0.5755 0.0006  0.0002  -0.0227 194 ARG B CD  
3206 N  NE  . ARG B 203 ? 0.6114 0.6013 0.6164 -0.0044 -0.0002 0.0007  194 ARG B NE  
3207 C  CZ  . ARG B 203 ? 0.6689 0.6214 0.6558 0.0087  -0.0015 -0.0032 194 ARG B CZ  
3208 N  NH1 . ARG B 203 ? 0.6850 0.6219 0.6448 -0.0013 0.0022  0.0122  194 ARG B NH1 
3209 N  NH2 . ARG B 203 ? 0.6612 0.6227 0.6387 -0.0220 0.0064  -0.0032 194 ARG B NH2 
3210 N  N   . VAL B 204 ? 0.4469 0.4732 0.4545 0.0136  -0.0097 0.0002  195 VAL B N   
3211 C  CA  . VAL B 204 ? 0.4605 0.4737 0.4502 0.0096  -0.0056 0.0035  195 VAL B CA  
3212 C  C   . VAL B 204 ? 0.4586 0.4705 0.4383 0.0104  -0.0032 0.0081  195 VAL B C   
3213 O  O   . VAL B 204 ? 0.4435 0.4397 0.3912 0.0295  -0.0240 0.0130  195 VAL B O   
3214 C  CB  . VAL B 204 ? 0.4414 0.4650 0.4374 0.0047  -0.0111 -0.0022 195 VAL B CB  
3215 C  CG1 . VAL B 204 ? 0.4580 0.4532 0.4176 0.0180  0.0052  0.0188  195 VAL B CG1 
3216 C  CG2 . VAL B 204 ? 0.4664 0.4508 0.4549 0.0047  -0.0012 -0.0057 195 VAL B CG2 
3217 N  N   . ASN B 205 ? 0.4827 0.4916 0.4554 0.0012  -0.0063 0.0013  196 ASN B N   
3218 C  CA  . ASN B 205 ? 0.5035 0.5061 0.4894 0.0084  -0.0082 0.0056  196 ASN B CA  
3219 C  C   . ASN B 205 ? 0.5262 0.5293 0.5028 0.0064  -0.0043 0.0008  196 ASN B C   
3220 O  O   . ASN B 205 ? 0.5440 0.5391 0.5170 0.0015  0.0005  0.0004  196 ASN B O   
3221 C  CB  . ASN B 205 ? 0.5202 0.5196 0.5029 0.0048  -0.0053 -0.0010 196 ASN B CB  
3222 C  CG  . ASN B 205 ? 0.5199 0.5493 0.5543 0.0048  0.0007  -0.0071 196 ASN B CG  
3223 O  OD1 . ASN B 205 ? 0.5671 0.5655 0.5558 -0.0047 0.0005  -0.0016 196 ASN B OD1 
3224 N  ND2 . ASN B 205 ? 0.5546 0.5584 0.5847 0.0062  -0.0214 0.0107  196 ASN B ND2 
3225 N  N   . GLU B 206 ? 0.5403 0.5298 0.5039 0.0135  -0.0095 -0.0011 197 GLU B N   
3226 C  CA  . GLU B 206 ? 0.5538 0.5478 0.5298 0.0107  0.0008  -0.0002 197 GLU B CA  
3227 C  C   . GLU B 206 ? 0.5460 0.5418 0.5251 0.0192  0.0000  0.0010  197 GLU B C   
3228 O  O   . GLU B 206 ? 0.5402 0.5540 0.5040 0.0285  -0.0135 0.0047  197 GLU B O   
3229 C  CB  . GLU B 206 ? 0.5660 0.5510 0.5308 0.0118  -0.0023 0.0017  197 GLU B CB  
3230 C  CG  . GLU B 206 ? 0.6052 0.5866 0.6031 0.0129  0.0074  -0.0007 197 GLU B CG  
3231 C  CD  . GLU B 206 ? 0.6344 0.5854 0.6227 0.0095  0.0047  -0.0061 197 GLU B CD  
3232 O  OE1 . GLU B 206 ? 0.6728 0.7130 0.7138 0.0230  -0.0060 -0.0028 197 GLU B OE1 
3233 O  OE2 . GLU B 206 ? 0.6740 0.6756 0.7390 -0.0172 -0.0007 -0.0115 197 GLU B OE2 
3234 N  N   . LYS B 207 ? 0.5541 0.5444 0.5226 0.0083  -0.0013 -0.0016 198 LYS B N   
3235 C  CA  . LYS B 207 ? 0.5584 0.5590 0.5393 0.0042  0.0038  0.0008  198 LYS B CA  
3236 C  C   . LYS B 207 ? 0.5516 0.5583 0.5321 0.0020  -0.0043 0.0022  198 LYS B C   
3237 O  O   . LYS B 207 ? 0.5400 0.5388 0.5204 0.0049  -0.0037 0.0081  198 LYS B O   
3238 C  CB  . LYS B 207 ? 0.5650 0.5750 0.5493 0.0033  0.0014  0.0019  198 LYS B CB  
3239 C  CG  . LYS B 207 ? 0.5739 0.5657 0.5625 0.0048  0.0072  -0.0005 198 LYS B CG  
3240 C  CD  . LYS B 207 ? 0.5626 0.5707 0.5794 0.0003  -0.0032 0.0020  198 LYS B CD  
3241 C  CE  . LYS B 207 ? 0.5742 0.5965 0.5916 0.0113  -0.0028 0.0014  198 LYS B CE  
3242 N  NZ  . LYS B 207 ? 0.5724 0.5648 0.5209 0.0172  -0.0078 0.0116  198 LYS B NZ  
3243 N  N   . TYR B 208 ? 0.5557 0.5651 0.5290 0.0048  0.0009  0.0028  199 TYR B N   
3244 C  CA  . TYR B 208 ? 0.5730 0.5737 0.5555 0.0036  0.0024  0.0007  199 TYR B CA  
3245 C  C   . TYR B 208 ? 0.5793 0.5823 0.5601 0.0042  0.0029  0.0012  199 TYR B C   
3246 O  O   . TYR B 208 ? 0.5760 0.5844 0.5328 0.0095  0.0055  -0.0013 199 TYR B O   
3247 C  CB  . TYR B 208 ? 0.5738 0.5379 0.5563 0.0102  0.0005  0.0034  199 TYR B CB  
3248 C  CG  . TYR B 208 ? 0.5711 0.5707 0.5413 0.0049  0.0008  0.0024  199 TYR B CG  
3249 C  CD1 . TYR B 208 ? 0.5341 0.5488 0.5137 0.0071  -0.0114 0.0186  199 TYR B CD1 
3250 C  CD2 . TYR B 208 ? 0.5942 0.5874 0.5703 0.0194  -0.0038 -0.0040 199 TYR B CD2 
3251 C  CE1 . TYR B 208 ? 0.5511 0.5614 0.5624 -0.0028 -0.0002 -0.0123 199 TYR B CE1 
3252 C  CE2 . TYR B 208 ? 0.5976 0.5858 0.5840 0.0045  -0.0004 -0.0016 199 TYR B CE2 
3253 C  CZ  . TYR B 208 ? 0.5804 0.5722 0.5562 0.0046  0.0023  -0.0088 199 TYR B CZ  
3254 O  OH  . TYR B 208 ? 0.5768 0.5817 0.5286 0.0178  -0.0092 0.0357  199 TYR B OH  
3255 N  N   . LEU B 209 ? 0.5928 0.6006 0.5742 0.0036  -0.0039 -0.0045 200 LEU B N   
3256 C  CA  . LEU B 209 ? 0.6137 0.6117 0.5924 0.0022  -0.0047 0.0031  200 LEU B CA  
3257 C  C   . LEU B 209 ? 0.6239 0.6239 0.6051 0.0033  -0.0015 0.0036  200 LEU B C   
3258 O  O   . LEU B 209 ? 0.6421 0.6252 0.6395 0.0091  -0.0121 0.0106  200 LEU B O   
3259 C  CB  . LEU B 209 ? 0.6233 0.6161 0.6093 0.0000  -0.0018 -0.0010 200 LEU B CB  
3260 C  CG  . LEU B 209 ? 0.6402 0.6460 0.6513 0.0036  -0.0037 -0.0030 200 LEU B CG  
3261 C  CD1 . LEU B 209 ? 0.6678 0.6602 0.6673 0.0006  -0.0080 -0.0021 200 LEU B CD1 
3262 C  CD2 . LEU B 209 ? 0.6513 0.6434 0.6508 0.0040  -0.0097 0.0091  200 LEU B CD2 
3263 N  N   . GLN B 210 ? 0.6336 0.6229 0.6023 0.0076  -0.0008 0.0051  201 GLN B N   
3264 C  CA  . GLN B 210 ? 0.6361 0.6354 0.6280 0.0052  0.0003  0.0021  201 GLN B CA  
3265 C  C   . GLN B 210 ? 0.6510 0.6421 0.6422 0.0054  0.0060  0.0027  201 GLN B C   
3266 O  O   . GLN B 210 ? 0.6776 0.6525 0.6530 0.0032  0.0176  0.0048  201 GLN B O   
3267 C  CB  . GLN B 210 ? 0.6428 0.6328 0.6297 0.0014  -0.0020 0.0033  201 GLN B CB  
3268 C  CG  . GLN B 210 ? 0.6571 0.6450 0.6404 -0.0025 -0.0022 0.0000  201 GLN B CG  
3269 C  CD  . GLN B 210 ? 0.6594 0.6463 0.6592 0.0087  0.0008  -0.0005 201 GLN B CD  
3270 O  OE1 . GLN B 210 ? 0.7045 0.6899 0.7204 0.0048  -0.0059 -0.0136 201 GLN B OE1 
3271 N  NE2 . GLN B 210 ? 0.6812 0.6773 0.7245 0.0012  -0.0107 -0.0075 201 GLN B NE2 
3272 N  N   . ALA B 211 ? 0.6440 0.6426 0.6368 0.0059  0.0042  0.0056  202 ALA B N   
3273 C  CA  . ALA B 211 ? 0.6535 0.6461 0.6486 0.0014  0.0014  0.0021  202 ALA B CA  
3274 C  C   . ALA B 211 ? 0.6707 0.6569 0.6672 0.0003  -0.0031 0.0049  202 ALA B C   
3275 O  O   . ALA B 211 ? 0.6759 0.6488 0.6661 0.0002  -0.0028 0.0054  202 ALA B O   
3276 C  CB  . ALA B 211 ? 0.6470 0.6368 0.6430 0.0017  0.0001  0.0059  202 ALA B CB  
3277 N  N   . ILE B 212 ? 0.6773 0.6662 0.6826 0.0016  -0.0061 0.0076  203 ILE B N   
3278 C  CA  . ILE B 212 ? 0.6788 0.6736 0.6831 0.0035  -0.0019 0.0053  203 ILE B CA  
3279 C  C   . ILE B 212 ? 0.6947 0.6846 0.6913 0.0015  0.0054  0.0045  203 ILE B C   
3280 O  O   . ILE B 212 ? 0.7053 0.6852 0.7071 -0.0009 0.0127  0.0045  203 ILE B O   
3281 C  CB  . ILE B 212 ? 0.6795 0.6776 0.6906 0.0061  -0.0044 0.0034  203 ILE B CB  
3282 C  CG1 . ILE B 212 ? 0.6747 0.6651 0.6774 0.0019  -0.0030 0.0091  203 ILE B CG1 
3283 C  CG2 . ILE B 212 ? 0.6894 0.6738 0.6955 -0.0012 -0.0065 0.0069  203 ILE B CG2 
3284 C  CD1 . ILE B 212 ? 0.6841 0.6781 0.6835 0.0041  -0.0060 0.0075  203 ILE B CD1 
3285 MN MN  . MN  C .   ? 0.2574 0.2571 0.1969 -0.0165 -0.0249 0.0071  209 MN  A MN  
3286 MN MN  . MN  D .   ? 0.2780 0.2506 0.2441 0.0270  -0.0326 0.0060  209 MN  B MN  
3287 O  O   . HOH E .   ? 0.2819 0.2054 0.2068 -0.0063 -0.0377 0.0047  210 HOH A O   
3288 O  O   . HOH E .   ? 0.2171 0.2260 0.2747 0.0241  -0.0167 0.0306  211 HOH A O   
3289 O  O   . HOH E .   ? 0.3093 0.2510 0.2689 -0.0057 0.0007  0.0274  212 HOH A O   
3290 O  O   . HOH E .   ? 0.2854 0.2681 0.2512 -0.0105 0.0203  0.0277  213 HOH A O   
3291 O  O   . HOH E .   ? 0.2899 0.2844 0.2600 0.0451  -0.0399 0.0198  214 HOH A O   
3292 O  O   . HOH E .   ? 0.3414 0.3078 0.2519 0.0124  -0.0063 -0.0117 215 HOH A O   
3293 O  O   . HOH E .   ? 0.2927 0.2802 0.2585 0.0415  -0.0376 -0.0597 216 HOH A O   
3294 O  O   . HOH E .   ? 0.3259 0.3933 0.1774 0.0202  0.0007  0.0106  217 HOH A O   
3295 O  O   . HOH E .   ? 0.3330 0.2989 0.3226 0.0009  0.0000  -0.0039 218 HOH A O   
3296 O  O   . HOH E .   ? 0.3840 0.2916 0.2491 0.0329  -0.0307 0.0209  219 HOH A O   
3297 O  O   . HOH E .   ? 0.3132 0.3707 0.2213 -0.0349 -0.0110 0.0129  220 HOH A O   
3298 O  O   . HOH E .   ? 0.3482 0.3109 0.2453 -0.0173 -0.0274 0.0505  221 HOH A O   
3299 O  O   . HOH E .   ? 0.3130 0.3214 0.3179 -0.0080 -0.0141 -0.0106 222 HOH A O   
3300 O  O   . HOH E .   ? 0.3548 0.3755 0.2145 0.0008  0.0192  0.0018  223 HOH A O   
3301 O  O   . HOH E .   ? 0.3626 0.3075 0.3131 -0.0130 0.0273  0.0368  224 HOH A O   
3302 O  O   . HOH E .   ? 0.3305 0.2707 0.3318 -0.0062 -0.0225 0.0123  225 HOH A O   
3303 O  O   . HOH E .   ? 0.3477 0.3985 0.2867 -0.0221 -0.0078 0.0439  226 HOH A O   
3304 O  O   . HOH E .   ? 0.3252 0.3872 0.2451 -0.0207 -0.0628 0.0532  227 HOH A O   
3305 O  O   . HOH E .   ? 0.3917 0.3328 0.2998 -0.0408 0.0274  0.0337  228 HOH A O   
3306 O  O   . HOH E .   ? 0.3662 0.3322 0.2830 -0.0370 -0.0147 0.0362  229 HOH A O   
3307 O  O   . HOH E .   ? 0.3779 0.3705 0.2560 0.0028  0.0302  -0.0019 230 HOH A O   
3308 O  O   . HOH E .   ? 0.3841 0.3679 0.2574 0.0362  -0.0723 -0.0153 231 HOH A O   
3309 O  O   . HOH E .   ? 0.3449 0.3335 0.3081 -0.0538 0.0397  -0.0691 232 HOH A O   
3310 O  O   . HOH E .   ? 0.2922 0.3549 0.4491 -0.0557 -0.0576 0.0317  233 HOH A O   
3311 O  O   . HOH E .   ? 0.3202 0.3331 0.3063 0.0180  -0.0390 0.0597  234 HOH A O   
3312 O  O   . HOH E .   ? 0.3857 0.3417 0.3647 0.0103  -0.0480 -0.0367 235 HOH A O   
3313 O  O   . HOH E .   ? 0.3969 0.2532 0.3762 -0.0507 -0.0158 -0.0174 236 HOH A O   
