data_1XSB
# 
_entry.id   1XSB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XSB         
RCSB  RCSB030710   
WWPDB D_1000030710 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB  1XSA 'the same protein(E63A) of Apo structure'                                 unspecified 
PDB  1XSC 'the same protein(E63A) of ATP bound structure including ATP constraints' unspecified 
BMRB 6336 'assignments of human AP4A hydrolase in complex with ATP'                 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XSB 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Swarbrick, J.D.' 1 
'Buyya, S.'       2 
'Gunawardana, D.' 3 
'Gayler, K.R.'    4 
'McLennan, A.G.'  5 
'Gooley, P.R.'    6 
# 
_citation.id                        primary 
_citation.title                     'Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                8471 
_citation.page_last                 8481 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15596429 
_citation.pdbx_database_id_DOI      10.1074/jbc.M412318200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Swarbrick, J.D.' 1 
primary 'Buyya, S.'       2 
primary 'Gunawardana, D.' 3 
primary 'Gayler, K.R.'    4 
primary 'McLennan, A.G.'  5 
primary 'Gooley, P.R.'    6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           "Bis(5'-nucleosyl)-tetraphosphatase" 
_entity.formula_weight             17317.809 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.6.1.17 
_entity.pdbx_mutation              E63A 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase, Diadenosine tetraphosphatase, Ap4A hydrolase, Ap4AASE
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEG
FKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEAL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEG
FKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEAL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   ALA n 
1 8   LEU n 
1 9   ARG n 
1 10  ALA n 
1 11  CYS n 
1 12  GLY n 
1 13  LEU n 
1 14  ILE n 
1 15  ILE n 
1 16  PHE n 
1 17  ARG n 
1 18  ARG n 
1 19  CYS n 
1 20  LEU n 
1 21  ILE n 
1 22  PRO n 
1 23  LYS n 
1 24  VAL n 
1 25  ASP n 
1 26  ASN n 
1 27  ASN n 
1 28  ALA n 
1 29  ILE n 
1 30  GLU n 
1 31  PHE n 
1 32  LEU n 
1 33  LEU n 
1 34  LEU n 
1 35  GLN n 
1 36  ALA n 
1 37  SER n 
1 38  ASP n 
1 39  GLY n 
1 40  ILE n 
1 41  HIS n 
1 42  HIS n 
1 43  TRP n 
1 44  THR n 
1 45  PRO n 
1 46  PRO n 
1 47  LYS n 
1 48  GLY n 
1 49  HIS n 
1 50  VAL n 
1 51  GLU n 
1 52  PRO n 
1 53  GLY n 
1 54  GLU n 
1 55  ASP n 
1 56  ASP n 
1 57  LEU n 
1 58  GLU n 
1 59  THR n 
1 60  ALA n 
1 61  LEU n 
1 62  ARG n 
1 63  ALA n 
1 64  THR n 
1 65  GLN n 
1 66  GLU n 
1 67  GLU n 
1 68  ALA n 
1 69  GLY n 
1 70  ILE n 
1 71  GLU n 
1 72  ALA n 
1 73  GLY n 
1 74  GLN n 
1 75  LEU n 
1 76  THR n 
1 77  ILE n 
1 78  ILE n 
1 79  GLU n 
1 80  GLY n 
1 81  PHE n 
1 82  LYS n 
1 83  ARG n 
1 84  GLU n 
1 85  LEU n 
1 86  ASN n 
1 87  TYR n 
1 88  VAL n 
1 89  ALA n 
1 90  ARG n 
1 91  ASN n 
1 92  LYS n 
1 93  PRO n 
1 94  LYS n 
1 95  THR n 
1 96  VAL n 
1 97  ILE n 
1 98  TYR n 
1 99  TRP n 
1 100 LEU n 
1 101 ALA n 
1 102 GLU n 
1 103 VAL n 
1 104 LYS n 
1 105 ASP n 
1 106 TYR n 
1 107 ASP n 
1 108 VAL n 
1 109 GLU n 
1 110 ILE n 
1 111 ARG n 
1 112 LEU n 
1 113 SER n 
1 114 HIS n 
1 115 GLU n 
1 116 HIS n 
1 117 GLN n 
1 118 ALA n 
1 119 TYR n 
1 120 ARG n 
1 121 TRP n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 GLU n 
1 126 GLU n 
1 127 ALA n 
1 128 CYS n 
1 129 GLN n 
1 130 LEU n 
1 131 ALA n 
1 132 GLN n 
1 133 PHE n 
1 134 LYS n 
1 135 GLU n 
1 136 MET n 
1 137 LYS n 
1 138 ALA n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 GLU n 
1 143 GLY n 
1 144 HIS n 
1 145 GLN n 
1 146 PHE n 
1 147 LEU n 
1 148 CYS n 
1 149 SER n 
1 150 ILE n 
1 151 GLU n 
1 152 ALA n 
1 153 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6-P3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AP4A_HUMAN 
_struct_ref.pdbx_db_accession          P50583 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL
NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
;
_struct_ref.pdbx_align_begin           0 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XSB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 152 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P50583 
_struct_ref_seq.db_align_beg                  0 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XSB GLY A 1   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 1   1 
1 1XSB PRO A 2   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 2   2 
1 1XSB LEU A 3   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 3   3 
1 1XSB GLY A 4   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 4   4 
1 1XSB SER A 5   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 5   5 
1 1XSB ALA A 63  ? UNP P50583 GLU 57 ENGINEERED         63  6 
1 1XSB LEU A 153 ? UNP P50583 ?   ?  'CLONING ARTIFACT' 153 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 'C HSQC-NOESY'                   
2 1 1 3D_15N-separated_NOESY           
3 2 1 '13C HSQC-NOESY'                 
4 2 1 '13C NOESY-HSQC aromatic region' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      52.5mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.0mM human AP4A hydrolase' '20mM MgCl2, 20mM imidazole, pH 6.5, 90% H2O 10% D2O, 10mM DTT, 1mM EDTA, 1.5mM ATP' 
2 '1.0mM human AP4A hydrolase' '20mM MgCl2, 20mM imidazole, pH 6.5, 100% D2O, 10mM DTT, 1mM EDTA, 1.5mM ATP'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian INOVA 500 
# 
_pdbx_nmr_refine.entry_id           1XSB 
_pdbx_nmr_refine.method             
;CANDID 
xplor-NIH RAMA potential. Refine against CA & CB shifts.
;
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1XSB 
_pdbx_nmr_details.text       
;Residues 1 and 2 are cganged from GP to Alanine in the calculations. These are non native from precission cleavage site and are unstructured.   
ATP constraints are not included. Different calculation protocol is used for this and deposited separately (lower temp, slower cooling).
;
# 
_pdbx_nmr_ensemble.entry_id                                      1XSB 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             39 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1XSB 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
CYANA     1.0.7 'structure solution' 'P Guntert' 1 
XPLOR-NIH 2.9.1 refinement           ?           2 
# 
_exptl.entry_id          1XSB 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1XSB 
_struct.title                     
'Structure of the nudix enzyme AP4A hydrolase from homo sapiens (E63A mutant) in complex with ATP. No ATP restraints included' 
_struct.pdbx_descriptor           
;Bis(5'-nucleosyl)-tetraphosphatase (E.C.3.6.1.17)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XSB 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'nudix enzyme, human AP4A hydrolase, alpha-beta, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 55  ? GLU A 67  ? ASP A 55  GLU A 67  1 ? 13 
HELX_P HELX_P2 2 GLY A 123 ? ALA A 131 ? GLY A 123 ALA A 131 1 ? 9  
HELX_P HELX_P3 3 PHE A 133 ? CYS A 148 ? PHE A 133 CYS A 148 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   11 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? parallel      
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  TRP A 43  ? THR A 44  ? TRP A 43  THR A 44  
A 2  ILE A 29  ? ALA A 36  ? ILE A 29  ALA A 36  
A 3  HIS A 116 ? LEU A 122 ? HIS A 116 LEU A 122 
A 4  ILE A 29  ? ALA A 36  ? ILE A 29  ALA A 36  
A 5  LEU A 8   ? ARG A 18  ? LEU A 8   ARG A 18  
A 6  LYS A 47  ? HIS A 49  ? LYS A 47  HIS A 49  
A 7  LEU A 8   ? ARG A 18  ? LEU A 8   ARG A 18  
A 8  PRO A 93  ? VAL A 103 ? PRO A 93  VAL A 103 
A 9  LEU A 75  ? ILE A 77  ? LEU A 75  ILE A 77  
A 10 PRO A 93  ? VAL A 103 ? PRO A 93  VAL A 103 
A 11 ARG A 83  ? VAL A 88  ? ARG A 83  VAL A 88  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N THR A 44  ? N THR A 44  O LEU A 34  ? O LEU A 34  
A 2  3  O GLN A 35  ? O GLN A 35  N GLN A 117 ? N GLN A 117 
A 3  4  O LEU A 122 ? O LEU A 122 N PHE A 31  ? N PHE A 31  
A 4  5  N LEU A 32  ? N LEU A 32  O ILE A 15  ? O ILE A 15  
A 5  6  N CYS A 11  ? N CYS A 11  O GLY A 48  ? O GLY A 48  
A 6  7  O GLY A 48  ? O GLY A 48  N CYS A 11  ? N CYS A 11  
A 7  8  N LEU A 8   ? N LEU A 8   O PRO A 93  ? O PRO A 93  
A 8  9  O GLU A 102 ? O GLU A 102 N THR A 76  ? N THR A 76  
A 9  10 N THR A 76  ? N THR A 76  O GLU A 102 ? O GLU A 102 
A 10 11 N TYR A 98  ? N TYR A 98  O ARG A 83  ? O ARG A 83  
# 
_database_PDB_matrix.entry_id          1XSB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XSB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 21.413  -14.539 -5.884  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 20.720  -13.300 -6.171  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 19.353  -13.292 -5.500  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 18.415  -13.916 -5.989  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 20.951  -15.227 -5.306  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 21.309  -12.462 -5.798  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 20.592  -13.199 -7.249  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . PRO A 1 2   ? 19.244  -12.582 -4.375  1.00 0.00 ? 2   PRO A N    1  
ATOM 9     C CA   . PRO A 1 2   ? 18.026  -12.457 -3.604  1.00 0.00 ? 2   PRO A CA   1  
ATOM 10    C C    . PRO A 1 2   ? 17.041  -11.565 -4.346  1.00 0.00 ? 2   PRO A C    1  
ATOM 11    O O    . PRO A 1 2   ? 17.442  -10.606 -5.001  1.00 0.00 ? 2   PRO A O    1  
ATOM 12    C CB   . PRO A 1 2   ? 18.460  -11.816 -2.287  1.00 0.00 ? 2   PRO A CB   1  
ATOM 13    C CG   . PRO A 1 2   ? 19.664  -10.972 -2.702  1.00 0.00 ? 2   PRO A CG   1  
ATOM 14    C CD   . PRO A 1 2   ? 20.328  -11.837 -3.771  1.00 0.00 ? 2   PRO A CD   1  
ATOM 15    H HA   . PRO A 1 2   ? 17.576  -13.433 -3.421  1.00 0.00 ? 2   PRO A HA   1  
ATOM 16    H HB2  . PRO A 1 2   ? 17.668  -11.218 -1.837  1.00 0.00 ? 2   PRO A HB2  1  
ATOM 17    H HB3  . PRO A 1 2   ? 18.792  -12.596 -1.601  1.00 0.00 ? 2   PRO A HB3  1  
ATOM 18    H HG2  . PRO A 1 2   ? 19.311  -10.047 -3.158  1.00 0.00 ? 2   PRO A HG2  1  
ATOM 19    H HG3  . PRO A 1 2   ? 20.331  -10.760 -1.867  1.00 0.00 ? 2   PRO A HG3  1  
ATOM 20    H HD2  . PRO A 1 2   ? 20.848  -11.220 -4.503  1.00 0.00 ? 2   PRO A HD2  1  
ATOM 21    H HD3  . PRO A 1 2   ? 21.022  -12.535 -3.302  1.00 0.00 ? 2   PRO A HD3  1  
ATOM 22    N N    . LEU A 1 3   ? 15.774  -11.834 -4.276  1.00 0.00 ? 3   LEU A N    1  
ATOM 23    C CA   . LEU A 1 3   ? 14.780  -10.983 -4.989  1.00 0.00 ? 3   LEU A CA   1  
ATOM 24    C C    . LEU A 1 3   ? 14.527  -9.704  -4.187  1.00 0.00 ? 3   LEU A C    1  
ATOM 25    O O    . LEU A 1 3   ? 13.874  -8.791  -4.652  1.00 0.00 ? 3   LEU A O    1  
ATOM 26    C CB   . LEU A 1 3   ? 13.469  -11.753 -5.153  1.00 0.00 ? 3   LEU A CB   1  
ATOM 27    C CG   . LEU A 1 3   ? 13.672  -12.896 -6.151  1.00 0.00 ? 3   LEU A CG   1  
ATOM 28    C CD1  . LEU A 1 3   ? 14.531  -13.991 -5.514  1.00 0.00 ? 3   LEU A CD1  1  
ATOM 29    C CD2  . LEU A 1 3   ? 12.315  -13.485 -6.546  1.00 0.00 ? 3   LEU A CD2  1  
ATOM 30    H H    . LEU A 1 3   ? 15.473  -12.604 -3.747  1.00 0.00 ? 3   LEU A H    1  
ATOM 31    H HA   . LEU A 1 3   ? 15.167  -10.723 -5.964  1.00 0.00 ? 3   LEU A HA   1  
ATOM 32    H HB2  . LEU A 1 3   ? 13.164  -12.154 -4.198  1.00 0.00 ? 3   LEU A HB2  1  
ATOM 33    H HB3  . LEU A 1 3   ? 12.706  -11.084 -5.524  1.00 0.00 ? 3   LEU A HB3  1  
ATOM 34    H HG   . LEU A 1 3   ? 14.169  -12.518 -7.033  1.00 0.00 ? 3   LEU A HG   1  
ATOM 35    H HD11 . LEU A 1 3   ? 14.324  -14.046 -4.457  1.00 0.00 ? 3   LEU A HD11 1  
ATOM 36    H HD12 . LEU A 1 3   ? 15.577  -13.760 -5.667  1.00 0.00 ? 3   LEU A HD12 1  
ATOM 37    H HD13 . LEU A 1 3   ? 14.305  -14.940 -5.976  1.00 0.00 ? 3   LEU A HD13 1  
ATOM 38    H HD21 . LEU A 1 3   ? 12.313  -13.711 -7.602  1.00 0.00 ? 3   LEU A HD21 1  
ATOM 39    H HD22 . LEU A 1 3   ? 11.533  -12.771 -6.330  1.00 0.00 ? 3   LEU A HD22 1  
ATOM 40    H HD23 . LEU A 1 3   ? 12.138  -14.391 -5.984  1.00 0.00 ? 3   LEU A HD23 1  
ATOM 41    N N    . GLY A 1 4   ? 15.040  -9.626  -2.991  1.00 0.00 ? 4   GLY A N    1  
ATOM 42    C CA   . GLY A 1 4   ? 14.830  -8.401  -2.168  1.00 0.00 ? 4   GLY A CA   1  
ATOM 43    C C    . GLY A 1 4   ? 13.430  -8.420  -1.554  1.00 0.00 ? 4   GLY A C    1  
ATOM 44    O O    . GLY A 1 4   ? 12.834  -7.390  -1.312  1.00 0.00 ? 4   GLY A O    1  
ATOM 45    H H    . GLY A 1 4   ? 15.566  -10.372 -2.633  1.00 0.00 ? 4   GLY A H    1  
ATOM 46    H HA2  . GLY A 1 4   ? 15.568  -8.367  -1.380  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 47    H HA3  . GLY A 1 4   ? 14.930  -7.526  -2.793  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 48    N N    . SER A 1 5   ? 12.900  -9.584  -1.296  1.00 0.00 ? 5   SER A N    1  
ATOM 49    C CA   . SER A 1 5   ? 11.538  -9.663  -0.696  1.00 0.00 ? 5   SER A CA   1  
ATOM 50    C C    . SER A 1 5   ? 11.639  -9.428  0.811   1.00 0.00 ? 5   SER A C    1  
ATOM 51    O O    . SER A 1 5   ? 10.667  -9.524  1.530   1.00 0.00 ? 5   SER A O    1  
ATOM 52    C CB   . SER A 1 5   ? 10.942  -11.046 -0.956  1.00 0.00 ? 5   SER A CB   1  
ATOM 53    O OG   . SER A 1 5   ? 11.518  -11.983 -0.053  1.00 0.00 ? 5   SER A OG   1  
ATOM 54    H H    . SER A 1 5   ? 13.397  -10.404 -1.498  1.00 0.00 ? 5   SER A H    1  
ATOM 55    H HA   . SER A 1 5   ? 10.907  -8.907  -1.138  1.00 0.00 ? 5   SER A HA   1  
ATOM 56    H HB2  . SER A 1 5   ? 9.876   -11.015 -0.801  1.00 0.00 ? 5   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 5   ? 11.146  -11.341 -1.976  1.00 0.00 ? 5   SER A HB3  1  
ATOM 58    H HG   . SER A 1 5   ? 12.085  -12.572 -0.557  1.00 0.00 ? 5   SER A HG   1  
ATOM 59    N N    . MET A 1 6   ? 12.813  -9.121  1.294   1.00 0.00 ? 6   MET A N    1  
ATOM 60    C CA   . MET A 1 6   ? 12.985  -8.883  2.751   1.00 0.00 ? 6   MET A CA   1  
ATOM 61    C C    . MET A 1 6   ? 11.793  -8.090  3.287   1.00 0.00 ? 6   MET A C    1  
ATOM 62    O O    . MET A 1 6   ? 11.346  -7.135  2.686   1.00 0.00 ? 6   MET A O    1  
ATOM 63    C CB   . MET A 1 6   ? 14.264  -8.083  2.999   1.00 0.00 ? 6   MET A CB   1  
ATOM 64    C CG   . MET A 1 6   ? 14.527  -8.003  4.504   1.00 0.00 ? 6   MET A CG   1  
ATOM 65    S SD   . MET A 1 6   ? 15.436  -6.484  4.881   1.00 0.00 ? 6   MET A SD   1  
ATOM 66    C CE   . MET A 1 6   ? 13.997  -5.447  5.245   1.00 0.00 ? 6   MET A CE   1  
ATOM 67    H H    . MET A 1 6   ? 13.586  -9.050  0.697   1.00 0.00 ? 6   MET A H    1  
ATOM 68    H HA   . MET A 1 6   ? 13.048  -9.830  3.266   1.00 0.00 ? 6   MET A HA   1  
ATOM 69    H HB2  . MET A 1 6   ? 15.095  -8.571  2.511   1.00 0.00 ? 6   MET A HB2  1  
ATOM 70    H HB3  . MET A 1 6   ? 14.149  -7.086  2.603   1.00 0.00 ? 6   MET A HB3  1  
ATOM 71    H HG2  . MET A 1 6   ? 13.587  -8.000  5.034   1.00 0.00 ? 6   MET A HG2  1  
ATOM 72    H HG3  . MET A 1 6   ? 15.112  -8.858  4.813   1.00 0.00 ? 6   MET A HG3  1  
ATOM 73    H HE1  . MET A 1 6   ? 13.442  -5.272  4.334   1.00 0.00 ? 6   MET A HE1  1  
ATOM 74    H HE2  . MET A 1 6   ? 14.323  -4.505  5.652   1.00 0.00 ? 6   MET A HE2  1  
ATOM 75    H HE3  . MET A 1 6   ? 13.364  -5.949  5.967   1.00 0.00 ? 6   MET A HE3  1  
ATOM 76    N N    . ALA A 1 7   ? 11.289  -8.479  4.420   1.00 0.00 ? 7   ALA A N    1  
ATOM 77    C CA   . ALA A 1 7   ? 10.133  -7.756  5.021   1.00 0.00 ? 7   ALA A CA   1  
ATOM 78    C C    . ALA A 1 7   ? 8.835   -8.186  4.341   1.00 0.00 ? 7   ALA A C    1  
ATOM 79    O O    . ALA A 1 7   ? 8.829   -8.710  3.246   1.00 0.00 ? 7   ALA A O    1  
ATOM 80    C CB   . ALA A 1 7   ? 10.319  -6.247  4.851   1.00 0.00 ? 7   ALA A CB   1  
ATOM 81    H H    . ALA A 1 7   ? 11.678  -9.250  4.885   1.00 0.00 ? 7   ALA A H    1  
ATOM 82    H HA   . ALA A 1 7   ? 10.074  -7.995  6.072   1.00 0.00 ? 7   ALA A HA   1  
ATOM 83    H HB1  . ALA A 1 7   ? 9.832   -5.729  5.664   1.00 0.00 ? 7   ALA A HB1  1  
ATOM 84    H HB2  . ALA A 1 7   ? 9.884   -5.934  3.914   1.00 0.00 ? 7   ALA A HB2  1  
ATOM 85    H HB3  . ALA A 1 7   ? 11.373  -6.014  4.855   1.00 0.00 ? 7   ALA A HB3  1  
ATOM 86    N N    . LEU A 1 8   ? 7.734   -7.969  5.000   1.00 0.00 ? 8   LEU A N    1  
ATOM 87    C CA   . LEU A 1 8   ? 6.419   -8.362  4.415   1.00 0.00 ? 8   LEU A CA   1  
ATOM 88    C C    . LEU A 1 8   ? 5.739   -7.129  3.811   1.00 0.00 ? 8   LEU A C    1  
ATOM 89    O O    . LEU A 1 8   ? 5.760   -6.057  4.384   1.00 0.00 ? 8   LEU A O    1  
ATOM 90    C CB   . LEU A 1 8   ? 5.518   -8.931  5.516   1.00 0.00 ? 8   LEU A CB   1  
ATOM 91    C CG   . LEU A 1 8   ? 6.344   -9.768  6.499   1.00 0.00 ? 8   LEU A CG   1  
ATOM 92    C CD1  . LEU A 1 8   ? 7.244   -8.853  7.333   1.00 0.00 ? 8   LEU A CD1  1  
ATOM 93    C CD2  . LEU A 1 8   ? 5.398   -10.513 7.439   1.00 0.00 ? 8   LEU A CD2  1  
ATOM 94    H H    . LEU A 1 8   ? 7.774   -7.547  5.886   1.00 0.00 ? 8   LEU A H    1  
ATOM 95    H HA   . LEU A 1 8   ? 6.568   -9.105  3.647   1.00 0.00 ? 8   LEU A HA   1  
ATOM 96    H HB2  . LEU A 1 8   ? 5.044   -8.121  6.043   1.00 0.00 ? 8   LEU A HB2  1  
ATOM 97    H HB3  . LEU A 1 8   ? 4.759   -9.557  5.068   1.00 0.00 ? 8   LEU A HB3  1  
ATOM 98    H HG   . LEU A 1 8   ? 6.949   -10.478 5.956   1.00 0.00 ? 8   LEU A HG   1  
ATOM 99    H HD11 . LEU A 1 8   ? 8.256   -8.887  6.953   1.00 0.00 ? 8   LEU A HD11 1  
ATOM 100   H HD12 . LEU A 1 8   ? 7.240   -9.182  8.360   1.00 0.00 ? 8   LEU A HD12 1  
ATOM 101   H HD13 . LEU A 1 8   ? 6.872   -7.844  7.279   1.00 0.00 ? 8   LEU A HD13 1  
ATOM 102   H HD21 . LEU A 1 8   ? 5.862   -10.607 8.410   1.00 0.00 ? 8   LEU A HD21 1  
ATOM 103   H HD22 . LEU A 1 8   ? 5.191   -11.494 7.041   1.00 0.00 ? 8   LEU A HD22 1  
ATOM 104   H HD23 . LEU A 1 8   ? 4.474   -9.959  7.534   1.00 0.00 ? 8   LEU A HD23 1  
ATOM 105   N N    . ARG A 1 9   ? 5.123   -7.272  2.669   1.00 0.00 ? 9   ARG A N    1  
ATOM 106   C CA   . ARG A 1 9   ? 4.432   -6.108  2.048   1.00 0.00 ? 9   ARG A CA   1  
ATOM 107   C C    . ARG A 1 9   ? 2.993   -6.058  2.568   1.00 0.00 ? 9   ARG A C    1  
ATOM 108   O O    . ARG A 1 9   ? 2.326   -7.070  2.659   1.00 0.00 ? 9   ARG A O    1  
ATOM 109   C CB   . ARG A 1 9   ? 4.422   -6.266  0.527   1.00 0.00 ? 9   ARG A CB   1  
ATOM 110   C CG   . ARG A 1 9   ? 4.053   -4.932  -0.123  1.00 0.00 ? 9   ARG A CG   1  
ATOM 111   C CD   . ARG A 1 9   ? 3.904   -5.128  -1.632  1.00 0.00 ? 9   ARG A CD   1  
ATOM 112   N NE   . ARG A 1 9   ? 5.168   -5.688  -2.185  1.00 0.00 ? 9   ARG A NE   1  
ATOM 113   C CZ   . ARG A 1 9   ? 5.417   -5.604  -3.463  1.00 0.00 ? 9   ARG A CZ   1  
ATOM 114   N NH1  . ARG A 1 9   ? 4.559   -5.022  -4.256  1.00 0.00 ? 9   ARG A NH1  1  
ATOM 115   N NH2  . ARG A 1 9   ? 6.521   -6.100  -3.947  1.00 0.00 ? 9   ARG A NH2  1  
ATOM 116   H H    . ARG A 1 9   ? 5.105   -8.147  2.228   1.00 0.00 ? 9   ARG A H    1  
ATOM 117   H HA   . ARG A 1 9   ? 4.946   -5.197  2.315   1.00 0.00 ? 9   ARG A HA   1  
ATOM 118   H HB2  . ARG A 1 9   ? 5.404   -6.572  0.192   1.00 0.00 ? 9   ARG A HB2  1  
ATOM 119   H HB3  . ARG A 1 9   ? 3.697   -7.014  0.247   1.00 0.00 ? 9   ARG A HB3  1  
ATOM 120   H HG2  . ARG A 1 9   ? 3.121   -4.574  0.290   1.00 0.00 ? 9   ARG A HG2  1  
ATOM 121   H HG3  . ARG A 1 9   ? 4.832   -4.209  0.068   1.00 0.00 ? 9   ARG A HG3  1  
ATOM 122   H HD2  . ARG A 1 9   ? 3.091   -5.813  -1.828  1.00 0.00 ? 9   ARG A HD2  1  
ATOM 123   H HD3  . ARG A 1 9   ? 3.695   -4.178  -2.101  1.00 0.00 ? 9   ARG A HD3  1  
ATOM 124   H HE   . ARG A 1 9   ? 5.813   -6.124  -1.588  1.00 0.00 ? 9   ARG A HE   1  
ATOM 125   H HH11 . ARG A 1 9   ? 3.711   -4.644  -3.885  1.00 0.00 ? 9   ARG A HH11 1  
ATOM 126   H HH12 . ARG A 1 9   ? 4.751   -4.956  -5.234  1.00 0.00 ? 9   ARG A HH12 1  
ATOM 127   H HH21 . ARG A 1 9   ? 7.177   -6.547  -3.338  1.00 0.00 ? 9   ARG A HH21 1  
ATOM 128   H HH22 . ARG A 1 9   ? 6.713   -6.035  -4.926  1.00 0.00 ? 9   ARG A HH22 1  
ATOM 129   N N    . ALA A 1 10  ? 2.506   -4.899  2.921   1.00 0.00 ? 10  ALA A N    1  
ATOM 130   C CA   . ALA A 1 10  ? 1.111   -4.817  3.441   1.00 0.00 ? 10  ALA A CA   1  
ATOM 131   C C    . ALA A 1 10  ? 0.442   -3.537  2.950   1.00 0.00 ? 10  ALA A C    1  
ATOM 132   O O    . ALA A 1 10  ? 1.090   -2.554  2.652   1.00 0.00 ? 10  ALA A O    1  
ATOM 133   C CB   . ALA A 1 10  ? 1.132   -4.806  4.969   1.00 0.00 ? 10  ALA A CB   1  
ATOM 134   H H    . ALA A 1 10  ? 3.055   -4.091  2.849   1.00 0.00 ? 10  ALA A H    1  
ATOM 135   H HA   . ALA A 1 10  ? 0.548   -5.671  3.097   1.00 0.00 ? 10  ALA A HA   1  
ATOM 136   H HB1  . ALA A 1 10  ? 2.149   -4.913  5.316   1.00 0.00 ? 10  ALA A HB1  1  
ATOM 137   H HB2  . ALA A 1 10  ? 0.534   -5.624  5.339   1.00 0.00 ? 10  ALA A HB2  1  
ATOM 138   H HB3  . ALA A 1 10  ? 0.724   -3.870  5.325   1.00 0.00 ? 10  ALA A HB3  1  
ATOM 139   N N    . CYS A 1 11  ? -0.859  -3.541  2.878   1.00 0.00 ? 11  CYS A N    1  
ATOM 140   C CA   . CYS A 1 11  ? -1.582  -2.329  2.425   1.00 0.00 ? 11  CYS A CA   1  
ATOM 141   C C    . CYS A 1 11  ? -2.906  -2.219  3.182   1.00 0.00 ? 11  CYS A C    1  
ATOM 142   O O    . CYS A 1 11  ? -3.724  -3.117  3.160   1.00 0.00 ? 11  CYS A O    1  
ATOM 143   C CB   . CYS A 1 11  ? -1.856  -2.426  0.926   1.00 0.00 ? 11  CYS A CB   1  
ATOM 144   S SG   . CYS A 1 11  ? -0.538  -1.581  0.020   1.00 0.00 ? 11  CYS A SG   1  
ATOM 145   H H    . CYS A 1 11  ? -1.362  -4.343  3.134   1.00 0.00 ? 11  CYS A H    1  
ATOM 146   H HA   . CYS A 1 11  ? -0.980  -1.454  2.626   1.00 0.00 ? 11  CYS A HA   1  
ATOM 147   H HB2  . CYS A 1 11  ? -1.889  -3.465  0.634   1.00 0.00 ? 11  CYS A HB2  1  
ATOM 148   H HB3  . CYS A 1 11  ? -2.805  -1.959  0.703   1.00 0.00 ? 11  CYS A HB3  1  
ATOM 149   H HG   . CYS A 1 11  ? 0.160   -1.366  0.644   1.00 0.00 ? 11  CYS A HG   1  
ATOM 150   N N    . GLY A 1 12  ? -3.120  -1.121  3.843   1.00 0.00 ? 12  GLY A N    1  
ATOM 151   C CA   . GLY A 1 12  ? -4.389  -0.927  4.597   1.00 0.00 ? 12  GLY A CA   1  
ATOM 152   C C    . GLY A 1 12  ? -5.053  0.357   4.104   1.00 0.00 ? 12  GLY A C    1  
ATOM 153   O O    . GLY A 1 12  ? -4.518  1.048   3.261   1.00 0.00 ? 12  GLY A O    1  
ATOM 154   H H    . GLY A 1 12  ? -2.441  -0.412  3.839   1.00 0.00 ? 12  GLY A H    1  
ATOM 155   H HA2  . GLY A 1 12  ? -5.047  -1.769  4.425   1.00 0.00 ? 12  GLY A HA2  1  
ATOM 156   H HA3  . GLY A 1 12  ? -4.178  -0.838  5.652   1.00 0.00 ? 12  GLY A HA3  1  
ATOM 157   N N    . LEU A 1 13  ? -6.214  0.684   4.602   1.00 0.00 ? 13  LEU A N    1  
ATOM 158   C CA   . LEU A 1 13  ? -6.880  1.927   4.122   1.00 0.00 ? 13  LEU A CA   1  
ATOM 159   C C    . LEU A 1 13  ? -7.223  2.852   5.286   1.00 0.00 ? 13  LEU A C    1  
ATOM 160   O O    . LEU A 1 13  ? -8.046  2.532   6.121   1.00 0.00 ? 13  LEU A O    1  
ATOM 161   C CB   . LEU A 1 13  ? -8.185  1.562   3.401   1.00 0.00 ? 13  LEU A CB   1  
ATOM 162   C CG   . LEU A 1 13  ? -8.064  1.855   1.903   1.00 0.00 ? 13  LEU A CG   1  
ATOM 163   C CD1  . LEU A 1 13  ? -9.429  1.695   1.231   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 164   C CD2  . LEU A 1 13  ? -7.577  3.288   1.690   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 165   H H    . LEU A 1 13  ? -6.644  0.118   5.275   1.00 0.00 ? 13  LEU A H    1  
ATOM 166   H HA   . LEU A 1 13  ? -6.223  2.440   3.442   1.00 0.00 ? 13  LEU A HA   1  
ATOM 167   H HB2  . LEU A 1 13  ? -8.391  0.514   3.546   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 168   H HB3  . LEU A 1 13  ? -8.996  2.145   3.813   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 169   H HG   . LEU A 1 13  ? -7.367  1.165   1.464   1.00 0.00 ? 13  LEU A HG   1  
ATOM 170   H HD11 . LEU A 1 13  ? -9.443  0.780   0.657   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 171   H HD12 . LEU A 1 13  ? -9.602  2.534   0.572   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 172   H HD13 . LEU A 1 13  ? -10.202 1.662   1.983   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 173   H HD21 . LEU A 1 13  ? -8.110  3.732   0.867   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 174   H HD22 . LEU A 1 13  ? -6.521  3.276   1.472   1.00 0.00 ? 13  LEU A HD22 1  
ATOM 175   H HD23 . LEU A 1 13  ? -7.752  3.866   2.586   1.00 0.00 ? 13  LEU A HD23 1  
ATOM 176   N N    . ILE A 1 14  ? -6.655  4.027   5.310   1.00 0.00 ? 14  ILE A N    1  
ATOM 177   C CA   . ILE A 1 14  ? -7.023  4.986   6.379   1.00 0.00 ? 14  ILE A CA   1  
ATOM 178   C C    . ILE A 1 14  ? -8.288  5.679   5.897   1.00 0.00 ? 14  ILE A C    1  
ATOM 179   O O    . ILE A 1 14  ? -8.256  6.566   5.066   1.00 0.00 ? 14  ILE A O    1  
ATOM 180   C CB   . ILE A 1 14  ? -5.904  5.998   6.619   1.00 0.00 ? 14  ILE A CB   1  
ATOM 181   C CG1  . ILE A 1 14  ? -4.736  5.293   7.312   1.00 0.00 ? 14  ILE A CG1  1  
ATOM 182   C CG2  . ILE A 1 14  ? -6.422  7.127   7.513   1.00 0.00 ? 14  ILE A CG2  1  
ATOM 183   C CD1  . ILE A 1 14  ? -3.556  6.256   7.446   1.00 0.00 ? 14  ILE A CD1  1  
ATOM 184   H H    . ILE A 1 14  ? -6.035  4.291   4.601   1.00 0.00 ? 14  ILE A H    1  
ATOM 185   H HA   . ILE A 1 14  ? -7.235  4.446   7.293   1.00 0.00 ? 14  ILE A HA   1  
ATOM 186   H HB   . ILE A 1 14  ? -5.576  6.407   5.674   1.00 0.00 ? 14  ILE A HB   1  
ATOM 187   H HG12 . ILE A 1 14  ? -5.049  4.970   8.294   1.00 0.00 ? 14  ILE A HG12 1  
ATOM 188   H HG13 . ILE A 1 14  ? -4.438  4.434   6.731   1.00 0.00 ? 14  ILE A HG13 1  
ATOM 189   H HG21 . ILE A 1 14  ? -5.663  7.393   8.234   1.00 0.00 ? 14  ILE A HG21 1  
ATOM 190   H HG22 . ILE A 1 14  ? -7.309  6.795   8.030   1.00 0.00 ? 14  ILE A HG22 1  
ATOM 191   H HG23 . ILE A 1 14  ? -6.661  7.987   6.906   1.00 0.00 ? 14  ILE A HG23 1  
ATOM 192   H HD11 . ILE A 1 14  ? -3.711  6.894   8.304   1.00 0.00 ? 14  ILE A HD11 1  
ATOM 193   H HD12 . ILE A 1 14  ? -3.481  6.861   6.554   1.00 0.00 ? 14  ILE A HD12 1  
ATOM 194   H HD13 . ILE A 1 14  ? -2.644  5.690   7.577   1.00 0.00 ? 14  ILE A HD13 1  
ATOM 195   N N    . ILE A 1 15  ? -9.403  5.233   6.376   1.00 0.00 ? 15  ILE A N    1  
ATOM 196   C CA   . ILE A 1 15  ? -10.700 5.792   5.924   1.00 0.00 ? 15  ILE A CA   1  
ATOM 197   C C    . ILE A 1 15  ? -11.094 6.983   6.783   1.00 0.00 ? 15  ILE A C    1  
ATOM 198   O O    . ILE A 1 15  ? -10.943 6.971   7.986   1.00 0.00 ? 15  ILE A O    1  
ATOM 199   C CB   . ILE A 1 15  ? -11.725 4.676   6.054   1.00 0.00 ? 15  ILE A CB   1  
ATOM 200   C CG1  . ILE A 1 15  ? -11.327 3.538   5.112   1.00 0.00 ? 15  ILE A CG1  1  
ATOM 201   C CG2  . ILE A 1 15  ? -13.123 5.174   5.703   1.00 0.00 ? 15  ILE A CG2  1  
ATOM 202   C CD1  . ILE A 1 15  ? -12.076 2.264   5.492   1.00 0.00 ? 15  ILE A CD1  1  
ATOM 203   H H    . ILE A 1 15  ? -9.393  4.487   7.011   1.00 0.00 ? 15  ILE A H    1  
ATOM 204   H HA   . ILE A 1 15  ? -10.627 6.095   4.891   1.00 0.00 ? 15  ILE A HA   1  
ATOM 205   H HB   . ILE A 1 15  ? -11.720 4.316   7.067   1.00 0.00 ? 15  ILE A HB   1  
ATOM 206   H HG12 . ILE A 1 15  ? -11.571 3.811   4.096   1.00 0.00 ? 15  ILE A HG12 1  
ATOM 207   H HG13 . ILE A 1 15  ? -10.264 3.366   5.192   1.00 0.00 ? 15  ILE A HG13 1  
ATOM 208   H HG21 . ILE A 1 15  ? -13.850 4.569   6.224   1.00 0.00 ? 15  ILE A HG21 1  
ATOM 209   H HG22 . ILE A 1 15  ? -13.276 5.089   4.640   1.00 0.00 ? 15  ILE A HG22 1  
ATOM 210   H HG23 . ILE A 1 15  ? -13.231 6.205   6.006   1.00 0.00 ? 15  ILE A HG23 1  
ATOM 211   H HD11 . ILE A 1 15  ? -12.673 1.936   4.656   1.00 0.00 ? 15  ILE A HD11 1  
ATOM 212   H HD12 . ILE A 1 15  ? -12.717 2.461   6.340   1.00 0.00 ? 15  ILE A HD12 1  
ATOM 213   H HD13 . ILE A 1 15  ? -11.362 1.496   5.749   1.00 0.00 ? 15  ILE A HD13 1  
ATOM 214   N N    . PHE A 1 16  ? -11.599 8.016   6.165   1.00 0.00 ? 16  PHE A N    1  
ATOM 215   C CA   . PHE A 1 16  ? -12.003 9.211   6.942   1.00 0.00 ? 16  PHE A CA   1  
ATOM 216   C C    . PHE A 1 16  ? -13.335 9.750   6.417   1.00 0.00 ? 16  PHE A C    1  
ATOM 217   O O    . PHE A 1 16  ? -13.473 10.058  5.252   1.00 0.00 ? 16  PHE A O    1  
ATOM 218   C CB   . PHE A 1 16  ? -10.930 10.287  6.792   1.00 0.00 ? 16  PHE A CB   1  
ATOM 219   C CG   . PHE A 1 16  ? -10.925 10.797  5.372   1.00 0.00 ? 16  PHE A CG   1  
ATOM 220   C CD1  . PHE A 1 16  ? -10.174 10.136  4.392   1.00 0.00 ? 16  PHE A CD1  1  
ATOM 221   C CD2  . PHE A 1 16  ? -11.672 11.932  5.037   1.00 0.00 ? 16  PHE A CD2  1  
ATOM 222   C CE1  . PHE A 1 16  ? -10.170 10.609  3.077   1.00 0.00 ? 16  PHE A CE1  1  
ATOM 223   C CE2  . PHE A 1 16  ? -11.670 12.406  3.719   1.00 0.00 ? 16  PHE A CE2  1  
ATOM 224   C CZ   . PHE A 1 16  ? -10.918 11.746  2.739   1.00 0.00 ? 16  PHE A CZ   1  
ATOM 225   H H    . PHE A 1 16  ? -11.708 8.001   5.191   1.00 0.00 ? 16  PHE A H    1  
ATOM 226   H HA   . PHE A 1 16  ? -12.102 8.947   7.976   1.00 0.00 ? 16  PHE A HA   1  
ATOM 227   H HB2  . PHE A 1 16  ? -11.138 11.102  7.468   1.00 0.00 ? 16  PHE A HB2  1  
ATOM 228   H HB3  . PHE A 1 16  ? -9.965  9.864   7.022   1.00 0.00 ? 16  PHE A HB3  1  
ATOM 229   H HD1  . PHE A 1 16  ? -9.598  9.260   4.653   1.00 0.00 ? 16  PHE A HD1  1  
ATOM 230   H HD2  . PHE A 1 16  ? -12.252 12.441  5.792   1.00 0.00 ? 16  PHE A HD2  1  
ATOM 231   H HE1  . PHE A 1 16  ? -9.586  10.102  2.321   1.00 0.00 ? 16  PHE A HE1  1  
ATOM 232   H HE2  . PHE A 1 16  ? -12.248 13.281  3.459   1.00 0.00 ? 16  PHE A HE2  1  
ATOM 233   H HZ   . PHE A 1 16  ? -10.914 12.113  1.725   1.00 0.00 ? 16  PHE A HZ   1  
ATOM 234   N N    . ARG A 1 17  ? -14.313 9.886   7.274   1.00 0.00 ? 17  ARG A N    1  
ATOM 235   C CA   . ARG A 1 17  ? -15.624 10.425  6.819   1.00 0.00 ? 17  ARG A CA   1  
ATOM 236   C C    . ARG A 1 17  ? -15.608 11.943  6.962   1.00 0.00 ? 17  ARG A C    1  
ATOM 237   O O    . ARG A 1 17  ? -15.543 12.473  8.053   1.00 0.00 ? 17  ARG A O    1  
ATOM 238   C CB   . ARG A 1 17  ? -16.750 9.844   7.674   1.00 0.00 ? 17  ARG A CB   1  
ATOM 239   C CG   . ARG A 1 17  ? -16.909 8.363   7.345   1.00 0.00 ? 17  ARG A CG   1  
ATOM 240   C CD   . ARG A 1 17  ? -18.104 7.786   8.108   1.00 0.00 ? 17  ARG A CD   1  
ATOM 241   N NE   . ARG A 1 17  ? -17.946 8.057   9.564   1.00 0.00 ? 17  ARG A NE   1  
ATOM 242   C CZ   . ARG A 1 17  ? -18.991 8.047   10.348  1.00 0.00 ? 17  ARG A CZ   1  
ATOM 243   N NH1  . ARG A 1 17  ? -20.173 7.787   9.857   1.00 0.00 ? 17  ARG A NH1  1  
ATOM 244   N NH2  . ARG A 1 17  ? -18.855 8.294   11.622  1.00 0.00 ? 17  ARG A NH2  1  
ATOM 245   H H    . ARG A 1 17  ? -14.181 9.645   8.213   1.00 0.00 ? 17  ARG A H    1  
ATOM 246   H HA   . ARG A 1 17  ? -15.783 10.156  5.785   1.00 0.00 ? 17  ARG A HA   1  
ATOM 247   H HB2  . ARG A 1 17  ? -16.507 9.959   8.721   1.00 0.00 ? 17  ARG A HB2  1  
ATOM 248   H HB3  . ARG A 1 17  ? -17.672 10.359  7.456   1.00 0.00 ? 17  ARG A HB3  1  
ATOM 249   H HG2  . ARG A 1 17  ? -17.073 8.257   6.286   1.00 0.00 ? 17  ARG A HG2  1  
ATOM 250   H HG3  . ARG A 1 17  ? -16.015 7.835   7.622   1.00 0.00 ? 17  ARG A HG3  1  
ATOM 251   H HD2  . ARG A 1 17  ? -19.012 8.247   7.754   1.00 0.00 ? 17  ARG A HD2  1  
ATOM 252   H HD3  . ARG A 1 17  ? -18.155 6.720   7.943   1.00 0.00 ? 17  ARG A HD3  1  
ATOM 253   H HE   . ARG A 1 17  ? -17.059 8.247   9.934   1.00 0.00 ? 17  ARG A HE   1  
ATOM 254   H HH11 . ARG A 1 17  ? -20.279 7.594   8.881   1.00 0.00 ? 17  ARG A HH11 1  
ATOM 255   H HH12 . ARG A 1 17  ? -20.973 7.779   10.457  1.00 0.00 ? 17  ARG A HH12 1  
ATOM 256   H HH21 . ARG A 1 17  ? -17.950 8.490   11.999  1.00 0.00 ? 17  ARG A HH21 1  
ATOM 257   H HH22 . ARG A 1 17  ? -19.655 8.285   12.222  1.00 0.00 ? 17  ARG A HH22 1  
ATOM 258   N N    . ARG A 1 18  ? -15.661 12.652  5.870   1.00 0.00 ? 18  ARG A N    1  
ATOM 259   C CA   . ARG A 1 18  ? -15.638 14.135  5.955   1.00 0.00 ? 18  ARG A CA   1  
ATOM 260   C C    . ARG A 1 18  ? -17.056 14.660  6.185   1.00 0.00 ? 18  ARG A C    1  
ATOM 261   O O    . ARG A 1 18  ? -18.019 14.130  5.665   1.00 0.00 ? 18  ARG A O    1  
ATOM 262   C CB   . ARG A 1 18  ? -15.076 14.713  4.656   1.00 0.00 ? 18  ARG A CB   1  
ATOM 263   C CG   . ARG A 1 18  ? -14.800 16.206  4.845   1.00 0.00 ? 18  ARG A CG   1  
ATOM 264   C CD   . ARG A 1 18  ? -14.326 16.806  3.522   1.00 0.00 ? 18  ARG A CD   1  
ATOM 265   N NE   . ARG A 1 18  ? -13.117 16.072  3.048   1.00 0.00 ? 18  ARG A NE   1  
ATOM 266   C CZ   . ARG A 1 18  ? -11.927 16.594  3.191   1.00 0.00 ? 18  ARG A CZ   1  
ATOM 267   N NH1  . ARG A 1 18  ? -11.778 17.749  3.781   1.00 0.00 ? 18  ARG A NH1  1  
ATOM 268   N NH2  . ARG A 1 18  ? -10.881 15.950  2.751   1.00 0.00 ? 18  ARG A NH2  1  
ATOM 269   H H    . ARG A 1 18  ? -15.707 12.208  4.997   1.00 0.00 ? 18  ARG A H    1  
ATOM 270   H HA   . ARG A 1 18  ? -15.010 14.435  6.780   1.00 0.00 ? 18  ARG A HA   1  
ATOM 271   H HB2  . ARG A 1 18  ? -14.157 14.204  4.405   1.00 0.00 ? 18  ARG A HB2  1  
ATOM 272   H HB3  . ARG A 1 18  ? -15.792 14.578  3.860   1.00 0.00 ? 18  ARG A HB3  1  
ATOM 273   H HG2  . ARG A 1 18  ? -15.706 16.702  5.162   1.00 0.00 ? 18  ARG A HG2  1  
ATOM 274   H HG3  . ARG A 1 18  ? -14.034 16.339  5.593   1.00 0.00 ? 18  ARG A HG3  1  
ATOM 275   H HD2  . ARG A 1 18  ? -15.112 16.720  2.786   1.00 0.00 ? 18  ARG A HD2  1  
ATOM 276   H HD3  . ARG A 1 18  ? -14.083 17.846  3.666   1.00 0.00 ? 18  ARG A HD3  1  
ATOM 277   H HE   . ARG A 1 18  ? -13.218 15.198  2.619   1.00 0.00 ? 18  ARG A HE   1  
ATOM 278   H HH11 . ARG A 1 18  ? -12.578 18.242  4.125   1.00 0.00 ? 18  ARG A HH11 1  
ATOM 279   H HH12 . ARG A 1 18  ? -10.866 18.141  3.887   1.00 0.00 ? 18  ARG A HH12 1  
ATOM 280   H HH21 . ARG A 1 18  ? -10.990 15.061  2.305   1.00 0.00 ? 18  ARG A HH21 1  
ATOM 281   H HH22 . ARG A 1 18  ? -9.969  16.348  2.856   1.00 0.00 ? 18  ARG A HH22 1  
ATOM 282   N N    . CYS A 1 19  ? -17.191 15.698  6.965   1.00 0.00 ? 19  CYS A N    1  
ATOM 283   C CA   . CYS A 1 19  ? -18.546 16.257  7.234   1.00 0.00 ? 19  CYS A CA   1  
ATOM 284   C C    . CYS A 1 19  ? -18.852 17.357  6.217   1.00 0.00 ? 19  CYS A C    1  
ATOM 285   O O    . CYS A 1 19  ? -17.967 18.009  5.702   1.00 0.00 ? 19  CYS A O    1  
ATOM 286   C CB   . CYS A 1 19  ? -18.590 16.840  8.646   1.00 0.00 ? 19  CYS A CB   1  
ATOM 287   S SG   . CYS A 1 19  ? -20.218 16.522  9.376   1.00 0.00 ? 19  CYS A SG   1  
ATOM 288   H H    . CYS A 1 19  ? -16.404 16.109  7.376   1.00 0.00 ? 19  CYS A H    1  
ATOM 289   H HA   . CYS A 1 19  ? -19.282 15.473  7.143   1.00 0.00 ? 19  CYS A HA   1  
ATOM 290   H HB2  . CYS A 1 19  ? -17.828 16.377  9.253   1.00 0.00 ? 19  CYS A HB2  1  
ATOM 291   H HB3  . CYS A 1 19  ? -18.418 17.907  8.602   1.00 0.00 ? 19  CYS A HB3  1  
ATOM 292   H HG   . CYS A 1 19  ? -20.095 15.939  10.130  1.00 0.00 ? 19  CYS A HG   1  
ATOM 293   N N    . LEU A 1 20  ? -20.107 17.562  5.919   1.00 0.00 ? 20  LEU A N    1  
ATOM 294   C CA   . LEU A 1 20  ? -20.478 18.612  4.929   1.00 0.00 ? 20  LEU A CA   1  
ATOM 295   C C    . LEU A 1 20  ? -19.920 19.960  5.380   1.00 0.00 ? 20  LEU A C    1  
ATOM 296   O O    . LEU A 1 20  ? -19.429 20.737  4.586   1.00 0.00 ? 20  LEU A O    1  
ATOM 297   C CB   . LEU A 1 20  ? -22.002 18.701  4.844   1.00 0.00 ? 20  LEU A CB   1  
ATOM 298   C CG   . LEU A 1 20  ? -22.582 17.303  4.634   1.00 0.00 ? 20  LEU A CG   1  
ATOM 299   C CD1  . LEU A 1 20  ? -24.100 17.401  4.469   1.00 0.00 ? 20  LEU A CD1  1  
ATOM 300   C CD2  . LEU A 1 20  ? -21.975 16.676  3.378   1.00 0.00 ? 20  LEU A CD2  1  
ATOM 301   H H    . LEU A 1 20  ? -20.805 17.019  6.343   1.00 0.00 ? 20  LEU A H    1  
ATOM 302   H HA   . LEU A 1 20  ? -20.076 18.357  3.960   1.00 0.00 ? 20  LEU A HA   1  
ATOM 303   H HB2  . LEU A 1 20  ? -22.390 19.121  5.761   1.00 0.00 ? 20  LEU A HB2  1  
ATOM 304   H HB3  . LEU A 1 20  ? -22.280 19.331  4.013   1.00 0.00 ? 20  LEU A HB3  1  
ATOM 305   H HG   . LEU A 1 20  ? -22.352 16.689  5.495   1.00 0.00 ? 20  LEU A HG   1  
ATOM 306   H HD11 . LEU A 1 20  ? -24.344 18.300  3.922   1.00 0.00 ? 20  LEU A HD11 1  
ATOM 307   H HD12 . LEU A 1 20  ? -24.567 17.431  5.442   1.00 0.00 ? 20  LEU A HD12 1  
ATOM 308   H HD13 . LEU A 1 20  ? -24.457 16.540  3.923   1.00 0.00 ? 20  LEU A HD13 1  
ATOM 309   H HD21 . LEU A 1 20  ? -22.603 15.863  3.043   1.00 0.00 ? 20  LEU A HD21 1  
ATOM 310   H HD22 . LEU A 1 20  ? -20.989 16.299  3.603   1.00 0.00 ? 20  LEU A HD22 1  
ATOM 311   H HD23 . LEU A 1 20  ? -21.906 17.422  2.600   1.00 0.00 ? 20  LEU A HD23 1  
ATOM 312   N N    . ILE A 1 21  ? -19.990 20.249  6.652   1.00 0.00 ? 21  ILE A N    1  
ATOM 313   C CA   . ILE A 1 21  ? -19.460 21.554  7.142   1.00 0.00 ? 21  ILE A CA   1  
ATOM 314   C C    . ILE A 1 21  ? -18.785 21.363  8.506   1.00 0.00 ? 21  ILE A C    1  
ATOM 315   O O    . ILE A 1 21  ? -19.054 20.411  9.210   1.00 0.00 ? 21  ILE A O    1  
ATOM 316   C CB   . ILE A 1 21  ? -20.613 22.550  7.280   1.00 0.00 ? 21  ILE A CB   1  
ATOM 317   C CG1  . ILE A 1 21  ? -21.844 21.832  7.836   1.00 0.00 ? 21  ILE A CG1  1  
ATOM 318   C CG2  . ILE A 1 21  ? -20.944 23.140  5.909   1.00 0.00 ? 21  ILE A CG2  1  
ATOM 319   C CD1  . ILE A 1 21  ? -22.588 22.759  8.800   1.00 0.00 ? 21  ILE A CD1  1  
ATOM 320   H H    . ILE A 1 21  ? -20.391 19.610  7.279   1.00 0.00 ? 21  ILE A H    1  
ATOM 321   H HA   . ILE A 1 21  ? -18.745 21.932  6.431   1.00 0.00 ? 21  ILE A HA   1  
ATOM 322   H HB   . ILE A 1 21  ? -20.322 23.345  7.952   1.00 0.00 ? 21  ILE A HB   1  
ATOM 323   H HG12 . ILE A 1 21  ? -22.500 21.559  7.022   1.00 0.00 ? 21  ILE A HG12 1  
ATOM 324   H HG13 . ILE A 1 21  ? -21.536 20.942  8.363   1.00 0.00 ? 21  ILE A HG13 1  
ATOM 325   H HG21 . ILE A 1 21  ? -21.321 22.360  5.263   1.00 0.00 ? 21  ILE A HG21 1  
ATOM 326   H HG22 . ILE A 1 21  ? -20.053 23.567  5.474   1.00 0.00 ? 21  ILE A HG22 1  
ATOM 327   H HG23 . ILE A 1 21  ? -21.695 23.910  6.018   1.00 0.00 ? 21  ILE A HG23 1  
ATOM 328   H HD11 . ILE A 1 21  ? -21.992 22.908  9.689   1.00 0.00 ? 21  ILE A HD11 1  
ATOM 329   H HD12 . ILE A 1 21  ? -23.534 22.313  9.071   1.00 0.00 ? 21  ILE A HD12 1  
ATOM 330   H HD13 . ILE A 1 21  ? -22.762 23.711  8.321   1.00 0.00 ? 21  ILE A HD13 1  
ATOM 331   N N    . PRO A 1 22  ? -17.912 22.269  8.879   1.00 0.00 ? 22  PRO A N    1  
ATOM 332   C CA   . PRO A 1 22  ? -17.190 22.203  10.186  1.00 0.00 ? 22  PRO A CA   1  
ATOM 333   C C    . PRO A 1 22  ? -18.135 22.318  11.384  1.00 0.00 ? 22  PRO A C    1  
ATOM 334   O O    . PRO A 1 22  ? -19.195 22.907  11.301  1.00 0.00 ? 22  PRO A O    1  
ATOM 335   C CB   . PRO A 1 22  ? -16.232 23.401  10.161  1.00 0.00 ? 22  PRO A CB   1  
ATOM 336   C CG   . PRO A 1 22  ? -16.198 23.875  8.746   1.00 0.00 ? 22  PRO A CG   1  
ATOM 337   C CD   . PRO A 1 22  ? -17.515 23.453  8.104   1.00 0.00 ? 22  PRO A CD   1  
ATOM 338   H HA   . PRO A 1 22  ? -16.621 21.291  10.249  1.00 0.00 ? 22  PRO A HA   1  
ATOM 339   H HB2  . PRO A 1 22  ? -16.602 24.183  10.810  1.00 0.00 ? 22  PRO A HB2  1  
ATOM 340   H HB3  . PRO A 1 22  ? -15.246 23.094  10.471  1.00 0.00 ? 22  PRO A HB3  1  
ATOM 341   H HG2  . PRO A 1 22  ? -16.098 24.952  8.721   1.00 0.00 ? 22  PRO A HG2  1  
ATOM 342   H HG3  . PRO A 1 22  ? -15.375 23.415  8.221   1.00 0.00 ? 22  PRO A HG3  1  
ATOM 343   H HD2  . PRO A 1 22  ? -18.251 24.239  8.199   1.00 0.00 ? 22  PRO A HD2  1  
ATOM 344   H HD3  . PRO A 1 22  ? -17.363 23.193  7.070   1.00 0.00 ? 22  PRO A HD3  1  
ATOM 345   N N    . LYS A 1 23  ? -17.749 21.772  12.504  1.00 0.00 ? 23  LYS A N    1  
ATOM 346   C CA   . LYS A 1 23  ? -18.611 21.856  13.716  1.00 0.00 ? 23  LYS A CA   1  
ATOM 347   C C    . LYS A 1 23  ? -17.782 22.413  14.872  1.00 0.00 ? 23  LYS A C    1  
ATOM 348   O O    . LYS A 1 23  ? -17.837 23.586  15.186  1.00 0.00 ? 23  LYS A O    1  
ATOM 349   C CB   . LYS A 1 23  ? -19.124 20.459  14.077  1.00 0.00 ? 23  LYS A CB   1  
ATOM 350   C CG   . LYS A 1 23  ? -20.651 20.479  14.155  1.00 0.00 ? 23  LYS A CG   1  
ATOM 351   C CD   . LYS A 1 23  ? -21.234 20.508  12.741  1.00 0.00 ? 23  LYS A CD   1  
ATOM 352   C CE   . LYS A 1 23  ? -22.303 21.598  12.652  1.00 0.00 ? 23  LYS A CE   1  
ATOM 353   N NZ   . LYS A 1 23  ? -23.288 21.417  13.756  1.00 0.00 ? 23  LYS A NZ   1  
ATOM 354   H H    . LYS A 1 23  ? -16.885 21.311  12.549  1.00 0.00 ? 23  LYS A H    1  
ATOM 355   H HA   . LYS A 1 23  ? -19.447 22.511  13.522  1.00 0.00 ? 23  LYS A HA   1  
ATOM 356   H HB2  . LYS A 1 23  ? -18.808 19.755  13.321  1.00 0.00 ? 23  LYS A HB2  1  
ATOM 357   H HB3  . LYS A 1 23  ? -18.722 20.162  15.033  1.00 0.00 ? 23  LYS A HB3  1  
ATOM 358   H HG2  . LYS A 1 23  ? -20.996 19.594  14.669  1.00 0.00 ? 23  LYS A HG2  1  
ATOM 359   H HG3  . LYS A 1 23  ? -20.975 21.358  14.692  1.00 0.00 ? 23  LYS A HG3  1  
ATOM 360   H HD2  . LYS A 1 23  ? -20.448 20.715  12.030  1.00 0.00 ? 23  LYS A HD2  1  
ATOM 361   H HD3  . LYS A 1 23  ? -21.680 19.550  12.517  1.00 0.00 ? 23  LYS A HD3  1  
ATOM 362   H HE2  . LYS A 1 23  ? -21.835 22.567  12.742  1.00 0.00 ? 23  LYS A HE2  1  
ATOM 363   H HE3  . LYS A 1 23  ? -22.811 21.529  11.702  1.00 0.00 ? 23  LYS A HE3  1  
ATOM 364   H HZ1  . LYS A 1 23  ? -23.887 22.264  13.828  1.00 0.00 ? 23  LYS A HZ1  1  
ATOM 365   H HZ2  . LYS A 1 23  ? -22.780 21.273  14.654  1.00 0.00 ? 23  LYS A HZ2  1  
ATOM 366   H HZ3  . LYS A 1 23  ? -23.884 20.589  13.557  1.00 0.00 ? 23  LYS A HZ3  1  
ATOM 367   N N    . VAL A 1 24  ? -16.999 21.579  15.495  1.00 0.00 ? 24  VAL A N    1  
ATOM 368   C CA   . VAL A 1 24  ? -16.148 22.048  16.621  1.00 0.00 ? 24  VAL A CA   1  
ATOM 369   C C    . VAL A 1 24  ? -14.718 22.236  16.109  1.00 0.00 ? 24  VAL A C    1  
ATOM 370   O O    . VAL A 1 24  ? -13.788 22.406  16.873  1.00 0.00 ? 24  VAL A O    1  
ATOM 371   C CB   . VAL A 1 24  ? -16.158 21.003  17.736  1.00 0.00 ? 24  VAL A CB   1  
ATOM 372   C CG1  . VAL A 1 24  ? -16.361 21.693  19.085  1.00 0.00 ? 24  VAL A CG1  1  
ATOM 373   C CG2  . VAL A 1 24  ? -17.301 20.015  17.494  1.00 0.00 ? 24  VAL A CG2  1  
ATOM 374   H H    . VAL A 1 24  ? -16.966 20.643  15.214  1.00 0.00 ? 24  VAL A H    1  
ATOM 375   H HA   . VAL A 1 24  ? -16.524 22.987  16.998  1.00 0.00 ? 24  VAL A HA   1  
ATOM 376   H HB   . VAL A 1 24  ? -15.216 20.472  17.742  1.00 0.00 ? 24  VAL A HB   1  
ATOM 377   H HG11 . VAL A 1 24  ? -16.382 20.950  19.870  1.00 0.00 ? 24  VAL A HG11 1  
ATOM 378   H HG12 . VAL A 1 24  ? -17.296 22.233  19.076  1.00 0.00 ? 24  VAL A HG12 1  
ATOM 379   H HG13 . VAL A 1 24  ? -15.548 22.381  19.263  1.00 0.00 ? 24  VAL A HG13 1  
ATOM 380   H HG21 . VAL A 1 24  ? -17.113 19.463  16.586  1.00 0.00 ? 24  VAL A HG21 1  
ATOM 381   H HG22 . VAL A 1 24  ? -18.231 20.557  17.400  1.00 0.00 ? 24  VAL A HG22 1  
ATOM 382   H HG23 . VAL A 1 24  ? -17.367 19.330  18.326  1.00 0.00 ? 24  VAL A HG23 1  
ATOM 383   N N    . ASP A 1 25  ? -14.539 22.188  14.815  1.00 0.00 ? 25  ASP A N    1  
ATOM 384   C CA   . ASP A 1 25  ? -13.172 22.346  14.235  1.00 0.00 ? 25  ASP A CA   1  
ATOM 385   C C    . ASP A 1 25  ? -12.279 21.215  14.748  1.00 0.00 ? 25  ASP A C    1  
ATOM 386   O O    . ASP A 1 25  ? -11.125 21.417  15.071  1.00 0.00 ? 25  ASP A O    1  
ATOM 387   C CB   . ASP A 1 25  ? -12.584 23.697  14.649  1.00 0.00 ? 25  ASP A CB   1  
ATOM 388   C CG   . ASP A 1 25  ? -11.287 23.947  13.876  1.00 0.00 ? 25  ASP A CG   1  
ATOM 389   O OD1  . ASP A 1 25  ? -10.998 23.177  12.976  1.00 0.00 ? 25  ASP A OD1  1  
ATOM 390   O OD2  . ASP A 1 25  ? -10.604 24.906  14.198  1.00 0.00 ? 25  ASP A OD2  1  
ATOM 391   H H    . ASP A 1 25  ? -15.305 22.036  14.222  1.00 0.00 ? 25  ASP A H    1  
ATOM 392   H HA   . ASP A 1 25  ? -13.233 22.294  13.158  1.00 0.00 ? 25  ASP A HA   1  
ATOM 393   H HB2  . ASP A 1 25  ? -13.294 24.480  14.427  1.00 0.00 ? 25  ASP A HB2  1  
ATOM 394   H HB3  . ASP A 1 25  ? -12.372 23.690  15.707  1.00 0.00 ? 25  ASP A HB3  1  
ATOM 395   H HD2  . ASP A 1 25  ? -9.807  25.001  13.672  1.00 0.00 ? 25  ASP A HD2  1  
ATOM 396   N N    . ASN A 1 26  ? -12.810 20.030  14.825  1.00 0.00 ? 26  ASN A N    1  
ATOM 397   C CA   . ASN A 1 26  ? -12.007 18.874  15.314  1.00 0.00 ? 26  ASN A CA   1  
ATOM 398   C C    . ASN A 1 26  ? -12.693 17.583  14.884  1.00 0.00 ? 26  ASN A C    1  
ATOM 399   O O    . ASN A 1 26  ? -12.095 16.706  14.293  1.00 0.00 ? 26  ASN A O    1  
ATOM 400   C CB   . ASN A 1 26  ? -11.935 18.922  16.839  1.00 0.00 ? 26  ASN A CB   1  
ATOM 401   C CG   . ASN A 1 26  ? -10.753 18.078  17.321  1.00 0.00 ? 26  ASN A CG   1  
ATOM 402   O OD1  . ASN A 1 26  ? -9.625  18.312  16.933  1.00 0.00 ? 26  ASN A OD1  1  
ATOM 403   N ND2  . ASN A 1 26  ? -10.965 17.099  18.157  1.00 0.00 ? 26  ASN A ND2  1  
ATOM 404   H H    . ASN A 1 26  ? -13.745 19.895  14.559  1.00 0.00 ? 26  ASN A H    1  
ATOM 405   H HA   . ASN A 1 26  ? -11.016 18.915  14.900  1.00 0.00 ? 26  ASN A HA   1  
ATOM 406   H HB2  . ASN A 1 26  ? -11.808 19.944  17.160  1.00 0.00 ? 26  ASN A HB2  1  
ATOM 407   H HB3  . ASN A 1 26  ? -12.849 18.526  17.255  1.00 0.00 ? 26  ASN A HB3  1  
ATOM 408   H HD21 . ASN A 1 26  ? -11.873 16.909  18.470  1.00 0.00 ? 26  ASN A HD21 1  
ATOM 409   H HD22 . ASN A 1 26  ? -10.215 16.550  18.472  1.00 0.00 ? 26  ASN A HD22 1  
ATOM 410   N N    . ASN A 1 27  ? -13.953 17.473  15.180  1.00 0.00 ? 27  ASN A N    1  
ATOM 411   C CA   . ASN A 1 27  ? -14.717 16.252  14.797  1.00 0.00 ? 27  ASN A CA   1  
ATOM 412   C C    . ASN A 1 27  ? -15.203 16.390  13.355  1.00 0.00 ? 27  ASN A C    1  
ATOM 413   O O    . ASN A 1 27  ? -15.994 15.601  12.877  1.00 0.00 ? 27  ASN A O    1  
ATOM 414   C CB   . ASN A 1 27  ? -15.918 16.093  15.730  1.00 0.00 ? 27  ASN A CB   1  
ATOM 415   C CG   . ASN A 1 27  ? -15.429 15.995  17.177  1.00 0.00 ? 27  ASN A CG   1  
ATOM 416   O OD1  . ASN A 1 27  ? -14.481 15.289  17.465  1.00 0.00 ? 27  ASN A OD1  1  
ATOM 417   N ND2  . ASN A 1 27  ? -16.031 16.684  18.106  1.00 0.00 ? 27  ASN A ND2  1  
ATOM 418   H H    . ASN A 1 27  ? -14.401 18.204  15.655  1.00 0.00 ? 27  ASN A H    1  
ATOM 419   H HA   . ASN A 1 27  ? -14.077 15.385  14.881  1.00 0.00 ? 27  ASN A HA   1  
ATOM 420   H HB2  . ASN A 1 27  ? -16.571 16.946  15.626  1.00 0.00 ? 27  ASN A HB2  1  
ATOM 421   H HB3  . ASN A 1 27  ? -16.456 15.192  15.474  1.00 0.00 ? 27  ASN A HB3  1  
ATOM 422   H HD21 . ASN A 1 27  ? -16.794 17.257  17.874  1.00 0.00 ? 27  ASN A HD21 1  
ATOM 423   H HD22 . ASN A 1 27  ? -15.723 16.630  19.035  1.00 0.00 ? 27  ASN A HD22 1  
ATOM 424   N N    . ALA A 1 28  ? -14.740 17.391  12.659  1.00 0.00 ? 28  ALA A N    1  
ATOM 425   C CA   . ALA A 1 28  ? -15.178 17.581  11.247  1.00 0.00 ? 28  ALA A CA   1  
ATOM 426   C C    . ALA A 1 28  ? -14.894 16.305  10.457  1.00 0.00 ? 28  ALA A C    1  
ATOM 427   O O    . ALA A 1 28  ? -15.653 15.917  9.590   1.00 0.00 ? 28  ALA A O    1  
ATOM 428   C CB   . ALA A 1 28  ? -14.397 18.742  10.626  1.00 0.00 ? 28  ALA A CB   1  
ATOM 429   H H    . ALA A 1 28  ? -14.106 18.019  13.063  1.00 0.00 ? 28  ALA A H    1  
ATOM 430   H HA   . ALA A 1 28  ? -16.235 17.800  11.220  1.00 0.00 ? 28  ALA A HA   1  
ATOM 431   H HB1  . ALA A 1 28  ? -13.565 18.351  10.059  1.00 0.00 ? 28  ALA A HB1  1  
ATOM 432   H HB2  . ALA A 1 28  ? -14.027 19.388  11.409  1.00 0.00 ? 28  ALA A HB2  1  
ATOM 433   H HB3  . ALA A 1 28  ? -15.046 19.305  9.972   1.00 0.00 ? 28  ALA A HB3  1  
ATOM 434   N N    . ILE A 1 29  ? -13.806 15.647  10.745  1.00 0.00 ? 29  ILE A N    1  
ATOM 435   C CA   . ILE A 1 29  ? -13.472 14.397  10.012  1.00 0.00 ? 29  ILE A CA   1  
ATOM 436   C C    . ILE A 1 29  ? -13.389 13.224  10.987  1.00 0.00 ? 29  ILE A C    1  
ATOM 437   O O    . ILE A 1 29  ? -12.858 13.337  12.074  1.00 0.00 ? 29  ILE A O    1  
ATOM 438   C CB   . ILE A 1 29  ? -12.141 14.571  9.286   1.00 0.00 ? 29  ILE A CB   1  
ATOM 439   C CG1  . ILE A 1 29  ? -12.331 15.558  8.135   1.00 0.00 ? 29  ILE A CG1  1  
ATOM 440   C CG2  . ILE A 1 29  ? -11.676 13.223  8.737   1.00 0.00 ? 29  ILE A CG2  1  
ATOM 441   C CD1  . ILE A 1 29  ? -11.008 16.261  7.830   1.00 0.00 ? 29  ILE A CD1  1  
ATOM 442   H H    . ILE A 1 29  ? -13.206 15.977  11.447  1.00 0.00 ? 29  ILE A H    1  
ATOM 443   H HA   . ILE A 1 29  ? -14.246 14.197  9.285   1.00 0.00 ? 29  ILE A HA   1  
ATOM 444   H HB   . ILE A 1 29  ? -11.402 14.956  9.974   1.00 0.00 ? 29  ILE A HB   1  
ATOM 445   H HG12 . ILE A 1 29  ? -12.666 15.020  7.257   1.00 0.00 ? 29  ILE A HG12 1  
ATOM 446   H HG13 . ILE A 1 29  ? -13.073 16.288  8.412   1.00 0.00 ? 29  ILE A HG13 1  
ATOM 447   H HG21 . ILE A 1 29  ? -12.515 12.547  8.686   1.00 0.00 ? 29  ILE A HG21 1  
ATOM 448   H HG22 . ILE A 1 29  ? -10.921 12.811  9.389   1.00 0.00 ? 29  ILE A HG22 1  
ATOM 449   H HG23 . ILE A 1 29  ? -11.264 13.362  7.748   1.00 0.00 ? 29  ILE A HG23 1  
ATOM 450   H HD11 . ILE A 1 29  ? -10.672 16.793  8.706   1.00 0.00 ? 29  ILE A HD11 1  
ATOM 451   H HD12 . ILE A 1 29  ? -11.151 16.959  7.018   1.00 0.00 ? 29  ILE A HD12 1  
ATOM 452   H HD13 . ILE A 1 29  ? -10.269 15.526  7.546   1.00 0.00 ? 29  ILE A HD13 1  
ATOM 453   N N    . GLU A 1 30  ? -13.908 12.097  10.595  1.00 0.00 ? 30  GLU A N    1  
ATOM 454   C CA   . GLU A 1 30  ? -13.871 10.898  11.482  1.00 0.00 ? 30  GLU A CA   1  
ATOM 455   C C    . GLU A 1 30  ? -13.135 9.775   10.746  1.00 0.00 ? 30  GLU A C    1  
ATOM 456   O O    . GLU A 1 30  ? -13.080 9.768   9.537   1.00 0.00 ? 30  GLU A O    1  
ATOM 457   C CB   . GLU A 1 30  ? -15.303 10.455  11.790  1.00 0.00 ? 30  GLU A CB   1  
ATOM 458   C CG   . GLU A 1 30  ? -16.105 11.641  12.332  1.00 0.00 ? 30  GLU A CG   1  
ATOM 459   C CD   . GLU A 1 30  ? -15.485 12.126  13.644  1.00 0.00 ? 30  GLU A CD   1  
ATOM 460   O OE1  . GLU A 1 30  ? -15.794 13.235  14.049  1.00 0.00 ? 30  GLU A OE1  1  
ATOM 461   O OE2  . GLU A 1 30  ? -14.717 11.378  14.223  1.00 0.00 ? 30  GLU A OE2  1  
ATOM 462   H H    . GLU A 1 30  ? -14.328 12.039  9.710   1.00 0.00 ? 30  GLU A H    1  
ATOM 463   H HA   . GLU A 1 30  ? -13.354 11.135  12.401  1.00 0.00 ? 30  GLU A HA   1  
ATOM 464   H HB2  . GLU A 1 30  ? -15.767 10.090  10.885  1.00 0.00 ? 30  GLU A HB2  1  
ATOM 465   H HB3  . GLU A 1 30  ? -15.285 9.667   12.529  1.00 0.00 ? 30  GLU A HB3  1  
ATOM 466   H HG2  . GLU A 1 30  ? -16.088 12.445  11.610  1.00 0.00 ? 30  GLU A HG2  1  
ATOM 467   H HG3  . GLU A 1 30  ? -17.124 11.336  12.509  1.00 0.00 ? 30  GLU A HG3  1  
ATOM 468   H HE2  . GLU A 1 30  ? -14.368 11.746  15.039  1.00 0.00 ? 30  GLU A HE2  1  
ATOM 469   N N    . PHE A 1 31  ? -12.565 8.834   11.457  1.00 0.00 ? 31  PHE A N    1  
ATOM 470   C CA   . PHE A 1 31  ? -11.831 7.728   10.766  1.00 0.00 ? 31  PHE A CA   1  
ATOM 471   C C    . PHE A 1 31  ? -12.449 6.371   11.115  1.00 0.00 ? 31  PHE A C    1  
ATOM 472   O O    . PHE A 1 31  ? -13.020 6.189   12.172  1.00 0.00 ? 31  PHE A O    1  
ATOM 473   C CB   . PHE A 1 31  ? -10.359 7.726   11.201  1.00 0.00 ? 31  PHE A CB   1  
ATOM 474   C CG   . PHE A 1 31  ? -9.694  9.028   10.813  1.00 0.00 ? 31  PHE A CG   1  
ATOM 475   C CD1  . PHE A 1 31  ? -9.268  9.235   9.493   1.00 0.00 ? 31  PHE A CD1  1  
ATOM 476   C CD2  . PHE A 1 31  ? -9.496  10.025  11.776  1.00 0.00 ? 31  PHE A CD2  1  
ATOM 477   C CE1  . PHE A 1 31  ? -8.646  10.440  9.141   1.00 0.00 ? 31  PHE A CE1  1  
ATOM 478   C CE2  . PHE A 1 31  ? -8.873  11.228  11.421  1.00 0.00 ? 31  PHE A CE2  1  
ATOM 479   C CZ   . PHE A 1 31  ? -8.449  11.433  10.103  1.00 0.00 ? 31  PHE A CZ   1  
ATOM 480   H H    . PHE A 1 31  ? -12.614 8.857   12.435  1.00 0.00 ? 31  PHE A H    1  
ATOM 481   H HA   . PHE A 1 31  ? -11.884 7.875   9.702   1.00 0.00 ? 31  PHE A HA   1  
ATOM 482   H HB2  . PHE A 1 31  ? -10.304 7.603   12.273  1.00 0.00 ? 31  PHE A HB2  1  
ATOM 483   H HB3  . PHE A 1 31  ? -9.847  6.907   10.720  1.00 0.00 ? 31  PHE A HB3  1  
ATOM 484   H HD1  . PHE A 1 31  ? -9.421  8.468   8.748   1.00 0.00 ? 31  PHE A HD1  1  
ATOM 485   H HD2  . PHE A 1 31  ? -9.822  9.866   12.794  1.00 0.00 ? 31  PHE A HD2  1  
ATOM 486   H HE1  . PHE A 1 31  ? -8.314  10.602  8.127   1.00 0.00 ? 31  PHE A HE1  1  
ATOM 487   H HE2  . PHE A 1 31  ? -8.717  11.996  12.163  1.00 0.00 ? 31  PHE A HE2  1  
ATOM 488   H HZ   . PHE A 1 31  ? -7.970  12.359  9.830   1.00 0.00 ? 31  PHE A HZ   1  
ATOM 489   N N    . LEU A 1 32  ? -12.313 5.406   10.239  1.00 0.00 ? 32  LEU A N    1  
ATOM 490   C CA   . LEU A 1 32  ? -12.867 4.052   10.527  1.00 0.00 ? 32  LEU A CA   1  
ATOM 491   C C    . LEU A 1 32  ? -11.813 3.247   11.285  1.00 0.00 ? 32  LEU A C    1  
ATOM 492   O O    . LEU A 1 32  ? -10.680 3.133   10.861  1.00 0.00 ? 32  LEU A O    1  
ATOM 493   C CB   . LEU A 1 32  ? -13.213 3.328   9.219   1.00 0.00 ? 32  LEU A CB   1  
ATOM 494   C CG   . LEU A 1 32  ? -13.607 1.878   9.521   1.00 0.00 ? 32  LEU A CG   1  
ATOM 495   C CD1  . LEU A 1 32  ? -14.756 1.860   10.529  1.00 0.00 ? 32  LEU A CD1  1  
ATOM 496   C CD2  . LEU A 1 32  ? -14.060 1.191   8.231   1.00 0.00 ? 32  LEU A CD2  1  
ATOM 497   H H    . LEU A 1 32  ? -11.833 5.571   9.401   1.00 0.00 ? 32  LEU A H    1  
ATOM 498   H HA   . LEU A 1 32  ? -13.756 4.147   11.135  1.00 0.00 ? 32  LEU A HA   1  
ATOM 499   H HB2  . LEU A 1 32  ? -14.034 3.828   8.733   1.00 0.00 ? 32  LEU A HB2  1  
ATOM 500   H HB3  . LEU A 1 32  ? -12.360 3.333   8.570   1.00 0.00 ? 32  LEU A HB3  1  
ATOM 501   H HG   . LEU A 1 32  ? -12.758 1.352   9.933   1.00 0.00 ? 32  LEU A HG   1  
ATOM 502   H HD11 . LEU A 1 32  ? -15.299 0.930   10.436  1.00 0.00 ? 32  LEU A HD11 1  
ATOM 503   H HD12 . LEU A 1 32  ? -15.420 2.688   10.329  1.00 0.00 ? 32  LEU A HD12 1  
ATOM 504   H HD13 . LEU A 1 32  ? -14.359 1.948   11.529  1.00 0.00 ? 32  LEU A HD13 1  
ATOM 505   H HD21 . LEU A 1 32  ? -14.505 1.921   7.571   1.00 0.00 ? 32  LEU A HD21 1  
ATOM 506   H HD22 . LEU A 1 32  ? -14.786 0.428   8.469   1.00 0.00 ? 32  LEU A HD22 1  
ATOM 507   H HD23 . LEU A 1 32  ? -13.207 0.738   7.747   1.00 0.00 ? 32  LEU A HD23 1  
ATOM 508   N N    . LEU A 1 33  ? -12.176 2.691   12.405  1.00 0.00 ? 33  LEU A N    1  
ATOM 509   C CA   . LEU A 1 33  ? -11.197 1.895   13.194  1.00 0.00 ? 33  LEU A CA   1  
ATOM 510   C C    . LEU A 1 33  ? -11.798 0.540   13.549  1.00 0.00 ? 33  LEU A C    1  
ATOM 511   O O    . LEU A 1 33  ? -12.918 0.446   14.003  1.00 0.00 ? 33  LEU A O    1  
ATOM 512   C CB   . LEU A 1 33  ? -10.845 2.652   14.475  1.00 0.00 ? 33  LEU A CB   1  
ATOM 513   C CG   . LEU A 1 33  ? -9.680  3.604   14.200  1.00 0.00 ? 33  LEU A CG   1  
ATOM 514   C CD1  . LEU A 1 33  ? -9.595  4.647   15.314  1.00 0.00 ? 33  LEU A CD1  1  
ATOM 515   C CD2  . LEU A 1 33  ? -8.368  2.812   14.140  1.00 0.00 ? 33  LEU A CD2  1  
ATOM 516   H H    . LEU A 1 33  ? -13.096 2.797   12.728  1.00 0.00 ? 33  LEU A H    1  
ATOM 517   H HA   . LEU A 1 33  ? -10.301 1.746   12.609  1.00 0.00 ? 33  LEU A HA   1  
ATOM 518   H HB2  . LEU A 1 33  ? -11.705 3.220   14.803  1.00 0.00 ? 33  LEU A HB2  1  
ATOM 519   H HB3  . LEU A 1 33  ? -10.564 1.949   15.247  1.00 0.00 ? 33  LEU A HB3  1  
ATOM 520   H HG   . LEU A 1 33  ? -9.844  4.103   13.254  1.00 0.00 ? 33  LEU A HG   1  
ATOM 521   H HD11 . LEU A 1 33  ? -9.937  5.601   14.942  1.00 0.00 ? 33  LEU A HD11 1  
ATOM 522   H HD12 . LEU A 1 33  ? -8.571  4.735   15.648  1.00 0.00 ? 33  LEU A HD12 1  
ATOM 523   H HD13 . LEU A 1 33  ? -10.218 4.342   16.143  1.00 0.00 ? 33  LEU A HD13 1  
ATOM 524   H HD21 . LEU A 1 33  ? -8.487  1.876   14.665  1.00 0.00 ? 33  LEU A HD21 1  
ATOM 525   H HD22 . LEU A 1 33  ? -7.581  3.387   14.603  1.00 0.00 ? 33  LEU A HD22 1  
ATOM 526   H HD23 . LEU A 1 33  ? -8.114  2.617   13.109  1.00 0.00 ? 33  LEU A HD23 1  
ATOM 527   N N    . LEU A 1 34  ? -11.056 -0.511  13.344  1.00 0.00 ? 34  LEU A N    1  
ATOM 528   C CA   . LEU A 1 34  ? -11.578 -1.867  13.669  1.00 0.00 ? 34  LEU A CA   1  
ATOM 529   C C    . LEU A 1 34  ? -10.917 -2.364  14.957  1.00 0.00 ? 34  LEU A C    1  
ATOM 530   O O    . LEU A 1 34  ? -9.756  -2.111  15.207  1.00 0.00 ? 34  LEU A O    1  
ATOM 531   C CB   . LEU A 1 34  ? -11.258 -2.820  12.519  1.00 0.00 ? 34  LEU A CB   1  
ATOM 532   C CG   . LEU A 1 34  ? -11.797 -2.236  11.212  1.00 0.00 ? 34  LEU A CG   1  
ATOM 533   C CD1  . LEU A 1 34  ? -11.536 -3.213  10.069  1.00 0.00 ? 34  LEU A CD1  1  
ATOM 534   C CD2  . LEU A 1 34  ? -13.301 -2.008  11.340  1.00 0.00 ? 34  LEU A CD2  1  
ATOM 535   H H    . LEU A 1 34  ? -10.154 -0.410  12.977  1.00 0.00 ? 34  LEU A H    1  
ATOM 536   H HA   . LEU A 1 34  ? -12.647 -1.817  13.811  1.00 0.00 ? 34  LEU A HA   1  
ATOM 537   H HB2  . LEU A 1 34  ? -10.187 -2.951  12.443  1.00 0.00 ? 34  LEU A HB2  1  
ATOM 538   H HB3  . LEU A 1 34  ? -11.725 -3.776  12.702  1.00 0.00 ? 34  LEU A HB3  1  
ATOM 539   H HG   . LEU A 1 34  ? -11.303 -1.297  11.005  1.00 0.00 ? 34  LEU A HG   1  
ATOM 540   H HD11 . LEU A 1 34  ? -10.484 -3.211  9.827   1.00 0.00 ? 34  LEU A HD11 1  
ATOM 541   H HD12 . LEU A 1 34  ? -12.104 -2.910  9.202   1.00 0.00 ? 34  LEU A HD12 1  
ATOM 542   H HD13 . LEU A 1 34  ? -11.836 -4.205  10.368  1.00 0.00 ? 34  LEU A HD13 1  
ATOM 543   H HD21 . LEU A 1 34  ? -13.714 -2.728  12.030  1.00 0.00 ? 34  LEU A HD21 1  
ATOM 544   H HD22 . LEU A 1 34  ? -13.767 -2.128  10.373  1.00 0.00 ? 34  LEU A HD22 1  
ATOM 545   H HD23 . LEU A 1 34  ? -13.487 -1.009  11.708  1.00 0.00 ? 34  LEU A HD23 1  
ATOM 546   N N    . GLN A 1 35  ? -11.647 -3.065  15.782  1.00 0.00 ? 35  GLN A N    1  
ATOM 547   C CA   . GLN A 1 35  ? -11.055 -3.565  17.054  1.00 0.00 ? 35  GLN A CA   1  
ATOM 548   C C    . GLN A 1 35  ? -10.650 -5.031  16.889  1.00 0.00 ? 35  GLN A C    1  
ATOM 549   O O    . GLN A 1 35  ? -11.435 -5.855  16.467  1.00 0.00 ? 35  GLN A O    1  
ATOM 550   C CB   . GLN A 1 35  ? -12.083 -3.447  18.178  1.00 0.00 ? 35  GLN A CB   1  
ATOM 551   C CG   . GLN A 1 35  ? -11.397 -3.693  19.524  1.00 0.00 ? 35  GLN A CG   1  
ATOM 552   C CD   . GLN A 1 35  ? -12.398 -3.468  20.658  1.00 0.00 ? 35  GLN A CD   1  
ATOM 553   O OE1  . GLN A 1 35  ? -13.519 -3.063  20.421  1.00 0.00 ? 35  GLN A OE1  1  
ATOM 554   N NE2  . GLN A 1 35  ? -12.038 -3.713  21.887  1.00 0.00 ? 35  GLN A NE2  1  
ATOM 555   H H    . GLN A 1 35  ? -12.585 -3.255  15.569  1.00 0.00 ? 35  GLN A H    1  
ATOM 556   H HA   . GLN A 1 35  ? -10.183 -2.977  17.301  1.00 0.00 ? 35  GLN A HA   1  
ATOM 557   H HB2  . GLN A 1 35  ? -12.515 -2.461  18.168  1.00 0.00 ? 35  GLN A HB2  1  
ATOM 558   H HB3  . GLN A 1 35  ? -12.859 -4.183  18.035  1.00 0.00 ? 35  GLN A HB3  1  
ATOM 559   H HG2  . GLN A 1 35  ? -11.033 -4.709  19.562  1.00 0.00 ? 35  GLN A HG2  1  
ATOM 560   H HG3  . GLN A 1 35  ? -10.569 -3.009  19.636  1.00 0.00 ? 35  GLN A HG3  1  
ATOM 561   H HE21 . GLN A 1 35  ? -11.133 -4.037  22.076  1.00 0.00 ? 35  GLN A HE21 1  
ATOM 562   H HE22 . GLN A 1 35  ? -12.672 -3.570  22.621  1.00 0.00 ? 35  GLN A HE22 1  
ATOM 563   N N    . ALA A 1 36  ? -9.432  -5.363  17.223  1.00 0.00 ? 36  ALA A N    1  
ATOM 564   C CA   . ALA A 1 36  ? -8.980  -6.778  17.088  1.00 0.00 ? 36  ALA A CA   1  
ATOM 565   C C    . ALA A 1 36  ? -9.858  -7.684  17.951  1.00 0.00 ? 36  ALA A C    1  
ATOM 566   O O    . ALA A 1 36  ? -10.285 -7.312  19.026  1.00 0.00 ? 36  ALA A O    1  
ATOM 567   C CB   . ALA A 1 36  ? -7.526  -6.894  17.552  1.00 0.00 ? 36  ALA A CB   1  
ATOM 568   H H    . ALA A 1 36  ? -8.816  -4.683  17.565  1.00 0.00 ? 36  ALA A H    1  
ATOM 569   H HA   . ALA A 1 36  ? -9.052  -7.082  16.055  1.00 0.00 ? 36  ALA A HA   1  
ATOM 570   H HB1  . ALA A 1 36  ? -7.055  -5.923  17.516  1.00 0.00 ? 36  ALA A HB1  1  
ATOM 571   H HB2  . ALA A 1 36  ? -6.993  -7.577  16.904  1.00 0.00 ? 36  ALA A HB2  1  
ATOM 572   H HB3  . ALA A 1 36  ? -7.500  -7.269  18.565  1.00 0.00 ? 36  ALA A HB3  1  
ATOM 573   N N    . SER A 1 37  ? -10.127 -8.875  17.490  1.00 0.00 ? 37  SER A N    1  
ATOM 574   C CA   . SER A 1 37  ? -10.977 -9.805  18.287  1.00 0.00 ? 37  SER A CA   1  
ATOM 575   C C    . SER A 1 37  ? -10.106 -10.517 19.324  1.00 0.00 ? 37  SER A C    1  
ATOM 576   O O    . SER A 1 37  ? -10.585 -11.295 20.125  1.00 0.00 ? 37  SER A O    1  
ATOM 577   C CB   . SER A 1 37  ? -11.613 -10.839 17.358  1.00 0.00 ? 37  SER A CB   1  
ATOM 578   O OG   . SER A 1 37  ? -10.632 -11.796 16.980  1.00 0.00 ? 37  SER A OG   1  
ATOM 579   H H    . SER A 1 37  ? -9.771  -9.157  16.624  1.00 0.00 ? 37  SER A H    1  
ATOM 580   H HA   . SER A 1 37  ? -11.750 -9.245  18.790  1.00 0.00 ? 37  SER A HA   1  
ATOM 581   H HB2  . SER A 1 37  ? -12.418 -11.338 17.870  1.00 0.00 ? 37  SER A HB2  1  
ATOM 582   H HB3  . SER A 1 37  ? -12.001 -10.339 16.479  1.00 0.00 ? 37  SER A HB3  1  
ATOM 583   H HG   . SER A 1 37  ? -10.022 -11.371 16.373  1.00 0.00 ? 37  SER A HG   1  
ATOM 584   N N    . ASP A 1 38  ? -8.828  -10.253 19.317  1.00 0.00 ? 38  ASP A N    1  
ATOM 585   C CA   . ASP A 1 38  ? -7.922  -10.908 20.301  1.00 0.00 ? 38  ASP A CA   1  
ATOM 586   C C    . ASP A 1 38  ? -6.717  -10.001 20.562  1.00 0.00 ? 38  ASP A C    1  
ATOM 587   O O    . ASP A 1 38  ? -6.634  -8.902  20.051  1.00 0.00 ? 38  ASP A O    1  
ATOM 588   C CB   . ASP A 1 38  ? -7.434  -12.246 19.743  1.00 0.00 ? 38  ASP A CB   1  
ATOM 589   C CG   . ASP A 1 38  ? -6.601  -12.002 18.482  1.00 0.00 ? 38  ASP A CG   1  
ATOM 590   O OD1  . ASP A 1 38  ? -6.316  -10.852 18.196  1.00 0.00 ? 38  ASP A OD1  1  
ATOM 591   O OD2  . ASP A 1 38  ? -6.258  -12.973 17.826  1.00 0.00 ? 38  ASP A OD2  1  
ATOM 592   H H    . ASP A 1 38  ? -8.462  -9.622  18.663  1.00 0.00 ? 38  ASP A H    1  
ATOM 593   H HA   . ASP A 1 38  ? -8.453  -11.076 21.225  1.00 0.00 ? 38  ASP A HA   1  
ATOM 594   H HB2  . ASP A 1 38  ? -6.828  -12.745 20.484  1.00 0.00 ? 38  ASP A HB2  1  
ATOM 595   H HB3  . ASP A 1 38  ? -8.283  -12.863 19.497  1.00 0.00 ? 38  ASP A HB3  1  
ATOM 596   H HD2  . ASP A 1 38  ? -5.739  -12.746 17.051  1.00 0.00 ? 38  ASP A HD2  1  
ATOM 597   N N    . GLY A 1 39  ? -5.787  -10.452 21.353  1.00 0.00 ? 39  GLY A N    1  
ATOM 598   C CA   . GLY A 1 39  ? -4.587  -9.617  21.644  1.00 0.00 ? 39  GLY A CA   1  
ATOM 599   C C    . GLY A 1 39  ? -4.951  -8.533  22.662  1.00 0.00 ? 39  GLY A C    1  
ATOM 600   O O    . GLY A 1 39  ? -5.872  -8.681  23.440  1.00 0.00 ? 39  GLY A O    1  
ATOM 601   H H    . GLY A 1 39  ? -5.872  -11.343 21.752  1.00 0.00 ? 39  GLY A H    1  
ATOM 602   H HA2  . GLY A 1 39  ? -3.802  -10.242 22.047  1.00 0.00 ? 39  GLY A HA2  1  
ATOM 603   H HA3  . GLY A 1 39  ? -4.242  -9.148  20.734  1.00 0.00 ? 39  GLY A HA3  1  
ATOM 604   N N    . ILE A 1 40  ? -4.232  -7.443  22.663  1.00 0.00 ? 40  ILE A N    1  
ATOM 605   C CA   . ILE A 1 40  ? -4.533  -6.349  23.629  1.00 0.00 ? 40  ILE A CA   1  
ATOM 606   C C    . ILE A 1 40  ? -5.769  -5.578  23.158  1.00 0.00 ? 40  ILE A C    1  
ATOM 607   O O    . ILE A 1 40  ? -6.167  -4.602  23.760  1.00 0.00 ? 40  ILE A O    1  
ATOM 608   C CB   . ILE A 1 40  ? -3.329  -5.408  23.719  1.00 0.00 ? 40  ILE A CB   1  
ATOM 609   C CG1  . ILE A 1 40  ? -3.231  -4.566  22.444  1.00 0.00 ? 40  ILE A CG1  1  
ATOM 610   C CG2  . ILE A 1 40  ? -2.050  -6.229  23.882  1.00 0.00 ? 40  ILE A CG2  1  
ATOM 611   C CD1  . ILE A 1 40  ? -2.024  -3.630  22.548  1.00 0.00 ? 40  ILE A CD1  1  
ATOM 612   H H    . ILE A 1 40  ? -3.493  -7.345  22.027  1.00 0.00 ? 40  ILE A H    1  
ATOM 613   H HA   . ILE A 1 40  ? -4.727  -6.775  24.602  1.00 0.00 ? 40  ILE A HA   1  
ATOM 614   H HB   . ILE A 1 40  ? -3.449  -4.756  24.574  1.00 0.00 ? 40  ILE A HB   1  
ATOM 615   H HG12 . ILE A 1 40  ? -3.111  -5.215  21.590  1.00 0.00 ? 40  ILE A HG12 1  
ATOM 616   H HG13 . ILE A 1 40  ? -4.127  -3.975  22.326  1.00 0.00 ? 40  ILE A HG13 1  
ATOM 617   H HG21 . ILE A 1 40  ? -2.135  -6.859  24.754  1.00 0.00 ? 40  ILE A HG21 1  
ATOM 618   H HG22 . ILE A 1 40  ? -1.208  -5.564  23.998  1.00 0.00 ? 40  ILE A HG22 1  
ATOM 619   H HG23 . ILE A 1 40  ? -1.903  -6.845  23.007  1.00 0.00 ? 40  ILE A HG23 1  
ATOM 620   H HD11 . ILE A 1 40  ? -2.254  -2.691  22.067  1.00 0.00 ? 40  ILE A HD11 1  
ATOM 621   H HD12 . ILE A 1 40  ? -1.174  -4.085  22.061  1.00 0.00 ? 40  ILE A HD12 1  
ATOM 622   H HD13 . ILE A 1 40  ? -1.793  -3.456  23.587  1.00 0.00 ? 40  ILE A HD13 1  
ATOM 623   N N    . HIS A 1 41  ? -6.374  -6.013  22.085  1.00 0.00 ? 41  HIS A N    1  
ATOM 624   C CA   . HIS A 1 41  ? -7.587  -5.315  21.563  1.00 0.00 ? 41  HIS A CA   1  
ATOM 625   C C    . HIS A 1 41  ? -7.201  -3.935  21.029  1.00 0.00 ? 41  HIS A C    1  
ATOM 626   O O    . HIS A 1 41  ? -7.939  -2.978  21.157  1.00 0.00 ? 41  HIS A O    1  
ATOM 627   C CB   . HIS A 1 41  ? -8.619  -5.164  22.681  1.00 0.00 ? 41  HIS A CB   1  
ATOM 628   C CG   . HIS A 1 41  ? -8.788  -6.484  23.383  1.00 0.00 ? 41  HIS A CG   1  
ATOM 629   N ND1  . HIS A 1 41  ? -9.499  -7.535  22.820  1.00 0.00 ? 41  HIS A ND1  1  
ATOM 630   C CD2  . HIS A 1 41  ? -8.344  -6.938  24.601  1.00 0.00 ? 41  HIS A CD2  1  
ATOM 631   C CE1  . HIS A 1 41  ? -9.461  -8.561  23.692  1.00 0.00 ? 41  HIS A CE1  1  
ATOM 632   N NE2  . HIS A 1 41  ? -8.772  -8.248  24.788  1.00 0.00 ? 41  HIS A NE2  1  
ATOM 633   H H    . HIS A 1 41  ? -6.030  -6.805  21.620  1.00 0.00 ? 41  HIS A H    1  
ATOM 634   H HA   . HIS A 1 41  ? -8.014  -5.900  20.761  1.00 0.00 ? 41  HIS A HA   1  
ATOM 635   H HB2  . HIS A 1 41  ? -8.287  -4.418  23.386  1.00 0.00 ? 41  HIS A HB2  1  
ATOM 636   H HB3  . HIS A 1 41  ? -9.565  -4.861  22.258  1.00 0.00 ? 41  HIS A HB3  1  
ATOM 637   H HD1  . HIS A 1 41  ? -9.946  -7.529  21.951  1.00 0.00 ? 41  HIS A HD1  1  
ATOM 638   H HD2  . HIS A 1 41  ? -7.755  -6.368  25.303  1.00 0.00 ? 41  HIS A HD2  1  
ATOM 639   H HE1  . HIS A 1 41  ? -9.932  -9.519  23.520  1.00 0.00 ? 41  HIS A HE1  1  
ATOM 640   H HE2  . HIS A 1 41  ? -8.602  -8.821  25.565  1.00 0.00 ? 41  HIS A HE2  1  
ATOM 641   N N    . HIS A 1 42  ? -6.052  -3.826  20.423  1.00 0.00 ? 42  HIS A N    1  
ATOM 642   C CA   . HIS A 1 42  ? -5.622  -2.513  19.872  1.00 0.00 ? 42  HIS A CA   1  
ATOM 643   C C    . HIS A 1 42  ? -6.549  -2.120  18.721  1.00 0.00 ? 42  HIS A C    1  
ATOM 644   O O    . HIS A 1 42  ? -7.184  -2.957  18.110  1.00 0.00 ? 42  HIS A O    1  
ATOM 645   C CB   . HIS A 1 42  ? -4.193  -2.627  19.347  1.00 0.00 ? 42  HIS A CB   1  
ATOM 646   C CG   . HIS A 1 42  ? -4.080  -3.851  18.481  1.00 0.00 ? 42  HIS A CG   1  
ATOM 647   N ND1  . HIS A 1 42  ? -4.127  -5.135  19.006  1.00 0.00 ? 42  HIS A ND1  1  
ATOM 648   C CD2  . HIS A 1 42  ? -3.927  -4.004  17.125  1.00 0.00 ? 42  HIS A CD2  1  
ATOM 649   C CE1  . HIS A 1 42  ? -4.005  -5.997  17.980  1.00 0.00 ? 42  HIS A CE1  1  
ATOM 650   N NE2  . HIS A 1 42  ? -3.881  -5.358  16.815  1.00 0.00 ? 42  HIS A NE2  1  
ATOM 651   H H    . HIS A 1 42  ? -5.474  -4.611  20.324  1.00 0.00 ? 42  HIS A H    1  
ATOM 652   H HA   . HIS A 1 42  ? -5.665  -1.761  20.647  1.00 0.00 ? 42  HIS A HA   1  
ATOM 653   H HB2  . HIS A 1 42  ? -3.953  -1.752  18.761  1.00 0.00 ? 42  HIS A HB2  1  
ATOM 654   H HB3  . HIS A 1 42  ? -3.507  -2.707  20.177  1.00 0.00 ? 42  HIS A HB3  1  
ATOM 655   H HD1  . HIS A 1 42  ? -4.233  -5.371  19.952  1.00 0.00 ? 42  HIS A HD1  1  
ATOM 656   H HD2  . HIS A 1 42  ? -3.848  -3.198  16.412  1.00 0.00 ? 42  HIS A HD2  1  
ATOM 657   H HE1  . HIS A 1 42  ? -4.006  -7.072  18.087  1.00 0.00 ? 42  HIS A HE1  1  
ATOM 658   H HE2  . HIS A 1 42  ? -3.784  -5.761  15.925  1.00 0.00 ? 42  HIS A HE2  1  
ATOM 659   N N    . TRP A 1 43  ? -6.631  -0.855  18.415  1.00 0.00 ? 43  TRP A N    1  
ATOM 660   C CA   . TRP A 1 43  ? -7.515  -0.417  17.298  1.00 0.00 ? 43  TRP A CA   1  
ATOM 661   C C    . TRP A 1 43  ? -6.665  -0.179  16.050  1.00 0.00 ? 43  TRP A C    1  
ATOM 662   O O    . TRP A 1 43  ? -5.612  0.423   16.111  1.00 0.00 ? 43  TRP A O    1  
ATOM 663   C CB   . TRP A 1 43  ? -8.217  0.885   17.684  1.00 0.00 ? 43  TRP A CB   1  
ATOM 664   C CG   . TRP A 1 43  ? -9.112  0.644   18.858  1.00 0.00 ? 43  TRP A CG   1  
ATOM 665   C CD1  . TRP A 1 43  ? -8.715  0.650   20.151  1.00 0.00 ? 43  TRP A CD1  1  
ATOM 666   C CD2  . TRP A 1 43  ? -10.540 0.366   18.868  1.00 0.00 ? 43  TRP A CD2  1  
ATOM 667   N NE1  . TRP A 1 43  ? -9.812  0.387   20.955  1.00 0.00 ? 43  TRP A NE1  1  
ATOM 668   C CE2  . TRP A 1 43  ? -10.959 0.206   20.211  1.00 0.00 ? 43  TRP A CE2  1  
ATOM 669   C CE3  . TRP A 1 43  ? -11.505 0.240   17.853  1.00 0.00 ? 43  TRP A CE3  1  
ATOM 670   C CZ2  . TRP A 1 43  ? -12.287 -0.072  20.534  1.00 0.00 ? 43  TRP A CZ2  1  
ATOM 671   C CZ3  . TRP A 1 43  ? -12.842 -0.040  18.175  1.00 0.00 ? 43  TRP A CZ3  1  
ATOM 672   C CH2  . TRP A 1 43  ? -13.232 -0.195  19.512  1.00 0.00 ? 43  TRP A CH2  1  
ATOM 673   H H    . TRP A 1 43  ? -6.107  -0.194  18.915  1.00 0.00 ? 43  TRP A H    1  
ATOM 674   H HA   . TRP A 1 43  ? -8.251  -1.181  17.096  1.00 0.00 ? 43  TRP A HA   1  
ATOM 675   H HB2  . TRP A 1 43  ? -7.476  1.628   17.940  1.00 0.00 ? 43  TRP A HB2  1  
ATOM 676   H HB3  . TRP A 1 43  ? -8.806  1.238   16.849  1.00 0.00 ? 43  TRP A HB3  1  
ATOM 677   H HD1  . TRP A 1 43  ? -7.709  0.827   20.499  1.00 0.00 ? 43  TRP A HD1  1  
ATOM 678   H HE1  . TRP A 1 43  ? -9.794  0.333   21.932  1.00 0.00 ? 43  TRP A HE1  1  
ATOM 679   H HE3  . TRP A 1 43  ? -11.216 0.358   16.820  1.00 0.00 ? 43  TRP A HE3  1  
ATOM 680   H HZ2  . TRP A 1 43  ? -12.582 -0.192  21.565  1.00 0.00 ? 43  TRP A HZ2  1  
ATOM 681   H HZ3  . TRP A 1 43  ? -13.573 -0.135  17.390  1.00 0.00 ? 43  TRP A HZ3  1  
ATOM 682   H HH2  . TRP A 1 43  ? -14.264 -0.411  19.753  1.00 0.00 ? 43  TRP A HH2  1  
ATOM 683   N N    . THR A 1 44  ? -7.112  -0.643  14.916  1.00 0.00 ? 44  THR A N    1  
ATOM 684   C CA   . THR A 1 44  ? -6.322  -0.434  13.673  1.00 0.00 ? 44  THR A CA   1  
ATOM 685   C C    . THR A 1 44  ? -7.249  -0.499  12.457  1.00 0.00 ? 44  THR A C    1  
ATOM 686   O O    . THR A 1 44  ? -8.242  -1.200  12.462  1.00 0.00 ? 44  THR A O    1  
ATOM 687   C CB   . THR A 1 44  ? -5.259  -1.530  13.554  1.00 0.00 ? 44  THR A CB   1  
ATOM 688   O OG1  . THR A 1 44  ? -5.655  -2.651  14.330  1.00 0.00 ? 44  THR A OG1  1  
ATOM 689   C CG2  . THR A 1 44  ? -3.917  -1.003  14.062  1.00 0.00 ? 44  THR A CG2  1  
ATOM 690   H H    . THR A 1 44  ? -7.964  -1.126  14.883  1.00 0.00 ? 44  THR A H    1  
ATOM 691   H HA   . THR A 1 44  ? -5.841  0.530   13.712  1.00 0.00 ? 44  THR A HA   1  
ATOM 692   H HB   . THR A 1 44  ? -5.159  -1.824  12.521  1.00 0.00 ? 44  THR A HB   1  
ATOM 693   H HG1  . THR A 1 44  ? -5.062  -2.716  15.082  1.00 0.00 ? 44  THR A HG1  1  
ATOM 694   H HG21 . THR A 1 44  ? -3.973  -0.840  15.128  1.00 0.00 ? 44  THR A HG21 1  
ATOM 695   H HG22 . THR A 1 44  ? -3.684  -0.071  13.567  1.00 0.00 ? 44  THR A HG22 1  
ATOM 696   H HG23 . THR A 1 44  ? -3.145  -1.727  13.849  1.00 0.00 ? 44  THR A HG23 1  
ATOM 697   N N    . PRO A 1 45  ? -6.920  0.218   11.416  1.00 0.00 ? 45  PRO A N    1  
ATOM 698   C CA   . PRO A 1 45  ? -7.727  0.233   10.165  1.00 0.00 ? 45  PRO A CA   1  
ATOM 699   C C    . PRO A 1 45  ? -7.604  -1.088  9.400   1.00 0.00 ? 45  PRO A C    1  
ATOM 700   O O    . PRO A 1 45  ? -6.700  -1.861  9.633   1.00 0.00 ? 45  PRO A O    1  
ATOM 701   C CB   . PRO A 1 45  ? -7.131  1.384   9.351   1.00 0.00 ? 45  PRO A CB   1  
ATOM 702   C CG   . PRO A 1 45  ? -5.738  1.558   9.864   1.00 0.00 ? 45  PRO A CG   1  
ATOM 703   C CD   . PRO A 1 45  ? -5.740  1.093   11.319  1.00 0.00 ? 45  PRO A CD   1  
ATOM 704   H HA   . PRO A 1 45  ? -8.759  0.445   10.390  1.00 0.00 ? 45  PRO A HA   1  
ATOM 705   H HB2  . PRO A 1 45  ? -7.117  1.127   8.300   1.00 0.00 ? 45  PRO A HB2  1  
ATOM 706   H HB3  . PRO A 1 45  ? -7.700  2.288   9.510   1.00 0.00 ? 45  PRO A HB3  1  
ATOM 707   H HG2  . PRO A 1 45  ? -5.054  0.961   9.280   1.00 0.00 ? 45  PRO A HG2  1  
ATOM 708   H HG3  . PRO A 1 45  ? -5.456  2.599   9.817   1.00 0.00 ? 45  PRO A HG3  1  
ATOM 709   H HD2  . PRO A 1 45  ? -4.836  0.541   11.540  1.00 0.00 ? 45  PRO A HD2  1  
ATOM 710   H HD3  . PRO A 1 45  ? -5.845  1.934   11.986  1.00 0.00 ? 45  PRO A HD3  1  
ATOM 711   N N    . PRO A 1 46  ? -8.509  -1.346  8.498   1.00 0.00 ? 46  PRO A N    1  
ATOM 712   C CA   . PRO A 1 46  ? -8.498  -2.596  7.691   1.00 0.00 ? 46  PRO A CA   1  
ATOM 713   C C    . PRO A 1 46  ? -7.101  -2.937  7.160   1.00 0.00 ? 46  PRO A C    1  
ATOM 714   O O    . PRO A 1 46  ? -6.705  -2.486  6.102   1.00 0.00 ? 46  PRO A O    1  
ATOM 715   C CB   . PRO A 1 46  ? -9.444  -2.283  6.531   1.00 0.00 ? 46  PRO A CB   1  
ATOM 716   C CG   . PRO A 1 46  ? -10.383 -1.246  7.051   1.00 0.00 ? 46  PRO A CG   1  
ATOM 717   C CD   . PRO A 1 46  ? -9.644  -0.475  8.149   1.00 0.00 ? 46  PRO A CD   1  
ATOM 718   H HA   . PRO A 1 46  ? -8.892  -3.419  8.265   1.00 0.00 ? 46  PRO A HA   1  
ATOM 719   H HB2  . PRO A 1 46  ? -8.887  -1.897  5.689   1.00 0.00 ? 46  PRO A HB2  1  
ATOM 720   H HB3  . PRO A 1 46  ? -9.993  -3.166  6.246   1.00 0.00 ? 46  PRO A HB3  1  
ATOM 721   H HG2  . PRO A 1 46  ? -10.669 -0.576  6.252   1.00 0.00 ? 46  PRO A HG2  1  
ATOM 722   H HG3  . PRO A 1 46  ? -11.258 -1.718  7.469   1.00 0.00 ? 46  PRO A HG3  1  
ATOM 723   H HD2  . PRO A 1 46  ? -9.295  0.478   7.773   1.00 0.00 ? 46  PRO A HD2  1  
ATOM 724   H HD3  . PRO A 1 46  ? -10.283 -0.335  9.005   1.00 0.00 ? 46  PRO A HD3  1  
ATOM 725   N N    . LYS A 1 47  ? -6.354  -3.733  7.879   1.00 0.00 ? 47  LYS A N    1  
ATOM 726   C CA   . LYS A 1 47  ? -4.988  -4.102  7.401   1.00 0.00 ? 47  LYS A CA   1  
ATOM 727   C C    . LYS A 1 47  ? -5.045  -5.444  6.671   1.00 0.00 ? 47  LYS A C    1  
ATOM 728   O O    . LYS A 1 47  ? -5.752  -6.349  7.069   1.00 0.00 ? 47  LYS A O    1  
ATOM 729   C CB   . LYS A 1 47  ? -4.028  -4.219  8.590   1.00 0.00 ? 47  LYS A CB   1  
ATOM 730   C CG   . LYS A 1 47  ? -3.794  -2.842  9.209   1.00 0.00 ? 47  LYS A CG   1  
ATOM 731   C CD   . LYS A 1 47  ? -2.599  -2.909  10.162  1.00 0.00 ? 47  LYS A CD   1  
ATOM 732   C CE   . LYS A 1 47  ? -2.944  -3.810  11.349  1.00 0.00 ? 47  LYS A CE   1  
ATOM 733   N NZ   . LYS A 1 47  ? -1.950  -3.600  12.439  1.00 0.00 ? 47  LYS A NZ   1  
ATOM 734   H H    . LYS A 1 47  ? -6.691  -4.090  8.727   1.00 0.00 ? 47  LYS A H    1  
ATOM 735   H HA   . LYS A 1 47  ? -4.629  -3.340  6.725   1.00 0.00 ? 47  LYS A HA   1  
ATOM 736   H HB2  . LYS A 1 47  ? -4.456  -4.878  9.332   1.00 0.00 ? 47  LYS A HB2  1  
ATOM 737   H HB3  . LYS A 1 47  ? -3.086  -4.624  8.252   1.00 0.00 ? 47  LYS A HB3  1  
ATOM 738   H HG2  . LYS A 1 47  ? -3.595  -2.123  8.429   1.00 0.00 ? 47  LYS A HG2  1  
ATOM 739   H HG3  . LYS A 1 47  ? -4.671  -2.544  9.761   1.00 0.00 ? 47  LYS A HG3  1  
ATOM 740   H HD2  . LYS A 1 47  ? -1.743  -3.310  9.638   1.00 0.00 ? 47  LYS A HD2  1  
ATOM 741   H HD3  . LYS A 1 47  ? -2.370  -1.916  10.522  1.00 0.00 ? 47  LYS A HD3  1  
ATOM 742   H HE2  . LYS A 1 47  ? -3.931  -3.568  11.709  1.00 0.00 ? 47  LYS A HE2  1  
ATOM 743   H HE3  . LYS A 1 47  ? -2.919  -4.844  11.034  1.00 0.00 ? 47  LYS A HE3  1  
ATOM 744   H HZ1  . LYS A 1 47  ? -1.361  -2.774  12.218  1.00 0.00 ? 47  LYS A HZ1  1  
ATOM 745   H HZ2  . LYS A 1 47  ? -1.348  -4.445  12.526  1.00 0.00 ? 47  LYS A HZ2  1  
ATOM 746   H HZ3  . LYS A 1 47  ? -2.451  -3.436  13.336  1.00 0.00 ? 47  LYS A HZ3  1  
ATOM 747   N N    . GLY A 1 48  ? -4.299  -5.582  5.610   1.00 0.00 ? 48  GLY A N    1  
ATOM 748   C CA   . GLY A 1 48  ? -4.300  -6.866  4.855   1.00 0.00 ? 48  GLY A CA   1  
ATOM 749   C C    . GLY A 1 48  ? -2.937  -7.060  4.188   1.00 0.00 ? 48  GLY A C    1  
ATOM 750   O O    . GLY A 1 48  ? -2.060  -6.224  4.293   1.00 0.00 ? 48  GLY A O    1  
ATOM 751   H H    . GLY A 1 48  ? -3.733  -4.840  5.310   1.00 0.00 ? 48  GLY A H    1  
ATOM 752   H HA2  . GLY A 1 48  ? -4.491  -7.685  5.535   1.00 0.00 ? 48  GLY A HA2  1  
ATOM 753   H HA3  . GLY A 1 48  ? -5.067  -6.839  4.099   1.00 0.00 ? 48  GLY A HA3  1  
ATOM 754   N N    . HIS A 1 49  ? -2.749  -8.154  3.498   1.00 0.00 ? 49  HIS A N    1  
ATOM 755   C CA   . HIS A 1 49  ? -1.442  -8.397  2.822   1.00 0.00 ? 49  HIS A CA   1  
ATOM 756   C C    . HIS A 1 49  ? -1.647  -8.363  1.305   1.00 0.00 ? 49  HIS A C    1  
ATOM 757   O O    . HIS A 1 49  ? -2.656  -8.807  0.797   1.00 0.00 ? 49  HIS A O    1  
ATOM 758   C CB   . HIS A 1 49  ? -0.898  -9.765  3.241   1.00 0.00 ? 49  HIS A CB   1  
ATOM 759   C CG   . HIS A 1 49  ? -0.634  -9.763  4.723   1.00 0.00 ? 49  HIS A CG   1  
ATOM 760   N ND1  . HIS A 1 49  ? -1.582  -10.184 5.644   1.00 0.00 ? 49  HIS A ND1  1  
ATOM 761   C CD2  . HIS A 1 49  ? 0.466   -9.396  5.459   1.00 0.00 ? 49  HIS A CD2  1  
ATOM 762   C CE1  . HIS A 1 49  ? -1.043  -10.059 6.870   1.00 0.00 ? 49  HIS A CE1  1  
ATOM 763   N NE2  . HIS A 1 49  ? 0.202   -9.582  6.811   1.00 0.00 ? 49  HIS A NE2  1  
ATOM 764   H H    . HIS A 1 49  ? -3.471  -8.815  3.424   1.00 0.00 ? 49  HIS A H    1  
ATOM 765   H HA   . HIS A 1 49  ? -0.741  -7.628  3.108   1.00 0.00 ? 49  HIS A HA   1  
ATOM 766   H HB2  . HIS A 1 49  ? -1.623  -10.528 3.005   1.00 0.00 ? 49  HIS A HB2  1  
ATOM 767   H HB3  . HIS A 1 49  ? 0.023   -9.964  2.713   1.00 0.00 ? 49  HIS A HB3  1  
ATOM 768   H HD1  . HIS A 1 49  ? -2.483  -10.513 5.439   1.00 0.00 ? 49  HIS A HD1  1  
ATOM 769   H HD2  . HIS A 1 49  ? 1.392   -9.021  5.050   1.00 0.00 ? 49  HIS A HD2  1  
ATOM 770   H HE1  . HIS A 1 49  ? -1.554  -10.313 7.787   1.00 0.00 ? 49  HIS A HE1  1  
ATOM 771   H HE2  . HIS A 1 49  ? 0.803   -9.402  7.564   1.00 0.00 ? 49  HIS A HE2  1  
ATOM 772   N N    . VAL A 1 50  ? -0.706  -7.824  0.578   1.00 0.00 ? 50  VAL A N    1  
ATOM 773   C CA   . VAL A 1 50  ? -0.863  -7.748  -0.902  1.00 0.00 ? 50  VAL A CA   1  
ATOM 774   C C    . VAL A 1 50  ? -0.232  -8.972  -1.570  1.00 0.00 ? 50  VAL A C    1  
ATOM 775   O O    . VAL A 1 50  ? 0.853   -9.399  -1.227  1.00 0.00 ? 50  VAL A O    1  
ATOM 776   C CB   . VAL A 1 50  ? -0.202  -6.467  -1.421  1.00 0.00 ? 50  VAL A CB   1  
ATOM 777   C CG1  . VAL A 1 50  ? 0.624   -5.825  -0.306  1.00 0.00 ? 50  VAL A CG1  1  
ATOM 778   C CG2  . VAL A 1 50  ? 0.708   -6.793  -2.610  1.00 0.00 ? 50  VAL A CG2  1  
ATOM 779   H H    . VAL A 1 50  ? 0.097   -7.458  1.005   1.00 0.00 ? 50  VAL A H    1  
ATOM 780   H HA   . VAL A 1 50  ? -1.916  -7.723  -1.145  1.00 0.00 ? 50  VAL A HA   1  
ATOM 781   H HB   . VAL A 1 50  ? -0.964  -5.773  -1.736  1.00 0.00 ? 50  VAL A HB   1  
ATOM 782   H HG11 . VAL A 1 50  ? 1.297   -6.557  0.113   1.00 0.00 ? 50  VAL A HG11 1  
ATOM 783   H HG12 . VAL A 1 50  ? -0.038  -5.460  0.465   1.00 0.00 ? 50  VAL A HG12 1  
ATOM 784   H HG13 . VAL A 1 50  ? 1.192   -5.002  -0.711  1.00 0.00 ? 50  VAL A HG13 1  
ATOM 785   H HG21 . VAL A 1 50  ? 0.136   -7.303  -3.373  1.00 0.00 ? 50  VAL A HG21 1  
ATOM 786   H HG22 . VAL A 1 50  ? 1.521   -7.427  -2.283  1.00 0.00 ? 50  VAL A HG22 1  
ATOM 787   H HG23 . VAL A 1 50  ? 1.110   -5.876  -3.016  1.00 0.00 ? 50  VAL A HG23 1  
ATOM 788   N N    . GLU A 1 51  ? -0.915  -9.525  -2.535  1.00 0.00 ? 51  GLU A N    1  
ATOM 789   C CA   . GLU A 1 51  ? -0.393  -10.713 -3.268  1.00 0.00 ? 51  GLU A CA   1  
ATOM 790   C C    . GLU A 1 51  ? 0.772   -10.262 -4.165  1.00 0.00 ? 51  GLU A C    1  
ATOM 791   O O    . GLU A 1 51  ? 1.192   -9.125  -4.099  1.00 0.00 ? 51  GLU A O    1  
ATOM 792   C CB   . GLU A 1 51  ? -1.534  -11.288 -4.116  1.00 0.00 ? 51  GLU A CB   1  
ATOM 793   C CG   . GLU A 1 51  ? -1.806  -12.747 -3.735  1.00 0.00 ? 51  GLU A CG   1  
ATOM 794   C CD   . GLU A 1 51  ? -2.459  -13.464 -4.918  1.00 0.00 ? 51  GLU A CD   1  
ATOM 795   O OE1  . GLU A 1 51  ? -3.288  -12.851 -5.572  1.00 0.00 ? 51  GLU A OE1  1  
ATOM 796   O OE2  . GLU A 1 51  ? -2.119  -14.611 -5.152  1.00 0.00 ? 51  GLU A OE2  1  
ATOM 797   H H    . GLU A 1 51  ? -1.781  -9.146  -2.788  1.00 0.00 ? 51  GLU A H    1  
ATOM 798   H HA   . GLU A 1 51  ? -0.047  -11.453 -2.564  1.00 0.00 ? 51  GLU A HA   1  
ATOM 799   H HB2  . GLU A 1 51  ? -2.420  -10.714 -3.940  1.00 0.00 ? 51  GLU A HB2  1  
ATOM 800   H HB3  . GLU A 1 51  ? -1.277  -11.227 -5.160  1.00 0.00 ? 51  GLU A HB3  1  
ATOM 801   H HG2  . GLU A 1 51  ? -0.883  -13.241 -3.479  1.00 0.00 ? 51  GLU A HG2  1  
ATOM 802   H HG3  . GLU A 1 51  ? -2.475  -12.776 -2.888  1.00 0.00 ? 51  GLU A HG3  1  
ATOM 803   H HE2  . GLU A 1 51  ? -2.569  -14.996 -5.908  1.00 0.00 ? 51  GLU A HE2  1  
ATOM 804   N N    . PRO A 1 52  ? 1.307   -11.131 -4.988  1.00 0.00 ? 52  PRO A N    1  
ATOM 805   C CA   . PRO A 1 52  ? 2.448   -10.772 -5.878  1.00 0.00 ? 52  PRO A CA   1  
ATOM 806   C C    . PRO A 1 52  ? 2.007   -9.900  -7.054  1.00 0.00 ? 52  PRO A C    1  
ATOM 807   O O    . PRO A 1 52  ? 2.286   -8.721  -7.104  1.00 0.00 ? 52  PRO A O    1  
ATOM 808   C CB   . PRO A 1 52  ? 2.967   -12.122 -6.375  1.00 0.00 ? 52  PRO A CB   1  
ATOM 809   C CG   . PRO A 1 52  ? 1.802   -13.050 -6.293  1.00 0.00 ? 52  PRO A CG   1  
ATOM 810   C CD   . PRO A 1 52  ? 0.895   -12.533 -5.171  1.00 0.00 ? 52  PRO A CD   1  
ATOM 811   H HA   . PRO A 1 52  ? 3.221   -10.275 -5.314  1.00 0.00 ? 52  PRO A HA   1  
ATOM 812   H HB2  . PRO A 1 52  ? 3.311   -12.036 -7.398  1.00 0.00 ? 52  PRO A HB2  1  
ATOM 813   H HB3  . PRO A 1 52  ? 3.765   -12.474 -5.738  1.00 0.00 ? 52  PRO A HB3  1  
ATOM 814   H HG2  . PRO A 1 52  ? 1.265   -13.048 -7.234  1.00 0.00 ? 52  PRO A HG2  1  
ATOM 815   H HG3  . PRO A 1 52  ? 2.137   -14.048 -6.059  1.00 0.00 ? 52  PRO A HG3  1  
ATOM 816   H HD2  . PRO A 1 52  ? -0.136  -12.593 -5.477  1.00 0.00 ? 52  PRO A HD2  1  
ATOM 817   H HD3  . PRO A 1 52  ? 1.057   -13.092 -4.263  1.00 0.00 ? 52  PRO A HD3  1  
ATOM 818   N N    . GLY A 1 53  ? 1.307   -10.467 -7.997  1.00 0.00 ? 53  GLY A N    1  
ATOM 819   C CA   . GLY A 1 53  ? 0.840   -9.660  -9.158  1.00 0.00 ? 53  GLY A CA   1  
ATOM 820   C C    . GLY A 1 53  ? -0.365  -8.824  -8.727  1.00 0.00 ? 53  GLY A C    1  
ATOM 821   O O    . GLY A 1 53  ? -1.148  -8.376  -9.544  1.00 0.00 ? 53  GLY A O    1  
ATOM 822   H H    . GLY A 1 53  ? 1.082   -11.420 -7.938  1.00 0.00 ? 53  GLY A H    1  
ATOM 823   H HA2  . GLY A 1 53  ? 1.635   -9.006  -9.486  1.00 0.00 ? 53  GLY A HA2  1  
ATOM 824   H HA3  . GLY A 1 53  ? 0.553   -10.317 -9.964  1.00 0.00 ? 53  GLY A HA3  1  
ATOM 825   N N    . GLU A 1 54  ? -0.521  -8.615  -7.448  1.00 0.00 ? 54  GLU A N    1  
ATOM 826   C CA   . GLU A 1 54  ? -1.675  -7.814  -6.953  1.00 0.00 ? 54  GLU A CA   1  
ATOM 827   C C    . GLU A 1 54  ? -1.260  -6.349  -6.816  1.00 0.00 ? 54  GLU A C    1  
ATOM 828   O O    . GLU A 1 54  ? -0.116  -6.039  -6.554  1.00 0.00 ? 54  GLU A O    1  
ATOM 829   C CB   . GLU A 1 54  ? -2.117  -8.341  -5.587  1.00 0.00 ? 54  GLU A CB   1  
ATOM 830   C CG   . GLU A 1 54  ? -3.416  -7.653  -5.174  1.00 0.00 ? 54  GLU A CG   1  
ATOM 831   C CD   . GLU A 1 54  ? -3.796  -8.073  -3.753  1.00 0.00 ? 54  GLU A CD   1  
ATOM 832   O OE1  . GLU A 1 54  ? -2.996  -8.737  -3.118  1.00 0.00 ? 54  GLU A OE1  1  
ATOM 833   O OE2  . GLU A 1 54  ? -4.883  -7.724  -3.321  1.00 0.00 ? 54  GLU A OE2  1  
ATOM 834   H H    . GLU A 1 54  ? 0.122   -8.990  -6.810  1.00 0.00 ? 54  GLU A H    1  
ATOM 835   H HA   . GLU A 1 54  ? -2.496  -7.894  -7.651  1.00 0.00 ? 54  GLU A HA   1  
ATOM 836   H HB2  . GLU A 1 54  ? -2.275  -9.403  -5.651  1.00 0.00 ? 54  GLU A HB2  1  
ATOM 837   H HB3  . GLU A 1 54  ? -1.352  -8.134  -4.857  1.00 0.00 ? 54  GLU A HB3  1  
ATOM 838   H HG2  . GLU A 1 54  ? -3.278  -6.585  -5.209  1.00 0.00 ? 54  GLU A HG2  1  
ATOM 839   H HG3  . GLU A 1 54  ? -4.205  -7.935  -5.853  1.00 0.00 ? 54  GLU A HG3  1  
ATOM 840   H HE2  . GLU A 1 54  ? -5.053  -8.023  -2.425  1.00 0.00 ? 54  GLU A HE2  1  
ATOM 841   N N    . ASP A 1 55  ? -2.185  -5.447  -6.997  1.00 0.00 ? 55  ASP A N    1  
ATOM 842   C CA   . ASP A 1 55  ? -1.849  -4.000  -6.884  1.00 0.00 ? 55  ASP A CA   1  
ATOM 843   C C    . ASP A 1 55  ? -1.645  -3.626  -5.423  1.00 0.00 ? 55  ASP A C    1  
ATOM 844   O O    . ASP A 1 55  ? -2.093  -4.304  -4.519  1.00 0.00 ? 55  ASP A O    1  
ATOM 845   C CB   . ASP A 1 55  ? -2.991  -3.156  -7.428  1.00 0.00 ? 55  ASP A CB   1  
ATOM 846   C CG   . ASP A 1 55  ? -2.556  -1.691  -7.508  1.00 0.00 ? 55  ASP A CG   1  
ATOM 847   O OD1  . ASP A 1 55  ? -2.830  -0.960  -6.571  1.00 0.00 ? 55  ASP A OD1  1  
ATOM 848   O OD2  . ASP A 1 55  ? -1.959  -1.325  -8.507  1.00 0.00 ? 55  ASP A OD2  1  
ATOM 849   H H    . ASP A 1 55  ? -3.101  -5.721  -7.209  1.00 0.00 ? 55  ASP A H    1  
ATOM 850   H HA   . ASP A 1 55  ? -0.949  -3.791  -7.440  1.00 0.00 ? 55  ASP A HA   1  
ATOM 851   H HB2  . ASP A 1 55  ? -3.271  -3.505  -8.404  1.00 0.00 ? 55  ASP A HB2  1  
ATOM 852   H HB3  . ASP A 1 55  ? -3.828  -3.237  -6.764  1.00 0.00 ? 55  ASP A HB3  1  
ATOM 853   H HD2  . ASP A 1 55  ? -1.718  -0.396  -8.489  1.00 0.00 ? 55  ASP A HD2  1  
ATOM 854   N N    . ASP A 1 56  ? -0.982  -2.536  -5.192  1.00 0.00 ? 56  ASP A N    1  
ATOM 855   C CA   . ASP A 1 56  ? -0.755  -2.088  -3.793  1.00 0.00 ? 56  ASP A CA   1  
ATOM 856   C C    . ASP A 1 56  ? -2.058  -1.510  -3.228  1.00 0.00 ? 56  ASP A C    1  
ATOM 857   O O    . ASP A 1 56  ? -2.477  -1.842  -2.136  1.00 0.00 ? 56  ASP A O    1  
ATOM 858   C CB   . ASP A 1 56  ? 0.335   -1.015  -3.775  1.00 0.00 ? 56  ASP A CB   1  
ATOM 859   C CG   . ASP A 1 56  ? 1.645   -1.607  -4.299  1.00 0.00 ? 56  ASP A CG   1  
ATOM 860   O OD1  . ASP A 1 56  ? 1.763   -2.820  -4.303  1.00 0.00 ? 56  ASP A OD1  1  
ATOM 861   O OD2  . ASP A 1 56  ? 2.505   -0.835  -4.692  1.00 0.00 ? 56  ASP A OD2  1  
ATOM 862   H H    . ASP A 1 56  ? -0.649  -2.004  -5.944  1.00 0.00 ? 56  ASP A H    1  
ATOM 863   H HA   . ASP A 1 56  ? -0.443  -2.929  -3.191  1.00 0.00 ? 56  ASP A HA   1  
ATOM 864   H HB2  . ASP A 1 56  ? 0.034   -0.187  -4.403  1.00 0.00 ? 56  ASP A HB2  1  
ATOM 865   H HB3  . ASP A 1 56  ? 0.481   -0.668  -2.763  1.00 0.00 ? 56  ASP A HB3  1  
ATOM 866   H HD2  . ASP A 1 56  ? 3.297   -1.276  -5.007  1.00 0.00 ? 56  ASP A HD2  1  
ATOM 867   N N    . LEU A 1 57  ? -2.700  -0.640  -3.966  1.00 0.00 ? 57  LEU A N    1  
ATOM 868   C CA   . LEU A 1 57  ? -3.970  -0.033  -3.473  1.00 0.00 ? 57  LEU A CA   1  
ATOM 869   C C    . LEU A 1 57  ? -5.104  -1.061  -3.496  1.00 0.00 ? 57  LEU A C    1  
ATOM 870   O O    . LEU A 1 57  ? -5.864  -1.168  -2.556  1.00 0.00 ? 57  LEU A O    1  
ATOM 871   C CB   . LEU A 1 57  ? -4.346  1.160   -4.358  1.00 0.00 ? 57  LEU A CB   1  
ATOM 872   C CG   . LEU A 1 57  ? -5.655  1.776   -3.856  1.00 0.00 ? 57  LEU A CG   1  
ATOM 873   C CD1  . LEU A 1 57  ? -5.485  2.250   -2.413  1.00 0.00 ? 57  LEU A CD1  1  
ATOM 874   C CD2  . LEU A 1 57  ? -6.033  2.967   -4.741  1.00 0.00 ? 57  LEU A CD2  1  
ATOM 875   H H    . LEU A 1 57  ? -2.342  -0.384  -4.843  1.00 0.00 ? 57  LEU A H    1  
ATOM 876   H HA   . LEU A 1 57  ? -3.826  0.311   -2.460  1.00 0.00 ? 57  LEU A HA   1  
ATOM 877   H HB2  . LEU A 1 57  ? -3.561  1.898   -4.317  1.00 0.00 ? 57  LEU A HB2  1  
ATOM 878   H HB3  . LEU A 1 57  ? -4.476  0.826   -5.376  1.00 0.00 ? 57  LEU A HB3  1  
ATOM 879   H HG   . LEU A 1 57  ? -6.438  1.035   -3.899  1.00 0.00 ? 57  LEU A HG   1  
ATOM 880   H HD11 . LEU A 1 57  ? -5.665  1.425   -1.738  1.00 0.00 ? 57  LEU A HD11 1  
ATOM 881   H HD12 . LEU A 1 57  ? -6.194  3.041   -2.208  1.00 0.00 ? 57  LEU A HD12 1  
ATOM 882   H HD13 . LEU A 1 57  ? -4.484  2.621   -2.272  1.00 0.00 ? 57  LEU A HD13 1  
ATOM 883   H HD21 . LEU A 1 57  ? -6.203  2.626   -5.751  1.00 0.00 ? 57  LEU A HD21 1  
ATOM 884   H HD22 . LEU A 1 57  ? -5.230  3.690   -4.734  1.00 0.00 ? 57  LEU A HD22 1  
ATOM 885   H HD23 . LEU A 1 57  ? -6.932  3.426   -4.359  1.00 0.00 ? 57  LEU A HD23 1  
ATOM 886   N N    . GLU A 1 58  ? -5.234  -1.816  -4.556  1.00 0.00 ? 58  GLU A N    1  
ATOM 887   C CA   . GLU A 1 58  ? -6.338  -2.817  -4.610  1.00 0.00 ? 58  GLU A CA   1  
ATOM 888   C C    . GLU A 1 58  ? -6.261  -3.703  -3.370  1.00 0.00 ? 58  GLU A C    1  
ATOM 889   O O    . GLU A 1 58  ? -7.266  -4.040  -2.778  1.00 0.00 ? 58  GLU A O    1  
ATOM 890   C CB   . GLU A 1 58  ? -6.209  -3.677  -5.871  1.00 0.00 ? 58  GLU A CB   1  
ATOM 891   C CG   . GLU A 1 58  ? -6.626  -2.866  -7.106  1.00 0.00 ? 58  GLU A CG   1  
ATOM 892   C CD   . GLU A 1 58  ? -5.515  -1.891  -7.505  1.00 0.00 ? 58  GLU A CD   1  
ATOM 893   O OE1  . GLU A 1 58  ? -5.168  -1.054  -6.691  1.00 0.00 ? 58  GLU A OE1  1  
ATOM 894   O OE2  . GLU A 1 58  ? -5.033  -2.000  -8.620  1.00 0.00 ? 58  GLU A OE2  1  
ATOM 895   H H    . GLU A 1 58  ? -4.616  -1.719  -5.310  1.00 0.00 ? 58  GLU A H    1  
ATOM 896   H HA   . GLU A 1 58  ? -7.290  -2.300  -4.618  1.00 0.00 ? 58  GLU A HA   1  
ATOM 897   H HB2  . GLU A 1 58  ? -5.191  -4.009  -5.978  1.00 0.00 ? 58  GLU A HB2  1  
ATOM 898   H HB3  . GLU A 1 58  ? -6.851  -4.540  -5.783  1.00 0.00 ? 58  GLU A HB3  1  
ATOM 899   H HG2  . GLU A 1 58  ? -6.818  -3.540  -7.927  1.00 0.00 ? 58  GLU A HG2  1  
ATOM 900   H HG3  . GLU A 1 58  ? -7.521  -2.311  -6.883  1.00 0.00 ? 58  GLU A HG3  1  
ATOM 901   H HE2  . GLU A 1 58  ? -4.343  -1.357  -8.802  1.00 0.00 ? 58  GLU A HE2  1  
ATOM 902   N N    . THR A 1 59  ? -5.078  -4.055  -2.944  1.00 0.00 ? 59  THR A N    1  
ATOM 903   C CA   . THR A 1 59  ? -4.967  -4.884  -1.716  1.00 0.00 ? 59  THR A CA   1  
ATOM 904   C C    . THR A 1 59  ? -5.612  -4.108  -0.576  1.00 0.00 ? 59  THR A C    1  
ATOM 905   O O    . THR A 1 59  ? -6.366  -4.643  0.211   1.00 0.00 ? 59  THR A O    1  
ATOM 906   C CB   . THR A 1 59  ? -3.497  -5.157  -1.401  1.00 0.00 ? 59  THR A CB   1  
ATOM 907   O OG1  . THR A 1 59  ? -2.930  -5.913  -2.461  1.00 0.00 ? 59  THR A OG1  1  
ATOM 908   C CG2  . THR A 1 59  ? -3.386  -5.938  -0.087  1.00 0.00 ? 59  THR A CG2  1  
ATOM 909   H H    . THR A 1 59  ? -4.272  -3.756  -3.414  1.00 0.00 ? 59  THR A H    1  
ATOM 910   H HA   . THR A 1 59  ? -5.491  -5.818  -1.860  1.00 0.00 ? 59  THR A HA   1  
ATOM 911   H HB   . THR A 1 59  ? -2.966  -4.223  -1.303  1.00 0.00 ? 59  THR A HB   1  
ATOM 912   H HG1  . THR A 1 59  ? -3.558  -5.916  -3.190  1.00 0.00 ? 59  THR A HG1  1  
ATOM 913   H HG21 . THR A 1 59  ? -3.800  -6.928  -0.219  1.00 0.00 ? 59  THR A HG21 1  
ATOM 914   H HG22 . THR A 1 59  ? -3.933  -5.422  0.686   1.00 0.00 ? 59  THR A HG22 1  
ATOM 915   H HG23 . THR A 1 59  ? -2.348  -6.018  0.198   1.00 0.00 ? 59  THR A HG23 1  
ATOM 916   N N    . ALA A 1 60  ? -5.346  -2.831  -0.504  1.00 0.00 ? 60  ALA A N    1  
ATOM 917   C CA   . ALA A 1 60  ? -5.974  -2.012  0.562   1.00 0.00 ? 60  ALA A CA   1  
ATOM 918   C C    . ALA A 1 60  ? -7.483  -2.004  0.316   1.00 0.00 ? 60  ALA A C    1  
ATOM 919   O O    . ALA A 1 60  ? -8.273  -2.160  1.224   1.00 0.00 ? 60  ALA A O    1  
ATOM 920   C CB   . ALA A 1 60  ? -5.433  -0.582  0.493   1.00 0.00 ? 60  ALA A CB   1  
ATOM 921   H H    . ALA A 1 60  ? -4.753  -2.413  -1.165  1.00 0.00 ? 60  ALA A H    1  
ATOM 922   H HA   . ALA A 1 60  ? -5.762  -2.440  1.528   1.00 0.00 ? 60  ALA A HA   1  
ATOM 923   H HB1  . ALA A 1 60  ? -4.503  -0.577  -0.058  1.00 0.00 ? 60  ALA A HB1  1  
ATOM 924   H HB2  . ALA A 1 60  ? -5.263  -0.213  1.493   1.00 0.00 ? 60  ALA A HB2  1  
ATOM 925   H HB3  . ALA A 1 60  ? -6.150  0.050   -0.007  1.00 0.00 ? 60  ALA A HB3  1  
ATOM 926   N N    . LEU A 1 61  ? -7.882  -1.851  -0.920  1.00 0.00 ? 61  LEU A N    1  
ATOM 927   C CA   . LEU A 1 61  ? -9.334  -1.856  -1.253  1.00 0.00 ? 61  LEU A CA   1  
ATOM 928   C C    . LEU A 1 61  ? -9.932  -3.203  -0.862  1.00 0.00 ? 61  LEU A C    1  
ATOM 929   O O    . LEU A 1 61  ? -10.945 -3.286  -0.197  1.00 0.00 ? 61  LEU A O    1  
ATOM 930   C CB   . LEU A 1 61  ? -9.495  -1.682  -2.763  1.00 0.00 ? 61  LEU A CB   1  
ATOM 931   C CG   . LEU A 1 61  ? -8.814  -0.397  -3.214  1.00 0.00 ? 61  LEU A CG   1  
ATOM 932   C CD1  . LEU A 1 61  ? -8.893  -0.302  -4.736  1.00 0.00 ? 61  LEU A CD1  1  
ATOM 933   C CD2  . LEU A 1 61  ? -9.518  0.807   -2.585  1.00 0.00 ? 61  LEU A CD2  1  
ATOM 934   H H    . LEU A 1 61  ? -7.219  -1.745  -1.635  1.00 0.00 ? 61  LEU A H    1  
ATOM 935   H HA   . LEU A 1 61  ? -9.843  -1.058  -0.736  1.00 0.00 ? 61  LEU A HA   1  
ATOM 936   H HB2  . LEU A 1 61  ? -9.043  -2.524  -3.266  1.00 0.00 ? 61  LEU A HB2  1  
ATOM 937   H HB3  . LEU A 1 61  ? -10.541 -1.639  -3.012  1.00 0.00 ? 61  LEU A HB3  1  
ATOM 938   H HG   . LEU A 1 61  ? -7.781  -0.411  -2.907  1.00 0.00 ? 61  LEU A HG   1  
ATOM 939   H HD11 . LEU A 1 61  ? -7.908  -0.115  -5.138  1.00 0.00 ? 61  LEU A HD11 1  
ATOM 940   H HD12 . LEU A 1 61  ? -9.554  0.505   -5.013  1.00 0.00 ? 61  LEU A HD12 1  
ATOM 941   H HD13 . LEU A 1 61  ? -9.271  -1.233  -5.133  1.00 0.00 ? 61  LEU A HD13 1  
ATOM 942   H HD21 . LEU A 1 61  ? -9.138  0.963   -1.587  1.00 0.00 ? 61  LEU A HD21 1  
ATOM 943   H HD22 . LEU A 1 61  ? -10.581 0.619   -2.542  1.00 0.00 ? 61  LEU A HD22 1  
ATOM 944   H HD23 . LEU A 1 61  ? -9.331  1.686   -3.184  1.00 0.00 ? 61  LEU A HD23 1  
ATOM 945   N N    . ARG A 1 62  ? -9.301  -4.263  -1.284  1.00 0.00 ? 62  ARG A N    1  
ATOM 946   C CA   . ARG A 1 62  ? -9.808  -5.625  -0.960  1.00 0.00 ? 62  ARG A CA   1  
ATOM 947   C C    . ARG A 1 62  ? -9.861  -5.813  0.557   1.00 0.00 ? 62  ARG A C    1  
ATOM 948   O O    . ARG A 1 62  ? -10.826 -6.313  1.095   1.00 0.00 ? 62  ARG A O    1  
ATOM 949   C CB   . ARG A 1 62  ? -8.864  -6.661  -1.572  1.00 0.00 ? 62  ARG A CB   1  
ATOM 950   C CG   . ARG A 1 62  ? -9.421  -8.067  -1.352  1.00 0.00 ? 62  ARG A CG   1  
ATOM 951   C CD   . ARG A 1 62  ? -8.431  -9.089  -1.911  1.00 0.00 ? 62  ARG A CD   1  
ATOM 952   N NE   . ARG A 1 62  ? -9.014  -10.456 -1.818  1.00 0.00 ? 62  ARG A NE   1  
ATOM 953   C CZ   . ARG A 1 62  ? -8.455  -11.443 -2.462  1.00 0.00 ? 62  ARG A CZ   1  
ATOM 954   N NH1  . ARG A 1 62  ? -7.390  -11.230 -3.186  1.00 0.00 ? 62  ARG A NH1  1  
ATOM 955   N NH2  . ARG A 1 62  ? -8.960  -12.643 -2.380  1.00 0.00 ? 62  ARG A NH2  1  
ATOM 956   H H    . ARG A 1 62  ? -8.488  -4.160  -1.826  1.00 0.00 ? 62  ARG A H    1  
ATOM 957   H HA   . ARG A 1 62  ? -10.796 -5.750  -1.374  1.00 0.00 ? 62  ARG A HA   1  
ATOM 958   H HB2  . ARG A 1 62  ? -8.767  -6.475  -2.633  1.00 0.00 ? 62  ARG A HB2  1  
ATOM 959   H HB3  . ARG A 1 62  ? -7.894  -6.583  -1.106  1.00 0.00 ? 62  ARG A HB3  1  
ATOM 960   H HG2  . ARG A 1 62  ? -9.561  -8.237  -0.295  1.00 0.00 ? 62  ARG A HG2  1  
ATOM 961   H HG3  . ARG A 1 62  ? -10.366 -8.165  -1.863  1.00 0.00 ? 62  ARG A HG3  1  
ATOM 962   H HD2  . ARG A 1 62  ? -8.221  -8.858  -2.945  1.00 0.00 ? 62  ARG A HD2  1  
ATOM 963   H HD3  . ARG A 1 62  ? -7.514  -9.049  -1.340  1.00 0.00 ? 62  ARG A HD3  1  
ATOM 964   H HE   . ARG A 1 62  ? -9.813  -10.614 -1.273  1.00 0.00 ? 62  ARG A HE   1  
ATOM 965   H HH11 . ARG A 1 62  ? -7.004  -10.309 -3.248  1.00 0.00 ? 62  ARG A HH11 1  
ATOM 966   H HH12 . ARG A 1 62  ? -6.962  -11.987 -3.682  1.00 0.00 ? 62  ARG A HH12 1  
ATOM 967   H HH21 . ARG A 1 62  ? -9.773  -12.806 -1.823  1.00 0.00 ? 62  ARG A HH21 1  
ATOM 968   H HH22 . ARG A 1 62  ? -8.530  -13.399 -2.873  1.00 0.00 ? 62  ARG A HH22 1  
ATOM 969   N N    . ALA A 1 63  ? -8.834  -5.413  1.254   1.00 0.00 ? 63  ALA A N    1  
ATOM 970   C CA   . ALA A 1 63  ? -8.830  -5.570  2.735   1.00 0.00 ? 63  ALA A CA   1  
ATOM 971   C C    . ALA A 1 63  ? -9.854  -4.619  3.356   1.00 0.00 ? 63  ALA A C    1  
ATOM 972   O O    . ALA A 1 63  ? -10.457 -4.914  4.370   1.00 0.00 ? 63  ALA A O    1  
ATOM 973   C CB   . ALA A 1 63  ? -7.438  -5.240  3.281   1.00 0.00 ? 63  ALA A CB   1  
ATOM 974   H H    . ALA A 1 63  ? -8.063  -5.009  0.802   1.00 0.00 ? 63  ALA A H    1  
ATOM 975   H HA   . ALA A 1 63  ? -9.084  -6.589  2.992   1.00 0.00 ? 63  ALA A HA   1  
ATOM 976   H HB1  . ALA A 1 63  ? -7.292  -5.739  4.227   1.00 0.00 ? 63  ALA A HB1  1  
ATOM 977   H HB2  . ALA A 1 63  ? -7.352  -4.172  3.421   1.00 0.00 ? 63  ALA A HB2  1  
ATOM 978   H HB3  . ALA A 1 63  ? -6.687  -5.572  2.580   1.00 0.00 ? 63  ALA A HB3  1  
ATOM 979   N N    . THR A 1 64  ? -10.045 -3.473  2.764   1.00 0.00 ? 64  THR A N    1  
ATOM 980   C CA   . THR A 1 64  ? -11.016 -2.494  3.322   1.00 0.00 ? 64  THR A CA   1  
ATOM 981   C C    . THR A 1 64  ? -12.418 -3.106  3.376   1.00 0.00 ? 64  THR A C    1  
ATOM 982   O O    . THR A 1 64  ? -13.112 -3.000  4.366   1.00 0.00 ? 64  THR A O    1  
ATOM 983   C CB   . THR A 1 64  ? -11.044 -1.255  2.428   1.00 0.00 ? 64  THR A CB   1  
ATOM 984   O OG1  . THR A 1 64  ? -9.719  -0.779  2.250   1.00 0.00 ? 64  THR A OG1  1  
ATOM 985   C CG2  . THR A 1 64  ? -11.890 -0.168  3.084   1.00 0.00 ? 64  THR A CG2  1  
ATOM 986   H H    . THR A 1 64  ? -9.540  -3.252  1.953   1.00 0.00 ? 64  THR A H    1  
ATOM 987   H HA   . THR A 1 64  ? -10.709 -2.209  4.318   1.00 0.00 ? 64  THR A HA   1  
ATOM 988   H HB   . THR A 1 64  ? -11.469 -1.509  1.469   1.00 0.00 ? 64  THR A HB   1  
ATOM 989   H HG1  . THR A 1 64  ? -9.163  -1.199  2.909   1.00 0.00 ? 64  THR A HG1  1  
ATOM 990   H HG21 . THR A 1 64  ? -11.328 0.292   3.881   1.00 0.00 ? 64  THR A HG21 1  
ATOM 991   H HG22 . THR A 1 64  ? -12.795 -0.604  3.483   1.00 0.00 ? 64  THR A HG22 1  
ATOM 992   H HG23 . THR A 1 64  ? -12.146 0.580   2.349   1.00 0.00 ? 64  THR A HG23 1  
ATOM 993   N N    . GLN A 1 65  ? -12.841 -3.741  2.318   1.00 0.00 ? 65  GLN A N    1  
ATOM 994   C CA   . GLN A 1 65  ? -14.203 -4.348  2.309   1.00 0.00 ? 65  GLN A CA   1  
ATOM 995   C C    . GLN A 1 65  ? -14.188 -5.687  3.051   1.00 0.00 ? 65  GLN A C    1  
ATOM 996   O O    . GLN A 1 65  ? -15.121 -6.028  3.749   1.00 0.00 ? 65  GLN A O    1  
ATOM 997   C CB   . GLN A 1 65  ? -14.660 -4.536  0.853   1.00 0.00 ? 65  GLN A CB   1  
ATOM 998   C CG   . GLN A 1 65  ? -15.043 -5.996  0.586   1.00 0.00 ? 65  GLN A CG   1  
ATOM 999   C CD   . GLN A 1 65  ? -16.296 -6.358  1.387   1.00 0.00 ? 65  GLN A CD   1  
ATOM 1000  O OE1  . GLN A 1 65  ? -17.314 -5.704  1.273   1.00 0.00 ? 65  GLN A OE1  1  
ATOM 1001  N NE2  . GLN A 1 65  ? -16.266 -7.383  2.193   1.00 0.00 ? 65  GLN A NE2  1  
ATOM 1002  H H    . GLN A 1 65  ? -12.270 -3.809  1.526   1.00 0.00 ? 65  GLN A H    1  
ATOM 1003  H HA   . GLN A 1 65  ? -14.884 -3.681  2.809   1.00 0.00 ? 65  GLN A HA   1  
ATOM 1004  H HB2  . GLN A 1 65  ? -15.516 -3.903  0.666   1.00 0.00 ? 65  GLN A HB2  1  
ATOM 1005  H HB3  . GLN A 1 65  ? -13.856 -4.251  0.190   1.00 0.00 ? 65  GLN A HB3  1  
ATOM 1006  H HG2  . GLN A 1 65  ? -15.244 -6.122  -0.468  1.00 0.00 ? 65  GLN A HG2  1  
ATOM 1007  H HG3  . GLN A 1 65  ? -14.231 -6.645  0.873   1.00 0.00 ? 65  GLN A HG3  1  
ATOM 1008  H HE21 . GLN A 1 65  ? -15.444 -7.911  2.282   1.00 0.00 ? 65  GLN A HE21 1  
ATOM 1009  H HE22 . GLN A 1 65  ? -17.062 -7.624  2.711   1.00 0.00 ? 65  GLN A HE22 1  
ATOM 1010  N N    . GLU A 1 66  ? -13.146 -6.455  2.899   1.00 0.00 ? 66  GLU A N    1  
ATOM 1011  C CA   . GLU A 1 66  ? -13.090 -7.775  3.592   1.00 0.00 ? 66  GLU A CA   1  
ATOM 1012  C C    . GLU A 1 66  ? -13.079 -7.588  5.113   1.00 0.00 ? 66  GLU A C    1  
ATOM 1013  O O    . GLU A 1 66  ? -13.687 -8.345  5.841   1.00 0.00 ? 66  GLU A O    1  
ATOM 1014  C CB   . GLU A 1 66  ? -11.819 -8.508  3.165   1.00 0.00 ? 66  GLU A CB   1  
ATOM 1015  C CG   . GLU A 1 66  ? -11.932 -8.922  1.697   1.00 0.00 ? 66  GLU A CG   1  
ATOM 1016  C CD   . GLU A 1 66  ? -13.060 -9.942  1.537   1.00 0.00 ? 66  GLU A CD   1  
ATOM 1017  O OE1  . GLU A 1 66  ? -13.478 -10.164 0.412   1.00 0.00 ? 66  GLU A OE1  1  
ATOM 1018  O OE2  . GLU A 1 66  ? -13.488 -10.487 2.542   1.00 0.00 ? 66  GLU A OE2  1  
ATOM 1019  H H    . GLU A 1 66  ? -12.403 -6.170  2.325   1.00 0.00 ? 66  GLU A H    1  
ATOM 1020  H HA   . GLU A 1 66  ? -13.952 -8.362  3.311   1.00 0.00 ? 66  GLU A HA   1  
ATOM 1021  H HB2  . GLU A 1 66  ? -10.969 -7.853  3.289   1.00 0.00 ? 66  GLU A HB2  1  
ATOM 1022  H HB3  . GLU A 1 66  ? -11.688 -9.388  3.776   1.00 0.00 ? 66  GLU A HB3  1  
ATOM 1023  H HG2  . GLU A 1 66  ? -12.148 -8.052  1.095   1.00 0.00 ? 66  GLU A HG2  1  
ATOM 1024  H HG3  . GLU A 1 66  ? -11.002 -9.362  1.374   1.00 0.00 ? 66  GLU A HG3  1  
ATOM 1025  H HE2  . GLU A 1 66  ? -14.193 -11.114 2.366   1.00 0.00 ? 66  GLU A HE2  1  
ATOM 1026  N N    . GLU A 1 67  ? -12.385 -6.597  5.601   1.00 0.00 ? 67  GLU A N    1  
ATOM 1027  C CA   . GLU A 1 67  ? -12.334 -6.385  7.078   1.00 0.00 ? 67  GLU A CA   1  
ATOM 1028  C C    . GLU A 1 67  ? -13.247 -5.226  7.487   1.00 0.00 ? 67  GLU A C    1  
ATOM 1029  O O    . GLU A 1 67  ? -13.243 -4.800  8.625   1.00 0.00 ? 67  GLU A O    1  
ATOM 1030  C CB   . GLU A 1 67  ? -10.895 -6.073  7.496   1.00 0.00 ? 67  GLU A CB   1  
ATOM 1031  C CG   . GLU A 1 67  ? -9.999  -7.264  7.156   1.00 0.00 ? 67  GLU A CG   1  
ATOM 1032  C CD   . GLU A 1 67  ? -8.571  -6.979  7.627   1.00 0.00 ? 67  GLU A CD   1  
ATOM 1033  O OE1  . GLU A 1 67  ? -7.773  -7.900  7.614   1.00 0.00 ? 67  GLU A OE1  1  
ATOM 1034  O OE2  . GLU A 1 67  ? -8.302  -5.847  7.993   1.00 0.00 ? 67  GLU A OE2  1  
ATOM 1035  H H    . GLU A 1 67  ? -11.891 -5.999  5.001   1.00 0.00 ? 67  GLU A H    1  
ATOM 1036  H HA   . GLU A 1 67  ? -12.658 -7.286  7.577   1.00 0.00 ? 67  GLU A HA   1  
ATOM 1037  H HB2  . GLU A 1 67  ? -10.550 -5.199  6.965   1.00 0.00 ? 67  GLU A HB2  1  
ATOM 1038  H HB3  . GLU A 1 67  ? -10.859 -5.890  8.560   1.00 0.00 ? 67  GLU A HB3  1  
ATOM 1039  H HG2  . GLU A 1 67  ? -10.374 -8.147  7.650   1.00 0.00 ? 67  GLU A HG2  1  
ATOM 1040  H HG3  . GLU A 1 67  ? -9.999  -7.422  6.089   1.00 0.00 ? 67  GLU A HG3  1  
ATOM 1041  H HE2  . GLU A 1 67  ? -7.390  -5.744  8.274   1.00 0.00 ? 67  GLU A HE2  1  
ATOM 1042  N N    . ALA A 1 68  ? -14.027 -4.709  6.580   1.00 0.00 ? 68  ALA A N    1  
ATOM 1043  C CA   . ALA A 1 68  ? -14.929 -3.577  6.943   1.00 0.00 ? 68  ALA A CA   1  
ATOM 1044  C C    . ALA A 1 68  ? -16.193 -3.623  6.087   1.00 0.00 ? 68  ALA A C    1  
ATOM 1045  O O    . ALA A 1 68  ? -17.234 -3.140  6.478   1.00 0.00 ? 68  ALA A O    1  
ATOM 1046  C CB   . ALA A 1 68  ? -14.212 -2.253  6.694   1.00 0.00 ? 68  ALA A CB   1  
ATOM 1047  H H    . ALA A 1 68  ? -14.020 -5.061  5.666   1.00 0.00 ? 68  ALA A H    1  
ATOM 1048  H HA   . ALA A 1 68  ? -15.197 -3.649  7.985   1.00 0.00 ? 68  ALA A HA   1  
ATOM 1049  H HB1  . ALA A 1 68  ? -14.616 -1.786  5.808   1.00 0.00 ? 68  ALA A HB1  1  
ATOM 1050  H HB2  . ALA A 1 68  ? -13.156 -2.433  6.558   1.00 0.00 ? 68  ALA A HB2  1  
ATOM 1051  H HB3  . ALA A 1 68  ? -14.359 -1.601  7.542   1.00 0.00 ? 68  ALA A HB3  1  
ATOM 1052  N N    . GLY A 1 69  ? -16.111 -4.189  4.918   1.00 0.00 ? 69  GLY A N    1  
ATOM 1053  C CA   . GLY A 1 69  ? -17.312 -4.253  4.041   1.00 0.00 ? 69  GLY A CA   1  
ATOM 1054  C C    . GLY A 1 69  ? -17.331 -3.031  3.123   1.00 0.00 ? 69  GLY A C    1  
ATOM 1055  O O    . GLY A 1 69  ? -18.196 -2.886  2.282   1.00 0.00 ? 69  GLY A O    1  
ATOM 1056  H H    . GLY A 1 69  ? -15.259 -4.567  4.613   1.00 0.00 ? 69  GLY A H    1  
ATOM 1057  H HA2  . GLY A 1 69  ? -17.278 -5.153  3.446   1.00 0.00 ? 69  GLY A HA2  1  
ATOM 1058  H HA3  . GLY A 1 69  ? -18.205 -4.252  4.648   1.00 0.00 ? 69  GLY A HA3  1  
ATOM 1059  N N    . ILE A 1 70  ? -16.382 -2.148  3.280   1.00 0.00 ? 70  ILE A N    1  
ATOM 1060  C CA   . ILE A 1 70  ? -16.348 -0.938  2.419   1.00 0.00 ? 70  ILE A CA   1  
ATOM 1061  C C    . ILE A 1 70  ? -15.228 -1.089  1.386   1.00 0.00 ? 70  ILE A C    1  
ATOM 1062  O O    . ILE A 1 70  ? -14.081 -1.297  1.729   1.00 0.00 ? 70  ILE A O    1  
ATOM 1063  C CB   . ILE A 1 70  ? -16.078 0.300   3.274   1.00 0.00 ? 70  ILE A CB   1  
ATOM 1064  C CG1  . ILE A 1 70  ? -16.910 0.252   4.558   1.00 0.00 ? 70  ILE A CG1  1  
ATOM 1065  C CG2  . ILE A 1 70  ? -16.489 1.533   2.474   1.00 0.00 ? 70  ILE A CG2  1  
ATOM 1066  C CD1  . ILE A 1 70  ? -16.278 1.155   5.621   1.00 0.00 ? 70  ILE A CD1  1  
ATOM 1067  H H    . ILE A 1 70  ? -15.696 -2.281  3.966   1.00 0.00 ? 70  ILE A H    1  
ATOM 1068  H HA   . ILE A 1 70  ? -17.292 -0.826  1.911   1.00 0.00 ? 70  ILE A HA   1  
ATOM 1069  H HB   . ILE A 1 70  ? -15.026 0.351   3.515   1.00 0.00 ? 70  ILE A HB   1  
ATOM 1070  H HG12 . ILE A 1 70  ? -17.907 0.599   4.349   1.00 0.00 ? 70  ILE A HG12 1  
ATOM 1071  H HG13 . ILE A 1 70  ? -16.954 -0.762  4.930   1.00 0.00 ? 70  ILE A HG13 1  
ATOM 1072  H HG21 . ILE A 1 70  ? -16.256 2.420   3.038   1.00 0.00 ? 70  ILE A HG21 1  
ATOM 1073  H HG22 . ILE A 1 70  ? -17.550 1.496   2.284   1.00 0.00 ? 70  ILE A HG22 1  
ATOM 1074  H HG23 . ILE A 1 70  ? -15.959 1.547   1.538   1.00 0.00 ? 70  ILE A HG23 1  
ATOM 1075  H HD11 . ILE A 1 70  ? -15.996 0.561   6.477   1.00 0.00 ? 70  ILE A HD11 1  
ATOM 1076  H HD12 . ILE A 1 70  ? -16.995 1.906   5.925   1.00 0.00 ? 70  ILE A HD12 1  
ATOM 1077  H HD13 . ILE A 1 70  ? -15.403 1.639   5.213   1.00 0.00 ? 70  ILE A HD13 1  
ATOM 1078  N N    . GLU A 1 71  ? -15.553 -0.987  0.126   1.00 0.00 ? 71  GLU A N    1  
ATOM 1079  C CA   . GLU A 1 71  ? -14.511 -1.126  -0.932  1.00 0.00 ? 71  GLU A CA   1  
ATOM 1080  C C    . GLU A 1 71  ? -14.362 0.205   -1.675  1.00 0.00 ? 71  GLU A C    1  
ATOM 1081  O O    . GLU A 1 71  ? -15.086 1.146   -1.426  1.00 0.00 ? 71  GLU A O    1  
ATOM 1082  C CB   . GLU A 1 71  ? -14.925 -2.237  -1.905  1.00 0.00 ? 71  GLU A CB   1  
ATOM 1083  C CG   . GLU A 1 71  ? -15.395 -1.633  -3.230  1.00 0.00 ? 71  GLU A CG   1  
ATOM 1084  C CD   . GLU A 1 71  ? -16.048 -2.723  -4.081  1.00 0.00 ? 71  GLU A CD   1  
ATOM 1085  O OE1  . GLU A 1 71  ? -15.980 -3.875  -3.685  1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1086  O OE2  . GLU A 1 71  ? -16.606 -2.385  -5.111  1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1087  H H    . GLU A 1 71  ? -16.482 -0.819  -0.126  1.00 0.00 ? 71  GLU A H    1  
ATOM 1088  H HA   . GLU A 1 71  ? -13.567 -1.385  -0.474  1.00 0.00 ? 71  GLU A HA   1  
ATOM 1089  H HB2  . GLU A 1 71  ? -14.081 -2.887  -2.086  1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1090  H HB3  . GLU A 1 71  ? -15.728 -2.811  -1.469  1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1091  H HG2  . GLU A 1 71  ? -16.111 -0.847  -3.036  1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1092  H HG3  . GLU A 1 71  ? -14.548 -1.231  -3.760  1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1093  H HE2  . GLU A 1 71  ? -16.993 -3.119  -5.594  1.00 0.00 ? 71  GLU A HE2  1  
ATOM 1094  N N    . ALA A 1 72  ? -13.427 0.295   -2.584  1.00 0.00 ? 72  ALA A N    1  
ATOM 1095  C CA   . ALA A 1 72  ? -13.237 1.573   -3.330  1.00 0.00 ? 72  ALA A CA   1  
ATOM 1096  C C    . ALA A 1 72  ? -14.557 2.008   -3.959  1.00 0.00 ? 72  ALA A C    1  
ATOM 1097  O O    . ALA A 1 72  ? -14.850 3.182   -4.062  1.00 0.00 ? 72  ALA A O    1  
ATOM 1098  C CB   . ALA A 1 72  ? -12.183 1.383   -4.416  1.00 0.00 ? 72  ALA A CB   1  
ATOM 1099  H H    . ALA A 1 72  ? -12.852 -0.474  -2.769  1.00 0.00 ? 72  ALA A H    1  
ATOM 1100  H HA   . ALA A 1 72  ? -12.907 2.338   -2.653  1.00 0.00 ? 72  ALA A HA   1  
ATOM 1101  H HB1  . ALA A 1 72  ? -12.597 1.658   -5.375  1.00 0.00 ? 72  ALA A HB1  1  
ATOM 1102  H HB2  . ALA A 1 72  ? -11.872 0.348   -4.439  1.00 0.00 ? 72  ALA A HB2  1  
ATOM 1103  H HB3  . ALA A 1 72  ? -11.332 2.010   -4.197  1.00 0.00 ? 72  ALA A HB3  1  
ATOM 1104  N N    . GLY A 1 73  ? -15.370 1.074   -4.362  1.00 0.00 ? 73  GLY A N    1  
ATOM 1105  C CA   . GLY A 1 73  ? -16.678 1.446   -4.960  1.00 0.00 ? 73  GLY A CA   1  
ATOM 1106  C C    . GLY A 1 73  ? -17.557 2.059   -3.871  1.00 0.00 ? 73  GLY A C    1  
ATOM 1107  O O    . GLY A 1 73  ? -18.610 2.603   -4.136  1.00 0.00 ? 73  GLY A O    1  
ATOM 1108  H H    . GLY A 1 73  ? -15.126 0.133   -4.255  1.00 0.00 ? 73  GLY A H    1  
ATOM 1109  H HA2  . GLY A 1 73  ? -16.521 2.163   -5.754  1.00 0.00 ? 73  GLY A HA2  1  
ATOM 1110  H HA3  . GLY A 1 73  ? -17.161 0.564   -5.356  1.00 0.00 ? 73  GLY A HA3  1  
ATOM 1111  N N    . GLN A 1 74  ? -17.128 1.963   -2.637  1.00 0.00 ? 74  GLN A N    1  
ATOM 1112  C CA   . GLN A 1 74  ? -17.935 2.527   -1.517  1.00 0.00 ? 74  GLN A CA   1  
ATOM 1113  C C    . GLN A 1 74  ? -17.207 3.709   -0.863  1.00 0.00 ? 74  GLN A C    1  
ATOM 1114  O O    . GLN A 1 74  ? -17.798 4.457   -0.111  1.00 0.00 ? 74  GLN A O    1  
ATOM 1115  C CB   . GLN A 1 74  ? -18.196 1.435   -0.482  1.00 0.00 ? 74  GLN A CB   1  