3314 O  O   . HOH E .   ? 0.3467 0.3959 0.3632 -0.0051 -0.0190 0.0267  237 HOH A O   
3315 O  O   . HOH E .   ? 0.3471 0.3981 0.3434 -0.0322 -0.0635 0.0281  238 HOH A O   
3316 O  O   . HOH E .   ? 0.2734 0.4742 0.2478 0.0055  -0.0149 0.0206  239 HOH A O   
3317 O  O   . HOH E .   ? 0.4022 0.3481 0.4158 -0.0206 -0.0177 0.0670  240 HOH A O   
3318 O  O   . HOH E .   ? 0.4037 0.3916 0.3078 -0.0291 0.0121  -0.0107 241 HOH A O   
3319 O  O   . HOH E .   ? 0.4248 0.3970 0.2465 0.0008  -0.0206 0.0618  242 HOH A O   
3320 O  O   . HOH E .   ? 0.4204 0.3687 0.4151 0.0145  0.0260  0.0298  243 HOH A O   
3321 O  O   . HOH E .   ? 0.3944 0.3992 0.2824 -0.0102 -0.0846 -0.0188 244 HOH A O   
3322 O  O   . HOH E .   ? 0.4133 0.3367 0.3865 0.0238  -0.0169 0.0065  245 HOH A O   
3323 O  O   . HOH E .   ? 0.4341 0.4008 0.2484 0.0009  -0.0021 0.0507  246 HOH A O   
3324 O  O   . HOH E .   ? 0.4000 0.4209 0.3343 -0.0014 -0.0560 -0.0258 247 HOH A O   
3325 O  O   . HOH E .   ? 0.4162 0.4028 0.4179 0.0282  0.0182  -0.0373 248 HOH A O   
3326 O  O   . HOH E .   ? 0.4572 0.3671 0.4051 -0.0487 0.0212  0.0523  249 HOH A O   
3327 O  O   . HOH E .   ? 0.3420 0.4456 0.3808 0.0224  -0.0184 -0.0255 250 HOH A O   
3328 O  O   . HOH E .   ? 0.4658 0.4009 0.3821 -0.0115 -0.0187 -0.0536 251 HOH A O   
3329 O  O   . HOH E .   ? 0.4658 0.3898 0.3894 -0.0126 -0.0343 -0.0518 252 HOH A O   
3330 O  O   . HOH E .   ? 0.3797 0.4505 0.4810 -0.0008 -0.0520 -0.0073 253 HOH A O   
3331 O  O   . HOH E .   ? 0.3969 0.4017 0.3367 -0.0186 -0.0232 -0.0328 254 HOH A O   
3332 O  O   . HOH E .   ? 0.3908 0.3776 0.4396 -0.0226 0.0005  0.0241  255 HOH A O   
3333 O  O   . HOH E .   ? 0.4273 0.4735 0.3430 -0.0203 -0.0369 -0.0288 256 HOH A O   
3334 O  O   . HOH E .   ? 0.4398 0.3890 0.4111 0.0179  -0.0244 -0.0329 257 HOH A O   
3335 O  O   . HOH E .   ? 0.4133 0.4769 0.3891 -0.0117 -0.0089 -0.0402 258 HOH A O   
3336 O  O   . HOH E .   ? 0.4781 0.4636 0.3567 0.0084  0.0021  0.0263  259 HOH A O   
3337 O  O   . HOH E .   ? 0.3706 0.4593 0.4137 -0.0155 0.0143  -0.0253 260 HOH A O   
3338 O  O   . HOH E .   ? 0.4682 0.4731 0.3020 0.0172  -0.0013 0.0456  261 HOH A O   
3339 O  O   . HOH E .   ? 0.3205 0.4569 0.4880 0.0412  -0.0125 0.0108  262 HOH A O   
3340 O  O   . HOH E .   ? 0.4865 0.4128 0.3767 -0.0138 -0.0045 -0.0374 263 HOH A O   
3341 O  O   . HOH E .   ? 0.3995 0.4682 0.3128 -0.0256 -0.0599 -0.0090 264 HOH A O   
3342 O  O   . HOH E .   ? 0.5423 0.3621 0.3911 0.0220  -0.0367 0.0354  265 HOH A O   
3343 O  O   . HOH E .   ? 0.4945 0.5373 0.4531 -0.0084 -0.0173 0.0323  266 HOH A O   
3344 O  O   . HOH E .   ? 0.4488 0.4850 0.4168 -0.0123 -0.0110 -0.0018 267 HOH A O   
3345 O  O   . HOH E .   ? 0.4571 0.4789 0.3593 0.0370  -0.0002 -0.0155 268 HOH A O   
3346 O  O   . HOH E .   ? 0.4580 0.4735 0.4201 0.0001  0.0028  -0.0177 269 HOH A O   
3347 O  O   . HOH E .   ? 0.4224 0.4821 0.3964 -0.0212 0.0205  0.0227  270 HOH A O   
3348 O  O   . HOH E .   ? 0.4397 0.4577 0.4592 0.0023  -0.0479 0.0040  271 HOH A O   
3349 O  O   . HOH E .   ? 0.4458 0.4635 0.4119 -0.0053 0.0348  0.0323  272 HOH A O   
3350 O  O   . HOH E .   ? 0.3589 0.4538 0.4910 0.0301  -0.0051 -0.0135 273 HOH A O   
3351 O  O   . HOH E .   ? 0.4989 0.4877 0.4458 -0.0049 -0.0121 -0.0080 274 HOH A O   
3352 O  O   . HOH E .   ? 0.4795 0.4350 0.4635 -0.0178 0.0205  0.0211  275 HOH A O   
3353 O  O   . HOH E .   ? 0.3982 0.4498 0.3978 -0.0195 0.0096  -0.0115 276 HOH A O   
3354 O  O   . HOH E .   ? 0.5219 0.3865 0.3684 0.0305  -0.0094 0.0017  277 HOH A O   
3355 O  O   . HOH E .   ? 0.4844 0.4745 0.3459 0.0006  0.0004  0.0306  278 HOH A O   
3356 O  O   . HOH E .   ? 0.4771 0.4450 0.4824 0.0163  -0.0257 0.0118  279 HOH A O   
3357 O  O   . HOH E .   ? 0.4273 0.4723 0.5064 -0.0125 0.0391  -0.0149 280 HOH A O   
3358 O  O   . HOH E .   ? 0.4720 0.4665 0.3670 -0.0024 -0.0466 0.0374  281 HOH A O   
3359 O  O   . HOH E .   ? 0.5430 0.4984 0.4436 -0.0183 -0.0018 -0.0375 282 HOH A O   
3360 O  O   . HOH E .   ? 0.5889 0.4362 0.4347 -0.0065 0.0054  -0.0175 283 HOH A O   
3361 O  O   . HOH E .   ? 0.5051 0.5082 0.4437 0.0358  -0.0565 -0.0661 284 HOH A O   
3362 O  O   . HOH E .   ? 0.4833 0.4545 0.4451 -0.0102 -0.0368 0.0245  285 HOH A O   
3363 O  O   . HOH E .   ? 0.4796 0.5200 0.4482 0.0207  0.0138  -0.0216 286 HOH A O   
3364 O  O   . HOH E .   ? 0.4576 0.4998 0.4259 -0.0113 -0.0003 0.0436  287 HOH A O   
3365 O  O   . HOH E .   ? 0.5380 0.5660 0.5262 0.0238  0.0020  0.0136  288 HOH A O   
3366 O  O   . HOH E .   ? 0.5530 0.5566 0.5149 -0.0232 -0.0171 0.0046  289 HOH A O   
3367 O  O   . HOH E .   ? 0.4223 0.4564 0.5015 0.0475  -0.0213 -0.0242 290 HOH A O   
3368 O  O   . HOH E .   ? 0.4724 0.5054 0.4942 0.0004  0.0244  -0.0169 291 HOH A O   
3369 O  O   . HOH E .   ? 0.5411 0.4499 0.5002 -0.0103 0.0177  0.0085  292 HOH A O   
3370 O  O   . HOH E .   ? 0.4885 0.4855 0.5024 -0.0068 0.0114  -0.0048 293 HOH A O   
3371 O  O   . HOH E .   ? 0.5385 0.5320 0.4714 0.0298  0.0093  0.0227  294 HOH A O   
3372 O  O   . HOH E .   ? 0.5156 0.4979 0.5439 0.0599  -0.0510 -0.0156 295 HOH A O   
3373 O  O   . HOH E .   ? 0.5254 0.5514 0.5084 -0.0157 0.0092  0.0407  296 HOH A O   
3374 O  O   . HOH E .   ? 0.4844 0.4634 0.4723 0.0700  0.0181  0.0316  297 HOH A O   
3375 O  O   . HOH E .   ? 0.5036 0.5388 0.4286 0.0111  -0.0105 0.0082  298 HOH A O   
3376 O  O   . HOH E .   ? 0.5459 0.4793 0.4973 0.0545  0.0193  -0.0010 299 HOH A O   
3377 O  O   . HOH E .   ? 0.4523 0.5474 0.5346 0.0342  -0.0195 -0.0024 300 HOH A O   
3378 O  O   . HOH E .   ? 0.5288 0.5294 0.5712 0.0016  -0.0039 -0.0142 301 HOH A O   
3379 O  O   . HOH E .   ? 0.5954 0.4907 0.4461 -0.0123 -0.0170 0.0404  302 HOH A O   
3380 O  O   . HOH E .   ? 0.5378 0.5157 0.5012 -0.0266 -0.0549 0.0038  303 HOH A O   
3381 O  O   . HOH E .   ? 0.5663 0.5315 0.4407 -0.0076 -0.0109 0.0267  304 HOH A O   
3382 O  O   . HOH E .   ? 0.4798 0.5831 0.5297 -0.0209 -0.0079 0.0063  305 HOH A O   
3383 O  O   . HOH E .   ? 0.5495 0.5839 0.5263 0.0052  -0.0348 -0.0051 306 HOH A O   
3384 O  O   . HOH E .   ? 0.6352 0.6475 0.6637 -0.0065 -0.0059 0.0159  307 HOH A O   
3385 O  O   . HOH E .   ? 0.5013 0.5004 0.4882 0.0149  -0.0263 -0.0165 308 HOH A O   
3386 O  O   . HOH E .   ? 0.4771 0.5735 0.5153 0.0119  -0.0228 0.0179  309 HOH A O   
3387 O  O   . HOH E .   ? 0.5868 0.6394 0.5679 0.0107  0.0424  0.0024  310 HOH A O   
3388 O  O   . HOH E .   ? 0.5389 0.5046 0.5063 0.0080  0.0095  -0.0136 311 HOH A O   
3389 O  O   . HOH E .   ? 0.6744 0.5805 0.6342 0.0104  0.0270  -0.0050 312 HOH A O   
3390 O  O   . HOH E .   ? 0.5022 0.5253 0.4871 0.0343  -0.0248 -0.0250 313 HOH A O   
3391 O  O   . HOH E .   ? 0.5205 0.5472 0.5676 -0.0052 -0.0013 0.0091  314 HOH A O   
3392 O  O   . HOH E .   ? 0.5724 0.5053 0.5401 -0.0201 -0.0139 0.0044  315 HOH A O   
3393 O  O   . HOH E .   ? 0.5319 0.5261 0.5775 -0.0101 -0.0029 -0.0187 316 HOH A O   
3394 O  O   . HOH E .   ? 0.5466 0.5550 0.5540 -0.0181 -0.0040 -0.0071 317 HOH A O   
3395 O  O   . HOH E .   ? 0.5048 0.5506 0.5080 0.0139  0.0132  0.0049  318 HOH A O   
3396 O  O   . HOH E .   ? 0.5911 0.5799 0.5287 -0.0126 0.0079  -0.0001 319 HOH A O   
3397 O  O   . HOH E .   ? 0.5474 0.5831 0.5522 0.0199  -0.0007 0.0146  320 HOH A O   
3398 O  O   . HOH E .   ? 0.6849 0.6374 0.6090 0.0070  -0.0136 0.0353  321 HOH A O   
3399 O  O   . HOH E .   ? 0.6090 0.6470 0.5752 -0.0113 0.0218  -0.0116 322 HOH A O   
3400 O  O   . HOH E .   ? 0.5870 0.5837 0.5761 0.0258  -0.0347 -0.0076 323 HOH A O   
3401 O  O   . HOH E .   ? 0.7475 0.7349 0.7313 -0.0138 0.0026  -0.0079 324 HOH A O   
3402 O  O   . HOH E .   ? 0.7460 0.7439 0.7655 -0.0059 -0.0129 -0.0106 325 HOH A O   
3403 O  O   . HOH E .   ? 0.7371 0.6659 0.7014 -0.0049 -0.0094 -0.0250 326 HOH A O   
3404 O  O   . HOH E .   ? 0.5947 0.4813 0.5636 0.0141  0.0101  0.0056  327 HOH A O   
3405 O  O   . HOH E .   ? 0.5024 0.5440 0.5253 0.0177  -0.0165 -0.0090 328 HOH A O   
3406 O  O   . HOH E .   ? 0.5331 0.5882 0.5497 -0.0065 0.0100  -0.0027 329 HOH A O   
3407 O  O   . HOH E .   ? 0.5871 0.5167 0.5229 -0.0289 0.0084  -0.0126 330 HOH A O   
3408 O  O   . HOH E .   ? 0.4740 0.4799 0.4676 -0.0024 0.0264  -0.0418 331 HOH A O   
3409 O  O   . HOH E .   ? 0.4808 0.4553 0.4297 -0.0073 -0.0488 0.0059  332 HOH A O   
3410 O  O   . HOH E .   ? 0.3861 0.4745 0.5184 0.0471  -0.0526 -0.0175 333 HOH A O   
3411 O  O   . HOH E .   ? 0.5374 0.5971 0.6743 -0.0165 0.0056  -0.0240 334 HOH A O   
3412 O  O   . HOH E .   ? 0.5444 0.6263 0.5802 0.0054  -0.0011 -0.0370 335 HOH A O   
3413 O  O   . HOH E .   ? 0.5610 0.4398 0.4767 -0.0112 0.0367  0.0424  336 HOH A O   
3414 O  O   . HOH E .   ? 0.6044 0.6498 0.5603 -0.0212 0.0074  0.0083  337 HOH A O   
3415 O  O   . HOH E .   ? 0.5558 0.5561 0.5653 0.0074  -0.0004 0.0030  338 HOH A O   
3416 O  O   . HOH E .   ? 0.5099 0.5720 0.5729 0.0076  -0.0219 0.0197  339 HOH A O   
3417 O  O   . HOH E .   ? 0.5651 0.5965 0.6099 0.0035  -0.0094 -0.0091 340 HOH A O   
3418 O  O   . HOH E .   ? 0.5560 0.6060 0.5851 -0.0160 -0.0094 -0.0104 341 HOH A O   
3419 O  O   . HOH E .   ? 0.5109 0.5117 0.5826 0.0104  -0.0246 0.0186  342 HOH A O   
3420 O  O   . HOH E .   ? 0.5430 0.5808 0.5517 -0.0248 -0.0397 -0.0010 343 HOH A O   
3421 O  O   . HOH E .   ? 0.5918 0.5805 0.5707 -0.0342 0.0002  0.0252  344 HOH A O   
3422 O  O   . HOH E .   ? 0.6157 0.6018 0.6897 0.0201  0.0145  0.0112  345 HOH A O   