ATOM 1116  C CG   . GLN A 1 74  ? -19.066 0.346   -1.112  1.00 0.00 ? 74  GLN A CG   1  
ATOM 1117  C CD   . GLN A 1 74  ? -19.366 -0.734  -0.072  1.00 0.00 ? 74  GLN A CD   1  
ATOM 1118  O OE1  . GLN A 1 74  ? -18.566 -1.619  0.152   1.00 0.00 ? 74  GLN A OE1  1  
ATOM 1119  N NE2  . GLN A 1 74  ? -20.498 -0.699  0.579   1.00 0.00 ? 74  GLN A NE2  1  
ATOM 1120  H H    . GLN A 1 74  ? -16.278 1.513   -2.448  1.00 0.00 ? 74  GLN A H    1  
ATOM 1121  H HA   . GLN A 1 74  ? -18.880 2.876   -1.907  1.00 0.00 ? 74  GLN A HA   1  
ATOM 1122  H HB2  . GLN A 1 74  ? -17.258 1.005   -0.165  1.00 0.00 ? 74  GLN A HB2  1  
ATOM 1123  H HB3  . GLN A 1 74  ? -18.711 1.857   0.369   1.00 0.00 ? 74  GLN A HB3  1  
ATOM 1124  H HG2  . GLN A 1 74  ? -19.992 0.783   -1.458  1.00 0.00 ? 74  GLN A HG2  1  
ATOM 1125  H HG3  . GLN A 1 74  ? -18.542 -0.097  -1.946  1.00 0.00 ? 74  GLN A HG3  1  
ATOM 1126  H HE21 . GLN A 1 74  ? -21.144 0.014   0.398   1.00 0.00 ? 74  GLN A HE21 1  
ATOM 1127  H HE22 . GLN A 1 74  ? -20.699 -1.385  1.248   1.00 0.00 ? 74  GLN A HE22 1  
ATOM 1128  N N    . LEU A 1 75  ? -15.941 3.911   -1.150  1.00 0.00 ? 75  LEU A N    1  
ATOM 1129  C CA   . LEU A 1 75  ? -15.235 5.083   -0.544  1.00 0.00 ? 75  LEU A CA   1  
ATOM 1130  C C    . LEU A 1 75  ? -14.546 5.885   -1.642  1.00 0.00 ? 75  LEU A C    1  
ATOM 1131  O O    . LEU A 1 75  ? -14.659 5.592   -2.815  1.00 0.00 ? 75  LEU A O    1  
ATOM 1132  C CB   . LEU A 1 75  ? -14.168 4.681   0.500   1.00 0.00 ? 75  LEU A CB   1  
ATOM 1133  C CG   . LEU A 1 75  ? -13.966 3.165   0.559   1.00 0.00 ? 75  LEU A CG   1  
ATOM 1134  C CD1  . LEU A 1 75  ? -12.715 2.798   -0.235  1.00 0.00 ? 75  LEU A CD1  1  
ATOM 1135  C CD2  . LEU A 1 75  ? -13.767 2.730   2.011   1.00 0.00 ? 75  LEU A CD2  1  
ATOM 1136  H H    . LEU A 1 75  ? -15.474 3.315   -1.773  1.00 0.00 ? 75  LEU A H    1  
ATOM 1137  H HA   . LEU A 1 75  ? -15.968 5.717   -0.073  1.00 0.00 ? 75  LEU A HA   1  
ATOM 1138  H HB2  . LEU A 1 75  ? -13.230 5.150   0.240   1.00 0.00 ? 75  LEU A HB2  1  
ATOM 1139  H HB3  . LEU A 1 75  ? -14.474 5.036   1.469   1.00 0.00 ? 75  LEU A HB3  1  
ATOM 1140  H HG   . LEU A 1 75  ? -14.822 2.667   0.146   1.00 0.00 ? 75  LEU A HG   1  
ATOM 1141  H HD11 . LEU A 1 75  ? -11.847 2.872   0.407   1.00 0.00 ? 75  LEU A HD11 1  
ATOM 1142  H HD12 . LEU A 1 75  ? -12.604 3.476   -1.065  1.00 0.00 ? 75  LEU A HD12 1  
ATOM 1143  H HD13 . LEU A 1 75  ? -12.801 1.784   -0.601  1.00 0.00 ? 75  LEU A HD13 1  
ATOM 1144  H HD21 . LEU A 1 75  ? -13.960 1.673   2.098   1.00 0.00 ? 75  LEU A HD21 1  
ATOM 1145  H HD22 . LEU A 1 75  ? -14.443 3.270   2.648   1.00 0.00 ? 75  LEU A HD22 1  
ATOM 1146  H HD23 . LEU A 1 75  ? -12.750 2.932   2.311   1.00 0.00 ? 75  LEU A HD23 1  
ATOM 1147  N N    . THR A 1 76  ? -13.827 6.896   -1.251  1.00 0.00 ? 76  THR A N    1  
ATOM 1148  C CA   . THR A 1 76  ? -13.107 7.739   -2.238  1.00 0.00 ? 76  THR A CA   1  
ATOM 1149  C C    . THR A 1 76  ? -11.638 7.810   -1.831  1.00 0.00 ? 76  THR A C    1  
ATOM 1150  O O    . THR A 1 76  ? -11.283 8.467   -0.876  1.00 0.00 ? 76  THR A O    1  
ATOM 1151  C CB   . THR A 1 76  ? -13.713 9.147   -2.234  1.00 0.00 ? 76  THR A CB   1  
ATOM 1152  O OG1  . THR A 1 76  ? -14.998 9.110   -2.837  1.00 0.00 ? 76  THR A OG1  1  
ATOM 1153  C CG2  . THR A 1 76  ? -12.809 10.105  -3.009  1.00 0.00 ? 76  THR A CG2  1  
ATOM 1154  H H    . THR A 1 76  ? -13.753 7.099   -0.297  1.00 0.00 ? 76  THR A H    1  
ATOM 1155  H HA   . THR A 1 76  ? -13.194 7.306   -3.225  1.00 0.00 ? 76  THR A HA   1  
ATOM 1156  H HB   . THR A 1 76  ? -13.805 9.493   -1.216  1.00 0.00 ? 76  THR A HB   1  
ATOM 1157  H HG1  . THR A 1 76  ? -14.929 9.509   -3.708  1.00 0.00 ? 76  THR A HG1  1  
ATOM 1158  H HG21 . THR A 1 76  ? -12.241 10.705  -2.313  1.00 0.00 ? 76  THR A HG21 1  
ATOM 1159  H HG22 . THR A 1 76  ? -13.416 10.751  -3.627  1.00 0.00 ? 76  THR A HG22 1  
ATOM 1160  H HG23 . THR A 1 76  ? -12.133 9.539   -3.633  1.00 0.00 ? 76  THR A HG23 1  
ATOM 1161  N N    . ILE A 1 77  ? -10.779 7.136   -2.547  1.00 0.00 ? 77  ILE A N    1  
ATOM 1162  C CA   . ILE A 1 77  ? -9.335  7.166   -2.189  1.00 0.00 ? 77  ILE A CA   1  
ATOM 1163  C C    . ILE A 1 77  ? -8.767  8.530   -2.577  1.00 0.00 ? 77  ILE A C    1  
ATOM 1164  O O    . ILE A 1 77  ? -8.914  8.976   -3.700  1.00 0.00 ? 77  ILE A O    1  
ATOM 1165  C CB   . ILE A 1 77  ? -8.592  6.062   -2.950  1.00 0.00 ? 77  ILE A CB   1  
ATOM 1166  C CG1  . ILE A 1 77  ? -9.415  4.764   -2.923  1.00 0.00 ? 77  ILE A CG1  1  
ATOM 1167  C CG2  . ILE A 1 77  ? -7.228  5.816   -2.299  1.00 0.00 ? 77  ILE A CG2  1  
ATOM 1168  C CD1  . ILE A 1 77  ? -9.458  4.194   -1.502  1.00 0.00 ? 77  ILE A CD1  1  
ATOM 1169  H H    . ILE A 1 77  ? -11.084 6.608   -3.314  1.00 0.00 ? 77  ILE A H    1  
ATOM 1170  H HA   . ILE A 1 77  ? -9.220  7.017   -1.126  1.00 0.00 ? 77  ILE A HA   1  
ATOM 1171  H HB   . ILE A 1 77  ? -8.447  6.374   -3.975  1.00 0.00 ? 77  ILE A HB   1  
ATOM 1172  H HG12 . ILE A 1 77  ? -10.420 4.968   -3.257  1.00 0.00 ? 77  ILE A HG12 1  
ATOM 1173  H HG13 . ILE A 1 77  ? -8.961  4.040   -3.582  1.00 0.00 ? 77  ILE A HG13 1  
ATOM 1174  H HG21 . ILE A 1 77  ? -6.637  5.174   -2.935  1.00 0.00 ? 77  ILE A HG21 1  
ATOM 1175  H HG22 . ILE A 1 77  ? -7.364  5.344   -1.337  1.00 0.00 ? 77  ILE A HG22 1  
ATOM 1176  H HG23 . ILE A 1 77  ? -6.719  6.758   -2.167  1.00 0.00 ? 77  ILE A HG23 1  
ATOM 1177  H HD11 . ILE A 1 77  ? -8.963  4.870   -0.826  1.00 0.00 ? 77  ILE A HD11 1  
ATOM 1178  H HD12 . ILE A 1 77  ? -8.957  3.236   -1.486  1.00 0.00 ? 77  ILE A HD12 1  
ATOM 1179  H HD13 . ILE A 1 77  ? -10.485 4.066   -1.196  1.00 0.00 ? 77  ILE A HD13 1  
ATOM 1180  N N    . ILE A 1 78  ? -8.131  9.206   -1.663  1.00 0.00 ? 78  ILE A N    1  
ATOM 1181  C CA   . ILE A 1 78  ? -7.574  10.546  -1.990  1.00 0.00 ? 78  ILE A CA   1  
ATOM 1182  C C    . ILE A 1 78  ? -6.198  10.392  -2.631  1.00 0.00 ? 78  ILE A C    1  
ATOM 1183  O O    . ILE A 1 78  ? -5.394  9.575   -2.230  1.00 0.00 ? 78  ILE A O    1  
ATOM 1184  C CB   . ILE A 1 78  ? -7.474  11.388  -0.719  1.00 0.00 ? 78  ILE A CB   1  
ATOM 1185  C CG1  . ILE A 1 78  ? -8.505  12.514  -0.785  1.00 0.00 ? 78  ILE A CG1  1  
ATOM 1186  C CG2  . ILE A 1 78  ? -6.071  11.990  -0.597  1.00 0.00 ? 78  ILE A CG2  1  
ATOM 1187  C CD1  . ILE A 1 78  ? -9.916  11.921  -0.734  1.00 0.00 ? 78  ILE A CD1  1  
ATOM 1188  H H    . ILE A 1 78  ? -8.029  8.838   -0.760  1.00 0.00 ? 78  ILE A H    1  
ATOM 1189  H HA   . ILE A 1 78  ? -8.234  11.039  -2.691  1.00 0.00 ? 78  ILE A HA   1  
ATOM 1190  H HB   . ILE A 1 78  ? -7.674  10.765  0.136   1.00 0.00 ? 78  ILE A HB   1  
ATOM 1191  H HG12 . ILE A 1 78  ? -8.362  13.181  0.046   1.00 0.00 ? 78  ILE A HG12 1  
ATOM 1192  H HG13 . ILE A 1 78  ? -8.384  13.061  -1.706  1.00 0.00 ? 78  ILE A HG13 1  
ATOM 1193  H HG21 . ILE A 1 78  ? -5.845  12.565  -1.483  1.00 0.00 ? 78  ILE A HG21 1  
ATOM 1194  H HG22 . ILE A 1 78  ? -5.346  11.197  -0.487  1.00 0.00 ? 78  ILE A HG22 1  
ATOM 1195  H HG23 . ILE A 1 78  ? -6.032  12.634  0.268   1.00 0.00 ? 78  ILE A HG23 1  
ATOM 1196  H HD11 . ILE A 1 78  ? -10.616 12.681  -0.423  1.00 0.00 ? 78  ILE A HD11 1  
ATOM 1197  H HD12 . ILE A 1 78  ? -9.936  11.103  -0.028  1.00 0.00 ? 78  ILE A HD12 1  
ATOM 1198  H HD13 . ILE A 1 78  ? -10.191 11.557  -1.713  1.00 0.00 ? 78  ILE A HD13 1  
ATOM 1199  N N    . GLU A 1 79  ? -5.934  11.172  -3.638  1.00 0.00 ? 79  GLU A N    1  
ATOM 1200  C CA   . GLU A 1 79  ? -4.624  11.083  -4.336  1.00 0.00 ? 79  GLU A CA   1  
ATOM 1201  C C    . GLU A 1 79  ? -3.697  12.204  -3.862  1.00 0.00 ? 79  GLU A C    1  
ATOM 1202  O O    . GLU A 1 79  ? -4.137  13.266  -3.474  1.00 0.00 ? 79  GLU A O    1  
ATOM 1203  C CB   . GLU A 1 79  ? -4.853  11.207  -5.841  1.00 0.00 ? 79  GLU A CB   1  
ATOM 1204  C CG   . GLU A 1 79  ? -5.762  10.070  -6.311  1.00 0.00 ? 79  GLU A CG   1  
ATOM 1205  C CD   . GLU A 1 79  ? -5.960  10.162  -7.824  1.00 0.00 ? 79  GLU A CD   1  
ATOM 1206  O OE1  . GLU A 1 79  ? -5.557  11.161  -8.396  1.00 0.00 ? 79  GLU A OE1  1  
ATOM 1207  O OE2  . GLU A 1 79  ? -6.515  9.232   -8.387  1.00 0.00 ? 79  GLU A OE2  1  
ATOM 1208  H H    . GLU A 1 79  ? -6.608  11.816  -3.941  1.00 0.00 ? 79  GLU A H    1  
ATOM 1209  H HA   . GLU A 1 79  ? -4.168  10.126  -4.121  1.00 0.00 ? 79  GLU A HA   1  
ATOM 1210  H HB2  . GLU A 1 79  ? -5.321  12.157  -6.053  1.00 0.00 ? 79  GLU A HB2  1  
ATOM 1211  H HB3  . GLU A 1 79  ? -3.907  11.146  -6.356  1.00 0.00 ? 79  GLU A HB3  1  
ATOM 1212  H HG2  . GLU A 1 79  ? -5.307  9.122   -6.065  1.00 0.00 ? 79  GLU A HG2  1  
ATOM 1213  H HG3  . GLU A 1 79  ? -6.720  10.148  -5.817  1.00 0.00 ? 79  GLU A HG3  1  
ATOM 1214  H HE2  . GLU A 1 79  ? -6.605  9.358   -9.334  1.00 0.00 ? 79  GLU A HE2  1  
ATOM 1215  N N    . GLY A 1 80  ? -2.412  11.973  -3.903  1.00 0.00 ? 80  GLY A N    1  
ATOM 1216  C CA   . GLY A 1 80  ? -1.449  13.023  -3.466  1.00 0.00 ? 80  GLY A CA   1  
ATOM 1217  C C    . GLY A 1 80  ? -0.884  12.668  -2.091  1.00 0.00 ? 80  GLY A C    1  
ATOM 1218  O O    . GLY A 1 80  ? 0.189   13.101  -1.721  1.00 0.00 ? 80  GLY A O    1  
ATOM 1219  H H    . GLY A 1 80  ? -2.080  11.110  -4.223  1.00 0.00 ? 80  GLY A H    1  
ATOM 1220  H HA2  . GLY A 1 80  ? -0.644  13.088  -4.182  1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1221  H HA3  . GLY A 1 80  ? -1.955  13.974  -3.407  1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1222  N N    . PHE A 1 81  ? -1.593  11.878  -1.336  1.00 0.00 ? 81  PHE A N    1  
ATOM 1223  C CA   . PHE A 1 81  ? -1.090  11.492  0.015   1.00 0.00 ? 81  PHE A CA   1  
ATOM 1224  C C    . PHE A 1 81  ? -0.656  10.027  0.014   1.00 0.00 ? 81  PHE A C    1  
ATOM 1225  O O    . PHE A 1 81  ? -1.397  9.152   -0.387  1.00 0.00 ? 81  PHE A O    1  
ATOM 1226  C CB   . PHE A 1 81  ? -2.197  11.672  1.053   1.00 0.00 ? 81  PHE A CB   1  
ATOM 1227  C CG   . PHE A 1 81  ? -1.702  11.144  2.378   1.00 0.00 ? 81  PHE A CG   1  
ATOM 1228  C CD1  . PHE A 1 81  ? -1.792  9.774   2.661   1.00 0.00 ? 81  PHE A CD1  1  
ATOM 1229  C CD2  . PHE A 1 81  ? -1.155  12.019  3.322   1.00 0.00 ? 81  PHE A CD2  1  
ATOM 1230  C CE1  . PHE A 1 81  ? -1.331  9.283   3.887   1.00 0.00 ? 81  PHE A CE1  1  
ATOM 1231  C CE2  . PHE A 1 81  ? -0.695  11.524  4.549   1.00 0.00 ? 81  PHE A CE2  1  
ATOM 1232  C CZ   . PHE A 1 81  ? -0.784  10.157  4.831   1.00 0.00 ? 81  PHE A CZ   1  
ATOM 1233  H H    . PHE A 1 81  ? -2.455  11.534  -1.655  1.00 0.00 ? 81  PHE A H    1  
ATOM 1234  H HA   . PHE A 1 81  ? -0.249  12.115  0.276   1.00 0.00 ? 81  PHE A HA   1  
ATOM 1235  H HB2  . PHE A 1 81  ? -2.439  12.721  1.146   1.00 0.00 ? 81  PHE A HB2  1  
ATOM 1236  H HB3  . PHE A 1 81  ? -3.073  11.122  0.749   1.00 0.00 ? 81  PHE A HB3  1  
ATOM 1237  H HD1  . PHE A 1 81  ? -2.215  9.100   1.931   1.00 0.00 ? 81  PHE A HD1  1  
ATOM 1238  H HD2  . PHE A 1 81  ? -1.087  13.073  3.105   1.00 0.00 ? 81  PHE A HD2  1  
ATOM 1239  H HE1  . PHE A 1 81  ? -1.398  8.227   4.104   1.00 0.00 ? 81  PHE A HE1  1  
ATOM 1240  H HE2  . PHE A 1 81  ? -0.272  12.200  5.277   1.00 0.00 ? 81  PHE A HE2  1  
ATOM 1241  H HZ   . PHE A 1 81  ? -0.427  9.777   5.778   1.00 0.00 ? 81  PHE A HZ   1  
ATOM 1242  N N    . LYS A 1 82  ? 0.529   9.746   0.481   1.00 0.00 ? 82  LYS A N    1  
ATOM 1243  C CA   . LYS A 1 82  ? 0.980   8.328   0.521   1.00 0.00 ? 82  LYS A CA   1  
ATOM 1244  C C    . LYS A 1 82  ? 2.088   8.167   1.561   1.00 0.00 ? 82  LYS A C    1  
ATOM 1245  O O    . LYS A 1 82  ? 3.043   8.915   1.595   1.00 0.00 ? 82  LYS A O    1  
ATOM 1246  C CB   . LYS A 1 82  ? 1.514   7.904   -0.839  1.00 0.00 ? 82  LYS A CB   1  
ATOM 1247  C CG   . LYS A 1 82  ? 1.262   6.409   -1.027  1.00 0.00 ? 82  LYS A CG   1  
ATOM 1248  C CD   . LYS A 1 82  ? 1.844   5.954   -2.363  1.00 0.00 ? 82  LYS A CD   1  
ATOM 1249  C CE   . LYS A 1 82  ? 3.363   5.823   -2.248  1.00 0.00 ? 82  LYS A CE   1  
ATOM 1250  N NZ   . LYS A 1 82  ? 4.020   6.745   -3.217  1.00 0.00 ? 82  LYS A NZ   1  
ATOM 1251  H H    . LYS A 1 82  ? 1.112   10.460  0.816   1.00 0.00 ? 82  LYS A H    1  
ATOM 1252  H HA   . LYS A 1 82  ? 0.146   7.698   0.790   1.00 0.00 ? 82  LYS A HA   1  
ATOM 1253  H HB2  . LYS A 1 82  ? 1.014   8.461   -1.617  1.00 0.00 ? 82  LYS A HB2  1  
ATOM 1254  H HB3  . LYS A 1 82  ? 2.573   8.094   -0.879  1.00 0.00 ? 82  LYS A HB3  1  
ATOM 1255  H HG2  . LYS A 1 82  ? 1.732   5.862   -0.220  1.00 0.00 ? 82  LYS A HG2  1  
ATOM 1256  H HG3  . LYS A 1 82  ? 0.200   6.221   -1.015  1.00 0.00 ? 82  LYS A HG3  1  
ATOM 1257  H HD2  . LYS A 1 82  ? 1.424   4.998   -2.628  1.00 0.00 ? 82  LYS A HD2  1  
ATOM 1258  H HD3  . LYS A 1 82  ? 1.604   6.678   -3.127  1.00 0.00 ? 82  LYS A HD3  1  
ATOM 1259  H HE2  . LYS A 1 82  ? 3.674   6.077   -1.246  1.00 0.00 ? 82  LYS A HE2  1  
ATOM 1260  H HE3  . LYS A 1 82  ? 3.650   4.806   -2.468  1.00 0.00 ? 82  LYS A HE3  1  
ATOM 1261  H HZ1  . LYS A 1 82  ? 3.296   7.200   -3.809  1.00 0.00 ? 82  LYS A HZ1  1  
ATOM 1262  H HZ2  . LYS A 1 82  ? 4.673   6.204   -3.821  1.00 0.00 ? 82  LYS A HZ2  1  
ATOM 1263  H HZ3  . LYS A 1 82  ? 4.548   7.474   -2.699  1.00 0.00 ? 82  LYS A HZ3  1  
ATOM 1264  N N    . ARG A 1 83  ? 1.964   7.183   2.399   1.00 0.00 ? 83  ARG A N    1  
ATOM 1265  C CA   . ARG A 1 83  ? 3.002   6.938   3.436   1.00 0.00 ? 83  ARG A CA   1  
ATOM 1266  C C    . ARG A 1 83  ? 2.866   5.505   3.938   1.00 0.00 ? 83  ARG A C    1  
ATOM 1267  O O    . ARG A 1 83  ? 1.771   5.001   4.087   1.00 0.00 ? 83  ARG A O    1  
ATOM 1268  C CB   . ARG A 1 83  ? 2.810   7.911   4.602   1.00 0.00 ? 83  ARG A CB   1  
ATOM 1269  C CG   . ARG A 1 83  ? 3.829   7.598   5.701   1.00 0.00 ? 83  ARG A CG   1  
ATOM 1270  C CD   . ARG A 1 83  ? 3.674   8.607   6.840   1.00 0.00 ? 83  ARG A CD   1  
ATOM 1271  N NE   . ARG A 1 83  ? 4.674   8.310   7.903   1.00 0.00 ? 83  ARG A NE   1  
ATOM 1272  C CZ   . ARG A 1 83  ? 5.920   8.664   7.743   1.00 0.00 ? 83  ARG A CZ   1  
ATOM 1273  N NH1  . ARG A 1 83  ? 6.286   9.291   6.660   1.00 0.00 ? 83  ARG A NH1  1  
ATOM 1274  N NH2  . ARG A 1 83  ? 6.798   8.390   8.670   1.00 0.00 ? 83  ARG A NH2  1  
ATOM 1275  H H    . ARG A 1 83  ? 1.188   6.591   2.336   1.00 0.00 ? 83  ARG A H    1  
ATOM 1276  H HA   . ARG A 1 83  ? 3.983   7.078   3.007   1.00 0.00 ? 83  ARG A HA   1  
ATOM 1277  H HB2  . ARG A 1 83  ? 2.951   8.923   4.254   1.00 0.00 ? 83  ARG A HB2  1  
ATOM 1278  H HB3  . ARG A 1 83  ? 1.811   7.801   5.000   1.00 0.00 ? 83  ARG A HB3  1  
ATOM 1279  H HG2  . ARG A 1 83  ? 3.658   6.601   6.077   1.00 0.00 ? 83  ARG A HG2  1  
ATOM 1280  H HG3  . ARG A 1 83  ? 4.828   7.667   5.294   1.00 0.00 ? 83  ARG A HG3  1  
ATOM 1281  H HD2  . ARG A 1 83  ? 3.839   9.605   6.461   1.00 0.00 ? 83  ARG A HD2  1  
ATOM 1282  H HD3  . ARG A 1 83  ? 2.680   8.537   7.252   1.00 0.00 ? 83  ARG A HD3  1  
ATOM 1283  H HE   . ARG A 1 83  ? 4.398   7.844   8.720   1.00 0.00 ? 83  ARG A HE   1  
ATOM 1284  H HH11 . ARG A 1 83  ? 5.613   9.502   5.951   1.00 0.00 ? 83  ARG A HH11 1  
ATOM 1285  H HH12 . ARG A 1 83  ? 7.242   9.562   6.537   1.00 0.00 ? 83  ARG A HH12 1  
ATOM 1286  H HH21 . ARG A 1 83  ? 6.517   7.911   9.500   1.00 0.00 ? 83  ARG A HH21 1  
ATOM 1287  H HH22 . ARG A 1 83  ? 7.754   8.659   8.547   1.00 0.00 ? 83  ARG A HH22 1  
ATOM 1288  N N    . GLU A 1 84  ? 3.954   4.838   4.206   1.00 0.00 ? 84  GLU A N    1  
ATOM 1289  C CA   . GLU A 1 84  ? 3.839   3.442   4.702   1.00 0.00 ? 84  GLU A CA   1  
ATOM 1290  C C    . GLU A 1 84  ? 4.500   3.317   6.066   1.00 0.00 ? 84  GLU A C    1  
ATOM 1291  O O    . GLU A 1 84  ? 5.565   3.849   6.304   1.00 0.00 ? 84  GLU A O    1  
ATOM 1292  C CB   . GLU A 1 84  ? 4.507   2.471   3.731   1.00 0.00 ? 84  GLU A CB   1  
ATOM 1293  C CG   . GLU A 1 84  ? 5.925   2.940   3.408   1.00 0.00 ? 84  GLU A CG   1  
ATOM 1294  C CD   . GLU A 1 84  ? 5.869   4.234   2.597   1.00 0.00 ? 84  GLU A CD   1  
ATOM 1295  O OE1  . GLU A 1 84  ? 6.870   4.929   2.555   1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1296  O OE2  . GLU A 1 84  ? 4.824   4.509   2.029   1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1297  H H    . GLU A 1 84  ? 4.834   5.252   4.087   1.00 0.00 ? 84  GLU A H    1  
ATOM 1298  H HA   . GLU A 1 84  ? 2.800   3.194   4.790   1.00 0.00 ? 84  GLU A HA   1  
ATOM 1299  H HB2  . GLU A 1 84  ? 4.547   1.491   4.182   1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1300  H HB3  . GLU A 1 84  ? 3.933   2.425   2.829   1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1301  H HG2  . GLU A 1 84  ? 6.462   3.111   4.326   1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1302  H HG3  . GLU A 1 84  ? 6.432   2.181   2.832   1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1303  H HE2  . GLU A 1 84  ? 4.860   5.334   1.540   1.00 0.00 ? 84  GLU A HE2  1  
ATOM 1304  N N    . LEU A 1 85  ? 3.885   2.597   6.960   1.00 0.00 ? 85  LEU A N    1  
ATOM 1305  C CA   . LEU A 1 85  ? 4.493   2.423   8.297   1.00 0.00 ? 85  LEU A CA   1  
ATOM 1306  C C    . LEU A 1 85  ? 5.317   1.139   8.262   1.00 0.00 ? 85  LEU A C    1  
ATOM 1307  O O    . LEU A 1 85  ? 4.799   0.065   8.032   1.00 0.00 ? 85  LEU A O    1  
ATOM 1308  C CB   . LEU A 1 85  ? 3.392   2.310   9.357   1.00 0.00 ? 85  LEU A CB   1  
ATOM 1309  C CG   . LEU A 1 85  ? 2.374   3.439   9.167   1.00 0.00 ? 85  LEU A CG   1  
ATOM 1310  C CD1  . LEU A 1 85  ? 1.551   3.620   10.446  1.00 0.00 ? 85  LEU A CD1  1  
ATOM 1311  C CD2  . LEU A 1 85  ? 3.098   4.747   8.843   1.00 0.00 ? 85  LEU A CD2  1  
ATOM 1312  H H    . LEU A 1 85  ? 3.033   2.164   6.744   1.00 0.00 ? 85  LEU A H    1  
ATOM 1313  H HA   . LEU A 1 85  ? 5.133   3.259   8.519   1.00 0.00 ? 85  LEU A HA   1  
ATOM 1314  H HB2  . LEU A 1 85  ? 2.897   1.355   9.257   1.00 0.00 ? 85  LEU A HB2  1  
ATOM 1315  H HB3  . LEU A 1 85  ? 3.833   2.383   10.341  1.00 0.00 ? 85  LEU A HB3  1  
ATOM 1316  H HG   . LEU A 1 85  ? 1.712   3.185   8.353   1.00 0.00 ? 85  LEU A HG   1  
ATOM 1317  H HD11 . LEU A 1 85  ? 0.501   3.600   10.205  1.00 0.00 ? 85  LEU A HD11 1  
ATOM 1318  H HD12 . LEU A 1 85  ? 1.797   4.570   10.899  1.00 0.00 ? 85  LEU A HD12 1  
ATOM 1319  H HD13 . LEU A 1 85  ? 1.777   2.822   11.137  1.00 0.00 ? 85  LEU A HD13 1  
ATOM 1320  H HD21 . LEU A 1 85  ? 3.948   4.861   9.496   1.00 0.00 ? 85  LEU A HD21 1  
ATOM 1321  H HD22 . LEU A 1 85  ? 2.420   5.576   8.985   1.00 0.00 ? 85  LEU A HD22 1  
ATOM 1322  H HD23 . LEU A 1 85  ? 3.429   4.729   7.816   1.00 0.00 ? 85  LEU A HD23 1  
ATOM 1323  N N    . ASN A 1 86  ? 6.599   1.242   8.465   1.00 0.00 ? 86  ASN A N    1  
ATOM 1324  C CA   . ASN A 1 86  ? 7.451   0.026   8.417   1.00 0.00 ? 86  ASN A CA   1  
ATOM 1325  C C    . ASN A 1 86  ? 8.107   -0.195  9.776   1.00 0.00 ? 86  ASN A C    1  
ATOM 1326  O O    . ASN A 1 86  ? 8.749   0.681   10.318  1.00 0.00 ? 86  ASN A O    1  
ATOM 1327  C CB   . ASN A 1 86  ? 8.534   0.217   7.352   1.00 0.00 ? 86  ASN A CB   1  
ATOM 1328  C CG   . ASN A 1 86  ? 7.880   0.668   6.046   1.00 0.00 ? 86  ASN A CG   1  
ATOM 1329  O OD1  . ASN A 1 86  ? 6.675   0.798   5.971   1.00 0.00 ? 86  ASN A OD1  1  
ATOM 1330  N ND2  . ASN A 1 86  ? 8.629   0.914   5.004   1.00 0.00 ? 86  ASN A ND2  1  
ATOM 1331  H H    . ASN A 1 86  ? 7.002   2.120   8.632   1.00 0.00 ? 86  ASN A H    1  
ATOM 1332  H HA   . ASN A 1 86  ? 6.848   -0.830  8.164   1.00 0.00 ? 86  ASN A HA   1  
ATOM 1333  H HB2  . ASN A 1 86  ? 9.237   0.967   7.685   1.00 0.00 ? 86  ASN A HB2  1  
ATOM 1334  H HB3  . ASN A 1 86  ? 9.049   -0.717  7.191   1.00 0.00 ? 86  ASN A HB3  1  
ATOM 1335  H HD21 . ASN A 1 86  ? 9.600   0.809   5.063   1.00 0.00 ? 86  ASN A HD21 1  
ATOM 1336  H HD22 . ASN A 1 86  ? 8.218   1.201   4.163   1.00 0.00 ? 86  ASN A HD22 1  
ATOM 1337  N N    . TYR A 1 87  ? 7.953   -1.364  10.330  1.00 0.00 ? 87  TYR A N    1  
ATOM 1338  C CA   . TYR A 1 87  ? 8.570   -1.644  11.650  1.00 0.00 ? 87  TYR A CA   1  
ATOM 1339  C C    . TYR A 1 87  ? 8.547   -3.143  11.920  1.00 0.00 ? 87  TYR A C    1  
ATOM 1340  O O    . TYR A 1 87  ? 7.686   -3.860  11.450  1.00 0.00 ? 87  TYR A O    1  
ATOM 1341  C CB   . TYR A 1 87  ? 7.795   -0.921  12.748  1.00 0.00 ? 87  TYR A CB   1  
ATOM 1342  C CG   . TYR A 1 87  ? 6.324   -1.244  12.631  1.00 0.00 ? 87  TYR A CG   1  
ATOM 1343  C CD1  . TYR A 1 87  ? 5.842   -2.486  13.062  1.00 0.00 ? 87  TYR A CD1  1  
ATOM 1344  C CD2  . TYR A 1 87  ? 5.438   -0.298  12.096  1.00 0.00 ? 87  TYR A CD2  1  
ATOM 1345  C CE1  . TYR A 1 87  ? 4.478   -2.784  12.958  1.00 0.00 ? 87  TYR A CE1  1  
ATOM 1346  C CE2  . TYR A 1 87  ? 4.074   -0.596  11.991  1.00 0.00 ? 87  TYR A CE2  1  
ATOM 1347  C CZ   . TYR A 1 87  ? 3.594   -1.840  12.421  1.00 0.00 ? 87  TYR A CZ   1  
ATOM 1348  O OH   . TYR A 1 87  ? 2.250   -2.133  12.320  1.00 0.00 ? 87  TYR A OH   1  
ATOM 1349  H H    . TYR A 1 87  ? 7.433   -2.060  9.875   1.00 0.00 ? 87  TYR A H    1  
ATOM 1350  H HA   . TYR A 1 87  ? 9.592   -1.297  11.646  1.00 0.00 ? 87  TYR A HA   1  
ATOM 1351  H HB2  . TYR A 1 87  ? 8.158   -1.245  13.712  1.00 0.00 ? 87  TYR A HB2  1  
ATOM 1352  H HB3  . TYR A 1 87  ? 7.940   0.141   12.648  1.00 0.00 ? 87  TYR A HB3  1  
ATOM 1353  H HD1  . TYR A 1 87  ? 6.523   -3.216  13.475  1.00 0.00 ? 87  TYR A HD1  1  
ATOM 1354  H HD2  . TYR A 1 87  ? 5.807   0.661   11.765  1.00 0.00 ? 87  TYR A HD2  1  
ATOM 1355  H HE1  . TYR A 1 87  ? 4.108   -3.743  13.288  1.00 0.00 ? 87  TYR A HE1  1  
ATOM 1356  H HE2  . TYR A 1 87  ? 3.393   0.134   11.577  1.00 0.00 ? 87  TYR A HE2  1  
ATOM 1357  H HH   . TYR A 1 87  ? 1.950   -2.453  13.173  1.00 0.00 ? 87  TYR A HH   1  
ATOM 1358  N N    . VAL A 1 88  ? 9.483   -3.615  12.685  1.00 0.00 ? 88  VAL A N    1  
ATOM 1359  C CA   . VAL A 1 88  ? 9.515   -5.065  13.005  1.00 0.00 ? 88  VAL A CA   1  
ATOM 1360  C C    . VAL A 1 88  ? 9.145   -5.253  14.474  1.00 0.00 ? 88  VAL A C    1  
ATOM 1361  O O    . VAL A 1 88  ? 9.944   -5.034  15.360  1.00 0.00 ? 88  VAL A O    1  
ATOM 1362  C CB   . VAL A 1 88  ? 10.920  -5.615  12.753  1.00 0.00 ? 88  VAL A CB   1  
ATOM 1363  C CG1  . VAL A 1 88  ? 11.910  -4.932  13.692  1.00 0.00 ? 88  VAL A CG1  1  
ATOM 1364  C CG2  . VAL A 1 88  ? 10.929  -7.115  13.016  1.00 0.00 ? 88  VAL A CG2  1  
ATOM 1365  H H    . VAL A 1 88  ? 10.158  -3.010  13.058  1.00 0.00 ? 88  VAL A H    1  
ATOM 1366  H HA   . VAL A 1 88  ? 8.804   -5.589  12.385  1.00 0.00 ? 88  VAL A HA   1  
ATOM 1367  H HB   . VAL A 1 88  ? 11.203  -5.423  11.727  1.00 0.00 ? 88  VAL A HB   1  
ATOM 1368  H HG11 . VAL A 1 88  ? 12.851  -4.793  13.181  1.00 0.00 ? 88  VAL A HG11 1  
ATOM 1369  H HG12 . VAL A 1 88  ? 12.059  -5.551  14.564  1.00 0.00 ? 88  VAL A HG12 1  
ATOM 1370  H HG13 . VAL A 1 88  ? 11.517  -3.975  13.994  1.00 0.00 ? 88  VAL A HG13 1  
ATOM 1371  H HG21 . VAL A 1 88  ? 11.137  -7.641  12.096  1.00 0.00 ? 88  VAL A HG21 1  
ATOM 1372  H HG22 . VAL A 1 88  ? 9.965   -7.415  13.397  1.00 0.00 ? 88  VAL A HG22 1  
ATOM 1373  H HG23 . VAL A 1 88  ? 11.694  -7.346  13.743  1.00 0.00 ? 88  VAL A HG23 1  
ATOM 1374  N N    . ALA A 1 89  ? 7.932   -5.646  14.737  1.00 0.00 ? 89  ALA A N    1  
ATOM 1375  C CA   . ALA A 1 89  ? 7.506   -5.835  16.151  1.00 0.00 ? 89  ALA A CA   1  
ATOM 1376  C C    . ALA A 1 89  ? 8.113   -7.120  16.716  1.00 0.00 ? 89  ALA A C    1  
ATOM 1377  O O    . ALA A 1 89  ? 9.190   -7.114  17.280  1.00 0.00 ? 89  ALA A O    1  
ATOM 1378  C CB   . ALA A 1 89  ? 5.980   -5.922  16.216  1.00 0.00 ? 89  ALA A CB   1  
ATOM 1379  H H    . ALA A 1 89  ? 7.296   -5.808  14.005  1.00 0.00 ? 89  ALA A H    1  
ATOM 1380  H HA   . ALA A 1 89  ? 7.842   -4.992  16.737  1.00 0.00 ? 89  ALA A HA   1  
ATOM 1381  H HB1  . ALA A 1 89  ? 5.629   -6.627  15.477  1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1382  H HB2  . ALA A 1 89  ? 5.555   -4.951  16.019  1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1383  H HB3  . ALA A 1 89  ? 5.682   -6.254  17.200  1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1384  N N    . ARG A 1 90  ? 7.424   -8.222  16.585  1.00 0.00 ? 90  ARG A N    1  
ATOM 1385  C CA   . ARG A 1 90  ? 7.956   -9.503  17.130  1.00 0.00 ? 90  ARG A CA   1  
ATOM 1386  C C    . ARG A 1 90  ? 9.343   -9.793  16.554  1.00 0.00 ? 90  ARG A C    1  
ATOM 1387  O O    . ARG A 1 90  ? 10.301  -9.964  17.282  1.00 0.00 ? 90  ARG A O    1  
ATOM 1388  C CB   . ARG A 1 90  ? 7.002   -10.637 16.750  1.00 0.00 ? 90  ARG A CB   1  
ATOM 1389  C CG   . ARG A 1 90  ? 7.597   -11.976 17.188  1.00 0.00 ? 90  ARG A CG   1  
ATOM 1390  C CD   . ARG A 1 90  ? 6.556   -13.083 17.004  1.00 0.00 ? 90  ARG A CD   1  
ATOM 1391  N NE   . ARG A 1 90  ? 6.307   -13.298 15.551  1.00 0.00 ? 90  ARG A NE   1  
ATOM 1392  C CZ   . ARG A 1 90  ? 7.196   -13.909 14.820  1.00 0.00 ? 90  ARG A CZ   1  
ATOM 1393  N NH1  . ARG A 1 90  ? 8.312   -14.320 15.358  1.00 0.00 ? 90  ARG A NH1  1  
ATOM 1394  N NH2  . ARG A 1 90  ? 6.971   -14.110 13.550  1.00 0.00 ? 90  ARG A NH2  1  
ATOM 1395  H H    . ARG A 1 90  ? 6.553   -8.205  16.137  1.00 0.00 ? 90  ARG A H    1  
ATOM 1396  H HA   . ARG A 1 90  ? 8.020   -9.438  18.206  1.00 0.00 ? 90  ARG A HA   1  
ATOM 1397  H HB2  . ARG A 1 90  ? 6.051   -10.488 17.240  1.00 0.00 ? 90  ARG A HB2  1  
ATOM 1398  H HB3  . ARG A 1 90  ? 6.858   -10.644 15.680  1.00 0.00 ? 90  ARG A HB3  1  
ATOM 1399  H HG2  . ARG A 1 90  ? 8.466   -12.196 16.587  1.00 0.00 ? 90  ARG A HG2  1  
ATOM 1400  H HG3  . ARG A 1 90  ? 7.881   -11.919 18.226  1.00 0.00 ? 90  ARG A HG3  1  
ATOM 1401  H HD2  . ARG A 1 90  ? 6.922   -13.997 17.446  1.00 0.00 ? 90  ARG A HD2  1  
ATOM 1402  H HD3  . ARG A 1 90  ? 5.634   -12.791 17.488  1.00 0.00 ? 90  ARG A HD3  1  
ATOM 1403  H HE   . ARG A 1 90  ? 5.472   -12.982 15.146  1.00 0.00 ? 90  ARG A HE   1  
ATOM 1404  H HH11 . ARG A 1 90  ? 8.484   -14.167 16.332  1.00 0.00 ? 90  ARG A HH11 1  
ATOM 1405  H HH12 . ARG A 1 90  ? 8.994   -14.788 14.798  1.00 0.00 ? 90  ARG A HH12 1  
ATOM 1406  H HH21 . ARG A 1 90  ? 6.117   -13.795 13.138  1.00 0.00 ? 90  ARG A HH21 1  
ATOM 1407  H HH22 . ARG A 1 90  ? 7.653   -14.579 12.989  1.00 0.00 ? 90  ARG A HH22 1  
ATOM 1408  N N    . ASN A 1 91  ? 9.459   -9.842  15.256  1.00 0.00 ? 91  ASN A N    1  
ATOM 1409  C CA   . ASN A 1 91  ? 10.786  -10.117 14.635  1.00 0.00 ? 91  ASN A CA   1  
ATOM 1410  C C    . ASN A 1 91  ? 10.650  -10.069 13.110  1.00 0.00 ? 91  ASN A C    1  
ATOM 1411  O O    . ASN A 1 91  ? 11.448  -10.636 12.387  1.00 0.00 ? 91  ASN A O    1  
ATOM 1412  C CB   . ASN A 1 91  ? 11.280  -11.505 15.060  1.00 0.00 ? 91  ASN A CB   1  
ATOM 1413  C CG   . ASN A 1 91  ? 10.510  -12.584 14.295  1.00 0.00 ? 91  ASN A CG   1  
ATOM 1414  O OD1  . ASN A 1 91  ? 10.938  -13.719 14.230  1.00 0.00 ? 91  ASN A OD1  1  
ATOM 1415  N ND2  . ASN A 1 91  ? 9.387   -12.276 13.710  1.00 0.00 ? 91  ASN A ND2  1  
ATOM 1416  H H    . ASN A 1 91  ? 8.672   -9.698  14.690  1.00 0.00 ? 91  ASN A H    1  
ATOM 1417  H HA   . ASN A 1 91  ? 11.494  -9.367  14.956  1.00 0.00 ? 91  ASN A HA   1  
ATOM 1418  H HB2  . ASN A 1 91  ? 12.335  -11.593 14.844  1.00 0.00 ? 91  ASN A HB2  1  
ATOM 1419  H HB3  . ASN A 1 91  ? 11.118  -11.636 16.121  1.00 0.00 ? 91  ASN A HB3  1  
ATOM 1420  H HD21 . ASN A 1 91  ? 9.041   -11.362 13.766  1.00 0.00 ? 91  ASN A HD21 1  
ATOM 1421  H HD22 . ASN A 1 91  ? 8.887   -12.961 13.221  1.00 0.00 ? 91  ASN A HD22 1  
ATOM 1422  N N    . LYS A 1 92  ? 9.647   -9.397  12.614  1.00 0.00 ? 92  LYS A N    1  
ATOM 1423  C CA   . LYS A 1 92  ? 9.457   -9.313  11.140  1.00 0.00 ? 92  LYS A CA   1  
ATOM 1424  C C    . LYS A 1 92  ? 9.022   -7.890  10.765  1.00 0.00 ? 92  LYS A C    1  
ATOM 1425  O O    . LYS A 1 92  ? 8.040   -7.387  11.274  1.00 0.00 ? 92  LYS A O    1  
ATOM 1426  C CB   . LYS A 1 92  ? 8.369   -10.305 10.722  1.00 0.00 ? 92  LYS A CB   1  
ATOM 1427  C CG   . LYS A 1 92  ? 8.810   -11.070 9.473   1.00 0.00 ? 92  LYS A CG   1  
ATOM 1428  C CD   . LYS A 1 92  ? 9.775   -12.190 9.868   1.00 0.00 ? 92  LYS A CD   1  
ATOM 1429  C CE   . LYS A 1 92  ? 9.004   -13.317 10.561  1.00 0.00 ? 92  LYS A CE   1  
ATOM 1430  N NZ   . LYS A 1 92  ? 9.215   -14.591 9.818   1.00 0.00 ? 92  LYS A NZ   1  
ATOM 1431  H H    . LYS A 1 92  ? 9.016   -8.949  13.215  1.00 0.00 ? 92  LYS A H    1  
ATOM 1432  H HA   . LYS A 1 92  ? 10.382  -9.560  10.642  1.00 0.00 ? 92  LYS A HA   1  
ATOM 1433  H HB2  . LYS A 1 92  ? 8.195   -11.002 11.528  1.00 0.00 ? 92  LYS A HB2  1  
ATOM 1434  H HB3  . LYS A 1 92  ? 7.458   -9.766  10.510  1.00 0.00 ? 92  LYS A HB3  1  
ATOM 1435  H HG2  . LYS A 1 92  ? 7.943   -11.496 8.989   1.00 0.00 ? 92  LYS A HG2  1  
ATOM 1436  H HG3  . LYS A 1 92  ? 9.305   -10.395 8.792   1.00 0.00 ? 92  LYS A HG3  1  
ATOM 1437  H HD2  . LYS A 1 92  ? 10.258  -12.578 8.983   1.00 0.00 ? 92  LYS A HD2  1  
ATOM 1438  H HD3  . LYS A 1 92  ? 10.521  -11.802 10.542  1.00 0.00 ? 92  LYS A HD3  1  
ATOM 1439  H HE2  . LYS A 1 92  ? 9.362   -13.427 11.574  1.00 0.00 ? 92  LYS A HE2  1  
ATOM 1440  H HE3  . LYS A 1 92  ? 7.950   -13.077 10.576  1.00 0.00 ? 92  LYS A HE3  1  
ATOM 1441  H HZ1  . LYS A 1 92  ? 9.690   -15.278 10.436  1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 1442  H HZ2  . LYS A 1 92  ? 9.806   -14.409 8.982   1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 1443  H HZ3  . LYS A 1 92  ? 8.295   -14.973 9.519   1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 1444  N N    . PRO A 1 93  ? 9.745   -7.246  9.883   1.00 0.00 ? 93  PRO A N    1  
ATOM 1445  C CA   . PRO A 1 93  ? 9.429   -5.858  9.437   1.00 0.00 ? 93  PRO A CA   1  
ATOM 1446  C C    . PRO A 1 93  ? 8.240   -5.843  8.494   1.00 0.00 ? 93  PRO A C    1  
ATOM 1447  O O    . PRO A 1 93  ? 8.208   -6.566  7.524   1.00 0.00 ? 93  PRO A O    1  
ATOM 1448  C CB   . PRO A 1 93  ? 10.681  -5.417  8.699   1.00 0.00 ? 93  PRO A CB   1  
ATOM 1449  C CG   . PRO A 1 93  ? 11.294  -6.680  8.198   1.00 0.00 ? 93  PRO A CG   1  
ATOM 1450  C CD   . PRO A 1 93  ? 10.934  -7.770  9.201   1.00 0.00 ? 93  PRO A CD   1  
ATOM 1451  H HA   . PRO A 1 93  ? 9.256   -5.215  10.282  1.00 0.00 ? 93  PRO A HA   1  
ATOM 1452  H HB2  . PRO A 1 93  ? 10.417  -4.768  7.873   1.00 0.00 ? 93  PRO A HB2  1  
ATOM 1453  H HB3  . PRO A 1 93  ? 11.351  -4.917  9.372   1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1454  H HG2  . PRO A 1 93  ? 10.892  -6.919  7.233   1.00 0.00 ? 93  PRO A HG2  1  
ATOM 1455  H HG3  . PRO A 1 93  ? 12.355  -6.589  8.139   1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1456  H HD2  . PRO A 1 93  ? 10.704  -8.690  8.684   1.00 0.00 ? 93  PRO A HD2  1  
ATOM 1457  H HD3  . PRO A 1 93  ? 11.733  -7.918  9.903   1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1458  N N    . LYS A 1 94  ? 7.265   -5.035  8.767   1.00 0.00 ? 94  LYS A N    1  
ATOM 1459  C CA   . LYS A 1 94  ? 6.074   -5.005  7.878   1.00 0.00 ? 94  LYS A CA   1  
ATOM 1460  C C    . LYS A 1 94  ? 5.856   -3.607  7.310   1.00 0.00 ? 94  LYS A C    1  
ATOM 1461  O O    . LYS A 1 94  ? 5.598   -2.665  8.032   1.00 0.00 ? 94  LYS A O    1  
ATOM 1462  C CB   . LYS A 1 94  ? 4.840   -5.419  8.678   1.00 0.00 ? 94  LYS A CB   1  
ATOM 1463  C CG   . LYS A 1 94  ? 4.209   -6.655  8.037   1.00 0.00 ? 94  LYS A CG   1  
ATOM 1464  C CD   . LYS A 1 94  ? 2.886   -6.980  8.730   1.00 0.00 ? 94  LYS A CD   1  
ATOM 1465  C CE   . LYS A 1 94  ? 1.742   -6.278  8.001   1.00 0.00 ? 94  LYS A CE   1  
ATOM 1466  N NZ   . LYS A 1 94  ? 1.873   -4.804  8.172   1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1467  H H    . LYS A 1 94  ? 7.315   -4.459  9.559   1.00 0.00 ? 94  LYS A H    1  
ATOM 1468  H HA   . LYS A 1 94  ? 6.216   -5.700  7.064   1.00 0.00 ? 94  LYS A HA   1  
ATOM 1469  H HB2  . LYS A 1 94  ? 5.132   -5.648  9.693   1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1470  H HB3  . LYS A 1 94  ? 4.125   -4.611  8.680   1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1471  H HG2  . LYS A 1 94  ? 4.029   -6.462  6.991   1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1472  H HG3  . LYS A 1 94  ? 4.880   -7.493  8.143   1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1473  H HD2  . LYS A 1 94  ? 2.723   -8.049  8.709   1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1474  H HD3  . LYS A 1 94  ? 2.919   -6.641  9.754   1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1475  H HE2  . LYS A 1 94  ? 1.781   -6.522  6.951   1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1476  H HE3  . LYS A 1 94  ? 0.800   -6.606  8.408   1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1477  H HZ1  . LYS A 1 94  ? 2.632   -4.449  7.558   1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1478  H HZ2  . LYS A 1 94  ? 2.101   -4.590  9.166   1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1479  H HZ3  . LYS A 1 94  ? 0.977   -4.343  7.916   1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1480  N N    . THR A 1 95  ? 5.917   -3.474  6.012   1.00 0.00 ? 95  THR A N    1  
ATOM 1481  C CA   . THR A 1 95  ? 5.672   -2.144  5.395   1.00 0.00 ? 95  THR A CA   1  
ATOM 1482  C C    . THR A 1 95  ? 4.174   -2.007  5.166   1.00 0.00 ? 95  THR A C    1  
ATOM 1483  O O    . THR A 1 95  ? 3.551   -2.852  4.555   1.00 0.00 ? 95  THR A O    1  
ATOM 1484  C CB   . THR A 1 95  ? 6.408   -2.046  4.050   1.00 0.00 ? 95  THR A CB   1  
ATOM 1485  O OG1  . THR A 1 95  ? 7.810   -2.029  4.282   1.00 0.00 ? 95  THR A OG1  1  
ATOM 1486  C CG2  . THR A 1 95  ? 5.992   -0.765  3.314   1.00 0.00 ? 95  THR A CG2  1  
ATOM 1487  H H    . THR A 1 95  ? 6.097   -4.253  5.446   1.00 0.00 ? 95  THR A H    1  
ATOM 1488  H HA   . THR A 1 95  ? 6.015   -1.365  6.059   1.00 0.00 ? 95  THR A HA   1  
ATOM 1489  H HB   . THR A 1 95  ? 6.158   -2.902  3.442   1.00 0.00 ? 95  THR A HB   1  
ATOM 1490  H HG1  . THR A 1 95  ? 7.962   -2.269  5.199   1.00 0.00 ? 95  THR A HG1  1  
ATOM 1491  H HG21 . THR A 1 95  ? 6.461   -0.740  2.341   1.00 0.00 ? 95  THR A HG21 1  
ATOM 1492  H HG22 . THR A 1 95  ? 6.303   0.097   3.884   1.00 0.00 ? 95  THR A HG22 1  
ATOM 1493  H HG23 . THR A 1 95  ? 4.918   -0.745  3.194   1.00 0.00 ? 95  THR A HG23 1  
ATOM 1494  N N    . VAL A 1 96  ? 3.589   -0.956  5.654   1.00 0.00 ? 96  VAL A N    1  
ATOM 1495  C CA   . VAL A 1 96  ? 2.129   -0.775  5.467   1.00 0.00 ? 96  VAL A CA   1  
ATOM 1496  C C    . VAL A 1 96  ? 1.886   0.532   4.723   1.00 0.00 ? 96  VAL A C    1  
ATOM 1497  O O    . VAL A 1 96  ? 2.196   1.592   5.214   1.00 0.00 ? 96  VAL A O    1  
ATOM 1498  C CB   . VAL A 1 96  ? 1.457   -0.712  6.841   1.00 0.00 ? 96  VAL A CB   1  
ATOM 1499  C CG1  . VAL A 1 96  ? -0.053  -0.551  6.667   1.00 0.00 ? 96  VAL A CG1  1  
ATOM 1500  C CG2  . VAL A 1 96  ? 1.745   -2.008  7.606   1.00 0.00 ? 96  VAL A CG2  1  
ATOM 1501  H H    . VAL A 1 96  ? 4.109   -0.288  6.147   1.00 0.00 ? 96  VAL A H    1  
ATOM 1502  H HA   . VAL A 1 96  ? 1.724   -1.599  4.900   1.00 0.00 ? 96  VAL A HA   1  
ATOM 1503  H HB   . VAL A 1 96  ? 1.851   0.132   7.395   1.00 0.00 ? 96  VAL A HB   1  
ATOM 1504  H HG11 . VAL A 1 96  ? -0.542  -0.716  7.615   1.00 0.00 ? 96  VAL A HG11 1  
ATOM 1505  H HG12 . VAL A 1 96  ? -0.412  -1.271  5.946   1.00 0.00 ? 96  VAL A HG12 1  
ATOM 1506  H HG13 . VAL A 1 96  ? -0.271  0.448   6.317   1.00 0.00 ? 96  VAL A HG13 1  
ATOM 1507  H HG21 . VAL A 1 96  ? 1.894   -1.783  8.651   1.00 0.00 ? 96  VAL A HG21 1  
ATOM 1508  H HG22 . VAL A 1 96  ? 2.638   -2.470  7.208   1.00 0.00 ? 96  VAL A HG22 1  
ATOM 1509  H HG23 . VAL A 1 96  ? 0.910   -2.684  7.497   1.00 0.00 ? 96  VAL A HG23 1  
ATOM 1510  N N    . ILE A 1 97  ? 1.322   0.466   3.549   1.00 0.00 ? 97  ILE A N    1  
ATOM 1511  C CA   . ILE A 1 97  ? 1.050   1.715   2.784   1.00 0.00 ? 97  ILE A CA   1  
ATOM 1512  C C    . ILE A 1 97  ? -0.381  2.148   3.079   1.00 0.00 ? 97  ILE A C    1  
ATOM 1513  O O    . ILE A 1 97  ? -1.311  1.377   2.948   1.00 0.00 ? 97  ILE A O    1  
ATOM 1514  C CB   . ILE A 1 97  ? 1.235   1.446   1.285   1.00 0.00 ? 97  ILE A CB   1  
ATOM 1515  C CG1  . ILE A 1 97  ? 2.655   0.910   1.040   1.00 0.00 ? 97  ILE A CG1  1  
ATOM 1516  C CG2  . ILE A 1 97  ? 1.017   2.743   0.496   1.00 0.00 ? 97  ILE A CG2  1  
ATOM 1517  C CD1  . ILE A 1 97  ? 3.572   2.023   0.517   1.00 0.00 ? 97  ILE A CD1  1  
ATOM 1518  H H    . ILE A 1 97  ? 1.068   -0.403  3.175   1.00 0.00 ? 97  ILE A H    1  
ATOM 1519  H HA   . ILE A 1 97  ? 1.731   2.489   3.099   1.00 0.00 ? 97  ILE A HA   1  
ATOM 1520  H HB   . ILE A 1 97  ? 0.512   0.712   0.961   1.00 0.00 ? 97  ILE A HB   1  
ATOM 1521  H HG12 . ILE A 1 97  ? 3.058   0.527   1.968   1.00 0.00 ? 97  ILE A HG12 1  
ATOM 1522  H HG13 . ILE A 1 97  ? 2.616   0.112   0.314   1.00 0.00 ? 97  ILE A HG13 1  
ATOM 1523  H HG21 . ILE A 1 97  ? 1.379   2.616   -0.515  1.00 0.00 ? 97  ILE A HG21 1  
ATOM 1524  H HG22 . ILE A 1 97  ? 1.557   3.547   0.973   1.00 0.00 ? 97  ILE A HG22 1  
ATOM 1525  H HG23 . ILE A 1 97  ? -0.036  2.980   0.473   1.00 0.00 ? 97  ILE A HG23 1  
ATOM 1526  H HD11 . ILE A 1 97  ? 3.298   2.967   0.966   1.00 0.00 ? 97  ILE A HD11 1  
ATOM 1527  H HD12 . ILE A 1 97  ? 3.479   2.094   -0.555  1.00 0.00 ? 97  ILE A HD12 1  
ATOM 1528  H HD13 . ILE A 1 97  ? 4.598   1.791   0.774   1.00 0.00 ? 97  ILE A HD13 1  
ATOM 1529  N N    . TYR A 1 98  ? -0.566  3.367   3.511   1.00 0.00 ? 98  TYR A N    1  
ATOM 1530  C CA   . TYR A 1 98  ? -1.941  3.827   3.852   1.00 0.00 ? 98  TYR A CA   1  
ATOM 1531  C C    . TYR A 1 98  ? -2.409  4.931   2.906   1.00 0.00 ? 98  TYR A C    1  
ATOM 1532  O O    . TYR A 1 98  ? -1.699  5.875   2.624   1.00 0.00 ? 98  TYR A O    1  
ATOM 1533  C CB   . TYR A 1 98  ? -1.951  4.387   5.274   1.00 0.00 ? 98  TYR A CB   1  
ATOM 1534  C CG   . TYR A 1 98  ? -1.969  3.264   6.286   1.00 0.00 ? 98  TYR A CG   1  
ATOM 1535  C CD1  . TYR A 1 98  ? -3.050  2.378   6.331   1.00 0.00 ? 98  TYR A CD1  1  
ATOM 1536  C CD2  . TYR A 1 98  ? -0.910  3.124   7.189   1.00 0.00 ? 98  TYR A CD2  1  
ATOM 1537  C CE1  . TYR A 1 98  ? -3.073  1.349   7.282   1.00 0.00 ? 98  TYR A CE1  1  
ATOM 1538  C CE2  . TYR A 1 98  ? -0.932  2.093   8.136   1.00 0.00 ? 98  TYR A CE2  1  
ATOM 1539  C CZ   . TYR A 1 98  ? -2.012  1.206   8.183   1.00 0.00 ? 98  TYR A CZ   1  
ATOM 1540  O OH   . TYR A 1 98  ? -2.032  0.194   9.121   1.00 0.00 ? 98  TYR A OH   1  
ATOM 1541  H H    . TYR A 1 98  ? 0.200   3.968   3.638   1.00 0.00 ? 98  TYR A H    1  
ATOM 1542  H HA   . TYR A 1 98  ? -2.623  2.993   3.796   1.00 0.00 ? 98  TYR A HA   1  
ATOM 1543  H HB2  . TYR A 1 98  ? -1.066  4.987   5.427   1.00 0.00 ? 98  TYR A HB2  1  
ATOM 1544  H HB3  . TYR A 1 98  ? -2.825  5.002   5.407   1.00 0.00 ? 98  TYR A HB3  1  
ATOM 1545  H HD1  . TYR A 1 98  ? -3.869  2.486   5.634   1.00 0.00 ? 98  TYR A HD1  1  
ATOM 1546  H HD2  . TYR A 1 98  ? -0.077  3.809   7.154   1.00 0.00 ? 98  TYR A HD2  1  
ATOM 1547  H HE1  . TYR A 1 98  ? -3.907  0.666   7.318   1.00 0.00 ? 98  TYR A HE1  1  
ATOM 1548  H HE2  . TYR A 1 98  ? -0.113  1.981   8.832   1.00 0.00 ? 98  TYR A HE2  1  
ATOM 1549  H HH   . TYR A 1 98  ? -2.937  -0.114  9.205   1.00 0.00 ? 98  TYR A HH   1  
ATOM 1550  N N    . TRP A 1 99  ? -3.625  4.827   2.454   1.00 0.00 ? 99  TRP A N    1  
ATOM 1551  C CA   . TRP A 1 99  ? -4.203  5.872   1.567   1.00 0.00 ? 99  TRP A CA   1  
ATOM 1552  C C    . TRP A 1 99  ? -5.411  6.468   2.284   1.00 0.00 ? 99  TRP A C    1  
ATOM 1553  O O    . TRP A 1 99  ? -6.142  5.768   2.958   1.00 0.00 ? 99  TRP A O    1  
ATOM 1554  C CB   . TRP A 1 99  ? -4.658  5.252   0.246   1.00 0.00 ? 99  TRP A CB   1  
ATOM 1555  C CG   . TRP A 1 99  ? -3.509  5.145   -0.699  1.00 0.00 ? 99  TRP A CG   1  
ATOM 1556  C CD1  . TRP A 1 99  ? -3.036  6.153   -1.468  1.00 0.00 ? 99  TRP A CD1  1  
ATOM 1557  C CD2  . TRP A 1 99  ? -2.687  3.981   -0.999  1.00 0.00 ? 99  TRP A CD2  1  
ATOM 1558  N NE1  . TRP A 1 99  ? -1.975  5.681   -2.220  1.00 0.00 ? 99  TRP A NE1  1  
ATOM 1559  C CE2  . TRP A 1 99  ? -1.721  4.347   -1.964  1.00 0.00 ? 99  TRP A CE2  1  
ATOM 1560  C CE3  . TRP A 1 99  ? -2.686  2.656   -0.526  1.00 0.00 ? 99  TRP A CE3  1  
ATOM 1561  C CZ2  . TRP A 1 99  ? -0.790  3.429   -2.449  1.00 0.00 ? 99  TRP A CZ2  1  
ATOM 1562  C CZ3  . TRP A 1 99  ? -1.747  1.731   -1.011  1.00 0.00 ? 99  TRP A CZ3  1  
ATOM 1563  C CH2  . TRP A 1 99  ? -0.803  2.118   -1.970  1.00 0.00 ? 99  TRP A CH2  1  
ATOM 1564  H H    . TRP A 1 99  ? -4.180  4.068   2.730   1.00 0.00 ? 99  TRP A H    1  
ATOM 1565  H HA   . TRP A 1 99  ? -3.468  6.642   1.381   1.00 0.00 ? 99  TRP A HA   1  
ATOM 1566  H HB2  . TRP A 1 99  ? -5.054  4.268   0.431   1.00 0.00 ? 99  TRP A HB2  1  
ATOM 1567  H HB3  . TRP A 1 99  ? -5.427  5.870   -0.194  1.00 0.00 ? 99  TRP A HB3  1  
ATOM 1568  H HD1  . TRP A 1 99  ? -3.425  7.161   -1.489  1.00 0.00 ? 99  TRP A HD1  1  
ATOM 1569  H HE1  . TRP A 1 99  ? -1.457  6.212   -2.860  1.00 0.00 ? 99  TRP A HE1  1  
ATOM 1570  H HE3  . TRP A 1 99  ? -3.413  2.348   0.212   1.00 0.00 ? 99  TRP A HE3  1  
ATOM 1571  H HZ2  . TRP A 1 99  ? -0.066  3.728   -3.189  1.00 0.00 ? 99  TRP A HZ2  1  
ATOM 1572  H HZ3  . TRP A 1 99  ? -1.755  0.715   -0.643  1.00 0.00 ? 99  TRP A HZ3  1  
ATOM 1573  H HH2  . TRP A 1 99  ? -0.084  1.405   -2.339  1.00 0.00 ? 99  TRP A HH2  1  
ATOM 1574  N N    . LEU A 1 100 ? -5.645  7.740   2.157   1.00 0.00 ? 100 LEU A N    1  
ATOM 1575  C CA   . LEU A 1 100 ? -6.824  8.323   2.851   1.00 0.00 ? 100 LEU A CA   1  
ATOM 1576  C C    . LEU A 1 100 ? -8.069  8.006   2.028   1.00 0.00 ? 100 LEU A C    1  
ATOM 1577  O O    . LEU A 1 100 ? -8.076  8.146   0.821   1.00 0.00 ? 100 LEU A O    1  
ATOM 1578  C CB   . LEU A 1 100 ? -6.659  9.838   2.974   1.00 0.00 ? 100 LEU A CB   1  
ATOM 1579  C CG   . LEU A 1 100 ? -5.174  10.196  2.912   1.00 0.00 ? 100 LEU A CG   1  
ATOM 1580  C CD1  . LEU A 1 100 ? -4.998  11.678  3.232   1.00 0.00 ? 100 LEU A CD1  1  
ATOM 1581  C CD2  . LEU A 1 100 ? -4.400  9.358   3.931   1.00 0.00 ? 100 LEU A CD2  1  
ATOM 1582  H H    . LEU A 1 100 ? -5.057  8.303   1.613   1.00 0.00 ? 100 LEU A H    1  
ATOM 1583  H HA   . LEU A 1 100 ? -6.919  7.887   3.834   1.00 0.00 ? 100 LEU A HA   1  
ATOM 1584  H HB2  . LEU A 1 100 ? -7.183  10.325  2.168   1.00 0.00 ? 100 LEU A HB2  1  
ATOM 1585  H HB3  . LEU A 1 100 ? -7.066  10.169  3.917   1.00 0.00 ? 100 LEU A HB3  1  
ATOM 1586  H HG   . LEU A 1 100 ? -4.802  9.996   1.917   1.00 0.00 ? 100 LEU A HG   1  
ATOM 1587  H HD11 . LEU A 1 100 ? -3.981  11.972  3.022   1.00 0.00 ? 100 LEU A HD11 1  
ATOM 1588  H HD12 . LEU A 1 100 ? -5.217  11.850  4.273   1.00 0.00 ? 100 LEU A HD12 1  
ATOM 1589  H HD13 . LEU A 1 100 ? -5.671  12.257  2.622   1.00 0.00 ? 100 LEU A HD13 1  
ATOM 1590  H HD21 . LEU A 1 100 ? -5.088  8.936   4.649   1.00 0.00 ? 100 LEU A HD21 1  
ATOM 1591  H HD22 . LEU A 1 100 ? -3.686  9.986   4.442   1.00 0.00 ? 100 LEU A HD22 1  
ATOM 1592  H HD23 . LEU A 1 100 ? -3.878  8.562   3.420   1.00 0.00 ? 100 LEU A HD23 1  
ATOM 1593  N N    . ALA A 1 101 ? -9.119  7.565   2.662   1.00 0.00 ? 101 ALA A N    1  
ATOM 1594  C CA   . ALA A 1 101 ? -10.348 7.229   1.894   1.00 0.00 ? 101 ALA A CA   1  
ATOM 1595  C C    . ALA A 1 101 ? -11.577 7.764   2.621   1.00 0.00 ? 101 ALA A C    1  
ATOM 1596  O O    . ALA A 1 101 ? -11.602 7.881   3.831   1.00 0.00 ? 101 ALA A O    1  
ATOM 1597  C CB   . ALA A 1 101 ? -10.463 5.710   1.759   1.00 0.00 ? 101 ALA A CB   1  
ATOM 1598  H H    . ALA A 1 101 ? -9.096  7.446   3.634   1.00 0.00 ? 101 ALA A H    1  
ATOM 1599  H HA   . ALA A 1 101 ? -10.289 7.671   0.912   1.00 0.00 ? 101 ALA A HA   1  
ATOM 1600  H HB1  . ALA A 1 101 ? -10.539 5.446   0.714   1.00 0.00 ? 101 ALA A HB1  1  
ATOM 1601  H HB2  . ALA A 1 101 ? -11.345 5.367   2.281   1.00 0.00 ? 101 ALA A HB2  1  
ATOM 1602  H HB3  . ALA A 1 101 ? -9.588  5.243   2.185   1.00 0.00 ? 101 ALA A HB3  1  
ATOM 1603  N N    . GLU A 1 102 ? -12.605 8.087   1.887   1.00 0.00 ? 102 GLU A N    1  
ATOM 1604  C CA   . GLU A 1 102 ? -13.844 8.611   2.518   1.00 0.00 ? 102 GLU A CA   1  
ATOM 1605  C C    . GLU A 1 102 ? -15.018 7.720   2.117   1.00 0.00 ? 102 GLU A C    1  
ATOM 1606  O O    . GLU A 1 102 ? -15.304 7.549   0.950   1.00 0.00 ? 102 GLU A O    1  
ATOM 1607  C CB   . GLU A 1 102 ? -14.094 10.039  2.023   1.00 0.00 ? 102 GLU A CB   1  
ATOM 1608  C CG   . GLU A 1 102 ? -15.306 10.630  2.742   1.00 0.00 ? 102 GLU A CG   1  
ATOM 1609  C CD   . GLU A 1 102 ? -15.628 12.005  2.151   1.00 0.00 ? 102 GLU A CD   1  
ATOM 1610  O OE1  . GLU A 1 102 ? -14.917 12.423  1.252   1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1611  O OE2  . GLU A 1 102 ? -16.580 12.616  2.605   1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1612  H H    . GLU A 1 102 ? -12.561 7.981   0.915   1.00 0.00 ? 102 GLU A H    1  
ATOM 1613  H HA   . GLU A 1 102 ? -13.737 8.610   3.590   1.00 0.00 ? 102 GLU A HA   1  
ATOM 1614  H HB2  . GLU A 1 102 ? -13.222 10.645  2.227   1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1615  H HB3  . GLU A 1 102 ? -14.279 10.025  0.958   1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1616  H HG2  . GLU A 1 102 ? -16.155 9.975   2.617   1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1617  H HG3  . GLU A 1 102 ? -15.084 10.738  3.790   1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1618  H HE2  . GLU A 1 102 ? -16.722 13.469  2.187   1.00 0.00 ? 102 GLU A HE2  1  
ATOM 1619  N N    . VAL A 1 103 ? -15.703 7.145   3.069   1.00 0.00 ? 103 VAL A N    1  
ATOM 1620  C CA   . VAL A 1 103 ? -16.850 6.266   2.718   1.00 0.00 ? 103 VAL A CA   1  
ATOM 1621  C C    . VAL A 1 103 ? -18.042 7.132   2.294   1.00 0.00 ? 103 VAL A C    1  
ATOM 1622  O O    . VAL A 1 103 ? -18.354 8.137   2.902   1.00 0.00 ? 103 VAL A O    1  
ATOM 1623  C CB   . VAL A 1 103 ? -17.203 5.367   3.908   1.00 0.00 ? 103 VAL A CB   1  
ATOM 1624  C CG1  . VAL A 1 103 ? -15.925 4.733   4.432   1.00 0.00 ? 103 VAL A CG1  1  
ATOM 1625  C CG2  . VAL A 1 103 ? -17.827 6.179   5.036   1.00 0.00 ? 103 VAL A CG2  1  
ATOM 1626  H H    . VAL A 1 103 ? -15.460 7.288   4.008   1.00 0.00 ? 103 VAL A H    1  
ATOM 1627  H HA   . VAL A 1 103 ? -16.567 5.644   1.886   1.00 0.00 ? 103 VAL A HA   1  
ATOM 1628  H HB   . VAL A 1 103 ? -17.885 4.592   3.589   1.00 0.00 ? 103 VAL A HB   1  
ATOM 1629  H HG11 . VAL A 1 103 ? -16.137 3.736   4.795   1.00 0.00 ? 103 VAL A HG11 1  
ATOM 1630  H HG12 . VAL A 1 103 ? -15.540 5.340   5.238   1.00 0.00 ? 103 VAL A HG12 1  
ATOM 1631  H HG13 . VAL A 1 103 ? -15.201 4.685   3.636   1.00 0.00 ? 103 VAL A HG13 1  
ATOM 1632  H HG21 . VAL A 1 103 ? -18.830 5.833   5.209   1.00 0.00 ? 103 VAL A HG21 1  
ATOM 1633  H HG22 . VAL A 1 103 ? -17.844 7.219   4.765   1.00 0.00 ? 103 VAL A HG22 1  
ATOM 1634  H HG23 . VAL A 1 103 ? -17.239 6.046   5.935   1.00 0.00 ? 103 VAL A HG23 1  
ATOM 1635  N N    . LYS A 1 104 ? -18.675 6.762   1.219   1.00 0.00 ? 104 LYS A N    1  
ATOM 1636  C CA   . LYS A 1 104 ? -19.819 7.556   0.689   1.00 0.00 ? 104 LYS A CA   1  
ATOM 1637  C C    . LYS A 1 104 ? -20.955 7.661   1.714   1.00 0.00 ? 104 LYS A C    1  
ATOM 1638  O O    . LYS A 1 104 ? -21.567 8.700   1.862   1.00 0.00 ? 104 LYS A O    1  
ATOM 1639  C CB   . LYS A 1 104 ? -20.349 6.840   -0.547  1.00 0.00 ? 104 LYS A CB   1  
ATOM 1640  C CG   . LYS A 1 104 ? -19.228 6.709   -1.574  1.00 0.00 ? 104 LYS A CG   1  
ATOM 1641  C CD   . LYS A 1 104 ? -19.693 5.801   -2.708  1.00 0.00 ? 104 LYS A CD   1  
ATOM 1642  C CE   . LYS A 1 104 ? -18.503 5.459   -3.608  1.00 0.00 ? 104 LYS A CE   1  
ATOM 1643  N NZ   . LYS A 1 104 ? -18.994 5.116   -4.971  1.00 0.00 ? 104 LYS A NZ   1  
ATOM 1644  H H    . LYS A 1 104 ? -18.375 5.966   0.733   1.00 0.00 ? 104 LYS A H    1  
ATOM 1645  H HA   . LYS A 1 104 ? -19.482 8.544   0.412   1.00 0.00 ? 104 LYS A HA   1  
ATOM 1646  H HB2  . LYS A 1 104 ? -20.702 5.858   -0.270  1.00 0.00 ? 104 LYS A HB2  1  
ATOM 1647  H HB3  . LYS A 1 104 ? -21.161 7.410   -0.973  1.00 0.00 ? 104 LYS A HB3  1  
ATOM 1648  H HG2  . LYS A 1 104 ? -18.984 7.684   -1.968  1.00 0.00 ? 104 LYS A HG2  1  
ATOM 1649  H HG3  . LYS A 1 104 ? -18.356 6.281   -1.107  1.00 0.00 ? 104 LYS A HG3  1  
ATOM 1650  H HD2  . LYS A 1 104 ? -20.106 4.893   -2.288  1.00 0.00 ? 104 LYS A HD2  1  
ATOM 1651  H HD3  . LYS A 1 104 ? -20.448 6.306   -3.287  1.00 0.00 ? 104 LYS A HD3  1  
ATOM 1652  H HE2  . LYS A 1 104 ? -17.840 6.309   -3.666  1.00 0.00 ? 104 LYS A HE2  1  
ATOM 1653  H HE3  . LYS A 1 104 ? -17.972 4.616   -3.193  1.00 0.00 ? 104 LYS A HE3  1  
ATOM 1654  H HZ1  . LYS A 1 104 ? -18.218 5.215   -5.655  1.00 0.00 ? 104 LYS A HZ1  1  
ATOM 1655  H HZ2  . LYS A 1 104 ? -19.772 5.757   -5.230  1.00 0.00 ? 104 LYS A HZ2  1  
ATOM 1656  H HZ3  . LYS A 1 104 ? -19.336 4.134   -4.980  1.00 0.00 ? 104 LYS A HZ3  1  
ATOM 1657  N N    . ASP A 1 105 ? -21.268 6.594   2.397   1.00 0.00 ? 105 ASP A N    1  
ATOM 1658  C CA   . ASP A 1 105 ? -22.399 6.651   3.371   1.00 0.00 ? 105 ASP A CA   1  
ATOM 1659  C C    . ASP A 1 105 ? -21.894 6.819   4.799   1.00 0.00 ? 105 ASP A C    1  
ATOM 1660  O O    . ASP A 1 105 ? -20.958 6.177   5.222   1.00 0.00 ? 105 ASP A O    1  
ATOM 1661  C CB   . ASP A 1 105 ? -23.212 5.361   3.285   1.00 0.00 ? 105 ASP A CB   1  
ATOM 1662  C CG   . ASP A 1 105 ? -24.703 5.694   3.204   1.00 0.00 ? 105 ASP A CG   1  
ATOM 1663  O OD1  . ASP A 1 105 ? -25.397 5.450   4.176   1.00 0.00 ? 105 ASP A OD1  1  
ATOM 1664  O OD2  . ASP A 1 105 ? -25.123 6.182   2.168   1.00 0.00 ? 105 ASP A OD2  1  
ATOM 1665  H H    . ASP A 1 105 ? -20.783 5.753   2.247   1.00 0.00 ? 105 ASP A H    1  
ATOM 1666  H HA   . ASP A 1 105 ? -23.037 7.482   3.126   1.00 0.00 ? 105 ASP A HA   1  
ATOM 1667  H HB2  . ASP A 1 105 ? -22.916 4.814   2.406   1.00 0.00 ? 105 ASP A HB2  1  
ATOM 1668  H HB3  . ASP A 1 105 ? -23.027 4.763   4.163   1.00 0.00 ? 105 ASP A HB3  1  
ATOM 1669  H HD2  . ASP A 1 105 ? -26.065 6.364   2.188   1.00 0.00 ? 105 ASP A HD2  1  
ATOM 1670  N N    . TYR A 1 106 ? -22.537 7.666   5.552   1.00 0.00 ? 106 TYR A N    1  
ATOM 1671  C CA   . TYR A 1 106 ? -22.130 7.868   6.968   1.00 0.00 ? 106 TYR A CA   1  
ATOM 1672  C C    . TYR A 1 106 ? -22.404 6.573   7.729   1.00 0.00 ? 106 TYR A C    1  
ATOM 1673  O O    . TYR A 1 106 ? -21.617 6.130   8.543   1.00 0.00 ? 106 TYR A O    1  
ATOM 1674  C CB   . TYR A 1 106 ? -22.945 9.012   7.575   1.00 0.00 ? 106 TYR A CB   1  
ATOM 1675  C CG   . TYR A 1 106 ? -22.411 9.344   8.947   1.00 0.00 ? 106 TYR A CG   1  
ATOM 1676  C CD1  . TYR A 1 106 ? -21.237 10.097  9.074   1.00 0.00 ? 106 TYR A CD1  1  
ATOM 1677  C CD2  . TYR A 1 106 ? -23.084 8.901   10.091  1.00 0.00 ? 106 TYR A CD2  1  
ATOM 1678  C CE1  . TYR A 1 106 ? -20.739 10.407  10.344  1.00 0.00 ? 106 TYR A CE1  1  
ATOM 1679  C CE2  . TYR A 1 106 ? -22.586 9.213   11.361  1.00 0.00 ? 106 TYR A CE2  1  
ATOM 1680  C CZ   . TYR A 1 106 ? -21.415 9.966   11.488  1.00 0.00 ? 106 TYR A CZ   1  
ATOM 1681  O OH   . TYR A 1 106 ? -20.927 10.277  12.743  1.00 0.00 ? 106 TYR A OH   1  
ATOM 1682  H H    . TYR A 1 106 ? -23.304 8.153   5.189   1.00 0.00 ? 106 TYR A H    1  
ATOM 1683  H HA   . TYR A 1 106 ? -21.078 8.102   7.016   1.00 0.00 ? 106 TYR A HA   1  
ATOM 1684  H HB2  . TYR A 1 106 ? -22.873 9.882   6.940   1.00 0.00 ? 106 TYR A HB2  1  
ATOM 1685  H HB3  . TYR A 1 106 ? -23.979 8.711   7.658   1.00 0.00 ? 106 TYR A HB3  1  
ATOM 1686  H HD1  . TYR A 1 106 ? -20.716 10.435  8.190   1.00 0.00 ? 106 TYR A HD1  1  
ATOM 1687  H HD2  . TYR A 1 106 ? -23.991 8.320   9.992   1.00 0.00 ? 106 TYR A HD2  1  
ATOM 1688  H HE1  . TYR A 1 106 ? -19.835 10.987  10.441  1.00 0.00 ? 106 TYR A HE1  1  
ATOM 1689  H HE2  . TYR A 1 106 ? -23.107 8.871   12.243  1.00 0.00 ? 106 TYR A HE2  1  
ATOM 1690  H HH   . TYR A 1 106 ? -21.653 10.631  13.261  1.00 0.00 ? 106 TYR A HH   1  
ATOM 1691  N N    . ASP A 1 107 ? -23.516 5.951   7.448   1.00 0.00 ? 107 ASP A N    1  
ATOM 1692  C CA   . ASP A 1 107 ? -23.859 4.670   8.124   1.00 0.00 ? 107 ASP A CA   1  
ATOM 1693  C C    . ASP A 1 107 ? -23.438 3.515   7.218   1.00 0.00 ? 107 ASP A C    1  
ATOM 1694  O O    . ASP A 1 107 ? -23.896 2.398   7.360   1.00 0.00 ? 107 ASP A O    1  
ATOM 1695  C CB   . ASP A 1 107 ? -25.365 4.605   8.367   1.00 0.00 ? 107 ASP A CB   1  
ATOM 1696  C CG   . ASP A 1 107 ? -25.764 5.678   9.381   1.00 0.00 ? 107 ASP A CG   1  
ATOM 1697  O OD1  . ASP A 1 107 ? -24.882 6.194   10.048  1.00 0.00 ? 107 ASP A OD1  1  
ATOM 1698  O OD2  . ASP A 1 107 ? -26.946 5.967   9.475   1.00 0.00 ? 107 ASP A OD2  1  
ATOM 1699  H H    . ASP A 1 107 ? -24.124 6.325   6.776   1.00 0.00 ? 107 ASP A H    1  
ATOM 1700  H HA   . ASP A 1 107 ? -23.332 4.604   9.063   1.00 0.00 ? 107 ASP A HA   1  
ATOM 1701  H HB2  . ASP A 1 107 ? -25.887 4.774   7.438   1.00 0.00 ? 107 ASP A HB2  1  
ATOM 1702  H HB3  . ASP A 1 107 ? -25.625 3.632   8.755   1.00 0.00 ? 107 ASP A HB3  1  
ATOM 1703  H HD2  . ASP A 1 107 ? -27.122 6.647   10.130  1.00 0.00 ? 107 ASP A HD2  1  
ATOM 1704  N N    . VAL A 1 108 ? -22.567 3.784   6.283   1.00 0.00 ? 108 VAL A N    1  
ATOM 1705  C CA   . VAL A 1 108 ? -22.103 2.719   5.353   1.00 0.00 ? 108 VAL A CA   1  
ATOM 1706  C C    . VAL A 1 108 ? -21.968 1.408   6.123   1.00 0.00 ? 108 VAL A C    1  
ATOM 1707  O O    . VAL A 1 108 ? -21.698 1.400   7.307   1.00 0.00 ? 108 VAL A O    1  
ATOM 1708  C CB   . VAL A 1 108 ? -20.748 3.137   4.784   1.00 0.00 ? 108 VAL A CB   1  
ATOM 1709  C CG1  . VAL A 1 108 ? -19.827 3.532   5.932   1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1710  C CG2  . VAL A 1 108 ? -20.119 1.982   4.009   1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1711  H H    . VAL A 1 108 ? -22.215 4.695   6.193   1.00 0.00 ? 108 VAL A H    1  
ATOM 1712  H HA   . VAL A 1 108 ? -22.813 2.599   4.551   1.00 0.00 ? 108 VAL A HA   1  
ATOM 1713  H HB   . VAL A 1 108 ? -20.882 3.985   4.124   1.00 0.00 ? 108 VAL A HB   1  
ATOM 1714  H HG11 . VAL A 1 108 ? -19.865 2.771   6.697   1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1715  H HG12 . VAL A 1 108 ? -20.153 4.473   6.343   1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1716  H HG13 . VAL A 1 108 ? -18.817 3.625   5.565   1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1717  H HG21 . VAL A 1 108 ? -19.160 2.297   3.625   1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1718  H HG22 . VAL A 1 108 ? -20.762 1.703   3.189   1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1719  H HG23 . VAL A 1 108 ? -19.983 1.139   4.669   1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1720  N N    . GLU A 1 109 ? -22.181 0.300   5.470   1.00 0.00 ? 109 GLU A N    1  
ATOM 1721  C CA   . GLU A 1 109 ? -22.090 -1.000  6.179   1.00 0.00 ? 109 GLU A CA   1  
ATOM 1722  C C    . GLU A 1 109 ? -20.681 -1.215  6.713   1.00 0.00 ? 109 GLU A C    1  
ATOM 1723  O O    . GLU A 1 109 ? -19.694 -0.867  6.096   1.00 0.00 ? 109 GLU A O    1  
ATOM 1724  C CB   . GLU A 1 109 ? -22.462 -2.150  5.240   1.00 0.00 ? 109 GLU A CB   1  
ATOM 1725  C CG   . GLU A 1 109 ? -21.246 -3.051  4.995   1.00 0.00 ? 109 GLU A CG   1  
ATOM 1726  C CD   . GLU A 1 109 ? -21.592 -4.097  3.934   1.00 0.00 ? 109 GLU A CD   1  
ATOM 1727  O OE1  . GLU A 1 109 ? -20.677 -4.722  3.424   1.00 0.00 ? 109 GLU A OE1  1  
ATOM 1728  O OE2  . GLU A 1 109 ? -22.768 -4.260  3.653   1.00 0.00 ? 109 GLU A OE2  1  
ATOM 1729  H H    . GLU A 1 109 ? -22.414 0.325   4.524   1.00 0.00 ? 109 GLU A H    1  
ATOM 1730  H HA   . GLU A 1 109 ? -22.780 -0.993  7.009   1.00 0.00 ? 109 GLU A HA   1  
ATOM 1731  H HB2  . GLU A 1 109 ? -23.248 -2.731  5.698   1.00 0.00 ? 109 GLU A HB2  1  
ATOM 1732  H HB3  . GLU A 1 109 ? -22.811 -1.750  4.300   1.00 0.00 ? 109 GLU A HB3  1  
ATOM 1733  H HG2  . GLU A 1 109 ? -20.414 -2.454  4.653   1.00 0.00 ? 109 GLU A HG2  1  
ATOM 1734  H HG3  . GLU A 1 109 ? -20.977 -3.555  5.914   1.00 0.00 ? 109 GLU A HG3  1  
ATOM 1735  H HE2  . GLU A 1 109 ? -22.911 -4.932  2.982   1.00 0.00 ? 109 GLU A HE2  1  
ATOM 1736  N N    . ILE A 1 110 ? -20.603 -1.816  7.853   1.00 0.00 ? 110 ILE A N    1  
ATOM 1737  C CA   . ILE A 1 110 ? -19.285 -2.113  8.471   1.00 0.00 ? 110 ILE A CA   1  
ATOM 1738  C C    . ILE A 1 110 ? -19.199 -3.609  8.756   1.00 0.00 ? 110 ILE A C    1  
ATOM 1739  O O    . ILE A 1 110 ? -19.782 -4.103  9.702   1.00 0.00 ? 110 ILE A O    1  
ATOM 1740  C CB   . ILE A 1 110 ? -19.135 -1.338  9.781   1.00 0.00 ? 110 ILE A CB   1  
ATOM 1741  C CG1  . ILE A 1 110 ? -18.982 0.158   9.485   1.00 0.00 ? 110 ILE A CG1  1  
ATOM 1742  C CG2  . ILE A 1 110 ? -17.901 -1.847  10.528  1.00 0.00 ? 110 ILE A CG2  1  
ATOM 1743  C CD1  . ILE A 1 110 ? -17.727 0.393   8.636   1.00 0.00 ? 110 ILE A CD1  1  
ATOM 1744  H H    . ILE A 1 110 ? -21.430 -2.095  8.295   1.00 0.00 ? 110 ILE A H    1  
ATOM 1745  H HA   . ILE A 1 110 ? -18.493 -1.834  7.795   1.00 0.00 ? 110 ILE A HA   1  
ATOM 1746  H HB   . ILE A 1 110 ? -20.011 -1.497  10.393  1.00 0.00 ? 110 ILE A HB   1  
ATOM 1747  H HG12 . ILE A 1 110 ? -19.851 0.509   8.949   1.00 0.00 ? 110 ILE A HG12 1  
ATOM 1748  H HG13 . ILE A 1 110 ? -18.889 0.700   10.414  1.00 0.00 ? 110 ILE A HG13 1  
ATOM 1749  H HG21 . ILE A 1 110 ? -17.415 -1.024  11.026  1.00 0.00 ? 110 ILE A HG21 1  
ATOM 1750  H HG22 . ILE A 1 110 ? -17.216 -2.296  9.823   1.00 0.00 ? 110 ILE A HG22 1  
ATOM 1751  H HG23 . ILE A 1 110 ? -18.202 -2.584  11.257  1.00 0.00 ? 110 ILE A HG23 1  
ATOM 1752  H HD11 . ILE A 1 110 ? -17.999 0.409   7.591   1.00 0.00 ? 110 ILE A HD11 1  
ATOM 1753  H HD12 . ILE A 1 110 ? -17.015 -0.400  8.812   1.00 0.00 ? 110 ILE A HD12 1  
ATOM 1754  H HD13 . ILE A 1 110 ? -17.282 1.340   8.905   1.00 0.00 ? 110 ILE A HD13 1  
ATOM 1755  N N    . ARG A 1 111 ? -18.478 -4.337  7.954   1.00 0.00 ? 111 ARG A N    1  
ATOM 1756  C CA   . ARG A 1 111 ? -18.363 -5.799  8.195   1.00 0.00 ? 111 ARG A CA   1  
ATOM 1757  C C    . ARG A 1 111 ? -16.976 -6.102  8.731   1.00 0.00 ? 111 ARG A C    1  
ATOM 1758  O O    . ARG A 1 111 ? -15.973 -5.759  8.137   1.00 0.00 ? 111 ARG A O    1  
ATOM 1759  C CB   . ARG A 1 111 ? -18.600 -6.566  6.900   1.00 0.00 ? 111 ARG A CB   1  
ATOM 1760  C CG   . ARG A 1 111 ? -19.900 -7.359  7.026   1.00 0.00 ? 111 ARG A CG   1  
ATOM 1761  C CD   . ARG A 1 111 ? -19.771 -8.387  8.154   1.00 0.00 ? 111 ARG A CD   1  
ATOM 1762  N NE   . ARG A 1 111 ? -20.521 -9.623  7.790   1.00 0.00 ? 111 ARG A NE   1  
ATOM 1763  C CZ   . ARG A 1 111 ? -19.939 -10.560 7.093   1.00 0.00 ? 111 ARG A CZ   1  
ATOM 1764  N NH1  . ARG A 1 111 ? -18.700 -10.413 6.708   1.00 0.00 ? 111 ARG A NH1  1  
ATOM 1765  N NH2  . ARG A 1 111 ? -20.593 -11.644 6.783   1.00 0.00 ? 111 ARG A NH2  1  
ATOM 1766  H H    . ARG A 1 111 ? -18.007 -3.922  7.198   1.00 0.00 ? 111 ARG A H    1  
ATOM 1767  H HA   . ARG A 1 111 ? -19.098 -6.094  8.928   1.00 0.00 ? 111 ARG A HA   1  
ATOM 1768  H HB2  . ARG A 1 111 ? -18.676 -5.871  6.076   1.00 0.00 ? 111 ARG A HB2  1  
ATOM 1769  H HB3  . ARG A 1 111 ? -17.781 -7.246  6.725   1.00 0.00 ? 111 ARG A HB3  1  
ATOM 1770  H HG2  . ARG A 1 111 ? -20.713 -6.681  7.243   1.00 0.00 ? 111 ARG A HG2  1  
ATOM 1771  H HG3  . ARG A 1 111 ? -20.097 -7.868  6.100   1.00 0.00 ? 111 ARG A HG3  1  
ATOM 1772  H HD2  . ARG A 1 111 ? -18.730 -8.629  8.306   1.00 0.00 ? 111 ARG A HD2  1  
ATOM 1773  H HD3  . ARG A 1 111 ? -20.181 -7.977  9.063   1.00 0.00 ? 111 ARG A HD3  1  
ATOM 1774  H HE   . ARG A 1 111 ? -21.449 -9.734  8.078   1.00 0.00 ? 111 ARG A HE   1  
ATOM 1775  H HH11 . ARG A 1 111 ? -18.197 -9.582  6.947   1.00 0.00 ? 111 ARG A HH11 1  
ATOM 1776  H HH12 . ARG A 1 111 ? -18.255 -11.132 6.176   1.00 0.00 ? 111 ARG A HH12 1  
ATOM 1777  H HH21 . ARG A 1 111 ? -21.543 -11.756 7.080   1.00 0.00 ? 111 ARG A HH21 1  
ATOM 1778  H HH22 . ARG A 1 111 ? -20.149 -12.361 6.248   1.00 0.00 ? 111 ARG A HH22 1  
ATOM 1779  N N    . LEU A 1 112 ? -16.913 -6.727  9.867   1.00 0.00 ? 112 LEU A N    1  
ATOM 1780  C CA   . LEU A 1 112 ? -15.591 -7.033  10.471  1.00 0.00 ? 112 LEU A CA   1  
ATOM 1781  C C    . LEU A 1 112 ? -15.270 -8.517  10.303  1.00 0.00 ? 112 LEU A C    1  
ATOM 1782  O O    . LEU A 1 112 ? -16.114 -9.370  10.489  1.00 0.00 ? 112 LEU A O    1  
ATOM 1783  C CB   . LEU A 1 112 ? -15.637 -6.691  11.960  1.00 0.00 ? 112 LEU A CB   1  
ATOM 1784  C CG   . LEU A 1 112 ? -16.320 -5.334  12.162  1.00 0.00 ? 112 LEU A CG   1  
ATOM 1785  C CD1  . LEU A 1 112 ? -16.113 -4.877  13.605  1.00 0.00 ? 112 LEU A CD1  1  
ATOM 1786  C CD2  . LEU A 1 112 ? -15.726 -4.291  11.207  1.00 0.00 ? 112 LEU A CD2  1  
ATOM 1787  H H    . LEU A 1 112 ? -17.739 -6.979  10.330  1.00 0.00 ? 112 LEU A H    1  
ATOM 1788  H HA   . LEU A 1 112 ? -14.826 -6.443  9.990   1.00 0.00 ? 112 LEU A HA   1  
ATOM 1789  H HB2  . LEU A 1 112 ? -16.192 -7.453  12.486  1.00 0.00 ? 112 LEU A HB2  1  
ATOM 1790  H HB3  . LEU A 1 112 ? -14.632 -6.645  12.350  1.00 0.00 ? 112 LEU A HB3  1  
ATOM 1791  H HG   . LEU A 1 112 ? -17.378 -5.437  11.970  1.00 0.00 ? 112 LEU A HG   1  
ATOM 1792  H HD11 . LEU A 1 112 ? -15.529 -3.969  13.616  1.00 0.00 ? 112 LEU A HD11 1  
ATOM 1793  H HD12 . LEU A 1 112 ? -15.589 -5.648  14.154  1.00 0.00 ? 112 LEU A HD12 1  
ATOM 1794  H HD13 . LEU A 1 112 ? -17.072 -4.697  14.068  1.00 0.00 ? 112 LEU A HD13 1  
ATOM 1795  H HD21 . LEU A 1 112 ? -16.246 -4.329  10.260  1.00 0.00 ? 112 LEU A HD21 1  
ATOM 1796  H HD22 . LEU A 1 112 ? -14.678 -4.497  11.051  1.00 0.00 ? 112 LEU A HD22 1  
ATOM 1797  H HD23 . LEU A 1 112 ? -15.839 -3.305  11.635  1.00 0.00 ? 112 LEU A HD23 1  
ATOM 1798  N N    . SER A 1 113 ? -14.050 -8.832  9.973   1.00 0.00 ? 113 SER A N    1  
ATOM 1799  C CA   . SER A 1 113 ? -13.670 -10.261 9.817   1.00 0.00 ? 113 SER A CA   1  
ATOM 1800  C C    . SER A 1 113 ? -13.421 -10.848 11.204  1.00 0.00 ? 113 SER A C    1  
ATOM 1801  O O    . SER A 1 113 ? -13.353 -10.134 12.184  1.00 0.00 ? 113 SER A O    1  
ATOM 1802  C CB   . SER A 1 113 ? -12.398 -10.369 8.973   1.00 0.00 ? 113 SER A CB   1  
ATOM 1803  O OG   . SER A 1 113 ? -11.293 -9.892  9.729   1.00 0.00 ? 113 SER A OG   1  
ATOM 1804  H H    . SER A 1 113 ? -13.379 -8.129  9.842   1.00 0.00 ? 113 SER A H    1  
ATOM 1805  H HA   . SER A 1 113 ? -14.474 -10.800 9.335   1.00 0.00 ? 113 SER A HA   1  
ATOM 1806  H HB2  . SER A 1 113 ? -12.228 -11.398 8.705   1.00 0.00 ? 113 SER A HB2  1  
ATOM 1807  H HB3  . SER A 1 113 ? -12.514 -9.779  8.074   1.00 0.00 ? 113 SER A HB3  1  
ATOM 1808  H HG   . SER A 1 113 ? -11.603 -9.690  10.614  1.00 0.00 ? 113 SER A HG   1  
ATOM 1809  N N    . HIS A 1 114 ? -13.288 -12.138 11.304  1.00 0.00 ? 114 HIS A N    1  
ATOM 1810  C CA   . HIS A 1 114 ? -13.049 -12.753 12.641  1.00 0.00 ? 114 HIS A CA   1  
ATOM 1811  C C    . HIS A 1 114 ? -11.902 -12.022 13.343  1.00 0.00 ? 114 HIS A C    1  
ATOM 1812  O O    . HIS A 1 114 ? -11.887 -11.886 14.550  1.00 0.00 ? 114 HIS A O    1  
ATOM 1813  C CB   . HIS A 1 114 ? -12.689 -14.227 12.460  1.00 0.00 ? 114 HIS A CB   1  
ATOM 1814  C CG   . HIS A 1 114 ? -13.811 -14.923 11.741  1.00 0.00 ? 114 HIS A CG   1  
ATOM 1815  N ND1  . HIS A 1 114 ? -15.087 -15.026 12.280  1.00 0.00 ? 114 HIS A ND1  1  
ATOM 1816  C CD2  . HIS A 1 114 ? -13.869 -15.544 10.518  1.00 0.00 ? 114 HIS A CD2  1  
ATOM 1817  C CE1  . HIS A 1 114 ? -15.851 -15.687 11.391  1.00 0.00 ? 114 HIS A CE1  1  
ATOM 1818  N NE2  . HIS A 1 114 ? -15.156 -16.023 10.303  1.00 0.00 ? 114 HIS A NE2  1  
ATOM 1819  H H    . HIS A 1 114 ? -13.350 -12.703 10.507  1.00 0.00 ? 114 HIS A H    1  
ATOM 1820  H HA   . HIS A 1 114 ? -13.946 -12.672 13.237  1.00 0.00 ? 114 HIS A HA   1  
ATOM 1821  H HB2  . HIS A 1 114 ? -11.781 -14.309 11.880  1.00 0.00 ? 114 HIS A HB2  1  
ATOM 1822  H HB3  . HIS A 1 114 ? -12.542 -14.684 13.427  1.00 0.00 ? 114 HIS A HB3  1  
ATOM 1823  H HD1  . HIS A 1 114 ? -15.377 -14.684 13.152  1.00 0.00 ? 114 HIS A HD1  1  
ATOM 1824  H HD2  . HIS A 1 114 ? -13.043 -15.641 9.830   1.00 0.00 ? 114 HIS A HD2  1  
ATOM 1825  H HE1  . HIS A 1 114 ? -16.897 -15.910 11.534  1.00 0.00 ? 114 HIS A HE1  1  
ATOM 1826  H HE2  . HIS A 1 114 ? -15.483 -16.509 9.518   1.00 0.00 ? 114 HIS A HE2  1  
ATOM 1827  N N    . GLU A 1 115 ? -10.939 -11.548 12.598  1.00 0.00 ? 115 GLU A N    1  
ATOM 1828  C CA   . GLU A 1 115 ? -9.797  -10.825 13.229  1.00 0.00 ? 115 GLU A CA   1  
ATOM 1829  C C    . GLU A 1 115 ? -10.306 -9.572  13.950  1.00 0.00 ? 115 GLU A C    1  
ATOM 1830  O O    . GLU A 1 115 ? -9.773  -9.176  14.967  1.00 0.00 ? 115 GLU A O    1  
ATOM 1831  C CB   . GLU A 1 115 ? -8.790  -10.421 12.150  1.00 0.00 ? 115 GLU A CB   1  
ATOM 1832  C CG   . GLU A 1 115 ? -7.562  -9.787  12.808  1.00 0.00 ? 115 GLU A CG   1  
ATOM 1833  C CD   . GLU A 1 115 ? -6.584  -9.325  11.728  1.00 0.00 ? 115 GLU A CD   1  
ATOM 1834  O OE1  . GLU A 1 115 ? -6.877  -9.531  10.562  1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1835  O OE2  . GLU A 1 115 ? -5.556  -8.768  12.084  1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1836  H H    . GLU A 1 115 ? -10.969 -11.665 11.628  1.00 0.00 ? 115 GLU A H    1  
ATOM 1837  H HA   . GLU A 1 115 ? -9.315  -11.476 13.943  1.00 0.00 ? 115 GLU A HA   1  
ATOM 1838  H HB2  . GLU A 1 115 ? -8.489  -11.295 11.591  1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1839  H HB3  . GLU A 1 115 ? -9.245  -9.705  11.482  1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1840  H HG2  . GLU A 1 115 ? -7.870  -8.939  13.405  1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1841  H HG3  . GLU A 1 115 ? -7.077  -10.514 13.442  1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1842  H HE2  . GLU A 1 115 ? -4.991  -8.505  11.354  1.00 0.00 ? 115 GLU A HE2  1  
ATOM 1843  N N    . HIS A 1 116 ? -11.330 -8.943  13.434  1.00 0.00 ? 116 HIS A N    1  
ATOM 1844  C CA   . HIS A 1 116 ? -11.864 -7.718  14.096  1.00 0.00 ? 116 HIS A CA   1  
ATOM 1845  C C    . HIS A 1 116 ? -13.239 -8.027  14.691  1.00 0.00 ? 116 HIS A C    1  
ATOM 1846  O O    . HIS A 1 116 ? -14.019 -8.762  14.118  1.00 0.00 ? 116 HIS A O    1  
ATOM 1847  C CB   . HIS A 1 116 ? -11.981 -6.592  13.070  1.00 0.00 ? 116 HIS A CB   1  
ATOM 1848  C CG   . HIS A 1 116 ? -10.605 -6.116  12.691  1.00 0.00 ? 116 HIS A CG   1  
ATOM 1849  N ND1  . HIS A 1 116 ? -10.020 -6.429  11.474  1.00 0.00 ? 116 HIS A ND1  1  
ATOM 1850  C CD2  . HIS A 1 116 ? -9.682  -5.353  13.366  1.00 0.00 ? 116 HIS A CD2  1  
ATOM 1851  C CE1  . HIS A 1 116 ? -8.799  -5.862  11.450  1.00 0.00 ? 116 HIS A CE1  1  
ATOM 1852  N NE2  . HIS A 1 116 ? -8.547  -5.197  12.579  1.00 0.00 ? 116 HIS A NE2  1  
ATOM 1853  H H    . HIS A 1 116 ? -11.749 -9.276  12.614  1.00 0.00 ? 116 HIS A H    1  
ATOM 1854  H HA   . HIS A 1 116 ? -11.192 -7.417  14.886  1.00 0.00 ? 116 HIS A HA   1  
ATOM 1855  H HB2  . HIS A 1 116 ? -12.486 -6.960  12.189  1.00 0.00 ? 116 HIS A HB2  1  
ATOM 1856  H HB3  . HIS A 1 116 ? -12.543 -5.773  13.493  1.00 0.00 ? 116 HIS A HB3  1  
ATOM 1857  H HD1  . HIS A 1 116 ? -10.424 -6.964  10.758  1.00 0.00 ? 116 HIS A HD1  1  
ATOM 1858  H HD2  . HIS A 1 116 ? -9.817  -4.940  14.354  1.00 0.00 ? 116 HIS A HD2  1  
ATOM 1859  H HE1  . HIS A 1 116 ? -8.110  -5.941  10.624  1.00 0.00 ? 116 HIS A HE1  1  
ATOM 1860  H HE2  . HIS A 1 116 ? -7.732  -4.702  12.805  1.00 0.00 ? 116 HIS A HE2  1  
ATOM 1861  N N    . GLN A 1 117 ? -13.538 -7.489  15.844  1.00 0.00 ? 117 GLN A N    1  
ATOM 1862  C CA   . GLN A 1 117 ? -14.858 -7.777  16.476  1.00 0.00 ? 117 GLN A CA   1  
ATOM 1863  C C    . GLN A 1 117 ? -15.709 -6.508  16.571  1.00 0.00 ? 117 GLN A C    1  
ATOM 1864  O O    . GLN A 1 117 ? -16.921 -6.567  16.509  1.00 0.00 ? 117 GLN A O    1  
ATOM 1865  C CB   . GLN A 1 117 ? -14.629 -8.336  17.882  1.00 0.00 ? 117 GLN A CB   1  
ATOM 1866  C CG   . GLN A 1 117 ? -13.825 -7.327  18.705  1.00 0.00 ? 117 GLN A CG   1  
ATOM 1867  C CD   . GLN A 1 117 ? -13.510 -7.925  20.080  1.00 0.00 ? 117 GLN A CD   1  
ATOM 1868  O OE1  . GLN A 1 117 ? -12.805 -7.326  20.868  1.00 0.00 ? 117 GLN A OE1  1  
ATOM 1869  N NE2  . GLN A 1 117 ? -14.006 -9.088  20.402  1.00 0.00 ? 117 GLN A NE2  1  
ATOM 1870  H H    . GLN A 1 117 ? -12.893 -6.910  16.300  1.00 0.00 ? 117 GLN A H    1  
ATOM 1871  H HA   . GLN A 1 117 ? -15.382 -8.513  15.887  1.00 0.00 ? 117 GLN A HA   1  
ATOM 1872  H HB2  . GLN A 1 117 ? -15.582 -8.511  18.358  1.00 0.00 ? 117 GLN A HB2  1  
ATOM 1873  H HB3  . GLN A 1 117 ? -14.080 -9.262  17.816  1.00 0.00 ? 117 GLN A HB3  1  
ATOM 1874  H HG2  . GLN A 1 117 ? -12.902 -7.097  18.193  1.00 0.00 ? 117 GLN A HG2  1  
ATOM 1875  H HG3  . GLN A 1 117 ? -14.401 -6.423  18.833  1.00 0.00 ? 117 GLN A HG3  1  
ATOM 1876  H HE21 . GLN A 1 117 ? -14.575 -9.571  19.768  1.00 0.00 ? 117 GLN A HE21 1  
ATOM 1877  H HE22 . GLN A 1 117 ? -13.807 -9.480  21.278  1.00 0.00 ? 117 GLN A HE22 1  
ATOM 1878  N N    . ALA A 1 118 ? -15.105 -5.363  16.738  1.00 0.00 ? 118 ALA A N    1  
ATOM 1879  C CA   . ALA A 1 118 ? -15.918 -4.119  16.852  1.00 0.00 ? 118 ALA A CA   1  
ATOM 1880  C C    . ALA A 1 118 ? -15.179 -2.935  16.226  1.00 0.00 ? 118 ALA A C    1  
ATOM 1881  O O    . ALA A 1 118 ? -13.968 -2.919  16.129  1.00 0.00 ? 118 ALA A O    1  
ATOM 1882  C CB   . ALA A 1 118 ? -16.183 -3.827  18.330  1.00 0.00 ? 118 ALA A CB   1  
ATOM 1883  H H    . ALA A 1 118 ? -14.127 -5.323  16.799  1.00 0.00 ? 118 ALA A H    1  
ATOM 1884  H HA   . ALA A 1 118 ? -16.860 -4.259  16.343  1.00 0.00 ? 118 ALA A HA   1  
ATOM 1885  H HB1  . ALA A 1 118 ? -17.007 -4.435  18.674  1.00 0.00 ? 118 ALA A HB1  1  
ATOM 1886  H HB2  . ALA A 1 118 ? -16.430 -2.783  18.455  1.00 0.00 ? 118 ALA A HB2  1  
ATOM 1887  H HB3  . ALA A 1 118 ? -15.301 -4.060  18.906  1.00 0.00 ? 118 ALA A HB3  1  
ATOM 1888  N N    . TYR A 1 119 ? -15.912 -1.939  15.806  1.00 0.00 ? 119 TYR A N    1  
ATOM 1889  C CA   . TYR A 1 119 ? -15.281 -0.739  15.186  1.00 0.00 ? 119 TYR A CA   1  
ATOM 1890  C C    . TYR A 1 119 ? -15.910 0.523   15.778  1.00 0.00 ? 119 TYR A C    1  
ATOM 1891  O O    . TYR A 1 119 ? -17.022 0.499   16.270  1.00 0.00 ? 119 TYR A O    1  
ATOM 1892  C CB   . TYR A 1 119 ? -15.530 -0.766  13.678  1.00 0.00 ? 119 TYR A CB   1  
ATOM 1893  C CG   . TYR A 1 119 ? -16.982 -0.471  13.417  1.00 0.00 ? 119 TYR A CG   1  
ATOM 1894  C CD1  . TYR A 1 119 ? -17.920 -1.506  13.472  1.00 0.00 ? 119 TYR A CD1  1  
ATOM 1895  C CD2  . TYR A 1 119 ? -17.393 0.832   13.120  1.00 0.00 ? 119 TYR A CD2  1  
ATOM 1896  C CE1  . TYR A 1 119 ? -19.271 -1.242  13.231  1.00 0.00 ? 119 TYR A CE1  1  
ATOM 1897  C CE2  . TYR A 1 119 ? -18.747 1.100   12.879  1.00 0.00 ? 119 TYR A CE2  1  
ATOM 1898  C CZ   . TYR A 1 119 ? -19.686 0.061   12.933  1.00 0.00 ? 119 TYR A CZ   1  
ATOM 1899  O OH   . TYR A 1 119 ? -21.019 0.325   12.696  1.00 0.00 ? 119 TYR A OH   1  
ATOM 1900  H H    . TYR A 1 119 ? -16.887 -1.981  15.899  1.00 0.00 ? 119 TYR A H    1  
ATOM 1901  H HA   . TYR A 1 119 ? -14.220 -0.747  15.381  1.00 0.00 ? 119 TYR A HA   1  
ATOM 1902  H HB2  . TYR A 1 119 ? -14.916 -0.018  13.198  1.00 0.00 ? 119 TYR A HB2  1  
ATOM 1903  H HB3  . TYR A 1 119 ? -15.284 -1.741  13.289  1.00 0.00 ? 119 TYR A HB3  1  
ATOM 1904  H HD1  . TYR A 1 119 ? -17.598 -2.512  13.702  1.00 0.00 ? 119 TYR A HD1  1  
ATOM 1905  H HD2  . TYR A 1 119 ? -16.669 1.631   13.076  1.00 0.00 ? 119 TYR A HD2  1  
ATOM 1906  H HE1  . TYR A 1 119 ? -19.994 -2.042  13.274  1.00 0.00 ? 119 TYR A HE1  1  
ATOM 1907  H HE2  . TYR A 1 119 ? -19.066 2.104   12.649  1.00 0.00 ? 119 TYR A HE2  1  
ATOM 1908  H HH   . TYR A 1 119 ? -21.390 -0.427  12.226  1.00 0.00 ? 119 TYR A HH   1  
ATOM 1909  N N    . ARG A 1 120 ? -15.218 1.629   15.730  1.00 0.00 ? 120 ARG A N    1  
ATOM 1910  C CA   . ARG A 1 120 ? -15.792 2.885   16.289  1.00 0.00 ? 120 ARG A CA   1  
ATOM 1911  C C    . ARG A 1 120 ? -15.485 4.056   15.355  1.00 0.00 ? 120 ARG A C    1  
ATOM 1912  O O    . ARG A 1 120 ? -14.453 4.103   14.714  1.00 0.00 ? 120 ARG A O    1  
ATOM 1913  C CB   . ARG A 1 120 ? -15.176 3.182   17.656  1.00 0.00 ? 120 ARG A CB   1  
ATOM 1914  C CG   . ARG A 1 120 ? -15.571 2.094   18.656  1.00 0.00 ? 120 ARG A CG   1  
ATOM 1915  C CD   . ARG A 1 120 ? -15.032 2.462   20.042  1.00 0.00 ? 120 ARG A CD   1  
ATOM 1916  N NE   . ARG A 1 120 ? -15.238 1.323   20.981  1.00 0.00 ? 120 ARG A NE   1  
ATOM 1917  C CZ   . ARG A 1 120 ? -15.064 1.498   22.262  1.00 0.00 ? 120 ARG A CZ   1  
ATOM 1918  N NH1  . ARG A 1 120 ? -14.708 2.669   22.717  1.00 0.00 ? 120 ARG A NH1  1  
ATOM 1919  N NH2  . ARG A 1 120 ? -15.241 0.504   23.089  1.00 0.00 ? 120 ARG A NH2  1  
ATOM 1920  H H    . ARG A 1 120 ? -14.326 1.633   15.325  1.00 0.00 ? 120 ARG A H    1  
ATOM 1921  H HA   . ARG A 1 120 ? -16.861 2.780   16.391  1.00 0.00 ? 120 ARG A HA   1  
ATOM 1922  H HB2  . ARG A 1 120 ? -14.101 3.213   17.564  1.00 0.00 ? 120 ARG A HB2  1  
ATOM 1923  H HB3  . ARG A 1 120 ? -15.532 4.138   18.010  1.00 0.00 ? 120 ARG A HB3  1  
ATOM 1924  H HG2  . ARG A 1 120 ? -16.647 2.014   18.696  1.00 0.00 ? 120 ARG A HG2  1  
ATOM 1925  H HG3  . ARG A 1 120 ? -15.150 1.151   18.347  1.00 0.00 ? 120 ARG A HG3  1  
ATOM 1926  H HD2  . ARG A 1 120 ? -13.976 2.681   19.969  1.00 0.00 ? 120 ARG A HD2  1  
ATOM 1927  H HD3  . ARG A 1 120 ? -15.554 3.332   20.410  1.00 0.00 ? 120 ARG A HD3  1  
ATOM 1928  H HE   . ARG A 1 120 ? -15.505 0.445   20.637  1.00 0.00 ? 120 ARG A HE   1  
ATOM 1929  H HH11 . ARG A 1 120 ? -14.569 3.431   22.083  1.00 0.00 ? 120 ARG A HH11 1  
ATOM 1930  H HH12 . ARG A 1 120 ? -14.572 2.805   23.697  1.00 0.00 ? 120 ARG A HH12 1  
ATOM 1931  H HH21 . ARG A 1 120 ? -15.510 -0.395  22.741  1.00 0.00 ? 120 ARG A HH21 1  
ATOM 1932  H HH22 . ARG A 1 120 ? -15.112 0.641   24.071  1.00 0.00 ? 120 ARG A HH22 1  
ATOM 1933  N N    . TRP A 1 121 ? -16.359 5.019   15.306  1.00 0.00 ? 121 TRP A N    1  
ATOM 1934  C CA   . TRP A 1 121 ? -16.110 6.209   14.451  1.00 0.00 ? 121 TRP A CA   1  
ATOM 1935  C C    . TRP A 1 121 ? -15.698 7.360   15.364  1.00 0.00 ? 121 TRP A C    1  
ATOM 1936  O O    . TRP A 1 121 ? -16.501 7.891   16.106  1.00 0.00 ? 121 TRP A O    1  
ATOM 1937  C CB   . TRP A 1 121 ? -17.390 6.581   13.700  1.00 0.00 ? 121 TRP A CB   1  
ATOM 1938  C CG   . TRP A 1 121 ? -17.523 5.724   12.482  1.00 0.00 ? 121 TRP A CG   1  
ATOM 1939  C CD1  . TRP A 1 121 ? -18.378 4.684   12.345  1.00 0.00 ? 121 TRP A CD1  1  
ATOM 1940  C CD2  . TRP A 1 121 ? -16.792 5.820   11.228  1.00 0.00 ? 121 TRP A CD2  1  
ATOM 1941  N NE1  . TRP A 1 121 ? -18.218 4.136   11.083  1.00 0.00 ? 121 TRP A NE1  1  
ATOM 1942  C CE2  . TRP A 1 121 ? -17.249 4.805   10.357  1.00 0.00 ? 121 TRP A CE2  1  
ATOM 1943  C CE3  . TRP A 1 121 ? -15.783 6.685   10.769  1.00 0.00 ? 121 TRP A CE3  1  
ATOM 1944  C CZ2  . TRP A 1 121 ? -16.724 4.654   9.072   1.00 0.00 ? 121 TRP A CZ2  1  
ATOM 1945  C CZ3  . TRP A 1 121 ? -15.255 6.537   9.481   1.00 0.00 ? 121 TRP A CZ3  1  
ATOM 1946  C CH2  . TRP A 1 121 ? -15.724 5.524   8.633   1.00 0.00 ? 121 TRP A CH2  1  
ATOM 1947  H H    . TRP A 1 121 ? -17.167 4.970   15.856  1.00 0.00 ? 121 TRP A H    1  
ATOM 1948  H HA   . TRP A 1 121 ? -15.318 5.999   13.749  1.00 0.00 ? 121 TRP A HA   1  
ATOM 1949  H HB2  . TRP A 1 121 ? -18.241 6.427   14.344  1.00 0.00 ? 121 TRP A HB2  1  
ATOM 1950  H HB3  . TRP A 1 121 ? -17.344 7.619   13.405  1.00 0.00 ? 121 TRP A HB3  1  
ATOM 1951  H HD1  . TRP A 1 121 ? -19.073 4.338   13.096  1.00 0.00 ? 121 TRP A HD1  1  
ATOM 1952  H HE1  . TRP A 1 121 ? -18.718 3.370   10.730  1.00 0.00 ? 121 TRP A HE1  1  
ATOM 1953  H HE3  . TRP A 1 121 ? -15.415 7.468   11.414  1.00 0.00 ? 121 TRP A HE3  1  
ATOM 1954  H HZ2  . TRP A 1 121 ? -17.088 3.873   8.420   1.00 0.00 ? 121 TRP A HZ2  1  
ATOM 1955  H HZ3  . TRP A 1 121 ? -14.480 7.208   9.137   1.00 0.00 ? 121 TRP A HZ3  1  
ATOM 1956  H HH2  . TRP A 1 121 ? -15.314 5.417   7.642   1.00 0.00 ? 121 TRP A HH2  1  
ATOM 1957  N N    . LEU A 1 122 ? -14.446 7.732   15.345  1.00 0.00 ? 122 LEU A N    1  
ATOM 1958  C CA   . LEU A 1 122 ? -13.987 8.826   16.245  1.00 0.00 ? 122 LEU A CA   1  
ATOM 1959  C C    . LEU A 1 122 ? -13.213 9.877   15.456  1.00 0.00 ? 122 LEU A C    1  
ATOM 1960  O O    . LEU A 1 122 ? -12.912 9.706   14.292  1.00 0.00 ? 122 LEU A O    1  
ATOM 1961  C CB   . LEU A 1 122 ? -13.073 8.254   17.329  1.00 0.00 ? 122 LEU A CB   1  
ATOM 1962  C CG   . LEU A 1 122 ? -13.408 6.779   17.584  1.00 0.00 ? 122 LEU A CG   1  
ATOM 1963  C CD1  . LEU A 1 122 ? -12.298 5.898   17.016  1.00 0.00 ? 122 LEU A CD1  1  
ATOM 1964  C CD2  . LEU A 1 122 ? -13.541 6.534   19.089  1.00 0.00 ? 122 LEU A CD2  1  
ATOM 1965  H H    . LEU A 1 122 ? -13.807 7.277   14.756  1.00 0.00 ? 122 LEU A H    1  
ATOM 1966  H HA   . LEU A 1 122 ? -14.844 9.290   16.712  1.00 0.00 ? 122 LEU A HA   1  
ATOM 1967  H HB2  . LEU A 1 122 ? -12.043 8.341   17.007  1.00 0.00 ? 122 LEU A HB2  1  
ATOM 1968  H HB3  . LEU A 1 122 ? -13.213 8.813   18.241  1.00 0.00 ? 122 LEU A HB3  1  
ATOM 1969  H HG   . LEU A 1 122 ? -14.338 6.529   17.102  1.00 0.00 ? 122 LEU A HG   1  
ATOM 1970  H HD11 . LEU A 1 122 ? -12.398 4.897   17.405  1.00 0.00 ? 122 LEU A HD11 1  
ATOM 1971  H HD12 . LEU A 1 122 ? -11.337 6.303   17.301  1.00 0.00 ? 122 LEU A HD12 1  
ATOM 1972  H HD13 . LEU A 1 122 ? -12.372 5.874   15.939  1.00 0.00 ? 122 LEU A HD13 1  
ATOM 1973  H HD21 . LEU A 1 122 ? -13.823 5.505   19.262  1.00 0.00 ? 122 LEU A HD21 1  
ATOM 1974  H HD22 . LEU A 1 122 ? -14.301 7.187   19.493  1.00 0.00 ? 122 LEU A HD22 1  
ATOM 1975  H HD23 . LEU A 1 122 ? -12.602 6.737   19.574  1.00 0.00 ? 122 LEU A HD23 1  
ATOM 1976  N N    . GLY A 1 123 ? -12.886 10.966  16.097  1.00 0.00 ? 123 GLY A N    1  
ATOM 1977  C CA   . GLY A 1 123 ? -12.125 12.042  15.411  1.00 0.00 ? 123 GLY A CA   1  
ATOM 1978  C C    . GLY A 1 123 ? -10.631 11.728  15.486  1.00 0.00 ? 123 GLY A C    1  
ATOM 1979  O O    . GLY A 1 123 ? -10.228 10.688  15.968  1.00 0.00 ? 123 GLY A O    1  
ATOM 1980  H H    . GLY A 1 123 ? -13.140 11.071  17.037  1.00 0.00 ? 123 GLY A H    1  
ATOM 1981  H HA2  . GLY A 1 123 ? -12.433 12.100  14.375  1.00 0.00 ? 123 GLY A HA2  1  
ATOM 1982  H HA3  . GLY A 1 123 ? -12.314 12.987  15.897  1.00 0.00 ? 123 GLY A HA3  1  
ATOM 1983  N N    . LEU A 1 124 ? -9.808  12.613  15.006  1.00 0.00 ? 124 LEU A N    1  
ATOM 1984  C CA   . LEU A 1 124 ? -8.338  12.368  15.040  1.00 0.00 ? 124 LEU A CA   1  
ATOM 1985  C C    . LEU A 1 124 ? -7.856  12.186  16.482  1.00 0.00 ? 124 LEU A C    1  
ATOM 1986  O O    . LEU A 1 124 ? -7.009  11.363  16.759  1.00 0.00 ? 124 LEU A O    1  
ATOM 1987  C CB   . LEU A 1 124 ? -7.624  13.565  14.411  1.00 0.00 ? 124 LEU A CB   1  
ATOM 1988  C CG   . LEU A 1 124 ? -6.109  13.367  14.481  1.00 0.00 ? 124 LEU A CG   1  
ATOM 1989  C CD1  . LEU A 1 124 ? -5.743  11.976  13.964  1.00 0.00 ? 124 LEU A CD1  1  
ATOM 1990  C CD2  . LEU A 1 124 ? -5.431  14.421  13.609  1.00 0.00 ? 124 LEU A CD2  1  
ATOM 1991  H H    . LEU A 1 124 ? -10.156 13.444  14.617  1.00 0.00 ? 124 LEU A H    1  
ATOM 1992  H HA   . LEU A 1 124 ? -8.116  11.477  14.473  1.00 0.00 ? 124 LEU A HA   1  
ATOM 1993  H HB2  . LEU A 1 124 ? -7.924  13.661  13.380  1.00 0.00 ? 124 LEU A HB2  1  
ATOM 1994  H HB3  . LEU A 1 124 ? -7.889  14.462  14.946  1.00 0.00 ? 124 LEU A HB3  1  
ATOM 1995  H HG   . LEU A 1 124 ? -5.776  13.472  15.503  1.00 0.00 ? 124 LEU A HG   1  
ATOM 1996  H HD11 . LEU A 1 124 ? -5.917  11.246  14.742  1.00 0.00 ? 124 LEU A HD11 1  
ATOM 1997  H HD12 . LEU A 1 124 ? -4.702  11.958  13.679  1.00 0.00 ? 124 LEU A HD12 1  
ATOM 1998  H HD13 . LEU A 1 124 ? -6.354  11.738  13.106  1.00 0.00 ? 124 LEU A HD13 1  
ATOM 1999  H HD21 . LEU A 1 124 ? -5.498  14.123  12.572  1.00 0.00 ? 124 LEU A HD21 1  
ATOM 2000  H HD22 . LEU A 1 124 ? -4.394  14.510  13.894  1.00 0.00 ? 124 LEU A HD22 1  
ATOM 2001  H HD23 . LEU A 1 124 ? -5.925  15.371  13.744  1.00 0.00 ? 124 LEU A HD23 1  
ATOM 2002  N N    . GLU A 1 125 ? -8.378  12.954  17.397  1.00 0.00 ? 125 GLU A N    1  
ATOM 2003  C CA   . GLU A 1 125 ? -7.936  12.836  18.821  1.00 0.00 ? 125 GLU A CA   1  
ATOM 2004  C C    . GLU A 1 125 ? -8.151  11.411  19.335  1.00 0.00 ? 125 GLU A C    1  
ATOM 2005  O O    . GLU A 1 125 ? -7.237  10.774  19.819  1.00 0.00 ? 125 GLU A O    1  
ATOM 2006  C CB   . GLU A 1 125 ? -8.744  13.813  19.679  1.00 0.00 ? 125 GLU A CB   1  
ATOM 2007  C CG   . GLU A 1 125 ? -10.241 13.511  19.541  1.00 0.00 ? 125 GLU A CG   1  
ATOM 2008  C CD   . GLU A 1 125 ? -11.052 14.630  20.193  1.00 0.00 ? 125 GLU A CD   1  
ATOM 2009  O OE1  . GLU A 1 125 ? -10.447 15.493  20.809  1.00 0.00 ? 125 GLU A OE1  1  
ATOM 2010  O OE2  . GLU A 1 125 ? -12.264 14.606  20.064  1.00 0.00 ? 125 GLU A OE2  1  
ATOM 2011  H H    . GLU A 1 125 ? -9.052  13.619  17.147  1.00 0.00 ? 125 GLU A H    1  
ATOM 2012  H HA   . GLU A 1 125 ? -6.887  13.084  18.891  1.00 0.00 ? 125 GLU A HA   1  
ATOM 2013  H HB2  . GLU A 1 125 ? -8.450  13.712  20.714  1.00 0.00 ? 125 GLU A HB2  1  
ATOM 2014  H HB3  . GLU A 1 125 ? -8.552  14.824  19.348  1.00 0.00 ? 125 GLU A HB3  1  
ATOM 2015  H HG2  . GLU A 1 125 ? -10.497 13.440  18.496  1.00 0.00 ? 125 GLU A HG2  1  
ATOM 2016  H HG3  . GLU A 1 125 ? -10.471 12.575  20.032  1.00 0.00 ? 125 GLU A HG3  1  
ATOM 2017  H HE2  . GLU A 1 125 ? -12.709 15.338  20.498  1.00 0.00 ? 125 GLU A HE2  1  
ATOM 2018  N N    . GLU A 1 126 ? -9.345  10.901  19.234  1.00 0.00 ? 126 GLU A N    1  
ATOM 2019  C CA   . GLU A 1 126 ? -9.606  9.518   19.718  1.00 0.00 ? 126 GLU A CA   1  
ATOM 2020  C C    . GLU A 1 126 ? -8.928  8.535   18.776  1.00 0.00 ? 126 GLU A C    1  
ATOM 2021  O O    . GLU A 1 126 ? -8.222  7.640   19.192  1.00 0.00 ? 126 GLU A O    1  
ATOM 2022  C CB   . GLU A 1 126 ? -11.111 9.265   19.723  1.00 0.00 ? 126 GLU A CB   1  
ATOM 2023  C CG   . GLU A 1 126 ? -11.652 9.197   21.157  1.00 0.00 ? 126 GLU A CG   1  
ATOM 2024  C CD   . GLU A 1 126 ? -10.837 10.099  22.088  1.00 0.00 ? 126 GLU A CD   1  
ATOM 2025  O OE1  . GLU A 1 126 ? -10.703 9.750   23.250  1.00 0.00 ? 126 GLU A OE1  1  
ATOM 2026  O OE2  . GLU A 1 126 ? -10.364 11.123  21.627  1.00 0.00 ? 126 GLU A OE2  1  
ATOM 2027  H H    . GLU A 1 126 ? -10.071 11.428  18.840  1.00 0.00 ? 126 GLU A H    1  
ATOM 2028  H HA   . GLU A 1 126 ? -9.204  9.395   20.715  1.00 0.00 ? 126 GLU A HA   1  
ATOM 2029  H HB2  . GLU A 1 126 ? -11.607 10.066  19.193  1.00 0.00 ? 126 GLU A HB2  1  
ATOM 2030  H HB3  . GLU A 1 126 ? -11.309 8.332   19.223  1.00 0.00 ? 126 GLU A HB3  1  
ATOM 2031  H HG2  . GLU A 1 126 ? -12.679 9.525   21.157  1.00 0.00 ? 126 GLU A HG2  1  
ATOM 2032  H HG3  . GLU A 1 126 ? -11.602 8.178   21.508  1.00 0.00 ? 126 GLU A HG3  1  
ATOM 2033  H HE2  . GLU A 1 126 ? -9.867  11.637  22.267  1.00 0.00 ? 126 GLU A HE2  1  
ATOM 2034  N N    . ALA A 1 127 ? -9.114  8.702   17.501  1.00 0.00 ? 127 ALA A N    1  
ATOM 2035  C CA   . ALA A 1 127 ? -8.450  7.779   16.554  1.00 0.00 ? 127 ALA A CA   1  
ATOM 2036  C C    . ALA A 1 127 ? -6.973  7.735   16.924  1.00 0.00 ? 127 ALA A C    1  
ATOM 2037  O O    . ALA A 1 127 ? -6.313  6.723   16.800  1.00 0.00 ? 127 ALA A O    1  
ATOM 2038  C CB   . ALA A 1 127 ? -8.627  8.307   15.134  1.00 0.00 ? 127 ALA A CB   1  
ATOM 2039  H H    . ALA A 1 127 ? -9.670  9.437   17.172  1.00 0.00 ? 127 ALA A H    1  
ATOM 2040  H HA   . ALA A 1 127 ? -8.881  6.792   16.638  1.00 0.00 ? 127 ALA A HA   1  
ATOM 2041  H HB1  . ALA A 1 127 ? -9.666  8.568   14.980  1.00 0.00 ? 127 ALA A HB1  1  
ATOM 2042  H HB2  . ALA A 1 127 ? -8.336  7.545   14.428  1.00 0.00 ? 127 ALA A HB2  1  
ATOM 2043  H HB3  . ALA A 1 127 ? -8.010  9.184   14.998  1.00 0.00 ? 127 ALA A HB3  1  
ATOM 2044  N N    . CYS A 1 128 ? -6.461  8.829   17.415  1.00 0.00 ? 128 CYS A N    1  
ATOM 2045  C CA   . CYS A 1 128 ? -5.038  8.867   17.837  1.00 0.00 ? 128 CYS A CA   1  
ATOM 2046  C C    . CYS A 1 128 ? -4.919  8.205   19.211  1.00 0.00 ? 128 CYS A C    1  
ATOM 2047  O O    . CYS A 1 128 ? -3.976  7.490   19.489  1.00 0.00 ? 128 CYS A O    1  
ATOM 2048  C CB   . CYS A 1 128 ? -4.572  10.320  17.921  1.00 0.00 ? 128 CYS A CB   1  
ATOM 2049  S SG   . CYS A 1 128 ? -3.829  10.809  16.343  1.00 0.00 ? 128 CYS A SG   1  
ATOM 2050  H H    . CYS A 1 128 ? -7.025  9.622   17.526  1.00 0.00 ? 128 CYS A H    1  
ATOM 2051  H HA   . CYS A 1 128 ? -4.430  8.329   17.123  1.00 0.00 ? 128 CYS A HA   1  
ATOM 2052  H HB2  . CYS A 1 128 ? -5.416  10.957  18.133  1.00 0.00 ? 128 CYS A HB2  1  
ATOM 2053  H HB3  . CYS A 1 128 ? -3.847  10.421  18.708  1.00 0.00 ? 128 CYS A HB3  1  
ATOM 2054  H HG   . CYS A 1 128 ? -3.446  10.026  15.940  1.00 0.00 ? 128 CYS A HG   1  
ATOM 2055  N N    . GLN A 1 129 ? -5.875  8.438   20.074  1.00 0.00 ? 129 GLN A N    1  
ATOM 2056  C CA   . GLN A 1 129 ? -5.819  7.818   21.429  1.00 0.00 ? 129 GLN A CA   1  
ATOM 2057  C C    . GLN A 1 129 ? -5.954  6.301   21.297  1.00 0.00 ? 129 GLN A C    1  
ATOM 2058  O O    . GLN A 1 129 ? -5.183  5.551   21.862  1.00 0.00 ? 129 GLN A O    1  
ATOM 2059  C CB   . GLN A 1 129 ? -6.945  8.395   22.305  1.00 0.00 ? 129 GLN A CB   1  
ATOM 2060  C CG   . GLN A 1 129 ? -8.195  7.510   22.261  1.00 0.00 ? 129 GLN A CG   1  
ATOM 2061  C CD   . GLN A 1 129 ? -7.984  6.269   23.133  1.00 0.00 ? 129 GLN A CD   1  
ATOM 2062  O OE1  . GLN A 1 129 ? -6.904  6.044   23.639  1.00 0.00 ? 129 GLN A OE1  1  
ATOM 2063  N NE2  . GLN A 1 129 ? -8.981  5.451   23.335  1.00 0.00 ? 129 GLN A NE2  1  
ATOM 2064  H H    . GLN A 1 129 ? -6.628  9.013   19.830  1.00 0.00 ? 129 GLN A H    1  
ATOM 2065  H HA   . GLN A 1 129 ? -4.866  8.048   21.880  1.00 0.00 ? 129 GLN A HA   1  
ATOM 2066  H HB2  . GLN A 1 129 ? -6.600  8.458   23.318  1.00 0.00 ? 129 GLN A HB2  1  
ATOM 2067  H HB3  . GLN A 1 129 ? -7.199  9.385   21.954  1.00 0.00 ? 129 GLN A HB3  1  
ATOM 2068  H HG2  . GLN A 1 129 ? -9.040  8.071   22.635  1.00 0.00 ? 129 GLN A HG2  1  
ATOM 2069  H HG3  . GLN A 1 129 ? -8.391  7.211   21.249  1.00 0.00 ? 129 GLN A HG3  1  
ATOM 2070  H HE21 . GLN A 1 129 ? -9.855  5.635   22.930  1.00 0.00 ? 129 GLN A HE21 1  
ATOM 2071  H HE22 . GLN A 1 129 ? -8.856  4.653   23.891  1.00 0.00 ? 129 GLN A HE22 1  
ATOM 2072  N N    . LEU A 1 130 ? -6.908  5.841   20.543  1.00 0.00 ? 130 LEU A N    1  
ATOM 2073  C CA   . LEU A 1 130 ? -7.065  4.372   20.365  1.00 0.00 ? 130 LEU A CA   1  
ATOM 2074  C C    . LEU A 1 130 ? -5.841  3.845   19.625  1.00 0.00 ? 130 LEU A C    1  
ATOM 2075  O O    . LEU A 1 130 ? -5.238  2.864   20.011  1.00 0.00 ? 130 LEU A O    1  
ATOM 2076  C CB   . LEU A 1 130 ? -8.315  4.089   19.538  1.00 0.00 ? 130 LEU A CB   1  
ATOM 2077  C CG   . LEU A 1 130 ? -9.555  4.485   20.339  1.00 0.00 ? 130 LEU A CG   1  
ATOM 2078  C CD1  . LEU A 1 130 ? -10.614 5.029   19.389  1.00 0.00 ? 130 LEU A CD1  1  
ATOM 2079  C CD2  . LEU A 1 130 ? -10.111 3.253   21.050  1.00 0.00 ? 130 LEU A CD2  1  
ATOM 2080  H H    . LEU A 1 130 ? -7.511  6.463   20.087  1.00 0.00 ? 130 LEU A H    1  
ATOM 2081  H HA   . LEU A 1 130 ? -7.144  3.892   21.330  1.00 0.00 ? 130 LEU A HA   1  
ATOM 2082  H HB2  . LEU A 1 130 ? -8.277  4.662   18.623  1.00 0.00 ? 130 LEU A HB2  1  
ATOM 2083  H HB3  . LEU A 1 130 ? -8.362  3.039   19.306  1.00 0.00 ? 130 LEU A HB3  1  
ATOM 2084  H HG   . LEU A 1 130 ? -9.295  5.237   21.064  1.00 0.00 ? 130 LEU A HG   1  
ATOM 2085  H HD11 . LEU A 1 130 ? -10.506 6.100   19.312  1.00 0.00 ? 130 LEU A HD11 1  
ATOM 2086  H HD12 . LEU A 1 130 ? -11.594 4.789   19.772  1.00 0.00 ? 130 LEU A HD12 1  
ATOM 2087  H HD13 . LEU A 1 130 ? -10.486 4.581   18.417  1.00 0.00 ? 130 LEU A HD13 1  
ATOM 2088  H HD21 . LEU A 1 130 ? -10.817 3.562   21.804  1.00 0.00 ? 130 LEU A HD21 1  
ATOM 2089  H HD22 . LEU A 1 130 ? -9.303  2.706   21.511  1.00 0.00 ? 130 LEU A HD22 1  
ATOM 2090  H HD23 . LEU A 1 130 ? -10.609 2.624   20.328  1.00 0.00 ? 130 LEU A HD23 1  
ATOM 2091  N N    . ALA A 1 131 ? -5.450  4.517   18.576  1.00 0.00 ? 131 ALA A N    1  
ATOM 2092  C CA   . ALA A 1 131 ? -4.244  4.083   17.830  1.00 0.00 ? 131 ALA A CA   1  
ATOM 2093  C C    . ALA A 1 131 ? -3.028  4.581   18.600  1.00 0.00 ? 131 ALA A C    1  
ATOM 2094  O O    . ALA A 1 131 ? -2.137  5.203   18.061  1.00 0.00 ? 131 ALA A O    1  
ATOM 2095  C CB   . ALA A 1 131 ? -4.255  4.677   16.420  1.00 0.00 ? 131 ALA A CB   1  
ATOM 2096  H H    . ALA A 1 131 ? -5.938  5.319   18.299  1.00 0.00 ? 131 ALA A H    1  
ATOM 2097  H HA   . ALA A 1 131 ? -4.221  3.005   17.773  1.00 0.00 ? 131 ALA A HA   1  
ATOM 2098  H HB1  . ALA A 1 131 ? -3.687  5.595   16.412  1.00 0.00 ? 131 ALA A HB1  1  
ATOM 2099  H HB2  . ALA A 1 131 ? -5.274  4.878   16.122  1.00 0.00 ? 131 ALA A HB2  1  
ATOM 2100  H HB3  . ALA A 1 131 ? -3.814  3.973   15.734  1.00 0.00 ? 131 ALA A HB3  1  
ATOM 2101  N N    . GLN A 1 132 ? -3.009  4.310   19.872  1.00 0.00 ? 132 GLN A N    1  
ATOM 2102  C CA   . GLN A 1 132 ? -1.882  4.757   20.734  1.00 0.00 ? 132 GLN A CA   1  
ATOM 2103  C C    . GLN A 1 132 ? -0.571  4.642   19.963  1.00 0.00 ? 132 GLN A C    1  
ATOM 2104  O O    . GLN A 1 132 ? 0.341   5.425   20.141  1.00 0.00 ? 132 GLN A O    1  
ATOM 2105  C CB   . GLN A 1 132 ? -1.817  3.847   21.956  1.00 0.00 ? 132 GLN A CB   1  
ATOM 2106  C CG   . GLN A 1 132 ? -2.141  2.414   21.531  1.00 0.00 ? 132 GLN A CG   1  
ATOM 2107  C CD   . GLN A 1 132 ? -1.290  1.436   22.341  1.00 0.00 ? 132 GLN A CD   1  
ATOM 2108  O OE1  . GLN A 1 132 ? -1.809  0.526   22.955  1.00 0.00 ? 132 GLN A OE1  1  
ATOM 2109  N NE2  . GLN A 1 132 ? 0.006   1.589   22.368  1.00 0.00 ? 132 GLN A NE2  1  
ATOM 2110  H H    . GLN A 1 132 ? -3.756  3.816   20.269  1.00 0.00 ? 132 GLN A H    1  
ATOM 2111  H HA   . GLN A 1 132 ? -2.039  5.776   21.050  1.00 0.00 ? 132 GLN A HA   1  
ATOM 2112  H HB2  . GLN A 1 132 ? -0.824  3.881   22.379  1.00 0.00 ? 132 GLN A HB2  1  
ATOM 2113  H HB3  . GLN A 1 132 ? -2.536  4.173   22.689  1.00 0.00 ? 132 GLN A HB3  1  
ATOM 2114  H HG2  . GLN A 1 132 ? -3.188  2.216   21.708  1.00 0.00 ? 132 GLN A HG2  1  
ATOM 2115  H HG3  . GLN A 1 132 ? -1.925  2.295   20.482  1.00 0.00 ? 132 GLN A HG3  1  
ATOM 2116  H HE21 . GLN A 1 132 ? 0.423   2.326   21.874  1.00 0.00 ? 132 GLN A HE21 1  
ATOM 2117  H HE22 . GLN A 1 132 ? 0.561   0.964   22.881  1.00 0.00 ? 132 GLN A HE22 1  
ATOM 2118  N N    . PHE A 1 133 ? -0.467  3.666   19.115  1.00 0.00 ? 133 PHE A N    1  
ATOM 2119  C CA   . PHE A 1 133 ? 0.788   3.486   18.338  1.00 0.00 ? 133 PHE A CA   1  
ATOM 2120  C C    . PHE A 1 133 ? 1.149   4.803   17.647  1.00 0.00 ? 133 PHE A C    1  
ATOM 2121  O O    . PHE A 1 133 ? 0.390   5.340   16.865  1.00 0.00 ? 133 PHE A O    1  
ATOM 2122  C CB   . PHE A 1 133 ? 0.571   2.381   17.305  1.00 0.00 ? 133 PHE A CB   1  
ATOM 2123  C CG   . PHE A 1 133 ? 0.077   1.156   18.032  1.00 0.00 ? 133 PHE A CG   1  
ATOM 2124  C CD1  . PHE A 1 133 ? -1.259  1.092   18.451  1.00 0.00 ? 133 PHE A CD1  1  
ATOM 2125  C CD2  . PHE A 1 133 ? 0.949   0.099   18.315  1.00 0.00 ? 133 PHE A CD2  1  
ATOM 2126  C CE1  . PHE A 1 133 ? -1.722  -0.023  19.153  1.00 0.00 ? 133 PHE A CE1  1  
ATOM 2127  C CE2  . PHE A 1 133 ? 0.485   -1.019  19.020  1.00 0.00 ? 133 PHE A CE2  1  
ATOM 2128  C CZ   . PHE A 1 133 ? -0.850  -1.080  19.439  1.00 0.00 ? 133 PHE A CZ   1  
ATOM 2129  H H    . PHE A 1 133 ? -1.211  3.043   18.995  1.00 0.00 ? 133 PHE A H    1  
ATOM 2130  H HA   . PHE A 1 133 ? 1.582   3.201   19.010  1.00 0.00 ? 133 PHE A HA   1  
ATOM 2131  H HB2  . PHE A 1 133 ? -0.163  2.698   16.580  1.00 0.00 ? 133 PHE A HB2  1  
ATOM 2132  H HB3  . PHE A 1 133 ? 1.503   2.155   16.809  1.00 0.00 ? 133 PHE A HB3  1  
ATOM 2133  H HD1  . PHE A 1 133 ? -1.931  1.906   18.228  1.00 0.00 ? 133 PHE A HD1  1  
ATOM 2134  H HD2  . PHE A 1 133 ? 1.978   0.145   17.991  1.00 0.00 ? 133 PHE A HD2  1  
ATOM 2135  H HE1  . PHE A 1 133 ? -2.749  -0.062  19.482  1.00 0.00 ? 133 PHE A HE1  1  
ATOM 2136  H HE2  . PHE A 1 133 ? 1.157   -1.834  19.242  1.00 0.00 ? 133 PHE A HE2  1  
ATOM 2137  H HZ   . PHE A 1 133 ? -1.210  -1.942  19.982  1.00 0.00 ? 133 PHE A HZ   1  
ATOM 2138  N N    . LYS A 1 134 ? 2.309   5.319   17.943  1.00 0.00 ? 134 LYS A N    1  
ATOM 2139  C CA   . LYS A 1 134 ? 2.759   6.608   17.338  1.00 0.00 ? 134 LYS A CA   1  
ATOM 2140  C C    . LYS A 1 134 ? 2.623   6.569   15.818  1.00 0.00 ? 134 LYS A C    1  
ATOM 2141  O O    . LYS A 1 134 ? 2.246   7.540   15.192  1.00 0.00 ? 134 LYS A O    1  
ATOM 2142  C CB   . LYS A 1 134 ? 4.238   6.804   17.679  1.00 0.00 ? 134 LYS A CB   1  
ATOM 2143  C CG   . LYS A 1 134 ? 4.770   8.085   17.031  1.00 0.00 ? 134 LYS A CG   1  
ATOM 2144  C CD   . LYS A 1 134 ? 6.269   7.928   16.783  1.00 0.00 ? 134 LYS A CD   1  
ATOM 2145  C CE   . LYS A 1 134 ? 6.818   9.193   16.126  1.00 0.00 ? 134 LYS A CE   1  
ATOM 2146  N NZ   . LYS A 1 134 ? 8.301   9.093   16.018  1.00 0.00 ? 134 LYS A NZ   1  
ATOM 2147  H H    . LYS A 1 134 ? 2.892   4.857   18.580  1.00 0.00 ? 134 LYS A H    1  
ATOM 2148  H HA   . LYS A 1 134 ? 2.184   7.427   17.742  1.00 0.00 ? 134 LYS A HA   1  
ATOM 2149  H HB2  . LYS A 1 134 ? 4.351   6.869   18.750  1.00 0.00 ? 134 LYS A HB2  1  
ATOM 2150  H HB3  . LYS A 1 134 ? 4.802   5.957   17.310  1.00 0.00 ? 134 LYS A HB3  1  
ATOM 2151  H HG2  . LYS A 1 134 ? 4.263   8.260   16.092  1.00 0.00 ? 134 LYS A HG2  1  
ATOM 2152  H HG3  . LYS A 1 134 ? 4.601   8.920   17.694  1.00 0.00 ? 134 LYS A HG3  1  
ATOM 2153  H HD2  . LYS A 1 134 ? 6.774   7.760   17.724  1.00 0.00 ? 134 LYS A HD2  1  
ATOM 2154  H HD3  . LYS A 1 134 ? 6.438   7.083   16.130  1.00 0.00 ? 134 LYS A HD3  1  
ATOM 2155  H HE2  . LYS A 1 134 ? 6.393   9.299   15.139  1.00 0.00 ? 134 LYS A HE2  1  
ATOM 2156  H HE3  . LYS A 1 134 ? 6.558   10.052  16.724  1.00 0.00 ? 134 LYS A HE3  1  
ATOM 2157  H HZ1  . LYS A 1 134 ? 8.619   8.194   16.435  1.00 0.00 ? 134 LYS A HZ1  1  
ATOM 2158  H HZ2  . LYS A 1 134 ? 8.739   9.886   16.528  1.00 0.00 ? 134 LYS A HZ2  1  
ATOM 2159  H HZ3  . LYS A 1 134 ? 8.580   9.126   15.017  1.00 0.00 ? 134 LYS A HZ3  1  
ATOM 2160  N N    . GLU A 1 135 ? 2.963   5.469   15.222  1.00 0.00 ? 135 GLU A N    1  
ATOM 2161  C CA   . GLU A 1 135 ? 2.897   5.374   13.741  1.00 0.00 ? 135 GLU A CA   1  
ATOM 2162  C C    . GLU A 1 135 ? 1.472   5.639   13.253  1.00 0.00 ? 135 GLU A C    1  
ATOM 2163  O O    . GLU A 1 135 ? 1.261   6.345   12.287  1.00 0.00 ? 135 GLU A O    1  
ATOM 2164  C CB   . GLU A 1 135 ? 3.318   3.967   13.334  1.00 0.00 ? 135 GLU A CB   1  
ATOM 2165  C CG   . GLU A 1 135 ? 4.693   3.664   13.927  1.00 0.00 ? 135 GLU A CG   1  
ATOM 2166  C CD   . GLU A 1 135 ? 4.545   3.268   15.398  1.00 0.00 ? 135 GLU A CD   1  
ATOM 2167  O OE1  . GLU A 1 135 ? 5.558   3.187   16.074  1.00 0.00 ? 135 GLU A OE1  1  
ATOM 2168  O OE2  . GLU A 1 135 ? 3.423   3.055   15.823  1.00 0.00 ? 135 GLU A OE2  1  
ATOM 2169  H H    . GLU A 1 135 ? 3.287   4.711   15.746  1.00 0.00 ? 135 GLU A H    1  
ATOM 2170  H HA   . GLU A 1 135 ? 3.571   6.093   13.300  1.00 0.00 ? 135 GLU A HA   1  
ATOM 2171  H HB2  . GLU A 1 135 ? 2.598   3.253   13.701  1.00 0.00 ? 135 GLU A HB2  1  
ATOM 2172  H HB3  . GLU A 1 135 ? 3.374   3.905   12.259  1.00 0.00 ? 135 GLU A HB3  1  
ATOM 2173  H HG2  . GLU A 1 135 ? 5.141   2.853   13.383  1.00 0.00 ? 135 GLU A HG2  1  
ATOM 2174  H HG3  . GLU A 1 135 ? 5.320   4.541   13.853  1.00 0.00 ? 135 GLU A HG3  1  
ATOM 2175  H HE2  . GLU A 1 135 ? 3.406   2.812   16.751  1.00 0.00 ? 135 GLU A HE2  1  
ATOM 2176  N N    . MET A 1 136 ? 0.491   5.084   13.905  1.00 0.00 ? 136 MET A N    1  
ATOM 2177  C CA   . MET A 1 136 ? -0.910  5.311   13.459  1.00 0.00 ? 136 MET A CA   1  
ATOM 2178  C C    . MET A 1 136 ? -1.333  6.738   13.789  1.00 0.00 ? 136 MET A C    1  
ATOM 2179  O O    . MET A 1 136 ? -1.954  7.410   12.989  1.00 0.00 ? 136 MET A O    1  
ATOM 2180  C CB   . MET A 1 136 ? -1.836  4.325   14.159  1.00 0.00 ? 136 MET A CB   1  
ATOM 2181  C CG   . MET A 1 136 ? -1.474  2.907   13.726  1.00 0.00 ? 136 MET A CG   1  
ATOM 2182  S SD   . MET A 1 136 ? -2.769  2.255   12.637  1.00 0.00 ? 136 MET A SD   1  
ATOM 2183  C CE   . MET A 1 136 ? -2.626  3.487   11.316  1.00 0.00 ? 136 MET A CE   1  
ATOM 2184  H H    . MET A 1 136 ? 0.674   4.515   14.683  1.00 0.00 ? 136 MET A H    1  
ATOM 2185  H HA   . MET A 1 136 ? -0.970  5.163   12.393  1.00 0.00 ? 136 MET A HA   1  
ATOM 2186  H HB2  . MET A 1 136 ? -1.720  4.418   15.230  1.00 0.00 ? 136 MET A HB2  1  
ATOM 2187  H HB3  . MET A 1 136 ? -2.858  4.533   13.885  1.00 0.00 ? 136 MET A HB3  1  
ATOM 2188  H HG2  . MET A 1 136 ? -0.528  2.923   13.201  1.00 0.00 ? 136 MET A HG2  1  
ATOM 2189  H HG3  . MET A 1 136 ? -1.387  2.277   14.599  1.00 0.00 ? 136 MET A HG3  1  
ATOM 2190  H HE1  . MET A 1 136 ? -1.593  3.568   11.011  1.00 0.00 ? 136 MET A HE1  1  
ATOM 2191  H HE2  . MET A 1 136 ? -2.973  4.443   11.670  1.00 0.00 ? 136 MET A HE2  1  
ATOM 2192  H HE3  . MET A 1 136 ? -3.231  3.180   10.475  1.00 0.00 ? 136 MET A HE3  1  
ATOM 2193  N N    . LYS A 1 137 ? -0.993  7.218   14.952  1.00 0.00 ? 137 LYS A N    1  
ATOM 2194  C CA   . LYS A 1 137 ? -1.371  8.608   15.304  1.00 0.00 ? 137 LYS A CA   1  
ATOM 2195  C C    . LYS A 1 137 ? -0.822  9.540   14.234  1.00 0.00 ? 137 LYS A C    1  
ATOM 2196  O O    . LYS A 1 137 ? -1.465  10.486  13.838  1.00 0.00 ? 137 LYS A O    1  
ATOM 2197  C CB   . LYS A 1 137 ? -0.792  8.970   16.675  1.00 0.00 ? 137 LYS A CB   1  
ATOM 2198  C CG   . LYS A 1 137 ? -1.680  8.371   17.771  1.00 0.00 ? 137 LYS A CG   1  
ATOM 2199  C CD   . LYS A 1 137 ? -0.838  7.552   18.746  1.00 0.00 ? 137 LYS A CD   1  
ATOM 2200  C CE   . LYS A 1 137 ? -0.011  8.478   19.639  1.00 0.00 ? 137 LYS A CE   1  
ATOM 2201  N NZ   . LYS A 1 137 ? 0.597   9.558   18.814  1.00 0.00 ? 137 LYS A NZ   1  
ATOM 2202  H H    . LYS A 1 137 ? -0.482  6.668   15.583  1.00 0.00 ? 137 LYS A H    1  
ATOM 2203  H HA   . LYS A 1 137 ? -2.448  8.694   15.333  1.00 0.00 ? 137 LYS A HA   1  
ATOM 2204  H HB2  . LYS A 1 137 ? 0.209   8.571   16.759  1.00 0.00 ? 137 LYS A HB2  1  
ATOM 2205  H HB3  . LYS A 1 137 ? -0.766  10.045  16.783  1.00 0.00 ? 137 LYS A HB3  1  
ATOM 2206  H HG2  . LYS A 1 137 ? -2.170  9.168   18.307  1.00 0.00 ? 137 LYS A HG2  1  
ATOM 2207  H HG3  . LYS A 1 137 ? -2.421  7.731   17.323  1.00 0.00 ? 137 LYS A HG3  1  
ATOM 2208  H HD2  . LYS A 1 137 ? -1.491  6.953   19.361  1.00 0.00 ? 137 LYS A HD2  1  
ATOM 2209  H HD3  . LYS A 1 137 ? -0.182  6.908   18.192  1.00 0.00 ? 137 LYS A HD3  1  
ATOM 2210  H HE2  . LYS A 1 137 ? -0.650  8.915   20.393  1.00 0.00 ? 137 LYS A HE2  1  
ATOM 2211  H HE3  . LYS A 1 137 ? 0.772   7.907   20.118  1.00 0.00 ? 137 LYS A HE3  1  
ATOM 2212  H HZ1  . LYS A 1 137 ? 1.177   9.137   18.061  1.00 0.00 ? 137 LYS A HZ1  1  
ATOM 2213  H HZ2  . LYS A 1 137 ? 1.196   10.160  19.418  1.00 0.00 ? 137 LYS A HZ2  1  
ATOM 2214  H HZ3  . LYS A 1 137 ? -0.156  10.135  18.388  1.00 0.00 ? 137 LYS A HZ3  1  
ATOM 2215  N N    . ALA A 1 138 ? 0.359   9.261   13.747  1.00 0.00 ? 138 ALA A N    1  
ATOM 2216  C CA   . ALA A 1 138 ? 0.942   10.114  12.679  1.00 0.00 ? 138 ALA A CA   1  
ATOM 2217  C C    . ALA A 1 138 ? 0.182   9.873   11.374  1.00 0.00 ? 138 ALA A C    1  
ATOM 2218  O O    . ALA A 1 138 ? -0.185  10.796  10.675  1.00 0.00 ? 138 ALA A O    1  
ATOM 2219  C CB   . ALA A 1 138 ? 2.411   9.762   12.483  1.00 0.00 ? 138 ALA A CB   1  
ATOM 2220  H H    . ALA A 1 138 ? 0.852   8.476   14.072  1.00 0.00 ? 138 ALA A H    1  
ATOM 2221  H HA   . ALA A 1 138 ? 0.863   11.151  12.961  1.00 0.00 ? 138 ALA A HA   1  
ATOM 2222  H HB1  . ALA A 1 138 ? 2.894   10.557  11.938  1.00 0.00 ? 138 ALA A HB1  1  
ATOM 2223  H HB2  . ALA A 1 138 ? 2.489   8.839   11.928  1.00 0.00 ? 138 ALA A HB2  1  
ATOM 2224  H HB3  . ALA A 1 138 ? 2.882   9.648   13.447  1.00 0.00 ? 138 ALA A HB3  1  
ATOM 2225  N N    . ALA A 1 139 ? -0.070  8.632   11.044  1.00 0.00 ? 139 ALA A N    1  
ATOM 2226  C CA   . ALA A 1 139 ? -0.819  8.334   9.792   1.00 0.00 ? 139 ALA A CA   1  
ATOM 2227  C C    . ALA A 1 139 ? -2.172  9.025   9.880   1.00 0.00 ? 139 ALA A C    1  
ATOM 2228  O O    . ALA A 1 139 ? -2.601  9.711   8.973   1.00 0.00 ? 139 ALA A O    1  
ATOM 2229  C CB   . ALA A 1 139 ? -1.025  6.822   9.661   1.00 0.00 ? 139 ALA A CB   1  
ATOM 2230  H H    . ALA A 1 139 ? 0.225   7.899   11.626  1.00 0.00 ? 139 ALA A H    1  
ATOM 2231  H HA   . ALA A 1 139 ? -0.272  8.706   8.938   1.00 0.00 ? 139 ALA A HA   1  
ATOM 2232  H HB1  . ALA A 1 139 ? -2.048  6.574   9.911   1.00 0.00 ? 139 ALA A HB1  1  
ATOM 2233  H HB2  . ALA A 1 139 ? -0.357  6.309   10.338  1.00 0.00 ? 139 ALA A HB2  1  
ATOM 2234  H HB3  . ALA A 1 139 ? -0.816  6.515   8.648   1.00 0.00 ? 139 ALA A HB3  1  
ATOM 2235  N N    . LEU A 1 140 ? -2.834  8.869   10.989  1.00 0.00 ? 140 LEU A N    1  
ATOM 2236  C CA   . LEU A 1 140 ? -4.146  9.535   11.176  1.00 0.00 ? 140 LEU A CA   1  
ATOM 2237  C C    . LEU A 1 140 ? -3.897  11.042  11.263  1.00 0.00 ? 140 LEU A C    1  
ATOM 2238  O O    . LEU A 1 140 ? -4.729  11.849  10.898  1.00 0.00 ? 140 LEU A O    1  
ATOM 2239  C CB   . LEU A 1 140 ? -4.785  9.030   12.473  1.00 0.00 ? 140 LEU A CB   1  
ATOM 2240  C CG   . LEU A 1 140 ? -4.880  7.503   12.435  1.00 0.00 ? 140 LEU A CG   1  
ATOM 2241  C CD1  . LEU A 1 140 ? -4.737  6.945   13.852  1.00 0.00 ? 140 LEU A CD1  1  
ATOM 2242  C CD2  . LEU A 1 140 ? -6.238  7.083   11.869  1.00 0.00 ? 140 LEU A CD2  1  
ATOM 2243  H H    . LEU A 1 140 ? -2.453  8.329   11.711  1.00 0.00 ? 140 LEU A H    1  
ATOM 2244  H HA   . LEU A 1 140 ? -4.789  9.316   10.336  1.00 0.00 ? 140 LEU A HA   1  
ATOM 2245  H HB2  . LEU A 1 140 ? -4.183  9.335   13.315  1.00 0.00 ? 140 LEU A HB2  1  
ATOM 2246  H HB3  . LEU A 1 140 ? -5.777  9.448   12.569  1.00 0.00 ? 140 LEU A HB3  1  
ATOM 2247  H HG   . LEU A 1 140 ? -4.091  7.106   11.813  1.00 0.00 ? 140 LEU A HG   1  
ATOM 2248  H HD11 . LEU A 1 140 ? -3.810  7.290   14.281  1.00 0.00 ? 140 LEU A HD11 1  
ATOM 2249  H HD12 . LEU A 1 140 ? -4.737  5.865   13.813  1.00 0.00 ? 140 LEU A HD12 1  
ATOM 2250  H HD13 . LEU A 1 140 ? -5.564  7.284   14.456  1.00 0.00 ? 140 LEU A HD13 1  
ATOM 2251  H HD21 . LEU A 1 140 ? -6.211  6.032   11.614  1.00 0.00 ? 140 LEU A HD21 1  
ATOM 2252  H HD22 . LEU A 1 140 ? -6.456  7.662   10.986  1.00 0.00 ? 140 LEU A HD22 1  
ATOM 2253  H HD23 . LEU A 1 140 ? -7.005  7.253   12.611  1.00 0.00 ? 140 LEU A HD23 1  
ATOM 2254  N N    . GLN A 1 141 ? -2.743  11.418  11.757  1.00 0.00 ? 141 GLN A N    1  
ATOM 2255  C CA   . GLN A 1 141 ? -2.401  12.864  11.890  1.00 0.00 ? 141 GLN A CA   1  
ATOM 2256  C C    . GLN A 1 141 ? -2.019  13.456  10.532  1.00 0.00 ? 141 GLN A C    1  
ATOM 2257  O O    . GLN A 1 141 ? -2.543  14.471  10.117  1.00 0.00 ? 141 GLN A O    1  
ATOM 2258  C CB   . GLN A 1 141 ? -1.199  12.998  12.825  1.00 0.00 ? 141 GLN A CB   1  
ATOM 2259  C CG   . GLN A 1 141 ? -1.669  13.416  14.214  1.00 0.00 ? 141 GLN A CG   1  
ATOM 2260  C CD   . GLN A 1 141 ? -1.949  14.919  14.217  1.00 0.00 ? 141 GLN A CD   1  
ATOM 2261  O OE1  . GLN A 1 141 ? -1.896  15.559  15.248  1.00 0.00 ? 141 GLN A OE1  1  
ATOM 2262  N NE2  . GLN A 1 141 ? -2.240  15.515  13.093  1.00 0.00 ? 141 GLN A NE2  1  
ATOM 2263  H H    . GLN A 1 141 ? -2.097  10.739  12.045  1.00 0.00 ? 141 GLN A H    1  
ATOM 2264  H HA   . GLN A 1 141 ? -3.240  13.403  12.301  1.00 0.00 ? 141 GLN A HA   1  
ATOM 2265  H HB2  . GLN A 1 141 ? -0.697  12.052  12.886  1.00 0.00 ? 141 GLN A HB2  1  
ATOM 2266  H HB3  . GLN A 1 141 ? -0.516  13.737  12.437  1.00 0.00 ? 141 GLN A HB3  1  
ATOM 2267  H HG2  . GLN A 1 141 ? -2.567  12.875  14.468  1.00 0.00 ? 141 GLN A HG2  1  
ATOM 2268  H HG3  . GLN A 1 141 ? -0.897  13.194  14.936  1.00 0.00 ? 141 GLN A HG3  1  
ATOM 2269  H HE21 . GLN A 1 141 ? -2.277  14.998  12.261  1.00 0.00 ? 141 GLN A HE21 1  
ATOM 2270  H HE22 . GLN A 1 141 ? -2.420  16.477  13.082  1.00 0.00 ? 141 GLN A HE22 1  
ATOM 2271  N N    . GLU A 1 142 ? -1.097  12.843  9.845   1.00 0.00 ? 142 GLU A N    1  
ATOM 2272  C CA   . GLU A 1 142 ? -0.675  13.391  8.527   1.00 0.00 ? 142 GLU A CA   1  
ATOM 2273  C C    . GLU A 1 142 ? -1.839  13.311  7.540   1.00 0.00 ? 142 GLU A C    1  
ATOM 2274  O O    . GLU A 1 142 ? -2.033  14.193  6.725   1.00 0.00 ? 142 GLU A O    1  
ATOM 2275  C CB   . GLU A 1 142 ? 0.517   12.589  7.996   1.00 0.00 ? 142 GLU A CB   1  
ATOM 2276  C CG   . GLU A 1 142 ? 1.690   12.721  8.967   1.00 0.00 ? 142 GLU A CG   1  
ATOM 2277  C CD   . GLU A 1 142 ? 2.921   12.030  8.380   1.00 0.00 ? 142 GLU A CD   1  
ATOM 2278  O OE1  . GLU A 1 142 ? 2.787   11.415  7.335   1.00 0.00 ? 142 GLU A OE1  1  
ATOM 2279  O OE2  . GLU A 1 142 ? 3.976   12.125  8.987   1.00 0.00 ? 142 GLU A OE2  1  
ATOM 2280  H H    . GLU A 1 142 ? -0.674  12.033  10.199  1.00 0.00 ? 142 GLU A H    1  
ATOM 2281  H HA   . GLU A 1 142 ? -0.384  14.425  8.649   1.00 0.00 ? 142 GLU A HA   1  
ATOM 2282  H HB2  . GLU A 1 142 ? 0.238   11.550  7.899   1.00 0.00 ? 142 GLU A HB2  1  
ATOM 2283  H HB3  . GLU A 1 142 ? 0.807   12.976  7.031   1.00 0.00 ? 142 GLU A HB3  1  
ATOM 2284  H HG2  . GLU A 1 142 ? 1.906   13.767  9.130   1.00 0.00 ? 142 GLU A HG2  1  
ATOM 2285  H HG3  . GLU A 1 142 ? 1.432   12.257  9.908   1.00 0.00 ? 142 GLU A HG3  1  
ATOM 2286  H HE2  . GLU A 1 142 ? 4.704   11.667  8.561   1.00 0.00 ? 142 GLU A HE2  1  
ATOM 2287  N N    . GLY A 1 143 ? -2.626  12.271  7.604   1.00 0.00 ? 143 GLY A N    1  
ATOM 2288  C CA   . GLY A 1 143 ? -3.777  12.165  6.667   1.00 0.00 ? 143 GLY A CA   1  
ATOM 2289  C C    . GLY A 1 143 ? -4.688  13.375  6.875   1.00 0.00 ? 143 GLY A C    1  
ATOM 2290  O O    . GLY A 1 143 ? -5.080  14.041  5.938   1.00 0.00 ? 143 GLY A O    1  
ATOM 2291  H H    . GLY A 1 143 ? -2.466  11.570  8.269   1.00 0.00 ? 143 GLY A H    1  
ATOM 2292  H HA2  . GLY A 1 143 ? -3.415  12.150  5.648   1.00 0.00 ? 143 GLY A HA2  1  
ATOM 2293  H HA3  . GLY A 1 143 ? -4.331  11.261  6.869   1.00 0.00 ? 143 GLY A HA3  1  
ATOM 2294  N N    . HIS A 1 144 ? -5.011  13.672  8.103   1.00 0.00 ? 144 HIS A N    1  
ATOM 2295  C CA   . HIS A 1 144 ? -5.878  14.848  8.380   1.00 0.00 ? 144 HIS A CA   1  
ATOM 2296  C C    . HIS A 1 144 ? -5.159  16.116  7.923   1.00 0.00 ? 144 HIS A C    1  
ATOM 2297  O O    . HIS A 1 144 ? -5.743  17.006  7.338   1.00 0.00 ? 144 HIS A O    1  
ATOM 2298  C CB   . HIS A 1 144 ? -6.145  14.933  9.888   1.00 0.00 ? 144 HIS A CB   1  
ATOM 2299  C CG   . HIS A 1 144 ? -7.092  16.065  10.170  1.00 0.00 ? 144 HIS A CG   1  
ATOM 2300  N ND1  . HIS A 1 144 ? -6.713  17.394  10.052  1.00 0.00 ? 144 HIS A ND1  1  
ATOM 2301  C CD2  . HIS A 1 144 ? -8.407  16.084  10.569  1.00 0.00 ? 144 HIS A CD2  1  
ATOM 2302  C CE1  . HIS A 1 144 ? -7.779  18.151  10.375  1.00 0.00 ? 144 HIS A CE1  1  
ATOM 2303  N NE2  . HIS A 1 144 ? -8.834  17.400  10.697  1.00 0.00 ? 144 HIS A NE2  1  
ATOM 2304  H H    . HIS A 1 144 ? -4.672  13.129  8.842   1.00 0.00 ? 144 HIS A H    1  
ATOM 2305  H HA   . HIS A 1 144 ? -6.814  14.747  7.850   1.00 0.00 ? 144 HIS A HA   1  
ATOM 2306  H HB2  . HIS A 1 144 ? -6.579  14.007  10.229  1.00 0.00 ? 144 HIS A HB2  1  
ATOM 2307  H HB3  . HIS A 1 144 ? -5.215  15.107  10.407  1.00 0.00 ? 144 HIS A HB3  1  
ATOM 2308  H HD1  . HIS A 1 144 ? -5.831  17.722  9.782   1.00 0.00 ? 144 HIS A HD1  1  
ATOM 2309  H HD2  . HIS A 1 144 ? -9.016  15.210  10.754  1.00 0.00 ? 144 HIS A HD2  1  
ATOM 2310  H HE1  . HIS A 1 144 ? -7.780  19.232  10.373  1.00 0.00 ? 144 HIS A HE1  1  
ATOM 2311  H HE2  . HIS A 1 144 ? -9.723  17.711  10.968  1.00 0.00 ? 144 HIS A HE2  1  
ATOM 2312  N N    . GLN A 1 145 ? -3.886  16.200  8.198   1.00 0.00 ? 145 GLN A N    1  
ATOM 2313  C CA   . GLN A 1 145 ? -3.106  17.402  7.799   1.00 0.00 ? 145 GLN A CA   1  
ATOM 2314  C C    . GLN A 1 145 ? -3.155  17.590  6.279   1.00 0.00 ? 145 GLN A C    1  
ATOM 2315  O O    . GLN A 1 145 ? -3.335  18.686  5.785   1.00 0.00 ? 145 GLN A O    1  
ATOM 2316  C CB   . GLN A 1 145 ? -1.650  17.208  8.228   1.00 0.00 ? 145 GLN A CB   1  
ATOM 2317  C CG   . GLN A 1 145 ? -0.875  18.508  8.015   1.00 0.00 ? 145 GLN A CG   1  
ATOM 2318  C CD   . GLN A 1 145 ? -1.295  19.532  9.072   1.00 0.00 ? 145 GLN A CD   1  
ATOM 2319  O OE1  . GLN A 1 145 ? -1.044  19.346  10.246  1.00 0.00 ? 145 GLN A OE1  1  
ATOM 2320  N NE2  . GLN A 1 145 ? -1.926  20.614  8.704   1.00 0.00 ? 145 GLN A NE2  1  
ATOM 2321  H H    . GLN A 1 145 ? -3.444  15.468  8.678   1.00 0.00 ? 145 GLN A H    1  
ATOM 2322  H HA   . GLN A 1 145 ? -3.509  18.277  8.286   1.00 0.00 ? 145 GLN A HA   1  
ATOM 2323  H HB2  . GLN A 1 145 ? -1.615  16.930  9.271   1.00 0.00 ? 145 GLN A HB2  1  
ATOM 2324  H HB3  . GLN A 1 145 ? -1.202  16.425  7.634   1.00 0.00 ? 145 GLN A HB3  1  
ATOM 2325  H HG2  . GLN A 1 145 ? 0.185   18.314  8.101   1.00 0.00 ? 145 GLN A HG2  1  
ATOM 2326  H HG3  . GLN A 1 145 ? -1.091  18.897  7.031   1.00 0.00 ? 145 GLN A HG3  1  
ATOM 2327  H HE21 . GLN A 1 145 ? -2.129  20.765  7.757   1.00 0.00 ? 145 GLN A HE21 1  
ATOM 2328  H HE22 . GLN A 1 145 ? -2.197  21.274  9.376   1.00 0.00 ? 145 GLN A HE22 1  
ATOM 2329  N N    . PHE A 1 146 ? -2.979  16.533  5.535   1.00 0.00 ? 146 PHE A N    1  
ATOM 2330  C CA   . PHE A 1 146 ? -2.995  16.649  4.048   1.00 0.00 ? 146 PHE A CA   1  
ATOM 2331  C C    . PHE A 1 146 ? -4.406  16.956  3.534   1.00 0.00 ? 146 PHE A C    1  
ATOM 2332  O O    . PHE A 1 146 ? -4.598  17.847  2.730   1.00 0.00 ? 146 PHE A O    1  
ATOM 2333  C CB   . PHE A 1 146 ? -2.512  15.335  3.437   1.00 0.00 ? 146 PHE A CB   1  
ATOM 2334  C CG   . PHE A 1 146 ? -2.548  15.442  1.934   1.00 0.00 ? 146 PHE A CG   1  
ATOM 2335  C CD1  . PHE A 1 146 ? -3.749  15.230  1.251   1.00 0.00 ? 146 PHE A CD1  1  
ATOM 2336  C CD2  . PHE A 1 146 ? -1.382  15.746  1.221   1.00 0.00 ? 146 PHE A CD2  1  
ATOM 2337  C CE1  . PHE A 1 146 ? -3.792  15.323  -0.142  1.00 0.00 ? 146 PHE A CE1  1  
ATOM 2338  C CE2  . PHE A 1 146 ? -1.423  15.841  -0.176  1.00 0.00 ? 146 PHE A CE2  1  
ATOM 2339  C CZ   . PHE A 1 146 ? -2.628  15.629  -0.857  1.00 0.00 ? 146 PHE A CZ   1  
ATOM 2340  H H    . PHE A 1 146 ? -2.823  15.662  5.956   1.00 0.00 ? 146 PHE A H    1  
ATOM 2341  H HA   . PHE A 1 146 ? -2.328  17.443  3.750   1.00 0.00 ? 146 PHE A HA   1  
ATOM 2342  H HB2  . PHE A 1 146 ? -1.500  15.141  3.762   1.00 0.00 ? 146 PHE A HB2  1  
ATOM 2343  H HB3  . PHE A 1 146 ? -3.155  14.529  3.757   1.00 0.00 ? 146 PHE A HB3  1  
ATOM 2344  H HD1  . PHE A 1 146 ? -4.646  14.997  1.804   1.00 0.00 ? 146 PHE A HD1  1  
ATOM 2345  H HD2  . PHE A 1 146 ? -0.454  15.910  1.747   1.00 0.00 ? 146 PHE A HD2  1  
ATOM 2346  H HE1  . PHE A 1 146 ? -4.721  15.159  -0.664  1.00 0.00 ? 146 PHE A HE1  1  
ATOM 2347  H HE2  . PHE A 1 146 ? -0.525  16.076  -0.728  1.00 0.00 ? 146 PHE A HE2  1  
ATOM 2348  H HZ   . PHE A 1 146 ? -2.661  15.702  -1.936  1.00 0.00 ? 146 PHE A HZ   1  
ATOM 2349  N N    . LEU A 1 147 ? -5.391  16.220  3.972   1.00 0.00 ? 147 LEU A N    1  
ATOM 2350  C CA   . LEU A 1 147 ? -6.777  16.466  3.484   1.00 0.00 ? 147 LEU A CA   1  
ATOM 2351  C C    . LEU A 1 147 ? -7.163  17.927  3.719   1.00 0.00 ? 147 LEU A C    1  
ATOM 2352  O O    . LEU A 1 147 ? -7.842  18.534  2.918   1.00 0.00 ? 147 LEU A O    1  
ATOM 2353  C CB   . LEU A 1 147 ? -7.755  15.543  4.215   1.00 0.00 ? 147 LEU A CB   1  
ATOM 2354  C CG   . LEU A 1 147 ? -7.437  14.088  3.866   1.00 0.00 ? 147 LEU A CG   1  
ATOM 2355  C CD1  . LEU A 1 147 ? -8.420  13.162  4.581   1.00 0.00 ? 147 LEU A CD1  1  
ATOM 2356  C CD2  . LEU A 1 147 ? -7.573  13.880  2.358   1.00 0.00 ? 147 LEU A CD2  1  
ATOM 2357  H H    . LEU A 1 147 ? -5.215  15.496  4.607   1.00 0.00 ? 147 LEU A H    1  
ATOM 2358  H HA   . LEU A 1 147 ? -6.819  16.259  2.427   1.00 0.00 ? 147 LEU A HA   1  
ATOM 2359  H HB2  . LEU A 1 147 ? -7.658  15.687  5.281   1.00 0.00 ? 147 LEU A HB2  1  
ATOM 2360  H HB3  . LEU A 1 147 ? -8.765  15.771  3.912   1.00 0.00 ? 147 LEU A HB3  1  
ATOM 2361  H HG   . LEU A 1 147 ? -6.430  13.852  4.175   1.00 0.00 ? 147 LEU A HG   1  
ATOM 2362  H HD11 . LEU A 1 147 ? -8.689  12.355  3.918   1.00 0.00 ? 147 LEU A HD11 1  
ATOM 2363  H HD12 . LEU A 1 147 ? -9.306  13.717  4.849   1.00 0.00 ? 147 LEU A HD12 1  
ATOM 2364  H HD13 . LEU A 1 147 ? -7.959  12.763  5.470   1.00 0.00 ? 147 LEU A HD13 1  
ATOM 2365  H HD21 . LEU A 1 147 ? -8.341  14.535  1.972   1.00 0.00 ? 147 LEU A HD21 1  
ATOM 2366  H HD22 . LEU A 1 147 ? -7.842  12.854  2.161   1.00 0.00 ? 147 LEU A HD22 1  
ATOM 2367  H HD23 . LEU A 1 147 ? -6.634  14.104  1.877   1.00 0.00 ? 147 LEU A HD23 1  
ATOM 2368  N N    . CYS A 1 148 ? -6.732  18.503  4.804   1.00 0.00 ? 148 CYS A N    1  
ATOM 2369  C CA   . CYS A 1 148 ? -7.072  19.929  5.065   1.00 0.00 ? 148 CYS A CA   1  
ATOM 2370  C C    . CYS A 1 148 ? -6.285  20.813  4.092   1.00 0.00 ? 148 CYS A C    1  
ATOM 2371  O O    . CYS A 1 148 ? -6.529  21.997  3.971   1.00 0.00 ? 148 CYS A O    1  
ATOM 2372  C CB   . CYS A 1 148 ? -6.706  20.289  6.507   1.00 0.00 ? 148 CYS A CB   1  
ATOM 2373  S SG   . CYS A 1 148 ? -7.808  19.412  7.645   1.00 0.00 ? 148 CYS A SG   1  
ATOM 2374  H H    . CYS A 1 148 ? -6.176  18.005  5.440   1.00 0.00 ? 148 CYS A H    1  
ATOM 2375  H HA   . CYS A 1 148 ? -8.130  20.079  4.912   1.00 0.00 ? 148 CYS A HA   1  
ATOM 2376  H HB2  . CYS A 1 148 ? -5.683  19.999  6.703   1.00 0.00 ? 148 CYS A HB2  1  
ATOM 2377  H HB3  . CYS A 1 148 ? -6.813  21.354  6.652   1.00 0.00 ? 148 CYS A HB3  1  
ATOM 2378  H HG   . CYS A 1 148 ? -7.722  19.815  8.511   1.00 0.00 ? 148 CYS A HG   1  
ATOM 2379  N N    . SER A 1 149 ? -5.327  20.239  3.412   1.00 0.00 ? 149 SER A N    1  
ATOM 2380  C CA   . SER A 1 149 ? -4.501  21.029  2.454   1.00 0.00 ? 149 SER A CA   1  
ATOM 2381  C C    . SER A 1 149 ? -5.116  20.998  1.050   1.00 0.00 ? 149 SER A C    1  
ATOM 2382  O O    . SER A 1 149 ? -4.685  21.709  0.163   1.00 0.00 ? 149 SER A O    1  
ATOM 2383  C CB   . SER A 1 149 ? -3.096  20.430  2.394   1.00 0.00 ? 149 SER A CB   1  
ATOM 2384  O OG   . SER A 1 149 ? -2.139  21.452  2.638   1.00 0.00 ? 149 SER A OG   1  
ATOM 2385  H H    . SER A 1 149 ? -5.147  19.284  3.537   1.00 0.00 ? 149 SER A H    1  
ATOM 2386  H HA   . SER A 1 149 ? -4.438  22.052  2.793   1.00 0.00 ? 149 SER A HA   1  
ATOM 2387  H HB2  . SER A 1 149 ? -2.997  19.664  3.146   1.00 0.00 ? 149 SER A HB2  1  
ATOM 2388  H HB3  . SER A 1 149 ? -2.934  19.995  1.415   1.00 0.00 ? 149 SER A HB3  1  
ATOM 2389  H HG   . SER A 1 149 ? -1.406  21.063  3.122   1.00 0.00 ? 149 SER A HG   1  
ATOM 2390  N N    . ILE A 1 150 ? -6.100  20.172  0.826   1.00 0.00 ? 150 ILE A N    1  
ATOM 2391  C CA   . ILE A 1 150 ? -6.707  20.101  -0.534  1.00 0.00 ? 150 ILE A CA   1  
ATOM 2392  C C    . ILE A 1 150 ? -7.686  21.260  -0.726  1.00 0.00 ? 150 ILE A C    1  
ATOM 2393  O O    . ILE A 1 150 ? -7.344  22.413  -0.561  1.00 0.00 ? 150 ILE A O    1  
ATOM 2394  C CB   . ILE A 1 150 ? -7.446  18.768  -0.708  1.00 0.00 ? 150 ILE A CB   1  
ATOM 2395  C CG1  . ILE A 1 150 ? -6.735  17.668  0.080   1.00 0.00 ? 150 ILE A CG1  1  
ATOM 2396  C CG2  . ILE A 1 150 ? -7.450  18.390  -2.188  1.00 0.00 ? 150 ILE A CG2  1  
ATOM 2397  C CD1  . ILE A 1 150 ? -7.576  16.390  0.031   1.00 0.00 ? 150 ILE A CD1  1  
ATOM 2398  H H    . ILE A 1 150 ? -6.433  19.593  1.542   1.00 0.00 ? 150 ILE A H    1  
ATOM 2399  H HA   . ILE A 1 150 ? -5.927  20.171  -1.276  1.00 0.00 ? 150 ILE A HA   1  
ATOM 2400  H HB   . ILE A 1 150 ? -8.463  18.867  -0.355  1.00 0.00 ? 150 ILE A HB   1  
ATOM 2401  H HG12 . ILE A 1 150 ? -5.767  17.480  -0.357  1.00 0.00 ? 150 ILE A HG12 1  
ATOM 2402  H HG13 . ILE A 1 150 ? -6.615  17.977  1.105   1.00 0.00 ? 150 ILE A HG13 1  
ATOM 2403  H HG21 . ILE A 1 150 ? -7.919  17.424  -2.310  1.00 0.00 ? 150 ILE A HG21 1  
ATOM 2404  H HG22 . ILE A 1 150 ? -6.430  18.342  -2.545  1.00 0.00 ? 150 ILE A HG22 1  
ATOM 2405  H HG23 . ILE A 1 150 ? -7.994  19.132  -2.751  1.00 0.00 ? 150 ILE A HG23 1  
ATOM 2406  H HD11 . ILE A 1 150 ? -8.014  16.282  -0.950  1.00 0.00 ? 150 ILE A HD11 1  
ATOM 2407  H HD12 . ILE A 1 150 ? -8.360  16.448  0.769   1.00 0.00 ? 150 ILE A HD12 1  
ATOM 2408  H HD13 . ILE A 1 150 ? -6.947  15.538  0.238   1.00 0.00 ? 150 ILE A HD13 1  
ATOM 2409  N N    . GLU A 1 151 ? -8.903  20.958  -1.078  1.00 0.00 ? 151 GLU A N    1  
ATOM 2410  C CA   . GLU A 1 151 ? -9.915  22.031  -1.291  1.00 0.00 ? 151 GLU A CA   1  
ATOM 2411  C C    . GLU A 1 151 ? -10.748 22.204  -0.019  1.00 0.00 ? 151 GLU A C    1  
ATOM 2412  O O    . GLU A 1 151 ? -10.712 23.235  0.624   1.00 0.00 ? 151 GLU A O    1  
ATOM 2413  C CB   . GLU A 1 151 ? -10.833 21.637  -2.452  1.00 0.00 ? 151 GLU A CB   1  
ATOM 2414  C CG   . GLU A 1 151 ? -11.835 22.761  -2.721  1.00 0.00 ? 151 GLU A CG   1  
ATOM 2415  C CD   . GLU A 1 151 ? -12.813 22.326  -3.814  1.00 0.00 ? 151 GLU A CD   1  
ATOM 2416  O OE1  . GLU A 1 151 ? -12.669 21.219  -4.304  1.00 0.00 ? 151 GLU A OE1  1  
ATOM 2417  O OE2  . GLU A 1 151 ? -13.689 23.109  -4.142  1.00 0.00 ? 151 GLU A OE2  1  
ATOM 2418  H H    . GLU A 1 151 ? -9.149  20.021  -1.208  1.00 0.00 ? 151 GLU A H    1  
ATOM 2419  H HA   . GLU A 1 151 ? -9.415  22.959  -1.526  1.00 0.00 ? 151 GLU A HA   1  
ATOM 2420  H HB2  . GLU A 1 151 ? -10.240 21.463  -3.337  1.00 0.00 ? 151 GLU A HB2  1  
ATOM 2421  H HB3  . GLU A 1 151 ? -11.368 20.735  -2.194  1.00 0.00 ? 151 GLU A HB3  1  
ATOM 2422  H HG2  . GLU A 1 151 ? -12.381 22.981  -1.814  1.00 0.00 ? 151 GLU A HG2  1  
ATOM 2423  H HG3  . GLU A 1 151 ? -11.306 23.645  -3.044  1.00 0.00 ? 151 GLU A HG3  1  
ATOM 2424  H HE2  . GLU A 1 151 ? -14.265 22.770  -4.832  1.00 0.00 ? 151 GLU A HE2  1  
ATOM 2425  N N    . ALA A 1 152 ? -11.496 21.201  0.350   1.00 0.00 ? 152 ALA A N    1  
ATOM 2426  C CA   . ALA A 1 152 ? -12.327 21.308  1.583   1.00 0.00 ? 152 ALA A CA   1  
ATOM 2427  C C    . ALA A 1 152 ? -11.432 21.684  2.765   1.00 0.00 ? 152 ALA A C    1  
ATOM 2428  O O    . ALA A 1 152 ? -10.286 21.284  2.842   1.00 0.00 ? 152 ALA A O    1  
ATOM 2429  C CB   . ALA A 1 152 ? -13.005 19.965  1.860   1.00 0.00 ? 152 ALA A CB   1  
ATOM 2430  H H    . ALA A 1 152 ? -11.509 20.379  -0.181  1.00 0.00 ? 152 ALA A H    1  
ATOM 2431  H HA   . ALA A 1 152 ? -13.080 22.071  1.446   1.00 0.00 ? 152 ALA A HA   1  
ATOM 2432  H HB1  . ALA A 1 152 ? -13.927 19.903  1.300   1.00 0.00 ? 152 ALA A HB1  1  
ATOM 2433  H HB2  . ALA A 1 152 ? -13.220 19.880  2.915   1.00 0.00 ? 152 ALA A HB2  1  
ATOM 2434  H HB3  . ALA A 1 152 ? -12.348 19.161  1.562   1.00 0.00 ? 152 ALA A HB3  1  
ATOM 2435  N N    . LEU A 1 153 ? -11.943 22.453  3.687   1.00 0.00 ? 153 LEU A N    1  
ATOM 2436  C CA   . LEU A 1 153 ? -11.120 22.855  4.860   1.00 0.00 ? 153 LEU A CA   1  
ATOM 2437  C C    . LEU A 1 153 ? -10.642 21.604  5.600   1.00 0.00 ? 153 LEU A C    1  
ATOM 2438  O O    . LEU A 1 153 ? -10.937 20.483  5.191   1.00 0.00 ? 153 LEU A O    1  
ATOM 2439  C CB   . LEU A 1 153 ? -11.962 23.712  5.805   1.00 0.00 ? 153 LEU A CB   1  
ATOM 2440  C CG   . LEU A 1 153 ? -11.646 25.189  5.576   1.00 0.00 ? 153 LEU A CG   1  
ATOM 2441  C CD1  . LEU A 1 153 ? -10.228 25.492  6.064   1.00 0.00 ? 153 LEU A CD1  1  
ATOM 2442  C CD2  . LEU A 1 153 ? -11.746 25.508  4.081   1.00 0.00 ? 153 LEU A CD2  1  
ATOM 2443  H H    . LEU A 1 153 ? -12.868 22.767  3.606   1.00 0.00 ? 153 LEU A H    1  
ATOM 2444  H HA   . LEU A 1 153 ? -10.265 23.424  4.523   1.00 0.00 ? 153 LEU A HA   1  
ATOM 2445  H HB2  . LEU A 1 153 ? -13.011 23.532  5.615   1.00 0.00 ? 153 LEU A HB2  1  
ATOM 2446  H HB3  . LEU A 1 153 ? -11.735 23.451  6.827   1.00 0.00 ? 153 LEU A HB3  1  
ATOM 2447  H HG   . LEU A 1 153 ? -12.353 25.798  6.123   1.00 0.00 ? 153 LEU A HG   1  
ATOM 2448  H HD11 . LEU A 1 153 ? -9.791  24.593  6.474   1.00 0.00 ? 153 LEU A HD11 1  
ATOM 2449  H HD12 . LEU A 1 153 ? -10.266 26.255  6.824   1.00 0.00 ? 153 LEU A HD12 1  
ATOM 2450  H HD13 . LEU A 1 153 ? -9.629  25.837  5.235   1.00 0.00 ? 153 LEU A HD13 1  
ATOM 2451  H HD21 . LEU A 1 153 ? -10.760 25.501  3.644   1.00 0.00 ? 153 LEU A HD21 1  
ATOM 2452  H HD22 . LEU A 1 153 ? -12.192 26.482  3.950   1.00 0.00 ? 153 LEU A HD22 1  
ATOM 2453  H HD23 . LEU A 1 153 ? -12.361 24.762  3.596   1.00 0.00 ? 153 LEU A HD23 1  
ATOM 2454  N N    . GLY A 1 1   ? 18.445  -4.643  -6.115  1.00 0.00 ? 1   GLY A N    2  
ATOM 2455  C CA   . GLY A 1 1   ? 19.089  -5.912  -5.840  1.00 0.00 ? 1   GLY A CA   2  
ATOM 2456  C C    . GLY A 1 1   ? 18.341  -6.655  -4.742  1.00 0.00 ? 1   GLY A C    2  
ATOM 2457  O O    . GLY A 1 1   ? 17.114  -6.720  -4.757  1.00 0.00 ? 1   GLY A O    2  
ATOM 2458  H H1   . GLY A 1 1   ? 17.621  -4.396  -5.586  1.00 0.00 ? 1   GLY A H1   2  
ATOM 2459  H HA2  . GLY A 1 1   ? 19.094  -6.517  -6.747  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2460  H HA3  . GLY A 1 1   ? 20.116  -5.733  -5.520  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2461  N N    . PRO A 1 2   ? 19.086  -7.217  -3.787  1.00 0.00 ? 2   PRO A N    2  
ATOM 2462  C CA   . PRO A 1 2   ? 18.551  -7.965  -2.670  1.00 0.00 ? 2   PRO A CA   2  
ATOM 2463  C C    . PRO A 1 2   ? 17.887  -7.010  -1.688  1.00 0.00 ? 2   PRO A C    2  
ATOM 2464  O O    . PRO A 1 2   ? 17.276  -7.445  -0.714  1.00 0.00 ? 2   PRO A O    2  
ATOM 2465  C CB   . PRO A 1 2   ? 19.764  -8.644  -2.037  1.00 0.00 ? 2   PRO A CB   2  
ATOM 2466  C CG   . PRO A 1 2   ? 20.898  -7.667  -2.345  1.00 0.00 ? 2   PRO A CG   2  
ATOM 2467  C CD   . PRO A 1 2   ? 20.531  -7.156  -3.736  1.00 0.00 ? 2   PRO A CD   2  
ATOM 2468  H HA   . PRO A 1 2   ? 17.831  -8.710  -3.006  1.00 0.00 ? 2   PRO A HA   2  
ATOM 2469  H HB2  . PRO A 1 2   ? 19.635  -8.808  -0.967  1.00 0.00 ? 2   PRO A HB2  2  
ATOM 2470  H HB3  . PRO A 1 2   ? 19.956  -9.586  -2.551  1.00 0.00 ? 2   PRO A HB3  2  
ATOM 2471  H HG2  . PRO A 1 2   ? 20.858  -6.840  -1.636  1.00 0.00 ? 2   PRO A HG2  2  
ATOM 2472  H HG3  . PRO A 1 2   ? 21.877  -8.147  -2.325  1.00 0.00 ? 2   PRO A HG3  2  
ATOM 2473  H HD2  . PRO A 1 2   ? 20.894  -6.139  -3.884  1.00 0.00 ? 2   PRO A HD2  2  
ATOM 2474  H HD3  . PRO A 1 2   ? 20.943  -7.820  -4.495  1.00 0.00 ? 2   PRO A HD3  2  
ATOM 2475  N N    . LEU A 1 3   ? 17.980  -5.734  -1.901  1.00 0.00 ? 3   LEU A N    2  
ATOM 2476  C CA   . LEU A 1 3   ? 17.350  -4.756  -0.970  1.00 0.00 ? 3   LEU A CA   2  
ATOM 2477  C C    . LEU A 1 3   ? 15.864  -4.625  -1.298  1.00 0.00 ? 3   LEU A C    2  
ATOM 2478  O O    . LEU A 1 3   ? 15.480  -4.445  -2.438  1.00 0.00 ? 3   LEU A O    2  
ATOM 2479  C CB   . LEU A 1 3   ? 18.029  -3.396  -1.137  1.00 0.00 ? 3   LEU A CB   2  
ATOM 2480  C CG   . LEU A 1 3   ? 17.440  -2.399  -0.138  1.00 0.00 ? 3   LEU A CG   2  
ATOM 2481  C CD1  . LEU A 1 3   ? 17.933  -2.722  1.275   1.00 0.00 ? 3   LEU A CD1  2  
ATOM 2482  C CD2  . LEU A 1 3   ? 17.878  -0.984  -0.520  1.00 0.00 ? 3   LEU A CD2  2  
ATOM 2483  H H    . LEU A 1 3   ? 18.472  -5.412  -2.684  1.00 0.00 ? 3   LEU A H    2  
ATOM 2484  H HA   . LEU A 1 3   ? 17.467  -5.098  0.049   1.00 0.00 ? 3   LEU A HA   2  
ATOM 2485  H HB2  . LEU A 1 3   ? 19.090  -3.502  -0.962  1.00 0.00 ? 3   LEU A HB2  2  
ATOM 2486  H HB3  . LEU A 1 3   ? 17.864  -3.035  -2.140  1.00 0.00 ? 3   LEU A HB3  2  
ATOM 2487  H HG   . LEU A 1 3   ? 16.362  -2.460  -0.162  1.00 0.00 ? 3   LEU A HG   2  
ATOM 2488  H HD11 . LEU A 1 3   ? 18.800  -3.364  1.219   1.00 0.00 ? 3   LEU A HD11 2  
ATOM 2489  H HD12 . LEU A 1 3   ? 17.150  -3.224  1.823   1.00 0.00 ? 3   LEU A HD12 2  
ATOM 2490  H HD13 . LEU A 1 3   ? 18.196  -1.806  1.781   1.00 0.00 ? 3   LEU A HD13 2  
ATOM 2491  H HD21 . LEU A 1 3   ? 18.956  -0.944  -0.580  1.00 0.00 ? 3   LEU A HD21 2  
ATOM 2492  H HD22 . LEU A 1 3   ? 17.532  -0.285  0.228   1.00 0.00 ? 3   LEU A HD22 2  
ATOM 2493  H HD23 . LEU A 1 3   ? 17.454  -0.724  -1.480  1.00 0.00 ? 3   LEU A HD23 2  
ATOM 2494  N N    . GLY A 1 4   ? 15.020  -4.708  -0.306  1.00 0.00 ? 4   GLY A N    2  
ATOM 2495  C CA   . GLY A 1 4   ? 13.557  -4.582  -0.554  1.00 0.00 ? 4   GLY A CA   2  
ATOM 2496  C C    . GLY A 1 4   ? 12.926  -5.974  -0.628  1.00 0.00 ? 4   GLY A C    2  
ATOM 2497  O O    . GLY A 1 4   ? 11.718  -6.118  -0.645  1.00 0.00 ? 4   GLY A O    2  
ATOM 2498  H H    . GLY A 1 4   ? 15.350  -4.850  0.607   1.00 0.00 ? 4   GLY A H    2  
ATOM 2499  H HA2  . GLY A 1 4   ? 13.103  -4.020  0.250   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 2500  H HA3  . GLY A 1 4   ? 13.394  -4.069  -1.490  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 2501  N N    . SER A 1 5   ? 13.730  -7.000  -0.667  1.00 0.00 ? 5   SER A N    2  
ATOM 2502  C CA   . SER A 1 5   ? 13.169  -8.379  -0.735  1.00 0.00 ? 5   SER A CA   2  
ATOM 2503  C C    . SER A 1 5   ? 12.868  -8.871  0.682   1.00 0.00 ? 5   SER A C    2  
ATOM 2504  O O    . SER A 1 5   ? 12.346  -9.951  0.877   1.00 0.00 ? 5   SER A O    2  
ATOM 2505  C CB   . SER A 1 5   ? 14.184  -9.313  -1.395  1.00 0.00 ? 5   SER A CB   2  
ATOM 2506  O OG   . SER A 1 5   ? 14.384  -8.914  -2.744  1.00 0.00 ? 5   SER A OG   2  
ATOM 2507  H H    . SER A 1 5   ? 14.700  -6.865  -0.651  1.00 0.00 ? 5   SER A H    2  
ATOM 2508  H HA   . SER A 1 5   ? 12.258  -8.370  -1.314  1.00 0.00 ? 5   SER A HA   2  
ATOM 2509  H HB2  . SER A 1 5   ? 15.121  -9.261  -0.868  1.00 0.00 ? 5   SER A HB2  2  
ATOM 2510  H HB3  . SER A 1 5   ? 13.812  -10.329 -1.362  1.00 0.00 ? 5   SER A HB3  2  
ATOM 2511  H HG   . SER A 1 5   ? 13.612  -9.182  -3.249  1.00 0.00 ? 5   SER A HG   2  
ATOM 2512  N N    . MET A 1 6   ? 13.194  -8.089  1.674   1.00 0.00 ? 6   MET A N    2  
ATOM 2513  C CA   . MET A 1 6   ? 12.931  -8.513  3.078   1.00 0.00 ? 6   MET A CA   2  
ATOM 2514  C C    . MET A 1 6   ? 11.640  -7.869  3.584   1.00 0.00 ? 6   MET A C    2  
ATOM 2515  O O    . MET A 1 6   ? 10.995  -7.106  2.890   1.00 0.00 ? 6   MET A O    2  
ATOM 2516  C CB   . MET A 1 6   ? 14.094  -8.075  3.973   1.00 0.00 ? 6   MET A CB   2  
ATOM 2517  C CG   . MET A 1 6   ? 14.354  -9.148  5.029   1.00 0.00 ? 6   MET A CG   2  
ATOM 2518  S SD   . MET A 1 6   ? 15.367  -8.455  6.358   1.00 0.00 ? 6   MET A SD   2  
ATOM 2519  C CE   . MET A 1 6   ? 14.101  -7.378  7.074   1.00 0.00 ? 6   MET A CE   2  
ATOM 2520  H H    . MET A 1 6   ? 13.616  -7.223  1.495   1.00 0.00 ? 6   MET A H    2  
ATOM 2521  H HA   . MET A 1 6   ? 12.836  -9.588  3.116   1.00 0.00 ? 6   MET A HA   2  
ATOM 2522  H HB2  . MET A 1 6   ? 14.979  -7.935  3.369   1.00 0.00 ? 6   MET A HB2  2  
ATOM 2523  H HB3  . MET A 1 6   ? 13.842  -7.144  4.461   1.00 0.00 ? 6   MET A HB3  2  
ATOM 2524  H HG2  . MET A 1 6   ? 13.414  -9.491  5.433   1.00 0.00 ? 6   MET A HG2  2  
ATOM 2525  H HG3  . MET A 1 6   ? 14.875  -9.978  4.575   1.00 0.00 ? 6   MET A HG3  2  
ATOM 2526  H HE1  . MET A 1 6   ? 14.205  -7.369  8.152   1.00 0.00 ? 6   MET A HE1  2  
ATOM 2527  H HE2  . MET A 1 6   ? 13.121  -7.746  6.813   1.00 0.00 ? 6   MET A HE2  2  
ATOM 2528  H HE3  . MET A 1 6   ? 14.221  -6.375  6.689   1.00 0.00 ? 6   MET A HE3  2  
ATOM 2529  N N    . ALA A 1 7   ? 11.264  -8.166  4.798   1.00 0.00 ? 7   ALA A N    2  
ATOM 2530  C CA   . ALA A 1 7   ? 10.023  -7.571  5.371   1.00 0.00 ? 7   ALA A CA   2  
ATOM 2531  C C    . ALA A 1 7   ? 8.805   -8.023  4.572   1.00 0.00 ? 7   ALA A C    2  
ATOM 2532  O O    . ALA A 1 7   ? 8.912   -8.504  3.462   1.00 0.00 ? 7   ALA A O    2  
ATOM 2533  C CB   . ALA A 1 7   ? 10.121  -6.045  5.335   1.00 0.00 ? 7   ALA A CB   2  
ATOM 2534  H H    . ALA A 1 7   ? 11.807  -8.777  5.339   1.00 0.00 ? 7   ALA A H    2  
ATOM 2535  H HA   . ALA A 1 7   ? 9.912   -7.900  6.395   1.00 0.00 ? 7   ALA A HA   2  
ATOM 2536  H HB1  . ALA A 1 7   ? 9.741   -5.683  4.392   1.00 0.00 ? 7   ALA A HB1  2  
ATOM 2537  H HB2  . ALA A 1 7   ? 11.152  -5.748  5.448   1.00 0.00 ? 7   ALA A HB2  2  
ATOM 2538  H HB3  . ALA A 1 7   ? 9.538   -5.626  6.143   1.00 0.00 ? 7   ALA A HB3  2  
ATOM 2539  N N    . LEU A 1 8   ? 7.643   -7.877  5.145   1.00 0.00 ? 8   LEU A N    2  
ATOM 2540  C CA   . LEU A 1 8   ? 6.401   -8.304  4.442   1.00 0.00 ? 8   LEU A CA   2  
ATOM 2541  C C    . LEU A 1 8   ? 5.729   -7.089  3.796   1.00 0.00 ? 8   LEU A C    2  
ATOM 2542  O O    . LEU A 1 8   ? 5.659   -6.024  4.377   1.00 0.00 ? 8   LEU A O    2  
ATOM 2543  C CB   . LEU A 1 8   ? 5.433   -8.919  5.455   1.00 0.00 ? 8   LEU A CB   2  
ATOM 2544  C CG   . LEU A 1 8   ? 6.199   -9.793  6.453   1.00 0.00 ? 8   LEU A CG   2  
ATOM 2545  C CD1  . LEU A 1 8   ? 7.006   -8.908  7.406   1.00 0.00 ? 8   LEU A CD1  2  
ATOM 2546  C CD2  . LEU A 1 8   ? 5.200   -10.611 7.269   1.00 0.00 ? 8   LEU A CD2  2  
ATOM 2547  H H    . LEU A 1 8   ? 7.590   -7.492  6.046   1.00 0.00 ? 8   LEU A H    2  
ATOM 2548  H HA   . LEU A 1 8   ? 6.643   -9.032  3.685   1.00 0.00 ? 8   LEU A HA   2  
ATOM 2549  H HB2  . LEU A 1 8   ? 4.920   -8.130  5.983   1.00 0.00 ? 8   LEU A HB2  2  
ATOM 2550  H HB3  . LEU A 1 8   ? 4.709   -9.527  4.932   1.00 0.00 ? 8   LEU A HB3  2  
ATOM 2551  H HG   . LEU A 1 8   ? 6.866   -10.457 5.921   1.00 0.00 ? 8   LEU A HG   2  
ATOM 2552  H HD11 . LEU A 1 8   ? 6.597   -7.911  7.398   1.00 0.00 ? 8   LEU A HD11 2  
ATOM 2553  H HD12 . LEU A 1 8   ? 8.042   -8.879  7.095   1.00 0.00 ? 8   LEU A HD12 2  
ATOM 2554  H HD13 . LEU A 1 8   ? 6.946   -9.311  8.405   1.00 0.00 ? 8   LEU A HD13 2  
ATOM 2555  H HD21 . LEU A 1 8   ? 4.727   -11.342 6.631   1.00 0.00 ? 8   LEU A HD21 2  
ATOM 2556  H HD22 . LEU A 1 8   ? 4.447   -9.951  7.680   1.00 0.00 ? 8   LEU A HD22 2  
ATOM 2557  H HD23 . LEU A 1 8   ? 5.719   -11.112 8.071   1.00 0.00 ? 8   LEU A HD23 2  
ATOM 2558  N N    . ARG A 1 9   ? 5.221   -7.242  2.603   1.00 0.00 ? 9   ARG A N    2  
ATOM 2559  C CA   . ARG A 1 9   ? 4.537   -6.099  1.934   1.00 0.00 ? 9   ARG A CA   2  
ATOM 2560  C C    . ARG A 1 9   ? 3.087   -6.053  2.421   1.00 0.00 ? 9   ARG A C    2  
ATOM 2561  O O    . ARG A 1 9   ? 2.428   -7.069  2.520   1.00 0.00 ? 9   ARG A O    2  
ATOM 2562  C CB   . ARG A 1 9   ? 4.571   -6.299  0.417   1.00 0.00 ? 9   ARG A CB   2  
ATOM 2563  C CG   . ARG A 1 9   ? 4.164   -5.002  -0.281  1.00 0.00 ? 9   ARG A CG   2  
ATOM 2564  C CD   . ARG A 1 9   ? 4.174   -5.215  -1.797  1.00 0.00 ? 9   ARG A CD   2  
ATOM 2565  N NE   . ARG A 1 9   ? 5.550   -5.593  -2.230  1.00 0.00 ? 9   ARG A NE   2  
ATOM 2566  C CZ   . ARG A 1 9   ? 5.755   -6.053  -3.434  1.00 0.00 ? 9   ARG A CZ   2  
ATOM 2567  N NH1  . ARG A 1 9   ? 4.758   -6.172  -4.267  1.00 0.00 ? 9   ARG A NH1  2  
ATOM 2568  N NH2  . ARG A 1 9   ? 6.960   -6.388  -3.803  1.00 0.00 ? 9   ARG A NH2  2  
ATOM 2569  H H    . ARG A 1 9   ? 5.274   -8.111  2.155   1.00 0.00 ? 9   ARG A H    2  
ATOM 2570  H HA   . ARG A 1 9   ? 5.035   -5.175  2.192   1.00 0.00 ? 9   ARG A HA   2  
ATOM 2571  H HB2  . ARG A 1 9   ? 5.570   -6.574  0.112   1.00 0.00 ? 9   ARG A HB2  2  
ATOM 2572  H HB3  . ARG A 1 9   ? 3.883   -7.085  0.143   1.00 0.00 ? 9   ARG A HB3  2  
ATOM 2573  H HG2  . ARG A 1 9   ? 3.172   -4.717  0.038   1.00 0.00 ? 9   ARG A HG2  2  
ATOM 2574  H HG3  . ARG A 1 9   ? 4.863   -4.220  -0.026  1.00 0.00 ? 9   ARG A HG3  2  
ATOM 2575  H HD2  . ARG A 1 9   ? 3.485   -6.006  -2.054  1.00 0.00 ? 9   ARG A HD2  2  
ATOM 2576  H HD3  . ARG A 1 9   ? 3.877   -4.303  -2.292  1.00 0.00 ? 9   ARG A HD3  2  
ATOM 2577  H HE   . ARG A 1 9   ? 6.300   -5.500  -1.607  1.00 0.00 ? 9   ARG A HE   2  
ATOM 2578  H HH11 . ARG A 1 9   ? 3.834   -5.912  -3.983  1.00 0.00 ? 9   ARG A HH11 2  
ATOM 2579  H HH12 . ARG A 1 9   ? 4.917   -6.528  -5.188  1.00 0.00 ? 9   ARG A HH12 2  
ATOM 2580  H HH21 . ARG A 1 9   ? 7.723   -6.293  -3.165  1.00 0.00 ? 9   ARG A HH21 2  
ATOM 2581  H HH22 . ARG A 1 9   ? 7.121   -6.737  -4.726  1.00 0.00 ? 9   ARG A HH22 2  
ATOM 2582  N N    . ALA A 1 10  ? 2.583   -4.892  2.742   1.00 0.00 ? 10  ALA A N    2  
ATOM 2583  C CA   . ALA A 1 10  ? 1.180   -4.815  3.239   1.00 0.00 ? 10  ALA A CA   2  
ATOM 2584  C C    . ALA A 1 10  ? 0.511   -3.535  2.749   1.00 0.00 ? 10  ALA A C    2  
ATOM 2585  O O    . ALA A 1 10  ? 1.161   -2.566  2.410   1.00 0.00 ? 10  ALA A O    2  
ATOM 2586  C CB   . ALA A 1 10  ? 1.186   -4.807  4.764   1.00 0.00 ? 10  ALA A CB   2  
ATOM 2587  H H    . ALA A 1 10  ? 3.127   -4.080  2.671   1.00 0.00 ? 10  ALA A H    2  
ATOM 2588  H HA   . ALA A 1 10  ? 0.625   -5.669  2.887   1.00 0.00 ? 10  ALA A HA   2  
ATOM 2589  H HB1  . ALA A 1 10  ? 0.489   -4.062  5.123   1.00 0.00 ? 10  ALA A HB1  2  
ATOM 2590  H HB2  . ALA A 1 10  ? 2.179   -4.569  5.113   1.00 0.00 ? 10  ALA A HB2  2  
ATOM 2591  H HB3  . ALA A 1 10  ? 0.895   -5.780  5.133   1.00 0.00 ? 10  ALA A HB3  2  
ATOM 2592  N N    . CYS A 1 11  ? -0.791  -3.526  2.723   1.00 0.00 ? 11  CYS A N    2  
ATOM 2593  C CA   . CYS A 1 11  ? -1.513  -2.310  2.272   1.00 0.00 ? 11  CYS A CA   2  
ATOM 2594  C C    . CYS A 1 11  ? -2.847  -2.210  3.013   1.00 0.00 ? 11  CYS A C    2  
ATOM 2595  O O    . CYS A 1 11  ? -3.660  -3.112  2.973   1.00 0.00 ? 11  CYS A O    2  
ATOM 2596  C CB   . CYS A 1 11  ? -1.771  -2.406  0.770   1.00 0.00 ? 11  CYS A CB   2  
ATOM 2597  S SG   . CYS A 1 11  ? -0.456  -1.542  -0.123  1.00 0.00 ? 11  CYS A SG   2  
ATOM 2598  H H    . CYS A 1 11  ? -1.294  -4.317  3.011   1.00 0.00 ? 11  CYS A H    2  
ATOM 2599  H HA   . CYS A 1 11  ? -0.916  -1.434  2.480   1.00 0.00 ? 11  CYS A HA   2  
ATOM 2600  H HB2  . CYS A 1 11  ? -1.786  -3.445  0.474   1.00 0.00 ? 11  CYS A HB2  2  
ATOM 2601  H HB3  . CYS A 1 11  ? -2.725  -1.953  0.537   1.00 0.00 ? 11  CYS A HB3  2  
ATOM 2602  H HG   . CYS A 1 11  ? 0.379   -1.751  0.303   1.00 0.00 ? 11  CYS A HG   2  
ATOM 2603  N N    . GLY A 1 12  ? -3.079  -1.117  3.684   1.00 0.00 ? 12  GLY A N    2  
ATOM 2604  C CA   . GLY A 1 12  ? -4.361  -0.943  4.422   1.00 0.00 ? 12  GLY A CA   2  
ATOM 2605  C C    . GLY A 1 12  ? -5.015  0.358   3.968   1.00 0.00 ? 12  GLY A C    2  
ATOM 2606  O O    . GLY A 1 12  ? -4.479  1.066   3.140   1.00 0.00 ? 12  GLY A O    2  
ATOM 2607  H H    . GLY A 1 12  ? -2.408  -0.403  3.697   1.00 0.00 ? 12  GLY A H    2  
ATOM 2608  H HA2  . GLY A 1 12  ? -5.019  -1.773  4.203   1.00 0.00 ? 12  GLY A HA2  2  
ATOM 2609  H HA3  . GLY A 1 12  ? -4.173  -0.902  5.482   1.00 0.00 ? 12  GLY A HA3  2  
ATOM 2610  N N    . LEU A 1 13  ? -6.172  0.680   4.482   1.00 0.00 ? 13  LEU A N    2  
ATOM 2611  C CA   . LEU A 1 13  ? -6.837  1.936   4.037   1.00 0.00 ? 13  LEU A CA   2  
ATOM 2612  C C    . LEU A 1 13  ? -7.140  2.853   5.220   1.00 0.00 ? 13  LEU A C    2  
ATOM 2613  O O    . LEU A 1 13  ? -7.944  2.534   6.074   1.00 0.00 ? 13  LEU A O    2  
ATOM 2614  C CB   . LEU A 1 13  ? -8.169  1.600   3.346   1.00 0.00 ? 13  LEU A CB   2  
ATOM 2615  C CG   . LEU A 1 13  ? -8.054  1.799   1.834   1.00 0.00 ? 13  LEU A CG   2  
ATOM 2616  C CD1  . LEU A 1 13  ? -9.427  1.633   1.183   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 2617  C CD2  . LEU A 1 13  ? -7.538  3.203   1.534   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 2618  H H    . LEU A 1 13  ? -6.603  0.096   5.140   1.00 0.00 ? 13  LEU A H    2  
ATOM 2619  H HA   . LEU A 1 13  ? -6.194  2.453   3.346   1.00 0.00 ? 13  LEU A HA   2  
ATOM 2620  H HB2  . LEU A 1 13  ? -8.430  0.573   3.552   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 2621  H HB3  . LEU A 1 13  ? -8.944  2.246   3.729   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 2622  H HG   . LEU A 1 13  ? -7.377  1.070   1.430   1.00 0.00 ? 13  LEU A HG   2  
ATOM 2623  H HD11 . LEU A 1 13  ? -10.188 1.607   1.947   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 2624  H HD12 . LEU A 1 13  ? -9.449  0.712   0.619   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 2625  H HD13 . LEU A 1 13  ? -9.610  2.467   0.520   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 2626  H HD21 . LEU A 1 13  ? -8.057  3.602   0.677   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 2627  H HD22 . LEU A 1 13  ? -6.481  3.159   1.327   1.00 0.00 ? 13  LEU A HD22 2  
ATOM 2628  H HD23 . LEU A 1 13  ? -7.714  3.842   2.389   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 2629  N N    . ILE A 1 14  ? -6.566  4.025   5.237   1.00 0.00 ? 14  ILE A N    2  
ATOM 2630  C CA   . ILE A 1 14  ? -6.900  4.983   6.318   1.00 0.00 ? 14  ILE A CA   2  
ATOM 2631  C C    . ILE A 1 14  ? -8.176  5.677   5.865   1.00 0.00 ? 14  ILE A C    2  
ATOM 2632  O O    . ILE A 1 14  ? -8.158  6.601   5.076   1.00 0.00 ? 14  ILE A O    2  
ATOM 2633  C CB   . ILE A 1 14  ? -5.770  5.997   6.521   1.00 0.00 ? 14  ILE A CB   2  
ATOM 2634  C CG1  . ILE A 1 14  ? -4.588  5.297   7.199   1.00 0.00 ? 14  ILE A CG1  2  
ATOM 2635  C CG2  . ILE A 1 14  ? -6.258  7.143   7.408   1.00 0.00 ? 14  ILE A CG2  2  
ATOM 2636  C CD1  . ILE A 1 14  ? -3.392  6.248   7.266   1.00 0.00 ? 14  ILE A CD1  2  
ATOM 2637  H H    . ILE A 1 14  ? -5.965  4.291   4.509   1.00 0.00 ? 14  ILE A H    2  
ATOM 2638  H HA   . ILE A 1 14  ? -7.086  4.443   7.237   1.00 0.00 ? 14  ILE A HA   2  
ATOM 2639  H HB   . ILE A 1 14  ? -5.459  6.386   5.563   1.00 0.00 ? 14  ILE A HB   2  
ATOM 2640  H HG12 . ILE A 1 14  ? -4.872  5.007   8.200   1.00 0.00 ? 14  ILE A HG12 2  
ATOM 2641  H HG13 . ILE A 1 14  ? -4.318  4.419   6.634   1.00 0.00 ? 14  ILE A HG13 2  
ATOM 2642  H HG21 . ILE A 1 14  ? -7.167  6.849   7.912   1.00 0.00 ? 14  ILE A HG21 2  
ATOM 2643  H HG22 . ILE A 1 14  ? -6.451  8.013   6.797   1.00 0.00 ? 14  ILE A HG22 2  
ATOM 2644  H HG23 . ILE A 1 14  ? -5.500  7.381   8.140   1.00 0.00 ? 14  ILE A HG23 2  
ATOM 2645  H HD11 . ILE A 1 14  ? -3.445  6.832   8.173   1.00 0.00 ? 14  ILE A HD11 2  
ATOM 2646  H HD12 . ILE A 1 14  ? -3.409  6.910   6.411   1.00 0.00 ? 14  ILE A HD12 2  
ATOM 2647  H HD13 . ILE A 1 14  ? -2.478  5.674   7.260   1.00 0.00 ? 14  ILE A HD13 2  
ATOM 2648  N N    . ILE A 1 15  ? -9.285  5.183   6.317   1.00 0.00 ? 15  ILE A N    2  
ATOM 2649  C CA   . ILE A 1 15  ? -10.594 5.730   5.887   1.00 0.00 ? 15  ILE A CA   2  
ATOM 2650  C C    . ILE A 1 15  ? -10.978 6.937   6.729   1.00 0.00 ? 15  ILE A C    2  
ATOM 2651  O O    . ILE A 1 15  ? -10.780 6.964   7.926   1.00 0.00 ? 15  ILE A O    2  
ATOM 2652  C CB   . ILE A 1 15  ? -11.622 4.622   6.065   1.00 0.00 ? 15  ILE A CB   2  
ATOM 2653  C CG1  . ILE A 1 15  ? -11.219 3.441   5.180   1.00 0.00 ? 15  ILE A CG1  2  
ATOM 2654  C CG2  . ILE A 1 15  ? -13.018 5.114   5.682   1.00 0.00 ? 15  ILE A CG2  2  
ATOM 2655  C CD1  . ILE A 1 15  ? -11.993 2.194   5.596   1.00 0.00 ? 15  ILE A CD1  2  
ATOM 2656  H H    . ILE A 1 15  ? -9.259  4.406   6.913   1.00 0.00 ? 15  ILE A H    2  
ATOM 2657  H HA   . ILE A 1 15  ? -10.548 6.012   4.846   1.00 0.00 ? 15  ILE A HA   2  
ATOM 2658  H HB   . ILE A 1 15  ? -11.622 4.311   7.094   1.00 0.00 ? 15  ILE A HB   2  
ATOM 2659  H HG12 . ILE A 1 15  ? -11.436 3.673   4.148   1.00 0.00 ? 15  ILE A HG12 2  
ATOM 2660  H HG13 . ILE A 1 15  ? -10.161 3.257   5.292   1.00 0.00 ? 15  ILE A HG13 2  
ATOM 2661  H HG21 . ILE A 1 15  ? -13.123 5.104   4.607   1.00 0.00 ? 15  ILE A HG21 2  
ATOM 2662  H HG22 . ILE A 1 15  ? -13.165 6.117   6.052   1.00 0.00 ? 15  ILE A HG22 2  
ATOM 2663  H HG23 . ILE A 1 15  ? -13.756 4.457   6.122   1.00 0.00 ? 15  ILE A HG23 2  
ATOM 2664  H HD11 . ILE A 1 15  ? -12.645 1.892   4.790   1.00 0.00 ? 15  ILE A HD11 2  
ATOM 2665  H HD12 . ILE A 1 15  ? -12.580 2.412   6.476   1.00 0.00 ? 15  ILE A HD12 2  
ATOM 2666  H HD13 . ILE A 1 15  ? -11.294 1.399   5.813   1.00 0.00 ? 15  ILE A HD13 2  
ATOM 2667  N N    . PHE A 1 16  ? -11.535 7.937   6.102   1.00 0.00 ? 16  PHE A N    2  
ATOM 2668  C CA   . PHE A 1 16  ? -11.944 9.145   6.856   1.00 0.00 ? 16  PHE A CA   2  
ATOM 2669  C C    . PHE A 1 16  ? -13.292 9.648   6.337   1.00 0.00 ? 16  PHE A C    2  
ATOM 2670  O O    . PHE A 1 16  ? -13.439 9.963   5.174   1.00 0.00 ? 16  PHE A O    2  
ATOM 2671  C CB   . PHE A 1 16  ? -10.890 10.233  6.668   1.00 0.00 ? 16  PHE A CB   2  
ATOM 2672  C CG   . PHE A 1 16  ? -10.907 10.718  5.236   1.00 0.00 ? 16  PHE A CG   2  
ATOM 2673  C CD1  . PHE A 1 16  ? -10.114 10.081  4.273   1.00 0.00 ? 16  PHE A CD1  2  
ATOM 2674  C CD2  . PHE A 1 16  ? -11.709 11.807  4.870   1.00 0.00 ? 16  PHE A CD2  2  
ATOM 2675  C CE1  . PHE A 1 16  ? -10.122 10.530  2.947   1.00 0.00 ? 16  PHE A CE1  2  
ATOM 2676  C CE2  . PHE A 1 16  ? -11.718 12.256  3.543   1.00 0.00 ? 16  PHE A CE2  2  
ATOM 2677  C CZ   . PHE A 1 16  ? -10.924 11.618  2.583   1.00 0.00 ? 16  PHE A CZ   2  
ATOM 2678  H H    . PHE A 1 16  ? -11.687 7.886   5.136   1.00 0.00 ? 16  PHE A H    2  
ATOM 2679  H HA   . PHE A 1 16  ? -12.028 8.903   7.898   1.00 0.00 ? 16  PHE A HA   2  
ATOM 2680  H HB2  . PHE A 1 16  ? -11.102 11.055  7.330   1.00 0.00 ? 16  PHE A HB2  2  
ATOM 2681  H HB3  . PHE A 1 16  ? -9.916  9.831   6.896   1.00 0.00 ? 16  PHE A HB3  2  
ATOM 2682  H HD1  . PHE A 1 16  ? -9.495  9.240   4.553   1.00 0.00 ? 16  PHE A HD1  2  
ATOM 2683  H HD2  . PHE A 1 16  ? -12.323 12.300  5.610   1.00 0.00 ? 16  PHE A HD2  2  
ATOM 2684  H HE1  . PHE A 1 16  ? -9.509  10.040  2.205   1.00 0.00 ? 16  PHE A HE1  2  
ATOM 2685  H HE2  . PHE A 1 16  ? -12.335 13.096  3.262   1.00 0.00 ? 16  PHE A HE2  2  
ATOM 2686  H HZ   . PHE A 1 16  ? -10.932 11.965  1.561   1.00 0.00 ? 16  PHE A HZ   2  
ATOM 2687  N N    . ARG A 1 17  ? -14.275 9.746   7.191   1.00 0.00 ? 17  ARG A N    2  
ATOM 2688  C CA   . ARG A 1 17  ? -15.601 10.250  6.732   1.00 0.00 ? 17  ARG A CA   2  
ATOM 2689  C C    . ARG A 1 17  ? -15.619 11.770  6.878   1.00 0.00 ? 17  ARG A C    2  
ATOM 2690  O O    . ARG A 1 17  ? -15.580 12.296  7.972   1.00 0.00 ? 17  ARG A O    2  
ATOM 2691  C CB   . ARG A 1 17  ? -16.714 9.645   7.592   1.00 0.00 ? 17  ARG A CB   2  
ATOM 2692  C CG   . ARG A 1 17  ? -18.026 9.613   6.798   1.00 0.00 ? 17  ARG A CG   2  
ATOM 2693  C CD   . ARG A 1 17  ? -18.486 11.040  6.490   1.00 0.00 ? 17  ARG A CD   2  
ATOM 2694  N NE   . ARG A 1 17  ? -19.856 11.003  5.901   1.00 0.00 ? 17  ARG A NE   2  
ATOM 2695  C CZ   . ARG A 1 17  ? -20.032 10.562  4.685   1.00 0.00 ? 17  ARG A CZ   2  
ATOM 2696  N NH1  . ARG A 1 17  ? -19.010 10.145  3.988   1.00 0.00 ? 17  ARG A NH1  2  
ATOM 2697  N NH2  . ARG A 1 17  ? -21.231 10.536  4.168   1.00 0.00 ? 17  ARG A NH2  2  
ATOM 2698  H H    . ARG A 1 17  ? -14.139 9.501   8.130   1.00 0.00 ? 17  ARG A H    2  
ATOM 2699  H HA   . ARG A 1 17  ? -15.753 9.980   5.698   1.00 0.00 ? 17  ARG A HA   2  
ATOM 2700  H HB2  . ARG A 1 17  ? -16.443 8.637   7.872   1.00 0.00 ? 17  ARG A HB2  2  
ATOM 2701  H HB3  . ARG A 1 17  ? -16.849 10.242  8.480   1.00 0.00 ? 17  ARG A HB3  2  
ATOM 2702  H HG2  . ARG A 1 17  ? -17.870 9.081   5.872   1.00 0.00 ? 17  ARG A HG2  2  
ATOM 2703  H HG3  . ARG A 1 17  ? -18.784 9.110   7.377   1.00 0.00 ? 17  ARG A HG3  2  
ATOM 2704  H HD2  . ARG A 1 17  ? -18.501 11.618  7.402   1.00 0.00 ? 17  ARG A HD2  2  
ATOM 2705  H HD3  . ARG A 1 17  ? -17.805 11.494  5.787   1.00 0.00 ? 17  ARG A HD3  2  
ATOM 2706  H HE   . ARG A 1 17  ? -20.623 11.314  6.425   1.00 0.00 ? 17  ARG A HE   2  
ATOM 2707  H HH11 . ARG A 1 17  ? -18.094 10.163  4.386   1.00 0.00 ? 17  ARG A HH11 2  
ATOM 2708  H HH12 . ARG A 1 17  ? -19.145 9.805   3.057   1.00 0.00 ? 17  ARG A HH12 2  
ATOM 2709  H HH21 . ARG A 1 17  ? -22.012 10.853  4.706   1.00 0.00 ? 17  ARG A HH21 2  
ATOM 2710  H HH22 . ARG A 1 17  ? -21.368 10.202  3.236   1.00 0.00 ? 17  ARG A HH22 2  
ATOM 2711  N N    . ARG A 1 18  ? -15.679 12.482  5.788   1.00 0.00 ? 18  ARG A N    2  
ATOM 2712  C CA   . ARG A 1 18  ? -15.695 13.968  5.877   1.00 0.00 ? 18  ARG A CA   2  
ATOM 2713  C C    . ARG A 1 18  ? -17.130 14.449  6.096   1.00 0.00 ? 18  ARG A C    2  
ATOM 2714  O O    . ARG A 1 18  ? -18.054 13.994  5.452   1.00 0.00 ? 18  ARG A O    2  
ATOM 2715  C CB   . ARG A 1 18  ? -15.142 14.566  4.583   1.00 0.00 ? 18  ARG A CB   2  
ATOM 2716  C CG   . ARG A 1 18  ? -14.962 16.075  4.755   1.00 0.00 ? 18  ARG A CG   2  
ATOM 2717  C CD   . ARG A 1 18  ? -14.452 16.677  3.446   1.00 0.00 ? 18  ARG A CD   2  
ATOM 2718  N NE   . ARG A 1 18  ? -13.135 16.068  3.100   1.00 0.00 ? 18  ARG A NE   2  
ATOM 2719  C CZ   . ARG A 1 18  ? -12.337 16.670  2.262   1.00 0.00 ? 18  ARG A CZ   2  
ATOM 2720  N NH1  . ARG A 1 18  ? -12.692 17.807  1.725   1.00 0.00 ? 18  ARG A NH1  2  
ATOM 2721  N NH2  . ARG A 1 18  ? -11.183 16.141  1.961   1.00 0.00 ? 18  ARG A NH2  2  
ATOM 2722  H H    . ARG A 1 18  ? -15.709 12.042  4.913   1.00 0.00 ? 18  ARG A H    2  
ATOM 2723  H HA   . ARG A 1 18  ? -15.082 14.284  6.708   1.00 0.00 ? 18  ARG A HA   2  
ATOM 2724  H HB2  . ARG A 1 18  ? -14.188 14.114  4.356   1.00 0.00 ? 18  ARG A HB2  2  
ATOM 2725  H HB3  . ARG A 1 18  ? -15.832 14.380  3.774   1.00 0.00 ? 18  ARG A HB3  2  
ATOM 2726  H HG2  . ARG A 1 18  ? -15.910 16.523  5.016   1.00 0.00 ? 18  ARG A HG2  2  
ATOM 2727  H HG3  . ARG A 1 18  ? -14.244 16.267  5.540   1.00 0.00 ? 18  ARG A HG3  2  
ATOM 2728  H HD2  . ARG A 1 18  ? -15.161 16.477  2.657   1.00 0.00 ? 18  ARG A HD2  2  
ATOM 2729  H HD3  . ARG A 1 18  ? -14.336 17.745  3.560   1.00 0.00 ? 18  ARG A HD3  2  
ATOM 2730  H HE   . ARG A 1 18  ? -12.870 15.216  3.503   1.00 0.00 ? 18  ARG A HE   2  
ATOM 2731  H HH11 . ARG A 1 18  ? -13.576 18.213  1.957   1.00 0.00 ? 18  ARG A HH11 2  
ATOM 2732  H HH12 . ARG A 1 18  ? -12.080 18.271  1.085   1.00 0.00 ? 18  ARG A HH12 2  
ATOM 2733  H HH21 . ARG A 1 18  ? -10.910 15.270  2.373   1.00 0.00 ? 18  ARG A HH21 2  
ATOM 2734  H HH22 . ARG A 1 18  ? -10.573 16.603  1.318   1.00 0.00 ? 18  ARG A HH22 2  
ATOM 2735  N N    . CYS A 1 19  ? -17.320 15.366  7.003   1.00 0.00 ? 19  CYS A N    2  
ATOM 2736  C CA   . CYS A 1 19  ? -18.692 15.878  7.268   1.00 0.00 ? 19  CYS A CA   2  
ATOM 2737  C C    . CYS A 1 19  ? -18.909 17.168  6.476   1.00 0.00 ? 19  CYS A C    2  
ATOM 2738  O O    . CYS A 1 19  ? -18.026 17.994  6.361   1.00 0.00 ? 19  CYS A O    2  
ATOM 2739  C CB   . CYS A 1 19  ? -18.847 16.164  8.764   1.00 0.00 ? 19  CYS A CB   2  
ATOM 2740  S SG   . CYS A 1 19  ? -20.404 15.454  9.354   1.00 0.00 ? 19  CYS A SG   2  
ATOM 2741  H H    . CYS A 1 19  ? -16.560 15.719  7.511   1.00 0.00 ? 19  CYS A H    2  
ATOM 2742  H HA   . CYS A 1 19  ? -19.419 15.141  6.965   1.00 0.00 ? 19  CYS A HA   2  
ATOM 2743  H HB2  . CYS A 1 19  ? -18.023 15.723  9.303   1.00 0.00 ? 19  CYS A HB2  2  
ATOM 2744  H HB3  . CYS A 1 19  ? -18.853 17.232  8.928   1.00 0.00 ? 19  CYS A HB3  2  
ATOM 2745  H HG   . CYS A 1 19  ? -20.640 15.898  10.172  1.00 0.00 ? 19  CYS A HG   2  
ATOM 2746  N N    . LEU A 1 20  ? -20.078 17.349  5.923   1.00 0.00 ? 20  LEU A N    2  
ATOM 2747  C CA   . LEU A 1 20  ? -20.341 18.586  5.135   1.00 0.00 ? 20  LEU A CA   2  
ATOM 2748  C C    . LEU A 1 20  ? -19.999 19.804  5.989   1.00 0.00 ? 20  LEU A C    2  
ATOM 2749  O O    . LEU A 1 20  ? -19.382 20.746  5.531   1.00 0.00 ? 20  LEU A O    2  
ATOM 2750  C CB   . LEU A 1 20  ? -21.820 18.632  4.757   1.00 0.00 ? 20  LEU A CB   2  
ATOM 2751  C CG   . LEU A 1 20  ? -22.215 17.317  4.086   1.00 0.00 ? 20  LEU A CG   2  
ATOM 2752  C CD1  . LEU A 1 20  ? -23.694 17.366  3.696   1.00 0.00 ? 20  LEU A CD1  2  
ATOM 2753  C CD2  . LEU A 1 20  ? -21.367 17.104  2.830   1.00 0.00 ? 20  LEU A CD2  2  
ATOM 2754  H H    . LEU A 1 20  ? -20.778 16.672  6.022   1.00 0.00 ? 20  LEU A H    2  
ATOM 2755  H HA   . LEU A 1 20  ? -19.735 18.584  4.241   1.00 0.00 ? 20  LEU A HA   2  
ATOM 2756  H HB2  . LEU A 1 20  ? -22.415 18.779  5.646   1.00 0.00 ? 20  LEU A HB2  2  
ATOM 2757  H HB3  . LEU A 1 20  ? -21.991 19.449  4.070   1.00 0.00 ? 20  LEU A HB3  2  
ATOM 2758  H HG   . LEU A 1 20  ? -22.052 16.502  4.777   1.00 0.00 ? 20  LEU A HG   2  
ATOM 2759  H HD11 . LEU A 1 20  ? -23.783 17.377  2.621   1.00 0.00 ? 20  LEU A HD11 2  
ATOM 2760  H HD12 . LEU A 1 20  ? -24.146 18.259  4.105   1.00 0.00 ? 20  LEU A HD12 2  
ATOM 2761  H HD13 . LEU A 1 20  ? -24.200 16.496  4.090   1.00 0.00 ? 20  LEU A HD13 2  
ATOM 2762  H HD21 . LEU A 1 20  ? -20.494 16.519  3.079   1.00 0.00 ? 20  LEU A HD21 2  
ATOM 2763  H HD22 . LEU A 1 20  ? -21.058 18.061  2.437   1.00 0.00 ? 20  LEU A HD22 2  
ATOM 2764  H HD23 . LEU A 1 20  ? -21.951 16.581  2.086   1.00 0.00 ? 20  LEU A HD23 2  
ATOM 2765  N N    . ILE A 1 21  ? -20.385 19.787  7.235   1.00 0.00 ? 21  ILE A N    2  
ATOM 2766  C CA   . ILE A 1 21  ? -20.074 20.939  8.126   1.00 0.00 ? 21  ILE A CA   2  
ATOM 2767  C C    . ILE A 1 21  ? -19.752 20.421  9.533   1.00 0.00 ? 21  ILE A C    2  
ATOM 2768  O O    . ILE A 1 21  ? -20.001 19.275  9.848   1.00 0.00 ? 21  ILE A O    2  
ATOM 2769  C CB   . ILE A 1 21  ? -21.268 21.897  8.183   1.00 0.00 ? 21  ILE A CB   2  
ATOM 2770  C CG1  . ILE A 1 21  ? -22.514 21.212  7.614   1.00 0.00 ? 21  ILE A CG1  2  
ATOM 2771  C CG2  . ILE A 1 21  ? -20.956 23.145  7.352   1.00 0.00 ? 21  ILE A CG2  2  
ATOM 2772  C CD1  . ILE A 1 21  ? -22.932 20.065  8.536   1.00 0.00 ? 21  ILE A CD1  2  
ATOM 2773  H H    . ILE A 1 21  ? -20.875 19.013  7.585   1.00 0.00 ? 21  ILE A H    2  
ATOM 2774  H HA   . ILE A 1 21  ? -19.215 21.462  7.732   1.00 0.00 ? 21  ILE A HA   2  
ATOM 2775  H HB   . ILE A 1 21  ? -21.447 22.186  9.207   1.00 0.00 ? 21  ILE A HB   2  
ATOM 2776  H HG12 . ILE A 1 21  ? -23.318 21.930  7.546   1.00 0.00 ? 21  ILE A HG12 2  
ATOM 2777  H HG13 . ILE A 1 21  ? -22.298 20.823  6.630   1.00 0.00 ? 21  ILE A HG13 2  
ATOM 2778  H HG21 . ILE A 1 21  ? -20.188 23.724  7.845   1.00 0.00 ? 21  ILE A HG21 2  
ATOM 2779  H HG22 . ILE A 1 21  ? -21.848 23.745  7.253   1.00 0.00 ? 21  ILE A HG22 2  
ATOM 2780  H HG23 . ILE A 1 21  ? -20.610 22.849  6.374   1.00 0.00 ? 21  ILE A HG23 2  
ATOM 2781  H HD11 . ILE A 1 21  ? -22.397 20.143  9.470   1.00 0.00 ? 21  ILE A HD11 2  
ATOM 2782  H HD12 . ILE A 1 21  ? -22.701 19.120  8.066   1.00 0.00 ? 21  ILE A HD12 2  
ATOM 2783  H HD13 . ILE A 1 21  ? -23.994 20.123  8.723   1.00 0.00 ? 21  ILE A HD13 2  
ATOM 2784  N N    . PRO A 1 22  ? -19.192 21.256  10.369  1.00 0.00 ? 22  PRO A N    2  
ATOM 2785  C CA   . PRO A 1 22  ? -18.817 20.877  11.768  1.00 0.00 ? 22  PRO A CA   2  
ATOM 2786  C C    . PRO A 1 22  ? -20.014 20.426  12.616  1.00 0.00 ? 22  PRO A C    2  
ATOM 2787  O O    . PRO A 1 22  ? -21.142 20.809  12.376  1.00 0.00 ? 22  PRO A O    2  
ATOM 2788  C CB   . PRO A 1 22  ? -18.227 22.162  12.359  1.00 0.00 ? 22  PRO A CB   2  
ATOM 2789  C CG   . PRO A 1 22  ? -17.880 23.027  11.195  1.00 0.00 ? 22  PRO A CG   2  
ATOM 2790  C CD   . PRO A 1 22  ? -18.848 22.658  10.078  1.00 0.00 ? 22  PRO A CD   2  
ATOM 2791  H HA   . PRO A 1 22  ? -18.058 20.112  11.757  1.00 0.00 ? 22  PRO A HA   2  
ATOM 2792  H HB2  . PRO A 1 22  ? -18.965 22.647  12.982  1.00 0.00 ? 22  PRO A HB2  2  
ATOM 2793  H HB3  . PRO A 1 22  ? -17.342 21.937  12.932  1.00 0.00 ? 22  PRO A HB3  2  
ATOM 2794  H HG2  . PRO A 1 22  ? -17.997 24.069  11.463  1.00 0.00 ? 22  PRO A HG2  2  
ATOM 2795  H HG3  . PRO A 1 22  ? -16.868 22.834  10.876  1.00 0.00 ? 22  PRO A HG3  2  
ATOM 2796  H HD2  . PRO A 1 22  ? -19.728 23.286  10.117  1.00 0.00 ? 22  PRO A HD2  2  
ATOM 2797  H HD3  . PRO A 1 22  ? -18.366 22.734  9.118   1.00 0.00 ? 22  PRO A HD3  2  
ATOM 2798  N N    . LYS A 1 23  ? -19.764 19.623  13.619  1.00 0.00 ? 23  LYS A N    2  
ATOM 2799  C CA   . LYS A 1 23  ? -20.867 19.152  14.508  1.00 0.00 ? 23  LYS A CA   2  
ATOM 2800  C C    . LYS A 1 23  ? -20.456 19.378  15.964  1.00 0.00 ? 23  LYS A C    2  
ATOM 2801  O O    . LYS A 1 23  ? -20.852 20.342  16.591  1.00 0.00 ? 23  LYS A O    2  
ATOM 2802  C CB   . LYS A 1 23  ? -21.109 17.656  14.276  1.00 0.00 ? 23  LYS A CB   2  
ATOM 2803  C CG   . LYS A 1 23  ? -21.295 17.390  12.779  1.00 0.00 ? 23  LYS A CG   2  
ATOM 2804  C CD   . LYS A 1 23  ? -22.615 17.998  12.300  1.00 0.00 ? 23  LYS A CD   2  
ATOM 2805  C CE   . LYS A 1 23  ? -22.750 17.781  10.795  1.00 0.00 ? 23  LYS A CE   2  
ATOM 2806  N NZ   . LYS A 1 23  ? -22.910 16.327  10.510  1.00 0.00 ? 23  LYS A NZ   2  
ATOM 2807  H H    . LYS A 1 23  ? -18.842 19.339  13.797  1.00 0.00 ? 23  LYS A H    2  
ATOM 2808  H HA   . LYS A 1 23  ? -21.767 19.706  14.299  1.00 0.00 ? 23  LYS A HA   2  
ATOM 2809  H HB2  . LYS A 1 23  ? -20.262 17.093  14.639  1.00 0.00 ? 23  LYS A HB2  2  
ATOM 2810  H HB3  . LYS A 1 23  ? -21.999 17.349  14.805  1.00 0.00 ? 23  LYS A HB3  2  
ATOM 2811  H HG2  . LYS A 1 23  ? -20.475 17.834  12.231  1.00 0.00 ? 23  LYS A HG2  2  
ATOM 2812  H HG3  . LYS A 1 23  ? -21.308 16.325  12.603  1.00 0.00 ? 23  LYS A HG3  2  
ATOM 2813  H HD2  . LYS A 1 23  ? -23.438 17.519  12.810  1.00 0.00 ? 23  LYS A HD2  2  
ATOM 2814  H HD3  . LYS A 1 23  ? -22.626 19.056  12.508  1.00 0.00 ? 23  LYS A HD3  2  
ATOM 2815  H HE2  . LYS A 1 23  ? -23.615 18.317  10.430  1.00 0.00 ? 23  LYS A HE2  2  
ATOM 2816  H HE3  . LYS A 1 23  ? -21.865 18.149  10.300  1.00 0.00 ? 23  LYS A HE3  2  
ATOM 2817  H HZ1  . LYS A 1 23  ? -23.885 16.036  10.723  1.00 0.00 ? 23  LYS A HZ1  2  
ATOM 2818  H HZ2  . LYS A 1 23  ? -22.250 15.784  11.104  1.00 0.00 ? 23  LYS A HZ2  2  
ATOM 2819  H HZ3  . LYS A 1 23  ? -22.708 16.147  9.507   1.00 0.00 ? 23  LYS A HZ3  2  
ATOM 2820  N N    . VAL A 1 24  ? -19.654 18.503  16.499  1.00 0.00 ? 24  VAL A N    2  
ATOM 2821  C CA   . VAL A 1 24  ? -19.194 18.660  17.909  1.00 0.00 ? 24  VAL A CA   2  
ATOM 2822  C C    . VAL A 1 24  ? -18.214 19.834  17.986  1.00 0.00 ? 24  VAL A C    2  
ATOM 2823  O O    . VAL A 1 24  ? -17.723 20.177  19.043  1.00 0.00 ? 24  VAL A O    2  
ATOM 2824  C CB   . VAL A 1 24  ? -18.494 17.378  18.364  1.00 0.00 ? 24  VAL A CB   2  
ATOM 2825  C CG1  . VAL A 1 24  ? -17.936 17.569  19.777  1.00 0.00 ? 24  VAL A CG1  2  
ATOM 2826  C CG2  . VAL A 1 24  ? -19.499 16.225  18.369  1.00 0.00 ? 24  VAL A CG2  2  
ATOM 2827  H H    . VAL A 1 24  ? -19.342 17.742  15.966  1.00 0.00 ? 24  VAL A H    2  
ATOM 2828  H HA   . VAL A 1 24  ? -20.043 18.856  18.546  1.00 0.00 ? 24  VAL A HA   2  
ATOM 2829  H HB   . VAL A 1 24  ? -17.684 17.149  17.686  1.00 0.00 ? 24  VAL A HB   2  
ATOM 2830  H HG11 . VAL A 1 24  ? -18.079 16.661  20.347  1.00 0.00 ? 24  VAL A HG11 2  
ATOM 2831  H HG12 . VAL A 1 24  ? -18.453 18.382  20.263  1.00 0.00 ? 24  VAL A HG12 2  
ATOM 2832  H HG13 . VAL A 1 24  ? -16.881 17.794  19.721  1.00 0.00 ? 24  VAL A HG13 2  
ATOM 2833  H HG21 . VAL A 1 24  ? -19.700 15.918  17.353  1.00 0.00 ? 24  VAL A HG21 2  
ATOM 2834  H HG22 . VAL A 1 24  ? -20.418 16.550  18.833  1.00 0.00 ? 24  VAL A HG22 2  
ATOM 2835  H HG23 . VAL A 1 24  ? -19.091 15.393  18.921  1.00 0.00 ? 24  VAL A HG23 2  
ATOM 2836  N N    . ASP A 1 25  ? -17.915 20.437  16.867  1.00 0.00 ? 25  ASP A N    2  
ATOM 2837  C CA   . ASP A 1 25  ? -16.956 21.581  16.850  1.00 0.00 ? 25  ASP A CA   2  
ATOM 2838  C C    . ASP A 1 25  ? -15.585 21.101  17.328  1.00 0.00 ? 25  ASP A C    2  
ATOM 2839  O O    . ASP A 1 25  ? -14.914 21.761  18.095  1.00 0.00 ? 25  ASP A O    2  
ATOM 2840  C CB   . ASP A 1 25  ? -17.461 22.701  17.763  1.00 0.00 ? 25  ASP A CB   2  
ATOM 2841  C CG   . ASP A 1 25  ? -18.776 23.253  17.214  1.00 0.00 ? 25  ASP A CG   2  
ATOM 2842  O OD1  . ASP A 1 25  ? -19.477 23.913  17.962  1.00 0.00 ? 25  ASP A OD1  2  
ATOM 2843  O OD2  . ASP A 1 25  ? -19.060 23.008  16.053  1.00 0.00 ? 25  ASP A OD2  2  
ATOM 2844  H H    . ASP A 1 25  ? -18.318 20.129  16.028  1.00 0.00 ? 25  ASP A H    2  
ATOM 2845  H HA   . ASP A 1 25  ? -16.867 21.954  15.840  1.00 0.00 ? 25  ASP A HA   2  
ATOM 2846  H HB2  . ASP A 1 25  ? -17.618 22.316  18.758  1.00 0.00 ? 25  ASP A HB2  2  
ATOM 2847  H HB3  . ASP A 1 25  ? -16.727 23.492  17.796  1.00 0.00 ? 25  ASP A HB3  2  
ATOM 2848  H HD2  . ASP A 1 25  ? -19.898 23.386  15.777  1.00 0.00 ? 25  ASP A HD2  2  
ATOM 2849  N N    . ASN A 1 26  ? -15.166 19.954  16.870  1.00 0.00 ? 26  ASN A N    2  
ATOM 2850  C CA   . ASN A 1 26  ? -13.838 19.418  17.278  1.00 0.00 ? 26  ASN A CA   2  
ATOM 2851  C C    . ASN A 1 26  ? -13.089 18.951  16.031  1.00 0.00 ? 26  ASN A C    2  
ATOM 2852  O O    . ASN A 1 26  ? -12.280 19.665  15.475  1.00 0.00 ? 26  ASN A O    2  
ATOM 2853  C CB   . ASN A 1 26  ? -14.033 18.239  18.235  1.00 0.00 ? 26  ASN A CB   2  
ATOM 2854  C CG   . ASN A 1 26  ? -12.706 17.909  18.918  1.00 0.00 ? 26  ASN A CG   2  
ATOM 2855  O OD1  . ASN A 1 26  ? -11.838 18.754  19.025  1.00 0.00 ? 26  ASN A OD1  2  
ATOM 2856  N ND2  . ASN A 1 26  ? -12.506 16.709  19.387  1.00 0.00 ? 26  ASN A ND2  2  
ATOM 2857  H H    . ASN A 1 26  ? -15.726 19.444  16.248  1.00 0.00 ? 26  ASN A H    2  
ATOM 2858  H HA   . ASN A 1 26  ? -13.271 20.192  17.769  1.00 0.00 ? 26  ASN A HA   2  
ATOM 2859  H HB2  . ASN A 1 26  ? -14.767 18.501  18.983  1.00 0.00 ? 26  ASN A HB2  2  
ATOM 2860  H HB3  . ASN A 1 26  ? -14.376 17.378  17.683  1.00 0.00 ? 26  ASN A HB3  2  
ATOM 2861  H HD21 . ASN A 1 26  ? -13.205 16.027  19.301  1.00 0.00 ? 26  ASN A HD21 2  
ATOM 2862  H HD22 . ASN A 1 26  ? -11.659 16.487  19.823  1.00 0.00 ? 26  ASN A HD22 2  
ATOM 2863  N N    . ASN A 1 27  ? -13.363 17.758  15.582  1.00 0.00 ? 27  ASN A N    2  
ATOM 2864  C CA   . ASN A 1 27  ? -12.679 17.242  14.364  1.00 0.00 ? 27  ASN A CA   2  
ATOM 2865  C C    . ASN A 1 27  ? -13.701 17.114  13.231  1.00 0.00 ? 27  ASN A C    2  
ATOM 2866  O O    . ASN A 1 27  ? -14.621 16.322  13.299  1.00 0.00 ? 27  ASN A O    2  
ATOM 2867  C CB   . ASN A 1 27  ? -12.067 15.872  14.657  1.00 0.00 ? 27  ASN A CB   2  
ATOM 2868  C CG   . ASN A 1 27  ? -10.985 15.561  13.620  1.00 0.00 ? 27  ASN A CG   2  
ATOM 2869  O OD1  . ASN A 1 27  ? -10.391 16.462  13.058  1.00 0.00 ? 27  ASN A OD1  2  
ATOM 2870  N ND2  . ASN A 1 27  ? -10.704 14.320  13.338  1.00 0.00 ? 27  ASN A ND2  2  
ATOM 2871  H H    . ASN A 1 27  ? -14.025 17.205  16.043  1.00 0.00 ? 27  ASN A H    2  
ATOM 2872  H HA   . ASN A 1 27  ? -11.899 17.930  14.069  1.00 0.00 ? 27  ASN A HA   2  
ATOM 2873  H HB2  . ASN A 1 27  ? -11.629 15.877  15.646  1.00 0.00 ? 27  ASN A HB2  2  
ATOM 2874  H HB3  . ASN A 1 27  ? -12.835 15.116  14.608  1.00 0.00 ? 27  ASN A HB3  2  
ATOM 2875  H HD21 . ASN A 1 27  ? -11.182 13.595  13.791  1.00 0.00 ? 27  ASN A HD21 2  
ATOM 2876  H HD22 . ASN A 1 27  ? -10.014 14.113  12.673  1.00 0.00 ? 27  ASN A HD22 2  
ATOM 2877  N N    . ALA A 1 28  ? -13.552 17.888  12.194  1.00 0.00 ? 28  ALA A N    2  
ATOM 2878  C CA   . ALA A 1 28  ? -14.517 17.813  11.061  1.00 0.00 ? 28  ALA A CA   2  
ATOM 2879  C C    . ALA A 1 28  ? -14.407 16.452  10.374  1.00 0.00 ? 28  ALA A C    2  
ATOM 2880  O O    . ALA A 1 28  ? -15.332 15.995  9.731   1.00 0.00 ? 28  ALA A O    2  
ATOM 2881  C CB   . ALA A 1 28  ? -14.192 18.906  10.045  1.00 0.00 ? 28  ALA A CB   2  
ATOM 2882  H H    . ALA A 1 28  ? -12.806 18.522  12.160  1.00 0.00 ? 28  ALA A H    2  
ATOM 2883  H HA   . ALA A 1 28  ? -15.522 17.951  11.429  1.00 0.00 ? 28  ALA A HA   2  
ATOM 2884  H HB1  . ALA A 1 28  ? -13.604 18.485  9.242   1.00 0.00 ? 28  ALA A HB1  2  
ATOM 2885  H HB2  . ALA A 1 28  ? -13.632 19.691  10.528  1.00 0.00 ? 28  ALA A HB2  2  
ATOM 2886  H HB3  . ALA A 1 28  ? -15.109 19.311  9.645   1.00 0.00 ? 28  ALA A HB3  2  
ATOM 2887  N N    . ILE A 1 29  ? -13.276 15.816  10.480  1.00 0.00 ? 29  ILE A N    2  
ATOM 2888  C CA   . ILE A 1 29  ? -13.097 14.500  9.807   1.00 0.00 ? 29  ILE A CA   2  
ATOM 2889  C C    . ILE A 1 29  ? -12.966 13.371  10.834  1.00 0.00 ? 29  ILE A C    2  
ATOM 2890  O O    . ILE A 1 29  ? -12.328 13.510  11.856  1.00 0.00 ? 29  ILE A O    2  
ATOM 2891  C CB   . ILE A 1 29  ? -11.839 14.562  8.944   1.00 0.00 ? 29  ILE A CB   2  
ATOM 2892  C CG1  . ILE A 1 29  ? -12.063 15.559  7.808   1.00 0.00 ? 29  ILE A CG1  2  
ATOM 2893  C CG2  . ILE A 1 29  ? -11.544 13.186  8.362   1.00 0.00 ? 29  ILE A CG2  2  
ATOM 2894  C CD1  . ILE A 1 29  ? -10.767 16.321  7.524   1.00 0.00 ? 29  ILE A CD1  2  
ATOM 2895  H H    . ILE A 1 29  ? -12.536 16.214  10.986  1.00 0.00 ? 29  ILE A H    2  
ATOM 2896  H HA   . ILE A 1 29  ? -13.948 14.306  9.174   1.00 0.00 ? 29  ILE A HA   2  
ATOM 2897  H HB   . ILE A 1 29  ? -11.003 14.883  9.550   1.00 0.00 ? 29  ILE A HB   2  
ATOM 2898  H HG12 . ILE A 1 29  ? -12.368 15.026  6.919   1.00 0.00 ? 29  ILE A HG12 2  
ATOM 2899  H HG13 . ILE A 1 29  ? -12.835 16.257  8.093   1.00 0.00 ? 29  ILE A HG13 2  
ATOM 2900  H HG21 . ILE A 1 29  ? -10.726 12.732  8.902   1.00 0.00 ? 29  ILE A HG21 2  
ATOM 2901  H HG22 . ILE A 1 29  ? -11.274 13.291  7.322   1.00 0.00 ? 29  ILE A HG22 2  
ATOM 2902  H HG23 . ILE A 1 29  ? -12.422 12.564  8.445   1.00 0.00 ? 29  ILE A HG23 2  
ATOM 2903  H HD11 . ILE A 1 29  ? -10.956 17.096  6.796   1.00 0.00 ? 29  ILE A HD11 2  
ATOM 2904  H HD12 . ILE A 1 29  ? -10.023 15.637  7.138   1.00 0.00 ? 29  ILE A HD12 2  
ATOM 2905  H HD13 . ILE A 1 29  ? -10.404 16.768  8.439   1.00 0.00 ? 29  ILE A HD13 2  
ATOM 2906  N N    . GLU A 1 30  ? -13.563 12.245  10.543  1.00 0.00 ? 30  GLU A N    2  
ATOM 2907  C CA   . GLU A 1 30  ? -13.485 11.077  11.472  1.00 0.00 ? 30  GLU A CA   2  
ATOM 2908  C C    . GLU A 1 30  ? -12.832 9.910   10.728  1.00 0.00 ? 30  GLU A C    2  
ATOM 2909  O O    . GLU A 1 30  ? -12.780 9.903   9.518   1.00 0.00 ? 30  GLU A O    2  
ATOM 2910  C CB   . GLU A 1 30  ? -14.895 10.678  11.913  1.00 0.00 ? 30  GLU A CB   2  
ATOM 2911  C CG   . GLU A 1 30  ? -15.576 11.865  12.600  1.00 0.00 ? 30  GLU A CG   2  
ATOM 2912  C CD   . GLU A 1 30  ? -16.958 11.439  13.096  1.00 0.00 ? 30  GLU A CD   2  
ATOM 2913  O OE1  . GLU A 1 30  ? -17.392 10.358  12.731  1.00 0.00 ? 30  GLU A OE1  2  
ATOM 2914  O OE2  . GLU A 1 30  ? -17.562 12.200  13.834  1.00 0.00 ? 30  GLU A OE2  2  
ATOM 2915  H H    . GLU A 1 30  ? -14.061 12.165  9.703   1.00 0.00 ? 30  GLU A H    2  
ATOM 2916  H HA   . GLU A 1 30  ? -12.890 11.337  12.335  1.00 0.00 ? 30  GLU A HA   2  
ATOM 2917  H HB2  . GLU A 1 30  ? -15.471 10.383  11.046  1.00 0.00 ? 30  GLU A HB2  2  
ATOM 2918  H HB3  . GLU A 1 30  ? -14.834 9.850   12.603  1.00 0.00 ? 30  GLU A HB3  2  
ATOM 2919  H HG2  . GLU A 1 30  ? -14.974 12.188  13.436  1.00 0.00 ? 30  GLU A HG2  2  
ATOM 2920  H HG3  . GLU A 1 30  ? -15.681 12.677  11.897  1.00 0.00 ? 30  GLU A HG3  2  
ATOM 2921  H HE2  . GLU A 1 30  ? -18.421 11.869  14.105  1.00 0.00 ? 30  GLU A HE2  2  
ATOM 2922  N N    . PHE A 1 31  ? -12.323 8.928   11.428  1.00 0.00 ? 31  PHE A N    2  
ATOM 2923  C CA   . PHE A 1 31  ? -11.665 7.782   10.727  1.00 0.00 ? 31  PHE A CA   2  
ATOM 2924  C C    . PHE A 1 31  ? -12.330 6.457   11.117  1.00 0.00 ? 31  PHE A C    2  
ATOM 2925  O O    . PHE A 1 31  ? -12.894 6.321   12.184  1.00 0.00 ? 31  PHE A O    2  
ATOM 2926  C CB   . PHE A 1 31  ? -10.184 7.730   11.113  1.00 0.00 ? 31  PHE A CB   2  
ATOM 2927  C CG   . PHE A 1 31  ? -9.510  9.029   10.733  1.00 0.00 ? 31  PHE A CG   2  
ATOM 2928  C CD1  . PHE A 1 31  ? -9.111  9.255   9.409   1.00 0.00 ? 31  PHE A CD1  2  
ATOM 2929  C CD2  . PHE A 1 31  ? -9.277  10.009  11.709  1.00 0.00 ? 31  PHE A CD2  2  
ATOM 2930  C CE1  . PHE A 1 31  ? -8.483  10.457  9.061   1.00 0.00 ? 31  PHE A CE1  2  
ATOM 2931  C CE2  . PHE A 1 31  ? -8.648  11.210  11.359  1.00 0.00 ? 31  PHE A CE2  2  
ATOM 2932  C CZ   . PHE A 1 31  ? -8.252  11.434  10.036  1.00 0.00 ? 31  PHE A CZ   2  
ATOM 2933  H H    . PHE A 1 31  ? -12.364 8.950   12.408  1.00 0.00 ? 31  PHE A H    2  
ATOM 2934  H HA   . PHE A 1 31  ? -11.749 7.917   9.665   1.00 0.00 ? 31  PHE A HA   2  
ATOM 2935  H HB2  . PHE A 1 31  ? -10.098 7.579   12.179  1.00 0.00 ? 31  PHE A HB2  2  
ATOM 2936  H HB3  . PHE A 1 31  ? -9.706  6.913   10.595  1.00 0.00 ? 31  PHE A HB3  2  
ATOM 2937  H HD1  . PHE A 1 31  ? -9.289  8.501   8.656   1.00 0.00 ? 31  PHE A HD1  2  
ATOM 2938  H HD2  . PHE A 1 31  ? -9.583  9.835   12.729  1.00 0.00 ? 31  PHE A HD2  2  
ATOM 2939  H HE1  . PHE A 1 31  ? -8.177  10.631  8.042   1.00 0.00 ? 31  PHE A HE1  2  
ATOM 2940  H HE2  . PHE A 1 31  ? -8.467  11.967  12.112  1.00 0.00 ? 31  PHE A HE2  2  
ATOM 2941  H HZ   . PHE A 1 31  ? -7.768  12.360  9.767   1.00 0.00 ? 31  PHE A HZ   2  
ATOM 2942  N N    . LEU A 1 32  ? -12.243 5.470   10.258  1.00 0.00 ? 32  LEU A N    2  
ATOM 2943  C CA   . LEU A 1 32  ? -12.842 4.140   10.576  1.00 0.00 ? 32  LEU A CA   2  
ATOM 2944  C C    . LEU A 1 32  ? -11.816 3.315   11.351  1.00 0.00 ? 32  LEU A C    2  
ATOM 2945  O O    . LEU A 1 32  ? -10.686 3.160   10.931  1.00 0.00 ? 32  LEU A O    2  
ATOM 2946  C CB   . LEU A 1 32  ? -13.213 3.402   9.281   1.00 0.00 ? 32  LEU A CB   2  
ATOM 2947  C CG   . LEU A 1 32  ? -13.661 1.974   9.611   1.00 0.00 ? 32  LEU A CG   2  
ATOM 2948  C CD1  . LEU A 1 32  ? -14.864 2.018   10.551  1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2949  C CD2  . LEU A 1 32  ? -14.059 1.251   8.323   1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2950  H H    . LEU A 1 32  ? -11.767 5.600   9.411   1.00 0.00 ? 32  LEU A H    2  
ATOM 2951  H HA   . LEU A 1 32  ? -13.727 4.279   11.182  1.00 0.00 ? 32  LEU A HA   2  
ATOM 2952  H HB2  . LEU A 1 32  ? -14.014 3.923   8.781   1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2953  H HB3  . LEU A 1 32  ? -12.359 3.362   8.632   1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2954  H HG   . LEU A 1 32  ? -12.852 1.442   10.088  1.00 0.00 ? 32  LEU A HG   2  
ATOM 2955  H HD11 . LEU A 1 32  ? -15.520 2.818   10.254  1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2956  H HD12 . LEU A 1 32  ? -14.523 2.184   11.562  1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2957  H HD13 . LEU A 1 32  ? -15.394 1.078   10.499  1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2958  H HD21 . LEU A 1 32  ? -14.448 1.966   7.613   1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2959  H HD22 . LEU A 1 32  ? -14.818 0.515   8.544   1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2960  H HD23 . LEU A 1 32  ? -13.192 0.760   7.903   1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2961  N N    . LEU A 1 33  ? -12.199 2.784   12.478  1.00 0.00 ? 33  LEU A N    2  
ATOM 2962  C CA   . LEU A 1 33  ? -11.240 1.972   13.277  1.00 0.00 ? 33  LEU A CA   2  
ATOM 2963  C C    . LEU A 1 33  ? -11.845 0.601   13.570  1.00 0.00 ? 33  LEU A C    2  
ATOM 2964  O O    . LEU A 1 33  ? -12.998 0.481   13.926  1.00 0.00 ? 33  LEU A O    2  
ATOM 2965  C CB   . LEU A 1 33  ? -10.935 2.690   14.589  1.00 0.00 ? 33  LEU A CB   2  
ATOM 2966  C CG   . LEU A 1 33  ? -9.808  3.695   14.358  1.00 0.00 ? 33  LEU A CG   2  
ATOM 2967  C CD1  . LEU A 1 33  ? -9.792  4.720   15.489  1.00 0.00 ? 33  LEU A CD1  2  
ATOM 2968  C CD2  . LEU A 1 33  ? -8.471  2.953   14.329  1.00 0.00 ? 33  LEU A CD2  2  
ATOM 2969  H H    . LEU A 1 33  ? -13.114 2.921   12.799  1.00 0.00 ? 33  LEU A H    2  
ATOM 2970  H HA   . LEU A 1 33  ? -10.327 1.843   12.718  1.00 0.00 ? 33  LEU A HA   2  
ATOM 2971  H HB2  . LEU A 1 33  ? -11.819 3.212   14.929  1.00 0.00 ? 33  LEU A HB2  2  
ATOM 2972  H HB3  . LEU A 1 33  ? -10.632 1.974   15.336  1.00 0.00 ? 33  LEU A HB3  2  
ATOM 2973  H HG   . LEU A 1 33  ? -9.962  4.199   13.415  1.00 0.00 ? 33  LEU A HG   2  
ATOM 2974  H HD11 . LEU A 1 33  ? -8.779  4.853   15.839  1.00 0.00 ? 33  LEU A HD11 2  
ATOM 2975  H HD12 . LEU A 1 33  ? -10.410 4.369   16.303  1.00 0.00 ? 33  LEU A HD12 2  
ATOM 2976  H HD13 . LEU A 1 33  ? -10.177 5.662   15.125  1.00 0.00 ? 33  LEU A HD13 2  
ATOM 2977  H HD21 . LEU A 1 33  ? -7.917  3.171   15.230  1.00 0.00 ? 33  LEU A HD21 2  
ATOM 2978  H HD22 . LEU A 1 33  ? -7.900  3.272   13.470  1.00 0.00 ? 33  LEU A HD22 2  
ATOM 2979  H HD23 . LEU A 1 33  ? -8.650  1.889   14.267  1.00 0.00 ? 33  LEU A HD23 2  
ATOM 2980  N N    . LEU A 1 34  ? -11.066 -0.432  13.418  1.00 0.00 ? 34  LEU A N    2  
ATOM 2981  C CA   . LEU A 1 34  ? -11.579 -1.803  13.681  1.00 0.00 ? 34  LEU A CA   2  
ATOM 2982  C C    . LEU A 1 34  ? -10.904 -2.367  14.934  1.00 0.00 ? 34  LEU A C    2  
ATOM 2983  O O    . LEU A 1 34  ? -9.721  -2.189  15.147  1.00 0.00 ? 34  LEU A O    2  
ATOM 2984  C CB   . LEU A 1 34  ? -11.259 -2.689  12.476  1.00 0.00 ? 34  LEU A CB   2  
ATOM 2985  C CG   . LEU A 1 34  ? -11.783 -2.016  11.206  1.00 0.00 ? 34  LEU A CG   2  
ATOM 2986  C CD1  . LEU A 1 34  ? -11.401 -2.852  9.988   1.00 0.00 ? 34  LEU A CD1  2  
ATOM 2987  C CD2  . LEU A 1 34  ? -13.306 -1.904  11.275  1.00 0.00 ? 34  LEU A CD2  2  
ATOM 2988  H H    . LEU A 1 34  ? -10.139 -0.304  13.130  1.00 0.00 ? 34  LEU A H    2  
ATOM 2989  H HA   . LEU A 1 34  ? -12.648 -1.768  13.829  1.00 0.00 ? 34  LEU A HA   2  
ATOM 2990  H HB2  . LEU A 1 34  ? -10.189 -2.823  12.402  1.00 0.00 ? 34  LEU A HB2  2  
ATOM 2991  H HB3  . LEU A 1 34  ? -11.735 -3.649  12.596  1.00 0.00 ? 34  LEU A HB3  2  
ATOM 2992  H HG   . LEU A 1 34  ? -11.351 -1.031  11.115  1.00 0.00 ? 34  LEU A HG   2  
ATOM 2993  H HD11 . LEU A 1 34  ? -11.567 -3.898  10.200  1.00 0.00 ? 34  LEU A HD11 2  
ATOM 2994  H HD12 . LEU A 1 34  ? -10.360 -2.691  9.755   1.00 0.00 ? 34  LEU A HD12 2  
ATOM 2995  H HD13 . LEU A 1 34  ? -12.008 -2.556  9.145   1.00 0.00 ? 34  LEU A HD13 2  
ATOM 2996  H HD21 . LEU A 1 34  ? -13.688 -2.632  11.975  1.00 0.00 ? 34  LEU A HD21 2  
ATOM 2997  H HD22 . LEU A 1 34  ? -13.722 -2.089  10.296  1.00 0.00 ? 34  LEU A HD22 2  
ATOM 2998  H HD23 . LEU A 1 34  ? -13.578 -0.910  11.601  1.00 0.00 ? 34  LEU A HD23 2  
ATOM 2999  N N    . GLN A 1 35  ? -11.646 -3.045  15.764  1.00 0.00 ? 35  GLN A N    2  
ATOM 3000  C CA   . GLN A 1 35  ? -11.046 -3.623  17.003  1.00 0.00 ? 35  GLN A CA   2  
ATOM 3001  C C    . GLN A 1 35  ? -10.183 -4.828  16.628  1.00 0.00 ? 35  GLN A C    2  
ATOM 3002  O O    . GLN A 1 35  ? -10.453 -5.520  15.671  1.00 0.00 ? 35  GLN A O    2  
ATOM 3003  C CB   . GLN A 1 35  ? -12.161 -4.063  17.952  1.00 0.00 ? 35  GLN A CB   2  
ATOM 3004  C CG   . GLN A 1 35  ? -11.553 -4.532  19.276  1.00 0.00 ? 35  GLN A CG   2  
ATOM 3005  C CD   . GLN A 1 35  ? -11.048 -3.324  20.064  1.00 0.00 ? 35  GLN A CD   2  
ATOM 3006  O OE1  . GLN A 1 35  ? -11.819 -2.464  20.438  1.00 0.00 ? 35  GLN A OE1  2  
ATOM 3007  N NE2  . GLN A 1 35  ? -9.776  -3.223  20.336  1.00 0.00 ? 35  GLN A NE2  2  
ATOM 3008  H H    . GLN A 1 35  ? -12.599 -3.179  15.575  1.00 0.00 ? 35  GLN A H    2  
ATOM 3009  H HA   . GLN A 1 35  ? -10.433 -2.875  17.487  1.00 0.00 ? 35  GLN A HA   2  
ATOM 3010  H HB2  . GLN A 1 35  ? -12.827 -3.233  18.135  1.00 0.00 ? 35  GLN A HB2  2  
ATOM 3011  H HB3  . GLN A 1 35  ? -12.714 -4.876  17.504  1.00 0.00 ? 35  GLN A HB3  2  
ATOM 3012  H HG2  . GLN A 1 35  ? -12.307 -5.050  19.854  1.00 0.00 ? 35  GLN A HG2  2  
ATOM 3013  H HG3  . GLN A 1 35  ? -10.728 -5.200  19.081  1.00 0.00 ? 35  GLN A HG3  2  
ATOM 3014  H HE21 . GLN A 1 35  ? -9.154  -3.917  20.034  1.00 0.00 ? 35  GLN A HE21 2  
ATOM 3015  H HE22 . GLN A 1 35  ? -9.443  -2.452  20.839  1.00 0.00 ? 35  GLN A HE22 2  
ATOM 3016  N N    . ALA A 1 36  ? -9.141  -5.082  17.371  1.00 0.00 ? 36  ALA A N    2  
ATOM 3017  C CA   . ALA A 1 36  ? -8.257  -6.242  17.052  1.00 0.00 ? 36  ALA A CA   2  
ATOM 3018  C C    . ALA A 1 36  ? -8.967  -7.554  17.406  1.00 0.00 ? 36  ALA A C    2  
ATOM 3019  O O    . ALA A 1 36  ? -8.470  -8.628  17.137  1.00 0.00 ? 36  ALA A O    2  
ATOM 3020  C CB   . ALA A 1 36  ? -6.964  -6.132  17.861  1.00 0.00 ? 36  ALA A CB   2  
ATOM 3021  H H    . ALA A 1 36  ? -8.934  -4.507  18.138  1.00 0.00 ? 36  ALA A H    2  
ATOM 3022  H HA   . ALA A 1 36  ? -8.023  -6.234  15.999  1.00 0.00 ? 36  ALA A HA   2  
ATOM 3023  H HB1  . ALA A 1 36  ? -6.659  -5.098  17.913  1.00 0.00 ? 36  ALA A HB1  2  
ATOM 3024  H HB2  . ALA A 1 36  ? -6.190  -6.714  17.383  1.00 0.00 ? 36  ALA A HB2  2  
ATOM 3025  H HB3  . ALA A 1 36  ? -7.132  -6.508  18.859  1.00 0.00 ? 36  ALA A HB3  2  
ATOM 3026  N N    . SER A 1 37  ? -10.118 -7.473  18.017  1.00 0.00 ? 37  SER A N    2  
ATOM 3027  C CA   . SER A 1 37  ? -10.857 -8.712  18.398  1.00 0.00 ? 37  SER A CA   2  
ATOM 3028  C C    . SER A 1 37  ? -10.065 -9.470  19.466  1.00 0.00 ? 37  SER A C    2  
ATOM 3029  O O    . SER A 1 37  ? -10.566 -9.763  20.535  1.00 0.00 ? 37  SER A O    2  
ATOM 3030  C CB   . SER A 1 37  ? -11.043 -9.607  17.172  1.00 0.00 ? 37  SER A CB   2  
ATOM 3031  O OG   . SER A 1 37  ? -9.863  -10.370 16.961  1.00 0.00 ? 37  SER A OG   2  
ATOM 3032  H H    . SER A 1 37  ? -10.496 -6.595  18.228  1.00 0.00 ? 37  SER A H    2  
ATOM 3033  H HA   . SER A 1 37  ? -11.825 -8.443  18.794  1.00 0.00 ? 37  SER A HA   2  
ATOM 3034  H HB2  . SER A 1 37  ? -11.870 -10.276 17.338  1.00 0.00 ? 37  SER A HB2  2  
ATOM 3035  H HB3  . SER A 1 37  ? -11.249 -8.993  16.306  1.00 0.00 ? 37  SER A HB3  2  
ATOM 3036  H HG   . SER A 1 37  ? -9.818  -11.041 17.648  1.00 0.00 ? 37  SER A HG   2  
ATOM 3037  N N    . ASP A 1 38  ? -8.831  -9.789  19.186  1.00 0.00 ? 38  ASP A N    2  
ATOM 3038  C CA   . ASP A 1 38  ? -8.002  -10.526 20.183  1.00 0.00 ? 38  ASP A CA   2  
ATOM 3039  C C    . ASP A 1 38  ? -6.690  -9.774  20.409  1.00 0.00 ? 38  ASP A C    2  
ATOM 3040  O O    . ASP A 1 38  ? -6.500  -8.680  19.916  1.00 0.00 ? 38  ASP A O    2  
ATOM 3041  C CB   . ASP A 1 38  ? -7.704  -11.933 19.659  1.00 0.00 ? 38  ASP A CB   2  
ATOM 3042  C CG   . ASP A 1 38  ? -6.875  -11.835 18.376  1.00 0.00 ? 38  ASP A CG   2  
ATOM 3043  O OD1  . ASP A 1 38  ? -6.390  -10.755 18.087  1.00 0.00 ? 38  ASP A OD1  2  
ATOM 3044  O OD2  . ASP A 1 38  ? -6.741  -12.846 17.704  1.00 0.00 ? 38  ASP A OD2  2  
ATOM 3045  H H    . ASP A 1 38  ? -8.445  -9.544  18.319  1.00 0.00 ? 38  ASP A H    2  
ATOM 3046  H HA   . ASP A 1 38  ? -8.540  -10.599 21.117  1.00 0.00 ? 38  ASP A HA   2  
ATOM 3047  H HB2  . ASP A 1 38  ? -7.149  -12.484 20.406  1.00 0.00 ? 38  ASP A HB2  2  
ATOM 3048  H HB3  . ASP A 1 38  ? -8.630  -12.442 19.450  1.00 0.00 ? 38  ASP A HB3  2  
ATOM 3049  H HD2  . ASP A 1 38  ? -6.211  -12.712 16.915  1.00 0.00 ? 38  ASP A HD2  2  
ATOM 3050  N N    . GLY A 1 39  ? -5.783  -10.352 21.149  1.00 0.00 ? 39  GLY A N    2  
ATOM 3051  C CA   . GLY A 1 39  ? -4.485  -9.665  21.401  1.00 0.00 ? 39  GLY A CA   2  
ATOM 3052  C C    . GLY A 1 39  ? -4.634  -8.702  22.581  1.00 0.00 ? 39  GLY A C    2  
ATOM 3053  O O    . GLY A 1 39  ? -5.471  -8.884  23.442  1.00 0.00 ? 39  GLY A O    2  
ATOM 3054  H H    . GLY A 1 39  ? -5.955  -11.235 21.536  1.00 0.00 ? 39  GLY A H    2  
ATOM 3055  H HA2  . GLY A 1 39  ? -3.728  -10.401 21.627  1.00 0.00 ? 39  GLY A HA2  2  
ATOM 3056  H HA3  . GLY A 1 39  ? -4.195  -9.110  20.523  1.00 0.00 ? 39  GLY A HA3  2  
ATOM 3057  N N    . ILE A 1 40  ? -3.825  -7.680  22.628  1.00 0.00 ? 40  ILE A N    2  
ATOM 3058  C CA   . ILE A 1 40  ? -3.916  -6.708  23.754  1.00 0.00 ? 40  ILE A CA   2  
ATOM 3059  C C    . ILE A 1 40  ? -5.204  -5.890  23.618  1.00 0.00 ? 40  ILE A C    2  
ATOM 3060  O O    . ILE A 1 40  ? -5.455  -4.985  24.387  1.00 0.00 ? 40  ILE A O    2  
ATOM 3061  C CB   . ILE A 1 40  ? -2.697  -5.779  23.729  1.00 0.00 ? 40  ILE A CB   2  
ATOM 3062  C CG1  . ILE A 1 40  ? -2.824  -4.782  22.572  1.00 0.00 ? 40  ILE A CG1  2  
ATOM 3063  C CG2  . ILE A 1 40  ? -1.430  -6.617  23.543  1.00 0.00 ? 40  ILE A CG2  2  
ATOM 3064  C CD1  . ILE A 1 40  ? -1.641  -3.811  22.605  1.00 0.00 ? 40  ILE A CD1  2  
ATOM 3065  H H    . ILE A 1 40  ? -3.154  -7.551  21.925  1.00 0.00 ? 40  ILE A H    2  
ATOM 3066  H HA   . ILE A 1 40  ? -3.936  -7.248  24.688  1.00 0.00 ? 40  ILE A HA   2  
ATOM 3067  H HB   . ILE A 1 40  ? -2.638  -5.243  24.665  1.00 0.00 ? 40  ILE A HB   2  
ATOM 3068  H HG12 . ILE A 1 40  ? -2.824  -5.318  21.633  1.00 0.00 ? 40  ILE A HG12 2  
ATOM 3069  H HG13 . ILE A 1 40  ? -3.743  -4.226  22.670  1.00 0.00 ? 40  ILE A HG13 2  
ATOM 3070  H HG21 . ILE A 1 40  ? -1.413  -7.410  24.277  1.00 0.00 ? 40  ILE A HG21 2  
ATOM 3071  H HG22 . ILE A 1 40  ? -0.561  -5.991  23.671  1.00 0.00 ? 40  ILE A HG22 2  
ATOM 3072  H HG23 . ILE A 1 40  ? -1.422  -7.046  22.552  1.00 0.00 ? 40  ILE A HG23 2  
ATOM 3073  H HD11 . ILE A 1 40  ? -0.722  -4.364  22.712  1.00 0.00 ? 40  ILE A HD11 2  
ATOM 3074  H HD12 . ILE A 1 40  ? -1.755  -3.137  23.441  1.00 0.00 ? 40  ILE A HD12 2  
ATOM 3075  H HD13 . ILE A 1 40  ? -1.616  -3.244  21.686  1.00 0.00 ? 40  ILE A HD13 2  
ATOM 3076  N N    . HIS A 1 41  ? -6.019  -6.204  22.646  1.00 0.00 ? 41  HIS A N    2  
ATOM 3077  C CA   . HIS A 1 41  ? -7.295  -5.454  22.457  1.00 0.00 ? 41  HIS A CA   2  
ATOM 3078  C C    . HIS A 1 41  ? -6.993  -4.016  22.028  1.00 0.00 ? 41  HIS A C    2  
ATOM 3079  O O    . HIS A 1 41  ? -7.448  -3.068  22.636  1.00 0.00 ? 41  HIS A O    2  
ATOM 3080  C CB   . HIS A 1 41  ? -8.092  -5.442  23.765  1.00 0.00 ? 41  HIS A CB   2  
ATOM 3081  C CG   . HIS A 1 41  ? -8.153  -6.836  24.326  1.00 0.00 ? 41  HIS A CG   2  
ATOM 3082  N ND1  . HIS A 1 41  ? -8.896  -7.844  23.724  1.00 0.00 ? 41  HIS A ND1  2  
ATOM 3083  C CD2  . HIS A 1 41  ? -7.570  -7.408  25.431  1.00 0.00 ? 41  HIS A CD2  2  
ATOM 3084  C CE1  . HIS A 1 41  ? -8.741  -8.957  24.464  1.00 0.00 ? 41  HIS A CE1  2  
ATOM 3085  N NE2  . HIS A 1 41  ? -7.944  -8.742  25.512  1.00 0.00 ? 41  HIS A NE2  2  
ATOM 3086  H H    . HIS A 1 41  ? -5.793  -6.940  22.040  1.00 0.00 ? 41  HIS A H    2  
ATOM 3087  H HA   . HIS A 1 41  ? -7.880  -5.937  21.688  1.00 0.00 ? 41  HIS A HA   2  
ATOM 3088  H HB2  . HIS A 1 41  ? -7.614  -4.784  24.476  1.00 0.00 ? 41  HIS A HB2  2  
ATOM 3089  H HB3  . HIS A 1 41  ? -9.096  -5.091  23.570  1.00 0.00 ? 41  HIS A HB3  2  
ATOM 3090  H HD1  . HIS A 1 41  ? -9.434  -7.759  22.911  1.00 0.00 ? 41  HIS A HD1  2  
ATOM 3091  H HD2  . HIS A 1 41  ? -6.920  -6.897  26.128  1.00 0.00 ? 41  HIS A HD2  2  
ATOM 3092  H HE1  . HIS A 1 41  ? -9.204  -9.906  24.238  1.00 0.00 ? 41  HIS A HE1  2  
ATOM 3093  H HE2  . HIS A 1 41  ? -7.678  -9.392  26.198  1.00 0.00 ? 41  HIS A HE2  2  
ATOM 3094  N N    . HIS A 1 42  ? -6.232  -3.846  20.979  1.00 0.00 ? 42  HIS A N    2  
ATOM 3095  C CA   . HIS A 1 42  ? -5.907  -2.468  20.509  1.00 0.00 ? 42  HIS A CA   2  
ATOM 3096  C C    . HIS A 1 42  ? -6.729  -2.153  19.258  1.00 0.00 ? 42  HIS A C    2  
ATOM 3097  O O    . HIS A 1 42  ? -7.339  -3.023  18.669  1.00 0.00 ? 42  HIS A O    2  
ATOM 3098  C CB   . HIS A 1 42  ? -4.416  -2.380  20.178  1.00 0.00 ? 42  HIS A CB   2  
ATOM 3099  C CG   . HIS A 1 42  ? -4.089  -3.347  19.072  1.00 0.00 ? 42  HIS A CG   2  
ATOM 3100  N ND1  . HIS A 1 42  ? -4.157  -4.721  19.248  1.00 0.00 ? 42  HIS A ND1  2  
ATOM 3101  C CD2  . HIS A 1 42  ? -3.691  -3.154  17.772  1.00 0.00 ? 42  HIS A CD2  2  
ATOM 3102  C CE1  . HIS A 1 42  ? -3.805  -5.295  18.083  1.00 0.00 ? 42  HIS A CE1  2  
ATOM 3103  N NE2  . HIS A 1 42  ? -3.512  -4.385  17.154  1.00 0.00 ? 42  HIS A NE2  2  
ATOM 3104  H H    . HIS A 1 42  ? -5.877  -4.623  20.502  1.00 0.00 ? 42  HIS A H    2  
ATOM 3105  H HA   . HIS A 1 42  ? -6.146  -1.757  21.288  1.00 0.00 ? 42  HIS A HA   2  
ATOM 3106  H HB2  . HIS A 1 42  ? -4.176  -1.377  19.861  1.00 0.00 ? 42  HIS A HB2  2  
ATOM 3107  H HB3  . HIS A 1 42  ? -3.837  -2.627  21.054  1.00 0.00 ? 42  HIS A HB3  2  
ATOM 3108  H HD1  . HIS A 1 42  ? -4.413  -5.189  20.072  1.00 0.00 ? 42  HIS A HD1  2  
ATOM 3109  H HD2  . HIS A 1 42  ? -3.537  -2.193  17.303  1.00 0.00 ? 42  HIS A HD2  2  
ATOM 3110  H HE1  . HIS A 1 42  ? -3.766  -6.365  17.921  1.00 0.00 ? 42  HIS A HE1  2  
ATOM 3111  H HE2  . HIS A 1 42  ? -3.231  -4.550  16.230  1.00 0.00 ? 42  HIS A HE2  2  
ATOM 3112  N N    . TRP A 1 43  ? -6.756  -0.914  18.847  1.00 0.00 ? 43  TRP A N    2  
ATOM 3113  C CA   . TRP A 1 43  ? -7.544  -0.548  17.635  1.00 0.00 ? 43  TRP A CA   2  
ATOM 3114  C C    . TRP A 1 43  ? -6.602  -0.352  16.447  1.00 0.00 ? 43  TRP A C    2  
ATOM 3115  O O    . TRP A 1 43  ? -5.529  0.204   16.578  1.00 0.00 ? 43  TRP A O    2  
ATOM 3116  C CB   . TRP A 1 43  ? -8.297  0.758   17.887  1.00 0.00 ? 43  TRP A CB   2  
ATOM 3117  C CG   . TRP A 1 43  ? -9.272  0.572   19.008  1.00 0.00 ? 43  TRP A CG   2  
ATOM 3118  C CD1  . TRP A 1 43  ? -8.968  0.661   20.322  1.00 0.00 ? 43  TRP A CD1  2  
ATOM 3119  C CD2  . TRP A 1 43  ? -10.698 0.283   18.934  1.00 0.00 ? 43  TRP A CD2  2  
ATOM 3120  N NE1  . TRP A 1 43  ? -10.115 0.436   21.061  1.00 0.00 ? 43  TRP A NE1  2  
ATOM 3121  C CE2  . TRP A 1 43  ? -11.208 0.201   20.252  1.00 0.00 ? 43  TRP A CE2  2  
ATOM 3122  C CE3  . TRP A 1 43  ? -11.590 0.085   17.865  1.00 0.00 ? 43  TRP A CE3  2  
ATOM 3123  C CZ2  . TRP A 1 43  ? -12.554 -0.069  20.499  1.00 0.00 ? 43  TRP A CZ2  2  
ATOM 3124  C CZ3  . TRP A 1 43  ? -12.945 -0.186  18.112  1.00 0.00 ? 43  TRP A CZ3  2  
ATOM 3125  C CH2  . TRP A 1 43  ? -13.425 -0.264  19.426  1.00 0.00 ? 43  TRP A CH2  2  
ATOM 3126  H H    . TRP A 1 43  ? -6.261  -0.223  19.336  1.00 0.00 ? 43  TRP A H    2  
ATOM 3127  H HA   . TRP A 1 43  ? -8.249  -1.335  17.411  1.00 0.00 ? 43  TRP A HA   2  
ATOM 3128  H HB2  . TRP A 1 43  ? -7.590  1.531   18.148  1.00 0.00 ? 43  TRP A HB2  2  
ATOM 3129  H HB3  . TRP A 1 43  ? -8.828  1.042   16.991  1.00 0.00 ? 43  TRP A HB3  2  
ATOM 3130  H HD1  . TRP A 1 43  ? -7.990  0.869   20.727  1.00 0.00 ? 43  TRP A HD1  2  
ATOM 3131  H HE1  . TRP A 1 43  ? -10.166 0.441   22.040  1.00 0.00 ? 43  TRP A HE1  2  
ATOM 3132  H HE3  . TRP A 1 43  ? -11.229 0.142   16.848  1.00 0.00 ? 43  TRP A HE3  2  
ATOM 3133  H HZ2  . TRP A 1 43  ? -12.919 -0.129  21.515  1.00 0.00 ? 43  TRP A HZ2  2  
ATOM 3134  H HZ3  . TRP A 1 43  ? -13.620 -0.335  17.286  1.00 0.00 ? 43  TRP A HZ3  2  
ATOM 3135  H HH2  . TRP A 1 43  ? -14.470 -0.473  19.608  1.00 0.00 ? 43  TRP A HH2  2  
ATOM 3136  N N    . THR A 1 44  ? -7.000  -0.793  15.287  1.00 0.00 ? 44  THR A N    2  
ATOM 3137  C CA   . THR A 1 44  ? -6.136  -0.625  14.085  1.00 0.00 ? 44  THR A CA   2  
ATOM 3138  C C    . THR A 1 44  ? -7.020  -0.593  12.836  1.00 0.00 ? 44  THR A C    2  
ATOM 3139  O O    . THR A 1 44  ? -8.065  -1.212  12.795  1.00 0.00 ? 44  THR A O    2  
ATOM 3140  C CB   . THR A 1 44  ? -5.158  -1.799  13.993  1.00 0.00 ? 44  THR A CB   2  
ATOM 3141  O OG1  . THR A 1 44  ? -5.614  -2.859  14.822  1.00 0.00 ? 44  THR A OG1  2  
ATOM 3142  C CG2  . THR A 1 44  ? -3.770  -1.349  14.457  1.00 0.00 ? 44  THR A CG2  2  
ATOM 3143  H H    . THR A 1 44  ? -7.872  -1.231  15.205  1.00 0.00 ? 44  THR A H    2  
ATOM 3144  H HA   . THR A 1 44  ? -5.586  0.300   14.167  1.00 0.00 ? 44  THR A HA   2  
ATOM 3145  H HB   . THR A 1 44  ? -5.099  -2.139  12.971  1.00 0.00 ? 44  THR A HB   2  
ATOM 3146  H HG1  . THR A 1 44  ? -5.015  -2.934  15.566  1.00 0.00 ? 44  THR A HG1  2  
ATOM 3147  H HG21 . THR A 1 44  ? -3.365  -0.644  13.749  1.00 0.00 ? 44  THR A HG21 2  
ATOM 3148  H HG22 . THR A 1 44  ? -3.118  -2.207  14.526  1.00 0.00 ? 44  THR A HG22 2  
ATOM 3149  H HG23 . THR A 1 44  ? -3.850  -0.880  15.428  1.00 0.00 ? 44  THR A HG23 2  
ATOM 3150  N N    . PRO A 1 45  ? -6.605  0.123   11.822  1.00 0.00 ? 45  PRO A N    2  
ATOM 3151  C CA   . PRO A 1 45  ? -7.374  0.229   10.549  1.00 0.00 ? 45  PRO A CA   2  
ATOM 3152  C C    . PRO A 1 45  ? -7.348  -1.080  9.759   1.00 0.00 ? 45  PRO A C    2  
ATOM 3153  O O    . PRO A 1 45  ? -6.481  -1.910  9.951   1.00 0.00 ? 45  PRO A O    2  
ATOM 3154  C CB   . PRO A 1 45  ? -6.656  1.331   9.769   1.00 0.00 ? 45  PRO A CB   2  
ATOM 3155  C CG   . PRO A 1 45  ? -5.274  1.380   10.326  1.00 0.00 ? 45  PRO A CG   2  
ATOM 3156  C CD   . PRO A 1 45  ? -5.361  0.903   11.777  1.00 0.00 ? 45  PRO A CD   2  
ATOM 3157  H HA   . PRO A 1 45  ? -8.389  0.529   10.748  1.00 0.00 ? 45  PRO A HA   2  
ATOM 3158  H HB2  . PRO A 1 45  ? -6.630  1.085   8.716   1.00 0.00 ? 45  PRO A HB2  2  
ATOM 3159  H HB3  . PRO A 1 45  ? -7.148  2.279   9.921   1.00 0.00 ? 45  PRO A HB3  2  
ATOM 3160  H HG2  . PRO A 1 45  ? -4.625  0.726   9.757   1.00 0.00 ? 45  PRO A HG2  2  
ATOM 3161  H HG3  . PRO A 1 45  ? -4.900  2.389   10.297  1.00 0.00 ? 45  PRO A HG3  2  
ATOM 3162  H HD2  . PRO A 1 45  ? -4.508  0.284   12.021  1.00 0.00 ? 45  PRO A HD2  2  
ATOM 3163  H HD3  . PRO A 1 45  ? -5.423  1.745   12.448  1.00 0.00 ? 45  PRO A HD3  2  
ATOM 3164  N N    . PRO A 1 46  ? -8.293  -1.262  8.878   1.00 0.00 ? 46  PRO A N    2  
ATOM 3165  C CA   . PRO A 1 46  ? -8.383  -2.492  8.043   1.00 0.00 ? 46  PRO A CA   2  
ATOM 3166  C C    . PRO A 1 46  ? -7.138  -2.686  7.175   1.00 0.00 ? 46  PRO A C    2  
ATOM 3167  O O    . PRO A 1 46  ? -6.960  -2.022  6.173   1.00 0.00 ? 46  PRO A O    2  
ATOM 3168  C CB   . PRO A 1 46  ? -9.619  -2.271  7.164   1.00 0.00 ? 46  PRO A CB   2  
ATOM 3169  C CG   . PRO A 1 46  ? -9.954  -0.817  7.263   1.00 0.00 ? 46  PRO A CG   2  
ATOM 3170  C CD   . PRO A 1 46  ? -9.372  -0.313  8.582   1.00 0.00 ? 46  PRO A CD   2  
ATOM 3171  H HA   . PRO A 1 46  ? -8.537  -3.356  8.669   1.00 0.00 ? 46  PRO A HA   2  
ATOM 3172  H HB2  . PRO A 1 46  ? -9.397  -2.534  6.141   1.00 0.00 ? 46  PRO A HB2  2  
ATOM 3173  H HB3  . PRO A 1 46  ? -10.445 -2.862  7.528   1.00 0.00 ? 46  PRO A HB3  2  
ATOM 3174  H HG2  . PRO A 1 46  ? -9.518  -0.279  6.434   1.00 0.00 ? 46  PRO A HG2  2  
ATOM 3175  H HG3  . PRO A 1 46  ? -11.026 -0.685  7.269   1.00 0.00 ? 46  PRO A HG3  2  
ATOM 3176  H HD2  . PRO A 1 46  ? -8.982  0.689   8.464   1.00 0.00 ? 46  PRO A HD2  2  
ATOM 3177  H HD3  . PRO A 1 46  ? -10.118 -0.342  9.361   1.00 0.00 ? 46  PRO A HD3  2  
ATOM 3178  N N    . LYS A 1 47  ? -6.276  -3.594  7.549   1.00 0.00 ? 47  LYS A N    2  
ATOM 3179  C CA   . LYS A 1 47  ? -5.047  -3.829  6.744   1.00 0.00 ? 47  LYS A CA   2  
ATOM 3180  C C    . LYS A 1 47  ? -4.934  -5.309  6.394   1.00 0.00 ? 47  LYS A C    2  
ATOM 3181  O O    . LYS A 1 47  ? -5.519  -6.161  7.034   1.00 0.00 ? 47  LYS A O    2  
ATOM 3182  C CB   . LYS A 1 47  ? -3.815  -3.394  7.543   1.00 0.00 ? 47  LYS A CB   2  
ATOM 3183  C CG   . LYS A 1 47  ? -3.625  -4.318  8.746   1.00 0.00 ? 47  LYS A CG   2  
ATOM 3184  C CD   . LYS A 1 47  ? -2.466  -3.803  9.604   1.00 0.00 ? 47  LYS A CD   2  
ATOM 3185  C CE   . LYS A 1 47  ? -2.082  -4.855  10.647  1.00 0.00 ? 47  LYS A CE   2  
ATOM 3186  N NZ   . LYS A 1 47  ? -0.608  -4.827  10.863  1.00 0.00 ? 47  LYS A NZ   2  
ATOM 3187  H H    . LYS A 1 47  ? -6.440  -4.120  8.360   1.00 0.00 ? 47  LYS A H    2  
ATOM 3188  H HA   . LYS A 1 47  ? -5.101  -3.254  5.833   1.00 0.00 ? 47  LYS A HA   2  
ATOM 3189  H HB2  . LYS A 1 47  ? -2.940  -3.445  6.910   1.00 0.00 ? 47  LYS A HB2  2  
ATOM 3190  H HB3  . LYS A 1 47  ? -3.950  -2.381  7.885   1.00 0.00 ? 47  LYS A HB3  2  
ATOM 3191  H HG2  . LYS A 1 47  ? -4.532  -4.334  9.334   1.00 0.00 ? 47  LYS A HG2  2  
ATOM 3192  H HG3  . LYS A 1 47  ? -3.400  -5.316  8.401   1.00 0.00 ? 47  LYS A HG3  2  
ATOM 3193  H HD2  . LYS A 1 47  ? -1.615  -3.599  8.970   1.00 0.00 ? 47  LYS A HD2  2  
ATOM 3194  H HD3  . LYS A 1 47  ? -2.765  -2.895  10.107  1.00 0.00 ? 47  LYS A HD3  2  
ATOM 3195  H HE2  . LYS A 1 47  ? -2.586  -4.640  11.576  1.00 0.00 ? 47  LYS A HE2  2  
ATOM 3196  H HE3  . LYS A 1 47  ? -2.375  -5.834  10.297  1.00 0.00 ? 47  LYS A HE3  2  
ATOM 3197  H HZ1  . LYS A 1 47  ? -0.281  -3.841  10.901  1.00 0.00 ? 47  LYS A HZ1  2  
ATOM 3198  H HZ2  . LYS A 1 47  ? -0.133  -5.322  10.080  1.00 0.00 ? 47  LYS A HZ2  2  
ATOM 3199  H HZ3  . LYS A 1 47  ? -0.380  -5.299  11.762  1.00 0.00 ? 47  LYS A HZ3  2  
ATOM 3200  N N    . GLY A 1 48  ? -4.181  -5.622  5.377   1.00 0.00 ? 48  GLY A N    2  
ATOM 3201  C CA   . GLY A 1 48  ? -4.021  -7.046  4.970   1.00 0.00 ? 48  GLY A CA   2  
ATOM 3202  C C    . GLY A 1 48  ? -2.690  -7.216  4.235   1.00 0.00 ? 48  GLY A C    2  
ATOM 3203  O O    . GLY A 1 48  ? -1.877  -6.315  4.189   1.00 0.00 ? 48  GLY A O    2  
ATOM 3204  H H    . GLY A 1 48  ? -3.720  -4.917  4.877   1.00 0.00 ? 48  GLY A H    2  
ATOM 3205  H HA2  . GLY A 1 48  ? -4.034  -7.675  5.849   1.00 0.00 ? 48  GLY A HA2  2  
ATOM 3206  H HA3  . GLY A 1 48  ? -4.831  -7.326  4.313   1.00 0.00 ? 48  GLY A HA3  2  
ATOM 3207  N N    . HIS A 1 49  ? -2.461  -8.364  3.659   1.00 0.00 ? 49  HIS A N    2  
ATOM 3208  C CA   . HIS A 1 49  ? -1.183  -8.592  2.928   1.00 0.00 ? 49  HIS A CA   2  
ATOM 3209  C C    . HIS A 1 49  ? -1.450  -8.575  1.421   1.00 0.00 ? 49  HIS A C    2  
ATOM 3210  O O    . HIS A 1 49  ? -2.432  -9.113  0.949   1.00 0.00 ? 49  HIS A O    2  
ATOM 3211  C CB   . HIS A 1 49  ? -0.606  -9.950  3.330   1.00 0.00 ? 49  HIS A CB   2  
ATOM 3212  C CG   . HIS A 1 49  ? -0.227  -9.921  4.786   1.00 0.00 ? 49  HIS A CG   2  
ATOM 3213  N ND1  . HIS A 1 49  ? 1.095   -9.863  5.205   1.00 0.00 ? 49  HIS A ND1  2  
ATOM 3214  C CD2  . HIS A 1 49  ? -0.984  -9.948  5.931   1.00 0.00 ? 49  HIS A CD2  2  
ATOM 3215  C CE1  . HIS A 1 49  ? 1.092   -9.857  6.552   1.00 0.00 ? 49  HIS A CE1  2  
ATOM 3216  N NE2  . HIS A 1 49  ? -0.148  -9.906  7.041   1.00 0.00 ? 49  HIS A NE2  2  
ATOM 3217  H H    . HIS A 1 49  ? -3.131  -9.078  3.707   1.00 0.00 ? 49  HIS A H    2  
ATOM 3218  H HA   . HIS A 1 49  ? -0.478  -7.813  3.176   1.00 0.00 ? 49  HIS A HA   2  
ATOM 3219  H HB2  . HIS A 1 49  ? -1.348  -10.719 3.164   1.00 0.00 ? 49  HIS A HB2  2  
ATOM 3220  H HB3  . HIS A 1 49  ? 0.270   -10.160 2.734   1.00 0.00 ? 49  HIS A HB3  2  
ATOM 3221  H HD1  . HIS A 1 49  ? 1.886   -9.829  4.627   1.00 0.00 ? 49  HIS A HD1  2  
ATOM 3222  H HD2  . HIS A 1 49  ? -2.063  -9.991  5.965   1.00 0.00 ? 49  HIS A HD2  2  
ATOM 3223  H HE1  . HIS A 1 49  ? 1.983   -9.823  7.160   1.00 0.00 ? 49  HIS A HE1  2  
ATOM 3224  H HE2  . HIS A 1 49  ? -0.413  -9.912  7.985   1.00 0.00 ? 49  HIS A HE2  2  
ATOM 3225  N N    . VAL A 1 50  ? -0.589  -7.953  0.663   1.00 0.00 ? 50  VAL A N    2  
ATOM 3226  C CA   . VAL A 1 50  ? -0.803  -7.894  -0.810  1.00 0.00 ? 50  VAL A CA   2  
ATOM 3227  C C    . VAL A 1 50  ? -0.182  -9.125  -1.478  1.00 0.00 ? 50  VAL A C    2  
ATOM 3228  O O    . VAL A 1 50  ? 0.939   -9.501  -1.202  1.00 0.00 ? 50  VAL A O    2  
ATOM 3229  C CB   . VAL A 1 50  ? -0.165  -6.614  -1.366  1.00 0.00 ? 50  VAL A CB   2  
ATOM 3230  C CG1  . VAL A 1 50  ? 0.642   -5.922  -0.266  1.00 0.00 ? 50  VAL A CG1  2  
ATOM 3231  C CG2  . VAL A 1 50  ? 0.757   -6.950  -2.541  1.00 0.00 ? 50  VAL A CG2  2  
ATOM 3232  H H    . VAL A 1 50  ? 0.193   -7.520  1.063   1.00 0.00 ? 50  VAL A H    2  
ATOM 3233  H HA   . VAL A 1 50  ? -1.864  -7.881  -1.015  1.00 0.00 ? 50  VAL A HA   2  
ATOM 3234  H HB   . VAL A 1 50  ? -0.940  -5.945  -1.701  1.00 0.00 ? 50  VAL A HB   2  
ATOM 3235  H HG11 . VAL A 1 50  ? 1.433   -6.578  0.067   1.00 0.00 ? 50  VAL A HG11 2  
ATOM 3236  H HG12 . VAL A 1 50  ? -0.009  -5.691  0.563   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 3237  H HG13 . VAL A 1 50  ? 1.068   -5.010  -0.655  1.00 0.00 ? 50  VAL A HG13 2  
ATOM 3238  H HG21 . VAL A 1 50  ? 1.578   -7.562  -2.196  1.00 0.00 ? 50  VAL A HG21 2  
ATOM 3239  H HG22 . VAL A 1 50  ? 1.145   -6.037  -2.966  1.00 0.00 ? 50  VAL A HG22 2  
ATOM 3240  H HG23 . VAL A 1 50  ? 0.196   -7.488  -3.297  1.00 0.00 ? 50  VAL A HG23 2  
ATOM 3241  N N    . GLU A 1 51  ? -0.912  -9.750  -2.362  1.00 0.00 ? 51  GLU A N    2  
ATOM 3242  C CA   . GLU A 1 51  ? -0.385  -10.952 -3.069  1.00 0.00 ? 51  GLU A CA   2  
ATOM 3243  C C    . GLU A 1 51  ? 0.799   -10.521 -3.954  1.00 0.00 ? 51  GLU A C    2  
ATOM 3244  O O    . GLU A 1 51  ? 1.239   -9.390  -3.880  1.00 0.00 ? 51  GLU A O    2  
ATOM 3245  C CB   . GLU A 1 51  ? -1.519  -11.542 -3.919  1.00 0.00 ? 51  GLU A CB   2  
ATOM 3246  C CG   . GLU A 1 51  ? -1.772  -13.008 -3.539  1.00 0.00 ? 51  GLU A CG   2  
ATOM 3247  C CD   . GLU A 1 51  ? -2.881  -13.075 -2.483  1.00 0.00 ? 51  GLU A CD   2  
ATOM 3248  O OE1  . GLU A 1 51  ? -2.916  -12.201 -1.634  1.00 0.00 ? 51  GLU A OE1  2  
ATOM 3249  O OE2  . GLU A 1 51  ? -3.672  -14.002 -2.542  1.00 0.00 ? 51  GLU A OE2  2  
ATOM 3250  H H    . GLU A 1 51  ? -1.812  -9.422  -2.568  1.00 0.00 ? 51  GLU A H    2  
ATOM 3251  H HA   . GLU A 1 51  ? -0.051  -11.679 -2.343  1.00 0.00 ? 51  GLU A HA   2  
ATOM 3252  H HB2  . GLU A 1 51  ? -2.414  -10.979 -3.739  1.00 0.00 ? 51  GLU A HB2  2  
ATOM 3253  H HB3  . GLU A 1 51  ? -1.267  -11.472 -4.963  1.00 0.00 ? 51  GLU A HB3  2  
ATOM 3254  H HG2  . GLU A 1 51  ? -2.081  -13.560 -4.416  1.00 0.00 ? 51  GLU A HG2  2  
ATOM 3255  H HG3  . GLU A 1 51  ? -0.874  -13.446 -3.138  1.00 0.00 ? 51  GLU A HG3  2  
ATOM 3256  H HE2  . GLU A 1 51  ? -4.337  -13.980 -1.850  1.00 0.00 ? 51  GLU A HE2  2  
ATOM 3257  N N    . PRO A 1 52  ? 1.329   -11.398 -4.776  1.00 0.00 ? 52  PRO A N    2  
ATOM 3258  C CA   . PRO A 1 52  ? 2.487   -11.057 -5.654  1.00 0.00 ? 52  PRO A CA   2  
ATOM 3259  C C    . PRO A 1 52  ? 2.076   -10.169 -6.831  1.00 0.00 ? 52  PRO A C    2  
ATOM 3260  O O    . PRO A 1 52  ? 2.429   -9.008  -6.897  1.00 0.00 ? 52  PRO A O    2  
ATOM 3261  C CB   . PRO A 1 52  ? 2.981   -12.415 -6.151  1.00 0.00 ? 52  PRO A CB   2  
ATOM 3262  C CG   . PRO A 1 52  ? 1.797   -13.321 -6.084  1.00 0.00 ? 52  PRO A CG   2  
ATOM 3263  C CD   . PRO A 1 52  ? 0.895   -12.793 -4.966  1.00 0.00 ? 52  PRO A CD   2  
ATOM 3264  H HA   . PRO A 1 52  ? 3.263   -10.581 -5.079  1.00 0.00 ? 52  PRO A HA   2  
ATOM 3265  H HB2  . PRO A 1 52  ? 3.335   -12.334 -7.171  1.00 0.00 ? 52  PRO A HB2  2  
ATOM 3266  H HB3  . PRO A 1 52  ? 3.765   -12.788 -5.509  1.00 0.00 ? 52  PRO A HB3  2  
ATOM 3267  H HG2  . PRO A 1 52  ? 1.268   -13.303 -7.028  1.00 0.00 ? 52  PRO A HG2  2  
ATOM 3268  H HG3  . PRO A 1 52  ? 2.109   -14.326 -5.853  1.00 0.00 ? 52  PRO A HG3  2  
ATOM 3269  H HD2  . PRO A 1 52  ? -0.134  -12.837 -5.276  1.00 0.00 ? 52  PRO A HD2  2  
ATOM 3270  H HD3  . PRO A 1 52  ? 1.044   -13.355 -4.060  1.00 0.00 ? 52  PRO A HD3  2  
ATOM 3271  N N    . GLY A 1 53  ? 1.329   -10.702 -7.758  1.00 0.00 ? 53  GLY A N    2  
ATOM 3272  C CA   . GLY A 1 53  ? 0.893   -9.881  -8.921  1.00 0.00 ? 53  GLY A CA   2  
ATOM 3273  C C    . GLY A 1 53  ? -0.310  -9.032  -8.511  1.00 0.00 ? 53  GLY A C    2  
ATOM 3274  O O    . GLY A 1 53  ? -1.043  -8.528  -9.341  1.00 0.00 ? 53  GLY A O    2  
ATOM 3275  H H    . GLY A 1 53  ? 1.050   -11.637 -7.686  1.00 0.00 ? 53  GLY A H    2  
ATOM 3276  H HA2  . GLY A 1 53  ? 1.705   -9.238  -9.235  1.00 0.00 ? 53  GLY A HA2  2  
ATOM 3277  H HA3  . GLY A 1 53  ? 0.609   -10.529 -9.736  1.00 0.00 ? 53  GLY A HA3  2  
ATOM 3278  N N    . GLU A 1 54  ? -0.519  -8.870  -7.233  1.00 0.00 ? 54  GLU A N    2  
ATOM 3279  C CA   . GLU A 1 54  ? -1.673  -8.059  -6.757  1.00 0.00 ? 54  GLU A CA   2  
ATOM 3280  C C    . GLU A 1 54  ? -1.258  -6.591  -6.632  1.00 0.00 ? 54  GLU A C    2  
ATOM 3281  O O    . GLU A 1 54  ? -0.120  -6.279  -6.340  1.00 0.00 ? 54  GLU A O    2  
ATOM 3282  C CB   . GLU A 1 54  ? -2.128  -8.569  -5.389  1.00 0.00 ? 54  GLU A CB   2  
ATOM 3283  C CG   . GLU A 1 54  ? -3.413  -7.852  -4.985  1.00 0.00 ? 54  GLU A CG   2  
ATOM 3284  C CD   . GLU A 1 54  ? -3.806  -8.253  -3.560  1.00 0.00 ? 54  GLU A CD   2  
ATOM 3285  O OE1  . GLU A 1 54  ? -3.035  -8.954  -2.928  1.00 0.00 ? 54  GLU A OE1  2  
ATOM 3286  O OE2  . GLU A 1 54  ? -4.873  -7.850  -3.127  1.00 0.00 ? 54  GLU A OE2  2  
ATOM 3287  H H    . GLU A 1 54  ? 0.086   -9.286  -6.584  1.00 0.00 ? 54  GLU A H    2  
ATOM 3288  H HA   . GLU A 1 54  ? -2.487  -8.144  -7.462  1.00 0.00 ? 54  GLU A HA   2  
ATOM 3289  H HB2  . GLU A 1 54  ? -2.309  -9.628  -5.444  1.00 0.00 ? 54  GLU A HB2  2  
ATOM 3290  H HB3  . GLU A 1 54  ? -1.361  -8.371  -4.658  1.00 0.00 ? 54  GLU A HB3  2  
ATOM 3291  H HG2  . GLU A 1 54  ? -3.253  -6.789  -5.028  1.00 0.00 ? 54  GLU A HG2  2  
ATOM 3292  H HG3  . GLU A 1 54  ? -4.206  -8.125  -5.665  1.00 0.00 ? 54  GLU A HG3  2  
ATOM 3293  H HE2  . GLU A 1 54  ? -5.054  -8.139  -2.230  1.00 0.00 ? 54  GLU A HE2  2  
ATOM 3294  N N    . ASP A 1 55  ? -2.173  -5.689  -6.850  1.00 0.00 ? 55  ASP A N    2  
ATOM 3295  C CA   . ASP A 1 55  ? -1.840  -4.239  -6.745  1.00 0.00 ? 55  ASP A CA   2  
ATOM 3296  C C    . ASP A 1 55  ? -1.658  -3.853  -5.284  1.00 0.00 ? 55  ASP A C    2  
ATOM 3297  O O    . ASP A 1 55  ? -2.129  -4.521  -4.384  1.00 0.00 ? 55  ASP A O    2  
ATOM 3298  C CB   . ASP A 1 55  ? -2.975  -3.402  -7.312  1.00 0.00 ? 55  ASP A CB   2  
ATOM 3299  C CG   . ASP A 1 55  ? -2.542  -1.937  -7.399  1.00 0.00 ? 55  ASP A CG   2  
ATOM 3300  O OD1  . ASP A 1 55  ? -1.920  -1.580  -8.386  1.00 0.00 ? 55  ASP A OD1  2  
ATOM 3301  O OD2  . ASP A 1 55  ? -2.844  -1.197  -6.478  1.00 0.00 ? 55  ASP A OD2  2  
ATOM 3302  H H    . ASP A 1 55  ? -3.084  -5.965  -7.082  1.00 0.00 ? 55  ASP A H    2  
ATOM 3303  H HA   . ASP A 1 55  ? -0.931  -4.034  -7.290  1.00 0.00 ? 55  ASP A HA   2  
ATOM 3304  H HB2  . ASP A 1 55  ? -3.242  -3.762  -8.287  1.00 0.00 ? 55  ASP A HB2  2  
ATOM 3305  H HB3  . ASP A 1 55  ? -3.820  -3.481  -6.659  1.00 0.00 ? 55  ASP A HB3  2  
ATOM 3306  H HD2  . ASP A 1 55  ? -2.542  -0.294  -6.600  1.00 0.00 ? 55  ASP A HD2  2  
ATOM 3307  N N    . ASP A 1 56  ? -0.988  -2.767  -5.048  1.00 0.00 ? 56  ASP A N    2  
ATOM 3308  C CA   . ASP A 1 56  ? -0.778  -2.308  -3.649  1.00 0.00 ? 56  ASP A CA   2  
ATOM 3309  C C    . ASP A 1 56  ? -2.079  -1.712  -3.102  1.00 0.00 ? 56  ASP A C    2  
ATOM 3310  O O    . ASP A 1 56  ? -2.513  -2.031  -2.011  1.00 0.00 ? 56  ASP A O    2  
ATOM 3311  C CB   . ASP A 1 56  ? 0.322   -1.244  -3.630  1.00 0.00 ? 56  ASP A CB   2  
ATOM 3312  C CG   . ASP A 1 56  ? -0.134  -0.017  -4.423  1.00 0.00 ? 56  ASP A CG   2  
ATOM 3313  O OD1  . ASP A 1 56  ? -1.013  -0.164  -5.255  1.00 0.00 ? 56  ASP A OD1  2  
ATOM 3314  O OD2  . ASP A 1 56  ? 0.410   1.052   -4.190  1.00 0.00 ? 56  ASP A OD2  2  
ATOM 3315  H H    . ASP A 1 56  ? -0.636  -2.244  -5.799  1.00 0.00 ? 56  ASP A H    2  
ATOM 3316  H HA   . ASP A 1 56  ? -0.479  -3.146  -3.036  1.00 0.00 ? 56  ASP A HA   2  
ATOM 3317  H HB2  . ASP A 1 56  ? 0.528   -0.960  -2.609  1.00 0.00 ? 56  ASP A HB2  2  
ATOM 3318  H HB3  . ASP A 1 56  ? 1.216   -1.645  -4.078  1.00 0.00 ? 56  ASP A HB3  2  
ATOM 3319  H HD2  . ASP A 1 56  ? 0.075   1.776   -4.725  1.00 0.00 ? 56  ASP A HD2  2  
ATOM 3320  N N    . LEU A 1 57  ? -2.704  -0.840  -3.849  1.00 0.00 ? 57  LEU A N    2  
ATOM 3321  C CA   . LEU A 1 57  ? -3.971  -0.216  -3.371  1.00 0.00 ? 57  LEU A CA   2  
ATOM 3322  C C    . LEU A 1 57  ? -5.117  -1.232  -3.402  1.00 0.00 ? 57  LEU A C    2  
ATOM 3323  O O    . LEU A 1 57  ? -5.897  -1.320  -2.474  1.00 0.00 ? 57  LEU A O    2  
ATOM 3324  C CB   . LEU A 1 57  ? -4.321  0.980   -4.262  1.00 0.00 ? 57  LEU A CB   2  
ATOM 3325  C CG   . LEU A 1 57  ? -5.635  1.608   -3.788  1.00 0.00 ? 57  LEU A CG   2  
ATOM 3326  C CD1  . LEU A 1 57  ? -5.510  2.023   -2.323  1.00 0.00 ? 57  LEU A CD1  2  
ATOM 3327  C CD2  . LEU A 1 57  ? -5.944  2.843   -4.632  1.00 0.00 ? 57  LEU A CD2  2  
ATOM 3328  H H    . LEU A 1 57  ? -2.335  -0.592  -4.722  1.00 0.00 ? 57  LEU A H    2  
ATOM 3329  H HA   . LEU A 1 57  ? -3.832  0.127   -2.357  1.00 0.00 ? 57  LEU A HA   2  
ATOM 3330  H HB2  . LEU A 1 57  ? -3.529  1.713   -4.204  1.00 0.00 ? 57  LEU A HB2  2  
ATOM 3331  H HB3  . LEU A 1 57  ? -4.430  0.649   -5.283  1.00 0.00 ? 57  LEU A HB3  2  
ATOM 3332  H HG   . LEU A 1 57  ? -6.430  0.889   -3.891  1.00 0.00 ? 57  LEU A HG   2  
ATOM 3333  H HD11 . LEU A 1 57  ? -5.721  1.175   -1.690  1.00 0.00 ? 57  LEU A HD11 2  
ATOM 3334  H HD12 . LEU A 1 57  ? -6.215  2.814   -2.113  1.00 0.00 ? 57  LEU A HD12 2  
ATOM 3335  H HD13 . LEU A 1 57  ? -4.509  2.374   -2.133  1.00 0.00 ? 57  LEU A HD13 2  
ATOM 3336  H HD21 . LEU A 1 57  ? -6.027  2.558   -5.671  1.00 0.00 ? 57  LEU A HD21 2  
ATOM 3337  H HD22 . LEU A 1 57  ? -5.150  3.566   -4.518  1.00 0.00 ? 57  LEU A HD22 2  
ATOM 3338  H HD23 . LEU A 1 57  ? -6.877  3.277   -4.301  1.00 0.00 ? 57  LEU A HD23 2  
ATOM 3339  N N    . GLU A 1 58  ? -5.233  -2.002  -4.450  1.00 0.00 ? 58  GLU A N    2  
ATOM 3340  C CA   . GLU A 1 58  ? -6.343  -2.995  -4.508  1.00 0.00 ? 58  GLU A CA   2  
ATOM 3341  C C    . GLU A 1 58  ? -6.274  -3.882  -3.267  1.00 0.00 ? 58  GLU A C    2  
ATOM 3342  O O    . GLU A 1 58  ? -7.280  -4.226  -2.682  1.00 0.00 ? 58  GLU A O    2  
ATOM 3343  C CB   . GLU A 1 58  ? -6.213  -3.859  -5.767  1.00 0.00 ? 58  GLU A CB   2  
ATOM 3344  C CG   . GLU A 1 58  ? -6.605  -3.038  -7.002  1.00 0.00 ? 58  GLU A CG   2  
ATOM 3345  C CD   . GLU A 1 58  ? -5.482  -2.070  -7.381  1.00 0.00 ? 58  GLU A CD   2  
ATOM 3346  O OE1  . GLU A 1 58  ? -5.193  -1.187  -6.589  1.00 0.00 ? 58  GLU A OE1  2  
ATOM 3347  O OE2  . GLU A 1 58  ? -4.930  -2.228  -8.457  1.00 0.00 ? 58  GLU A OE2  2  
ATOM 3348  H H    . GLU A 1 58  ? -4.600  -1.923  -5.193  1.00 0.00 ? 58  GLU A H    2  
ATOM 3349  H HA   . GLU A 1 58  ? -7.292  -2.476  -4.523  1.00 0.00 ? 58  GLU A HA   2  
ATOM 3350  H HB2  . GLU A 1 58  ? -5.198  -4.202  -5.861  1.00 0.00 ? 58  GLU A HB2  2  
ATOM 3351  H HB3  . GLU A 1 58  ? -6.867  -4.711  -5.685  1.00 0.00 ? 58  GLU A HB3  2  
ATOM 3352  H HG2  . GLU A 1 58  ? -6.795  -3.705  -7.829  1.00 0.00 ? 58  GLU A HG2  2  
ATOM 3353  H HG3  . GLU A 1 58  ? -7.497  -2.476  -6.788  1.00 0.00 ? 58  GLU A HG3  2  
ATOM 3354  H HE2  . GLU A 1 58  ? -4.237  -1.586  -8.628  1.00 0.00 ? 58  GLU A HE2  2  
ATOM 3355  N N    . THR A 1 59  ? -5.091  -4.226  -2.839  1.00 0.00 ? 59  THR A N    2  
ATOM 3356  C CA   . THR A 1 59  ? -4.976  -5.055  -1.613  1.00 0.00 ? 59  THR A CA   2  
ATOM 3357  C C    . THR A 1 59  ? -5.645  -4.291  -0.478  1.00 0.00 ? 59  THR A C    2  
ATOM 3358  O O    . THR A 1 59  ? -6.388  -4.842  0.310   1.00 0.00 ? 59  THR A O    2  
ATOM 3359  C CB   . THR A 1 59  ? -3.499  -5.301  -1.293  1.00 0.00 ? 59  THR A CB   2  
ATOM 3360  O OG1  . THR A 1 59  ? -2.919  -6.054  -2.349  1.00 0.00 ? 59  THR A OG1  2  
ATOM 3361  C CG2  . THR A 1 59  ? -3.368  -6.071  0.023   1.00 0.00 ? 59  THR A CG2  2  
ATOM 3362  H H    . THR A 1 59  ? -4.287  -3.921  -3.308  1.00 0.00 ? 59  THR A H    2  
ATOM 3363  H HA   . THR A 1 59  ? -5.481  -5.998  -1.762  1.00 0.00 ? 59  THR A HA   2  
ATOM 3364  H HB   . THR A 1 59  ? -2.988  -4.355  -1.205  1.00 0.00 ? 59  THR A HB   2  
ATOM 3365  H HG1  . THR A 1 59  ? -3.512  -6.014  -3.102  1.00 0.00 ? 59  THR A HG1  2  
ATOM 3366  H HG21 . THR A 1 59  ? -3.900  -5.545  0.802   1.00 0.00 ? 59  THR A HG21 2  
ATOM 3367  H HG22 . THR A 1 59  ? -2.325  -6.144  0.293   1.00 0.00 ? 59  THR A HG22 2  
ATOM 3368  H HG23 . THR A 1 59  ? -3.780  -7.061  -0.093  1.00 0.00 ? 59  THR A HG23 2  
ATOM 3369  N N    . ALA A 1 60  ? -5.415  -3.008  -0.414  1.00 0.00 ? 60  ALA A N    2  
ATOM 3370  C CA   . ALA A 1 60  ? -6.064  -2.190  0.642   1.00 0.00 ? 60  ALA A CA   2  
ATOM 3371  C C    . ALA A 1 60  ? -7.567  -2.158  0.368   1.00 0.00 ? 60  ALA A C    2  
ATOM 3372  O O    . ALA A 1 60  ? -8.377  -2.296  1.261   1.00 0.00 ? 60  ALA A O    2  
ATOM 3373  C CB   . ALA A 1 60  ? -5.501  -0.770  0.598   1.00 0.00 ? 60  ALA A CB   2  
ATOM 3374  H H    . ALA A 1 60  ? -4.831  -2.579  -1.079  1.00 0.00 ? 60  ALA A H    2  
ATOM 3375  H HA   . ALA A 1 60  ? -5.878  -2.628  1.612   1.00 0.00 ? 60  ALA A HA   2  
ATOM 3376  H HB1  . ALA A 1 60  ? -6.189  -0.126  0.075   1.00 0.00 ? 60  ALA A HB1  2  
ATOM 3377  H HB2  . ALA A 1 60  ? -4.552  -0.774  0.083   1.00 0.00 ? 60  ALA A HB2  2  
ATOM 3378  H HB3  . ALA A 1 60  ? -5.361  -0.407  1.605   1.00 0.00 ? 60  ALA A HB3  2  
ATOM 3379  N N    . LEU A 1 61  ? -7.941  -1.990  -0.873  1.00 0.00 ? 61  LEU A N    2  
ATOM 3380  C CA   . LEU A 1 61  ? -9.388  -1.963  -1.224  1.00 0.00 ? 61  LEU A CA   2  
ATOM 3381  C C    . LEU A 1 61  ? -10.028 -3.292  -0.821  1.00 0.00 ? 61  LEU A C    2  
ATOM 3382  O O    . LEU A 1 61  ? -11.037 -3.330  -0.144  1.00 0.00 ? 61  LEU A O    2  
ATOM 3383  C CB   . LEU A 1 61  ? -9.525  -1.801  -2.734  1.00 0.00 ? 61  LEU A CB   2  
ATOM 3384  C CG   . LEU A 1 61  ? -8.881  -0.492  -3.181  1.00 0.00 ? 61  LEU A CG   2  
ATOM 3385  C CD1  . LEU A 1 61  ? -8.934  -0.412  -4.706  1.00 0.00 ? 61  LEU A CD1  2  
ATOM 3386  C CD2  . LEU A 1 61  ? -9.643  0.690   -2.579  1.00 0.00 ? 61  LEU A CD2  2  
ATOM 3387  H H    . LEU A 1 61  ? -7.266  -1.891  -1.577  1.00 0.00 ? 61  LEU A H    2  
ATOM 3388  H HA   . LEU A 1 61  ? -9.879  -1.145  -0.722  1.00 0.00 ? 61  LEU A HA   2  
ATOM 3389  H HB2  . LEU A 1 61  ? -9.036  -2.628  -3.224  1.00 0.00 ? 61  LEU A HB2  2  
ATOM 3390  H HB3  . LEU A 1 61  ? -10.567 -1.796  -3.005  1.00 0.00 ? 61  LEU A HB3  2  
ATOM 3391  H HG   . LEU A 1 61  ? -7.854  -0.464  -2.853  1.00 0.00 ? 61  LEU A HG   2  
ATOM 3392  H HD11 . LEU A 1 61  ? -9.266  -1.361  -5.099  1.00 0.00 ? 61  LEU A HD11 2  
ATOM 3393  H HD12 . LEU A 1 61  ? -7.952  -0.186  -5.091  1.00 0.00 ? 61  LEU A HD12 2  
ATOM 3394  H HD13 . LEU A 1 61  ? -9.626  0.361   -5.003  1.00 0.00 ? 61  LEU A HD13 2  
ATOM 3395  H HD21 . LEU A 1 61  ? -9.722  1.480   -3.312  1.00 0.00 ? 61  LEU A HD21 2  
ATOM 3396  H HD22 . LEU A 1 61  ? -9.111  1.055   -1.713  1.00 0.00 ? 61  LEU A HD22 2  
ATOM 3397  H HD23 . LEU A 1 61  ? -10.631 0.370   -2.285  1.00 0.00 ? 61  LEU A HD23 2  
ATOM 3398  N N    . ARG A 1 62  ? -9.443  -4.379  -1.238  1.00 0.00 ? 62  ARG A N    2  
ATOM 3399  C CA   . ARG A 1 62  ? -10.008 -5.714  -0.887  1.00 0.00 ? 62  ARG A CA   2  
ATOM 3400  C C    . ARG A 1 62  ? -10.030 -5.877  0.634   1.00 0.00 ? 62  ARG A C    2  
ATOM 3401  O O    . ARG A 1 62  ? -10.998 -6.339  1.202   1.00 0.00 ? 62  ARG A O    2  
ATOM 3402  C CB   . ARG A 1 62  ? -9.136  -6.810  -1.499  1.00 0.00 ? 62  ARG A CB   2  
ATOM 3403  C CG   . ARG A 1 62  ? -9.801  -8.171  -1.279  1.00 0.00 ? 62  ARG A CG   2  
ATOM 3404  C CD   . ARG A 1 62  ? -8.886  -9.279  -1.808  1.00 0.00 ? 62  ARG A CD   2  
ATOM 3405  N NE   . ARG A 1 62  ? -7.724  -9.443  -0.889  1.00 0.00 ? 62  ARG A NE   2  
ATOM 3406  C CZ   . ARG A 1 62  ? -6.760  -10.266 -1.194  1.00 0.00 ? 62  ARG A CZ   2  
ATOM 3407  N NH1  . ARG A 1 62  ? -6.797  -10.931 -2.317  1.00 0.00 ? 62  ARG A NH1  2  
ATOM 3408  N NH2  . ARG A 1 62  ? -5.753  -10.422 -0.377  1.00 0.00 ? 62  ARG A NH2  2  
ATOM 3409  H H    . ARG A 1 62  ? -8.632  -4.318  -1.786  1.00 0.00 ? 62  ARG A H    2  
ATOM 3410  H HA   . ARG A 1 62  ? -11.012 -5.792  -1.274  1.00 0.00 ? 62  ARG A HA   2  
ATOM 3411  H HB2  . ARG A 1 62  ? -9.024  -6.630  -2.560  1.00 0.00 ? 62  ARG A HB2  2  
ATOM 3412  H HB3  . ARG A 1 62  ? -8.166  -6.807  -1.028  1.00 0.00 ? 62  ARG A HB3  2  
ATOM 3413  H HG2  . ARG A 1 62  ? -9.972  -8.320  -0.221  1.00 0.00 ? 62  ARG A HG2  2  
ATOM 3414  H HG3  . ARG A 1 62  ? -10.744 -8.203  -1.804  1.00 0.00 ? 62  ARG A HG3  2  
ATOM 3415  H HD2  . ARG A 1 62  ? -9.437  -10.207 -1.861  1.00 0.00 ? 62  ARG A HD2  2  
ATOM 3416  H HD3  . ARG A 1 62  ? -8.532  -9.014  -2.793  1.00 0.00 ? 62  ARG A HD3  2  
ATOM 3417  H HE   . ARG A 1 62  ? -7.689  -8.937  -0.051  1.00 0.00 ? 62  ARG A HE   2  
ATOM 3418  H HH11 . ARG A 1 62  ? -7.567  -10.809 -2.944  1.00 0.00 ? 62  ARG A HH11 2  
ATOM 3419  H HH12 . ARG A 1 62  ? -6.059  -11.564 -2.548  1.00 0.00 ? 62  ARG A HH12 2  
ATOM 3420  H HH21 . ARG A 1 62  ? -5.724  -9.911  0.481   1.00 0.00 ? 62  ARG A HH21 2  
ATOM 3421  H HH22 . ARG A 1 62  ? -5.013  -11.054 -0.609  1.00 0.00 ? 62  ARG A HH22 2  
ATOM 3422  N N    . ALA A 1 63  ? -8.970  -5.501  1.293   1.00 0.00 ? 63  ALA A N    2  
ATOM 3423  C CA   . ALA A 1 63  ? -8.932  -5.637  2.777   1.00 0.00 ? 63  ALA A CA   2  
ATOM 3424  C C    . ALA A 1 63  ? -9.934  -4.665  3.403   1.00 0.00 ? 63  ALA A C    2  
ATOM 3425  O O    . ALA A 1 63  ? -10.533 -4.945  4.421   1.00 0.00 ? 63  ALA A O    2  
ATOM 3426  C CB   . ALA A 1 63  ? -7.524  -5.310  3.283   1.00 0.00 ? 63  ALA A CB   2  
ATOM 3427  H H    . ALA A 1 63  ? -8.200  -5.131  0.815   1.00 0.00 ? 63  ALA A H    2  
ATOM 3428  H HA   . ALA A 1 63  ? -9.190  -6.647  3.053   1.00 0.00 ? 63  ALA A HA   2  
ATOM 3429  H HB1  . ALA A 1 63  ? -7.538  -5.236  4.361   1.00 0.00 ? 63  ALA A HB1  2  
ATOM 3430  H HB2  . ALA A 1 63  ? -7.199  -4.371  2.862   1.00 0.00 ? 63  ALA A HB2  2  
ATOM 3431  H HB3  . ALA A 1 63  ? -6.844  -6.094  2.984   1.00 0.00 ? 63  ALA A HB3  2  
ATOM 3432  N N    . THR A 1 64  ? -10.109 -3.520  2.803   1.00 0.00 ? 64  THR A N    2  
ATOM 3433  C CA   . THR A 1 64  ? -11.061 -2.520  3.361   1.00 0.00 ? 64  THR A CA   2  
ATOM 3434  C C    . THR A 1 64  ? -12.468 -3.119  3.440   1.00 0.00 ? 64  THR A C    2  
ATOM 3435  O O    . THR A 1 64  ? -13.157 -2.977  4.428   1.00 0.00 ? 64  THR A O    2  
ATOM 3436  C CB   . THR A 1 64  ? -11.080 -1.290  2.455   1.00 0.00 ? 64  THR A CB   2  
ATOM 3437  O OG1  . THR A 1 64  ? -9.752  -0.815  2.280   1.00 0.00 ? 64  THR A OG1  2  
ATOM 3438  C CG2  . THR A 1 64  ? -11.932 -0.192  3.089   1.00 0.00 ? 64  THR A CG2  2  
ATOM 3439  H H    . THR A 1 64  ? -9.609  -3.315  1.986   1.00 0.00 ? 64  THR A H    2  
ATOM 3440  H HA   . THR A 1 64  ? -10.739 -2.231  4.350   1.00 0.00 ? 64  THR A HA   2  
ATOM 3441  H HB   . THR A 1 64  ? -11.497 -1.555  1.497   1.00 0.00 ? 64  THR A HB   2  
ATOM 3442  H HG1  . THR A 1 64  ? -9.149  -1.526  2.513   1.00 0.00 ? 64  THR A HG1  2  
ATOM 3443  H HG21 . THR A 1 64  ? -11.399 0.239   3.920   1.00 0.00 ? 64  THR A HG21 2  
ATOM 3444  H HG22 . THR A 1 64  ? -12.865 -0.613  3.439   1.00 0.00 ? 64  THR A HG22 2  
ATOM 3445  H HG23 . THR A 1 64  ? -12.136 0.572   2.355   1.00 0.00 ? 64  THR A HG23 2  
ATOM 3446  N N    . GLN A 1 65  ? -12.904 -3.784  2.406   1.00 0.00 ? 65  GLN A N    2  
ATOM 3447  C CA   . GLN A 1 65  ? -14.267 -4.381  2.433   1.00 0.00 ? 65  GLN A CA   2  
ATOM 3448  C C    . GLN A 1 65  ? -14.245 -5.703  3.207   1.00 0.00 ? 65  GLN A C    2  
ATOM 3449  O O    . GLN A 1 65  ? -15.155 -6.012  3.949   1.00 0.00 ? 65  GLN A O    2  
ATOM 3450  C CB   . GLN A 1 65  ? -14.763 -4.602  0.998   1.00 0.00 ? 65  GLN A CB   2  
ATOM 3451  C CG   . GLN A 1 65  ? -14.951 -6.096  0.726   1.00 0.00 ? 65  GLN A CG   2  
ATOM 3452  C CD   . GLN A 1 65  ? -15.383 -6.293  -0.728  1.00 0.00 ? 65  GLN A CD   2  
ATOM 3453  O OE1  . GLN A 1 65  ? -14.681 -5.905  -1.641  1.00 0.00 ? 65  GLN A OE1  2  
ATOM 3454  N NE2  . GLN A 1 65  ? -16.518 -6.884  -0.985  1.00 0.00 ? 65  GLN A NE2  2  
ATOM 3455  H H    . GLN A 1 65  ? -12.337 -3.888  1.613   1.00 0.00 ? 65  GLN A H    2  
ATOM 3456  H HA   . GLN A 1 65  ? -14.934 -3.698  2.935   1.00 0.00 ? 65  GLN A HA   2  
ATOM 3457  H HB2  . GLN A 1 65  ? -15.707 -4.091  0.867   1.00 0.00 ? 65  GLN A HB2  2  
ATOM 3458  H HB3  . GLN A 1 65  ? -14.040 -4.200  0.305   1.00 0.00 ? 65  GLN A HB3  2  
ATOM 3459  H HG2  . GLN A 1 65  ? -14.019 -6.615  0.897   1.00 0.00 ? 65  GLN A HG2  2  
ATOM 3460  H HG3  . GLN A 1 65  ? -15.712 -6.491  1.382   1.00 0.00 ? 65  GLN A HG3  2  
ATOM 3461  H HE21 . GLN A 1 65  ? -17.085 -7.196  -0.248  1.00 0.00 ? 65  GLN A HE21 2  
ATOM 3462  H HE22 . GLN A 1 65  ? -16.804 -7.016  -1.912  1.00 0.00 ? 65  GLN A HE22 2  
ATOM 3463  N N    . GLU A 1 66  ? -13.217 -6.485  3.043   1.00 0.00 ? 66  GLU A N    2  
ATOM 3464  C CA   . GLU A 1 66  ? -13.148 -7.780  3.775   1.00 0.00 ? 66  GLU A CA   2  
ATOM 3465  C C    . GLU A 1 66  ? -13.081 -7.519  5.281   1.00 0.00 ? 66  GLU A C    2  
ATOM 3466  O O    . GLU A 1 66  ? -13.655 -8.237  6.073   1.00 0.00 ? 66  GLU A O    2  
ATOM 3467  C CB   . GLU A 1 66  ? -11.900 -8.545  3.337   1.00 0.00 ? 66  GLU A CB   2  
ATOM 3468  C CG   . GLU A 1 66  ? -12.066 -9.006  1.887   1.00 0.00 ? 66  GLU A CG   2  
ATOM 3469  C CD   . GLU A 1 66  ? -13.205 -10.025 1.804   1.00 0.00 ? 66  GLU A CD   2  
ATOM 3470  O OE1  . GLU A 1 66  ? -13.580 -10.549 2.839   1.00 0.00 ? 66  GLU A OE1  2  
ATOM 3471  O OE2  . GLU A 1 66  ? -13.680 -10.264 0.706   1.00 0.00 ? 66  GLU A OE2  2  
ATOM 3472  H H    . GLU A 1 66  ? -12.489 -6.222  2.441   1.00 0.00 ? 66  GLU A H    2  
ATOM 3473  H HA   . GLU A 1 66  ? -14.028 -8.368  3.552   1.00 0.00 ? 66  GLU A HA   2  
ATOM 3474  H HB2  . GLU A 1 66  ? -11.038 -7.899  3.412   1.00 0.00 ? 66  GLU A HB2  2  
ATOM 3475  H HB3  . GLU A 1 66  ? -11.762 -9.406  3.973   1.00 0.00 ? 66  GLU A HB3  2  
ATOM 3476  H HG2  . GLU A 1 66  ? -12.301 -8.155  1.265   1.00 0.00 ? 66  GLU A HG2  2  
ATOM 3477  H HG3  . GLU A 1 66  ? -11.149 -9.461  1.546   1.00 0.00 ? 66  GLU A HG3  2  
ATOM 3478  H HE2  . GLU A 1 66  ? -14.388 -10.912 0.730   1.00 0.00 ? 66  GLU A HE2  2  
ATOM 3479  N N    . GLU A 1 67  ? -12.375 -6.497  5.680   1.00 0.00 ? 67  GLU A N    2  
ATOM 3480  C CA   . GLU A 1 67  ? -12.260 -6.193  7.135   1.00 0.00 ? 67  GLU A CA   2  
ATOM 3481  C C    . GLU A 1 67  ? -13.199 -5.041  7.515   1.00 0.00 ? 67  GLU A C    2  
ATOM 3482  O O    . GLU A 1 67  ? -13.189 -4.573  8.636   1.00 0.00 ? 67  GLU A O    2  
ATOM 3483  C CB   . GLU A 1 67  ? -10.816 -5.805  7.456   1.00 0.00 ? 67  GLU A CB   2  
ATOM 3484  C CG   . GLU A 1 67  ? -9.891  -6.988  7.155   1.00 0.00 ? 67  GLU A CG   2  
ATOM 3485  C CD   . GLU A 1 67  ? -8.454  -6.620  7.532   1.00 0.00 ? 67  GLU A CD   2  
ATOM 3486  O OE1  . GLU A 1 67  ? -7.613  -7.503  7.510   1.00 0.00 ? 67  GLU A OE1  2  
ATOM 3487  O OE2  . GLU A 1 67  ? -8.220  -5.464  7.838   1.00 0.00 ? 67  GLU A OE2  2  
ATOM 3488  H H    . GLU A 1 67  ? -11.914 -5.933  5.024   1.00 0.00 ? 67  GLU A H    2  
ATOM 3489  H HA   . GLU A 1 67  ? -12.527 -7.072  7.704   1.00 0.00 ? 67  GLU A HA   2  
ATOM 3490  H HB2  . GLU A 1 67  ? -10.528 -4.960  6.848   1.00 0.00 ? 67  GLU A HB2  2  
ATOM 3491  H HB3  . GLU A 1 67  ? -10.734 -5.543  8.500   1.00 0.00 ? 67  GLU A HB3  2  
ATOM 3492  H HG2  . GLU A 1 67  ? -10.209 -7.846  7.729   1.00 0.00 ? 67  GLU A HG2  2  
ATOM 3493  H HG3  . GLU A 1 67  ? -9.936  -7.220  6.101   1.00 0.00 ? 67  GLU A HG3  2  
ATOM 3494  H HE2  . GLU A 1 67  ? -7.300  -5.307  8.063   1.00 0.00 ? 67  GLU A HE2  2  
ATOM 3495  N N    . ALA A 1 68  ? -14.008 -4.575  6.601   1.00 0.00 ? 68  ALA A N    2  
ATOM 3496  C CA   . ALA A 1 68  ? -14.930 -3.453  6.936   1.00 0.00 ? 68  ALA A CA   2  
ATOM 3497  C C    . ALA A 1 68  ? -16.185 -3.523  6.065   1.00 0.00 ? 68  ALA A C    2  
ATOM 3498  O O    . ALA A 1 68  ? -17.218 -2.989  6.409   1.00 0.00 ? 68  ALA A O    2  
ATOM 3499  C CB   . ALA A 1 68  ? -14.221 -2.120  6.689   1.00 0.00 ? 68  ALA A CB   2  
ATOM 3500  H H    . ALA A 1 68  ? -14.006 -4.960  5.698   1.00 0.00 ? 68  ALA A H    2  
ATOM 3501  H HA   . ALA A 1 68  ? -15.213 -3.520  7.976   1.00 0.00 ? 68  ALA A HA   2  
ATOM 3502  H HB1  . ALA A 1 68  ? -14.391 -1.463  7.528   1.00 0.00 ? 68  ALA A HB1  2  
ATOM 3503  H HB2  . ALA A 1 68  ? -14.612 -1.666  5.791   1.00 0.00 ? 68  ALA A HB2  2  
ATOM 3504  H HB3  . ALA A 1 68  ? -13.161 -2.293  6.576   1.00 0.00 ? 68  ALA A HB3  2  
ATOM 3505  N N    . GLY A 1 69  ? -16.109 -4.169  4.936   1.00 0.00 ? 69  GLY A N    2  
ATOM 3506  C CA   . GLY A 1 69  ? -17.305 -4.266  4.053   1.00 0.00 ? 69  GLY A CA   2  
ATOM 3507  C C    . GLY A 1 69  ? -17.362 -3.045  3.134   1.00 0.00 ? 69  GLY A C    2  
ATOM 3508  O O    . GLY A 1 69  ? -18.249 -2.915  2.314   1.00 0.00 ? 69  GLY A O    2  
ATOM 3509  H H    . GLY A 1 69  ? -15.265 -4.591  4.670   1.00 0.00 ? 69  GLY A H    2  
ATOM 3510  H HA2  . GLY A 1 69  ? -17.238 -5.164  3.455   1.00 0.00 ? 69  GLY A HA2  2  
ATOM 3511  H HA3  . GLY A 1 69  ? -18.199 -4.298  4.655   1.00 0.00 ? 69  GLY A HA3  2  
ATOM 3512  N N    . ILE A 1 70  ? -16.424 -2.149  3.265   1.00 0.00 ? 70  ILE A N    2  
ATOM 3513  C CA   . ILE A 1 70  ? -16.426 -0.941  2.400   1.00 0.00 ? 70  ILE A CA   2  
ATOM 3514  C C    . ILE A 1 70  ? -15.337 -1.093  1.333   1.00 0.00 ? 70  ILE A C    2  
ATOM 3515  O O    . ILE A 1 70  ? -14.195 -1.374  1.636   1.00 0.00 ? 70  ILE A O    2  
ATOM 3516  C CB   . ILE A 1 70  ? -16.145 0.298   3.254   1.00 0.00 ? 70  ILE A CB   2  
ATOM 3517  C CG1  . ILE A 1 70  ? -16.980 0.246   4.539   1.00 0.00 ? 70  ILE A CG1  2  
ATOM 3518  C CG2  . ILE A 1 70  ? -16.543 1.541   2.463   1.00 0.00 ? 70  ILE A CG2  2  
ATOM 3519  C CD1  . ILE A 1 70  ? -16.353 1.147   5.607   1.00 0.00 ? 70  ILE A CD1  2  
ATOM 3520  H H    . ILE A 1 70  ? -15.719 -2.270  3.934   1.00 0.00 ? 70  ILE A H    2  
ATOM 3521  H HA   . ILE A 1 70  ? -17.387 -0.839  1.922   1.00 0.00 ? 70  ILE A HA   2  
ATOM 3522  H HB   . ILE A 1 70  ? -15.094 0.337   3.498   1.00 0.00 ? 70  ILE A HB   2  
ATOM 3523  H HG12 . ILE A 1 70  ? -17.978 0.593   4.327   1.00 0.00 ? 70  ILE A HG12 2  
ATOM 3524  H HG13 . ILE A 1 70  ? -17.021 -0.767  4.907   1.00 0.00 ? 70  ILE A HG13 2  
ATOM 3525  H HG21 . ILE A 1 70  ? -17.606 1.525   2.285   1.00 0.00 ? 70  ILE A HG21 2  
ATOM 3526  H HG22 . ILE A 1 70  ? -16.024 1.550   1.519   1.00 0.00 ? 70  ILE A HG22 2  
ATOM 3527  H HG23 . ILE A 1 70  ? -16.290 2.422   3.025   1.00 0.00 ? 70  ILE A HG23 2  
ATOM 3528  H HD11 . ILE A 1 70  ? -15.450 1.596   5.218   1.00 0.00 ? 70  ILE A HD11 2  