3423 O  O   . HOH E .   ? 0.5844 0.5636 0.5466 -0.0147 -0.0126 -0.0091 346 HOH A O   
3424 O  O   . HOH E .   ? 0.4945 0.4087 0.4719 -0.0017 -0.0467 -0.0236 347 HOH A O   
3425 O  O   . HOH E .   ? 0.4924 0.6002 0.4469 0.0137  0.0090  0.0331  348 HOH A O   
3426 O  O   . HOH E .   ? 0.5522 0.6429 0.5908 0.0049  -0.0078 -0.0036 349 HOH A O   
3427 O  O   . HOH E .   ? 0.4515 0.5499 0.3905 -0.0143 -0.0162 -0.0194 350 HOH A O   
3428 O  O   . HOH E .   ? 0.5640 0.5791 0.6028 0.0161  0.0402  0.0126  351 HOH A O   
3429 O  O   . HOH E .   ? 0.6023 0.4413 0.4904 -0.0222 0.0007  0.0382  352 HOH A O   
3430 O  O   . HOH E .   ? 0.5492 0.4755 0.5568 -0.0248 -0.0196 -0.0079 353 HOH A O   
3431 O  O   . HOH E .   ? 0.7526 0.7406 0.7255 -0.0088 -0.0081 -0.0142 354 HOH A O   
3432 O  O   . HOH E .   ? 0.5125 0.6283 0.5624 0.0184  -0.0222 0.0045  355 HOH A O   
3433 O  O   . HOH E .   ? 0.6801 0.7165 0.6634 0.0083  -0.0011 -0.0059 356 HOH A O   
3434 O  O   . HOH E .   ? 0.6896 0.6635 0.6509 0.0013  -0.0110 0.0106  357 HOH A O   
3435 O  O   . HOH E .   ? 0.5529 0.5913 0.5748 -0.0180 0.0022  0.0026  358 HOH A O   
3436 O  O   . HOH E .   ? 0.5919 0.5925 0.5061 -0.0044 -0.0103 -0.0069 359 HOH A O   
3437 O  O   . HOH E .   ? 0.6098 0.6123 0.5783 -0.0325 0.0096  -0.0233 360 HOH A O   
3438 O  O   . HOH E .   ? 0.5670 0.6372 0.6085 0.0211  -0.0129 -0.0273 361 HOH A O   
3439 O  O   . HOH E .   ? 0.5105 0.5560 0.5272 0.0211  -0.0104 0.0178  362 HOH A O   
3440 O  O   . HOH E .   ? 0.6195 0.6084 0.5911 -0.0162 0.0138  0.0151  363 HOH A O   
3441 O  O   . HOH E .   ? 0.5892 0.5812 0.6041 -0.0275 0.0095  0.0111  364 HOH A O   
3442 O  O   . HOH E .   ? 0.7100 0.7100 0.6783 -0.0090 0.0127  -0.0033 365 HOH A O   
3443 O  O   . HOH E .   ? 0.6201 0.6287 0.6416 -0.0091 -0.0352 -0.0185 366 HOH A O   
3444 O  O   . HOH E .   ? 0.6026 0.5821 0.6154 -0.0387 0.0064  0.0019  367 HOH A O   
3445 O  O   . HOH E .   ? 0.6939 0.6547 0.6642 0.0009  -0.0010 -0.0224 368 HOH A O   
3446 O  O   . HOH E .   ? 0.7612 0.7696 0.7591 -0.0046 0.0022  0.0081  369 HOH A O   
3447 O  O   . HOH E .   ? 0.8017 0.7871 0.7554 0.0008  -0.0007 -0.0048 370 HOH A O   
3448 O  O   . HOH E .   ? 0.7231 0.6733 0.6943 0.0026  0.0197  -0.0039 371 HOH A O   
3449 O  O   . HOH E .   ? 0.5714 0.5755 0.5086 -0.0111 -0.0042 0.0160  372 HOH A O   
3450 O  O   . HOH E .   ? 0.5958 0.6430 0.5677 0.0114  -0.0013 -0.0053 373 HOH A O   
3451 O  O   . HOH E .   ? 0.7189 0.7759 0.7085 -0.0100 -0.0036 -0.0010 374 HOH A O   
3452 O  O   . HOH E .   ? 0.6067 0.5500 0.5688 -0.0064 0.0025  -0.0203 375 HOH A O   
3453 O  O   . HOH E .   ? 0.8005 0.7642 0.7749 -0.0127 0.0002  -0.0098 376 HOH A O   
3454 O  O   . HOH E .   ? 0.7536 0.7262 0.7496 -0.0006 0.0018  0.0099  377 HOH A O   
3455 O  O   . HOH E .   ? 0.6414 0.6506 0.7075 -0.0119 -0.0081 -0.0090 378 HOH A O   
3456 O  O   . HOH E .   ? 0.7284 0.6817 0.6776 -0.0095 -0.0024 0.0088  379 HOH A O   
3457 O  O   . HOH E .   ? 0.6670 0.7010 0.6793 0.0168  -0.0096 -0.0134 380 HOH A O   
3458 O  O   . HOH E .   ? 0.7837 0.7938 0.7984 0.0056  0.0066  0.0109  381 HOH A O   
3459 O  O   . HOH E .   ? 0.7436 0.7405 0.7362 -0.0128 0.0062  -0.0123 382 HOH A O   
3460 O  O   . HOH E .   ? 0.5810 0.5796 0.5017 -0.0003 -0.0190 -0.0068 383 HOH A O   
3461 O  O   . HOH E .   ? 0.5033 0.5272 0.5776 0.0241  -0.0110 0.0284  384 HOH A O   
3462 O  O   . HOH E .   ? 0.6311 0.6171 0.5863 0.0238  -0.0030 -0.0250 385 HOH A O   
3463 O  O   . HOH E .   ? 0.4823 0.5393 0.5167 -0.0163 0.0114  -0.0280 386 HOH A O   
3464 O  O   . HOH E .   ? 0.7594 0.7705 0.7636 -0.0005 -0.0140 0.0005  387 HOH A O   
3465 O  O   . HOH E .   ? 0.2949 0.2308 0.1596 0.0253  0.0007  0.0062  388 HOH A O   
3466 O  O   . HOH E .   ? 0.5869 0.5808 0.5670 0.0121  -0.0108 -0.0025 389 HOH A O   
3467 O  O   . HOH E .   ? 0.6415 0.4510 0.5915 -0.0114 -0.0137 -0.0143 390 HOH A O   
3468 O  O   . HOH E .   ? 0.6006 0.6145 0.5449 0.0028  -0.0162 0.0583  391 HOH A O   
3469 O  O   . HOH E .   ? 0.6050 0.5824 0.5161 -0.0115 -0.0250 0.0086  392 HOH A O   
3470 O  O   . HOH E .   ? 0.5643 0.5486 0.6081 0.0083  0.0325  0.0080  393 HOH A O   
3471 O  O   . HOH E .   ? 0.6159 0.6247 0.5612 -0.0286 -0.0031 0.0059  394 HOH A O   
3472 O  O   . HOH F .   ? 0.2363 0.2411 0.2045 -0.0149 -0.0086 -0.0067 210 HOH B O   
3473 O  O   . HOH F .   ? 0.2686 0.2461 0.2177 -0.0384 -0.0314 -0.0035 211 HOH B O   
3474 O  O   . HOH F .   ? 0.2491 0.3031 0.2701 0.0179  -0.0152 0.0096  212 HOH B O   
3475 O  O   . HOH F .   ? 0.2458 0.2353 0.2778 0.0145  -0.0220 -0.0096 213 HOH B O   
3476 O  O   . HOH F .   ? 0.3112 0.2599 0.2197 -0.0343 0.0046  0.0181  214 HOH B O   
3477 O  O   . HOH F .   ? 0.2350 0.3351 0.2477 -0.0793 -0.0401 -0.0047 215 HOH B O   
3478 O  O   . HOH F .   ? 0.3174 0.2479 0.3024 -0.0403 -0.0258 0.0498  216 HOH B O   
3479 O  O   . HOH F .   ? 0.3072 0.3068 0.2484 -0.0207 0.0227  0.0355  217 HOH B O   
3480 O  O   . HOH F .   ? 0.3046 0.2975 0.3134 -0.0351 -0.0181 -0.0092 218 HOH B O   
3481 O  O   . HOH F .   ? 0.3494 0.2965 0.2857 -0.0088 -0.0018 -0.0077 219 HOH B O   
3482 O  O   . HOH F .   ? 0.3181 0.3414 0.1961 0.0097  -0.0131 0.0115  220 HOH B O   
3483 O  O   . HOH F .   ? 0.3012 0.2521 0.3551 -0.0003 -0.0177 0.0299  221 HOH B O   
3484 O  O   . HOH F .   ? 0.3558 0.3214 0.3104 -0.0169 -0.0262 0.0009  222 HOH B O   
3485 O  O   . HOH F .   ? 0.3574 0.3133 0.2821 0.0122  -0.0238 -0.0210 223 HOH B O   
3486 O  O   . HOH F .   ? 0.3694 0.3442 0.2327 0.0173  -0.0063 0.0501  224 HOH B O   
3487 O  O   . HOH F .   ? 0.2991 0.4037 0.2539 -0.0145 -0.0145 -0.0179 225 HOH B O   
3488 O  O   . HOH F .   ? 0.4018 0.3020 0.2800 0.0022  -0.0022 0.0554  226 HOH B O   
3489 O  O   . HOH F .   ? 0.3138 0.3295 0.3259 -0.0357 0.0016  0.0130  227 HOH B O   
3490 O  O   . HOH F .   ? 0.3481 0.3188 0.3600 0.0417  -0.0064 -0.0077 228 HOH B O   
3491 O  O   . HOH F .   ? 0.3575 0.3389 0.3971 0.0274  -0.0114 -0.0184 229 HOH B O   
3492 O  O   . HOH F .   ? 0.3931 0.3429 0.3475 0.0128  0.0048  0.0322  230 HOH B O   
3493 O  O   . HOH F .   ? 0.4431 0.3255 0.2954 -0.0032 0.0190  0.0045  231 HOH B O   
3494 O  O   . HOH F .   ? 0.4122 0.3853 0.2987 0.0366  -0.0132 0.0422  232 HOH B O   
3495 O  O   . HOH F .   ? 0.4635 0.2784 0.3254 -0.0261 -0.0416 0.0459  233 HOH B O   
3496 O  O   . HOH F .   ? 0.3477 0.3381 0.4072 -0.0426 -0.0479 0.0429  234 HOH B O   
3497 O  O   . HOH F .   ? 0.3943 0.5010 0.1841 0.0044  -0.0103 0.0202  235 HOH B O   
3498 O  O   . HOH F .   ? 0.3503 0.3417 0.3957 -0.0145 -0.0043 0.0437  236 HOH B O   
3499 O  O   . HOH F .   ? 0.4724 0.3762 0.3370 0.0148  -0.0326 0.0120  237 HOH B O   
3500 O  O   . HOH F .   ? 0.3512 0.3553 0.3684 0.0016  -0.0331 0.0212  238 HOH B O   
3501 O  O   . HOH F .   ? 0.3521 0.4232 0.3613 0.0056  0.0137  0.0475  239 HOH B O   
3502 O  O   . HOH F .   ? 0.2918 0.3942 0.3560 0.0268  -0.0014 -0.0138 240 HOH B O   
3503 O  O   . HOH F .   ? 0.4187 0.3515 0.3446 0.0002  -0.0057 0.0102  241 HOH B O   
3504 O  O   . HOH F .   ? 0.3960 0.4241 0.2970 -0.0009 0.0221  0.0467  242 HOH B O   
3505 O  O   . HOH F .   ? 0.4409 0.3949 0.4008 0.0184  -0.0022 -0.0073 243 HOH B O   
3506 O  O   . HOH F .   ? 0.4601 0.3583 0.4083 -0.0184 0.0000  0.0103  244 HOH B O   
3507 O  O   . HOH F .   ? 0.3641 0.4105 0.3513 -0.0333 -0.0294 -0.0175 245 HOH B O   
3508 O  O   . HOH F .   ? 0.4179 0.4501 0.3427 -0.0062 -0.0290 0.0168  246 HOH B O   
3509 O  O   . HOH F .   ? 0.4550 0.3707 0.4558 -0.0282 0.0134  0.0331  247 HOH B O   
3510 O  O   . HOH F .   ? 0.4383 0.3561 0.4044 -0.0038 0.0053  0.0077  248 HOH B O   
3511 O  O   . HOH F .   ? 0.4444 0.4028 0.3936 0.0388  -0.0228 0.0229  249 HOH B O   
3512 O  O   . HOH F .   ? 0.4105 0.4202 0.3192 0.0438  -0.0529 0.0290  250 HOH B O   
3513 O  O   . HOH F .   ? 0.3633 0.4319 0.4314 0.0305  0.0072  0.0417  251 HOH B O   
3514 O  O   . HOH F .   ? 0.3955 0.4377 0.4287 -0.0182 -0.0389 -0.0518 252 HOH B O   
3515 O  O   . HOH F .   ? 0.4503 0.3690 0.4244 -0.0146 -0.0037 -0.0041 253 HOH B O   
3516 O  O   . HOH F .   ? 0.4081 0.4234 0.3570 0.0256  0.0026  0.0417  254 HOH B O   
3517 O  O   . HOH F .   ? 0.4053 0.3861 0.3962 -0.0468 -0.0224 0.0428  255 HOH B O   
3518 O  O   . HOH F .   ? 0.4450 0.3824 0.3928 -0.0097 -0.0024 -0.0273 256 HOH B O   
3519 O  O   . HOH F .   ? 0.4112 0.3142 0.4706 -0.0111 -0.0036 0.0833  257 HOH B O   
3520 O  O   . HOH F .   ? 0.4808 0.3772 0.4223 -0.0425 -0.0166 0.0641  258 HOH B O   
3521 O  O   . HOH F .   ? 0.4797 0.4020 0.3761 -0.0262 -0.0163 0.0634  259 HOH B O   
3522 O  O   . HOH F .   ? 0.3950 0.4208 0.4882 0.0008  0.0041  0.0413  260 HOH B O   
3523 O  O   . HOH F .   ? 0.4426 0.5186 0.3856 -0.0349 0.0057  -0.0305 261 HOH B O   
3524 O  O   . HOH F .   ? 0.3975 0.5506 0.3957 0.0230  -0.0024 0.0384  262 HOH B O   
3525 O  O   . HOH F .   ? 0.4854 0.4407 0.4211 -0.0014 0.0109  0.0083  263 HOH B O   
3526 O  O   . HOH F .   ? 0.4720 0.4376 0.4309 0.0113  0.0214  -0.0163 264 HOH B O   
3527 O  O   . HOH F .   ? 0.3694 0.5090 0.4941 0.0148  -0.0143 0.0077  265 HOH B O   
3528 O  O   . HOH F .   ? 0.4495 0.4603 0.4555 0.0323  -0.0386 0.0086  266 HOH B O   
3529 O  O   . HOH F .   ? 0.4620 0.3628 0.4513 0.0393  -0.0229 -0.0016 267 HOH B O   
3530 O  O   . HOH F .   ? 0.4851 0.4515 0.4684 0.0067  0.0126  -0.0038 268 HOH B O   
3531 O  O   . HOH F .   ? 0.4166 0.4822 0.5001 -0.0376 -0.0008 0.0062  269 HOH B O   