ATOM 3529  H HD12 . ILE A 1 70  ? -16.111 0.555   6.478   1.00 0.00 ? 70  ILE A HD12 2  
ATOM 3530  H HD13 . ILE A 1 70  ? -17.055 1.922   5.879   1.00 0.00 ? 70  ILE A HD13 2  
ATOM 3531  N N    . GLU A 1 71  ? -15.685 -0.927  0.086   1.00 0.00 ? 71  GLU A N    2  
ATOM 3532  C CA   . GLU A 1 71  ? -14.678 -1.076  -1.005  1.00 0.00 ? 71  GLU A CA   2  
ATOM 3533  C C    . GLU A 1 71  ? -14.511 0.248   -1.753  1.00 0.00 ? 71  GLU A C    2  
ATOM 3534  O O    . GLU A 1 71  ? -15.274 1.175   -1.574  1.00 0.00 ? 71  GLU A O    2  
ATOM 3535  C CB   . GLU A 1 71  ? -15.155 -2.152  -1.982  1.00 0.00 ? 71  GLU A CB   2  
ATOM 3536  C CG   . GLU A 1 71  ? -16.415 -1.658  -2.697  1.00 0.00 ? 71  GLU A CG   2  
ATOM 3537  C CD   . GLU A 1 71  ? -16.965 -2.773  -3.588  1.00 0.00 ? 71  GLU A CD   2  
ATOM 3538  O OE1  . GLU A 1 71  ? -16.313 -3.797  -3.692  1.00 0.00 ? 71  GLU A OE1  2  
ATOM 3539  O OE2  . GLU A 1 71  ? -18.031 -2.584  -4.152  1.00 0.00 ? 71  GLU A OE2  2  
ATOM 3540  H H    . GLU A 1 71  ? -16.615 -0.710  -0.136  1.00 0.00 ? 71  GLU A H    2  
ATOM 3541  H HA   . GLU A 1 71  ? -13.730 -1.374  -0.582  1.00 0.00 ? 71  GLU A HA   2  
ATOM 3542  H HB2  . GLU A 1 71  ? -14.381 -2.347  -2.708  1.00 0.00 ? 71  GLU A HB2  2  
ATOM 3543  H HB3  . GLU A 1 71  ? -15.382 -3.057  -1.440  1.00 0.00 ? 71  GLU A HB3  2  
ATOM 3544  H HG2  . GLU A 1 71  ? -17.159 -1.381  -1.963  1.00 0.00 ? 71  GLU A HG2  2  
ATOM 3545  H HG3  . GLU A 1 71  ? -16.171 -0.801  -3.304  1.00 0.00 ? 71  GLU A HG3  2  
ATOM 3546  H HE2  . GLU A 1 71  ? -18.314 -3.325  -4.693  1.00 0.00 ? 71  GLU A HE2  2  
ATOM 3547  N N    . ALA A 1 72  ? -13.519 0.339   -2.603  1.00 0.00 ? 72  ALA A N    2  
ATOM 3548  C CA   . ALA A 1 72  ? -13.307 1.602   -3.369  1.00 0.00 ? 72  ALA A CA   2  
ATOM 3549  C C    . ALA A 1 72  ? -14.626 2.026   -4.001  1.00 0.00 ? 72  ALA A C    2  
ATOM 3550  O O    . ALA A 1 72  ? -14.937 3.195   -4.089  1.00 0.00 ? 72  ALA A O    2  
ATOM 3551  C CB   . ALA A 1 72  ? -12.264 1.364   -4.460  1.00 0.00 ? 72  ALA A CB   2  
ATOM 3552  H H    . ALA A 1 72  ? -12.918 -0.423  -2.738  1.00 0.00 ? 72  ALA A H    2  
ATOM 3553  H HA   . ALA A 1 72  ? -12.960 2.376   -2.713  1.00 0.00 ? 72  ALA A HA   2  
ATOM 3554  H HB1  . ALA A 1 72  ? -11.760 0.427   -4.274  1.00 0.00 ? 72  ALA A HB1  2  
ATOM 3555  H HB2  . ALA A 1 72  ? -11.547 2.169   -4.446  1.00 0.00 ? 72  ALA A HB2  2  
ATOM 3556  H HB3  . ALA A 1 72  ? -12.753 1.327   -5.421  1.00 0.00 ? 72  ALA A HB3  2  
ATOM 3557  N N    . GLY A 1 73  ? -15.416 1.081   -4.418  1.00 0.00 ? 73  GLY A N    2  
ATOM 3558  C CA   . GLY A 1 73  ? -16.728 1.430   -5.017  1.00 0.00 ? 73  GLY A CA   2  
ATOM 3559  C C    . GLY A 1 73  ? -17.597 2.076   -3.940  1.00 0.00 ? 73  GLY A C    2  
ATOM 3560  O O    . GLY A 1 73  ? -18.616 2.671   -4.224  1.00 0.00 ? 73  GLY A O    2  
ATOM 3561  H H    . GLY A 1 73  ? -15.154 0.144   -4.316  1.00 0.00 ? 73  GLY A H    2  
ATOM 3562  H HA2  . GLY A 1 73  ? -16.580 2.123   -5.834  1.00 0.00 ? 73  GLY A HA2  2  
ATOM 3563  H HA3  . GLY A 1 73  ? -17.212 0.537   -5.379  1.00 0.00 ? 73  GLY A HA3  2  
ATOM 3564  N N    . GLN A 1 74  ? -17.198 1.951   -2.698  1.00 0.00 ? 74  GLN A N    2  
ATOM 3565  C CA   . GLN A 1 74  ? -18.002 2.548   -1.595  1.00 0.00 ? 74  GLN A CA   2  
ATOM 3566  C C    . GLN A 1 74  ? -17.237 3.708   -0.932  1.00 0.00 ? 74  GLN A C    2  
ATOM 3567  O O    . GLN A 1 74  ? -17.812 4.476   -0.186  1.00 0.00 ? 74  GLN A O    2  
ATOM 3568  C CB   . GLN A 1 74  ? -18.329 1.463   -0.564  1.00 0.00 ? 74  GLN A CB   2  
ATOM 3569  C CG   . GLN A 1 74  ? -19.359 1.994   0.439   1.00 0.00 ? 74  GLN A CG   2  
ATOM 3570  C CD   . GLN A 1 74  ? -20.691 2.229   -0.274  1.00 0.00 ? 74  GLN A CD   2  
ATOM 3571  O OE1  . GLN A 1 74  ? -21.243 1.327   -0.873  1.00 0.00 ? 74  GLN A OE1  2  
ATOM 3572  N NE2  . GLN A 1 74  ? -21.237 3.414   -0.233  1.00 0.00 ? 74  GLN A NE2  2  
ATOM 3573  H H    . GLN A 1 74  ? -16.375 1.461   -2.495  1.00 0.00 ? 74  GLN A H    2  
ATOM 3574  H HA   . GLN A 1 74  ? -18.925 2.934   -2.002  1.00 0.00 ? 74  GLN A HA   2  
ATOM 3575  H HB2  . GLN A 1 74  ? -18.734 0.600   -1.072  1.00 0.00 ? 74  GLN A HB2  2  
ATOM 3576  H HB3  . GLN A 1 74  ? -17.431 1.182   -0.040  1.00 0.00 ? 74  GLN A HB3  2  
ATOM 3577  H HG2  . GLN A 1 74  ? -19.501 1.268   1.227   1.00 0.00 ? 74  GLN A HG2  2  
ATOM 3578  H HG3  . GLN A 1 74  ? -19.009 2.923   0.863   1.00 0.00 ? 74  GLN A HG3  2  
ATOM 3579  H HE21 . GLN A 1 74  ? -20.790 4.142   0.247   1.00 0.00 ? 74  GLN A HE21 2  
ATOM 3580  H HE22 . GLN A 1 74  ? -22.092 3.576   -0.684  1.00 0.00 ? 74  GLN A HE22 2  
ATOM 3581  N N    . LEU A 1 75  ? -15.961 3.872   -1.207  1.00 0.00 ? 75  LEU A N    2  
ATOM 3582  C CA   . LEU A 1 75  ? -15.226 5.026   -0.592  1.00 0.00 ? 75  LEU A CA   2  
ATOM 3583  C C    . LEU A 1 75  ? -14.498 5.812   -1.677  1.00 0.00 ? 75  LEU A C    2  
ATOM 3584  O O    . LEU A 1 75  ? -14.560 5.496   -2.849  1.00 0.00 ? 75  LEU A O    2  
ATOM 3585  C CB   . LEU A 1 75  ? -14.188 4.594   0.466   1.00 0.00 ? 75  LEU A CB   2  
ATOM 3586  C CG   . LEU A 1 75  ? -13.995 3.078   0.492   1.00 0.00 ? 75  LEU A CG   2  
ATOM 3587  C CD1  . LEU A 1 75  ? -12.749 2.723   -0.311  1.00 0.00 ? 75  LEU A CD1  2  
ATOM 3588  C CD2  . LEU A 1 75  ? -13.795 2.609   1.934   1.00 0.00 ? 75  LEU A CD2  2  
ATOM 3589  H H    . LEU A 1 75  ? -15.504 3.266   -1.826  1.00 0.00 ? 75  LEU A H    2  
ATOM 3590  H HA   . LEU A 1 75  ? -15.948 5.679   -0.129  1.00 0.00 ? 75  LEU A HA   2  
ATOM 3591  H HB2  . LEU A 1 75  ? -13.242 5.062   0.235   1.00 0.00 ? 75  LEU A HB2  2  
ATOM 3592  H HB3  . LEU A 1 75  ? -14.511 4.929   1.435   1.00 0.00 ? 75  LEU A HB3  2  
ATOM 3593  H HG   . LEU A 1 75  ? -14.858 2.593   0.069   1.00 0.00 ? 75  LEU A HG   2  
ATOM 3594  H HD11 . LEU A 1 75  ? -12.619 3.441   -1.106  1.00 0.00 ? 75  LEU A HD11 2  
ATOM 3595  H HD12 . LEU A 1 75  ? -12.857 1.732   -0.727  1.00 0.00 ? 75  LEU A HD12 2  
ATOM 3596  H HD13 . LEU A 1 75  ? -11.884 2.745   0.339   1.00 0.00 ? 75  LEU A HD13 2  
ATOM 3597  H HD21 . LEU A 1 75  ? -13.994 1.552   1.999   1.00 0.00 ? 75  LEU A HD21 2  
ATOM 3598  H HD22 . LEU A 1 75  ? -14.467 3.141   2.583   1.00 0.00 ? 75  LEU A HD22 2  
ATOM 3599  H HD23 . LEU A 1 75  ? -12.777 2.803   2.236   1.00 0.00 ? 75  LEU A HD23 2  
ATOM 3600  N N    . THR A 1 76  ? -13.802 6.839   -1.282  1.00 0.00 ? 76  THR A N    2  
ATOM 3601  C CA   . THR A 1 76  ? -13.048 7.669   -2.261  1.00 0.00 ? 76  THR A CA   2  
ATOM 3602  C C    . THR A 1 76  ? -11.584 7.717   -1.840  1.00 0.00 ? 76  THR A C    2  
ATOM 3603  O O    . THR A 1 76  ? -11.251 8.251   -0.804  1.00 0.00 ? 76  THR A O    2  
ATOM 3604  C CB   . THR A 1 76  ? -13.627 9.086   -2.267  1.00 0.00 ? 76  THR A CB   2  
ATOM 3605  O OG1  . THR A 1 76  ? -14.922 9.064   -2.849  1.00 0.00 ? 76  THR A OG1  2  
ATOM 3606  C CG2  . THR A 1 76  ? -12.715 10.017  -3.066  1.00 0.00 ? 76  THR A CG2  2  
ATOM 3607  H H    . THR A 1 76  ? -13.768 7.061   -0.329  1.00 0.00 ? 76  THR A H    2  
ATOM 3608  H HA   . THR A 1 76  ? -13.130 7.238   -3.247  1.00 0.00 ? 76  THR A HA   2  
ATOM 3609  H HB   . THR A 1 76  ? -13.697 9.446   -1.251  1.00 0.00 ? 76  THR A HB   2  
ATOM 3610  H HG1  . THR A 1 76  ? -14.974 9.779   -3.486  1.00 0.00 ? 76  THR A HG1  2  
ATOM 3611  H HG21 . THR A 1 76  ? -13.313 10.623  -3.732  1.00 0.00 ? 76  THR A HG21 2  
ATOM 3612  H HG22 . THR A 1 76  ? -12.014 9.432   -3.642  1.00 0.00 ? 76  THR A HG22 2  
ATOM 3613  H HG23 . THR A 1 76  ? -12.175 10.659  -2.384  1.00 0.00 ? 76  THR A HG23 2  
ATOM 3614  N N    . ILE A 1 77  ? -10.705 7.171   -2.632  1.00 0.00 ? 77  ILE A N    2  
ATOM 3615  C CA   . ILE A 1 77  ? -9.264  7.193   -2.261  1.00 0.00 ? 77  ILE A CA   2  
ATOM 3616  C C    . ILE A 1 77  ? -8.674  8.543   -2.668  1.00 0.00 ? 77  ILE A C    2  
ATOM 3617  O O    . ILE A 1 77  ? -8.816  8.976   -3.795  1.00 0.00 ? 77  ILE A O    2  
ATOM 3618  C CB   . ILE A 1 77  ? -8.527  6.068   -2.997  1.00 0.00 ? 77  ILE A CB   2  
ATOM 3619  C CG1  . ILE A 1 77  ? -9.368  4.784   -2.965  1.00 0.00 ? 77  ILE A CG1  2  
ATOM 3620  C CG2  . ILE A 1 77  ? -7.178  5.814   -2.319  1.00 0.00 ? 77  ILE A CG2  2  
ATOM 3621  C CD1  . ILE A 1 77  ? -9.460  4.243   -1.536  1.00 0.00 ? 77  ILE A CD1  2  
ATOM 3622  H H    . ILE A 1 77  ? -10.993 6.748   -3.468  1.00 0.00 ? 77  ILE A H    2  
ATOM 3623  H HA   . ILE A 1 77  ? -9.162  7.062   -1.194  1.00 0.00 ? 77  ILE A HA   2  
ATOM 3624  H HB   . ILE A 1 77  ? -8.361  6.364   -4.024  1.00 0.00 ? 77  ILE A HB   2  
ATOM 3625  H HG12 . ILE A 1 77  ? -10.362 4.997   -3.330  1.00 0.00 ? 77  ILE A HG12 2  
ATOM 3626  H HG13 . ILE A 1 77  ? -8.907  4.040   -3.598  1.00 0.00 ? 77  ILE A HG13 2  
ATOM 3627  H HG21 . ILE A 1 77  ? -6.585  5.156   -2.937  1.00 0.00 ? 77  ILE A HG21 2  
ATOM 3628  H HG22 . ILE A 1 77  ? -7.338  5.353   -1.355  1.00 0.00 ? 77  ILE A HG22 2  
ATOM 3629  H HG23 . ILE A 1 77  ? -6.658  6.751   -2.189  1.00 0.00 ? 77  ILE A HG23 2  
ATOM 3630  H HD11 . ILE A 1 77  ? -8.958  3.288   -1.483  1.00 0.00 ? 77  ILE A HD11 2  
ATOM 3631  H HD12 . ILE A 1 77  ? -10.498 4.122   -1.261  1.00 0.00 ? 77  ILE A HD12 2  
ATOM 3632  H HD13 . ILE A 1 77  ? -8.989  4.934   -0.856  1.00 0.00 ? 77  ILE A HD13 2  
ATOM 3633  N N    . ILE A 1 78  ? -8.024  9.224   -1.764  1.00 0.00 ? 78  ILE A N    2  
ATOM 3634  C CA   . ILE A 1 78  ? -7.445  10.550  -2.113  1.00 0.00 ? 78  ILE A CA   2  
ATOM 3635  C C    . ILE A 1 78  ? -6.057  10.364  -2.722  1.00 0.00 ? 78  ILE A C    2  
ATOM 3636  O O    . ILE A 1 78  ? -5.275  9.539   -2.290  1.00 0.00 ? 78  ILE A O    2  
ATOM 3637  C CB   . ILE A 1 78  ? -7.366  11.428  -0.863  1.00 0.00 ? 78  ILE A CB   2  
ATOM 3638  C CG1  . ILE A 1 78  ? -8.396  12.552  -0.986  1.00 0.00 ? 78  ILE A CG1  2  
ATOM 3639  C CG2  . ILE A 1 78  ? -5.965  12.034  -0.724  1.00 0.00 ? 78  ILE A CG2  2  
ATOM 3640  C CD1  . ILE A 1 78  ? -9.803  11.952  -1.035  1.00 0.00 ? 78  ILE A CD1  2  
ATOM 3641  H H    . ILE A 1 78  ? -7.926  8.866   -0.856  1.00 0.00 ? 78  ILE A H    2  
ATOM 3642  H HA   . ILE A 1 78  ? -8.082  11.030  -2.840  1.00 0.00 ? 78  ILE A HA   2  
ATOM 3643  H HB   . ILE A 1 78  ? -7.589  10.834  0.006   1.00 0.00 ? 78  ILE A HB   2  
ATOM 3644  H HG12 . ILE A 1 78  ? -8.310  13.211  -0.139  1.00 0.00 ? 78  ILE A HG12 2  
ATOM 3645  H HG13 . ILE A 1 78  ? -8.214  13.108  -1.889  1.00 0.00 ? 78  ILE A HG13 2  
ATOM 3646  H HG21 . ILE A 1 78  ? -5.246  11.247  -0.547  1.00 0.00 ? 78  ILE A HG21 2  
ATOM 3647  H HG22 . ILE A 1 78  ? -5.955  12.723  0.107   1.00 0.00 ? 78  ILE A HG22 2  
ATOM 3648  H HG23 . ILE A 1 78  ? -5.708  12.564  -1.630  1.00 0.00 ? 78  ILE A HG23 2  
ATOM 3649  H HD11 . ILE A 1 78  ? -10.093 11.798  -2.063  1.00 0.00 ? 78  ILE A HD11 2  
ATOM 3650  H HD12 . ILE A 1 78  ? -10.501 12.630  -0.565  1.00 0.00 ? 78  ILE A HD12 2  
ATOM 3651  H HD13 . ILE A 1 78  ? -9.811  11.008  -0.513  1.00 0.00 ? 78  ILE A HD13 2  
ATOM 3652  N N    . GLU A 1 79  ? -5.761  11.120  -3.739  1.00 0.00 ? 79  GLU A N    2  
ATOM 3653  C CA   . GLU A 1 79  ? -4.439  10.998  -4.415  1.00 0.00 ? 79  GLU A CA   2  
ATOM 3654  C C    . GLU A 1 79  ? -3.501  12.115  -3.950  1.00 0.00 ? 79  GLU A C    2  
ATOM 3655  O O    . GLU A 1 79  ? -3.930  13.193  -3.591  1.00 0.00 ? 79  GLU A O    2  
ATOM 3656  C CB   . GLU A 1 79  ? -4.645  11.101  -5.924  1.00 0.00 ? 79  GLU A CB   2  
ATOM 3657  C CG   . GLU A 1 79  ? -5.593  9.990   -6.379  1.00 0.00 ? 79  GLU A CG   2  
ATOM 3658  C CD   . GLU A 1 79  ? -5.794  10.071  -7.894  1.00 0.00 ? 79  GLU A CD   2  
ATOM 3659  O OE1  . GLU A 1 79  ? -5.348  11.045  -8.478  1.00 0.00 ? 79  GLU A OE1  2  
ATOM 3660  O OE2  . GLU A 1 79  ? -6.394  9.160   -8.441  1.00 0.00 ? 79  GLU A OE2  2  
ATOM 3661  H H    . GLU A 1 79  ? -6.420  11.770  -4.065  1.00 0.00 ? 79  GLU A H    2  
ATOM 3662  H HA   . GLU A 1 79  ? -4.001  10.041  -4.178  1.00 0.00 ? 79  GLU A HA   2  
ATOM 3663  H HB2  . GLU A 1 79  ? -5.073  12.063  -6.161  1.00 0.00 ? 79  GLU A HB2  2  
ATOM 3664  H HB3  . GLU A 1 79  ? -3.697  10.993  -6.428  1.00 0.00 ? 79  GLU A HB3  2  
ATOM 3665  H HG2  . GLU A 1 79  ? -5.168  9.030   -6.124  1.00 0.00 ? 79  GLU A HG2  2  
ATOM 3666  H HG3  . GLU A 1 79  ? -6.546  10.103  -5.883  1.00 0.00 ? 79  GLU A HG3  2  
ATOM 3667  H HE2  . GLU A 1 79  ? -6.483  9.278   -9.390  1.00 0.00 ? 79  GLU A HE2  2  
ATOM 3668  N N    . GLY A 1 80  ? -2.221  11.864  -3.966  1.00 0.00 ? 80  GLY A N    2  
ATOM 3669  C CA   . GLY A 1 80  ? -1.246  12.906  -3.536  1.00 0.00 ? 80  GLY A CA   2  
ATOM 3670  C C    . GLY A 1 80  ? -0.712  12.576  -2.142  1.00 0.00 ? 80  GLY A C    2  
ATOM 3671  O O    . GLY A 1 80  ? 0.350   13.020  -1.756  1.00 0.00 ? 80  GLY A O    2  
ATOM 3672  H H    . GLY A 1 80  ? -1.899  10.989  -4.267  1.00 0.00 ? 80  GLY A H    2  
ATOM 3673  H HA2  . GLY A 1 80  ? -0.425  12.938  -4.238  1.00 0.00 ? 80  GLY A HA2  2  
ATOM 3674  H HA3  . GLY A 1 80  ? -1.735  13.867  -3.511  1.00 0.00 ? 80  GLY A HA3  2  
ATOM 3675  N N    . PHE A 1 81  ? -1.435  11.797  -1.384  1.00 0.00 ? 81  PHE A N    2  
ATOM 3676  C CA   . PHE A 1 81  ? -0.956  11.442  -0.017  1.00 0.00 ? 81  PHE A CA   2  
ATOM 3677  C C    . PHE A 1 81  ? -0.599  9.960   0.055   1.00 0.00 ? 81  PHE A C    2  
ATOM 3678  O O    . PHE A 1 81  ? -1.408  9.104   -0.248  1.00 0.00 ? 81  PHE A O    2  
ATOM 3679  C CB   . PHE A 1 81  ? -2.050  11.723  1.008   1.00 0.00 ? 81  PHE A CB   2  
ATOM 3680  C CG   . PHE A 1 81  ? -1.613  11.162  2.339   1.00 0.00 ? 81  PHE A CG   2  
ATOM 3681  C CD1  . PHE A 1 81  ? -1.786  9.800   2.611   1.00 0.00 ? 81  PHE A CD1  2  
ATOM 3682  C CD2  . PHE A 1 81  ? -1.017  11.995  3.290   1.00 0.00 ? 81  PHE A CD2  2  
ATOM 3683  C CE1  . PHE A 1 81  ? -1.367  9.271   3.837   1.00 0.00 ? 81  PHE A CE1  2  
ATOM 3684  C CE2  . PHE A 1 81  ? -0.596  11.465  4.515   1.00 0.00 ? 81  PHE A CE2  2  
ATOM 3685  C CZ   . PHE A 1 81  ? -0.772  10.105  4.789   1.00 0.00 ? 81  PHE A CZ   2  
ATOM 3686  H H    . PHE A 1 81  ? -2.290  11.444  -1.713  1.00 0.00 ? 81  PHE A H    2  
ATOM 3687  H HA   . PHE A 1 81  ? -0.085  12.033  0.223   1.00 0.00 ? 81  PHE A HA   2  
ATOM 3688  H HB2  . PHE A 1 81  ? -2.204  12.787  1.093   1.00 0.00 ? 81  PHE A HB2  2  
ATOM 3689  H HB3  . PHE A 1 81  ? -2.968  11.246  0.700   1.00 0.00 ? 81  PHE A HB3  2  
ATOM 3690  H HD1  . PHE A 1 81  ? -2.246  9.156   1.876   1.00 0.00 ? 81  PHE A HD1  2  
ATOM 3691  H HD2  . PHE A 1 81  ? -0.881  13.045  3.081   1.00 0.00 ? 81  PHE A HD2  2  
ATOM 3692  H HE1  . PHE A 1 81  ? -1.504  8.220   4.047   1.00 0.00 ? 81  PHE A HE1  2  
ATOM 3693  H HE2  . PHE A 1 81  ? -0.138  12.106  5.248   1.00 0.00 ? 81  PHE A HE2  2  
ATOM 3694  H HZ   . PHE A 1 81  ? -0.448  9.698   5.736   1.00 0.00 ? 81  PHE A HZ   2  
ATOM 3695  N N    . LYS A 1 82  ? 0.591   9.643   0.483   1.00 0.00 ? 82  LYS A N    2  
ATOM 3696  C CA   . LYS A 1 82  ? 0.965   8.208   0.603   1.00 0.00 ? 82  LYS A CA   2  
ATOM 3697  C C    . LYS A 1 82  ? 2.130   8.051   1.579   1.00 0.00 ? 82  LYS A C    2  
ATOM 3698  O O    . LYS A 1 82  ? 3.193   8.614   1.396   1.00 0.00 ? 82  LYS A O    2  
ATOM 3699  C CB   . LYS A 1 82  ? 1.373   7.647   -0.754  1.00 0.00 ? 82  LYS A CB   2  
ATOM 3700  C CG   . LYS A 1 82  ? 0.679   6.299   -0.977  1.00 0.00 ? 82  LYS A CG   2  
ATOM 3701  C CD   . LYS A 1 82  ? 1.682   5.281   -1.518  1.00 0.00 ? 82  LYS A CD   2  
ATOM 3702  C CE   . LYS A 1 82  ? 2.436   5.861   -2.714  1.00 0.00 ? 82  LYS A CE   2  
ATOM 3703  N NZ   . LYS A 1 82  ? 1.642   6.962   -3.328  1.00 0.00 ? 82  LYS A NZ   2  
ATOM 3704  H H    . LYS A 1 82  ? 1.223   10.342  0.747   1.00 0.00 ? 82  LYS A H    2  
ATOM 3705  H HA   . LYS A 1 82  ? 0.116   7.659   0.980   1.00 0.00 ? 82  LYS A HA   2  
ATOM 3706  H HB2  . LYS A 1 82  ? 1.085   8.339   -1.531  1.00 0.00 ? 82  LYS A HB2  2  
ATOM 3707  H HB3  . LYS A 1 82  ? 2.440   7.505   -0.769  1.00 0.00 ? 82  LYS A HB3  2  
ATOM 3708  H HG2  . LYS A 1 82  ? 0.279   5.936   -0.043  1.00 0.00 ? 82  LYS A HG2  2  
ATOM 3709  H HG3  . LYS A 1 82  ? -0.126  6.419   -1.683  1.00 0.00 ? 82  LYS A HG3  2  
ATOM 3710  H HD2  . LYS A 1 82  ? 2.389   5.025   -0.743  1.00 0.00 ? 82  LYS A HD2  2  
ATOM 3711  H HD3  . LYS A 1 82  ? 1.155   4.394   -1.831  1.00 0.00 ? 82  LYS A HD3  2  
ATOM 3712  H HE2  . LYS A 1 82  ? 3.388   6.243   -2.382  1.00 0.00 ? 82  LYS A HE2  2  
ATOM 3713  H HE3  . LYS A 1 82  ? 2.597   5.083   -3.443  1.00 0.00 ? 82  LYS A HE3  2  
ATOM 3714  H HZ1  . LYS A 1 82  ? 1.958   7.874   -2.942  1.00 0.00 ? 82  LYS A HZ1  2  
ATOM 3715  H HZ2  . LYS A 1 82  ? 0.633   6.822   -3.116  1.00 0.00 ? 82  LYS A HZ2  2  
ATOM 3716  H HZ3  . LYS A 1 82  ? 1.783   6.958   -4.358  1.00 0.00 ? 82  LYS A HZ3  2  
ATOM 3717  N N    . ARG A 1 83  ? 1.939   7.273   2.600   1.00 0.00 ? 83  ARG A N    2  
ATOM 3718  C CA   . ARG A 1 83  ? 3.021   7.040   3.592   1.00 0.00 ? 83  ARG A CA   2  
ATOM 3719  C C    . ARG A 1 83  ? 2.904   5.602   4.090   1.00 0.00 ? 83  ARG A C    2  
ATOM 3720  O O    . ARG A 1 83  ? 1.819   5.132   4.370   1.00 0.00 ? 83  ARG A O    2  
ATOM 3721  C CB   . ARG A 1 83  ? 2.857   8.006   4.771   1.00 0.00 ? 83  ARG A CB   2  
ATOM 3722  C CG   . ARG A 1 83  ? 4.059   7.891   5.712   1.00 0.00 ? 83  ARG A CG   2  
ATOM 3723  C CD   . ARG A 1 83  ? 5.232   8.701   5.152   1.00 0.00 ? 83  ARG A CD   2  
ATOM 3724  N NE   . ARG A 1 83  ? 6.420   8.529   6.034   1.00 0.00 ? 83  ARG A NE   2  
ATOM 3725  C CZ   . ARG A 1 83  ? 7.195   7.489   5.886   1.00 0.00 ? 83  ARG A CZ   2  
ATOM 3726  N NH1  . ARG A 1 83  ? 6.929   6.603   4.966   1.00 0.00 ? 83  ARG A NH1  2  
ATOM 3727  N NH2  . ARG A 1 83  ? 8.237   7.339   6.658   1.00 0.00 ? 83  ARG A NH2  2  
ATOM 3728  H H    . ARG A 1 83  ? 1.075   6.822   2.705   1.00 0.00 ? 83  ARG A H    2  
ATOM 3729  H HA   . ARG A 1 83  ? 3.983   7.186   3.124   1.00 0.00 ? 83  ARG A HA   2  
ATOM 3730  H HB2  . ARG A 1 83  ? 2.787   9.018   4.396   1.00 0.00 ? 83  ARG A HB2  2  
ATOM 3731  H HB3  . ARG A 1 83  ? 1.956   7.761   5.311   1.00 0.00 ? 83  ARG A HB3  2  
ATOM 3732  H HG2  . ARG A 1 83  ? 3.790   8.272   6.686   1.00 0.00 ? 83  ARG A HG2  2  
ATOM 3733  H HG3  . ARG A 1 83  ? 4.350   6.856   5.798   1.00 0.00 ? 83  ARG A HG3  2  
ATOM 3734  H HD2  . ARG A 1 83  ? 5.472   8.352   4.160   1.00 0.00 ? 83  ARG A HD2  2  
ATOM 3735  H HD3  . ARG A 1 83  ? 4.962   9.745   5.112   1.00 0.00 ? 83  ARG A HD3  2  
ATOM 3736  H HE   . ARG A 1 83  ? 6.620   9.197   6.723   1.00 0.00 ? 83  ARG A HE   2  
ATOM 3737  H HH11 . ARG A 1 83  ? 6.131   6.720   4.376   1.00 0.00 ? 83  ARG A HH11 2  
ATOM 3738  H HH12 . ARG A 1 83  ? 7.524   5.808   4.850   1.00 0.00 ? 83  ARG A HH12 2  
ATOM 3739  H HH21 . ARG A 1 83  ? 8.440   8.019   7.362   1.00 0.00 ? 83  ARG A HH21 2  
ATOM 3740  H HH22 . ARG A 1 83  ? 8.831   6.543   6.547   1.00 0.00 ? 83  ARG A HH22 2  
ATOM 3741  N N    . GLU A 1 84  ? 3.992   4.890   4.205   1.00 0.00 ? 84  GLU A N    2  
ATOM 3742  C CA   . GLU A 1 84  ? 3.880   3.486   4.687   1.00 0.00 ? 84  GLU A CA   2  
ATOM 3743  C C    . GLU A 1 84  ? 4.500   3.348   6.069   1.00 0.00 ? 84  GLU A C    2  
ATOM 3744  O O    . GLU A 1 84  ? 5.552   3.885   6.348   1.00 0.00 ? 84  GLU A O    2  
ATOM 3745  C CB   . GLU A 1 84  ? 4.580   2.522   3.726   1.00 0.00 ? 84  GLU A CB   2  
ATOM 3746  C CG   . GLU A 1 84  ? 6.003   2.997   3.443   1.00 0.00 ? 84  GLU A CG   2  
ATOM 3747  C CD   . GLU A 1 84  ? 5.963   4.284   2.619   1.00 0.00 ? 84  GLU A CD   2  
ATOM 3748  O OE1  . GLU A 1 84  ? 6.980   4.955   2.555   1.00 0.00 ? 84  GLU A OE1  2  
ATOM 3749  O OE2  . GLU A 1 84  ? 4.919   4.575   2.064   1.00 0.00 ? 84  GLU A OE2  2  
ATOM 3750  H H    . GLU A 1 84  ? 4.865   5.271   3.977   1.00 0.00 ? 84  GLU A H    2  
ATOM 3751  H HA   . GLU A 1 84  ? 2.841   3.225   4.743   1.00 0.00 ? 84  GLU A HA   2  
ATOM 3752  H HB2  . GLU A 1 84  ? 4.614   1.539   4.171   1.00 0.00 ? 84  GLU A HB2  2  
ATOM 3753  H HB3  . GLU A 1 84  ? 4.030   2.476   2.808   1.00 0.00 ? 84  GLU A HB3  2  
ATOM 3754  H HG2  . GLU A 1 84  ? 6.507   3.176   4.376   1.00 0.00 ? 84  GLU A HG2  2  
ATOM 3755  H HG3  . GLU A 1 84  ? 6.531   2.234   2.890   1.00 0.00 ? 84  GLU A HG3  2  
ATOM 3756  H HE2  . GLU A 1 84  ? 4.967   5.394   1.565   1.00 0.00 ? 84  GLU A HE2  2  
ATOM 3757  N N    . LEU A 1 85  ? 3.858   2.617   6.937   1.00 0.00 ? 85  LEU A N    2  
ATOM 3758  C CA   . LEU A 1 85  ? 4.423   2.429   8.293   1.00 0.00 ? 85  LEU A CA   2  
ATOM 3759  C C    . LEU A 1 85  ? 5.128   1.076   8.325   1.00 0.00 ? 85  LEU A C    2  
ATOM 3760  O O    . LEU A 1 85  ? 4.513   0.045   8.142   1.00 0.00 ? 85  LEU A O    2  
ATOM 3761  C CB   . LEU A 1 85  ? 3.296   2.445   9.331   1.00 0.00 ? 85  LEU A CB   2  
ATOM 3762  C CG   . LEU A 1 85  ? 2.328   3.596   9.032   1.00 0.00 ? 85  LEU A CG   2  
ATOM 3763  C CD1  . LEU A 1 85  ? 1.435   3.848   10.252  1.00 0.00 ? 85  LEU A CD1  2  
ATOM 3764  C CD2  . LEU A 1 85  ? 3.105   4.871   8.702   1.00 0.00 ? 85  LEU A CD2  2  
ATOM 3765  H H    . LEU A 1 85  ? 3.015   2.181   6.689   1.00 0.00 ? 85  LEU A H    2  
ATOM 3766  H HA   . LEU A 1 85  ? 5.130   3.212   8.507   1.00 0.00 ? 85  LEU A HA   2  
ATOM 3767  H HB2  . LEU A 1 85  ? 2.762   1.506   9.290   1.00 0.00 ? 85  LEU A HB2  2  
ATOM 3768  H HB3  . LEU A 1 85  ? 3.717   2.578   10.313  1.00 0.00 ? 85  LEU A HB3  2  
ATOM 3769  H HG   . LEU A 1 85  ? 1.707   3.328   8.188   1.00 0.00 ? 85  LEU A HG   2  
ATOM 3770  H HD11 . LEU A 1 85  ? 1.460   2.985   10.904  1.00 0.00 ? 85  LEU A HD11 2  
ATOM 3771  H HD12 . LEU A 1 85  ? 0.422   4.025   9.929   1.00 0.00 ? 85  LEU A HD12 2  
ATOM 3772  H HD13 . LEU A 1 85  ? 1.798   4.713   10.787  1.00 0.00 ? 85  LEU A HD13 2  
ATOM 3773  H HD21 . LEU A 1 85  ? 3.343   4.884   7.648   1.00 0.00 ? 85  LEU A HD21 2  
ATOM 3774  H HD22 . LEU A 1 85  ? 4.016   4.898   9.282   1.00 0.00 ? 85  LEU A HD22 2  
ATOM 3775  H HD23 . LEU A 1 85  ? 2.501   5.732   8.944   1.00 0.00 ? 85  LEU A HD23 2  
ATOM 3776  N N    . ASN A 1 86  ? 6.414   1.070   8.539   1.00 0.00 ? 86  ASN A N    2  
ATOM 3777  C CA   . ASN A 1 86  ? 7.150   -0.223  8.560   1.00 0.00 ? 86  ASN A CA   2  
ATOM 3778  C C    . ASN A 1 86  ? 7.760   -0.443  9.943   1.00 0.00 ? 86  ASN A C    2  
ATOM 3779  O O    . ASN A 1 86  ? 8.586   0.323   10.401  1.00 0.00 ? 86  ASN A O    2  
ATOM 3780  C CB   . ASN A 1 86  ? 8.267   -0.179  7.514   1.00 0.00 ? 86  ASN A CB   2  
ATOM 3781  C CG   . ASN A 1 86  ? 7.719   0.416   6.216   1.00 0.00 ? 86  ASN A CG   2  
ATOM 3782  O OD1  . ASN A 1 86  ? 6.549   0.724   6.123   1.00 0.00 ? 86  ASN A OD1  2  
ATOM 3783  N ND2  . ASN A 1 86  ? 8.521   0.593   5.203   1.00 0.00 ? 86  ASN A ND2  2  
ATOM 3784  H H    . ASN A 1 86  ? 6.895   1.915   8.668   1.00 0.00 ? 86  ASN A H    2  
ATOM 3785  H HA   . ASN A 1 86  ? 6.474   -1.029  8.331   1.00 0.00 ? 86  ASN A HA   2  
ATOM 3786  H HB2  . ASN A 1 86  ? 9.079   0.434   7.879   1.00 0.00 ? 86  ASN A HB2  2  
ATOM 3787  H HB3  . ASN A 1 86  ? 8.626   -1.180  7.328   1.00 0.00 ? 86  ASN A HB3  2  
ATOM 3788  H HD21 . ASN A 1 86  ? 9.467   0.346   5.276   1.00 0.00 ? 86  ASN A HD21 2  
ATOM 3789  H HD22 . ASN A 1 86  ? 8.178   0.973   4.367   1.00 0.00 ? 86  ASN A HD22 2  
ATOM 3790  N N    . TYR A 1 87  ? 7.368   -1.492  10.611  1.00 0.00 ? 87  TYR A N    2  
ATOM 3791  C CA   . TYR A 1 87  ? 7.933   -1.769  11.955  1.00 0.00 ? 87  TYR A CA   2  
ATOM 3792  C C    . TYR A 1 87  ? 7.902   -3.270  12.214  1.00 0.00 ? 87  TYR A C    2  
ATOM 3793  O O    . TYR A 1 87  ? 7.080   -3.987  11.676  1.00 0.00 ? 87  TYR A O    2  
ATOM 3794  C CB   . TYR A 1 87  ? 7.113   -1.041  13.021  1.00 0.00 ? 87  TYR A CB   2  
ATOM 3795  C CG   . TYR A 1 87  ? 5.640   -1.267  12.774  1.00 0.00 ? 87  TYR A CG   2  
ATOM 3796  C CD1  . TYR A 1 87  ? 5.035   -2.453  13.202  1.00 0.00 ? 87  TYR A CD1  2  
ATOM 3797  C CD2  . TYR A 1 87  ? 4.879   -0.290  12.117  1.00 0.00 ? 87  TYR A CD2  2  
ATOM 3798  C CE1  . TYR A 1 87  ? 3.671   -2.665  12.977  1.00 0.00 ? 87  TYR A CE1  2  
ATOM 3799  C CE2  . TYR A 1 87  ? 3.513   -0.502  11.891  1.00 0.00 ? 87  TYR A CE2  2  
ATOM 3800  C CZ   . TYR A 1 87  ? 2.908   -1.689  12.322  1.00 0.00 ? 87  TYR A CZ   2  
ATOM 3801  O OH   . TYR A 1 87  ? 1.562   -1.900  12.100  1.00 0.00 ? 87  TYR A OH   2  
ATOM 3802  H H    . TYR A 1 87  ? 6.706   -2.104  10.223  1.00 0.00 ? 87  TYR A H    2  
ATOM 3803  H HA   . TYR A 1 87  ? 8.955   -1.421  11.992  1.00 0.00 ? 87  TYR A HA   2  
ATOM 3804  H HB2  . TYR A 1 87  ? 7.374   -1.426  13.997  1.00 0.00 ? 87  TYR A HB2  2  
ATOM 3805  H HB3  . TYR A 1 87  ? 7.329   0.013   12.983  1.00 0.00 ? 87  TYR A HB3  2  
ATOM 3806  H HD1  . TYR A 1 87  ? 5.624   -3.206  13.707  1.00 0.00 ? 87  TYR A HD1  2  
ATOM 3807  H HD2  . TYR A 1 87  ? 5.344   0.627   11.786  1.00 0.00 ? 87  TYR A HD2  2  
ATOM 3808  H HE1  . TYR A 1 87  ? 3.205   -3.580  13.309  1.00 0.00 ? 87  TYR A HE1  2  
ATOM 3809  H HE2  . TYR A 1 87  ? 2.925   0.250   11.386  1.00 0.00 ? 87  TYR A HE2  2  
ATOM 3810  H HH   . TYR A 1 87  ? 1.259   -1.243  11.469  1.00 0.00 ? 87  TYR A HH   2  
ATOM 3811  N N    . VAL A 1 88  ? 8.790   -3.750  13.032  1.00 0.00 ? 88  VAL A N    2  
ATOM 3812  C CA   . VAL A 1 88  ? 8.816   -5.207  13.330  1.00 0.00 ? 88  VAL A CA   2  
ATOM 3813  C C    . VAL A 1 88  ? 8.342   -5.438  14.767  1.00 0.00 ? 88  VAL A C    2  
ATOM 3814  O O    . VAL A 1 88  ? 9.050   -5.172  15.718  1.00 0.00 ? 88  VAL A O    2  
ATOM 3815  C CB   . VAL A 1 88  ? 10.242  -5.737  13.155  1.00 0.00 ? 88  VAL A CB   2  
ATOM 3816  C CG1  . VAL A 1 88  ? 11.184  -5.004  14.108  1.00 0.00 ? 88  VAL A CG1  2  
ATOM 3817  C CG2  . VAL A 1 88  ? 10.278  -7.232  13.465  1.00 0.00 ? 88  VAL A CG2  2  
ATOM 3818  H H    . VAL A 1 88  ? 9.440   -3.146  13.454  1.00 0.00 ? 88  VAL A H    2  
ATOM 3819  H HA   . VAL A 1 88  ? 8.154   -5.724  12.650  1.00 0.00 ? 88  VAL A HA   2  
ATOM 3820  H HB   . VAL A 1 88  ? 10.562  -5.572  12.137  1.00 0.00 ? 88  VAL A HB   2  
ATOM 3821  H HG11 . VAL A 1 88  ? 11.306  -5.585  15.008  1.00 0.00 ? 88  VAL A HG11 2  
ATOM 3822  H HG12 . VAL A 1 88  ? 10.770  -4.038  14.352  1.00 0.00 ? 88  VAL A HG12 2  
ATOM 3823  H HG13 . VAL A 1 88  ? 12.144  -4.874  13.630  1.00 0.00 ? 88  VAL A HG13 2  
ATOM 3824  H HG21 . VAL A 1 88  ? 11.119  -7.445  14.108  1.00 0.00 ? 88  VAL A HG21 2  
ATOM 3825  H HG22 . VAL A 1 88  ? 10.376  -7.787  12.545  1.00 0.00 ? 88  VAL A HG22 2  
ATOM 3826  H HG23 . VAL A 1 88  ? 9.363   -7.520  13.963  1.00 0.00 ? 88  VAL A HG23 2  
ATOM 3827  N N    . ALA A 1 89  ? 7.148   -5.937  14.927  1.00 0.00 ? 89  ALA A N    2  
ATOM 3828  C CA   . ALA A 1 89  ? 6.623   -6.190  16.300  1.00 0.00 ? 89  ALA A CA   2  
ATOM 3829  C C    . ALA A 1 89  ? 6.707   -7.687  16.608  1.00 0.00 ? 89  ALA A C    2  
ATOM 3830  O O    . ALA A 1 89  ? 7.509   -8.125  17.410  1.00 0.00 ? 89  ALA A O    2  
ATOM 3831  C CB   . ALA A 1 89  ? 5.165   -5.735  16.378  1.00 0.00 ? 89  ALA A CB   2  
ATOM 3832  H H    . ALA A 1 89  ? 6.596   -6.142  14.143  1.00 0.00 ? 89  ALA A H    2  
ATOM 3833  H HA   . ALA A 1 89  ? 7.211   -5.641  17.018  1.00 0.00 ? 89  ALA A HA   2  
ATOM 3834  H HB1  . ALA A 1 89  ? 4.890   -5.583  17.412  1.00 0.00 ? 89  ALA A HB1  2  
ATOM 3835  H HB2  . ALA A 1 89  ? 4.527   -6.493  15.944  1.00 0.00 ? 89  ALA A HB2  2  
ATOM 3836  H HB3  . ALA A 1 89  ? 5.046   -4.810  15.833  1.00 0.00 ? 89  ALA A HB3  2  
ATOM 3837  N N    . ARG A 1 90  ? 5.884   -8.472  15.972  1.00 0.00 ? 90  ARG A N    2  
ATOM 3838  C CA   . ARG A 1 90  ? 5.903   -9.942  16.213  1.00 0.00 ? 90  ARG A CA   2  
ATOM 3839  C C    . ARG A 1 90  ? 7.267   -10.513 15.816  1.00 0.00 ? 90  ARG A C    2  
ATOM 3840  O O    . ARG A 1 90  ? 7.456   -11.711 15.774  1.00 0.00 ? 90  ARG A O    2  
ATOM 3841  C CB   . ARG A 1 90  ? 4.806   -10.606 15.379  1.00 0.00 ? 90  ARG A CB   2  
ATOM 3842  C CG   . ARG A 1 90  ? 5.112   -10.420 13.891  1.00 0.00 ? 90  ARG A CG   2  
ATOM 3843  C CD   . ARG A 1 90  ? 3.883   -10.803 13.062  1.00 0.00 ? 90  ARG A CD   2  
ATOM 3844  N NE   . ARG A 1 90  ? 2.855   -9.731  13.172  1.00 0.00 ? 90  ARG A NE   2  
ATOM 3845  C CZ   . ARG A 1 90  ? 1.880   -9.835  14.037  1.00 0.00 ? 90  ARG A CZ   2  
ATOM 3846  N NH1  . ARG A 1 90  ? 1.800   -10.881 14.815  1.00 0.00 ? 90  ARG A NH1  2  
ATOM 3847  N NH2  . ARG A 1 90  ? 0.982   -8.891  14.121  1.00 0.00 ? 90  ARG A NH2  2  
ATOM 3848  H H    . ARG A 1 90  ? 5.252   -8.092  15.330  1.00 0.00 ? 90  ARG A H    2  
ATOM 3849  H HA   . ARG A 1 90  ? 5.725   -10.136 17.260  1.00 0.00 ? 90  ARG A HA   2  
ATOM 3850  H HB2  . ARG A 1 90  ? 4.766   -11.661 15.611  1.00 0.00 ? 90  ARG A HB2  2  
ATOM 3851  H HB3  . ARG A 1 90  ? 3.856   -10.150 15.609  1.00 0.00 ? 90  ARG A HB3  2  
ATOM 3852  H HG2  . ARG A 1 90  ? 5.365   -9.387  13.705  1.00 0.00 ? 90  ARG A HG2  2  
ATOM 3853  H HG3  . ARG A 1 90  ? 5.942   -11.051 13.613  1.00 0.00 ? 90  ARG A HG3  2  
ATOM 3854  H HD2  . ARG A 1 90  ? 4.173   -10.921 12.028  1.00 0.00 ? 90  ARG A HD2  2  
ATOM 3855  H HD3  . ARG A 1 90  ? 3.476   -11.733 13.429  1.00 0.00 ? 90  ARG A HD3  2  
ATOM 3856  H HE   . ARG A 1 90  ? 2.908   -8.943  12.591  1.00 0.00 ? 90  ARG A HE   2  
ATOM 3857  H HH11 . ARG A 1 90  ? 2.486   -11.605 14.753  1.00 0.00 ? 90  ARG A HH11 2  
ATOM 3858  H HH12 . ARG A 1 90  ? 1.054   -10.956 15.475  1.00 0.00 ? 90  ARG A HH12 2  
ATOM 3859  H HH21 . ARG A 1 90  ? 1.042   -8.090  13.526  1.00 0.00 ? 90  ARG A HH21 2  
ATOM 3860  H HH22 . ARG A 1 90  ? 0.235   -8.971  14.782  1.00 0.00 ? 90  ARG A HH22 2  
ATOM 3861  N N    . ASN A 1 91  ? 8.208   -9.655  15.508  1.00 0.00 ? 91  ASN A N    2  
ATOM 3862  C CA   . ASN A 1 91  ? 9.571   -10.112 15.091  1.00 0.00 ? 91  ASN A CA   2  
ATOM 3863  C C    . ASN A 1 91  ? 9.618   -10.184 13.566  1.00 0.00 ? 91  ASN A C    2  
ATOM 3864  O O    . ASN A 1 91  ? 10.390  -10.918 12.985  1.00 0.00 ? 91  ASN A O    2  
ATOM 3865  C CB   . ASN A 1 91  ? 9.881   -11.492 15.681  1.00 0.00 ? 91  ASN A CB   2  
ATOM 3866  C CG   . ASN A 1 91  ? 11.398  -11.692 15.736  1.00 0.00 ? 91  ASN A CG   2  
ATOM 3867  O OD1  . ASN A 1 91  ? 12.150  -10.836 15.317  1.00 0.00 ? 91  ASN A OD1  2  
ATOM 3868  N ND2  . ASN A 1 91  ? 11.881  -12.795 16.242  1.00 0.00 ? 91  ASN A ND2  2  
ATOM 3869  H H    . ASN A 1 91  ? 8.015   -8.696  15.541  1.00 0.00 ? 91  ASN A H    2  
ATOM 3870  H HA   . ASN A 1 91  ? 10.306  -9.399  15.437  1.00 0.00 ? 91  ASN A HA   2  
ATOM 3871  H HB2  . ASN A 1 91  ? 9.473   -11.560 16.680  1.00 0.00 ? 91  ASN A HB2  2  
ATOM 3872  H HB3  . ASN A 1 91  ? 9.445   -12.258 15.059  1.00 0.00 ? 91  ASN A HB3  2  
ATOM 3873  H HD21 . ASN A 1 91  ? 11.274  -13.485 16.585  1.00 0.00 ? 91  ASN A HD21 2  
ATOM 3874  H HD22 . ASN A 1 91  ? 12.850  -12.932 16.281  1.00 0.00 ? 91  ASN A HD22 2  
ATOM 3875  N N    . LYS A 1 92  ? 8.795   -9.406  12.920  1.00 0.00 ? 92  LYS A N    2  
ATOM 3876  C CA   . LYS A 1 92  ? 8.771   -9.388  11.433  1.00 0.00 ? 92  LYS A CA   2  
ATOM 3877  C C    . LYS A 1 92  ? 8.375   -7.978  10.974  1.00 0.00 ? 92  LYS A C    2  
ATOM 3878  O O    . LYS A 1 92  ? 7.347   -7.464  11.367  1.00 0.00 ? 92  LYS A O    2  
ATOM 3879  C CB   . LYS A 1 92  ? 7.733   -10.394 10.930  1.00 0.00 ? 92  LYS A CB   2  
ATOM 3880  C CG   . LYS A 1 92  ? 8.346   -11.272 9.834   1.00 0.00 ? 92  LYS A CG   2  
ATOM 3881  C CD   . LYS A 1 92  ? 9.256   -12.331 10.469  1.00 0.00 ? 92  LYS A CD   2  
ATOM 3882  C CE   . LYS A 1 92  ? 9.594   -13.409 9.434   1.00 0.00 ? 92  LYS A CE   2  
ATOM 3883  N NZ   . LYS A 1 92  ? 11.070  -13.465 9.238   1.00 0.00 ? 92  LYS A NZ   2  
ATOM 3884  H H    . LYS A 1 92  ? 8.193   -8.817  13.421  1.00 0.00 ? 92  LYS A H    2  
ATOM 3885  H HA   . LYS A 1 92  ? 9.747   -9.644  11.048  1.00 0.00 ? 92  LYS A HA   2  
ATOM 3886  H HB2  . LYS A 1 92  ? 7.410   -11.017 11.751  1.00 0.00 ? 92  LYS A HB2  2  
ATOM 3887  H HB3  . LYS A 1 92  ? 6.887   -9.861  10.528  1.00 0.00 ? 92  LYS A HB3  2  
ATOM 3888  H HG2  . LYS A 1 92  ? 7.555   -11.762 9.283   1.00 0.00 ? 92  LYS A HG2  2  
ATOM 3889  H HG3  . LYS A 1 92  ? 8.926   -10.658 9.162   1.00 0.00 ? 92  LYS A HG3  2  
ATOM 3890  H HD2  . LYS A 1 92  ? 10.167  -11.863 10.811  1.00 0.00 ? 92  LYS A HD2  2  
ATOM 3891  H HD3  . LYS A 1 92  ? 8.749   -12.786 11.305  1.00 0.00 ? 92  LYS A HD3  2  
ATOM 3892  H HE2  . LYS A 1 92  ? 9.241   -14.367 9.786   1.00 0.00 ? 92  LYS A HE2  2  
ATOM 3893  H HE3  . LYS A 1 92  ? 9.115   -13.172 8.496   1.00 0.00 ? 92  LYS A HE3  2  
ATOM 3894  H HZ1  . LYS A 1 92  ? 11.284  -13.985 8.363   1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 3895  H HZ2  . LYS A 1 92  ? 11.509  -13.949 10.048  1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 3896  H HZ3  . LYS A 1 92  ? 11.448  -12.499 9.165   1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 3897  N N    . PRO A 1 93  ? 9.184   -7.350  10.163  1.00 0.00 ? 93  PRO A N    2  
ATOM 3898  C CA   . PRO A 1 93  ? 8.906   -5.975  9.666   1.00 0.00 ? 93  PRO A CA   2  
ATOM 3899  C C    . PRO A 1 93  ? 7.898   -5.982  8.536   1.00 0.00 ? 93  PRO A C    2  
ATOM 3900  O O    . PRO A 1 93  ? 8.077   -6.656  7.543   1.00 0.00 ? 93  PRO A O    2  
ATOM 3901  C CB   . PRO A 1 93  ? 10.251  -5.502  9.153   1.00 0.00 ? 93  PRO A CB   2  
ATOM 3902  C CG   . PRO A 1 93  ? 10.936  -6.749  8.708   1.00 0.00 ? 93  PRO A CG   2  
ATOM 3903  C CD   . PRO A 1 93  ? 10.442  -7.872  9.617   1.00 0.00 ? 93  PRO A CD   2  
ATOM 3904  H HA   . PRO A 1 93  ? 8.576   -5.337  10.468  1.00 0.00 ? 93  PRO A HA   2  
ATOM 3905  H HB2  . PRO A 1 93  ? 10.114  -4.819  8.324   1.00 0.00 ? 93  PRO A HB2  2  
ATOM 3906  H HB3  . PRO A 1 93  ? 10.803  -5.031  9.943   1.00 0.00 ? 93  PRO A HB3  2  
ATOM 3907  H HG2  . PRO A 1 93  ? 10.677  -6.956  7.686   1.00 0.00 ? 93  PRO A HG2  2  
ATOM 3908  H HG3  . PRO A 1 93  ? 11.993  -6.651  8.801   1.00 0.00 ? 93  PRO A HG3  2  
ATOM 3909  H HD2  . PRO A 1 93  ? 10.268  -8.772  9.046   1.00 0.00 ? 93  PRO A HD2  2  
ATOM 3910  H HD3  . PRO A 1 93  ? 11.146  -8.052  10.409  1.00 0.00 ? 93  PRO A HD3  2  
ATOM 3911  N N    . LYS A 1 94  ? 6.849   -5.241  8.673   1.00 0.00 ? 94  LYS A N    2  
ATOM 3912  C CA   . LYS A 1 94  ? 5.823   -5.218  7.602   1.00 0.00 ? 94  LYS A CA   2  
ATOM 3913  C C    . LYS A 1 94  ? 5.611   -3.792  7.106   1.00 0.00 ? 94  LYS A C    2  
ATOM 3914  O O    . LYS A 1 94  ? 5.226   -2.910  7.847   1.00 0.00 ? 94  LYS A O    2  
ATOM 3915  C CB   . LYS A 1 94  ? 4.511   -5.785  8.154   1.00 0.00 ? 94  LYS A CB   2  
ATOM 3916  C CG   . LYS A 1 94  ? 3.499   -5.938  7.020   1.00 0.00 ? 94  LYS A CG   2  
ATOM 3917  C CD   . LYS A 1 94  ? 2.646   -7.189  7.254   1.00 0.00 ? 94  LYS A CD   2  
ATOM 3918  C CE   . LYS A 1 94  ? 1.706   -6.962  8.437   1.00 0.00 ? 94  LYS A CE   2  
ATOM 3919  N NZ   . LYS A 1 94  ? 1.422   -8.264  9.107   1.00 0.00 ? 94  LYS A NZ   2  
ATOM 3920  H H    . LYS A 1 94  ? 6.738   -4.701  9.484   1.00 0.00 ? 94  LYS A H    2  
ATOM 3921  H HA   . LYS A 1 94  ? 6.154   -5.831  6.777   1.00 0.00 ? 94  LYS A HA   2  
ATOM 3922  H HB2  . LYS A 1 94  ? 4.697   -6.747  8.604   1.00 0.00 ? 94  LYS A HB2  2  
ATOM 3923  H HB3  . LYS A 1 94  ? 4.114   -5.111  8.896   1.00 0.00 ? 94  LYS A HB3  2  
ATOM 3924  H HG2  . LYS A 1 94  ? 2.861   -5.068  6.998   1.00 0.00 ? 94  LYS A HG2  2  
ATOM 3925  H HG3  . LYS A 1 94  ? 4.020   -6.027  6.079   1.00 0.00 ? 94  LYS A HG3  2  
ATOM 3926  H HD2  . LYS A 1 94  ? 2.065   -7.396  6.367   1.00 0.00 ? 94  LYS A HD2  2  
ATOM 3927  H HD3  . LYS A 1 94  ? 3.289   -8.028  7.465   1.00 0.00 ? 94  LYS A HD3  2  
ATOM 3928  H HE2  . LYS A 1 94  ? 2.171   -6.292  9.141   1.00 0.00 ? 94  LYS A HE2  2  
ATOM 3929  H HE3  . LYS A 1 94  ? 0.782   -6.531  8.084   1.00 0.00 ? 94  LYS A HE3  2  
ATOM 3930  H HZ1  . LYS A 1 94  ? 2.053   -8.996  8.725   1.00 0.00 ? 94  LYS A HZ1  2  
ATOM 3931  H HZ2  . LYS A 1 94  ? 0.433   -8.534  8.933   1.00 0.00 ? 94  LYS A HZ2  2  
ATOM 3932  H HZ3  . LYS A 1 94  ? 1.581   -8.170  10.130  1.00 0.00 ? 94  LYS A HZ3  2  
ATOM 3933  N N    . THR A 1 95  ? 5.841   -3.567  5.842   1.00 0.00 ? 95  THR A N    2  
ATOM 3934  C CA   . THR A 1 95  ? 5.638   -2.207  5.281   1.00 0.00 ? 95  THR A CA   2  
ATOM 3935  C C    . THR A 1 95  ? 4.149   -2.018  5.029   1.00 0.00 ? 95  THR A C    2  
ATOM 3936  O O    . THR A 1 95  ? 3.509   -2.842  4.405   1.00 0.00 ? 95  THR A O    2  
ATOM 3937  C CB   . THR A 1 95  ? 6.399   -2.072  3.958   1.00 0.00 ? 95  THR A CB   2  
ATOM 3938  O OG1  . THR A 1 95  ? 7.797   -2.135  4.205   1.00 0.00 ? 95  THR A OG1  2  
ATOM 3939  C CG2  . THR A 1 95  ? 6.051   -0.737  3.287   1.00 0.00 ? 95  THR A CG2  2  
ATOM 3940  H H    . THR A 1 95  ? 6.138   -4.300  5.262   1.00 0.00 ? 95  THR A H    2  
ATOM 3941  H HA   . THR A 1 95  ? 5.989   -1.465  5.983   1.00 0.00 ? 95  THR A HA   2  
ATOM 3942  H HB   . THR A 1 95  ? 6.117   -2.883  3.303   1.00 0.00 ? 95  THR A HB   2  
ATOM 3943  H HG1  . THR A 1 95  ? 7.942   -2.742  4.933   1.00 0.00 ? 95  THR A HG1  2  
ATOM 3944  H HG21 . THR A 1 95  ? 6.313   0.079   3.944   1.00 0.00 ? 95  THR A HG21 2  
ATOM 3945  H HG22 . THR A 1 95  ? 4.993   -0.701  3.076   1.00 0.00 ? 95  THR A HG22 2  
ATOM 3946  H HG23 . THR A 1 95  ? 6.601   -0.644  2.363   1.00 0.00 ? 95  THR A HG23 2  
ATOM 3947  N N    . VAL A 1 96  ? 3.585   -0.951  5.508   1.00 0.00 ? 96  VAL A N    2  
ATOM 3948  C CA   . VAL A 1 96  ? 2.134   -0.730  5.295   1.00 0.00 ? 96  VAL A CA   2  
ATOM 3949  C C    . VAL A 1 96  ? 1.925   0.597   4.574   1.00 0.00 ? 96  VAL A C    2  
ATOM 3950  O O    . VAL A 1 96  ? 2.221   1.641   5.101   1.00 0.00 ? 96  VAL A O    2  
ATOM 3951  C CB   . VAL A 1 96  ? 1.439   -0.681  6.656   1.00 0.00 ? 96  VAL A CB   2  
ATOM 3952  C CG1  . VAL A 1 96  ? -0.067  -0.509  6.459   1.00 0.00 ? 96  VAL A CG1  2  
ATOM 3953  C CG2  . VAL A 1 96  ? 1.706   -1.985  7.412   1.00 0.00 ? 96  VAL A CG2  2  
ATOM 3954  H H    . VAL A 1 96  ? 4.115   -0.299  6.013   1.00 0.00 ? 96  VAL A H    2  
ATOM 3955  H HA   . VAL A 1 96  ? 1.722   -1.536  4.706   1.00 0.00 ? 96  VAL A HA   2  
ATOM 3956  H HB   . VAL A 1 96  ? 1.828   0.154   7.225   1.00 0.00 ? 96  VAL A HB   2  
ATOM 3957  H HG11 . VAL A 1 96  ? -0.576  -0.737  7.383   1.00 0.00 ? 96  VAL A HG11 2  
ATOM 3958  H HG12 . VAL A 1 96  ? -0.407  -1.179  5.684   1.00 0.00 ? 96  VAL A HG12 2  
ATOM 3959  H HG13 . VAL A 1 96  ? -0.279  0.511   6.174   1.00 0.00 ? 96  VAL A HG13 2  
ATOM 3960  H HG21 . VAL A 1 96  ? 1.912   -1.763  8.449   1.00 0.00 ? 96  VAL A HG21 2  
ATOM 3961  H HG22 . VAL A 1 96  ? 2.558   -2.488  6.976   1.00 0.00 ? 96  VAL A HG22 2  
ATOM 3962  H HG23 . VAL A 1 96  ? 0.837   -2.624  7.346   1.00 0.00 ? 96  VAL A HG23 2  
ATOM 3963  N N    . ILE A 1 97  ? 1.391   0.562   3.386   1.00 0.00 ? 97  ILE A N    2  
ATOM 3964  C CA   . ILE A 1 97  ? 1.145   1.828   2.642   1.00 0.00 ? 97  ILE A CA   2  
ATOM 3965  C C    . ILE A 1 97  ? -0.294  2.252   2.908   1.00 0.00 ? 97  ILE A C    2  
ATOM 3966  O O    . ILE A 1 97  ? -1.208  1.459   2.816   1.00 0.00 ? 97  ILE A O    2  
ATOM 3967  C CB   . ILE A 1 97  ? 1.371   1.589   1.147   1.00 0.00 ? 97  ILE A CB   2  
ATOM 3968  C CG1  . ILE A 1 97  ? 2.785   1.019   0.944   1.00 0.00 ? 97  ILE A CG1  2  
ATOM 3969  C CG2  . ILE A 1 97  ? 1.216   2.906   0.380   1.00 0.00 ? 97  ILE A CG2  2  
ATOM 3970  C CD1  . ILE A 1 97  ? 3.748   2.115   0.469   1.00 0.00 ? 97  ILE A CD1  2  
ATOM 3971  H H    . ILE A 1 97  ? 1.141   -0.297  2.983   1.00 0.00 ? 97  ILE A H    2  
ATOM 3972  H HA   . ILE A 1 97  ? 1.816   2.594   2.993   1.00 0.00 ? 97  ILE A HA   2  
ATOM 3973  H HB   . ILE A 1 97  ? 0.643   0.878   0.786   1.00 0.00 ? 97  ILE A HB   2  
ATOM 3974  H HG12 . ILE A 1 97  ? 3.145   0.618   1.880   1.00 0.00 ? 97  ILE A HG12 2  
ATOM 3975  H HG13 . ILE A 1 97  ? 2.749   0.231   0.207   1.00 0.00 ? 97  ILE A HG13 2  
ATOM 3976  H HG21 . ILE A 1 97  ? 0.168   3.138   0.268   1.00 0.00 ? 97  ILE A HG21 2  
ATOM 3977  H HG22 . ILE A 1 97  ? 1.668   2.809   -0.597  1.00 0.00 ? 97  ILE A HG22 2  
ATOM 3978  H HG23 . ILE A 1 97  ? 1.704   3.701   0.925   1.00 0.00 ? 97  ILE A HG23 2  
ATOM 3979  H HD11 . ILE A 1 97  ? 4.757   1.851   0.753   1.00 0.00 ? 97  ILE A HD11 2  
ATOM 3980  H HD12 . ILE A 1 97  ? 3.484   3.058   0.928   1.00 0.00 ? 97  ILE A HD12 2  
ATOM 3981  H HD13 . ILE A 1 97  ? 3.688   2.206   -0.606  1.00 0.00 ? 97  ILE A HD13 2  
ATOM 3982  N N    . TYR A 1 98  ? -0.507  3.486   3.280   1.00 0.00 ? 98  TYR A N    2  
ATOM 3983  C CA   . TYR A 1 98  ? -1.894  3.922   3.593   1.00 0.00 ? 98  TYR A CA   2  
ATOM 3984  C C    . TYR A 1 98  ? -2.372  5.023   2.652   1.00 0.00 ? 98  TYR A C    2  
ATOM 3985  O O    . TYR A 1 98  ? -1.697  6.005   2.418   1.00 0.00 ? 98  TYR A O    2  
ATOM 3986  C CB   . TYR A 1 98  ? -1.943  4.474   5.017   1.00 0.00 ? 98  TYR A CB   2  
ATOM 3987  C CG   . TYR A 1 98  ? -1.949  3.348   6.026   1.00 0.00 ? 98  TYR A CG   2  
ATOM 3988  C CD1  . TYR A 1 98  ? -2.994  2.416   6.037   1.00 0.00 ? 98  TYR A CD1  2  
ATOM 3989  C CD2  . TYR A 1 98  ? -0.919  3.251   6.970   1.00 0.00 ? 98  TYR A CD2  2  
ATOM 3990  C CE1  . TYR A 1 98  ? -3.007  1.389   6.988   1.00 0.00 ? 98  TYR A CE1  2  
ATOM 3991  C CE2  . TYR A 1 98  ? -0.930  2.223   7.918   1.00 0.00 ? 98  TYR A CE2  2  
ATOM 3992  C CZ   . TYR A 1 98  ? -1.976  1.292   7.928   1.00 0.00 ? 98  TYR A CZ   2  
ATOM 3993  O OH   . TYR A 1 98  ? -1.992  0.278   8.867   1.00 0.00 ? 98  TYR A OH   2  
ATOM 3994  H H    . TYR A 1 98  ? 0.247   4.109   3.383   1.00 0.00 ? 98  TYR A H    2  
ATOM 3995  H HA   . TYR A 1 98  ? -2.561  3.077   3.523   1.00 0.00 ? 98  TYR A HA   2  
ATOM 3996  H HB2  . TYR A 1 98  ? -1.080  5.100   5.187   1.00 0.00 ? 98  TYR A HB2  2  
ATOM 3997  H HB3  . TYR A 1 98  ? -2.838  5.064   5.134   1.00 0.00 ? 98  TYR A HB3  2  
ATOM 3998  H HD1  . TYR A 1 98  ? -3.790  2.488   5.311   1.00 0.00 ? 98  TYR A HD1  2  
ATOM 3999  H HD2  . TYR A 1 98  ? -0.112  3.973   6.961   1.00 0.00 ? 98  TYR A HD2  2  
ATOM 4000  H HE1  . TYR A 1 98  ? -3.814  0.672   6.997   1.00 0.00 ? 98  TYR A HE1  2  
ATOM 4001  H HE2  . TYR A 1 98  ? -0.134  2.151   8.644   1.00 0.00 ? 98  TYR A HE2  2  
ATOM 4002  H HH   . TYR A 1 98  ? -2.464  -0.467  8.490   1.00 0.00 ? 98  TYR A HH   2  
ATOM 4003  N N    . TRP A 1 99  ? -3.572  4.880   2.166   1.00 0.00 ? 99  TRP A N    2  
ATOM 4004  C CA   . TRP A 1 99  ? -4.170  5.924   1.296   1.00 0.00 ? 99  TRP A CA   2  
ATOM 4005  C C    . TRP A 1 99  ? -5.363  6.501   2.054   1.00 0.00 ? 99  TRP A C    2  
ATOM 4006  O O    . TRP A 1 99  ? -6.085  5.780   2.709   1.00 0.00 ? 99  TRP A O    2  
ATOM 4007  C CB   . TRP A 1 99  ? -4.666  5.309   -0.016  1.00 0.00 ? 99  TRP A CB   2  
ATOM 4008  C CG   . TRP A 1 99  ? -3.519  5.036   -0.932  1.00 0.00 ? 99  TRP A CG   2  
ATOM 4009  C CD1  . TRP A 1 99  ? -3.023  5.908   -1.839  1.00 0.00 ? 99  TRP A CD1  2  
ATOM 4010  C CD2  . TRP A 1 99  ? -2.730  3.821   -1.057  1.00 0.00 ? 99  TRP A CD2  2  
ATOM 4011  N NE1  . TRP A 1 99  ? -1.979  5.304   -2.513  1.00 0.00 ? 99  TRP A NE1  2  
ATOM 4012  C CE2  . TRP A 1 99  ? -1.757  4.016   -2.065  1.00 0.00 ? 99  TRP A CE2  2  
ATOM 4013  C CE3  . TRP A 1 99  ? -2.761  2.580   -0.397  1.00 0.00 ? 99  TRP A CE3  2  
ATOM 4014  C CZ2  . TRP A 1 99  ? -0.851  3.015   -2.408  1.00 0.00 ? 99  TRP A CZ2  2  
ATOM 4015  C CZ3  . TRP A 1 99  ? -1.849  1.571   -0.740  1.00 0.00 ? 99  TRP A CZ3  2  
ATOM 4016  C CH2  . TRP A 1 99  ? -0.898  1.788   -1.743  1.00 0.00 ? 99  TRP A CH2  2  
ATOM 4017  H H    . TRP A 1 99  ? -4.103  4.096   2.416   1.00 0.00 ? 99  TRP A H    2  
ATOM 4018  H HA   . TRP A 1 99  ? -3.446  6.701   1.093   1.00 0.00 ? 99  TRP A HA   2  
ATOM 4019  H HB2  . TRP A 1 99  ? -5.178  4.385   0.195   1.00 0.00 ? 99  TRP A HB2  2  
ATOM 4020  H HB3  . TRP A 1 99  ? -5.350  5.994   -0.492  1.00 0.00 ? 99  TRP A HB3  2  
ATOM 4021  H HD1  . TRP A 1 99  ? -3.386  6.911   -2.010  1.00 0.00 ? 99  TRP A HD1  2  
ATOM 4022  H HE1  . TRP A 1 99  ? -1.447  5.721   -3.223  1.00 0.00 ? 99  TRP A HE1  2  
ATOM 4023  H HE3  . TRP A 1 99  ? -3.494  2.405   0.379   1.00 0.00 ? 99  TRP A HE3  2  
ATOM 4024  H HZ2  . TRP A 1 99  ? -0.119  3.186   -3.184  1.00 0.00 ? 99  TRP A HZ2  2  
ATOM 4025  H HZ3  . TRP A 1 99  ? -1.884  0.623   -0.227  1.00 0.00 ? 99  TRP A HZ3  2  
ATOM 4026  H HH2  . TRP A 1 99  ? -0.197  1.008   -2.000  1.00 0.00 ? 99  TRP A HH2  2  
ATOM 4027  N N    . LEU A 1 100 ? -5.593  7.777   1.985   1.00 0.00 ? 100 LEU A N    2  
ATOM 4028  C CA   . LEU A 1 100 ? -6.759  8.330   2.724   1.00 0.00 ? 100 LEU A CA   2  
ATOM 4029  C C    . LEU A 1 100 ? -8.018  7.992   1.932   1.00 0.00 ? 100 LEU A C    2  
ATOM 4030  O O    . LEU A 1 100 ? -8.057  8.135   0.727   1.00 0.00 ? 100 LEU A O    2  
ATOM 4031  C CB   . LEU A 1 100 ? -6.620  9.845   2.864   1.00 0.00 ? 100 LEU A CB   2  
ATOM 4032  C CG   . LEU A 1 100 ? -5.140  10.222  2.873   1.00 0.00 ? 100 LEU A CG   2  
ATOM 4033  C CD1  . LEU A 1 100 ? -4.987  11.691  3.258   1.00 0.00 ? 100 LEU A CD1  2  
ATOM 4034  C CD2  . LEU A 1 100 ? -4.394  9.353   3.889   1.00 0.00 ? 100 LEU A CD2  2  
ATOM 4035  H H    . LEU A 1 100 ? -5.013  8.364   1.455   1.00 0.00 ? 100 LEU A H    2  
ATOM 4036  H HA   . LEU A 1 100 ? -6.818  7.875   3.701   1.00 0.00 ? 100 LEU A HA   2  
ATOM 4037  H HB2  . LEU A 1 100 ? -7.112  10.331  2.035   1.00 0.00 ? 100 LEU A HB2  2  
ATOM 4038  H HB3  . LEU A 1 100 ? -7.076  10.165  3.790   1.00 0.00 ? 100 LEU A HB3  2  
ATOM 4039  H HG   . LEU A 1 100 ? -4.726  10.062  1.888   1.00 0.00 ? 100 LEU A HG   2  
ATOM 4040  H HD11 . LEU A 1 100 ? -3.941  11.961  3.247   1.00 0.00 ? 100 LEU A HD11 2  
ATOM 4041  H HD12 . LEU A 1 100 ? -5.388  11.844  4.249   1.00 0.00 ? 100 LEU A HD12 2  
ATOM 4042  H HD13 . LEU A 1 100 ? -5.525  12.306  2.551   1.00 0.00 ? 100 LEU A HD13 2  
ATOM 4043  H HD21 . LEU A 1 100 ? -5.101  8.918   4.579   1.00 0.00 ? 100 LEU A HD21 2  
ATOM 4044  H HD22 . LEU A 1 100 ? -3.689  9.963   4.435   1.00 0.00 ? 100 LEU A HD22 2  
ATOM 4045  H HD23 . LEU A 1 100 ? -3.867  8.567   3.371   1.00 0.00 ? 100 LEU A HD23 2  
ATOM 4046  N N    . ALA A 1 101 ? -9.042  7.522   2.589   1.00 0.00 ? 101 ALA A N    2  
ATOM 4047  C CA   . ALA A 1 101 ? -10.280 7.158   1.849   1.00 0.00 ? 101 ALA A CA   2  
ATOM 4048  C C    . ALA A 1 101 ? -11.506 7.705   2.574   1.00 0.00 ? 101 ALA A C    2  
ATOM 4049  O O    . ALA A 1 101 ? -11.503 7.892   3.774   1.00 0.00 ? 101 ALA A O    2  
ATOM 4050  C CB   . ALA A 1 101 ? -10.384 5.634   1.756   1.00 0.00 ? 101 ALA A CB   2  
ATOM 4051  H H    . ALA A 1 101 ? -8.991  7.395   3.559   1.00 0.00 ? 101 ALA A H    2  
ATOM 4052  H HA   . ALA A 1 101 ? -10.235 7.572   0.858   1.00 0.00 ? 101 ALA A HA   2  
ATOM 4053  H HB1  . ALA A 1 101 ? -11.044 5.368   0.945   1.00 0.00 ? 101 ALA A HB1  2  
ATOM 4054  H HB2  . ALA A 1 101 ? -10.776 5.245   2.682   1.00 0.00 ? 101 ALA A HB2  2  
ATOM 4055  H HB3  . ALA A 1 101 ? -9.405  5.218   1.575   1.00 0.00 ? 101 ALA A HB3  2  
ATOM 4056  N N    . GLU A 1 102 ? -12.558 7.961   1.846   1.00 0.00 ? 102 GLU A N    2  
ATOM 4057  C CA   . GLU A 1 102 ? -13.793 8.497   2.477   1.00 0.00 ? 102 GLU A CA   2  
ATOM 4058  C C    . GLU A 1 102 ? -14.982 7.616   2.089   1.00 0.00 ? 102 GLU A C    2  
ATOM 4059  O O    . GLU A 1 102 ? -15.281 7.451   0.925   1.00 0.00 ? 102 GLU A O    2  
ATOM 4060  C CB   . GLU A 1 102 ? -14.034 9.922   1.971   1.00 0.00 ? 102 GLU A CB   2  
ATOM 4061  C CG   . GLU A 1 102 ? -15.249 10.525  2.674   1.00 0.00 ? 102 GLU A CG   2  
ATOM 4062  C CD   . GLU A 1 102 ? -15.560 11.891  2.061   1.00 0.00 ? 102 GLU A CD   2  
ATOM 4063  O OE1  . GLU A 1 102 ? -16.486 12.532  2.532   1.00 0.00 ? 102 GLU A OE1  2  
ATOM 4064  O OE2  . GLU A 1 102 ? -14.870 12.271  1.131   1.00 0.00 ? 102 GLU A OE2  2  
ATOM 4065  H H    . GLU A 1 102 ? -12.533 7.800   0.881   1.00 0.00 ? 102 GLU A H    2  
ATOM 4066  H HA   . GLU A 1 102 ? -13.682 8.504   3.549   1.00 0.00 ? 102 GLU A HA   2  
ATOM 4067  H HB2  . GLU A 1 102 ? -13.163 10.527  2.178   1.00 0.00 ? 102 GLU A HB2  2  
ATOM 4068  H HB3  . GLU A 1 102 ? -14.211 9.901   0.907   1.00 0.00 ? 102 GLU A HB3  2  
ATOM 4069  H HG2  . GLU A 1 102 ? -16.098 9.870   2.551   1.00 0.00 ? 102 GLU A HG2  2  
ATOM 4070  H HG3  . GLU A 1 102 ? -15.036 10.645  3.724   1.00 0.00 ? 102 GLU A HG3  2  
ATOM 4071  H HE2  . GLU A 1 102 ? -15.122 13.135  0.797   1.00 0.00 ? 102 GLU A HE2  2  
ATOM 4072  N N    . VAL A 1 103 ? -15.667 7.054   3.049   1.00 0.00 ? 103 VAL A N    2  
ATOM 4073  C CA   . VAL A 1 103 ? -16.835 6.192   2.713   1.00 0.00 ? 103 VAL A CA   2  
ATOM 4074  C C    . VAL A 1 103 ? -18.017 7.083   2.318   1.00 0.00 ? 103 VAL A C    2  
ATOM 4075  O O    . VAL A 1 103 ? -18.333 8.059   2.971   1.00 0.00 ? 103 VAL A O    2  
ATOM 4076  C CB   . VAL A 1 103 ? -17.176 5.300   3.906   1.00 0.00 ? 103 VAL A CB   2  
ATOM 4077  C CG1  . VAL A 1 103 ? -15.900 4.640   4.400   1.00 0.00 ? 103 VAL A CG1  2  
ATOM 4078  C CG2  . VAL A 1 103 ? -17.769 6.126   5.042   1.00 0.00 ? 103 VAL A CG2  2  
ATOM 4079  H H    . VAL A 1 103 ? -15.413 7.197   3.984   1.00 0.00 ? 103 VAL A H    2  
ATOM 4080  H HA   . VAL A 1 103 ? -16.578 5.568   1.874   1.00 0.00 ? 103 VAL A HA   2  
ATOM 4081  H HB   . VAL A 1 103 ? -17.878 4.538   3.599   1.00 0.00 ? 103 VAL A HB   2  
ATOM 4082  H HG11 . VAL A 1 103 ? -16.132 3.676   4.827   1.00 0.00 ? 103 VAL A HG11 2  
ATOM 4083  H HG12 . VAL A 1 103 ? -15.449 5.270   5.150   1.00 0.00 ? 103 VAL A HG12 2  
ATOM 4084  H HG13 . VAL A 1 103 ? -15.219 4.519   3.575   1.00 0.00 ? 103 VAL A HG13 2  
ATOM 4085  H HG21 . VAL A 1 103 ? -18.836 5.967   5.079   1.00 0.00 ? 103 VAL A HG21 2  
ATOM 4086  H HG22 . VAL A 1 103 ? -17.558 7.169   4.876   1.00 0.00 ? 103 VAL A HG22 2  
ATOM 4087  H HG23 . VAL A 1 103 ? -17.326 5.811   5.980   1.00 0.00 ? 103 VAL A HG23 2  
ATOM 4088  N N    . LYS A 1 104 ? -18.642 6.762   1.221   1.00 0.00 ? 104 LYS A N    2  
ATOM 4089  C CA   . LYS A 1 104 ? -19.778 7.584   0.708   1.00 0.00 ? 104 LYS A CA   2  
ATOM 4090  C C    . LYS A 1 104 ? -20.911 7.678   1.734   1.00 0.00 ? 104 LYS A C    2  
ATOM 4091  O O    . LYS A 1 104 ? -21.514 8.719   1.902   1.00 0.00 ? 104 LYS A O    2  
ATOM 4092  C CB   . LYS A 1 104 ? -20.318 6.904   -0.547  1.00 0.00 ? 104 LYS A CB   2  
ATOM 4093  C CG   . LYS A 1 104 ? -19.202 6.786   -1.583  1.00 0.00 ? 104 LYS A CG   2  
ATOM 4094  C CD   . LYS A 1 104 ? -19.695 5.932   -2.747  1.00 0.00 ? 104 LYS A CD   2  
ATOM 4095  C CE   . LYS A 1 104 ? -18.516 5.560   -3.649  1.00 0.00 ? 104 LYS A CE   2  
ATOM 4096  N NZ   . LYS A 1 104 ? -19.016 5.276   -5.024  1.00 0.00 ? 104 LYS A NZ   2  
ATOM 4097  H H    . LYS A 1 104 ? -18.339 5.988   0.704   1.00 0.00 ? 104 LYS A H    2  
ATOM 4098  H HA   . LYS A 1 104 ? -19.431 8.572   0.456   1.00 0.00 ? 104 LYS A HA   2  
ATOM 4099  H HB2  . LYS A 1 104 ? -20.682 5.918   -0.293  1.00 0.00 ? 104 LYS A HB2  2  
ATOM 4100  H HB3  . LYS A 1 104 ? -21.125 7.492   -0.955  1.00 0.00 ? 104 LYS A HB3  2  
ATOM 4101  H HG2  . LYS A 1 104 ? -18.939 7.771   -1.942  1.00 0.00 ? 104 LYS A HG2  2  
ATOM 4102  H HG3  . LYS A 1 104 ? -18.338 6.322   -1.137  1.00 0.00 ? 104 LYS A HG3  2  
ATOM 4103  H HD2  . LYS A 1 104 ? -20.153 5.034   -2.358  1.00 0.00 ? 104 LYS A HD2  2  
ATOM 4104  H HD3  . LYS A 1 104 ? -20.422 6.488   -3.318  1.00 0.00 ? 104 LYS A HD3  2  
ATOM 4105  H HE2  . LYS A 1 104 ? -17.813 6.379   -3.683  1.00 0.00 ? 104 LYS A HE2  2  
ATOM 4106  H HE3  . LYS A 1 104 ? -18.026 4.680   -3.257  1.00 0.00 ? 104 LYS A HE3  2  
ATOM 4107  H HZ1  . LYS A 1 104 ? -19.078 4.248   -5.166  1.00 0.00 ? 104 LYS A HZ1  2  
ATOM 4108  H HZ2  . LYS A 1 104 ? -18.363 5.686   -5.723  1.00 0.00 ? 104 LYS A HZ2  2  
ATOM 4109  H HZ3  . LYS A 1 104 ? -19.959 5.698   -5.142  1.00 0.00 ? 104 LYS A HZ3  2  
ATOM 4110  N N    . ASP A 1 105 ? -21.235 6.602   2.392   1.00 0.00 ? 105 ASP A N    2  
ATOM 4111  C CA   . ASP A 1 105 ? -22.365 6.653   3.368   1.00 0.00 ? 105 ASP A CA   2  
ATOM 4112  C C    . ASP A 1 105 ? -21.860 6.840   4.793   1.00 0.00 ? 105 ASP A C    2  
ATOM 4113  O O    . ASP A 1 105 ? -20.992 6.134   5.257   1.00 0.00 ? 105 ASP A O    2  
ATOM 4114  C CB   . ASP A 1 105 ? -23.162 5.356   3.298   1.00 0.00 ? 105 ASP A CB   2  
ATOM 4115  C CG   . ASP A 1 105 ? -24.573 5.647   2.789   1.00 0.00 ? 105 ASP A CG   2  
ATOM 4116  O OD1  . ASP A 1 105 ? -25.081 4.849   2.016   1.00 0.00 ? 105 ASP A OD1  2  
ATOM 4117  O OD2  . ASP A 1 105 ? -25.127 6.660   3.182   1.00 0.00 ? 105 ASP A OD2  2  
ATOM 4118  H H    . ASP A 1 105 ? -20.760 5.760   2.225   1.00 0.00 ? 105 ASP A H    2  
ATOM 4119  H HA   . ASP A 1 105 ? -23.012 7.475   3.115   1.00 0.00 ? 105 ASP A HA   2  
ATOM 4120  H HB2  . ASP A 1 105 ? -22.668 4.673   2.628   1.00 0.00 ? 105 ASP A HB2  2  
ATOM 4121  H HB3  . ASP A 1 105 ? -23.220 4.916   4.281   1.00 0.00 ? 105 ASP A HB3  2  
ATOM 4122  H HD2  . ASP A 1 105 ? -26.009 6.778   2.823   1.00 0.00 ? 105 ASP A HD2  2  
ATOM 4123  N N    . TYR A 1 106 ? -22.429 7.776   5.499   1.00 0.00 ? 106 TYR A N    2  
ATOM 4124  C CA   . TYR A 1 106 ? -22.017 8.001   6.913   1.00 0.00 ? 106 TYR A CA   2  
ATOM 4125  C C    . TYR A 1 106 ? -22.350 6.739   7.709   1.00 0.00 ? 106 TYR A C    2  
ATOM 4126  O O    . TYR A 1 106 ? -21.590 6.292   8.545   1.00 0.00 ? 106 TYR A O    2  
ATOM 4127  C CB   . TYR A 1 106 ? -22.781 9.197   7.487   1.00 0.00 ? 106 TYR A CB   2  
ATOM 4128  C CG   . TYR A 1 106 ? -22.256 9.524   8.867   1.00 0.00 ? 106 TYR A CG   2  
ATOM 4129  C CD1  . TYR A 1 106 ? -21.048 10.219  9.006   1.00 0.00 ? 106 TYR A CD1  2  
ATOM 4130  C CD2  . TYR A 1 106 ? -22.979 9.143   10.004  1.00 0.00 ? 106 TYR A CD2  2  
ATOM 4131  C CE1  . TYR A 1 106 ? -20.563 10.532  10.282  1.00 0.00 ? 106 TYR A CE1  2  
ATOM 4132  C CE2  . TYR A 1 106 ? -22.493 9.455   11.280  1.00 0.00 ? 106 TYR A CE2  2  
ATOM 4133  C CZ   . TYR A 1 106 ? -21.285 10.149  11.418  1.00 0.00 ? 106 TYR A CZ   2  
ATOM 4134  O OH   . TYR A 1 106 ? -20.807 10.458  12.675  1.00 0.00 ? 106 TYR A OH   2  
ATOM 4135  H H    . TYR A 1 106 ? -23.147 8.311   5.102   1.00 0.00 ? 106 TYR A H    2  
ATOM 4136  H HA   . TYR A 1 106 ? -20.954 8.189   6.958   1.00 0.00 ? 106 TYR A HA   2  
ATOM 4137  H HB2  . TYR A 1 106 ? -22.649 10.054  6.842   1.00 0.00 ? 106 TYR A HB2  2  
ATOM 4138  H HB3  . TYR A 1 106 ? -23.831 8.957   7.552   1.00 0.00 ? 106 TYR A HB3  2  
ATOM 4139  H HD1  . TYR A 1 106 ? -20.490 10.513  8.130   1.00 0.00 ? 106 TYR A HD1  2  
ATOM 4140  H HD2  . TYR A 1 106 ? -23.911 8.606   9.898   1.00 0.00 ? 106 TYR A HD2  2  
ATOM 4141  H HE1  . TYR A 1 106 ? -19.633 11.068  10.389  1.00 0.00 ? 106 TYR A HE1  2  
ATOM 4142  H HE2  . TYR A 1 106 ? -23.049 9.160   12.158  1.00 0.00 ? 106 TYR A HE2  2  
ATOM 4143  H HH   . TYR A 1 106 ? -21.543 10.767  13.206  1.00 0.00 ? 106 TYR A HH   2  
ATOM 4144  N N    . ASP A 1 107 ? -23.485 6.152   7.430   1.00 0.00 ? 107 ASP A N    2  
ATOM 4145  C CA   . ASP A 1 107 ? -23.888 4.904   8.135   1.00 0.00 ? 107 ASP A CA   2  
ATOM 4146  C C    . ASP A 1 107 ? -23.492 3.712   7.263   1.00 0.00 ? 107 ASP A C    2  
ATOM 4147  O O    . ASP A 1 107 ? -23.990 2.613   7.427   1.00 0.00 ? 107 ASP A O    2  
ATOM 4148  C CB   . ASP A 1 107 ? -25.403 4.901   8.353   1.00 0.00 ? 107 ASP A CB   2  
ATOM 4149  C CG   . ASP A 1 107 ? -25.805 3.653   9.144   1.00 0.00 ? 107 ASP A CG   2  
ATOM 4150  O OD1  . ASP A 1 107 ? -26.996 3.405   9.254   1.00 0.00 ? 107 ASP A OD1  2  
ATOM 4151  O OD2  . ASP A 1 107 ? -24.918 2.971   9.625   1.00 0.00 ? 107 ASP A OD2  2  
ATOM 4152  H H    . ASP A 1 107 ? -24.068 6.530   6.738   1.00 0.00 ? 107 ASP A H    2  
ATOM 4153  H HA   . ASP A 1 107 ? -23.380 4.843   9.087   1.00 0.00 ? 107 ASP A HA   2  
ATOM 4154  H HB2  . ASP A 1 107 ? -25.689 5.785   8.906   1.00 0.00 ? 107 ASP A HB2  2  
ATOM 4155  H HB3  . ASP A 1 107 ? -25.906 4.897   7.397   1.00 0.00 ? 107 ASP A HB3  2  
ATOM 4156  H HD2  . ASP A 1 107 ? -25.243 2.206   10.106  1.00 0.00 ? 107 ASP A HD2  2  
ATOM 4157  N N    . VAL A 1 108 ? -22.601 3.930   6.333   1.00 0.00 ? 108 VAL A N    2  
ATOM 4158  C CA   . VAL A 1 108 ? -22.162 2.828   5.431   1.00 0.00 ? 108 VAL A CA   2  
ATOM 4159  C C    . VAL A 1 108 ? -22.043 1.533   6.233   1.00 0.00 ? 108 VAL A C    2  
ATOM 4160  O O    . VAL A 1 108 ? -21.731 1.542   7.408   1.00 0.00 ? 108 VAL A O    2  
ATOM 4161  C CB   . VAL A 1 108 ? -20.807 3.192   4.824   1.00 0.00 ? 108 VAL A CB   2  
ATOM 4162  C CG1  . VAL A 1 108 ? -19.840 3.570   5.940   1.00 0.00 ? 108 VAL A CG1  2  
ATOM 4163  C CG2  . VAL A 1 108 ? -20.242 2.003   4.048   1.00 0.00 ? 108 VAL A CG2  2  
ATOM 4164  H H    . VAL A 1 108 ? -22.220 4.825   6.223   1.00 0.00 ? 108 VAL A H    2  
ATOM 4165  H HA   . VAL A 1 108 ? -22.888 2.697   4.641   1.00 0.00 ? 108 VAL A HA   2  
ATOM 4166  H HB   . VAL A 1 108 ? -20.929 4.035   4.156   1.00 0.00 ? 108 VAL A HB   2  
ATOM 4167  H HG11 . VAL A 1 108 ? -20.147 4.505   6.380   1.00 0.00 ? 108 VAL A HG11 2  
ATOM 4168  H HG12 . VAL A 1 108 ? -18.846 3.674   5.533   1.00 0.00 ? 108 VAL A HG12 2  
ATOM 4169  H HG13 . VAL A 1 108 ? -19.843 2.798   6.694   1.00 0.00 ? 108 VAL A HG13 2  
ATOM 4170  H HG21 . VAL A 1 108 ? -20.935 1.716   3.273   1.00 0.00 ? 108 VAL A HG21 2  
ATOM 4171  H HG22 . VAL A 1 108 ? -20.089 1.173   4.721   1.00 0.00 ? 108 VAL A HG22 2  
ATOM 4172  H HG23 . VAL A 1 108 ? -19.299 2.285   3.603   1.00 0.00 ? 108 VAL A HG23 2  
ATOM 4173  N N    . GLU A 1 109 ? -22.307 0.420   5.610   1.00 0.00 ? 109 GLU A N    2  
ATOM 4174  C CA   . GLU A 1 109 ? -22.232 -0.872  6.335   1.00 0.00 ? 109 GLU A CA   2  
ATOM 4175  C C    . GLU A 1 109 ? -20.798 -1.158  6.756   1.00 0.00 ? 109 GLU A C    2  
ATOM 4176  O O    . GLU A 1 109 ? -19.846 -0.819  6.080   1.00 0.00 ? 109 GLU A O    2  
ATOM 4177  C CB   . GLU A 1 109 ? -22.735 -2.005  5.441   1.00 0.00 ? 109 GLU A CB   2  
ATOM 4178  C CG   . GLU A 1 109 ? -21.582 -2.954  5.102   1.00 0.00 ? 109 GLU A CG   2  
ATOM 4179  C CD   . GLU A 1 109 ? -22.067 -4.022  4.121   1.00 0.00 ? 109 GLU A CD   2  
ATOM 4180  O OE1  . GLU A 1 109 ? -22.858 -4.858  4.530   1.00 0.00 ? 109 GLU A OE1  2  
ATOM 4181  O OE2  . GLU A 1 109 ? -21.639 -3.989  2.979   1.00 0.00 ? 109 GLU A OE2  2  
ATOM 4182  H H    . GLU A 1 109 ? -22.567 0.435   4.672   1.00 0.00 ? 109 GLU A H    2  
ATOM 4183  H HA   . GLU A 1 109 ? -22.852 -0.817  7.216   1.00 0.00 ? 109 GLU A HA   2  
ATOM 4184  H HB2  . GLU A 1 109 ? -23.504 -2.551  5.965   1.00 0.00 ? 109 GLU A HB2  2  
ATOM 4185  H HB3  . GLU A 1 109 ? -23.140 -1.594  4.529   1.00 0.00 ? 109 GLU A HB3  2  
ATOM 4186  H HG2  . GLU A 1 109 ? -20.773 -2.395  4.654   1.00 0.00 ? 109 GLU A HG2  2  
ATOM 4187  H HG3  . GLU A 1 109 ? -21.234 -3.431  6.005   1.00 0.00 ? 109 GLU A HG3  2  
ATOM 4188  H HE2  . GLU A 1 109 ? -21.986 -4.689  2.421   1.00 0.00 ? 109 GLU A HE2  2  
ATOM 4189  N N    . ILE A 1 110 ? -20.654 -1.802  7.870   1.00 0.00 ? 110 ILE A N    2  
ATOM 4190  C CA   . ILE A 1 110 ? -19.301 -2.163  8.376   1.00 0.00 ? 110 ILE A CA   2  
ATOM 4191  C C    . ILE A 1 110 ? -19.217 -3.681  8.561   1.00 0.00 ? 110 ILE A C    2  
ATOM 4192  O O    . ILE A 1 110 ? -19.832 -4.242  9.447   1.00 0.00 ? 110 ILE A O    2  
ATOM 4193  C CB   . ILE A 1 110 ? -19.049 -1.458  9.713   1.00 0.00 ? 110 ILE A CB   2  
ATOM 4194  C CG1  . ILE A 1 110 ? -18.941 0.054   9.487   1.00 0.00 ? 110 ILE A CG1  2  
ATOM 4195  C CG2  . ILE A 1 110 ? -17.749 -1.976  10.329  1.00 0.00 ? 110 ILE A CG2  2  
ATOM 4196  C CD1  . ILE A 1 110 ? -17.778 0.355   8.536   1.00 0.00 ? 110 ILE A CD1  2  
ATOM 4197  H H    . ILE A 1 110 ? -21.453 -2.070  8.365   1.00 0.00 ? 110 ILE A H    2  
ATOM 4198  H HA   . ILE A 1 110 ? -18.556 -1.851  7.663   1.00 0.00 ? 110 ILE A HA   2  
ATOM 4199  H HB   . ILE A 1 110 ? -19.869 -1.661  10.386  1.00 0.00 ? 110 ILE A HB   2  
ATOM 4200  H HG12 . ILE A 1 110 ? -19.863 0.419   9.057   1.00 0.00 ? 110 ILE A HG12 2  
ATOM 4201  H HG13 . ILE A 1 110 ? -18.765 0.546   10.429  1.00 0.00 ? 110 ILE A HG13 2  
ATOM 4202  H HG21 . ILE A 1 110 ? -17.254 -1.170  10.852  1.00 0.00 ? 110 ILE A HG21 2  
ATOM 4203  H HG22 . ILE A 1 110 ? -17.103 -2.347  9.545   1.00 0.00 ? 110 ILE A HG22 2  
ATOM 4204  H HG23 . ILE A 1 110 ? -17.973 -2.773  11.021  1.00 0.00 ? 110 ILE A HG23 2  
ATOM 4205  H HD11 . ILE A 1 110 ? -18.147 0.404   7.521   1.00 0.00 ? 110 ILE A HD11 2  
ATOM 4206  H HD12 . ILE A 1 110 ? -17.036 -0.427  8.611   1.00 0.00 ? 110 ILE A HD12 2  
ATOM 4207  H HD13 . ILE A 1 110 ? -17.334 1.302   8.802   1.00 0.00 ? 110 ILE A HD13 2  
ATOM 4208  N N    . ARG A 1 111 ? -18.450 -4.351  7.742   1.00 0.00 ? 111 ARG A N    2  
ATOM 4209  C CA   . ARG A 1 111 ? -18.322 -5.832  7.884   1.00 0.00 ? 111 ARG A CA   2  
ATOM 4210  C C    . ARG A 1 111 ? -16.961 -6.143  8.487   1.00 0.00 ? 111 ARG A C    2  
ATOM 4211  O O    . ARG A 1 111 ? -15.929 -5.855  7.914   1.00 0.00 ? 111 ARG A O    2  
ATOM 4212  C CB   . ARG A 1 111 ? -18.447 -6.498  6.513   1.00 0.00 ? 111 ARG A CB   2  
ATOM 4213  C CG   . ARG A 1 111 ? -19.873 -6.308  6.003   1.00 0.00 ? 111 ARG A CG   2  
ATOM 4214  C CD   . ARG A 1 111 ? -19.966 -6.722  4.533   1.00 0.00 ? 111 ARG A CD   2  
ATOM 4215  N NE   . ARG A 1 111 ? -19.892 -8.204  4.424   1.00 0.00 ? 111 ARG A NE   2  
ATOM 4216  C CZ   . ARG A 1 111 ? -19.622 -8.762  3.274   1.00 0.00 ? 111 ARG A CZ   2  
ATOM 4217  N NH1  . ARG A 1 111 ? -19.398 -8.017  2.226   1.00 0.00 ? 111 ARG A NH1  2  
ATOM 4218  N NH2  . ARG A 1 111 ? -19.581 -10.060 3.174   1.00 0.00 ? 111 ARG A NH2  2  
ATOM 4219  H H    . ARG A 1 111 ? -17.953 -3.881  7.038   1.00 0.00 ? 111 ARG A H    2  
ATOM 4220  H HA   . ARG A 1 111 ? -19.098 -6.200  8.537   1.00 0.00 ? 111 ARG A HA   2  
ATOM 4221  H HB2  . ARG A 1 111 ? -17.748 -6.047  5.827   1.00 0.00 ? 111 ARG A HB2  2  
ATOM 4222  H HB3  . ARG A 1 111 ? -18.236 -7.552  6.602   1.00 0.00 ? 111 ARG A HB3  2  
ATOM 4223  H HG2  . ARG A 1 111 ? -20.546 -6.917  6.593   1.00 0.00 ? 111 ARG A HG2  2  
ATOM 4224  H HG3  . ARG A 1 111 ? -20.146 -5.273  6.107   1.00 0.00 ? 111 ARG A HG3  2  
ATOM 4225  H HD2  . ARG A 1 111 ? -20.904 -6.377  4.123   1.00 0.00 ? 111 ARG A HD2  2  
ATOM 4226  H HD3  . ARG A 1 111 ? -19.149 -6.278  3.983   1.00 0.00 ? 111 ARG A HD3  2  
ATOM 4227  H HE   . ARG A 1 111 ? -20.054 -8.763  5.214   1.00 0.00 ? 111 ARG A HE   2  
ATOM 4228  H HH11 . ARG A 1 111 ? -19.432 -7.021  2.301   1.00 0.00 ? 111 ARG A HH11 2  
ATOM 4229  H HH12 . ARG A 1 111 ? -19.190 -8.444  1.344   1.00 0.00 ? 111 ARG A HH12 2  
ATOM 4230  H HH21 . ARG A 1 111 ? -19.752 -10.630 3.978   1.00 0.00 ? 111 ARG A HH21 2  
ATOM 4231  H HH22 . ARG A 1 111 ? -19.374 -10.487 2.294   1.00 0.00 ? 111 ARG A HH22 2  
ATOM 4232  N N    . LEU A 1 112 ? -16.954 -6.709  9.653   1.00 0.00 ? 112 LEU A N    2  
ATOM 4233  C CA   . LEU A 1 112 ? -15.664 -7.020  10.318  1.00 0.00 ? 112 LEU A CA   2  
ATOM 4234  C C    . LEU A 1 112 ? -15.331 -8.506  10.162  1.00 0.00 ? 112 LEU A C    2  
ATOM 4235  O O    . LEU A 1 112 ? -16.186 -9.361  10.279  1.00 0.00 ? 112 LEU A O    2  
ATOM 4236  C CB   . LEU A 1 112 ? -15.773 -6.679  11.803  1.00 0.00 ? 112 LEU A CB   2  
ATOM 4237  C CG   . LEU A 1 112 ? -16.398 -5.293  11.974  1.00 0.00 ? 112 LEU A CG   2  
ATOM 4238  C CD1  . LEU A 1 112 ? -16.255 -4.853  13.431  1.00 0.00 ? 112 LEU A CD1  2  
ATOM 4239  C CD2  . LEU A 1 112 ? -15.694 -4.282  11.060  1.00 0.00 ? 112 LEU A CD2  2  
ATOM 4240  H H    . LEU A 1 112 ? -17.802 -6.916  10.099  1.00 0.00 ? 112 LEU A H    2  
ATOM 4241  H HA   . LEU A 1 112 ? -14.879 -6.428  9.871   1.00 0.00 ? 112 LEU A HA   2  
ATOM 4242  H HB2  . LEU A 1 112 ? -16.395 -7.417  12.293  1.00 0.00 ? 112 LEU A HB2  2  
ATOM 4243  H HB3  . LEU A 1 112 ? -14.792 -6.688  12.245  1.00 0.00 ? 112 LEU A HB3  2  
ATOM 4244  H HG   . LEU A 1 112 ? -17.446 -5.341  11.719  1.00 0.00 ? 112 LEU A HG   2  
ATOM 4245  H HD11 . LEU A 1 112 ? -17.234 -4.738  13.870  1.00 0.00 ? 112 LEU A HD11 2  
ATOM 4246  H HD12 . LEU A 1 112 ? -15.726 -3.912  13.474  1.00 0.00 ? 112 LEU A HD12 2  
ATOM 4247  H HD13 . LEU A 1 112 ? -15.700 -5.601  13.979  1.00 0.00 ? 112 LEU A HD13 2  
ATOM 4248  H HD21 . LEU A 1 112 ? -15.828 -3.285  11.457  1.00 0.00 ? 112 LEU A HD21 2  
ATOM 4249  H HD22 . LEU A 1 112 ? -16.122 -4.333  10.069  1.00 0.00 ? 112 LEU A HD22 2  
ATOM 4250  H HD23 . LEU A 1 112 ? -14.640 -4.512  11.010  1.00 0.00 ? 112 LEU A HD23 2  
ATOM 4251  N N    . SER A 1 113 ? -14.088 -8.818  9.917   1.00 0.00 ? 113 SER A N    2  
ATOM 4252  C CA   . SER A 1 113 ? -13.692 -10.245 9.774   1.00 0.00 ? 113 SER A CA   2  
ATOM 4253  C C    . SER A 1 113 ? -13.343 -10.800 11.156  1.00 0.00 ? 113 SER A C    2  
ATOM 4254  O O    . SER A 1 113 ? -13.344 -10.085 12.139  1.00 0.00 ? 113 SER A O    2  
ATOM 4255  C CB   . SER A 1 113 ? -12.473 -10.352 8.857   1.00 0.00 ? 113 SER A CB   2  
ATOM 4256  O OG   . SER A 1 113 ? -11.327 -9.865  9.541   1.00 0.00 ? 113 SER A OG   2  
ATOM 4257  H H    . SER A 1 113 ? -13.412 -8.113  9.840   1.00 0.00 ? 113 SER A H    2  
ATOM 4258  H HA   . SER A 1 113 ? -14.513 -10.809 9.355   1.00 0.00 ? 113 SER A HA   2  
ATOM 4259  H HB2  . SER A 1 113 ? -12.313 -11.383 8.587   1.00 0.00 ? 113 SER A HB2  2  
ATOM 4260  H HB3  . SER A 1 113 ? -12.646 -9.771  7.962   1.00 0.00 ? 113 SER A HB3  2  
ATOM 4261  H HG   . SER A 1 113 ? -11.143 -8.980  9.218   1.00 0.00 ? 113 SER A HG   2  
ATOM 4262  N N    . HIS A 1 114 ? -13.046 -12.066 11.243  1.00 0.00 ? 114 HIS A N    2  
ATOM 4263  C CA   . HIS A 1 114 ? -12.700 -12.657 12.567  1.00 0.00 ? 114 HIS A CA   2  
ATOM 4264  C C    . HIS A 1 114 ? -11.620 -11.805 13.239  1.00 0.00 ? 114 HIS A C    2  
ATOM 4265  O O    . HIS A 1 114 ? -11.611 -11.627 14.440  1.00 0.00 ? 114 HIS A O    2  
ATOM 4266  C CB   . HIS A 1 114 ? -12.175 -14.080 12.367  1.00 0.00 ? 114 HIS A CB   2  
ATOM 4267  C CG   . HIS A 1 114 ? -11.911 -14.713 13.707  1.00 0.00 ? 114 HIS A CG   2  
ATOM 4268  N ND1  . HIS A 1 114 ? -10.695 -14.575 14.363  1.00 0.00 ? 114 HIS A ND1  2  
ATOM 4269  C CD2  . HIS A 1 114 ? -12.693 -15.495 14.522  1.00 0.00 ? 114 HIS A CD2  2  
ATOM 4270  C CE1  . HIS A 1 114 ? -10.781 -15.260 15.521  1.00 0.00 ? 114 HIS A CE1  2  
ATOM 4271  N NE2  . HIS A 1 114 ? -11.976 -15.837 15.662  1.00 0.00 ? 114 HIS A NE2  2  
ATOM 4272  H H    . HIS A 1 114 ? -13.050 -12.628 10.441  1.00 0.00 ? 114 HIS A H    2  
ATOM 4273  H HA   . HIS A 1 114 ? -13.581 -12.680 13.192  1.00 0.00 ? 114 HIS A HA   2  
ATOM 4274  H HB2  . HIS A 1 114 ? -12.910 -14.663 11.832  1.00 0.00 ? 114 HIS A HB2  2  
ATOM 4275  H HB3  . HIS A 1 114 ? -11.259 -14.048 11.798  1.00 0.00 ? 114 HIS A HB3  2  
ATOM 4276  H HD1  . HIS A 1 114 ? -9.918  -14.073 14.045  1.00 0.00 ? 114 HIS A HD1  2  
ATOM 4277  H HD2  . HIS A 1 114 ? -13.707 -15.799 14.309  1.00 0.00 ? 114 HIS A HD2  2  
ATOM 4278  H HE1  . HIS A 1 114 ? -9.982  -15.333 16.242  1.00 0.00 ? 114 HIS A HE1  2  
ATOM 4279  H HE2  . HIS A 1 114 ? -12.284 -16.388 16.412  1.00 0.00 ? 114 HIS A HE2  2  
ATOM 4280  N N    . GLU A 1 115 ? -10.704 -11.282 12.469  1.00 0.00 ? 115 GLU A N    2  
ATOM 4281  C CA   . GLU A 1 115 ? -9.617  -10.445 13.057  1.00 0.00 ? 115 GLU A CA   2  
ATOM 4282  C C    . GLU A 1 115 ? -10.216 -9.238  13.793  1.00 0.00 ? 115 GLU A C    2  
ATOM 4283  O O    . GLU A 1 115 ? -9.649  -8.751  14.751  1.00 0.00 ? 115 GLU A O    2  
ATOM 4284  C CB   . GLU A 1 115 ? -8.697  -9.955  11.938  1.00 0.00 ? 115 GLU A CB   2  
ATOM 4285  C CG   . GLU A 1 115 ? -7.512  -9.199  12.544  1.00 0.00 ? 115 GLU A CG   2  
ATOM 4286  C CD   . GLU A 1 115 ? -6.632  -8.646  11.421  1.00 0.00 ? 115 GLU A CD   2  
ATOM 4287  O OE1  . GLU A 1 115 ? -5.634  -8.018  11.733  1.00 0.00 ? 115 GLU A OE1  2  
ATOM 4288  O OE2  . GLU A 1 115 ? -6.970  -8.865  10.270  1.00 0.00 ? 115 GLU A OE2  2  
ATOM 4289  H H    . GLU A 1 115 ? -10.727 -11.440 11.501  1.00 0.00 ? 115 GLU A H    2  
ATOM 4290  H HA   . GLU A 1 115 ? -9.046  -11.040 13.754  1.00 0.00 ? 115 GLU A HA   2  
ATOM 4291  H HB2  . GLU A 1 115 ? -8.333  -10.802 11.374  1.00 0.00 ? 115 GLU A HB2  2  
ATOM 4292  H HB3  . GLU A 1 115 ? -9.243  -9.294  11.283  1.00 0.00 ? 115 GLU A HB3  2  
ATOM 4293  H HG2  . GLU A 1 115 ? -7.879  -8.381  13.150  1.00 0.00 ? 115 GLU A HG2  2  
ATOM 4294  H HG3  . GLU A 1 115 ? -6.931  -9.870  13.157  1.00 0.00 ? 115 GLU A HG3  2  
ATOM 4295  H HE2  . GLU A 1 115 ? -6.372  -8.490  9.619   1.00 0.00 ? 115 GLU A HE2  2  
ATOM 4296  N N    . HIS A 1 116 ? -11.345 -8.746  13.353  1.00 0.00 ? 116 HIS A N    2  
ATOM 4297  C CA   . HIS A 1 116 ? -11.958 -7.566  14.033  1.00 0.00 ? 116 HIS A CA   2  
ATOM 4298  C C    . HIS A 1 116 ? -13.348 -7.930  14.559  1.00 0.00 ? 116 HIS A C    2  
ATOM 4299  O O    . HIS A 1 116 ? -14.094 -8.649  13.922  1.00 0.00 ? 116 HIS A O    2  
ATOM 4300  C CB   . HIS A 1 116 ? -12.071 -6.409  13.037  1.00 0.00 ? 116 HIS A CB   2  
ATOM 4301  C CG   . HIS A 1 116 ? -10.694 -5.965  12.622  1.00 0.00 ? 116 HIS A CG   2  
ATOM 4302  N ND1  . HIS A 1 116 ? -9.914  -5.130  13.412  1.00 0.00 ? 116 HIS A ND1  2  
ATOM 4303  C CD2  . HIS A 1 116 ? -9.945  -6.231  11.502  1.00 0.00 ? 116 HIS A CD2  2  
ATOM 4304  C CE1  . HIS A 1 116 ? -8.754  -4.927  12.760  1.00 0.00 ? 116 HIS A CE1  2  
ATOM 4305  N NE2  . HIS A 1 116 ? -8.723  -5.576  11.595  1.00 0.00 ? 116 HIS A NE2  2  
ATOM 4306  H H    . HIS A 1 116 ? -11.784 -9.145  12.572  1.00 0.00 ? 116 HIS A H    2  
ATOM 4307  H HA   . HIS A 1 116 ? -11.334 -7.268  14.858  1.00 0.00 ? 116 HIS A HA   2  
ATOM 4308  H HB2  . HIS A 1 116 ? -12.617 -6.737  12.166  1.00 0.00 ? 116 HIS A HB2  2  
ATOM 4309  H HB3  . HIS A 1 116 ? -12.591 -5.584  13.499  1.00 0.00 ? 116 HIS A HB3  2  
ATOM 4310  H HD1  . HIS A 1 116 ? -10.163 -4.757  14.282  1.00 0.00 ? 116 HIS A HD1  2  
ATOM 4311  H HD2  . HIS A 1 116 ? -10.259 -6.852  10.677  1.00 0.00 ? 116 HIS A HD2  2  
ATOM 4312  H HE1  . HIS A 1 116 ? -7.946  -4.315  13.136  1.00 0.00 ? 116 HIS A HE1  2  
ATOM 4313  H HE2  . HIS A 1 116 ? -7.994  -5.587  10.943  1.00 0.00 ? 116 HIS A HE2  2  
ATOM 4314  N N    . GLN A 1 117 ? -13.703 -7.445  15.722  1.00 0.00 ? 117 GLN A N    2  
ATOM 4315  C CA   . GLN A 1 117 ? -15.043 -7.768  16.292  1.00 0.00 ? 117 GLN A CA   2  
ATOM 4316  C C    . GLN A 1 117 ? -15.873 -6.489  16.450  1.00 0.00 ? 117 GLN A C    2  
ATOM 4317  O O    . GLN A 1 117 ? -17.088 -6.531  16.466  1.00 0.00 ? 117 GLN A O    2  
ATOM 4318  C CB   . GLN A 1 117 ? -14.875 -8.430  17.662  1.00 0.00 ? 117 GLN A CB   2  
ATOM 4319  C CG   . GLN A 1 117 ? -14.352 -7.405  18.671  1.00 0.00 ? 117 GLN A CG   2  
ATOM 4320  C CD   . GLN A 1 117 ? -14.031 -8.110  19.988  1.00 0.00 ? 117 GLN A CD   2  
ATOM 4321  O OE1  . GLN A 1 117 ? -13.582 -9.239  19.995  1.00 0.00 ? 117 GLN A OE1  2  
ATOM 4322  N NE2  . GLN A 1 117 ? -14.241 -7.488  21.115  1.00 0.00 ? 117 GLN A NE2  2  
ATOM 4323  H H    . GLN A 1 117 ? -13.083 -6.871  16.223  1.00 0.00 ? 117 GLN A H    2  
ATOM 4324  H HA   . GLN A 1 117 ? -15.556 -8.448  15.631  1.00 0.00 ? 117 GLN A HA   2  
ATOM 4325  H HB2  . GLN A 1 117 ? -15.828 -8.811  17.997  1.00 0.00 ? 117 GLN A HB2  2  
ATOM 4326  H HB3  . GLN A 1 117 ? -14.171 -9.243  17.584  1.00 0.00 ? 117 GLN A HB3  2  
ATOM 4327  H HG2  . GLN A 1 117 ? -13.459 -6.939  18.281  1.00 0.00 ? 117 GLN A HG2  2  
ATOM 4328  H HG3  . GLN A 1 117 ? -15.106 -6.652  18.844  1.00 0.00 ? 117 GLN A HG3  2  
ATOM 4329  H HE21 . GLN A 1 117 ? -14.603 -6.576  21.113  1.00 0.00 ? 117 GLN A HE21 2  
ATOM 4330  H HE22 . GLN A 1 117 ? -14.037 -7.931  21.967  1.00 0.00 ? 117 GLN A HE22 2  
ATOM 4331  N N    . ALA A 1 118 ? -15.240 -5.354  16.576  1.00 0.00 ? 118 ALA A N    2  
ATOM 4332  C CA   . ALA A 1 118 ? -16.019 -4.092  16.741  1.00 0.00 ? 118 ALA A CA   2  
ATOM 4333  C C    . ALA A 1 118 ? -15.280 -2.923  16.085  1.00 0.00 ? 118 ALA A C    2  
ATOM 4334  O O    . ALA A 1 118 ? -14.075 -2.940  15.931  1.00 0.00 ? 118 ALA A O    2  
ATOM 4335  C CB   . ALA A 1 118 ? -16.199 -3.799  18.231  1.00 0.00 ? 118 ALA A CB   2  
ATOM 4336  H H    . ALA A 1 118 ? -14.259 -5.330  16.566  1.00 0.00 ? 118 ALA A H    2  
ATOM 4337  H HA   . ALA A 1 118 ? -16.989 -4.208  16.280  1.00 0.00 ? 118 ALA A HA   2  
ATOM 4338  H HB1  . ALA A 1 118 ? -15.234 -3.792  18.716  1.00 0.00 ? 118 ALA A HB1  2  
ATOM 4339  H HB2  . ALA A 1 118 ? -16.819 -4.563  18.676  1.00 0.00 ? 118 ALA A HB2  2  
ATOM 4340  H HB3  . ALA A 1 118 ? -16.670 -2.835  18.354  1.00 0.00 ? 118 ALA A HB3  2  
ATOM 4341  N N    . TYR A 1 119 ? -16.001 -1.903  15.707  1.00 0.00 ? 119 TYR A N    2  
ATOM 4342  C CA   . TYR A 1 119 ? -15.358 -0.719  15.066  1.00 0.00 ? 119 TYR A CA   2  
ATOM 4343  C C    . TYR A 1 119 ? -15.959 0.563   15.649  1.00 0.00 ? 119 TYR A C    2  
ATOM 4344  O O    . TYR A 1 119 ? -17.049 0.559   16.186  1.00 0.00 ? 119 TYR A O    2  
ATOM 4345  C CB   . TYR A 1 119 ? -15.611 -0.753  13.558  1.00 0.00 ? 119 TYR A CB   2  
ATOM 4346  C CG   . TYR A 1 119 ? -17.071 -0.488  13.292  1.00 0.00 ? 119 TYR A CG   2  
ATOM 4347  C CD1  . TYR A 1 119 ? -17.977 -1.551  13.268  1.00 0.00 ? 119 TYR A CD1  2  
ATOM 4348  C CD2  . TYR A 1 119 ? -17.518 0.820   13.077  1.00 0.00 ? 119 TYR A CD2  2  
ATOM 4349  C CE1  . TYR A 1 119 ? -19.334 -1.312  13.027  1.00 0.00 ? 119 TYR A CE1  2  
ATOM 4350  C CE2  . TYR A 1 119 ? -18.874 1.063   12.835  1.00 0.00 ? 119 TYR A CE2  2  
ATOM 4351  C CZ   . TYR A 1 119 ? -19.784 -0.002  12.809  1.00 0.00 ? 119 TYR A CZ   2  
ATOM 4352  O OH   . TYR A 1 119 ? -21.122 0.238   12.569  1.00 0.00 ? 119 TYR A OH   2  
ATOM 4353  H H    . TYR A 1 119 ? -16.971 -1.911  15.849  1.00 0.00 ? 119 TYR A H    2  
ATOM 4354  H HA   . TYR A 1 119 ? -14.297 -0.739  15.255  1.00 0.00 ? 119 TYR A HA   2  
ATOM 4355  H HB2  . TYR A 1 119 ? -15.015 0.005   13.075  1.00 0.00 ? 119 TYR A HB2  2  
ATOM 4356  H HB3  . TYR A 1 119 ? -15.349 -1.725  13.171  1.00 0.00 ? 119 TYR A HB3  2  
ATOM 4357  H HD1  . TYR A 1 119 ? -17.631 -2.560  13.436  1.00 0.00 ? 119 TYR A HD1  2  
ATOM 4358  H HD2  . TYR A 1 119 ? -16.815 1.640   13.095  1.00 0.00 ? 119 TYR A HD2  2  
ATOM 4359  H HE1  . TYR A 1 119 ? -20.032 -2.133  13.006  1.00 0.00 ? 119 TYR A HE1  2  
ATOM 4360  H HE2  . TYR A 1 119 ? -19.219 2.071   12.665  1.00 0.00 ? 119 TYR A HE2  2  
ATOM 4361  H HH   . TYR A 1 119 ? -21.254 1.190   12.539  1.00 0.00 ? 119 TYR A HH   2  
ATOM 4362  N N    . ARG A 1 120 ? -15.261 1.661   15.547  1.00 0.00 ? 120 ARG A N    2  
ATOM 4363  C CA   . ARG A 1 120 ? -15.801 2.937   16.096  1.00 0.00 ? 120 ARG A CA   2  
ATOM 4364  C C    . ARG A 1 120 ? -15.434 4.106   15.181  1.00 0.00 ? 120 ARG A C    2  
ATOM 4365  O O    . ARG A 1 120 ? -14.387 4.126   14.563  1.00 0.00 ? 120 ARG A O    2  
ATOM 4366  C CB   . ARG A 1 120 ? -15.200 3.196   17.480  1.00 0.00 ? 120 ARG A CB   2  
ATOM 4367  C CG   . ARG A 1 120 ? -15.643 2.107   18.458  1.00 0.00 ? 120 ARG A CG   2  
ATOM 4368  C CD   . ARG A 1 120 ? -15.136 2.453   19.861  1.00 0.00 ? 120 ARG A CD   2  
ATOM 4369  N NE   . ARG A 1 120 ? -15.390 1.313   20.784  1.00 0.00 ? 120 ARG A NE   2  
ATOM 4370  C CZ   . ARG A 1 120 ? -15.001 1.387   22.029  1.00 0.00 ? 120 ARG A CZ   2  
ATOM 4371  N NH1  . ARG A 1 120 ? -14.393 2.459   22.457  1.00 0.00 ? 120 ARG A NH1  2  
ATOM 4372  N NH2  . ARG A 1 120 ? -15.220 0.389   22.843  1.00 0.00 ? 120 ARG A NH2  2  
ATOM 4373  H H    . ARG A 1 120 ? -14.382 1.647   15.109  1.00 0.00 ? 120 ARG A H    2  
ATOM 4374  H HA   . ARG A 1 120 ? -16.875 2.867   16.179  1.00 0.00 ? 120 ARG A HA   2  
ATOM 4375  H HB2  . ARG A 1 120 ? -14.124 3.200   17.404  1.00 0.00 ? 120 ARG A HB2  2  
ATOM 4376  H HB3  . ARG A 1 120 ? -15.536 4.157   17.840  1.00 0.00 ? 120 ARG A HB3  2  
ATOM 4377  H HG2  . ARG A 1 120 ? -16.721 2.045   18.466  1.00 0.00 ? 120 ARG A HG2  2  
ATOM 4378  H HG3  . ARG A 1 120 ? -15.228 1.157   18.153  1.00 0.00 ? 120 ARG A HG3  2  
ATOM 4379  H HD2  . ARG A 1 120 ? -14.076 2.653   19.820  1.00 0.00 ? 120 ARG A HD2  2  
ATOM 4380  H HD3  . ARG A 1 120 ? -15.653 3.332   20.221  1.00 0.00 ? 120 ARG A HD3  2  
ATOM 4381  H HE   . ARG A 1 120 ? -15.846 0.510   20.460  1.00 0.00 ? 120 ARG A HE   2  
ATOM 4382  H HH11 . ARG A 1 120 ? -14.225 3.222   21.833  1.00 0.00 ? 120 ARG A HH11 2  
ATOM 4383  H HH12 . ARG A 1 120 ? -14.096 2.518   23.411  1.00 0.00 ? 120 ARG A HH12 2  
ATOM 4384  H HH21 . ARG A 1 120 ? -15.686 -0.431  22.515  1.00 0.00 ? 120 ARG A HH21 2  
ATOM 4385  H HH22 . ARG A 1 120 ? -14.922 0.448   23.797  1.00 0.00 ? 120 ARG A HH22 2  
ATOM 4386  N N    . TRP A 1 121 ? -16.275 5.100   15.126  1.00 0.00 ? 121 TRP A N    2  
ATOM 4387  C CA   . TRP A 1 121 ? -15.972 6.298   14.295  1.00 0.00 ? 121 TRP A CA   2  
ATOM 4388  C C    . TRP A 1 121 ? -15.632 7.445   15.245  1.00 0.00 ? 121 TRP A C    2  
ATOM 4389  O O    . TRP A 1 121 ? -16.490 7.964   15.930  1.00 0.00 ? 121 TRP A O    2  
ATOM 4390  C CB   . TRP A 1 121 ? -17.197 6.672   13.455  1.00 0.00 ? 121 TRP A CB   2  
ATOM 4391  C CG   . TRP A 1 121 ? -17.314 5.743   12.288  1.00 0.00 ? 121 TRP A CG   2  
ATOM 4392  C CD1  . TRP A 1 121 ? -18.044 4.605   12.268  1.00 0.00 ? 121 TRP A CD1  2  
ATOM 4393  C CD2  . TRP A 1 121 ? -16.700 5.860   10.973  1.00 0.00 ? 121 TRP A CD2  2  
ATOM 4394  N NE1  . TRP A 1 121 ? -17.915 4.013   11.023  1.00 0.00 ? 121 TRP A NE1  2  
ATOM 4395  C CE2  . TRP A 1 121 ? -17.097 4.751   10.189  1.00 0.00 ? 121 TRP A CE2  2  
ATOM 4396  C CE3  . TRP A 1 121 ? -15.845 6.813   10.389  1.00 0.00 ? 121 TRP A CE3  2  
ATOM 4397  C CZ2  . TRP A 1 121 ? -16.660 4.594   8.873   1.00 0.00 ? 121 TRP A CZ2  2  
ATOM 4398  C CZ3  . TRP A 1 121 ? -15.403 6.657   9.067   1.00 0.00 ? 121 TRP A CZ3  2  
ATOM 4399  C CH2  . TRP A 1 121 ? -15.811 5.551   8.309   1.00 0.00 ? 121 TRP A CH2  2  
ATOM 4400  H H    . TRP A 1 121 ? -17.095 5.071   15.659  1.00 0.00 ? 121 TRP A H    2  
ATOM 4401  H HA   . TRP A 1 121 ? -15.131 6.094   13.649  1.00 0.00 ? 121 TRP A HA   2  
ATOM 4402  H HB2  . TRP A 1 121 ? -18.086 6.596   14.064  1.00 0.00 ? 121 TRP A HB2  2  
ATOM 4403  H HB3  . TRP A 1 121 ? -17.091 7.684   13.100  1.00 0.00 ? 121 TRP A HB3  2  
ATOM 4404  H HD1  . TRP A 1 121 ? -18.628 4.218   13.091  1.00 0.00 ? 121 TRP A HD1  2  
ATOM 4405  H HE1  . TRP A 1 121 ? -18.343 3.174   10.747  1.00 0.00 ? 121 TRP A HE1  2  
ATOM 4406  H HE3  . TRP A 1 121 ? -15.526 7.670   10.965  1.00 0.00 ? 121 TRP A HE3  2  
ATOM 4407  H HZ2  . TRP A 1 121 ? -16.977 3.740   8.293   1.00 0.00 ? 121 TRP A HZ2  2  
ATOM 4408  H HZ3  . TRP A 1 121 ? -14.747 7.393   8.628   1.00 0.00 ? 121 TRP A HZ3  2  
ATOM 4409  H HH2  . TRP A 1 121 ? -15.469 5.436   7.295   1.00 0.00 ? 121 TRP A HH2  2  
ATOM 4410  N N    . LEU A 1 122 ? -14.385 7.824   15.321  1.00 0.00 ? 122 LEU A N    2  
ATOM 4411  C CA   . LEU A 1 122 ? -14.000 8.911   16.265  1.00 0.00 ? 122 LEU A CA   2  
ATOM 4412  C C    . LEU A 1 122 ? -13.188 9.982   15.536  1.00 0.00 ? 122 LEU A C    2  
ATOM 4413  O O    . LEU A 1 122 ? -12.840 9.840   14.380  1.00 0.00 ? 122 LEU A O    2  
ATOM 4414  C CB   . LEU A 1 122 ? -13.154 8.331   17.403  1.00 0.00 ? 122 LEU A CB   2  
ATOM 4415  C CG   . LEU A 1 122 ? -13.496 6.848   17.617  1.00 0.00 ? 122 LEU A CG   2  
ATOM 4416  C CD1  . LEU A 1 122 ? -12.365 5.985   17.061  1.00 0.00 ? 122 LEU A CD1  2  
ATOM 4417  C CD2  . LEU A 1 122 ? -13.670 6.564   19.113  1.00 0.00 ? 122 LEU A CD2  2  
ATOM 4418  H H    . LEU A 1 122 ? -13.701 7.377   14.781  1.00 0.00 ? 122 LEU A H    2  
ATOM 4419  H HA   . LEU A 1 122 ? -14.891 9.362   16.676  1.00 0.00 ? 122 LEU A HA   2  
ATOM 4420  H HB2  . LEU A 1 122 ? -12.106 8.425   17.147  1.00 0.00 ? 122 LEU A HB2  2  
ATOM 4421  H HB3  . LEU A 1 122 ? -13.353 8.878   18.310  1.00 0.00 ? 122 LEU A HB3  2  
ATOM 4422  H HG   . LEU A 1 122 ? -14.412 6.606   17.104  1.00 0.00 ? 122 LEU A HG   2  
ATOM 4423  H HD11 . LEU A 1 122 ? -12.386 6.015   15.982  1.00 0.00 ? 122 LEU A HD11 2  
ATOM 4424  H HD12 . LEU A 1 122 ? -12.495 4.966   17.394  1.00 0.00 ? 122 LEU A HD12 2  
ATOM 4425  H HD13 . LEU A 1 122 ? -11.418 6.363   17.410  1.00 0.00 ? 122 LEU A HD13 2  
ATOM 4426  H HD21 . LEU A 1 122 ? -13.900 5.518   19.254  1.00 0.00 ? 122 LEU A HD21 2  
ATOM 4427  H HD22 . LEU A 1 122 ? -14.479 7.165   19.500  1.00 0.00 ? 122 LEU A HD22 2  
ATOM 4428  H HD23 . LEU A 1 122 ? -12.761 6.806   19.636  1.00 0.00 ? 122 LEU A HD23 2  
ATOM 4429  N N    . GLY A 1 123 ? -12.884 11.054  16.216  1.00 0.00 ? 123 GLY A N    2  
ATOM 4430  C CA   . GLY A 1 123 ? -12.094 12.144  15.585  1.00 0.00 ? 123 GLY A CA   2  
ATOM 4431  C C    . GLY A 1 123 ? -10.607 11.788  15.624  1.00 0.00 ? 123 GLY A C    2  
ATOM 4432  O O    . GLY A 1 123 ? -10.224 10.717  16.053  1.00 0.00 ? 123 GLY A O    2  
ATOM 4433  H H    . GLY A 1 123 ? -13.175 11.141  17.149  1.00 0.00 ? 123 GLY A H    2  
ATOM 4434  H HA2  . GLY A 1 123 ? -12.409 12.269  14.558  1.00 0.00 ? 123 GLY A HA2  2  
ATOM 4435  H HA3  . GLY A 1 123 ? -12.254 13.064  16.125  1.00 0.00 ? 123 GLY A HA3  2  
ATOM 4436  N N    . LEU A 1 124 ? -9.770  12.679  15.173  1.00 0.00 ? 124 LEU A N    2  
ATOM 4437  C CA   . LEU A 1 124 ? -8.305  12.403  15.170  1.00 0.00 ? 124 LEU A CA   2  
ATOM 4438  C C    . LEU A 1 124 ? -7.801  12.160  16.596  1.00 0.00 ? 124 LEU A C    2  
ATOM 4439  O O    . LEU A 1 124 ? -6.974  11.302  16.829  1.00 0.00 ? 124 LEU A O    2  
ATOM 4440  C CB   . LEU A 1 124 ? -7.580  13.608  14.568  1.00 0.00 ? 124 LEU A CB   2  
ATOM 4441  C CG   . LEU A 1 124 ? -6.067  13.398  14.645  1.00 0.00 ? 124 LEU A CG   2  
ATOM 4442  C CD1  . LEU A 1 124 ? -5.702  12.047  14.033  1.00 0.00 ? 124 LEU A CD1  2  
ATOM 4443  C CD2  . LEU A 1 124 ? -5.366  14.508  13.864  1.00 0.00 ? 124 LEU A CD2  2  
ATOM 4444  H H    . LEU A 1 124 ? -10.105 13.531  14.829  1.00 0.00 ? 124 LEU A H    2  
ATOM 4445  H HA   . LEU A 1 124 ? -8.110  11.530  14.567  1.00 0.00 ? 124 LEU A HA   2  
ATOM 4446  H HB2  . LEU A 1 124 ? -7.875  13.724  13.537  1.00 0.00 ? 124 LEU A HB2  2  
ATOM 4447  H HB3  . LEU A 1 124 ? -7.844  14.498  15.119  1.00 0.00 ? 124 LEU A HB3  2  
ATOM 4448  H HG   . LEU A 1 124 ? -5.750  13.424  15.678  1.00 0.00 ? 124 LEU A HG   2  
ATOM 4449  H HD11 . LEU A 1 124 ? -5.930  11.263  14.738  1.00 0.00 ? 124 LEU A HD11 2  
ATOM 4450  H HD12 . LEU A 1 124 ? -4.645  12.031  13.805  1.00 0.00 ? 124 LEU A HD12 2  
ATOM 4451  H HD13 . LEU A 1 124 ? -6.269  11.896  13.128  1.00 0.00 ? 124 LEU A HD13 2  
ATOM 4452  H HD21 . LEU A 1 124 ? -5.736  15.468  14.192  1.00 0.00 ? 124 LEU A HD21 2  
ATOM 4453  H HD22 . LEU A 1 124 ? -5.566  14.386  12.811  1.00 0.00 ? 124 LEU A HD22 2  
ATOM 4454  H HD23 . LEU A 1 124 ? -4.304  14.453  14.038  1.00 0.00 ? 124 LEU A HD23 2  
ATOM 4455  N N    . GLU A 1 125 ? -8.278  12.914  17.547  1.00 0.00 ? 125 GLU A N    2  
ATOM 4456  C CA   . GLU A 1 125 ? -7.809  12.728  18.954  1.00 0.00 ? 125 GLU A CA   2  
ATOM 4457  C C    . GLU A 1 125 ? -8.117  11.309  19.433  1.00 0.00 ? 125 GLU A C    2  
ATOM 4458  O O    . GLU A 1 125 ? -7.242  10.592  19.878  1.00 0.00 ? 125 GLU A O    2  
ATOM 4459  C CB   . GLU A 1 125 ? -8.515  13.737  19.865  1.00 0.00 ? 125 GLU A CB   2  
ATOM 4460  C CG   . GLU A 1 125 ? -10.012 13.409  19.949  1.00 0.00 ? 125 GLU A CG   2  
ATOM 4461  C CD   . GLU A 1 125 ? -10.738 14.524  20.704  1.00 0.00 ? 125 GLU A CD   2  
ATOM 4462  O OE1  . GLU A 1 125 ? -10.060 15.353  21.290  1.00 0.00 ? 125 GLU A OE1  2  
ATOM 4463  O OE2  . GLU A 1 125 ? -11.958 14.529  20.683  1.00 0.00 ? 125 GLU A OE2  2  
ATOM 4464  H H    . GLU A 1 125 ? -8.937  13.606  17.337  1.00 0.00 ? 125 GLU A H    2  
ATOM 4465  H HA   . GLU A 1 125 ? -6.741  12.893  18.999  1.00 0.00 ? 125 GLU A HA   2  
ATOM 4466  H HB2  . GLU A 1 125 ? -8.082  13.692  20.854  1.00 0.00 ? 125 GLU A HB2  2  
ATOM 4467  H HB3  . GLU A 1 125 ? -8.390  14.732  19.463  1.00 0.00 ? 125 GLU A HB3  2  
ATOM 4468  H HG2  . GLU A 1 125 ? -10.420 13.325  18.953  1.00 0.00 ? 125 GLU A HG2  2  
ATOM 4469  H HG3  . GLU A 1 125 ? -10.152 12.476  20.476  1.00 0.00 ? 125 GLU A HG3  2  
ATOM 4470  H HE2  . GLU A 1 125 ? -12.345 15.256  21.177  1.00 0.00 ? 125 GLU A HE2  2  
ATOM 4471  N N    . GLU A 1 126 ? -9.349  10.896  19.350  1.00 0.00 ? 126 GLU A N    2  
ATOM 4472  C CA   . GLU A 1 126 ? -9.701  9.523   19.802  1.00 0.00 ? 126 GLU A CA   2  
ATOM 4473  C C    . GLU A 1 126 ? -9.107  8.513   18.830  1.00 0.00 ? 126 GLU A C    2  
ATOM 4474  O O    . GLU A 1 126 ? -8.547  7.513   19.224  1.00 0.00 ? 126 GLU A O    2  
ATOM 4475  C CB   . GLU A 1 126 ? -11.216 9.371   19.817  1.00 0.00 ? 126 GLU A CB   2  
ATOM 4476  C CG   . GLU A 1 126 ? -11.740 9.443   21.252  1.00 0.00 ? 126 GLU A CG   2  
ATOM 4477  C CD   . GLU A 1 126 ? -11.044 10.571  22.017  1.00 0.00 ? 126 GLU A CD   2  
ATOM 4478  O OE1  . GLU A 1 126 ? -10.048 10.295  22.667  1.00 0.00 ? 126 GLU A OE1  2  
ATOM 4479  O OE2  . GLU A 1 126 ? -11.527 11.688  21.952  1.00 0.00 ? 126 GLU A OE2  2  
ATOM 4480  H H    . GLU A 1 126 ? -10.042 11.487  18.988  1.00 0.00 ? 126 GLU A H    2  
ATOM 4481  H HA   . GLU A 1 126 ? -9.300  9.348   20.791  1.00 0.00 ? 126 GLU A HA   2  
ATOM 4482  H HB2  . GLU A 1 126 ? -11.661 10.160  19.232  1.00 0.00 ? 126 GLU A HB2  2  
ATOM 4483  H HB3  . GLU A 1 126 ? -11.475 8.417   19.390  1.00 0.00 ? 126 GLU A HB3  2  
ATOM 4484  H HG2  . GLU A 1 126 ? -12.799 9.633   21.227  1.00 0.00 ? 126 GLU A HG2  2  
ATOM 4485  H HG3  . GLU A 1 126 ? -11.556 8.505   21.750  1.00 0.00 ? 126 GLU A HG3  2  
ATOM 4486  H HE2  . GLU A 1 126 ? -11.041 12.344  22.459  1.00 0.00 ? 126 GLU A HE2  2  
ATOM 4487  N N    . ALA A 1 127 ? -9.203  8.770   17.560  1.00 0.00 ? 127 ALA A N    2  
ATOM 4488  C CA   . ALA A 1 127 ? -8.617  7.818   16.591  1.00 0.00 ? 127 ALA A CA   2  
ATOM 4489  C C    . ALA A 1 127 ? -7.143  7.669   16.944  1.00 0.00 ? 127 ALA A C    2  
ATOM 4490  O O    . ALA A 1 127 ? -6.551  6.621   16.787  1.00 0.00 ? 127 ALA A O    2  
ATOM 4491  C CB   . ALA A 1 127 ? -8.770  8.366   15.176  1.00 0.00 ? 127 ALA A CB   2  
ATOM 4492  H H    . ALA A 1 127 ? -9.646  9.587   17.249  1.00 0.00 ? 127 ALA A H    2  
ATOM 4493  H HA   . ALA A 1 127 ? -9.111  6.863   16.675  1.00 0.00 ? 127 ALA A HA   2  
ATOM 4494  H HB1  . ALA A 1 127 ? -9.794  8.683   15.025  1.00 0.00 ? 127 ALA A HB1  2  
ATOM 4495  H HB2  . ALA A 1 127 ? -8.519  7.596   14.463  1.00 0.00 ? 127 ALA A HB2  2  
ATOM 4496  H HB3  . ALA A 1 127 ? -8.107  9.209   15.045  1.00 0.00 ? 127 ALA A HB3  2  
ATOM 4497  N N    . CYS A 1 128 ? -6.560  8.719   17.452  1.00 0.00 ? 128 CYS A N    2  
ATOM 4498  C CA   . CYS A 1 128 ? -5.134  8.664   17.859  1.00 0.00 ? 128 CYS A CA   2  
ATOM 4499  C C    . CYS A 1 128 ? -5.037  7.998   19.236  1.00 0.00 ? 128 CYS A C    2  
ATOM 4500  O O    . CYS A 1 128 ? -4.152  7.209   19.492  1.00 0.00 ? 128 CYS A O    2  
ATOM 4501  C CB   . CYS A 1 128 ? -4.576  10.084  17.934  1.00 0.00 ? 128 CYS A CB   2  
ATOM 4502  S SG   . CYS A 1 128 ? -3.972  10.583  16.304  1.00 0.00 ? 128 CYS A SG   2  
ATOM 4503  H H    . CYS A 1 128 ? -7.072  9.545   17.584  1.00 0.00 ? 128 CYS A H    2  
ATOM 4504  H HA   . CYS A 1 128 ? -4.572  8.089   17.139  1.00 0.00 ? 128 CYS A HA   2  
ATOM 4505  H HB2  . CYS A 1 128 ? -5.356  10.759  18.253  1.00 0.00 ? 128 CYS A HB2  2  
ATOM 4506  H HB3  . CYS A 1 128 ? -3.766  10.114  18.641  1.00 0.00 ? 128 CYS A HB3  2  
ATOM 4507  H HG   . CYS A 1 128 ? -4.177  11.514  16.184  1.00 0.00 ? 128 CYS A HG   2  
ATOM 4508  N N    . GLN A 1 129 ? -5.944  8.314   20.127  1.00 0.00 ? 129 GLN A N    2  
ATOM 4509  C CA   . GLN A 1 129 ? -5.899  7.697   21.484  1.00 0.00 ? 129 GLN A CA   2  
ATOM 4510  C C    . GLN A 1 129 ? -6.071  6.182   21.356  1.00 0.00 ? 129 GLN A C    2  
ATOM 4511  O O    . GLN A 1 129 ? -5.320  5.413   21.919  1.00 0.00 ? 129 GLN A O    2  
ATOM 4512  C CB   . GLN A 1 129 ? -7.002  8.306   22.364  1.00 0.00 ? 129 GLN A CB   2  
ATOM 4513  C CG   . GLN A 1 129 ? -8.284  7.470   22.319  1.00 0.00 ? 129 GLN A CG   2  
ATOM 4514  C CD   . GLN A 1 129 ? -8.124  6.226   23.197  1.00 0.00 ? 129 GLN A CD   2  
ATOM 4515  O OE1  . GLN A 1 129 ? -7.042  5.932   23.664  1.00 0.00 ? 129 GLN A OE1  2  
ATOM 4516  N NE2  . GLN A 1 129 ? -9.168  5.485   23.453  1.00 0.00 ? 129 GLN A NE2  2  
ATOM 4517  H H    . GLN A 1 129 ? -6.650  8.955   19.904  1.00 0.00 ? 129 GLN A H    2  
ATOM 4518  H HA   . GLN A 1 129 ? -4.936  7.903   21.930  1.00 0.00 ? 129 GLN A HA   2  
ATOM 4519  H HB2  . GLN A 1 129 ? -6.656  8.350   23.377  1.00 0.00 ? 129 GLN A HB2  2  
ATOM 4520  H HB3  . GLN A 1 129 ? -7.218  9.305   22.020  1.00 0.00 ? 129 GLN A HB3  2  
ATOM 4521  H HG2  . GLN A 1 129 ? -9.108  8.065   22.688  1.00 0.00 ? 129 GLN A HG2  2  
ATOM 4522  H HG3  . GLN A 1 129 ? -8.489  7.174   21.308  1.00 0.00 ? 129 GLN A HG3  2  
ATOM 4523  H HE21 . GLN A 1 129 ? -10.043 5.725   23.086  1.00 0.00 ? 129 GLN A HE21 2  
ATOM 4524  H HE22 . GLN A 1 129 ? -9.074  4.686   24.015  1.00 0.00 ? 129 GLN A HE22 2  
ATOM 4525  N N    . LEU A 1 130 ? -7.035  5.749   20.598  1.00 0.00 ? 130 LEU A N    2  
ATOM 4526  C CA   . LEU A 1 130 ? -7.231  4.284   20.411  1.00 0.00 ? 130 LEU A CA   2  
ATOM 4527  C C    . LEU A 1 130 ? -6.045  3.741   19.614  1.00 0.00 ? 130 LEU A C    2  
ATOM 4528  O O    . LEU A 1 130 ? -5.506  2.695   19.910  1.00 0.00 ? 130 LEU A O    2  
ATOM 4529  C CB   . LEU A 1 130 ? -8.521  4.035   19.634  1.00 0.00 ? 130 LEU A CB   2  
ATOM 4530  C CG   . LEU A 1 130 ? -9.720  4.489   20.464  1.00 0.00 ? 130 LEU A CG   2  
ATOM 4531  C CD1  . LEU A 1 130 ? -10.778 5.080   19.540  1.00 0.00 ? 130 LEU A CD1  2  
ATOM 4532  C CD2  . LEU A 1 130 ? -10.319 3.289   21.197  1.00 0.00 ? 130 LEU A CD2  2  
ATOM 4533  H H    . LEU A 1 130 ? -7.618  6.387   20.138  1.00 0.00 ? 130 LEU A H    2  
ATOM 4534  H HA   . LEU A 1 130 ? -7.280  3.795   21.373  1.00 0.00 ? 130 LEU A HA   2  
ATOM 4535  H HB2  . LEU A 1 130 ? -8.491  4.588   18.705  1.00 0.00 ? 130 LEU A HB2  2  
ATOM 4536  H HB3  . LEU A 1 130 ? -8.614  2.983   19.419  1.00 0.00 ? 130 LEU A HB3  2  
ATOM 4537  H HG   . LEU A 1 130 ? -9.407  5.233   21.179  1.00 0.00 ? 130 LEU A HG   2  
ATOM 4538  H HD11 . LEU A 1 130 ? -11.760 4.870   19.937  1.00 0.00 ? 130 LEU A HD11 2  
ATOM 4539  H HD12 . LEU A 1 130 ? -10.683 4.636   18.559  1.00 0.00 ? 130 LEU A HD12 2  
ATOM 4540  H HD13 . LEU A 1 130 ? -10.637 6.148   19.470  1.00 0.00 ? 130 LEU A HD13 2  
ATOM 4541  H HD21 . LEU A 1 130 ? -11.020 3.637   21.940  1.00 0.00 ? 130 LEU A HD21 2  
ATOM 4542  H HD22 . LEU A 1 130 ? -9.532  2.730   21.677  1.00 0.00 ? 130 LEU A HD22 2  
ATOM 4543  H HD23 . LEU A 1 130 ? -10.831 2.660   20.486  1.00 0.00 ? 130 LEU A HD23 2  
ATOM 4544  N N    . ALA A 1 131 ? -5.625  4.469   18.612  1.00 0.00 ? 131 ALA A N    2  
ATOM 4545  C CA   . ALA A 1 131 ? -4.460  4.026   17.798  1.00 0.00 ? 131 ALA A CA   2  
ATOM 4546  C C    . ALA A 1 131 ? -3.186  4.385   18.554  1.00 0.00 ? 131 ALA A C    2  
ATOM 4547  O O    . ALA A 1 131 ? -2.254  4.937   18.002  1.00 0.00 ? 131 ALA A O    2  
ATOM 4548  C CB   . ALA A 1 131 ? -4.476  4.736   16.446  1.00 0.00 ? 131 ALA A CB   2  
ATOM 4549  H H    . ALA A 1 131 ? -6.070  5.316   18.406  1.00 0.00 ? 131 ALA A H    2  
ATOM 4550  H HA   . ALA A 1 131 ? -4.506  2.957   17.649  1.00 0.00 ? 131 ALA A HA   2  
ATOM 4551  H HB1  . ALA A 1 131 ? -3.859  4.194   15.749  1.00 0.00 ? 131 ALA A HB1  2  
ATOM 4552  H HB2  . ALA A 1 131 ? -4.093  5.739   16.563  1.00 0.00 ? 131 ALA A HB2  2  
ATOM 4553  H HB3  . ALA A 1 131 ? -5.489  4.779   16.073  1.00 0.00 ? 131 ALA A HB3  2  
ATOM 4554  N N    . GLN A 1 132 ? -3.155  4.087   19.822  1.00 0.00 ? 132 GLN A N    2  
ATOM 4555  C CA   . GLN A 1 132 ? -1.960  4.417   20.650  1.00 0.00 ? 132 GLN A CA   2  
ATOM 4556  C C    . GLN A 1 132 ? -0.695  4.214   19.826  1.00 0.00 ? 132 GLN A C    2  
ATOM 4557  O O    . GLN A 1 132 ? 0.323   4.826   20.078  1.00 0.00 ? 132 GLN A O    2  
ATOM 4558  C CB   . GLN A 1 132 ? -1.900  3.507   21.883  1.00 0.00 ? 132 GLN A CB   2  
ATOM 4559  C CG   . GLN A 1 132 ? -2.751  2.254   21.662  1.00 0.00 ? 132 GLN A CG   2  
ATOM 4560  C CD   . GLN A 1 132 ? -2.938  1.529   22.995  1.00 0.00 ? 132 GLN A CD   2  
ATOM 4561  O OE1  . GLN A 1 132 ? -3.610  0.521   23.063  1.00 0.00 ? 132 GLN A OE1  2  
ATOM 4562  N NE2  . GLN A 1 132 ? -2.367  2.008   24.067  1.00 0.00 ? 132 GLN A NE2  2  
ATOM 4563  H H    . GLN A 1 132 ? -3.929  3.657   20.235  1.00 0.00 ? 132 GLN A H    2  
ATOM 4564  H HA   . GLN A 1 132 ? -2.020  5.448   20.969  1.00 0.00 ? 132 GLN A HA   2  
ATOM 4565  H HB2  . GLN A 1 132 ? -0.876  3.210   22.055  1.00 0.00 ? 132 GLN A HB2  2  
ATOM 4566  H HB3  . GLN A 1 132 ? -2.268  4.042   22.744  1.00 0.00 ? 132 GLN A HB3  2  
ATOM 4567  H HG2  . GLN A 1 132 ? -3.714  2.533   21.269  1.00 0.00 ? 132 GLN A HG2  2  
ATOM 4568  H HG3  . GLN A 1 132 ? -2.254  1.597   20.966  1.00 0.00 ? 132 GLN A HG3  2  
ATOM 4569  H HE21 . GLN A 1 132 ? -1.826  2.827   24.012  1.00 0.00 ? 132 GLN A HE21 2  
ATOM 4570  H HE22 . GLN A 1 132 ? -2.480  1.554   24.929  1.00 0.00 ? 132 GLN A HE22 2  
ATOM 4571  N N    . PHE A 1 133 ? -0.745  3.366   18.844  1.00 0.00 ? 133 PHE A N    2  
ATOM 4572  C CA   . PHE A 1 133 ? 0.465   3.140   18.016  1.00 0.00 ? 133 PHE A CA   2  
ATOM 4573  C C    . PHE A 1 133 ? 0.927   4.486   17.451  1.00 0.00 ? 133 PHE A C    2  
ATOM 4574  O O    . PHE A 1 133 ? 0.213   5.149   16.727  1.00 0.00 ? 133 PHE A O    2  
ATOM 4575  C CB   . PHE A 1 133 ? 0.140   2.166   16.883  1.00 0.00 ? 133 PHE A CB   2  
ATOM 4576  C CG   . PHE A 1 133 ? 0.171   0.752   17.421  1.00 0.00 ? 133 PHE A CG   2  
ATOM 4577  C CD1  . PHE A 1 133 ? -0.458  0.453   18.635  1.00 0.00 ? 133 PHE A CD1  2  
ATOM 4578  C CD2  . PHE A 1 133 ? 0.836   -0.255  16.711  1.00 0.00 ? 133 PHE A CD2  2  
ATOM 4579  C CE1  . PHE A 1 133 ? -0.427  -0.850  19.139  1.00 0.00 ? 133 PHE A CE1  2  
ATOM 4580  C CE2  . PHE A 1 133 ? 0.869   -1.562  17.218  1.00 0.00 ? 133 PHE A CE2  2  
ATOM 4581  C CZ   . PHE A 1 133 ? 0.238   -1.859  18.432  1.00 0.00 ? 133 PHE A CZ   2  
ATOM 4582  H H    . PHE A 1 133 ? -1.574  2.879   18.652  1.00 0.00 ? 133 PHE A H    2  
ATOM 4583  H HA   . PHE A 1 133 ? 1.243   2.725   18.638  1.00 0.00 ? 133 PHE A HA   2  
ATOM 4584  H HB2  . PHE A 1 133 ? -0.845  2.382   16.493  1.00 0.00 ? 133 PHE A HB2  2  
ATOM 4585  H HB3  . PHE A 1 133 ? 0.869   2.270   16.095  1.00 0.00 ? 133 PHE A HB3  2  
ATOM 4586  H HD1  . PHE A 1 133 ? -0.971  1.225   19.181  1.00 0.00 ? 133 PHE A HD1  2  
ATOM 4587  H HD2  . PHE A 1 133 ? 1.323   -0.026  15.774  1.00 0.00 ? 133 PHE A HD2  2  
ATOM 4588  H HE1  . PHE A 1 133 ? -0.913  -1.076  20.077  1.00 0.00 ? 133 PHE A HE1  2  
ATOM 4589  H HE2  . PHE A 1 133 ? 1.382   -2.341  16.671  1.00 0.00 ? 133 PHE A HE2  2  
ATOM 4590  H HZ   . PHE A 1 133 ? 0.264   -2.865  18.823  1.00 0.00 ? 133 PHE A HZ   2  
ATOM 4591  N N    . LYS A 1 134 ? 2.117   4.894   17.797  1.00 0.00 ? 134 LYS A N    2  
ATOM 4592  C CA   . LYS A 1 134 ? 2.637   6.204   17.313  1.00 0.00 ? 134 LYS A CA   2  
ATOM 4593  C C    . LYS A 1 134 ? 2.569   6.281   15.787  1.00 0.00 ? 134 LYS A C    2  
ATOM 4594  O O    . LYS A 1 134 ? 2.256   7.312   15.226  1.00 0.00 ? 134 LYS A O    2  
ATOM 4595  C CB   . LYS A 1 134 ? 4.096   6.345   17.753  1.00 0.00 ? 134 LYS A CB   2  
ATOM 4596  C CG   . LYS A 1 134 ? 4.647   7.707   17.318  1.00 0.00 ? 134 LYS A CG   2  
ATOM 4597  C CD   . LYS A 1 134 ? 6.127   7.565   16.958  1.00 0.00 ? 134 LYS A CD   2  
ATOM 4598  C CE   . LYS A 1 134 ? 6.940   7.257   18.218  1.00 0.00 ? 134 LYS A CE   2  
ATOM 4599  N NZ   . LYS A 1 134 ? 8.078   6.361   17.869  1.00 0.00 ? 134 LYS A NZ   2  
ATOM 4600  H H    . LYS A 1 134 ? 2.664   4.344   18.393  1.00 0.00 ? 134 LYS A H    2  
ATOM 4601  H HA   . LYS A 1 134 ? 2.057   7.006   17.742  1.00 0.00 ? 134 LYS A HA   2  
ATOM 4602  H HB2  . LYS A 1 134 ? 4.151   6.261   18.828  1.00 0.00 ? 134 LYS A HB2  2  
ATOM 4603  H HB3  . LYS A 1 134 ? 4.680   5.560   17.301  1.00 0.00 ? 134 LYS A HB3  2  
ATOM 4604  H HG2  . LYS A 1 134 ? 4.098   8.064   16.460  1.00 0.00 ? 134 LYS A HG2  2  
ATOM 4605  H HG3  . LYS A 1 134 ? 4.543   8.412   18.129  1.00 0.00 ? 134 LYS A HG3  2  
ATOM 4606  H HD2  . LYS A 1 134 ? 6.249   6.758   16.246  1.00 0.00 ? 134 LYS A HD2  2  
ATOM 4607  H HD3  . LYS A 1 134 ? 6.480   8.486   16.519  1.00 0.00 ? 134 LYS A HD3  2  
ATOM 4608  H HE2  . LYS A 1 134 ? 7.320   8.178   18.633  1.00 0.00 ? 134 LYS A HE2  2  
ATOM 4609  H HE3  . LYS A 1 134 ? 6.309   6.769   18.944  1.00 0.00 ? 134 LYS A HE3  2  
ATOM 4610  H HZ1  . LYS A 1 134 ? 8.923   6.649   18.404  1.00 0.00 ? 134 LYS A HZ1  2  
ATOM 4611  H HZ2  . LYS A 1 134 ? 8.275   6.432   16.847  1.00 0.00 ? 134 LYS A HZ2  2  
ATOM 4612  H HZ3  . LYS A 1 134 ? 7.835   5.382   18.109  1.00 0.00 ? 134 LYS A HZ3  2  
ATOM 4613  N N    . GLU A 1 135 ? 2.876   5.214   15.111  1.00 0.00 ? 135 GLU A N    2  
ATOM 4614  C CA   . GLU A 1 135 ? 2.846   5.256   13.623  1.00 0.00 ? 135 GLU A CA   2  
ATOM 4615  C C    . GLU A 1 135 ? 1.448   5.644   13.147  1.00 0.00 ? 135 GLU A C    2  
ATOM 4616  O O    . GLU A 1 135 ? 1.288   6.409   12.218  1.00 0.00 ? 135 GLU A O    2  
ATOM 4617  C CB   . GLU A 1 135 ? 3.191   3.877   13.070  1.00 0.00 ? 135 GLU A CB   2  
ATOM 4618  C CG   . GLU A 1 135 ? 4.278   3.244   13.941  1.00 0.00 ? 135 GLU A CG   2  
ATOM 4619  C CD   . GLU A 1 135 ? 3.636   2.318   14.979  1.00 0.00 ? 135 GLU A CD   2  
ATOM 4620  O OE1  . GLU A 1 135 ? 2.580   1.778   14.693  1.00 0.00 ? 135 GLU A OE1  2  
ATOM 4621  O OE2  . GLU A 1 135 ? 4.210   2.169   16.045  1.00 0.00 ? 135 GLU A OE2  2  
ATOM 4622  H H    . GLU A 1 135 ? 3.143   4.394   15.574  1.00 0.00 ? 135 GLU A H    2  
ATOM 4623  H HA   . GLU A 1 135 ? 3.564   5.979   13.265  1.00 0.00 ? 135 GLU A HA   2  
ATOM 4624  H HB2  . GLU A 1 135 ? 2.306   3.256   13.072  1.00 0.00 ? 135 GLU A HB2  2  
ATOM 4625  H HB3  . GLU A 1 135 ? 3.558   3.977   12.059  1.00 0.00 ? 135 GLU A HB3  2  
ATOM 4626  H HG2  . GLU A 1 135 ? 4.949   2.676   13.319  1.00 0.00 ? 135 GLU A HG2  2  
ATOM 4627  H HG3  . GLU A 1 135 ? 4.829   4.021   14.448  1.00 0.00 ? 135 GLU A HG3  2  
ATOM 4628  H HE2  . GLU A 1 135 ? 3.752   1.578   16.646  1.00 0.00 ? 135 GLU A HE2  2  
ATOM 4629  N N    . MET A 1 136 ? 0.434   5.115   13.768  1.00 0.00 ? 136 MET A N    2  
ATOM 4630  C CA   . MET A 1 136 ? -0.947  5.446   13.337  1.00 0.00 ? 136 MET A CA   2  
ATOM 4631  C C    . MET A 1 136 ? -1.306  6.857   13.791  1.00 0.00 ? 136 MET A C    2  
ATOM 4632  O O    . MET A 1 136 ? -1.953  7.597   13.076  1.00 0.00 ? 136 MET A O    2  
ATOM 4633  C CB   . MET A 1 136 ? -1.909  4.431   13.940  1.00 0.00 ? 136 MET A CB   2  
ATOM 4634  C CG   . MET A 1 136 ? -1.443  3.018   13.574  1.00 0.00 ? 136 MET A CG   2  
ATOM 4635  S SD   . MET A 1 136 ? -1.029  2.943   11.812  1.00 0.00 ? 136 MET A SD   2  
ATOM 4636  C CE   . MET A 1 136 ? -2.629  3.484   11.166  1.00 0.00 ? 136 MET A CE   2  
ATOM 4637  H H    . MET A 1 136 ? 0.578   4.493   14.512  1.00 0.00 ? 136 MET A H    2  
ATOM 4638  H HA   . MET A 1 136 ? -1.002  5.398   12.262  1.00 0.00 ? 136 MET A HA   2  
ATOM 4639  H HB2  . MET A 1 136 ? -1.915  4.542   15.015  1.00 0.00 ? 136 MET A HB2  2  
ATOM 4640  H HB3  . MET A 1 136 ? -2.902  4.596   13.549  1.00 0.00 ? 136 MET A HB3  2  
ATOM 4641  H HG2  . MET A 1 136 ? -0.569  2.764   14.158  1.00 0.00 ? 136 MET A HG2  2  
ATOM 4642  H HG3  . MET A 1 136 ? -2.233  2.312   13.787  1.00 0.00 ? 136 MET A HG3  2  
ATOM 4643  H HE1  . MET A 1 136 ? -3.415  3.155   11.832  1.00 0.00 ? 136 MET A HE1  2  
ATOM 4644  H HE2  . MET A 1 136 ? -2.784  3.054   10.190  1.00 0.00 ? 136 MET A HE2  2  
ATOM 4645  H HE3  . MET A 1 136 ? -2.642  4.561   11.086  1.00 0.00 ? 136 MET A HE3  2  
ATOM 4646  N N    . LYS A 1 137 ? -0.885  7.256   14.959  1.00 0.00 ? 137 LYS A N    2  
ATOM 4647  C CA   . LYS A 1 137 ? -1.211  8.636   15.400  1.00 0.00 ? 137 LYS A CA   2  
ATOM 4648  C C    . LYS A 1 137 ? -0.680  9.597   14.346  1.00 0.00 ? 137 LYS A C    2  
ATOM 4649  O O    . LYS A 1 137 ? -1.313  10.577  14.015  1.00 0.00 ? 137 LYS A O    2  
ATOM 4650  C CB   . LYS A 1 137 ? -0.551  8.941   16.753  1.00 0.00 ? 137 LYS A CB   2  
ATOM 4651  C CG   . LYS A 1 137 ? -1.524  8.621   17.898  1.00 0.00 ? 137 LYS A CG   2  
ATOM 4652  C CD   . LYS A 1 137 ? -1.032  7.410   18.695  1.00 0.00 ? 137 LYS A CD   2  
ATOM 4653  C CE   . LYS A 1 137 ? -0.215  7.882   19.897  1.00 0.00 ? 137 LYS A CE   2  
ATOM 4654  N NZ   . LYS A 1 137 ? 0.550   9.107   19.529  1.00 0.00 ? 137 LYS A NZ   2  
ATOM 4655  H H    . LYS A 1 137 ? -0.352  6.663   15.527  1.00 0.00 ? 137 LYS A H    2  
ATOM 4656  H HA   . LYS A 1 137 ? -2.283  8.747   15.479  1.00 0.00 ? 137 LYS A HA   2  
ATOM 4657  H HB2  . LYS A 1 137 ? 0.344   8.347   16.858  1.00 0.00 ? 137 LYS A HB2  2  
ATOM 4658  H HB3  . LYS A 1 137 ? -0.291  9.989   16.792  1.00 0.00 ? 137 LYS A HB3  2  
ATOM 4659  H HG2  . LYS A 1 137 ? -1.591  9.474   18.556  1.00 0.00 ? 137 LYS A HG2  2  
ATOM 4660  H HG3  . LYS A 1 137 ? -2.498  8.406   17.495  1.00 0.00 ? 137 LYS A HG3  2  
ATOM 4661  H HD2  . LYS A 1 137 ? -1.883  6.844   19.043  1.00 0.00 ? 137 LYS A HD2  2  
ATOM 4662  H HD3  . LYS A 1 137 ? -0.418  6.785   18.067  1.00 0.00 ? 137 LYS A HD3  2  
ATOM 4663  H HE2  . LYS A 1 137 ? -0.882  8.105   20.716  1.00 0.00 ? 137 LYS A HE2  2  
ATOM 4664  H HE3  . LYS A 1 137 ? 0.473   7.103   20.192  1.00 0.00 ? 137 LYS A HE3  2  
ATOM 4665  H HZ1  . LYS A 1 137 ? 1.567   8.930   19.647  1.00 0.00 ? 137 LYS A HZ1  2  
ATOM 4666  H HZ2  . LYS A 1 137 ? 0.260   9.894   20.144  1.00 0.00 ? 137 LYS A HZ2  2  
ATOM 4667  H HZ3  . LYS A 1 137 ? 0.357   9.351   18.538  1.00 0.00 ? 137 LYS A HZ3  2  
ATOM 4668  N N    . ALA A 1 138 ? 0.471   9.308   13.799  1.00 0.00 ? 138 ALA A N    2  
ATOM 4669  C CA   . ALA A 1 138 ? 1.038   10.189  12.746  1.00 0.00 ? 138 ALA A CA   2  
ATOM 4670  C C    . ALA A 1 138 ? 0.270   9.969   11.442  1.00 0.00 ? 138 ALA A C    2  
ATOM 4671  O O    . ALA A 1 138 ? -0.100  10.905  10.760  1.00 0.00 ? 138 ALA A O    2  
ATOM 4672  C CB   . ALA A 1 138 ? 2.506   9.852   12.524  1.00 0.00 ? 138 ALA A CB   2  
ATOM 4673  H H    . ALA A 1 138 ? 0.954   8.500   14.074  1.00 0.00 ? 138 ALA A H    2  
ATOM 4674  H HA   . ALA A 1 138 ? 0.952   11.217  13.052  1.00 0.00 ? 138 ALA A HA   2  
ATOM 4675  H HB1  . ALA A 1 138 ? 3.011   9.808   13.476  1.00 0.00 ? 138 ALA A HB1  2  
ATOM 4676  H HB2  . ALA A 1 138 ? 2.956   10.619  11.912  1.00 0.00 ? 138 ALA A HB2  2  
ATOM 4677  H HB3  . ALA A 1 138 ? 2.585   8.895   12.028  1.00 0.00 ? 138 ALA A HB3  2  
ATOM 4678  N N    . ALA A 1 139 ? 0.021   8.734   11.093  1.00 0.00 ? 139 ALA A N    2  
ATOM 4679  C CA   . ALA A 1 139 ? -0.729  8.456   9.837   1.00 0.00 ? 139 ALA A CA   2  
ATOM 4680  C C    . ALA A 1 139 ? -2.085  9.148   9.921   1.00 0.00 ? 139 ALA A C    2  
ATOM 4681  O O    . ALA A 1 139 ? -2.485  9.873   9.032   1.00 0.00 ? 139 ALA A O    2  
ATOM 4682  C CB   . ALA A 1 139 ? -0.936  6.948   9.689   1.00 0.00 ? 139 ALA A CB   2  
ATOM 4683  H H    . ALA A 1 139 ? 0.321   7.993   11.659  1.00 0.00 ? 139 ALA A H    2  
ATOM 4684  H HA   . ALA A 1 139 ? -0.177  8.834   8.990   1.00 0.00 ? 139 ALA A HA   2  
ATOM 4685  H HB1  . ALA A 1 139 ? -1.794  6.643   10.271  1.00 0.00 ? 139 ALA A HB1  2  
ATOM 4686  H HB2  . ALA A 1 139 ? -0.058  6.428   10.044  1.00 0.00 ? 139 ALA A HB2  2  
ATOM 4687  H HB3  . ALA A 1 139 ? -1.100  6.708   8.649   1.00 0.00 ? 139 ALA A HB3  2  
ATOM 4688  N N    . LEU A 1 140 ? -2.781  8.949   11.001  1.00 0.00 ? 140 LEU A N    2  
ATOM 4689  C CA   . LEU A 1 140 ? -4.096  9.615   11.169  1.00 0.00 ? 140 LEU A CA   2  
ATOM 4690  C C    . LEU A 1 140 ? -3.849  11.121  11.240  1.00 0.00 ? 140 LEU A C    2  
ATOM 4691  O O    . LEU A 1 140 ? -4.665  11.924  10.833  1.00 0.00 ? 140 LEU A O    2  
ATOM 4692  C CB   . LEU A 1 140 ? -4.740  9.133   12.475  1.00 0.00 ? 140 LEU A CB   2  
ATOM 4693  C CG   . LEU A 1 140 ? -4.850  7.604   12.461  1.00 0.00 ? 140 LEU A CG   2  
ATOM 4694  C CD1  . LEU A 1 140 ? -4.829  7.076   13.897  1.00 0.00 ? 140 LEU A CD1  2  
ATOM 4695  C CD2  . LEU A 1 140 ? -6.163  7.188   11.796  1.00 0.00 ? 140 LEU A CD2  2  
ATOM 4696  H H    . LEU A 1 140 ? -2.428  8.375   11.714  1.00 0.00 ? 140 LEU A H    2  
ATOM 4697  H HA   . LEU A 1 140 ? -4.737  9.381   10.331  1.00 0.00 ? 140 LEU A HA   2  
ATOM 4698  H HB2  . LEU A 1 140 ? -4.132  9.445   13.312  1.00 0.00 ? 140 LEU A HB2  2  
ATOM 4699  H HB3  . LEU A 1 140 ? -5.727  9.561   12.569  1.00 0.00 ? 140 LEU A HB3  2  
ATOM 4700  H HG   . LEU A 1 140 ? -4.018  7.189   11.913  1.00 0.00 ? 140 LEU A HG   2  
ATOM 4701  H HD11 . LEU A 1 140 ? -5.535  6.266   13.993  1.00 0.00 ? 140 LEU A HD11 2  
ATOM 4702  H HD12 . LEU A 1 140 ? -5.094  7.870   14.578  1.00 0.00 ? 140 LEU A HD12 2  
ATOM 4703  H HD13 . LEU A 1 140 ? -3.835  6.718   14.132  1.00 0.00 ? 140 LEU A HD13 2  
ATOM 4704  H HD21 . LEU A 1 140 ? -6.257  6.113   11.830  1.00 0.00 ? 140 LEU A HD21 2  
ATOM 4705  H HD22 . LEU A 1 140 ? -6.168  7.520   10.769  1.00 0.00 ? 140 LEU A HD22 2  
ATOM 4706  H HD23 . LEU A 1 140 ? -6.993  7.636   12.324  1.00 0.00 ? 140 LEU A HD23 2  
ATOM 4707  N N    . GLN A 1 141 ? -2.716  11.500  11.769  1.00 0.00 ? 141 GLN A N    2  
ATOM 4708  C CA   . GLN A 1 141 ? -2.376  12.945  11.897  1.00 0.00 ? 141 GLN A CA   2  
ATOM 4709  C C    . GLN A 1 141 ? -2.054  13.546  10.529  1.00 0.00 ? 141 GLN A C    2  
ATOM 4710  O O    . GLN A 1 141 ? -2.602  14.560  10.144  1.00 0.00 ? 141 GLN A O    2  
ATOM 4711  C CB   . GLN A 1 141 ? -1.144  13.073  12.790  1.00 0.00 ? 141 GLN A CB   2  
ATOM 4712  C CG   . GLN A 1 141 ? -1.569  13.490  14.198  1.00 0.00 ? 141 GLN A CG   2  
ATOM 4713  C CD   . GLN A 1 141 ? -1.849  14.994  14.220  1.00 0.00 ? 141 GLN A CD   2  
ATOM 4714  O OE1  . GLN A 1 141 ? -2.113  15.560  15.263  1.00 0.00 ? 141 GLN A OE1  2  
ATOM 4715  N NE2  . GLN A 1 141 ? -1.801  15.671  13.105  1.00 0.00 ? 141 GLN A NE2  2  
ATOM 4716  H H    . GLN A 1 141 ? -2.085  10.826  12.092  1.00 0.00 ? 141 GLN A H    2  
ATOM 4717  H HA   . GLN A 1 141 ? -3.202  13.476  12.342  1.00 0.00 ? 141 GLN A HA   2  
ATOM 4718  H HB2  . GLN A 1 141 ? -0.647  12.123  12.834  1.00 0.00 ? 141 GLN A HB2  2  
ATOM 4719  H HB3  . GLN A 1 141 ? -0.469  13.809  12.382  1.00 0.00 ? 141 GLN A HB3  2  
ATOM 4720  H HG2  . GLN A 1 141 ? -2.462  12.952  14.475  1.00 0.00 ? 141 GLN A HG2  2  
ATOM 4721  H HG3  . GLN A 1 141 ? -0.779  13.262  14.895  1.00 0.00 ? 141 GLN A HG3  2  
ATOM 4722  H HE21 . GLN A 1 141 ? -1.589  15.215  12.263  1.00 0.00 ? 141 GLN A HE21 2  
ATOM 4723  H HE22 . GLN A 1 141 ? -1.976  16.635  13.108  1.00 0.00 ? 141 GLN A HE22 2  
ATOM 4724  N N    . GLU A 1 142 ? -1.161  12.942  9.797   1.00 0.00 ? 142 GLU A N    2  
ATOM 4725  C CA   . GLU A 1 142 ? -0.804  13.503  8.466   1.00 0.00 ? 142 GLU A CA   2  
ATOM 4726  C C    . GLU A 1 142 ? -2.008  13.400  7.532   1.00 0.00 ? 142 GLU A C    2  
ATOM 4727  O O    . GLU A 1 142 ? -2.259  14.279  6.736   1.00 0.00 ? 142 GLU A O    2  
ATOM 4728  C CB   . GLU A 1 142 ? 0.379   12.728  7.880   1.00 0.00 ? 142 GLU A CB   2  
ATOM 4729  C CG   . GLU A 1 142 ? 1.594   12.871  8.799   1.00 0.00 ? 142 GLU A CG   2  
ATOM 4730  C CD   . GLU A 1 142 ? 2.806   12.198  8.152   1.00 0.00 ? 142 GLU A CD   2  
ATOM 4731  O OE1  . GLU A 1 142 ? 3.900   12.378  8.662   1.00 0.00 ? 142 GLU A OE1  2  
ATOM 4732  O OE2  . GLU A 1 142 ? 2.619   11.516  7.159   1.00 0.00 ? 142 GLU A OE2  2  
ATOM 4733  H H    . GLU A 1 142 ? -0.720  12.130  10.125  1.00 0.00 ? 142 GLU A H    2  
ATOM 4734  H HA   . GLU A 1 142 ? -0.531  14.543  8.581   1.00 0.00 ? 142 GLU A HA   2  
ATOM 4735  H HB2  . GLU A 1 142 ? 0.118   11.685  7.783   1.00 0.00 ? 142 GLU A HB2  2  
ATOM 4736  H HB3  . GLU A 1 142 ? 0.624   13.131  6.908   1.00 0.00 ? 142 GLU A HB3  2  
ATOM 4737  H HG2  . GLU A 1 142 ? 1.804   13.919  8.958   1.00 0.00 ? 142 GLU A HG2  2  
ATOM 4738  H HG3  . GLU A 1 142 ? 1.384   12.399  9.747   1.00 0.00 ? 142 GLU A HG3  2  
ATOM 4739  H HE2  . GLU A 1 142 ? 3.423   11.126  6.807   1.00 0.00 ? 142 GLU A HE2  2  
ATOM 4740  N N    . GLY A 1 143 ? -2.767  12.341  7.631   1.00 0.00 ? 143 GLY A N    2  
ATOM 4741  C CA   . GLY A 1 143 ? -3.958  12.211  6.748   1.00 0.00 ? 143 GLY A CA   2  