3532 O  O   . HOH F .   ? 0.4130 0.4546 0.4542 -0.0437 0.0126  0.0290  270 HOH B O   
3533 O  O   . HOH F .   ? 0.4826 0.5114 0.3952 -0.0342 -0.0629 -0.0289 271 HOH B O   
3534 O  O   . HOH F .   ? 0.4271 0.4349 0.3888 0.0095  -0.0120 -0.0123 272 HOH B O   
3535 O  O   . HOH F .   ? 0.4895 0.4968 0.4807 0.0479  -0.0218 0.0026  273 HOH B O   
3536 O  O   . HOH F .   ? 0.4334 0.4054 0.4322 0.0344  -0.0107 0.0505  274 HOH B O   
3537 O  O   . HOH F .   ? 0.4944 0.3887 0.4423 -0.0093 0.0039  -0.0258 275 HOH B O   
3538 O  O   . HOH F .   ? 0.4999 0.4249 0.4094 0.0324  -0.0309 0.0535  276 HOH B O   
3539 O  O   . HOH F .   ? 0.5100 0.4493 0.4676 0.0240  0.0081  0.0124  277 HOH B O   
3540 O  O   . HOH F .   ? 0.6208 0.5882 0.5941 -0.0079 -0.0006 0.0062  278 HOH B O   
3541 O  O   . HOH F .   ? 0.5141 0.3939 0.4832 0.0566  0.0138  -0.0266 279 HOH B O   
3542 O  O   . HOH F .   ? 0.4783 0.4536 0.4167 -0.0195 -0.0252 -0.0125 280 HOH B O   
3543 O  O   . HOH F .   ? 0.4937 0.4367 0.3876 -0.0175 -0.0299 -0.0017 281 HOH B O   
3544 O  O   . HOH F .   ? 0.4361 0.4680 0.5323 0.0372  0.0345  0.0170  282 HOH B O   
3545 O  O   . HOH F .   ? 0.4577 0.5067 0.4244 0.0173  -0.0096 -0.0304 283 HOH B O   
3546 O  O   . HOH F .   ? 0.4410 0.4348 0.4611 0.0224  -0.0170 0.0267  284 HOH B O   
3547 O  O   . HOH F .   ? 0.5296 0.5407 0.4388 0.0594  0.0283  -0.0229 285 HOH B O   
3548 O  O   . HOH F .   ? 0.4824 0.5332 0.4208 0.0412  -0.0053 -0.0067 286 HOH B O   
3549 O  O   . HOH F .   ? 0.4827 0.4395 0.4857 0.0016  0.0125  0.0005  287 HOH B O   
3550 O  O   . HOH F .   ? 0.5689 0.5635 0.5236 0.0135  -0.0071 -0.0104 288 HOH B O   
3551 O  O   . HOH F .   ? 0.5218 0.5451 0.4255 0.0233  -0.0210 -0.0436 289 HOH B O   
3552 O  O   . HOH F .   ? 0.4605 0.5401 0.4912 0.0362  -0.0259 0.0157  290 HOH B O   
3553 O  O   . HOH F .   ? 0.5187 0.3956 0.4625 -0.0072 -0.0546 0.0476  291 HOH B O   
3554 O  O   . HOH F .   ? 0.4823 0.4837 0.4694 0.0138  0.0123  0.0248  292 HOH B O   
3555 O  O   . HOH F .   ? 0.5085 0.5096 0.4285 -0.0372 -0.0219 0.0255  293 HOH B O   
3556 O  O   . HOH F .   ? 0.4923 0.5583 0.4655 0.0214  0.0004  -0.0313 294 HOH B O   
3557 O  O   . HOH F .   ? 0.4798 0.5104 0.4989 -0.0158 -0.0438 0.0063  295 HOH B O   
3558 O  O   . HOH F .   ? 0.5258 0.4128 0.5396 0.0159  0.0472  0.0317  296 HOH B O   
3559 O  O   . HOH F .   ? 0.4424 0.4744 0.3519 0.0475  -0.0011 0.0104  297 HOH B O   
3560 O  O   . HOH F .   ? 0.4957 0.6048 0.3951 -0.0024 0.0297  0.0095  298 HOH B O   
3561 O  O   . HOH F .   ? 0.5644 0.5655 0.5337 -0.0289 0.0185  0.0185  299 HOH B O   
3562 O  O   . HOH F .   ? 0.5675 0.4292 0.4791 -0.0062 -0.0011 -0.0074 300 HOH B O   
3563 O  O   . HOH F .   ? 0.4959 0.6107 0.4672 0.0179  -0.0018 0.0398  301 HOH B O   
3564 O  O   . HOH F .   ? 0.4574 0.4757 0.4896 -0.0449 -0.0096 0.0055  302 HOH B O   
3565 O  O   . HOH F .   ? 0.4754 0.5365 0.4811 -0.0103 -0.0386 -0.0133 303 HOH B O   
3566 O  O   . HOH F .   ? 0.5548 0.4373 0.4800 0.0097  -0.0075 -0.0228 304 HOH B O   
3567 O  O   . HOH F .   ? 0.5231 0.5725 0.5215 0.0222  -0.0067 0.0207  305 HOH B O   
3568 O  O   . HOH F .   ? 0.5642 0.5705 0.5535 -0.0233 -0.0445 -0.0215 306 HOH B O   
3569 O  O   . HOH F .   ? 0.6176 0.5078 0.5408 0.0027  0.0006  -0.0371 307 HOH B O   
3570 O  O   . HOH F .   ? 0.5853 0.6239 0.5435 -0.0009 -0.0382 -0.0176 308 HOH B O   
3571 O  O   . HOH F .   ? 0.4985 0.5858 0.5269 0.0496  0.0064  0.0188  309 HOH B O   
3572 O  O   . HOH F .   ? 0.5681 0.5032 0.5243 -0.0132 -0.0132 0.0028  310 HOH B O   
3573 O  O   . HOH F .   ? 0.5325 0.5425 0.4884 -0.0570 -0.0041 -0.0175 311 HOH B O   
3574 O  O   . HOH F .   ? 0.5299 0.5275 0.4928 -0.0056 -0.0060 0.0182  312 HOH B O   
3575 O  O   . HOH F .   ? 0.6145 0.5808 0.6341 -0.0038 -0.0222 0.0018  313 HOH B O   
3576 O  O   . HOH F .   ? 0.5422 0.5486 0.6535 0.0034  -0.0042 0.0099  314 HOH B O   
3577 O  O   . HOH F .   ? 0.5653 0.5773 0.5998 0.0248  -0.0129 0.0009  315 HOH B O   
3578 O  O   . HOH F .   ? 0.6136 0.6389 0.5945 0.0378  0.0138  -0.0151 316 HOH B O   
3579 O  O   . HOH F .   ? 0.5275 0.5178 0.6269 0.0144  -0.0288 0.0270  317 HOH B O   
3580 O  O   . HOH F .   ? 0.6369 0.6066 0.6072 -0.0225 -0.0297 -0.0117 318 HOH B O   
3581 O  O   . HOH F .   ? 0.6112 0.5976 0.6517 0.0054  -0.0222 0.0156  319 HOH B O   
3582 O  O   . HOH F .   ? 0.6216 0.6398 0.5643 0.0180  -0.0164 0.0105  320 HOH B O   
3583 O  O   . HOH F .   ? 0.6993 0.6915 0.6137 0.0102  -0.0005 -0.0001 321 HOH B O   
3584 O  O   . HOH F .   ? 0.7501 0.7009 0.7048 0.0097  0.0050  0.0049  322 HOH B O   
3585 O  O   . HOH F .   ? 0.6170 0.6417 0.6178 0.0159  -0.0015 0.0075  323 HOH B O   
3586 O  O   . HOH F .   ? 0.5518 0.5765 0.5426 -0.0292 -0.0106 0.0017  324 HOH B O   
3587 O  O   . HOH F .   ? 0.5438 0.4633 0.4439 -0.0004 0.0095  -0.0757 325 HOH B O   
3588 O  O   . HOH F .   ? 0.5158 0.4667 0.4485 0.0054  -0.0047 0.0438  326 HOH B O   
3589 O  O   . HOH F .   ? 0.5815 0.5780 0.5919 0.0257  -0.0038 -0.0410 327 HOH B O   
3590 O  O   . HOH F .   ? 0.5287 0.5324 0.3638 0.0183  -0.0292 0.0154  328 HOH B O   
3591 O  O   . HOH F .   ? 0.5146 0.4745 0.4354 -0.0248 -0.0181 0.0290  329 HOH B O   
3592 O  O   . HOH F .   ? 0.5681 0.5595 0.5346 0.0045  0.0160  -0.0092 330 HOH B O   
3593 O  O   . HOH F .   ? 0.7457 0.7188 0.7299 -0.0020 -0.0049 0.0083  331 HOH B O   
3594 O  O   . HOH F .   ? 0.6932 0.6853 0.6822 0.0059  0.0166  0.0007  332 HOH B O   
3595 O  O   . HOH F .   ? 0.6441 0.6428 0.6121 -0.0022 0.0073  0.0124  333 HOH B O   
3596 O  O   . HOH F .   ? 0.5655 0.5640 0.5704 -0.0192 -0.0311 -0.0468 334 HOH B O   
3597 O  O   . HOH F .   ? 0.5093 0.4588 0.4259 -0.0040 -0.0105 0.0161  335 HOH B O   
3598 O  O   . HOH F .   ? 0.5313 0.4493 0.3561 -0.0104 -0.0377 -0.0616 336 HOH B O   
3599 O  O   . HOH F .   ? 0.4962 0.5080 0.5396 0.0224  -0.0178 -0.0329 337 HOH B O   
3600 O  O   . HOH F .   ? 0.6968 0.6871 0.7202 0.0029  0.0044  0.0252  338 HOH B O   
3601 O  O   . HOH F .   ? 0.6298 0.5207 0.5485 0.0227  0.0488  0.0068  339 HOH B O   
3602 O  O   . HOH F .   ? 0.5274 0.5319 0.5309 0.0091  0.0028  -0.0115 340 HOH B O   
3603 O  O   . HOH F .   ? 0.5471 0.3906 0.4821 -0.0182 0.0053  -0.0049 341 HOH B O   
3604 O  O   . HOH F .   ? 0.7254 0.7194 0.7104 -0.0092 0.0007  0.0158  342 HOH B O   
3605 O  O   . HOH F .   ? 0.5324 0.5699 0.5671 -0.0053 -0.0253 -0.0446 343 HOH B O   
3606 O  O   . HOH F .   ? 0.5384 0.5874 0.5904 0.0014  -0.0007 0.0258  344 HOH B O   
3607 O  O   . HOH F .   ? 0.6011 0.6460 0.6047 0.0123  -0.0057 -0.0008 345 HOH B O   
3608 O  O   . HOH F .   ? 0.5863 0.4819 0.5915 0.0290  -0.0135 0.0061  346 HOH B O   
3609 O  O   . HOH F .   ? 0.6057 0.6079 0.5740 -0.0181 -0.0067 0.0187  347 HOH B O   
3610 O  O   . HOH F .   ? 0.6254 0.6221 0.6347 -0.0154 0.0062  -0.0057 348 HOH B O   
3611 O  O   . HOH F .   ? 0.5502 0.5944 0.5402 -0.0022 -0.0389 -0.0029 349 HOH B O   
3612 O  O   . HOH F .   ? 0.6455 0.5398 0.5793 -0.0104 0.0089  -0.0324 350 HOH B O   
3613 O  O   . HOH F .   ? 0.5331 0.6008 0.5010 0.0044  -0.0195 -0.0071 351 HOH B O   
3614 O  O   . HOH F .   ? 0.4288 0.4069 0.3866 0.0133  -0.0213 -0.0174 352 HOH B O   
3615 O  O   . HOH F .   ? 0.5498 0.6073 0.6672 -0.0079 -0.0215 0.0154  353 HOH B O   
3616 O  O   . HOH F .   ? 0.6084 0.6382 0.5537 0.0015  -0.0171 0.0001  354 HOH B O   
3617 O  O   . HOH F .   ? 0.6065 0.3691 0.4757 -0.0333 -0.0253 -0.0041 355 HOH B O   
3618 O  O   . HOH F .   ? 0.6046 0.5976 0.5831 0.0068  -0.0140 -0.0086 356 HOH B O   
3619 O  O   . HOH F .   ? 0.5839 0.5533 0.5490 -0.0228 -0.0049 -0.0203 357 HOH B O   
3620 O  O   . HOH F .   ? 0.6070 0.5852 0.6435 -0.0270 0.0030  -0.0016 358 HOH B O   
3621 O  O   . HOH F .   ? 0.5074 0.5412 0.4324 0.0278  -0.0556 0.0361  359 HOH B O   
3622 O  O   . HOH F .   ? 0.6409 0.5456 0.5888 0.0001  0.0066  -0.0001 360 HOH B O   
3623 O  O   . HOH F .   ? 0.6582 0.6334 0.6304 -0.0087 0.0227  -0.0028 361 HOH B O   
3624 O  O   . HOH F .   ? 0.5672 0.4880 0.5640 0.0253  0.0067  -0.0110 362 HOH B O   
3625 O  O   . HOH F .   ? 0.5638 0.4634 0.5395 -0.0374 -0.0062 -0.0369 363 HOH B O   
3626 O  O   . HOH F .   ? 0.4920 0.5012 0.4867 0.0123  -0.0287 -0.0170 364 HOH B O   
3627 O  O   . HOH F .   ? 0.6838 0.6512 0.7087 0.0001  -0.0081 -0.0026 365 HOH B O   
3628 O  O   . HOH F .   ? 0.4727 0.5067 0.4169 -0.0153 -0.0032 0.0244  366 HOH B O   
3629 O  O   . HOH F .   ? 0.6855 0.6774 0.6666 0.0141  -0.0161 -0.0184 367 HOH B O   
3630 O  O   . HOH F .   ? 0.5036 0.5522 0.4873 -0.0014 -0.0014 -0.0289 368 HOH B O   
3631 O  O   . HOH F .   ? 0.7416 0.7380 0.7018 0.0149  0.0061  0.0023  369 HOH B O   
3632 O  O   . HOH F .   ? 0.5642 0.5664 0.5900 -0.0104 -0.0274 -0.0111 370 HOH B O   
3633 O  O   . HOH F .   ? 0.6628 0.6517 0.5924 -0.0072 -0.0197 0.0145  371 HOH B O   
3634 O  O   . HOH F .   ? 0.5367 0.6172 0.5164 0.0354  0.0025  0.0083  372 HOH B O   
3635 O  O   . HOH F .   ? 0.6479 0.6640 0.6047 0.0147  -0.0191 0.0237  373 HOH B O   
3636 O  O   . HOH F .   ? 0.5963 0.6421 0.6846 -0.0002 0.0180  -0.0058 374 HOH B O   
3637 O  O   . HOH F .   ? 0.7617 0.7655 0.8272 -0.0023 0.0018  0.0170  375 HOH B O   
3638 O  O   . HOH F .   ? 0.4605 0.4220 0.4483 -0.0330 -0.0253 0.0064  376 HOH B O   
3639 O  O   . HOH F .   ? 0.6674 0.6545 0.6103 -0.0007 -0.0018 0.0077  377 HOH B O   
3640 O  O   . HOH F .   ? 0.6325 0.6310 0.6179 -0.0071 -0.0040 0.0168  378 HOH B O   