ATOM 4742  C C    . GLY A 1 143 ? -4.857  13.425  6.973   1.00 0.00 ? 143 GLY A C    2  
ATOM 4743  O O    . GLY A 1 143 ? -5.327  14.047  6.042   1.00 0.00 ? 143 GLY A O    2  
ATOM 4744  H H    . GLY A 1 143 ? -2.559  11.643  8.286   1.00 0.00 ? 143 GLY A H    2  
ATOM 4745  H HA2  . GLY A 1 143 ? -3.644  12.176  5.716   1.00 0.00 ? 143 GLY A HA2  2  
ATOM 4746  H HA3  . GLY A 1 143 ? -4.500  11.312  6.997   1.00 0.00 ? 143 GLY A HA3  2  
ATOM 4747  N N    . HIS A 1 144 ? -5.082  13.775  8.209   1.00 0.00 ? 144 HIS A N    2  
ATOM 4748  C CA   . HIS A 1 144 ? -5.928  14.961  8.510   1.00 0.00 ? 144 HIS A CA   2  
ATOM 4749  C C    . HIS A 1 144 ? -5.225  16.216  7.996   1.00 0.00 ? 144 HIS A C    2  
ATOM 4750  O O    . HIS A 1 144 ? -5.832  17.092  7.414   1.00 0.00 ? 144 HIS A O    2  
ATOM 4751  C CB   . HIS A 1 144 ? -6.119  15.074  10.024  1.00 0.00 ? 144 HIS A CB   2  
ATOM 4752  C CG   . HIS A 1 144 ? -6.931  16.298  10.339  1.00 0.00 ? 144 HIS A CG   2  
ATOM 4753  N ND1  . HIS A 1 144 ? -6.345  17.508  10.679  1.00 0.00 ? 144 HIS A ND1  2  
ATOM 4754  C CD2  . HIS A 1 144 ? -8.287  16.516  10.369  1.00 0.00 ? 144 HIS A CD2  2  
ATOM 4755  C CE1  . HIS A 1 144 ? -7.337  18.392  10.900  1.00 0.00 ? 144 HIS A CE1  2  
ATOM 4756  N NE2  . HIS A 1 144 ? -8.536  17.836  10.724  1.00 0.00 ? 144 HIS A NE2  2  
ATOM 4757  H H    . HIS A 1 144 ? -4.679  13.261  8.940   1.00 0.00 ? 144 HIS A H    2  
ATOM 4758  H HA   . HIS A 1 144 ? -6.888  14.856  8.029   1.00 0.00 ? 144 HIS A HA   2  
ATOM 4759  H HB2  . HIS A 1 144 ? -6.633  14.196  10.389  1.00 0.00 ? 144 HIS A HB2  2  
ATOM 4760  H HB3  . HIS A 1 144 ? -5.154  15.151  10.503  1.00 0.00 ? 144 HIS A HB3  2  
ATOM 4761  H HD1  . HIS A 1 144 ? -5.383  17.688  10.750  1.00 0.00 ? 144 HIS A HD1  2  
ATOM 4762  H HD2  . HIS A 1 144 ? -9.041  15.775  10.152  1.00 0.00 ? 144 HIS A HD2  2  
ATOM 4763  H HE1  . HIS A 1 144 ? -7.181  19.421  11.184  1.00 0.00 ? 144 HIS A HE1  2  
ATOM 4764  H HE2  . HIS A 1 144 ? -9.409  18.267  10.824  1.00 0.00 ? 144 HIS A HE2  2  
ATOM 4765  N N    . GLN A 1 145 ? -3.943  16.305  8.220   1.00 0.00 ? 145 GLN A N    2  
ATOM 4766  C CA   . GLN A 1 145 ? -3.177  17.498  7.766   1.00 0.00 ? 145 GLN A CA   2  
ATOM 4767  C C    . GLN A 1 145 ? -3.240  17.623  6.242   1.00 0.00 ? 145 GLN A C    2  
ATOM 4768  O O    . GLN A 1 145 ? -3.388  18.702  5.703   1.00 0.00 ? 145 GLN A O    2  
ATOM 4769  C CB   . GLN A 1 145 ? -1.715  17.337  8.191   1.00 0.00 ? 145 GLN A CB   2  
ATOM 4770  C CG   . GLN A 1 145 ? -0.955  18.634  7.910   1.00 0.00 ? 145 GLN A CG   2  
ATOM 4771  C CD   . GLN A 1 145 ? -1.379  19.707  8.915   1.00 0.00 ? 145 GLN A CD   2  
ATOM 4772  O OE1  . GLN A 1 145 ? -1.274  19.511  10.109  1.00 0.00 ? 145 GLN A OE1  2  
ATOM 4773  N NE2  . GLN A 1 145 ? -1.856  20.839  8.480   1.00 0.00 ? 145 GLN A NE2  2  
ATOM 4774  H H    . GLN A 1 145 ? -3.483  15.584  8.701   1.00 0.00 ? 145 GLN A H    2  
ATOM 4775  H HA   . GLN A 1 145 ? -3.588  18.387  8.219   1.00 0.00 ? 145 GLN A HA   2  
ATOM 4776  H HB2  . GLN A 1 145 ? -1.670  17.110  9.246   1.00 0.00 ? 145 GLN A HB2  2  
ATOM 4777  H HB3  . GLN A 1 145 ? -1.266  16.532  7.631   1.00 0.00 ? 145 GLN A HB3  2  
ATOM 4778  H HG2  . GLN A 1 145 ? 0.107   18.454  7.999   1.00 0.00 ? 145 GLN A HG2  2  
ATOM 4779  H HG3  . GLN A 1 145 ? -1.180  18.972  6.909   1.00 0.00 ? 145 GLN A HG3  2  
ATOM 4780  H HE21 . GLN A 1 145 ? -1.944  20.997  7.517   1.00 0.00 ? 145 GLN A HE21 2  
ATOM 4781  H HE22 . GLN A 1 145 ? -2.128  21.534  9.116   1.00 0.00 ? 145 GLN A HE22 2  
ATOM 4782  N N    . PHE A 1 146 ? -3.108  16.534  5.537   1.00 0.00 ? 146 PHE A N    2  
ATOM 4783  C CA   . PHE A 1 146 ? -3.137  16.605  4.048   1.00 0.00 ? 146 PHE A CA   2  
ATOM 4784  C C    . PHE A 1 146 ? -4.551  16.922  3.549   1.00 0.00 ? 146 PHE A C    2  
ATOM 4785  O O    . PHE A 1 146 ? -4.758  17.860  2.803   1.00 0.00 ? 146 PHE A O    2  
ATOM 4786  C CB   . PHE A 1 146 ? -2.689  15.266  3.465   1.00 0.00 ? 146 PHE A CB   2  
ATOM 4787  C CG   . PHE A 1 146 ? -2.605  15.384  1.963   1.00 0.00 ? 146 PHE A CG   2  
ATOM 4788  C CD1  . PHE A 1 146 ? -3.776  15.376  1.198   1.00 0.00 ? 146 PHE A CD1  2  
ATOM 4789  C CD2  . PHE A 1 146 ? -1.361  15.509  1.335   1.00 0.00 ? 146 PHE A CD2  2  
ATOM 4790  C CE1  . PHE A 1 146 ? -3.706  15.491  -0.193  1.00 0.00 ? 146 PHE A CE1  2  
ATOM 4791  C CE2  . PHE A 1 146 ? -1.289  15.624  -0.059  1.00 0.00 ? 146 PHE A CE2  2  
ATOM 4792  C CZ   . PHE A 1 146 ? -2.463  15.616  -0.823  1.00 0.00 ? 146 PHE A CZ   2  
ATOM 4793  H H    . PHE A 1 146 ? -2.971  15.672  5.984   1.00 0.00 ? 146 PHE A H    2  
ATOM 4794  H HA   . PHE A 1 146 ? -2.461  17.379  3.717   1.00 0.00 ? 146 PHE A HA   2  
ATOM 4795  H HB2  . PHE A 1 146 ? -1.718  15.007  3.864   1.00 0.00 ? 146 PHE A HB2  2  
ATOM 4796  H HB3  . PHE A 1 146 ? -3.404  14.501  3.727   1.00 0.00 ? 146 PHE A HB3  2  
ATOM 4797  H HD1  . PHE A 1 146 ? -4.735  15.283  1.680   1.00 0.00 ? 146 PHE A HD1  2  
ATOM 4798  H HD2  . PHE A 1 146 ? -0.457  15.514  1.924   1.00 0.00 ? 146 PHE A HD2  2  
ATOM 4799  H HE1  . PHE A 1 146 ? -4.614  15.486  -0.777  1.00 0.00 ? 146 PHE A HE1  2  
ATOM 4800  H HE2  . PHE A 1 146 ? -0.329  15.721  -0.543  1.00 0.00 ? 146 PHE A HE2  2  
ATOM 4801  H HZ   . PHE A 1 146 ? -2.409  15.704  -1.899  1.00 0.00 ? 146 PHE A HZ   2  
ATOM 4802  N N    . LEU A 1 147 ? -5.522  16.140  3.931   1.00 0.00 ? 147 LEU A N    2  
ATOM 4803  C CA   . LEU A 1 147 ? -6.914  16.391  3.452   1.00 0.00 ? 147 LEU A CA   2  
ATOM 4804  C C    . LEU A 1 147 ? -7.333  17.817  3.799   1.00 0.00 ? 147 LEU A C    2  
ATOM 4805  O O    . LEU A 1 147 ? -7.991  18.484  3.025   1.00 0.00 ? 147 LEU A O    2  
ATOM 4806  C CB   . LEU A 1 147 ? -7.872  15.397  4.110   1.00 0.00 ? 147 LEU A CB   2  
ATOM 4807  C CG   . LEU A 1 147 ? -7.465  13.975  3.721   1.00 0.00 ? 147 LEU A CG   2  
ATOM 4808  C CD1  . LEU A 1 147 ? -8.427  12.972  4.354   1.00 0.00 ? 147 LEU A CD1  2  
ATOM 4809  C CD2  . LEU A 1 147 ? -7.521  13.823  2.202   1.00 0.00 ? 147 LEU A CD2  2  
ATOM 4810  H H    . LEU A 1 147 ? -5.335  15.376  4.517   1.00 0.00 ? 147 LEU A H    2  
ATOM 4811  H HA   . LEU A 1 147 ? -6.945  16.260  2.385   1.00 0.00 ? 147 LEU A HA   2  
ATOM 4812  H HB2  . LEU A 1 147 ? -7.827  15.508  5.184   1.00 0.00 ? 147 LEU A HB2  2  
ATOM 4813  H HB3  . LEU A 1 147 ? -8.878  15.587  3.768   1.00 0.00 ? 147 LEU A HB3  2  
ATOM 4814  H HG   . LEU A 1 147 ? -6.462  13.783  4.068   1.00 0.00 ? 147 LEU A HG   2  
ATOM 4815  H HD11 . LEU A 1 147 ? -8.383  12.044  3.806   1.00 0.00 ? 147 LEU A HD11 2  
ATOM 4816  H HD12 . LEU A 1 147 ? -9.431  13.366  4.319   1.00 0.00 ? 147 LEU A HD12 2  
ATOM 4817  H HD13 . LEU A 1 147 ? -8.141  12.797  5.383   1.00 0.00 ? 147 LEU A HD13 2  
ATOM 4818  H HD21 . LEU A 1 147 ? -7.704  12.788  1.952   1.00 0.00 ? 147 LEU A HD21 2  
ATOM 4819  H HD22 . LEU A 1 147 ? -6.582  14.133  1.772   1.00 0.00 ? 147 LEU A HD22 2  
ATOM 4820  H HD23 . LEU A 1 147 ? -8.317  14.436  1.805   1.00 0.00 ? 147 LEU A HD23 2  
ATOM 4821  N N    . CYS A 1 148 ? -6.952  18.298  4.947   1.00 0.00 ? 148 CYS A N    2  
ATOM 4822  C CA   . CYS A 1 148 ? -7.326  19.688  5.326   1.00 0.00 ? 148 CYS A CA   2  
ATOM 4823  C C    . CYS A 1 148 ? -6.582  20.663  4.410   1.00 0.00 ? 148 CYS A C    2  
ATOM 4824  O O    . CYS A 1 148 ? -6.881  21.840  4.361   1.00 0.00 ? 148 CYS A O    2  
ATOM 4825  C CB   . CYS A 1 148 ? -6.932  19.947  6.781   1.00 0.00 ? 148 CYS A CB   2  
ATOM 4826  S SG   . CYS A 1 148 ? -7.968  18.947  7.877   1.00 0.00 ? 148 CYS A SG   2  
ATOM 4827  H H    . CYS A 1 148 ? -6.414  17.750  5.556   1.00 0.00 ? 148 CYS A H    2  
ATOM 4828  H HA   . CYS A 1 148 ? -8.391  19.820  5.207   1.00 0.00 ? 148 CYS A HA   2  
ATOM 4829  H HB2  . CYS A 1 148 ? -5.894  19.681  6.924   1.00 0.00 ? 148 CYS A HB2  2  
ATOM 4830  H HB3  . CYS A 1 148 ? -7.070  20.993  7.008   1.00 0.00 ? 148 CYS A HB3  2  
ATOM 4831  H HG   . CYS A 1 148 ? -8.317  19.521  8.561   1.00 0.00 ? 148 CYS A HG   2  
ATOM 4832  N N    . SER A 1 149 ? -5.606  20.177  3.695   1.00 0.00 ? 149 SER A N    2  
ATOM 4833  C CA   . SER A 1 149 ? -4.822  21.059  2.783   1.00 0.00 ? 149 SER A CA   2  
ATOM 4834  C C    . SER A 1 149 ? -5.484  21.125  1.405   1.00 0.00 ? 149 SER A C    2  
ATOM 4835  O O    . SER A 1 149 ? -5.139  21.954  0.585   1.00 0.00 ? 149 SER A O    2  
ATOM 4836  C CB   . SER A 1 149 ? -3.415  20.491  2.629   1.00 0.00 ? 149 SER A CB   2  
ATOM 4837  O OG   . SER A 1 149 ? -2.464  21.468  3.035   1.00 0.00 ? 149 SER A OG   2  
ATOM 4838  H H    . SER A 1 149 ? -5.382  19.223  3.759   1.00 0.00 ? 149 SER A H    2  
ATOM 4839  H HA   . SER A 1 149 ? -4.766  22.051  3.205   1.00 0.00 ? 149 SER A HA   2  
ATOM 4840  H HB2  . SER A 1 149 ? -3.311  19.614  3.249   1.00 0.00 ? 149 SER A HB2  2  
ATOM 4841  H HB3  . SER A 1 149 ? -3.252  20.219  1.593   1.00 0.00 ? 149 SER A HB3  2  
ATOM 4842  H HG   . SER A 1 149 ? -2.148  21.227  3.909   1.00 0.00 ? 149 SER A HG   2  
ATOM 4843  N N    . ILE A 1 150 ? -6.420  20.259  1.130   1.00 0.00 ? 150 ILE A N    2  
ATOM 4844  C CA   . ILE A 1 150 ? -7.078  20.283  -0.205  1.00 0.00 ? 150 ILE A CA   2  
ATOM 4845  C C    . ILE A 1 150 ? -8.120  21.401  -0.234  1.00 0.00 ? 150 ILE A C    2  
ATOM 4846  O O    . ILE A 1 150 ? -7.834  22.543  0.068   1.00 0.00 ? 150 ILE A O    2  
ATOM 4847  C CB   . ILE A 1 150 ? -7.761  18.936  -0.473  1.00 0.00 ? 150 ILE A CB   2  
ATOM 4848  C CG1  . ILE A 1 150 ? -6.939  17.793  0.129   1.00 0.00 ? 150 ILE A CG1  2  
ATOM 4849  C CG2  . ILE A 1 150 ? -7.866  18.721  -1.981  1.00 0.00 ? 150 ILE A CG2  2  
ATOM 4850  C CD1  . ILE A 1 150 ? -7.736  16.491  0.028   1.00 0.00 ? 150 ILE A CD1  2  
ATOM 4851  H H    . ILE A 1 150 ? -6.686  19.591  1.794   1.00 0.00 ? 150 ILE A H    2  
ATOM 4852  H HA   . ILE A 1 150 ? -6.337  20.468  -0.965  1.00 0.00 ? 150 ILE A HA   2  
ATOM 4853  H HB   . ILE A 1 150 ? -8.750  18.938  -0.040  1.00 0.00 ? 150 ILE A HB   2  
ATOM 4854  H HG12 . ILE A 1 150 ? -6.011  17.689  -0.412  1.00 0.00 ? 150 ILE A HG12 2  
ATOM 4855  H HG13 . ILE A 1 150 ? -6.730  18.006  1.165   1.00 0.00 ? 150 ILE A HG13 2  
ATOM 4856  H HG21 . ILE A 1 150 ? -8.193  17.711  -2.177  1.00 0.00 ? 150 ILE A HG21 2  
ATOM 4857  H HG22 . ILE A 1 150 ? -6.897  18.879  -2.434  1.00 0.00 ? 150 ILE A HG22 2  
ATOM 4858  H HG23 . ILE A 1 150 ? -8.577  19.418  -2.396  1.00 0.00 ? 150 ILE A HG23 2  
ATOM 4859  H HD11 . ILE A 1 150 ? -8.507  16.479  0.785   1.00 0.00 ? 150 ILE A HD11 2  
ATOM 4860  H HD12 . ILE A 1 150 ? -7.073  15.650  0.176   1.00 0.00 ? 150 ILE A HD12 2  
ATOM 4861  H HD13 . ILE A 1 150 ? -8.191  16.422  -0.948  1.00 0.00 ? 150 ILE A HD13 2  
ATOM 4862  N N    . GLU A 1 151 ? -9.327  21.076  -0.596  1.00 0.00 ? 151 GLU A N    2  
ATOM 4863  C CA   . GLU A 1 151 ? -10.403 22.106  -0.651  1.00 0.00 ? 151 GLU A CA   2  
ATOM 4864  C C    . GLU A 1 151 ? -11.460 21.794  0.414   1.00 0.00 ? 151 GLU A C    2  
ATOM 4865  O O    . GLU A 1 151 ? -11.353 22.210  1.550   1.00 0.00 ? 151 GLU A O    2  
ATOM 4866  C CB   . GLU A 1 151 ? -11.054 22.089  -2.038  1.00 0.00 ? 151 GLU A CB   2  
ATOM 4867  C CG   . GLU A 1 151 ? -10.028 22.511  -3.091  1.00 0.00 ? 151 GLU A CG   2  
ATOM 4868  C CD   . GLU A 1 151 ? -9.604  23.962  -2.845  1.00 0.00 ? 151 GLU A CD   2  
ATOM 4869  O OE1  . GLU A 1 151 ? -10.310 24.652  -2.128  1.00 0.00 ? 151 GLU A OE1  2  
ATOM 4870  O OE2  . GLU A 1 151 ? -8.577  24.355  -3.377  1.00 0.00 ? 151 GLU A OE2  2  
ATOM 4871  H H    . GLU A 1 151 ? -9.525  20.148  -0.833  1.00 0.00 ? 151 GLU A H    2  
ATOM 4872  H HA   . GLU A 1 151 ? -9.980  23.082  -0.463  1.00 0.00 ? 151 GLU A HA   2  
ATOM 4873  H HB2  . GLU A 1 151 ? -11.407 21.090  -2.257  1.00 0.00 ? 151 GLU A HB2  2  
ATOM 4874  H HB3  . GLU A 1 151 ? -11.887 22.776  -2.052  1.00 0.00 ? 151 GLU A HB3  2  
ATOM 4875  H HG2  . GLU A 1 151 ? -9.164  21.867  -3.030  1.00 0.00 ? 151 GLU A HG2  2  
ATOM 4876  H HG3  . GLU A 1 151 ? -10.467 22.430  -4.074  1.00 0.00 ? 151 GLU A HG3  2  
ATOM 4877  H HE2  . GLU A 1 151 ? -8.372  25.271  -3.179  1.00 0.00 ? 151 GLU A HE2  2  
ATOM 4878  N N    . ALA A 1 152 ? -12.478 21.063  0.054   1.00 0.00 ? 152 ALA A N    2  
ATOM 4879  C CA   . ALA A 1 152 ? -13.542 20.722  1.041   1.00 0.00 ? 152 ALA A CA   2  
ATOM 4880  C C    . ALA A 1 152 ? -14.502 19.705  0.423   1.00 0.00 ? 152 ALA A C    2  
ATOM 4881  O O    . ALA A 1 152 ? -15.701 19.774  0.612   1.00 0.00 ? 152 ALA A O    2  
ATOM 4882  C CB   . ALA A 1 152 ? -14.313 21.989  1.418   1.00 0.00 ? 152 ALA A CB   2  
ATOM 4883  H H    . ALA A 1 152 ? -12.543 20.737  -0.868  1.00 0.00 ? 152 ALA A H    2  
ATOM 4884  H HA   . ALA A 1 152 ? -13.091 20.299  1.925   1.00 0.00 ? 152 ALA A HA   2  
ATOM 4885  H HB1  . ALA A 1 152 ? -14.843 21.824  2.344   1.00 0.00 ? 152 ALA A HB1  2  
ATOM 4886  H HB2  . ALA A 1 152 ? -15.019 22.229  0.637   1.00 0.00 ? 152 ALA A HB2  2  
ATOM 4887  H HB3  . ALA A 1 152 ? -13.621 22.808  1.542   1.00 0.00 ? 152 ALA A HB3  2  
ATOM 4888  N N    . LEU A 1 153 ? -13.985 18.763  -0.316  1.00 0.00 ? 153 LEU A N    2  
ATOM 4889  C CA   . LEU A 1 153 ? -14.862 17.738  -0.948  1.00 0.00 ? 153 LEU A CA   2  
ATOM 4890  C C    . LEU A 1 153 ? -14.583 16.372  -0.318  1.00 0.00 ? 153 LEU A C    2  
ATOM 4891  O O    . LEU A 1 153 ? -13.752 16.252  0.579   1.00 0.00 ? 153 LEU A O    2  
ATOM 4892  C CB   . LEU A 1 153 ? -14.573 17.679  -2.449  1.00 0.00 ? 153 LEU A CB   2  
ATOM 4893  C CG   . LEU A 1 153 ? -15.513 16.670  -3.116  1.00 0.00 ? 153 LEU A CG   2  
ATOM 4894  C CD1  . LEU A 1 153 ? -16.953 17.179  -3.036  1.00 0.00 ? 153 LEU A CD1  2  
ATOM 4895  C CD2  . LEU A 1 153 ? -15.118 16.495  -4.584  1.00 0.00 ? 153 LEU A CD2  2  
ATOM 4896  H H    . LEU A 1 153 ? -13.015 18.729  -0.455  1.00 0.00 ? 153 LEU A H    2  
ATOM 4897  H HA   . LEU A 1 153 ? -15.898 18.003  -0.790  1.00 0.00 ? 153 LEU A HA   2  
ATOM 4898  H HB2  . LEU A 1 153 ? -14.726 18.657  -2.884  1.00 0.00 ? 153 LEU A HB2  2  
ATOM 4899  H HB3  . LEU A 1 153 ? -13.550 17.372  -2.606  1.00 0.00 ? 153 LEU A HB3  2  
ATOM 4900  H HG   . LEU A 1 153 ? -15.441 15.719  -2.607  1.00 0.00 ? 153 LEU A HG   2  
ATOM 4901  H HD11 . LEU A 1 153 ? -17.412 16.817  -2.129  1.00 0.00 ? 153 LEU A HD11 2  
ATOM 4902  H HD12 . LEU A 1 153 ? -17.508 16.819  -3.891  1.00 0.00 ? 153 LEU A HD12 2  
ATOM 4903  H HD13 . LEU A 1 153 ? -16.953 18.259  -3.037  1.00 0.00 ? 153 LEU A HD13 2  
ATOM 4904  H HD21 . LEU A 1 153 ? -15.245 15.462  -4.871  1.00 0.00 ? 153 LEU A HD21 2  
ATOM 4905  H HD22 . LEU A 1 153 ? -14.086 16.781  -4.717  1.00 0.00 ? 153 LEU A HD22 2  
ATOM 4906  H HD23 . LEU A 1 153 ? -15.747 17.119  -5.202  1.00 0.00 ? 153 LEU A HD23 2  
ATOM 4907  N N    . GLY A 1 1   ? 12.529  -18.825 -2.371  1.00 0.00 ? 1   GLY A N    3  
ATOM 4908  C CA   . GLY A 1 1   ? 12.612  -17.594 -3.131  1.00 0.00 ? 1   GLY A CA   3  
ATOM 4909  C C    . GLY A 1 1   ? 13.308  -16.515 -2.313  1.00 0.00 ? 1   GLY A C    3  
ATOM 4910  O O    . GLY A 1 1   ? 12.741  -15.995 -1.355  1.00 0.00 ? 1   GLY A O    3  
ATOM 4911  H H1   . GLY A 1 1   ? 12.916  -18.842 -1.438  1.00 0.00 ? 1   GLY A H1   3  
ATOM 4912  H HA2  . GLY A 1 1   ? 13.175  -17.773 -4.047  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4913  H HA3  . GLY A 1 1   ? 11.606  -17.260 -3.386  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4914  N N    . PRO A 1 2   ? 14.543  -16.181 -2.694  1.00 0.00 ? 2   PRO A N    3  
ATOM 4915  C CA   . PRO A 1 2   ? 15.355  -15.177 -2.040  1.00 0.00 ? 2   PRO A CA   3  
ATOM 4916  C C    . PRO A 1 2   ? 14.807  -13.793 -2.353  1.00 0.00 ? 2   PRO A C    3  
ATOM 4917  O O    . PRO A 1 2   ? 14.951  -12.870 -1.554  1.00 0.00 ? 2   PRO A O    3  
ATOM 4918  C CB   . PRO A 1 2   ? 16.752  -15.359 -2.629  1.00 0.00 ? 2   PRO A CB   3  
ATOM 4919  C CG   . PRO A 1 2   ? 16.461  -15.882 -4.035  1.00 0.00 ? 2   PRO A CG   3  
ATOM 4920  C CD   . PRO A 1 2   ? 15.241  -16.773 -3.815  1.00 0.00 ? 2   PRO A CD   3  
ATOM 4921  H HA   . PRO A 1 2   ? 15.375  -15.332 -0.961  1.00 0.00 ? 2   PRO A HA   3  
ATOM 4922  H HB2  . PRO A 1 2   ? 17.321  -14.429 -2.640  1.00 0.00 ? 2   PRO A HB2  3  
ATOM 4923  H HB3  . PRO A 1 2   ? 17.281  -16.128 -2.066  1.00 0.00 ? 2   PRO A HB3  3  
ATOM 4924  H HG2  . PRO A 1 2   ? 16.184  -15.045 -4.676  1.00 0.00 ? 2   PRO A HG2  3  
ATOM 4925  H HG3  . PRO A 1 2   ? 17.303  -16.430 -4.457  1.00 0.00 ? 2   PRO A HG3  3  
ATOM 4926  H HD2  . PRO A 1 2   ? 14.615  -16.801 -4.707  1.00 0.00 ? 2   PRO A HD2  3  
ATOM 4927  H HD3  . PRO A 1 2   ? 15.561  -17.779 -3.544  1.00 0.00 ? 2   PRO A HD3  3  
ATOM 4928  N N    . LEU A 1 3   ? 14.187  -13.605 -3.478  1.00 0.00 ? 3   LEU A N    3  
ATOM 4929  C CA   . LEU A 1 3   ? 13.635  -12.264 -3.825  1.00 0.00 ? 3   LEU A CA   3  
ATOM 4930  C C    . LEU A 1 3   ? 12.230  -12.123 -3.236  1.00 0.00 ? 3   LEU A C    3  
ATOM 4931  O O    . LEU A 1 3   ? 11.410  -13.013 -3.335  1.00 0.00 ? 3   LEU A O    3  
ATOM 4932  C CB   . LEU A 1 3   ? 13.566  -12.115 -5.345  1.00 0.00 ? 3   LEU A CB   3  
ATOM 4933  C CG   . LEU A 1 3   ? 14.977  -12.181 -5.931  1.00 0.00 ? 3   LEU A CG   3  
ATOM 4934  C CD1  . LEU A 1 3   ? 15.530  -13.600 -5.789  1.00 0.00 ? 3   LEU A CD1  3  
ATOM 4935  C CD2  . LEU A 1 3   ? 14.931  -11.800 -7.414  1.00 0.00 ? 3   LEU A CD2  3  
ATOM 4936  H H    . LEU A 1 3   ? 14.084  -14.355 -4.100  1.00 0.00 ? 3   LEU A H    3  
ATOM 4937  H HA   . LEU A 1 3   ? 14.274  -11.496 -3.417  1.00 0.00 ? 3   LEU A HA   3  
ATOM 4938  H HB2  . LEU A 1 3   ? 12.964  -12.913 -5.759  1.00 0.00 ? 3   LEU A HB2  3  
ATOM 4939  H HB3  . LEU A 1 3   ? 13.119  -11.164 -5.592  1.00 0.00 ? 3   LEU A HB3  3  
ATOM 4940  H HG   . LEU A 1 3   ? 15.617  -11.490 -5.401  1.00 0.00 ? 3   LEU A HG   3  
ATOM 4941  H HD11 . LEU A 1 3   ? 16.149  -13.832 -6.643  1.00 0.00 ? 3   LEU A HD11 3  
ATOM 4942  H HD12 . LEU A 1 3   ? 14.713  -14.302 -5.733  1.00 0.00 ? 3   LEU A HD12 3  
ATOM 4943  H HD13 . LEU A 1 3   ? 16.123  -13.666 -4.889  1.00 0.00 ? 3   LEU A HD13 3  
ATOM 4944  H HD21 . LEU A 1 3   ? 15.547  -10.929 -7.579  1.00 0.00 ? 3   LEU A HD21 3  
ATOM 4945  H HD22 . LEU A 1 3   ? 13.913  -11.579 -7.697  1.00 0.00 ? 3   LEU A HD22 3  
ATOM 4946  H HD23 . LEU A 1 3   ? 15.302  -12.622 -8.008  1.00 0.00 ? 3   LEU A HD23 3  
ATOM 4947  N N    . GLY A 1 4   ? 11.951  -11.008 -2.620  1.00 0.00 ? 4   GLY A N    3  
ATOM 4948  C CA   . GLY A 1 4   ? 10.602  -10.803 -2.020  1.00 0.00 ? 4   GLY A CA   3  
ATOM 4949  C C    . GLY A 1 4   ? 10.626  -11.270 -0.565  1.00 0.00 ? 4   GLY A C    3  
ATOM 4950  O O    . GLY A 1 4   ? 9.678   -11.083 0.174   1.00 0.00 ? 4   GLY A O    3  
ATOM 4951  H H    . GLY A 1 4   ? 12.629  -10.304 -2.550  1.00 0.00 ? 4   GLY A H    3  
ATOM 4952  H HA2  . GLY A 1 4   ? 10.345  -9.754  -2.062  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 4953  H HA3  . GLY A 1 4   ? 9.870   -11.377 -2.568  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 4954  N N    . SER A 1 5   ? 11.704  -11.873 -0.146  1.00 0.00 ? 5   SER A N    3  
ATOM 4955  C CA   . SER A 1 5   ? 11.794  -12.350 1.260   1.00 0.00 ? 5   SER A CA   3  
ATOM 4956  C C    . SER A 1 5   ? 12.252  -11.197 2.155   1.00 0.00 ? 5   SER A C    3  
ATOM 4957  O O    . SER A 1 5   ? 12.426  -11.357 3.346   1.00 0.00 ? 5   SER A O    3  
ATOM 4958  C CB   . SER A 1 5   ? 12.803  -13.496 1.347   1.00 0.00 ? 5   SER A CB   3  
ATOM 4959  O OG   . SER A 1 5   ? 12.313  -14.612 0.616   1.00 0.00 ? 5   SER A OG   3  
ATOM 4960  H H    . SER A 1 5   ? 12.457  -12.011 -0.760  1.00 0.00 ? 5   SER A H    3  
ATOM 4961  H HA   . SER A 1 5   ? 10.825  -12.697 1.585   1.00 0.00 ? 5   SER A HA   3  
ATOM 4962  H HB2  . SER A 1 5   ? 13.745  -13.184 0.926   1.00 0.00 ? 5   SER A HB2  3  
ATOM 4963  H HB3  . SER A 1 5   ? 12.949  -13.769 2.386   1.00 0.00 ? 5   SER A HB3  3  
ATOM 4964  H HG   . SER A 1 5   ? 12.900  -14.759 -0.131  1.00 0.00 ? 5   SER A HG   3  
ATOM 4965  N N    . MET A 1 6   ? 12.447  -10.038 1.589   1.00 0.00 ? 6   MET A N    3  
ATOM 4966  C CA   . MET A 1 6   ? 12.895  -8.878  2.409   1.00 0.00 ? 6   MET A CA   3  
ATOM 4967  C C    . MET A 1 6   ? 11.679  -8.195  3.036   1.00 0.00 ? 6   MET A C    3  
ATOM 4968  O O    . MET A 1 6   ? 10.806  -7.706  2.347   1.00 0.00 ? 6   MET A O    3  
ATOM 4969  C CB   . MET A 1 6   ? 13.629  -7.873  1.521   1.00 0.00 ? 6   MET A CB   3  
ATOM 4970  C CG   . MET A 1 6   ? 14.270  -6.797  2.400   1.00 0.00 ? 6   MET A CG   3  
ATOM 4971  S SD   . MET A 1 6   ? 14.291  -5.223  1.511   1.00 0.00 ? 6   MET A SD   3  
ATOM 4972  C CE   . MET A 1 6   ? 13.051  -4.381  2.526   1.00 0.00 ? 6   MET A CE   3  
ATOM 4973  H H    . MET A 1 6   ? 12.301  -9.931  0.626   1.00 0.00 ? 6   MET A H    3  
ATOM 4974  H HA   . MET A 1 6   ? 13.558  -9.222  3.189   1.00 0.00 ? 6   MET A HA   3  
ATOM 4975  H HB2  . MET A 1 6   ? 14.394  -8.382  0.956   1.00 0.00 ? 6   MET A HB2  3  
ATOM 4976  H HB3  . MET A 1 6   ? 12.926  -7.408  0.845   1.00 0.00 ? 6   MET A HB3  3  
ATOM 4977  H HG2  . MET A 1 6   ? 13.700  -6.688  3.310   1.00 0.00 ? 6   MET A HG2  3  
ATOM 4978  H HG3  . MET A 1 6   ? 15.283  -7.087  2.642   1.00 0.00 ? 6   MET A HG3  3  
ATOM 4979  H HE1  . MET A 1 6   ? 12.114  -4.916  2.466   1.00 0.00 ? 6   MET A HE1  3  
ATOM 4980  H HE2  . MET A 1 6   ? 12.911  -3.375  2.167   1.00 0.00 ? 6   MET A HE2  3  
ATOM 4981  H HE3  . MET A 1 6   ? 13.388  -4.352  3.553   1.00 0.00 ? 6   MET A HE3  3  
ATOM 4982  N N    . ALA A 1 7   ? 11.623  -8.150  4.338   1.00 0.00 ? 7   ALA A N    3  
ATOM 4983  C CA   . ALA A 1 7   ? 10.470  -7.492  5.020   1.00 0.00 ? 7   ALA A CA   3  
ATOM 4984  C C    . ALA A 1 7   ? 9.156   -7.987  4.422   1.00 0.00 ? 7   ALA A C    3  
ATOM 4985  O O    . ALA A 1 7   ? 9.127   -8.649  3.406   1.00 0.00 ? 7   ALA A O    3  
ATOM 4986  C CB   . ALA A 1 7   ? 10.564  -5.975  4.846   1.00 0.00 ? 7   ALA A CB   3  
ATOM 4987  H H    . ALA A 1 7   ? 12.343  -8.543  4.871   1.00 0.00 ? 7   ALA A H    3  
ATOM 4988  H HA   . ALA A 1 7   ? 10.493  -7.736  6.073   1.00 0.00 ? 7   ALA A HA   3  
ATOM 4989  H HB1  . ALA A 1 7   ? 10.252  -5.708  3.846   1.00 0.00 ? 7   ALA A HB1  3  
ATOM 4990  H HB2  . ALA A 1 7   ? 11.582  -5.656  5.003   1.00 0.00 ? 7   ALA A HB2  3  
ATOM 4991  H HB3  . ALA A 1 7   ? 9.921   -5.489  5.567   1.00 0.00 ? 7   ALA A HB3  3  
ATOM 4992  N N    . LEU A 1 8   ? 8.065   -7.668  5.056   1.00 0.00 ? 8   LEU A N    3  
ATOM 4993  C CA   . LEU A 1 8   ? 6.743   -8.116  4.540   1.00 0.00 ? 8   LEU A CA   3  
ATOM 4994  C C    . LEU A 1 8   ? 6.014   -6.932  3.899   1.00 0.00 ? 8   LEU A C    3  
ATOM 4995  O O    . LEU A 1 8   ? 6.049   -5.826  4.399   1.00 0.00 ? 8   LEU A O    3  
ATOM 4996  C CB   . LEU A 1 8   ? 5.898   -8.654  5.693   1.00 0.00 ? 8   LEU A CB   3  
ATOM 4997  C CG   . LEU A 1 8   ? 6.792   -9.366  6.714   1.00 0.00 ? 8   LEU A CG   3  
ATOM 4998  C CD1  . LEU A 1 8   ? 7.505   -8.339  7.597   1.00 0.00 ? 8   LEU A CD1  3  
ATOM 4999  C CD2  . LEU A 1 8   ? 5.927   -10.258 7.600   1.00 0.00 ? 8   LEU A CD2  3  
ATOM 5000  H H    . LEU A 1 8   ? 8.117   -7.136  5.879   1.00 0.00 ? 8   LEU A H    3  
ATOM 5001  H HA   . LEU A 1 8   ? 6.887   -8.893  3.805   1.00 0.00 ? 8   LEU A HA   3  
ATOM 5002  H HB2  . LEU A 1 8   ? 5.384   -7.839  6.166   1.00 0.00 ? 8   LEU A HB2  3  
ATOM 5003  H HB3  . LEU A 1 8   ? 5.173   -9.356  5.306   1.00 0.00 ? 8   LEU A HB3  3  
ATOM 5004  H HG   . LEU A 1 8   ? 7.525   -9.968  6.196   1.00 0.00 ? 8   LEU A HG   3  
ATOM 5005  H HD11 . LEU A 1 8   ? 8.494   -8.145  7.206   1.00 0.00 ? 8   LEU A HD11 3  
ATOM 5006  H HD12 . LEU A 1 8   ? 7.587   -8.726  8.598   1.00 0.00 ? 8   LEU A HD12 3  
ATOM 5007  H HD13 . LEU A 1 8   ? 6.936   -7.424  7.618   1.00 0.00 ? 8   LEU A HD13 3  
ATOM 5008  H HD21 . LEU A 1 8   ? 6.430   -10.424 8.541   1.00 0.00 ? 8   LEU A HD21 3  
ATOM 5009  H HD22 . LEU A 1 8   ? 5.763   -11.205 7.107   1.00 0.00 ? 8   LEU A HD22 3  
ATOM 5010  H HD23 . LEU A 1 8   ? 4.979   -9.773  7.781   1.00 0.00 ? 8   LEU A HD23 3  
ATOM 5011  N N    . ARG A 1 9   ? 5.344   -7.158  2.803   1.00 0.00 ? 9   ARG A N    3  
ATOM 5012  C CA   . ARG A 1 9   ? 4.599   -6.049  2.140   1.00 0.00 ? 9   ARG A CA   3  
ATOM 5013  C C    . ARG A 1 9   ? 3.168   -6.016  2.684   1.00 0.00 ? 9   ARG A C    3  
ATOM 5014  O O    . ARG A 1 9   ? 2.528   -7.040  2.828   1.00 0.00 ? 9   ARG A O    3  
ATOM 5015  C CB   . ARG A 1 9   ? 4.565   -6.291  0.630   1.00 0.00 ? 9   ARG A CB   3  
ATOM 5016  C CG   . ARG A 1 9   ? 4.102   -5.021  -0.084  1.00 0.00 ? 9   ARG A CG   3  
ATOM 5017  C CD   . ARG A 1 9   ? 4.043   -5.278  -1.591  1.00 0.00 ? 9   ARG A CD   3  
ATOM 5018  N NE   . ARG A 1 9   ? 3.744   -4.005  -2.307  1.00 0.00 ? 9   ARG A NE   3  
ATOM 5019  C CZ   . ARG A 1 9   ? 4.666   -3.090  -2.424  1.00 0.00 ? 9   ARG A CZ   3  
ATOM 5020  N NH1  . ARG A 1 9   ? 5.843   -3.279  -1.892  1.00 0.00 ? 9   ARG A NH1  3  
ATOM 5021  N NH2  . ARG A 1 9   ? 4.409   -1.983  -3.067  1.00 0.00 ? 9   ARG A NH2  3  
ATOM 5022  H H    . ARG A 1 9   ? 5.318   -8.060  2.421   1.00 0.00 ? 9   ARG A H    3  
ATOM 5023  H HA   . ARG A 1 9   ? 5.088   -5.109  2.347   1.00 0.00 ? 9   ARG A HA   3  
ATOM 5024  H HB2  . ARG A 1 9   ? 5.553   -6.560  0.286   1.00 0.00 ? 9   ARG A HB2  3  
ATOM 5025  H HB3  . ARG A 1 9   ? 3.878   -7.093  0.409   1.00 0.00 ? 9   ARG A HB3  3  
ATOM 5026  H HG2  . ARG A 1 9   ? 3.122   -4.742  0.273   1.00 0.00 ? 9   ARG A HG2  3  
ATOM 5027  H HG3  . ARG A 1 9   ? 4.801   -4.220  0.115   1.00 0.00 ? 9   ARG A HG3  3  
ATOM 5028  H HD2  . ARG A 1 9   ? 4.995   -5.664  -1.927  1.00 0.00 ? 9   ARG A HD2  3  
ATOM 5029  H HD3  . ARG A 1 9   ? 3.269   -6.001  -1.802  1.00 0.00 ? 9   ARG A HD3  3  
ATOM 5030  H HE   . ARG A 1 9   ? 2.858   -3.861  -2.697  1.00 0.00 ? 9   ARG A HE   3  
ATOM 5031  H HH11 . ARG A 1 9   ? 6.039   -4.124  -1.398  1.00 0.00 ? 9   ARG A HH11 3  
ATOM 5032  H HH12 . ARG A 1 9   ? 6.549   -2.577  -1.981  1.00 0.00 ? 9   ARG A HH12 3  
ATOM 5033  H HH21 . ARG A 1 9   ? 3.506   -1.837  -3.470  1.00 0.00 ? 9   ARG A HH21 3  
ATOM 5034  H HH22 . ARG A 1 9   ? 5.117   -1.282  -3.156  1.00 0.00 ? 9   ARG A HH22 3  
ATOM 5035  N N    . ALA A 1 10  ? 2.658   -4.855  2.993   1.00 0.00 ? 10  ALA A N    3  
ATOM 5036  C CA   . ALA A 1 10  ? 1.270   -4.780  3.533   1.00 0.00 ? 10  ALA A CA   3  
ATOM 5037  C C    . ALA A 1 10  ? 0.563   -3.543  2.985   1.00 0.00 ? 10  ALA A C    3  
ATOM 5038  O O    . ALA A 1 10  ? 1.187   -2.572  2.605   1.00 0.00 ? 10  ALA A O    3  
ATOM 5039  C CB   . ALA A 1 10  ? 1.317   -4.681  5.057   1.00 0.00 ? 10  ALA A CB   3  
ATOM 5040  H H    . ALA A 1 10  ? 3.185   -4.038  2.875   1.00 0.00 ? 10  ALA A H    3  
ATOM 5041  H HA   . ALA A 1 10  ? 0.722   -5.664  3.247   1.00 0.00 ? 10  ALA A HA   3  
ATOM 5042  H HB1  . ALA A 1 10  ? 0.970   -5.607  5.489   1.00 0.00 ? 10  ALA A HB1  3  
ATOM 5043  H HB2  . ALA A 1 10  ? 0.681   -3.868  5.382   1.00 0.00 ? 10  ALA A HB2  3  
ATOM 5044  H HB3  . ALA A 1 10  ? 2.332   -4.491  5.373   1.00 0.00 ? 10  ALA A HB3  3  
ATOM 5045  N N    . CYS A 1 11  ? -0.742  -3.567  2.953   1.00 0.00 ? 11  CYS A N    3  
ATOM 5046  C CA   . CYS A 1 11  ? -1.491  -2.390  2.444   1.00 0.00 ? 11  CYS A CA   3  
ATOM 5047  C C    . CYS A 1 11  ? -2.821  -2.269  3.191   1.00 0.00 ? 11  CYS A C    3  
ATOM 5048  O O    . CYS A 1 11  ? -3.623  -3.183  3.208   1.00 0.00 ? 11  CYS A O    3  
ATOM 5049  C CB   . CYS A 1 11  ? -1.759  -2.563  0.948   1.00 0.00 ? 11  CYS A CB   3  
ATOM 5050  S SG   . CYS A 1 11  ? -0.507  -1.660  0.004   1.00 0.00 ? 11  CYS A SG   3  
ATOM 5051  H H    . CYS A 1 11  ? -1.225  -4.358  3.272   1.00 0.00 ? 11  CYS A H    3  
ATOM 5052  H HA   . CYS A 1 11  ? -0.906  -1.496  2.602   1.00 0.00 ? 11  CYS A HA   3  
ATOM 5053  H HB2  . CYS A 1 11  ? -1.716  -3.613  0.692   1.00 0.00 ? 11  CYS A HB2  3  
ATOM 5054  H HB3  . CYS A 1 11  ? -2.739  -2.174  0.712   1.00 0.00 ? 11  CYS A HB3  3  
ATOM 5055  H HG   . CYS A 1 11  ? 0.356   -1.925  0.329   1.00 0.00 ? 11  CYS A HG   3  
ATOM 5056  N N    . GLY A 1 12  ? -3.064  -1.140  3.794   1.00 0.00 ? 12  GLY A N    3  
ATOM 5057  C CA   . GLY A 1 12  ? -4.346  -0.944  4.531   1.00 0.00 ? 12  GLY A CA   3  
ATOM 5058  C C    . GLY A 1 12  ? -5.002  0.345   4.043   1.00 0.00 ? 12  GLY A C    3  
ATOM 5059  O O    . GLY A 1 12  ? -4.448  1.055   3.228   1.00 0.00 ? 12  GLY A O    3  
ATOM 5060  H H    . GLY A 1 12  ? -2.405  -0.417  3.760   1.00 0.00 ? 12  GLY A H    3  
ATOM 5061  H HA2  . GLY A 1 12  ? -5.004  -1.778  4.341   1.00 0.00 ? 12  GLY A HA2  3  
ATOM 5062  H HA3  . GLY A 1 12  ? -4.151  -0.869  5.590   1.00 0.00 ? 12  GLY A HA3  3  
ATOM 5063  N N    . LEU A 1 13  ? -6.181  0.655   4.514   1.00 0.00 ? 13  LEU A N    3  
ATOM 5064  C CA   . LEU A 1 13  ? -6.849  1.900   4.041   1.00 0.00 ? 13  LEU A CA   3  
ATOM 5065  C C    . LEU A 1 13  ? -7.172  2.831   5.208   1.00 0.00 ? 13  LEU A C    3  
ATOM 5066  O O    . LEU A 1 13  ? -7.973  2.514   6.062   1.00 0.00 ? 13  LEU A O    3  
ATOM 5067  C CB   . LEU A 1 13  ? -8.171  1.541   3.343   1.00 0.00 ? 13  LEU A CB   3  
ATOM 5068  C CG   . LEU A 1 13  ? -8.083  1.840   1.843   1.00 0.00 ? 13  LEU A CG   3  
ATOM 5069  C CD1  . LEU A 1 13  ? -9.462  1.677   1.197   1.00 0.00 ? 13  LEU A CD1  3  
ATOM 5070  C CD2  . LEU A 1 13  ? -7.603  3.276   1.626   1.00 0.00 ? 13  LEU A CD2  3  
ATOM 5071  H H    . LEU A 1 13  ? -6.624  0.070   5.164   1.00 0.00 ? 13  LEU A H    3  
ATOM 5072  H HA   . LEU A 1 13  ? -6.204  2.410   3.346   1.00 0.00 ? 13  LEU A HA   3  
ATOM 5073  H HB2  . LEU A 1 13  ? -8.377  0.493   3.488   1.00 0.00 ? 13  LEU A HB2  3  
ATOM 5074  H HB3  . LEU A 1 13  ? -8.971  2.125   3.775   1.00 0.00 ? 13  LEU A HB3  3  
ATOM 5075  H HG   . LEU A 1 13  ? -7.392  1.154   1.386   1.00 0.00 ? 13  LEU A HG   3  
ATOM 5076  H HD11 . LEU A 1 13  ? -9.477  0.777   0.602   1.00 0.00 ? 13  LEU A HD11 3  
ATOM 5077  H HD12 . LEU A 1 13  ? -9.663  2.530   0.564   1.00 0.00 ? 13  LEU A HD12 3  
ATOM 5078  H HD13 . LEU A 1 13  ? -10.218 1.613   1.967   1.00 0.00 ? 13  LEU A HD13 3  
ATOM 5079  H HD21 . LEU A 1 13  ? -6.556  3.268   1.369   1.00 0.00 ? 13  LEU A HD21 3  
ATOM 5080  H HD22 . LEU A 1 13  ? -7.751  3.847   2.531   1.00 0.00 ? 13  LEU A HD22 3  
ATOM 5081  H HD23 . LEU A 1 13  ? -8.167  3.724   0.824   1.00 0.00 ? 13  LEU A HD23 3  
ATOM 5082  N N    . ILE A 1 14  ? -6.608  4.008   5.214   1.00 0.00 ? 14  ILE A N    3  
ATOM 5083  C CA   . ILE A 1 14  ? -6.960  4.973   6.286   1.00 0.00 ? 14  ILE A CA   3  
ATOM 5084  C C    . ILE A 1 14  ? -8.227  5.669   5.814   1.00 0.00 ? 14  ILE A C    3  
ATOM 5085  O O    . ILE A 1 14  ? -8.211  6.487   4.917   1.00 0.00 ? 14  ILE A O    3  
ATOM 5086  C CB   . ILE A 1 14  ? -5.830  5.978   6.504   1.00 0.00 ? 14  ILE A CB   3  
ATOM 5087  C CG1  . ILE A 1 14  ? -4.673  5.272   7.217   1.00 0.00 ? 14  ILE A CG1  3  
ATOM 5088  C CG2  . ILE A 1 14  ? -6.332  7.138   7.368   1.00 0.00 ? 14  ILE A CG2  3  
ATOM 5089  C CD1  . ILE A 1 14  ? -3.456  6.196   7.276   1.00 0.00 ? 14  ILE A CD1  3  
ATOM 5090  H H    . ILE A 1 14  ? -6.005  4.273   4.489   1.00 0.00 ? 14  ILE A H    3  
ATOM 5091  H HA   . ILE A 1 14  ? -7.162  4.436   7.203   1.00 0.00 ? 14  ILE A HA   3  
ATOM 5092  H HB   . ILE A 1 14  ? -5.493  6.357   5.550   1.00 0.00 ? 14  ILE A HB   3  
ATOM 5093  H HG12 . ILE A 1 14  ? -4.978  5.015   8.220   1.00 0.00 ? 14  ILE A HG12 3  
ATOM 5094  H HG13 . ILE A 1 14  ? -4.420  4.374   6.680   1.00 0.00 ? 14  ILE A HG13 3  
ATOM 5095  H HG21 . ILE A 1 14  ? -5.548  7.447   8.044   1.00 0.00 ? 14  ILE A HG21 3  
ATOM 5096  H HG22 . ILE A 1 14  ? -7.194  6.818   7.935   1.00 0.00 ? 14  ILE A HG22 3  
ATOM 5097  H HG23 . ILE A 1 14  ? -6.603  7.968   6.734   1.00 0.00 ? 14  ILE A HG23 3  
ATOM 5098  H HD11 . ILE A 1 14  ? -2.557  5.600   7.303   1.00 0.00 ? 14  ILE A HD11 3  
ATOM 5099  H HD12 . ILE A 1 14  ? -3.509  6.803   8.167   1.00 0.00 ? 14  ILE A HD12 3  
ATOM 5100  H HD13 . ILE A 1 14  ? -3.442  6.834   6.405   1.00 0.00 ? 14  ILE A HD13 3  
ATOM 5101  N N    . ILE A 1 15  ? -9.330  5.292   6.371   1.00 0.00 ? 15  ILE A N    3  
ATOM 5102  C CA   . ILE A 1 15  ? -10.628 5.855   5.929   1.00 0.00 ? 15  ILE A CA   3  
ATOM 5103  C C    . ILE A 1 15  ? -11.020 7.051   6.788   1.00 0.00 ? 15  ILE A C    3  
ATOM 5104  O O    . ILE A 1 15  ? -10.863 7.047   7.992   1.00 0.00 ? 15  ILE A O    3  
ATOM 5105  C CB   . ILE A 1 15  ? -11.662 4.744   6.060   1.00 0.00 ? 15  ILE A CB   3  
ATOM 5106  C CG1  . ILE A 1 15  ? -11.277 3.601   5.116   1.00 0.00 ? 15  ILE A CG1  3  
ATOM 5107  C CG2  . ILE A 1 15  ? -13.061 5.252   5.716   1.00 0.00 ? 15  ILE A CG2  3  
ATOM 5108  C CD1  . ILE A 1 15  ? -12.026 2.330   5.510   1.00 0.00 ? 15  ILE A CD1  3  
ATOM 5109  H H    . ILE A 1 15  ? -9.314  4.592   7.057   1.00 0.00 ? 15  ILE A H    3  
ATOM 5110  H HA   . ILE A 1 15  ? -10.558 6.158   4.896   1.00 0.00 ? 15  ILE A HA   3  
ATOM 5111  H HB   . ILE A 1 15  ? -11.655 4.384   7.072   1.00 0.00 ? 15  ILE A HB   3  
ATOM 5112  H HG12 . ILE A 1 15  ? -11.534 3.872   4.102   1.00 0.00 ? 15  ILE A HG12 3  
ATOM 5113  H HG13 . ILE A 1 15  ? -10.213 3.425   5.183   1.00 0.00 ? 15  ILE A HG13 3  
ATOM 5114  H HG21 . ILE A 1 15  ? -13.785 4.718   6.314   1.00 0.00 ? 15  ILE A HG21 3  
ATOM 5115  H HG22 . ILE A 1 15  ? -13.259 5.079   4.669   1.00 0.00 ? 15  ILE A HG22 3  
ATOM 5116  H HG23 . ILE A 1 15  ? -13.129 6.308   5.925   1.00 0.00 ? 15  ILE A HG23 3  
ATOM 5117  H HD11 . ILE A 1 15  ? -12.662 2.021   4.694   1.00 0.00 ? 15  ILE A HD11 3  
ATOM 5118  H HD12 . ILE A 1 15  ? -12.631 2.524   6.386   1.00 0.00 ? 15  ILE A HD12 3  
ATOM 5119  H HD13 . ILE A 1 15  ? -11.314 1.550   5.726   1.00 0.00 ? 15  ILE A HD13 3  
ATOM 5120  N N    . PHE A 1 16  ? -11.533 8.075   6.166   1.00 0.00 ? 16  PHE A N    3  
ATOM 5121  C CA   . PHE A 1 16  ? -11.948 9.280   6.926   1.00 0.00 ? 16  PHE A CA   3  
ATOM 5122  C C    . PHE A 1 16  ? -13.293 9.777   6.400   1.00 0.00 ? 16  PHE A C    3  
ATOM 5123  O O    . PHE A 1 16  ? -13.429 10.105  5.240   1.00 0.00 ? 16  PHE A O    3  
ATOM 5124  C CB   . PHE A 1 16  ? -10.901 10.377  6.745   1.00 0.00 ? 16  PHE A CB   3  
ATOM 5125  C CG   . PHE A 1 16  ? -10.882 10.818  5.302   1.00 0.00 ? 16  PHE A CG   3  
ATOM 5126  C CD1  . PHE A 1 16  ? -10.064 10.156  4.377   1.00 0.00 ? 16  PHE A CD1  3  
ATOM 5127  C CD2  . PHE A 1 16  ? -11.684 11.888  4.884   1.00 0.00 ? 16  PHE A CD2  3  
ATOM 5128  C CE1  . PHE A 1 16  ? -10.049 10.563  3.037   1.00 0.00 ? 16  PHE A CE1  3  
ATOM 5129  C CE2  . PHE A 1 16  ? -11.668 12.295  3.546   1.00 0.00 ? 16  PHE A CE2  3  
ATOM 5130  C CZ   . PHE A 1 16  ? -10.851 11.632  2.623   1.00 0.00 ? 16  PHE A CZ   3  
ATOM 5131  H H    . PHE A 1 16  ? -11.648 8.049   5.193   1.00 0.00 ? 16  PHE A H    3  
ATOM 5132  H HA   . PHE A 1 16  ? -12.036 9.034   7.968   1.00 0.00 ? 16  PHE A HA   3  
ATOM 5133  H HB2  . PHE A 1 16  ? -11.145 11.217  7.378   1.00 0.00 ? 16  PHE A HB2  3  
ATOM 5134  H HB3  . PHE A 1 16  ? -9.930  9.991   7.013   1.00 0.00 ? 16  PHE A HB3  3  
ATOM 5135  H HD1  . PHE A 1 16  ? -9.444  9.331   4.696   1.00 0.00 ? 16  PHE A HD1  3  
ATOM 5136  H HD2  . PHE A 1 16  ? -12.315 12.398  5.597   1.00 0.00 ? 16  PHE A HD2  3  
ATOM 5137  H HE1  . PHE A 1 16  ? -9.417  10.055  2.323   1.00 0.00 ? 16  PHE A HE1  3  
ATOM 5138  H HE2  . PHE A 1 16  ? -12.288 13.119  3.225   1.00 0.00 ? 16  PHE A HE2  3  
ATOM 5139  H HZ   . PHE A 1 16  ? -10.841 11.946  1.590   1.00 0.00 ? 16  PHE A HZ   3  
ATOM 5140  N N    . ARG A 1 17  ? -14.284 9.862   7.243   1.00 0.00 ? 17  ARG A N    3  
ATOM 5141  C CA   . ARG A 1 17  ? -15.602 10.366  6.770   1.00 0.00 ? 17  ARG A CA   3  
ATOM 5142  C C    . ARG A 1 17  ? -15.589 11.894  6.849   1.00 0.00 ? 17  ARG A C    3  
ATOM 5143  O O    . ARG A 1 17  ? -15.489 12.466  7.917   1.00 0.00 ? 17  ARG A O    3  
ATOM 5144  C CB   . ARG A 1 17  ? -16.724 9.816   7.650   1.00 0.00 ? 17  ARG A CB   3  
ATOM 5145  C CG   . ARG A 1 17  ? -18.067 10.285  7.089   1.00 0.00 ? 17  ARG A CG   3  
ATOM 5146  C CD   . ARG A 1 17  ? -19.203 9.799   7.988   1.00 0.00 ? 17  ARG A CD   3  
ATOM 5147  N NE   . ARG A 1 17  ? -20.504 10.261  7.424   1.00 0.00 ? 17  ARG A NE   3  
ATOM 5148  C CZ   . ARG A 1 17  ? -20.851 11.514  7.540   1.00 0.00 ? 17  ARG A CZ   3  
ATOM 5149  N NH1  . ARG A 1 17  ? -20.067 12.353  8.160   1.00 0.00 ? 17  ARG A NH1  3  
ATOM 5150  N NH2  . ARG A 1 17  ? -21.982 11.928  7.039   1.00 0.00 ? 17  ARG A NH2  3  
ATOM 5151  H H    . ARG A 1 17  ? -14.159 9.610   8.181   1.00 0.00 ? 17  ARG A H    3  
ATOM 5152  H HA   . ARG A 1 17  ? -15.759 10.058  5.748   1.00 0.00 ? 17  ARG A HA   3  
ATOM 5153  H HB2  . ARG A 1 17  ? -16.687 8.735   7.651   1.00 0.00 ? 17  ARG A HB2  3  
ATOM 5154  H HB3  . ARG A 1 17  ? -16.608 10.182  8.658   1.00 0.00 ? 17  ARG A HB3  3  
ATOM 5155  H HG2  . ARG A 1 17  ? -18.080 11.363  7.044   1.00 0.00 ? 17  ARG A HG2  3  
ATOM 5156  H HG3  . ARG A 1 17  ? -18.200 9.882   6.096   1.00 0.00 ? 17  ARG A HG3  3  
ATOM 5157  H HD2  . ARG A 1 17  ? -19.191 8.720   8.034   1.00 0.00 ? 17  ARG A HD2  3  
ATOM 5158  H HD3  . ARG A 1 17  ? -19.077 10.204  8.980   1.00 0.00 ? 17  ARG A HD3  3  
ATOM 5159  H HE   . ARG A 1 17  ? -21.091 9.629   6.962   1.00 0.00 ? 17  ARG A HE   3  
ATOM 5160  H HH11 . ARG A 1 17  ? -19.198 12.034  8.543   1.00 0.00 ? 17  ARG A HH11 3  
ATOM 5161  H HH12 . ARG A 1 17  ? -20.331 13.311  8.251   1.00 0.00 ? 17  ARG A HH12 3  
ATOM 5162  H HH21 . ARG A 1 17  ? -22.584 11.286  6.562   1.00 0.00 ? 17  ARG A HH21 3  
ATOM 5163  H HH22 . ARG A 1 17  ? -22.249 12.888  7.131   1.00 0.00 ? 17  ARG A HH22 3  
ATOM 5164  N N    . ARG A 1 18  ? -15.670 12.560  5.732   1.00 0.00 ? 18  ARG A N    3  
ATOM 5165  C CA   . ARG A 1 18  ? -15.640 14.048  5.754   1.00 0.00 ? 18  ARG A CA   3  
ATOM 5166  C C    . ARG A 1 18  ? -17.059 14.604  5.871   1.00 0.00 ? 18  ARG A C    3  
ATOM 5167  O O    . ARG A 1 18  ? -17.983 14.122  5.249   1.00 0.00 ? 18  ARG A O    3  
ATOM 5168  C CB   . ARG A 1 18  ? -14.993 14.566  4.469   1.00 0.00 ? 18  ARG A CB   3  
ATOM 5169  C CG   . ARG A 1 18  ? -14.723 16.065  4.602   1.00 0.00 ? 18  ARG A CG   3  
ATOM 5170  C CD   . ARG A 1 18  ? -14.139 16.594  3.293   1.00 0.00 ? 18  ARG A CD   3  
ATOM 5171  N NE   . ARG A 1 18  ? -12.872 15.872  2.988   1.00 0.00 ? 18  ARG A NE   3  
ATOM 5172  C CZ   . ARG A 1 18  ? -12.233 16.116  1.877   1.00 0.00 ? 18  ARG A CZ   3  
ATOM 5173  N NH1  . ARG A 1 18  ? -12.699 16.998  1.038   1.00 0.00 ? 18  ARG A NH1  3  
ATOM 5174  N NH2  . ARG A 1 18  ? -11.128 15.479  1.610   1.00 0.00 ? 18  ARG A NH2  3  
ATOM 5175  H H    . ARG A 1 18  ? -15.736 12.082  4.879   1.00 0.00 ? 18  ARG A H    3  
ATOM 5176  H HA   . ARG A 1 18  ? -15.059 14.380  6.600   1.00 0.00 ? 18  ARG A HA   3  
ATOM 5177  H HB2  . ARG A 1 18  ? -14.062 14.044  4.300   1.00 0.00 ? 18  ARG A HB2  3  
ATOM 5178  H HB3  . ARG A 1 18  ? -15.660 14.396  3.637   1.00 0.00 ? 18  ARG A HB3  3  
ATOM 5179  H HG2  . ARG A 1 18  ? -15.647 16.580  4.820   1.00 0.00 ? 18  ARG A HG2  3  
ATOM 5180  H HG3  . ARG A 1 18  ? -14.019 16.235  5.403   1.00 0.00 ? 18  ARG A HG3  3  
ATOM 5181  H HD2  . ARG A 1 18  ? -14.846 16.437  2.494   1.00 0.00 ? 18  ARG A HD2  3  
ATOM 5182  H HD3  . ARG A 1 18  ? -13.936 17.652  3.390   1.00 0.00 ? 18  ARG A HD3  3  
ATOM 5183  H HE   . ARG A 1 18  ? -12.521 15.213  3.622   1.00 0.00 ? 18  ARG A HE   3  
ATOM 5184  H HH11 . ARG A 1 18  ? -13.546 17.487  1.244   1.00 0.00 ? 18  ARG A HH11 3  
ATOM 5185  H HH12 . ARG A 1 18  ? -12.209 17.185  0.186   1.00 0.00 ? 18  ARG A HH12 3  
ATOM 5186  H HH21 . ARG A 1 18  ? -10.770 14.802  2.256   1.00 0.00 ? 18  ARG A HH21 3  
ATOM 5187  H HH22 . ARG A 1 18  ? -10.635 15.664  0.759   1.00 0.00 ? 18  ARG A HH22 3  
ATOM 5188  N N    . CYS A 1 19  ? -17.232 15.630  6.661   1.00 0.00 ? 19  CYS A N    3  
ATOM 5189  C CA   . CYS A 1 19  ? -18.582 16.237  6.818   1.00 0.00 ? 19  CYS A CA   3  
ATOM 5190  C C    . CYS A 1 19  ? -18.647 17.513  5.975   1.00 0.00 ? 19  CYS A C    3  
ATOM 5191  O O    . CYS A 1 19  ? -17.714 18.289  5.941   1.00 0.00 ? 19  CYS A O    3  
ATOM 5192  C CB   . CYS A 1 19  ? -18.820 16.582  8.288   1.00 0.00 ? 19  CYS A CB   3  
ATOM 5193  S SG   . CYS A 1 19  ? -20.018 15.423  8.996   1.00 0.00 ? 19  CYS A SG   3  
ATOM 5194  H H    . CYS A 1 19  ? -16.468 16.007  7.147   1.00 0.00 ? 19  CYS A H    3  
ATOM 5195  H HA   . CYS A 1 19  ? -19.336 15.540  6.481   1.00 0.00 ? 19  CYS A HA   3  
ATOM 5196  H HB2  . CYS A 1 19  ? -17.889 16.510  8.830   1.00 0.00 ? 19  CYS A HB2  3  
ATOM 5197  H HB3  . CYS A 1 19  ? -19.203 17.589  8.365   1.00 0.00 ? 19  CYS A HB3  3  
ATOM 5198  H HG   . CYS A 1 19  ? -19.692 15.147  9.855   1.00 0.00 ? 19  CYS A HG   3  
ATOM 5199  N N    . LEU A 1 20  ? -19.734 17.732  5.288   1.00 0.00 ? 20  LEU A N    3  
ATOM 5200  C CA   . LEU A 1 20  ? -19.837 18.954  4.440   1.00 0.00 ? 20  LEU A CA   3  
ATOM 5201  C C    . LEU A 1 20  ? -19.602 20.204  5.292   1.00 0.00 ? 20  LEU A C    3  
ATOM 5202  O O    . LEU A 1 20  ? -18.944 21.133  4.867   1.00 0.00 ? 20  LEU A O    3  
ATOM 5203  C CB   . LEU A 1 20  ? -21.227 19.022  3.808   1.00 0.00 ? 20  LEU A CB   3  
ATOM 5204  C CG   . LEU A 1 20  ? -21.302 20.229  2.865   1.00 0.00 ? 20  LEU A CG   3  
ATOM 5205  C CD1  . LEU A 1 20  ? -20.423 19.981  1.637   1.00 0.00 ? 20  LEU A CD1  3  
ATOM 5206  C CD2  . LEU A 1 20  ? -22.752 20.437  2.420   1.00 0.00 ? 20  LEU A CD2  3  
ATOM 5207  H H    . LEU A 1 20  ? -20.476 17.092  5.319   1.00 0.00 ? 20  LEU A H    3  
ATOM 5208  H HA   . LEU A 1 20  ? -19.092 18.910  3.659   1.00 0.00 ? 20  LEU A HA   3  
ATOM 5209  H HB2  . LEU A 1 20  ? -21.414 18.117  3.249   1.00 0.00 ? 20  LEU A HB2  3  
ATOM 5210  H HB3  . LEU A 1 20  ? -21.971 19.128  4.582   1.00 0.00 ? 20  LEU A HB3  3  
ATOM 5211  H HG   . LEU A 1 20  ? -20.953 21.111  3.384   1.00 0.00 ? 20  LEU A HG   3  
ATOM 5212  H HD11 . LEU A 1 20  ? -20.853 20.483  0.780   1.00 0.00 ? 20  LEU A HD11 3  
ATOM 5213  H HD12 . LEU A 1 20  ? -20.366 18.922  1.439   1.00 0.00 ? 20  LEU A HD12 3  
ATOM 5214  H HD13 . LEU A 1 20  ? -19.432 20.367  1.818   1.00 0.00 ? 20  LEU A HD13 3  
ATOM 5215  H HD21 . LEU A 1 20  ? -22.773 20.703  1.375   1.00 0.00 ? 20  LEU A HD21 3  
ATOM 5216  H HD22 . LEU A 1 20  ? -23.197 21.229  3.004   1.00 0.00 ? 20  LEU A HD22 3  
ATOM 5217  H HD23 . LEU A 1 20  ? -23.308 19.523  2.571   1.00 0.00 ? 20  LEU A HD23 3  
ATOM 5218  N N    . ILE A 1 21  ? -20.133 20.245  6.483   1.00 0.00 ? 21  ILE A N    3  
ATOM 5219  C CA   . ILE A 1 21  ? -19.927 21.451  7.334   1.00 0.00 ? 21  ILE A CA   3  
ATOM 5220  C C    . ILE A 1 21  ? -19.915 21.062  8.819   1.00 0.00 ? 21  ILE A C    3  
ATOM 5221  O O    . ILE A 1 21  ? -20.432 20.031  9.203   1.00 0.00 ? 21  ILE A O    3  
ATOM 5222  C CB   . ILE A 1 21  ? -21.055 22.452  7.084   1.00 0.00 ? 21  ILE A CB   3  
ATOM 5223  C CG1  . ILE A 1 21  ? -22.361 21.700  6.820   1.00 0.00 ? 21  ILE A CG1  3  
ATOM 5224  C CG2  . ILE A 1 21  ? -20.713 23.315  5.866   1.00 0.00 ? 21  ILE A CG2  3  
ATOM 5225  C CD1  . ILE A 1 21  ? -23.501 22.372  7.587   1.00 0.00 ? 21  ILE A CD1  3  
ATOM 5226  H H    . ILE A 1 21  ? -20.663 19.489  6.812   1.00 0.00 ? 21  ILE A H    3  
ATOM 5227  H HA   . ILE A 1 21  ? -18.985 21.903  7.072   1.00 0.00 ? 21  ILE A HA   3  
ATOM 5228  H HB   . ILE A 1 21  ? -21.168 23.087  7.949   1.00 0.00 ? 21  ILE A HB   3  
ATOM 5229  H HG12 . ILE A 1 21  ? -22.579 21.715  5.763   1.00 0.00 ? 21  ILE A HG12 3  
ATOM 5230  H HG13 . ILE A 1 21  ? -22.263 20.678  7.152   1.00 0.00 ? 21  ILE A HG13 3  
ATOM 5231  H HG21 . ILE A 1 21  ? -19.785 23.837  6.044   1.00 0.00 ? 21  ILE A HG21 3  
ATOM 5232  H HG22 . ILE A 1 21  ? -21.504 24.032  5.700   1.00 0.00 ? 21  ILE A HG22 3  
ATOM 5233  H HG23 . ILE A 1 21  ? -20.611 22.686  4.995   1.00 0.00 ? 21  ILE A HG23 3  
ATOM 5234  H HD11 . ILE A 1 21  ? -23.697 23.346  7.161   1.00 0.00 ? 21  ILE A HD11 3  
ATOM 5235  H HD12 . ILE A 1 21  ? -23.223 22.482  8.624   1.00 0.00 ? 21  ILE A HD12 3  
ATOM 5236  H HD13 . ILE A 1 21  ? -24.391 21.762  7.515   1.00 0.00 ? 21  ILE A HD13 3  
ATOM 5237  N N    . PRO A 1 22  ? -19.326 21.890  9.646   1.00 0.00 ? 22  PRO A N    3  
ATOM 5238  C CA   . PRO A 1 22  ? -19.239 21.651  11.119  1.00 0.00 ? 22  PRO A CA   3  
ATOM 5239  C C    . PRO A 1 22  ? -20.612 21.591  11.796  1.00 0.00 ? 22  PRO A C    3  
ATOM 5240  O O    . PRO A 1 22  ? -21.569 22.181  11.336  1.00 0.00 ? 22  PRO A O    3  
ATOM 5241  C CB   . PRO A 1 22  ? -18.455 22.854  11.656  1.00 0.00 ? 22  PRO A CB   3  
ATOM 5242  C CG   . PRO A 1 22  ? -17.801 23.482  10.471  1.00 0.00 ? 22  PRO A CG   3  
ATOM 5243  C CD   . PRO A 1 22  ? -18.676 23.155  9.268   1.00 0.00 ? 22  PRO A CD   3  
ATOM 5244  H HA   . PRO A 1 22  ? -18.687 20.746  11.317  1.00 0.00 ? 22  PRO A HA   3  
ATOM 5245  H HB2  . PRO A 1 22  ? -19.134 23.553  12.124  1.00 0.00 ? 22  PRO A HB2  3  
ATOM 5246  H HB3  . PRO A 1 22  ? -17.708 22.527  12.360  1.00 0.00 ? 22  PRO A HB3  3  
ATOM 5247  H HG2  . PRO A 1 22  ? -17.741 24.552  10.609  1.00 0.00 ? 22  PRO A HG2  3  
ATOM 5248  H HG3  . PRO A 1 22  ? -16.815 23.068  10.327  1.00 0.00 ? 22  PRO A HG3  3  
ATOM 5249  H HD2  . PRO A 1 22  ? -19.410 23.933  9.110   1.00 0.00 ? 22  PRO A HD2  3  
ATOM 5250  H HD3  . PRO A 1 22  ? -18.069 23.019  8.389   1.00 0.00 ? 22  PRO A HD3  3  
ATOM 5251  N N    . LYS A 1 23  ? -20.706 20.894  12.895  1.00 0.00 ? 23  LYS A N    3  
ATOM 5252  C CA   . LYS A 1 23  ? -22.004 20.800  13.621  1.00 0.00 ? 23  LYS A CA   3  
ATOM 5253  C C    . LYS A 1 23  ? -21.762 21.098  15.102  1.00 0.00 ? 23  LYS A C    3  
ATOM 5254  O O    . LYS A 1 23  ? -21.970 22.198  15.567  1.00 0.00 ? 23  LYS A O    3  
ATOM 5255  C CB   . LYS A 1 23  ? -22.572 19.386  13.471  1.00 0.00 ? 23  LYS A CB   3  
ATOM 5256  C CG   . LYS A 1 23  ? -22.569 18.983  11.993  1.00 0.00 ? 23  LYS A CG   3  
ATOM 5257  C CD   . LYS A 1 23  ? -23.598 19.812  11.223  1.00 0.00 ? 23  LYS A CD   3  
ATOM 5258  C CE   . LYS A 1 23  ? -23.526 19.456  9.739   1.00 0.00 ? 23  LYS A CE   3  
ATOM 5259  N NZ   . LYS A 1 23  ? -23.158 18.020  9.587   1.00 0.00 ? 23  LYS A NZ   3  
ATOM 5260  H H    . LYS A 1 23  ? -19.915 20.436  13.252  1.00 0.00 ? 23  LYS A H    3  
ATOM 5261  H HA   . LYS A 1 23  ? -22.700 21.518  13.220  1.00 0.00 ? 23  LYS A HA   3  
ATOM 5262  H HB2  . LYS A 1 23  ? -21.965 18.693  14.034  1.00 0.00 ? 23  LYS A HB2  3  
ATOM 5263  H HB3  . LYS A 1 23  ? -23.584 19.365  13.845  1.00 0.00 ? 23  LYS A HB3  3  
ATOM 5264  H HG2  . LYS A 1 23  ? -21.586 19.153  11.576  1.00 0.00 ? 23  LYS A HG2  3  
ATOM 5265  H HG3  . LYS A 1 23  ? -22.817 17.935  11.907  1.00 0.00 ? 23  LYS A HG3  3  
ATOM 5266  H HD2  . LYS A 1 23  ? -24.588 19.598  11.599  1.00 0.00 ? 23  LYS A HD2  3  
ATOM 5267  H HD3  . LYS A 1 23  ? -23.385 20.861  11.348  1.00 0.00 ? 23  LYS A HD3  3  
ATOM 5268  H HE2  . LYS A 1 23  ? -24.488 19.634  9.280   1.00 0.00 ? 23  LYS A HE2  3  
ATOM 5269  H HE3  . LYS A 1 23  ? -22.780 20.073  9.261   1.00 0.00 ? 23  LYS A HE3  3  
ATOM 5270  H HZ1  . LYS A 1 23  ? -22.148 17.898  9.798   1.00 0.00 ? 23  LYS A HZ1  3  
ATOM 5271  H HZ2  . LYS A 1 23  ? -23.349 17.717  8.610   1.00 0.00 ? 23  LYS A HZ2  3  
ATOM 5272  H HZ3  . LYS A 1 23  ? -23.719 17.447  10.246  1.00 0.00 ? 23  LYS A HZ3  3  
ATOM 5273  N N    . VAL A 1 24  ? -21.311 20.124  15.840  1.00 0.00 ? 24  VAL A N    3  
ATOM 5274  C CA   . VAL A 1 24  ? -21.036 20.343  17.286  1.00 0.00 ? 24  VAL A CA   3  
ATOM 5275  C C    . VAL A 1 24  ? -19.749 21.160  17.419  1.00 0.00 ? 24  VAL A C    3  
ATOM 5276  O O    . VAL A 1 24  ? -19.327 21.507  18.506  1.00 0.00 ? 24  VAL A O    3  
ATOM 5277  C CB   . VAL A 1 24  ? -20.868 18.992  17.988  1.00 0.00 ? 24  VAL A CB   3  
ATOM 5278  C CG1  . VAL A 1 24  ? -20.920 19.189  19.505  1.00 0.00 ? 24  VAL A CG1  3  
ATOM 5279  C CG2  . VAL A 1 24  ? -22.000 18.054  17.560  1.00 0.00 ? 24  VAL A CG2  3  
ATOM 5280  H H    . VAL A 1 24  ? -21.141 19.246  15.437  1.00 0.00 ? 24  VAL A H    3  
ATOM 5281  H HA   . VAL A 1 24  ? -21.857 20.884  17.732  1.00 0.00 ? 24  VAL A HA   3  
ATOM 5282  H HB   . VAL A 1 24  ? -19.917 18.560  17.714  1.00 0.00 ? 24  VAL A HB   3  
ATOM 5283  H HG11 . VAL A 1 24  ? -21.911 19.511  19.790  1.00 0.00 ? 24  VAL A HG11 3  
ATOM 5284  H HG12 . VAL A 1 24  ? -20.201 19.938  19.797  1.00 0.00 ? 24  VAL A HG12 3  
ATOM 5285  H HG13 . VAL A 1 24  ? -20.688 18.257  19.997  1.00 0.00 ? 24  VAL A HG13 3  
ATOM 5286  H HG21 . VAL A 1 24  ? -22.786 18.628  17.092  1.00 0.00 ? 24  VAL A HG21 3  
ATOM 5287  H HG22 . VAL A 1 24  ? -22.394 17.547  18.429  1.00 0.00 ? 24  VAL A HG22 3  
ATOM 5288  H HG23 . VAL A 1 24  ? -21.619 17.326  16.861  1.00 0.00 ? 24  VAL A HG23 3  
ATOM 5289  N N    . ASP A 1 25  ? -19.116 21.457  16.315  1.00 0.00 ? 25  ASP A N    3  
ATOM 5290  C CA   . ASP A 1 25  ? -17.847 22.240  16.355  1.00 0.00 ? 25  ASP A CA   3  
ATOM 5291  C C    . ASP A 1 25  ? -16.800 21.467  17.152  1.00 0.00 ? 25  ASP A C    3  
ATOM 5292  O O    . ASP A 1 25  ? -16.082 22.022  17.960  1.00 0.00 ? 25  ASP A O    3  
ATOM 5293  C CB   . ASP A 1 25  ? -18.090 23.606  17.006  1.00 0.00 ? 25  ASP A CB   3  
ATOM 5294  C CG   . ASP A 1 25  ? -19.045 24.425  16.136  1.00 0.00 ? 25  ASP A CG   3  
ATOM 5295  O OD1  . ASP A 1 25  ? -19.536 25.433  16.616  1.00 0.00 ? 25  ASP A OD1  3  
ATOM 5296  O OD2  . ASP A 1 25  ? -19.266 24.030  15.002  1.00 0.00 ? 25  ASP A OD2  3  
ATOM 5297  H H    . ASP A 1 25  ? -19.475 21.156  15.455  1.00 0.00 ? 25  ASP A H    3  
ATOM 5298  H HA   . ASP A 1 25  ? -17.487 22.384  15.345  1.00 0.00 ? 25  ASP A HA   3  
ATOM 5299  H HB2  . ASP A 1 25  ? -18.525 23.468  17.985  1.00 0.00 ? 25  ASP A HB2  3  
ATOM 5300  H HB3  . ASP A 1 25  ? -17.152 24.132  17.100  1.00 0.00 ? 25  ASP A HB3  3  
ATOM 5301  H HD2  . ASP A 1 25  ? -19.872 24.592  14.514  1.00 0.00 ? 25  ASP A HD2  3  
ATOM 5302  N N    . ASN A 1 26  ? -16.708 20.186  16.924  1.00 0.00 ? 26  ASN A N    3  
ATOM 5303  C CA   . ASN A 1 26  ? -15.707 19.363  17.656  1.00 0.00 ? 26  ASN A CA   3  
ATOM 5304  C C    . ASN A 1 26  ? -14.803 18.658  16.645  1.00 0.00 ? 26  ASN A C    3  
ATOM 5305  O O    . ASN A 1 26  ? -13.750 19.148  16.292  1.00 0.00 ? 26  ASN A O    3  
ATOM 5306  C CB   . ASN A 1 26  ? -16.426 18.319  18.511  1.00 0.00 ? 26  ASN A CB   3  
ATOM 5307  C CG   . ASN A 1 26  ? -15.402 17.560  19.357  1.00 0.00 ? 26  ASN A CG   3  
ATOM 5308  O OD1  . ASN A 1 26  ? -14.220 17.832  19.289  1.00 0.00 ? 26  ASN A OD1  3  
ATOM 5309  N ND2  . ASN A 1 26  ? -15.807 16.610  20.154  1.00 0.00 ? 26  ASN A ND2  3  
ATOM 5310  H H    . ASN A 1 26  ? -17.296 19.764  16.264  1.00 0.00 ? 26  ASN A H    3  
ATOM 5311  H HA   . ASN A 1 26  ? -15.109 19.998  18.290  1.00 0.00 ? 26  ASN A HA   3  
ATOM 5312  H HB2  . ASN A 1 26  ? -17.136 18.811  19.160  1.00 0.00 ? 26  ASN A HB2  3  
ATOM 5313  H HB3  . ASN A 1 26  ? -16.948 17.623  17.870  1.00 0.00 ? 26  ASN A HB3  3  
ATOM 5314  H HD21 . ASN A 1 26  ? -16.759 16.388  20.208  1.00 0.00 ? 26  ASN A HD21 3  
ATOM 5315  H HD22 . ASN A 1 26  ? -15.158 16.116  20.698  1.00 0.00 ? 26  ASN A HD22 3  
ATOM 5316  N N    . ASN A 1 27  ? -15.212 17.512  16.175  1.00 0.00 ? 27  ASN A N    3  
ATOM 5317  C CA   . ASN A 1 27  ? -14.381 16.774  15.183  1.00 0.00 ? 27  ASN A CA   3  
ATOM 5318  C C    . ASN A 1 27  ? -15.044 16.847  13.805  1.00 0.00 ? 27  ASN A C    3  
ATOM 5319  O O    . ASN A 1 27  ? -16.066 16.236  13.564  1.00 0.00 ? 27  ASN A O    3  
ATOM 5320  C CB   . ASN A 1 27  ? -14.262 15.312  15.614  1.00 0.00 ? 27  ASN A CB   3  
ATOM 5321  C CG   . ASN A 1 27  ? -13.528 15.233  16.953  1.00 0.00 ? 27  ASN A CG   3  
ATOM 5322  O OD1  . ASN A 1 27  ? -12.832 16.157  17.332  1.00 0.00 ? 27  ASN A OD1  3  
ATOM 5323  N ND2  . ASN A 1 27  ? -13.655 14.166  17.694  1.00 0.00 ? 27  ASN A ND2  3  
ATOM 5324  H H    . ASN A 1 27  ? -16.065 17.141  16.472  1.00 0.00 ? 27  ASN A H    3  
ATOM 5325  H HA   . ASN A 1 27  ? -13.396 17.216  15.132  1.00 0.00 ? 27  ASN A HA   3  
ATOM 5326  H HB2  . ASN A 1 27  ? -15.250 14.887  15.719  1.00 0.00 ? 27  ASN A HB2  3  
ATOM 5327  H HB3  . ASN A 1 27  ? -13.709 14.760  14.869  1.00 0.00 ? 27  ASN A HB3  3  
ATOM 5328  H HD21 . ASN A 1 27  ? -14.218 13.425  17.389  1.00 0.00 ? 27  ASN A HD21 3  
ATOM 5329  H HD22 . ASN A 1 27  ? -13.188 14.107  18.553  1.00 0.00 ? 27  ASN A HD22 3  
ATOM 5330  N N    . ALA A 1 28  ? -14.472 17.591  12.899  1.00 0.00 ? 28  ALA A N    3  
ATOM 5331  C CA   . ALA A 1 28  ? -15.071 17.702  11.538  1.00 0.00 ? 28  ALA A CA   3  
ATOM 5332  C C    . ALA A 1 28  ? -14.882 16.390  10.775  1.00 0.00 ? 28  ALA A C    3  
ATOM 5333  O O    . ALA A 1 28  ? -15.750 15.958  10.040  1.00 0.00 ? 28  ALA A O    3  
ATOM 5334  C CB   . ALA A 1 28  ? -14.380 18.830  10.769  1.00 0.00 ? 28  ALA A CB   3  
ATOM 5335  H H    . ALA A 1 28  ? -13.647 18.075  13.112  1.00 0.00 ? 28  ALA A H    3  
ATOM 5336  H HA   . ALA A 1 28  ? -16.124 17.920  11.627  1.00 0.00 ? 28  ALA A HA   3  
ATOM 5337  H HB1  . ALA A 1 28  ? -15.063 19.656  10.650  1.00 0.00 ? 28  ALA A HB1  3  
ATOM 5338  H HB2  . ALA A 1 28  ? -14.081 18.466  9.796   1.00 0.00 ? 28  ALA A HB2  3  
ATOM 5339  H HB3  . ALA A 1 28  ? -13.509 19.157  11.315  1.00 0.00 ? 28  ALA A HB3  3  
ATOM 5340  N N    . ILE A 1 29  ? -13.748 15.762  10.931  1.00 0.00 ? 29  ILE A N    3  
ATOM 5341  C CA   . ILE A 1 29  ? -13.492 14.486  10.200  1.00 0.00 ? 29  ILE A CA   3  
ATOM 5342  C C    . ILE A 1 29  ? -13.286 13.332  11.176  1.00 0.00 ? 29  ILE A C    3  
ATOM 5343  O O    . ILE A 1 29  ? -12.663 13.472  12.210  1.00 0.00 ? 29  ILE A O    3  
ATOM 5344  C CB   . ILE A 1 29  ? -12.248 14.649  9.330   1.00 0.00 ? 29  ILE A CB   3  
ATOM 5345  C CG1  . ILE A 1 29  ? -12.570 15.588  8.168   1.00 0.00 ? 29  ILE A CG1  3  
ATOM 5346  C CG2  . ILE A 1 29  ? -11.816 13.288  8.786   1.00 0.00 ? 29  ILE A CG2  3  
ATOM 5347  C CD1  . ILE A 1 29  ? -11.282 16.240  7.663   1.00 0.00 ? 29  ILE A CD1  3  
ATOM 5348  H H    . ILE A 1 29  ? -13.059 16.135  11.517  1.00 0.00 ? 29  ILE A H    3  
ATOM 5349  H HA   . ILE A 1 29  ? -14.338 14.266  9.566   1.00 0.00 ? 29  ILE A HA   3  
ATOM 5350  H HB   . ILE A 1 29  ? -11.449 15.071  9.922   1.00 0.00 ? 29  ILE A HB   3  
ATOM 5351  H HG12 . ILE A 1 29  ? -13.025 15.022  7.368   1.00 0.00 ? 29  ILE A HG12 3  
ATOM 5352  H HG13 . ILE A 1 29  ? -13.254 16.351  8.503   1.00 0.00 ? 29  ILE A HG13 3  
ATOM 5353  H HG21 . ILE A 1 29  ? -12.691 12.700  8.547   1.00 0.00 ? 29  ILE A HG21 3  
ATOM 5354  H HG22 . ILE A 1 29  ? -11.228 12.774  9.529   1.00 0.00 ? 29  ILE A HG22 3  
ATOM 5355  H HG23 . ILE A 1 29  ? -11.224 13.430  7.892   1.00 0.00 ? 29  ILE A HG23 3  
ATOM 5356  H HD11 . ILE A 1 29  ? -10.478 15.518  7.693   1.00 0.00 ? 29  ILE A HD11 3  
ATOM 5357  H HD12 . ILE A 1 29  ? -11.035 17.083  8.289   1.00 0.00 ? 29  ILE A HD12 3  
ATOM 5358  H HD13 . ILE A 1 29  ? -11.425 16.577  6.646   1.00 0.00 ? 29  ILE A HD13 3  
ATOM 5359  N N    . GLU A 1 30  ? -13.797 12.184  10.834  1.00 0.00 ? 30  GLU A N    3  
ATOM 5360  C CA   . GLU A 1 30  ? -13.636 10.988  11.708  1.00 0.00 ? 30  GLU A CA   3  
ATOM 5361  C C    . GLU A 1 30  ? -13.001 9.868   10.884  1.00 0.00 ? 30  GLU A C    3  
ATOM 5362  O O    . GLU A 1 30  ? -13.061 9.878   9.671   1.00 0.00 ? 30  GLU A O    3  
ATOM 5363  C CB   . GLU A 1 30  ? -15.004 10.539  12.222  1.00 0.00 ? 30  GLU A CB   3  
ATOM 5364  C CG   . GLU A 1 30  ? -15.637 11.662  13.046  1.00 0.00 ? 30  GLU A CG   3  
ATOM 5365  C CD   . GLU A 1 30  ? -16.974 11.184  13.615  1.00 0.00 ? 30  GLU A CD   3  
ATOM 5366  O OE1  . GLU A 1 30  ? -17.529 11.884  14.444  1.00 0.00 ? 30  GLU A OE1  3  
ATOM 5367  O OE2  . GLU A 1 30  ? -17.422 10.123  13.209  1.00 0.00 ? 30  GLU A OE2  3  
ATOM 5368  H H    . GLU A 1 30  ? -14.282 12.107  9.985   1.00 0.00 ? 30  GLU A H    3  
ATOM 5369  H HA   . GLU A 1 30  ? -12.994 11.233  12.540  1.00 0.00 ? 30  GLU A HA   3  
ATOM 5370  H HB2  . GLU A 1 30  ? -15.643 10.302  11.385  1.00 0.00 ? 30  GLU A HB2  3  
ATOM 5371  H HB3  . GLU A 1 30  ? -14.886 9.664   12.842  1.00 0.00 ? 30  GLU A HB3  3  
ATOM 5372  H HG2  . GLU A 1 30  ? -14.976 11.932  13.857  1.00 0.00 ? 30  GLU A HG2  3  
ATOM 5373  H HG3  . GLU A 1 30  ? -15.804 12.521  12.415  1.00 0.00 ? 30  GLU A HG3  3  
ATOM 5374  H HE2  . GLU A 1 30  ? -18.263 9.886   13.607  1.00 0.00 ? 30  GLU A HE2  3  
ATOM 5375  N N    . PHE A 1 31  ? -12.379 8.911   11.522  1.00 0.00 ? 31  PHE A N    3  
ATOM 5376  C CA   . PHE A 1 31  ? -11.729 7.809   10.753  1.00 0.00 ? 31  PHE A CA   3  
ATOM 5377  C C    . PHE A 1 31  ? -12.341 6.458   11.131  1.00 0.00 ? 31  PHE A C    3  
ATOM 5378  O O    . PHE A 1 31  ? -12.841 6.273   12.224  1.00 0.00 ? 31  PHE A O    3  
ATOM 5379  C CB   . PHE A 1 31  ? -10.231 7.787   11.069  1.00 0.00 ? 31  PHE A CB   3  
ATOM 5380  C CG   . PHE A 1 31  ? -9.607  9.107   10.674  1.00 0.00 ? 31  PHE A CG   3  
ATOM 5381  C CD1  . PHE A 1 31  ? -9.550  10.157  11.598  1.00 0.00 ? 31  PHE A CD1  3  
ATOM 5382  C CD2  . PHE A 1 31  ? -9.080  9.277   9.388   1.00 0.00 ? 31  PHE A CD2  3  
ATOM 5383  C CE1  . PHE A 1 31  ? -8.968  11.379  11.234  1.00 0.00 ? 31  PHE A CE1  3  
ATOM 5384  C CE2  . PHE A 1 31  ? -8.498  10.498  9.027   1.00 0.00 ? 31  PHE A CE2  3  
ATOM 5385  C CZ   . PHE A 1 31  ? -8.442  11.546  9.949   1.00 0.00 ? 31  PHE A CZ   3  
ATOM 5386  H H    . PHE A 1 31  ? -12.331 8.926   12.500  1.00 0.00 ? 31  PHE A H    3  
ATOM 5387  H HA   . PHE A 1 31  ? -11.869 7.977   9.701   1.00 0.00 ? 31  PHE A HA   3  
ATOM 5388  H HB2  . PHE A 1 31  ? -10.089 7.626   12.128  1.00 0.00 ? 31  PHE A HB2  3  
ATOM 5389  H HB3  . PHE A 1 31  ? -9.759  6.989   10.518  1.00 0.00 ? 31  PHE A HB3  3  
ATOM 5390  H HD1  . PHE A 1 31  ? -9.956  10.028  12.590  1.00 0.00 ? 31  PHE A HD1  3  
ATOM 5391  H HD2  . PHE A 1 31  ? -9.123  8.466   8.676   1.00 0.00 ? 31  PHE A HD2  3  
ATOM 5392  H HE1  . PHE A 1 31  ? -8.922  12.191  11.946  1.00 0.00 ? 31  PHE A HE1  3  
ATOM 5393  H HE2  . PHE A 1 31  ? -8.090  10.630  8.036   1.00 0.00 ? 31  PHE A HE2  3  
ATOM 5394  H HZ   . PHE A 1 31  ? -7.995  12.486  9.669   1.00 0.00 ? 31  PHE A HZ   3  
ATOM 5395  N N    . LEU A 1 32  ? -12.286 5.504   10.237  1.00 0.00 ? 32  LEU A N    3  
ATOM 5396  C CA   . LEU A 1 32  ? -12.841 4.155   10.547  1.00 0.00 ? 32  LEU A CA   3  
ATOM 5397  C C    . LEU A 1 32  ? -11.783 3.357   11.302  1.00 0.00 ? 32  LEU A C    3  
ATOM 5398  O O    . LEU A 1 32  ? -10.654 3.243   10.871  1.00 0.00 ? 32  LEU A O    3  
ATOM 5399  C CB   . LEU A 1 32  ? -13.200 3.418   9.249   1.00 0.00 ? 32  LEU A CB   3  
ATOM 5400  C CG   . LEU A 1 32  ? -13.602 1.976   9.570   1.00 0.00 ? 32  LEU A CG   3  
ATOM 5401  C CD1  . LEU A 1 32  ? -14.790 1.973   10.530  1.00 0.00 ? 32  LEU A CD1  3  
ATOM 5402  C CD2  . LEU A 1 32  ? -13.995 1.255   8.280   1.00 0.00 ? 32  LEU A CD2  3  
ATOM 5403  H H    . LEU A 1 32  ? -11.866 5.672   9.368   1.00 0.00 ? 32  LEU A H    3  
ATOM 5404  H HA   . LEU A 1 32  ? -13.724 4.260   11.160  1.00 0.00 ? 32  LEU A HA   3  
ATOM 5405  H HB2  . LEU A 1 32  ? -14.020 3.920   8.758   1.00 0.00 ? 32  LEU A HB2  3  
ATOM 5406  H HB3  . LEU A 1 32  ? -12.349 3.410   8.595   1.00 0.00 ? 32  LEU A HB3  3  
ATOM 5407  H HG   . LEU A 1 32  ? -12.769 1.463   10.029  1.00 0.00 ? 32  LEU A HG   3  
ATOM 5408  H HD11 . LEU A 1 32  ? -14.431 1.951   11.548  1.00 0.00 ? 32  LEU A HD11 3  
ATOM 5409  H HD12 . LEU A 1 32  ? -15.399 1.101   10.344  1.00 0.00 ? 32  LEU A HD12 3  
ATOM 5410  H HD13 . LEU A 1 32  ? -15.381 2.865   10.373  1.00 0.00 ? 32  LEU A HD13 3  
ATOM 5411  H HD21 . LEU A 1 32  ? -14.455 1.959   7.601   1.00 0.00 ? 32  LEU A HD21 3  
ATOM 5412  H HD22 . LEU A 1 32  ? -14.695 0.467   8.508   1.00 0.00 ? 32  LEU A HD22 3  
ATOM 5413  H HD23 . LEU A 1 32  ? -13.114 0.834   7.820   1.00 0.00 ? 32  LEU A HD23 3  
ATOM 5414  N N    . LEU A 1 33  ? -12.140 2.808   12.426  1.00 0.00 ? 33  LEU A N    3  
ATOM 5415  C CA   . LEU A 1 33  ? -11.153 2.019   13.212  1.00 0.00 ? 33  LEU A CA   3  
ATOM 5416  C C    . LEU A 1 33  ? -11.727 0.641   13.524  1.00 0.00 ? 33  LEU A C    3  
ATOM 5417  O O    . LEU A 1 33  ? -12.833 0.512   14.005  1.00 0.00 ? 33  LEU A O    3  
ATOM 5418  C CB   . LEU A 1 33  ? -10.843 2.756   14.518  1.00 0.00 ? 33  LEU A CB   3  
ATOM 5419  C CG   . LEU A 1 33  ? -9.697  3.738   14.285  1.00 0.00 ? 33  LEU A CG   3  
ATOM 5420  C CD1  . LEU A 1 33  ? -9.678  4.776   15.404  1.00 0.00 ? 33  LEU A CD1  3  
ATOM 5421  C CD2  . LEU A 1 33  ? -8.367  2.979   14.274  1.00 0.00 ? 33  LEU A CD2  3  
ATOM 5422  H H    . LEU A 1 33  ? -13.057 2.915   12.756  1.00 0.00 ? 33  LEU A H    3  
ATOM 5423  H HA   . LEU A 1 33  ? -10.244 1.908   12.641  1.00 0.00 ? 33  LEU A HA   3  
ATOM 5424  H HB2  . LEU A 1 33  ? -11.723 3.296   14.839  1.00 0.00 ? 33  LEU A HB2  3  
ATOM 5425  H HB3  . LEU A 1 33  ? -10.561 2.044   15.278  1.00 0.00 ? 33  LEU A HB3  3  
ATOM 5426  H HG   . LEU A 1 33  ? -9.837  4.237   13.336  1.00 0.00 ? 33  LEU A HG   3  
ATOM 5427  H HD11 . LEU A 1 33  ? -8.662  4.922   15.741  1.00 0.00 ? 33  LEU A HD11 3  
ATOM 5428  H HD12 . LEU A 1 33  ? -10.284 4.429   16.228  1.00 0.00 ? 33  LEU A HD12 3  
ATOM 5429  H HD13 . LEU A 1 33  ? -10.074 5.710   15.035  1.00 0.00 ? 33  LEU A HD13 3  
ATOM 5430  H HD21 . LEU A 1 33  ? -7.792  3.251   15.146  1.00 0.00 ? 33  LEU A HD21 3  
ATOM 5431  H HD22 . LEU A 1 33  ? -7.813  3.237   13.383  1.00 0.00 ? 33  LEU A HD22 3  
ATOM 5432  H HD23 . LEU A 1 33  ? -8.558  1.917   14.283  1.00 0.00 ? 33  LEU A HD23 3  
ATOM 5433  N N    . LEU A 1 34  ? -10.977 -0.391  13.257  1.00 0.00 ? 34  LEU A N    3  
ATOM 5434  C CA   . LEU A 1 34  ? -11.468 -1.766  13.542  1.00 0.00 ? 34  LEU A CA   3  
ATOM 5435  C C    . LEU A 1 34  ? -10.778 -2.281  14.804  1.00 0.00 ? 34  LEU A C    3  
ATOM 5436  O O    . LEU A 1 34  ? -9.605  -2.045  15.019  1.00 0.00 ? 34  LEU A O    3  
ATOM 5437  C CB   . LEU A 1 34  ? -11.143 -2.674  12.353  1.00 0.00 ? 34  LEU A CB   3  
ATOM 5438  C CG   . LEU A 1 34  ? -11.690 -2.036  11.073  1.00 0.00 ? 34  LEU A CG   3  
ATOM 5439  C CD1  . LEU A 1 34  ? -11.468 -2.978  9.889   1.00 0.00 ? 34  LEU A CD1  3  
ATOM 5440  C CD2  . LEU A 1 34  ? -13.185 -1.775  11.232  1.00 0.00 ? 34  LEU A CD2  3  
ATOM 5441  H H    . LEU A 1 34  ? -10.085 -0.261  12.873  1.00 0.00 ? 34  LEU A H    3  
ATOM 5442  H HA   . LEU A 1 34  ? -12.538 -1.743  13.697  1.00 0.00 ? 34  LEU A HA   3  
ATOM 5443  H HB2  . LEU A 1 34  ? -10.073 -2.792  12.272  1.00 0.00 ? 34  LEU A HB2  3  
ATOM 5444  H HB3  . LEU A 1 34  ? -11.605 -3.638  12.498  1.00 0.00 ? 34  LEU A HB3  3  
ATOM 5445  H HG   . LEU A 1 34  ? -11.179 -1.102  10.890  1.00 0.00 ? 34  LEU A HG   3  
ATOM 5446  H HD11 . LEU A 1 34  ? -10.417 -3.015  9.654   1.00 0.00 ? 34  LEU A HD11 3  
ATOM 5447  H HD12 . LEU A 1 34  ? -12.018 -2.614  9.034   1.00 0.00 ? 34  LEU A HD12 3  
ATOM 5448  H HD13 . LEU A 1 34  ? -11.813 -3.969  10.147  1.00 0.00 ? 34  LEU A HD13 3  
ATOM 5449  H HD21 . LEU A 1 34  ? -13.620 -2.552  11.841  1.00 0.00 ? 34  LEU A HD21 3  
ATOM 5450  H HD22 . LEU A 1 34  ? -13.656 -1.773  10.259  1.00 0.00 ? 34  LEU A HD22 3  
ATOM 5451  H HD23 . LEU A 1 34  ? -13.336 -0.818  11.707  1.00 0.00 ? 34  LEU A HD23 3  
ATOM 5452  N N    . GLN A 1 35  ? -11.492 -2.972  15.647  1.00 0.00 ? 35  GLN A N    3  
ATOM 5453  C CA   . GLN A 1 35  ? -10.868 -3.481  16.901  1.00 0.00 ? 35  GLN A CA   3  
ATOM 5454  C C    . GLN A 1 35  ? -10.407 -4.923  16.709  1.00 0.00 ? 35  GLN A C    3  
ATOM 5455  O O    . GLN A 1 35  ? -11.147 -5.766  16.245  1.00 0.00 ? 35  GLN A O    3  
ATOM 5456  C CB   . GLN A 1 35  ? -11.892 -3.435  18.035  1.00 0.00 ? 35  GLN A CB   3  
ATOM 5457  C CG   . GLN A 1 35  ? -11.216 -3.830  19.348  1.00 0.00 ? 35  GLN A CG   3  
ATOM 5458  C CD   . GLN A 1 35  ? -12.272 -3.975  20.442  1.00 0.00 ? 35  GLN A CD   3  
ATOM 5459  O OE1  . GLN A 1 35  ? -13.164 -4.794  20.339  1.00 0.00 ? 35  GLN A OE1  3  
ATOM 5460  N NE2  . GLN A 1 35  ? -12.208 -3.210  21.498  1.00 0.00 ? 35  GLN A NE2  3  
ATOM 5461  H H    . GLN A 1 35  ? -12.439 -3.142  15.466  1.00 0.00 ? 35  GLN A H    3  
ATOM 5462  H HA   . GLN A 1 35  ? -10.022 -2.862  17.159  1.00 0.00 ? 35  GLN A HA   3  
ATOM 5463  H HB2  . GLN A 1 35  ? -12.291 -2.435  18.121  1.00 0.00 ? 35  GLN A HB2  3  
ATOM 5464  H HB3  . GLN A 1 35  ? -12.696 -4.125  17.824  1.00 0.00 ? 35  GLN A HB3  3  
ATOM 5465  H HG2  . GLN A 1 35  ? -10.699 -4.769  19.216  1.00 0.00 ? 35  GLN A HG2  3  
ATOM 5466  H HG3  . GLN A 1 35  ? -10.508 -3.065  19.630  1.00 0.00 ? 35  GLN A HG3  3  
ATOM 5467  H HE21 . GLN A 1 35  ? -11.489 -2.550  21.582  1.00 0.00 ? 35  GLN A HE21 3  
ATOM 5468  H HE22 . GLN A 1 35  ? -12.880 -3.295  22.206  1.00 0.00 ? 35  GLN A HE22 3  
ATOM 5469  N N    . ALA A 1 36  ? -9.189  -5.219  17.076  1.00 0.00 ? 36  ALA A N    3  
ATOM 5470  C CA   . ALA A 1 36  ? -8.689  -6.612  16.927  1.00 0.00 ? 36  ALA A CA   3  
ATOM 5471  C C    . ALA A 1 36  ? -9.583  -7.550  17.740  1.00 0.00 ? 36  ALA A C    3  
ATOM 5472  O O    . ALA A 1 36  ? -10.109 -7.179  18.771  1.00 0.00 ? 36  ALA A O    3  
ATOM 5473  C CB   . ALA A 1 36  ? -7.252  -6.699  17.445  1.00 0.00 ? 36  ALA A CB   3  
ATOM 5474  H H    . ALA A 1 36  ? -8.611  -4.527  17.458  1.00 0.00 ? 36  ALA A H    3  
ATOM 5475  H HA   . ALA A 1 36  ? -8.717  -6.897  15.886  1.00 0.00 ? 36  ALA A HA   3  
ATOM 5476  H HB1  . ALA A 1 36  ? -6.563  -6.613  16.617  1.00 0.00 ? 36  ALA A HB1  3  
ATOM 5477  H HB2  . ALA A 1 36  ? -7.105  -7.646  17.940  1.00 0.00 ? 36  ALA A HB2  3  
ATOM 5478  H HB3  . ALA A 1 36  ? -7.072  -5.896  18.144  1.00 0.00 ? 36  ALA A HB3  3  
ATOM 5479  N N    . SER A 1 37  ? -9.767  -8.758  17.288  1.00 0.00 ? 37  SER A N    3  
ATOM 5480  C CA   . SER A 1 37  ? -10.632 -9.708  18.041  1.00 0.00 ? 37  SER A CA   3  
ATOM 5481  C C    . SER A 1 37  ? -9.861  -10.261 19.242  1.00 0.00 ? 37  SER A C    3  
ATOM 5482  O O    . SER A 1 37  ? -10.384 -11.028 20.028  1.00 0.00 ? 37  SER A O    3  
ATOM 5483  C CB   . SER A 1 37  ? -11.045 -10.860 17.125  1.00 0.00 ? 37  SER A CB   3  
ATOM 5484  O OG   . SER A 1 37  ? -9.906  -11.659 16.831  1.00 0.00 ? 37  SER A OG   3  
ATOM 5485  H H    . SER A 1 37  ? -9.337  -9.040  16.454  1.00 0.00 ? 37  SER A H    3  
ATOM 5486  H HA   . SER A 1 37  ? -11.515 -9.193  18.388  1.00 0.00 ? 37  SER A HA   3  
ATOM 5487  H HB2  . SER A 1 37  ? -11.786 -11.467 17.620  1.00 0.00 ? 37  SER A HB2  3  
ATOM 5488  H HB3  . SER A 1 37  ? -11.463 -10.457 16.211  1.00 0.00 ? 37  SER A HB3  3  
ATOM 5489  H HG   . SER A 1 37  ? -9.157  -11.072 16.712  1.00 0.00 ? 37  SER A HG   3  
ATOM 5490  N N    . ASP A 1 38  ? -8.626  -9.873  19.394  1.00 0.00 ? 38  ASP A N    3  
ATOM 5491  C CA   . ASP A 1 38  ? -7.821  -10.370 20.547  1.00 0.00 ? 38  ASP A CA   3  
ATOM 5492  C C    . ASP A 1 38  ? -6.673  -9.401  20.821  1.00 0.00 ? 38  ASP A C    3  
ATOM 5493  O O    . ASP A 1 38  ? -6.597  -8.333  20.248  1.00 0.00 ? 38  ASP A O    3  
ATOM 5494  C CB   . ASP A 1 38  ? -7.252  -11.749 20.218  1.00 0.00 ? 38  ASP A CB   3  
ATOM 5495  C CG   . ASP A 1 38  ? -6.587  -12.341 21.463  1.00 0.00 ? 38  ASP A CG   3  
ATOM 5496  O OD1  . ASP A 1 38  ? -6.736  -11.759 22.524  1.00 0.00 ? 38  ASP A OD1  3  
ATOM 5497  O OD2  . ASP A 1 38  ? -5.938  -13.365 21.331  1.00 0.00 ? 38  ASP A OD2  3  
ATOM 5498  H H    . ASP A 1 38  ? -8.225  -9.252  18.750  1.00 0.00 ? 38  ASP A H    3  
ATOM 5499  H HA   . ASP A 1 38  ? -8.452  -10.439 21.421  1.00 0.00 ? 38  ASP A HA   3  
ATOM 5500  H HB2  . ASP A 1 38  ? -8.048  -12.398 19.894  1.00 0.00 ? 38  ASP A HB2  3  
ATOM 5501  H HB3  . ASP A 1 38  ? -6.519  -11.658 19.431  1.00 0.00 ? 38  ASP A HB3  3  
ATOM 5502  H HD2  . ASP A 1 38  ? -5.550  -13.678 22.151  1.00 0.00 ? 38  ASP A HD2  3  
ATOM 5503  N N    . GLY A 1 39  ? -5.777  -9.769  21.694  1.00 0.00 ? 39  GLY A N    3  
ATOM 5504  C CA   . GLY A 1 39  ? -4.630  -8.869  22.004  1.00 0.00 ? 39  GLY A CA   3  
ATOM 5505  C C    . GLY A 1 39  ? -5.085  -7.781  22.976  1.00 0.00 ? 39  GLY A C    3  
ATOM 5506  O O    . GLY A 1 39  ? -6.090  -7.915  23.648  1.00 0.00 ? 39  GLY A O    3  
ATOM 5507  H H    . GLY A 1 39  ? -5.857  -10.635 22.143  1.00 0.00 ? 39  GLY A H    3  
ATOM 5508  H HA2  . GLY A 1 39  ? -3.834  -9.445  22.453  1.00 0.00 ? 39  GLY A HA2  3  
ATOM 5509  H HA3  . GLY A 1 39  ? -4.275  -8.410  21.095  1.00 0.00 ? 39  GLY A HA3  3  
ATOM 5510  N N    . ILE A 1 40  ? -4.357  -6.702  23.058  1.00 0.00 ? 40  ILE A N    3  
ATOM 5511  C CA   . ILE A 1 40  ? -4.753  -5.604  23.983  1.00 0.00 ? 40  ILE A CA   3  
ATOM 5512  C C    . ILE A 1 40  ? -5.992  -4.900  23.431  1.00 0.00 ? 40  ILE A C    3  
ATOM 5513  O O    . ILE A 1 40  ? -6.452  -3.918  23.976  1.00 0.00 ? 40  ILE A O    3  
ATOM 5514  C CB   . ILE A 1 40  ? -3.606  -4.596  24.108  1.00 0.00 ? 40  ILE A CB   3  
ATOM 5515  C CG1  . ILE A 1 40  ? -3.549  -3.715  22.854  1.00 0.00 ? 40  ILE A CG1  3  
ATOM 5516  C CG2  . ILE A 1 40  ? -2.281  -5.347  24.258  1.00 0.00 ? 40  ILE A CG2  3  
ATOM 5517  C CD1  . ILE A 1 40  ? -2.466  -2.646  23.026  1.00 0.00 ? 40  ILE A CD1  3  
ATOM 5518  H H    . ILE A 1 40  ? -3.552  -6.611  22.505  1.00 0.00 ? 40  ILE A H    3  
ATOM 5519  H HA   . ILE A 1 40  ? -4.976  -6.018  24.956  1.00 0.00 ? 40  ILE A HA   3  
ATOM 5520  H HB   . ILE A 1 40  ? -3.765  -3.977  24.979  1.00 0.00 ? 40  ILE A HB   3  
ATOM 5521  H HG12 . ILE A 1 40  ? -3.317  -4.325  21.994  1.00 0.00 ? 40  ILE A HG12 3  
ATOM 5522  H HG13 . ILE A 1 40  ? -4.501  -3.231  22.705  1.00 0.00 ? 40  ILE A HG13 3  
ATOM 5523  H HG21 . ILE A 1 40  ? -2.469  -6.331  24.664  1.00 0.00 ? 40  ILE A HG21 3  
ATOM 5524  H HG22 . ILE A 1 40  ? -1.631  -4.801  24.925  1.00 0.00 ? 40  ILE A HG22 3  
ATOM 5525  H HG23 . ILE A 1 40  ? -1.808  -5.439  23.292  1.00 0.00 ? 40  ILE A HG23 3  
ATOM 5526  H HD11 . ILE A 1 40  ? -1.774  -2.700  22.199  1.00 0.00 ? 40  ILE A HD11 3  
ATOM 5527  H HD12 . ILE A 1 40  ? -1.936  -2.816  23.951  1.00 0.00 ? 40  ILE A HD12 3  
ATOM 5528  H HD13 . ILE A 1 40  ? -2.926  -1.668  23.048  1.00 0.00 ? 40  ILE A HD13 3  
ATOM 5529  N N    . HIS A 1 41  ? -6.522  -5.388  22.342  1.00 0.00 ? 41  HIS A N    3  
ATOM 5530  C CA   . HIS A 1 41  ? -7.721  -4.744  21.736  1.00 0.00 ? 41  HIS A CA   3  
ATOM 5531  C C    . HIS A 1 41  ? -7.295  -3.426  21.087  1.00 0.00 ? 41  HIS A C    3  
ATOM 5532  O O    . HIS A 1 41  ? -8.016  -2.448  21.106  1.00 0.00 ? 41  HIS A O    3  
ATOM 5533  C CB   . HIS A 1 41  ? -8.774  -4.473  22.815  1.00 0.00 ? 41  HIS A CB   3  
ATOM 5534  C CG   . HIS A 1 41  ? -8.864  -5.655  23.737  1.00 0.00 ? 41  HIS A CG   3  
ATOM 5535  N ND1  . HIS A 1 41  ? -9.414  -6.868  23.338  1.00 0.00 ? 41  HIS A ND1  3  
ATOM 5536  C CD2  . HIS A 1 41  ? -8.474  -5.832  25.043  1.00 0.00 ? 41  HIS A CD2  3  
ATOM 5537  C CE1  . HIS A 1 41  ? -9.340  -7.709  24.386  1.00 0.00 ? 41  HIS A CE1  3  
ATOM 5538  N NE2  . HIS A 1 41  ? -8.777  -7.129  25.445  1.00 0.00 ? 41  HIS A NE2  3  
ATOM 5539  H H    . HIS A 1 41  ? -6.123  -6.176  21.916  1.00 0.00 ? 41  HIS A H    3  
ATOM 5540  H HA   . HIS A 1 41  ? -8.137  -5.397  20.982  1.00 0.00 ? 41  HIS A HA   3  
ATOM 5541  H HB2  . HIS A 1 41  ? -8.501  -3.593  23.376  1.00 0.00 ? 41  HIS A HB2  3  
ATOM 5542  H HB3  . HIS A 1 41  ? -9.735  -4.314  22.344  1.00 0.00 ? 41  HIS A HB3  3  
ATOM 5543  H HD1  . HIS A 1 41  ? -9.788  -7.070  22.457  1.00 0.00 ? 41  HIS A HD1  3  
ATOM 5544  H HD2  . HIS A 1 41  ? -8.005  -5.081  25.661  1.00 0.00 ? 41  HIS A HD2  3  
ATOM 5545  H HE1  . HIS A 1 41  ? -9.693  -8.731  24.371  1.00 0.00 ? 41  HIS A HE1  3  
ATOM 5546  H HE2  . HIS A 1 41  ? -8.611  -7.530  26.324  1.00 0.00 ? 41  HIS A HE2  3  
ATOM 5547  N N    . HIS A 1 42  ? -6.122  -3.397  20.515  1.00 0.00 ? 42  HIS A N    3  
ATOM 5548  C CA   . HIS A 1 42  ? -5.637  -2.147  19.865  1.00 0.00 ? 42  HIS A CA   3  
ATOM 5549  C C    . HIS A 1 42  ? -6.517  -1.833  18.656  1.00 0.00 ? 42  HIS A C    3  
ATOM 5550  O O    . HIS A 1 42  ? -7.083  -2.714  18.042  1.00 0.00 ? 42  HIS A O    3  
ATOM 5551  C CB   . HIS A 1 42  ? -4.190  -2.342  19.406  1.00 0.00 ? 42  HIS A CB   3  
ATOM 5552  C CG   . HIS A 1 42  ? -4.082  -3.612  18.606  1.00 0.00 ? 42  HIS A CG   3  
ATOM 5553  N ND1  . HIS A 1 42  ? -4.112  -4.865  19.201  1.00 0.00 ? 42  HIS A ND1  3  
ATOM 5554  C CD2  . HIS A 1 42  ? -3.941  -3.839  17.259  1.00 0.00 ? 42  HIS A CD2  3  
ATOM 5555  C CE1  . HIS A 1 42  ? -3.991  -5.782  18.223  1.00 0.00 ? 42  HIS A CE1  3  
ATOM 5556  N NE2  . HIS A 1 42  ? -3.884  -5.208  17.024  1.00 0.00 ? 42  HIS A NE2  3  
ATOM 5557  H H    . HIS A 1 42  ? -5.559  -4.198  20.515  1.00 0.00 ? 42  HIS A H    3  
ATOM 5558  H HA   . HIS A 1 42  ? -5.686  -1.330  20.569  1.00 0.00 ? 42  HIS A HA   3  
ATOM 5559  H HB2  . HIS A 1 42  ? -3.890  -1.505  18.796  1.00 0.00 ? 42  HIS A HB2  3  
ATOM 5560  H HB3  . HIS A 1 42  ? -3.544  -2.406  20.271  1.00 0.00 ? 42  HIS A HB3  3  
ATOM 5561  H HD1  . HIS A 1 42  ? -4.206  -5.051  20.160  1.00 0.00 ? 42  HIS A HD1  3  
ATOM 5562  H HD2  . HIS A 1 42  ? -3.884  -3.073  16.500  1.00 0.00 ? 42  HIS A HD2  3  
ATOM 5563  H HE1  . HIS A 1 42  ? -3.983  -6.851  18.389  1.00 0.00 ? 42  HIS A HE1  3  
ATOM 5564  H HE2  . HIS A 1 42  ? -3.785  -5.658  16.158  1.00 0.00 ? 42  HIS A HE2  3  
ATOM 5565  N N    . TRP A 1 43  ? -6.640  -0.581  18.314  1.00 0.00 ? 43  TRP A N    3  
ATOM 5566  C CA   . TRP A 1 43  ? -7.486  -0.209  17.149  1.00 0.00 ? 43  TRP A CA   3  
ATOM 5567  C C    . TRP A 1 43  ? -6.591  0.150   15.963  1.00 0.00 ? 43  TRP A C    3  
ATOM 5568  O O    . TRP A 1 43  ? -5.619  0.863   16.102  1.00 0.00 ? 43  TRP A O    3  
ATOM 5569  C CB   . TRP A 1 43  ? -8.346  0.997   17.517  1.00 0.00 ? 43  TRP A CB   3  
ATOM 5570  C CG   . TRP A 1 43  ? -9.188  0.665   18.707  1.00 0.00 ? 43  TRP A CG   3  
ATOM 5571  C CD1  . TRP A 1 43  ? -8.741  0.609   19.982  1.00 0.00 ? 43  TRP A CD1  3  
ATOM 5572  C CD2  . TRP A 1 43  ? -10.607 0.351   18.758  1.00 0.00 ? 43  TRP A CD2  3  
ATOM 5573  N NE1  . TRP A 1 43  ? -9.796  0.274   20.813  1.00 0.00 ? 43  TRP A NE1  3  
ATOM 5574  C CE2  . TRP A 1 43  ? -10.968 0.107   20.102  1.00 0.00 ? 43  TRP A CE2  3  
ATOM 5575  C CE3  . TRP A 1 43  ? -11.608 0.255   17.774  1.00 0.00 ? 43  TRP A CE3  3  
ATOM 5576  C CZ2  . TRP A 1 43  ? -12.276 -0.221  20.461  1.00 0.00 ? 43  TRP A CZ2  3  
ATOM 5577  C CZ3  . TRP A 1 43  ? -12.925 -0.073  18.131  1.00 0.00 ? 43  TRP A CZ3  3  
ATOM 5578  C CH2  . TRP A 1 43  ? -13.258 -0.312  19.471  1.00 0.00 ? 43  TRP A CH2  3  
ATOM 5579  H H    . TRP A 1 43  ? -6.175  0.114   18.824  1.00 0.00 ? 43  TRP A H    3  
ATOM 5580  H HA   . TRP A 1 43  ? -8.123  -1.039  16.884  1.00 0.00 ? 43  TRP A HA   3  
ATOM 5581  H HB2  . TRP A 1 43  ? -7.705  1.836   17.746  1.00 0.00 ? 43  TRP A HB2  3  
ATOM 5582  H HB3  . TRP A 1 43  ? -8.984  1.251   16.684  1.00 0.00 ? 43  TRP A HB3  3  
ATOM 5583  H HD1  . TRP A 1 43  ? -7.725  0.792   20.301  1.00 0.00 ? 43  TRP A HD1  3  
ATOM 5584  H HE1  . TRP A 1 43  ? -9.740  0.167   21.784  1.00 0.00 ? 43  TRP A HE1  3  
ATOM 5585  H HE3  . TRP A 1 43  ? -11.360 0.436   16.738  1.00 0.00 ? 43  TRP A HE3  3  
ATOM 5586  H HZ2  . TRP A 1 43  ? -12.529 -0.403  21.495  1.00 0.00 ? 43  TRP A HZ2  3  
ATOM 5587  H HZ3  . TRP A 1 43  ? -13.683 -0.147  17.369  1.00 0.00 ? 43  TRP A HZ3  3  
ATOM 5588  H HH2  . TRP A 1 43  ? -14.273 -0.566  19.738  1.00 0.00 ? 43  TRP A HH2  3  
ATOM 5589  N N    . THR A 1 44  ? -6.914  -0.336  14.800  1.00 0.00 ? 44  THR A N    3  
ATOM 5590  C CA   . THR A 1 44  ? -6.086  -0.020  13.604  1.00 0.00 ? 44  THR A CA   3  
ATOM 5591  C C    . THR A 1 44  ? -6.958  -0.128  12.352  1.00 0.00 ? 44  THR A C    3  
ATOM 5592  O O    . THR A 1 44  ? -7.915  -0.875  12.320  1.00 0.00 ? 44  THR A O    3  
ATOM 5593  C CB   . THR A 1 44  ? -4.928  -1.019  13.514  1.00 0.00 ? 44  THR A CB   3  
ATOM 5594  O OG1  . THR A 1 44  ? -5.425  -2.333  13.726  1.00 0.00 ? 44  THR A OG1  3  
ATOM 5595  C CG2  . THR A 1 44  ? -3.882  -0.689  14.580  1.00 0.00 ? 44  THR A CG2  3  
ATOM 5596  H H    . THR A 1 44  ? -7.705  -0.907  14.709  1.00 0.00 ? 44  THR A H    3  
ATOM 5597  H HA   . THR A 1 44  ? -5.693  0.983   13.689  1.00 0.00 ? 44  THR A HA   3  
ATOM 5598  H HB   . THR A 1 44  ? -4.473  -0.960  12.538  1.00 0.00 ? 44  THR A HB   3  
ATOM 5599  H HG1  . THR A 1 44  ? -6.236  -2.264  14.235  1.00 0.00 ? 44  THR A HG1  3  
ATOM 5600  H HG21 . THR A 1 44  ? -2.994  -1.279  14.407  1.00 0.00 ? 44  THR A HG21 3  
ATOM 5601  H HG22 . THR A 1 44  ? -4.280  -0.918  15.558  1.00 0.00 ? 44  THR A HG22 3  
ATOM 5602  H HG23 . THR A 1 44  ? -3.633  0.360   14.529  1.00 0.00 ? 44  THR A HG23 3  
ATOM 5603  N N    . PRO A 1 45  ? -6.626  0.606   11.323  1.00 0.00 ? 45  PRO A N    3  
ATOM 5604  C CA   . PRO A 1 45  ? -7.394  0.583   10.048  1.00 0.00 ? 45  PRO A CA   3  
ATOM 5605  C C    . PRO A 1 45  ? -7.332  -0.793  9.380   1.00 0.00 ? 45  PRO A C    3  
ATOM 5606  O O    . PRO A 1 45  ? -6.406  -1.550  9.595   1.00 0.00 ? 45  PRO A O    3  
ATOM 5607  C CB   . PRO A 1 45  ? -6.711  1.639   9.171   1.00 0.00 ? 45  PRO A CB   3  
ATOM 5608  C CG   . PRO A 1 45  ? -5.369  1.877   9.783   1.00 0.00 ? 45  PRO A CG   3  
ATOM 5609  C CD   . PRO A 1 45  ? -5.489  1.531   11.266  1.00 0.00 ? 45  PRO A CD   3  
ATOM 5610  H HA   . PRO A 1 45  ? -8.417  0.868   10.226  1.00 0.00 ? 45  PRO A HA   3  
ATOM 5611  H HB2  . PRO A 1 45  ? -6.601  1.269   8.160   1.00 0.00 ? 45  PRO A HB2  3  
ATOM 5612  H HB3  . PRO A 1 45  ? -7.283  2.553   9.172   1.00 0.00 ? 45  PRO A HB3  3  
ATOM 5613  H HG2  . PRO A 1 45  ? -4.629  1.246   9.310   1.00 0.00 ? 45  PRO A HG2  3  
ATOM 5614  H HG3  . PRO A 1 45  ? -5.094  2.916   9.675   1.00 0.00 ? 45  PRO A HG3  3  
ATOM 5615  H HD2  . PRO A 1 45  ? -4.586  1.050   11.615  1.00 0.00 ? 45  PRO A HD2  3  
ATOM 5616  H HD3  . PRO A 1 45  ? -5.699  2.416   11.847  1.00 0.00 ? 45  PRO A HD3  3  
ATOM 5617  N N    . PRO A 1 46  ? -8.311  -1.117  8.583   1.00 0.00 ? 46  PRO A N    3  
ATOM 5618  C CA   . PRO A 1 46  ? -8.368  -2.429  7.883   1.00 0.00 ? 46  PRO A CA   3  
ATOM 5619  C C    . PRO A 1 46  ? -7.110  -2.675  7.048   1.00 0.00 ? 46  PRO A C    3  
ATOM 5620  O O    . PRO A 1 46  ? -6.863  -2.005  6.065   1.00 0.00 ? 46  PRO A O    3  
ATOM 5621  C CB   . PRO A 1 46  ? -9.606  -2.336  6.981   1.00 0.00 ? 46  PRO A CB   3  
ATOM 5622  C CG   . PRO A 1 46  ? -10.033 -0.900  6.992   1.00 0.00 ? 46  PRO A CG   3  
ATOM 5623  C CD   . PRO A 1 46  ? -9.465  -0.272  8.261   1.00 0.00 ? 46  PRO A CD   3  
ATOM 5624  H HA   . PRO A 1 46  ? -8.498  -3.226  8.596   1.00 0.00 ? 46  PRO A HA   3  
ATOM 5625  H HB2  . PRO A 1 46  ? -9.355  -2.643  5.976   1.00 0.00 ? 46  PRO A HB2  3  
ATOM 5626  H HB3  . PRO A 1 46  ? -10.399 -2.953  7.373   1.00 0.00 ? 46  PRO A HB3  3  
ATOM 5627  H HG2  . PRO A 1 46  ? -9.640  -0.394  6.120   1.00 0.00 ? 46  PRO A HG2  3  
ATOM 5628  H HG3  . PRO A 1 46  ? -11.109 -0.834  7.006   1.00 0.00 ? 46  PRO A HG3  3  
ATOM 5629  H HD2  . PRO A 1 46  ? -9.151  0.747   8.072   1.00 0.00 ? 46  PRO A HD2  3  
ATOM 5630  H HD3  . PRO A 1 46  ? -10.188 -0.304  9.061   1.00 0.00 ? 46  PRO A HD3  3  
ATOM 5631  N N    . LYS A 1 47  ? -6.306  -3.626  7.439   1.00 0.00 ? 47  LYS A N    3  
ATOM 5632  C CA   . LYS A 1 47  ? -5.064  -3.904  6.672   1.00 0.00 ? 47  LYS A CA   3  
ATOM 5633  C C    . LYS A 1 47  ? -4.844  -5.410  6.541   1.00 0.00 ? 47  LYS A C    3  
ATOM 5634  O O    . LYS A 1 47  ? -5.342  -6.200  7.317   1.00 0.00 ? 47  LYS A O    3  
ATOM 5635  C CB   . LYS A 1 47  ? -3.867  -3.276  7.391   1.00 0.00 ? 47  LYS A CB   3  
ATOM 5636  C CG   . LYS A 1 47  ? -3.645  -3.980  8.730   1.00 0.00 ? 47  LYS A CG   3  
ATOM 5637  C CD   . LYS A 1 47  ? -2.533  -3.262  9.500   1.00 0.00 ? 47  LYS A CD   3  
ATOM 5638  C CE   . LYS A 1 47  ? -2.096  -4.121  10.687  1.00 0.00 ? 47  LYS A CE   3  
ATOM 5639  N NZ   . LYS A 1 47  ? -0.868  -3.535  11.295  1.00 0.00 ? 47  LYS A NZ   3  
ATOM 5640  H H    . LYS A 1 47  ? -6.520  -4.152  8.239   1.00 0.00 ? 47  LYS A H    3  
ATOM 5641  H HA   . LYS A 1 47  ? -5.150  -3.473  5.689   1.00 0.00 ? 47  LYS A HA   3  
ATOM 5642  H HB2  . LYS A 1 47  ? -2.983  -3.384  6.777   1.00 0.00 ? 47  LYS A HB2  3  
ATOM 5643  H HB3  . LYS A 1 47  ? -4.059  -2.230  7.562   1.00 0.00 ? 47  LYS A HB3  3  
ATOM 5644  H HG2  . LYS A 1 47  ? -4.557  -3.955  9.307   1.00 0.00 ? 47  LYS A HG2  3  
ATOM 5645  H HG3  . LYS A 1 47  ? -3.355  -5.004  8.556   1.00 0.00 ? 47  LYS A HG3  3  
ATOM 5646  H HD2  . LYS A 1 47  ? -1.690  -3.100  8.844   1.00 0.00 ? 47  LYS A HD2  3  
ATOM 5647  H HD3  . LYS A 1 47  ? -2.897  -2.313  9.860   1.00 0.00 ? 47  LYS A HD3  3  
ATOM 5648  H HE2  . LYS A 1 47  ? -2.884  -4.147  11.425  1.00 0.00 ? 47  LYS A HE2  3  
ATOM 5649  H HE3  . LYS A 1 47  ? -1.884  -5.126  10.348  1.00 0.00 ? 47  LYS A HE3  3  
ATOM 5650  H HZ1  . LYS A 1 47  ? -0.098  -4.235  11.264  1.00 0.00 ? 47  LYS A HZ1  3  
ATOM 5651  H HZ2  . LYS A 1 47  ? -1.060  -3.273  12.283  1.00 0.00 ? 47  LYS A HZ2  3  
ATOM 5652  H HZ3  . LYS A 1 47  ? -0.585  -2.690  10.761  1.00 0.00 ? 47  LYS A HZ3  3  
ATOM 5653  N N    . GLY A 1 48  ? -4.085  -5.803  5.558   1.00 0.00 ? 48  GLY A N    3  
ATOM 5654  C CA   . GLY A 1 48  ? -3.802  -7.248  5.348   1.00 0.00 ? 48  GLY A CA   3  
ATOM 5655  C C    . GLY A 1 48  ? -2.495  -7.381  4.565   1.00 0.00 ? 48  GLY A C    3  
ATOM 5656  O O    . GLY A 1 48  ? -1.782  -6.416  4.371   1.00 0.00 ? 48  GLY A O    3  
ATOM 5657  H H    . GLY A 1 48  ? -3.695  -5.138  4.953   1.00 0.00 ? 48  GLY A H    3  
ATOM 5658  H HA2  . GLY A 1 48  ? -3.705  -7.739  6.307   1.00 0.00 ? 48  GLY A HA2  3  
ATOM 5659  H HA3  . GLY A 1 48  ? -4.604  -7.700  4.785   1.00 0.00 ? 48  GLY A HA3  3  
ATOM 5660  N N    . HIS A 1 49  ? -2.171  -8.557  4.109   1.00 0.00 ? 49  HIS A N    3  
ATOM 5661  C CA   . HIS A 1 49  ? -0.907  -8.724  3.338   1.00 0.00 ? 49  HIS A CA   3  
ATOM 5662  C C    . HIS A 1 49  ? -1.238  -8.750  1.845   1.00 0.00 ? 49  HIS A C    3  
ATOM 5663  O O    . HIS A 1 49  ? -2.165  -9.409  1.418   1.00 0.00 ? 49  HIS A O    3  
ATOM 5664  C CB   . HIS A 1 49  ? -0.231  -10.036 3.739   1.00 0.00 ? 49  HIS A CB   3  
ATOM 5665  C CG   . HIS A 1 49  ? 0.132   -9.985  5.198   1.00 0.00 ? 49  HIS A CG   3  
ATOM 5666  N ND1  . HIS A 1 49  ? -0.694  -10.505 6.183   1.00 0.00 ? 49  HIS A ND1  3  
ATOM 5667  C CD2  . HIS A 1 49  ? 1.225   -9.476  5.854   1.00 0.00 ? 49  HIS A CD2  3  
ATOM 5668  C CE1  . HIS A 1 49  ? -0.090  -10.300 7.369   1.00 0.00 ? 49  HIS A CE1  3  
ATOM 5669  N NE2  . HIS A 1 49  ? 1.080   -9.677  7.223   1.00 0.00 ? 49  HIS A NE2  3  
ATOM 5670  H H    . HIS A 1 49  ? -2.756  -9.325  4.270   1.00 0.00 ? 49  HIS A H    3  
ATOM 5671  H HA   . HIS A 1 49  ? -0.245  -7.898  3.545   1.00 0.00 ? 49  HIS A HA   3  
ATOM 5672  H HB2  . HIS A 1 49  ? -0.910  -10.859 3.563   1.00 0.00 ? 49  HIS A HB2  3  
ATOM 5673  H HB3  . HIS A 1 49  ? 0.661   -10.175 3.151   1.00 0.00 ? 49  HIS A HB3  3  
ATOM 5674  H HD1  . HIS A 1 49  ? -1.560  -10.945 6.043   1.00 0.00 ? 49  HIS A HD1  3  
ATOM 5675  H HD2  . HIS A 1 49  ? 2.067   -8.994  5.381   1.00 0.00 ? 49  HIS A HD2  3  
ATOM 5676  H HE1  . HIS A 1 49  ? -0.502  -10.602 8.322   1.00 0.00 ? 49  HIS A HE1  3  
ATOM 5677  H HE2  . HIS A 1 49  ? 1.705   -9.418  7.930   1.00 0.00 ? 49  HIS A HE2  3  
ATOM 5678  N N    . VAL A 1 50  ? -0.497  -8.032  1.047   1.00 0.00 ? 50  VAL A N    3  
ATOM 5679  C CA   . VAL A 1 50  ? -0.790  -8.013  -0.414  1.00 0.00 ? 50  VAL A CA   3  
ATOM 5680  C C    . VAL A 1 50  ? -0.163  -9.236  -1.086  1.00 0.00 ? 50  VAL A C    3  
ATOM 5681  O O    . VAL A 1 50  ? 0.983   -9.572  -0.861  1.00 0.00 ? 50  VAL A O    3  
ATOM 5682  C CB   . VAL A 1 50  ? -0.241  -6.724  -1.045  1.00 0.00 ? 50  VAL A CB   3  
ATOM 5683  C CG1  . VAL A 1 50  ? 0.540   -5.926  -0.002  1.00 0.00 ? 50  VAL A CG1  3  
ATOM 5684  C CG2  . VAL A 1 50  ? 0.674   -7.060  -2.225  1.00 0.00 ? 50  VAL A CG2  3  
ATOM 5685  H H    . VAL A 1 50  ? 0.242   -7.499  1.408   1.00 0.00 ? 50  VAL A H    3  
ATOM 5686  H HA   . VAL A 1 50  ? -1.860  -8.047  -0.557  1.00 0.00 ? 50  VAL A HA   3  
ATOM 5687  H HB   . VAL A 1 50  ? -1.065  -6.124  -1.395  1.00 0.00 ? 50  VAL A HB   3  
ATOM 5688  H HG11 . VAL A 1 50  ? -0.131  -5.594  0.775   1.00 0.00 ? 50  VAL A HG11 3  
ATOM 5689  H HG12 . VAL A 1 50  ? 0.993   -5.066  -0.478  1.00 0.00 ? 50  VAL A HG12 3  
ATOM 5690  H HG13 . VAL A 1 50  ? 1.311   -6.548  0.425   1.00 0.00 ? 50  VAL A HG13 3  
ATOM 5691  H HG21 . VAL A 1 50  ? 1.525   -7.627  -1.876  1.00 0.00 ? 50  VAL A HG21 3  
ATOM 5692  H HG22 . VAL A 1 50  ? 1.018   -6.143  -2.683  1.00 0.00 ? 50  VAL A HG22 3  
ATOM 5693  H HG23 . VAL A 1 50  ? 0.125   -7.639  -2.955  1.00 0.00 ? 50  VAL A HG23 3  
ATOM 5694  N N    . GLU A 1 51  ? -0.918  -9.896  -1.920  1.00 0.00 ? 51  GLU A N    3  
ATOM 5695  C CA   . GLU A 1 51  ? -0.397  -11.094 -2.634  1.00 0.00 ? 51  GLU A CA   3  
ATOM 5696  C C    . GLU A 1 51  ? 0.741   -10.650 -3.569  1.00 0.00 ? 51  GLU A C    3  
ATOM 5697  O O    . GLU A 1 51  ? 1.138   -9.504  -3.557  1.00 0.00 ? 51  GLU A O    3  
ATOM 5698  C CB   . GLU A 1 51  ? -1.551  -11.706 -3.440  1.00 0.00 ? 51  GLU A CB   3  
ATOM 5699  C CG   . GLU A 1 51  ? -1.801  -13.159 -3.006  1.00 0.00 ? 51  GLU A CG   3  
ATOM 5700  C CD   . GLU A 1 51  ? -2.430  -13.939 -4.160  1.00 0.00 ? 51  GLU A CD   3  
ATOM 5701  O OE1  . GLU A 1 51  ? -3.198  -13.345 -4.903  1.00 0.00 ? 51  GLU A OE1  3  
ATOM 5702  O OE2  . GLU A 1 51  ? -2.136  -15.115 -4.287  1.00 0.00 ? 51  GLU A OE2  3  
ATOM 5703  H H    . GLU A 1 51  ? -1.836  -9.596  -2.084  1.00 0.00 ? 51  GLU A H    3  
ATOM 5704  H HA   . GLU A 1 51  ? -0.024  -11.812 -1.918  1.00 0.00 ? 51  GLU A HA   3  
ATOM 5705  H HB2  . GLU A 1 51  ? -2.441  -11.137 -3.265  1.00 0.00 ? 51  GLU A HB2  3  
ATOM 5706  H HB3  . GLU A 1 51  ? -1.317  -11.673 -4.490  1.00 0.00 ? 51  GLU A HB3  3  
ATOM 5707  H HG2  . GLU A 1 51  ? -0.869  -13.623 -2.725  1.00 0.00 ? 51  GLU A HG2  3  
ATOM 5708  H HG3  . GLU A 1 51  ? -2.472  -13.168 -2.164  1.00 0.00 ? 51  GLU A HG3  3  
ATOM 5709  H HE2  . GLU A 1 51  ? -2.568  -15.540 -5.032  1.00 0.00 ? 51  GLU A HE2  3  
ATOM 5710  N N    . PRO A 1 52  ? 1.271   -11.543 -4.365  1.00 0.00 ? 52  PRO A N    3  
ATOM 5711  C CA   . PRO A 1 52  ? 2.383   -11.213 -5.302  1.00 0.00 ? 52  PRO A CA   3  
ATOM 5712  C C    . PRO A 1 52  ? 1.892   -10.440 -6.530  1.00 0.00 ? 52  PRO A C    3  
ATOM 5713  O O    . PRO A 1 52  ? 2.180   -9.272  -6.695  1.00 0.00 ? 52  PRO A O    3  
ATOM 5714  C CB   . PRO A 1 52  ? 2.929   -12.580 -5.709  1.00 0.00 ? 52  PRO A CB   3  
ATOM 5715  C CG   . PRO A 1 52  ? 1.789   -13.530 -5.550  1.00 0.00 ? 52  PRO A CG   3  
ATOM 5716  C CD   . PRO A 1 52  ? 0.875   -12.957 -4.466  1.00 0.00 ? 52  PRO A CD   3  
ATOM 5717  H HA   . PRO A 1 52  ? 3.151   -10.657 -4.790  1.00 0.00 ? 52  PRO A HA   3  
ATOM 5718  H HB2  . PRO A 1 52  ? 3.259   -12.560 -6.738  1.00 0.00 ? 52  PRO A HB2  3  
ATOM 5719  H HB3  . PRO A 1 52  ? 3.740   -12.869 -5.059  1.00 0.00 ? 52  PRO A HB3  3  
ATOM 5720  H HG2  . PRO A 1 52  ? 1.250   -13.615 -6.483  1.00 0.00 ? 52  PRO A HG2  3  
ATOM 5721  H HG3  . PRO A 1 52  ? 2.151   -14.497 -5.240  1.00 0.00 ? 52  PRO A HG3  3  
ATOM 5722  H HD2  . PRO A 1 52  ? -0.154  -13.045 -4.771  1.00 0.00 ? 52  PRO A HD2  3  
ATOM 5723  H HD3  . PRO A 1 52  ? 1.041   -13.457 -3.524  1.00 0.00 ? 52  PRO A HD3  3  
ATOM 5724  N N    . GLY A 1 53  ? 1.147   -11.081 -7.386  1.00 0.00 ? 53  GLY A N    3  
ATOM 5725  C CA   . GLY A 1 53  ? 0.631   -10.376 -8.595  1.00 0.00 ? 53  GLY A CA   3  
ATOM 5726  C C    . GLY A 1 53  ? -0.569  -9.516  -8.197  1.00 0.00 ? 53  GLY A C    3  
ATOM 5727  O O    . GLY A 1 53  ? -1.370  -9.127  -9.023  1.00 0.00 ? 53  GLY A O    3  
ATOM 5728  H H    . GLY A 1 53  ? 0.919   -12.021 -7.232  1.00 0.00 ? 53  GLY A H    3  
ATOM 5729  H HA2  . GLY A 1 53  ? 1.410   -9.750  -9.005  1.00 0.00 ? 53  GLY A HA2  3  
ATOM 5730  H HA3  . GLY A 1 53  ? 0.321   -11.102 -9.331  1.00 0.00 ? 53  GLY A HA3  3  
ATOM 5731  N N    . GLU A 1 54  ? -0.700  -9.223  -6.931  1.00 0.00 ? 54  GLU A N    3  
ATOM 5732  C CA   . GLU A 1 54  ? -1.850  -8.397  -6.465  1.00 0.00 ? 54  GLU A CA   3  
ATOM 5733  C C    . GLU A 1 54  ? -1.467  -6.916  -6.495  1.00 0.00 ? 54  GLU A C    3  
ATOM 5734  O O    . GLU A 1 54  ? -0.319  -6.558  -6.322  1.00 0.00 ? 54  GLU A O    3  
ATOM 5735  C CB   . GLU A 1 54  ? -2.212  -8.794  -5.035  1.00 0.00 ? 54  GLU A CB   3  
ATOM 5736  C CG   . GLU A 1 54  ? -3.509  -8.099  -4.626  1.00 0.00 ? 54  GLU A CG   3  
ATOM 5737  C CD   . GLU A 1 54  ? -3.821  -8.405  -3.160  1.00 0.00 ? 54  GLU A CD   3  
ATOM 5738  O OE1  . GLU A 1 54  ? -3.008  -9.053  -2.521  1.00 0.00 ? 54  GLU A OE1  3  
ATOM 5739  O OE2  . GLU A 1 54  ? -4.873  -7.990  -2.699  1.00 0.00 ? 54  GLU A OE2  3  
ATOM 5740  H H    . GLU A 1 54  ? -0.043  -9.555  -6.283  1.00 0.00 ? 54  GLU A H    3  
ATOM 5741  H HA   . GLU A 1 54  ? -2.698  -8.564  -7.110  1.00 0.00 ? 54  GLU A HA   3  
ATOM 5742  H HB2  . GLU A 1 54  ? -2.345  -9.860  -4.985  1.00 0.00 ? 54  GLU A HB2  3  
ATOM 5743  H HB3  . GLU A 1 54  ? -1.419  -8.498  -4.364  1.00 0.00 ? 54  GLU A HB3  3  
ATOM 5744  H HG2  . GLU A 1 54  ? -3.395  -7.035  -4.755  1.00 0.00 ? 54  GLU A HG2  3  
ATOM 5745  H HG3  . GLU A 1 54  ? -4.318  -8.452  -5.247  1.00 0.00 ? 54  GLU A HG3  3  
ATOM 5746  H HE2  . GLU A 1 54  ? -5.003  -8.220  -1.776  1.00 0.00 ? 54  GLU A HE2  3  
ATOM 5747  N N    . ASP A 1 55  ? -2.421  -6.053  -6.719  1.00 0.00 ? 55  ASP A N    3  
ATOM 5748  C CA   . ASP A 1 55  ? -2.113  -4.597  -6.765  1.00 0.00 ? 55  ASP A CA   3  
ATOM 5749  C C    . ASP A 1 55  ? -1.800  -4.083  -5.365  1.00 0.00 ? 55  ASP A C    3  
ATOM 5750  O O    . ASP A 1 55  ? -2.123  -4.703  -4.370  1.00 0.00 ? 55  ASP A O    3  
ATOM 5751  C CB   . ASP A 1 55  ? -3.318  -3.823  -7.280  1.00 0.00 ? 55  ASP A CB   3  
ATOM 5752  C CG   . ASP A 1 55  ? -2.887  -2.413  -7.689  1.00 0.00 ? 55  ASP A CG   3  
ATOM 5753  O OD1  . ASP A 1 55  ? -1.702  -2.133  -7.622  1.00 0.00 ? 55  ASP A OD1  3  
ATOM 5754  O OD2  . ASP A 1 55  ? -3.752  -1.637  -8.058  1.00 0.00 ? 55  ASP A OD2  3  
ATOM 5755  H H    . ASP A 1 55  ? -3.342  -6.363  -6.858  1.00 0.00 ? 55  ASP A H    3  
ATOM 5756  H HA   . ASP A 1 55  ? -1.267  -4.423  -7.414  1.00 0.00 ? 55  ASP A HA   3  
ATOM 5757  H HB2  . ASP A 1 55  ? -3.751  -4.335  -8.117  1.00 0.00 ? 55  ASP A HB2  3  
ATOM 5758  H HB3  . ASP A 1 55  ? -4.037  -3.754  -6.494  1.00 0.00 ? 55  ASP A HB3  3  
ATOM 5759  H HD2  . ASP A 1 55  ? -3.411  -0.772  -8.298  1.00 0.00 ? 55  ASP A HD2  3  
ATOM 5760  N N    . ASP A 1 56  ? -1.193  -2.939  -5.288  1.00 0.00 ? 56  ASP A N    3  
ATOM 5761  C CA   . ASP A 1 56  ? -0.867  -2.349  -3.960  1.00 0.00 ? 56  ASP A CA   3  
ATOM 5762  C C    . ASP A 1 56  ? -2.143  -1.764  -3.347  1.00 0.00 ? 56  ASP A C    3  
ATOM 5763  O O    . ASP A 1 56  ? -2.619  -2.215  -2.322  1.00 0.00 ? 56  ASP A O    3  
ATOM 5764  C CB   . ASP A 1 56  ? 0.165   -1.236  -4.139  1.00 0.00 ? 56  ASP A CB   3  
ATOM 5765  C CG   . ASP A 1 56  ? 1.474   -1.831  -4.663  1.00 0.00 ? 56  ASP A CG   3  
ATOM 5766  O OD1  . ASP A 1 56  ? 1.605   -3.043  -4.638  1.00 0.00 ? 56  ASP A OD1  3  
ATOM 5767  O OD2  . ASP A 1 56  ? 2.325   -1.061  -5.083  1.00 0.00 ? 56  ASP A OD2  3  
ATOM 5768  H H    . ASP A 1 56  ? -0.965  -2.457  -6.110  1.00 0.00 ? 56  ASP A H    3  
ATOM 5769  H HA   . ASP A 1 56  ? -0.469  -3.115  -3.309  1.00 0.00 ? 56  ASP A HA   3  
ATOM 5770  H HB2  . ASP A 1 56  ? -0.208  -0.507  -4.844  1.00 0.00 ? 56  ASP A HB2  3  
ATOM 5771  H HB3  . ASP A 1 56  ? 0.347   -0.759  -3.189  1.00 0.00 ? 56  ASP A HB3  3  
ATOM 5772  H HD2  . ASP A 1 56  ? 3.118   -1.503  -5.396  1.00 0.00 ? 56  ASP A HD2  3  
ATOM 5773  N N    . LEU A 1 57  ? -2.701  -0.758  -3.970  1.00 0.00 ? 57  LEU A N    3  
ATOM 5774  C CA   . LEU A 1 57  ? -3.947  -0.141  -3.430  1.00 0.00 ? 57  LEU A CA   3  
ATOM 5775  C C    . LEU A 1 57  ? -5.081  -1.165  -3.453  1.00 0.00 ? 57  LEU A C    3  
ATOM 5776  O O    . LEU A 1 57  ? -5.853  -1.269  -2.520  1.00 0.00 ? 57  LEU A O    3  
ATOM 5777  C CB   . LEU A 1 57  ? -4.328  1.069   -4.291  1.00 0.00 ? 57  LEU A CB   3  
ATOM 5778  C CG   . LEU A 1 57  ? -5.634  1.687   -3.778  1.00 0.00 ? 57  LEU A CG   3  
ATOM 5779  C CD1  . LEU A 1 57  ? -5.450  2.174   -2.343  1.00 0.00 ? 57  LEU A CD1  3  
ATOM 5780  C CD2  . LEU A 1 57  ? -6.018  2.870   -4.665  1.00 0.00 ? 57  LEU A CD2  3  
ATOM 5781  H H    . LEU A 1 57  ? -2.300  -0.412  -4.795  1.00 0.00 ? 57  LEU A H    3  
ATOM 5782  H HA   . LEU A 1 57  ? -3.773  0.182   -2.414  1.00 0.00 ? 57  LEU A HA   3  
ATOM 5783  H HB2  . LEU A 1 57  ? -3.541  1.805   -4.243  1.00 0.00 ? 57  LEU A HB2  3  
ATOM 5784  H HB3  . LEU A 1 57  ? -4.462  0.752   -5.315  1.00 0.00 ? 57  LEU A HB3  3  
ATOM 5785  H HG   . LEU A 1 57  ? -6.415  0.947   -3.809  1.00 0.00 ? 57  LEU A HG   3  
ATOM 5786  H HD11 . LEU A 1 57  ? -5.539  1.339   -1.663  1.00 0.00 ? 57  LEU A HD11 3  
ATOM 5787  H HD12 . LEU A 1 57  ? -6.212  2.905   -2.112  1.00 0.00 ? 57  LEU A HD12 3  
ATOM 5788  H HD13 . LEU A 1 57  ? -4.476  2.623   -2.237  1.00 0.00 ? 57  LEU A HD13 3  
ATOM 5789  H HD21 . LEU A 1 57  ? -6.771  3.462   -4.168  1.00 0.00 ? 57  LEU A HD21 3  
ATOM 5790  H HD22 . LEU A 1 57  ? -6.409  2.504   -5.604  1.00 0.00 ? 57  LEU A HD22 3  
ATOM 5791  H HD23 . LEU A 1 57  ? -5.147  3.480   -4.848  1.00 0.00 ? 57  LEU A HD23 3  
ATOM 5792  N N    . GLU A 1 58  ? -5.186  -1.928  -4.507  1.00 0.00 ? 58  GLU A N    3  
ATOM 5793  C CA   . GLU A 1 58  ? -6.272  -2.946  -4.582  1.00 0.00 ? 58  GLU A CA   3  
ATOM 5794  C C    . GLU A 1 58  ? -6.243  -3.791  -3.310  1.00 0.00 ? 58  GLU A C    3  
ATOM 5795  O O    . GLU A 1 58  ? -7.267  -4.108  -2.742  1.00 0.00 ? 58  GLU A O    3  
ATOM 5796  C CB   . GLU A 1 58  ? -6.027  -3.846  -5.792  1.00 0.00 ? 58  GLU A CB   3  
ATOM 5797  C CG   . GLU A 1 58  ? -7.230  -4.734  -6.048  1.00 0.00 ? 58  GLU A CG   3  
ATOM 5798  C CD   . GLU A 1 58  ? -6.913  -5.704  -7.189  1.00 0.00 ? 58  GLU A CD   3  
ATOM 5799  O OE1  . GLU A 1 58  ? -5.801  -5.657  -7.687  1.00 0.00 ? 58  GLU A OE1  3  
ATOM 5800  O OE2  . GLU A 1 58  ? -7.787  -6.478  -7.541  1.00 0.00 ? 58  GLU A OE2  3  
ATOM 5801  H H    . GLU A 1 58  ? -4.550  -1.833  -5.245  1.00 0.00 ? 58  GLU A H    3  
ATOM 5802  H HA   . GLU A 1 58  ? -7.233  -2.456  -4.676  1.00 0.00 ? 58  GLU A HA   3  
ATOM 5803  H HB2  . GLU A 1 58  ? -5.847  -3.236  -6.664  1.00 0.00 ? 58  GLU A HB2  3  
ATOM 5804  H HB3  . GLU A 1 58  ? -5.169  -4.469  -5.597  1.00 0.00 ? 58  GLU A HB3  3  
ATOM 5805  H HG2  . GLU A 1 58  ? -7.454  -5.289  -5.156  1.00 0.00 ? 58  GLU A HG2  3  
ATOM 5806  H HG3  . GLU A 1 58  ? -8.069  -4.124  -6.322  1.00 0.00 ? 58  GLU A HG3  3  
ATOM 5807  H HE2  . GLU A 1 58  ? -7.518  -7.056  -8.259  1.00 0.00 ? 58  GLU A HE2  3  
ATOM 5808  N N    . THR A 1 59  ? -5.072  -4.139  -2.842  1.00 0.00 ? 59  THR A N    3  
ATOM 5809  C CA   . THR A 1 59  ? -4.995  -4.940  -1.594  1.00 0.00 ? 59  THR A CA   3  
ATOM 5810  C C    . THR A 1 59  ? -5.675  -4.154  -0.479  1.00 0.00 ? 59  THR A C    3  
ATOM 5811  O O    . THR A 1 59  ? -6.456  -4.686  0.285   1.00 0.00 ? 59  THR A O    3  
ATOM 5812  C CB   . THR A 1 59  ? -3.532  -5.199  -1.238  1.00 0.00 ? 59  THR A CB   3  
ATOM 5813  O OG1  . THR A 1 59  ? -2.920  -5.914  -2.300  1.00 0.00 ? 59  THR A OG1  3  
ATOM 5814  C CG2  . THR A 1 59  ? -3.452  -6.017  0.053   1.00 0.00 ? 59  THR A CG2  3  
ATOM 5815  H H    . THR A 1 59  ? -4.253  -3.861  -3.303  1.00 0.00 ? 59  THR A H    3  
ATOM 5816  H HA   . THR A 1 59  ? -5.506  -5.880  -1.735  1.00 0.00 ? 59  THR A HA   3  
ATOM 5817  H HB   . THR A 1 59  ? -3.019  -4.259  -1.094  1.00 0.00 ? 59  THR A HB   3  
ATOM 5818  H HG1  . THR A 1 59  ? -3.589  -6.460  -2.716  1.00 0.00 ? 59  THR A HG1  3  
ATOM 5819  H HG21 . THR A 1 59  ? -3.827  -7.013  -0.127  1.00 0.00 ? 59  THR A HG21 3  
ATOM 5820  H HG22 . THR A 1 59  ? -4.046  -5.542  0.819   1.00 0.00 ? 59  THR A HG22 3  
ATOM 5821  H HG23 . THR A 1 59  ? -2.424  -6.075  0.382   1.00 0.00 ? 59  THR A HG23 3  
ATOM 5822  N N    . ALA A 1 60  ? -5.405  -2.879  -0.395  1.00 0.00 ? 60  ALA A N    3  
ATOM 5823  C CA   . ALA A 1 60  ? -6.064  -2.058  0.651   1.00 0.00 ? 60  ALA A CA   3  
ATOM 5824  C C    . ALA A 1 60  ? -7.560  -2.024  0.350   1.00 0.00 ? 60  ALA A C    3  
ATOM 5825  O O    . ALA A 1 60  ? -8.386  -2.157  1.228   1.00 0.00 ? 60  ALA A O    3  
ATOM 5826  C CB   . ALA A 1 60  ? -5.499  -0.636  0.620   1.00 0.00 ? 60  ALA A CB   3  
ATOM 5827  H H    . ALA A 1 60  ? -4.787  -2.464  -1.033  1.00 0.00 ? 60  ALA A H    3  
ATOM 5828  H HA   . ALA A 1 60  ? -5.895  -2.496  1.624   1.00 0.00 ? 60  ALA A HA   3  
ATOM 5829  H HB1  . ALA A 1 60  ? -5.484  -0.231  1.621   1.00 0.00 ? 60  ALA A HB1  3  
ATOM 5830  H HB2  . ALA A 1 60  ? -6.121  -0.018  -0.008  1.00 0.00 ? 60  ALA A HB2  3  
ATOM 5831  H HB3  . ALA A 1 60  ? -4.495  -0.656  0.226   1.00 0.00 ? 60  ALA A HB3  3  
ATOM 5832  N N    . LEU A 1 61  ? -7.905  -1.866  -0.899  1.00 0.00 ? 61  LEU A N    3  
ATOM 5833  C CA   . LEU A 1 61  ? -9.345  -1.842  -1.282  1.00 0.00 ? 61  LEU A CA   3  
ATOM 5834  C C    . LEU A 1 61  ? -9.972  -3.186  -0.925  1.00 0.00 ? 61  LEU A C    3  
ATOM 5835  O O    . LEU A 1 61  ? -10.994 -3.260  -0.270  1.00 0.00 ? 61  LEU A O    3  
ATOM 5836  C CB   . LEU A 1 61  ? -9.446  -1.651  -2.791  1.00 0.00 ? 61  LEU A CB   3  
ATOM 5837  C CG   . LEU A 1 61  ? -8.774  -0.343  -3.192  1.00 0.00 ? 61  LEU A CG   3  
ATOM 5838  C CD1  . LEU A 1 61  ? -8.773  -0.232  -4.715  1.00 0.00 ? 61  LEU A CD1  3  
ATOM 5839  C CD2  . LEU A 1 61  ? -9.543  0.836   -2.591  1.00 0.00 ? 61  LEU A CD2  3  
ATOM 5840  H H    . LEU A 1 61  ? -7.216  -1.774  -1.587  1.00 0.00 ? 61  LEU A H    3  
ATOM 5841  H HA   . LEU A 1 61  ? -9.857  -1.041  -0.771  1.00 0.00 ? 61  LEU A HA   3  
ATOM 5842  H HB2  . LEU A 1 61  ? -8.953  -2.472  -3.289  1.00 0.00 ? 61  LEU A HB2  3  
ATOM 5843  H HB3  . LEU A 1 61  ? -10.480 -1.627  -3.087  1.00 0.00 ? 61  LEU A HB3  3  
ATOM 5844  H HG   . LEU A 1 61  ? -7.760  -0.338  -2.827  1.00 0.00 ? 61  LEU A HG   3  
ATOM 5845  H HD11 . LEU A 1 61  ? -9.221  0.705   -5.010  1.00 0.00 ? 61  LEU A HD11 3  
ATOM 5846  H HD12 . LEU A 1 61  ? -9.339  -1.052  -5.131  1.00 0.00 ? 61  LEU A HD12 3  
ATOM 5847  H HD13 . LEU A 1 61  ? -7.759  -0.277  -5.081  1.00 0.00 ? 61  LEU A HD13 3  
ATOM 5848  H HD21 . LEU A 1 61  ? -9.516  1.670   -3.276  1.00 0.00 ? 61  LEU A HD21 3  
ATOM 5849  H HD22 . LEU A 1 61  ? -9.084  1.123   -1.656  1.00 0.00 ? 61  LEU A HD22 3  
ATOM 5850  H HD23 . LEU A 1 61  ? -10.566 0.546   -2.414  1.00 0.00 ? 61  LEU A HD23 3  
ATOM 5851  N N    . ARG A 1 62  ? -9.359  -4.249  -1.361  1.00 0.00 ? 62  ARG A N    3  
ATOM 5852  C CA   . ARG A 1 62  ? -9.900  -5.602  -1.065  1.00 0.00 ? 62  ARG A CA   3  
ATOM 5853  C C    . ARG A 1 62  ? -9.955  -5.812  0.449   1.00 0.00 ? 62  ARG A C    3  
ATOM 5854  O O    . ARG A 1 62  ? -10.923 -6.315  0.979   1.00 0.00 ? 62  ARG A O    3  
ATOM 5855  C CB   . ARG A 1 62  ? -8.987  -6.657  -1.697  1.00 0.00 ? 62  ARG A CB   3  
ATOM 5856  C CG   . ARG A 1 62  ? -9.621  -8.042  -1.550  1.00 0.00 ? 62  ARG A CG   3  
ATOM 5857  C CD   . ARG A 1 62  ? -8.706  -9.095  -2.178  1.00 0.00 ? 62  ARG A CD   3  
ATOM 5858  N NE   . ARG A 1 62  ? -9.380  -10.423 -2.143  1.00 0.00 ? 62  ARG A NE   3  
ATOM 5859  C CZ   . ARG A 1 62  ? -9.355  -11.139 -1.051  1.00 0.00 ? 62  ARG A CZ   3  
ATOM 5860  N NH1  . ARG A 1 62  ? -8.725  -10.696 0.003   1.00 0.00 ? 62  ARG A NH1  3  
ATOM 5861  N NH2  . ARG A 1 62  ? -9.953  -12.297 -1.015  1.00 0.00 ? 62  ARG A NH2  3  
ATOM 5862  H H    . ARG A 1 62  ? -8.539  -4.155  -1.892  1.00 0.00 ? 62  ARG A H    3  
ATOM 5863  H HA   . ARG A 1 62  ? -10.894 -5.693  -1.479  1.00 0.00 ? 62  ARG A HA   3  
ATOM 5864  H HB2  . ARG A 1 62  ? -8.850  -6.434  -2.744  1.00 0.00 ? 62  ARG A HB2  3  
ATOM 5865  H HB3  . ARG A 1 62  ? -8.030  -6.648  -1.198  1.00 0.00 ? 62  ARG A HB3  3  
ATOM 5866  H HG2  . ARG A 1 62  ? -9.759  -8.265  -0.502  1.00 0.00 ? 62  ARG A HG2  3  
ATOM 5867  H HG3  . ARG A 1 62  ? -10.579 -8.056  -2.050  1.00 0.00 ? 62  ARG A HG3  3  
ATOM 5868  H HD2  . ARG A 1 62  ? -8.496  -8.826  -3.204  1.00 0.00 ? 62  ARG A HD2  3  
ATOM 5869  H HD3  . ARG A 1 62  ? -7.780  -9.145  -1.624  1.00 0.00 ? 62  ARG A HD3  3  
ATOM 5870  H HE   . ARG A 1 62  ? -9.847  -10.758 -2.937  1.00 0.00 ? 62  ARG A HE   3  
ATOM 5871  H HH11 . ARG A 1 62  ? -8.265  -9.809  -0.025  1.00 0.00 ? 62  ARG A HH11 3  
ATOM 5872  H HH12 . ARG A 1 62  ? -8.705  -11.244 0.840   1.00 0.00 ? 62  ARG A HH12 3  
ATOM 5873  H HH21 . ARG A 1 62  ? -10.434 -12.638 -1.824  1.00 0.00 ? 62  ARG A HH21 3  
ATOM 5874  H HH22 . ARG A 1 62  ? -9.934  -12.845 -0.179  1.00 0.00 ? 62  ARG A HH22 3  
ATOM 5875  N N    . ALA A 1 63  ? -8.926  -5.426  1.150   1.00 0.00 ? 63  ALA A N    3  
ATOM 5876  C CA   . ALA A 1 63  ? -8.926  -5.604  2.630   1.00 0.00 ? 63  ALA A CA   3  
ATOM 5877  C C    . ALA A 1 63  ? -9.943  -4.649  3.262   1.00 0.00 ? 63  ALA A C    3  
ATOM 5878  O O    . ALA A 1 63  ? -10.557 -4.956  4.267   1.00 0.00 ? 63  ALA A O    3  
ATOM 5879  C CB   . ALA A 1 63  ? -7.531  -5.305  3.182   1.00 0.00 ? 63  ALA A CB   3  
ATOM 5880  H H    . ALA A 1 63  ? -8.152  -5.019  0.706   1.00 0.00 ? 63  ALA A H    3  
ATOM 5881  H HA   . ALA A 1 63  ? -9.196  -6.624  2.868   1.00 0.00 ? 63  ALA A HA   3  
ATOM 5882  H HB1  . ALA A 1 63  ? -7.608  -5.013  4.218   1.00 0.00 ? 63  ALA A HB1  3  
ATOM 5883  H HB2  . ALA A 1 63  ? -7.084  -4.502  2.614   1.00 0.00 ? 63  ALA A HB2  3  
ATOM 5884  H HB3  . ALA A 1 63  ? -6.913  -6.189  3.101   1.00 0.00 ? 63  ALA A HB3  3  
ATOM 5885  N N    . THR A 1 64  ? -10.115 -3.488  2.692   1.00 0.00 ? 64  THR A N    3  
ATOM 5886  C CA   . THR A 1 64  ? -11.080 -2.505  3.265   1.00 0.00 ? 64  THR A CA   3  
ATOM 5887  C C    . THR A 1 64  ? -12.488 -3.105  3.305   1.00 0.00 ? 64  THR A C    3  
ATOM 5888  O O    . THR A 1 64  ? -13.180 -3.018  4.299   1.00 0.00 ? 64  THR A O    3  
ATOM 5889  C CB   . THR A 1 64  ? -11.091 -1.248  2.391   1.00 0.00 ? 64  THR A CB   3  
ATOM 5890  O OG1  . THR A 1 64  ? -9.766  -0.759  2.258   1.00 0.00 ? 64  THR A OG1  3  
ATOM 5891  C CG2  . THR A 1 64  ? -11.966 -0.173  3.037   1.00 0.00 ? 64  THR A CG2  3  
ATOM 5892  H H    . THR A 1 64  ? -9.603  -3.259  1.889   1.00 0.00 ? 64  THR A H    3  
ATOM 5893  H HA   . THR A 1 64  ? -10.773 -2.242  4.266   1.00 0.00 ? 64  THR A HA   3  
ATOM 5894  H HB   . THR A 1 64  ? -11.486 -1.491  1.417   1.00 0.00 ? 64  THR A HB   3  
ATOM 5895  H HG1  . THR A 1 64  ? -9.391  -1.132  1.457   1.00 0.00 ? 64  THR A HG1  3  
ATOM 5896  H HG21 . THR A 1 64  ? -12.864 -0.624  3.431   1.00 0.00 ? 64  THR A HG21 3  
ATOM 5897  H HG22 . THR A 1 64  ? -12.228 0.565   2.295   1.00 0.00 ? 64  THR A HG22 3  
ATOM 5898  H HG23 . THR A 1 64  ? -11.419 0.303   3.838   1.00 0.00 ? 64  THR A HG23 3  
ATOM 5899  N N    . GLN A 1 65  ? -12.925 -3.704  2.229   1.00 0.00 ? 65  GLN A N    3  
ATOM 5900  C CA   . GLN A 1 65  ? -14.292 -4.297  2.213   1.00 0.00 ? 65  GLN A CA   3  
ATOM 5901  C C    . GLN A 1 65  ? -14.287 -5.641  2.942   1.00 0.00 ? 65  GLN A C    3  
ATOM 5902  O O    . GLN A 1 65  ? -15.212 -5.973  3.656   1.00 0.00 ? 65  GLN A O    3  
ATOM 5903  C CB   . GLN A 1 65  ? -14.755 -4.469  0.758   1.00 0.00 ? 65  GLN A CB   3  
ATOM 5904  C CG   . GLN A 1 65  ? -15.239 -5.901  0.506   1.00 0.00 ? 65  GLN A CG   3  
ATOM 5905  C CD   . GLN A 1 65  ? -16.507 -6.170  1.315   1.00 0.00 ? 65  GLN A CD   3  
ATOM 5906  O OE1  . GLN A 1 65  ? -16.544 -7.079  2.120   1.00 0.00 ? 65  GLN A OE1  3  
ATOM 5907  N NE2  . GLN A 1 65  ? -17.558 -5.416  1.134   1.00 0.00 ? 65  GLN A NE2  3  
ATOM 5908  H H    . GLN A 1 65  ? -12.354 -3.761  1.434   1.00 0.00 ? 65  GLN A H    3  
ATOM 5909  H HA   . GLN A 1 65  ? -14.967 -3.628  2.721   1.00 0.00 ? 65  GLN A HA   3  
ATOM 5910  H HB2  . GLN A 1 65  ? -15.565 -3.779  0.561   1.00 0.00 ? 65  GLN A HB2  3  
ATOM 5911  H HB3  . GLN A 1 65  ? -13.932 -4.247  0.094   1.00 0.00 ? 65  GLN A HB3  3  
ATOM 5912  H HG2  . GLN A 1 65  ? -15.456 -6.022  -0.546  1.00 0.00 ? 65  GLN A HG2  3  
ATOM 5913  H HG3  . GLN A 1 65  ? -14.470 -6.602  0.793   1.00 0.00 ? 65  GLN A HG3  3  
ATOM 5914  H HE21 . GLN A 1 65  ? -17.528 -4.685  0.483   1.00 0.00 ? 65  GLN A HE21 3  
ATOM 5915  H HE22 . GLN A 1 65  ? -18.374 -5.582  1.647   1.00 0.00 ? 65  GLN A HE22 3  
ATOM 5916  N N    . GLU A 1 66  ? -13.255 -6.417  2.769   1.00 0.00 ? 66  GLU A N    3  
ATOM 5917  C CA   . GLU A 1 66  ? -13.198 -7.740  3.452   1.00 0.00 ? 66  GLU A CA   3  
ATOM 5918  C C    . GLU A 1 66  ? -13.121 -7.544  4.969   1.00 0.00 ? 66  GLU A C    3  
ATOM 5919  O O    . GLU A 1 66  ? -13.717 -8.280  5.729   1.00 0.00 ? 66  GLU A O    3  
ATOM 5920  C CB   . GLU A 1 66  ? -11.956 -8.495  2.980   1.00 0.00 ? 66  GLU A CB   3  
ATOM 5921  C CG   . GLU A 1 66  ? -12.113 -8.871  1.504   1.00 0.00 ? 66  GLU A CG   3  
ATOM 5922  C CD   . GLU A 1 66  ? -13.246 -9.884  1.351   1.00 0.00 ? 66  GLU A CD   3  
ATOM 5923  O OE1  . GLU A 1 66  ? -13.619 -10.485 2.345   1.00 0.00 ? 66  GLU A OE1  3  
ATOM 5924  O OE2  . GLU A 1 66  ? -13.727 -10.043 0.240   1.00 0.00 ? 66  GLU A OE2  3  
ATOM 5925  H H    . GLU A 1 66  ? -12.520 -6.133  2.189   1.00 0.00 ? 66  GLU A H    3  
ATOM 5926  H HA   . GLU A 1 66  ? -14.080 -8.310  3.208   1.00 0.00 ? 66  GLU A HA   3  
ATOM 5927  H HB2  . GLU A 1 66  ? -11.086 -7.867  3.100   1.00 0.00 ? 66  GLU A HB2  3  
ATOM 5928  H HB3  . GLU A 1 66  ? -11.836 -9.392  3.567   1.00 0.00 ? 66  GLU A HB3  3  
ATOM 5929  H HG2  . GLU A 1 66  ? -12.343 -7.986  0.932   1.00 0.00 ? 66  GLU A HG2  3  
ATOM 5930  H HG3  . GLU A 1 66  ? -11.191 -9.303  1.144   1.00 0.00 ? 66  GLU A HG3  3  
ATOM 5931  H HE2  . GLU A 1 66  ? -14.433 -10.693 0.218   1.00 0.00 ? 66  GLU A HE2  3  
ATOM 5932  N N    . GLU A 1 67  ? -12.384 -6.563  5.420   1.00 0.00 ? 67  GLU A N    3  
ATOM 5933  C CA   . GLU A 1 67  ? -12.267 -6.338  6.889   1.00 0.00 ? 67  GLU A CA   3  
ATOM 5934  C C    . GLU A 1 67  ? -13.186 -5.195  7.329   1.00 0.00 ? 67  GLU A C    3  
ATOM 5935  O O    . GLU A 1 67  ? -13.167 -4.784  8.472   1.00 0.00 ? 67  GLU A O    3  
ATOM 5936  C CB   . GLU A 1 67  ? -10.818 -5.983  7.235   1.00 0.00 ? 67  GLU A CB   3  
ATOM 5937  C CG   . GLU A 1 67  ? -9.899  -7.146  6.858   1.00 0.00 ? 67  GLU A CG   3  
ATOM 5938  C CD   . GLU A 1 67  ? -8.465  -6.818  7.275   1.00 0.00 ? 67  GLU A CD   3  
ATOM 5939  O OE1  . GLU A 1 67  ? -8.226  -5.687  7.667   1.00 0.00 ? 67  GLU A OE1  3  
ATOM 5940  O OE2  . GLU A 1 67  ? -7.629  -7.702  7.197   1.00 0.00 ? 67  GLU A OE2  3  
ATOM 5941  H H    . GLU A 1 67  ? -11.903 -5.983  4.792   1.00 0.00 ? 67  GLU A H    3  
ATOM 5942  H HA   . GLU A 1 67  ? -12.545 -7.240  7.411   1.00 0.00 ? 67  GLU A HA   3  
ATOM 5943  H HB2  . GLU A 1 67  ? -10.524 -5.100  6.688   1.00 0.00 ? 67  GLU A HB2  3  
ATOM 5944  H HB3  . GLU A 1 67  ? -10.738 -5.792  8.296   1.00 0.00 ? 67  GLU A HB3  3  
ATOM 5945  H HG2  . GLU A 1 67  ? -10.228 -8.042  7.364   1.00 0.00 ? 67  GLU A HG2  3  
ATOM 5946  H HG3  . GLU A 1 67  ? -9.935  -7.302  5.791   1.00 0.00 ? 67  GLU A HG3  3  
ATOM 5947  H HE2  . GLU A 1 67  ? -6.753  -7.425  7.475   1.00 0.00 ? 67  GLU A HE2  3  
ATOM 5948  N N    . ALA A 1 68  ? -13.986 -4.671  6.443   1.00 0.00 ? 68  ALA A N    3  
ATOM 5949  C CA   . ALA A 1 68  ? -14.889 -3.551  6.841   1.00 0.00 ? 68  ALA A CA   3  
ATOM 5950  C C    . ALA A 1 68  ? -16.171 -3.585  6.012   1.00 0.00 ? 68  ALA A C    3  
ATOM 5951  O O    . ALA A 1 68  ? -17.182 -3.047  6.403   1.00 0.00 ? 68  ALA A O    3  
ATOM 5952  C CB   . ALA A 1 68  ? -14.181 -2.219  6.605   1.00 0.00 ? 68  ALA A CB   3  
ATOM 5953  H H    . ALA A 1 68  ? -13.992 -5.006  5.522   1.00 0.00 ? 68  ALA A H    3  
ATOM 5954  H HA   . ALA A 1 68  ? -15.135 -3.644  7.888   1.00 0.00 ? 68  ALA A HA   3  
ATOM 5955  H HB1  . ALA A 1 68  ? -14.568 -1.762  5.706   1.00 0.00 ? 68  ALA A HB1  3  
ATOM 5956  H HB2  . ALA A 1 68  ? -13.120 -2.386  6.497   1.00 0.00 ? 68  ALA A HB2  3  
ATOM 5957  H HB3  . ALA A 1 68  ? -14.361 -1.563  7.445   1.00 0.00 ? 68  ALA A HB3  3  
ATOM 5958  N N    . GLY A 1 69  ? -16.139 -4.196  4.869   1.00 0.00 ? 69  GLY A N    3  
ATOM 5959  C CA   . GLY A 1 69  ? -17.367 -4.243  4.027   1.00 0.00 ? 69  GLY A CA   3  
ATOM 5960  C C    . GLY A 1 69  ? -17.410 -3.005  3.133   1.00 0.00 ? 69  GLY A C    3  
ATOM 5961  O O    . GLY A 1 69  ? -18.308 -2.839  2.331   1.00 0.00 ? 69  GLY A O    3  
ATOM 5962  H H    . GLY A 1 69  ? -15.312 -4.621  4.557   1.00 0.00 ? 69  GLY A H    3  
ATOM 5963  H HA2  . GLY A 1 69  ? -17.356 -5.134  3.422   1.00 0.00 ? 69  GLY A HA2  3  
ATOM 5964  H HA3  . GLY A 1 69  ? -18.239 -4.250  4.664   1.00 0.00 ? 69  GLY A HA3  3  
ATOM 5965  N N    . ILE A 1 70  ? -16.448 -2.132  3.263   1.00 0.00 ? 70  ILE A N    3  
ATOM 5966  C CA   . ILE A 1 70  ? -16.438 -0.909  2.421   1.00 0.00 ? 70  ILE A CA   3  
ATOM 5967  C C    . ILE A 1 70  ? -15.360 -1.052  1.339   1.00 0.00 ? 70  ILE A C    3  
ATOM 5968  O O    . ILE A 1 70  ? -14.204 -1.297  1.625   1.00 0.00 ? 70  ILE A O    3  
ATOM 5969  C CB   . ILE A 1 70  ? -16.135 0.314   3.292   1.00 0.00 ? 70  ILE A CB   3  
ATOM 5970  C CG1  . ILE A 1 70  ? -16.943 0.248   4.593   1.00 0.00 ? 70  ILE A CG1  3  
ATOM 5971  C CG2  . ILE A 1 70  ? -16.555 1.568   2.530   1.00 0.00 ? 70  ILE A CG2  3  
ATOM 5972  C CD1  . ILE A 1 70  ? -16.313 1.161   5.648   1.00 0.00 ? 70  ILE A CD1  3  
ATOM 5973  H H    . ILE A 1 70  ? -15.733 -2.282  3.918   1.00 0.00 ? 70  ILE A H    3  
ATOM 5974  H HA   . ILE A 1 70  ? -17.398 -0.786  1.952   1.00 0.00 ? 70  ILE A HA   3  
ATOM 5975  H HB   . ILE A 1 70  ? -15.079 0.353   3.513   1.00 0.00 ? 70  ILE A HB   3  
ATOM 5976  H HG12 . ILE A 1 70  ? -17.950 0.577   4.401   1.00 0.00 ? 70  ILE A HG12 3  
ATOM 5977  H HG13 . ILE A 1 70  ? -16.958 -0.766  4.962   1.00 0.00 ? 70  ILE A HG13 3  
ATOM 5978  H HG21 . ILE A 1 70  ? -16.336 2.441   3.118   1.00 0.00 ? 70  ILE A HG21 3  
ATOM 5979  H HG22 . ILE A 1 70  ? -17.615 1.527   2.333   1.00 0.00 ? 70  ILE A HG22 3  
ATOM 5980  H HG23 . ILE A 1 70  ? -16.021 1.616   1.596   1.00 0.00 ? 70  ILE A HG23 3  
ATOM 5981  H HD11 . ILE A 1 70  ? -16.012 0.572   6.501   1.00 0.00 ? 70  ILE A HD11 3  
ATOM 5982  H HD12 . ILE A 1 70  ? -17.036 1.902   5.960   1.00 0.00 ? 70  ILE A HD12 3  
ATOM 5983  H HD13 . ILE A 1 70  ? -15.447 1.656   5.231   1.00 0.00 ? 70  ILE A HD13 3  
ATOM 5984  N N    . GLU A 1 71  ? -15.738 -0.910  0.096   1.00 0.00 ? 71  GLU A N    3  
ATOM 5985  C CA   . GLU A 1 71  ? -14.752 -1.045  -1.020  1.00 0.00 ? 71  GLU A CA   3  
ATOM 5986  C C    . GLU A 1 71  ? -14.546 0.312   -1.698  1.00 0.00 ? 71  GLU A C    3  
ATOM 5987  O O    . GLU A 1 71  ? -15.268 1.256   -1.448  1.00 0.00 ? 71  GLU A O    3  
ATOM 5988  C CB   . GLU A 1 71  ? -15.288 -2.045  -2.046  1.00 0.00 ? 71  GLU A CB   3  
ATOM 5989  C CG   . GLU A 1 71  ? -16.530 -1.459  -2.722  1.00 0.00 ? 71  GLU A CG   3  
ATOM 5990  C CD   . GLU A 1 71  ? -17.170 -2.517  -3.622  1.00 0.00 ? 71  GLU A CD   3  
ATOM 5991  O OE1  . GLU A 1 71  ? -16.584 -3.576  -3.771  1.00 0.00 ? 71  GLU A OE1  3  
ATOM 5992  O OE2  . GLU A 1 71  ? -18.238 -2.249  -4.149  1.00 0.00 ? 71  GLU A OE2  3  
ATOM 5993  H H    . GLU A 1 71  ? -16.678 -0.719  -0.109  1.00 0.00 ? 71  GLU A H    3  
ATOM 5994  H HA   . GLU A 1 71  ? -13.811 -1.400  -0.628  1.00 0.00 ? 71  GLU A HA   3  
ATOM 5995  H HB2  . GLU A 1 71  ? -14.530 -2.238  -2.790  1.00 0.00 ? 71  GLU A HB2  3  
ATOM 5996  H HB3  . GLU A 1 71  ? -15.550 -2.967  -1.551  1.00 0.00 ? 71  GLU A HB3  3  
ATOM 5997  H HG2  . GLU A 1 71  ? -17.238 -1.151  -1.968  1.00 0.00 ? 71  GLU A HG2  3  
ATOM 5998  H HG3  . GLU A 1 71  ? -16.246 -0.607  -3.318  1.00 0.00 ? 71  GLU A HG3  3  
ATOM 5999  H HE2  . GLU A 1 71  ? -18.580 -2.958  -4.699  1.00 0.00 ? 71  GLU A HE2  3  
ATOM 6000  N N    . ALA A 1 72  ? -13.571 0.412   -2.562  1.00 0.00 ? 72  ALA A N    3  
ATOM 6001  C CA   . ALA A 1 72  ? -13.325 1.707   -3.259  1.00 0.00 ? 72  ALA A CA   3  
ATOM 6002  C C    . ALA A 1 72  ? -14.630 2.190   -3.878  1.00 0.00 ? 72  ALA A C    3  
ATOM 6003  O O    . ALA A 1 72  ? -14.911 3.371   -3.921  1.00 0.00 ? 72  ALA A O    3  
ATOM 6004  C CB   . ALA A 1 72  ? -12.275 1.509   -4.347  1.00 0.00 ? 72  ALA A CB   3  
ATOM 6005  H H    . ALA A 1 72  ? -13.004 -0.363  -2.756  1.00 0.00 ? 72  ALA A H    3  
ATOM 6006  H HA   . ALA A 1 72  ? -12.975 2.438   -2.558  1.00 0.00 ? 72  ALA A HA   3  
ATOM 6007  H HB1  . ALA A 1 72  ? -11.858 0.516   -4.267  1.00 0.00 ? 72  ALA A HB1  3  
ATOM 6008  H HB2  . ALA A 1 72  ? -11.490 2.240   -4.219  1.00 0.00 ? 72  ALA A HB2  3  
ATOM 6009  H HB3  . ALA A 1 72  ? -12.731 1.636   -5.317  1.00 0.00 ? 72  ALA A HB3  3  
ATOM 6010  N N    . GLY A 1 73  ? -15.443 1.286   -4.334  1.00 0.00 ? 73  GLY A N    3  
ATOM 6011  C CA   . GLY A 1 73  ? -16.743 1.690   -4.923  1.00 0.00 ? 73  GLY A CA   3  
ATOM 6012  C C    . GLY A 1 73  ? -17.602 2.314   -3.823  1.00 0.00 ? 73  GLY A C    3  
ATOM 6013  O O    . GLY A 1 73  ? -18.574 2.988   -4.088  1.00 0.00 ? 73  GLY A O    3  
ATOM 6014  H H    . GLY A 1 73  ? -15.205 0.339   -4.269  1.00 0.00 ? 73  GLY A H    3  
ATOM 6015  H HA2  . GLY A 1 73  ? -16.575 2.414   -5.711  1.00 0.00 ? 73  GLY A HA2  3  
ATOM 6016  H HA3  . GLY A 1 73  ? -17.247 0.826   -5.323  1.00 0.00 ? 73  GLY A HA3  3  
ATOM 6017  N N    . GLN A 1 74  ? -17.251 2.079   -2.583  1.00 0.00 ? 74  GLN A N    3  
ATOM 6018  C CA   . GLN A 1 74  ? -18.055 2.648   -1.466  1.00 0.00 ? 74  GLN A CA   3  
ATOM 6019  C C    . GLN A 1 74  ? -17.299 3.805   -0.793  1.00 0.00 ? 74  GLN A C    3  
ATOM 6020  O O    . GLN A 1 74  ? -17.871 4.546   -0.021  1.00 0.00 ? 74  GLN A O    3  
ATOM 6021  C CB   . GLN A 1 74  ? -18.364 1.546   -0.451  1.00 0.00 ? 74  GLN A CB   3  
ATOM 6022  C CG   . GLN A 1 74  ? -19.442 2.030   0.522   1.00 0.00 ? 74  GLN A CG   3  
ATOM 6023  C CD   . GLN A 1 74  ? -20.772 2.187   -0.224  1.00 0.00 ? 74  GLN A CD   3  
ATOM 6024  O OE1  . GLN A 1 74  ? -21.138 1.345   -1.018  1.00 0.00 ? 74  GLN A OE1  3  
ATOM 6025  N NE2  . GLN A 1 74  ? -21.511 3.239   0.001   1.00 0.00 ? 74  GLN A NE2  3  
ATOM 6026  H H    . GLN A 1 74  ? -16.468 1.524   -2.391  1.00 0.00 ? 74  GLN A H    3  
ATOM 6027  H HA   . GLN A 1 74  ? -18.984 3.029   -1.863  1.00 0.00 ? 74  GLN A HA   3  
ATOM 6028  H HB2  . GLN A 1 74  ? -18.715 0.668   -0.971  1.00 0.00 ? 74  GLN A HB2  3  
ATOM 6029  H HB3  . GLN A 1 74  ? -17.470 1.302   0.097   1.00 0.00 ? 74  GLN A HB3  3  
ATOM 6030  H HG2  . GLN A 1 74  ? -19.562 1.305   1.315   1.00 0.00 ? 74  GLN A HG2  3  
ATOM 6031  H HG3  . GLN A 1 74  ? -19.153 2.982   0.943   1.00 0.00 ? 74  GLN A HG3  3  
ATOM 6032  H HE21 . GLN A 1 74  ? -21.215 3.919   0.642   1.00 0.00 ? 74  GLN A HE21 3  
ATOM 6033  H HE22 . GLN A 1 74  ? -22.363 3.348   -0.472  1.00 0.00 ? 74  GLN A HE22 3  
ATOM 6034  N N    . LEU A 1 75  ? -16.035 3.998   -1.093  1.00 0.00 ? 75  LEU A N    3  
ATOM 6035  C CA   . LEU A 1 75  ? -15.307 5.152   -0.475  1.00 0.00 ? 75  LEU A CA   3  
ATOM 6036  C C    . LEU A 1 75  ? -14.636 5.969   -1.573  1.00 0.00 ? 75  LEU A C    3  
ATOM 6037  O O    . LEU A 1 75  ? -14.826 5.734   -2.750  1.00 0.00 ? 75  LEU A O    3  
ATOM 6038  C CB   . LEU A 1 75  ? -14.217 4.726   0.533   1.00 0.00 ? 75  LEU A CB   3  
ATOM 6039  C CG   . LEU A 1 75  ? -14.069 3.208   0.615   1.00 0.00 ? 75  LEU A CG   3  
ATOM 6040  C CD1  . LEU A 1 75  ? -12.828 2.778   -0.162  1.00 0.00 ? 75  LEU A CD1  3  
ATOM 6041  C CD2  . LEU A 1 75  ? -13.889 2.790   2.074   1.00 0.00 ? 75  LEU A CD2  3  
ATOM 6042  H H    . LEU A 1 75  ? -15.583 3.413   -1.737  1.00 0.00 ? 75  LEU A H    3  
ATOM 6043  H HA   . LEU A 1 75  ? -16.026 5.779   0.025   1.00 0.00 ? 75  LEU A HA   3  
ATOM 6044  H HB2  . LEU A 1 75  ? -13.273 5.153   0.229   1.00 0.00 ? 75  LEU A HB2  3  
ATOM 6045  H HB3  . LEU A 1 75  ? -14.470 5.111   1.508   1.00 0.00 ? 75  LEU A HB3  3  
ATOM 6046  H HG   . LEU A 1 75  ? -14.941 2.732   0.207   1.00 0.00 ? 75  LEU A HG   3  
ATOM 6047  H HD11 . LEU A 1 75  ? -11.972 2.780   0.499   1.00 0.00 ? 75  LEU A HD11 3  
ATOM 6048  H HD12 . LEU A 1 75  ? -12.655 3.470   -0.973  1.00 0.00 ? 75  LEU A HD12 3  
ATOM 6049  H HD13 . LEU A 1 75  ? -12.976 1.784   -0.556  1.00 0.00 ? 75  LEU A HD13 3  
ATOM 6050  H HD21 . LEU A 1 75  ? -14.034 1.727   2.164   1.00 0.00 ? 75  LEU A HD21 3  
ATOM 6051  H HD22 . LEU A 1 75  ? -14.609 3.302   2.685   1.00 0.00 ? 75  LEU A HD22 3  
ATOM 6052  H HD23 . LEU A 1 75  ? -12.892 3.045   2.402   1.00 0.00 ? 75  LEU A HD23 3  
ATOM 6053  N N    . THR A 1 76  ? -13.847 6.927   -1.185  1.00 0.00 ? 76  THR A N    3  
ATOM 6054  C CA   . THR A 1 76  ? -13.141 7.773   -2.181  1.00 0.00 ? 76  THR A CA   3  
ATOM 6055  C C    . THR A 1 76  ? -11.667 7.850   -1.795  1.00 0.00 ? 76  THR A C    3  
ATOM 6056  O O    . THR A 1 76  ? -11.298 8.535   -0.861  1.00 0.00 ? 76  THR A O    3  
ATOM 6057  C CB   . THR A 1 76  ? -13.751 9.176   -2.168  1.00 0.00 ? 76  THR A CB   3  
ATOM 6058  O OG1  . THR A 1 76  ? -15.061 9.129   -2.721  1.00 0.00 ? 76  THR A OG1  3  
ATOM 6059  C CG2  . THR A 1 76  ? -12.881 10.129  -2.984  1.00 0.00 ? 76  THR A CG2  3  
ATOM 6060  H H    . THR A 1 76  ? -13.708 7.084   -0.228  1.00 0.00 ? 76  THR A H    3  
ATOM 6061  H HA   . THR A 1 76  ? -13.239 7.340   -3.166  1.00 0.00 ? 76  THR A HA   3  
ATOM 6062  H HB   . THR A 1 76  ? -13.808 9.530   -1.150  1.00 0.00 ? 76  THR A HB   3  
ATOM 6063  H HG1  . THR A 1 76  ? -15.000 9.373   -3.647  1.00 0.00 ? 76  THR A HG1  3  
ATOM 6064  H HG21 . THR A 1 76  ? -12.332 10.775  -2.313  1.00 0.00 ? 76  THR A HG21 3  
ATOM 6065  H HG22 . THR A 1 76  ? -13.507 10.727  -3.627  1.00 0.00 ? 76  THR A HG22 3  
ATOM 6066  H HG23 . THR A 1 76  ? -12.186 9.560   -3.584  1.00 0.00 ? 76  THR A HG23 3  
ATOM 6067  N N    . ILE A 1 77  ? -10.816 7.157   -2.498  1.00 0.00 ? 77  ILE A N    3  
ATOM 6068  C CA   . ILE A 1 77  ? -9.372  7.202   -2.152  1.00 0.00 ? 77  ILE A CA   3  
ATOM 6069  C C    . ILE A 1 77  ? -8.814  8.562   -2.562  1.00 0.00 ? 77  ILE A C    3  
ATOM 6070  O O    . ILE A 1 77  ? -8.931  8.970   -3.700  1.00 0.00 ? 77  ILE A O    3  
ATOM 6071  C CB   . ILE A 1 77  ? -8.622  6.096   -2.900  1.00 0.00 ? 77  ILE A CB   3  
ATOM 6072  C CG1  . ILE A 1 77  ? -9.433  4.793   -2.860  1.00 0.00 ? 77  ILE A CG1  3  
ATOM 6073  C CG2  . ILE A 1 77  ? -7.257  5.870   -2.240  1.00 0.00 ? 77  ILE A CG2  3  
ATOM 6074  C CD1  . ILE A 1 77  ? -9.470  4.236   -1.435  1.00 0.00 ? 77  ILE A CD1  3  
ATOM 6075  H H    . ILE A 1 77  ? -11.128 6.609   -3.248  1.00 0.00 ? 77  ILE A H    3  
ATOM 6076  H HA   . ILE A 1 77  ? -9.250  7.070   -1.088  1.00 0.00 ? 77  ILE A HA   3  
ATOM 6077  H HB   . ILE A 1 77  ? -8.473  6.398   -3.927  1.00 0.00 ? 77  ILE A HB   3  
ATOM 6078  H HG12 . ILE A 1 77  ? -10.440 4.986   -3.196  1.00 0.00 ? 77  ILE A HG12 3  
ATOM 6079  H HG13 . ILE A 1 77  ? -8.973  4.065   -3.513  1.00 0.00 ? 77  ILE A HG13 3  
ATOM 6080  H HG21 . ILE A 1 77  ? -7.380  5.281   -1.342  1.00 0.00 ? 77  ILE A HG21 3  
ATOM 6081  H HG22 . ILE A 1 77  ? -6.820  6.824   -1.985  1.00 0.00 ? 77  ILE A HG22 3  
ATOM 6082  H HG23 . ILE A 1 77  ? -6.607  5.351   -2.926  1.00 0.00 ? 77  ILE A HG23 3  
ATOM 6083  H HD11 . ILE A 1 77  ? -10.486 3.983   -1.170  1.00 0.00 ? 77  ILE A HD11 3  
ATOM 6084  H HD12 . ILE A 1 77  ? -9.094  4.978   -0.749  1.00 0.00 ? 77  ILE A HD12 3  
ATOM 6085  H HD13 . ILE A 1 77  ? -8.851  3.352   -1.380  1.00 0.00 ? 77  ILE A HD13 3  
ATOM 6086  N N    . ILE A 1 78  ? -8.219  9.272   -1.647  1.00 0.00 ? 78  ILE A N    3  
ATOM 6087  C CA   . ILE A 1 78  ? -7.669  10.609  -1.996  1.00 0.00 ? 78  ILE A CA   3  
ATOM 6088  C C    . ILE A 1 78  ? -6.295  10.442  -2.639  1.00 0.00 ? 78  ILE A C    3  
ATOM 6089  O O    . ILE A 1 78  ? -5.491  9.630   -2.224  1.00 0.00 ? 78  ILE A O    3  
ATOM 6090  C CB   . ILE A 1 78  ? -7.570  11.470  -0.738  1.00 0.00 ? 78  ILE A CB   3  
ATOM 6091  C CG1  . ILE A 1 78  ? -8.533  12.651  -0.866  1.00 0.00 ? 78  ILE A CG1  3  
ATOM 6092  C CG2  . ILE A 1 78  ? -6.142  11.995  -0.565  1.00 0.00 ? 78  ILE A CG2  3  
ATOM 6093  C CD1  . ILE A 1 78  ? -9.964  12.134  -1.049  1.00 0.00 ? 78  ILE A CD1  3  
ATOM 6094  H H    . ILE A 1 78  ? -8.141  8.929   -0.731  1.00 0.00 ? 78  ILE A H    3  
ATOM 6095  H HA   . ILE A 1 78  ? -8.332  11.086  -2.703  1.00 0.00 ? 78  ILE A HA   3  
ATOM 6096  H HB   . ILE A 1 78  ? -7.844  10.878  0.122   1.00 0.00 ? 78  ILE A HB   3  
ATOM 6097  H HG12 . ILE A 1 78  ? -8.478  13.256  0.021   1.00 0.00 ? 78  ILE A HG12 3  
ATOM 6098  H HG13 . ILE A 1 78  ? -8.258  13.246  -1.720  1.00 0.00 ? 78  ILE A HG13 3  
ATOM 6099  H HG21 . ILE A 1 78  ? -5.855  12.558  -1.440  1.00 0.00 ? 78  ILE A HG21 3  
ATOM 6100  H HG22 . ILE A 1 78  ? -5.464  11.163  -0.430  1.00 0.00 ? 78  ILE A HG22 3  
ATOM 6101  H HG23 . ILE A 1 78  ? -6.098  12.634  0.303   1.00 0.00 ? 78  ILE A HG23 3  
ATOM 6102  H HD11 . ILE A 1 78  ? -10.222 12.149  -2.097  1.00 0.00 ? 78  ILE A HD11 3  
ATOM 6103  H HD12 . ILE A 1 78  ? -10.647 12.765  -0.502  1.00 0.00 ? 78  ILE A HD12 3  
ATOM 6104  H HD13 . ILE A 1 78  ? -10.032 11.121  -0.674  1.00 0.00 ? 78  ILE A HD13 3  
ATOM 6105  N N    . GLU A 1 79  ? -6.034  11.202  -3.663  1.00 0.00 ? 79  GLU A N    3  
ATOM 6106  C CA   . GLU A 1 79  ? -4.725  11.095  -4.365  1.00 0.00 ? 79  GLU A CA   3  
ATOM 6107  C C    . GLU A 1 79  ? -3.791  12.220  -3.917  1.00 0.00 ? 79  GLU A C    3  
ATOM 6108  O O    . GLU A 1 79  ? -4.224  13.289  -3.533  1.00 0.00 ? 79  GLU A O    3  
ATOM 6109  C CB   . GLU A 1 79  ? -4.957  11.194  -5.873  1.00 0.00 ? 79  GLU A CB   3  
ATOM 6110  C CG   . GLU A 1 79  ? -5.869  10.048  -6.319  1.00 0.00 ? 79  GLU A CG   3  
ATOM 6111  C CD   . GLU A 1 79  ? -6.082  10.120  -7.833  1.00 0.00 ? 79  GLU A CD   3  
ATOM 6112  O OE1  . GLU A 1 79  ? -5.706  11.122  -8.417  1.00 0.00 ? 79  GLU A OE1  3  
ATOM 6113  O OE2  . GLU A 1 79  ? -6.621  9.172   -8.379  1.00 0.00 ? 79  GLU A OE2  3  
ATOM 6114  H H    . GLU A 1 79  ? -6.710  11.839  -3.977  1.00 0.00 ? 79  GLU A H    3  
ATOM 6115  H HA   . GLU A 1 79  ? -4.272  10.141  -4.137  1.00 0.00 ? 79  GLU A HA   3  
ATOM 6116  H HB2  . GLU A 1 79  ? -5.422  12.141  -6.104  1.00 0.00 ? 79  GLU A HB2  3  
ATOM 6117  H HB3  . GLU A 1 79  ? -4.011  11.120  -6.388  1.00 0.00 ? 79  GLU A HB3  3  
ATOM 6118  H HG2  . GLU A 1 79  ? -5.410  9.104   -6.064  1.00 0.00 ? 79  GLU A HG2  3  
ATOM 6119  H HG3  . GLU A 1 79  ? -6.822  10.130  -5.819  1.00 0.00 ? 79  GLU A HG3  3  
ATOM 6120  H HE2  . GLU A 1 79  ? -6.723  9.286   -9.327  1.00 0.00 ? 79  GLU A HE2  3  
ATOM 6121  N N    . GLY A 1 80  ? -2.508  11.981  -3.963  1.00 0.00 ? 80  GLY A N    3  
ATOM 6122  C CA   . GLY A 1 80  ? -1.534  13.027  -3.543  1.00 0.00 ? 80  GLY A CA   3  
ATOM 6123  C C    . GLY A 1 80  ? -0.969  12.672  -2.168  1.00 0.00 ? 80  GLY A C    3  
ATOM 6124  O O    . GLY A 1 80  ? 0.070   13.161  -1.770  1.00 0.00 ? 80  GLY A O    3  
ATOM 6125  H H    . GLY A 1 80  ? -2.185  11.112  -4.276  1.00 0.00 ? 80  GLY A H    3  
ATOM 6126  H HA2  . GLY A 1 80  ? -0.731  13.081  -4.263  1.00 0.00 ? 80  GLY A HA2  3  
ATOM 6127  H HA3  . GLY A 1 80  ? -2.032  13.984  -3.487  1.00 0.00 ? 80  GLY A HA3  3  
ATOM 6128  N N    . PHE A 1 81  ? -1.640  11.820  -1.443  1.00 0.00 ? 81  PHE A N    3  
ATOM 6129  C CA   . PHE A 1 81  ? -1.136  11.427  -0.097  1.00 0.00 ? 81  PHE A CA   3  
ATOM 6130  C C    . PHE A 1 81  ? -0.683  9.969   -0.119  1.00 0.00 ? 81  PHE A C    3  
ATOM 6131  O O    . PHE A 1 81  ? -1.431  9.085   -0.485  1.00 0.00 ? 81  PHE A O    3  
ATOM 6132  C CB   . PHE A 1 81  ? -2.253  11.576  0.932   1.00 0.00 ? 81  PHE A CB   3  
ATOM 6133  C CG   . PHE A 1 81  ? -1.754  11.103  2.275   1.00 0.00 ? 81  PHE A CG   3  
ATOM 6134  C CD1  . PHE A 1 81  ? -1.733  9.734   2.572   1.00 0.00 ? 81  PHE A CD1  3  
ATOM 6135  C CD2  . PHE A 1 81  ? -1.305  12.029  3.221   1.00 0.00 ? 81  PHE A CD2  3  
ATOM 6136  C CE1  . PHE A 1 81  ? -1.264  9.293   3.815   1.00 0.00 ? 81  PHE A CE1  3  
ATOM 6137  C CE2  . PHE A 1 81  ? -0.835  11.588  4.463   1.00 0.00 ? 81  PHE A CE2  3  
ATOM 6138  C CZ   . PHE A 1 81  ? -0.817  10.221  4.761   1.00 0.00 ? 81  PHE A CZ   3  
ATOM 6139  H H    . PHE A 1 81  ? -2.474  11.435  -1.788  1.00 0.00 ? 81  PHE A H    3  
ATOM 6140  H HA   . PHE A 1 81  ? -0.305  12.060  0.178   1.00 0.00 ? 81  PHE A HA   3  
ATOM 6141  H HB2  . PHE A 1 81  ? -2.549  12.614  0.999   1.00 0.00 ? 81  PHE A HB2  3  
ATOM 6142  H HB3  . PHE A 1 81  ? -3.101  10.977  0.633   1.00 0.00 ? 81  PHE A HB3  3  
ATOM 6143  H HD1  . PHE A 1 81  ? -2.079  9.017   1.840   1.00 0.00 ? 81  PHE A HD1  3  
ATOM 6144  H HD2  . PHE A 1 81  ? -1.320  13.081  2.992   1.00 0.00 ? 81  PHE A HD2  3  
ATOM 6145  H HE1  . PHE A 1 81  ? -1.248  8.238   4.044   1.00 0.00 ? 81  PHE A HE1  3  
ATOM 6146  H HE2  . PHE A 1 81  ? -0.489  12.305  5.192   1.00 0.00 ? 81  PHE A HE2  3  
ATOM 6147  H HZ   . PHE A 1 81  ? -0.453  9.881   5.721   1.00 0.00 ? 81  PHE A HZ   3  
ATOM 6148  N N    . LYS A 1 82  ? 0.523   9.701   0.296   1.00 0.00 ? 82  LYS A N    3  
ATOM 6149  C CA   . LYS A 1 82  ? 0.990   8.290   0.319   1.00 0.00 ? 82  LYS A CA   3  
ATOM 6150  C C    . LYS A 1 82  ? 2.129   8.146   1.324   1.00 0.00 ? 82  LYS A C    3  
ATOM 6151  O O    . LYS A 1 82  ? 3.093   8.885   1.310   1.00 0.00 ? 82  LYS A O    3  
ATOM 6152  C CB   . LYS A 1 82  ? 1.493   7.864   -1.055  1.00 0.00 ? 82  LYS A CB   3  
ATOM 6153  C CG   . LYS A 1 82  ? 1.311   6.351   -1.198  1.00 0.00 ? 82  LYS A CG   3  
ATOM 6154  C CD   . LYS A 1 82  ? 1.837   5.894   -2.560  1.00 0.00 ? 82  LYS A CD   3  
ATOM 6155  C CE   . LYS A 1 82  ? 3.360   5.772   -2.511  1.00 0.00 ? 82  LYS A CE   3  
ATOM 6156  N NZ   . LYS A 1 82  ? 3.958   6.551   -3.631  1.00 0.00 ? 82  LYS A NZ   3  
ATOM 6157  H H    . LYS A 1 82  ? 1.111   10.421  0.608   1.00 0.00 ? 82  LYS A H    3  
ATOM 6158  H HA   . LYS A 1 82  ? 0.173   7.650   0.615   1.00 0.00 ? 82  LYS A HA   3  
ATOM 6159  H HB2  . LYS A 1 82  ? 0.933   8.375   -1.824  1.00 0.00 ? 82  LYS A HB2  3  
ATOM 6160  H HB3  . LYS A 1 82  ? 2.537   8.106   -1.140  1.00 0.00 ? 82  LYS A HB3  3  
ATOM 6161  H HG2  . LYS A 1 82  ? 1.854   5.846   -0.413  1.00 0.00 ? 82  LYS A HG2  3  
ATOM 6162  H HG3  . LYS A 1 82  ? 0.261   6.107   -1.122  1.00 0.00 ? 82  LYS A HG3  3  
ATOM 6163  H HD2  . LYS A 1 82  ? 1.409   4.935   -2.804  1.00 0.00 ? 82  LYS A HD2  3  
ATOM 6164  H HD3  . LYS A 1 82  ? 1.559   6.614   -3.313  1.00 0.00 ? 82  LYS A HD3  3  
ATOM 6165  H HE2  . LYS A 1 82  ? 3.724   6.157   -1.570  1.00 0.00 ? 82  LYS A HE2  3  
ATOM 6166  H HE3  . LYS A 1 82  ? 3.637   4.733   -2.607  1.00 0.00 ? 82  LYS A HE3  3  
ATOM 6167  H HZ1  . LYS A 1 82  ? 4.755   7.116   -3.275  1.00 0.00 ? 82  LYS A HZ1  3  
ATOM 6168  H HZ2  . LYS A 1 82  ? 3.238   7.183   -4.038  1.00 0.00 ? 82  LYS A HZ2  3  
ATOM 6169  H HZ3  . LYS A 1 82  ? 4.301   5.898   -4.364  1.00 0.00 ? 82  LYS A HZ3  3  
ATOM 6170  N N    . ARG A 1 83  ? 2.019   7.187   2.188   1.00 0.00 ? 83  ARG A N    3  
ATOM 6171  C CA   . ARG A 1 83  ? 3.079   6.955   3.203   1.00 0.00 ? 83  ARG A CA   3  
ATOM 6172  C C    . ARG A 1 83  ? 2.928   5.537   3.746   1.00 0.00 ? 83  ARG A C    3  
ATOM 6173  O O    . ARG A 1 83  ? 1.828   5.054   3.922   1.00 0.00 ? 83  ARG A O    3  
ATOM 6174  C CB   . ARG A 1 83  ? 2.927   7.964   4.342   1.00 0.00 ? 83  ARG A CB   3  
ATOM 6175  C CG   . ARG A 1 83  ? 3.981   7.688   5.415   1.00 0.00 ? 83  ARG A CG   3  
ATOM 6176  C CD   . ARG A 1 83  ? 3.832   8.703   6.549   1.00 0.00 ? 83  ARG A CD   3  
ATOM 6177  N NE   . ARG A 1 83  ? 4.869   8.444   7.586   1.00 0.00 ? 83  ARG A NE   3  
ATOM 6178  C CZ   . ARG A 1 83  ? 6.094   8.847   7.396   1.00 0.00 ? 83  ARG A CZ   3  
ATOM 6179  N NH1  . ARG A 1 83  ? 6.412   9.470   6.294   1.00 0.00 ? 83  ARG A NH1  3  
ATOM 6180  N NH2  . ARG A 1 83  ? 7.003   8.627   8.306   1.00 0.00 ? 83  ARG A NH2  3  
ATOM 6181  H H    . ARG A 1 83  ? 1.234   6.606   2.162   1.00 0.00 ? 83  ARG A H    3  
ATOM 6182  H HA   . ARG A 1 83  ? 4.052   7.068   2.745   1.00 0.00 ? 83  ARG A HA   3  
ATOM 6183  H HB2  . ARG A 1 83  ? 3.060   8.965   3.956   1.00 0.00 ? 83  ARG A HB2  3  
ATOM 6184  H HB3  . ARG A 1 83  ? 1.942   7.873   4.773   1.00 0.00 ? 83  ARG A HB3  3  
ATOM 6185  H HG2  . ARG A 1 83  ? 3.845   6.689   5.807   1.00 0.00 ? 83  ARG A HG2  3  
ATOM 6186  H HG3  . ARG A 1 83  ? 4.967   7.775   4.984   1.00 0.00 ? 83  ARG A HG3  3  
ATOM 6187  H HD2  . ARG A 1 83  ? 3.960   9.699   6.155   1.00 0.00 ? 83  ARG A HD2  3  
ATOM 6188  H HD3  . ARG A 1 83  ? 2.850   8.612   6.990   1.00 0.00 ? 83  ARG A HD3  3  
ATOM 6189  H HE   . ARG A 1 83  ? 4.630   7.972   8.413   1.00 0.00 ? 83  ARG A HE   3  
ATOM 6190  H HH11 . ARG A 1 83  ? 5.715   9.636   5.595   1.00 0.00 ? 83  ARG A HH11 3  
ATOM 6191  H HH12 . ARG A 1 83  ? 7.350   9.780   6.146   1.00 0.00 ? 83  ARG A HH12 3  
ATOM 6192  H HH21 . ARG A 1 83  ? 6.760   8.148   9.149   1.00 0.00 ? 83  ARG A HH21 3  
ATOM 6193  H HH22 . ARG A 1 83  ? 7.942   8.936   8.160   1.00 0.00 ? 83  ARG A HH22 3  
ATOM 6194  N N    . GLU A 1 84  ? 4.011   4.859   4.015   1.00 0.00 ? 84  GLU A N    3  
ATOM 6195  C CA   . GLU A 1 84  ? 3.883   3.476   4.548   1.00 0.00 ? 84  GLU A CA   3  
ATOM 6196  C C    . GLU A 1 84  ? 4.514   3.392   5.929   1.00 0.00 ? 84  GLU A C    3  
ATOM 6197  O O    . GLU A 1 84  ? 5.560   3.956   6.182   1.00 0.00 ? 84  GLU A O    3  
ATOM 6198  C CB   . GLU A 1 84  ? 4.572   2.474   3.618   1.00 0.00 ? 84  GLU A CB   3  
ATOM 6199  C CG   . GLU A 1 84  ? 5.967   2.973   3.247   1.00 0.00 ? 84  GLU A CG   3  
ATOM 6200  C CD   . GLU A 1 84  ? 5.857   4.219   2.367   1.00 0.00 ? 84  GLU A CD   3  
ATOM 6201  O OE1  . GLU A 1 84  ? 6.847   4.921   2.243   1.00 0.00 ? 84  GLU A OE1  3  
ATOM 6202  O OE2  . GLU A 1 84  ? 4.784   4.451   1.833   1.00 0.00 ? 84  GLU A OE2  3  
ATOM 6203  H H    . GLU A 1 84  ? 4.894   5.256   3.871   1.00 0.00 ? 84  GLU A H    3  
ATOM 6204  H HA   . GLU A 1 84  ? 2.842   3.230   4.623   1.00 0.00 ? 84  GLU A HA   3  
ATOM 6205  H HB2  . GLU A 1 84  ? 4.653   1.520   4.120   1.00 0.00 ? 84  GLU A HB2  3  
ATOM 6206  H HB3  . GLU A 1 84  ? 3.985   2.357   2.729   1.00 0.00 ? 84  GLU A HB3  3  
ATOM 6207  H HG2  . GLU A 1 84  ? 6.506   3.212   4.148   1.00 0.00 ? 84  GLU A HG2  3  
ATOM 6208  H HG3  . GLU A 1 84  ? 6.494   2.200   2.709   1.00 0.00 ? 84  GLU A HG3  3  
ATOM 6209  H HE2  . GLU A 1 84  ? 4.789   5.247   1.297   1.00 0.00 ? 84  GLU A HE2  3  
ATOM 6210  N N    . LEU A 1 85  ? 3.898   2.673   6.825   1.00 0.00 ? 85  LEU A N    3  
ATOM 6211  C CA   . LEU A 1 85  ? 4.487   2.543   8.177   1.00 0.00 ? 85  LEU A CA   3  
ATOM 6212  C C    . LEU A 1 85  ? 5.356   1.291   8.186   1.00 0.00 ? 85  LEU A C    3  
ATOM 6213  O O    . LEU A 1 85  ? 4.878   0.191   7.994   1.00 0.00 ? 85  LEU A O    3  
ATOM 6214  C CB   . LEU A 1 85  ? 3.371   2.418   9.216   1.00 0.00 ? 85  LEU A CB   3  
ATOM 6215  C CG   . LEU A 1 85  ? 2.325   3.512   8.979   1.00 0.00 ? 85  LEU A CG   3  
ATOM 6216  C CD1  . LEU A 1 85  ? 1.441   3.658   10.217  1.00 0.00 ? 85  LEU A CD1  3  
ATOM 6217  C CD2  . LEU A 1 85  ? 3.018   4.843   8.691   1.00 0.00 ? 85  LEU A CD2  3  
ATOM 6218  H H    . LEU A 1 85  ? 3.063   2.211   6.601   1.00 0.00 ? 85  LEU A H    3  
ATOM 6219  H HA   . LEU A 1 85  ? 5.092   3.405   8.392   1.00 0.00 ? 85  LEU A HA   3  
ATOM 6220  H HB2  . LEU A 1 85  ? 2.906   1.447   9.129   1.00 0.00 ? 85  LEU A HB2  3  
ATOM 6221  H HB3  . LEU A 1 85  ? 3.788   2.529   10.206  1.00 0.00 ? 85  LEU A HB3  3  
ATOM 6222  H HG   . LEU A 1 85  ? 1.712   3.236   8.134   1.00 0.00 ? 85  LEU A HG   3  
ATOM 6223  H HD11 . LEU A 1 85  ? 1.610   2.824   10.884  1.00 0.00 ? 85  LEU A HD11 3  
ATOM 6224  H HD12 . LEU A 1 85  ? 0.405   3.674   9.917   1.00 0.00 ? 85  LEU A HD12 3  
ATOM 6225  H HD13 . LEU A 1 85  ? 1.681   4.580   10.724  1.00 0.00 ? 85  LEU A HD13 3  
ATOM 6226  H HD21 . LEU A 1 85  ? 3.395   4.840   7.680   1.00 0.00 ? 85  LEU A HD21 3  
ATOM 6227  H HD22 . LEU A 1 85  ? 3.836   4.982   9.382   1.00 0.00 ? 85  LEU A HD22 3  
ATOM 6228  H HD23 . LEU A 1 85  ? 2.309   5.648   8.807   1.00 0.00 ? 85  LEU A HD23 3  
ATOM 6229  N N    . ASN A 1 86  ? 6.634   1.451   8.388   1.00 0.00 ? 86  ASN A N    3  
ATOM 6230  C CA   . ASN A 1 86  ? 7.534   0.266   8.381   1.00 0.00 ? 86  ASN A CA   3  
ATOM 6231  C C    . ASN A 1 86  ? 8.096   0.037   9.782   1.00 0.00 ? 86  ASN A C    3  
ATOM 6232  O O    . ASN A 1 86  ? 8.645   0.925   10.398  1.00 0.00 ? 86  ASN A O    3  
ATOM 6233  C CB   . ASN A 1 86  ? 8.687   0.520   7.407   1.00 0.00 ? 86  ASN A CB   3  
ATOM 6234  C CG   . ASN A 1 86  ? 8.122   1.011   6.073   1.00 0.00 ? 86  ASN A CG   3  
ATOM 6235  O OD1  . ASN A 1 86  ? 8.860   1.453   5.213   1.00 0.00 ? 86  ASN A OD1  3  
ATOM 6236  N ND2  . ASN A 1 86  ? 6.835   0.957   5.864   1.00 0.00 ? 86  ASN A ND2  3  
ATOM 6237  H H    . ASN A 1 86  ? 7.003   2.345   8.525   1.00 0.00 ? 86  ASN A H    3  
ATOM 6238  H HA   . ASN A 1 86  ? 6.985   -0.604  8.066   1.00 0.00 ? 86  ASN A HA   3  
ATOM 6239  H HB2  . ASN A 1 86  ? 9.349   1.269   7.818   1.00 0.00 ? 86  ASN A HB2  3  
ATOM 6240  H HB3  . ASN A 1 86  ? 9.233   -0.397  7.247   1.00 0.00 ? 86  ASN A HB3  3  
ATOM 6241  H HD21 . ASN A 1 86  ? 6.242   0.603   6.556   1.00 0.00 ? 86  ASN A HD21 3  
ATOM 6242  H HD22 . ASN A 1 86  ? 6.464   1.272   5.012   1.00 0.00 ? 86  ASN A HD22 3  
ATOM 6243  N N    . TYR A 1 87  ? 7.964   -1.157  10.281  1.00 0.00 ? 87  TYR A N    3  
ATOM 6244  C CA   . TYR A 1 87  ? 8.493   -1.456  11.636  1.00 0.00 ? 87  TYR A CA   3  
ATOM 6245  C C    . TYR A 1 87  ? 8.540   -2.965  11.846  1.00 0.00 ? 87  TYR A C    3  
ATOM 6246  O O    . TYR A 1 87  ? 7.761   -3.708  11.282  1.00 0.00 ? 87  TYR A O    3  
ATOM 6247  C CB   . TYR A 1 87  ? 7.585   -0.825  12.692  1.00 0.00 ? 87  TYR A CB   3  
ATOM 6248  C CG   . TYR A 1 87  ? 6.147   -1.194  12.408  1.00 0.00 ? 87  TYR A CG   3  
ATOM 6249  C CD1  . TYR A 1 87  ? 5.652   -2.439  12.813  1.00 0.00 ? 87  TYR A CD1  3  
ATOM 6250  C CD2  . TYR A 1 87  ? 5.310   -0.293  11.736  1.00 0.00 ? 87  TYR A CD2  3  
ATOM 6251  C CE1  . TYR A 1 87  ? 4.323   -2.784  12.547  1.00 0.00 ? 87  TYR A CE1  3  
ATOM 6252  C CE2  . TYR A 1 87  ? 3.980   -0.638  11.469  1.00 0.00 ? 87  TYR A CE2  3  
ATOM 6253  C CZ   . TYR A 1 87  ? 3.486   -1.883  11.875  1.00 0.00 ? 87  TYR A CZ   3  
ATOM 6254  O OH   . TYR A 1 87  ? 2.176   -2.225  11.613  1.00 0.00 ? 87  TYR A OH   3  
ATOM 6255  H H    . TYR A 1 87  ? 7.520   -1.861  9.766   1.00 0.00 ? 87  TYR A H    3  
ATOM 6256  H HA   . TYR A 1 87  ? 9.487   -1.049  11.731  1.00 0.00 ? 87  TYR A HA   3  
ATOM 6257  H HB2  . TYR A 1 87  ? 7.862   -1.193  13.669  1.00 0.00 ? 87  TYR A HB2  3  
ATOM 6258  H HB3  . TYR A 1 87  ? 7.696   0.245   12.667  1.00 0.00 ? 87  TYR A HB3  3  
ATOM 6259  H HD1  . TYR A 1 87  ? 6.298   -3.132  13.329  1.00 0.00 ? 87  TYR A HD1  3  
ATOM 6260  H HD2  . TYR A 1 87  ? 5.690   0.669   11.423  1.00 0.00 ? 87  TYR A HD2  3  
ATOM 6261  H HE1  . TYR A 1 87  ? 3.941   -3.744  12.860  1.00 0.00 ? 87  TYR A HE1  3  
ATOM 6262  H HE2  . TYR A 1 87  ? 3.335   0.056   10.954  1.00 0.00 ? 87  TYR A HE2  3  
ATOM 6263  H HH   . TYR A 1 87  ? 2.028   -3.114  11.941  1.00 0.00 ? 87  TYR A HH   3  
ATOM 6264  N N    . VAL A 1 88  ? 9.445   -3.419  12.659  1.00 0.00 ? 88  VAL A N    3  
ATOM 6265  C CA   . VAL A 1 88  ? 9.547   -4.878  12.923  1.00 0.00 ? 88  VAL A CA   3  
ATOM 6266  C C    . VAL A 1 88  ? 9.058   -5.155  14.341  1.00 0.00 ? 88  VAL A C    3  
ATOM 6267  O O    . VAL A 1 88  ? 9.745   -4.898  15.308  1.00 0.00 ? 88  VAL A O    3  
ATOM 6268  C CB   . VAL A 1 88  ? 11.004  -5.320  12.784  1.00 0.00 ? 88  VAL A CB   3  
ATOM 6269  C CG1  . VAL A 1 88  ? 11.853  -4.620  13.839  1.00 0.00 ? 88  VAL A CG1  3  
ATOM 6270  C CG2  . VAL A 1 88  ? 11.104  -6.831  12.983  1.00 0.00 ? 88  VAL A CG2  3  
ATOM 6271  H H    . VAL A 1 88  ? 10.053  -2.793  13.107  1.00 0.00 ? 88  VAL A H    3  
ATOM 6272  H HA   . VAL A 1 88  ? 8.933   -5.421  12.221  1.00 0.00 ? 88  VAL A HA   3  
ATOM 6273  H HB   . VAL A 1 88  ? 11.366  -5.061  11.798  1.00 0.00 ? 88  VAL A HB   3  
ATOM 6274  H HG11 . VAL A 1 88  ? 12.010  -5.288  14.674  1.00 0.00 ? 88  VAL A HG11 3  
ATOM 6275  H HG12 . VAL A 1 88  ? 11.342  -3.733  14.182  1.00 0.00 ? 88  VAL A HG12 3  
ATOM 6276  H HG13 . VAL A 1 88  ? 12.806  -4.346  13.411  1.00 0.00 ? 88  VAL A HG13 3  
ATOM 6277  H HG21 . VAL A 1 88  ? 11.890  -7.049  13.693  1.00 0.00 ? 88  VAL A HG21 3  
ATOM 6278  H HG22 . VAL A 1 88  ? 11.333  -7.305  12.040  1.00 0.00 ? 88  VAL A HG22 3  
ATOM 6279  H HG23 . VAL A 1 88  ? 10.166  -7.206  13.360  1.00 0.00 ? 88  VAL A HG23 3  
ATOM 6280  N N    . ALA A 1 89  ? 7.867   -5.669  14.472  1.00 0.00 ? 89  ALA A N    3  
ATOM 6281  C CA   . ALA A 1 89  ? 7.330   -5.947  15.829  1.00 0.00 ? 89  ALA A CA   3  
ATOM 6282  C C    . ALA A 1 89  ? 8.013   -7.186  16.411  1.00 0.00 ? 89  ALA A C    3  
ATOM 6283  O O    . ALA A 1 89  ? 9.033   -7.095  17.065  1.00 0.00 ? 89  ALA A O    3  
ATOM 6284  C CB   . ALA A 1 89  ? 5.821   -6.185  15.743  1.00 0.00 ? 89  ALA A CB   3  
ATOM 6285  H H    . ALA A 1 89  ? 7.325   -5.859  13.676  1.00 0.00 ? 89  ALA A H    3  
ATOM 6286  H HA   . ALA A 1 89  ? 7.525   -5.102  16.468  1.00 0.00 ? 89  ALA A HA   3  
ATOM 6287  H HB1  . ALA A 1 89  ? 5.429   -6.369  16.732  1.00 0.00 ? 89  ALA A HB1  3  
ATOM 6288  H HB2  . ALA A 1 89  ? 5.627   -7.041  15.114  1.00 0.00 ? 89  ALA A HB2  3  
ATOM 6289  H HB3  . ALA A 1 89  ? 5.344   -5.313  15.323  1.00 0.00 ? 89  ALA A HB3  3  
ATOM 6290  N N    . ARG A 1 90  ? 7.457   -8.346  16.190  1.00 0.00 ? 90  ARG A N    3  
ATOM 6291  C CA   . ARG A 1 90  ? 8.072   -9.582  16.746  1.00 0.00 ? 90  ARG A CA   3  
ATOM 6292  C C    . ARG A 1 90  ? 9.509   -9.731  16.241  1.00 0.00 ? 90  ARG A C    3  
ATOM 6293  O O    . ARG A 1 90  ? 10.437  -9.843  17.015  1.00 0.00 ? 90  ARG A O    3  
ATOM 6294  C CB   . ARG A 1 90  ? 7.252   -10.797 16.309  1.00 0.00 ? 90  ARG A CB   3  
ATOM 6295  C CG   . ARG A 1 90  ? 7.944   -12.073 16.786  1.00 0.00 ? 90  ARG A CG   3  
ATOM 6296  C CD   . ARG A 1 90  ? 7.063   -13.285 16.479  1.00 0.00 ? 90  ARG A CD   3  
ATOM 6297  N NE   . ARG A 1 90  ? 7.713   -14.514 17.016  1.00 0.00 ? 90  ARG A NE   3  
ATOM 6298  C CZ   . ARG A 1 90  ? 6.986   -15.544 17.359  1.00 0.00 ? 90  ARG A CZ   3  
ATOM 6299  N NH1  . ARG A 1 90  ? 5.690   -15.503 17.223  1.00 0.00 ? 90  ARG A NH1  3  
ATOM 6300  N NH2  . ARG A 1 90  ? 7.560   -16.613 17.839  1.00 0.00 ? 90  ARG A NH2  3  
ATOM 6301  H H    . ARG A 1 90  ? 6.628   -8.402  15.666  1.00 0.00 ? 90  ARG A H    3  
ATOM 6302  H HA   . ARG A 1 90  ? 8.078   -9.525  17.824  1.00 0.00 ? 90  ARG A HA   3  
ATOM 6303  H HB2  . ARG A 1 90  ? 6.265   -10.737 16.741  1.00 0.00 ? 90  ARG A HB2  3  
ATOM 6304  H HB3  . ARG A 1 90  ? 7.176   -10.810 15.231  1.00 0.00 ? 90  ARG A HB3  3  
ATOM 6305  H HG2  . ARG A 1 90  ? 8.891   -12.180 16.274  1.00 0.00 ? 90  ARG A HG2  3  
ATOM 6306  H HG3  . ARG A 1 90  ? 8.115   -12.011 17.847  1.00 0.00 ? 90  ARG A HG3  3  
ATOM 6307  H HD2  . ARG A 1 90  ? 6.098   -13.153 16.945  1.00 0.00 ? 90  ARG A HD2  3  
ATOM 6308  H HD3  . ARG A 1 90  ? 6.939   -13.380 15.411  1.00 0.00 ? 90  ARG A HD3  3  
ATOM 6309  H HE   . ARG A 1 90  ? 8.687   -14.548 17.116  1.00 0.00 ? 90  ARG A HE   3  
ATOM 6310  H HH11 . ARG A 1 90  ? 5.251   -14.683 16.854  1.00 0.00 ? 90  ARG A HH11 3  
ATOM 6311  H HH12 . ARG A 1 90  ? 5.135   -16.291 17.488  1.00 0.00 ? 90  ARG A HH12 3  
ATOM 6312  H HH21 . ARG A 1 90  ? 8.554   -16.646 17.943  1.00 0.00 ? 90  ARG A HH21 3  
ATOM 6313  H HH22 . ARG A 1 90  ? 7.005   -17.402 18.102  1.00 0.00 ? 90  ARG A HH22 3  
ATOM 6314  N N    . ASN A 1 91  ? 9.698   -9.729  14.953  1.00 0.00 ? 91  ASN A N    3  
ATOM 6315  C CA   . ASN A 1 91  ? 11.077  -9.869  14.402  1.00 0.00 ? 91  ASN A CA   3  
ATOM 6316  C C    . ASN A 1 91  ? 11.031  -9.766  12.876  1.00 0.00 ? 91  ASN A C    3  
ATOM 6317  O O    . ASN A 1 91  ? 11.920  -10.228 12.187  1.00 0.00 ? 91  ASN A O    3  
ATOM 6318  C CB   . ASN A 1 91  ? 11.651  -11.230 14.799  1.00 0.00 ? 91  ASN A CB   3  
ATOM 6319  C CG   . ASN A 1 91  ? 11.039  -12.320 13.916  1.00 0.00 ? 91  ASN A CG   3  
ATOM 6320  O OD1  . ASN A 1 91  ? 10.056  -12.090 13.239  1.00 0.00 ? 91  ASN A OD1  3  
ATOM 6321  N ND2  . ASN A 1 91  ? 11.582  -13.506 13.897  1.00 0.00 ? 91  ASN A ND2  3  
ATOM 6322  H H    . ASN A 1 91  ? 8.933   -9.636  14.348  1.00 0.00 ? 91  ASN A H    3  
ATOM 6323  H HA   . ASN A 1 91  ? 11.704  -9.085  14.797  1.00 0.00 ? 91  ASN A HA   3  
ATOM 6324  H HB2  . ASN A 1 91  ? 12.722  -11.220 14.669  1.00 0.00 ? 91  ASN A HB2  3  
ATOM 6325  H HB3  . ASN A 1 91  ? 11.415  -11.433 15.833  1.00 0.00 ? 91  ASN A HB3  3  
ATOM 6326  H HD21 . ASN A 1 91  ? 12.373  -13.691 14.443  1.00 0.00 ? 91  ASN A HD21 3  
ATOM 6327  H HD22 . ASN A 1 91  ? 11.199  -14.210 13.334  1.00 0.00 ? 91  ASN A HD22 3  
ATOM 6328  N N    . LYS A 1 92  ? 10.005  -9.165  12.348  1.00 0.00 ? 92  LYS A N    3  
ATOM 6329  C CA   . LYS A 1 92  ? 9.902   -9.033  10.870  1.00 0.00 ? 92  LYS A CA   3  
ATOM 6330  C C    . LYS A 1 92  ? 9.334   -7.646  10.526  1.00 0.00 ? 92  LYS A C    3  
ATOM 6331  O O    . LYS A 1 92  ? 8.283   -7.266  11.003  1.00 0.00 ? 92  LYS A O    3  
ATOM 6332  C CB   . LYS A 1 92  ? 8.976   -10.126 10.337  1.00 0.00 ? 92  LYS A CB   3  
ATOM 6333  C CG   . LYS A 1 92  ? 9.404   -10.532 8.923   1.00 0.00 ? 92  LYS A CG   3  
ATOM 6334  C CD   . LYS A 1 92  ? 10.647  -11.419 8.997   1.00 0.00 ? 92  LYS A CD   3  
ATOM 6335  C CE   . LYS A 1 92  ? 10.264  -12.865 8.680   1.00 0.00 ? 92  LYS A CE   3  
ATOM 6336  N NZ   . LYS A 1 92  ? 11.426  -13.759 8.947   1.00 0.00 ? 92  LYS A NZ   3  
ATOM 6337  H H    . LYS A 1 92  ? 9.303   -8.800  12.922  1.00 0.00 ? 92  LYS A H    3  
ATOM 6338  H HA   . LYS A 1 92  ? 10.882  -9.145  10.434  1.00 0.00 ? 92  LYS A HA   3  
ATOM 6339  H HB2  . LYS A 1 92  ? 9.032   -10.985 10.988  1.00 0.00 ? 92  LYS A HB2  3  
ATOM 6340  H HB3  . LYS A 1 92  ? 7.965   -9.757  10.317  1.00 0.00 ? 92  LYS A HB3  3  
ATOM 6341  H HG2  . LYS A 1 92  ? 8.601   -11.077 8.447   1.00 0.00 ? 92  LYS A HG2  3  
ATOM 6342  H HG3  . LYS A 1 92  ? 9.628   -9.651  8.346   1.00 0.00 ? 92  LYS A HG3  3  
ATOM 6343  H HD2  . LYS A 1 92  ? 11.378  -11.075 8.278   1.00 0.00 ? 92  LYS A HD2  3  
ATOM 6344  H HD3  . LYS A 1 92  ? 11.068  -11.370 9.990   1.00 0.00 ? 92  LYS A HD3  3  
ATOM 6345  H HE2  . LYS A 1 92  ? 9.432   -13.161 9.303   1.00 0.00 ? 92  LYS A HE2  3  
ATOM 6346  H HE3  . LYS A 1 92  ? 9.980   -12.945 7.640   1.00 0.00 ? 92  LYS A HE3  3  
ATOM 6347  H HZ1  . LYS A 1 92  ? 11.324  -14.190 9.887   1.00 0.00 ? 92  LYS A HZ1  3  
ATOM 6348  H HZ2  . LYS A 1 92  ? 12.305  -13.204 8.912   1.00 0.00 ? 92  LYS A HZ2  3  
ATOM 6349  H HZ3  . LYS A 1 92  ? 11.460  -14.509 8.227   1.00 0.00 ? 92  LYS A HZ3  3  
ATOM 6350  N N    . PRO A 1 93  ? 10.037  -6.892  9.716   1.00 0.00 ? 93  PRO A N    3  
ATOM 6351  C CA   . PRO A 1 93  ? 9.617   -5.515  9.310   1.00 0.00 ? 93  PRO A CA   3  
ATOM 6352  C C    . PRO A 1 93  ? 8.429   -5.515  8.361   1.00 0.00 ? 93  PRO A C    3  
ATOM 6353  O O    . PRO A 1 93  ? 8.472   -6.080  7.289   1.00 0.00 ? 93  PRO A O    3  
ATOM 6354  C CB   . PRO A 1 93  ? 10.834  -4.953  8.596   1.00 0.00 ? 93  PRO A CB   3  
ATOM 6355  C CG   . PRO A 1 93  ? 11.571  -6.149  8.099   1.00 0.00 ? 93  PRO A CG   3  
ATOM 6356  C CD   . PRO A 1 93  ? 11.310  -7.270  9.093   1.00 0.00 ? 93  PRO A CD   3  
ATOM 6357  H HA   . PRO A 1 93  ? 9.402   -4.913  10.176  1.00 0.00 ? 93  PRO A HA   3  
ATOM 6358  H HB2  . PRO A 1 93  ? 10.520  -4.330  7.771   1.00 0.00 ? 93  PRO A HB2  3  
ATOM 6359  H HB3  . PRO A 1 93  ? 11.442  -4.395  9.279   1.00 0.00 ? 93  PRO A HB3  3  
ATOM 6360  H HG2  . PRO A 1 93  ? 11.203  -6.422  7.131   1.00 0.00 ? 93  PRO A HG2  3  
ATOM 6361  H HG3  . PRO A 1 93  ? 12.618  -5.952  8.047   1.00 0.00 ? 93  PRO A HG3  3  
ATOM 6362  H HD2  . PRO A 1 93  ? 11.221  -8.211  8.576   1.00 0.00 ? 93  PRO A HD2  3  
ATOM 6363  H HD3  . PRO A 1 93  ? 12.087  -7.315  9.831   1.00 0.00 ? 93  PRO A HD3  3  
ATOM 6364  N N    . LYS A 1 94  ? 7.381   -4.864  8.742   1.00 0.00 ? 94  LYS A N    3  
ATOM 6365  C CA   . LYS A 1 94  ? 6.179   -4.811  7.869   1.00 0.00 ? 94  LYS A CA   3  
ATOM 6366  C C    . LYS A 1 94  ? 6.025   -3.433  7.243   1.00 0.00 ? 94  LYS A C    3  
ATOM 6367  O O    . LYS A 1 94  ? 5.868   -2.446  7.929   1.00 0.00 ? 94  LYS A O    3  
ATOM 6368  C CB   . LYS A 1 94  ? 4.928   -5.090  8.703   1.00 0.00 ? 94  LYS A CB   3  
ATOM 6369  C CG   . LYS A 1 94  ? 4.632   -6.588  8.750   1.00 0.00 ? 94  LYS A CG   3  
ATOM 6370  C CD   . LYS A 1 94  ? 3.265   -6.809  9.401   1.00 0.00 ? 94  LYS A CD   3  
ATOM 6371  C CE   . LYS A 1 94  ? 2.188   -6.101  8.571   1.00 0.00 ? 94  LYS A CE   3  
ATOM 6372  N NZ   . LYS A 1 94  ? 1.982   -4.720  9.093   1.00 0.00 ? 94  LYS A NZ   3  
ATOM 6373  H H    . LYS A 1 94  ? 7.388   -4.401  9.603   1.00 0.00 ? 94  LYS A H    3  
ATOM 6374  H HA   . LYS A 1 94  ? 6.259   -5.550  7.088   1.00 0.00 ? 94  LYS A HA   3  
ATOM 6375  H HB2  . LYS A 1 94  ? 5.085   -4.729  9.706   1.00 0.00 ? 94  LYS A HB2  3  
ATOM 6376  H HB3  . LYS A 1 94  ? 4.092   -4.575  8.263   1.00 0.00 ? 94  LYS A HB3  3  
ATOM 6377  H HG2  . LYS A 1 94  ? 4.617   -6.984  7.748   1.00 0.00 ? 94  LYS A HG2  3  
ATOM 6378  H HG3  . LYS A 1 94  ? 5.392   -7.092  9.328   1.00 0.00 ? 94  LYS A HG3  3  
ATOM 6379  H HD2  . LYS A 1 94  ? 3.052   -7.866  9.442   1.00 0.00 ? 94  LYS A HD2  3  
ATOM 6380  H HD3  . LYS A 1 94  ? 3.272   -6.402  10.400  1.00 0.00 ? 94  LYS A HD3  3  
ATOM 6381  H HE2  . LYS A 1 94  ? 2.506   -6.052  7.540   1.00 0.00 ? 94  LYS A HE2  3  
ATOM 6382  H HE3  . LYS A 1 94  ? 1.263   -6.650  8.635   1.00 0.00 ? 94  LYS A HE3  3  
ATOM 6383  H HZ1  . LYS A 1 94  ? 0.964   -4.530  9.176   1.00 0.00 ? 94  LYS A HZ1  3  
ATOM 6384  H HZ2  . LYS A 1 94  ? 2.411   -4.035  8.438   1.00 0.00 ? 94  LYS A HZ2  3  
ATOM 6385  H HZ3  . LYS A 1 94  ? 2.427   -4.631  10.028  1.00 0.00 ? 94  LYS A HZ3  3  
ATOM 6386  N N    . THR A 1 95  ? 6.008   -3.363  5.943   1.00 0.00 ? 95  THR A N    3  
ATOM 6387  C CA   . THR A 1 95  ? 5.797   -2.050  5.286   1.00 0.00 ? 95  THR A CA   3  
ATOM 6388  C C    . THR A 1 95  ? 4.302   -1.924  5.028   1.00 0.00 ? 95  THR A C    3  
ATOM 6389  O O    . THR A 1 95  ? 3.707   -2.757  4.375   1.00 0.00 ? 95  THR A O    3  
ATOM 6390  C CB   . THR A 1 95  ? 6.558   -1.986  3.955   1.00 0.00 ? 95  THR A CB   3  
ATOM 6391  O OG1  . THR A 1 95  ? 7.954   -2.030  4.212   1.00 0.00 ? 95  THR A OG1  3  
ATOM 6392  C CG2  . THR A 1 95  ? 6.209   -0.685  3.218   1.00 0.00 ? 95  THR A CG2  3  
ATOM 6393  H H    . THR A 1 95  ? 6.091   -4.176  5.402   1.00 0.00 ? 95  THR A H    3  
ATOM 6394  H HA   . THR A 1 95  ? 6.124   -1.256  5.940   1.00 0.00 ? 95  THR A HA   3  
ATOM 6395  H HB   . THR A 1 95  ? 6.279   -2.827  3.341   1.00 0.00 ? 95  THR A HB   3  
ATOM 6396  H HG1  . THR A 1 95  ? 8.412   -1.947  3.371   1.00 0.00 ? 95  THR A HG1  3  
ATOM 6397  H HG21 . THR A 1 95  ? 6.546   -0.750  2.195   1.00 0.00 ? 95  THR A HG21 3  
ATOM 6398  H HG22 . THR A 1 95  ? 6.698   0.146   3.703   1.00 0.00 ? 95  THR A HG22 3  
ATOM 6399  H HG23 . THR A 1 95  ? 5.140   -0.530  3.233   1.00 0.00 ? 95  THR A HG23 3  
ATOM 6400  N N    . VAL A 1 96  ? 3.684   -0.905  5.539   1.00 0.00 ? 96  VAL A N    3  
ATOM 6401  C CA   . VAL A 1 96  ? 2.225   -0.753  5.326   1.00 0.00 ? 96  VAL A CA   3  
ATOM 6402  C C    . VAL A 1 96  ? 1.964   0.549   4.579   1.00 0.00 ? 96  VAL A C    3  
ATOM 6403  O O    . VAL A 1 96  ? 2.295   1.610   5.052   1.00 0.00 ? 96  VAL A O    3  
ATOM 6404  C CB   . VAL A 1 96  ? 1.529   -0.718  6.688   1.00 0.00 ? 96  VAL A CB   3  
ATOM 6405  C CG1  . VAL A 1 96  ? 0.017   -0.611  6.488   1.00 0.00 ? 96  VAL A CG1  3  
ATOM 6406  C CG2  . VAL A 1 96  ? 1.849   -2.004  7.456   1.00 0.00 ? 96  VAL A CG2  3  
ATOM 6407  H H    . VAL A 1 96  ? 4.176   -0.246  6.073   1.00 0.00 ? 96  VAL A H    3  
ATOM 6408  H HA   . VAL A 1 96  ? 1.850   -1.585  4.748   1.00 0.00 ? 96  VAL A HA   3  
ATOM 6409  H HB   . VAL A 1 96  ? 1.882   0.140   7.250   1.00 0.00 ? 96  VAL A HB   3  
ATOM 6410  H HG11 . VAL A 1 96  ? -0.229  0.375   6.122   1.00 0.00 ? 96  VAL A HG11 3  
ATOM 6411  H HG12 . VAL A 1 96  ? -0.483  -0.781  7.429   1.00 0.00 ? 96  VAL A HG12 3  
ATOM 6412  H HG13 . VAL A 1 96  ? -0.305  -1.351  5.772   1.00 0.00 ? 96  VAL A HG13 3  
ATOM 6413  H HG21 . VAL A 1 96  ? 1.961   -1.779  8.507   1.00 0.00 ? 96  VAL A HG21 3  
ATOM 6414  H HG22 . VAL A 1 96  ? 2.768   -2.429  7.080   1.00 0.00 ? 96  VAL A HG22 3  
ATOM 6415  H HG23 . VAL A 1 96  ? 1.044   -2.715  7.326   1.00 0.00 ? 96  VAL A HG23 3  
ATOM 6416  N N    . ILE A 1 97  ? 1.362   0.476   3.427   1.00 0.00 ? 97  ILE A N    3  
ATOM 6417  C CA   . ILE A 1 97  ? 1.073   1.716   2.655   1.00 0.00 ? 97  ILE A CA   3  
ATOM 6418  C C    . ILE A 1 97  ? -0.370  2.130   2.929   1.00 0.00 ? 97  ILE A C    3  
ATOM 6419  O O    . ILE A 1 97  ? -1.285  1.343   2.787   1.00 0.00 ? 97  ILE A O    3  
ATOM 6420  C CB   . ILE A 1 97  ? 1.271   1.446   1.161   1.00 0.00 ? 97  ILE A CB   3  
ATOM 6421  C CG1  . ILE A 1 97  ? 2.692   0.905   0.928   1.00 0.00 ? 97  ILE A CG1  3  
ATOM 6422  C CG2  . ILE A 1 97  ? 1.059   2.738   0.367   1.00 0.00 ? 97  ILE A CG2  3  
ATOM 6423  C CD1  . ILE A 1 97  ? 3.612   2.013   0.401   1.00 0.00 ? 97  ILE A CD1  3  
ATOM 6424  H H    . ILE A 1 97  ? 1.093   -0.397  3.067   1.00 0.00 ? 97  ILE A H    3  
ATOM 6425  H HA   . ILE A 1 97  ? 1.740   2.504   2.972   1.00 0.00 ? 97  ILE A HA   3  
ATOM 6426  H HB   . ILE A 1 97  ? 0.550   0.709   0.837   1.00 0.00 ? 97  ILE A HB   3  
ATOM 6427  H HG12 . ILE A 1 97  ? 3.089   0.529   1.862   1.00 0.00 ? 97  ILE A HG12 3  
ATOM 6428  H HG13 . ILE A 1 97  ? 2.655   0.101   0.208   1.00 0.00 ? 97  ILE A HG13 3  
ATOM 6429  H HG21 . ILE A 1 97  ? 1.629   3.538   0.819   1.00 0.00 ? 97  ILE A HG21 3  
ATOM 6430  H HG22 . ILE A 1 97  ? 0.011   2.997   0.373   1.00 0.00 ? 97  ILE A HG22 3  
ATOM 6431  H HG23 . ILE A 1 97  ? 1.387   2.595   -0.653  1.00 0.00 ? 97  ILE A HG23 3  
ATOM 6432  H HD11 . ILE A 1 97  ? 3.347   2.956   0.854   1.00 0.00 ? 97  ILE A HD11 3  
ATOM 6433  H HD12 . ILE A 1 97  ? 3.509   2.088   -0.672  1.00 0.00 ? 97  ILE A HD12 3  
ATOM 6434  H HD13 . ILE A 1 97  ? 4.638   1.772   0.650   1.00 0.00 ? 97  ILE A HD13 3  
ATOM 6435  N N    . TYR A 1 98  ? -0.582  3.347   3.349   1.00 0.00 ? 98  TYR A N    3  
ATOM 6436  C CA   . TYR A 1 98  ? -1.971  3.786   3.660   1.00 0.00 ? 98  TYR A CA   3  
ATOM 6437  C C    . TYR A 1 98  ? -2.429  4.898   2.721   1.00 0.00 ? 98  TYR A C    3  
ATOM 6438  O O    . TYR A 1 98  ? -1.740  5.875   2.502   1.00 0.00 ? 98  TYR A O    3  
ATOM 6439  C CB   . TYR A 1 98  ? -2.022  4.333   5.086   1.00 0.00 ? 98  TYR A CB   3  
ATOM 6440  C CG   . TYR A 1 98  ? -2.004  3.209   6.093   1.00 0.00 ? 98  TYR A CG   3  
ATOM 6441  C CD1  . TYR A 1 98  ? -3.089  2.327   6.182   1.00 0.00 ? 98  TYR A CD1  3  
ATOM 6442  C CD2  . TYR A 1 98  ? -0.908  3.058   6.950   1.00 0.00 ? 98  TYR A CD2  3  
ATOM 6443  C CE1  . TYR A 1 98  ? -3.075  1.298   7.131   1.00 0.00 ? 98  TYR A CE1  3  
ATOM 6444  C CE2  . TYR A 1 98  ? -0.896  2.029   7.898   1.00 0.00 ? 98  TYR A CE2  3  
ATOM 6445  C CZ   . TYR A 1 98  ? -1.980  1.149   7.989   1.00 0.00 ? 98  TYR A CZ   3  
ATOM 6446  O OH   . TYR A 1 98  ? -1.969  0.135   8.924   1.00 0.00 ? 98  TYR A OH   3  
ATOM 6447  H H    . TYR A 1 98  ? 0.171   3.962   3.482   1.00 0.00 ? 98  TYR A H    3  
ATOM 6448  H HA   . TYR A 1 98  ? -2.642  2.944   3.579   1.00 0.00 ? 98  TYR A HA   3  
ATOM 6449  H HB2  . TYR A 1 98  ? -1.167  4.971   5.251   1.00 0.00 ? 98  TYR A HB2  3  
ATOM 6450  H HB3  . TYR A 1 98  ? -2.924  4.910   5.206   1.00 0.00 ? 98  TYR A HB3  3  
ATOM 6451  H HD1  . TYR A 1 98  ? -3.935  2.443   5.520   1.00 0.00 ? 98  TYR A HD1  3  
ATOM 6452  H HD2  . TYR A 1 98  ? -0.071  3.736   6.880   1.00 0.00 ? 98  TYR A HD2  3  
ATOM 6453  H HE1  . TYR A 1 98  ? -3.913  0.619   7.202   1.00 0.00 ? 98  TYR A HE1  3  
ATOM 6454  H HE2  . TYR A 1 98  ? -0.051  1.914   8.560   1.00 0.00 ? 98  TYR A HE2  3  
ATOM 6455  H HH   . TYR A 1 98  ? -2.787  -0.356  8.839   1.00 0.00 ? 98  TYR A HH   3  
ATOM 6456  N N    . TRP A 1 99  ? -3.621  4.774   2.214   1.00 0.00 ? 99  TRP A N    3  
ATOM 6457  C CA   . TRP A 1 99  ? -4.193  5.831   1.340   1.00 0.00 ? 99  TRP A CA   3  
ATOM 6458  C C    . TRP A 1 99  ? -5.393  6.419   2.076   1.00 0.00 ? 99  TRP A C    3  
ATOM 6459  O O    . TRP A 1 99  ? -6.126  5.707   2.734   1.00 0.00 ? 99  TRP A O    3  
ATOM 6460  C CB   . TRP A 1 99  ? -4.654  5.231   0.009   1.00 0.00 ? 99  TRP A CB   3  
ATOM 6461  C CG   . TRP A 1 99  ? -3.493  5.067   -0.915  1.00 0.00 ? 99  TRP A CG   3  
ATOM 6462  C CD1  . TRP A 1 99  ? -3.019  6.023   -1.748  1.00 0.00 ? 99  TRP A CD1  3  
ATOM 6463  C CD2  . TRP A 1 99  ? -2.658  3.893   -1.123  1.00 0.00 ? 99  TRP A CD2  3  
ATOM 6464  N NE1  . TRP A 1 99  ? -1.948  5.507   -2.458  1.00 0.00 ? 99  TRP A NE1  3  
ATOM 6465  C CE2  . TRP A 1 99  ? -1.686  4.196   -2.107  1.00 0.00 ? 99  TRP A CE2  3  
ATOM 6466  C CE3  . TRP A 1 99  ? -2.649  2.604   -0.559  1.00 0.00 ? 99  TRP A CE3  3  
ATOM 6467  C CZ2  . TRP A 1 99  ? -0.743  3.255   -2.516  1.00 0.00 ? 99  TRP A CZ2  3  
ATOM 6468  C CZ3  . TRP A 1 99  ? -1.699  1.656   -0.970  1.00 0.00 ? 99  TRP A CZ3  3  
ATOM 6469  C CH2  . TRP A 1 99  ? -0.749  1.981   -1.947  1.00 0.00 ? 99  TRP A CH2  3  
ATOM 6470  H H    . TRP A 1 99  ? -4.165  3.993   2.447   1.00 0.00 ? 99  TRP A H    3  
ATOM 6471  H HA   . TRP A 1 99  ? -3.453  6.600   1.165   1.00 0.00 ? 99  TRP A HA   3  
ATOM 6472  H HB2  . TRP A 1 99  ? -5.102  4.268   0.186   1.00 0.00 ? 99  TRP A HB2  3  
ATOM 6473  H HB3  . TRP A 1 99  ? -5.382  5.887   -0.445  1.00 0.00 ? 99  TRP A HB3  3  
ATOM 6474  H HD1  . TRP A 1 99  ? -3.416  7.024   -1.846  1.00 0.00 ? 99  TRP A HD1  3  
ATOM 6475  H HE1  . TRP A 1 99  ? -1.428  5.994   -3.130  1.00 0.00 ? 99  TRP A HE1  3  
ATOM 6476  H HE3  . TRP A 1 99  ? -3.380  2.343   0.193   1.00 0.00 ? 99  TRP A HE3  3  
ATOM 6477  H HZ2  . TRP A 1 99  ? -0.016  3.506   -3.273  1.00 0.00 ? 99  TRP A HZ2  3  
ATOM 6478  H HZ3  . TRP A 1 99  ? -1.703  0.670   -0.531  1.00 0.00 ? 99  TRP A HZ3  3  
ATOM 6479  H HH2  . TRP A 1 99  ? -0.022  1.246   -2.256  1.00 0.00 ? 99  TRP A HH2  3  
ATOM 6480  N N    . LEU A 1 100 ? -5.614  7.699   1.992   1.00 0.00 ? 100 LEU A N    3  
ATOM 6481  C CA   . LEU A 1 100 ? -6.779  8.274   2.717   1.00 0.00 ? 100 LEU A CA   3  
ATOM 6482  C C    . LEU A 1 100 ? -8.050  7.951   1.929   1.00 0.00 ? 100 LEU A C    3  
ATOM 6483  O O    . LEU A 1 100 ? -8.079  8.046   0.717   1.00 0.00 ? 100 LEU A O    3  
ATOM 6484  C CB   . LEU A 1 100 ? -6.621  9.790   2.843   1.00 0.00 ? 100 LEU A CB   3  
ATOM 6485  C CG   . LEU A 1 100 ? -5.137  10.159  2.831   1.00 0.00 ? 100 LEU A CG   3  
ATOM 6486  C CD1  . LEU A 1 100 ? -4.978  11.632  3.212   1.00 0.00 ? 100 LEU A CD1  3  
ATOM 6487  C CD2  . LEU A 1 100 ? -4.376  9.292   3.835   1.00 0.00 ? 100 LEU A CD2  3  
ATOM 6488  H H    . LEU A 1 100 ? -5.019  8.274   1.466   1.00 0.00 ? 100 LEU A H    3  
ATOM 6489  H HA   . LEU A 1 100 ? -6.846  7.831   3.699   1.00 0.00 ? 100 LEU A HA   3  
ATOM 6490  H HB2  . LEU A 1 100 ? -7.118  10.272  2.016   1.00 0.00 ? 100 LEU A HB2  3  
ATOM 6491  H HB3  . LEU A 1 100 ? -7.064  10.119  3.770   1.00 0.00 ? 100 LEU A HB3  3  
ATOM 6492  H HG   . LEU A 1 100 ? -4.737  10.000  1.840   1.00 0.00 ? 100 LEU A HG   3  
ATOM 6493  H HD11 . LEU A 1 100 ? -3.928  11.870  3.298   1.00 0.00 ? 100 LEU A HD11 3  
ATOM 6494  H HD12 . LEU A 1 100 ? -5.467  11.813  4.156   1.00 0.00 ? 100 LEU A HD12 3  
ATOM 6495  H HD13 . LEU A 1 100 ? -5.425  12.250  2.449   1.00 0.00 ? 100 LEU A HD13 3  
ATOM 6496  H HD21 . LEU A 1 100 ? -3.858  8.503   3.308   1.00 0.00 ? 100 LEU A HD21 3  
ATOM 6497  H HD22 . LEU A 1 100 ? -5.071  8.860   4.539   1.00 0.00 ? 100 LEU A HD22 3  
ATOM 6498  H HD23 . LEU A 1 100 ? -3.659  9.901   4.366   1.00 0.00 ? 100 LEU A HD23 3  
ATOM 6499  N N    . ALA A 1 101 ? -9.095  7.557   2.603   1.00 0.00 ? 101 ALA A N    3  
ATOM 6500  C CA   . ALA A 1 101 ? -10.353 7.218   1.880   1.00 0.00 ? 101 ALA A CA   3  
ATOM 6501  C C    . ALA A 1 101 ? -11.558 7.780   2.633   1.00 0.00 ? 101 ALA A C    3  
ATOM 6502  O O    . ALA A 1 101 ? -11.520 7.983   3.829   1.00 0.00 ? 101 ALA A O    3  
ATOM 6503  C CB   . ALA A 1 101 ? -10.484 5.696   1.776   1.00 0.00 ? 101 ALA A CB   3  
ATOM 6504  H H    . ALA A 1 101 ? -9.050  7.475   3.578   1.00 0.00 ? 101 ALA A H    3  
ATOM 6505  H HA   . ALA A 1 101 ? -10.320 7.641   0.889   1.00 0.00 ? 101 ALA A HA   3  
ATOM 6506  H HB1  . ALA A 1 101 ? -9.552  5.235   2.070   1.00 0.00 ? 101 ALA A HB1  3  
ATOM 6507  H HB2  . ALA A 1 101 ? -10.717 5.424   0.758   1.00 0.00 ? 101 ALA A HB2  3  
ATOM 6508  H HB3  . ALA A 1 101 ? -11.273 5.359   2.429   1.00 0.00 ? 101 ALA A HB3  3  
ATOM 6509  N N    . GLU A 1 102 ? -12.629 8.035   1.931   1.00 0.00 ? 102 GLU A N    3  
ATOM 6510  C CA   . GLU A 1 102 ? -13.847 8.585   2.588   1.00 0.00 ? 102 GLU A CA   3  
ATOM 6511  C C    . GLU A 1 102 ? -15.050 7.708   2.236   1.00 0.00 ? 102 GLU A C    3  
ATOM 6512  O O    . GLU A 1 102 ? -15.363 7.521   1.079   1.00 0.00 ? 102 GLU A O    3  
ATOM 6513  C CB   . GLU A 1 102 ? -14.087 10.005  2.069   1.00 0.00 ? 102 GLU A CB   3  
ATOM 6514  C CG   . GLU A 1 102 ? -15.297 10.617  2.776   1.00 0.00 ? 102 GLU A CG   3  
ATOM 6515  C CD   . GLU A 1 102 ? -15.619 11.975  2.150   1.00 0.00 ? 102 GLU A CD   3  
ATOM 6516  O OE1  . GLU A 1 102 ? -14.896 12.377  1.251   1.00 0.00 ? 102 GLU A OE1  3  
ATOM 6517  O OE2  . GLU A 1 102 ? -16.583 12.589  2.576   1.00 0.00 ? 102 GLU A OE2  3  
ATOM 6518  H H    . GLU A 1 102 ? -12.630 7.861   0.967   1.00 0.00 ? 102 GLU A H    3  
ATOM 6519  H HA   . GLU A 1 102 ? -13.709 8.604   3.656   1.00 0.00 ? 102 GLU A HA   3  
ATOM 6520  H HB2  . GLU A 1 102 ? -13.213 10.611  2.264   1.00 0.00 ? 102 GLU A HB2  3  
ATOM 6521  H HB3  . GLU A 1 102 ? -14.271 9.974   1.007   1.00 0.00 ? 102 GLU A HB3  3  
ATOM 6522  H HG2  . GLU A 1 102 ? -16.147 9.960   2.673   1.00 0.00 ? 102 GLU A HG2  3  
ATOM 6523  H HG3  . GLU A 1 102 ? -15.070 10.754  3.820   1.00 0.00 ? 102 GLU A HG3  3  
ATOM 6524  H HE2  . GLU A 1 102 ? -16.725 13.431  2.137   1.00 0.00 ? 102 GLU A HE2  3  
ATOM 6525  N N    . VAL A 1 103 ? -15.737 7.171   3.212   1.00 0.00 ? 103 VAL A N    3  
ATOM 6526  C CA   . VAL A 1 103 ? -16.916 6.316   2.892   1.00 0.00 ? 103 VAL A CA   3  
ATOM 6527  C C    . VAL A 1 103 ? -18.102 7.205   2.512   1.00 0.00 ? 103 VAL A C    3  
ATOM 6528  O O    . VAL A 1 103 ? -18.400 8.189   3.158   1.00 0.00 ? 103 VAL A O    3  
ATOM 6529  C CB   . VAL A 1 103 ? -17.257 5.415   4.083   1.00 0.00 ? 103 VAL A CB   3  
ATOM 6530  C CG1  . VAL A 1 103 ? -15.989 4.714   4.544   1.00 0.00 ? 103 VAL A CG1  3  
ATOM 6531  C CG2  . VAL A 1 103 ? -17.815 6.235   5.242   1.00 0.00 ? 103 VAL A CG2  3  
ATOM 6532  H H    . VAL A 1 103 ? -15.480 7.330   4.145   1.00 0.00 ? 103 VAL A H    3  
ATOM 6533  H HA   . VAL A 1 103 ? -16.667 5.693   2.047   1.00 0.00 ? 103 VAL A HA   3  
ATOM 6534  H HB   . VAL A 1 103 ? -17.980 4.673   3.776   1.00 0.00 ? 103 VAL A HB   3  
ATOM 6535  H HG11 . VAL A 1 103 ? -15.554 5.273   5.354   1.00 0.00 ? 103 VAL A HG11 3  
ATOM 6536  H HG12 . VAL A 1 103 ? -15.292 4.667   3.725   1.00 0.00 ? 103 VAL A HG12 3  
ATOM 6537  H HG13 . VAL A 1 103 ? -16.227 3.714   4.878   1.00 0.00 ? 103 VAL A HG13 3  
ATOM 6538  H HG21 . VAL A 1 103 ? -17.664 7.284   5.053   1.00 0.00 ? 103 VAL A HG21 3  
ATOM 6539  H HG22 . VAL A 1 103 ? -17.304 5.954   6.154   1.00 0.00 ? 103 VAL A HG22 3  
ATOM 6540  H HG23 . VAL A 1 103 ? -18.870 6.032   5.345   1.00 0.00 ? 103 VAL A HG23 3  
ATOM 6541  N N    . LYS A 1 104 ? -18.748 6.874   1.431   1.00 0.00 ? 104 LYS A N    3  
ATOM 6542  C CA   . LYS A 1 104 ? -19.891 7.691   0.933   1.00 0.00 ? 104 LYS A CA   3  
ATOM 6543  C C    . LYS A 1 104 ? -21.026 7.765   1.960   1.00 0.00 ? 104 LYS A C    3  
ATOM 6544  O O    . LYS A 1 104 ? -21.641 8.798   2.134   1.00 0.00 ? 104 LYS A O    3  
ATOM 6545  C CB   . LYS A 1 104 ? -20.431 7.026   -0.327  1.00 0.00 ? 104 LYS A CB   3  
ATOM 6546  C CG   . LYS A 1 104 ? -19.312 6.898   -1.355  1.00 0.00 ? 104 LYS A CG   3  
ATOM 6547  C CD   . LYS A 1 104 ? -19.814 6.072   -2.534  1.00 0.00 ? 104 LYS A CD   3  
ATOM 6548  C CE   . LYS A 1 104 ? -18.639 5.691   -3.434  1.00 0.00 ? 104 LYS A CE   3  
ATOM 6549  N NZ   . LYS A 1 104 ? -19.159 5.160   -4.723  1.00 0.00 ? 104 LYS A NZ   3  
ATOM 6550  H H    . LYS A 1 104 ? -18.456 6.091   0.919   1.00 0.00 ? 104 LYS A H    3  
ATOM 6551  H HA   . LYS A 1 104 ? -19.552 8.686   0.696   1.00 0.00 ? 104 LYS A HA   3  
ATOM 6552  H HB2  . LYS A 1 104 ? -20.811 6.045   -0.082  1.00 0.00 ? 104 LYS A HB2  3  
ATOM 6553  H HB3  . LYS A 1 104 ? -21.228 7.629   -0.739  1.00 0.00 ? 104 LYS A HB3  3  
ATOM 6554  H HG2  . LYS A 1 104 ? -19.021 7.881   -1.698  1.00 0.00 ? 104 LYS A HG2  3  
ATOM 6555  H HG3  . LYS A 1 104 ? -18.464 6.406   -0.908  1.00 0.00 ? 104 LYS A HG3  3  
ATOM 6556  H HD2  . LYS A 1 104 ? -20.291 5.176   -2.160  1.00 0.00 ? 104 LYS A HD2  3  
ATOM 6557  H HD3  . LYS A 1 104 ? -20.529 6.651   -3.100  1.00 0.00 ? 104 LYS A HD3  3  
ATOM 6558  H HE2  . LYS A 1 104 ? -18.031 6.563   -3.621  1.00 0.00 ? 104 LYS A HE2  3  
ATOM 6559  H HE3  . LYS A 1 104 ? -18.044 4.934   -2.946  1.00 0.00 ? 104 LYS A HE3  3  
ATOM 6560  H HZ1  . LYS A 1 104 ? -18.627 4.307   -4.985  1.00 0.00 ? 104 LYS A HZ1  3  
ATOM 6561  H HZ2  . LYS A 1 104 ? -19.049 5.881   -5.466  1.00 0.00 ? 104 LYS A HZ2  3  
ATOM 6562  H HZ3  . LYS A 1 104 ? -20.166 4.920   -4.619  1.00 0.00 ? 104 LYS A HZ3  3  
ATOM 6563  N N    . ASP A 1 105 ? -21.344 6.677   2.608   1.00 0.00 ? 105 ASP A N    3  
ATOM 6564  C CA   . ASP A 1 105 ? -22.484 6.710   3.574   1.00 0.00 ? 105 ASP A CA   3  
ATOM 6565  C C    . ASP A 1 105 ? -22.004 6.819   5.021   1.00 0.00 ? 105 ASP A C    3  
ATOM 6566  O O    . ASP A 1 105 ? -21.066 6.174   5.431   1.00 0.00 ? 105 ASP A O    3  
ATOM 6567  C CB   . ASP A 1 105 ? -23.310 5.434   3.424   1.00 0.00 ? 105 ASP A CB   3  
ATOM 6568  C CG   . ASP A 1 105 ? -24.797 5.786   3.451   1.00 0.00 ? 105 ASP A CG   3  
ATOM 6569  O OD1  . ASP A 1 105 ? -25.138 6.789   4.054   1.00 0.00 ? 105 ASP A OD1  3  
ATOM 6570  O OD2  . ASP A 1 105 ? -25.571 5.042   2.868   1.00 0.00 ? 105 ASP A OD2  3  
ATOM 6571  H H    . ASP A 1 105 ? -20.865 5.838   2.432   1.00 0.00 ? 105 ASP A H    3  
ATOM 6572  H HA   . ASP A 1 105 ? -23.110 7.556   3.348   1.00 0.00 ? 105 ASP A HA   3  
ATOM 6573  H HB2  . ASP A 1 105 ? -23.066 4.958   2.487   1.00 0.00 ? 105 ASP A HB2  3  
ATOM 6574  H HB3  . ASP A 1 105 ? -23.085 4.763   4.238   1.00 0.00 ? 105 ASP A HB3  3  
ATOM 6575  H HD2  . ASP A 1 105 ? -26.487 5.323   2.927   1.00 0.00 ? 105 ASP A HD2  3  
ATOM 6576  N N    . TYR A 1 106 ? -22.685 7.618   5.799   1.00 0.00 ? 106 TYR A N    3  
ATOM 6577  C CA   . TYR A 1 106 ? -22.327 7.764   7.238   1.00 0.00 ? 106 TYR A CA   3  
ATOM 6578  C C    . TYR A 1 106 ? -22.598 6.434   7.939   1.00 0.00 ? 106 TYR A C    3  
ATOM 6579  O O    . TYR A 1 106 ? -21.829 5.977   8.762   1.00 0.00 ? 106 TYR A O    3  
ATOM 6580  C CB   . TYR A 1 106 ? -23.188 8.869   7.865   1.00 0.00 ? 106 TYR A CB   3  
ATOM 6581  C CG   . TYR A 1 106 ? -23.104 8.804   9.375   1.00 0.00 ? 106 TYR A CG   3  
ATOM 6582  C CD1  . TYR A 1 106 ? -21.860 8.684   10.010  1.00 0.00 ? 106 TYR A CD1  3  
ATOM 6583  C CD2  . TYR A 1 106 ? -24.275 8.866   10.140  1.00 0.00 ? 106 TYR A CD2  3  
ATOM 6584  C CE1  . TYR A 1 106 ? -21.791 8.627   11.408  1.00 0.00 ? 106 TYR A CE1  3  
ATOM 6585  C CE2  . TYR A 1 106 ? -24.205 8.809   11.538  1.00 0.00 ? 106 TYR A CE2  3  
ATOM 6586  C CZ   . TYR A 1 106 ? -22.963 8.688   12.171  1.00 0.00 ? 106 TYR A CZ   3  
ATOM 6587  O OH   . TYR A 1 106 ? -22.894 8.633   13.548  1.00 0.00 ? 106 TYR A OH   3  
ATOM 6588  H H    . TYR A 1 106 ? -23.456 8.102   5.437   1.00 0.00 ? 106 TYR A H    3  
ATOM 6589  H HA   . TYR A 1 106 ? -21.281 8.016   7.330   1.00 0.00 ? 106 TYR A HA   3  
ATOM 6590  H HB2  . TYR A 1 106 ? -22.833 9.830   7.529   1.00 0.00 ? 106 TYR A HB2  3  
ATOM 6591  H HB3  . TYR A 1 106 ? -24.214 8.738   7.559   1.00 0.00 ? 106 TYR A HB3  3  
ATOM 6592  H HD1  . TYR A 1 106 ? -20.954 8.636   9.425   1.00 0.00 ? 106 TYR A HD1  3  
ATOM 6593  H HD2  . TYR A 1 106 ? -25.234 8.958   9.652   1.00 0.00 ? 106 TYR A HD2  3  
ATOM 6594  H HE1  . TYR A 1 106 ? -20.832 8.533   11.899  1.00 0.00 ? 106 TYR A HE1  3  
ATOM 6595  H HE2  . TYR A 1 106 ? -25.108 8.858   12.127  1.00 0.00 ? 106 TYR A HE2  3  
ATOM 6596  H HH   . TYR A 1 106 ? -22.183 9.213   13.834  1.00 0.00 ? 106 TYR A HH   3  
ATOM 6597  N N    . ASP A 1 107 ? -23.689 5.806   7.598   1.00 0.00 ? 107 ASP A N    3  
ATOM 6598  C CA   . ASP A 1 107 ? -24.032 4.494   8.211   1.00 0.00 ? 107 ASP A CA   3  
ATOM 6599  C C    . ASP A 1 107 ? -23.551 3.384   7.279   1.00 0.00 ? 107 ASP A C    3  
ATOM 6600  O O    . ASP A 1 107 ? -23.993 2.255   7.358   1.00 0.00 ? 107 ASP A O    3  
ATOM 6601  C CB   . ASP A 1 107 ? -25.547 4.393   8.393   1.00 0.00 ? 107 ASP A CB   3  
ATOM 6602  C CG   . ASP A 1 107 ? -26.013 5.424   9.422   1.00 0.00 ? 107 ASP A CG   3  
ATOM 6603  O OD1  . ASP A 1 107 ? -25.168 5.963   10.118  1.00 0.00 ? 107 ASP A OD1  3  
ATOM 6604  O OD2  . ASP A 1 107 ? -27.208 5.659   9.496   1.00 0.00 ? 107 ASP A OD2  3  
ATOM 6605  H H    . ASP A 1 107 ? -24.282 6.196   6.923   1.00 0.00 ? 107 ASP A H    3  
ATOM 6606  H HA   . ASP A 1 107 ? -23.543 4.401   9.171   1.00 0.00 ? 107 ASP A HA   3  
ATOM 6607  H HB2  . ASP A 1 107 ? -26.034 4.582   7.447   1.00 0.00 ? 107 ASP A HB2  3  
ATOM 6608  H HB3  . ASP A 1 107 ? -25.803 3.403   8.737   1.00 0.00 ? 107 ASP A HB3  3  
ATOM 6609  H HD2  . ASP A 1 107 ? -27.427 6.315   10.162  1.00 0.00 ? 107 ASP A HD2  3  
ATOM 6610  N N    . VAL A 1 108 ? -22.649 3.704   6.392   1.00 0.00 ? 108 VAL A N    3  
ATOM 6611  C CA   . VAL A 1 108 ? -22.131 2.681   5.442   1.00 0.00 ? 108 VAL A CA   3  
ATOM 6612  C C    . VAL A 1 108 ? -21.957 1.356   6.182   1.00 0.00 ? 108 VAL A C    3  
ATOM 6613  O O    . VAL A 1 108 ? -21.675 1.321   7.364   1.00 0.00 ? 108 VAL A O    3  
ATOM 6614  C CB   . VAL A 1 108 ? -20.793 3.167   4.883   1.00 0.00 ? 108 VAL A CB   3  
ATOM 6615  C CG1  . VAL A 1 108 ? -19.879 3.558   6.039   1.00 0.00 ? 108 VAL A CG1  3  
ATOM 6616  C CG2  . VAL A 1 108 ? -20.128 2.064   4.062   1.00 0.00 ? 108 VAL A CG2  3  
ATOM 6617  H H    . VAL A 1 108 ? -22.312 4.622   6.349   1.00 0.00 ? 108 VAL A H    3  
ATOM 6618  H HA   . VAL A 1 108 ? -22.836 2.553   4.635   1.00 0.00 ? 108 VAL A HA   3  
ATOM 6619  H HB   . VAL A 1 108 ? -20.961 4.032   4.256   1.00 0.00 ? 108 VAL A HB   3  
ATOM 6620  H HG11 . VAL A 1 108 ? -20.233 4.478   6.482   1.00 0.00 ? 108 VAL A HG11 3  
ATOM 6621  H HG12 . VAL A 1 108 ? -18.874 3.701   5.671   1.00 0.00 ? 108 VAL A HG12 3  
ATOM 6622  H HG13 . VAL A 1 108 ? -19.884 2.775   6.782   1.00 0.00 ? 108 VAL A HG13 3  
ATOM 6623  H HG21 . VAL A 1 108 ? -19.147 2.395   3.752   1.00 0.00 ? 108 VAL A HG21 3  
ATOM 6624  H HG22 . VAL A 1 108 ? -20.729 1.851   3.189   1.00 0.00 ? 108 VAL A HG22 3  
ATOM 6625  H HG23 . VAL A 1 108 ? -20.032 1.171   4.662   1.00 0.00 ? 108 VAL A HG23 3  
ATOM 6626  N N    . GLU A 1 109 ? -22.149 0.262   5.501   1.00 0.00 ? 109 GLU A N    3  
ATOM 6627  C CA   . GLU A 1 109 ? -22.025 -1.061  6.164   1.00 0.00 ? 109 GLU A CA   3  
ATOM 6628  C C    . GLU A 1 109 ? -20.607 -1.275  6.678   1.00 0.00 ? 109 GLU A C    3  
ATOM 6629  O O    . GLU A 1 109 ? -19.632 -0.862  6.079   1.00 0.00 ? 109 GLU A O    3  
ATOM 6630  C CB   . GLU A 1 109 ? -22.391 -2.171  5.178   1.00 0.00 ? 109 GLU A CB   3  
ATOM 6631  C CG   . GLU A 1 109 ? -21.131 -2.923  4.738   1.00 0.00 ? 109 GLU A CG   3  
ATOM 6632  C CD   . GLU A 1 109 ? -21.462 -3.804  3.533   1.00 0.00 ? 109 GLU A CD   3  
ATOM 6633  O OE1  . GLU A 1 109 ? -22.620 -3.838  3.150   1.00 0.00 ? 109 GLU A OE1  3  
ATOM 6634  O OE2  . GLU A 1 109 ? -20.552 -4.429  3.012   1.00 0.00 ? 109 GLU A OE2  3  
ATOM 6635  H H    . GLU A 1 109 ? -22.392 0.311   4.560   1.00 0.00 ? 109 GLU A H    3  
ATOM 6636  H HA   . GLU A 1 109 ? -22.709 -1.098  7.000   1.00 0.00 ? 109 GLU A HA   3  
ATOM 6637  H HB2  . GLU A 1 109 ? -23.064 -2.862  5.663   1.00 0.00 ? 109 GLU A HB2  3  
ATOM 6638  H HB3  . GLU A 1 109 ? -22.874 -1.742  4.313   1.00 0.00 ? 109 GLU A HB3  3  
ATOM 6639  H HG2  . GLU A 1 109 ? -20.363 -2.214  4.469   1.00 0.00 ? 109 GLU A HG2  3  
ATOM 6640  H HG3  . GLU A 1 109 ? -20.779 -3.546  5.548   1.00 0.00 ? 109 GLU A HG3  3  
ATOM 6641  H HE2  . GLU A 1 109 ? -20.832 -4.959  2.262   1.00 0.00 ? 109 GLU A HE2  3  
ATOM 6642  N N    . ILE A 1 110 ? -20.505 -1.938  7.782   1.00 0.00 ? 110 ILE A N    3  
ATOM 6643  C CA   . ILE A 1 110 ? -19.177 -2.237  8.381   1.00 0.00 ? 110 ILE A CA   3  
ATOM 6644  C C    . ILE A 1 110 ? -19.054 -3.744  8.593   1.00 0.00 ? 110 ILE A C    3  
ATOM 6645  O O    . ILE A 1 110 ? -19.597 -4.296  9.530   1.00 0.00 ? 110 ILE A O    3  
ATOM 6646  C CB   . ILE A 1 110 ? -19.032 -1.511  9.717   1.00 0.00 ? 110 ILE A CB   3  
ATOM 6647  C CG1  . ILE A 1 110 ? -18.947 -0.001  9.471   1.00 0.00 ? 110 ILE A CG1  3  
ATOM 6648  C CG2  . ILE A 1 110 ? -17.763 -1.995  10.422  1.00 0.00 ? 110 ILE A CG2  3  
ATOM 6649  C CD1  . ILE A 1 110 ? -17.733 0.315   8.592   1.00 0.00 ? 110 ILE A CD1  3  
ATOM 6650  H H    . ILE A 1 110 ? -21.319 -2.263  8.213   1.00 0.00 ? 110 ILE A H    3  
ATOM 6651  H HA   . ILE A 1 110 ? -18.399 -1.908  7.709   1.00 0.00 ? 110 ILE A HA   3  
ATOM 6652  H HB   . ILE A 1 110 ? -19.890 -1.726  10.337  1.00 0.00 ? 110 ILE A HB   3  
ATOM 6653  H HG12 . ILE A 1 110 ? -19.845 0.333   8.972   1.00 0.00 ? 110 ILE A HG12 3  
ATOM 6654  H HG13 . ILE A 1 110 ? -18.848 0.513   10.413  1.00 0.00 ? 110 ILE A HG13 3  
ATOM 6655  H HG21 . ILE A 1 110 ? -17.085 -2.414  9.694   1.00 0.00 ? 110 ILE A HG21 3  
ATOM 6656  H HG22 . ILE A 1 110 ? -18.023 -2.750  11.149  1.00 0.00 ? 110 ILE A HG22 3  
ATOM 6657  H HG23 . ILE A 1 110 ? -17.288 -1.164  10.920  1.00 0.00 ? 110 ILE A HG23 3  
ATOM 6658  H HD11 . ILE A 1 110 ? -17.328 1.277   8.869   1.00 0.00 ? 110 ILE A HD11 3  
ATOM 6659  H HD12 . ILE A 1 110 ? -18.035 0.337   7.555   1.00 0.00 ? 110 ILE A HD12 3  
ATOM 6660  H HD13 . ILE A 1 110 ? -16.977 -0.444  8.730   1.00 0.00 ? 110 ILE A HD13 3  
ATOM 6661  N N    . ARG A 1 111 ? -18.340 -4.419  7.735   1.00 0.00 ? 111 ARG A N    3  
ATOM 6662  C CA   . ARG A 1 111 ? -18.181 -5.891  7.893   1.00 0.00 ? 111 ARG A CA   3  
ATOM 6663  C C    . ARG A 1 111 ? -16.806 -6.160  8.494   1.00 0.00 ? 111 ARG A C    3  
ATOM 6664  O O    . ARG A 1 111 ? -15.791 -5.848  7.907   1.00 0.00 ? 111 ARG A O    3  
ATOM 6665  C CB   . ARG A 1 111 ? -18.265 -6.582  6.526   1.00 0.00 ? 111 ARG A CB   3  
ATOM 6666  C CG   . ARG A 1 111 ? -19.724 -6.784  6.056   1.00 0.00 ? 111 ARG A CG   3  
ATOM 6667  C CD   . ARG A 1 111 ? -20.724 -6.017  6.928   1.00 0.00 ? 111 ARG A CD   3  
ATOM 6668  N NE   . ARG A 1 111 ? -22.024 -5.922  6.210   1.00 0.00 ? 111 ARG A NE   3  
ATOM 6669  C CZ   . ARG A 1 111 ? -23.122 -5.679  6.874   1.00 0.00 ? 111 ARG A CZ   3  
ATOM 6670  N NH1  . ARG A 1 111 ? -23.082 -5.536  8.170   1.00 0.00 ? 111 ARG A NH1  3  
ATOM 6671  N NH2  . ARG A 1 111 ? -24.261 -5.580  6.240   1.00 0.00 ? 111 ARG A NH2  3  
ATOM 6672  H H    . ARG A 1 111 ? -17.905 -3.955  6.988   1.00 0.00 ? 111 ARG A H    3  
ATOM 6673  H HA   . ARG A 1 111 ? -18.943 -6.275  8.552   1.00 0.00 ? 111 ARG A HA   3  
ATOM 6674  H HB2  . ARG A 1 111 ? -17.744 -5.983  5.797   1.00 0.00 ? 111 ARG A HB2  3  
ATOM 6675  H HB3  . ARG A 1 111 ? -17.784 -7.545  6.589   1.00 0.00 ? 111 ARG A HB3  3  
ATOM 6676  H HG2  . ARG A 1 111 ? -19.814 -6.440  5.038   1.00 0.00 ? 111 ARG A HG2  3  
ATOM 6677  H HG3  . ARG A 1 111 ? -19.959 -7.834  6.092   1.00 0.00 ? 111 ARG A HG3  3  
ATOM 6678  H HD2  . ARG A 1 111 ? -20.870 -6.540  7.861   1.00 0.00 ? 111 ARG A HD2  3  
ATOM 6679  H HD3  . ARG A 1 111 ? -20.354 -5.026  7.123   1.00 0.00 ? 111 ARG A HD3  3  
ATOM 6680  H HE   . ARG A 1 111 ? -22.056 -6.037  5.237   1.00 0.00 ? 111 ARG A HE   3  
ATOM 6681  H HH11 . ARG A 1 111 ? -22.211 -5.613  8.654   1.00 0.00 ? 111 ARG A HH11 3  
ATOM 6682  H HH12 . ARG A 1 111 ? -23.923 -5.349  8.679   1.00 0.00 ? 111 ARG A HH12 3  
ATOM 6683  H HH21 . ARG A 1 111 ? -24.293 -5.692  5.248   1.00 0.00 ? 111 ARG A HH21 3  
ATOM 6684  H HH22 . ARG A 1 111 ? -25.101 -5.393  6.750   1.00 0.00 ? 111 ARG A HH22 3  
ATOM 6685  N N    . LEU A 1 112 ? -16.765 -6.729  9.662   1.00 0.00 ? 112 LEU A N    3  
ATOM 6686  C CA   . LEU A 1 112 ? -15.451 -7.003  10.300  1.00 0.00 ? 112 LEU A CA   3  
ATOM 6687  C C    . LEU A 1 112 ? -15.087 -8.478  10.112  1.00 0.00 ? 112 LEU A C    3  
ATOM 6688  O O    . LEU A 1 112 ? -15.922 -9.353  10.232  1.00 0.00 ? 112 LEU A O    3  
ATOM 6689  C CB   . LEU A 1 112 ? -15.537 -6.690  11.793  1.00 0.00 ? 112 LEU A CB   3  
ATOM 6690  C CG   . LEU A 1 112 ? -16.165 -5.309  12.003  1.00 0.00 ? 112 LEU A CG   3  
ATOM 6691  C CD1  . LEU A 1 112 ? -15.933 -4.867  13.446  1.00 0.00 ? 112 LEU A CD1  3  
ATOM 6692  C CD2  . LEU A 1 112 ? -15.536 -4.289  11.048  1.00 0.00 ? 112 LEU A CD2  3  
ATOM 6693  H H    . LEU A 1 112 ? -17.594 -6.968  10.124  1.00 0.00 ? 112 LEU A H    3  
ATOM 6694  H HA   . LEU A 1 112 ? -14.692 -6.386  9.843   1.00 0.00 ? 112 LEU A HA   3  
ATOM 6695  H HB2  . LEU A 1 112 ? -16.145 -7.438  12.280  1.00 0.00 ? 112 LEU A HB2  3  
ATOM 6696  H HB3  . LEU A 1 112 ? -14.548 -6.700  12.217  1.00 0.00 ? 112 LEU A HB3  3  
ATOM 6697  H HG   . LEU A 1 112 ? -17.228 -5.370  11.815  1.00 0.00 ? 112 LEU A HG   3  
ATOM 6698  H HD11 . LEU A 1 112 ? -15.446 -3.904  13.455  1.00 0.00 ? 112 LEU A HD11 3  
ATOM 6699  H HD12 . LEU A 1 112 ? -15.307 -5.591  13.950  1.00 0.00 ? 112 LEU A HD12 3  
ATOM 6700  H HD13 . LEU A 1 112 ? -16.881 -4.795  13.958  1.00 0.00 ? 112 LEU A HD13 3  
ATOM 6701  H HD21 . LEU A 1 112 ? -15.727 -3.290  11.413  1.00 0.00 ? 112 LEU A HD21 3  
ATOM 6702  H HD22 . LEU A 1 112 ? -15.969 -4.399  10.065  1.00 0.00 ? 112 LEU A HD22 3  
ATOM 6703  H HD23 . LEU A 1 112 ? -14.470 -4.454  10.993  1.00 0.00 ? 112 LEU A HD23 3  
ATOM 6704  N N    . SER A 1 113 ? -13.847 -8.759  9.828   1.00 0.00 ? 113 SER A N    3  
ATOM 6705  C CA   . SER A 1 113 ? -13.427 -10.175 9.642   1.00 0.00 ? 113 SER A CA   3  
ATOM 6706  C C    . SER A 1 113 ? -13.146 -10.798 11.010  1.00 0.00 ? 113 SER A C    3  
ATOM 6707  O O    . SER A 1 113 ? -13.157 -10.123 12.022  1.00 0.00 ? 113 SER A O    3  
ATOM 6708  C CB   . SER A 1 113 ? -12.156 -10.225 8.791   1.00 0.00 ? 113 SER A CB   3  
ATOM 6709  O OG   . SER A 1 113 ? -11.867 -11.576 8.458   1.00 0.00 ? 113 SER A OG   3  
ATOM 6710  H H    . SER A 1 113 ? -13.190 -8.038  9.742   1.00 0.00 ? 113 SER A H    3  
ATOM 6711  H HA   . SER A 1 113 ? -14.214 -10.725 9.148   1.00 0.00 ? 113 SER A HA   3  
ATOM 6712  H HB2  . SER A 1 113 ? -12.302 -9.661  7.886   1.00 0.00 ? 113 SER A HB2  3  
ATOM 6713  H HB3  . SER A 1 113 ? -11.334 -9.799  9.352   1.00 0.00 ? 113 SER A HB3  3  
ATOM 6714  H HG   . SER A 1 113 ? -12.695 -12.016 8.251   1.00 0.00 ? 113 SER A HG   3  
ATOM 6715  N N    . HIS A 1 114 ? -12.892 -12.075 11.055  1.00 0.00 ? 114 HIS A N    3  
ATOM 6716  C CA   . HIS A 1 114 ? -12.610 -12.731 12.362  1.00 0.00 ? 114 HIS A CA   3  
ATOM 6717  C C    . HIS A 1 114 ? -11.521 -11.941 13.093  1.00 0.00 ? 114 HIS A C    3  
ATOM 6718  O O    . HIS A 1 114 ? -11.543 -11.804 14.300  1.00 0.00 ? 114 HIS A O    3  
ATOM 6719  C CB   . HIS A 1 114 ? -12.133 -14.167 12.118  1.00 0.00 ? 114 HIS A CB   3  
ATOM 6720  C CG   . HIS A 1 114 ? -11.828 -14.831 13.435  1.00 0.00 ? 114 HIS A CG   3  
ATOM 6721  N ND1  . HIS A 1 114 ? -12.815 -15.113 14.368  1.00 0.00 ? 114 HIS A ND1  3  
ATOM 6722  C CD2  . HIS A 1 114 ? -10.650 -15.269 13.987  1.00 0.00 ? 114 HIS A CD2  3  
ATOM 6723  C CE1  . HIS A 1 114 ? -12.217 -15.693 15.426  1.00 0.00 ? 114 HIS A CE1  3  
ATOM 6724  N NE2  . HIS A 1 114 ? -10.900 -15.811 15.241  1.00 0.00 ? 114 HIS A NE2  3  
ATOM 6725  H H    . HIS A 1 114 ? -12.886 -12.604 10.229  1.00 0.00 ? 114 HIS A H    3  
ATOM 6726  H HA   . HIS A 1 114 ? -13.509 -12.746 12.961  1.00 0.00 ? 114 HIS A HA   3  
ATOM 6727  H HB2  . HIS A 1 114 ? -12.906 -14.720 11.608  1.00 0.00 ? 114 HIS A HB2  3  
ATOM 6728  H HB3  . HIS A 1 114 ? -11.241 -14.150 11.508  1.00 0.00 ? 114 HIS A HB3  3  
ATOM 6729  H HD1  . HIS A 1 114 ? -13.773 -14.927 14.275  1.00 0.00 ? 114 HIS A HD1  3  
ATOM 6730  H HD2  . HIS A 1 114 ? -9.680  -15.206 13.516  1.00 0.00 ? 114 HIS A HD2  3  
ATOM 6731  H HE1  . HIS A 1 114 ? -12.736 -16.022 16.314  1.00 0.00 ? 114 HIS A HE1  3  
ATOM 6732  H HE2  . HIS A 1 114 ? -10.247 -16.193 15.861  1.00 0.00 ? 114 HIS A HE2  3  
ATOM 6733  N N    . GLU A 1 115 ? -10.568 -11.420 12.370  1.00 0.00 ? 115 GLU A N    3  
ATOM 6734  C CA   . GLU A 1 115 ? -9.477  -10.638 13.016  1.00 0.00 ? 115 GLU A CA   3  
ATOM 6735  C C    . GLU A 1 115 ? -10.061 -9.399  13.702  1.00 0.00 ? 115 GLU A C    3  
ATOM 6736  O O    . GLU A 1 115 ? -9.573  -8.957  14.724  1.00 0.00 ? 115 GLU A O    3  
ATOM 6737  C CB   . GLU A 1 115 ? -8.471  -10.199 11.950  1.00 0.00 ? 115 GLU A CB   3  
ATOM 6738  C CG   . GLU A 1 115 ? -7.798  -11.434 11.350  1.00 0.00 ? 115 GLU A CG   3  
ATOM 6739  C CD   . GLU A 1 115 ? -6.759  -10.998 10.315  1.00 0.00 ? 115 GLU A CD   3  
ATOM 6740  O OE1  . GLU A 1 115 ? -6.757  -9.830  9.965   1.00 0.00 ? 115 GLU A OE1  3  
ATOM 6741  O OE2  . GLU A 1 115 ? -5.985  -11.840 9.892   1.00 0.00 ? 115 GLU A OE2  3  
ATOM 6742  H H    . GLU A 1 115 ? -10.572 -11.542 11.396  1.00 0.00 ? 115 GLU A H    3  
ATOM 6743  H HA   . GLU A 1 115 ? -8.979  -11.252 13.750  1.00 0.00 ? 115 GLU A HA   3  
ATOM 6744  H HB2  . GLU A 1 115 ? -8.984  -9.654  11.171  1.00 0.00 ? 115 GLU A HB2  3  
ATOM 6745  H HB3  . GLU A 1 115 ? -7.721  -9.565  12.400  1.00 0.00 ? 115 GLU A HB3  3  
ATOM 6746  H HG2  . GLU A 1 115 ? -7.310  -11.996 12.136  1.00 0.00 ? 115 GLU A HG2  3  
ATOM 6747  H HG3  . GLU A 1 115 ? -8.541  -12.054 10.874  1.00 0.00 ? 115 GLU A HG3  3  
ATOM 6748  H HE2  . GLU A 1 115 ? -5.363  -11.496 9.247   1.00 0.00 ? 115 GLU A HE2  3  
ATOM 6749  N N    . HIS A 1 116 ? -11.103 -8.835  13.152  1.00 0.00 ? 116 HIS A N    3  
ATOM 6750  C CA   . HIS A 1 116 ? -11.715 -7.625  13.775  1.00 0.00 ? 116 HIS A CA   3  
ATOM 6751  C C    . HIS A 1 116 ? -13.088 -7.996  14.344  1.00 0.00 ? 116 HIS A C    3  
ATOM 6752  O O    . HIS A 1 116 ? -13.828 -8.755  13.751  1.00 0.00 ? 116 HIS A O    3  
ATOM 6753  C CB   . HIS A 1 116 ? -11.873 -6.533  12.717  1.00 0.00 ? 116 HIS A CB   3  
ATOM 6754  C CG   . HIS A 1 116 ? -10.514 -6.075  12.258  1.00 0.00 ? 116 HIS A CG   3  
ATOM 6755  N ND1  . HIS A 1 116 ? -9.961  -6.491  11.054  1.00 0.00 ? 116 HIS A ND1  3  
ATOM 6756  C CD2  . HIS A 1 116 ? -9.588  -5.235  12.825  1.00 0.00 ? 116 HIS A CD2  3  
ATOM 6757  C CE1  . HIS A 1 116 ? -8.756  -5.907  10.938  1.00 0.00 ? 116 HIS A CE1  3  
ATOM 6758  N NE2  . HIS A 1 116 ? -8.482  -5.133  11.990  1.00 0.00 ? 116 HIS A NE2  3  
ATOM 6759  H H    . HIS A 1 116 ? -11.484 -9.204  12.330  1.00 0.00 ? 116 HIS A H    3  
ATOM 6760  H HA   . HIS A 1 116 ? -11.078 -7.270  14.571  1.00 0.00 ? 116 HIS A HA   3  
ATOM 6761  H HB2  . HIS A 1 116 ? -12.419 -6.925  11.873  1.00 0.00 ? 116 HIS A HB2  3  
ATOM 6762  H HB3  . HIS A 1 116 ? -12.409 -5.696  13.138  1.00 0.00 ? 116 HIS A HB3  3  
ATOM 6763  H HD1  . HIS A 1 116 ? -10.375 -7.102  10.409  1.00 0.00 ? 116 HIS A HD1  3  
ATOM 6764  H HD2  . HIS A 1 116 ? -9.701  -4.733  13.775  1.00 0.00 ? 116 HIS A HD2  3  
ATOM 6765  H HE1  . HIS A 1 116 ? -8.091  -6.047  10.097  1.00 0.00 ? 116 HIS A HE1  3  
ATOM 6766  H HE2  . HIS A 1 116 ? -7.671  -4.603  12.141  1.00 0.00 ? 116 HIS A HE2  3  
ATOM 6767  N N    . GLN A 1 117 ? -13.429 -7.480  15.497  1.00 0.00 ? 117 GLN A N    3  
ATOM 6768  C CA   . GLN A 1 117 ? -14.749 -7.824  16.100  1.00 0.00 ? 117 GLN A CA   3  
ATOM 6769  C C    . GLN A 1 117 ? -15.573 -6.556  16.349  1.00 0.00 ? 117 GLN A C    3  
ATOM 6770  O O    . GLN A 1 117 ? -16.783 -6.609  16.456  1.00 0.00 ? 117 GLN A O    3  
ATOM 6771  C CB   . GLN A 1 117 ? -14.524 -8.554  17.426  1.00 0.00 ? 117 GLN A CB   3  
ATOM 6772  C CG   . GLN A 1 117 ? -13.782 -7.635  18.400  1.00 0.00 ? 117 GLN A CG   3  
ATOM 6773  C CD   . GLN A 1 117 ? -13.567 -8.366  19.726  1.00 0.00 ? 117 GLN A CD   3  
ATOM 6774  O OE1  . GLN A 1 117 ? -14.027 -9.478  19.904  1.00 0.00 ? 117 GLN A OE1  3  
ATOM 6775  N NE2  . GLN A 1 117 ? -12.881 -7.785  20.671  1.00 0.00 ? 117 GLN A NE2  3  
ATOM 6776  H H    . GLN A 1 117 ? -12.815 -6.877  15.967  1.00 0.00 ? 117 GLN A H    3  
ATOM 6777  H HA   . GLN A 1 117 ? -15.290 -8.471  15.426  1.00 0.00 ? 117 GLN A HA   3  
ATOM 6778  H HB2  . GLN A 1 117 ? -15.478 -8.834  17.848  1.00 0.00 ? 117 GLN A HB2  3  
ATOM 6779  H HB3  . GLN A 1 117 ? -13.934 -9.442  17.251  1.00 0.00 ? 117 GLN A HB3  3  
ATOM 6780  H HG2  . GLN A 1 117 ? -12.826 -7.361  17.978  1.00 0.00 ? 117 GLN A HG2  3  
ATOM 6781  H HG3  . GLN A 1 117 ? -14.369 -6.746  18.571  1.00 0.00 ? 117 GLN A HG3  3  
ATOM 6782  H HE21 . GLN A 1 117 ? -12.509 -6.889  20.529  1.00 0.00 ? 117 GLN A HE21 3  
ATOM 6783  H HE22 . GLN A 1 117 ? -12.737 -8.244  21.526  1.00 0.00 ? 117 GLN A HE22 3  
ATOM 6784  N N    . ALA A 1 118 ? -14.942 -5.417  16.456  1.00 0.00 ? 118 ALA A N    3  
ATOM 6785  C CA   . ALA A 1 118 ? -15.722 -4.171  16.710  1.00 0.00 ? 118 ALA A CA   3  
ATOM 6786  C C    . ALA A 1 118 ? -15.024 -2.965  16.077  1.00 0.00 ? 118 ALA A C    3  
ATOM 6787  O O    . ALA A 1 118 ? -13.821 -2.950  15.899  1.00 0.00 ? 118 ALA A O    3  
ATOM 6788  C CB   . ALA A 1 118 ? -15.844 -3.949  18.218  1.00 0.00 ? 118 ALA A CB   3  
ATOM 6789  H H    . ALA A 1 118 ? -13.966 -5.383  16.377  1.00 0.00 ? 118 ALA A H    3  
ATOM 6790  H HA   . ALA A 1 118 ? -16.708 -4.275  16.285  1.00 0.00 ? 118 ALA A HA   3  
ATOM 6791  H HB1  . ALA A 1 118 ? -14.888 -4.126  18.687  1.00 0.00 ? 118 ALA A HB1  3  
ATOM 6792  H HB2  . ALA A 1 118 ? -16.578 -4.628  18.625  1.00 0.00 ? 118 ALA A HB2  3  
ATOM 6793  H HB3  . ALA A 1 118 ? -16.152 -2.930  18.408  1.00 0.00 ? 118 ALA A HB3  3  
ATOM 6794  N N    . TYR A 1 119 ? -15.776 -1.950  15.746  1.00 0.00 ? 119 TYR A N    3  
ATOM 6795  C CA   . TYR A 1 119 ? -15.177 -0.731  15.134  1.00 0.00 ? 119 TYR A CA   3  
ATOM 6796  C C    . TYR A 1 119 ? -15.840 0.513   15.733  1.00 0.00 ? 119 TYR A C    3  
ATOM 6797  O O    . TYR A 1 119 ? -16.938 0.451   16.251  1.00 0.00 ? 119 TYR A O    3  
ATOM 6798  C CB   . TYR A 1 119 ? -15.419 -0.751  13.627  1.00 0.00 ? 119 TYR A CB   3  
ATOM 6799  C CG   . TYR A 1 119 ? -16.884 -0.524  13.356  1.00 0.00 ? 119 TYR A CG   3  
ATOM 6800  C CD1  . TYR A 1 119 ? -17.771 -1.605  13.379  1.00 0.00 ? 119 TYR A CD1  3  
ATOM 6801  C CD2  . TYR A 1 119 ? -17.356 0.765   13.087  1.00 0.00 ? 119 TYR A CD2  3  
ATOM 6802  C CE1  . TYR A 1 119 ? -19.132 -1.399  13.132  1.00 0.00 ? 119 TYR A CE1  3  
ATOM 6803  C CE2  . TYR A 1 119 ? -18.717 0.973   12.839  1.00 0.00 ? 119 TYR A CE2  3  
ATOM 6804  C CZ   . TYR A 1 119 ? -19.605 -0.110  12.862  1.00 0.00 ? 119 TYR A CZ   3  
ATOM 6805  O OH   . TYR A 1 119 ? -20.948 0.094   12.621  1.00 0.00 ? 119 TYR A OH   3  
ATOM 6806  H H    . TYR A 1 119 ? -16.742 -1.987  15.908  1.00 0.00 ? 119 TYR A H    3  
ATOM 6807  H HA   . TYR A 1 119 ? -14.118 -0.710  15.331  1.00 0.00 ? 119 TYR A HA   3  
ATOM 6808  H HB2  . TYR A 1 119 ? -14.842 0.034   13.158  1.00 0.00 ? 119 TYR A HB2  3  
ATOM 6809  H HB3  . TYR A 1 119 ? -15.123 -1.706  13.225  1.00 0.00 ? 119 TYR A HB3  3  
ATOM 6810  H HD1  . TYR A 1 119 ? -17.404 -2.599  13.585  1.00 0.00 ? 119 TYR A HD1  3  
ATOM 6811  H HD2  . TYR A 1 119 ? -16.669 1.598   13.069  1.00 0.00 ? 119 TYR A HD2  3  
ATOM 6812  H HE1  . TYR A 1 119 ? -19.815 -2.235  13.148  1.00 0.00 ? 119 TYR A HE1  3  
ATOM 6813  H HE2  . TYR A 1 119 ? -19.083 1.966   12.630  1.00 0.00 ? 119 TYR A HE2  3  
ATOM 6814  H HH   . TYR A 1 119 ? -21.300 0.635   13.331  1.00 0.00 ? 119 TYR A HH   3  
ATOM 6815  N N    . ARG A 1 120 ? -15.191 1.641   15.660  1.00 0.00 ? 120 ARG A N    3  
ATOM 6816  C CA   . ARG A 1 120 ? -15.799 2.882   16.221  1.00 0.00 ? 120 ARG A CA   3  
ATOM 6817  C C    . ARG A 1 120 ? -15.493 4.068   15.309  1.00 0.00 ? 120 ARG A C    3  
ATOM 6818  O O    . ARG A 1 120 ? -14.457 4.133   14.677  1.00 0.00 ? 120 ARG A O    3  
ATOM 6819  C CB   . ARG A 1 120 ? -15.215 3.177   17.603  1.00 0.00 ? 120 ARG A CB   3  
ATOM 6820  C CG   . ARG A 1 120 ? -15.614 2.081   18.589  1.00 0.00 ? 120 ARG A CG   3  
ATOM 6821  C CD   . ARG A 1 120 ? -15.118 2.461   19.986  1.00 0.00 ? 120 ARG A CD   3  
ATOM 6822  N NE   . ARG A 1 120 ? -15.252 1.294   20.903  1.00 0.00 ? 120 ARG A NE   3  
ATOM 6823  C CZ   . ARG A 1 120 ? -14.717 1.337   22.090  1.00 0.00 ? 120 ARG A CZ   3  
ATOM 6824  N NH1  . ARG A 1 120 ? -14.069 2.402   22.475  1.00 0.00 ? 120 ARG A NH1  3  
ATOM 6825  N NH2  . ARG A 1 120 ? -14.828 0.316   22.894  1.00 0.00 ? 120 ARG A NH2  3  
ATOM 6826  H H    . ARG A 1 120 ? -14.309 1.676   15.235  1.00 0.00 ? 120 ARG A H    3  
ATOM 6827  H HA   . ARG A 1 120 ? -16.868 2.755   16.303  1.00 0.00 ? 120 ARG A HA   3  
ATOM 6828  H HB2  . ARG A 1 120 ? -14.140 3.223   17.533  1.00 0.00 ? 120 ARG A HB2  3  
ATOM 6829  H HB3  . ARG A 1 120 ? -15.590 4.126   17.954  1.00 0.00 ? 120 ARG A HB3  3  
ATOM 6830  H HG2  . ARG A 1 120 ? -16.690 1.981   18.602  1.00 0.00 ? 120 ARG A HG2  3  
ATOM 6831  H HG3  . ARG A 1 120 ? -15.169 1.147   18.293  1.00 0.00 ? 120 ARG A HG3  3  
ATOM 6832  H HD2  . ARG A 1 120 ? -14.082 2.757   19.932  1.00 0.00 ? 120 ARG A HD2  3  
ATOM 6833  H HD3  . ARG A 1 120 ? -15.709 3.284   20.366  1.00 0.00 ? 120 ARG A HD3  3  
ATOM 6834  H HE   . ARG A 1 120 ? -15.740 0.494   20.612  1.00 0.00 ? 120 ARG A HE   3  
ATOM 6835  H HH11 . ARG A 1 120 ? -13.985 3.185   21.858  1.00 0.00 ? 120 ARG A HH11 3  
ATOM 6836  H HH12 . ARG A 1 120 ? -13.659 2.438   23.386  1.00 0.00 ? 120 ARG A HH12 3  
ATOM 6837  H HH21 . ARG A 1 120 ? -15.325 -0.501  22.599  1.00 0.00 ? 120 ARG A HH21 3  
ATOM 6838  H HH22 . ARG A 1 120 ? -14.419 0.349   23.805  1.00 0.00 ? 120 ARG A HH22 3  
ATOM 6839  N N    . TRP A 1 121 ? -16.376 5.027   15.266  1.00 0.00 ? 121 TRP A N    3  
ATOM 6840  C CA   . TRP A 1 121 ? -16.128 6.234   14.431  1.00 0.00 ? 121 TRP A CA   3  
ATOM 6841  C C    . TRP A 1 121 ? -15.776 7.384   15.370  1.00 0.00 ? 121 TRP A C    3  
ATOM 6842  O O    . TRP A 1 121 ? -16.616 7.889   16.088  1.00 0.00 ? 121 TRP A O    3  
ATOM 6843  C CB   . TRP A 1 121 ? -17.387 6.573   13.630  1.00 0.00 ? 121 TRP A CB   3  
ATOM 6844  C CG   . TRP A 1 121 ? -17.464 5.674   12.441  1.00 0.00 ? 121 TRP A CG   3  
ATOM 6845  C CD1  . TRP A 1 121 ? -18.161 4.515   12.380  1.00 0.00 ? 121 TRP A CD1  3  
ATOM 6846  C CD2  . TRP A 1 121 ? -16.829 5.841   11.143  1.00 0.00 ? 121 TRP A CD2  3  
ATOM 6847  N NE1  . TRP A 1 121 ? -17.987 3.956   11.124  1.00 0.00 ? 121 TRP A NE1  3  
ATOM 6848  C CE2  . TRP A 1 121 ? -17.176 4.740   10.325  1.00 0.00 ? 121 TRP A CE2  3  
ATOM 6849  C CE3  . TRP A 1 121 ? -15.992 6.835   10.606  1.00 0.00 ? 121 TRP A CE3  3  
ATOM 6850  C CZ2  . TRP A 1 121 ? -16.704 4.630   9.016   1.00 0.00 ? 121 TRP A CZ2  3  
ATOM 6851  C CZ3  . TRP A 1 121 ? -15.518 6.727   9.290   1.00 0.00 ? 121 TRP A CZ3  3  
ATOM 6852  C CH2  . TRP A 1 121 ? -15.874 5.627   8.499   1.00 0.00 ? 121 TRP A CH2  3  
ATOM 6853  H H    . TRP A 1 121 ? -17.188 4.965   15.807  1.00 0.00 ? 121 TRP A H    3  
ATOM 6854  H HA   . TRP A 1 121 ? -15.304 6.049   13.759  1.00 0.00 ? 121 TRP A HA   3  
ATOM 6855  H HB2  . TRP A 1 121 ? -18.260 6.429   14.250  1.00 0.00 ? 121 TRP A HB2  3  
ATOM 6856  H HB3  . TRP A 1 121 ? -17.340 7.600   13.302  1.00 0.00 ? 121 TRP A HB3  3  
ATOM 6857  H HD1  . TRP A 1 121 ? -18.751 4.094   13.180  1.00 0.00 ? 121 TRP A HD1  3  
ATOM 6858  H HE1  . TRP A 1 121 ? -18.384 3.111   10.819  1.00 0.00 ? 121 TRP A HE1  3  
ATOM 6859  H HE3  . TRP A 1 121 ? -15.712 7.685   11.208  1.00 0.00 ? 121 TRP A HE3  3  
ATOM 6860  H HZ2  . TRP A 1 121 ? -16.977 3.783   8.408   1.00 0.00 ? 121 TRP A HZ2  3  
ATOM 6861  H HZ3  . TRP A 1 121 ? -14.877 7.495   8.887   1.00 0.00 ? 121 TRP A HZ3  3  
ATOM 6862  H HH2  . TRP A 1 121 ? -15.505 5.552   7.489   1.00 0.00 ? 121 TRP A HH2  3  
ATOM 6863  N N    . LEU A 1 122 ? -14.535 7.783   15.393  1.00 0.00 ? 122 LEU A N    3  
ATOM 6864  C CA   . LEU A 1 122 ? -14.125 8.876   16.316  1.00 0.00 ? 122 LEU A CA   3  
ATOM 6865  C C    . LEU A 1 122 ? -13.353 9.950   15.553  1.00 0.00 ? 122 LEU A C    3  
ATOM 6866  O O    . LEU A 1 122 ? -13.040 9.800   14.390  1.00 0.00 ? 122 LEU A O    3  
ATOM 6867  C CB   . LEU A 1 122 ? -13.224 8.313   17.421  1.00 0.00 ? 122 LEU A CB   3  
ATOM 6868  C CG   . LEU A 1 122 ? -13.537 6.829   17.663  1.00 0.00 ? 122 LEU A CG   3  
ATOM 6869  C CD1  . LEU A 1 122 ? -12.391 5.971   17.125  1.00 0.00 ? 122 LEU A CD1  3  
ATOM 6870  C CD2  . LEU A 1 122 ? -13.701 6.576   19.167  1.00 0.00 ? 122 LEU A CD2  3  
ATOM 6871  H H    . LEU A 1 122 ? -13.867 7.345   14.823  1.00 0.00 ? 122 LEU A H    3  
ATOM 6872  H HA   . LEU A 1 122 ? -15.002 9.315   16.764  1.00 0.00 ? 122 LEU A HA   3  
ATOM 6873  H HB2  . LEU A 1 122 ? -12.189 8.421   17.124  1.00 0.00 ? 122 LEU A HB2  3  
ATOM 6874  H HB3  . LEU A 1 122 ? -13.395 8.866   18.331  1.00 0.00 ? 122 LEU A HB3  3  
ATOM 6875  H HG   . LEU A 1 122 ? -14.446 6.558   17.159  1.00 0.00 ? 122 LEU A HG   3  
ATOM 6876  H HD11 . LEU A 1 122 ? -12.487 4.963   17.508  1.00 0.00 ? 122 LEU A HD11 3  
ATOM 6877  H HD12 . LEU A 1 122 ? -11.447 6.388   17.439  1.00 0.00 ? 122 LEU A HD12 3  
ATOM 6878  H HD13 . LEU A 1 122 ? -12.432 5.950   16.047  1.00 0.00 ? 122 LEU A HD13 3  
ATOM 6879  H HD21 . LEU A 1 122 ? -12.750 6.690   19.661  1.00 0.00 ? 122 LEU A HD21 3  
ATOM 6880  H HD22 . LEU A 1 122 ? -14.069 5.575   19.323  1.00 0.00 ? 122 LEU A HD22 3  
ATOM 6881  H HD23 . LEU A 1 122 ? -14.407 7.286   19.574  1.00 0.00 ? 122 LEU A HD23 3  
ATOM 6882  N N    . GLY A 1 123 ? -13.040 11.033  16.210  1.00 0.00 ? 123 GLY A N    3  
ATOM 6883  C CA   . GLY A 1 123 ? -12.280 12.120  15.537  1.00 0.00 ? 123 GLY A CA   3  
ATOM 6884  C C    . GLY A 1 123 ? -10.789 11.792  15.583  1.00 0.00 ? 123 GLY A C    3  
ATOM 6885  O O    . GLY A 1 123 ? -10.386 10.755  16.070  1.00 0.00 ? 123 GLY A O    3  
ATOM 6886  H H    . GLY A 1 123 ? -13.297 11.127  17.151  1.00 0.00 ? 123 GLY A H    3  
ATOM 6887  H HA2  . GLY A 1 123 ? -12.603 12.204  14.510  1.00 0.00 ? 123 GLY A HA2  3  
ATOM 6888  H HA3  . GLY A 1 123 ? -12.455 13.054  16.049  1.00 0.00 ? 123 GLY A HA3  3  
ATOM 6889  N N    . LEU A 1 124 ? -9.967  12.664  15.078  1.00 0.00 ? 124 LEU A N    3  
ATOM 6890  C CA   . LEU A 1 124 ? -8.504  12.403  15.088  1.00 0.00 ? 124 LEU A CA   3  
ATOM 6891  C C    . LEU A 1 124 ? -8.010  12.215  16.526  1.00 0.00 ? 124 LEU A C    3  
ATOM 6892  O O    . LEU A 1 124 ? -7.189  11.365  16.799  1.00 0.00 ? 124 LEU A O    3  
ATOM 6893  C CB   . LEU A 1 124 ? -7.782  13.589  14.450  1.00 0.00 ? 124 LEU A CB   3  
ATOM 6894  C CG   . LEU A 1 124 ? -6.268  13.396  14.553  1.00 0.00 ? 124 LEU A CG   3  
ATOM 6895  C CD1  . LEU A 1 124 ? -5.883  12.014  14.027  1.00 0.00 ? 124 LEU A CD1  3  
ATOM 6896  C CD2  . LEU A 1 124 ? -5.571  14.464  13.714  1.00 0.00 ? 124 LEU A CD2  3  
ATOM 6897  H H    . LEU A 1 124 ? -10.315 13.494  14.687  1.00 0.00 ? 124 LEU A H    3  
ATOM 6898  H HA   . LEU A 1 124 ? -8.298  11.509  14.519  1.00 0.00 ? 124 LEU A HA   3  
ATOM 6899  H HB2  . LEU A 1 124 ? -8.064  13.665  13.413  1.00 0.00 ? 124 LEU A HB2  3  
ATOM 6900  H HB3  . LEU A 1 124 ? -8.060  14.497  14.964  1.00 0.00 ? 124 LEU A HB3  3  
ATOM 6901  H HG   . LEU A 1 124 ? -5.962  13.488  15.585  1.00 0.00 ? 124 LEU A HG   3  
ATOM 6902  H HD11 . LEU A 1 124 ? -6.109  11.269  14.774  1.00 0.00 ? 124 LEU A HD11 3  
ATOM 6903  H HD12 . LEU A 1 124 ? -4.825  11.994  13.809  1.00 0.00 ? 124 LEU A HD12 3  
ATOM 6904  H HD13 . LEU A 1 124 ? -6.440  11.803  13.125  1.00 0.00 ? 124 LEU A HD13 3  
ATOM 6905  H HD21 . LEU A 1 124 ? -5.825  14.323  12.673  1.00 0.00 ? 124 LEU A HD21 3  
ATOM 6906  H HD22 . LEU A 1 124 ? -4.504  14.379  13.840  1.00 0.00 ? 124 LEU A HD22 3  
ATOM 6907  H HD23 . LEU A 1 124 ? -5.895  15.443  14.033  1.00 0.00 ? 124 LEU A HD23 3  
ATOM 6908  N N    . GLU A 1 125 ? -8.498  13.005  17.443  1.00 0.00 ? 125 GLU A N    3  
ATOM 6909  C CA   . GLU A 1 125 ? -8.044  12.881  18.861  1.00 0.00 ? 125 GLU A CA   3  
ATOM 6910  C C    . GLU A 1 125 ? -8.288  11.460  19.374  1.00 0.00 ? 125 GLU A C    3  
ATOM 6911  O O    . GLU A 1 125 ? -7.388  10.802  19.855  1.00 0.00 ? 125 GLU A O    3  
ATOM 6912  C CB   . GLU A 1 125 ? -8.818  13.880  19.728  1.00 0.00 ? 125 GLU A CB   3  
ATOM 6913  C CG   . GLU A 1 125 ? -10.313 13.548  19.705  1.00 0.00 ? 125 GLU A CG   3  
ATOM 6914  C CD   . GLU A 1 125 ? -11.091 14.669  20.396  1.00 0.00 ? 125 GLU A CD   3  
ATOM 6915  O OE1  . GLU A 1 125 ? -12.309 14.652  20.322  1.00 0.00 ? 125 GLU A OE1  3  
ATOM 6916  O OE2  . GLU A 1 125 ? -10.457 15.524  20.989  1.00 0.00 ? 125 GLU A OE2  3  
ATOM 6917  H H    . GLU A 1 125 ? -9.153  13.689  17.196  1.00 0.00 ? 125 GLU A H    3  
ATOM 6918  H HA   . GLU A 1 125 ? -6.989  13.102  18.919  1.00 0.00 ? 125 GLU A HA   3  
ATOM 6919  H HB2  . GLU A 1 125 ? -8.456  13.830  20.745  1.00 0.00 ? 125 GLU A HB2  3  
ATOM 6920  H HB3  . GLU A 1 125 ? -8.670  14.878  19.345  1.00 0.00 ? 125 GLU A HB3  3  
ATOM 6921  H HG2  . GLU A 1 125 ? -10.647 13.454  18.680  1.00 0.00 ? 125 GLU A HG2  3  
ATOM 6922  H HG3  . GLU A 1 125 ? -10.490 12.619  20.229  1.00 0.00 ? 125 GLU A HG3  3  
ATOM 6923  H HE2  . GLU A 1 125 ? -11.009 16.194  21.398  1.00 0.00 ? 125 GLU A HE2  3  
ATOM 6924  N N    . GLU A 1 126 ? -9.495  10.983  19.279  1.00 0.00 ? 126 GLU A N    3  
ATOM 6925  C CA   . GLU A 1 126 ? -9.791  9.607   19.761  1.00 0.00 ? 126 GLU A CA   3  
ATOM 6926  C C    . GLU A 1 126 ? -9.165  8.599   18.810  1.00 0.00 ? 126 GLU A C    3  
ATOM 6927  O O    . GLU A 1 126 ? -8.550  7.637   19.218  1.00 0.00 ? 126 GLU A O    3  
ATOM 6928  C CB   . GLU A 1 126 ? -11.303 9.407   19.792  1.00 0.00 ? 126 GLU A CB   3  
ATOM 6929  C CG   . GLU A 1 126 ? -11.823 9.551   21.224  1.00 0.00 ? 126 GLU A CG   3  
ATOM 6930  C CD   . GLU A 1 126 ? -11.189 10.773  21.894  1.00 0.00 ? 126 GLU A CD   3  
ATOM 6931  O OE1  . GLU A 1 126 ? -10.136 10.618  22.493  1.00 0.00 ? 126 GLU A OE1  3  
ATOM 6932  O OE2  . GLU A 1 126 ? -11.776 11.839  21.813  1.00 0.00 ? 126 GLU A OE2  3  
ATOM 6933  H H    . GLU A 1 126 ? -10.209 11.529  18.887  1.00 0.00 ? 126 GLU A H    3  
ATOM 6934  H HA   . GLU A 1 126 ? -9.384  9.469   20.753  1.00 0.00 ? 126 GLU A HA   3  
ATOM 6935  H HB2  . GLU A 1 126 ? -11.773 10.147  19.162  1.00 0.00 ? 126 GLU A HB2  3  
ATOM 6936  H HB3  . GLU A 1 126 ? -11.536 8.421   19.424  1.00 0.00 ? 126 GLU A HB3  3  
ATOM 6937  H HG2  . GLU A 1 126 ? -12.893 9.677   21.197  1.00 0.00 ? 126 GLU A HG2  3  
ATOM 6938  H HG3  . GLU A 1 126 ? -11.577 8.664   21.787  1.00 0.00 ? 126 GLU A HG3  3  
ATOM 6939  H HE2  . GLU A 1 126 ? -11.324 12.559  22.259  1.00 0.00 ? 126 GLU A HE2  3  
ATOM 6940  N N    . ALA A 1 127 ? -9.293  8.815   17.537  1.00 0.00 ? 127 ALA A N    3  
ATOM 6941  C CA   . ALA A 1 127 ? -8.680  7.868   16.582  1.00 0.00 ? 127 ALA A CA   3  
ATOM 6942  C C    . ALA A 1 127 ? -7.200  7.769   16.929  1.00 0.00 ? 127 ALA A C    3  
ATOM 6943  O O    . ALA A 1 127 ? -6.571  6.743   16.770  1.00 0.00 ? 127 ALA A O    3  
ATOM 6944  C CB   . ALA A 1 127 ? -8.860  8.397   15.162  1.00 0.00 ? 127 ALA A CB   3  
ATOM 6945  H H    . ALA A 1 127 ? -9.778  9.603   17.213  1.00 0.00 ? 127 ALA A H    3  
ATOM 6946  H HA   . ALA A 1 127 ? -9.145  6.899   16.679  1.00 0.00 ? 127 ALA A HA   3  
ATOM 6947  H HB1  . ALA A 1 127 ? -8.235  9.268   15.020  1.00 0.00 ? 127 ALA A HB1  3  
ATOM 6948  H HB2  . ALA A 1 127 ? -9.898  8.665   15.011  1.00 0.00 ? 127 ALA A HB2  3  
ATOM 6949  H HB3  . ALA A 1 127 ? -8.579  7.632   14.452  1.00 0.00 ? 127 ALA A HB3  3  
ATOM 6950  N N    . CYS A 1 128 ? -6.655  8.840   17.433  1.00 0.00 ? 128 CYS A N    3  
ATOM 6951  C CA   . CYS A 1 128 ? -5.225  8.846   17.835  1.00 0.00 ? 128 CYS A CA   3  
ATOM 6952  C C    . CYS A 1 128 ? -5.096  8.190   19.213  1.00 0.00 ? 128 CYS A C    3  
ATOM 6953  O O    . CYS A 1 128 ? -4.152  7.475   19.485  1.00 0.00 ? 128 CYS A O    3  
ATOM 6954  C CB   . CYS A 1 128 ? -4.736  10.295  17.906  1.00 0.00 ? 128 CYS A CB   3  
ATOM 6955  S SG   . CYS A 1 128 ? -4.042  10.778  16.304  1.00 0.00 ? 128 CYS A SG   3  
ATOM 6956  H H    . CYS A 1 128 ? -7.200  9.642   17.567  1.00 0.00 ? 128 CYS A H    3  
ATOM 6957  H HA   . CYS A 1 128 ? -4.638  8.297   17.114  1.00 0.00 ? 128 CYS A HA   3  
ATOM 6958  H HB2  . CYS A 1 128 ? -5.563  10.942  18.150  1.00 0.00 ? 128 CYS A HB2  3  
ATOM 6959  H HB3  . CYS A 1 128 ? -3.983  10.385  18.668  1.00 0.00 ? 128 CYS A HB3  3  
ATOM 6960  H HG   . CYS A 1 128 ? -4.000  9.995   15.751  1.00 0.00 ? 128 CYS A HG   3  
ATOM 6961  N N    . GLN A 1 129 ? -6.040  8.431   20.085  1.00 0.00 ? 129 GLN A N    3  
ATOM 6962  C CA   . GLN A 1 129 ? -5.973  7.825   21.446  1.00 0.00 ? 129 GLN A CA   3  
ATOM 6963  C C    . GLN A 1 129 ? -6.076  6.303   21.337  1.00 0.00 ? 129 GLN A C    3  
ATOM 6964  O O    . GLN A 1 129 ? -5.308  5.575   21.933  1.00 0.00 ? 129 GLN A O    3  
ATOM 6965  C CB   . GLN A 1 129 ? -7.111  8.390   22.315  1.00 0.00 ? 129 GLN A CB   3  
ATOM 6966  C CG   . GLN A 1 129 ? -8.364  7.511   22.234  1.00 0.00 ? 129 GLN A CG   3  
ATOM 6967  C CD   . GLN A 1 129 ? -8.203  6.289   23.141  1.00 0.00 ? 129 GLN A CD   3  
ATOM 6968  O OE1  . GLN A 1 129 ? -7.121  6.007   23.618  1.00 0.00 ? 129 GLN A OE1  3  
ATOM 6969  N NE2  . GLN A 1 129 ? -9.247  5.551   23.408  1.00 0.00 ? 129 GLN A NE2  3  
ATOM 6970  H H    . GLN A 1 129 ? -6.793  9.011   19.844  1.00 0.00 ? 129 GLN A H    3  
ATOM 6971  H HA   . GLN A 1 129 ? -5.025  8.081   21.895  1.00 0.00 ? 129 GLN A HA   3  
ATOM 6972  H HB2  . GLN A 1 129 ? -6.783  8.434   23.335  1.00 0.00 ? 129 GLN A HB2  3  
ATOM 6973  H HB3  . GLN A 1 129 ? -7.354  9.386   21.978  1.00 0.00 ? 129 GLN A HB3  3  
ATOM 6974  H HG2  . GLN A 1 129 ? -9.221  8.085   22.558  1.00 0.00 ? 129 GLN A HG2  3  
ATOM 6975  H HG3  . GLN A 1 129 ? -8.516  7.190   21.222  1.00 0.00 ? 129 GLN A HG3  3  
ATOM 6976  H HE21 . GLN A 1 129 ? -10.119 5.783   23.027  1.00 0.00 ? 129 GLN A HE21 3  
ATOM 6977  H HE22 . GLN A 1 129 ? -9.158  4.767   23.987  1.00 0.00 ? 129 GLN A HE22 3  
ATOM 6978  N N    . LEU A 1 130 ? -7.012  5.817   20.573  1.00 0.00 ? 130 LEU A N    3  
ATOM 6979  C CA   . LEU A 1 130 ? -7.159  4.339   20.416  1.00 0.00 ? 130 LEU A CA   3  
ATOM 6980  C C    . LEU A 1 130 ? -5.951  3.788   19.661  1.00 0.00 ? 130 LEU A C    3  
ATOM 6981  O O    . LEU A 1 130 ? -5.366  2.795   20.045  1.00 0.00 ? 130 LEU A O    3  
ATOM 6982  C CB   . LEU A 1 130 ? -8.421  4.044   19.608  1.00 0.00 ? 130 LEU A CB   3  
ATOM 6983  C CG   . LEU A 1 130 ? -9.661  4.434   20.413  1.00 0.00 ? 130 LEU A CG   3  
ATOM 6984  C CD1  . LEU A 1 130 ? -10.706 5.018   19.469  1.00 0.00 ? 130 LEU A CD1  3  
ATOM 6985  C CD2  . LEU A 1 130 ? -10.240 3.192   21.089  1.00 0.00 ? 130 LEU A CD2  3  
ATOM 6986  H H    . LEU A 1 130 ? -7.614  6.425   20.099  1.00 0.00 ? 130 LEU A H    3  
ATOM 6987  H HA   . LEU A 1 130 ? -7.230  3.872   21.386  1.00 0.00 ? 130 LEU A HA   3  
ATOM 6988  H HB2  . LEU A 1 130 ? -8.395  4.609   18.688  1.00 0.00 ? 130 LEU A HB2  3  
ATOM 6989  H HB3  . LEU A 1 130 ? -8.461  2.994   19.382  1.00 0.00 ? 130 LEU A HB3  3  
ATOM 6990  H HG   . LEU A 1 130 ? -9.394  5.167   21.159  1.00 0.00 ? 130 LEU A HG   3  
ATOM 6991  H HD11 . LEU A 1 130 ? -10.545 4.632   18.475  1.00 0.00 ? 130 LEU A HD11 3  
ATOM 6992  H HD12 . LEU A 1 130 ? -10.618 6.094   19.460  1.00 0.00 ? 130 LEU A HD12 3  
ATOM 6993  H HD13 . LEU A 1 130 ? -11.691 4.736   19.809  1.00 0.00 ? 130 LEU A HD13 3  
ATOM 6994  H HD21 . LEU A 1 130 ? -9.439  2.584   21.477  1.00 0.00 ? 130 LEU A HD21 3  
ATOM 6995  H HD22 . LEU A 1 130 ? -10.809 2.624   20.366  1.00 0.00 ? 130 LEU A HD22 3  
ATOM 6996  H HD23 . LEU A 1 130 ? -10.890 3.495   21.899  1.00 0.00 ? 130 LEU A HD23 3  
ATOM 6997  N N    . ALA A 1 131 ? -5.568  4.434   18.594  1.00 0.00 ? 131 ALA A N    3  
ATOM 6998  C CA   . ALA A 1 131 ? -4.391  3.954   17.823  1.00 0.00 ? 131 ALA A CA   3  
ATOM 6999  C C    . ALA A 1 131 ? -3.132  4.327   18.600  1.00 0.00 ? 131 ALA A C    3  
ATOM 7000  O O    . ALA A 1 131 ? -2.244  4.988   18.100  1.00 0.00 ? 131 ALA A O    3  
ATOM 7001  C CB   . ALA A 1 131 ? -4.373  4.616   16.442  1.00 0.00 ? 131 ALA A CB   3  
ATOM 7002  H H    . ALA A 1 131 ? -6.049  5.237   18.307  1.00 0.00 ? 131 ALA A H    3  
ATOM 7003  H HA   . ALA A 1 131 ? -4.443  2.880   17.712  1.00 0.00 ? 131 ALA A HA   3  
ATOM 7004  H HB1  . ALA A 1 131 ? -3.702  5.461   16.454  1.00 0.00 ? 131 ALA A HB1  3  
ATOM 7005  H HB2  . ALA A 1 131 ? -5.367  4.948   16.191  1.00 0.00 ? 131 ALA A HB2  3  
ATOM 7006  H HB3  . ALA A 1 131 ? -4.038  3.899   15.707  1.00 0.00 ? 131 ALA A HB3  3  
ATOM 7007  N N    . GLN A 1 132 ? -3.069  3.909   19.831  1.00 0.00 ? 132 GLN A N    3  
ATOM 7008  C CA   . GLN A 1 132 ? -1.897  4.235   20.692  1.00 0.00 ? 132 GLN A CA   3  
ATOM 7009  C C    . GLN A 1 132 ? -0.617  4.205   19.861  1.00 0.00 ? 132 GLN A C    3  
ATOM 7010  O O    . GLN A 1 132 ? 0.308   4.955   20.105  1.00 0.00 ? 132 GLN A O    3  
ATOM 7011  C CB   . GLN A 1 132 ? -1.776  3.210   21.822  1.00 0.00 ? 132 GLN A CB   3  
ATOM 7012  C CG   . GLN A 1 132 ? -2.817  2.096   21.653  1.00 0.00 ? 132 GLN A CG   3  
ATOM 7013  C CD   . GLN A 1 132 ? -4.098  2.458   22.412  1.00 0.00 ? 132 GLN A CD   3  
ATOM 7014  O OE1  . GLN A 1 132 ? -5.009  1.658   22.503  1.00 0.00 ? 132 GLN A OE1  3  
ATOM 7015  N NE2  . GLN A 1 132 ? -4.210  3.634   22.966  1.00 0.00 ? 132 GLN A NE2  3  
ATOM 7016  H H    . GLN A 1 132 ? -3.811  3.389   20.200  1.00 0.00 ? 132 GLN A H    3  
ATOM 7017  H HA   . GLN A 1 132 ? -2.026  5.219   21.117  1.00 0.00 ? 132 GLN A HA   3  
ATOM 7018  H HB2  . GLN A 1 132 ? -0.787  2.778   21.806  1.00 0.00 ? 132 GLN A HB2  3  
ATOM 7019  H HB3  . GLN A 1 132 ? -1.929  3.704   22.770  1.00 0.00 ? 132 GLN A HB3  3  
ATOM 7020  H HG2  . GLN A 1 132 ? -3.043  1.959   20.607  1.00 0.00 ? 132 GLN A HG2  3  
ATOM 7021  H HG3  . GLN A 1 132 ? -2.421  1.176   22.051  1.00 0.00 ? 132 GLN A HG3  3  
ATOM 7022  H HE21 . GLN A 1 132 ? -3.477  4.282   22.896  1.00 0.00 ? 132 GLN A HE21 3  
ATOM 7023  H HE22 . GLN A 1 132 ? -5.025  3.869   23.456  1.00 0.00 ? 132 GLN A HE22 3  
ATOM 7024  N N    . PHE A 1 133 ? -0.547  3.350   18.883  1.00 0.00 ? 133 PHE A N    3  
ATOM 7025  C CA   . PHE A 1 133 ? 0.684   3.291   18.053  1.00 0.00 ? 133 PHE A CA   3  
ATOM 7026  C C    . PHE A 1 133 ? 0.941   4.673   17.451  1.00 0.00 ? 133 PHE A C    3  
ATOM 7027  O O    . PHE A 1 133 ? 0.114   5.223   16.750  1.00 0.00 ? 133 PHE A O    3  
ATOM 7028  C CB   . PHE A 1 133 ? 0.494   2.272   16.928  1.00 0.00 ? 133 PHE A CB   3  
ATOM 7029  C CG   . PHE A 1 133 ? 0.007   0.958   17.494  1.00 0.00 ? 133 PHE A CG   3  
ATOM 7030  C CD1  . PHE A 1 133 ? 0.436   0.520   18.755  1.00 0.00 ? 133 PHE A CD1  3  
ATOM 7031  C CD2  . PHE A 1 133 ? -0.883  0.173   16.749  1.00 0.00 ? 133 PHE A CD2  3  
ATOM 7032  C CE1  . PHE A 1 133 ? -0.023  -0.699  19.267  1.00 0.00 ? 133 PHE A CE1  3  
ATOM 7033  C CE2  . PHE A 1 133 ? -1.341  -1.047  17.262  1.00 0.00 ? 133 PHE A CE2  3  
ATOM 7034  C CZ   . PHE A 1 133 ? -0.911  -1.482  18.520  1.00 0.00 ? 133 PHE A CZ   3  
ATOM 7035  H H    . PHE A 1 133 ? -1.299  2.749   18.697  1.00 0.00 ? 133 PHE A H    3  
ATOM 7036  H HA   . PHE A 1 133 ? 1.525   3.007   18.667  1.00 0.00 ? 133 PHE A HA   3  
ATOM 7037  H HB2  . PHE A 1 133 ? -0.234  2.650   16.227  1.00 0.00 ? 133 PHE A HB2  3  
ATOM 7038  H HB3  . PHE A 1 133 ? 1.435   2.119   16.422  1.00 0.00 ? 133 PHE A HB3  3  
ATOM 7039  H HD1  . PHE A 1 133 ? 1.121   1.119   19.333  1.00 0.00 ? 133 PHE A HD1  3  
ATOM 7040  H HD2  . PHE A 1 133 ? -1.214  0.507   15.779  1.00 0.00 ? 133 PHE A HD2  3  
ATOM 7041  H HE1  . PHE A 1 133 ? 0.307   -1.036  20.239  1.00 0.00 ? 133 PHE A HE1  3  
ATOM 7042  H HE2  . PHE A 1 133 ? -2.026  -1.652  16.686  1.00 0.00 ? 133 PHE A HE2  3  
ATOM 7043  H HZ   . PHE A 1 133 ? -1.265  -2.423  18.917  1.00 0.00 ? 133 PHE A HZ   3  
ATOM 7044  N N    . LYS A 1 134 ? 2.087   5.237   17.722  1.00 0.00 ? 134 LYS A N    3  
ATOM 7045  C CA   . LYS A 1 134 ? 2.413   6.583   17.173  1.00 0.00 ? 134 LYS A CA   3  
ATOM 7046  C C    . LYS A 1 134 ? 2.333   6.555   15.646  1.00 0.00 ? 134 LYS A C    3  
ATOM 7047  O O    . LYS A 1 134 ? 1.956   7.521   15.014  1.00 0.00 ? 134 LYS A O    3  
ATOM 7048  C CB   . LYS A 1 134 ? 3.831   6.966   17.599  1.00 0.00 ? 134 LYS A CB   3  
ATOM 7049  C CG   . LYS A 1 134 ? 4.172   8.354   17.057  1.00 0.00 ? 134 LYS A CG   3  
ATOM 7050  C CD   . LYS A 1 134 ? 5.613   8.703   17.433  1.00 0.00 ? 134 LYS A CD   3  
ATOM 7051  C CE   . LYS A 1 134 ? 5.903   10.161  17.066  1.00 0.00 ? 134 LYS A CE   3  
ATOM 7052  N NZ   . LYS A 1 134 ? 5.146   10.526  15.834  1.00 0.00 ? 134 LYS A NZ   3  
ATOM 7053  H H    . LYS A 1 134 ? 2.735   4.770   18.289  1.00 0.00 ? 134 LYS A H    3  
ATOM 7054  H HA   . LYS A 1 134 ? 1.714   7.308   17.559  1.00 0.00 ? 134 LYS A HA   3  
ATOM 7055  H HB2  . LYS A 1 134 ? 3.891   6.974   18.677  1.00 0.00 ? 134 LYS A HB2  3  
ATOM 7056  H HB3  . LYS A 1 134 ? 4.531   6.245   17.204  1.00 0.00 ? 134 LYS A HB3  3  
ATOM 7057  H HG2  . LYS A 1 134 ? 4.069   8.356   15.982  1.00 0.00 ? 134 LYS A HG2  3  
ATOM 7058  H HG3  . LYS A 1 134 ? 3.502   9.083   17.486  1.00 0.00 ? 134 LYS A HG3  3  
ATOM 7059  H HD2  . LYS A 1 134 ? 5.750   8.565   18.494  1.00 0.00 ? 134 LYS A HD2  3  
ATOM 7060  H HD3  . LYS A 1 134 ? 6.293   8.057   16.895  1.00 0.00 ? 134 LYS A HD3  3  
ATOM 7061  H HE2  . LYS A 1 134 ? 5.596   10.802  17.877  1.00 0.00 ? 134 LYS A HE2  3  
ATOM 7062  H HE3  . LYS A 1 134 ? 6.960   10.284  16.889  1.00 0.00 ? 134 LYS A HE3  3  
ATOM 7063  H HZ1  . LYS A 1 134 ? 5.518   11.418  15.452  1.00 0.00 ? 134 LYS A HZ1  3  
ATOM 7064  H HZ2  . LYS A 1 134 ? 4.139   10.639  16.067  1.00 0.00 ? 134 LYS A HZ2  3  
ATOM 7065  H HZ3  . LYS A 1 134 ? 5.256   9.774   15.123  1.00 0.00 ? 134 LYS A HZ3  3  
ATOM 7066  N N    . GLU A 1 135 ? 2.701   5.457   15.055  1.00 0.00 ? 135 GLU A N    3  
ATOM 7067  C CA   . GLU A 1 135 ? 2.667   5.354   13.569  1.00 0.00 ? 135 GLU A CA   3  
ATOM 7068  C C    . GLU A 1 135 ? 1.264   5.666   13.073  1.00 0.00 ? 135 GLU A C    3  
ATOM 7069  O O    . GLU A 1 135 ? 1.074   6.384   12.110  1.00 0.00 ? 135 GLU A O    3  
ATOM 7070  C CB   . GLU A 1 135 ? 2.999   3.920   13.174  1.00 0.00 ? 135 GLU A CB   3  
ATOM 7071  C CG   . GLU A 1 135 ? 4.170   3.433   14.019  1.00 0.00 ? 135 GLU A CG   3  
ATOM 7072  C CD   . GLU A 1 135 ? 4.510   1.992   13.641  1.00 0.00 ? 135 GLU A CD   3  
ATOM 7073  O OE1  . GLU A 1 135 ? 5.528   1.502   14.102  1.00 0.00 ? 135 GLU A OE1  3  
ATOM 7074  O OE2  . GLU A 1 135 ? 3.745   1.402   12.896  1.00 0.00 ? 135 GLU A OE2  3  
ATOM 7075  H H    . GLU A 1 135 ? 3.010   4.698   15.589  1.00 0.00 ? 135 GLU A H    3  
ATOM 7076  H HA   . GLU A 1 135 ? 3.380   6.033   13.129  1.00 0.00 ? 135 GLU A HA   3  
ATOM 7077  H HB2  . GLU A 1 135 ? 2.135   3.289   13.341  1.00 0.00 ? 135 GLU A HB2  3  
ATOM 7078  H HB3  . GLU A 1 135 ? 3.274   3.887   12.131  1.00 0.00 ? 135 GLU A HB3  3  
ATOM 7079  H HG2  . GLU A 1 135 ? 5.022   4.065   13.844  1.00 0.00 ? 135 GLU A HG2  3  
ATOM 7080  H HG3  . GLU A 1 135 ? 3.903   3.475   15.064  1.00 0.00 ? 135 GLU A HG3  3  
ATOM 7081  H HE2  . GLU A 1 135 ? 4.020   0.503   12.701  1.00 0.00 ? 135 GLU A HE2  3  
ATOM 7082  N N    . MET A 1 136 ? 0.279   5.118   13.717  1.00 0.00 ? 136 MET A N    3  
ATOM 7083  C CA   . MET A 1 136 ? -1.114  5.359   13.281  1.00 0.00 ? 136 MET A CA   3  
ATOM 7084  C C    . MET A 1 136 ? -1.558  6.741   13.743  1.00 0.00 ? 136 MET A C    3  
ATOM 7085  O O    . MET A 1 136 ? -2.129  7.501   12.987  1.00 0.00 ? 136 MET A O    3  
ATOM 7086  C CB   . MET A 1 136 ? -2.006  4.279   13.876  1.00 0.00 ? 136 MET A CB   3  
ATOM 7087  C CG   . MET A 1 136 ? -1.430  2.907   13.511  1.00 0.00 ? 136 MET A CG   3  
ATOM 7088  S SD   . MET A 1 136 ? -1.102  2.829   11.732  1.00 0.00 ? 136 MET A SD   3  
ATOM 7089  C CE   . MET A 1 136 ? -2.734  3.359   11.157  1.00 0.00 ? 136 MET A CE   3  
ATOM 7090  H H    . MET A 1 136 ? 0.458   4.533   14.484  1.00 0.00 ? 136 MET A H    3  
ATOM 7091  H HA   . MET A 1 136 ? -1.161  5.316   12.205  1.00 0.00 ? 136 MET A HA   3  
ATOM 7092  H HB2  . MET A 1 136 ? -2.029  4.387   14.952  1.00 0.00 ? 136 MET A HB2  3  
ATOM 7093  H HB3  . MET A 1 136 ? -3.004  4.370   13.481  1.00 0.00 ? 136 MET A HB3  3  
ATOM 7094  H HG2  . MET A 1 136 ? -0.500  2.757   14.045  1.00 0.00 ? 136 MET A HG2  3  
ATOM 7095  H HG3  . MET A 1 136 ? -2.132  2.135   13.783  1.00 0.00 ? 136 MET A HG3  3  
ATOM 7096  H HE1  . MET A 1 136 ? -2.778  4.439   11.138  1.00 0.00 ? 136 MET A HE1  3  
ATOM 7097  H HE2  . MET A 1 136 ? -3.491  2.983   11.822  1.00 0.00 ? 136 MET A HE2  3  
ATOM 7098  H HE3  . MET A 1 136 ? -2.904  2.972   10.162  1.00 0.00 ? 136 MET A HE3  3  
ATOM 7099  N N    . LYS A 1 137 ? -1.276  7.098   14.964  1.00 0.00 ? 137 LYS A N    3  
ATOM 7100  C CA   . LYS A 1 137 ? -1.667  8.452   15.418  1.00 0.00 ? 137 LYS A CA   3  
ATOM 7101  C C    . LYS A 1 137 ? -1.040  9.439   14.448  1.00 0.00 ? 137 LYS A C    3  
ATOM 7102  O O    . LYS A 1 137 ? -1.613  10.455  14.114  1.00 0.00 ? 137 LYS A O    3  
ATOM 7103  C CB   . LYS A 1 137 ? -1.157  8.701   16.837  1.00 0.00 ? 137 LYS A CB   3  
ATOM 7104  C CG   . LYS A 1 137 ? -2.093  8.004   17.830  1.00 0.00 ? 137 LYS A CG   3  
ATOM 7105  C CD   . LYS A 1 137 ? -1.285  7.245   18.881  1.00 0.00 ? 137 LYS A CD   3  
ATOM 7106  C CE   . LYS A 1 137 ? -0.589  8.220   19.831  1.00 0.00 ? 137 LYS A CE   3  
ATOM 7107  N NZ   . LYS A 1 137 ? -0.454  9.553   19.181  1.00 0.00 ? 137 LYS A NZ   3  
ATOM 7108  H H    . LYS A 1 137 ? -0.793  6.490   15.564  1.00 0.00 ? 137 LYS A H    3  
ATOM 7109  H HA   . LYS A 1 137 ? -2.743  8.551   15.391  1.00 0.00 ? 137 LYS A HA   3  
ATOM 7110  H HB2  . LYS A 1 137 ? -0.159  8.305   16.937  1.00 0.00 ? 137 LYS A HB2  3  
ATOM 7111  H HB3  . LYS A 1 137 ? -1.148  9.761   17.035  1.00 0.00 ? 137 LYS A HB3  3  
ATOM 7112  H HG2  . LYS A 1 137 ? -2.707  8.742   18.315  1.00 0.00 ? 137 LYS A HG2  3  
ATOM 7113  H HG3  . LYS A 1 137 ? -2.721  7.308   17.296  1.00 0.00 ? 137 LYS A HG3  3  
ATOM 7114  H HD2  . LYS A 1 137 ? -1.952  6.615   19.450  1.00 0.00 ? 137 LYS A HD2  3  
ATOM 7115  H HD3  . LYS A 1 137 ? -0.549  6.633   18.389  1.00 0.00 ? 137 LYS A HD3  3  
ATOM 7116  H HE2  . LYS A 1 137 ? -1.174  8.318   20.735  1.00 0.00 ? 137 LYS A HE2  3  
ATOM 7117  H HE3  . LYS A 1 137 ? 0.390   7.839   20.081  1.00 0.00 ? 137 LYS A HE3  3  
ATOM 7118  H HZ1  . LYS A 1 137 ? -1.364  9.829   18.763  1.00 0.00 ? 137 LYS A HZ1  3  
ATOM 7119  H HZ2  . LYS A 1 137 ? 0.271   9.502   18.435  1.00 0.00 ? 137 LYS A HZ2  3  
ATOM 7120  H HZ3  . LYS A 1 137 ? -0.174  10.258  19.891  1.00 0.00 ? 137 LYS A HZ3  3  
ATOM 7121  N N    . ALA A 1 138 ? 0.129   9.114   13.962  1.00 0.00 ? 138 ALA A N    3  
ATOM 7122  C CA   . ALA A 1 138 ? 0.799   9.993   12.971  1.00 0.00 ? 138 ALA A CA   3  
ATOM 7123  C C    . ALA A 1 138 ? 0.104   9.814   11.622  1.00 0.00 ? 138 ALA A C    3  
ATOM 7124  O O    . ALA A 1 138 ? -0.204  10.768  10.936  1.00 0.00 ? 138 ALA A O    3  
ATOM 7125  C CB   . ALA A 1 138 ? 2.263   9.592   12.834  1.00 0.00 ? 138 ALA A CB   3  
ATOM 7126  H H    . ALA A 1 138 ? 0.550   8.272   14.229  1.00 0.00 ? 138 ALA A H    3  
ATOM 7127  H HA   . ALA A 1 138 ? 0.734   11.018  13.289  1.00 0.00 ? 138 ALA A HA   3  
ATOM 7128  H HB1  . ALA A 1 138 ? 2.809   10.405  12.380  1.00 0.00 ? 138 ALA A HB1  3  
ATOM 7129  H HB2  . ALA A 1 138 ? 2.339   8.711   12.214  1.00 0.00 ? 138 ALA A HB2  3  
ATOM 7130  H HB3  . ALA A 1 138 ? 2.671   9.381   13.812  1.00 0.00 ? 138 ALA A HB3  3  
ATOM 7131  N N    . ALA A 1 139 ? -0.155  8.588   11.244  1.00 0.00 ? 139 ALA A N    3  
ATOM 7132  C CA   . ALA A 1 139 ? -0.841  8.336   9.948   1.00 0.00 ? 139 ALA A CA   3  
ATOM 7133  C C    . ALA A 1 139 ? -2.190  9.042   9.978   1.00 0.00 ? 139 ALA A C    3  
ATOM 7134  O O    . ALA A 1 139 ? -2.548  9.770   9.075   1.00 0.00 ? 139 ALA A O    3  
ATOM 7135  C CB   . ALA A 1 139 ? -1.061  6.834   9.769   1.00 0.00 ? 139 ALA A CB   3  
ATOM 7136  H H    . ALA A 1 139 ? 0.096   7.835   11.820  1.00 0.00 ? 139 ALA A H    3  
ATOM 7137  H HA   . ALA A 1 139 ? -0.243  8.720   9.135   1.00 0.00 ? 139 ALA A HA   3  
ATOM 7138  H HB1  . ALA A 1 139 ? -0.195  6.296   10.126  1.00 0.00 ? 139 ALA A HB1  3  
ATOM 7139  H HB2  . ALA A 1 139 ? -1.214  6.616   8.723   1.00 0.00 ? 139 ALA A HB2  3  
ATOM 7140  H HB3  . ALA A 1 139 ? -1.933  6.530   10.332  1.00 0.00 ? 139 ALA A HB3  3  
ATOM 7141  N N    . LEU A 1 140 ? -2.927  8.850   11.033  1.00 0.00 ? 140 LEU A N    3  
ATOM 7142  C CA   . LEU A 1 140 ? -4.239  9.527   11.156  1.00 0.00 ? 140 LEU A CA   3  
ATOM 7143  C C    . LEU A 1 140 ? -3.972  11.032  11.198  1.00 0.00 ? 140 LEU A C    3  
ATOM 7144  O O    . LEU A 1 140 ? -4.767  11.836  10.754  1.00 0.00 ? 140 LEU A O    3  
ATOM 7145  C CB   . LEU A 1 140 ? -4.911  9.088   12.461  1.00 0.00 ? 140 LEU A CB   3  
ATOM 7146  C CG   . LEU A 1 140 ? -5.021  7.558   12.496  1.00 0.00 ? 140 LEU A CG   3  
ATOM 7147  C CD1  . LEU A 1 140 ? -5.003  7.075   13.946  1.00 0.00 ? 140 LEU A CD1  3  
ATOM 7148  C CD2  . LEU A 1 140 ? -6.332  7.117   11.842  1.00 0.00 ? 140 LEU A CD2  3  
ATOM 7149  H H    . LEU A 1 140 ? -2.604  8.272   11.757  1.00 0.00 ? 140 LEU A H    3  
ATOM 7150  H HA   . LEU A 1 140 ? -4.864  9.279   10.311  1.00 0.00 ? 140 LEU A HA   3  
ATOM 7151  H HB2  . LEU A 1 140 ? -4.321  9.427   13.298  1.00 0.00 ? 140 LEU A HB2  3  
ATOM 7152  H HB3  . LEU A 1 140 ? -5.899  9.518   12.518  1.00 0.00 ? 140 LEU A HB3  3  
ATOM 7153  H HG   . LEU A 1 140 ? -4.186  7.124   11.962  1.00 0.00 ? 140 LEU A HG   3  
ATOM 7154  H HD11 . LEU A 1 140 ? -5.726  6.281   14.069  1.00 0.00 ? 140 LEU A HD11 3  
ATOM 7155  H HD12 . LEU A 1 140 ? -5.254  7.893   14.604  1.00 0.00 ? 140 LEU A HD12 3  
ATOM 7156  H HD13 . LEU A 1 140 ? -4.019  6.704   14.190  1.00 0.00 ? 140 LEU A HD13 3  
ATOM 7157  H HD21 . LEU A 1 140 ? -7.070  6.935   12.609  1.00 0.00 ? 140 LEU A HD21 3  
ATOM 7158  H HD22 . LEU A 1 140 ? -6.164  6.209   11.283  1.00 0.00 ? 140 LEU A HD22 3  
ATOM 7159  H HD23 . LEU A 1 140 ? -6.684  7.891   11.177  1.00 0.00 ? 140 LEU A HD23 3  
ATOM 7160  N N    . GLN A 1 141 ? -2.844  11.401  11.744  1.00 0.00 ? 141 GLN A N    3  
ATOM 7161  C CA   . GLN A 1 141 ? -2.473  12.841  11.850  1.00 0.00 ? 141 GLN A CA   3  
ATOM 7162  C C    . GLN A 1 141 ? -2.075  13.401  10.485  1.00 0.00 ? 141 GLN A C    3  
ATOM 7163  O O    . GLN A 1 141 ? -2.567  14.424  10.057  1.00 0.00 ? 141 GLN A O    3  
ATOM 7164  C CB   . GLN A 1 141 ? -1.280  12.956  12.797  1.00 0.00 ? 141 GLN A CB   3  
ATOM 7165  C CG   . GLN A 1 141 ? -1.749  13.469  14.156  1.00 0.00 ? 141 GLN A CG   3  
ATOM 7166  C CD   . GLN A 1 141 ? -2.081  14.960  14.054  1.00 0.00 ? 141 GLN A CD   3  
ATOM 7167  O OE1  . GLN A 1 141 ? -2.152  15.648  15.053  1.00 0.00 ? 141 GLN A OE1  3  
ATOM 7168  N NE2  . GLN A 1 141 ? -2.286  15.492  12.878  1.00 0.00 ? 141 GLN A NE2  3  
ATOM 7169  H H    . GLN A 1 141 ? -2.235  10.720  12.095  1.00 0.00 ? 141 GLN A H    3  