3641 O  O   . HOH F .   ? 0.5615 0.4851 0.5443 -0.0027 -0.0114 -0.0309 379 HOH B O   
3642 O  O   . HOH F .   ? 0.5030 0.5628 0.5719 0.0392  -0.0272 -0.0018 380 HOH B O   
3643 O  O   . HOH F .   ? 0.5484 0.5190 0.6015 -0.0272 -0.0059 0.0012  381 HOH B O   
3644 O  O   . HOH F .   ? 0.7131 0.7426 0.7007 -0.0021 0.0072  -0.0086 382 HOH B O   
3645 O  O   . HOH F .   ? 0.7485 0.6621 0.7056 -0.0082 0.0119  0.0124  383 HOH B O   
3646 O  O   . HOH F .   ? 0.6089 0.6490 0.6216 -0.0191 0.0087  0.0034  384 HOH B O   
3647 O  O   . HOH F .   ? 0.8272 0.8199 0.7889 0.0052  0.0026  -0.0028 385 HOH B O   
3648 O  O   . HOH F .   ? 0.5576 0.5245 0.5124 -0.0180 -0.0022 -0.0163 386 HOH B O   
3649 O  O   . HOH F .   ? 0.6965 0.6819 0.6529 -0.0156 -0.0146 0.0059  387 HOH B O   
3650 O  O   . HOH F .   ? 0.6491 0.6879 0.6618 0.0212  -0.0030 0.0170  388 HOH B O   
3651 O  O   . HOH F .   ? 0.6296 0.6040 0.5985 -0.0183 0.0145  0.0028  389 HOH B O   
3652 O  O   . HOH F .   ? 0.8529 0.8392 0.8200 0.0006  -0.0029 -0.0009 390 HOH B O   
3653 O  O   . HOH F .   ? 0.7444 0.7162 0.7053 0.0119  -0.0018 -0.0227 391 HOH B O   
3654 O  O   . HOH F .   ? 0.5010 0.5463 0.5357 -0.0002 -0.0033 -0.0196 392 HOH B O   
3655 O  O   . HOH F .   ? 0.6711 0.6734 0.6921 -0.0156 0.0262  -0.0098 393 HOH B O   
3656 O  O   . HOH F .   ? 0.6400 0.6863 0.6135 0.0097  0.0017  -0.0070 394 HOH B O   
3657 O  O   . HOH F .   ? 0.7027 0.6994 0.7128 0.0054  0.0006  0.0052  395 HOH B O   
3658 O  O   . HOH F .   ? 0.8683 0.8345 0.8192 0.0045  -0.0088 0.0059  396 HOH B O   
3659 O  O   . HOH F .   ? 0.6788 0.6857 0.6616 0.0009  0.0146  -0.0003 397 HOH B O   
3660 O  O   . HOH F .   ? 0.8964 0.8695 0.8750 -0.0058 0.0032  0.0000  398 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -8  ?   ?   ?   A . n 
A 1 2   SER 2   -7  ?   ?   ?   A . n 
A 1 3   SER 3   -6  ?   ?   ?   A . n 
A 1 4   HIS 4   -5  ?   ?   ?   A . n 
A 1 5   HIS 5   -4  ?   ?   ?   A . n 
A 1 6   HIS 6   -3  ?   ?   ?   A . n 
A 1 7   HIS 7   -2  ?   ?   ?   A . n 
A 1 8   HIS 8   -1  ?   ?   ?   A . n 
A 1 9   HIS 9   0   ?   ?   ?   A . n 
A 1 10  MET 10  1   ?   ?   ?   A . n 
A 1 11  SER 11  2   ?   ?   ?   A . n 
A 1 12  SER 12  3   3   SER SER A . n 
A 1 13  PHE 13  4   4   PHE PHE A . n 
A 1 14  GLN 14  5   5   GLN GLN A . n 
A 1 15  LEU 15  6   6   LEU LEU A . n 
A 1 16  PRO 16  7   7   PRO PRO A . n 
A 1 17  LYS 17  8   8   LYS LYS A . n 
A 1 18  LEU 18  9   9   LEU LEU A . n 
A 1 19  SER 19  10  10  SER SER A . n 
A 1 20  TYR 20  11  11  TYR TYR A . n 
A 1 21  ASP 21  12  12  ASP ASP A . n 
A 1 22  TYR 22  13  13  TYR TYR A . n 
A 1 23  ASP 23  14  14  ASP ASP A . n 
A 1 24  GLU 24  15  15  GLU GLU A . n 
A 1 25  LEU 25  16  16  LEU LEU A . n 
A 1 26  GLU 26  17  17  GLU GLU A . n 
A 1 27  PRO 27  18  18  PRO PRO A . n 
A 1 28  TYR 28  19  19  TYR TYR A . n 
A 1 29  ILE 29  20  20  ILE ILE A . n 
A 1 30  ASP 30  21  21  ASP ASP A . n 
A 1 31  SER 31  22  22  SER SER A . n 
A 1 32  ASN 32  23  23  ASN ASN A . n 
A 1 33  THR 33  24  24  THR THR A . n 
A 1 34  LEU 34  25  25  LEU LEU A . n 
A 1 35  SER 35  26  26  SER SER A . n 
A 1 36  ILE 36  27  27  ILE ILE A . n 
A 1 37  HIS 37  28  28  HIS HIS A . n 
A 1 38  HIS 38  29  29  HIS HIS A . n 
A 1 39  GLY 39  30  30  GLY GLY A . n 
A 1 40  LYS 40  31  31  LYS LYS A . n 
A 1 41  HIS 41  32  32  HIS HIS A . n 
A 1 42  HIS 42  33  33  HIS HIS A . n 
A 1 43  ALA 43  34  34  ALA ALA A . n 
A 1 44  THR 44  35  35  THR THR A . n 
A 1 45  TYR 45  36  36  TYR TYR A . n 
A 1 46  VAL 46  37  37  VAL VAL A . n 
A 1 47  ASN 47  38  38  ASN ASN A . n 
A 1 48  ASN 48  39  39  ASN ASN A . n 
A 1 49  LEU 49  40  40  LEU LEU A . n 
A 1 50  ASN 50  41  41  ASN ASN A . n 
A 1 51  ALA 51  42  42  ALA ALA A . n 
A 1 52  ALA 52  43  43  ALA ALA A . n 
A 1 53  LEU 53  44  44  LEU LEU A . n 
A 1 54  GLU 54  45  45  GLU GLU A . n 
A 1 55  ASN 55  46  46  ASN ASN A . n 
A 1 56  TYR 56  47  47  TYR TYR A . n 
A 1 57  SER 57  48  48  SER SER A . n 
A 1 58  GLU 58  49  49  GLU GLU A . n 
A 1 59  LEU 59  50  50  LEU LEU A . n 
A 1 60  HIS 60  51  51  HIS HIS A . n 
A 1 61  ASN 61  52  52  ASN ASN A . n 
A 1 62  LYS 62  53  53  LYS LYS A . n 
A 1 63  SER 63  54  54  SER SER A . n 
A 1 64  LEU 64  55  55  LEU LEU A . n 
A 1 65  GLU 65  56  56  GLU GLU A . n 
A 1 66  GLU 66  57  57  GLU GLU A . n 
A 1 67  LEU 67  58  58  LEU LEU A . n 
A 1 68  LEU 68  59  59  LEU LEU A . n 
A 1 69  CYS 69  60  60  CYS CYS A . n 
A 1 70  ASN 70  61  61  ASN ASN A . n 
A 1 71  LEU 71  62  62  LEU LEU A . n 
A 1 72  GLU 72  63  63  GLU GLU A . n 
A 1 73  THR 73  64  64  THR THR A . n 
A 1 74  LEU 74  65  65  LEU LEU A . n 
A 1 75  PRO 75  66  66  PRO PRO A . n 
A 1 76  LYS 76  67  67  LYS LYS A . n 
A 1 77  GLU 77  68  68  GLU GLU A . n 
A 1 78  ILE 78  69  69  ILE ILE A . n 
A 1 79  VAL 79  70  70  VAL VAL A . n 
A 1 80  THR 80  71  71  THR THR A . n 
A 1 81  ALA 81  72  72  ALA ALA A . n 
A 1 82  VAL 82  73  73  VAL VAL A . n 
A 1 83  ARG 83  74  74  ARG ARG A . n 
A 1 84  ASN 84  75  75  ASN ASN A . n 
A 1 85  ASN 85  76  76  ASN ASN A . n 
A 1 86  GLY 86  77  77  GLY GLY A . n 
A 1 87  GLY 87  78  78  GLY GLY A . n 
A 1 88  GLY 88  79  79  GLY GLY A . n 
A 1 89  HIS 89  80  80  HIS HIS A . n 
A 1 90  TYR 90  81  81  TYR TYR A . n 
A 1 91  CYS 91  82  82  CYS CYS A . n 
A 1 92  HIS 92  83  83  HIS HIS A . n 
A 1 93  SER 93  84  84  SER SER A . n 
A 1 94  LEU 94  85  85  LEU LEU A . n 
A 1 95  PHE 95  86  86  PHE PHE A . n 
A 1 96  TRP 96  87  87  TRP TRP A . n 
A 1 97  GLU 97  88  88  GLU GLU A . n 
A 1 98  VAL 98  89  89  VAL VAL A . n 
A 1 99  MET 99  90  90  MET MET A . n 
A 1 100 SER 100 91  91  SER SER A . n 
A 1 101 PRO 101 92  92  PRO PRO A . n 
A 1 102 ARG 102 93  93  ARG ARG A . n 
A 1 103 GLY 103 94  94  GLY GLY A . n 
A 1 104 GLY 104 95  95  GLY GLY A . n 
A 1 105 GLY 105 96  96  GLY GLY A . n 
A 1 106 GLU 106 97  97  GLU GLU A . n 
A 1 107 PRO 107 98  98  PRO PRO A . n 
A 1 108 ASN 108 99  99  ASN ASN A . n 
A 1 109 GLY 109 100 100 GLY GLY A . n 
A 1 110 ASP 110 101 101 ASP ASP A . n 
A 1 111 VAL 111 102 102 VAL VAL A . n 
A 1 112 ALA 112 103 103 ALA ALA A . n 
A 1 113 LYS 113 104 104 LYS LYS A . n 
A 1 114 VAL 114 105 105 VAL VAL A . n 
A 1 115 ILE 115 106 106 ILE ILE A . n 
A 1 116 ASP 116 107 107 ASP ASP A . n 
A 1 117 TYR 117 108 108 TYR TYR A . n 
A 1 118 TYR 118 109 109 TYR TYR A . n 
A 1 119 PHE 119 110 110 PHE PHE A . n 
A 1 120 ASN 120 111 111 ASN ASN A . n 
A 1 121 THR 121 112 112 THR THR A . n 
A 1 122 PHE 122 113 113 PHE PHE A . n 
A 1 123 ASP 123 114 114 ASP ASP A . n 
A 1 124 ASN 124 115 115 ASN ASN A . n 
A 1 125 LEU 125 116 116 LEU LEU A . n 
A 1 126 LYS 126 117 117 LYS LYS A . n 
A 1 127 ASP 127 118 118 ASP ASP A . n 
A 1 128 GLN 128 119 119 GLN GLN A . n 
A 1 129 LEU 129 120 120 LEU LEU A . n 
A 1 130 SER 130 121 121 SER SER A . n 
A 1 131 LYS 131 122 122 LYS LYS A . n 
A 1 132 ALA 132 123 123 ALA ALA A . n 
A 1 133 ALA 133 124 124 ALA ALA A . n 
A 1 134 ILE 134 125 125 ILE ILE A . n 
A 1 135 SER 135 126 126 SER SER A . n 
A 1 136 ARG 136 127 127 ARG ARG A . n 
A 1 137 PHE 137 128 128 PHE PHE A . n 
A 1 138 GLY 138 129 129 GLY GLY A . n 
A 1 139 SER 139 130 130 SER SER A . n 
A 1 140 GLY 140 131 131 GLY GLY A . n 
A 1 141 TYR 141 132 132 TYR TYR A . n 
A 1 142 GLY 142 133 133 GLY GLY A . n 
A 1 143 TRP 143 134 134 TRP TRP A . n 
A 1 144 LEU 144 135 135 LEU LEU A . n 
A 1 145 VAL 145 136 136 VAL VAL A . n 
A 1 146 LEU 146 137 137 LEU LEU A . n 
A 1 147 ASP 147 138 138 ASP ASP A . n 
A 1 148 GLY 148 139 139 GLY GLY A . n 
A 1 149 GLU 149 140 140 GLU GLU A . n 
A 1 150 GLU 150 141 141 GLU GLU A . n 
A 1 151 LEU 151 142 142 LEU LEU A . n 
A 1 152 SER 152 143 143 SER SER A . n 
A 1 153 VAL 153 144 144 VAL VAL A . n 
A 1 154 MET 154 145 145 MET MET A . n 
A 1 155 SER 155 146 146 SER SER A . n 
A 1 156 THR 156 147 147 THR THR A . n 
A 1 157 PRO 157 148 148 PRO PRO A . n 
A 1 158 ASN 158 149 149 ASN ASN A . n 
A 1 159 GLN 159 150 150 GLN GLN A . n 
A 1 160 ASP 160 151 151 ASP ASP A . n 
A 1 161 THR 161 152 152 THR THR A . n 
A 1 162 PRO 162 153 153 PRO PRO A . n 
A 1 163 LEU 163 154 154 LEU LEU A . n 
A 1 164 GLN 164 155 155 GLN GLN A . n 
A 1 165 GLU 165 156 156 GLU GLU A . n 
A 1 166 GLY 166 157 157 GLY GLY A . n 
A 1 167 LYS 167 158 158 LYS LYS A . n 
A 1 168 ILE 168 159 159 ILE ILE A . n 
A 1 169 PRO 169 160 160 PRO PRO A . n 
A 1 170 LEU 170 161 161 LEU LEU A . n 
A 1 171 LEU 171 162 162 LEU LEU A . n 
A 1 172 VAL 172 163 163 VAL VAL A . n 
A 1 173 ILE 173 164 164 ILE ILE A . n 
A 1 174 ASP 174 165 165 ASP ASP A . n 
A 1 175 VAL 175 166 166 VAL VAL A . n 
A 1 176 TRP 176 167 167 TRP TRP A . n 
A 1 177 GLU 177 168 168 GLU GLU A . n 
A 1 178 HIS 178 169 169 HIS HIS A . n 
A 1 179 ALA 179 170 170 ALA ALA A . n 
A 1 180 TYR 180 171 171 TYR TYR A . n 
A 1 181 TYR 181 172 172 TYR TYR A . n 
A 1 182 LEU 182 173 173 LEU LEU A . n 
A 1 183 LYS 183 174 174 LYS LYS A . n 
A 1 184 TYR 184 175 175 TYR TYR A . n 
A 1 185 GLN 185 176 176 GLN GLN A . n 
A 1 186 ASN 186 177 177 ASN ASN A . n 
A 1 187 ARG 187 178 178 ARG ARG A . n 
A 1 188 ARG 188 179 179 ARG ARG A . n 
A 1 189 PRO 189 180 180 PRO PRO A . n 
A 1 190 GLU 190 181 181 GLU GLU A . n 
A 1 191 PHE 191 182 182 PHE PHE A . n 
A 1 192 VAL 192 183 183 VAL VAL A . n 
A 1 193 THR 193 184 184 THR THR A . n 
A 1 194 ASN 194 185 185 ASN ASN A . n 
A 1 195 TRP 195 186 186 TRP TRP A . n 
A 1 196 TRP 196 187 187 TRP TRP A . n 
A 1 197 HIS 197 188 188 HIS HIS A . n 
A 1 198 THR 198 189 189 THR THR A . n 
A 1 199 VAL 199 190 190 VAL VAL A . n 
A 1 200 ASN 200 191 191 ASN ASN A . n 
A 1 201 TRP 201 192 192 TRP TRP A . n 
A 1 202 ASP 202 193 193 ASP ASP A . n 
A 1 203 ARG 203 194 194 ARG ARG A . n 
A 1 204 VAL 204 195 195 VAL VAL A . n 
A 1 205 ASN 205 196 196 ASN ASN A . n 
A 1 206 GLU 206 197 197 GLU GLU A . n 
A 1 207 LYS 207 198 198 LYS LYS A . n 
A 1 208 TYR 208 199 199 TYR TYR A . n 
A 1 209 LEU 209 200 200 LEU LEU A . n 
A 1 210 GLN 210 201 201 GLN GLN A . n 
A 1 211 ALA 211 202 202 ALA ALA A . n 
A 1 212 ILE 212 203 203 ILE ILE A . n 
A 1 213 GLN 213 204 ?   ?   ?   A . n 
A 1 214 SER 214 205 ?   ?   ?   A . n 
A 1 215 GLN 215 206 ?   ?   ?   A . n 
A 1 216 LYS 216 207 ?   ?   ?   A . n 
A 1 217 HIS 217 208 ?   ?   ?   A . n 
B 1 1   GLY 1   -8  ?   ?   ?   B . n 
B 1 2   SER 2   -7  ?   ?   ?   B . n 
B 1 3   SER 3   -6  ?   ?   ?   B . n 
B 1 4   HIS 4   -5  ?   ?   ?   B . n 
B 1 5   HIS 5   -4  ?   ?   ?   B . n 
B 1 6   HIS 6   -3  ?   ?   ?   B . n 
B 1 7   HIS 7   -2  ?   ?   ?   B . n 
B 1 8   HIS 8   -1  ?   ?   ?   B . n 
B 1 9   HIS 9   0   ?   ?   ?   B . n 
B 1 10  MET 10  1   ?   ?   ?   B . n 
B 1 11  SER 11  2   ?   ?   ?   B . n 
B 1 12  SER 12  3   3   SER SER B . n 
B 1 13  PHE 13  4   4   PHE PHE B . n 
B 1 14  GLN 14  5   5   GLN GLN B . n 
B 1 15  LEU 15  6   6   LEU LEU B . n 
B 1 16  PRO 16  7   7   PRO PRO B . n 
B 1 17  LYS 17  8   8   LYS LYS B . n 
B 1 18  LEU 18  9   9   LEU LEU B . n 
B 1 19  SER 19  10  10  SER SER B . n 
B 1 20  TYR 20  11  11  TYR TYR B . n 
B 1 21  ASP 21  12  12  ASP ASP B . n 
B 1 22  TYR 22  13  13  TYR TYR B . n 
B 1 23  ASP 23  14  14  ASP ASP B . n 
B 1 24  GLU 24  15  15  GLU GLU B . n 
B 1 25  LEU 25  16  16  LEU LEU B . n 
B 1 26  GLU 26  17  17  GLU GLU B . n 
B 1 27  PRO 27  18  18  PRO PRO B . n 
B 1 28  TYR 28  19  19  TYR TYR B . n 
B 1 29  ILE 29  20  20  ILE ILE B . n 
B 1 30  ASP 30  21  21  ASP ASP B . n 
B 1 31  SER 31  22  22  SER SER B . n 
B 1 32  ASN 32  23  23  ASN ASN B . n 
B 1 33  THR 33  24  24  THR THR B . n 
B 1 34  LEU 34  25  25  LEU LEU B . n 
B 1 35  SER 35  26  26  SER SER B . n 
B 1 36  ILE 36  27  27  ILE ILE B . n 
B 1 37  HIS 37  28  28  HIS HIS B . n 
B 1 38  HIS 38  29  29  HIS HIS B . n 
B 1 39  GLY 39  30  30  GLY GLY B . n 
B 1 40  LYS 40  31  31  LYS LYS B . n 
B 1 41  HIS 41  32  32  HIS HIS B . n 
B 1 42  HIS 42  33  33  HIS HIS B . n 
B 1 43  ALA 43  34  34  ALA ALA B . n 
B 1 44  THR 44  35  35  THR THR B . n 
B 1 45  TYR 45  36  36  TYR TYR B . n 
B 1 46  VAL 46  37  37  VAL VAL B . n 
B 1 47  ASN 47  38  38  ASN ASN B . n 
B 1 48  ASN 48  39  39  ASN ASN B . n 
B 1 49  LEU 49  40  40  LEU LEU B . n 
B 1 50  ASN 50  41  41  ASN ASN B . n 
B 1 51  ALA 51  42  42  ALA ALA B . n 
B 1 52  ALA 52  43  43  ALA ALA B . n 
B 1 53  LEU 53  44  44  LEU LEU B . n 
B 1 54  GLU 54  45  45  GLU GLU B . n 
B 1 55  ASN 55  46  46  ASN ASN B . n 
B 1 56  TYR 56  47  47  TYR TYR B . n 
B 1 57  SER 57  48  48  SER SER B . n 
B 1 58  GLU 58  49  49  GLU GLU B . n 
B 1 59  LEU 59  50  50  LEU LEU B . n 
B 1 60  HIS 60  51  51  HIS HIS B . n 
B 1 61  ASN 61  52  52  ASN ASN B . n 
B 1 62  LYS 62  53  53  LYS LYS B . n 
B 1 63  SER 63  54  54  SER SER B . n 
B 1 64  LEU 64  55  55  LEU LEU B . n 
B 1 65  GLU 65  56  56  GLU GLU B . n 
B 1 66  GLU 66  57  57  GLU GLU B . n 
B 1 67  LEU 67  58  58  LEU LEU B . n 
B 1 68  LEU 68  59  59  LEU LEU B . n 
B 1 69  CYS 69  60  60  CYS CYS B . n 
B 1 70  ASN 70  61  61  ASN ASN B . n 
B 1 71  LEU 71  62  62  LEU LEU B . n 
B 1 72  GLU 72  63  63  GLU GLU B . n 
B 1 73  THR 73  64  64  THR THR B . n 
B 1 74  LEU 74  65  65  LEU LEU B . n 
B 1 75  PRO 75  66  66  PRO PRO B . n 
B 1 76  LYS 76  67  67  LYS LYS B . n 
B 1 77  GLU 77  68  68  GLU GLU B . n 
B 1 78  ILE 78  69  69  ILE ILE B . n 
B 1 79  VAL 79  70  70  VAL VAL B . n 
B 1 80  THR 80  71  71  THR THR B . n 
B 1 81  ALA 81  72  72  ALA ALA B . n 
B 1 82  VAL 82  73  73  VAL VAL B . n 
B 1 83  ARG 83  74  74  ARG ARG B . n 
B 1 84  ASN 84  75  75  ASN ASN B . n 
B 1 85  ASN 85  76  76  ASN ASN B . n 
B 1 86  GLY 86  77  77  GLY GLY B . n 
B 1 87  GLY 87  78  78  GLY GLY B . n 
B 1 88  GLY 88  79  79  GLY GLY B . n 
B 1 89  HIS 89  80  80  HIS HIS B . n 
B 1 90  TYR 90  81  81  TYR TYR B . n 
B 1 91  CYS 91  82  82  CYS CYS B . n 
B 1 92  HIS 92  83  83  HIS HIS B . n 
B 1 93  SER 93  84  84  SER SER B . n 
B 1 94  LEU 94  85  85  LEU LEU B . n 
B 1 95  PHE 95  86  86  PHE PHE B . n 
B 1 96  TRP 96  87  87  TRP TRP B . n 
B 1 97  GLU 97  88  88  GLU GLU B . n 
B 1 98  VAL 98  89  89  VAL VAL B . n 
B 1 99  MET 99  90  90  MET MET B . n 
B 1 100 SER 100 91  91  SER SER B . n 
B 1 101 PRO 101 92  92  PRO PRO B . n 
B 1 102 ARG 102 93  93  ARG ARG B . n 
B 1 103 GLY 103 94  94  GLY GLY B . n 
B 1 104 GLY 104 95  95  GLY GLY B . n 
B 1 105 GLY 105 96  96  GLY GLY B . n 
B 1 106 GLU 106 97  97  GLU GLU B . n 
B 1 107 PRO 107 98  98  PRO PRO B . n 
B 1 108 ASN 108 99  99  ASN ASN B . n 
B 1 109 GLY 109 100 100 GLY GLY B . n 
B 1 110 ASP 110 101 101 ASP ASP B . n 
B 1 111 VAL 111 102 102 VAL VAL B . n 
B 1 112 ALA 112 103 103 ALA ALA B . n 
B 1 113 LYS 113 104 104 LYS LYS B . n 
B 1 114 VAL 114 105 105 VAL VAL B . n 
B 1 115 ILE 115 106 106 ILE ILE B . n 
B 1 116 ASP 116 107 107 ASP ASP B . n 
B 1 117 TYR 117 108 108 TYR TYR B . n 
B 1 118 TYR 118 109 109 TYR TYR B . n 
B 1 119 PHE 119 110 110 PHE PHE B . n 
B 1 120 ASN 120 111 111 ASN ASN B . n 
B 1 121 THR 121 112 112 THR THR B . n 
B 1 122 PHE 122 113 113 PHE PHE B . n 
B 1 123 ASP 123 114 114 ASP ASP B . n 
B 1 124 ASN 124 115 115 ASN ASN B . n 
B 1 125 LEU 125 116 116 LEU LEU B . n 
B 1 126 LYS 126 117 117 LYS LYS B . n 
B 1 127 ASP 127 118 118 ASP ASP B . n 
B 1 128 GLN 128 119 119 GLN GLN B . n 
B 1 129 LEU 129 120 120 LEU LEU B . n 
B 1 130 SER 130 121 121 SER SER B . n 
B 1 131 LYS 131 122 122 LYS LYS B . n 
B 1 132 ALA 132 123 123 ALA ALA B . n 
B 1 133 ALA 133 124 124 ALA ALA B . n 
B 1 134 ILE 134 125 125 ILE ILE B . n 
B 1 135 SER 135 126 126 SER SER B . n 
B 1 136 ARG 136 127 127 ARG ARG B . n 
B 1 137 PHE 137 128 128 PHE PHE B . n 
B 1 138 GLY 138 129 129 GLY GLY B . n 
B 1 139 SER 139 130 130 SER SER B . n 
B 1 140 GLY 140 131 131 GLY GLY B . n 
B 1 141 TYR 141 132 132 TYR TYR B . n 
B 1 142 GLY 142 133 133 GLY GLY B . n 
B 1 143 TRP 143 134 134 TRP TRP B . n 
B 1 144 LEU 144 135 135 LEU LEU B . n 
B 1 145 VAL 145 136 136 VAL VAL B . n 
B 1 146 LEU 146 137 137 LEU LEU B . n 
B 1 147 ASP 147 138 138 ASP ASP B . n 
B 1 148 GLY 148 139 139 GLY GLY B . n 
B 1 149 GLU 149 140 140 GLU GLU B . n 
B 1 150 GLU 150 141 141 GLU GLU B . n 
B 1 151 LEU 151 142 142 LEU LEU B . n 
B 1 152 SER 152 143 143 SER SER B . n 
B 1 153 VAL 153 144 144 VAL VAL B . n 
B 1 154 MET 154 145 145 MET MET B . n 
B 1 155 SER 155 146 146 SER SER B . n 
B 1 156 THR 156 147 147 THR THR B . n 
B 1 157 PRO 157 148 148 PRO PRO B . n 
B 1 158 ASN 158 149 149 ASN ASN B . n 
B 1 159 GLN 159 150 150 GLN GLN B . n 
B 1 160 ASP 160 151 151 ASP ASP B . n 
B 1 161 THR 161 152 152 THR THR B . n 
B 1 162 PRO 162 153 153 PRO PRO B . n 
B 1 163 LEU 163 154 154 LEU LEU B . n 
B 1 164 GLN 164 155 155 GLN GLN B . n 
B 1 165 GLU 165 156 156 GLU GLU B . n 
B 1 166 GLY 166 157 157 GLY GLY B . n 
B 1 167 LYS 167 158 158 LYS LYS B . n 
B 1 168 ILE 168 159 159 ILE ILE B . n 
B 1 169 PRO 169 160 160 PRO PRO B . n 
B 1 170 LEU 170 161 161 LEU LEU B . n 
B 1 171 LEU 171 162 162 LEU LEU B . n 
B 1 172 VAL 172 163 163 VAL VAL B . n 
B 1 173 ILE 173 164 164 ILE ILE B . n 
B 1 174 ASP 174 165 165 ASP ASP B . n 
B 1 175 VAL 175 166 166 VAL VAL B . n 
B 1 176 TRP 176 167 167 TRP TRP B . n 
B 1 177 GLU 177 168 168 GLU GLU B . n 
B 1 178 HIS 178 169 169 HIS HIS B . n 
B 1 179 ALA 179 170 170 ALA ALA B . n 
B 1 180 TYR 180 171 171 TYR TYR B . n 
B 1 181 TYR 181 172 172 TYR TYR B . n 
B 1 182 LEU 182 173 173 LEU LEU B . n 
B 1 183 LYS 183 174 174 LYS LYS B . n 
B 1 184 TYR 184 175 175 TYR TYR B . n 
B 1 185 GLN 185 176 176 GLN GLN B . n 
B 1 186 ASN 186 177 177 ASN ASN B . n 
B 1 187 ARG 187 178 178 ARG ARG B . n 
B 1 188 ARG 188 179 179 ARG ARG B . n 
B 1 189 PRO 189 180 180 PRO PRO B . n 
B 1 190 GLU 190 181 181 GLU GLU B . n 
B 1 191 PHE 191 182 182 PHE PHE B . n 
B 1 192 VAL 192 183 183 VAL VAL B . n 
B 1 193 THR 193 184 184 THR THR B . n 
B 1 194 ASN 194 185 185 ASN ASN B . n 
B 1 195 TRP 195 186 186 TRP TRP B . n 
B 1 196 TRP 196 187 187 TRP TRP B . n 
B 1 197 HIS 197 188 188 HIS HIS B . n 
B 1 198 THR 198 189 189 THR THR B . n 
B 1 199 VAL 199 190 190 VAL VAL B . n 
B 1 200 ASN 200 191 191 ASN ASN B . n 
B 1 201 TRP 201 192 192 TRP TRP B . n 
B 1 202 ASP 202 193 193 ASP ASP B . n 
B 1 203 ARG 203 194 194 ARG ARG B . n 
B 1 204 VAL 204 195 195 VAL VAL B . n 
B 1 205 ASN 205 196 196 ASN ASN B . n 
B 1 206 GLU 206 197 197 GLU GLU B . n 
B 1 207 LYS 207 198 198 LYS LYS B . n 
B 1 208 TYR 208 199 199 TYR TYR B . n 
B 1 209 LEU 209 200 200 LEU LEU B . n 
B 1 210 GLN 210 201 201 GLN GLN B . n 
B 1 211 ALA 211 202 202 ALA ALA B . n 
B 1 212 ILE 212 203 203 ILE ILE B . n 
B 1 213 GLN 213 204 ?   ?   ?   B . n 
B 1 214 SER 214 205 ?   ?   ?   B . n 
B 1 215 GLN 215 206 ?   ?   ?   B . n 
B 1 216 LYS 216 207 ?   ?   ?   B . n 
B 1 217 HIS 217 208 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   209 1   MN  MN  A . 