ATOM 7170  H HA   . GLN A 1 141 ? -3.303  13.402  12.247  1.00 0.00 ? 141 GLN A HA   3  
ATOM 7171  H HB2  . GLN A 1 141 ? -0.832  11.987  12.916  1.00 0.00 ? 141 GLN A HB2  3  
ATOM 7172  H HB3  . GLN A 1 141 ? -0.550  13.636  12.386  1.00 0.00 ? 141 GLN A HB3  3  
ATOM 7173  H HG2  . GLN A 1 141 ? -2.628  12.922  14.461  1.00 0.00 ? 141 GLN A HG2  3  
ATOM 7174  H HG3  . GLN A 1 141 ? -0.967  13.326  14.885  1.00 0.00 ? 141 GLN A HG3  3  
ATOM 7175  H HE21 . GLN A 1 141 ? -2.227  14.936  12.071  1.00 0.00 ? 141 GLN A HE21 3  
ATOM 7176  H HE22 . GLN A 1 141 ? -2.500  16.445  12.803  1.00 0.00 ? 141 GLN A HE22 3  
ATOM 7177  N N    . GLU A 1 142 ? -1.173  12.751  9.806   1.00 0.00 ? 142 GLU A N    3  
ATOM 7178  C CA   . GLU A 1 142 ? -0.735  13.264  8.483   1.00 0.00 ? 142 GLU A CA   3  
ATOM 7179  C C    . GLU A 1 142 ? -1.913  13.244  7.508   1.00 0.00 ? 142 GLU A C    3  
ATOM 7180  O O    . GLU A 1 142 ? -2.065  14.126  6.688   1.00 0.00 ? 142 GLU A O    3  
ATOM 7181  C CB   . GLU A 1 142 ? 0.397   12.382  7.948   1.00 0.00 ? 142 GLU A CB   3  
ATOM 7182  C CG   . GLU A 1 142 ? 1.589   12.455  8.899   1.00 0.00 ? 142 GLU A CG   3  
ATOM 7183  C CD   . GLU A 1 142 ? 2.737   11.612  8.341   1.00 0.00 ? 142 GLU A CD   3  
ATOM 7184  O OE1  . GLU A 1 142 ? 2.505   10.901  7.379   1.00 0.00 ? 142 GLU A OE1  3  
ATOM 7185  O OE2  . GLU A 1 142 ? 3.826   11.691  8.886   1.00 0.00 ? 142 GLU A OE2  3  
ATOM 7186  H H    . GLU A 1 142 ? -0.775  11.933  10.174  1.00 0.00 ? 142 GLU A H    3  
ATOM 7187  H HA   . GLU A 1 142 ? -0.378  14.279  8.591   1.00 0.00 ? 142 GLU A HA   3  
ATOM 7188  H HB2  . GLU A 1 142 ? 0.053   11.361  7.875   1.00 0.00 ? 142 GLU A HB2  3  
ATOM 7189  H HB3  . GLU A 1 142 ? 0.696   12.735  6.973   1.00 0.00 ? 142 GLU A HB3  3  
ATOM 7190  H HG2  . GLU A 1 142 ? 1.912   13.482  8.998   1.00 0.00 ? 142 GLU A HG2  3  
ATOM 7191  H HG3  . GLU A 1 142 ? 1.304   12.073  9.868   1.00 0.00 ? 142 GLU A HG3  3  
ATOM 7192  H HE2  . GLU A 1 142 ? 4.496   11.134  8.482   1.00 0.00 ? 142 GLU A HE2  3  
ATOM 7193  N N    . GLY A 1 143 ? -2.756  12.252  7.596   1.00 0.00 ? 143 GLY A N    3  
ATOM 7194  C CA   . GLY A 1 143 ? -3.925  12.196  6.676   1.00 0.00 ? 143 GLY A CA   3  
ATOM 7195  C C    . GLY A 1 143 ? -4.766  13.457  6.868   1.00 0.00 ? 143 GLY A C    3  
ATOM 7196  O O    . GLY A 1 143 ? -5.066  14.164  5.930   1.00 0.00 ? 143 GLY A O    3  
ATOM 7197  H H    . GLY A 1 143 ? -2.623  11.549  8.267   1.00 0.00 ? 143 GLY A H    3  
ATOM 7198  H HA2  . GLY A 1 143 ? -3.578  12.140  5.653   1.00 0.00 ? 143 GLY A HA2  3  
ATOM 7199  H HA3  . GLY A 1 143 ? -4.525  11.326  6.903   1.00 0.00 ? 143 GLY A HA3  3  
ATOM 7200  N N    . HIS A 1 144 ? -5.133  13.754  8.083   1.00 0.00 ? 144 HIS A N    3  
ATOM 7201  C CA   . HIS A 1 144 ? -5.938  14.978  8.339   1.00 0.00 ? 144 HIS A CA   3  
ATOM 7202  C C    . HIS A 1 144 ? -5.128  16.199  7.907   1.00 0.00 ? 144 HIS A C    3  
ATOM 7203  O O    . HIS A 1 144 ? -5.639  17.117  7.295   1.00 0.00 ? 144 HIS A O    3  
ATOM 7204  C CB   . HIS A 1 144 ? -6.251  15.081  9.832   1.00 0.00 ? 144 HIS A CB   3  
ATOM 7205  C CG   . HIS A 1 144 ? -7.206  16.218  10.067  1.00 0.00 ? 144 HIS A CG   3  
ATOM 7206  N ND1  . HIS A 1 144 ? -6.771  17.496  10.386  1.00 0.00 ? 144 HIS A ND1  3  
ATOM 7207  C CD2  . HIS A 1 144 ? -8.576  16.286  10.032  1.00 0.00 ? 144 HIS A CD2  3  
ATOM 7208  C CE1  . HIS A 1 144 ? -7.862  18.273  10.527  1.00 0.00 ? 144 HIS A CE1  3  
ATOM 7209  N NE2  . HIS A 1 144 ? -8.983  17.582  10.323  1.00 0.00 ? 144 HIS A NE2  3  
ATOM 7210  H H    . HIS A 1 144 ? -4.868  13.176  8.831   1.00 0.00 ? 144 HIS A H    3  
ATOM 7211  H HA   . HIS A 1 144 ? -6.858  14.932  7.775   1.00 0.00 ? 144 HIS A HA   3  
ATOM 7212  H HB2  . HIS A 1 144 ? -6.697  14.160  10.173  1.00 0.00 ? 144 HIS A HB2  3  
ATOM 7213  H HB3  . HIS A 1 144 ? -5.338  15.262  10.379  1.00 0.00 ? 144 HIS A HB3  3  
ATOM 7214  H HD1  . HIS A 1 144 ? -5.839  17.783  10.488  1.00 0.00 ? 144 HIS A HD1  3  
ATOM 7215  H HD2  . HIS A 1 144 ? -9.235  15.459  9.813   1.00 0.00 ? 144 HIS A HD2  3  
ATOM 7216  H HE1  . HIS A 1 144 ? -7.832  19.324  10.775  1.00 0.00 ? 144 HIS A HE1  3  
ATOM 7217  H HE2  . HIS A 1 144 ? -9.903  17.918  10.367  1.00 0.00 ? 144 HIS A HE2  3  
ATOM 7218  N N    . GLN A 1 145 ? -3.865  16.213  8.230   1.00 0.00 ? 145 GLN A N    3  
ATOM 7219  C CA   . GLN A 1 145 ? -3.004  17.368  7.855   1.00 0.00 ? 145 GLN A CA   3  
ATOM 7220  C C    . GLN A 1 145 ? -3.017  17.565  6.337   1.00 0.00 ? 145 GLN A C    3  
ATOM 7221  O O    . GLN A 1 145 ? -3.114  18.671  5.846   1.00 0.00 ? 145 GLN A O    3  
ATOM 7222  C CB   . GLN A 1 145 ? -1.570  17.090  8.310   1.00 0.00 ? 145 GLN A CB   3  
ATOM 7223  C CG   . GLN A 1 145 ? -0.724  18.350  8.120   1.00 0.00 ? 145 GLN A CG   3  
ATOM 7224  C CD   . GLN A 1 145 ? -1.157  19.413  9.128   1.00 0.00 ? 145 GLN A CD   3  
ATOM 7225  O OE1  . GLN A 1 145 ? -1.372  19.118  10.287  1.00 0.00 ? 145 GLN A OE1  3  
ATOM 7226  N NE2  . GLN A 1 145 ? -1.300  20.650  8.734   1.00 0.00 ? 145 GLN A NE2  3  
ATOM 7227  H H    . GLN A 1 145 ? -3.481  15.460  8.728   1.00 0.00 ? 145 GLN A H    3  
ATOM 7228  H HA   . GLN A 1 145 ? -3.368  18.263  8.339   1.00 0.00 ? 145 GLN A HA   3  
ATOM 7229  H HB2  . GLN A 1 145 ? -1.566  16.804  9.350   1.00 0.00 ? 145 GLN A HB2  3  
ATOM 7230  H HB3  . GLN A 1 145 ? -1.155  16.289  7.716   1.00 0.00 ? 145 GLN A HB3  3  
ATOM 7231  H HG2  . GLN A 1 145 ? 0.318   18.109  8.274   1.00 0.00 ? 145 GLN A HG2  3  
ATOM 7232  H HG3  . GLN A 1 145 ? -0.861  18.728  7.117   1.00 0.00 ? 145 GLN A HG3  3  
ATOM 7233  H HE21 . GLN A 1 145 ? -1.128  20.888  7.798   1.00 0.00 ? 145 GLN A HE21 3  
ATOM 7234  H HE22 . GLN A 1 145 ? -1.579  21.339  9.373   1.00 0.00 ? 145 GLN A HE22 3  
ATOM 7235  N N    . PHE A 1 146 ? -2.902  16.502  5.590   1.00 0.00 ? 146 PHE A N    3  
ATOM 7236  C CA   . PHE A 1 146 ? -2.892  16.629  4.105   1.00 0.00 ? 146 PHE A CA   3  
ATOM 7237  C C    . PHE A 1 146 ? -4.291  16.952  3.571   1.00 0.00 ? 146 PHE A C    3  
ATOM 7238  O O    . PHE A 1 146 ? -4.461  17.833  2.753   1.00 0.00 ? 146 PHE A O    3  
ATOM 7239  C CB   . PHE A 1 146 ? -2.405  15.320  3.490   1.00 0.00 ? 146 PHE A CB   3  
ATOM 7240  C CG   . PHE A 1 146 ? -2.454  15.427  1.985   1.00 0.00 ? 146 PHE A CG   3  
ATOM 7241  C CD1  . PHE A 1 146 ? -3.671  15.255  1.320   1.00 0.00 ? 146 PHE A CD1  3  
ATOM 7242  C CD2  . PHE A 1 146 ? -1.290  15.694  1.256   1.00 0.00 ? 146 PHE A CD2  3  
ATOM 7243  C CE1  . PHE A 1 146 ? -3.729  15.347  -0.073  1.00 0.00 ? 146 PHE A CE1  3  
ATOM 7244  C CE2  . PHE A 1 146 ? -1.345  15.787  -0.140  1.00 0.00 ? 146 PHE A CE2  3  
ATOM 7245  C CZ   . PHE A 1 146 ? -2.566  15.614  -0.804  1.00 0.00 ? 146 PHE A CZ   3  
ATOM 7246  H H    . PHE A 1 146 ? -2.814  15.618  6.007   1.00 0.00 ? 146 PHE A H    3  
ATOM 7247  H HA   . PHE A 1 146 ? -2.215  17.423  3.825   1.00 0.00 ? 146 PHE A HA   3  
ATOM 7248  H HB2  . PHE A 1 146 ? -1.389  15.135  3.806   1.00 0.00 ? 146 PHE A HB2  3  
ATOM 7249  H HB3  . PHE A 1 146 ? -3.039  14.510  3.814   1.00 0.00 ? 146 PHE A HB3  3  
ATOM 7250  H HD1  . PHE A 1 146 ? -4.569  15.052  1.884   1.00 0.00 ? 146 PHE A HD1  3  
ATOM 7251  H HD2  . PHE A 1 146 ? -0.348  15.826  1.770   1.00 0.00 ? 146 PHE A HD2  3  
ATOM 7252  H HE1  . PHE A 1 146 ? -4.671  15.216  -0.585  1.00 0.00 ? 146 PHE A HE1  3  
ATOM 7253  H HE2  . PHE A 1 146 ? -0.447  15.992  -0.704  1.00 0.00 ? 146 PHE A HE2  3  
ATOM 7254  H HZ   . PHE A 1 146 ? -2.610  15.685  -1.882  1.00 0.00 ? 146 PHE A HZ   3  
ATOM 7255  N N    . LEU A 1 147 ? -5.293  16.242  4.008   1.00 0.00 ? 147 LEU A N    3  
ATOM 7256  C CA   . LEU A 1 147 ? -6.668  16.518  3.497   1.00 0.00 ? 147 LEU A CA   3  
ATOM 7257  C C    . LEU A 1 147 ? -7.014  17.989  3.716   1.00 0.00 ? 147 LEU A C    3  
ATOM 7258  O O    . LEU A 1 147 ? -7.667  18.609  2.900   1.00 0.00 ? 147 LEU A O    3  
ATOM 7259  C CB   . LEU A 1 147 ? -7.682  15.631  4.223   1.00 0.00 ? 147 LEU A CB   3  
ATOM 7260  C CG   . LEU A 1 147 ? -7.416  14.165  3.882   1.00 0.00 ? 147 LEU A CG   3  
ATOM 7261  C CD1  . LEU A 1 147 ? -8.458  13.283  4.566   1.00 0.00 ? 147 LEU A CD1  3  
ATOM 7262  C CD2  . LEU A 1 147 ? -7.512  13.960  2.369   1.00 0.00 ? 147 LEU A CD2  3  
ATOM 7263  H H    . LEU A 1 147 ? -5.144  15.525  4.657   1.00 0.00 ? 147 LEU A H    3  
ATOM 7264  H HA   . LEU A 1 147 ? -6.699  16.301  2.441   1.00 0.00 ? 147 LEU A HA   3  
ATOM 7265  H HB2  . LEU A 1 147 ? -7.590  15.778  5.289   1.00 0.00 ? 147 LEU A HB2  3  
ATOM 7266  H HB3  . LEU A 1 147 ? -8.681  15.896  3.907   1.00 0.00 ? 147 LEU A HB3  3  
ATOM 7267  H HG   . LEU A 1 147 ? -6.429  13.887  4.220   1.00 0.00 ? 147 LEU A HG   3  
ATOM 7268  H HD11 . LEU A 1 147 ? -7.998  12.742  5.376   1.00 0.00 ? 147 LEU A HD11 3  
ATOM 7269  H HD12 . LEU A 1 147 ? -8.857  12.585  3.846   1.00 0.00 ? 147 LEU A HD12 3  
ATOM 7270  H HD13 . LEU A 1 147 ? -9.254  13.900  4.951   1.00 0.00 ? 147 LEU A HD13 3  
ATOM 7271  H HD21 . LEU A 1 147 ? -7.831  12.949  2.162   1.00 0.00 ? 147 LEU A HD21 3  
ATOM 7272  H HD22 . LEU A 1 147 ? -6.546  14.131  1.920   1.00 0.00 ? 147 LEU A HD22 3  
ATOM 7273  H HD23 . LEU A 1 147 ? -8.228  14.655  1.956   1.00 0.00 ? 147 LEU A HD23 3  
ATOM 7274  N N    . CYS A 1 148 ? -6.575  18.559  4.803   1.00 0.00 ? 148 CYS A N    3  
ATOM 7275  C CA   . CYS A 1 148 ? -6.873  19.995  5.054   1.00 0.00 ? 148 CYS A CA   3  
ATOM 7276  C C    . CYS A 1 148 ? -6.075  20.850  4.068   1.00 0.00 ? 148 CYS A C    3  
ATOM 7277  O O    . CYS A 1 148 ? -6.329  22.026  3.901   1.00 0.00 ? 148 CYS A O    3  
ATOM 7278  C CB   . CYS A 1 148 ? -6.473  20.357  6.486   1.00 0.00 ? 148 CYS A CB   3  
ATOM 7279  S SG   . CYS A 1 148 ? -7.536  19.468  7.651   1.00 0.00 ? 148 CYS A SG   3  
ATOM 7280  H H    . CYS A 1 148 ? -6.043  18.047  5.446   1.00 0.00 ? 148 CYS A H    3  
ATOM 7281  H HA   . CYS A 1 148 ? -7.929  20.174  4.915   1.00 0.00 ? 148 CYS A HA   3  
ATOM 7282  H HB2  . CYS A 1 148 ? -5.444  20.080  6.654   1.00 0.00 ? 148 CYS A HB2  3  
ATOM 7283  H HB3  . CYS A 1 148 ? -6.588  21.421  6.634   1.00 0.00 ? 148 CYS A HB3  3  
ATOM 7284  H HG   . CYS A 1 148 ? -7.284  18.543  7.634   1.00 0.00 ? 148 CYS A HG   3  
ATOM 7285  N N    . SER A 1 149 ? -5.098  20.268  3.424   1.00 0.00 ? 149 SER A N    3  
ATOM 7286  C CA   . SER A 1 149 ? -4.270  21.045  2.459   1.00 0.00 ? 149 SER A CA   3  
ATOM 7287  C C    . SER A 1 149 ? -4.907  21.027  1.071   1.00 0.00 ? 149 SER A C    3  
ATOM 7288  O O    . SER A 1 149 ? -4.492  21.744  0.184   1.00 0.00 ? 149 SER A O    3  
ATOM 7289  C CB   . SER A 1 149 ? -2.875  20.430  2.375   1.00 0.00 ? 149 SER A CB   3  
ATOM 7290  O OG   . SER A 1 149 ? -1.964  21.224  3.122   1.00 0.00 ? 149 SER A OG   3  
ATOM 7291  H H    . SER A 1 149 ? -4.905  19.318  3.580   1.00 0.00 ? 149 SER A H    3  
ATOM 7292  H HA   . SER A 1 149 ? -4.188  22.068  2.801   1.00 0.00 ? 149 SER A HA   3  
ATOM 7293  H HB2  . SER A 1 149 ? -2.894  19.434  2.781   1.00 0.00 ? 149 SER A HB2  3  
ATOM 7294  H HB3  . SER A 1 149 ? -2.565  20.389  1.338   1.00 0.00 ? 149 SER A HB3  3  
ATOM 7295  H HG   . SER A 1 149 ? -2.454  21.952  3.512   1.00 0.00 ? 149 SER A HG   3  
ATOM 7296  N N    . ILE A 1 150 ? -5.903  20.213  0.863   1.00 0.00 ? 150 ILE A N    3  
ATOM 7297  C CA   . ILE A 1 150 ? -6.536  20.165  -0.478  1.00 0.00 ? 150 ILE A CA   3  
ATOM 7298  C C    . ILE A 1 150 ? -7.565  21.291  -0.587  1.00 0.00 ? 150 ILE A C    3  
ATOM 7299  O O    . ILE A 1 150 ? -7.302  22.426  -0.243  1.00 0.00 ? 150 ILE A O    3  
ATOM 7300  C CB   . ILE A 1 150 ? -7.238  18.821  -0.686  1.00 0.00 ? 150 ILE A CB   3  
ATOM 7301  C CG1  . ILE A 1 150 ? -6.514  17.715  0.082   1.00 0.00 ? 150 ILE A CG1  3  
ATOM 7302  C CG2  . ILE A 1 150 ? -7.226  18.476  -2.172  1.00 0.00 ? 150 ILE A CG2  3  
ATOM 7303  C CD1  . ILE A 1 150 ? -7.361  16.444  0.036   1.00 0.00 ? 150 ILE A CD1  3  
ATOM 7304  H H    . ILE A 1 150 ? -6.230  19.635  1.581   1.00 0.00 ? 150 ILE A H    3  
ATOM 7305  H HA   . ILE A 1 150 ? -5.778  20.296  -1.235  1.00 0.00 ? 150 ILE A HA   3  
ATOM 7306  H HB   . ILE A 1 150 ? -8.258  18.890  -0.339  1.00 0.00 ? 150 ILE A HB   3  
ATOM 7307  H HG12 . ILE A 1 150 ? -5.553  17.524  -0.373  1.00 0.00 ? 150 ILE A HG12 3  
ATOM 7308  H HG13 . ILE A 1 150 ? -6.374  18.016  1.108   1.00 0.00 ? 150 ILE A HG13 3  
ATOM 7309  H HG21 . ILE A 1 150 ? -6.209  18.289  -2.487  1.00 0.00 ? 150 ILE A HG21 3  
ATOM 7310  H HG22 . ILE A 1 150 ? -7.633  19.303  -2.735  1.00 0.00 ? 150 ILE A HG22 3  
ATOM 7311  H HG23 . ILE A 1 150 ? -7.823  17.595  -2.342  1.00 0.00 ? 150 ILE A HG23 3  
ATOM 7312  H HD11 . ILE A 1 150 ? -6.747  15.592  0.286   1.00 0.00 ? 150 ILE A HD11 3  
ATOM 7313  H HD12 . ILE A 1 150 ? -7.766  16.316  -0.956  1.00 0.00 ? 150 ILE A HD12 3  
ATOM 7314  H HD13 . ILE A 1 150 ? -8.170  16.528  0.747   1.00 0.00 ? 150 ILE A HD13 3  
ATOM 7315  N N    . GLU A 1 151 ? -8.734  20.974  -1.062  1.00 0.00 ? 151 GLU A N    3  
ATOM 7316  C CA   . GLU A 1 151 ? -9.798  22.007  -1.199  1.00 0.00 ? 151 GLU A CA   3  
ATOM 7317  C C    . GLU A 1 151 ? -10.972 21.651  -0.284  1.00 0.00 ? 151 GLU A C    3  
ATOM 7318  O O    . GLU A 1 151 ? -10.997 22.003  0.878   1.00 0.00 ? 151 GLU A O    3  
ATOM 7319  C CB   . GLU A 1 151 ? -10.276 22.053  -2.650  1.00 0.00 ? 151 GLU A CB   3  
ATOM 7320  C CG   . GLU A 1 151 ? -11.300 23.177  -2.815  1.00 0.00 ? 151 GLU A CG   3  
ATOM 7321  C CD   . GLU A 1 151 ? -11.850 23.161  -4.242  1.00 0.00 ? 151 GLU A CD   3  
ATOM 7322  O OE1  . GLU A 1 151 ? -12.681 24.001  -4.544  1.00 0.00 ? 151 GLU A OE1  3  
ATOM 7323  O OE2  . GLU A 1 151 ? -11.432 22.309  -5.007  1.00 0.00 ? 151 GLU A OE2  3  
ATOM 7324  H H    . GLU A 1 151 ? -8.915  20.049  -1.322  1.00 0.00 ? 151 GLU A H    3  
ATOM 7325  H HA   . GLU A 1 151 ? -9.403  22.973  -0.918  1.00 0.00 ? 151 GLU A HA   3  
ATOM 7326  H HB2  . GLU A 1 151 ? -9.434  22.232  -3.300  1.00 0.00 ? 151 GLU A HB2  3  
ATOM 7327  H HB3  . GLU A 1 151 ? -10.734 21.111  -2.907  1.00 0.00 ? 151 GLU A HB3  3  
ATOM 7328  H HG2  . GLU A 1 151 ? -12.111 23.032  -2.113  1.00 0.00 ? 151 GLU A HG2  3  
ATOM 7329  H HG3  . GLU A 1 151 ? -10.827 24.128  -2.623  1.00 0.00 ? 151 GLU A HG3  3  
ATOM 7330  H HE2  . GLU A 1 151 ? -11.821 22.358  -5.883  1.00 0.00 ? 151 GLU A HE2  3  
ATOM 7331  N N    . ALA A 1 152 ? -11.947 20.952  -0.802  1.00 0.00 ? 152 ALA A N    3  
ATOM 7332  C CA   . ALA A 1 152 ? -13.119 20.566  0.031   1.00 0.00 ? 152 ALA A CA   3  
ATOM 7333  C C    . ALA A 1 152 ? -13.629 19.197  -0.420  1.00 0.00 ? 152 ALA A C    3  
ATOM 7334  O O    . ALA A 1 152 ? -14.432 18.571  0.246   1.00 0.00 ? 152 ALA A O    3  
ATOM 7335  C CB   . ALA A 1 152 ? -14.229 21.604  -0.140  1.00 0.00 ? 152 ALA A CB   3  
ATOM 7336  H H    . ALA A 1 152 ? -11.904 20.677  -1.742  1.00 0.00 ? 152 ALA A H    3  
ATOM 7337  H HA   . ALA A 1 152 ? -12.824 20.519  1.068   1.00 0.00 ? 152 ALA A HA   3  
ATOM 7338  H HB1  . ALA A 1 152 ? -14.737 21.436  -1.077  1.00 0.00 ? 152 ALA A HB1  3  
ATOM 7339  H HB2  . ALA A 1 152 ? -13.799 22.594  -0.134  1.00 0.00 ? 152 ALA A HB2  3  
ATOM 7340  H HB3  . ALA A 1 152 ? -14.935 21.513  0.673   1.00 0.00 ? 152 ALA A HB3  3  
ATOM 7341  N N    . LEU A 1 153 ? -13.171 18.725  -1.546  1.00 0.00 ? 153 LEU A N    3  
ATOM 7342  C CA   . LEU A 1 153 ? -13.632 17.396  -2.041  1.00 0.00 ? 153 LEU A CA   3  
ATOM 7343  C C    . LEU A 1 153 ? -12.422 16.582  -2.502  1.00 0.00 ? 153 LEU A C    3  
ATOM 7344  O O    . LEU A 1 153 ? -11.285 17.043  -2.419  1.00 0.00 ? 153 LEU A O    3  
ATOM 7345  C CB   . LEU A 1 153 ? -14.596 17.594  -3.214  1.00 0.00 ? 153 LEU A CB   3  
ATOM 7346  C CG   . LEU A 1 153 ? -15.122 16.237  -3.684  1.00 0.00 ? 153 LEU A CG   3  
ATOM 7347  C CD1  . LEU A 1 153 ? -16.045 15.644  -2.617  1.00 0.00 ? 153 LEU A CD1  3  
ATOM 7348  C CD2  . LEU A 1 153 ? -15.905 16.420  -4.986  1.00 0.00 ? 153 LEU A CD2  3  
ATOM 7349  H H    . LEU A 1 153 ? -12.525 19.246  -2.070  1.00 0.00 ? 153 LEU A H    3  
ATOM 7350  H HA   . LEU A 1 153 ? -14.136 16.870  -1.245  1.00 0.00 ? 153 LEU A HA   3  
ATOM 7351  H HB2  . LEU A 1 153 ? -15.422 18.214  -2.899  1.00 0.00 ? 153 LEU A HB2  3  
ATOM 7352  H HB3  . LEU A 1 153 ? -14.076 18.076  -4.029  1.00 0.00 ? 153 LEU A HB3  3  
ATOM 7353  H HG   . LEU A 1 153 ? -14.292 15.566  -3.852  1.00 0.00 ? 153 LEU A HG   3  
ATOM 7354  H HD11 . LEU A 1 153 ? -16.891 15.172  -3.094  1.00 0.00 ? 153 LEU A HD11 3  
ATOM 7355  H HD12 . LEU A 1 153 ? -16.391 16.428  -1.961  1.00 0.00 ? 153 LEU A HD12 3  
ATOM 7356  H HD13 . LEU A 1 153 ? -15.501 14.906  -2.043  1.00 0.00 ? 153 LEU A HD13 3  
ATOM 7357  H HD21 . LEU A 1 153 ? -15.988 17.472  -5.211  1.00 0.00 ? 153 LEU A HD21 3  
ATOM 7358  H HD22 . LEU A 1 153 ? -16.892 15.995  -4.877  1.00 0.00 ? 153 LEU A HD22 3  
ATOM 7359  H HD23 . LEU A 1 153 ? -15.385 15.921  -5.789  1.00 0.00 ? 153 LEU A HD23 3  
ATOM 7360  N N    . GLY A 1 1   ? 12.072  -5.192  -6.378  1.00 0.00 ? 1   GLY A N    4  
ATOM 7361  C CA   . GLY A 1 1   ? 11.202  -6.350  -6.318  1.00 0.00 ? 1   GLY A CA   4  
ATOM 7362  C C    . GLY A 1 1   ? 11.955  -7.597  -6.759  1.00 0.00 ? 1   GLY A C    4  
ATOM 7363  O O    . GLY A 1 1   ? 11.358  -8.528  -7.297  1.00 0.00 ? 1   GLY A O    4  
ATOM 7364  H H1   . GLY A 1 1   ? 13.025  -5.321  -6.685  1.00 0.00 ? 1   GLY A H1   4  
ATOM 7365  H HA2  . GLY A 1 1   ? 10.850  -6.484  -5.296  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 7366  H HA3  . GLY A 1 1   ? 10.348  -6.193  -6.977  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 7367  N N    . PRO A 1 2   ? 13.270  -7.614  -6.530  1.00 0.00 ? 2   PRO A N    4  
ATOM 7368  C CA   . PRO A 1 2   ? 14.145  -8.712  -6.880  1.00 0.00 ? 2   PRO A CA   4  
ATOM 7369  C C    . PRO A 1 2   ? 13.895  -9.884  -5.941  1.00 0.00 ? 2   PRO A C    4  
ATOM 7370  O O    . PRO A 1 2   ? 12.920  -9.885  -5.193  1.00 0.00 ? 2   PRO A O    4  
ATOM 7371  C CB   . PRO A 1 2   ? 15.557  -8.160  -6.702  1.00 0.00 ? 2   PRO A CB   4  
ATOM 7372  C CG   . PRO A 1 2   ? 15.378  -7.126  -5.591  1.00 0.00 ? 2   PRO A CG   4  
ATOM 7373  C CD   . PRO A 1 2   ? 14.003  -6.538  -5.899  1.00 0.00 ? 2   PRO A CD   4  
ATOM 7374  H HA   . PRO A 1 2   ? 13.987  -9.025  -7.912  1.00 0.00 ? 2   PRO A HA   4  
ATOM 7375  H HB2  . PRO A 1 2   ? 16.275  -8.936  -6.435  1.00 0.00 ? 2   PRO A HB2  4  
ATOM 7376  H HB3  . PRO A 1 2   ? 15.861  -7.651  -7.616  1.00 0.00 ? 2   PRO A HB3  4  
ATOM 7377  H HG2  . PRO A 1 2   ? 15.343  -7.638  -4.629  1.00 0.00 ? 2   PRO A HG2  4  
ATOM 7378  H HG3  . PRO A 1 2   ? 16.163  -6.369  -5.597  1.00 0.00 ? 2   PRO A HG3  4  
ATOM 7379  H HD2  . PRO A 1 2   ? 13.512  -6.200  -4.986  1.00 0.00 ? 2   PRO A HD2  4  
ATOM 7380  H HD3  . PRO A 1 2   ? 14.103  -5.713  -6.604  1.00 0.00 ? 2   PRO A HD3  4  
ATOM 7381  N N    . LEU A 1 3   ? 14.729  -10.879 -5.949  1.00 0.00 ? 3   LEU A N    4  
ATOM 7382  C CA   . LEU A 1 3   ? 14.524  -12.050 -5.050  1.00 0.00 ? 3   LEU A CA   4  
ATOM 7383  C C    . LEU A 1 3   ? 15.125  -11.748 -3.675  1.00 0.00 ? 3   LEU A C    4  
ATOM 7384  O O    . LEU A 1 3   ? 16.127  -11.070 -3.559  1.00 0.00 ? 3   LEU A O    4  
ATOM 7385  C CB   . LEU A 1 3   ? 15.213  -13.277 -5.648  1.00 0.00 ? 3   LEU A CB   4  
ATOM 7386  C CG   . LEU A 1 3   ? 14.728  -13.489 -7.082  1.00 0.00 ? 3   LEU A CG   4  
ATOM 7387  C CD1  . LEU A 1 3   ? 15.329  -14.780 -7.639  1.00 0.00 ? 3   LEU A CD1  4  
ATOM 7388  C CD2  . LEU A 1 3   ? 13.200  -13.593 -7.093  1.00 0.00 ? 3   LEU A CD2  4  
ATOM 7389  H H    . LEU A 1 3   ? 15.498  -10.857 -6.555  1.00 0.00 ? 3   LEU A H    4  
ATOM 7390  H HA   . LEU A 1 3   ? 13.467  -12.244 -4.946  1.00 0.00 ? 3   LEU A HA   4  
ATOM 7391  H HB2  . LEU A 1 3   ? 16.282  -13.124 -5.649  1.00 0.00 ? 3   LEU A HB2  4  
ATOM 7392  H HB3  . LEU A 1 3   ? 14.975  -14.148 -5.056  1.00 0.00 ? 3   LEU A HB3  4  
ATOM 7393  H HG   . LEU A 1 3   ? 15.039  -12.654 -7.694  1.00 0.00 ? 3   LEU A HG   4  
ATOM 7394  H HD11 . LEU A 1 3   ? 15.696  -14.604 -8.639  1.00 0.00 ? 3   LEU A HD11 4  
ATOM 7395  H HD12 . LEU A 1 3   ? 14.572  -15.550 -7.666  1.00 0.00 ? 3   LEU A HD12 4  
ATOM 7396  H HD13 . LEU A 1 3   ? 16.144  -15.100 -7.007  1.00 0.00 ? 3   LEU A HD13 4  
ATOM 7397  H HD21 . LEU A 1 3   ? 12.870  -14.132 -6.217  1.00 0.00 ? 3   LEU A HD21 4  
ATOM 7398  H HD22 . LEU A 1 3   ? 12.881  -14.119 -7.983  1.00 0.00 ? 3   LEU A HD22 4  
ATOM 7399  H HD23 . LEU A 1 3   ? 12.772  -12.602 -7.089  1.00 0.00 ? 3   LEU A HD23 4  
ATOM 7400  N N    . GLY A 1 4   ? 14.521  -12.251 -2.630  1.00 0.00 ? 4   GLY A N    4  
ATOM 7401  C CA   . GLY A 1 4   ? 15.061  -11.992 -1.265  1.00 0.00 ? 4   GLY A CA   4  
ATOM 7402  C C    . GLY A 1 4   ? 14.629  -10.603 -0.794  1.00 0.00 ? 4   GLY A C    4  
ATOM 7403  O O    . GLY A 1 4   ? 15.393  -9.877  -0.189  1.00 0.00 ? 4   GLY A O    4  
ATOM 7404  H H    . GLY A 1 4   ? 13.716  -12.796 -2.743  1.00 0.00 ? 4   GLY A H    4  
ATOM 7405  H HA2  . GLY A 1 4   ? 14.682  -12.739 -0.582  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 7406  H HA3  . GLY A 1 4   ? 16.140  -12.040 -1.289  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 7407  N N    . SER A 1 5   ? 13.409  -10.225 -1.063  1.00 0.00 ? 5   SER A N    4  
ATOM 7408  C CA   . SER A 1 5   ? 12.936  -8.883  -0.625  1.00 0.00 ? 5   SER A CA   4  
ATOM 7409  C C    . SER A 1 5   ? 13.007  -8.797  0.902   1.00 0.00 ? 5   SER A C    4  
ATOM 7410  O O    . SER A 1 5   ? 12.742  -9.754  1.599   1.00 0.00 ? 5   SER A O    4  
ATOM 7411  C CB   . SER A 1 5   ? 11.490  -8.677  -1.080  1.00 0.00 ? 5   SER A CB   4  
ATOM 7412  O OG   . SER A 1 5   ? 11.084  -7.350  -0.767  1.00 0.00 ? 5   SER A OG   4  
ATOM 7413  H H    . SER A 1 5   ? 12.805  -10.825 -1.550  1.00 0.00 ? 5   SER A H    4  
ATOM 7414  H HA   . SER A 1 5   ? 13.562  -8.119  -1.060  1.00 0.00 ? 5   SER A HA   4  
ATOM 7415  H HB2  . SER A 1 5   ? 11.419  -8.826  -2.144  1.00 0.00 ? 5   SER A HB2  4  
ATOM 7416  H HB3  . SER A 1 5   ? 10.848  -9.389  -0.577  1.00 0.00 ? 5   SER A HB3  4  
ATOM 7417  H HG   . SER A 1 5   ? 11.050  -6.849  -1.585  1.00 0.00 ? 5   SER A HG   4  
ATOM 7418  N N    . MET A 1 6   ? 13.372  -7.657  1.424   1.00 0.00 ? 6   MET A N    4  
ATOM 7419  C CA   . MET A 1 6   ? 13.469  -7.516  2.901   1.00 0.00 ? 6   MET A CA   4  
ATOM 7420  C C    . MET A 1 6   ? 12.164  -6.949  3.457   1.00 0.00 ? 6   MET A C    4  
ATOM 7421  O O    . MET A 1 6   ? 11.599  -6.017  2.921   1.00 0.00 ? 6   MET A O    4  
ATOM 7422  C CB   . MET A 1 6   ? 14.612  -6.563  3.256   1.00 0.00 ? 6   MET A CB   4  
ATOM 7423  C CG   . MET A 1 6   ? 14.868  -6.622  4.763   1.00 0.00 ? 6   MET A CG   4  
ATOM 7424  S SD   . MET A 1 6   ? 15.563  -5.048  5.322   1.00 0.00 ? 6   MET A SD   4  
ATOM 7425  C CE   . MET A 1 6   ? 14.005  -4.284  5.843   1.00 0.00 ? 6   MET A CE   4  
ATOM 7426  H H    . MET A 1 6   ? 13.587  -6.898  0.845   1.00 0.00 ? 6   MET A H    4  
ATOM 7427  H HA   . MET A 1 6   ? 13.658  -8.482  3.345   1.00 0.00 ? 6   MET A HA   4  
ATOM 7428  H HB2  . MET A 1 6   ? 15.505  -6.860  2.725   1.00 0.00 ? 6   MET A HB2  4  
ATOM 7429  H HB3  . MET A 1 6   ? 14.342  -5.556  2.977   1.00 0.00 ? 6   MET A HB3  4  
ATOM 7430  H HG2  . MET A 1 6   ? 13.938  -6.810  5.276   1.00 0.00 ? 6   MET A HG2  4  
ATOM 7431  H HG3  . MET A 1 6   ? 15.564  -7.420  4.977   1.00 0.00 ? 6   MET A HG3  4  
ATOM 7432  H HE1  . MET A 1 6   ? 13.442  -4.985  6.449   1.00 0.00 ? 6   MET A HE1  4  
ATOM 7433  H HE2  . MET A 1 6   ? 13.425  -4.019  4.975   1.00 0.00 ? 6   MET A HE2  4  
ATOM 7434  H HE3  . MET A 1 6   ? 14.216  -3.395  6.420   1.00 0.00 ? 6   MET A HE3  4  
ATOM 7435  N N    . ALA A 1 7   ? 11.690  -7.499  4.538   1.00 0.00 ? 7   ALA A N    4  
ATOM 7436  C CA   . ALA A 1 7   ? 10.432  -6.988  5.148   1.00 0.00 ? 7   ALA A CA   4  
ATOM 7437  C C    . ALA A 1 7   ? 9.226   -7.528  4.390   1.00 0.00 ? 7   ALA A C    4  
ATOM 7438  O O    . ALA A 1 7   ? 9.331   -7.998  3.276   1.00 0.00 ? 7   ALA A O    4  
ATOM 7439  C CB   . ALA A 1 7   ? 10.422  -5.458  5.099   1.00 0.00 ? 7   ALA A CB   4  
ATOM 7440  H H    . ALA A 1 7   ? 12.172  -8.242  4.959   1.00 0.00 ? 7   ALA A H    4  
ATOM 7441  H HA   . ALA A 1 7   ? 10.375  -7.315  6.177   1.00 0.00 ? 7   ALA A HA   4  
ATOM 7442  H HB1  . ALA A 1 7   ? 11.437  -5.094  5.072   1.00 0.00 ? 7   ALA A HB1  4  
ATOM 7443  H HB2  . ALA A 1 7   ? 9.924   -5.070  5.976   1.00 0.00 ? 7   ALA A HB2  4  
ATOM 7444  H HB3  . ALA A 1 7   ? 9.898   -5.130  4.214   1.00 0.00 ? 7   ALA A HB3  4  
ATOM 7445  N N    . LEU A 1 8   ? 8.079   -7.463  4.999   1.00 0.00 ? 8   LEU A N    4  
ATOM 7446  C CA   . LEU A 1 8   ? 6.848   -7.972  4.333   1.00 0.00 ? 8   LEU A CA   4  
ATOM 7447  C C    . LEU A 1 8   ? 6.079   -6.801  3.722   1.00 0.00 ? 8   LEU A C    4  
ATOM 7448  O O    . LEU A 1 8   ? 5.994   -5.734  4.296   1.00 0.00 ? 8   LEU A O    4  
ATOM 7449  C CB   . LEU A 1 8   ? 5.957   -8.672  5.361   1.00 0.00 ? 8   LEU A CB   4  
ATOM 7450  C CG   . LEU A 1 8   ? 6.824   -9.392  6.399   1.00 0.00 ? 8   LEU A CG   4  
ATOM 7451  C CD1  . LEU A 1 8   ? 7.480   -8.368  7.324   1.00 0.00 ? 8   LEU A CD1  4  
ATOM 7452  C CD2  . LEU A 1 8   ? 5.939   -10.318 7.232   1.00 0.00 ? 8   LEU A CD2  4  
ATOM 7453  H H    . LEU A 1 8   ? 8.029   -7.079  5.900   1.00 0.00 ? 8   LEU A H    4  
ATOM 7454  H HA   . LEU A 1 8   ? 7.121   -8.671  3.555   1.00 0.00 ? 8   LEU A HA   4  
ATOM 7455  H HB2  . LEU A 1 8   ? 5.332   -7.942  5.850   1.00 0.00 ? 8   LEU A HB2  4  
ATOM 7456  H HB3  . LEU A 1 8   ? 5.332   -9.395  4.857   1.00 0.00 ? 8   LEU A HB3  4  
ATOM 7457  H HG   . LEU A 1 8   ? 7.586   -9.971  5.898   1.00 0.00 ? 8   LEU A HG   4  
ATOM 7458  H HD11 . LEU A 1 8   ? 8.535   -8.282  7.087   1.00 0.00 ? 8   LEU A HD11 4  
ATOM 7459  H HD12 . LEU A 1 8   ? 7.371   -8.686  8.348   1.00 0.00 ? 8   LEU A HD12 4  
ATOM 7460  H HD13 . LEU A 1 8   ? 7.004   -7.411  7.196   1.00 0.00 ? 8   LEU A HD13 4  
ATOM 7461  H HD21 . LEU A 1 8   ? 6.516   -10.722 8.052   1.00 0.00 ? 8   LEU A HD21 4  
ATOM 7462  H HD22 . LEU A 1 8   ? 5.577   -11.124 6.614   1.00 0.00 ? 8   LEU A HD22 4  
ATOM 7463  H HD23 . LEU A 1 8   ? 5.102   -9.758  7.624   1.00 0.00 ? 8   LEU A HD23 4  
ATOM 7464  N N    . ARG A 1 9   ? 5.507   -6.993  2.566   1.00 0.00 ? 9   ARG A N    4  
ATOM 7465  C CA   . ARG A 1 9   ? 4.732   -5.893  1.927   1.00 0.00 ? 9   ARG A CA   4  
ATOM 7466  C C    . ARG A 1 9   ? 3.306   -5.905  2.477   1.00 0.00 ? 9   ARG A C    4  
ATOM 7467  O O    . ARG A 1 9   ? 2.692   -6.945  2.608   1.00 0.00 ? 9   ARG A O    4  
ATOM 7468  C CB   . ARG A 1 9   ? 4.695   -6.109  0.414   1.00 0.00 ? 9   ARG A CB   4  
ATOM 7469  C CG   . ARG A 1 9   ? 4.065   -4.889  -0.261  1.00 0.00 ? 9   ARG A CG   4  
ATOM 7470  C CD   . ARG A 1 9   ? 3.968   -5.139  -1.768  1.00 0.00 ? 9   ARG A CD   4  
ATOM 7471  N NE   . ARG A 1 9   ? 5.331   -5.400  -2.312  1.00 0.00 ? 9   ARG A NE   4  
ATOM 7472  C CZ   . ARG A 1 9   ? 5.566   -5.241  -3.584  1.00 0.00 ? 9   ARG A CZ   4  
ATOM 7473  N NH1  . ARG A 1 9   ? 4.610   -4.853  -4.382  1.00 0.00 ? 9   ARG A NH1  4  
ATOM 7474  N NH2  . ARG A 1 9   ? 6.760   -5.470  -4.059  1.00 0.00 ? 9   ARG A NH2  4  
ATOM 7475  H H    . ARG A 1 9   ? 5.580   -7.863  2.123   1.00 0.00 ? 9   ARG A H    4  
ATOM 7476  H HA   . ARG A 1 9   ? 5.198   -4.945  2.148   1.00 0.00 ? 9   ARG A HA   4  
ATOM 7477  H HB2  . ARG A 1 9   ? 5.701   -6.246  0.045   1.00 0.00 ? 9   ARG A HB2  4  
ATOM 7478  H HB3  . ARG A 1 9   ? 4.107   -6.985  0.188   1.00 0.00 ? 9   ARG A HB3  4  
ATOM 7479  H HG2  . ARG A 1 9   ? 3.077   -4.724  0.141   1.00 0.00 ? 9   ARG A HG2  4  
ATOM 7480  H HG3  . ARG A 1 9   ? 4.679   -4.020  -0.082  1.00 0.00 ? 9   ARG A HG3  4  
ATOM 7481  H HD2  . ARG A 1 9   ? 3.336   -5.996  -1.951  1.00 0.00 ? 9   ARG A HD2  4  
ATOM 7482  H HD3  . ARG A 1 9   ? 3.547   -4.269  -2.251  1.00 0.00 ? 9   ARG A HD3  4  
ATOM 7483  H HE   . ARG A 1 9   ? 6.049   -5.689  -1.712  1.00 0.00 ? 9   ARG A HE   4  
ATOM 7484  H HH11 . ARG A 1 9   ? 3.696   -4.678  -4.019  1.00 0.00 ? 9   ARG A HH11 4  
ATOM 7485  H HH12 . ARG A 1 9   ? 4.792   -4.732  -5.359  1.00 0.00 ? 9   ARG A HH12 4  
ATOM 7486  H HH21 . ARG A 1 9   ? 7.493   -5.767  -3.447  1.00 0.00 ? 9   ARG A HH21 4  
ATOM 7487  H HH22 . ARG A 1 9   ? 6.942   -5.349  -5.034  1.00 0.00 ? 9   ARG A HH22 4  
ATOM 7488  N N    . ALA A 1 10  ? 2.772   -4.763  2.803   1.00 0.00 ? 10  ALA A N    4  
ATOM 7489  C CA   . ALA A 1 10  ? 1.384   -4.722  3.344   1.00 0.00 ? 10  ALA A CA   4  
ATOM 7490  C C    . ALA A 1 10  ? 0.685   -3.454  2.865   1.00 0.00 ? 10  ALA A C    4  
ATOM 7491  O O    . ALA A 1 10  ? 1.311   -2.442  2.619   1.00 0.00 ? 10  ALA A O    4  
ATOM 7492  C CB   . ALA A 1 10  ? 1.430   -4.715  4.869   1.00 0.00 ? 10  ALA A CB   4  
ATOM 7493  H H    . ALA A 1 10  ? 3.281   -3.932  2.691   1.00 0.00 ? 10  ALA A H    4  
ATOM 7494  H HA   . ALA A 1 10  ? 0.837   -5.588  3.002   1.00 0.00 ? 10  ALA A HA   4  
ATOM 7495  H HB1  . ALA A 1 10  ? 0.871   -3.866  5.240   1.00 0.00 ? 10  ALA A HB1  4  
ATOM 7496  H HB2  . ALA A 1 10  ? 2.455   -4.644  5.199   1.00 0.00 ? 10  ALA A HB2  4  
ATOM 7497  H HB3  . ALA A 1 10  ? 0.992   -5.628  5.249   1.00 0.00 ? 10  ALA A HB3  4  
ATOM 7498  N N    . CYS A 1 11  ? -0.611  -3.496  2.744   1.00 0.00 ? 11  CYS A N    4  
ATOM 7499  C CA   . CYS A 1 11  ? -1.347  -2.287  2.297   1.00 0.00 ? 11  CYS A CA   4  
ATOM 7500  C C    . CYS A 1 11  ? -2.685  -2.210  3.030   1.00 0.00 ? 11  CYS A C    4  
ATOM 7501  O O    . CYS A 1 11  ? -3.490  -3.119  2.976   1.00 0.00 ? 11  CYS A O    4  
ATOM 7502  C CB   . CYS A 1 11  ? -1.589  -2.363  0.792   1.00 0.00 ? 11  CYS A CB   4  
ATOM 7503  S SG   . CYS A 1 11  ? -0.311  -1.412  -0.069  1.00 0.00 ? 11  CYS A SG   4  
ATOM 7504  H H    . CYS A 1 11  ? -1.098  -4.318  2.957   1.00 0.00 ? 11  CYS A H    4  
ATOM 7505  H HA   . CYS A 1 11  ? -0.763  -1.407  2.525   1.00 0.00 ? 11  CYS A HA   4  
ATOM 7506  H HB2  . CYS A 1 11  ? -1.548  -3.393  0.471   1.00 0.00 ? 11  CYS A HB2  4  
ATOM 7507  H HB3  . CYS A 1 11  ? -2.559  -1.951  0.560   1.00 0.00 ? 11  CYS A HB3  4  
ATOM 7508  H HG   . CYS A 1 11  ? 0.417   -1.276  0.542   1.00 0.00 ? 11  CYS A HG   4  
ATOM 7509  N N    . GLY A 1 12  ? -2.931  -1.123  3.704   1.00 0.00 ? 12  GLY A N    4  
ATOM 7510  C CA   . GLY A 1 12  ? -4.220  -0.966  4.435   1.00 0.00 ? 12  GLY A CA   4  
ATOM 7511  C C    . GLY A 1 12  ? -4.909  0.303   3.947   1.00 0.00 ? 12  GLY A C    4  
ATOM 7512  O O    . GLY A 1 12  ? -4.387  1.010   3.105   1.00 0.00 ? 12  GLY A O    4  
ATOM 7513  H H    . GLY A 1 12  ? -2.268  -0.403  3.726   1.00 0.00 ? 12  GLY A H    4  
ATOM 7514  H HA2  . GLY A 1 12  ? -4.852  -1.821  4.238   1.00 0.00 ? 12  GLY A HA2  4  
ATOM 7515  H HA3  . GLY A 1 12  ? -4.033  -0.889  5.494   1.00 0.00 ? 12  GLY A HA3  4  
ATOM 7516  N N    . LEU A 1 13  ? -6.079  0.602   4.443   1.00 0.00 ? 13  LEU A N    4  
ATOM 7517  C CA   . LEU A 1 13  ? -6.775  1.828   3.968   1.00 0.00 ? 13  LEU A CA   4  
ATOM 7518  C C    . LEU A 1 13  ? -7.141  2.737   5.136   1.00 0.00 ? 13  LEU A C    4  
ATOM 7519  O O    . LEU A 1 13  ? -7.950  2.389   5.975   1.00 0.00 ? 13  LEU A O    4  
ATOM 7520  C CB   . LEU A 1 13  ? -8.073  1.431   3.246   1.00 0.00 ? 13  LEU A CB   4  
ATOM 7521  C CG   . LEU A 1 13  ? -8.040  1.919   1.795   1.00 0.00 ? 13  LEU A CG   4  
ATOM 7522  C CD1  . LEU A 1 13  ? -9.418  1.751   1.153   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 7523  C CD2  . LEU A 1 13  ? -7.647  3.394   1.750   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 7524  H H    . LEU A 1 13  ? -6.498  0.020   5.111   1.00 0.00 ? 13  LEU A H    4  
ATOM 7525  H HA   . LEU A 1 13  ? -6.134  2.360   3.285   1.00 0.00 ? 13  LEU A HA   4  
ATOM 7526  H HB2  . LEU A 1 13  ? -8.174  0.355   3.259   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 7527  H HB3  . LEU A 1 13  ? -8.915  1.877   3.753   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 7528  H HG   . LEU A 1 13  ? -7.325  1.339   1.246   1.00 0.00 ? 13  LEU A HG   4  
ATOM 7529  H HD11 . LEU A 1 13  ? -9.628  2.608   0.527   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 7530  H HD12 . LEU A 1 13  ? -10.172 1.674   1.922   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 7531  H HD13 . LEU A 1 13  ? -9.428  0.856   0.548   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 7532  H HD21 . LEU A 1 13  ? -7.765  3.830   2.731   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 7533  H HD22 . LEU A 1 13  ? -8.279  3.914   1.046   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 7534  H HD23 . LEU A 1 13  ? -6.618  3.480   1.440   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 7535  N N    . ILE A 1 14  ? -6.612  3.929   5.165   1.00 0.00 ? 14  ILE A N    4  
ATOM 7536  C CA   . ILE A 1 14  ? -7.007  4.869   6.242   1.00 0.00 ? 14  ILE A CA   4  
ATOM 7537  C C    . ILE A 1 14  ? -8.270  5.563   5.755   1.00 0.00 ? 14  ILE A C    4  
ATOM 7538  O O    . ILE A 1 14  ? -8.251  6.345   4.828   1.00 0.00 ? 14  ILE A O    4  
ATOM 7539  C CB   . ILE A 1 14  ? -5.894  5.884   6.515   1.00 0.00 ? 14  ILE A CB   4  
ATOM 7540  C CG1  . ILE A 1 14  ? -4.721  5.166   7.185   1.00 0.00 ? 14  ILE A CG1  4  
ATOM 7541  C CG2  . ILE A 1 14  ? -6.414  6.980   7.446   1.00 0.00 ? 14  ILE A CG2  4  
ATOM 7542  C CD1  . ILE A 1 14  ? -3.539  6.126   7.335   1.00 0.00 ? 14  ILE A CD1  4  
ATOM 7543  H H    . ILE A 1 14  ? -6.001  4.218   4.456   1.00 0.00 ? 14  ILE A H    4  
ATOM 7544  H HA   . ILE A 1 14  ? -7.226  4.313   7.144   1.00 0.00 ? 14  ILE A HA   4  
ATOM 7545  H HB   . ILE A 1 14  ? -5.568  6.325   5.584   1.00 0.00 ? 14  ILE A HB   4  
ATOM 7546  H HG12 . ILE A 1 14  ? -5.025  4.817   8.161   1.00 0.00 ? 14  ILE A HG12 4  
ATOM 7547  H HG13 . ILE A 1 14  ? -4.425  4.323   6.584   1.00 0.00 ? 14  ILE A HG13 4  
ATOM 7548  H HG21 . ILE A 1 14  ? -5.664  7.203   8.193   1.00 0.00 ? 14  ILE A HG21 4  
ATOM 7549  H HG22 . ILE A 1 14  ? -7.317  6.641   7.934   1.00 0.00 ? 14  ILE A HG22 4  
ATOM 7550  H HG23 . ILE A 1 14  ? -6.625  7.869   6.873   1.00 0.00 ? 14  ILE A HG23 4  
ATOM 7551  H HD11 . ILE A 1 14  ? -3.491  6.776   6.472   1.00 0.00 ? 14  ILE A HD11 4  
ATOM 7552  H HD12 . ILE A 1 14  ? -2.622  5.558   7.413   1.00 0.00 ? 14  ILE A HD12 4  
ATOM 7553  H HD13 . ILE A 1 14  ? -3.671  6.720   8.226   1.00 0.00 ? 14  ILE A HD13 4  
ATOM 7554  N N    . ILE A 1 15  ? -9.375  5.226   6.338   1.00 0.00 ? 15  ILE A N    4  
ATOM 7555  C CA   . ILE A 1 15  ? -10.670 5.791   5.885   1.00 0.00 ? 15  ILE A CA   4  
ATOM 7556  C C    . ILE A 1 15  ? -11.058 6.993   6.735   1.00 0.00 ? 15  ILE A C    4  
ATOM 7557  O O    . ILE A 1 15  ? -10.908 6.994   7.938   1.00 0.00 ? 15  ILE A O    4  
ATOM 7558  C CB   . ILE A 1 15  ? -11.708 4.683   6.024   1.00 0.00 ? 15  ILE A CB   4  
ATOM 7559  C CG1  . ILE A 1 15  ? -11.317 3.538   5.087   1.00 0.00 ? 15  ILE A CG1  4  
ATOM 7560  C CG2  . ILE A 1 15  ? -13.106 5.188   5.670   1.00 0.00 ? 15  ILE A CG2  4  
ATOM 7561  C CD1  . ILE A 1 15  ? -11.988 2.241   5.535   1.00 0.00 ? 15  ILE A CD1  4  
ATOM 7562  H H    . ILE A 1 15  ? -9.362  4.554   7.052   1.00 0.00 ? 15  ILE A H    4  
ATOM 7563  H HA   . ILE A 1 15  ? -10.596 6.086   4.850   1.00 0.00 ? 15  ILE A HA   4  
ATOM 7564  H HB   . ILE A 1 15  ? -11.703 4.328   7.039   1.00 0.00 ? 15  ILE A HB   4  
ATOM 7565  H HG12 . ILE A 1 15  ? -11.631 3.775   4.081   1.00 0.00 ? 15  ILE A HG12 4  
ATOM 7566  H HG13 . ILE A 1 15  ? -10.244 3.408   5.107   1.00 0.00 ? 15  ILE A HG13 4  
ATOM 7567  H HG21 . ILE A 1 15  ? -13.839 4.523   6.102   1.00 0.00 ? 15  ILE A HG21 4  
ATOM 7568  H HG22 . ILE A 1 15  ? -13.222 5.208   4.597   1.00 0.00 ? 15  ILE A HG22 4  
ATOM 7569  H HG23 . ILE A 1 15  ? -13.247 6.182   6.067   1.00 0.00 ? 15  ILE A HG23 4  
ATOM 7570  H HD11 . ILE A 1 15  ? -12.695 1.925   4.782   1.00 0.00 ? 15  ILE A HD11 4  
ATOM 7571  H HD12 . ILE A 1 15  ? -12.506 2.404   6.472   1.00 0.00 ? 15  ILE A HD12 4  
ATOM 7572  H HD13 . ILE A 1 15  ? -11.234 1.478   5.667   1.00 0.00 ? 15  ILE A HD13 4  
ATOM 7573  N N    . PHE A 1 16  ? -11.558 8.018   6.104   1.00 0.00 ? 16  PHE A N    4  
ATOM 7574  C CA   . PHE A 1 16  ? -11.965 9.230   6.857   1.00 0.00 ? 16  PHE A CA   4  
ATOM 7575  C C    . PHE A 1 16  ? -13.278 9.763   6.284   1.00 0.00 ? 16  PHE A C    4  
ATOM 7576  O O    . PHE A 1 16  ? -13.368 10.083  5.117   1.00 0.00 ? 16  PHE A O    4  
ATOM 7577  C CB   . PHE A 1 16  ? -10.883 10.296  6.711   1.00 0.00 ? 16  PHE A CB   4  
ATOM 7578  C CG   . PHE A 1 16  ? -10.865 10.797  5.287   1.00 0.00 ? 16  PHE A CG   4  
ATOM 7579  C CD1  . PHE A 1 16  ? -10.151 10.098  4.306   1.00 0.00 ? 16  PHE A CD1  4  
ATOM 7580  C CD2  . PHE A 1 16  ? -11.563 11.962  4.946   1.00 0.00 ? 16  PHE A CD2  4  
ATOM 7581  C CE1  . PHE A 1 16  ? -10.138 10.562  2.985   1.00 0.00 ? 16  PHE A CE1  4  
ATOM 7582  C CE2  . PHE A 1 16  ? -11.549 12.426  3.627   1.00 0.00 ? 16  PHE A CE2  4  
ATOM 7583  C CZ   . PHE A 1 16  ? -10.837 11.728  2.646   1.00 0.00 ? 16  PHE A CZ   4  
ATOM 7584  H H    . PHE A 1 16  ? -11.669 7.988   5.131   1.00 0.00 ? 16  PHE A H    4  
ATOM 7585  H HA   . PHE A 1 16  ? -12.095 8.985   7.894   1.00 0.00 ? 16  PHE A HA   4  
ATOM 7586  H HB2  . PHE A 1 16  ? -11.091 11.119  7.383   1.00 0.00 ? 16  PHE A HB2  4  
ATOM 7587  H HB3  . PHE A 1 16  ? -9.923  9.868   6.952   1.00 0.00 ? 16  PHE A HB3  4  
ATOM 7588  H HD1  . PHE A 1 16  ? -9.614  9.200   4.569   1.00 0.00 ? 16  PHE A HD1  4  
ATOM 7589  H HD2  . PHE A 1 16  ? -12.114 12.502  5.703   1.00 0.00 ? 16  PHE A HD2  4  
ATOM 7590  H HE1  . PHE A 1 16  ? -9.585  10.024  2.229   1.00 0.00 ? 16  PHE A HE1  4  
ATOM 7591  H HE2  . PHE A 1 16  ? -12.086 13.326  3.365   1.00 0.00 ? 16  PHE A HE2  4  
ATOM 7592  H HZ   . PHE A 1 16  ? -10.827 12.086  1.628   1.00 0.00 ? 16  PHE A HZ   4  
ATOM 7593  N N    . ARG A 1 17  ? -14.292 9.882   7.094   1.00 0.00 ? 17  ARG A N    4  
ATOM 7594  C CA   . ARG A 1 17  ? -15.582 10.411  6.576   1.00 0.00 ? 17  ARG A CA   4  
ATOM 7595  C C    . ARG A 1 17  ? -15.538 11.940  6.641   1.00 0.00 ? 17  ARG A C    4  
ATOM 7596  O O    . ARG A 1 17  ? -15.349 12.519  7.691   1.00 0.00 ? 17  ARG A O    4  
ATOM 7597  C CB   . ARG A 1 17  ? -16.738 9.886   7.430   1.00 0.00 ? 17  ARG A CB   4  
ATOM 7598  C CG   . ARG A 1 17  ? -16.728 10.575  8.795   1.00 0.00 ? 17  ARG A CG   4  
ATOM 7599  C CD   . ARG A 1 17  ? -17.644 9.810   9.750   1.00 0.00 ? 17  ARG A CD   4  
ATOM 7600  N NE   . ARG A 1 17  ? -17.848 10.610  10.989  1.00 0.00 ? 17  ARG A NE   4  
ATOM 7601  C CZ   . ARG A 1 17  ? -18.673 11.621  10.979  1.00 0.00 ? 17  ARG A CZ   4  
ATOM 7602  N NH1  . ARG A 1 17  ? -19.309 11.933  9.884   1.00 0.00 ? 17  ARG A NH1  4  
ATOM 7603  N NH2  . ARG A 1 17  ? -18.860 12.321  12.065  1.00 0.00 ? 17  ARG A NH2  4  
ATOM 7604  H H    . ARG A 1 17  ? -14.206 9.630   8.037   1.00 0.00 ? 17  ARG A H    4  
ATOM 7605  H HA   . ARG A 1 17  ? -15.717 10.094  5.553   1.00 0.00 ? 17  ARG A HA   4  
ATOM 7606  H HB2  . ARG A 1 17  ? -17.674 10.090  6.931   1.00 0.00 ? 17  ARG A HB2  4  
ATOM 7607  H HB3  . ARG A 1 17  ? -16.627 8.821   7.566   1.00 0.00 ? 17  ARG A HB3  4  
ATOM 7608  H HG2  . ARG A 1 17  ? -15.722 10.584  9.186   1.00 0.00 ? 17  ARG A HG2  4  
ATOM 7609  H HG3  . ARG A 1 17  ? -17.087 11.586  8.692   1.00 0.00 ? 17  ARG A HG3  4  
ATOM 7610  H HD2  . ARG A 1 17  ? -18.594 9.637   9.272   1.00 0.00 ? 17  ARG A HD2  4  
ATOM 7611  H HD3  . ARG A 1 17  ? -17.190 8.864   10.002  1.00 0.00 ? 17  ARG A HD3  4  
ATOM 7612  H HE   . ARG A 1 17  ? -17.367 10.377  11.810  1.00 0.00 ? 17  ARG A HE   4  
ATOM 7613  H HH11 . ARG A 1 17  ? -19.164 11.396  9.053   1.00 0.00 ? 17  ARG A HH11 4  
ATOM 7614  H HH12 . ARG A 1 17  ? -19.941 12.707  9.876   1.00 0.00 ? 17  ARG A HH12 4  
ATOM 7615  H HH21 . ARG A 1 17  ? -18.374 12.083  12.903  1.00 0.00 ? 17  ARG A HH21 4  
ATOM 7616  H HH22 . ARG A 1 17  ? -19.493 13.095  12.056  1.00 0.00 ? 17  ARG A HH22 4  
ATOM 7617  N N    . ARG A 1 18  ? -15.688 12.599  5.525   1.00 0.00 ? 18  ARG A N    4  
ATOM 7618  C CA   . ARG A 1 18  ? -15.631 14.088  5.530   1.00 0.00 ? 18  ARG A CA   4  
ATOM 7619  C C    . ARG A 1 18  ? -17.034 14.666  5.724   1.00 0.00 ? 18  ARG A C    4  
ATOM 7620  O O    . ARG A 1 18  ? -17.997 14.200  5.144   1.00 0.00 ? 18  ARG A O    4  
ATOM 7621  C CB   . ARG A 1 18  ? -15.045 14.578  4.205   1.00 0.00 ? 18  ARG A CB   4  
ATOM 7622  C CG   . ARG A 1 18  ? -14.831 16.091  4.265   1.00 0.00 ? 18  ARG A CG   4  
ATOM 7623  C CD   . ARG A 1 18  ? -13.992 16.533  3.063   1.00 0.00 ? 18  ARG A CD   4  
ATOM 7624  N NE   . ARG A 1 18  ? -14.739 16.251  1.803   1.00 0.00 ? 18  ARG A NE   4  
ATOM 7625  C CZ   . ARG A 1 18  ? -15.749 16.999  1.459   1.00 0.00 ? 18  ARG A CZ   4  
ATOM 7626  N NH1  . ARG A 1 18  ? -16.110 17.997  2.218   1.00 0.00 ? 18  ARG A NH1  4  
ATOM 7627  N NH2  . ARG A 1 18  ? -16.397 16.751  0.353   1.00 0.00 ? 18  ARG A NH2  4  
ATOM 7628  H H    . ARG A 1 18  ? -15.824 12.115  4.683   1.00 0.00 ? 18  ARG A H    4  
ATOM 7629  H HA   . ARG A 1 18  ? -14.997 14.416  6.341   1.00 0.00 ? 18  ARG A HA   4  
ATOM 7630  H HB2  . ARG A 1 18  ? -14.100 14.087  4.027   1.00 0.00 ? 18  ARG A HB2  4  
ATOM 7631  H HB3  . ARG A 1 18  ? -15.727 14.344  3.402   1.00 0.00 ? 18  ARG A HB3  4  
ATOM 7632  H HG2  . ARG A 1 18  ? -15.791 16.591  4.240   1.00 0.00 ? 18  ARG A HG2  4  
ATOM 7633  H HG3  . ARG A 1 18  ? -14.316 16.348  5.177   1.00 0.00 ? 18  ARG A HG3  4  
ATOM 7634  H HD2  . ARG A 1 18  ? -13.795 17.593  3.134   1.00 0.00 ? 18  ARG A HD2  4  
ATOM 7635  H HD3  . ARG A 1 18  ? -13.058 15.993  3.058   1.00 0.00 ? 18  ARG A HD3  4  
ATOM 7636  H HE   . ARG A 1 18  ? -14.466 15.501  1.232   1.00 0.00 ? 18  ARG A HE   4  
ATOM 7637  H HH11 . ARG A 1 18  ? -15.612 18.186  3.065   1.00 0.00 ? 18  ARG A HH11 4  
ATOM 7638  H HH12 . ARG A 1 18  ? -16.885 18.571  1.954   1.00 0.00 ? 18  ARG A HH12 4  
ATOM 7639  H HH21 . ARG A 1 18  ? -16.118 15.988  -0.227  1.00 0.00 ? 18  ARG A HH21 4  
ATOM 7640  H HH22 . ARG A 1 18  ? -17.172 17.325  0.091   1.00 0.00 ? 18  ARG A HH22 4  
ATOM 7641  N N    . CYS A 1 19  ? -17.153 15.682  6.533   1.00 0.00 ? 19  CYS A N    4  
ATOM 7642  C CA   . CYS A 1 19  ? -18.489 16.304  6.767   1.00 0.00 ? 19  CYS A CA   4  
ATOM 7643  C C    . CYS A 1 19  ? -18.788 17.287  5.636   1.00 0.00 ? 19  CYS A C    4  
ATOM 7644  O O    . CYS A 1 19  ? -17.899 17.729  4.936   1.00 0.00 ? 19  CYS A O    4  
ATOM 7645  C CB   . CYS A 1 19  ? -18.474 17.052  8.102   1.00 0.00 ? 19  CYS A CB   4  
ATOM 7646  S SG   . CYS A 1 19  ? -17.112 18.245  8.109   1.00 0.00 ? 19  CYS A SG   4  
ATOM 7647  H H    . CYS A 1 19  ? -16.364 16.042  6.985   1.00 0.00 ? 19  CYS A H    4  
ATOM 7648  H HA   . CYS A 1 19  ? -19.247 15.535  6.791   1.00 0.00 ? 19  CYS A HA   4  
ATOM 7649  H HB2  . CYS A 1 19  ? -19.411 17.574  8.231   1.00 0.00 ? 19  CYS A HB2  4  
ATOM 7650  H HB3  . CYS A 1 19  ? -18.340 16.348  8.909   1.00 0.00 ? 19  CYS A HB3  4  
ATOM 7651  H HG   . CYS A 1 19  ? -17.433 19.060  8.505   1.00 0.00 ? 19  CYS A HG   4  
ATOM 7652  N N    . LEU A 1 20  ? -20.032 17.630  5.443   1.00 0.00 ? 20  LEU A N    4  
ATOM 7653  C CA   . LEU A 1 20  ? -20.375 18.579  4.351   1.00 0.00 ? 20  LEU A CA   4  
ATOM 7654  C C    . LEU A 1 20  ? -19.569 19.865  4.534   1.00 0.00 ? 20  LEU A C    4  
ATOM 7655  O O    . LEU A 1 20  ? -19.055 20.428  3.587   1.00 0.00 ? 20  LEU A O    4  
ATOM 7656  C CB   . LEU A 1 20  ? -21.869 18.901  4.409   1.00 0.00 ? 20  LEU A CB   4  
ATOM 7657  C CG   . LEU A 1 20  ? -22.663 17.597  4.430   1.00 0.00 ? 20  LEU A CG   4  
ATOM 7658  C CD1  . LEU A 1 20  ? -24.161 17.910  4.392   1.00 0.00 ? 20  LEU A CD1  4  
ATOM 7659  C CD2  . LEU A 1 20  ? -22.291 16.750  3.212   1.00 0.00 ? 20  LEU A CD2  4  
ATOM 7660  H H    . LEU A 1 20  ? -20.738 17.261  6.015   1.00 0.00 ? 20  LEU A H    4  
ATOM 7661  H HA   . LEU A 1 20  ? -20.135 18.136  3.396   1.00 0.00 ? 20  LEU A HA   4  
ATOM 7662  H HB2  . LEU A 1 20  ? -22.080 19.470  5.302   1.00 0.00 ? 20  LEU A HB2  4  
ATOM 7663  H HB3  . LEU A 1 20  ? -22.147 19.477  3.538   1.00 0.00 ? 20  LEU A HB3  4  
ATOM 7664  H HG   . LEU A 1 20  ? -22.430 17.055  5.335   1.00 0.00 ? 20  LEU A HG   4  
ATOM 7665  H HD11 . LEU A 1 20  ? -24.722 16.997  4.536   1.00 0.00 ? 20  LEU A HD11 4  
ATOM 7666  H HD12 . LEU A 1 20  ? -24.415 18.342  3.437   1.00 0.00 ? 20  LEU A HD12 4  
ATOM 7667  H HD13 . LEU A 1 20  ? -24.402 18.608  5.179   1.00 0.00 ? 20  LEU A HD13 4  
ATOM 7668  H HD21 . LEU A 1 20  ? -21.444 16.125  3.452   1.00 0.00 ? 20  LEU A HD21 4  
ATOM 7669  H HD22 . LEU A 1 20  ? -22.037 17.398  2.385   1.00 0.00 ? 20  LEU A HD22 4  
ATOM 7670  H HD23 . LEU A 1 20  ? -23.130 16.128  2.936   1.00 0.00 ? 20  LEU A HD23 4  
ATOM 7671  N N    . ILE A 1 21  ? -19.442 20.330  5.749   1.00 0.00 ? 21  ILE A N    4  
ATOM 7672  C CA   . ILE A 1 21  ? -18.656 21.574  5.987   1.00 0.00 ? 21  ILE A CA   4  
ATOM 7673  C C    . ILE A 1 21  ? -18.003 21.518  7.376   1.00 0.00 ? 21  ILE A C    4  
ATOM 7674  O O    . ILE A 1 21  ? -18.508 20.885  8.279   1.00 0.00 ? 21  ILE A O    4  
ATOM 7675  C CB   . ILE A 1 21  ? -19.573 22.801  5.897   1.00 0.00 ? 21  ILE A CB   4  
ATOM 7676  C CG1  . ILE A 1 21  ? -20.441 22.910  7.158   1.00 0.00 ? 21  ILE A CG1  4  
ATOM 7677  C CG2  . ILE A 1 21  ? -20.477 22.680  4.669   1.00 0.00 ? 21  ILE A CG2  4  
ATOM 7678  C CD1  . ILE A 1 21  ? -21.295 21.650  7.321   1.00 0.00 ? 21  ILE A CD1  4  
ATOM 7679  H H    . ILE A 1 21  ? -19.859 19.856  6.499   1.00 0.00 ? 21  ILE A H    4  
ATOM 7680  H HA   . ILE A 1 21  ? -17.891 21.648  5.233   1.00 0.00 ? 21  ILE A HA   4  
ATOM 7681  H HB   . ILE A 1 21  ? -18.965 23.690  5.803   1.00 0.00 ? 21  ILE A HB   4  
ATOM 7682  H HG12 . ILE A 1 21  ? -19.809 23.030  8.025   1.00 0.00 ? 21  ILE A HG12 4  
ATOM 7683  H HG13 . ILE A 1 21  ? -21.090 23.768  7.071   1.00 0.00 ? 21  ILE A HG13 4  
ATOM 7684  H HG21 . ILE A 1 21  ? -19.869 22.550  3.785   1.00 0.00 ? 21  ILE A HG21 4  
ATOM 7685  H HG22 . ILE A 1 21  ? -21.069 23.577  4.570   1.00 0.00 ? 21  ILE A HG22 4  
ATOM 7686  H HG23 . ILE A 1 21  ? -21.130 21.828  4.784   1.00 0.00 ? 21  ILE A HG23 4  
ATOM 7687  H HD11 . ILE A 1 21  ? -21.750 21.397  6.377   1.00 0.00 ? 21  ILE A HD11 4  
ATOM 7688  H HD12 . ILE A 1 21  ? -22.070 21.833  8.053   1.00 0.00 ? 21  ILE A HD12 4  
ATOM 7689  H HD13 . ILE A 1 21  ? -20.674 20.832  7.653   1.00 0.00 ? 21  ILE A HD13 4  
ATOM 7690  N N    . PRO A 1 22  ? -16.887 22.187  7.547   1.00 0.00 ? 22  PRO A N    4  
ATOM 7691  C CA   . PRO A 1 22  ? -16.159 22.219  8.853   1.00 0.00 ? 22  PRO A CA   4  
ATOM 7692  C C    . PRO A 1 22  ? -17.010 22.821  9.973   1.00 0.00 ? 22  PRO A C    4  
ATOM 7693  O O    . PRO A 1 22  ? -17.883 23.634  9.738   1.00 0.00 ? 22  PRO A O    4  
ATOM 7694  C CB   . PRO A 1 22  ? -14.939 23.107  8.596   1.00 0.00 ? 22  PRO A CB   4  
ATOM 7695  C CG   . PRO A 1 22  ? -14.802 23.202  7.112   1.00 0.00 ? 22  PRO A CG   4  
ATOM 7696  C CD   . PRO A 1 22  ? -16.191 22.981  6.522   1.00 0.00 ? 22  PRO A CD   4  
ATOM 7697  H HA   . PRO A 1 22  ? -15.834 21.229  9.126   1.00 0.00 ? 22  PRO A HA   4  
ATOM 7698  H HB2  . PRO A 1 22  ? -15.099 24.089  9.021   1.00 0.00 ? 22  PRO A HB2  4  
ATOM 7699  H HB3  . PRO A 1 22  ? -14.055 22.655  9.018   1.00 0.00 ? 22  PRO A HB3  4  
ATOM 7700  H HG2  . PRO A 1 22  ? -14.432 24.182  6.838   1.00 0.00 ? 22  PRO A HG2  4  
ATOM 7701  H HG3  . PRO A 1 22  ? -14.130 22.440  6.752   1.00 0.00 ? 22  PRO A HG3  4  
ATOM 7702  H HD2  . PRO A 1 22  ? -16.691 23.928  6.366   1.00 0.00 ? 22  PRO A HD2  4  
ATOM 7703  H HD3  . PRO A 1 22  ? -16.122 22.429  5.600   1.00 0.00 ? 22  PRO A HD3  4  
ATOM 7704  N N    . LYS A 1 23  ? -16.754 22.433  11.192  1.00 0.00 ? 23  LYS A N    4  
ATOM 7705  C CA   . LYS A 1 23  ? -17.536 22.985  12.331  1.00 0.00 ? 23  LYS A CA   4  
ATOM 7706  C C    . LYS A 1 23  ? -16.568 23.443  13.423  1.00 0.00 ? 23  LYS A C    4  
ATOM 7707  O O    . LYS A 1 23  ? -16.227 24.606  13.519  1.00 0.00 ? 23  LYS A O    4  
ATOM 7708  C CB   . LYS A 1 23  ? -18.462 21.899  12.886  1.00 0.00 ? 23  LYS A CB   4  
ATOM 7709  C CG   . LYS A 1 23  ? -19.901 22.419  12.911  1.00 0.00 ? 23  LYS A CG   4  
ATOM 7710  C CD   . LYS A 1 23  ? -20.464 22.422  11.488  1.00 0.00 ? 23  LYS A CD   4  
ATOM 7711  C CE   . LYS A 1 23  ? -21.166 23.755  11.217  1.00 0.00 ? 23  LYS A CE   4  
ATOM 7712  N NZ   . LYS A 1 23  ? -22.019 23.628  10.002  1.00 0.00 ? 23  LYS A NZ   4  
ATOM 7713  H H    . LYS A 1 23  ? -16.040 21.782  11.357  1.00 0.00 ? 23  LYS A H    4  
ATOM 7714  H HA   . LYS A 1 23  ? -18.122 23.826  11.994  1.00 0.00 ? 23  LYS A HA   4  
ATOM 7715  H HB2  . LYS A 1 23  ? -18.405 21.024  12.255  1.00 0.00 ? 23  LYS A HB2  4  
ATOM 7716  H HB3  . LYS A 1 23  ? -18.159 21.640  13.889  1.00 0.00 ? 23  LYS A HB3  4  
ATOM 7717  H HG2  . LYS A 1 23  ? -20.503 21.777  13.537  1.00 0.00 ? 23  LYS A HG2  4  
ATOM 7718  H HG3  . LYS A 1 23  ? -19.915 23.424  13.304  1.00 0.00 ? 23  LYS A HG3  4  
ATOM 7719  H HD2  . LYS A 1 23  ? -19.655 22.291  10.783  1.00 0.00 ? 23  LYS A HD2  4  
ATOM 7720  H HD3  . LYS A 1 23  ? -21.173 21.615  11.381  1.00 0.00 ? 23  LYS A HD3  4  
ATOM 7721  H HE2  . LYS A 1 23  ? -21.781 24.016  12.065  1.00 0.00 ? 23  LYS A HE2  4  
ATOM 7722  H HE3  . LYS A 1 23  ? -20.424 24.525  11.058  1.00 0.00 ? 23  LYS A HE3  4  
ATOM 7723  H HZ1  . LYS A 1 23  ? -21.500 23.109  9.266   1.00 0.00 ? 23  LYS A HZ1  4  
ATOM 7724  H HZ2  . LYS A 1 23  ? -22.265 24.577  9.653   1.00 0.00 ? 23  LYS A HZ2  4  
ATOM 7725  H HZ3  . LYS A 1 23  ? -22.887 23.109  10.240  1.00 0.00 ? 23  LYS A HZ3  4  
ATOM 7726  N N    . VAL A 1 24  ? -16.121 22.535  14.241  1.00 0.00 ? 24  VAL A N    4  
ATOM 7727  C CA   . VAL A 1 24  ? -15.167 22.906  15.325  1.00 0.00 ? 24  VAL A CA   4  
ATOM 7728  C C    . VAL A 1 24  ? -13.736 22.725  14.817  1.00 0.00 ? 24  VAL A C    4  
ATOM 7729  O O    . VAL A 1 24  ? -12.781 22.923  15.541  1.00 0.00 ? 24  VAL A O    4  
ATOM 7730  C CB   . VAL A 1 24  ? -15.393 22.005  16.539  1.00 0.00 ? 24  VAL A CB   4  
ATOM 7731  C CG1  . VAL A 1 24  ? -14.505 22.471  17.692  1.00 0.00 ? 24  VAL A CG1  4  
ATOM 7732  C CG2  . VAL A 1 24  ? -16.862 22.083  16.964  1.00 0.00 ? 24  VAL A CG2  4  
ATOM 7733  H H    . VAL A 1 24  ? -16.407 21.604  14.137  1.00 0.00 ? 24  VAL A H    4  
ATOM 7734  H HA   . VAL A 1 24  ? -15.323 23.937  15.604  1.00 0.00 ? 24  VAL A HA   4  
ATOM 7735  H HB   . VAL A 1 24  ? -15.145 20.984  16.282  1.00 0.00 ? 24  VAL A HB   4  
ATOM 7736  H HG11 . VAL A 1 24  ? -14.100 23.446  17.464  1.00 0.00 ? 24  VAL A HG11 4  
ATOM 7737  H HG12 . VAL A 1 24  ? -13.697 21.768  17.829  1.00 0.00 ? 24  VAL A HG12 4  
ATOM 7738  H HG13 . VAL A 1 24  ? -15.091 22.526  18.599  1.00 0.00 ? 24  VAL A HG13 4  
ATOM 7739  H HG21 . VAL A 1 24  ? -16.924 22.462  17.974  1.00 0.00 ? 24  VAL A HG21 4  
ATOM 7740  H HG22 . VAL A 1 24  ? -17.303 21.098  16.922  1.00 0.00 ? 24  VAL A HG22 4  
ATOM 7741  H HG23 . VAL A 1 24  ? -17.395 22.745  16.298  1.00 0.00 ? 24  VAL A HG23 4  
ATOM 7742  N N    . ASP A 1 25  ? -13.583 22.334  13.580  1.00 0.00 ? 25  ASP A N    4  
ATOM 7743  C CA   . ASP A 1 25  ? -12.215 22.120  13.027  1.00 0.00 ? 25  ASP A CA   4  
ATOM 7744  C C    . ASP A 1 25  ? -11.496 21.068  13.873  1.00 0.00 ? 25  ASP A C    4  
ATOM 7745  O O    . ASP A 1 25  ? -10.332 21.201  14.195  1.00 0.00 ? 25  ASP A O    4  
ATOM 7746  C CB   . ASP A 1 25  ? -11.429 23.434  13.058  1.00 0.00 ? 25  ASP A CB   4  
ATOM 7747  C CG   . ASP A 1 25  ? -12.085 24.444  12.117  1.00 0.00 ? 25  ASP A CG   4  
ATOM 7748  O OD1  . ASP A 1 25  ? -12.921 24.034  11.330  1.00 0.00 ? 25  ASP A OD1  4  
ATOM 7749  O OD2  . ASP A 1 25  ? -11.740 25.612  12.199  1.00 0.00 ? 25  ASP A OD2  4  
ATOM 7750  H H    . ASP A 1 25  ? -14.369 22.168  13.018  1.00 0.00 ? 25  ASP A H    4  
ATOM 7751  H HA   . ASP A 1 25  ? -12.291 21.769  12.009  1.00 0.00 ? 25  ASP A HA   4  
ATOM 7752  H HB2  . ASP A 1 25  ? -11.422 23.828  14.063  1.00 0.00 ? 25  ASP A HB2  4  
ATOM 7753  H HB3  . ASP A 1 25  ? -10.415 23.253  12.737  1.00 0.00 ? 25  ASP A HB3  4  
ATOM 7754  H HD2  . ASP A 1 25  ? -12.193 26.188  11.579  1.00 0.00 ? 25  ASP A HD2  4  
ATOM 7755  N N    . ASN A 1 26  ? -12.189 20.025  14.233  1.00 0.00 ? 26  ASN A N    4  
ATOM 7756  C CA   . ASN A 1 26  ? -11.568 18.952  15.058  1.00 0.00 ? 26  ASN A CA   4  
ATOM 7757  C C    . ASN A 1 26  ? -12.315 17.645  14.812  1.00 0.00 ? 26  ASN A C    4  
ATOM 7758  O O    . ASN A 1 26  ? -11.774 16.688  14.295  1.00 0.00 ? 26  ASN A O    4  
ATOM 7759  C CB   . ASN A 1 26  ? -11.670 19.321  16.538  1.00 0.00 ? 26  ASN A CB   4  
ATOM 7760  C CG   . ASN A 1 26  ? -10.719 18.442  17.350  1.00 0.00 ? 26  ASN A CG   4  
ATOM 7761  O OD1  . ASN A 1 26  ? -9.689  18.027  16.861  1.00 0.00 ? 26  ASN A OD1  4  
ATOM 7762  N ND2  . ASN A 1 26  ? -11.027 18.134  18.581  1.00 0.00 ? 26  ASN A ND2  4  
ATOM 7763  H H    . ASN A 1 26  ? -13.126 19.945  13.957  1.00 0.00 ? 26  ASN A H    4  
ATOM 7764  H HA   . ASN A 1 26  ? -10.534 18.835  14.783  1.00 0.00 ? 26  ASN A HA   4  
ATOM 7765  H HB2  . ASN A 1 26  ? -11.406 20.359  16.670  1.00 0.00 ? 26  ASN A HB2  4  
ATOM 7766  H HB3  . ASN A 1 26  ? -12.683 19.162  16.878  1.00 0.00 ? 26  ASN A HB3  4  
ATOM 7767  H HD21 . ASN A 1 26  ? -11.861 18.465  18.976  1.00 0.00 ? 26  ASN A HD21 4  
ATOM 7768  H HD22 . ASN A 1 26  ? -10.424 17.570  19.111  1.00 0.00 ? 26  ASN A HD22 4  
ATOM 7769  N N    . ASN A 1 27  ? -13.561 17.608  15.180  1.00 0.00 ? 27  ASN A N    4  
ATOM 7770  C CA   . ASN A 1 27  ? -14.370 16.374  14.973  1.00 0.00 ? 27  ASN A CA   4  
ATOM 7771  C C    . ASN A 1 27  ? -15.000 16.412  13.581  1.00 0.00 ? 27  ASN A C    4  
ATOM 7772  O O    . ASN A 1 27  ? -15.816 15.581  13.237  1.00 0.00 ? 27  ASN A O    4  
ATOM 7773  C CB   . ASN A 1 27  ? -15.474 16.308  16.031  1.00 0.00 ? 27  ASN A CB   4  
ATOM 7774  C CG   . ASN A 1 27  ? -16.589 17.288  15.667  1.00 0.00 ? 27  ASN A CG   4  
ATOM 7775  O OD1  . ASN A 1 27  ? -16.405 18.157  14.838  1.00 0.00 ? 27  ASN A OD1  4  
ATOM 7776  N ND2  . ASN A 1 27  ? -17.752 17.185  16.254  1.00 0.00 ? 27  ASN A ND2  4  
ATOM 7777  H H    . ASN A 1 27  ? -13.967 18.398  15.589  1.00 0.00 ? 27  ASN A H    4  
ATOM 7778  H HA   . ASN A 1 27  ? -13.734 15.506  15.060  1.00 0.00 ? 27  ASN A HA   4  
ATOM 7779  H HB2  . ASN A 1 27  ? -15.873 15.304  16.073  1.00 0.00 ? 27  ASN A HB2  4  
ATOM 7780  H HB3  . ASN A 1 27  ? -15.065 16.574  16.994  1.00 0.00 ? 27  ASN A HB3  4  
ATOM 7781  H HD21 . ASN A 1 27  ? -17.901 16.483  16.923  1.00 0.00 ? 27  ASN A HD21 4  
ATOM 7782  H HD22 . ASN A 1 27  ? -18.472 17.807  16.028  1.00 0.00 ? 27  ASN A HD22 4  
ATOM 7783  N N    . ALA A 1 28  ? -14.630 17.373  12.778  1.00 0.00 ? 28  ALA A N    4  
ATOM 7784  C CA   . ALA A 1 28  ? -15.210 17.465  11.409  1.00 0.00 ? 28  ALA A CA   4  
ATOM 7785  C C    . ALA A 1 28  ? -14.892 16.189  10.631  1.00 0.00 ? 28  ALA A C    4  
ATOM 7786  O O    . ALA A 1 28  ? -15.681 15.726  9.830   1.00 0.00 ? 28  ALA A O    4  
ATOM 7787  C CB   . ALA A 1 28  ? -14.601 18.663  10.678  1.00 0.00 ? 28  ALA A CB   4  
ATOM 7788  H H    . ALA A 1 28  ? -13.972 18.033  13.077  1.00 0.00 ? 28  ALA A H    4  
ATOM 7789  H HA   . ALA A 1 28  ? -16.280 17.590  11.476  1.00 0.00 ? 28  ALA A HA   4  
ATOM 7790  H HB1  . ALA A 1 28  ? -13.882 18.312  9.950   1.00 0.00 ? 28  ALA A HB1  4  
ATOM 7791  H HB2  . ALA A 1 28  ? -14.106 19.306  11.391  1.00 0.00 ? 28  ALA A HB2  4  
ATOM 7792  H HB3  . ALA A 1 28  ? -15.382 19.215  10.176  1.00 0.00 ? 28  ALA A HB3  4  
ATOM 7793  N N    . ILE A 1 29  ? -13.740 15.616  10.857  1.00 0.00 ? 29  ILE A N    4  
ATOM 7794  C CA   . ILE A 1 29  ? -13.370 14.373  10.126  1.00 0.00 ? 29  ILE A CA   4  
ATOM 7795  C C    . ILE A 1 29  ? -13.166 13.218  11.102  1.00 0.00 ? 29  ILE A C    4  
ATOM 7796  O O    . ILE A 1 29  ? -12.517 13.350  12.120  1.00 0.00 ? 29  ILE A O    4  
ATOM 7797  C CB   . ILE A 1 29  ? -12.081 14.611  9.340   1.00 0.00 ? 29  ILE A CB   4  
ATOM 7798  C CG1  . ILE A 1 29  ? -12.385 15.527  8.155   1.00 0.00 ? 29  ILE A CG1  4  
ATOM 7799  C CG2  . ILE A 1 29  ? -11.538 13.277  8.832   1.00 0.00 ? 29  ILE A CG2  4  
ATOM 7800  C CD1  . ILE A 1 29  ? -11.107 16.242  7.715   1.00 0.00 ? 29  ILE A CD1  4  
ATOM 7801  H H    . ILE A 1 29  ? -13.118 16.008  11.504  1.00 0.00 ? 29  ILE A H    4  
ATOM 7802  H HA   . ILE A 1 29  ? -14.160 14.118  9.437   1.00 0.00 ? 29  ILE A HA   4  
ATOM 7803  H HB   . ILE A 1 29  ? -11.348 15.079  9.982   1.00 0.00 ? 29  ILE A HB   4  
ATOM 7804  H HG12 . ILE A 1 29  ? -12.766 14.934  7.335   1.00 0.00 ? 29  ILE A HG12 4  
ATOM 7805  H HG13 . ILE A 1 29  ? -13.125 16.253  8.447   1.00 0.00 ? 29  ILE A HG13 4  
ATOM 7806  H HG21 . ILE A 1 29  ? -10.917 12.828  9.596   1.00 0.00 ? 29  ILE A HG21 4  
ATOM 7807  H HG22 . ILE A 1 29  ? -10.948 13.444  7.943   1.00 0.00 ? 29  ILE A HG22 4  
ATOM 7808  H HG23 . ILE A 1 29  ? -12.358 12.615  8.602   1.00 0.00 ? 29  ILE A HG23 4  
ATOM 7809  H HD11 . ILE A 1 29  ? -11.340 16.946  6.929   1.00 0.00 ? 29  ILE A HD11 4  
ATOM 7810  H HD12 . ILE A 1 29  ? -10.395 15.516  7.347   1.00 0.00 ? 29  ILE A HD12 4  
ATOM 7811  H HD13 . ILE A 1 29  ? -10.681 16.768  8.555   1.00 0.00 ? 29  ILE A HD13 4  
ATOM 7812  N N    . GLU A 1 30  ? -13.708 12.078  10.779  1.00 0.00 ? 30  GLU A N    4  
ATOM 7813  C CA   . GLU A 1 30  ? -13.546 10.887  11.662  1.00 0.00 ? 30  GLU A CA   4  
ATOM 7814  C C    . GLU A 1 30  ? -12.949 9.751   10.835  1.00 0.00 ? 30  GLU A C    4  
ATOM 7815  O O    . GLU A 1 30  ? -13.052 9.740   9.629   1.00 0.00 ? 30  GLU A O    4  
ATOM 7816  C CB   . GLU A 1 30  ? -14.905 10.460  12.217  1.00 0.00 ? 30  GLU A CB   4  
ATOM 7817  C CG   . GLU A 1 30  ? -15.501 11.598  13.044  1.00 0.00 ? 30  GLU A CG   4  
ATOM 7818  C CD   . GLU A 1 30  ? -16.809 11.131  13.685  1.00 0.00 ? 30  GLU A CD   4  
ATOM 7819  O OE1  . GLU A 1 30  ? -17.265 10.054  13.337  1.00 0.00 ? 30  GLU A OE1  4  
ATOM 7820  O OE2  . GLU A 1 30  ? -17.333 11.859  14.513  1.00 0.00 ? 30  GLU A OE2  4  
ATOM 7821  H H    . GLU A 1 30  ? -14.213 12.005  9.943   1.00 0.00 ? 30  GLU A H    4  
ATOM 7822  H HA   . GLU A 1 30  ? -12.879 11.130  12.473  1.00 0.00 ? 30  GLU A HA   4  
ATOM 7823  H HB2  . GLU A 1 30  ? -15.569 10.221  11.399  1.00 0.00 ? 30  GLU A HB2  4  
ATOM 7824  H HB3  . GLU A 1 30  ? -14.780 9.589   12.844  1.00 0.00 ? 30  GLU A HB3  4  
ATOM 7825  H HG2  . GLU A 1 30  ? -14.803 11.885  13.817  1.00 0.00 ? 30  GLU A HG2  4  
ATOM 7826  H HG3  . GLU A 1 30  ? -15.698 12.446  12.403  1.00 0.00 ? 30  GLU A HG3  4  
ATOM 7827  H HE2  . GLU A 1 30  ? -18.149 11.503  14.872  1.00 0.00 ? 30  GLU A HE2  4  
ATOM 7828  N N    . PHE A 1 31  ? -12.310 8.805   11.468  1.00 0.00 ? 31  PHE A N    4  
ATOM 7829  C CA   . PHE A 1 31  ? -11.694 7.687   10.698  1.00 0.00 ? 31  PHE A CA   4  
ATOM 7830  C C    . PHE A 1 31  ? -12.330 6.352   11.093  1.00 0.00 ? 31  PHE A C    4  
ATOM 7831  O O    . PHE A 1 31  ? -12.831 6.189   12.189  1.00 0.00 ? 31  PHE A O    4  
ATOM 7832  C CB   . PHE A 1 31  ? -10.193 7.634   10.997  1.00 0.00 ? 31  PHE A CB   4  
ATOM 7833  C CG   . PHE A 1 31  ? -9.547  8.948   10.620  1.00 0.00 ? 31  PHE A CG   4  
ATOM 7834  C CD1  . PHE A 1 31  ? -9.051  9.141   9.324   1.00 0.00 ? 31  PHE A CD1  4  
ATOM 7835  C CD2  . PHE A 1 31  ? -9.438  9.971   11.571  1.00 0.00 ? 31  PHE A CD2  4  
ATOM 7836  C CE1  . PHE A 1 31  ? -8.449  10.358  8.980   1.00 0.00 ? 31  PHE A CE1  4  
ATOM 7837  C CE2  . PHE A 1 31  ? -8.835  11.185  11.227  1.00 0.00 ? 31  PHE A CE2  4  
ATOM 7838  C CZ   . PHE A 1 31  ? -8.340  11.380  9.932   1.00 0.00 ? 31  PHE A CZ   4  
ATOM 7839  H H    . PHE A 1 31  ? -12.225 8.835   12.445  1.00 0.00 ? 31  PHE A H    4  
ATOM 7840  H HA   . PHE A 1 31  ? -11.843 7.852   9.648   1.00 0.00 ? 31  PHE A HA   4  
ATOM 7841  H HB2  . PHE A 1 31  ? -10.044 7.448   12.050  1.00 0.00 ? 31  PHE A HB2  4  
ATOM 7842  H HB3  . PHE A 1 31  ? -9.742  6.836   10.424  1.00 0.00 ? 31  PHE A HB3  4  
ATOM 7843  H HD1  . PHE A 1 31  ? -9.136  8.352   8.591   1.00 0.00 ? 31  PHE A HD1  4  
ATOM 7844  H HD2  . PHE A 1 31  ? -9.820  9.820   12.570  1.00 0.00 ? 31  PHE A HD2  4  
ATOM 7845  H HE1  . PHE A 1 31  ? -8.065  10.508  7.983   1.00 0.00 ? 31  PHE A HE1  4  
ATOM 7846  H HE2  . PHE A 1 31  ? -8.749  11.973  11.959  1.00 0.00 ? 31  PHE A HE2  4  
ATOM 7847  H HZ   . PHE A 1 31  ? -7.876  12.316  9.665   1.00 0.00 ? 31  PHE A HZ   4  
ATOM 7848  N N    . LEU A 1 32  ? -12.293 5.387   10.210  1.00 0.00 ? 32  LEU A N    4  
ATOM 7849  C CA   . LEU A 1 32  ? -12.871 4.054   10.538  1.00 0.00 ? 32  LEU A CA   4  
ATOM 7850  C C    . LEU A 1 32  ? -11.827 3.249   11.307  1.00 0.00 ? 32  LEU A C    4  
ATOM 7851  O O    . LEU A 1 32  ? -10.703 3.097   10.871  1.00 0.00 ? 32  LEU A O    4  
ATOM 7852  C CB   . LEU A 1 32  ? -13.238 3.308   9.248   1.00 0.00 ? 32  LEU A CB   4  
ATOM 7853  C CG   . LEU A 1 32  ? -13.658 1.873   9.581   1.00 0.00 ? 32  LEU A CG   4  
ATOM 7854  C CD1  . LEU A 1 32  ? -14.857 1.888   10.525  1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7855  C CD2  . LEU A 1 32  ? -14.043 1.145   8.293   1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7856  H H    . LEU A 1 32  ? -11.870 5.536   9.340   1.00 0.00 ? 32  LEU A H    4  
ATOM 7857  H HA   . LEU A 1 32  ? -13.753 4.182   11.149  1.00 0.00 ? 32  LEU A HA   4  
ATOM 7858  H HB2  . LEU A 1 32  ? -14.053 3.814   8.754   1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7859  H HB3  . LEU A 1 32  ? -12.389 3.284   8.592   1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7860  H HG   . LEU A 1 32  ? -12.835 1.356   10.054  1.00 0.00 ? 32  LEU A HG   4  
ATOM 7861  H HD11 . LEU A 1 32  ? -14.520 2.084   11.531  1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7862  H HD12 . LEU A 1 32  ? -15.351 0.929   10.491  1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7863  H HD13 . LEU A 1 32  ? -15.547 2.661   10.216  1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7864  H HD21 . LEU A 1 32  ? -13.181 0.629   7.898   1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7865  H HD22 . LEU A 1 32  ? -14.398 1.862   7.568   1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7866  H HD23 . LEU A 1 32  ? -14.827 0.432   8.505   1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7867  N N    . LEU A 1 33  ? -12.187 2.735   12.446  1.00 0.00 ? 33  LEU A N    4  
ATOM 7868  C CA   . LEU A 1 33  ? -11.214 1.944   13.244  1.00 0.00 ? 33  LEU A CA   4  
ATOM 7869  C C    . LEU A 1 33  ? -11.813 0.579   13.569  1.00 0.00 ? 33  LEU A C    4  
ATOM 7870  O O    . LEU A 1 33  ? -12.944 0.471   13.999  1.00 0.00 ? 33  LEU A O    4  
ATOM 7871  C CB   . LEU A 1 33  ? -10.889 2.691   14.540  1.00 0.00 ? 33  LEU A CB   4  
ATOM 7872  C CG   . LEU A 1 33  ? -9.741  3.669   14.287  1.00 0.00 ? 33  LEU A CG   4  
ATOM 7873  C CD1  . LEU A 1 33  ? -9.699  4.716   15.401  1.00 0.00 ? 33  LEU A CD1  4  
ATOM 7874  C CD2  . LEU A 1 33  ? -8.417  2.901   14.264  1.00 0.00 ? 33  LEU A CD2  4  
ATOM 7875  H H    . LEU A 1 33  ? -13.098 2.873   12.778  1.00 0.00 ? 33  LEU A H    4  
ATOM 7876  H HA   . LEU A 1 33  ? -10.307 1.809   12.674  1.00 0.00 ? 33  LEU A HA   4  
ATOM 7877  H HB2  . LEU A 1 33  ? -11.762 3.237   14.868  1.00 0.00 ? 33  LEU A HB2  4  
ATOM 7878  H HB3  . LEU A 1 33  ? -10.600 1.986   15.304  1.00 0.00 ? 33  LEU A HB3  4  
ATOM 7879  H HG   . LEU A 1 33  ? -9.890  4.161   13.336  1.00 0.00 ? 33  LEU A HG   4  
ATOM 7880  H HD11 . LEU A 1 33  ? -10.063 5.658   15.021  1.00 0.00 ? 33  LEU A HD11 4  
ATOM 7881  H HD12 . LEU A 1 33  ? -8.682  4.834   15.746  1.00 0.00 ? 33  LEU A HD12 4  
ATOM 7882  H HD13 . LEU A 1 33  ? -10.323 4.394   16.220  1.00 0.00 ? 33  LEU A HD13 4  
ATOM 7883  H HD21 . LEU A 1 33  ? -7.850  3.137   15.152  1.00 0.00 ? 33  LEU A HD21 4  
ATOM 7884  H HD22 . LEU A 1 33  ? -7.852  3.182   13.388  1.00 0.00 ? 33  LEU A HD22 4  
ATOM 7885  H HD23 . LEU A 1 33  ? -8.617  1.840   14.238  1.00 0.00 ? 33  LEU A HD23 4  
ATOM 7886  N N    . LEU A 1 34  ? -11.060 -0.464  13.364  1.00 0.00 ? 34  LEU A N    4  
ATOM 7887  C CA   . LEU A 1 34  ? -11.576 -1.828  13.655  1.00 0.00 ? 34  LEU A CA   4  
ATOM 7888  C C    . LEU A 1 34  ? -10.928 -2.342  14.944  1.00 0.00 ? 34  LEU A C    4  
ATOM 7889  O O    . LEU A 1 34  ? -9.764  -2.107  15.202  1.00 0.00 ? 34  LEU A O    4  
ATOM 7890  C CB   . LEU A 1 34  ? -11.230 -2.752  12.487  1.00 0.00 ? 34  LEU A CB   4  
ATOM 7891  C CG   . LEU A 1 34  ? -11.753 -2.137  11.186  1.00 0.00 ? 34  LEU A CG   4  
ATOM 7892  C CD1  . LEU A 1 34  ? -11.501 -3.098  10.025  1.00 0.00 ? 34  LEU A CD1  4  
ATOM 7893  C CD2  . LEU A 1 34  ? -13.254 -1.881  11.308  1.00 0.00 ? 34  LEU A CD2  4  
ATOM 7894  H H    . LEU A 1 34  ? -10.151 -0.351  13.013  1.00 0.00 ? 34  LEU A H    4  
ATOM 7895  H HA   . LEU A 1 34  ? -12.646 -1.790  13.780  1.00 0.00 ? 34  LEU A HA   4  
ATOM 7896  H HB2  . LEU A 1 34  ? -10.157 -2.870  12.427  1.00 0.00 ? 34  LEU A HB2  4  
ATOM 7897  H HB3  . LEU A 1 34  ? -11.691 -3.716  12.640  1.00 0.00 ? 34  LEU A HB3  4  
ATOM 7898  H HG   . LEU A 1 34  ? -11.242 -1.203  10.999  1.00 0.00 ? 34  LEU A HG   4  
ATOM 7899  H HD11 . LEU A 1 34  ? -10.448 -3.114  9.794   1.00 0.00 ? 34  LEU A HD11 4  
ATOM 7900  H HD12 . LEU A 1 34  ? -12.056 -2.764  9.159   1.00 0.00 ? 34  LEU A HD12 4  
ATOM 7901  H HD13 . LEU A 1 34  ? -11.824 -4.090  10.301  1.00 0.00 ? 34  LEU A HD13 4  
ATOM 7902  H HD21 . LEU A 1 34  ? -13.419 -0.922  11.775  1.00 0.00 ? 34  LEU A HD21 4  
ATOM 7903  H HD22 . LEU A 1 34  ? -13.705 -2.657  11.907  1.00 0.00 ? 34  LEU A HD22 4  
ATOM 7904  H HD23 . LEU A 1 34  ? -13.699 -1.882  10.322  1.00 0.00 ? 34  LEU A HD23 4  
ATOM 7905  N N    . GLN A 1 35  ? -11.674 -3.030  15.763  1.00 0.00 ? 35  GLN A N    4  
ATOM 7906  C CA   . GLN A 1 35  ? -11.102 -3.544  17.041  1.00 0.00 ? 35  GLN A CA   4  
ATOM 7907  C C    . GLN A 1 35  ? -10.608 -4.978  16.853  1.00 0.00 ? 35  GLN A C    4  
ATOM 7908  O O    . GLN A 1 35  ? -11.330 -5.841  16.393  1.00 0.00 ? 35  GLN A O    4  
ATOM 7909  C CB   . GLN A 1 35  ? -12.180 -3.523  18.125  1.00 0.00 ? 35  GLN A CB   4  
ATOM 7910  C CG   . GLN A 1 35  ? -11.567 -3.938  19.463  1.00 0.00 ? 35  GLN A CG   4  
ATOM 7911  C CD   . GLN A 1 35  ? -12.646 -3.923  20.548  1.00 0.00 ? 35  GLN A CD   4  
ATOM 7912  O OE1  . GLN A 1 35  ? -13.745 -3.459  20.320  1.00 0.00 ? 35  GLN A OE1  4  
ATOM 7913  N NE2  . GLN A 1 35  ? -12.378 -4.417  21.725  1.00 0.00 ? 35  GLN A NE2  4  
ATOM 7914  H H    . GLN A 1 35  ? -12.614 -3.202  15.543  1.00 0.00 ? 35  GLN A H    4  
ATOM 7915  H HA   . GLN A 1 35  ? -10.277 -2.916  17.342  1.00 0.00 ? 35  GLN A HA   4  
ATOM 7916  H HB2  . GLN A 1 35  ? -12.586 -2.526  18.208  1.00 0.00 ? 35  GLN A HB2  4  
ATOM 7917  H HB3  . GLN A 1 35  ? -12.968 -4.212  17.862  1.00 0.00 ? 35  GLN A HB3  4  
ATOM 7918  H HG2  . GLN A 1 35  ? -11.157 -4.935  19.376  1.00 0.00 ? 35  GLN A HG2  4  
ATOM 7919  H HG3  . GLN A 1 35  ? -10.781 -3.249  19.729  1.00 0.00 ? 35  GLN A HG3  4  
ATOM 7920  H HE21 . GLN A 1 35  ? -11.491 -4.793  21.907  1.00 0.00 ? 35  GLN A HE21 4  
ATOM 7921  H HE22 . GLN A 1 35  ? -13.062 -4.411  22.427  1.00 0.00 ? 35  GLN A HE22 4  
ATOM 7922  N N    . ALA A 1 36  ? -9.381  -5.242  17.213  1.00 0.00 ? 36  ALA A N    4  
ATOM 7923  C CA   . ALA A 1 36  ? -8.843  -6.624  17.066  1.00 0.00 ? 36  ALA A CA   4  
ATOM 7924  C C    . ALA A 1 36  ? -9.695  -7.585  17.897  1.00 0.00 ? 36  ALA A C    4  
ATOM 7925  O O    . ALA A 1 36  ? -10.191 -7.235  18.950  1.00 0.00 ? 36  ALA A O    4  
ATOM 7926  C CB   . ALA A 1 36  ? -7.396  -6.665  17.563  1.00 0.00 ? 36  ALA A CB   4  
ATOM 7927  H H    . ALA A 1 36  ? -8.817  -4.535  17.587  1.00 0.00 ? 36  ALA A H    4  
ATOM 7928  H HA   . ALA A 1 36  ? -8.877  -6.916  16.026  1.00 0.00 ? 36  ALA A HA   4  
ATOM 7929  H HB1  . ALA A 1 36  ? -7.269  -7.505  18.230  1.00 0.00 ? 36  ALA A HB1  4  
ATOM 7930  H HB2  . ALA A 1 36  ? -7.170  -5.750  18.090  1.00 0.00 ? 36  ALA A HB2  4  
ATOM 7931  H HB3  . ALA A 1 36  ? -6.729  -6.769  16.720  1.00 0.00 ? 36  ALA A HB3  4  
ATOM 7932  N N    . SER A 1 37  ? -9.875  -8.788  17.432  1.00 0.00 ? 37  SER A N    4  
ATOM 7933  C CA   . SER A 1 37  ? -10.701 -9.763  18.198  1.00 0.00 ? 37  SER A CA   4  
ATOM 7934  C C    . SER A 1 37  ? -9.859  -10.378 19.319  1.00 0.00 ? 37  SER A C    4  
ATOM 7935  O O    . SER A 1 37  ? -10.339 -11.174 20.100  1.00 0.00 ? 37  SER A O    4  
ATOM 7936  C CB   . SER A 1 37  ? -11.185 -10.867 17.256  1.00 0.00 ? 37  SER A CB   4  
ATOM 7937  O OG   . SER A 1 37  ? -10.101 -11.730 16.945  1.00 0.00 ? 37  SER A OG   4  
ATOM 7938  H H    . SER A 1 37  ? -9.470  -9.051  16.579  1.00 0.00 ? 37  SER A H    4  
ATOM 7939  H HA   . SER A 1 37  ? -11.553 -9.256  18.624  1.00 0.00 ? 37  SER A HA   4  
ATOM 7940  H HB2  . SER A 1 37  ? -11.966 -11.434 17.735  1.00 0.00 ? 37  SER A HB2  4  
ATOM 7941  H HB3  . SER A 1 37  ? -11.574 -10.418 16.351  1.00 0.00 ? 37  SER A HB3  4  
ATOM 7942  H HG   . SER A 1 37  ? -9.799  -12.135 17.764  1.00 0.00 ? 37  SER A HG   4  
ATOM 7943  N N    . ASP A 1 38  ? -8.609  -10.013 19.403  1.00 0.00 ? 38  ASP A N    4  
ATOM 7944  C CA   . ASP A 1 38  ? -7.739  -10.575 20.475  1.00 0.00 ? 38  ASP A CA   4  
ATOM 7945  C C    . ASP A 1 38  ? -6.591  -9.608  20.767  1.00 0.00 ? 38  ASP A C    4  
ATOM 7946  O O    . ASP A 1 38  ? -6.511  -8.535  20.202  1.00 0.00 ? 38  ASP A O    4  
ATOM 7947  C CB   . ASP A 1 38  ? -7.166  -11.920 20.021  1.00 0.00 ? 38  ASP A CB   4  
ATOM 7948  C CG   . ASP A 1 38  ? -6.274  -11.709 18.795  1.00 0.00 ? 38  ASP A CG   4  
ATOM 7949  O OD1  . ASP A 1 38  ? -5.936  -10.570 18.521  1.00 0.00 ? 38  ASP A OD1  4  
ATOM 7950  O OD2  . ASP A 1 38  ? -5.945  -12.691 18.151  1.00 0.00 ? 38  ASP A OD2  4  
ATOM 7951  H H    . ASP A 1 38  ? -8.242  -9.369  18.763  1.00 0.00 ? 38  ASP A H    4  
ATOM 7952  H HA   . ASP A 1 38  ? -8.322  -10.719 21.372  1.00 0.00 ? 38  ASP A HA   4  
ATOM 7953  H HB2  . ASP A 1 38  ? -6.584  -12.350 20.821  1.00 0.00 ? 38  ASP A HB2  4  
ATOM 7954  H HB3  . ASP A 1 38  ? -7.975  -12.586 19.765  1.00 0.00 ? 38  ASP A HB3  4  
ATOM 7955  H HD2  . ASP A 1 38  ? -5.387  -12.484 17.398  1.00 0.00 ? 38  ASP A HD2  4  
ATOM 7956  N N    . GLY A 1 39  ? -5.701  -9.980  21.645  1.00 0.00 ? 39  GLY A N    4  
ATOM 7957  C CA   . GLY A 1 39  ? -4.557  -9.082  21.973  1.00 0.00 ? 39  GLY A CA   4  
ATOM 7958  C C    . GLY A 1 39  ? -5.024  -7.991  22.939  1.00 0.00 ? 39  GLY A C    4  
ATOM 7959  O O    . GLY A 1 39  ? -6.025  -8.136  23.612  1.00 0.00 ? 39  GLY A O    4  
ATOM 7960  H H    . GLY A 1 39  ? -5.785  -10.851 22.087  1.00 0.00 ? 39  GLY A H    4  
ATOM 7961  H HA2  . GLY A 1 39  ? -3.767  -9.660  22.434  1.00 0.00 ? 39  GLY A HA2  4  
ATOM 7962  H HA3  . GLY A 1 39  ? -4.188  -8.623  21.069  1.00 0.00 ? 39  GLY A HA3  4  
ATOM 7963  N N    . ILE A 1 40  ? -4.313  -6.900  23.007  1.00 0.00 ? 40  ILE A N    4  
ATOM 7964  C CA   . ILE A 1 40  ? -4.726  -5.803  23.925  1.00 0.00 ? 40  ILE A CA   4  
ATOM 7965  C C    . ILE A 1 40  ? -5.987  -5.141  23.373  1.00 0.00 ? 40  ILE A C    4  
ATOM 7966  O O    . ILE A 1 40  ? -6.462  -4.153  23.894  1.00 0.00 ? 40  ILE A O    4  
ATOM 7967  C CB   . ILE A 1 40  ? -3.600  -4.765  24.032  1.00 0.00 ? 40  ILE A CB   4  
ATOM 7968  C CG1  . ILE A 1 40  ? -3.550  -3.911  22.759  1.00 0.00 ? 40  ILE A CG1  4  
ATOM 7969  C CG2  . ILE A 1 40  ? -2.262  -5.485  24.211  1.00 0.00 ? 40  ILE A CG2  4  
ATOM 7970  C CD1  . ILE A 1 40  ? -2.510  -2.799  22.930  1.00 0.00 ? 40  ILE A CD1  4  
ATOM 7971  H H    . ILE A 1 40  ? -3.512  -6.801  22.454  1.00 0.00 ? 40  ILE A H    4  
ATOM 7972  H HA   . ILE A 1 40  ? -4.934  -6.210  24.904  1.00 0.00 ? 40  ILE A HA   4  
ATOM 7973  H HB   . ILE A 1 40  ? -3.780  -4.129  24.888  1.00 0.00 ? 40  ILE A HB   4  
ATOM 7974  H HG12 . ILE A 1 40  ? -3.277  -4.532  21.919  1.00 0.00 ? 40  ILE A HG12 4  
ATOM 7975  H HG13 . ILE A 1 40  ? -4.515  -3.466  22.579  1.00 0.00 ? 40  ILE A HG13 4  
ATOM 7976  H HG21 . ILE A 1 40  ? -1.669  -5.372  23.314  1.00 0.00 ? 40  ILE A HG21 4  
ATOM 7977  H HG22 . ILE A 1 40  ? -2.441  -6.534  24.394  1.00 0.00 ? 40  ILE A HG22 4  
ATOM 7978  H HG23 . ILE A 1 40  ? -1.732  -5.058  25.048  1.00 0.00 ? 40  ILE A HG23 4  
ATOM 7979  H HD11 . ILE A 1 40  ? -1.862  -3.036  23.759  1.00 0.00 ? 40  ILE A HD11 4  
ATOM 7980  H HD12 . ILE A 1 40  ? -3.013  -1.862  23.122  1.00 0.00 ? 40  ILE A HD12 4  
ATOM 7981  H HD13 . ILE A 1 40  ? -1.923  -2.714  22.027  1.00 0.00 ? 40  ILE A HD13 4  
ATOM 7982  N N    . HIS A 1 41  ? -6.524  -5.678  22.310  1.00 0.00 ? 41  HIS A N    4  
ATOM 7983  C CA   . HIS A 1 41  ? -7.748  -5.084  21.702  1.00 0.00 ? 41  HIS A CA   4  
ATOM 7984  C C    . HIS A 1 41  ? -7.409  -3.705  21.142  1.00 0.00 ? 41  HIS A C    4  
ATOM 7985  O O    . HIS A 1 41  ? -8.210  -2.791  21.174  1.00 0.00 ? 41  HIS A O    4  
ATOM 7986  C CB   . HIS A 1 41  ? -8.846  -4.955  22.762  1.00 0.00 ? 41  HIS A CB   4  
ATOM 7987  C CG   . HIS A 1 41  ? -8.967  -6.250  23.514  1.00 0.00 ? 41  HIS A CG   4  
ATOM 7988  N ND1  . HIS A 1 41  ? -9.413  -7.418  22.910  1.00 0.00 ? 41  HIS A ND1  4  
ATOM 7989  C CD2  . HIS A 1 41  ? -8.703  -6.582  24.820  1.00 0.00 ? 41  HIS A CD2  4  
ATOM 7990  C CE1  . HIS A 1 41  ? -9.404  -8.387  23.841  1.00 0.00 ? 41  HIS A CE1  4  
ATOM 7991  N NE2  . HIS A 1 41  ? -8.979  -7.931  25.021  1.00 0.00 ? 41  HIS A NE2  4  
ATOM 7992  H H    . HIS A 1 41  ? -6.115  -6.471  21.904  1.00 0.00 ? 41  HIS A H    4  
ATOM 7993  H HA   . HIS A 1 41  ? -8.096  -5.720  20.902  1.00 0.00 ? 41  HIS A HA   4  
ATOM 7994  H HB2  . HIS A 1 41  ? -8.597  -4.160  23.449  1.00 0.00 ? 41  HIS A HB2  4  
ATOM 7995  H HB3  . HIS A 1 41  ? -9.785  -4.731  22.279  1.00 0.00 ? 41  HIS A HB3  4  
ATOM 7996  H HD1  . HIS A 1 41  ? -9.687  -7.516  21.973  1.00 0.00 ? 41  HIS A HD1  4  
ATOM 7997  H HD2  . HIS A 1 41  ? -8.336  -5.901  25.575  1.00 0.00 ? 41  HIS A HD2  4  
ATOM 7998  H HE1  . HIS A 1 41  ? -9.701  -9.410  23.658  1.00 0.00 ? 41  HIS A HE1  4  
ATOM 7999  H HE2  . HIS A 1 41  ? -8.881  -8.438  25.853  1.00 0.00 ? 41  HIS A HE2  4  
ATOM 8000  N N    . HIS A 1 42  ? -6.223  -3.551  20.622  1.00 0.00 ? 42  HIS A N    4  
ATOM 8001  C CA   . HIS A 1 42  ? -5.820  -2.236  20.054  1.00 0.00 ? 42  HIS A CA   4  
ATOM 8002  C C    . HIS A 1 42  ? -6.671  -1.936  18.821  1.00 0.00 ? 42  HIS A C    4  
ATOM 8003  O O    . HIS A 1 42  ? -7.225  -2.827  18.206  1.00 0.00 ? 42  HIS A O    4  
ATOM 8004  C CB   . HIS A 1 42  ? -4.343  -2.281  19.659  1.00 0.00 ? 42  HIS A CB   4  
ATOM 8005  C CG   . HIS A 1 42  ? -4.091  -3.489  18.802  1.00 0.00 ? 42  HIS A CG   4  
ATOM 8006  N ND1  . HIS A 1 42  ? -4.115  -4.781  19.315  1.00 0.00 ? 42  HIS A ND1  4  
ATOM 8007  C CD2  . HIS A 1 42  ? -3.803  -3.623  17.465  1.00 0.00 ? 42  HIS A CD2  4  
ATOM 8008  C CE1  . HIS A 1 42  ? -3.848  -5.624  18.301  1.00 0.00 ? 42  HIS A CE1  4  
ATOM 8009  N NE2  . HIS A 1 42  ? -3.650  -4.969  17.155  1.00 0.00 ? 42  HIS A NE2  4  
ATOM 8010  H H    . HIS A 1 42  ? -5.593  -4.303  20.605  1.00 0.00 ? 42  HIS A H    4  
ATOM 8011  H HA   . HIS A 1 42  ? -5.973  -1.463  20.792  1.00 0.00 ? 42  HIS A HA   4  
ATOM 8012  H HB2  . HIS A 1 42  ? -4.092  -1.387  19.106  1.00 0.00 ? 42  HIS A HB2  4  
ATOM 8013  H HB3  . HIS A 1 42  ? -3.734  -2.338  20.549  1.00 0.00 ? 42  HIS A HB3  4  
ATOM 8014  H HD1  . HIS A 1 42  ? -4.293  -5.030  20.246  1.00 0.00 ? 42  HIS A HD1  4  
ATOM 8015  H HD2  . HIS A 1 42  ? -3.709  -2.807  16.764  1.00 0.00 ? 42  HIS A HD2  4  
ATOM 8016  H HE1  . HIS A 1 42  ? -3.798  -6.700  18.401  1.00 0.00 ? 42  HIS A HE1  4  
ATOM 8017  H HE2  . HIS A 1 42  ? -3.442  -5.356  16.280  1.00 0.00 ? 42  HIS A HE2  4  
ATOM 8018  N N    . TRP A 1 43  ? -6.784  -0.691  18.455  1.00 0.00 ? 43  TRP A N    4  
ATOM 8019  C CA   . TRP A 1 43  ? -7.605  -0.338  17.264  1.00 0.00 ? 43  TRP A CA   4  
ATOM 8020  C C    . TRP A 1 43  ? -6.688  -0.058  16.074  1.00 0.00 ? 43  TRP A C    4  
ATOM 8021  O O    . TRP A 1 43  ? -5.721  0.668   16.181  1.00 0.00 ? 43  TRP A O    4  
ATOM 8022  C CB   . TRP A 1 43  ? -8.424  0.913   17.572  1.00 0.00 ? 43  TRP A CB   4  
ATOM 8023  C CG   . TRP A 1 43  ? -9.301  0.654   18.754  1.00 0.00 ? 43  TRP A CG   4  
ATOM 8024  C CD1  . TRP A 1 43  ? -8.886  0.652   20.042  1.00 0.00 ? 43  TRP A CD1  4  
ATOM 8025  C CD2  . TRP A 1 43  ? -10.726 0.365   18.783  1.00 0.00 ? 43  TRP A CD2  4  
ATOM 8026  N NE1  . TRP A 1 43  ? -9.966  0.377   20.860  1.00 0.00 ? 43  TRP A NE1  4  
ATOM 8027  C CE2  . TRP A 1 43  ? -11.123 0.192   20.131  1.00 0.00 ? 43  TRP A CE2  4  
ATOM 8028  C CE3  . TRP A 1 43  ? -11.705 0.235   17.782  1.00 0.00 ? 43  TRP A CE3  4  
ATOM 8029  C CZ2  . TRP A 1 43  ? -12.444 -0.098  20.472  1.00 0.00 ? 43  TRP A CZ2  4  
ATOM 8030  C CZ3  . TRP A 1 43  ? -13.034 -0.058  18.122  1.00 0.00 ? 43  TRP A CZ3  4  
ATOM 8031  C CH2  . TRP A 1 43  ? -13.404 -0.224  19.465  1.00 0.00 ? 43  TRP A CH2  4  
ATOM 8032  H H    . TRP A 1 43  ? -6.334  0.013   18.965  1.00 0.00 ? 43  TRP A H    4  
ATOM 8033  H HA   . TRP A 1 43  ? -8.269  -1.155  17.025  1.00 0.00 ? 43  TRP A HA   4  
ATOM 8034  H HB2  . TRP A 1 43  ? -7.758  1.734   17.788  1.00 0.00 ? 43  TRP A HB2  4  
ATOM 8035  H HB3  . TRP A 1 43  ? -9.036  1.161   16.718  1.00 0.00 ? 43  TRP A HB3  4  
ATOM 8036  H HD1  . TRP A 1 43  ? -7.875  0.835   20.376  1.00 0.00 ? 43  TRP A HD1  4  
ATOM 8037  H HE1  . TRP A 1 43  ? -9.934  0.317   21.836  1.00 0.00 ? 43  TRP A HE1  4  
ATOM 8038  H HE3  . TRP A 1 43  ? -11.430 0.362   16.744  1.00 0.00 ? 43  TRP A HE3  4  
ATOM 8039  H HZ2  . TRP A 1 43  ? -12.724 -0.227  21.507  1.00 0.00 ? 43  TRP A HZ2  4  
ATOM 8040  H HZ3  . TRP A 1 43  ? -13.777 -0.156  17.346  1.00 0.00 ? 43  TRP A HZ3  4  
ATOM 8041  H HH2  . TRP A 1 43  ? -14.430 -0.450  19.719  1.00 0.00 ? 43  TRP A HH2  4  
ATOM 8042  N N    . THR A 1 44  ? -6.991  -0.621  14.939  1.00 0.00 ? 44  THR A N    4  
ATOM 8043  C CA   . THR A 1 44  ? -6.145  -0.380  13.738  1.00 0.00 ? 44  THR A CA   4  
ATOM 8044  C C    . THR A 1 44  ? -7.026  -0.414  12.488  1.00 0.00 ? 44  THR A C    4  
ATOM 8045  O O    . THR A 1 44  ? -8.058  -1.054  12.467  1.00 0.00 ? 44  THR A O    4  
ATOM 8046  C CB   . THR A 1 44  ? -5.078  -1.475  13.638  1.00 0.00 ? 44  THR A CB   4  
ATOM 8047  O OG1  . THR A 1 44  ? -5.542  -2.649  14.294  1.00 0.00 ? 44  THR A OG1  4  
ATOM 8048  C CG2  . THR A 1 44  ? -3.785  -0.996  14.300  1.00 0.00 ? 44  THR A CG2  4  
ATOM 8049  H H    . THR A 1 44  ? -7.781  -1.198  14.873  1.00 0.00 ? 44  THR A H    4  
ATOM 8050  H HA   . THR A 1 44  ? -5.666  0.582   13.822  1.00 0.00 ? 44  THR A HA   4  
ATOM 8051  H HB   . THR A 1 44  ? -4.885  -1.696  12.599  1.00 0.00 ? 44  THR A HB   4  
ATOM 8052  H HG1  . THR A 1 44  ? -5.886  -2.391  15.152  1.00 0.00 ? 44  THR A HG1  4  
ATOM 8053  H HG21 . THR A 1 44  ? -3.282  -0.301  13.644  1.00 0.00 ? 44  THR A HG21 4  
ATOM 8054  H HG22 . THR A 1 44  ? -3.142  -1.843  14.488  1.00 0.00 ? 44  THR A HG22 4  
ATOM 8055  H HG23 . THR A 1 44  ? -4.017  -0.507  15.234  1.00 0.00 ? 44  THR A HG23 4  
ATOM 8056  N N    . PRO A 1 45  ? -6.616  0.265   11.451  1.00 0.00 ? 45  PRO A N    4  
ATOM 8057  C CA   . PRO A 1 45  ? -7.379  0.309   10.171  1.00 0.00 ? 45  PRO A CA   4  
ATOM 8058  C C    . PRO A 1 45  ? -7.370  -1.046  9.460   1.00 0.00 ? 45  PRO A C    4  
ATOM 8059  O O    . PRO A 1 45  ? -6.479  -1.850  9.653   1.00 0.00 ? 45  PRO A O    4  
ATOM 8060  C CB   . PRO A 1 45  ? -6.646  1.358   9.333   1.00 0.00 ? 45  PRO A CB   4  
ATOM 8061  C CG   . PRO A 1 45  ? -5.273  1.452   9.910   1.00 0.00 ? 45  PRO A CG   4  
ATOM 8062  C CD   . PRO A 1 45  ? -5.386  1.065   11.386  1.00 0.00 ? 45  PRO A CD   4  
ATOM 8063  H HA   . PRO A 1 45  ? -8.391  0.632   10.352  1.00 0.00 ? 45  PRO A HA   4  
ATOM 8064  H HB2  . PRO A 1 45  ? -6.599  1.041   8.301   1.00 0.00 ? 45  PRO A HB2  4  
ATOM 8065  H HB3  . PRO A 1 45  ? -7.145  2.312   9.410   1.00 0.00 ? 45  PRO A HB3  4  
ATOM 8066  H HG2  . PRO A 1 45  ? -4.609  0.771   9.396   1.00 0.00 ? 45  PRO A HG2  4  
ATOM 8067  H HG3  . PRO A 1 45  ? -4.906  2.462   9.829   1.00 0.00 ? 45  PRO A HG3  4  
ATOM 8068  H HD2  . PRO A 1 45  ? -4.531  0.476   11.689  1.00 0.00 ? 45  PRO A HD2  4  
ATOM 8069  H HD3  . PRO A 1 45  ? -5.482  1.946   12.003  1.00 0.00 ? 45  PRO A HD3  4  
ATOM 8070  N N    . PRO A 1 46  ? -8.356  -1.298  8.643   1.00 0.00 ? 46  PRO A N    4  
ATOM 8071  C CA   . PRO A 1 46  ? -8.466  -2.580  7.891   1.00 0.00 ? 46  PRO A CA   4  
ATOM 8072  C C    . PRO A 1 46  ? -7.251  -2.814  6.991   1.00 0.00 ? 46  PRO A C    4  
ATOM 8073  O O    . PRO A 1 46  ? -7.154  -2.273  5.907   1.00 0.00 ? 46  PRO A O    4  
ATOM 8074  C CB   . PRO A 1 46  ? -9.741  -2.419  7.052   1.00 0.00 ? 46  PRO A CB   4  
ATOM 8075  C CG   . PRO A 1 46  ? -10.076 -0.962  7.072   1.00 0.00 ? 46  PRO A CG   4  
ATOM 8076  C CD   . PRO A 1 46  ? -9.468  -0.387  8.347   1.00 0.00 ? 46  PRO A CD   4  
ATOM 8077  H HA   . PRO A 1 46  ? -8.586  -3.404  8.574   1.00 0.00 ? 46  PRO A HA   4  
ATOM 8078  H HB2  . PRO A 1 46  ? -9.560  -2.749  6.038   1.00 0.00 ? 46  PRO A HB2  4  
ATOM 8079  H HB3  . PRO A 1 46  ? -10.546 -2.985  7.489   1.00 0.00 ? 46  PRO A HB3  4  
ATOM 8080  H HG2  . PRO A 1 46  ? -9.653  -0.474  6.203   1.00 0.00 ? 46  PRO A HG2  4  
ATOM 8081  H HG3  . PRO A 1 46  ? -11.145 -0.829  7.089   1.00 0.00 ? 46  PRO A HG3  4  
ATOM 8082  H HD2  . PRO A 1 46  ? -9.105  0.616   8.175   1.00 0.00 ? 46  PRO A HD2  4  
ATOM 8083  H HD3  . PRO A 1 46  ? -10.185 -0.401  9.152   1.00 0.00 ? 46  PRO A HD3  4  
ATOM 8084  N N    . LYS A 1 47  ? -6.317  -3.614  7.436   1.00 0.00 ? 47  LYS A N    4  
ATOM 8085  C CA   . LYS A 1 47  ? -5.102  -3.876  6.614   1.00 0.00 ? 47  LYS A CA   4  
ATOM 8086  C C    . LYS A 1 47  ? -4.840  -5.379  6.524   1.00 0.00 ? 47  LYS A C    4  
ATOM 8087  O O    . LYS A 1 47  ? -5.355  -6.161  7.300   1.00 0.00 ? 47  LYS A O    4  
ATOM 8088  C CB   . LYS A 1 47  ? -3.896  -3.187  7.253   1.00 0.00 ? 47  LYS A CB   4  
ATOM 8089  C CG   . LYS A 1 47  ? -3.567  -3.861  8.587   1.00 0.00 ? 47  LYS A CG   4  
ATOM 8090  C CD   . LYS A 1 47  ? -2.446  -3.092  9.287   1.00 0.00 ? 47  LYS A CD   4  
ATOM 8091  C CE   . LYS A 1 47  ? -1.919  -3.913  10.463  1.00 0.00 ? 47  LYS A CE   4  
ATOM 8092  N NZ   . LYS A 1 47  ? -2.990  -4.048  11.492  1.00 0.00 ? 47  LYS A NZ   4  
ATOM 8093  H H    . LYS A 1 47  ? -6.412  -4.034  8.317   1.00 0.00 ? 47  LYS A H    4  
ATOM 8094  H HA   . LYS A 1 47  ? -5.253  -3.483  5.621   1.00 0.00 ? 47  LYS A HA   4  
ATOM 8095  H HB2  . LYS A 1 47  ? -3.045  -3.264  6.591   1.00 0.00 ? 47  LYS A HB2  4  
ATOM 8096  H HB3  . LYS A 1 47  ? -4.125  -2.144  7.425   1.00 0.00 ? 47  LYS A HB3  4  
ATOM 8097  H HG2  . LYS A 1 47  ? -4.446  -3.865  9.215   1.00 0.00 ? 47  LYS A HG2  4  
ATOM 8098  H HG3  . LYS A 1 47  ? -3.246  -4.876  8.409   1.00 0.00 ? 47  LYS A HG3  4  
ATOM 8099  H HD2  . LYS A 1 47  ? -1.643  -2.909  8.586   1.00 0.00 ? 47  LYS A HD2  4  
ATOM 8100  H HD3  . LYS A 1 47  ? -2.825  -2.150  9.651   1.00 0.00 ? 47  LYS A HD3  4  
ATOM 8101  H HE2  . LYS A 1 47  ? -1.627  -4.894  10.117  1.00 0.00 ? 47  LYS A HE2  4  
ATOM 8102  H HE3  . LYS A 1 47  ? -1.066  -3.416  10.898  1.00 0.00 ? 47  LYS A HE3  4  
ATOM 8103  H HZ1  . LYS A 1 47  ? -3.364  -3.110  11.731  1.00 0.00 ? 47  LYS A HZ1  4  
ATOM 8104  H HZ2  . LYS A 1 47  ? -2.595  -4.492  12.347  1.00 0.00 ? 47  LYS A HZ2  4  
ATOM 8105  H HZ3  . LYS A 1 47  ? -3.758  -4.640  11.116  1.00 0.00 ? 47  LYS A HZ3  4  
ATOM 8106  N N    . GLY A 1 48  ? -4.037  -5.785  5.581   1.00 0.00 ? 48  GLY A N    4  
ATOM 8107  C CA   . GLY A 1 48  ? -3.725  -7.234  5.427   1.00 0.00 ? 48  GLY A CA   4  
ATOM 8108  C C    . GLY A 1 48  ? -2.447  -7.385  4.603   1.00 0.00 ? 48  GLY A C    4  
ATOM 8109  O O    . GLY A 1 48  ? -1.733  -6.429  4.366   1.00 0.00 ? 48  GLY A O    4  
ATOM 8110  H H    . GLY A 1 48  ? -3.635  -5.133  4.972   1.00 0.00 ? 48  GLY A H    4  
ATOM 8111  H HA2  . GLY A 1 48  ? -3.584  -7.679  6.403   1.00 0.00 ? 48  GLY A HA2  4  
ATOM 8112  H HA3  . GLY A 1 48  ? -4.539  -7.728  4.918   1.00 0.00 ? 48  GLY A HA3  4  
ATOM 8113  N N    . HIS A 1 49  ? -2.148  -8.574  4.158   1.00 0.00 ? 49  HIS A N    4  
ATOM 8114  C CA   . HIS A 1 49  ? -0.914  -8.771  3.347   1.00 0.00 ? 49  HIS A CA   4  
ATOM 8115  C C    . HIS A 1 49  ? -1.284  -8.742  1.863   1.00 0.00 ? 49  HIS A C    4  
ATOM 8116  O O    . HIS A 1 49  ? -2.272  -9.314  1.449   1.00 0.00 ? 49  HIS A O    4  
ATOM 8117  C CB   . HIS A 1 49  ? -0.281  -10.121 3.694   1.00 0.00 ? 49  HIS A CB   4  
ATOM 8118  C CG   . HIS A 1 49  ? 0.245   -10.081 5.102   1.00 0.00 ? 49  HIS A CG   4  
ATOM 8119  N ND1  . HIS A 1 49  ? -0.529  -10.448 6.194   1.00 0.00 ? 49  HIS A ND1  4  
ATOM 8120  C CD2  . HIS A 1 49  ? 1.466   -9.720  5.614   1.00 0.00 ? 49  HIS A CD2  4  
ATOM 8121  C CE1  . HIS A 1 49  ? 0.227   -10.299 7.297   1.00 0.00 ? 49  HIS A CE1  4  
ATOM 8122  N NE2  . HIS A 1 49  ? 1.450   -9.859  6.997   1.00 0.00 ? 49  HIS A NE2  4  
ATOM 8123  H H    . HIS A 1 49  ? -2.734  -9.332  4.354   1.00 0.00 ? 49  HIS A H    4  
ATOM 8124  H HA   . HIS A 1 49  ? -0.213  -7.979  3.558   1.00 0.00 ? 49  HIS A HA   4  
ATOM 8125  H HB2  . HIS A 1 49  ? -1.025  -10.900 3.609   1.00 0.00 ? 49  HIS A HB2  4  
ATOM 8126  H HB3  . HIS A 1 49  ? 0.530   -10.324 3.013   1.00 0.00 ? 49  HIS A HB3  4  
ATOM 8127  H HD1  . HIS A 1 49  ? -1.460  -10.759 6.168   1.00 0.00 ? 49  HIS A HD1  4  
ATOM 8128  H HD2  . HIS A 1 49  ? 2.310   -9.379  5.033   1.00 0.00 ? 49  HIS A HD2  4  
ATOM 8129  H HE1  . HIS A 1 49  ? -0.113  -10.511 8.301   1.00 0.00 ? 49  HIS A HE1  4  
ATOM 8130  H HE2  . HIS A 1 49  ? 2.184   -9.674  7.620   1.00 0.00 ? 49  HIS A HE2  4  
ATOM 8131  N N    . VAL A 1 50  ? -0.504  -8.072  1.060   1.00 0.00 ? 50  VAL A N    4  
ATOM 8132  C CA   . VAL A 1 50  ? -0.823  -8.000  -0.391  1.00 0.00 ? 50  VAL A CA   4  
ATOM 8133  C C    . VAL A 1 50  ? -0.234  -9.214  -1.109  1.00 0.00 ? 50  VAL A C    4  
ATOM 8134  O O    . VAL A 1 50  ? 0.900   -9.595  -0.891  1.00 0.00 ? 50  VAL A O    4  
ATOM 8135  C CB   . VAL A 1 50  ? -0.244  -6.708  -0.980  1.00 0.00 ? 50  VAL A CB   4  
ATOM 8136  C CG1  . VAL A 1 50  ? 0.500   -5.934  0.106   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 8137  C CG2  . VAL A 1 50  ? 0.719   -7.033  -2.128  1.00 0.00 ? 50  VAL A CG2  4  
ATOM 8138  H H    . VAL A 1 50  ? 0.286   -7.611  1.413   1.00 0.00 ? 50  VAL A H    4  
ATOM 8139  H HA   . VAL A 1 50  ? -1.894  -8.000  -0.518  1.00 0.00 ? 50  VAL A HA   4  
ATOM 8140  H HB   . VAL A 1 50  ? -1.049  -6.097  -1.355  1.00 0.00 ? 50  VAL A HB   4  
ATOM 8141  H HG11 . VAL A 1 50  ? 1.343   -6.515  0.451   1.00 0.00 ? 50  VAL A HG11 4  
ATOM 8142  H HG12 . VAL A 1 50  ? -0.168  -5.745  0.932   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 8143  H HG13 . VAL A 1 50  ? 0.850   -4.995  -0.295  1.00 0.00 ? 50  VAL A HG13 4  
ATOM 8144  H HG21 . VAL A 1 50  ? 0.188   -7.567  -2.902  1.00 0.00 ? 50  VAL A HG21 4  
ATOM 8145  H HG22 . VAL A 1 50  ? 1.533   -7.637  -1.760  1.00 0.00 ? 50  VAL A HG22 4  
ATOM 8146  H HG23 . VAL A 1 50  ? 1.113   -6.114  -2.535  1.00 0.00 ? 50  VAL A HG23 4  
ATOM 8147  N N    . GLU A 1 51  ? -1.001  -9.818  -1.970  1.00 0.00 ? 51  GLU A N    4  
ATOM 8148  C CA   . GLU A 1 51  ? -0.504  -11.003 -2.720  1.00 0.00 ? 51  GLU A CA   4  
ATOM 8149  C C    . GLU A 1 51  ? 0.731   -10.583 -3.533  1.00 0.00 ? 51  GLU A C    4  
ATOM 8150  O O    . GLU A 1 51  ? 1.184   -9.462  -3.430  1.00 0.00 ? 51  GLU A O    4  
ATOM 8151  C CB   . GLU A 1 51  ? -1.620  -11.490 -3.651  1.00 0.00 ? 51  GLU A CB   4  
ATOM 8152  C CG   . GLU A 1 51  ? -1.989  -12.946 -3.331  1.00 0.00 ? 51  GLU A CG   4  
ATOM 8153  C CD   . GLU A 1 51  ? -3.157  -12.969 -2.344  1.00 0.00 ? 51  GLU A CD   4  
ATOM 8154  O OE1  . GLU A 1 51  ? -4.216  -12.476 -2.699  1.00 0.00 ? 51  GLU A OE1  4  
ATOM 8155  O OE2  . GLU A 1 51  ? -2.973  -13.476 -1.251  1.00 0.00 ? 51  GLU A OE2  4  
ATOM 8156  H H    . GLU A 1 51  ? -1.909  -9.487  -2.130  1.00 0.00 ? 51  GLU A H    4  
ATOM 8157  H HA   . GLU A 1 51  ? -0.233  -11.783 -2.026  1.00 0.00 ? 51  GLU A HA   4  
ATOM 8158  H HB2  . GLU A 1 51  ? -2.486  -10.876 -3.505  1.00 0.00 ? 51  GLU A HB2  4  
ATOM 8159  H HB3  . GLU A 1 51  ? -1.301  -11.409 -4.676  1.00 0.00 ? 51  GLU A HB3  4  
ATOM 8160  H HG2  . GLU A 1 51  ? -2.278  -13.449 -4.243  1.00 0.00 ? 51  GLU A HG2  4  
ATOM 8161  H HG3  . GLU A 1 51  ? -1.142  -13.451 -2.896  1.00 0.00 ? 51  GLU A HG3  4  
ATOM 8162  H HE2  . GLU A 1 51  ? -3.748  -13.455 -0.685  1.00 0.00 ? 51  GLU A HE2  4  
ATOM 8163  N N    . PRO A 1 52  ? 1.284   -11.469 -4.321  1.00 0.00 ? 52  PRO A N    4  
ATOM 8164  C CA   . PRO A 1 52  ? 2.493   -11.157 -5.135  1.00 0.00 ? 52  PRO A CA   4  
ATOM 8165  C C    . PRO A 1 52  ? 2.170   -10.268 -6.341  1.00 0.00 ? 52  PRO A C    4  
ATOM 8166  O O    . PRO A 1 52  ? 2.566   -9.120  -6.399  1.00 0.00 ? 52  PRO A O    4  
ATOM 8167  C CB   . PRO A 1 52  ? 2.992   -12.529 -5.593  1.00 0.00 ? 52  PRO A CB   4  
ATOM 8168  C CG   . PRO A 1 52  ? 1.794   -13.422 -5.564  1.00 0.00 ? 52  PRO A CG   4  
ATOM 8169  C CD   . PRO A 1 52  ? 0.827   -12.853 -4.523  1.00 0.00 ? 52  PRO A CD   4  
ATOM 8170  H HA   . PRO A 1 52  ? 3.245   -10.691 -4.521  1.00 0.00 ? 52  PRO A HA   4  
ATOM 8171  H HB2  . PRO A 1 52  ? 3.388   -12.466 -6.596  1.00 0.00 ? 52  PRO A HB2  4  
ATOM 8172  H HB3  . PRO A 1 52  ? 3.743   -12.899 -4.915  1.00 0.00 ? 52  PRO A HB3  4  
ATOM 8173  H HG2  . PRO A 1 52  ? 1.324   -13.439 -6.539  1.00 0.00 ? 52  PRO A HG2  4  
ATOM 8174  H HG3  . PRO A 1 52  ? 2.085   -14.420 -5.278  1.00 0.00 ? 52  PRO A HG3  4  
ATOM 8175  H HD2  . PRO A 1 52  ? -0.180  -12.870 -4.907  1.00 0.00 ? 52  PRO A HD2  4  
ATOM 8176  H HD3  . PRO A 1 52  ? 0.894   -13.405 -3.599  1.00 0.00 ? 52  PRO A HD3  4  
ATOM 8177  N N    . GLY A 1 53  ? 1.453   -10.783 -7.300  1.00 0.00 ? 53  GLY A N    4  
ATOM 8178  C CA   . GLY A 1 53  ? 1.107   -9.961  -8.494  1.00 0.00 ? 53  GLY A CA   4  
ATOM 8179  C C    . GLY A 1 53  ? -0.096  -9.076  -8.167  1.00 0.00 ? 53  GLY A C    4  
ATOM 8180  O O    . GLY A 1 53  ? -0.788  -8.599  -9.046  1.00 0.00 ? 53  GLY A O    4  
ATOM 8181  H H    . GLY A 1 53  ? 1.140   -11.710 -7.236  1.00 0.00 ? 53  GLY A H    4  
ATOM 8182  H HA2  . GLY A 1 53  ? 1.952   -9.341  -8.762  1.00 0.00 ? 53  GLY A HA2  4  
ATOM 8183  H HA3  . GLY A 1 53  ? 0.860   -10.610 -9.321  1.00 0.00 ? 53  GLY A HA3  4  
ATOM 8184  N N    . GLU A 1 54  ? -0.358  -8.860  -6.907  1.00 0.00 ? 54  GLU A N    4  
ATOM 8185  C CA   . GLU A 1 54  ? -1.521  -8.018  -6.514  1.00 0.00 ? 54  GLU A CA   4  
ATOM 8186  C C    . GLU A 1 54  ? -1.096  -6.555  -6.408  1.00 0.00 ? 54  GLU A C    4  
ATOM 8187  O O    . GLU A 1 54  ? 0.022   -6.245  -6.049  1.00 0.00 ? 54  GLU A O    4  
ATOM 8188  C CB   . GLU A 1 54  ? -2.049  -8.486  -5.159  1.00 0.00 ? 54  GLU A CB   4  
ATOM 8189  C CG   . GLU A 1 54  ? -3.345  -7.745  -4.832  1.00 0.00 ? 54  GLU A CG   4  
ATOM 8190  C CD   . GLU A 1 54  ? -3.812  -8.127  -3.425  1.00 0.00 ? 54  GLU A CD   4  
ATOM 8191  O OE1  . GLU A 1 54  ? -3.084  -8.840  -2.753  1.00 0.00 ? 54  GLU A OE1  4  
ATOM 8192  O OE2  . GLU A 1 54  ? -4.890  -7.703  -3.046  1.00 0.00 ? 54  GLU A OE2  4  
ATOM 8193  H H    . GLU A 1 54  ? 0.210   -9.261  -6.217  1.00 0.00 ? 54  GLU A H    4  
ATOM 8194  H HA   . GLU A 1 54  ? -2.302  -8.114  -7.255  1.00 0.00 ? 54  GLU A HA   4  
ATOM 8195  H HB2  . GLU A 1 54  ? -2.239  -9.544  -5.197  1.00 0.00 ? 54  GLU A HB2  4  
ATOM 8196  H HB3  . GLU A 1 54  ? -1.317  -8.277  -4.398  1.00 0.00 ? 54  GLU A HB3  4  
ATOM 8197  H HG2  . GLU A 1 54  ? -3.166  -6.683  -4.878  1.00 0.00 ? 54  GLU A HG2  4  
ATOM 8198  H HG3  . GLU A 1 54  ? -4.105  -8.016  -5.548  1.00 0.00 ? 54  GLU A HG3  4  
ATOM 8199  H HE2  . GLU A 1 54  ? -5.118  -7.983  -2.156  1.00 0.00 ? 54  GLU A HE2  4  
ATOM 8200  N N    . ASP A 1 55  ? -1.985  -5.651  -6.712  1.00 0.00 ? 55  ASP A N    4  
ATOM 8201  C CA   . ASP A 1 55  ? -1.643  -4.205  -6.627  1.00 0.00 ? 55  ASP A CA   4  
ATOM 8202  C C    . ASP A 1 55  ? -1.512  -3.795  -5.169  1.00 0.00 ? 55  ASP A C    4  
ATOM 8203  O O    . ASP A 1 55  ? -2.006  -4.452  -4.272  1.00 0.00 ? 55  ASP A O    4  
ATOM 8204  C CB   . ASP A 1 55  ? -2.748  -3.365  -7.246  1.00 0.00 ? 55  ASP A CB   4  
ATOM 8205  C CG   . ASP A 1 55  ? -2.247  -1.935  -7.463  1.00 0.00 ? 55  ASP A CG   4  
ATOM 8206  O OD1  . ASP A 1 55  ? -1.667  -1.684  -8.506  1.00 0.00 ? 55  ASP A OD1  4  
ATOM 8207  O OD2  . ASP A 1 55  ? -2.452  -1.118  -6.580  1.00 0.00 ? 55  ASP A OD2  4  
ATOM 8208  H H    . ASP A 1 55  ? -2.883  -5.925  -6.995  1.00 0.00 ? 55  ASP A H    4  
ATOM 8209  H HA   . ASP A 1 55  ? -0.712  -4.017  -7.142  1.00 0.00 ? 55  ASP A HA   4  
ATOM 8210  H HB2  . ASP A 1 55  ? -3.049  -3.790  -8.184  1.00 0.00 ? 55  ASP A HB2  4  
ATOM 8211  H HB3  . ASP A 1 55  ? -3.582  -3.347  -6.574  1.00 0.00 ? 55  ASP A HB3  4  
ATOM 8212  H HD2  . ASP A 1 55  ? -2.111  -0.244  -6.783  1.00 0.00 ? 55  ASP A HD2  4  
ATOM 8213  N N    . ASP A 1 56  ? -0.869  -2.697  -4.931  1.00 0.00 ? 56  ASP A N    4  
ATOM 8214  C CA   . ASP A 1 56  ? -0.713  -2.214  -3.534  1.00 0.00 ? 56  ASP A CA   4  
ATOM 8215  C C    . ASP A 1 56  ? -2.038  -1.608  -3.053  1.00 0.00 ? 56  ASP A C    4  
ATOM 8216  O O    . ASP A 1 56  ? -2.521  -1.917  -1.981  1.00 0.00 ? 56  ASP A O    4  
ATOM 8217  C CB   . ASP A 1 56  ? 0.383   -1.149  -3.487  1.00 0.00 ? 56  ASP A CB   4  
ATOM 8218  C CG   . ASP A 1 56  ? 1.720   -1.774  -3.891  1.00 0.00 ? 56  ASP A CG   4  
ATOM 8219  O OD1  . ASP A 1 56  ? 2.626   -1.027  -4.218  1.00 0.00 ? 56  ASP A OD1  4  
ATOM 8220  O OD2  . ASP A 1 56  ? 1.814   -2.991  -3.867  1.00 0.00 ? 56  ASP A OD2  4  
ATOM 8221  H H    . ASP A 1 56  ? -0.499  -2.181  -5.678  1.00 0.00 ? 56  ASP A H    4  
ATOM 8222  H HA   . ASP A 1 56  ? -0.442  -3.040  -2.893  1.00 0.00 ? 56  ASP A HA   4  
ATOM 8223  H HB2  . ASP A 1 56  ? 0.138   -0.349  -4.169  1.00 0.00 ? 56  ASP A HB2  4  
ATOM 8224  H HB3  . ASP A 1 56  ? 0.462   -0.758  -2.484  1.00 0.00 ? 56  ASP A HB3  4  
ATOM 8225  H HD2  . ASP A 1 56  ? 2.679   -3.312  -4.133  1.00 0.00 ? 56  ASP A HD2  4  
ATOM 8226  N N    . LEU A 1 57  ? -2.626  -0.737  -3.836  1.00 0.00 ? 57  LEU A N    4  
ATOM 8227  C CA   . LEU A 1 57  ? -3.911  -0.108  -3.416  1.00 0.00 ? 57  LEU A CA   4  
ATOM 8228  C C    . LEU A 1 57  ? -5.054  -1.125  -3.463  1.00 0.00 ? 57  LEU A C    4  
ATOM 8229  O O    . LEU A 1 57  ? -5.845  -1.213  -2.547  1.00 0.00 ? 57  LEU A O    4  
ATOM 8230  C CB   . LEU A 1 57  ? -4.243  1.067   -4.342  1.00 0.00 ? 57  LEU A CB   4  
ATOM 8231  C CG   . LEU A 1 57  ? -5.591  1.675   -3.936  1.00 0.00 ? 57  LEU A CG   4  
ATOM 8232  C CD1  . LEU A 1 57  ? -5.520  2.187   -2.496  1.00 0.00 ? 57  LEU A CD1  4  
ATOM 8233  C CD2  . LEU A 1 57  ? -5.927  2.842   -4.864  1.00 0.00 ? 57  LEU A CD2  4  
ATOM 8234  H H    . LEU A 1 57  ? -2.219  -0.496  -4.694  1.00 0.00 ? 57  LEU A H    4  
ATOM 8235  H HA   . LEU A 1 57  ? -3.807  0.259   -2.406  1.00 0.00 ? 57  LEU A HA   4  
ATOM 8236  H HB2  . LEU A 1 57  ? -3.469  1.815   -4.262  1.00 0.00 ? 57  LEU A HB2  4  
ATOM 8237  H HB3  . LEU A 1 57  ? -4.301  0.716   -5.362  1.00 0.00 ? 57  LEU A HB3  4  
ATOM 8238  H HG   . LEU A 1 57  ? -6.361  0.924   -4.010  1.00 0.00 ? 57  LEU A HG   4  
ATOM 8239  H HD11 . LEU A 1 57  ? -4.573  2.678   -2.336  1.00 0.00 ? 57  LEU A HD11 4  
ATOM 8240  H HD12 . LEU A 1 57  ? -5.619  1.357   -1.812  1.00 0.00 ? 57  LEU A HD12 4  
ATOM 8241  H HD13 . LEU A 1 57  ? -6.322  2.890   -2.325  1.00 0.00 ? 57  LEU A HD13 4  
ATOM 8242  H HD21 . LEU A 1 57  ? -6.147  2.467   -5.852  1.00 0.00 ? 57  LEU A HD21 4  
ATOM 8243  H HD22 . LEU A 1 57  ? -5.086  3.517   -4.913  1.00 0.00 ? 57  LEU A HD22 4  
ATOM 8244  H HD23 . LEU A 1 57  ? -6.790  3.369   -4.478  1.00 0.00 ? 57  LEU A HD23 4  
ATOM 8245  N N    . GLU A 1 58  ? -5.156  -1.892  -4.515  1.00 0.00 ? 58  GLU A N    4  
ATOM 8246  C CA   . GLU A 1 58  ? -6.266  -2.885  -4.586  1.00 0.00 ? 58  GLU A CA   4  
ATOM 8247  C C    . GLU A 1 58  ? -6.228  -3.746  -3.328  1.00 0.00 ? 58  GLU A C    4  
ATOM 8248  O O    . GLU A 1 58  ? -7.252  -4.089  -2.770  1.00 0.00 ? 58  GLU A O    4  
ATOM 8249  C CB   . GLU A 1 58  ? -6.109  -3.770  -5.828  1.00 0.00 ? 58  GLU A CB   4  
ATOM 8250  C CG   . GLU A 1 58  ? -6.468  -2.975  -7.093  1.00 0.00 ? 58  GLU A CG   4  
ATOM 8251  C CD   . GLU A 1 58  ? -5.295  -2.091  -7.526  1.00 0.00 ? 58  GLU A CD   4  
ATOM 8252  O OE1  . GLU A 1 58  ? -4.740  -1.415  -6.678  1.00 0.00 ? 58  GLU A OE1  4  
ATOM 8253  O OE2  . GLU A 1 58  ? -4.971  -2.109  -8.703  1.00 0.00 ? 58  GLU A OE2  4  
ATOM 8254  H H    . GLU A 1 58  ? -4.514  -1.813  -5.251  1.00 0.00 ? 58  GLU A H    4  
ATOM 8255  H HA   . GLU A 1 58  ? -7.214  -2.362  -4.631  1.00 0.00 ? 58  GLU A HA   4  
ATOM 8256  H HB2  . GLU A 1 58  ? -5.093  -4.119  -5.894  1.00 0.00 ? 58  GLU A HB2  4  
ATOM 8257  H HB3  . GLU A 1 58  ? -6.770  -4.619  -5.746  1.00 0.00 ? 58  GLU A HB3  4  
ATOM 8258  H HG2  . GLU A 1 58  ? -6.710  -3.663  -7.890  1.00 0.00 ? 58  GLU A HG2  4  
ATOM 8259  H HG3  . GLU A 1 58  ? -7.323  -2.351  -6.892  1.00 0.00 ? 58  GLU A HG3  4  
ATOM 8260  H HE2  . GLU A 1 58  ? -4.229  -1.533  -8.904  1.00 0.00 ? 58  GLU A HE2  4  
ATOM 8261  N N    . THR A 1 59  ? -5.057  -4.078  -2.851  1.00 0.00 ? 59  THR A N    4  
ATOM 8262  C CA   . THR A 1 59  ? -4.986  -4.883  -1.606  1.00 0.00 ? 59  THR A CA   4  
ATOM 8263  C C    . THR A 1 59  ? -5.693  -4.107  -0.504  1.00 0.00 ? 59  THR A C    4  
ATOM 8264  O O    . THR A 1 59  ? -6.462  -4.652  0.263   1.00 0.00 ? 59  THR A O    4  
ATOM 8265  C CB   . THR A 1 59  ? -3.526  -5.126  -1.224  1.00 0.00 ? 59  THR A CB   4  
ATOM 8266  O OG1  . THR A 1 59  ? -2.883  -5.824  -2.280  1.00 0.00 ? 59  THR A OG1  4  
ATOM 8267  C CG2  . THR A 1 59  ? -3.466  -5.952  0.062   1.00 0.00 ? 59  THR A CG2  4  
ATOM 8268  H H    . THR A 1 59  ? -4.237  -3.775  -3.294  1.00 0.00 ? 59  THR A H    4  
ATOM 8269  H HA   . THR A 1 59  ? -5.484  -5.830  -1.760  1.00 0.00 ? 59  THR A HA   4  
ATOM 8270  H HB   . THR A 1 59  ? -3.027  -4.181  -1.063  1.00 0.00 ? 59  THR A HB   4  
ATOM 8271  H HG1  . THR A 1 59  ? -3.563  -6.232  -2.823  1.00 0.00 ? 59  THR A HG1  4  
ATOM 8272  H HG21 . THR A 1 59  ? -4.063  -5.474  0.824   1.00 0.00 ? 59  THR A HG21 4  
ATOM 8273  H HG22 . THR A 1 59  ? -2.443  -6.022  0.400   1.00 0.00 ? 59  THR A HG22 4  
ATOM 8274  H HG23 . THR A 1 59  ? -3.852  -6.943  -0.129  1.00 0.00 ? 59  THR A HG23 4  
ATOM 8275  N N    . ALA A 1 60  ? -5.463  -2.823  -0.438  1.00 0.00 ? 60  ALA A N    4  
ATOM 8276  C CA   . ALA A 1 60  ? -6.149  -2.004  0.592   1.00 0.00 ? 60  ALA A CA   4  
ATOM 8277  C C    . ALA A 1 60  ? -7.645  -2.011  0.280   1.00 0.00 ? 60  ALA A C    4  
ATOM 8278  O O    . ALA A 1 60  ? -8.475  -2.168  1.151   1.00 0.00 ? 60  ALA A O    4  
ATOM 8279  C CB   . ALA A 1 60  ? -5.617  -0.572  0.548   1.00 0.00 ? 60  ALA A CB   4  
ATOM 8280  H H    . ALA A 1 60  ? -4.857  -2.400  -1.081  1.00 0.00 ? 60  ALA A H    4  
ATOM 8281  H HA   . ALA A 1 60  ? -5.979  -2.428  1.570   1.00 0.00 ? 60  ALA A HA   4  
ATOM 8282  H HB1  . ALA A 1 60  ? -4.592  -0.579  0.210   1.00 0.00 ? 60  ALA A HB1  4  
ATOM 8283  H HB2  . ALA A 1 60  ? -5.665  -0.136  1.536   1.00 0.00 ? 60  ALA A HB2  4  
ATOM 8284  H HB3  . ALA A 1 60  ? -6.215  0.015   -0.132  1.00 0.00 ? 60  ALA A HB3  4  
ATOM 8285  N N    . LEU A 1 61  ? -7.989  -1.862  -0.972  1.00 0.00 ? 61  LEU A N    4  
ATOM 8286  C CA   . LEU A 1 61  ? -9.425  -1.876  -1.367  1.00 0.00 ? 61  LEU A CA   4  
ATOM 8287  C C    . LEU A 1 61  ? -10.044 -3.208  -0.949  1.00 0.00 ? 61  LEU A C    4  
ATOM 8288  O O    . LEU A 1 61  ? -11.067 -3.256  -0.296  1.00 0.00 ? 61  LEU A O    4  
ATOM 8289  C CB   . LEU A 1 61  ? -9.519  -1.751  -2.886  1.00 0.00 ? 61  LEU A CB   4  
ATOM 8290  C CG   . LEU A 1 61  ? -8.852  -0.458  -3.341  1.00 0.00 ? 61  LEU A CG   4  
ATOM 8291  C CD1  . LEU A 1 61  ? -8.876  -0.399  -4.867  1.00 0.00 ? 61  LEU A CD1  4  
ATOM 8292  C CD2  . LEU A 1 61  ? -9.612  0.741   -2.767  1.00 0.00 ? 61  LEU A CD2  4  
ATOM 8293  H H    . LEU A 1 61  ? -7.298  -1.753  -1.659  1.00 0.00 ? 61  LEU A H    4  
ATOM 8294  H HA   . LEU A 1 61  ? -9.950  -1.057  -0.899  1.00 0.00 ? 61  LEU A HA   4  
ATOM 8295  H HB2  . LEU A 1 61  ? -9.019  -2.593  -3.344  1.00 0.00 ? 61  LEU A HB2  4  
ATOM 8296  H HB3  . LEU A 1 61  ? -10.553 -1.745  -3.187  1.00 0.00 ? 61  LEU A HB3  4  
ATOM 8297  H HG   . LEU A 1 61  ? -7.832  -0.438  -2.995  1.00 0.00 ? 61  LEU A HG   4  
ATOM 8298  H HD11 . LEU A 1 61  ? -9.223  -1.345  -5.254  1.00 0.00 ? 61  LEU A HD11 4  
ATOM 8299  H HD12 . LEU A 1 61  ? -7.882  -0.202  -5.235  1.00 0.00 ? 61  LEU A HD12 4  
ATOM 8300  H HD13 . LEU A 1 61  ? -9.543  0.388   -5.187  1.00 0.00 ? 61  LEU A HD13 4  
ATOM 8301  H HD21 . LEU A 1 61  ? -10.671 0.522   -2.752  1.00 0.00 ? 61  LEU A HD21 4  
ATOM 8302  H HD22 . LEU A 1 61  ? -9.432  1.610   -3.384  1.00 0.00 ? 61  LEU A HD22 4  
ATOM 8303  H HD23 . LEU A 1 61  ? -9.269  0.937   -1.763  1.00 0.00 ? 61  LEU A HD23 4  
ATOM 8304  N N    . ARG A 1 62  ? -9.419  -4.288  -1.323  1.00 0.00 ? 62  ARG A N    4  
ATOM 8305  C CA   . ARG A 1 62  ? -9.950  -5.629  -0.956  1.00 0.00 ? 62  ARG A CA   4  
ATOM 8306  C C    . ARG A 1 62  ? -9.972  -5.776  0.566   1.00 0.00 ? 62  ARG A C    4  
ATOM 8307  O O    . ARG A 1 62  ? -10.930 -6.253  1.139   1.00 0.00 ? 62  ARG A O    4  
ATOM 8308  C CB   . ARG A 1 62  ? -9.049  -6.709  -1.557  1.00 0.00 ? 62  ARG A CB   4  
ATOM 8309  C CG   . ARG A 1 62  ? -9.622  -8.091  -1.236  1.00 0.00 ? 62  ARG A CG   4  
ATOM 8310  C CD   . ARG A 1 62  ? -8.660  -9.172  -1.727  1.00 0.00 ? 62  ARG A CD   4  
ATOM 8311  N NE   . ARG A 1 62  ? -9.256  -10.515 -1.475  1.00 0.00 ? 62  ARG A NE   4  
ATOM 8312  C CZ   . ARG A 1 62  ? -8.490  -11.529 -1.171  1.00 0.00 ? 62  ARG A CZ   4  
ATOM 8313  N NH1  . ARG A 1 62  ? -7.196  -11.372 -1.097  1.00 0.00 ? 62  ARG A NH1  4  
ATOM 8314  N NH2  . ARG A 1 62  ? -9.018  -12.700 -0.943  1.00 0.00 ? 62  ARG A NH2  4  
ATOM 8315  H H    . ARG A 1 62  ? -8.595  -4.216  -1.851  1.00 0.00 ? 62  ARG A H    4  
ATOM 8316  H HA   . ARG A 1 62  ? -10.953 -5.740  -1.343  1.00 0.00 ? 62  ARG A HA   4  
ATOM 8317  H HB2  . ARG A 1 62  ? -8.999  -6.580  -2.628  1.00 0.00 ? 62  ARG A HB2  4  
ATOM 8318  H HB3  . ARG A 1 62  ? -8.058  -6.628  -1.137  1.00 0.00 ? 62  ARG A HB3  4  
ATOM 8319  H HG2  . ARG A 1 62  ? -9.755  -8.186  -0.168  1.00 0.00 ? 62  ARG A HG2  4  
ATOM 8320  H HG3  . ARG A 1 62  ? -10.575 -8.208  -1.729  1.00 0.00 ? 62  ARG A HG3  4  
ATOM 8321  H HD2  . ARG A 1 62  ? -8.489  -9.047  -2.786  1.00 0.00 ? 62  ARG A HD2  4  
ATOM 8322  H HD3  . ARG A 1 62  ? -7.723  -9.087  -1.197  1.00 0.00 ? 62  ARG A HD3  4  
ATOM 8323  H HE   . ARG A 1 62  ? -10.227 -10.637 -1.532  1.00 0.00 ? 62  ARG A HE   4  
ATOM 8324  H HH11 . ARG A 1 62  ? -6.788  -10.477 -1.273  1.00 0.00 ? 62  ARG A HH11 4  
ATOM 8325  H HH12 . ARG A 1 62  ? -6.611  -12.150 -0.864  1.00 0.00 ? 62  ARG A HH12 4  
ATOM 8326  H HH21 . ARG A 1 62  ? -10.010 -12.819 -1.000  1.00 0.00 ? 62  ARG A HH21 4  
ATOM 8327  H HH22 . ARG A 1 62  ? -8.434  -13.475 -0.712  1.00 0.00 ? 62  ARG A HH22 4  
ATOM 8328  N N    . ALA A 1 63  ? -8.923  -5.373  1.226   1.00 0.00 ? 63  ALA A N    4  
ATOM 8329  C CA   . ALA A 1 63  ? -8.890  -5.496  2.710   1.00 0.00 ? 63  ALA A CA   4  
ATOM 8330  C C    . ALA A 1 63  ? -9.917  -4.543  3.322   1.00 0.00 ? 63  ALA A C    4  
ATOM 8331  O O    . ALA A 1 63  ? -10.521 -4.831  4.337   1.00 0.00 ? 63  ALA A O    4  
ATOM 8332  C CB   . ALA A 1 63  ? -7.492  -5.141  3.222   1.00 0.00 ? 63  ALA A CB   4  
ATOM 8333  H H    . ALA A 1 63  ? -8.158  -4.989  0.749   1.00 0.00 ? 63  ALA A H    4  
ATOM 8334  H HA   . ALA A 1 63  ? -9.130  -6.512  2.990   1.00 0.00 ? 63  ALA A HA   4  
ATOM 8335  H HB1  . ALA A 1 63  ? -7.458  -5.263  4.294   1.00 0.00 ? 63  ALA A HB1  4  
ATOM 8336  H HB2  . ALA A 1 63  ? -7.266  -4.116  2.969   1.00 0.00 ? 63  ALA A HB2  4  
ATOM 8337  H HB3  . ALA A 1 63  ? -6.764  -5.793  2.762   1.00 0.00 ? 63  ALA A HB3  4  
ATOM 8338  N N    . THR A 1 64  ? -10.113 -3.405  2.714   1.00 0.00 ? 64  THR A N    4  
ATOM 8339  C CA   . THR A 1 64  ? -11.094 -2.424  3.259   1.00 0.00 ? 64  THR A CA   4  
ATOM 8340  C C    . THR A 1 64  ? -12.485 -3.058  3.326   1.00 0.00 ? 64  THR A C    4  
ATOM 8341  O O    . THR A 1 64  ? -13.173 -2.964  4.323   1.00 0.00 ? 64  THR A O    4  
ATOM 8342  C CB   . THR A 1 64  ? -11.141 -1.204  2.336   1.00 0.00 ? 64  THR A CB   4  
ATOM 8343  O OG1  . THR A 1 64  ? -9.826  -0.701  2.155   1.00 0.00 ? 64  THR A OG1  4  
ATOM 8344  C CG2  . THR A 1 64  ? -12.016 -0.120  2.959   1.00 0.00 ? 64  THR A CG2  4  
ATOM 8345  H H    . THR A 1 64  ? -9.611  -3.194  1.900   1.00 0.00 ? 64  THR A H    4  
ATOM 8346  H HA   . THR A 1 64  ? -10.789 -2.116  4.247   1.00 0.00 ? 64  THR A HA   4  
ATOM 8347  H HB   . THR A 1 64  ? -11.552 -1.488  1.380   1.00 0.00 ? 64  THR A HB   4  
ATOM 8348  H HG1  . THR A 1 64  ? -9.257  -1.436  1.917   1.00 0.00 ? 64  THR A HG1  4  
ATOM 8349  H HG21 . THR A 1 64  ? -12.163 0.674   2.243   1.00 0.00 ? 64  THR A HG21 4  
ATOM 8350  H HG22 . THR A 1 64  ? -11.527 0.273   3.835   1.00 0.00 ? 64  THR A HG22 4  
ATOM 8351  H HG23 . THR A 1 64  ? -12.970 -0.538  3.236   1.00 0.00 ? 64  THR A HG23 4  
ATOM 8352  N N    . GLN A 1 65  ? -12.904 -3.703  2.272   1.00 0.00 ? 65  GLN A N    4  
ATOM 8353  C CA   . GLN A 1 65  ? -14.254 -4.338  2.277   1.00 0.00 ? 65  GLN A CA   4  
ATOM 8354  C C    . GLN A 1 65  ? -14.208 -5.670  3.029   1.00 0.00 ? 65  GLN A C    4  
ATOM 8355  O O    . GLN A 1 65  ? -15.110 -6.003  3.770   1.00 0.00 ? 65  GLN A O    4  
ATOM 8356  C CB   . GLN A 1 65  ? -14.714 -4.558  0.832   1.00 0.00 ? 65  GLN A CB   4  
ATOM 8357  C CG   . GLN A 1 65  ? -15.368 -5.933  0.693   1.00 0.00 ? 65  GLN A CG   4  
ATOM 8358  C CD   . GLN A 1 65  ? -16.006 -6.055  -0.691  1.00 0.00 ? 65  GLN A CD   4  
ATOM 8359  O OE1  . GLN A 1 65  ? -17.139 -5.663  -0.887  1.00 0.00 ? 65  GLN A OE1  4  
ATOM 8360  N NE2  . GLN A 1 65  ? -15.322 -6.583  -1.668  1.00 0.00 ? 65  GLN A NE2  4  
ATOM 8361  H H    . GLN A 1 65  ? -12.337 -3.766  1.477   1.00 0.00 ? 65  GLN A H    4  
ATOM 8362  H HA   . GLN A 1 65  ? -14.948 -3.680  2.771   1.00 0.00 ? 65  GLN A HA   4  
ATOM 8363  H HB2  . GLN A 1 65  ? -15.430 -3.792  0.568   1.00 0.00 ? 65  GLN A HB2  4  
ATOM 8364  H HB3  . GLN A 1 65  ? -13.863 -4.495  0.171   1.00 0.00 ? 65  GLN A HB3  4  
ATOM 8365  H HG2  . GLN A 1 65  ? -14.617 -6.702  0.810   1.00 0.00 ? 65  GLN A HG2  4  
ATOM 8366  H HG3  . GLN A 1 65  ? -16.128 -6.052  1.451   1.00 0.00 ? 65  GLN A HG3  4  
ATOM 8367  H HE21 . GLN A 1 65  ? -14.407 -6.898  -1.511  1.00 0.00 ? 65  GLN A HE21 4  
ATOM 8368  H HE22 . GLN A 1 65  ? -15.721 -6.665  -2.558  1.00 0.00 ? 65  GLN A HE22 4  
ATOM 8369  N N    . GLU A 1 66  ? -13.171 -6.437  2.847   1.00 0.00 ? 66  GLU A N    4  
ATOM 8370  C CA   . GLU A 1 66  ? -13.085 -7.745  3.556   1.00 0.00 ? 66  GLU A CA   4  
ATOM 8371  C C    . GLU A 1 66  ? -13.025 -7.515  5.068   1.00 0.00 ? 66  GLU A C    4  
ATOM 8372  O O    . GLU A 1 66  ? -13.589 -8.262  5.842   1.00 0.00 ? 66  GLU A O    4  
ATOM 8373  C CB   . GLU A 1 66  ? -11.819 -8.479  3.111   1.00 0.00 ? 66  GLU A CB   4  
ATOM 8374  C CG   . GLU A 1 66  ? -11.957 -8.909  1.652   1.00 0.00 ? 66  GLU A CG   4  
ATOM 8375  C CD   . GLU A 1 66  ? -13.065 -9.955  1.530   1.00 0.00 ? 66  GLU A CD   4  
ATOM 8376  O OE1  . GLU A 1 66  ? -13.520 -10.182 0.421   1.00 0.00 ? 66  GLU A OE1  4  
ATOM 8377  O OE2  . GLU A 1 66  ? -13.442 -10.512 2.547   1.00 0.00 ? 66  GLU A OE2  4  
ATOM 8378  H H    . GLU A 1 66  ? -12.451 -6.155  2.245   1.00 0.00 ? 66  GLU A H    4  