D 2 MN  1   209 2   MN  MN  B . 
E 3 HOH 1   210 2   HOH HOH A . 
E 3 HOH 2   211 4   HOH HOH A . 
E 3 HOH 3   212 7   HOH HOH A . 
E 3 HOH 4   213 8   HOH HOH A . 
E 3 HOH 5   214 12  HOH HOH A . 
E 3 HOH 6   215 13  HOH HOH A . 
E 3 HOH 7   216 14  HOH HOH A . 
E 3 HOH 8   217 17  HOH HOH A . 
E 3 HOH 9   218 18  HOH HOH A . 
E 3 HOH 10  219 20  HOH HOH A . 
E 3 HOH 11  220 21  HOH HOH A . 
E 3 HOH 12  221 24  HOH HOH A . 
E 3 HOH 13  222 25  HOH HOH A . 
E 3 HOH 14  223 26  HOH HOH A . 
E 3 HOH 15  224 31  HOH HOH A . 
E 3 HOH 16  225 32  HOH HOH A . 
E 3 HOH 17  226 34  HOH HOH A . 
E 3 HOH 18  227 36  HOH HOH A . 
E 3 HOH 19  228 37  HOH HOH A . 
E 3 HOH 20  229 38  HOH HOH A . 
E 3 HOH 21  230 39  HOH HOH A . 
E 3 HOH 22  231 40  HOH HOH A . 
E 3 HOH 23  232 42  HOH HOH A . 
E 3 HOH 24  233 44  HOH HOH A . 
E 3 HOH 25  234 45  HOH HOH A . 
E 3 HOH 26  235 47  HOH HOH A . 
E 3 HOH 27  236 48  HOH HOH A . 
E 3 HOH 28  237 50  HOH HOH A . 
E 3 HOH 29  238 51  HOH HOH A . 
E 3 HOH 30  239 53  HOH HOH A . 
E 3 HOH 31  240 55  HOH HOH A . 
E 3 HOH 32  241 57  HOH HOH A . 
E 3 HOH 33  242 58  HOH HOH A . 
E 3 HOH 34  243 61  HOH HOH A . 
E 3 HOH 35  244 64  HOH HOH A . 
E 3 HOH 36  245 66  HOH HOH A . 
E 3 HOH 37  246 67  HOH HOH A . 
E 3 HOH 38  247 70  HOH HOH A . 
E 3 HOH 39  248 73  HOH HOH A . 
E 3 HOH 40  249 76  HOH HOH A . 
E 3 HOH 41  250 77  HOH HOH A . 
E 3 HOH 42  251 78  HOH HOH A . 
E 3 HOH 43  252 81  HOH HOH A . 
E 3 HOH 44  253 82  HOH HOH A . 
E 3 HOH 45  254 85  HOH HOH A . 
E 3 HOH 46  255 86  HOH HOH A . 
E 3 HOH 47  256 88  HOH HOH A . 
E 3 HOH 48  257 92  HOH HOH A . 
E 3 HOH 49  258 93  HOH HOH A . 
E 3 HOH 50  259 95  HOH HOH A . 
E 3 HOH 51  260 99  HOH HOH A . 
E 3 HOH 52  261 100 HOH HOH A . 
E 3 HOH 53  262 103 HOH HOH A . 
E 3 HOH 54  263 106 HOH HOH A . 
E 3 HOH 55  264 108 HOH HOH A . 
E 3 HOH 56  265 109 HOH HOH A . 
E 3 HOH 57  266 110 HOH HOH A . 
E 3 HOH 58  267 111 HOH HOH A . 
E 3 HOH 59  268 112 HOH HOH A . 
E 3 HOH 60  269 113 HOH HOH A . 
E 3 HOH 61  270 115 HOH HOH A . 
E 3 HOH 62  271 116 HOH HOH A . 
E 3 HOH 63  272 117 HOH HOH A . 
E 3 HOH 64  273 120 HOH HOH A . 
E 3 HOH 65  274 121 HOH HOH A . 
E 3 HOH 66  275 122 HOH HOH A . 
E 3 HOH 67  276 127 HOH HOH A . 
E 3 HOH 68  277 129 HOH HOH A . 
E 3 HOH 69  278 132 HOH HOH A . 
E 3 HOH 70  279 133 HOH HOH A . 
E 3 HOH 71  280 136 HOH HOH A . 
E 3 HOH 72  281 142 HOH HOH A . 
E 3 HOH 73  282 144 HOH HOH A . 
E 3 HOH 74  283 145 HOH HOH A . 
E 3 HOH 75  284 146 HOH HOH A . 
E 3 HOH 76  285 148 HOH HOH A . 
E 3 HOH 77  286 151 HOH HOH A . 
E 3 HOH 78  287 152 HOH HOH A . 
E 3 HOH 79  288 153 HOH HOH A . 
E 3 HOH 80  289 157 HOH HOH A . 
E 3 HOH 81  290 158 HOH HOH A . 
E 3 HOH 82  291 160 HOH HOH A . 
E 3 HOH 83  292 161 HOH HOH A . 
E 3 HOH 84  293 162 HOH HOH A . 
E 3 HOH 85  294 167 HOH HOH A . 
E 3 HOH 86  295 170 HOH HOH A . 
E 3 HOH 87  296 171 HOH HOH A . 
E 3 HOH 88  297 172 HOH HOH A . 
E 3 HOH 89  298 173 HOH HOH A . 
E 3 HOH 90  299 175 HOH HOH A . 
E 3 HOH 91  300 176 HOH HOH A . 
E 3 HOH 92  301 179 HOH HOH A . 
E 3 HOH 93  302 180 HOH HOH A . 
E 3 HOH 94  303 181 HOH HOH A . 
E 3 HOH 95  304 185 HOH HOH A . 
E 3 HOH 96  305 187 HOH HOH A . 
E 3 HOH 97  306 190 HOH HOH A . 
E 3 HOH 98  307 191 HOH HOH A . 
E 3 HOH 99  308 192 HOH HOH A . 
E 3 HOH 100 309 195 HOH HOH A . 
E 3 HOH 101 310 199 HOH HOH A . 
E 3 HOH 102 311 200 HOH HOH A . 
E 3 HOH 103 312 201 HOH HOH A . 
E 3 HOH 104 313 202 HOH HOH A . 
E 3 HOH 105 314 203 HOH HOH A . 
E 3 HOH 106 315 204 HOH HOH A . 
E 3 HOH 107 316 205 HOH HOH A . 
E 3 HOH 108 317 206 HOH HOH A . 
E 3 HOH 109 318 207 HOH HOH A . 
E 3 HOH 110 319 210 HOH HOH A . 
E 3 HOH 111 320 213 HOH HOH A . 
E 3 HOH 112 321 217 HOH HOH A . 
E 3 HOH 113 322 219 HOH HOH A . 
E 3 HOH 114 323 221 HOH HOH A . 
E 3 HOH 115 324 227 HOH HOH A . 
E 3 HOH 116 325 229 HOH HOH A . 
E 3 HOH 117 326 231 HOH HOH A . 
E 3 HOH 118 327 232 HOH HOH A . 
E 3 HOH 119 328 233 HOH HOH A . 
E 3 HOH 120 329 234 HOH HOH A . 
E 3 HOH 121 330 236 HOH HOH A . 
E 3 HOH 122 331 237 HOH HOH A . 
E 3 HOH 123 332 239 HOH HOH A . 
E 3 HOH 124 333 247 HOH HOH A . 
E 3 HOH 125 334 248 HOH HOH A . 
E 3 HOH 126 335 250 HOH HOH A . 
E 3 HOH 127 336 251 HOH HOH A . 
E 3 HOH 128 337 252 HOH HOH A . 
E 3 HOH 129 338 255 HOH HOH A . 
E 3 HOH 130 339 257 HOH HOH A . 
E 3 HOH 131 340 264 HOH HOH A . 
E 3 HOH 132 341 265 HOH HOH A . 
E 3 HOH 133 342 270 HOH HOH A . 
E 3 HOH 134 343 271 HOH HOH A . 
E 3 HOH 135 344 273 HOH HOH A . 
E 3 HOH 136 345 274 HOH HOH A . 
E 3 HOH 137 346 276 HOH HOH A . 
E 3 HOH 138 347 278 HOH HOH A . 
E 3 HOH 139 348 279 HOH HOH A . 
E 3 HOH 140 349 280 HOH HOH A . 
E 3 HOH 141 350 281 HOH HOH A . 
E 3 HOH 142 351 283 HOH HOH A . 
E 3 HOH 143 352 285 HOH HOH A . 
E 3 HOH 144 353 287 HOH HOH A . 
E 3 HOH 145 354 289 HOH HOH A . 
E 3 HOH 146 355 295 HOH HOH A . 
E 3 HOH 147 356 298 HOH HOH A . 
E 3 HOH 148 357 299 HOH HOH A . 
E 3 HOH 149 358 301 HOH HOH A . 
E 3 HOH 150 359 302 HOH HOH A . 
E 3 HOH 151 360 304 HOH HOH A . 
E 3 HOH 152 361 311 HOH HOH A . 
E 3 HOH 153 362 312 HOH HOH A . 
E 3 HOH 154 363 314 HOH HOH A . 
E 3 HOH 155 364 315 HOH HOH A . 
E 3 HOH 156 365 317 HOH HOH A . 
E 3 HOH 157 366 319 HOH HOH A . 
E 3 HOH 158 367 324 HOH HOH A . 
E 3 HOH 159 368 328 HOH HOH A . 
E 3 HOH 160 369 331 HOH HOH A . 
E 3 HOH 161 370 332 HOH HOH A . 
E 3 HOH 162 371 335 HOH HOH A . 
E 3 HOH 163 372 336 HOH HOH A . 
E 3 HOH 164 373 337 HOH HOH A . 
E 3 HOH 165 374 343 HOH HOH A . 
E 3 HOH 166 375 344 HOH HOH A . 
E 3 HOH 167 376 348 HOH HOH A . 
E 3 HOH 168 377 350 HOH HOH A . 
E 3 HOH 169 378 351 HOH HOH A . 
E 3 HOH 170 379 352 HOH HOH A . 
E 3 HOH 171 380 356 HOH HOH A . 
E 3 HOH 172 381 357 HOH HOH A . 
E 3 HOH 173 382 359 HOH HOH A . 
E 3 HOH 174 383 362 HOH HOH A . 
E 3 HOH 175 384 364 HOH HOH A . 
E 3 HOH 176 385 366 HOH HOH A . 
E 3 HOH 177 386 367 HOH HOH A . 
E 3 HOH 178 387 368 HOH HOH A . 
E 3 HOH 179 388 369 HOH HOH A . 
E 3 HOH 180 389 372 HOH HOH A . 
E 3 HOH 181 390 373 HOH HOH A . 
E 3 HOH 182 391 374 HOH HOH A . 
E 3 HOH 183 392 375 HOH HOH A . 
E 3 HOH 184 393 376 HOH HOH A . 
E 3 HOH 185 394 377 HOH HOH A . 
F 3 HOH 1   210 1   HOH HOH B . 
F 3 HOH 2   211 3   HOH HOH B . 
F 3 HOH 3   212 5   HOH HOH B . 
F 3 HOH 4   213 6   HOH HOH B . 
F 3 HOH 5   214 9   HOH HOH B . 
F 3 HOH 6   215 10  HOH HOH B . 
F 3 HOH 7   216 11  HOH HOH B . 
F 3 HOH 8   217 15  HOH HOH B . 
F 3 HOH 9   218 16  HOH HOH B . 
F 3 HOH 10  219 19  HOH HOH B . 
F 3 HOH 11  220 22  HOH HOH B . 
F 3 HOH 12  221 23  HOH HOH B . 
F 3 HOH 13  222 27  HOH HOH B . 
F 3 HOH 14  223 28  HOH HOH B . 
F 3 HOH 15  224 29  HOH HOH B . 
F 3 HOH 16  225 30  HOH HOH B . 
F 3 HOH 17  226 33  HOH HOH B . 
F 3 HOH 18  227 35  HOH HOH B . 
F 3 HOH 19  228 41  HOH HOH B . 
F 3 HOH 20  229 43  HOH HOH B . 
F 3 HOH 21  230 46  HOH HOH B . 
F 3 HOH 22  231 49  HOH HOH B . 
F 3 HOH 23  232 52  HOH HOH B . 
F 3 HOH 24  233 54  HOH HOH B . 
F 3 HOH 25  234 56  HOH HOH B . 
F 3 HOH 26  235 59  HOH HOH B . 
F 3 HOH 27  236 60  HOH HOH B . 
F 3 HOH 28  237 62  HOH HOH B . 
F 3 HOH 29  238 63  HOH HOH B . 
F 3 HOH 30  239 65  HOH HOH B . 
F 3 HOH 31  240 68  HOH HOH B . 
F 3 HOH 32  241 69  HOH HOH B . 
F 3 HOH 33  242 71  HOH HOH B . 
F 3 HOH 34  243 72  HOH HOH B . 
F 3 HOH 35  244 74  HOH HOH B . 
F 3 HOH 36  245 75  HOH HOH B . 
F 3 HOH 37  246 79  HOH HOH B . 
F 3 HOH 38  247 80  HOH HOH B . 
F 3 HOH 39  248 83  HOH HOH B . 
F 3 HOH 40  249 84  HOH HOH B . 
F 3 HOH 41  250 87  HOH HOH B . 
F 3 HOH 42  251 89  HOH HOH B . 
F 3 HOH 43  252 90  HOH HOH B . 
F 3 HOH 44  253 91  HOH HOH B . 
F 3 HOH 45  254 94  HOH HOH B . 
F 3 HOH 46  255 96  HOH HOH B . 
F 3 HOH 47  256 97  HOH HOH B . 
F 3 HOH 48  257 98  HOH HOH B . 
F 3 HOH 49  258 101 HOH HOH B . 
F 3 HOH 50  259 102 HOH HOH B . 
F 3 HOH 51  260 104 HOH HOH B . 
F 3 HOH 52  261 105 HOH HOH B . 
F 3 HOH 53  262 107 HOH HOH B . 
F 3 HOH 54  263 114 HOH HOH B . 
F 3 HOH 55  264 118 HOH HOH B . 
F 3 HOH 56  265 119 HOH HOH B . 
F 3 HOH 57  266 123 HOH HOH B . 
F 3 HOH 58  267 124 HOH HOH B . 
F 3 HOH 59  268 125 HOH HOH B . 
F 3 HOH 60  269 126 HOH HOH B . 
F 3 HOH 61  270 128 HOH HOH B . 
F 3 HOH 62  271 130 HOH HOH B . 
F 3 HOH 63  272 131 HOH HOH B . 
F 3 HOH 64  273 134 HOH HOH B . 
F 3 HOH 65  274 135 HOH HOH B . 
F 3 HOH 66  275 137 HOH HOH B . 
F 3 HOH 67  276 138 HOH HOH B . 
F 3 HOH 68  277 139 HOH HOH B . 
F 3 HOH 69  278 140 HOH HOH B . 
F 3 HOH 70  279 141 HOH HOH B . 
F 3 HOH 71  280 143 HOH HOH B . 
F 3 HOH 72  281 147 HOH HOH B . 
F 3 HOH 73  282 149 HOH HOH B . 
F 3 HOH 74  283 150 HOH HOH B . 
F 3 HOH 75  284 154 HOH HOH B . 
F 3 HOH 76  285 155 HOH HOH B . 
F 3 HOH 77  286 156 HOH HOH B . 
F 3 HOH 78  287 159 HOH HOH B . 
F 3 HOH 79  288 163 HOH HOH B . 
F 3 HOH 80  289 164 HOH HOH B . 
F 3 HOH 81  290 165 HOH HOH B . 
F 3 HOH 82  291 166 HOH HOH B . 
F 3 HOH 83  292 168 HOH HOH B . 
F 3 HOH 84  293 169 HOH HOH B . 
F 3 HOH 85  294 174 HOH HOH B . 
F 3 HOH 86  295 177 HOH HOH B . 
F 3 HOH 87  296 178 HOH HOH B . 
F 3 HOH 88  297 182 HOH HOH B . 
F 3 HOH 89  298 183 HOH HOH B . 
F 3 HOH 90  299 184 HOH HOH B . 
F 3 HOH 91  300 186 HOH HOH B . 
F 3 HOH 92  301 188 HOH HOH B . 
F 3 HOH 93  302 189 HOH HOH B . 
F 3 HOH 94  303 193 HOH HOH B . 
F 3 HOH 95  304 194 HOH HOH B . 
F 3 HOH 96  305 196 HOH HOH B . 
F 3 HOH 97  306 197 HOH HOH B . 
F 3 HOH 98  307 198 HOH HOH B . 
F 3 HOH 99  308 208 HOH HOH B . 
F 3 HOH 100 309 209 HOH HOH B . 
F 3 HOH 101 310 211 HOH HOH B . 
F 3 HOH 102 311 212 HOH HOH B . 
F 3 HOH 103 312 214 HOH HOH B . 
F 3 HOH 104 313 215 HOH HOH B . 
F 3 HOH 105 314 216 HOH HOH B . 
F 3 HOH 106 315 218 HOH HOH B . 
F 3 HOH 107 316 220 HOH HOH B . 
F 3 HOH 108 317 222 HOH HOH B . 
F 3 HOH 109 318 223 HOH HOH B . 
F 3 HOH 110 319 224 HOH HOH B . 
F 3 HOH 111 320 225 HOH HOH B . 
F 3 HOH 112 321 226 HOH HOH B . 
F 3 HOH 113 322 228 HOH HOH B . 
F 3 HOH 114 323 230 HOH HOH B . 
F 3 HOH 115 324 235 HOH HOH B . 
F 3 HOH 116 325 238 HOH HOH B . 
F 3 HOH 117 326 240 HOH HOH B . 
F 3 HOH 118 327 241 HOH HOH B . 
F 3 HOH 119 328 242 HOH HOH B . 
F 3 HOH 120 329 243 HOH HOH B . 
F 3 HOH 121 330 244 HOH HOH B . 
F 3 HOH 122 331 245 HOH HOH B . 
F 3 HOH 123 332 246 HOH HOH B . 
F 3 HOH 124 333 249 HOH HOH B . 
F 3 HOH 125 334 253 HOH HOH B . 
F 3 HOH 126 335 254 HOH HOH B . 
F 3 HOH 127 336 256 HOH HOH B . 
F 3 HOH 128 337 258 HOH HOH B . 
F 3 HOH 129 338 259 HOH HOH B . 
F 3 HOH 130 339 260 HOH HOH B . 
F 3 HOH 131 340 261 HOH HOH B . 
F 3 HOH 132 341 262 HOH HOH B . 
F 3 HOH 133 342 263 HOH HOH B . 
F 3 HOH 134 343 266 HOH HOH B . 
F 3 HOH 135 344 267 HOH HOH B . 
F 3 HOH 136 345 268 HOH HOH B . 
F 3 HOH 137 346 269 HOH HOH B . 
F 3 HOH 138 347 272 HOH HOH B . 
F 3 HOH 139 348 275 HOH HOH B . 
F 3 HOH 140 349 277 HOH HOH B . 
F 3 HOH 141 350 282 HOH HOH B . 
F 3 HOH 142 351 284 HOH HOH B . 
F 3 HOH 143 352 286 HOH HOH B . 
F 3 HOH 144 353 288 HOH HOH B . 
F 3 HOH 145 354 290 HOH HOH B . 
F 3 HOH 146 355 291 HOH HOH B . 
F 3 HOH 147 356 292 HOH HOH B . 
F 3 HOH 148 357 293 HOH HOH B . 
F 3 HOH 149 358 294 HOH HOH B . 
F 3 HOH 150 359 296 HOH HOH B . 
F 3 HOH 151 360 297 HOH HOH B . 
F 3 HOH 152 361 300 HOH HOH B . 
F 3 HOH 153 362 303 HOH HOH B . 
F 3 HOH 154 363 305 HOH HOH B . 
F 3 HOH 155 364 306 HOH HOH B . 
F 3 HOH 156 365 307 HOH HOH B . 
F 3 HOH 157 366 308 HOH HOH B . 
F 3 HOH 158 367 309 HOH HOH B . 
F 3 HOH 159 368 310 HOH HOH B . 
F 3 HOH 160 369 313 HOH HOH B . 
F 3 HOH 161 370 316 HOH HOH B . 
F 3 HOH 162 371 318 HOH HOH B . 
F 3 HOH 163 372 320 HOH HOH B . 
F 3 HOH 164 373 321 HOH HOH B . 
F 3 HOH 165 374 322 HOH HOH B . 
F 3 HOH 166 375 323 HOH HOH B . 
F 3 HOH 167 376 325 HOH HOH B . 
F 3 HOH 168 377 326 HOH HOH B . 
F 3 HOH 169 378 327 HOH HOH B . 
F 3 HOH 170 379 329 HOH HOH B . 
F 3 HOH 171 380 333 HOH HOH B . 
F 3 HOH 172 381 334 HOH HOH B . 
F 3 HOH 173 382 338 HOH HOH B . 
F 3 HOH 174 383 339 HOH HOH B . 
F 3 HOH 175 384 340 HOH HOH B . 
F 3 HOH 176 385 341 HOH HOH B . 
F 3 HOH 177 386 342 HOH HOH B . 
F 3 HOH 178 387 345 HOH HOH B . 
F 3 HOH 179 388 349 HOH HOH B . 
F 3 HOH 180 389 353 HOH HOH B . 
F 3 HOH 181 390 354 HOH HOH B . 
F 3 HOH 182 391 355 HOH HOH B . 
F 3 HOH 183 392 358 HOH HOH B . 
F 3 HOH 184 393 360 HOH HOH B . 
F 3 HOH 185 394 361 HOH HOH B . 
F 3 HOH 186 395 363 HOH HOH B . 
F 3 HOH 187 396 365 HOH HOH B . 
F 3 HOH 188 397 370 HOH HOH B . 
F 3 HOH 189 398 371 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 O   ? E HOH .   ? A HOH 388 ? 1_555 88.5  ? 
2  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 88.0  ? 
3  O   ? E HOH .   ? A HOH 388 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 175.7 ? 
4  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 112.2 ? 
5  O   ? E HOH .   ? A HOH 388 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 90.3  ? 
6  NE2 ? A HIS 37  ? A HIS 28  ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 93.2  ? 
7  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 120.5 ? 
8  O   ? E HOH .   ? A HOH 388 ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 89.3  ? 
9  NE2 ? A HIS 37  ? A HIS 28  ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 90.5  ? 
10 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 MN ? C MN . ? A MN 209 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 127.2 ? 
11 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 O   ? F HOH .   ? B HOH 212 ? 1_555 89.7  ? 
12 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 90.3  ? 
13 O   ? F HOH .   ? B HOH 212 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 178.1 ? 
14 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 108.0 ? 
15 O   ? F HOH .   ? B HOH 212 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 84.5  ? 
16 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 93.7  ? 
17 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 126.9 ? 
18 O   ? F HOH .   ? B HOH 212 ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 90.7  ? 
19 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 90.8  ? 
20 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 MN ? D MN . ? B MN 209 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 124.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-19 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 111 ? ? 71.08   -55.64  
2 1 ASN A 149 ? ? 57.42   -126.88 
3 1 GLN A 176 ? ? 48.78   -129.00 
4 1 GLU B 63  ? ? -48.26  -19.84  
5 1 ASN B 111 ? ? 77.08   -53.87  
6 1 ASP B 138 ? ? -118.60 75.35   
7 1 ASN B 149 ? ? 56.18   -124.72 
8 1 TYR B 171 ? ? -144.16 -4.05   
9 1 GLN B 176 ? ? 45.92   -128.37 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -8  ? A GLY 1   
2  1 Y 1 A SER -7  ? A SER 2   
3  1 Y 1 A SER -6  ? A SER 3   
4  1 Y 1 A HIS -5  ? A HIS 4   
5  1 Y 1 A HIS -4  ? A HIS 5   
6  1 Y 1 A HIS -3  ? A HIS 6   
7  1 Y 1 A HIS -2  ? A HIS 7   
8  1 Y 1 A HIS -1  ? A HIS 8   
9  1 Y 1 A HIS 0   ? A HIS 9   
10 1 Y 1 A MET 1   ? A MET 10  
11 1 Y 1 A SER 2   ? A SER 11  
12 1 Y 1 A GLN 204 ? A GLN 213 
13 1 Y 1 A SER 205 ? A SER 214 
14 1 Y 1 A GLN 206 ? A GLN 215 
15 1 Y 1 A LYS 207 ? A LYS 216 
16 1 Y 1 A HIS 208 ? A HIS 217 
17 1 Y 1 B GLY -8  ? B GLY 1   
18 1 Y 1 B SER -7  ? B SER 2   
19 1 Y 1 B SER -6  ? B SER 3   
20 1 Y 1 B HIS -5  ? B HIS 4   
21 1 Y 1 B HIS -4  ? B HIS 5   
22 1 Y 1 B HIS -3  ? B HIS 6   
23 1 Y 1 B HIS -2  ? B HIS 7   
24 1 Y 1 B HIS -1  ? B HIS 8   
25 1 Y 1 B HIS 0   ? B HIS 9   
26 1 Y 1 B MET 1   ? B MET 10  
27 1 Y 1 B SER 2   ? B SER 11  
28 1 Y 1 B GLN 204 ? B GLN 213 
29 1 Y 1 B SER 205 ? B SER 214 
30 1 Y 1 B GLN 206 ? B GLN 215 
31 1 Y 1 B LYS 207 ? B LYS 216 
32 1 Y 1 B HIS 208 ? B HIS 217 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
#