ATOM 8379  H HA   . GLU A 1 66  ? -13.950 -8.343  3.317   1.00 0.00 ? 66  GLU A HA   4  
ATOM 8380  H HB2  . GLU A 1 66  ? -10.968 -7.821  3.215   1.00 0.00 ? 66  GLU A HB2  4  
ATOM 8381  H HB3  . GLU A 1 66  ? -11.674 -9.351  3.730   1.00 0.00 ? 66  GLU A HB3  4  
ATOM 8382  H HG2  . GLU A 1 66  ? -12.206 -8.050  1.045   1.00 0.00 ? 66  GLU A HG2  4  
ATOM 8383  H HG3  . GLU A 1 66  ? -11.024 -9.330  1.312   1.00 0.00 ? 66  GLU A HG3  4  
ATOM 8384  H HE2  . GLU A 1 66  ? -14.138 -11.155 2.395   1.00 0.00 ? 66  GLU A HE2  4  
ATOM 8385  N N    . GLU A 1 67  ? -12.335 -6.494  5.495   1.00 0.00 ? 67  GLU A N    4  
ATOM 8386  C CA   . GLU A 1 67  ? -12.227 -6.225  6.957   1.00 0.00 ? 67  GLU A CA   4  
ATOM 8387  C C    . GLU A 1 67  ? -13.193 -5.112  7.375   1.00 0.00 ? 67  GLU A C    4  
ATOM 8388  O O    . GLU A 1 67  ? -13.158 -4.642  8.496   1.00 0.00 ? 67  GLU A O    4  
ATOM 8389  C CB   . GLU A 1 67  ? -10.792 -5.805  7.283   1.00 0.00 ? 67  GLU A CB   4  
ATOM 8390  C CG   . GLU A 1 67  ? -9.846  -6.980  7.035   1.00 0.00 ? 67  GLU A CG   4  
ATOM 8391  C CD   . GLU A 1 67  ? -10.192 -8.125  7.988   1.00 0.00 ? 67  GLU A CD   4  
ATOM 8392  O OE1  . GLU A 1 67  ? -9.782  -9.241  7.717   1.00 0.00 ? 67  GLU A OE1  4  
ATOM 8393  O OE2  . GLU A 1 67  ? -10.857 -7.862  8.976   1.00 0.00 ? 67  GLU A OE2  4  
ATOM 8394  H H    . GLU A 1 67  ? -11.880 -5.909  4.855   1.00 0.00 ? 67  GLU A H    4  
ATOM 8395  H HA   . GLU A 1 67  ? -12.465 -7.125  7.503   1.00 0.00 ? 67  GLU A HA   4  
ATOM 8396  H HB2  . GLU A 1 67  ? -10.509 -4.979  6.649   1.00 0.00 ? 67  GLU A HB2  4  
ATOM 8397  H HB3  . GLU A 1 67  ? -10.729 -5.506  8.320   1.00 0.00 ? 67  GLU A HB3  4  
ATOM 8398  H HG2  . GLU A 1 67  ? -9.953  -7.318  6.012   1.00 0.00 ? 67  GLU A HG2  4  
ATOM 8399  H HG3  . GLU A 1 67  ? -8.828  -6.666  7.207   1.00 0.00 ? 67  GLU A HG3  4  
ATOM 8400  H HE2  . GLU A 1 67  ? -11.035 -8.626  9.530   1.00 0.00 ? 67  GLU A HE2  4  
ATOM 8401  N N    . ALA A 1 68  ? -14.055 -4.680  6.495   1.00 0.00 ? 68  ALA A N    4  
ATOM 8402  C CA   . ALA A 1 68  ? -15.009 -3.594  6.873   1.00 0.00 ? 68  ALA A CA   4  
ATOM 8403  C C    . ALA A 1 68  ? -16.270 -3.681  6.014   1.00 0.00 ? 68  ALA A C    4  
ATOM 8404  O O    . ALA A 1 68  ? -17.326 -3.237  6.408   1.00 0.00 ? 68  ALA A O    4  
ATOM 8405  C CB   . ALA A 1 68  ? -14.347 -2.234  6.652   1.00 0.00 ? 68  ALA A CB   4  
ATOM 8406  H H    . ALA A 1 68  ? -14.075 -5.064  5.593   1.00 0.00 ? 68  ALA A H    4  
ATOM 8407  H HA   . ALA A 1 68  ? -15.276 -3.697  7.914   1.00 0.00 ? 68  ALA A HA   4  
ATOM 8408  H HB1  . ALA A 1 68  ? -14.627 -1.566  7.453   1.00 0.00 ? 68  ALA A HB1  4  
ATOM 8409  H HB2  . ALA A 1 68  ? -14.677 -1.823  5.708   1.00 0.00 ? 68  ALA A HB2  4  
ATOM 8410  H HB3  . ALA A 1 68  ? -13.274 -2.352  6.639   1.00 0.00 ? 68  ALA A HB3  4  
ATOM 8411  N N    . GLY A 1 69  ? -16.169 -4.237  4.844   1.00 0.00 ? 69  GLY A N    4  
ATOM 8412  C CA   . GLY A 1 69  ? -17.370 -4.336  3.969   1.00 0.00 ? 69  GLY A CA   4  
ATOM 8413  C C    . GLY A 1 69  ? -17.442 -3.099  3.074   1.00 0.00 ? 69  GLY A C    4  
ATOM 8414  O O    . GLY A 1 69  ? -18.333 -2.960  2.260   1.00 0.00 ? 69  GLY A O    4  
ATOM 8415  H H    . GLY A 1 69  ? -15.305 -4.583  4.536   1.00 0.00 ? 69  GLY A H    4  
ATOM 8416  H HA2  . GLY A 1 69  ? -17.299 -5.226  3.359   1.00 0.00 ? 69  GLY A HA2  4  
ATOM 8417  H HA3  . GLY A 1 69  ? -18.259 -4.386  4.579   1.00 0.00 ? 69  GLY A HA3  4  
ATOM 8418  N N    . ILE A 1 70  ? -16.508 -2.198  3.218   1.00 0.00 ? 70  ILE A N    4  
ATOM 8419  C CA   . ILE A 1 70  ? -16.522 -0.974  2.375   1.00 0.00 ? 70  ILE A CA   4  
ATOM 8420  C C    . ILE A 1 70  ? -15.440 -1.103  1.297   1.00 0.00 ? 70  ILE A C    4  
ATOM 8421  O O    . ILE A 1 70  ? -14.289 -1.352  1.590   1.00 0.00 ? 70  ILE A O    4  
ATOM 8422  C CB   . ILE A 1 70  ? -16.228 0.256   3.242   1.00 0.00 ? 70  ILE A CB   4  
ATOM 8423  C CG1  . ILE A 1 70  ? -17.021 0.191   4.550   1.00 0.00 ? 70  ILE A CG1  4  
ATOM 8424  C CG2  . ILE A 1 70  ? -16.667 1.500   2.479   1.00 0.00 ? 70  ILE A CG2  4  
ATOM 8425  C CD1  . ILE A 1 70  ? -16.372 1.105   5.594   1.00 0.00 ? 70  ILE A CD1  4  
ATOM 8426  H H    . ILE A 1 70  ? -15.799 -2.329  3.882   1.00 0.00 ? 70  ILE A H    4  
ATOM 8427  H HA   . ILE A 1 70  ? -17.484 -0.867  1.907   1.00 0.00 ? 70  ILE A HA   4  
ATOM 8428  H HB   . ILE A 1 70  ? -15.170 0.308   3.451   1.00 0.00 ? 70  ILE A HB   4  
ATOM 8429  H HG12 . ILE A 1 70  ? -18.028 0.524   4.369   1.00 0.00 ? 70  ILE A HG12 4  
ATOM 8430  H HG13 . ILE A 1 70  ? -17.033 -0.822  4.920   1.00 0.00 ? 70  ILE A HG13 4  
ATOM 8431  H HG21 . ILE A 1 70  ? -16.497 2.373   3.084   1.00 0.00 ? 70  ILE A HG21 4  
ATOM 8432  H HG22 . ILE A 1 70  ? -17.719 1.422   2.253   1.00 0.00 ? 70  ILE A HG22 4  
ATOM 8433  H HG23 . ILE A 1 70  ? -16.108 1.577   1.561   1.00 0.00 ? 70  ILE A HG23 4  
ATOM 8434  H HD11 . ILE A 1 70  ? -16.027 0.513   6.427   1.00 0.00 ? 70  ILE A HD11 4  
ATOM 8435  H HD12 . ILE A 1 70  ? -17.098 1.825   5.941   1.00 0.00 ? 70  ILE A HD12 4  
ATOM 8436  H HD13 . ILE A 1 70  ? -15.535 1.626   5.151   1.00 0.00 ? 70  ILE A HD13 4  
ATOM 8437  N N    . GLU A 1 71  ? -15.803 -0.944  0.051   1.00 0.00 ? 71  GLU A N    4  
ATOM 8438  C CA   . GLU A 1 71  ? -14.794 -1.066  -1.041  1.00 0.00 ? 71  GLU A CA   4  
ATOM 8439  C C    . GLU A 1 71  ? -14.604 0.285   -1.736  1.00 0.00 ? 71  GLU A C    4  
ATOM 8440  O O    . GLU A 1 71  ? -15.352 1.216   -1.518  1.00 0.00 ? 71  GLU A O    4  
ATOM 8441  C CB   . GLU A 1 71  ? -15.265 -2.103  -2.063  1.00 0.00 ? 71  GLU A CB   4  
ATOM 8442  C CG   . GLU A 1 71  ? -16.468 -1.556  -2.830  1.00 0.00 ? 71  GLU A CG   4  
ATOM 8443  C CD   . GLU A 1 71  ? -17.007 -2.637  -3.770  1.00 0.00 ? 71  GLU A CD   4  
ATOM 8444  O OE1  . GLU A 1 71  ? -18.032 -2.400  -4.385  1.00 0.00 ? 71  GLU A OE1  4  
ATOM 8445  O OE2  . GLU A 1 71  ? -16.383 -3.683  -3.857  1.00 0.00 ? 71  GLU A OE2  4  
ATOM 8446  H H    . GLU A 1 71  ? -16.740 -0.747  -0.165  1.00 0.00 ? 71  GLU A H    4  
ATOM 8447  H HA   . GLU A 1 71  ? -13.851 -1.384  -0.624  1.00 0.00 ? 71  GLU A HA   4  
ATOM 8448  H HB2  . GLU A 1 71  ? -14.463 -2.317  -2.755  1.00 0.00 ? 71  GLU A HB2  4  
ATOM 8449  H HB3  . GLU A 1 71  ? -15.549 -3.010  -1.550  1.00 0.00 ? 71  GLU A HB3  4  
ATOM 8450  H HG2  . GLU A 1 71  ? -17.239 -1.269  -2.131  1.00 0.00 ? 71  GLU A HG2  4  
ATOM 8451  H HG3  . GLU A 1 71  ? -16.168 -0.698  -3.408  1.00 0.00 ? 71  GLU A HG3  4  
ATOM 8452  H HE2  . GLU A 1 71  ? -16.779 -4.314  -4.463  1.00 0.00 ? 71  GLU A HE2  4  
ATOM 8453  N N    . ALA A 1 72  ? -13.606 0.396   -2.574  1.00 0.00 ? 72  ALA A N    4  
ATOM 8454  C CA   . ALA A 1 72  ? -13.363 1.686   -3.283  1.00 0.00 ? 72  ALA A CA   4  
ATOM 8455  C C    . ALA A 1 72  ? -14.685 2.226   -3.817  1.00 0.00 ? 72  ALA A C    4  
ATOM 8456  O O    . ALA A 1 72  ? -14.942 3.412   -3.788  1.00 0.00 ? 72  ALA A O    4  
ATOM 8457  C CB   . ALA A 1 72  ? -12.394 1.452   -4.439  1.00 0.00 ? 72  ALA A CB   4  
ATOM 8458  H H    . ALA A 1 72  ? -13.015 -0.369  -2.734  1.00 0.00 ? 72  ALA A H    4  
ATOM 8459  H HA   . ALA A 1 72  ? -12.938 2.399   -2.605  1.00 0.00 ? 72  ALA A HA   4  
ATOM 8460  H HB1  . ALA A 1 72  ? -12.851 1.770   -5.364  1.00 0.00 ? 72  ALA A HB1  4  
ATOM 8461  H HB2  . ALA A 1 72  ? -12.148 0.403   -4.496  1.00 0.00 ? 72  ALA A HB2  4  
ATOM 8462  H HB3  . ALA A 1 72  ? -11.493 2.022   -4.268  1.00 0.00 ? 72  ALA A HB3  4  
ATOM 8463  N N    . GLY A 1 73  ? -15.535 1.362   -4.286  1.00 0.00 ? 73  GLY A N    4  
ATOM 8464  C CA   . GLY A 1 73  ? -16.851 1.823   -4.801  1.00 0.00 ? 73  GLY A CA   4  
ATOM 8465  C C    . GLY A 1 73  ? -17.612 2.519   -3.670  1.00 0.00 ? 73  GLY A C    4  
ATOM 8466  O O    . GLY A 1 73  ? -18.421 3.394   -3.900  1.00 0.00 ? 73  GLY A O    4  
ATOM 8467  H H    . GLY A 1 73  ? -15.316 0.408   -4.286  1.00 0.00 ? 73  GLY A H    4  
ATOM 8468  H HA2  . GLY A 1 73  ? -16.697 2.516   -5.616  1.00 0.00 ? 73  GLY A HA2  4  
ATOM 8469  H HA3  . GLY A 1 73  ? -17.422 0.977   -5.146  1.00 0.00 ? 73  GLY A HA3  4  
ATOM 8470  N N    . GLN A 1 74  ? -17.365 2.125   -2.448  1.00 0.00 ? 74  GLN A N    4  
ATOM 8471  C CA   . GLN A 1 74  ? -18.084 2.756   -1.306  1.00 0.00 ? 74  GLN A CA   4  
ATOM 8472  C C    . GLN A 1 74  ? -17.234 3.861   -0.669  1.00 0.00 ? 74  GLN A C    4  
ATOM 8473  O O    . GLN A 1 74  ? -17.712 4.603   0.166   1.00 0.00 ? 74  GLN A O    4  
ATOM 8474  C CB   . GLN A 1 74  ? -18.416 1.690   -0.262  1.00 0.00 ? 74  GLN A CB   4  
ATOM 8475  C CG   . GLN A 1 74  ? -19.394 0.677   -0.857  1.00 0.00 ? 74  GLN A CG   4  
ATOM 8476  C CD   . GLN A 1 74  ? -19.824 -0.315  0.223   1.00 0.00 ? 74  GLN A CD   4  
ATOM 8477  O OE1  . GLN A 1 74  ? -20.709 -0.030  1.007   1.00 0.00 ? 74  GLN A OE1  4  
ATOM 8478  N NE2  . GLN A 1 74  ? -19.232 -1.475  0.304   1.00 0.00 ? 74  GLN A NE2  4  
ATOM 8479  H H    . GLN A 1 74  ? -16.713 1.411   -2.282  1.00 0.00 ? 74  GLN A H    4  
ATOM 8480  H HA   . GLN A 1 74  ? -19.003 3.191   -1.667  1.00 0.00 ? 74  GLN A HA   4  
ATOM 8481  H HB2  . GLN A 1 74  ? -17.511 1.182   0.031   1.00 0.00 ? 74  GLN A HB2  4  
ATOM 8482  H HB3  . GLN A 1 74  ? -18.866 2.160   0.597   1.00 0.00 ? 74  GLN A HB3  4  
ATOM 8483  H HG2  . GLN A 1 74  ? -20.262 1.195   -1.237  1.00 0.00 ? 74  GLN A HG2  4  
ATOM 8484  H HG3  . GLN A 1 74  ? -18.915 0.143   -1.663  1.00 0.00 ? 74  GLN A HG3  4  
ATOM 8485  H HE21 . GLN A 1 74  ? -18.517 -1.704  -0.328  1.00 0.00 ? 74  GLN A HE21 4  
ATOM 8486  H HE22 . GLN A 1 74  ? -19.500 -2.116  0.994   1.00 0.00 ? 74  GLN A HE22 4  
ATOM 8487  N N    . LEU A 1 75  ? -15.995 4.012   -1.061  1.00 0.00 ? 75  LEU A N    4  
ATOM 8488  C CA   . LEU A 1 75  ? -15.174 5.116   -0.475  1.00 0.00 ? 75  LEU A CA   4  
ATOM 8489  C C    . LEU A 1 75  ? -14.506 5.896   -1.598  1.00 0.00 ? 75  LEU A C    4  
ATOM 8490  O O    . LEU A 1 75  ? -14.713 5.638   -2.766  1.00 0.00 ? 75  LEU A O    4  
ATOM 8491  C CB   . LEU A 1 75  ? -14.081 4.621   0.491   1.00 0.00 ? 75  LEU A CB   4  
ATOM 8492  C CG   . LEU A 1 75  ? -14.028 3.099   0.564   1.00 0.00 ? 75  LEU A CG   4  
ATOM 8493  C CD1  . LEU A 1 75  ? -12.782 2.608   -0.168  1.00 0.00 ? 75  LEU A CD1  4  
ATOM 8494  C CD2  . LEU A 1 75  ? -13.940 2.672   2.030   1.00 0.00 ? 75  LEU A CD2  4  
ATOM 8495  H H    . LEU A 1 75  ? -15.619 3.425   -1.751  1.00 0.00 ? 75  LEU A H    4  
ATOM 8496  H HA   . LEU A 1 75  ? -15.830 5.779   0.056   1.00 0.00 ? 75  LEU A HA   4  
ATOM 8497  H HB2  . LEU A 1 75  ? -13.126 4.990   0.155   1.00 0.00 ? 75  LEU A HB2  4  
ATOM 8498  H HB3  . LEU A 1 75  ? -14.278 5.017   1.474   1.00 0.00 ? 75  LEU A HB3  4  
ATOM 8499  H HG   . LEU A 1 75  ? -14.910 2.676   0.116   1.00 0.00 ? 75  LEU A HG   4  
ATOM 8500  H HD11 . LEU A 1 75  ? -12.531 3.306   -0.952  1.00 0.00 ? 75  LEU A HD11 4  
ATOM 8501  H HD12 . LEU A 1 75  ? -12.972 1.635   -0.594  1.00 0.00 ? 75  LEU A HD12 4  
ATOM 8502  H HD13 . LEU A 1 75  ? -11.959 2.541   0.530   1.00 0.00 ? 75  LEU A HD13 4  
ATOM 8503  H HD21 . LEU A 1 75  ? -14.714 3.165   2.594   1.00 0.00 ? 75  LEU A HD21 4  
ATOM 8504  H HD22 . LEU A 1 75  ? -12.976 2.946   2.430   1.00 0.00 ? 75  LEU A HD22 4  
ATOM 8505  H HD23 . LEU A 1 75  ? -14.069 1.603   2.102   1.00 0.00 ? 75  LEU A HD23 4  
ATOM 8506  N N    . THR A 1 76  ? -13.701 6.851   -1.241  1.00 0.00 ? 76  THR A N    4  
ATOM 8507  C CA   . THR A 1 76  ? -12.999 7.665   -2.263  1.00 0.00 ? 76  THR A CA   4  
ATOM 8508  C C    . THR A 1 76  ? -11.525 7.752   -1.887  1.00 0.00 ? 76  THR A C    4  
ATOM 8509  O O    . THR A 1 76  ? -11.155 8.418   -0.942  1.00 0.00 ? 76  THR A O    4  
ATOM 8510  C CB   . THR A 1 76  ? -13.610 9.069   -2.292  1.00 0.00 ? 76  THR A CB   4  
ATOM 8511  O OG1  . THR A 1 76  ? -14.915 9.005   -2.850  1.00 0.00 ? 76  THR A OG1  4  
ATOM 8512  C CG2  . THR A 1 76  ? -12.736 10.000  -3.134  1.00 0.00 ? 76  THR A CG2  4  
ATOM 8513  H H    . THR A 1 76  ? -13.552 7.028   -0.289  1.00 0.00 ? 76  THR A H    4  
ATOM 8514  H HA   . THR A 1 76  ? -13.102 7.203   -3.233  1.00 0.00 ? 76  THR A HA   4  
ATOM 8515  H HB   . THR A 1 76  ? -13.671 9.454   -1.287  1.00 0.00 ? 76  THR A HB   4  
ATOM 8516  H HG1  . THR A 1 76  ? -15.523 9.419   -2.233  1.00 0.00 ? 76  THR A HG1  4  
ATOM 8517  H HG21 . THR A 1 76  ? -13.365 10.605  -3.769  1.00 0.00 ? 76  THR A HG21 4  
ATOM 8518  H HG22 . THR A 1 76  ? -12.066 9.412   -3.743  1.00 0.00 ? 76  THR A HG22 4  
ATOM 8519  H HG23 . THR A 1 76  ? -12.163 10.639  -2.478  1.00 0.00 ? 76  THR A HG23 4  
ATOM 8520  N N    . ILE A 1 77  ? -10.676 7.083   -2.615  1.00 0.00 ? 77  ILE A N    4  
ATOM 8521  C CA   . ILE A 1 77  ? -9.229  7.131   -2.284  1.00 0.00 ? 77  ILE A CA   4  
ATOM 8522  C C    . ILE A 1 77  ? -8.683  8.499   -2.685  1.00 0.00 ? 77  ILE A C    4  
ATOM 8523  O O    . ILE A 1 77  ? -8.865  8.946   -3.800  1.00 0.00 ? 77  ILE A O    4  
ATOM 8524  C CB   . ILE A 1 77  ? -8.484  6.036   -3.053  1.00 0.00 ? 77  ILE A CB   4  
ATOM 8525  C CG1  . ILE A 1 77  ? -9.314  4.743   -3.065  1.00 0.00 ? 77  ILE A CG1  4  
ATOM 8526  C CG2  . ILE A 1 77  ? -7.140  5.766   -2.372  1.00 0.00 ? 77  ILE A CG2  4  
ATOM 8527  C CD1  . ILE A 1 77  ? -9.405  4.157   -1.653  1.00 0.00 ? 77  ILE A CD1  4  
ATOM 8528  H H    . ILE A 1 77  ? -10.991 6.551   -3.375  1.00 0.00 ? 77  ILE A H    4  
ATOM 8529  H HA   . ILE A 1 77  ? -9.094  6.988   -1.221  1.00 0.00 ? 77  ILE A HA   4  
ATOM 8530  H HB   . ILE A 1 77  ? -8.312  6.366   -4.066  1.00 0.00 ? 77  ILE A HB   4  
ATOM 8531  H HG12 . ILE A 1 77  ? -10.307 4.958   -3.429  1.00 0.00 ? 77  ILE A HG12 4  
ATOM 8532  H HG13 . ILE A 1 77  ? -8.843  4.025   -3.718  1.00 0.00 ? 77  ILE A HG13 4  
ATOM 8533  H HG21 . ILE A 1 77  ? -6.572  5.066   -2.967  1.00 0.00 ? 77  ILE A HG21 4  
ATOM 8534  H HG22 . ILE A 1 77  ? -7.310  5.347   -1.391  1.00 0.00 ? 77  ILE A HG22 4  
ATOM 8535  H HG23 . ILE A 1 77  ? -6.591  6.689   -2.281  1.00 0.00 ? 77  ILE A HG23 4  
ATOM 8536  H HD11 . ILE A 1 77  ? -8.927  4.822   -0.952  1.00 0.00 ? 77  ILE A HD11 4  
ATOM 8537  H HD12 . ILE A 1 77  ? -8.910  3.197   -1.631  1.00 0.00 ? 77  ILE A HD12 4  
ATOM 8538  H HD13 . ILE A 1 77  ? -10.444 4.033   -1.380  1.00 0.00 ? 77  ILE A HD13 4  
ATOM 8539  N N    . ILE A 1 78  ? -8.024  9.177   -1.786  1.00 0.00 ? 78  ILE A N    4  
ATOM 8540  C CA   . ILE A 1 78  ? -7.485  10.520  -2.128  1.00 0.00 ? 78  ILE A CA   4  
ATOM 8541  C C    . ILE A 1 78  ? -6.109  10.368  -2.770  1.00 0.00 ? 78  ILE A C    4  
ATOM 8542  O O    . ILE A 1 78  ? -5.289  9.583   -2.341  1.00 0.00 ? 78  ILE A O    4  
ATOM 8543  C CB   . ILE A 1 78  ? -7.384  11.375  -0.864  1.00 0.00 ? 78  ILE A CB   4  
ATOM 8544  C CG1  . ILE A 1 78  ? -8.427  12.490  -0.931  1.00 0.00 ? 78  ILE A CG1  4  
ATOM 8545  C CG2  . ILE A 1 78  ? -5.986  11.992  -0.754  1.00 0.00 ? 78  ILE A CG2  4  
ATOM 8546  C CD1  . ILE A 1 78  ? -9.829  11.880  -0.858  1.00 0.00 ? 78  ILE A CD1  4  
ATOM 8547  H H    . ILE A 1 78  ? -7.893  8.805   -0.889  1.00 0.00 ? 78  ILE A H    4  
ATOM 8548  H HA   . ILE A 1 78  ? -8.150  11.000  -2.831  1.00 0.00 ? 78  ILE A HA   4  
ATOM 8549  H HB   . ILE A 1 78  ? -7.573  10.759  -0.002  1.00 0.00 ? 78  ILE A HB   4  
ATOM 8550  H HG12 . ILE A 1 78  ? -8.281  13.166  -0.108  1.00 0.00 ? 78  ILE A HG12 4  
ATOM 8551  H HG13 . ILE A 1 78  ? -8.320  13.028  -1.856  1.00 0.00 ? 78  ILE A HG13 4  
ATOM 8552  H HG21 . ILE A 1 78  ? -5.762  12.546  -1.653  1.00 0.00 ? 78  ILE A HG21 4  
ATOM 8553  H HG22 . ILE A 1 78  ? -5.253  11.209  -0.618  1.00 0.00 ? 78  ILE A HG22 4  
ATOM 8554  H HG23 . ILE A 1 78  ? -5.955  12.660  0.094   1.00 0.00 ? 78  ILE A HG23 4  
ATOM 8555  H HD11 . ILE A 1 78  ? -9.835  11.077  -0.136  1.00 0.00 ? 78  ILE A HD11 4  
ATOM 8556  H HD12 . ILE A 1 78  ? -10.105 11.492  -1.828  1.00 0.00 ? 78  ILE A HD12 4  
ATOM 8557  H HD13 . ILE A 1 78  ? -10.536 12.639  -0.560  1.00 0.00 ? 78  ILE A HD13 4  
ATOM 8558  N N    . GLU A 1 79  ? -5.863  11.115  -3.804  1.00 0.00 ? 79  GLU A N    4  
ATOM 8559  C CA   . GLU A 1 79  ? -4.549  11.024  -4.497  1.00 0.00 ? 79  GLU A CA   4  
ATOM 8560  C C    . GLU A 1 79  ? -3.638  12.162  -4.030  1.00 0.00 ? 79  GLU A C    4  
ATOM 8561  O O    . GLU A 1 79  ? -4.094  13.222  -3.651  1.00 0.00 ? 79  GLU A O    4  
ATOM 8562  C CB   . GLU A 1 79  ? -4.764  11.127  -6.006  1.00 0.00 ? 79  GLU A CB   4  
ATOM 8563  C CG   . GLU A 1 79  ? -5.644  9.964   -6.472  1.00 0.00 ? 79  GLU A CG   4  
ATOM 8564  C CD   . GLU A 1 79  ? -5.826  10.037  -7.988  1.00 0.00 ? 79  GLU A CD   4  
ATOM 8565  O OE1  . GLU A 1 79  ? -6.335  9.081   -8.551  1.00 0.00 ? 79  GLU A OE1  4  
ATOM 8566  O OE2  . GLU A 1 79  ? -5.459  11.048  -8.561  1.00 0.00 ? 79  GLU A OE2  4  
ATOM 8567  H H    . GLU A 1 79  ? -6.548  11.740  -4.126  1.00 0.00 ? 79  GLU A H    4  
ATOM 8568  H HA   . GLU A 1 79  ? -4.086  10.077  -4.266  1.00 0.00 ? 79  GLU A HA   4  
ATOM 8569  H HB2  . GLU A 1 79  ? -5.250  12.064  -6.236  1.00 0.00 ? 79  GLU A HB2  4  
ATOM 8570  H HB3  . GLU A 1 79  ? -3.812  11.082  -6.511  1.00 0.00 ? 79  GLU A HB3  4  
ATOM 8571  H HG2  . GLU A 1 79  ? -5.167  9.029   -6.212  1.00 0.00 ? 79  GLU A HG2  4  
ATOM 8572  H HG3  . GLU A 1 79  ? -6.607  10.022  -5.990  1.00 0.00 ? 79  GLU A HG3  4  
ATOM 8573  H HE2  . GLU A 1 79  ? -5.605  11.025  -9.510  1.00 0.00 ? 79  GLU A HE2  4  
ATOM 8574  N N    . GLY A 1 80  ? -2.352  11.944  -4.051  1.00 0.00 ? 80  GLY A N    4  
ATOM 8575  C CA   . GLY A 1 80  ? -1.405  13.004  -3.608  1.00 0.00 ? 80  GLY A CA   4  
ATOM 8576  C C    . GLY A 1 80  ? -0.866  12.653  -2.225  1.00 0.00 ? 80  GLY A C    4  
ATOM 8577  O O    . GLY A 1 80  ? 0.191   13.104  -1.827  1.00 0.00 ? 80  GLY A O    4  
ATOM 8578  H H    . GLY A 1 80  ? -2.010  11.079  -4.360  1.00 0.00 ? 80  GLY A H    4  
ATOM 8579  H HA2  . GLY A 1 80  ? -0.587  13.071  -4.312  1.00 0.00 ? 80  GLY A HA2  4  
ATOM 8580  H HA3  . GLY A 1 80  ? -1.920  13.950  -3.562  1.00 0.00 ? 80  GLY A HA3  4  
ATOM 8581  N N    . PHE A 1 81  ? -1.576  11.844  -1.487  1.00 0.00 ? 81  PHE A N    4  
ATOM 8582  C CA   . PHE A 1 81  ? -1.095  11.458  -0.132  1.00 0.00 ? 81  PHE A CA   4  
ATOM 8583  C C    . PHE A 1 81  ? -0.634  10.002  -0.136  1.00 0.00 ? 81  PHE A C    4  
ATOM 8584  O O    . PHE A 1 81  ? -1.354  9.116   -0.549  1.00 0.00 ? 81  PHE A O    4  
ATOM 8585  C CB   . PHE A 1 81  ? -2.223  11.608  0.884   1.00 0.00 ? 81  PHE A CB   4  
ATOM 8586  C CG   . PHE A 1 81  ? -1.750  11.079  2.216   1.00 0.00 ? 81  PHE A CG   4  
ATOM 8587  C CD1  . PHE A 1 81  ? -1.822  9.708   2.486   1.00 0.00 ? 81  PHE A CD1  4  
ATOM 8588  C CD2  . PHE A 1 81  ? -1.227  11.953  3.172   1.00 0.00 ? 81  PHE A CD2  4  
ATOM 8589  C CE1  . PHE A 1 81  ? -1.373  9.210   3.715   1.00 0.00 ? 81  PHE A CE1  4  
ATOM 8590  C CE2  . PHE A 1 81  ? -0.777  11.457  4.401   1.00 0.00 ? 81  PHE A CE2  4  
ATOM 8591  C CZ   . PHE A 1 81  ? -0.850  10.087  4.673   1.00 0.00 ? 81  PHE A CZ   4  
ATOM 8592  H H    . PHE A 1 81  ? -2.423  11.484  -1.826  1.00 0.00 ? 81  PHE A H    4  
ATOM 8593  H HA   . PHE A 1 81  ? -0.271  12.095  0.152   1.00 0.00 ? 81  PHE A HA   4  
ATOM 8594  H HB2  . PHE A 1 81  ? -2.488  12.651  0.981   1.00 0.00 ? 81  PHE A HB2  4  
ATOM 8595  H HB3  . PHE A 1 81  ? -3.084  11.044  0.558   1.00 0.00 ? 81  PHE A HB3  4  
ATOM 8596  H HD1  . PHE A 1 81  ? -2.225  9.033   1.746   1.00 0.00 ? 81  PHE A HD1  4  
ATOM 8597  H HD2  . PHE A 1 81  ? -1.170  13.009  2.963   1.00 0.00 ? 81  PHE A HD2  4  
ATOM 8598  H HE1  . PHE A 1 81  ? -1.430  8.154   3.924   1.00 0.00 ? 81  PHE A HE1  4  
ATOM 8599  H HE2  . PHE A 1 81  ? -0.373  12.133  5.137   1.00 0.00 ? 81  PHE A HE2  4  
ATOM 8600  H HZ   . PHE A 1 81  ? -0.503  9.705   5.621   1.00 0.00 ? 81  PHE A HZ   4  
ATOM 8601  N N    . LYS A 1 82  ? 0.548   9.742   0.345   1.00 0.00 ? 82  LYS A N    4  
ATOM 8602  C CA   . LYS A 1 82  ? 1.029   8.337   0.390   1.00 0.00 ? 82  LYS A CA   4  
ATOM 8603  C C    . LYS A 1 82  ? 2.115   8.202   1.453   1.00 0.00 ? 82  LYS A C    4  
ATOM 8604  O O    . LYS A 1 82  ? 3.165   8.805   1.369   1.00 0.00 ? 82  LYS A O    4  
ATOM 8605  C CB   . LYS A 1 82  ? 1.616   7.926   -0.951  1.00 0.00 ? 82  LYS A CB   4  
ATOM 8606  C CG   . LYS A 1 82  ? 1.198   6.488   -1.264  1.00 0.00 ? 82  LYS A CG   4  
ATOM 8607  C CD   . LYS A 1 82  ? 1.883   6.024   -2.551  1.00 0.00 ? 82  LYS A CD   4  
ATOM 8608  C CE   . LYS A 1 82  ? 3.375   5.798   -2.291  1.00 0.00 ? 82  LYS A CE   4  
ATOM 8609  N NZ   . LYS A 1 82  ? 4.154   6.945   -2.840  1.00 0.00 ? 82  LYS A NZ   4  
ATOM 8610  H H    . LYS A 1 82  ? 1.109   10.467  0.692   1.00 0.00 ? 82  LYS A H    4  
ATOM 8611  H HA   . LYS A 1 82  ? 0.206   7.684   0.636   1.00 0.00 ? 82  LYS A HA   4  
ATOM 8612  H HB2  . LYS A 1 82  ? 1.260   8.590   -1.726  1.00 0.00 ? 82  LYS A HB2  4  
ATOM 8613  H HB3  . LYS A 1 82  ? 2.689   7.976   -0.890  1.00 0.00 ? 82  LYS A HB3  4  
ATOM 8614  H HG2  . LYS A 1 82  ? 1.482   5.844   -0.447  1.00 0.00 ? 82  LYS A HG2  4  
ATOM 8615  H HG3  . LYS A 1 82  ? 0.126   6.448   -1.398  1.00 0.00 ? 82  LYS A HG3  4  
ATOM 8616  H HD2  . LYS A 1 82  ? 1.436   5.100   -2.879  1.00 0.00 ? 82  LYS A HD2  4  
ATOM 8617  H HD3  . LYS A 1 82  ? 1.763   6.775   -3.316  1.00 0.00 ? 82  LYS A HD3  4  
ATOM 8618  H HE2  . LYS A 1 82  ? 3.550   5.721   -1.229  1.00 0.00 ? 82  LYS A HE2  4  
ATOM 8619  H HE3  . LYS A 1 82  ? 3.686   4.885   -2.774  1.00 0.00 ? 82  LYS A HE3  4  
ATOM 8620  H HZ1  . LYS A 1 82  ? 3.565   7.800   -2.834  1.00 0.00 ? 82  LYS A HZ1  4  
ATOM 8621  H HZ2  . LYS A 1 82  ? 4.442   6.729   -3.817  1.00 0.00 ? 82  LYS A HZ2  4  
ATOM 8622  H HZ3  . LYS A 1 82  ? 4.999   7.102   -2.255  1.00 0.00 ? 82  LYS A HZ3  4  
ATOM 8623  N N    . ARG A 1 83  ? 1.867   7.398   2.437   1.00 0.00 ? 83  ARG A N    4  
ATOM 8624  C CA   . ARG A 1 83  ? 2.874   7.185   3.511   1.00 0.00 ? 83  ARG A CA   4  
ATOM 8625  C C    . ARG A 1 83  ? 2.807   5.724   3.944   1.00 0.00 ? 83  ARG A C    4  
ATOM 8626  O O    . ARG A 1 83  ? 1.738   5.174   4.117   1.00 0.00 ? 83  ARG A O    4  
ATOM 8627  C CB   . ARG A 1 83  ? 2.561   8.081   4.718   1.00 0.00 ? 83  ARG A CB   4  
ATOM 8628  C CG   . ARG A 1 83  ? 2.710   9.557   4.335   1.00 0.00 ? 83  ARG A CG   4  
ATOM 8629  C CD   . ARG A 1 83  ? 4.191   9.944   4.324   1.00 0.00 ? 83  ARG A CD   4  
ATOM 8630  N NE   . ARG A 1 83  ? 4.439   10.921  3.227   1.00 0.00 ? 83  ARG A NE   4  
ATOM 8631  C CZ   . ARG A 1 83  ? 3.905   12.110  3.281   1.00 0.00 ? 83  ARG A CZ   4  
ATOM 8632  N NH1  . ARG A 1 83  ? 3.167   12.450  4.303   1.00 0.00 ? 83  ARG A NH1  4  
ATOM 8633  N NH2  . ARG A 1 83  ? 4.111   12.962  2.313   1.00 0.00 ? 83  ARG A NH2  4  
ATOM 8634  H H    . ARG A 1 83  ? 1.019   6.918   2.459   1.00 0.00 ? 83  ARG A H    4  
ATOM 8635  H HA   . ARG A 1 83  ? 3.860   7.407   3.134   1.00 0.00 ? 83  ARG A HA   4  
ATOM 8636  H HB2  . ARG A 1 83  ? 1.548   7.896   5.046   1.00 0.00 ? 83  ARG A HB2  4  
ATOM 8637  H HB3  . ARG A 1 83  ? 3.245   7.851   5.520   1.00 0.00 ? 83  ARG A HB3  4  
ATOM 8638  H HG2  . ARG A 1 83  ? 2.288   9.722   3.355   1.00 0.00 ? 83  ARG A HG2  4  
ATOM 8639  H HG3  . ARG A 1 83  ? 2.188   10.168  5.056   1.00 0.00 ? 83  ARG A HG3  4  
ATOM 8640  H HD2  . ARG A 1 83  ? 4.451   10.393  5.271   1.00 0.00 ? 83  ARG A HD2  4  
ATOM 8641  H HD3  . ARG A 1 83  ? 4.796   9.064   4.166   1.00 0.00 ? 83  ARG A HD3  4  
ATOM 8642  H HE   . ARG A 1 83  ? 4.997   10.668  2.464   1.00 0.00 ? 83  ARG A HE   4  
ATOM 8643  H HH11 . ARG A 1 83  ? 3.011   11.798  5.046   1.00 0.00 ? 83  ARG A HH11 4  
ATOM 8644  H HH12 . ARG A 1 83  ? 2.758   13.361  4.344   1.00 0.00 ? 83  ARG A HH12 4  
ATOM 8645  H HH21 . ARG A 1 83  ? 4.677   12.702  1.531   1.00 0.00 ? 83  ARG A HH21 4  
ATOM 8646  H HH22 . ARG A 1 83  ? 3.701   13.872  2.354   1.00 0.00 ? 83  ARG A HH22 4  
ATOM 8647  N N    . GLU A 1 84  ? 3.930   5.086   4.131   1.00 0.00 ? 84  GLU A N    4  
ATOM 8648  C CA   . GLU A 1 84  ? 3.890   3.665   4.562   1.00 0.00 ? 84  GLU A CA   4  
ATOM 8649  C C    . GLU A 1 84  ? 4.536   3.525   5.933   1.00 0.00 ? 84  GLU A C    4  
ATOM 8650  O O    . GLU A 1 84  ? 5.565   4.107   6.209   1.00 0.00 ? 84  GLU A O    4  
ATOM 8651  C CB   . GLU A 1 84  ? 4.630   2.766   3.564   1.00 0.00 ? 84  GLU A CB   4  
ATOM 8652  C CG   . GLU A 1 84  ? 6.011   3.337   3.247   1.00 0.00 ? 84  GLU A CG   4  
ATOM 8653  C CD   . GLU A 1 84  ? 5.874   4.711   2.588   1.00 0.00 ? 84  GLU A CD   4  
ATOM 8654  O OE1  . GLU A 1 84  ? 5.166   4.804   1.598   1.00 0.00 ? 84  GLU A OE1  4  
ATOM 8655  O OE2  . GLU A 1 84  ? 6.481   5.647   3.084   1.00 0.00 ? 84  GLU A OE2  4  
ATOM 8656  H H    . GLU A 1 84  ? 4.786   5.541   3.995   1.00 0.00 ? 84  GLU A H    4  
ATOM 8657  H HA   . GLU A 1 84  ? 2.867   3.350   4.624   1.00 0.00 ? 84  GLU A HA   4  
ATOM 8658  H HB2  . GLU A 1 84  ? 4.739   1.782   3.990   1.00 0.00 ? 84  GLU A HB2  4  
ATOM 8659  H HB3  . GLU A 1 84  ? 4.056   2.698   2.662   1.00 0.00 ? 84  GLU A HB3  4  
ATOM 8660  H HG2  . GLU A 1 84  ? 6.573   3.429   4.160   1.00 0.00 ? 84  GLU A HG2  4  
ATOM 8661  H HG3  . GLU A 1 84  ? 6.529   2.668   2.574   1.00 0.00 ? 84  GLU A HG3  4  
ATOM 8662  H HE2  . GLU A 1 84  ? 6.349   6.476   2.619   1.00 0.00 ? 84  GLU A HE2  4  
ATOM 8663  N N    . LEU A 1 85  ? 3.944   2.749   6.797   1.00 0.00 ? 85  LEU A N    4  
ATOM 8664  C CA   . LEU A 1 85  ? 4.541   2.575   8.142   1.00 0.00 ? 85  LEU A CA   4  
ATOM 8665  C C    . LEU A 1 85  ? 5.412   1.320   8.116   1.00 0.00 ? 85  LEU A C    4  
ATOM 8666  O O    . LEU A 1 85  ? 4.932   0.226   7.902   1.00 0.00 ? 85  LEU A O    4  
ATOM 8667  C CB   . LEU A 1 85  ? 3.432   2.420   9.187   1.00 0.00 ? 85  LEU A CB   4  
ATOM 8668  C CG   . LEU A 1 85  ? 2.372   3.505   8.974   1.00 0.00 ? 85  LEU A CG   4  
ATOM 8669  C CD1  . LEU A 1 85  ? 1.478   3.606   10.211  1.00 0.00 ? 85  LEU A CD1  4  
ATOM 8670  C CD2  . LEU A 1 85  ? 3.046   4.853   8.726   1.00 0.00 ? 85  LEU A CD2  4  
ATOM 8671  H H    . LEU A 1 85  ? 3.118   2.281   6.557   1.00 0.00 ? 85  LEU A H    4  
ATOM 8672  H HA   . LEU A 1 85  ? 5.149   3.429   8.379   1.00 0.00 ? 85  LEU A HA   4  
ATOM 8673  H HB2  . LEU A 1 85  ? 2.976   1.445   9.086   1.00 0.00 ? 85  LEU A HB2  4  
ATOM 8674  H HB3  . LEU A 1 85  ? 3.853   2.522   10.177  1.00 0.00 ? 85  LEU A HB3  4  
ATOM 8675  H HG   . LEU A 1 85  ? 1.768   3.245   8.118   1.00 0.00 ? 85  LEU A HG   4  
ATOM 8676  H HD11 . LEU A 1 85  ? 1.683   4.534   10.730  1.00 0.00 ? 85  LEU A HD11 4  
ATOM 8677  H HD12 . LEU A 1 85  ? 1.675   2.773   10.870  1.00 0.00 ? 85  LEU A HD12 4  
ATOM 8678  H HD13 . LEU A 1 85  ? 0.442   3.589   9.905   1.00 0.00 ? 85  LEU A HD13 4  
ATOM 8679  H HD21 . LEU A 1 85  ? 2.331   5.645   8.885   1.00 0.00 ? 85  LEU A HD21 4  
ATOM 8680  H HD22 . LEU A 1 85  ? 3.407   4.893   7.709   1.00 0.00 ? 85  LEU A HD22 4  
ATOM 8681  H HD23 . LEU A 1 85  ? 3.873   4.973   9.409   1.00 0.00 ? 85  LEU A HD23 4  
ATOM 8682  N N    . ASN A 1 86  ? 6.692   1.475   8.322   1.00 0.00 ? 86  ASN A N    4  
ATOM 8683  C CA   . ASN A 1 86  ? 7.595   0.292   8.294   1.00 0.00 ? 86  ASN A CA   4  
ATOM 8684  C C    . ASN A 1 86  ? 8.228   0.100   9.669   1.00 0.00 ? 86  ASN A C    4  
ATOM 8685  O O    . ASN A 1 86  ? 8.967   0.934   10.149  1.00 0.00 ? 86  ASN A O    4  
ATOM 8686  C CB   . ASN A 1 86  ? 8.693   0.517   7.252   1.00 0.00 ? 86  ASN A CB   4  
ATOM 8687  C CG   . ASN A 1 86  ? 9.016   2.009   7.163   1.00 0.00 ? 86  ASN A CG   4  
ATOM 8688  O OD1  . ASN A 1 86  ? 9.140   2.678   8.170   1.00 0.00 ? 86  ASN A OD1  4  
ATOM 8689  N ND2  . ASN A 1 86  ? 9.158   2.565   5.990   1.00 0.00 ? 86  ASN A ND2  4  
ATOM 8690  H H    . ASN A 1 86  ? 7.058   2.369   8.481   1.00 0.00 ? 86  ASN A H    4  
ATOM 8691  H HA   . ASN A 1 86  ? 7.029   -0.587  8.034   1.00 0.00 ? 86  ASN A HA   4  
ATOM 8692  H HB2  . ASN A 1 86  ? 9.580   -0.030  7.541   1.00 0.00 ? 86  ASN A HB2  4  
ATOM 8693  H HB3  . ASN A 1 86  ? 8.353   0.167   6.289   1.00 0.00 ? 86  ASN A HB3  4  
ATOM 8694  H HD21 . ASN A 1 86  ? 9.058   2.026   5.177   1.00 0.00 ? 86  ASN A HD21 4  
ATOM 8695  H HD22 . ASN A 1 86  ? 9.367   3.519   5.922   1.00 0.00 ? 86  ASN A HD22 4  
ATOM 8696  N N    . TYR A 1 87  ? 7.948   -1.005  10.303  1.00 0.00 ? 87  TYR A N    4  
ATOM 8697  C CA   . TYR A 1 87  ? 8.534   -1.261  11.642  1.00 0.00 ? 87  TYR A CA   4  
ATOM 8698  C C    . TYR A 1 87  ? 8.500   -2.755  11.933  1.00 0.00 ? 87  TYR A C    4  
ATOM 8699  O O    . TYR A 1 87  ? 7.669   -3.480  11.425  1.00 0.00 ? 87  TYR A O    4  
ATOM 8700  C CB   . TYR A 1 87  ? 7.725   -0.522  12.705  1.00 0.00 ? 87  TYR A CB   4  
ATOM 8701  C CG   . TYR A 1 87  ? 6.273   -0.927  12.596  1.00 0.00 ? 87  TYR A CG   4  
ATOM 8702  C CD1  . TYR A 1 87  ? 5.412   -0.224  11.743  1.00 0.00 ? 87  TYR A CD1  4  
ATOM 8703  C CD2  . TYR A 1 87  ? 5.790   -2.005  13.345  1.00 0.00 ? 87  TYR A CD2  4  
ATOM 8704  C CE1  . TYR A 1 87  ? 4.068   -0.601  11.641  1.00 0.00 ? 87  TYR A CE1  4  
ATOM 8705  C CE2  . TYR A 1 87  ? 4.445   -2.380  13.242  1.00 0.00 ? 87  TYR A CE2  4  
ATOM 8706  C CZ   . TYR A 1 87  ? 3.583   -1.680  12.390  1.00 0.00 ? 87  TYR A CZ   4  
ATOM 8707  O OH   . TYR A 1 87  ? 2.259   -2.050  12.291  1.00 0.00 ? 87  TYR A OH   4  
ATOM 8708  H H    . TYR A 1 87  ? 7.353   -1.669  9.896   1.00 0.00 ? 87  TYR A H    4  
ATOM 8709  H HA   . TYR A 1 87  ? 9.556   -0.913  11.662  1.00 0.00 ? 87  TYR A HA   4  
ATOM 8710  H HB2  . TYR A 1 87  ? 8.099   -0.782  13.685  1.00 0.00 ? 87  TYR A HB2  4  
ATOM 8711  H HB3  . TYR A 1 87  ? 7.819   0.537   12.554  1.00 0.00 ? 87  TYR A HB3  4  
ATOM 8712  H HD1  . TYR A 1 87  ? 5.783   0.610   11.165  1.00 0.00 ? 87  TYR A HD1  4  
ATOM 8713  H HD2  . TYR A 1 87  ? 6.453   -2.547  14.003  1.00 0.00 ? 87  TYR A HD2  4  
ATOM 8714  H HE1  . TYR A 1 87  ? 3.403   -0.057  10.984  1.00 0.00 ? 87  TYR A HE1  4  
ATOM 8715  H HE2  . TYR A 1 87  ? 4.072   -3.214  13.820  1.00 0.00 ? 87  TYR A HE2  4  
ATOM 8716  H HH   . TYR A 1 87  ? 1.747   -1.487  12.877  1.00 0.00 ? 87  TYR A HH   4  
ATOM 8717  N N    . VAL A 1 88  ? 9.393   -3.215  12.757  1.00 0.00 ? 88  VAL A N    4  
ATOM 8718  C CA   . VAL A 1 88  ? 9.413   -4.661  13.097  1.00 0.00 ? 88  VAL A CA   4  
ATOM 8719  C C    . VAL A 1 88  ? 8.969   -4.836  14.548  1.00 0.00 ? 88  VAL A C    4  
ATOM 8720  O O    . VAL A 1 88  ? 9.708   -4.561  15.472  1.00 0.00 ? 88  VAL A O    4  
ATOM 8721  C CB   . VAL A 1 88  ? 10.831  -5.206  12.922  1.00 0.00 ? 88  VAL A CB   4  
ATOM 8722  C CG1  . VAL A 1 88  ? 11.778  -4.493  13.883  1.00 0.00 ? 88  VAL A CG1  4  
ATOM 8723  C CG2  . VAL A 1 88  ? 10.843  -6.703  13.225  1.00 0.00 ? 88  VAL A CG2  4  
ATOM 8724  H H    . VAL A 1 88  ? 10.042  -2.603  13.161  1.00 0.00 ? 88  VAL A H    4  
ATOM 8725  H HA   . VAL A 1 88  ? 8.736   -5.196  12.449  1.00 0.00 ? 88  VAL A HA   4  
ATOM 8726  H HB   . VAL A 1 88  ? 11.156  -5.040  11.905  1.00 0.00 ? 88  VAL A HB   4  
ATOM 8727  H HG11 . VAL A 1 88  ? 11.960  -5.125  14.738  1.00 0.00 ? 88  VAL A HG11 4  
ATOM 8728  H HG12 . VAL A 1 88  ? 11.328  -3.567  14.207  1.00 0.00 ? 88  VAL A HG12 4  
ATOM 8729  H HG13 . VAL A 1 88  ? 12.710  -4.287  13.380  1.00 0.00 ? 88  VAL A HG13 4  
ATOM 8730  H HG21 . VAL A 1 88  ? 9.874   -7.002  13.591  1.00 0.00 ? 88  VAL A HG21 4  
ATOM 8731  H HG22 . VAL A 1 88  ? 11.592  -6.912  13.975  1.00 0.00 ? 88  VAL A HG22 4  
ATOM 8732  H HG23 . VAL A 1 88  ? 11.075  -7.250  12.323  1.00 0.00 ? 88  VAL A HG23 4  
ATOM 8733  N N    . ALA A 1 89  ? 7.763   -5.281  14.756  1.00 0.00 ? 89  ALA A N    4  
ATOM 8734  C CA   . ALA A 1 89  ? 7.273   -5.464  16.149  1.00 0.00 ? 89  ALA A CA   4  
ATOM 8735  C C    . ALA A 1 89  ? 7.790   -6.788  16.713  1.00 0.00 ? 89  ALA A C    4  
ATOM 8736  O O    . ALA A 1 89  ? 8.775   -6.829  17.423  1.00 0.00 ? 89  ALA A O    4  
ATOM 8737  C CB   . ALA A 1 89  ? 5.743   -5.467  16.155  1.00 0.00 ? 89  ALA A CB   4  
ATOM 8738  H H    . ALA A 1 89  ? 7.180   -5.489  13.994  1.00 0.00 ? 89  ALA A H    4  
ATOM 8739  H HA   . ALA A 1 89  ? 7.633   -4.651  16.762  1.00 0.00 ? 89  ALA A HA   4  
ATOM 8740  H HB1  . ALA A 1 89  ? 5.388   -5.855  17.099  1.00 0.00 ? 89  ALA A HB1  4  
ATOM 8741  H HB2  . ALA A 1 89  ? 5.380   -6.088  15.351  1.00 0.00 ? 89  ALA A HB2  4  
ATOM 8742  H HB3  . ALA A 1 89  ? 5.382   -4.458  16.023  1.00 0.00 ? 89  ALA A HB3  4  
ATOM 8743  N N    . ARG A 1 90  ? 7.128   -7.873  16.413  1.00 0.00 ? 90  ARG A N    4  
ATOM 8744  C CA   . ARG A 1 90  ? 7.579   -9.190  16.944  1.00 0.00 ? 90  ARG A CA   4  
ATOM 8745  C C    . ARG A 1 90  ? 9.011   -9.478  16.491  1.00 0.00 ? 90  ARG A C    4  
ATOM 8746  O O    . ARG A 1 90  ? 9.893   -9.700  17.296  1.00 0.00 ? 90  ARG A O    4  
ATOM 8747  C CB   . ARG A 1 90  ? 6.656   -10.286 16.414  1.00 0.00 ? 90  ARG A CB   4  
ATOM 8748  C CG   . ARG A 1 90  ? 7.148   -11.646 16.904  1.00 0.00 ? 90  ARG A CG   4  
ATOM 8749  C CD   . ARG A 1 90  ? 6.124   -12.720 16.543  1.00 0.00 ? 90  ARG A CD   4  
ATOM 8750  N NE   . ARG A 1 90  ? 6.095   -12.897 15.064  1.00 0.00 ? 90  ARG A NE   4  
ATOM 8751  C CZ   . ARG A 1 90  ? 5.468   -13.914 14.540  1.00 0.00 ? 90  ARG A CZ   4  
ATOM 8752  N NH1  . ARG A 1 90  ? 4.863   -14.776 15.312  1.00 0.00 ? 90  ARG A NH1  4  
ATOM 8753  N NH2  . ARG A 1 90  ? 5.445   -14.069 13.244  1.00 0.00 ? 90  ARG A NH2  4  
ATOM 8754  H H    . ARG A 1 90  ? 6.331   -7.819  15.845  1.00 0.00 ? 90  ARG A H    4  
ATOM 8755  H HA   . ARG A 1 90  ? 7.538   -9.179  18.023  1.00 0.00 ? 90  ARG A HA   4  
ATOM 8756  H HB2  . ARG A 1 90  ? 5.651   -10.116 16.773  1.00 0.00 ? 90  ARG A HB2  4  
ATOM 8757  H HB3  . ARG A 1 90  ? 6.661   -10.272 15.334  1.00 0.00 ? 90  ARG A HB3  4  
ATOM 8758  H HG2  . ARG A 1 90  ? 8.094   -11.876 16.433  1.00 0.00 ? 90  ARG A HG2  4  
ATOM 8759  H HG3  . ARG A 1 90  ? 7.277   -11.616 17.973  1.00 0.00 ? 90  ARG A HG3  4  
ATOM 8760  H HD2  . ARG A 1 90  ? 6.397   -13.653 17.013  1.00 0.00 ? 90  ARG A HD2  4  
ATOM 8761  H HD3  . ARG A 1 90  ? 5.145   -12.416 16.887  1.00 0.00 ? 90  ARG A HD3  4  
ATOM 8762  H HE   . ARG A 1 90  ? 6.548   -12.250 14.484  1.00 0.00 ? 90  ARG A HE   4  
ATOM 8763  H HH11 . ARG A 1 90  ? 4.880   -14.655 16.303  1.00 0.00 ? 90  ARG A HH11 4  
ATOM 8764  H HH12 . ARG A 1 90  ? 4.382   -15.554 14.908  1.00 0.00 ? 90  ARG A HH12 4  
ATOM 8765  H HH21 . ARG A 1 90  ? 5.908   -13.408 12.654  1.00 0.00 ? 90  ARG A HH21 4  
ATOM 8766  H HH22 . ARG A 1 90  ? 4.963   -14.848 12.842  1.00 0.00 ? 90  ARG A HH22 4  
ATOM 8767  N N    . ASN A 1 91  ? 9.247   -9.466  15.209  1.00 0.00 ? 91  ASN A N    4  
ATOM 8768  C CA   . ASN A 1 91  ? 10.623  -9.738  14.694  1.00 0.00 ? 91  ASN A CA   4  
ATOM 8769  C C    . ASN A 1 91  ? 10.613  -9.672  13.168  1.00 0.00 ? 91  ASN A C    4  
ATOM 8770  O O    . ASN A 1 91  ? 11.468  -10.230 12.507  1.00 0.00 ? 91  ASN A O    4  
ATOM 8771  C CB   . ASN A 1 91  ? 11.076  -11.133 15.129  1.00 0.00 ? 91  ASN A CB   4  
ATOM 8772  C CG   . ASN A 1 91  ? 12.587  -11.260 14.927  1.00 0.00 ? 91  ASN A CG   4  
ATOM 8773  O OD1  . ASN A 1 91  ? 13.266  -10.276 14.705  1.00 0.00 ? 91  ASN A OD1  4  
ATOM 8774  N ND2  . ASN A 1 91  ? 13.148  -12.436 14.996  1.00 0.00 ? 91  ASN A ND2  4  
ATOM 8775  H H    . ASN A 1 91  ? 8.518   -9.283  14.583  1.00 0.00 ? 91  ASN A H    4  
ATOM 8776  H HA   . ASN A 1 91  ? 11.305  -8.996  15.083  1.00 0.00 ? 91  ASN A HA   4  
ATOM 8777  H HB2  . ASN A 1 91  ? 10.837  -11.285 16.169  1.00 0.00 ? 91  ASN A HB2  4  
ATOM 8778  H HB3  . ASN A 1 91  ? 10.573  -11.878 14.531  1.00 0.00 ? 91  ASN A HB3  4  
ATOM 8779  H HD21 . ASN A 1 91  ? 12.601  -13.228 15.177  1.00 0.00 ? 91  ASN A HD21 4  
ATOM 8780  H HD22 . ASN A 1 91  ? 14.114  -12.527 14.867  1.00 0.00 ? 91  ASN A HD22 4  
ATOM 8781  N N    . LYS A 1 92  ? 9.653   -8.998  12.600  1.00 0.00 ? 92  LYS A N    4  
ATOM 8782  C CA   . LYS A 1 92  ? 9.587   -8.897  11.117  1.00 0.00 ? 92  LYS A CA   4  
ATOM 8783  C C    . LYS A 1 92  ? 9.070   -7.503  10.730  1.00 0.00 ? 92  LYS A C    4  
ATOM 8784  O O    . LYS A 1 92  ? 8.030   -7.073  11.189  1.00 0.00 ? 92  LYS A O    4  
ATOM 8785  C CB   . LYS A 1 92  ? 8.638   -9.972  10.588  1.00 0.00 ? 92  LYS A CB   4  
ATOM 8786  C CG   . LYS A 1 92  ? 9.301   -10.731 9.437   1.00 0.00 ? 92  LYS A CG   4  
ATOM 8787  C CD   . LYS A 1 92  ? 10.310  -11.736 9.998   1.00 0.00 ? 92  LYS A CD   4  
ATOM 8788  C CE   . LYS A 1 92  ? 10.869  -12.590 8.861   1.00 0.00 ? 92  LYS A CE   4  
ATOM 8789  N NZ   . LYS A 1 92  ? 12.308  -12.882 9.121   1.00 0.00 ? 92  LYS A NZ   4  
ATOM 8790  H H    . LYS A 1 92  ? 8.974   -8.553  13.153  1.00 0.00 ? 92  LYS A H    4  
ATOM 8791  H HA   . LYS A 1 92  ? 10.572  -9.048  10.706  1.00 0.00 ? 92  LYS A HA   4  
ATOM 8792  H HB2  . LYS A 1 92  ? 8.402   -10.664 11.385  1.00 0.00 ? 92  LYS A HB2  4  
ATOM 8793  H HB3  . LYS A 1 92  ? 7.729   -9.511  10.239  1.00 0.00 ? 92  LYS A HB3  4  
ATOM 8794  H HG2  . LYS A 1 92  ? 8.548   -11.257 8.869   1.00 0.00 ? 92  LYS A HG2  4  
ATOM 8795  H HG3  . LYS A 1 92  ? 9.813   -10.033 8.793   1.00 0.00 ? 92  LYS A HG3  4  
ATOM 8796  H HD2  . LYS A 1 92  ? 11.119  -11.204 10.480  1.00 0.00 ? 92  LYS A HD2  4  
ATOM 8797  H HD3  . LYS A 1 92  ? 9.820   -12.373 10.717  1.00 0.00 ? 92  LYS A HD3  4  
ATOM 8798  H HE2  . LYS A 1 92  ? 10.318  -13.517 8.802   1.00 0.00 ? 92  LYS A HE2  4  
ATOM 8799  H HE3  . LYS A 1 92  ? 10.774  -12.055 7.927   1.00 0.00 ? 92  LYS A HE3  4  
ATOM 8800  H HZ1  . LYS A 1 92  ? 12.730  -12.093 9.648   1.00 0.00 ? 92  LYS A HZ1  4  
ATOM 8801  H HZ2  . LYS A 1 92  ? 12.806  -13.003 8.215   1.00 0.00 ? 92  LYS A HZ2  4  
ATOM 8802  H HZ3  . LYS A 1 92  ? 12.389  -13.754 9.680   1.00 0.00 ? 92  LYS A HZ3  4  
ATOM 8803  N N    . PRO A 1 93  ? 9.798   -6.795  9.900   1.00 0.00 ? 93  PRO A N    4  
ATOM 8804  C CA   . PRO A 1 93  ? 9.418   -5.423  9.454   1.00 0.00 ? 93  PRO A CA   4  
ATOM 8805  C C    . PRO A 1 93  ? 8.356   -5.442  8.369   1.00 0.00 ? 93  PRO A C    4  
ATOM 8806  O O    . PRO A 1 93  ? 8.499   -6.101  7.362   1.00 0.00 ? 93  PRO A O    4  
ATOM 8807  C CB   . PRO A 1 93  ? 10.712  -4.864  8.889   1.00 0.00 ? 93  PRO A CB   4  
ATOM 8808  C CG   . PRO A 1 93  ? 11.440  -6.058  8.377   1.00 0.00 ? 93  PRO A CG   4  
ATOM 8809  C CD   . PRO A 1 93  ? 11.063  -7.224  9.285   1.00 0.00 ? 93  PRO A CD   4  
ATOM 8810  H HA   . PRO A 1 93  ? 9.099   -4.826  10.289  1.00 0.00 ? 93  PRO A HA   4  
ATOM 8811  H HB2  . PRO A 1 93  ? 10.500  -4.173  8.083   1.00 0.00 ? 93  PRO A HB2  4  
ATOM 8812  H HB3  . PRO A 1 93  ? 11.278  -4.383  9.662   1.00 0.00 ? 93  PRO A HB3  4  
ATOM 8813  H HG2  . PRO A 1 93  ? 11.139  -6.261  7.370   1.00 0.00 ? 93  PRO A HG2  4  
ATOM 8814  H HG3  . PRO A 1 93  ? 12.495  -5.903  8.416   1.00 0.00 ? 93  PRO A HG3  4  
ATOM 8815  H HD2  . PRO A 1 93  ? 10.921  -8.122  8.702   1.00 0.00 ? 93  PRO A HD2  4  
ATOM 8816  H HD3  . PRO A 1 93  ? 11.813  -7.375  10.038  1.00 0.00 ? 93  PRO A HD3  4  
ATOM 8817  N N    . LYS A 1 94  ? 7.301   -4.715  8.553   1.00 0.00 ? 94  LYS A N    4  
ATOM 8818  C CA   . LYS A 1 94  ? 6.233   -4.693  7.518   1.00 0.00 ? 94  LYS A CA   4  
ATOM 8819  C C    . LYS A 1 94  ? 6.096   -3.302  6.922   1.00 0.00 ? 94  LYS A C    4  
ATOM 8820  O O    . LYS A 1 94  ? 5.850   -2.342  7.622   1.00 0.00 ? 94  LYS A O    4  
ATOM 8821  C CB   . LYS A 1 94  ? 4.889   -5.042  8.151   1.00 0.00 ? 94  LYS A CB   4  
ATOM 8822  C CG   . LYS A 1 94  ? 4.884   -6.473  8.683   1.00 0.00 ? 94  LYS A CG   4  
ATOM 8823  C CD   . LYS A 1 94  ? 3.587   -6.703  9.461   1.00 0.00 ? 94  LYS A CD   4  
ATOM 8824  C CE   . LYS A 1 94  ? 2.401   -6.183  8.642   1.00 0.00 ? 94  LYS A CE   4  
ATOM 8825  N NZ   . LYS A 1 94  ? 2.330   -4.699  8.758   1.00 0.00 ? 94  LYS A NZ   4  
ATOM 8826  H H    . LYS A 1 94  ? 7.216   -4.177  9.368   1.00 0.00 ? 94  LYS A H    4  
ATOM 8827  H HA   . LYS A 1 94  ? 6.458   -5.401  6.739   1.00 0.00 ? 94  LYS A HA   4  
ATOM 8828  H HB2  . LYS A 1 94  ? 4.689   -4.359  8.962   1.00 0.00 ? 94  LYS A HB2  4  
ATOM 8829  H HB3  . LYS A 1 94  ? 4.122   -4.941  7.401   1.00 0.00 ? 94  LYS A HB3  4  
ATOM 8830  H HG2  . LYS A 1 94  ? 4.936   -7.165  7.857   1.00 0.00 ? 94  LYS A HG2  4  
ATOM 8831  H HG3  . LYS A 1 94  ? 5.728   -6.622  9.339   1.00 0.00 ? 94  LYS A HG3  4  
ATOM 8832  H HD2  . LYS A 1 94  ? 3.462   -7.761  9.648   1.00 0.00 ? 94  LYS A HD2  4  
ATOM 8833  H HD3  . LYS A 1 94  ? 3.631   -6.174  10.402  1.00 0.00 ? 94  LYS A HD3  4  
ATOM 8834  H HE2  . LYS A 1 94  ? 2.530   -6.458  7.605   1.00 0.00 ? 94  LYS A HE2  4  
ATOM 8835  H HE3  . LYS A 1 94  ? 1.486   -6.614  9.014   1.00 0.00 ? 94  LYS A HE3  4  
ATOM 8836  H HZ1  . LYS A 1 94  ? 2.592   -4.265  7.850   1.00 0.00 ? 94  LYS A HZ1  4  
ATOM 8837  H HZ2  . LYS A 1 94  ? 2.987   -4.378  9.498   1.00 0.00 ? 94  LYS A HZ2  4  
ATOM 8838  H HZ3  . LYS A 1 94  ? 1.362   -4.416  9.006   1.00 0.00 ? 94  LYS A HZ3  4  
ATOM 8839  N N    . THR A 1 95  ? 6.181   -3.185  5.629   1.00 0.00 ? 95  THR A N    4  
ATOM 8840  C CA   . THR A 1 95  ? 5.975   -1.852  5.020   1.00 0.00 ? 95  THR A CA   4  
ATOM 8841  C C    . THR A 1 95  ? 4.484   -1.730  4.750   1.00 0.00 ? 95  THR A C    4  
ATOM 8842  O O    . THR A 1 95  ? 3.924   -2.473  3.970   1.00 0.00 ? 95  THR A O    4  
ATOM 8843  C CB   . THR A 1 95  ? 6.745   -1.728  3.701   1.00 0.00 ? 95  THR A CB   4  
ATOM 8844  O OG1  . THR A 1 95  ? 8.139   -1.682  3.971   1.00 0.00 ? 95  THR A OG1  4  
ATOM 8845  C CG2  . THR A 1 95  ? 6.314   -0.447  2.978   1.00 0.00 ? 95  THR A CG2  4  
ATOM 8846  H H    . THR A 1 95  ? 6.327   -3.975  5.066   1.00 0.00 ? 95  THR A H    4  
ATOM 8847  H HA   . THR A 1 95  ? 6.290   -1.080  5.708   1.00 0.00 ? 95  THR A HA   4  
ATOM 8848  H HB   . THR A 1 95  ? 6.528   -2.582  3.076   1.00 0.00 ? 95  THR A HB   4  
ATOM 8849  H HG1  . THR A 1 95  ? 8.293   -2.116  4.814   1.00 0.00 ? 95  THR A HG1  4  
ATOM 8850  H HG21 . THR A 1 95  ? 6.914   -0.313  2.091   1.00 0.00 ? 95  THR A HG21 4  
ATOM 8851  H HG22 . THR A 1 95  ? 6.448   0.402   3.634   1.00 0.00 ? 95  THR A HG22 4  
ATOM 8852  H HG23 . THR A 1 95  ? 5.272   -0.520  2.699   1.00 0.00 ? 95  THR A HG23 4  
ATOM 8853  N N    . VAL A 1 96  ? 3.830   -0.821  5.402   1.00 0.00 ? 96  VAL A N    4  
ATOM 8854  C CA   . VAL A 1 96  ? 2.369   -0.685  5.193   1.00 0.00 ? 96  VAL A CA   4  
ATOM 8855  C C    . VAL A 1 96  ? 2.084   0.640   4.500   1.00 0.00 ? 96  VAL A C    4  
ATOM 8856  O O    . VAL A 1 96  ? 2.397   1.689   5.009   1.00 0.00 ? 96  VAL A O    4  
ATOM 8857  C CB   . VAL A 1 96  ? 1.671   -0.718  6.557   1.00 0.00 ? 96  VAL A CB   4  
ATOM 8858  C CG1  . VAL A 1 96  ? 0.159   -0.622  6.360   1.00 0.00 ? 96  VAL A CG1  4  
ATOM 8859  C CG2  . VAL A 1 96  ? 2.009   -2.036  7.270   1.00 0.00 ? 96  VAL A CG2  4  
ATOM 8860  H H    . VAL A 1 96  ? 4.293   -0.241  6.042   1.00 0.00 ? 96  VAL A H    4  
ATOM 8861  H HA   . VAL A 1 96  ? 2.009   -1.500  4.585   1.00 0.00 ? 96  VAL A HA   4  
ATOM 8862  H HB   . VAL A 1 96  ? 2.015   0.117   7.157   1.00 0.00 ? 96  VAL A HB   4  
ATOM 8863  H HG11 . VAL A 1 96  ? -0.101  0.370   6.020   1.00 0.00 ? 96  VAL A HG11 4  
ATOM 8864  H HG12 . VAL A 1 96  ? -0.338  -0.821  7.300   1.00 0.00 ? 96  VAL A HG12 4  
ATOM 8865  H HG13 . VAL A 1 96  ? -0.156  -1.349  5.627   1.00 0.00 ? 96  VAL A HG13 4  
ATOM 8866  H HG21 . VAL A 1 96  ? 2.426   -1.823  8.242   1.00 0.00 ? 96  VAL A HG21 4  
ATOM 8867  H HG22 . VAL A 1 96  ? 2.727   -2.591  6.684   1.00 0.00 ? 96  VAL A HG22 4  
ATOM 8868  H HG23 . VAL A 1 96  ? 1.111   -2.627  7.386   1.00 0.00 ? 96  VAL A HG23 4  
ATOM 8869  N N    . ILE A 1 97  ? 1.478   0.595   3.345   1.00 0.00 ? 97  ILE A N    4  
ATOM 8870  C CA   . ILE A 1 97  ? 1.161   1.854   2.617   1.00 0.00 ? 97  ILE A CA   4  
ATOM 8871  C C    . ILE A 1 97  ? -0.288  2.225   2.909   1.00 0.00 ? 97  ILE A C    4  
ATOM 8872  O O    . ILE A 1 97  ? -1.184  1.418   2.764   1.00 0.00 ? 97  ILE A O    4  
ATOM 8873  C CB   . ILE A 1 97  ? 1.356   1.637   1.111   1.00 0.00 ? 97  ILE A CB   4  
ATOM 8874  C CG1  . ILE A 1 97  ? 2.800   1.179   0.849   1.00 0.00 ? 97  ILE A CG1  4  
ATOM 8875  C CG2  . ILE A 1 97  ? 1.070   2.943   0.361   1.00 0.00 ? 97  ILE A CG2  4  
ATOM 8876  C CD1  . ILE A 1 97  ? 3.656   2.349   0.348   1.00 0.00 ? 97  ILE A CD1  4  
ATOM 8877  H H    . ILE A 1 97  ? 1.226   -0.269  2.958   1.00 0.00 ? 97  ILE A H    4  
ATOM 8878  H HA   . ILE A 1 97  ? 1.811   2.644   2.955   1.00 0.00 ? 97  ILE A HA   4  
ATOM 8879  H HB   . ILE A 1 97  ? 0.669   0.875   0.772   1.00 0.00 ? 97  ILE A HB   4  
ATOM 8880  H HG12 . ILE A 1 97  ? 3.224   0.795   1.766   1.00 0.00 ? 97  ILE A HG12 4  
ATOM 8881  H HG13 . ILE A 1 97  ? 2.795   0.398   0.104   1.00 0.00 ? 97  ILE A HG13 4  
ATOM 8882  H HG21 . ILE A 1 97  ? 1.614   3.752   0.823   1.00 0.00 ? 97  ILE A HG21 4  
ATOM 8883  H HG22 . ILE A 1 97  ? 0.012   3.153   0.397   1.00 0.00 ? 97  ILE A HG22 4  
ATOM 8884  H HG23 . ILE A 1 97  ? 1.382   2.841   -0.670  1.00 0.00 ? 97  ILE A HG23 4  
ATOM 8885  H HD11 . ILE A 1 97  ? 4.695   2.157   0.585   1.00 0.00 ? 97  ILE A HD11 4  
ATOM 8886  H HD12 . ILE A 1 97  ? 3.343   3.265   0.832   1.00 0.00 ? 97  ILE A HD12 4  
ATOM 8887  H HD13 . ILE A 1 97  ? 3.542   2.449   -0.720  1.00 0.00 ? 97  ILE A HD13 4  
ATOM 8888  N N    . TYR A 1 98  ? -0.524  3.430   3.348   1.00 0.00 ? 98  TYR A N    4  
ATOM 8889  C CA   . TYR A 1 98  ? -1.917  3.828   3.679   1.00 0.00 ? 98  TYR A CA   4  
ATOM 8890  C C    . TYR A 1 98  ? -2.413  4.936   2.754   1.00 0.00 ? 98  TYR A C    4  
ATOM 8891  O O    . TYR A 1 98  ? -1.779  5.957   2.582   1.00 0.00 ? 98  TYR A O    4  
ATOM 8892  C CB   . TYR A 1 98  ? -1.964  4.351   5.113   1.00 0.00 ? 98  TYR A CB   4  
ATOM 8893  C CG   . TYR A 1 98  ? -1.929  3.202   6.091   1.00 0.00 ? 98  TYR A CG   4  
ATOM 8894  C CD1  . TYR A 1 98  ? -3.002  2.307   6.162   1.00 0.00 ? 98  TYR A CD1  4  
ATOM 8895  C CD2  . TYR A 1 98  ? -0.825  3.040   6.934   1.00 0.00 ? 98  TYR A CD2  4  
ATOM 8896  C CE1  . TYR A 1 98  ? -2.971  1.249   7.078   1.00 0.00 ? 98  TYR A CE1  4  
ATOM 8897  C CE2  . TYR A 1 98  ? -0.795  1.983   7.852   1.00 0.00 ? 98  TYR A CE2  4  
ATOM 8898  C CZ   . TYR A 1 98  ? -1.867  1.088   7.923   1.00 0.00 ? 98  TYR A CZ   4  
ATOM 8899  O OH   . TYR A 1 98  ? -1.838  0.045   8.828   1.00 0.00 ? 98  TYR A OH   4  
ATOM 8900  H H    . TYR A 1 98  ? 0.215   4.061   3.483   1.00 0.00 ? 98  TYR A H    4  
ATOM 8901  H HA   . TYR A 1 98  ? -2.568  2.972   3.593   1.00 0.00 ? 98  TYR A HA   4  
ATOM 8902  H HB2  . TYR A 1 98  ? -1.112  4.992   5.285   1.00 0.00 ? 98  TYR A HB2  4  
ATOM 8903  H HB3  . TYR A 1 98  ? -2.871  4.915   5.252   1.00 0.00 ? 98  TYR A HB3  4  
ATOM 8904  H HD1  . TYR A 1 98  ? -3.854  2.430   5.508   1.00 0.00 ? 98  TYR A HD1  4  
ATOM 8905  H HD2  . TYR A 1 98  ? 0.002   3.731   6.878   1.00 0.00 ? 98  TYR A HD2  4  
ATOM 8906  H HE1  . TYR A 1 98  ? -3.800  0.558   7.135   1.00 0.00 ? 98  TYR A HE1  4  
ATOM 8907  H HE2  . TYR A 1 98  ? 0.058   1.858   8.503   1.00 0.00 ? 98  TYR A HE2  4  
ATOM 8908  H HH   . TYR A 1 98  ? -2.421  -0.645  8.503   1.00 0.00 ? 98  TYR A HH   4  
ATOM 8909  N N    . TRP A 1 99  ? -3.577  4.751   2.200   1.00 0.00 ? 99  TRP A N    4  
ATOM 8910  C CA   . TRP A 1 99  ? -4.178  5.793   1.329   1.00 0.00 ? 99  TRP A CA   4  
ATOM 8911  C C    . TRP A 1 99  ? -5.394  6.352   2.065   1.00 0.00 ? 99  TRP A C    4  
ATOM 8912  O O    . TRP A 1 99  ? -6.105  5.625   2.730   1.00 0.00 ? 99  TRP A O    4  
ATOM 8913  C CB   . TRP A 1 99  ? -4.623  5.180   0.000   1.00 0.00 ? 99  TRP A CB   4  
ATOM 8914  C CG   . TRP A 1 99  ? -3.468  5.096   -0.944  1.00 0.00 ? 99  TRP A CG   4  
ATOM 8915  C CD1  . TRP A 1 99  ? -3.005  6.119   -1.698  1.00 0.00 ? 99  TRP A CD1  4  
ATOM 8916  C CD2  . TRP A 1 99  ? -2.633  3.944   -1.259  1.00 0.00 ? 99  TRP A CD2  4  
ATOM 8917  N NE1  . TRP A 1 99  ? -1.940  5.670   -2.457  1.00 0.00 ? 99  TRP A NE1  4  
ATOM 8918  C CE2  . TRP A 1 99  ? -1.672  4.336   -2.223  1.00 0.00 ? 99  TRP A CE2  4  
ATOM 8919  C CE3  . TRP A 1 99  ? -2.616  2.612   -0.809  1.00 0.00 ? 99  TRP A CE3  4  
ATOM 8920  C CZ2  . TRP A 1 99  ? -0.729  3.436   -2.721  1.00 0.00 ? 99  TRP A CZ2  4  
ATOM 8921  C CZ3  . TRP A 1 99  ? -1.667  1.706   -1.310  1.00 0.00 ? 99  TRP A CZ3  4  
ATOM 8922  C CH2  . TRP A 1 99  ? -0.727  2.119   -2.263  1.00 0.00 ? 99  TRP A CH2  4  
ATOM 8923  H H    . TRP A 1 99  ? -4.080  3.930   2.390   1.00 0.00 ? 99  TRP A H    4  
ATOM 8924  H HA   . TRP A 1 99  ? -3.461  6.582   1.152   1.00 0.00 ? 99  TRP A HA   4  
ATOM 8925  H HB2  . TRP A 1 99  ? -5.010  4.188   0.175   1.00 0.00 ? 99  TRP A HB2  4  
ATOM 8926  H HB3  . TRP A 1 99  ? -5.395  5.794   -0.434  1.00 0.00 ? 99  TRP A HB3  4  
ATOM 8927  H HD1  . TRP A 1 99  ? -3.403  7.124   -1.705  1.00 0.00 ? 99  TRP A HD1  4  
ATOM 8928  H HE1  . TRP A 1 99  ? -1.426  6.215   -3.089  1.00 0.00 ? 99  TRP A HE1  4  
ATOM 8929  H HE3  . TRP A 1 99  ? -3.340  2.284   -0.076  1.00 0.00 ? 99  TRP A HE3  4  
ATOM 8930  H HZ2  . TRP A 1 99  ? -0.008  3.755   -3.457  1.00 0.00 ? 99  TRP A HZ2  4  
ATOM 8931  H HZ3  . TRP A 1 99  ? -1.662  0.686   -0.957  1.00 0.00 ? 99  TRP A HZ3  4  
ATOM 8932  H HH2  . TRP A 1 99  ? 0.001   1.418   -2.644  1.00 0.00 ? 99  TRP A HH2  4  
ATOM 8933  N N    . LEU A 1 100 ? -5.650  7.624   1.975   1.00 0.00 ? 100 LEU A N    4  
ATOM 8934  C CA   . LEU A 1 100 ? -6.826  8.176   2.698   1.00 0.00 ? 100 LEU A CA   4  
ATOM 8935  C C    . LEU A 1 100 ? -8.094  7.837   1.911   1.00 0.00 ? 100 LEU A C    4  
ATOM 8936  O O    . LEU A 1 100 ? -8.113  7.893   0.698   1.00 0.00 ? 100 LEU A O    4  
ATOM 8937  C CB   . LEU A 1 100 ? -6.689  9.694   2.829   1.00 0.00 ? 100 LEU A CB   4  
ATOM 8938  C CG   . LEU A 1 100 ? -5.208  10.078  2.786   1.00 0.00 ? 100 LEU A CG   4  
ATOM 8939  C CD1  . LEU A 1 100 ? -5.050  11.553  3.154   1.00 0.00 ? 100 LEU A CD1  4  
ATOM 8940  C CD2  . LEU A 1 100 ? -4.419  9.224   3.779   1.00 0.00 ? 100 LEU A CD2  4  
ATOM 8941  H H    . LEU A 1 100 ? -5.072  8.210   1.444   1.00 0.00 ? 100 LEU A H    4  
ATOM 8942  H HA   . LEU A 1 100 ? -6.886  7.732   3.682   1.00 0.00 ? 100 LEU A HA   4  
ATOM 8943  H HB2  . LEU A 1 100 ? -7.211  10.175  2.019   1.00 0.00 ? 100 LEU A HB2  4  
ATOM 8944  H HB3  . LEU A 1 100 ? -7.111  10.013  3.770   1.00 0.00 ? 100 LEU A HB3  4  
ATOM 8945  H HG   . LEU A 1 100 ? -4.826  9.917   1.787   1.00 0.00 ? 100 LEU A HG   4  
ATOM 8946  H HD11 . LEU A 1 100 ? -4.013  11.838  3.070   1.00 0.00 ? 100 LEU A HD11 4  
ATOM 8947  H HD12 . LEU A 1 100 ? -5.385  11.708  4.169   1.00 0.00 ? 100 LEU A HD12 4  
ATOM 8948  H HD13 . LEU A 1 100 ? -5.644  12.155  2.484   1.00 0.00 ? 100 LEU A HD13 4  
ATOM 8949  H HD21 . LEU A 1 100 ? -3.880  8.457   3.245   1.00 0.00 ? 100 LEU A HD21 4  
ATOM 8950  H HD22 . LEU A 1 100 ? -5.101  8.765   4.480   1.00 0.00 ? 100 LEU A HD22 4  
ATOM 8951  H HD23 . LEU A 1 100 ? -3.721  9.850   4.313   1.00 0.00 ? 100 LEU A HD23 4  
ATOM 8952  N N    . ALA A 1 101 ? -9.150  7.475   2.589   1.00 0.00 ? 101 ALA A N    4  
ATOM 8953  C CA   . ALA A 1 101 ? -10.406 7.122   1.867   1.00 0.00 ? 101 ALA A CA   4  
ATOM 8954  C C    . ALA A 1 101 ? -11.611 7.747   2.572   1.00 0.00 ? 101 ALA A C    4  
ATOM 8955  O O    . ALA A 1 101 ? -11.572 8.037   3.751   1.00 0.00 ? 101 ALA A O    4  
ATOM 8956  C CB   . ALA A 1 101 ? -10.565 5.600   1.838   1.00 0.00 ? 101 ALA A CB   4  
ATOM 8957  H H    . ALA A 1 101 ? -9.114  7.426   3.568   1.00 0.00 ? 101 ALA A H    4  
ATOM 8958  H HA   . ALA A 1 101 ? -10.351 7.492   0.857   1.00 0.00 ? 101 ALA A HA   4  
ATOM 8959  H HB1  . ALA A 1 101 ? -11.614 5.348   1.883   1.00 0.00 ? 101 ALA A HB1  4  
ATOM 8960  H HB2  . ALA A 1 101 ? -10.055 5.168   2.686   1.00 0.00 ? 101 ALA A HB2  4  
ATOM 8961  H HB3  . ALA A 1 101 ? -10.141 5.212   0.924   1.00 0.00 ? 101 ALA A HB3  4  
ATOM 8962  N N    . GLU A 1 102 ? -12.679 7.963   1.851   1.00 0.00 ? 102 GLU A N    4  
ATOM 8963  C CA   . GLU A 1 102 ? -13.891 8.577   2.468   1.00 0.00 ? 102 GLU A CA   4  
ATOM 8964  C C    . GLU A 1 102 ? -15.129 7.750   2.119   1.00 0.00 ? 102 GLU A C    4  
ATOM 8965  O O    . GLU A 1 102 ? -15.497 7.637   0.968   1.00 0.00 ? 102 GLU A O    4  
ATOM 8966  C CB   . GLU A 1 102 ? -14.062 9.995   1.913   1.00 0.00 ? 102 GLU A CB   4  
ATOM 8967  C CG   . GLU A 1 102 ? -15.257 10.672  2.586   1.00 0.00 ? 102 GLU A CG   4  
ATOM 8968  C CD   . GLU A 1 102 ? -15.533 12.013  1.906   1.00 0.00 ? 102 GLU A CD   4  
ATOM 8969  O OE1  . GLU A 1 102 ? -14.739 12.404  1.066   1.00 0.00 ? 102 GLU A OE1  4  
ATOM 8970  O OE2  . GLU A 1 102 ? -16.540 12.622  2.229   1.00 0.00 ? 102 GLU A OE2  4  
ATOM 8971  H H    . GLU A 1 102 ? -12.682 7.726   0.901   1.00 0.00 ? 102 GLU A H    4  
ATOM 8972  H HA   . GLU A 1 102 ? -13.772 8.619   3.538   1.00 0.00 ? 102 GLU A HA   4  
ATOM 8973  H HB2  . GLU A 1 102 ? -13.167 10.567  2.108   1.00 0.00 ? 102 GLU A HB2  4  
ATOM 8974  H HB3  . GLU A 1 102 ? -14.232 9.945   0.847   1.00 0.00 ? 102 GLU A HB3  4  
ATOM 8975  H HG2  . GLU A 1 102 ? -16.128 10.037  2.500   1.00 0.00 ? 102 GLU A HG2  4  
ATOM 8976  H HG3  . GLU A 1 102 ? -15.033 10.840  3.626   1.00 0.00 ? 102 GLU A HG3  4  
ATOM 8977  H HE2  . GLU A 1 102 ? -16.650 13.453  1.761   1.00 0.00 ? 102 GLU A HE2  4  
ATOM 8978  N N    . VAL A 1 103 ? -15.788 7.182   3.098   1.00 0.00 ? 103 VAL A N    4  
ATOM 8979  C CA   . VAL A 1 103 ? -17.011 6.379   2.801   1.00 0.00 ? 103 VAL A CA   4  
ATOM 8980  C C    . VAL A 1 103 ? -18.184 7.329   2.526   1.00 0.00 ? 103 VAL A C    4  
ATOM 8981  O O    . VAL A 1 103 ? -18.369 8.321   3.202   1.00 0.00 ? 103 VAL A O    4  
ATOM 8982  C CB   . VAL A 1 103 ? -17.316 5.445   3.976   1.00 0.00 ? 103 VAL A CB   4  
ATOM 8983  C CG1  . VAL A 1 103 ? -16.034 4.731   4.384   1.00 0.00 ? 103 VAL A CG1  4  
ATOM 8984  C CG2  . VAL A 1 103 ? -17.833 6.233   5.177   1.00 0.00 ? 103 VAL A CG2  4  
ATOM 8985  H H    . VAL A 1 103 ? -15.484 7.290   4.023   1.00 0.00 ? 103 VAL A H    4  
ATOM 8986  H HA   . VAL A 1 103 ? -16.830 5.785   1.919   1.00 0.00 ? 103 VAL A HA   4  
ATOM 8987  H HB   . VAL A 1 103 ? -18.049 4.713   3.674   1.00 0.00 ? 103 VAL A HB   4  
ATOM 8988  H HG11 . VAL A 1 103 ? -15.571 5.277   5.188   1.00 0.00 ? 103 VAL A HG11 4  
ATOM 8989  H HG12 . VAL A 1 103 ? -15.365 4.691   3.541   1.00 0.00 ? 103 VAL A HG12 4  
ATOM 8990  H HG13 . VAL A 1 103 ? -16.268 3.727   4.715   1.00 0.00 ? 103 VAL A HG13 4  
ATOM 8991  H HG21 . VAL A 1 103 ? -17.661 7.286   5.021   1.00 0.00 ? 103 VAL A HG21 4  
ATOM 8992  H HG22 . VAL A 1 103 ? -17.311 5.910   6.068   1.00 0.00 ? 103 VAL A HG22 4  
ATOM 8993  H HG23 . VAL A 1 103 ? -18.890 6.050   5.294   1.00 0.00 ? 103 VAL A HG23 4  
ATOM 8994  N N    . LYS A 1 104 ? -18.946 7.050   1.506   1.00 0.00 ? 104 LYS A N    4  
ATOM 8995  C CA   . LYS A 1 104 ? -20.085 7.947   1.136   1.00 0.00 ? 104 LYS A CA   4  
ATOM 8996  C C    . LYS A 1 104 ? -21.199 7.911   2.185   1.00 0.00 ? 104 LYS A C    4  
ATOM 8997  O O    . LYS A 1 104 ? -21.911 8.879   2.364   1.00 0.00 ? 104 LYS A O    4  
ATOM 8998  C CB   . LYS A 1 104 ? -20.675 7.503   -0.208  1.00 0.00 ? 104 LYS A CB   4  
ATOM 8999  C CG   . LYS A 1 104 ? -19.693 6.590   -0.942  1.00 0.00 ? 104 LYS A CG   4  
ATOM 9000  C CD   . LYS A 1 104 ? -18.356 7.309   -1.119  1.00 0.00 ? 104 LYS A CD   4  
ATOM 9001  C CE   . LYS A 1 104 ? -18.104 7.558   -2.607  1.00 0.00 ? 104 LYS A CE   4  
ATOM 9002  N NZ   . LYS A 1 104 ? -19.310 8.191   -3.214  1.00 0.00 ? 104 LYS A NZ   4  
ATOM 9003  H H    . LYS A 1 104 ? -18.753 6.259   0.959   1.00 0.00 ? 104 LYS A H    4  
ATOM 9004  H HA   . LYS A 1 104 ? -19.720 8.958   1.043   1.00 0.00 ? 104 LYS A HA   4  
ATOM 9005  H HB2  . LYS A 1 104 ? -21.598 6.971   -0.035  1.00 0.00 ? 104 LYS A HB2  4  
ATOM 9006  H HB3  . LYS A 1 104 ? -20.872 8.374   -0.816  1.00 0.00 ? 104 LYS A HB3  4  
ATOM 9007  H HG2  . LYS A 1 104 ? -19.548 5.687   -0.369  1.00 0.00 ? 104 LYS A HG2  4  
ATOM 9008  H HG3  . LYS A 1 104 ? -20.093 6.339   -1.913  1.00 0.00 ? 104 LYS A HG3  4  
ATOM 9009  H HD2  . LYS A 1 104 ? -18.380 8.250   -0.593  1.00 0.00 ? 104 LYS A HD2  4  
ATOM 9010  H HD3  . LYS A 1 104 ? -17.564 6.696   -0.723  1.00 0.00 ? 104 LYS A HD3  4  
ATOM 9011  H HE2  . LYS A 1 104 ? -17.256 8.216   -2.724  1.00 0.00 ? 104 LYS A HE2  4  
ATOM 9012  H HE3  . LYS A 1 104 ? -17.902 6.620   -3.101  1.00 0.00 ? 104 LYS A HE3  4  
ATOM 9013  H HZ1  . LYS A 1 104 ? -19.016 8.952   -3.857  1.00 0.00 ? 104 LYS A HZ1  4  
ATOM 9014  H HZ2  . LYS A 1 104 ? -19.911 8.583   -2.461  1.00 0.00 ? 104 LYS A HZ2  4  
ATOM 9015  H HZ3  . LYS A 1 104 ? -19.845 7.477   -3.748  1.00 0.00 ? 104 LYS A HZ3  4  
ATOM 9016  N N    . ASP A 1 105 ? -21.395 6.807   2.846   1.00 0.00 ? 105 ASP A N    4  
ATOM 9017  C CA   . ASP A 1 105 ? -22.511 6.741   3.837   1.00 0.00 ? 105 ASP A CA   4  
ATOM 9018  C C    . ASP A 1 105 ? -22.003 6.846   5.270   1.00 0.00 ? 105 ASP A C    4  
ATOM 9019  O O    . ASP A 1 105 ? -21.069 6.183   5.666   1.00 0.00 ? 105 ASP A O    4  
ATOM 9020  C CB   . ASP A 1 105 ? -23.258 5.421   3.674   1.00 0.00 ? 105 ASP A CB   4  
ATOM 9021  C CG   . ASP A 1 105 ? -24.729 5.699   3.358   1.00 0.00 ? 105 ASP A CG   4  
ATOM 9022  O OD1  . ASP A 1 105 ? -25.575 5.139   4.034   1.00 0.00 ? 105 ASP A OD1  4  
ATOM 9023  O OD2  . ASP A 1 105 ? -24.982 6.464   2.442   1.00 0.00 ? 105 ASP A OD2  4  
ATOM 9024  H H    . ASP A 1 105 ? -20.835 6.020   2.671   1.00 0.00 ? 105 ASP A H    4  
ATOM 9025  H HA   . ASP A 1 105 ? -23.195 7.550   3.651   1.00 0.00 ? 105 ASP A HA   4  
ATOM 9026  H HB2  . ASP A 1 105 ? -22.815 4.859   2.871   1.00 0.00 ? 105 ASP A HB2  4  
ATOM 9027  H HB3  . ASP A 1 105 ? -23.190 4.855   4.590   1.00 0.00 ? 105 ASP A HB3  4  
ATOM 9028  H HD2  . ASP A 1 105 ? -25.923 6.591   2.300   1.00 0.00 ? 105 ASP A HD2  4  
ATOM 9029  N N    . TYR A 1 106 ? -22.648 7.658   6.060   1.00 0.00 ? 106 TYR A N    4  
ATOM 9030  C CA   . TYR A 1 106 ? -22.251 7.795   7.489   1.00 0.00 ? 106 TYR A CA   4  
ATOM 9031  C C    . TYR A 1 106 ? -22.474 6.453   8.178   1.00 0.00 ? 106 TYR A C    4  
ATOM 9032  O O    . TYR A 1 106 ? -21.659 5.988   8.951   1.00 0.00 ? 106 TYR A O    4  
ATOM 9033  C CB   . TYR A 1 106 ? -23.117 8.866   8.159   1.00 0.00 ? 106 TYR A CB   4  
ATOM 9034  C CG   . TYR A 1 106 ? -22.800 8.927   9.635   1.00 0.00 ? 106 TYR A CG   4  
ATOM 9035  C CD1  . TYR A 1 106 ? -21.496 9.200   10.060  1.00 0.00 ? 106 TYR A CD1  4  
ATOM 9036  C CD2  . TYR A 1 106 ? -23.811 8.708   10.579  1.00 0.00 ? 106 TYR A CD2  4  
ATOM 9037  C CE1  . TYR A 1 106 ? -21.200 9.255   11.427  1.00 0.00 ? 106 TYR A CE1  4  
ATOM 9038  C CE2  . TYR A 1 106 ? -23.516 8.763   11.948  1.00 0.00 ? 106 TYR A CE2  4  
ATOM 9039  C CZ   . TYR A 1 106 ? -22.210 9.036   12.370  1.00 0.00 ? 106 TYR A CZ   4  
ATOM 9040  O OH   . TYR A 1 106 ? -21.920 9.091   13.719  1.00 0.00 ? 106 TYR A OH   4  
ATOM 9041  H H    . TYR A 1 106 ? -23.417 8.155   5.714   1.00 0.00 ? 106 TYR A H    4  
ATOM 9042  H HA   . TYR A 1 106 ? -21.210 8.071   7.553   1.00 0.00 ? 106 TYR A HA   4  
ATOM 9043  H HB2  . TYR A 1 106 ? -22.913 9.828   7.708   1.00 0.00 ? 106 TYR A HB2  4  
ATOM 9044  H HB3  . TYR A 1 106 ? -24.160 8.621   8.028   1.00 0.00 ? 106 TYR A HB3  4  
ATOM 9045  H HD1  . TYR A 1 106 ? -20.717 9.368   9.332   1.00 0.00 ? 106 TYR A HD1  4  
ATOM 9046  H HD2  . TYR A 1 106 ? -24.818 8.496   10.251  1.00 0.00 ? 106 TYR A HD2  4  
ATOM 9047  H HE1  . TYR A 1 106 ? -20.191 9.466   11.754  1.00 0.00 ? 106 TYR A HE1  4  
ATOM 9048  H HE2  . TYR A 1 106 ? -24.298 8.596   12.674  1.00 0.00 ? 106 TYR A HE2  4  
ATOM 9049  H HH   . TYR A 1 106 ? -21.333 9.838   13.866  1.00 0.00 ? 106 TYR A HH   4  
ATOM 9050  N N    . ASP A 1 107 ? -23.577 5.821   7.884   1.00 0.00 ? 107 ASP A N    4  
ATOM 9051  C CA   . ASP A 1 107 ? -23.872 4.498   8.494   1.00 0.00 ? 107 ASP A CA   4  
ATOM 9052  C C    . ASP A 1 107 ? -23.470 3.409   7.502   1.00 0.00 ? 107 ASP A C    4  
ATOM 9053  O O    . ASP A 1 107 ? -23.941 2.290   7.566   1.00 0.00 ? 107 ASP A O    4  
ATOM 9054  C CB   . ASP A 1 107 ? -25.367 4.392   8.798   1.00 0.00 ? 107 ASP A CB   4  
ATOM 9055  C CG   . ASP A 1 107 ? -25.643 3.090   9.553   1.00 0.00 ? 107 ASP A CG   4  
ATOM 9056  O OD1  . ASP A 1 107 ? -26.805 2.792   9.774   1.00 0.00 ? 107 ASP A OD1  4  
ATOM 9057  O OD2  . ASP A 1 107 ? -24.687 2.414   9.895   1.00 0.00 ? 107 ASP A OD2  4  
ATOM 9058  H H    . ASP A 1 107 ? -24.210 6.215   7.250   1.00 0.00 ? 107 ASP A H    4  
ATOM 9059  H HA   . ASP A 1 107 ? -23.306 4.385   9.407   1.00 0.00 ? 107 ASP A HA   4  
ATOM 9060  H HB2  . ASP A 1 107 ? -25.673 5.233   9.404   1.00 0.00 ? 107 ASP A HB2  4  
ATOM 9061  H HB3  . ASP A 1 107 ? -25.924 4.393   7.873   1.00 0.00 ? 107 ASP A HB3  4  
ATOM 9062  H HD2  . ASP A 1 107 ? -24.934 1.613   10.363  1.00 0.00 ? 107 ASP A HD2  4  
ATOM 9063  N N    . VAL A 1 108 ? -22.604 3.737   6.579   1.00 0.00 ? 108 VAL A N    4  
ATOM 9064  C CA   . VAL A 1 108 ? -22.161 2.734   5.571   1.00 0.00 ? 108 VAL A CA   4  
ATOM 9065  C C    . VAL A 1 108 ? -22.036 1.372   6.255   1.00 0.00 ? 108 VAL A C    4  
ATOM 9066  O O    . VAL A 1 108 ? -21.754 1.283   7.433   1.00 0.00 ? 108 VAL A O    4  
ATOM 9067  C CB   . VAL A 1 108 ? -20.812 3.171   4.998   1.00 0.00 ? 108 VAL A CB   4  
ATOM 9068  C CG1  . VAL A 1 108 ? -19.869 3.526   6.146   1.00 0.00 ? 108 VAL A CG1  4  
ATOM 9069  C CG2  . VAL A 1 108 ? -20.197 2.044   4.168   1.00 0.00 ? 108 VAL A CG2  4  
ATOM 9070  H H    . VAL A 1 108 ? -22.244 4.647   6.551   1.00 0.00 ? 108 VAL A H    4  
ATOM 9071  H HA   . VAL A 1 108 ? -22.890 2.673   4.777   1.00 0.00 ? 108 VAL A HA   4  
ATOM 9072  H HB   . VAL A 1 108 ? -20.956 4.042   4.373   1.00 0.00 ? 108 VAL A HB   4  
ATOM 9073  H HG11 . VAL A 1 108 ? -19.820 2.698   6.835   1.00 0.00 ? 108 VAL A HG11 4  
ATOM 9074  H HG12 . VAL A 1 108 ? -20.241 4.402   6.655   1.00 0.00 ? 108 VAL A HG12 4  
ATOM 9075  H HG13 . VAL A 1 108 ? -18.886 3.727   5.751   1.00 0.00 ? 108 VAL A HG13 4  
ATOM 9076  H HG21 . VAL A 1 108 ? -20.084 1.163   4.780   1.00 0.00 ? 108 VAL A HG21 4  
ATOM 9077  H HG22 . VAL A 1 108 ? -19.228 2.357   3.805   1.00 0.00 ? 108 VAL A HG22 4  
ATOM 9078  H HG23 . VAL A 1 108 ? -20.840 1.821   3.329   1.00 0.00 ? 108 VAL A HG23 4  
ATOM 9079  N N    . GLU A 1 109 ? -22.271 0.316   5.534   1.00 0.00 ? 109 GLU A N    4  
ATOM 9080  C CA   . GLU A 1 109 ? -22.199 -1.030  6.152   1.00 0.00 ? 109 GLU A CA   4  
ATOM 9081  C C    . GLU A 1 109 ? -20.791 -1.301  6.674   1.00 0.00 ? 109 GLU A C    4  
ATOM 9082  O O    . GLU A 1 109 ? -19.796 -0.933  6.079   1.00 0.00 ? 109 GLU A O    4  
ATOM 9083  C CB   . GLU A 1 109 ? -22.610 -2.102  5.130   1.00 0.00 ? 109 GLU A CB   4  
ATOM 9084  C CG   . GLU A 1 109 ? -21.395 -2.603  4.341   1.00 0.00 ? 109 GLU A CG   4  
ATOM 9085  C CD   . GLU A 1 109 ? -21.741 -2.675  2.851   1.00 0.00 ? 109 GLU A CD   4  
ATOM 9086  O OE1  . GLU A 1 109 ? -22.913 -2.814  2.540   1.00 0.00 ? 109 GLU A OE1  4  
ATOM 9087  O OE2  . GLU A 1 109 ? -20.828 -2.591  2.047   1.00 0.00 ? 109 GLU A OE2  4  
ATOM 9088  H H    . GLU A 1 109 ? -22.515 0.408   4.595   1.00 0.00 ? 109 GLU A H    4  
ATOM 9089  H HA   . GLU A 1 109 ? -22.886 -1.062  6.985   1.00 0.00 ? 109 GLU A HA   4  
ATOM 9090  H HB2  . GLU A 1 109 ? -23.057 -2.934  5.656   1.00 0.00 ? 109 GLU A HB2  4  
ATOM 9091  H HB3  . GLU A 1 109 ? -23.333 -1.683  4.448   1.00 0.00 ? 109 GLU A HB3  4  
ATOM 9092  H HG2  . GLU A 1 109 ? -20.569 -1.928  4.480   1.00 0.00 ? 109 GLU A HG2  4  
ATOM 9093  H HG3  . GLU A 1 109 ? -21.121 -3.587  4.689   1.00 0.00 ? 109 GLU A HG3  4  
ATOM 9094  H HE2  . GLU A 1 109 ? -21.118 -2.644  1.134   1.00 0.00 ? 109 GLU A HE2  4  
ATOM 9095  N N    . ILE A 1 110 ? -20.719 -1.952  7.788   1.00 0.00 ? 110 ILE A N    4  
ATOM 9096  C CA   . ILE A 1 110 ? -19.404 -2.294  8.391   1.00 0.00 ? 110 ILE A CA   4  
ATOM 9097  C C    . ILE A 1 110 ? -19.341 -3.802  8.607   1.00 0.00 ? 110 ILE A C    4  
ATOM 9098  O O    . ILE A 1 110 ? -19.978 -4.345  9.488   1.00 0.00 ? 110 ILE A O    4  
ATOM 9099  C CB   . ILE A 1 110 ? -19.238 -1.561  9.723   1.00 0.00 ? 110 ILE A CB   4  
ATOM 9100  C CG1  . ILE A 1 110 ? -19.117 -0.056  9.464   1.00 0.00 ? 110 ILE A CG1  4  
ATOM 9101  C CG2  . ILE A 1 110 ? -17.980 -2.064  10.437  1.00 0.00 ? 110 ILE A CG2  4  
ATOM 9102  C CD1  . ILE A 1 110 ? -17.908 0.220   8.563   1.00 0.00 ? 110 ILE A CD1  4  
ATOM 9103  H H    . ILE A 1 110 ? -21.543 -2.236  8.223   1.00 0.00 ? 110 ILE A H    4  
ATOM 9104  H HA   . ILE A 1 110 ? -18.613 -2.002  7.719   1.00 0.00 ? 110 ILE A HA   4  
ATOM 9105  H HB   . ILE A 1 110 ? -20.100 -1.748  10.346  1.00 0.00 ? 110 ILE A HB   4  
ATOM 9106  H HG12 . ILE A 1 110 ? -20.015 0.295   8.976   1.00 0.00 ? 110 ILE A HG12 4  
ATOM 9107  H HG13 . ILE A 1 110 ? -18.991 0.462   10.400  1.00 0.00 ? 110 ILE A HG13 4  
ATOM 9108  H HG21 . ILE A 1 110 ? -17.489 -1.238  10.928  1.00 0.00 ? 110 ILE A HG21 4  
ATOM 9109  H HG22 . ILE A 1 110 ? -17.310 -2.505  9.715   1.00 0.00 ? 110 ILE A HG22 4  
ATOM 9110  H HG23 . ILE A 1 110 ? -18.257 -2.808  11.171  1.00 0.00 ? 110 ILE A HG23 4  
ATOM 9111  H HD11 . ILE A 1 110 ? -17.171 -0.559  8.697   1.00 0.00 ? 110 ILE A HD11 4  
ATOM 9112  H HD12 . ILE A 1 110 ? -17.475 1.173   8.827   1.00 0.00 ? 110 ILE A HD12 4  
ATOM 9113  H HD13 . ILE A 1 110 ? -18.225 0.244   7.531   1.00 0.00 ? 110 ILE A HD13 4  
ATOM 9114  N N    . ARG A 1 111 ? -18.578 -4.486  7.806   1.00 0.00 ? 111 ARG A N    4  
ATOM 9115  C CA   . ARG A 1 111 ? -18.468 -5.960  7.955   1.00 0.00 ? 111 ARG A CA   4  
ATOM 9116  C C    . ARG A 1 111 ? -17.103 -6.279  8.556   1.00 0.00 ? 111 ARG A C    4  
ATOM 9117  O O    . ARG A 1 111 ? -16.078 -6.083  7.935   1.00 0.00 ? 111 ARG A O    4  
ATOM 9118  C CB   . ARG A 1 111 ? -18.597 -6.621  6.578   1.00 0.00 ? 111 ARG A CB   4  
ATOM 9119  C CG   . ARG A 1 111 ? -20.072 -6.687  6.156   1.00 0.00 ? 111 ARG A CG   4  
ATOM 9120  C CD   . ARG A 1 111 ? -20.813 -5.427  6.607   1.00 0.00 ? 111 ARG A CD   4  
ATOM 9121  N NE   . ARG A 1 111 ? -22.138 -5.362  5.928   1.00 0.00 ? 111 ARG A NE   4  
ATOM 9122  C CZ   . ARG A 1 111 ? -23.166 -5.979  6.445   1.00 0.00 ? 111 ARG A CZ   4  
ATOM 9123  N NH1  . ARG A 1 111 ? -23.033 -6.653  7.555   1.00 0.00 ? 111 ARG A NH1  4  
ATOM 9124  N NH2  . ARG A 1 111 ? -24.325 -5.924  5.850   1.00 0.00 ? 111 ARG A NH2  4  
ATOM 9125  H H    . ARG A 1 111 ? -18.073 -4.026  7.101   1.00 0.00 ? 111 ARG A H    4  
ATOM 9126  H HA   . ARG A 1 111 ? -19.245 -6.323  8.610   1.00 0.00 ? 111 ARG A HA   4  
ATOM 9127  H HB2  . ARG A 1 111 ? -18.043 -6.046  5.855   1.00 0.00 ? 111 ARG A HB2  4  
ATOM 9128  H HB3  . ARG A 1 111 ? -18.193 -7.619  6.619   1.00 0.00 ? 111 ARG A HB3  4  
ATOM 9129  H HG2  . ARG A 1 111 ? -20.133 -6.771  5.082   1.00 0.00 ? 111 ARG A HG2  4  
ATOM 9130  H HG3  . ARG A 1 111 ? -20.535 -7.550  6.606   1.00 0.00 ? 111 ARG A HG3  4  
ATOM 9131  H HD2  . ARG A 1 111 ? -20.964 -5.456  7.675   1.00 0.00 ? 111 ARG A HD2  4  
ATOM 9132  H HD3  . ARG A 1 111 ? -20.234 -4.555  6.349   1.00 0.00 ? 111 ARG A HD3  4  
ATOM 9133  H HE   . ARG A 1 111 ? -22.238 -4.858  5.095   1.00 0.00 ? 111 ARG A HE   4  
ATOM 9134  H HH11 . ARG A 1 111 ? -22.143 -6.696  8.010   1.00 0.00 ? 111 ARG A HH11 4  
ATOM 9135  H HH12 . ARG A 1 111 ? -23.821 -7.126  7.951   1.00 0.00 ? 111 ARG A HH12 4  
ATOM 9136  H HH21 . ARG A 1 111 ? -24.428 -5.408  5.000   1.00 0.00 ? 111 ARG A HH21 4  
ATOM 9137  H HH22 . ARG A 1 111 ? -25.113 -6.397  6.245   1.00 0.00 ? 111 ARG A HH22 4  
ATOM 9138  N N    . LEU A 1 112 ? -17.082 -6.751  9.767   1.00 0.00 ? 112 LEU A N    4  
ATOM 9139  C CA   . LEU A 1 112 ? -15.783 -7.060  10.413  1.00 0.00 ? 112 LEU A CA   4  
ATOM 9140  C C    . LEU A 1 112 ? -15.464 -8.544  10.237  1.00 0.00 ? 112 LEU A C    4  
ATOM 9141  O O    . LEU A 1 112 ? -16.314 -9.396  10.408  1.00 0.00 ? 112 LEU A O    4  
ATOM 9142  C CB   . LEU A 1 112 ? -15.868 -6.735  11.903  1.00 0.00 ? 112 LEU A CB   4  
ATOM 9143  C CG   . LEU A 1 112 ? -16.467 -5.339  12.095  1.00 0.00 ? 112 LEU A CG   4  
ATOM 9144  C CD1  . LEU A 1 112 ? -16.257 -4.894  13.544  1.00 0.00 ? 112 LEU A CD1  4  
ATOM 9145  C CD2  . LEU A 1 112 ? -15.790 -4.344  11.146  1.00 0.00 ? 112 LEU A CD2  4  
ATOM 9146  H H    . LEU A 1 112 ? -17.920 -6.889  10.257  1.00 0.00 ? 112 LEU A H    4  
ATOM 9147  H HA   . LEU A 1 112 ? -15.003 -6.468  9.958   1.00 0.00 ? 112 LEU A HA   4  
ATOM 9148  H HB2  . LEU A 1 112 ? -16.495 -7.466  12.394  1.00 0.00 ? 112 LEU A HB2  4  
ATOM 9149  H HB3  . LEU A 1 112 ? -14.881 -6.764  12.333  1.00 0.00 ? 112 LEU A HB3  4  
ATOM 9150  H HG   . LEU A 1 112 ? -17.526 -5.373  11.885  1.00 0.00 ? 112 LEU A HG   4  
ATOM 9151  H HD11 . LEU A 1 112 ? -17.214 -4.801  14.035  1.00 0.00 ? 112 LEU A HD11 4  
ATOM 9152  H HD12 . LEU A 1 112 ? -15.752 -3.941  13.559  1.00 0.00 ? 112 LEU A HD12 4  
ATOM 9153  H HD13 . LEU A 1 112 ? -15.657 -5.627  14.065  1.00 0.00 ? 112 LEU A HD13 4  
ATOM 9154  H HD21 . LEU A 1 112 ? -14.726 -4.531  11.126  1.00 0.00 ? 112 LEU A HD21 4  
ATOM 9155  H HD22 . LEU A 1 112 ? -15.971 -3.336  11.491  1.00 0.00 ? 112 LEU A HD22 4  
ATOM 9156  H HD23 . LEU A 1 112 ? -16.196 -4.459  10.150  1.00 0.00 ? 112 LEU A HD23 4  
ATOM 9157  N N    . SER A 1 113 ? -14.244 -8.858  9.911   1.00 0.00 ? 113 SER A N    4  
ATOM 9158  C CA   . SER A 1 113 ? -13.866 -10.286 9.739   1.00 0.00 ? 113 SER A CA   4  
ATOM 9159  C C    . SER A 1 113 ? -13.496 -10.864 11.105  1.00 0.00 ? 113 SER A C    4  
ATOM 9160  O O    . SER A 1 113 ? -13.430 -10.155 12.089  1.00 0.00 ? 113 SER A O    4  
ATOM 9161  C CB   . SER A 1 113 ? -12.669 -10.393 8.796   1.00 0.00 ? 113 SER A CB   4  
ATOM 9162  O OG   . SER A 1 113 ? -12.995 -9.781  7.554   1.00 0.00 ? 113 SER A OG   4  
ATOM 9163  H H    . SER A 1 113 ? -13.572 -8.156  9.786   1.00 0.00 ? 113 SER A H    4  
ATOM 9164  H HA   . SER A 1 113 ? -14.702 -10.836 9.329   1.00 0.00 ? 113 SER A HA   4  
ATOM 9165  H HB2  . SER A 1 113 ? -11.822 -9.889  9.228   1.00 0.00 ? 113 SER A HB2  4  
ATOM 9166  H HB3  . SER A 1 113 ? -12.425 -11.434 8.642   1.00 0.00 ? 113 SER A HB3  4  
ATOM 9167  H HG   . SER A 1 113 ? -12.840 -10.422 6.857   1.00 0.00 ? 113 SER A HG   4  
ATOM 9168  N N    . HIS A 1 114 ? -13.250 -12.141 11.178  1.00 0.00 ? 114 HIS A N    4  
ATOM 9169  C CA   . HIS A 1 114 ? -12.884 -12.745 12.487  1.00 0.00 ? 114 HIS A CA   4  
ATOM 9170  C C    . HIS A 1 114 ? -11.736 -11.942 13.106  1.00 0.00 ? 114 HIS A C    4  
ATOM 9171  O O    . HIS A 1 114 ? -11.631 -11.819 14.311  1.00 0.00 ? 114 HIS A O    4  
ATOM 9172  C CB   . HIS A 1 114 ? -12.441 -14.194 12.276  1.00 0.00 ? 114 HIS A CB   4  
ATOM 9173  C CG   . HIS A 1 114 ? -12.168 -14.833 13.610  1.00 0.00 ? 114 HIS A CG   4  
ATOM 9174  N ND1  . HIS A 1 114 ? -11.029 -14.545 14.349  1.00 0.00 ? 114 HIS A ND1  4  
ATOM 9175  C CD2  . HIS A 1 114 ? -12.878 -15.746 14.351  1.00 0.00 ? 114 HIS A CD2  4  
ATOM 9176  C CE1  . HIS A 1 114 ? -11.086 -15.272 15.482  1.00 0.00 ? 114 HIS A CE1  4  
ATOM 9177  N NE2  . HIS A 1 114 ? -12.191 -16.018 15.529  1.00 0.00 ? 114 HIS A NE2  4  
ATOM 9178  H H    . HIS A 1 114 ? -13.308 -12.701 10.376  1.00 0.00 ? 114 HIS A H    4  
ATOM 9179  H HA   . HIS A 1 114 ? -13.739 -12.722 13.148  1.00 0.00 ? 114 HIS A HA   4  
ATOM 9180  H HB2  . HIS A 1 114 ? -13.224 -14.739 11.768  1.00 0.00 ? 114 HIS A HB2  4  
ATOM 9181  H HB3  . HIS A 1 114 ? -11.542 -14.214 11.679  1.00 0.00 ? 114 HIS A HB3  4  
ATOM 9182  H HD1  . HIS A 1 114 ? -10.314 -13.928 14.095  1.00 0.00 ? 114 HIS A HD1  4  
ATOM 9183  H HD2  . HIS A 1 114 ? -13.822 -16.182 14.064  1.00 0.00 ? 114 HIS A HD2  4  
ATOM 9184  H HE1  . HIS A 1 114 ? -10.333 -15.253 16.255  1.00 0.00 ? 114 HIS A HE1  4  
ATOM 9185  H HE2  . HIS A 1 114 ? -12.461 -16.629 16.246  1.00 0.00 ? 114 HIS A HE2  4  
ATOM 9186  N N    . GLU A 1 115 ? -10.873 -11.401 12.290  1.00 0.00 ? 115 GLU A N    4  
ATOM 9187  C CA   . GLU A 1 115 ? -9.730  -10.611 12.828  1.00 0.00 ? 115 GLU A CA   4  
ATOM 9188  C C    . GLU A 1 115 ? -10.254 -9.402  13.614  1.00 0.00 ? 115 GLU A C    4  
ATOM 9189  O O    . GLU A 1 115 ? -9.668  -8.993  14.595  1.00 0.00 ? 115 GLU A O    4  
ATOM 9190  C CB   . GLU A 1 115 ? -8.864  -10.117 11.665  1.00 0.00 ? 115 GLU A CB   4  
ATOM 9191  C CG   . GLU A 1 115 ? -8.239  -11.316 10.950  1.00 0.00 ? 115 GLU A CG   4  
ATOM 9192  C CD   . GLU A 1 115 ? -7.311  -12.061 11.909  1.00 0.00 ? 115 GLU A CD   4  
ATOM 9193  O OE1  . GLU A 1 115 ? -6.988  -13.203 11.623  1.00 0.00 ? 115 GLU A OE1  4  
ATOM 9194  O OE2  . GLU A 1 115 ? -6.935  -11.479 12.913  1.00 0.00 ? 115 GLU A OE2  4  
ATOM 9195  H H    . GLU A 1 115 ? -10.976 -11.515 11.323  1.00 0.00 ? 115 GLU A H    4  
ATOM 9196  H HA   . GLU A 1 115 ? -9.136  -11.233 13.479  1.00 0.00 ? 115 GLU A HA   4  
ATOM 9197  H HB2  . GLU A 1 115 ? -9.476  -9.561  10.972  1.00 0.00 ? 115 GLU A HB2  4  
ATOM 9198  H HB3  . GLU A 1 115 ? -8.080  -9.479  12.047  1.00 0.00 ? 115 GLU A HB3  4  
ATOM 9199  H HG2  . GLU A 1 115 ? -9.020  -11.981 10.613  1.00 0.00 ? 115 GLU A HG2  4  
ATOM 9200  H HG3  . GLU A 1 115 ? -7.670  -10.970 10.099  1.00 0.00 ? 115 GLU A HG3  4  
ATOM 9201  H HE2  . GLU A 1 115 ? -6.356  -12.007 13.467  1.00 0.00 ? 115 GLU A HE2  4  
ATOM 9202  N N    . HIS A 1 116 ? -11.348 -8.828  13.189  1.00 0.00 ? 116 HIS A N    4  
ATOM 9203  C CA   . HIS A 1 116 ? -11.901 -7.647  13.915  1.00 0.00 ? 116 HIS A CA   4  
ATOM 9204  C C    . HIS A 1 116 ? -13.264 -8.006  14.508  1.00 0.00 ? 116 HIS A C    4  
ATOM 9205  O O    . HIS A 1 116 ? -14.045 -8.716  13.904  1.00 0.00 ? 116 HIS A O    4  
ATOM 9206  C CB   . HIS A 1 116 ? -12.054 -6.478  12.940  1.00 0.00 ? 116 HIS A CB   4  
ATOM 9207  C CG   . HIS A 1 116 ? -10.697 -6.057  12.449  1.00 0.00 ? 116 HIS A CG   4  
ATOM 9208  N ND1  . HIS A 1 116 ? -10.207 -6.439  11.206  1.00 0.00 ? 116 HIS A ND1  4  
ATOM 9209  C CD2  . HIS A 1 116 ? -9.708  -5.293  13.022  1.00 0.00 ? 116 HIS A CD2  4  
ATOM 9210  C CE1  . HIS A 1 116 ? -8.978  -5.910  11.074  1.00 0.00 ? 116 HIS A CE1  4  
ATOM 9211  N NE2  . HIS A 1 116 ? -8.629  -5.204  12.152  1.00 0.00 ? 116 HIS A NE2  4  
ATOM 9212  H H    . HIS A 1 116 ? -11.805 -9.172  12.393  1.00 0.00 ? 116 HIS A H    4  
ATOM 9213  H HA   . HIS A 1 116 ? -11.227 -7.365  14.708  1.00 0.00 ? 116 HIS A HA   4  
ATOM 9214  H HB2  . HIS A 1 116 ? -12.660 -6.787  12.099  1.00 0.00 ? 116 HIS A HB2  4  
ATOM 9215  H HB3  . HIS A 1 116 ? -12.529 -5.649  13.442  1.00 0.00 ? 116 HIS A HB3  4  
ATOM 9216  H HD1  . HIS A 1 116 ? -10.674 -6.993  10.547  1.00 0.00 ? 116 HIS A HD1  4  
ATOM 9217  H HD2  . HIS A 1 116 ? -9.764  -4.833  13.997  1.00 0.00 ? 116 HIS A HD2  4  
ATOM 9218  H HE1  . HIS A 1 116 ? -8.349  -6.040  10.205  1.00 0.00 ? 116 HIS A HE1  4  
ATOM 9219  H HE2  . HIS A 1 116 ? -7.786  -4.724  12.300  1.00 0.00 ? 116 HIS A HE2  4  
ATOM 9220  N N    . GLN A 1 117 ? -13.554 -7.532  15.691  1.00 0.00 ? 117 GLN A N    4  
ATOM 9221  C CA   . GLN A 1 117 ? -14.862 -7.863  16.325  1.00 0.00 ? 117 GLN A CA   4  
ATOM 9222  C C    . GLN A 1 117 ? -15.712 -6.598  16.500  1.00 0.00 ? 117 GLN A C    4  
ATOM 9223  O O    . GLN A 1 117 ? -16.919 -6.671  16.617  1.00 0.00 ? 117 GLN A O    4  
ATOM 9224  C CB   . GLN A 1 117 ? -14.611 -8.494  17.695  1.00 0.00 ? 117 GLN A CB   4  
ATOM 9225  C CG   . GLN A 1 117 ? -13.819 -7.521  18.571  1.00 0.00 ? 117 GLN A CG   4  
ATOM 9226  C CD   . GLN A 1 117 ? -13.585 -8.147  19.947  1.00 0.00 ? 117 GLN A CD   4  
ATOM 9227  O OE1  . GLN A 1 117 ? -13.958 -9.278  20.184  1.00 0.00 ? 117 GLN A OE1  4  
ATOM 9228  N NE2  . GLN A 1 117 ? -12.978 -7.453  20.872  1.00 0.00 ? 117 GLN A NE2  4  
ATOM 9229  H H    . GLN A 1 117 ? -12.907 -6.970  16.164  1.00 0.00 ? 117 GLN A H    4  
ATOM 9230  H HA   . GLN A 1 117 ? -15.394 -8.567  15.703  1.00 0.00 ? 117 GLN A HA   4  
ATOM 9231  H HB2  . GLN A 1 117 ? -15.556 -8.716  18.167  1.00 0.00 ? 117 GLN A HB2  4  
ATOM 9232  H HB3  . GLN A 1 117 ? -14.045 -9.405  17.574  1.00 0.00 ? 117 GLN A HB3  4  
ATOM 9233  H HG2  . GLN A 1 117 ? -12.868 -7.308  18.106  1.00 0.00 ? 117 GLN A HG2  4  
ATOM 9234  H HG3  . GLN A 1 117 ? -14.378 -6.603  18.685  1.00 0.00 ? 117 GLN A HG3  4  
ATOM 9235  H HE21 . GLN A 1 117 ? -12.679 -6.540  20.681  1.00 0.00 ? 117 GLN A HE21 4  
ATOM 9236  H HE22 . GLN A 1 117 ? -12.823 -7.847  21.756  1.00 0.00 ? 117 GLN A HE22 4  
ATOM 9237  N N    . ALA A 1 118 ? -15.104 -5.444  16.532  1.00 0.00 ? 118 ALA A N    4  
ATOM 9238  C CA   . ALA A 1 118 ? -15.908 -4.199  16.714  1.00 0.00 ? 118 ALA A CA   4  
ATOM 9239  C C    . ALA A 1 118 ? -15.203 -3.008  16.061  1.00 0.00 ? 118 ALA A C    4  
ATOM 9240  O O    . ALA A 1 118 ? -14.005 -3.015  15.859  1.00 0.00 ? 118 ALA A O    4  
ATOM 9241  C CB   . ALA A 1 118 ? -16.084 -3.925  18.209  1.00 0.00 ? 118 ALA A CB   4  
ATOM 9242  H H    . ALA A 1 118 ? -14.129 -5.393  16.445  1.00 0.00 ? 118 ALA A H    4  
ATOM 9243  H HA   . ALA A 1 118 ? -16.879 -4.332  16.259  1.00 0.00 ? 118 ALA A HA   4  
ATOM 9244  H HB1  . ALA A 1 118 ? -16.027 -2.863  18.389  1.00 0.00 ? 118 ALA A HB1  4  
ATOM 9245  H HB2  . ALA A 1 118 ? -15.305 -4.427  18.760  1.00 0.00 ? 118 ALA A HB2  4  
ATOM 9246  H HB3  . ALA A 1 118 ? -17.047 -4.292  18.529  1.00 0.00 ? 118 ALA A HB3  4  
ATOM 9247  N N    . TYR A 1 119 ? -15.944 -1.982  15.736  1.00 0.00 ? 119 TYR A N    4  
ATOM 9248  C CA   . TYR A 1 119 ? -15.331 -0.779  15.103  1.00 0.00 ? 119 TYR A CA   4  
ATOM 9249  C C    . TYR A 1 119 ? -15.960 0.485   15.693  1.00 0.00 ? 119 TYR A C    4  
ATOM 9250  O O    . TYR A 1 119 ? -17.050 0.454   16.228  1.00 0.00 ? 119 TYR A O    4  
ATOM 9251  C CB   . TYR A 1 119 ? -15.591 -0.813  13.598  1.00 0.00 ? 119 TYR A CB   4  
ATOM 9252  C CG   . TYR A 1 119 ? -17.056 -0.554  13.343  1.00 0.00 ? 119 TYR A CG   4  
ATOM 9253  C CD1  . TYR A 1 119 ? -17.970 -1.612  13.390  1.00 0.00 ? 119 TYR A CD1  4  
ATOM 9254  C CD2  . TYR A 1 119 ? -17.501 0.744   13.063  1.00 0.00 ? 119 TYR A CD2  4  
ATOM 9255  C CE1  . TYR A 1 119 ? -19.329 -1.375  13.156  1.00 0.00 ? 119 TYR A CE1  4  
ATOM 9256  C CE2  . TYR A 1 119 ? -18.860 0.980   12.828  1.00 0.00 ? 119 TYR A CE2  4  
ATOM 9257  C CZ   . TYR A 1 119 ? -19.774 -0.078  12.876  1.00 0.00 ? 119 TYR A CZ   4  
ATOM 9258  O OH   . TYR A 1 119 ? -21.115 0.157   12.645  1.00 0.00 ? 119 TYR A OH   4  
ATOM 9259  H H    . TYR A 1 119 ? -16.906 -2.001  15.913  1.00 0.00 ? 119 TYR A H    4  
ATOM 9260  H HA   . TYR A 1 119 ? -14.268 -0.777  15.285  1.00 0.00 ? 119 TYR A HA   4  
ATOM 9261  H HB2  . TYR A 1 119 ? -15.001 -0.048  13.114  1.00 0.00 ? 119 TYR A HB2  4  
ATOM 9262  H HB3  . TYR A 1 119 ? -15.324 -1.780  13.204  1.00 0.00 ? 119 TYR A HB3  4  
ATOM 9263  H HD1  . TYR A 1 119 ? -17.627 -2.612  13.607  1.00 0.00 ? 119 TYR A HD1  4  
ATOM 9264  H HD2  . TYR A 1 119 ? -16.795 1.562   13.025  1.00 0.00 ? 119 TYR A HD2  4  
ATOM 9265  H HE1  . TYR A 1 119 ? -20.033 -2.193  13.191  1.00 0.00 ? 119 TYR A HE1  4  
ATOM 9266  H HE2  . TYR A 1 119 ? -19.205 1.979   12.610  1.00 0.00 ? 119 TYR A HE2  4  
ATOM 9267  H HH   . TYR A 1 119 ? -21.409 0.830   13.262  1.00 0.00 ? 119 TYR A HH   4  
ATOM 9268  N N    . ARG A 1 120 ? -15.288 1.601   15.590  1.00 0.00 ? 120 ARG A N    4  
ATOM 9269  C CA   . ARG A 1 120 ? -15.861 2.867   16.135  1.00 0.00 ? 120 ARG A CA   4  
ATOM 9270  C C    . ARG A 1 120 ? -15.527 4.034   15.205  1.00 0.00 ? 120 ARG A C    4  
ATOM 9271  O O    . ARG A 1 120 ? -14.496 4.059   14.565  1.00 0.00 ? 120 ARG A O    4  
ATOM 9272  C CB   . ARG A 1 120 ? -15.262 3.168   17.511  1.00 0.00 ? 120 ARG A CB   4  
ATOM 9273  C CG   . ARG A 1 120 ? -15.705 2.118   18.529  1.00 0.00 ? 120 ARG A CG   4  
ATOM 9274  C CD   . ARG A 1 120 ? -15.187 2.514   19.912  1.00 0.00 ? 120 ARG A CD   4  
ATOM 9275  N NE   . ARG A 1 120 ? -15.381 1.386   20.865  1.00 0.00 ? 120 ARG A NE   4  
ATOM 9276  C CZ   . ARG A 1 120 ? -14.777 1.402   22.022  1.00 0.00 ? 120 ARG A CZ   4  
ATOM 9277  N NH1  . ARG A 1 120 ? -14.009 2.407   22.342  1.00 0.00 ? 120 ARG A NH1  4  
ATOM 9278  N NH2  . ARG A 1 120 ? -14.942 0.415   22.858  1.00 0.00 ? 120 ARG A NH2  4  
ATOM 9279  H H    . ARG A 1 120 ? -14.414 1.609   15.146  1.00 0.00 ? 120 ARG A H    4  
ATOM 9280  H HA   . ARG A 1 120 ? -16.932 2.770   16.223  1.00 0.00 ? 120 ARG A HA   4  
ATOM 9281  H HB2  . ARG A 1 120 ? -14.185 3.165   17.437  1.00 0.00 ? 120 ARG A HB2  4  
ATOM 9282  H HB3  . ARG A 1 120 ? -15.594 4.143   17.838  1.00 0.00 ? 120 ARG A HB3  4  
ATOM 9283  H HG2  . ARG A 1 120 ? -16.784 2.067   18.547  1.00 0.00 ? 120 ARG A HG2  4  
ATOM 9284  H HG3  . ARG A 1 120 ? -15.302 1.157   18.257  1.00 0.00 ? 120 ARG A HG3  4  
ATOM 9285  H HD2  . ARG A 1 120 ? -14.134 2.752   19.847  1.00 0.00 ? 120 ARG A HD2  4  
ATOM 9286  H HD3  . ARG A 1 120 ? -15.728 3.380   20.264  1.00 0.00 ? 120 ARG A HD3  4  
ATOM 9287  H HE   . ARG A 1 120 ? -15.960 0.633   20.623  1.00 0.00 ? 120 ARG A HE   4  
ATOM 9288  H HH11 . ARG A 1 120 ? -13.883 3.164   21.700  1.00 0.00 ? 120 ARG A HH11 4  
ATOM 9289  H HH12 . ARG A 1 120 ? -13.545 2.421   23.228  1.00 0.00 ? 120 ARG A HH12 4  
ATOM 9290  H HH21 . ARG A 1 120 ? -15.531 -0.355  22.613  1.00 0.00 ? 120 ARG A HH21 4  
ATOM 9291  H HH22 . ARG A 1 120 ? -14.479 0.427   23.744  1.00 0.00 ? 120 ARG A HH22 4  
ATOM 9292  N N    . TRP A 1 121 ? -16.382 5.016   15.161  1.00 0.00 ? 121 TRP A N    4  
ATOM 9293  C CA   . TRP A 1 121 ? -16.108 6.211   14.313  1.00 0.00 ? 121 TRP A CA   4  
ATOM 9294  C C    . TRP A 1 121 ? -15.758 7.372   15.242  1.00 0.00 ? 121 TRP A C    4  
ATOM 9295  O O    . TRP A 1 121 ? -16.604 7.891   15.942  1.00 0.00 ? 121 TRP A O    4  
ATOM 9296  C CB   . TRP A 1 121 ? -17.353 6.557   13.492  1.00 0.00 ? 121 TRP A CB   4  
ATOM 9297  C CG   . TRP A 1 121 ? -17.444 5.636   12.321  1.00 0.00 ? 121 TRP A CG   4  
ATOM 9298  C CD1  . TRP A 1 121 ? -18.169 4.494   12.281  1.00 0.00 ? 121 TRP A CD1  4  
ATOM 9299  C CD2  . TRP A 1 121 ? -16.805 5.761   11.021  1.00 0.00 ? 121 TRP A CD2  4  
ATOM 9300  N NE1  . TRP A 1 121 ? -18.011 3.907   11.037  1.00 0.00 ? 121 TRP A NE1  4  
ATOM 9301  C CE2  . TRP A 1 121 ? -17.180 4.655   10.223  1.00 0.00 ? 121 TRP A CE2  4  
ATOM 9302  C CE3  . TRP A 1 121 ? -15.944 6.722   10.461  1.00 0.00 ? 121 TRP A CE3  4  
ATOM 9303  C CZ2  . TRP A 1 121 ? -16.716 4.509   8.916   1.00 0.00 ? 121 TRP A CZ2  4  
ATOM 9304  C CZ3  . TRP A 1 121 ? -15.475 6.577   9.147   1.00 0.00 ? 121 TRP A CZ3  4  
ATOM 9305  C CH2  . TRP A 1 121 ? -15.861 5.473   8.377   1.00 0.00 ? 121 TRP A CH2  4  
ATOM 9306  H H    . TRP A 1 121 ? -17.190 4.982   15.712  1.00 0.00 ? 121 TRP A H    4  
ATOM 9307  H HA   . TRP A 1 121 ? -15.278 6.007   13.654  1.00 0.00 ? 121 TRP A HA   4  
ATOM 9308  H HB2  . TRP A 1 121 ? -18.232 6.447   14.108  1.00 0.00 ? 121 TRP A HB2  4  
ATOM 9309  H HB3  . TRP A 1 121 ? -17.281 7.577   13.146  1.00 0.00 ? 121 TRP A HB3  4  
ATOM 9310  H HD1  . TRP A 1 121 ? -18.769 4.104   13.090  1.00 0.00 ? 121 TRP A HD1  4  
ATOM 9311  H HE1  . TRP A 1 121 ? -18.431 3.066   10.749  1.00 0.00 ? 121 TRP A HE1  4  
ATOM 9312  H HE3  . TRP A 1 121 ? -15.641 7.576   11.049  1.00 0.00 ? 121 TRP A HE3  4  
ATOM 9313  H HZ2  . TRP A 1 121 ? -17.012 3.657   8.323   1.00 0.00 ? 121 TRP A HZ2  4  
ATOM 9314  H HZ3  . TRP A 1 121 ? -14.814 7.321   8.727   1.00 0.00 ? 121 TRP A HZ3  4  
ATOM 9315  H HH2  . TRP A 1 121 ? -15.497 5.367   7.369   1.00 0.00 ? 121 TRP A HH2  4  
ATOM 9316  N N    . LEU A 1 122 ? -14.513 7.764   15.278  1.00 0.00 ? 122 LEU A N    4  
ATOM 9317  C CA   . LEU A 1 122 ? -14.115 8.870   16.196  1.00 0.00 ? 122 LEU A CA   4  
ATOM 9318  C C    . LEU A 1 122 ? -13.336 9.939   15.430  1.00 0.00 ? 122 LEU A C    4  
ATOM 9319  O O    . LEU A 1 122 ? -13.005 9.775   14.273  1.00 0.00 ? 122 LEU A O    4  
ATOM 9320  C CB   . LEU A 1 122 ? -13.230 8.319   17.319  1.00 0.00 ? 122 LEU A CB   4  
ATOM 9321  C CG   . LEU A 1 122 ? -13.563 6.846   17.590  1.00 0.00 ? 122 LEU A CG   4  
ATOM 9322  C CD1  . LEU A 1 122 ? -12.441 5.958   17.048  1.00 0.00 ? 122 LEU A CD1  4  
ATOM 9323  C CD2  . LEU A 1 122 ? -13.712 6.620   19.097  1.00 0.00 ? 122 LEU A CD2  4  
ATOM 9324  H H    . LEU A 1 122 ? -13.839 7.319   14.724  1.00 0.00 ? 122 LEU A H    4  
ATOM 9325  H HA   . LEU A 1 122 ? -14.999 9.316   16.626  1.00 0.00 ? 122 LEU A HA   4  
ATOM 9326  H HB2  . LEU A 1 122 ? -12.191 8.409   17.028  1.00 0.00 ? 122 LEU A HB2  4  
ATOM 9327  H HB3  . LEU A 1 122 ? -13.401 8.893   18.217  1.00 0.00 ? 122 LEU A HB3  4  
ATOM 9328  H HG   . LEU A 1 122 ? -14.487 6.585   17.102  1.00 0.00 ? 122 LEU A HG   4  
ATOM 9329  H HD11 . LEU A 1 122 ? -12.553 4.958   17.439  1.00 0.00 ? 122 LEU A HD11 4  
ATOM 9330  H HD12 . LEU A 1 122 ? -11.486 6.360   17.347  1.00 0.00 ? 122 LEU A HD12 4  
ATOM 9331  H HD13 . LEU A 1 122 ? -12.495 5.930   15.969  1.00 0.00 ? 122 LEU A HD13 4  
ATOM 9332  H HD21 . LEU A 1 122 ? -14.435 7.318   19.495  1.00 0.00 ? 122 LEU A HD21 4  
ATOM 9333  H HD22 . LEU A 1 122 ? -12.762 6.771   19.583  1.00 0.00 ? 122 LEU A HD22 4  
ATOM 9334  H HD23 . LEU A 1 122 ? -14.052 5.610   19.278  1.00 0.00 ? 122 LEU A HD23 4  
ATOM 9335  N N    . GLY A 1 123 ? -13.035 11.031  16.079  1.00 0.00 ? 123 GLY A N    4  
ATOM 9336  C CA   . GLY A 1 123 ? -12.274 12.120  15.406  1.00 0.00 ? 123 GLY A CA   4  
ATOM 9337  C C    . GLY A 1 123 ? -10.781 11.794  15.453  1.00 0.00 ? 123 GLY A C    4  
ATOM 9338  O O    . GLY A 1 123 ? -10.374 10.768  15.961  1.00 0.00 ? 123 GLY A O    4  
ATOM 9339  H H    . GLY A 1 123 ? -13.310 11.133  17.014  1.00 0.00 ? 123 GLY A H    4  
ATOM 9340  H HA2  . GLY A 1 123 ? -12.595 12.204  14.378  1.00 0.00 ? 123 GLY A HA2  4  
ATOM 9341  H HA3  . GLY A 1 123 ? -12.451 13.053  15.918  1.00 0.00 ? 123 GLY A HA3  4  
ATOM 9342  N N    . LEU A 1 124 ? -9.961  12.659  14.926  1.00 0.00 ? 124 LEU A N    4  
ATOM 9343  C CA   . LEU A 1 124 ? -8.496  12.398  14.939  1.00 0.00 ? 124 LEU A CA   4  
ATOM 9344  C C    . LEU A 1 124 ? -8.003  12.233  16.377  1.00 0.00 ? 124 LEU A C    4  
ATOM 9345  O O    . LEU A 1 124 ? -7.165  11.404  16.663  1.00 0.00 ? 124 LEU A O    4  
ATOM 9346  C CB   . LEU A 1 124 ? -7.766  13.574  14.286  1.00 0.00 ? 124 LEU A CB   4  
ATOM 9347  C CG   . LEU A 1 124 ? -6.254  13.351  14.353  1.00 0.00 ? 124 LEU A CG   4  
ATOM 9348  C CD1  . LEU A 1 124 ? -5.910  11.959  13.823  1.00 0.00 ? 124 LEU A CD1  4  
ATOM 9349  C CD2  . LEU A 1 124 ? -5.553  14.403  13.495  1.00 0.00 ? 124 LEU A CD2  4  
ATOM 9350  H H    . LEU A 1 124 ? -10.309 13.480  14.520  1.00 0.00 ? 124 LEU A H    4  
ATOM 9351  H HA   . LEU A 1 124 ? -8.292  11.496  14.384  1.00 0.00 ? 124 LEU A HA   4  
ATOM 9352  H HB2  . LEU A 1 124 ? -8.072  13.659  13.254  1.00 0.00 ? 124 LEU A HB2  4  
ATOM 9353  H HB3  . LEU A 1 124 ? -8.017  14.484  14.809  1.00 0.00 ? 124 LEU A HB3  4  
ATOM 9354  H HG   . LEU A 1 124 ? -5.922  13.440  15.378  1.00 0.00 ? 124 LEU A HG   4  
ATOM 9355  H HD11 . LEU A 1 124 ? -6.083  11.227  14.599  1.00 0.00 ? 124 LEU A HD11 4  
ATOM 9356  H HD12 . LEU A 1 124 ? -4.871  11.935  13.529  1.00 0.00 ? 124 LEU A HD12 4  
ATOM 9357  H HD13 . LEU A 1 124 ? -6.532  11.735  12.970  1.00 0.00 ? 124 LEU A HD13 4  
ATOM 9358  H HD21 . LEU A 1 124 ? -5.596  14.106  12.458  1.00 0.00 ? 124 LEU A HD21 4  
ATOM 9359  H HD22 . LEU A 1 124 ? -4.521  14.489  13.802  1.00 0.00 ? 124 LEU A HD22 4  
ATOM 9360  H HD23 . LEU A 1 124 ? -6.045  15.356  13.617  1.00 0.00 ? 124 LEU A HD23 4  
ATOM 9361  N N    . GLU A 1 125 ? -8.509  13.024  17.281  1.00 0.00 ? 125 GLU A N    4  
ATOM 9362  C CA   . GLU A 1 125 ? -8.058  12.928  18.703  1.00 0.00 ? 125 GLU A CA   4  
ATOM 9363  C C    . GLU A 1 125 ? -8.306  11.519  19.246  1.00 0.00 ? 125 GLU A C    4  
ATOM 9364  O O    . GLU A 1 125 ? -7.410  10.875  19.756  1.00 0.00 ? 125 GLU A O    4  
ATOM 9365  C CB   . GLU A 1 125 ? -8.834  13.942  19.548  1.00 0.00 ? 125 GLU A CB   4  
ATOM 9366  C CG   . GLU A 1 125 ? -10.320 13.560  19.593  1.00 0.00 ? 125 GLU A CG   4  
ATOM 9367  C CD   . GLU A 1 125 ? -11.115 14.687  20.254  1.00 0.00 ? 125 GLU A CD   4  
ATOM 9368  O OE1  . GLU A 1 125 ? -12.330 14.597  20.272  1.00 0.00 ? 125 GLU A OE1  4  
ATOM 9369  O OE2  . GLU A 1 125 ? -10.493 15.622  20.733  1.00 0.00 ? 125 GLU A OE2  4  
ATOM 9370  H H    . GLU A 1 125 ? -9.176  13.692  17.024  1.00 0.00 ? 125 GLU A H    4  
ATOM 9371  H HA   . GLU A 1 125 ? -7.004  13.150  18.759  1.00 0.00 ? 125 GLU A HA   4  
ATOM 9372  H HB2  . GLU A 1 125 ? -8.435  13.952  20.552  1.00 0.00 ? 125 GLU A HB2  4  
ATOM 9373  H HB3  . GLU A 1 125 ? -8.733  14.925  19.111  1.00 0.00 ? 125 GLU A HB3  4  
ATOM 9374  H HG2  . GLU A 1 125 ? -10.681 13.404  18.588  1.00 0.00 ? 125 GLU A HG2  4  
ATOM 9375  H HG3  . GLU A 1 125 ? -10.447 12.652  20.168  1.00 0.00 ? 125 GLU A HG3  4  
ATOM 9376  H HE2  . GLU A 1 125 ? -11.055 16.291  21.131  1.00 0.00 ? 125 GLU A HE2  4  
ATOM 9377  N N    . GLU A 1 126 ? -9.508  11.033  19.144  1.00 0.00 ? 126 GLU A N    4  
ATOM 9378  C CA   . GLU A 1 126 ? -9.805  9.669   19.658  1.00 0.00 ? 126 GLU A CA   4  
ATOM 9379  C C    . GLU A 1 126 ? -9.165  8.636   18.742  1.00 0.00 ? 126 GLU A C    4  
ATOM 9380  O O    . GLU A 1 126 ? -8.560  7.682   19.187  1.00 0.00 ? 126 GLU A O    4  
ATOM 9381  C CB   . GLU A 1 126 ? -11.315 9.461   19.678  1.00 0.00 ? 126 GLU A CB   4  
ATOM 9382  C CG   . GLU A 1 126 ? -11.841 9.592   21.107  1.00 0.00 ? 126 GLU A CG   4  
ATOM 9383  C CD   . GLU A 1 126 ? -11.248 10.832  21.779  1.00 0.00 ? 126 GLU A CD   4  
ATOM 9384  O OE1  . GLU A 1 126 ? -10.202 10.706  22.395  1.00 0.00 ? 126 GLU A OE1  4  
ATOM 9385  O OE2  . GLU A 1 126 ? -11.858 11.883  21.680  1.00 0.00 ? 126 GLU A OE2  4  
ATOM 9386  H H    . GLU A 1 126 ? -10.219 11.566  18.730  1.00 0.00 ? 126 GLU A H    4  
ATOM 9387  H HA   . GLU A 1 126 ? -9.407  9.558   20.658  1.00 0.00 ? 126 GLU A HA   4  
ATOM 9388  H HB2  . GLU A 1 126 ? -11.785 10.203  19.052  1.00 0.00 ? 126 GLU A HB2  4  
ATOM 9389  H HB3  . GLU A 1 126 ? -11.541 8.478   19.302  1.00 0.00 ? 126 GLU A HB3  4  
ATOM 9390  H HG2  . GLU A 1 126 ? -12.914 9.686   21.078  1.00 0.00 ? 126 GLU A HG2  4  
ATOM 9391  H HG3  . GLU A 1 126 ? -11.571 8.711   21.672  1.00 0.00 ? 126 GLU A HG3  4  
ATOM 9392  H HE2  . GLU A 1 126 ? -11.431 12.616  22.128  1.00 0.00 ? 126 GLU A HE2  4  
ATOM 9393  N N    . ALA A 1 127 ? -9.271  8.817   17.462  1.00 0.00 ? 127 ALA A N    4  
ATOM 9394  C CA   . ALA A 1 127 ? -8.644  7.843   16.544  1.00 0.00 ? 127 ALA A CA   4  
ATOM 9395  C C    . ALA A 1 127 ? -7.164  7.768   16.902  1.00 0.00 ? 127 ALA A C    4  
ATOM 9396  O O    . ALA A 1 127 ? -6.536  6.732   16.818  1.00 0.00 ? 127 ALA A O    4  
ATOM 9397  C CB   . ALA A 1 127 ? -8.823  8.324   15.107  1.00 0.00 ? 127 ALA A CB   4  
ATOM 9398  H H    . ALA A 1 127 ? -9.748  9.597   17.110  1.00 0.00 ? 127 ALA A H    4  
ATOM 9399  H HA   . ALA A 1 127 ? -9.101  6.872   16.668  1.00 0.00 ? 127 ALA A HA   4  
ATOM 9400  H HB1  . ALA A 1 127 ? -8.618  7.511   14.425  1.00 0.00 ? 127 ALA A HB1  4  
ATOM 9401  H HB2  . ALA A 1 127 ? -8.138  9.138   14.914  1.00 0.00 ? 127 ALA A HB2  4  
ATOM 9402  H HB3  . ALA A 1 127 ? -9.840  8.665   14.971  1.00 0.00 ? 127 ALA A HB3  4  
ATOM 9403  N N    . CYS A 1 128 ? -6.617  8.869   17.336  1.00 0.00 ? 128 CYS A N    4  
ATOM 9404  C CA   . CYS A 1 128 ? -5.188  8.898   17.747  1.00 0.00 ? 128 CYS A CA   4  
ATOM 9405  C C    . CYS A 1 128 ? -5.063  8.264   19.133  1.00 0.00 ? 128 CYS A C    4  
ATOM 9406  O O    . CYS A 1 128 ? -4.113  7.563   19.424  1.00 0.00 ? 128 CYS A O    4  
ATOM 9407  C CB   . CYS A 1 128 ? -4.720  10.353  17.802  1.00 0.00 ? 128 CYS A CB   4  
ATOM 9408  S SG   . CYS A 1 128 ? -4.035  10.832  16.197  1.00 0.00 ? 128 CYS A SG   4  
ATOM 9409  H H    . CYS A 1 128 ? -7.159  9.682   17.412  1.00 0.00 ? 128 CYS A H    4  
ATOM 9410  H HA   . CYS A 1 128 ? -4.585  8.346   17.038  1.00 0.00 ? 128 CYS A HA   4  
ATOM 9411  H HB2  . CYS A 1 128 ? -5.558  10.989  18.039  1.00 0.00 ? 128 CYS A HB2  4  
ATOM 9412  H HB3  . CYS A 1 128 ? -3.968  10.461  18.561  1.00 0.00 ? 128 CYS A HB3  4  
ATOM 9413  H HG   . CYS A 1 128 ? -3.149  11.168  16.342  1.00 0.00 ? 128 CYS A HG   4  
ATOM 9414  N N    . GLN A 1 129 ? -6.017  8.507   19.993  1.00 0.00 ? 129 GLN A N    4  
ATOM 9415  C CA   . GLN A 1 129 ? -5.957  7.924   21.361  1.00 0.00 ? 129 GLN A CA   4  
ATOM 9416  C C    . GLN A 1 129 ? -6.078  6.400   21.278  1.00 0.00 ? 129 GLN A C    4  
ATOM 9417  O O    . GLN A 1 129 ? -5.304  5.674   21.870  1.00 0.00 ? 129 GLN A O    4  
ATOM 9418  C CB   . GLN A 1 129 ? -7.087  8.521   22.215  1.00 0.00 ? 129 GLN A CB   4  
ATOM 9419  C CG   . GLN A 1 129 ? -8.335  7.638   22.186  1.00 0.00 ? 129 GLN A CG   4  
ATOM 9420  C CD   . GLN A 1 129 ? -8.150  6.446   23.124  1.00 0.00 ? 129 GLN A CD   4  
ATOM 9421  O OE1  . GLN A 1 129 ? -7.068  6.214   23.629  1.00 0.00 ? 129 GLN A OE1  4  
ATOM 9422  N NE2  . GLN A 1 129 ? -9.170  5.676   23.390  1.00 0.00 ? 129 GLN A NE2  4  
ATOM 9423  H H    . GLN A 1 129 ? -6.773  9.076   19.736  1.00 0.00 ? 129 GLN A H    4  
ATOM 9424  H HA   . GLN A 1 129 ? -5.005  8.176   21.807  1.00 0.00 ? 129 GLN A HA   4  
ATOM 9425  H HB2  . GLN A 1 129 ? -6.748  8.611   23.228  1.00 0.00 ? 129 GLN A HB2  4  
ATOM 9426  H HB3  . GLN A 1 129 ? -7.339  9.500   21.836  1.00 0.00 ? 129 GLN A HB3  4  
ATOM 9427  H HG2  . GLN A 1 129 ? -9.188  8.217   22.512  1.00 0.00 ? 129 GLN A HG2  4  
ATOM 9428  H HG3  . GLN A 1 129 ? -8.509  7.285   21.188  1.00 0.00 ? 129 GLN A HG3  4  
ATOM 9429  H HE21 . GLN A 1 129 ? -10.044 5.865   22.986  1.00 0.00 ? 129 GLN A HE21 4  
ATOM 9430  H HE22 . GLN A 1 129 ? -9.064  4.909   23.987  1.00 0.00 ? 129 GLN A HE22 4  
ATOM 9431  N N    . LEU A 1 130 ? -7.030  5.909   20.539  1.00 0.00 ? 130 LEU A N    4  
ATOM 9432  C CA   . LEU A 1 130 ? -7.186  4.430   20.408  1.00 0.00 ? 130 LEU A CA   4  
ATOM 9433  C C    . LEU A 1 130 ? -5.971  3.865   19.674  1.00 0.00 ? 130 LEU A C    4  
ATOM 9434  O O    . LEU A 1 130 ? -5.427  2.845   20.046  1.00 0.00 ? 130 LEU A O    4  
ATOM 9435  C CB   . LEU A 1 130 ? -8.447  4.117   19.602  1.00 0.00 ? 130 LEU A CB   4  
ATOM 9436  C CG   . LEU A 1 130 ? -9.689  4.522   20.398  1.00 0.00 ? 130 LEU A CG   4  
ATOM 9437  C CD1  . LEU A 1 130 ? -10.745 5.072   19.444  1.00 0.00 ? 130 LEU A CD1  4  
ATOM 9438  C CD2  . LEU A 1 130 ? -10.258 3.299   21.113  1.00 0.00 ? 130 LEU A CD2  4  
ATOM 9439  H H    . LEU A 1 130 ? -7.637  6.512   20.063  1.00 0.00 ? 130 LEU A H    4  
ATOM 9440  H HA   . LEU A 1 130 ? -7.258  3.982   21.388  1.00 0.00 ? 130 LEU A HA   4  
ATOM 9441  H HB2  . LEU A 1 130 ? -8.421  4.666   18.670  1.00 0.00 ? 130 LEU A HB2  4  
ATOM 9442  H HB3  . LEU A 1 130 ? -8.487  3.060   19.396  1.00 0.00 ? 130 LEU A HB3  4  
ATOM 9443  H HG   . LEU A 1 130 ? -9.427  5.279   21.121  1.00 0.00 ? 130 LEU A HG   4  
ATOM 9444  H HD11 . LEU A 1 130 ? -10.642 6.144   19.374  1.00 0.00 ? 130 LEU A HD11 4  
ATOM 9445  H HD12 . LEU A 1 130 ? -11.728 4.824   19.815  1.00 0.00 ? 130 LEU A HD12 4  
ATOM 9446  H HD13 . LEU A 1 130 ? -10.609 4.632   18.467  1.00 0.00 ? 130 LEU A HD13 4  
ATOM 9447  H HD21 . LEU A 1 130 ? -10.869 3.621   21.944  1.00 0.00 ? 130 LEU A HD21 4  
ATOM 9448  H HD22 . LEU A 1 130 ? -9.449  2.684   21.476  1.00 0.00 ? 130 LEU A HD22 4  
ATOM 9449  H HD23 . LEU A 1 130 ? -10.864 2.731   20.422  1.00 0.00 ? 130 LEU A HD23 4  
ATOM 9450  N N    . ALA A 1 131 ? -5.534  4.528   18.638  1.00 0.00 ? 131 ALA A N    4  
ATOM 9451  C CA   . ALA A 1 131 ? -4.346  4.036   17.889  1.00 0.00 ? 131 ALA A CA   4  
ATOM 9452  C C    . ALA A 1 131 ? -3.089  4.441   18.658  1.00 0.00 ? 131 ALA A C    4  
ATOM 9453  O O    . ALA A 1 131 ? -2.226  5.129   18.151  1.00 0.00 ? 131 ALA A O    4  
ATOM 9454  C CB   . ALA A 1 131 ? -4.330  4.649   16.489  1.00 0.00 ? 131 ALA A CB   4  
ATOM 9455  H H    . ALA A 1 131 ? -5.982  5.354   18.361  1.00 0.00 ? 131 ALA A H    4  
ATOM 9456  H HA   . ALA A 1 131 ? -4.390  2.958   17.813  1.00 0.00 ? 131 ALA A HA   4  
ATOM 9457  H HB1  . ALA A 1 131 ? -5.331  4.952   16.217  1.00 0.00 ? 131 ALA A HB1  4  
ATOM 9458  H HB2  . ALA A 1 131 ? -3.973  3.916   15.781  1.00 0.00 ? 131 ALA A HB2  4  
ATOM 9459  H HB3  . ALA A 1 131 ? -3.678  5.510   16.479  1.00 0.00 ? 131 ALA A HB3  4  
ATOM 9460  N N    . GLN A 1 132 ? -2.999  4.020   19.886  1.00 0.00 ? 132 GLN A N    4  
ATOM 9461  C CA   . GLN A 1 132 ? -1.823  4.373   20.736  1.00 0.00 ? 132 GLN A CA   4  
ATOM 9462  C C    . GLN A 1 132 ? -0.548  4.375   19.896  1.00 0.00 ? 132 GLN A C    4  
ATOM 9463  O O    . GLN A 1 132 ? 0.341   5.173   20.108  1.00 0.00 ? 132 GLN A O    4  
ATOM 9464  C CB   . GLN A 1 132 ? -1.664  3.342   21.857  1.00 0.00 ? 132 GLN A CB   4  
ATOM 9465  C CG   . GLN A 1 132 ? -2.763  2.276   21.767  1.00 0.00 ? 132 GLN A CG   4  
ATOM 9466  C CD   . GLN A 1 132 ? -4.004  2.731   22.541  1.00 0.00 ? 132 GLN A CD   4  
ATOM 9467  O OE1  . GLN A 1 132 ? -5.108  2.335   22.225  1.00 0.00 ? 132 GLN A OE1  4  
ATOM 9468  N NE2  . GLN A 1 132 ? -3.871  3.544   23.552  1.00 0.00 ? 132 GLN A NE2  4  
ATOM 9469  H H    . GLN A 1 132 ? -3.723  3.477   20.260  1.00 0.00 ? 132 GLN A H    4  
ATOM 9470  H HA   . GLN A 1 132 ? -1.973  5.349   21.169  1.00 0.00 ? 132 GLN A HA   4  
ATOM 9471  H HB2  . GLN A 1 132 ? -0.697  2.867   21.763  1.00 0.00 ? 132 GLN A HB2  4  
ATOM 9472  H HB3  . GLN A 1 132 ? -1.723  3.841   22.810  1.00 0.00 ? 132 GLN A HB3  4  
ATOM 9473  H HG2  . GLN A 1 132 ? -3.023  2.105   20.733  1.00 0.00 ? 132 GLN A HG2  4  
ATOM 9474  H HG3  . GLN A 1 132 ? -2.400  1.355   22.193  1.00 0.00 ? 132 GLN A HG3  4  
ATOM 9475  H HE21 . GLN A 1 132 ? -2.982  3.863   23.812  1.00 0.00 ? 132 GLN A HE21 4  
ATOM 9476  H HE22 . GLN A 1 132 ? -4.661  3.831   24.055  1.00 0.00 ? 132 GLN A HE22 4  
ATOM 9477  N N    . PHE A 1 133 ? -0.443  3.485   18.953  1.00 0.00 ? 133 PHE A N    4  
ATOM 9478  C CA   . PHE A 1 133 ? 0.789   3.444   18.119  1.00 0.00 ? 133 PHE A CA   4  
ATOM 9479  C C    . PHE A 1 133 ? 1.019   4.818   17.487  1.00 0.00 ? 133 PHE A C    4  
ATOM 9480  O O    . PHE A 1 133 ? 0.180   5.338   16.779  1.00 0.00 ? 133 PHE A O    4  
ATOM 9481  C CB   . PHE A 1 133 ? 0.618   2.393   17.024  1.00 0.00 ? 133 PHE A CB   4  
ATOM 9482  C CG   . PHE A 1 133 ? 0.470   1.036   17.666  1.00 0.00 ? 133 PHE A CG   4  
ATOM 9483  C CD1  . PHE A 1 133 ? -0.773  0.633   18.165  1.00 0.00 ? 133 PHE A CD1  4  
ATOM 9484  C CD2  . PHE A 1 133 ? 1.576   0.182   17.765  1.00 0.00 ? 133 PHE A CD2  4  
ATOM 9485  C CE1  . PHE A 1 133 ? -0.911  -0.623  18.767  1.00 0.00 ? 133 PHE A CE1  4  
ATOM 9486  C CE2  . PHE A 1 133 ? 1.438   -1.075  18.364  1.00 0.00 ? 133 PHE A CE2  4  
ATOM 9487  C CZ   . PHE A 1 133 ? 0.194   -1.478  18.866  1.00 0.00 ? 133 PHE A CZ   4  
ATOM 9488  H H    . PHE A 1 133 ? -1.167  2.841   18.800  1.00 0.00 ? 133 PHE A H    4  
ATOM 9489  H HA   . PHE A 1 133 ? 1.635   3.186   18.738  1.00 0.00 ? 133 PHE A HA   4  
ATOM 9490  H HB2  . PHE A 1 133 ? -0.264  2.617   16.442  1.00 0.00 ? 133 PHE A HB2  4  
ATOM 9491  H HB3  . PHE A 1 133 ? 1.485   2.394   16.381  1.00 0.00 ? 133 PHE A HB3  4  
ATOM 9492  H HD1  . PHE A 1 133 ? -1.625  1.292   18.090  1.00 0.00 ? 133 PHE A HD1  4  
ATOM 9493  H HD2  . PHE A 1 133 ? 2.534   0.493   17.377  1.00 0.00 ? 133 PHE A HD2  4  
ATOM 9494  H HE1  . PHE A 1 133 ? -1.868  -0.933  19.154  1.00 0.00 ? 133 PHE A HE1  4  
ATOM 9495  H HE2  . PHE A 1 133 ? 2.288   -1.734  18.440  1.00 0.00 ? 133 PHE A HE2  4  
ATOM 9496  H HZ   . PHE A 1 133 ? 0.086   -2.448  19.330  1.00 0.00 ? 133 PHE A HZ   4  
ATOM 9497  N N    . LYS A 1 134 ? 2.158   5.403   17.737  1.00 0.00 ? 134 LYS A N    4  
ATOM 9498  C CA   . LYS A 1 134 ? 2.461   6.741   17.158  1.00 0.00 ? 134 LYS A CA   4  
ATOM 9499  C C    . LYS A 1 134 ? 2.369   6.676   15.635  1.00 0.00 ? 134 LYS A C    4  
ATOM 9500  O O    . LYS A 1 134 ? 1.984   7.625   14.981  1.00 0.00 ? 134 LYS A O    4  
ATOM 9501  C CB   . LYS A 1 134 ? 3.875   7.160   17.561  1.00 0.00 ? 134 LYS A CB   4  
ATOM 9502  C CG   . LYS A 1 134 ? 4.202   8.523   16.950  1.00 0.00 ? 134 LYS A CG   4  
ATOM 9503  C CD   . LYS A 1 134 ? 5.642   8.906   17.292  1.00 0.00 ? 134 LYS A CD   4  
ATOM 9504  C CE   . LYS A 1 134 ? 5.947   10.295  16.731  1.00 0.00 ? 134 LYS A CE   4  
ATOM 9505  N NZ   . LYS A 1 134 ? 6.976   10.183  15.659  1.00 0.00 ? 134 LYS A NZ   4  
ATOM 9506  H H    . LYS A 1 134 ? 2.820   4.958   18.308  1.00 0.00 ? 134 LYS A H    4  
ATOM 9507  H HA   . LYS A 1 134 ? 1.754   7.463   17.532  1.00 0.00 ? 134 LYS A HA   4  
ATOM 9508  H HB2  . LYS A 1 134 ? 3.936   7.225   18.638  1.00 0.00 ? 134 LYS A HB2  4  
ATOM 9509  H HB3  . LYS A 1 134 ? 4.583   6.428   17.206  1.00 0.00 ? 134 LYS A HB3  4  
ATOM 9510  H HG2  . LYS A 1 134 ? 4.088   8.471   15.877  1.00 0.00 ? 134 LYS A HG2  4  
ATOM 9511  H HG3  . LYS A 1 134 ? 3.529   9.268   17.348  1.00 0.00 ? 134 LYS A HG3  4  
ATOM 9512  H HD2  . LYS A 1 134 ? 5.770   8.912   18.364  1.00 0.00 ? 134 LYS A HD2  4  
ATOM 9513  H HD3  . LYS A 1 134 ? 6.318   8.187   16.853  1.00 0.00 ? 134 LYS A HD3  4  
ATOM 9514  H HE2  . LYS A 1 134 ? 5.044   10.723  16.319  1.00 0.00 ? 134 LYS A HE2  4  
ATOM 9515  H HE3  . LYS A 1 134 ? 6.318   10.930  17.521  1.00 0.00 ? 134 LYS A HE3  4  
ATOM 9516  H HZ1  . LYS A 1 134 ? 6.562   10.465  14.748  1.00 0.00 ? 134 LYS A HZ1  4  
ATOM 9517  H HZ2  . LYS A 1 134 ? 7.308   9.198   15.600  1.00 0.00 ? 134 LYS A HZ2  4  
ATOM 9518  H HZ3  . LYS A 1 134 ? 7.778   10.806  15.881  1.00 0.00 ? 134 LYS A HZ3  4  
ATOM 9519  N N    . GLU A 1 135 ? 2.735   5.565   15.069  1.00 0.00 ? 135 GLU A N    4  
ATOM 9520  C CA   . GLU A 1 135 ? 2.691   5.427   13.587  1.00 0.00 ? 135 GLU A CA   4  
ATOM 9521  C C    . GLU A 1 135 ? 1.280   5.716   13.096  1.00 0.00 ? 135 GLU A C    4  
ATOM 9522  O O    . GLU A 1 135 ? 1.075   6.436   12.140  1.00 0.00 ? 135 GLU A O    4  
ATOM 9523  C CB   . GLU A 1 135 ? 3.037   3.988   13.226  1.00 0.00 ? 135 GLU A CB   4  
ATOM 9524  C CG   . GLU A 1 135 ? 4.263   3.559   14.021  1.00 0.00 ? 135 GLU A CG   4  
ATOM 9525  C CD   . GLU A 1 135 ? 4.646   2.131   13.637  1.00 0.00 ? 135 GLU A CD   4  
ATOM 9526  O OE1  . GLU A 1 135 ? 3.884   1.510   12.917  1.00 0.00 ? 135 GLU A OE1  4  
ATOM 9527  O OE2  . GLU A 1 135 ? 5.695   1.682   14.071  1.00 0.00 ? 135 GLU A OE2  4  
ATOM 9528  H H    . GLU A 1 135 ? 3.052   4.820   15.619  1.00 0.00 ? 135 GLU A H    4  
ATOM 9529  H HA   . GLU A 1 135 ? 3.394   6.102   13.126  1.00 0.00 ? 135 GLU A HA   4  
ATOM 9530  H HB2  . GLU A 1 135 ? 2.198   3.346   13.462  1.00 0.00 ? 135 GLU A HB2  4  
ATOM 9531  H HB3  . GLU A 1 135 ? 3.255   3.925   12.171  1.00 0.00 ? 135 GLU A HB3  4  
ATOM 9532  H HG2  . GLU A 1 135 ? 5.078   4.226   13.801  1.00 0.00 ? 135 GLU A HG2  4  
ATOM 9533  H HG3  . GLU A 1 135 ? 4.039   3.601   15.075  1.00 0.00 ? 135 GLU A HG3  4  
ATOM 9534  H HE2  . GLU A 1 135 ? 5.870   0.781   13.789  1.00 0.00 ? 135 GLU A HE2  4  
ATOM 9535  N N    . MET A 1 136 ? 0.309   5.145   13.743  1.00 0.00 ? 136 MET A N    4  
ATOM 9536  C CA   . MET A 1 136 ? -1.092  5.365   13.320  1.00 0.00 ? 136 MET A CA   4  
ATOM 9537  C C    . MET A 1 136 ? -1.547  6.747   13.773  1.00 0.00 ? 136 MET A C    4  
ATOM 9538  O O    . MET A 1 136 ? -2.157  7.482   13.022  1.00 0.00 ? 136 MET A O    4  
ATOM 9539  C CB   . MET A 1 136 ? -1.960  4.280   13.941  1.00 0.00 ? 136 MET A CB   4  
ATOM 9540  C CG   . MET A 1 136 ? -1.344  2.917   13.615  1.00 0.00 ? 136 MET A CG   4  
ATOM 9541  S SD   . MET A 1 136 ? -0.993  2.815   11.843  1.00 0.00 ? 136 MET A SD   4  
ATOM 9542  C CE   . MET A 1 136 ? -2.642  3.248   11.240  1.00 0.00 ? 136 MET A CE   4  
ATOM 9543  H H    . MET A 1 136 ? 0.503   4.564   14.507  1.00 0.00 ? 136 MET A H    4  
ATOM 9544  H HA   . MET A 1 136 ? -1.152  5.307   12.245  1.00 0.00 ? 136 MET A HA   4  
ATOM 9545  H HB2  . MET A 1 136 ? -1.992  4.417   15.011  1.00 0.00 ? 136 MET A HB2  4  
ATOM 9546  H HB3  . MET A 1 136 ? -2.958  4.333   13.534  1.00 0.00 ? 136 MET A HB3  4  
ATOM 9547  H HG2  . MET A 1 136 ? -0.419  2.801   14.167  1.00 0.00 ? 136 MET A HG2  4  
ATOM 9548  H HG3  . MET A 1 136 ? -2.032  2.134   13.893  1.00 0.00 ? 136 MET A HG3  4  
ATOM 9549  H HE1  . MET A 1 136 ? -2.756  2.888   10.227  1.00 0.00 ? 136 MET A HE1  4  
ATOM 9550  H HE2  . MET A 1 136 ? -2.767  4.319   11.252  1.00 0.00 ? 136 MET A HE2  4  
ATOM 9551  H HE3  . MET A 1 136 ? -3.387  2.793   11.876  1.00 0.00 ? 136 MET A HE3  4  
ATOM 9552  N N    . LYS A 1 137 ? -1.226  7.133   14.977  1.00 0.00 ? 137 LYS A N    4  
ATOM 9553  C CA   . LYS A 1 137 ? -1.622  8.492   15.418  1.00 0.00 ? 137 LYS A CA   4  
ATOM 9554  C C    . LYS A 1 137 ? -1.021  9.469   14.420  1.00 0.00 ? 137 LYS A C    4  
ATOM 9555  O O    . LYS A 1 137 ? -1.607  10.478  14.085  1.00 0.00 ? 137 LYS A O    4  
ATOM 9556  C CB   . LYS A 1 137 ? -1.078  8.768   16.823  1.00 0.00 ? 137 LYS A CB   4  
ATOM 9557  C CG   . LYS A 1 137 ? -1.986  8.102   17.861  1.00 0.00 ? 137 LYS A CG   4  
ATOM 9558  C CD   . LYS A 1 137 ? -1.149  7.346   18.892  1.00 0.00 ? 137 LYS A CD   4  
ATOM 9559  C CE   . LYS A 1 137 ? -0.393  8.321   19.797  1.00 0.00 ? 137 LYS A CE   4  
ATOM 9560  N NZ   . LYS A 1 137 ? 0.142   9.454   18.990  1.00 0.00 ? 137 LYS A NZ   4  
ATOM 9561  H H    . LYS A 1 137 ? -0.708  6.547   15.566  1.00 0.00 ? 137 LYS A H    4  
ATOM 9562  H HA   . LYS A 1 137 ? -2.698  8.580   15.415  1.00 0.00 ? 137 LYS A HA   4  
ATOM 9563  H HB2  . LYS A 1 137 ? -0.080  8.368   16.904  1.00 0.00 ? 137 LYS A HB2  4  
ATOM 9564  H HB3  . LYS A 1 137 ? -1.055  9.832   16.996  1.00 0.00 ? 137 LYS A HB3  4  
ATOM 9565  H HG2  . LYS A 1 137 ? -2.569  8.858   18.362  1.00 0.00 ? 137 LYS A HG2  4  
ATOM 9566  H HG3  . LYS A 1 137 ? -2.647  7.408   17.364  1.00 0.00 ? 137 LYS A HG3  4  
ATOM 9567  H HD2  . LYS A 1 137 ? -1.803  6.740   19.500  1.00 0.00 ? 137 LYS A HD2  4  
ATOM 9568  H HD3  . LYS A 1 137 ? -0.447  6.712   18.382  1.00 0.00 ? 137 LYS A HD3  4  
ATOM 9569  H HE2  . LYS A 1 137 ? -1.063  8.701   20.554  1.00 0.00 ? 137 LYS A HE2  4  
ATOM 9570  H HE3  . LYS A 1 137 ? 0.427   7.801   20.274  1.00 0.00 ? 137 LYS A HE3  4  
ATOM 9571  H HZ1  . LYS A 1 137 ? 0.735   10.058  19.593  1.00 0.00 ? 137 LYS A HZ1  4  
ATOM 9572  H HZ2  . LYS A 1 137 ? -0.649  10.011  18.610  1.00 0.00 ? 137 LYS A HZ2  4  
ATOM 9573  H HZ3  . LYS A 1 137 ? 0.716   9.083   18.207  1.00 0.00 ? 137 LYS A HZ3  4  
ATOM 9574  N N    . ALA A 1 138 ? 0.143   9.147   13.918  1.00 0.00 ? 138 ALA A N    4  
ATOM 9575  C CA   . ALA A 1 138 ? 0.794   10.018  12.908  1.00 0.00 ? 138 ALA A CA   4  
ATOM 9576  C C    . ALA A 1 138 ? 0.098   9.808   11.561  1.00 0.00 ? 138 ALA A C    4  
ATOM 9577  O O    . ALA A 1 138 ? -0.247  10.748  10.873  1.00 0.00 ? 138 ALA A O    4  
ATOM 9578  C CB   . ALA A 1 138 ? 2.265   9.648   12.779  1.00 0.00 ? 138 ALA A CB   4  
ATOM 9579  H H    . ALA A 1 138 ? 0.577   8.313   14.192  1.00 0.00 ? 138 ALA A H    4  
ATOM 9580  H HA   . ALA A 1 138 ? 0.709   11.048  13.208  1.00 0.00 ? 138 ALA A HA   4  
ATOM 9581  H HB1  . ALA A 1 138 ? 2.692   9.532   13.763  1.00 0.00 ? 138 ALA A HB1  4  
ATOM 9582  H HB2  . ALA A 1 138 ? 2.782   10.435  12.251  1.00 0.00 ? 138 ALA A HB2  4  
ATOM 9583  H HB3  . ALA A 1 138 ? 2.358   8.720   12.231  1.00 0.00 ? 138 ALA A HB3  4  
ATOM 9584  N N    . ALA A 1 139 ? -0.121  8.572   11.186  1.00 0.00 ? 139 ALA A N    4  
ATOM 9585  C CA   . ALA A 1 139 ? -0.810  8.299   9.893   1.00 0.00 ? 139 ALA A CA   4  
ATOM 9586  C C    . ALA A 1 139 ? -2.170  8.979   9.933   1.00 0.00 ? 139 ALA A C    4  
ATOM 9587  O O    . ALA A 1 139 ? -2.565  9.675   9.019   1.00 0.00 ? 139 ALA A O    4  
ATOM 9588  C CB   . ALA A 1 139 ? -1.005  6.790   9.724   1.00 0.00 ? 139 ALA A CB   4  
ATOM 9589  H H    . ALA A 1 139 ? 0.155   7.828   11.760  1.00 0.00 ? 139 ALA A H    4  
ATOM 9590  H HA   . ALA A 1 139 ? -0.225  8.692   9.073   1.00 0.00 ? 139 ALA A HA   4  
ATOM 9591  H HB1  . ALA A 1 139 ? -0.993  6.541   8.673   1.00 0.00 ? 139 ALA A HB1  4  
ATOM 9592  H HB2  . ALA A 1 139 ? -1.955  6.502   10.152  1.00 0.00 ? 139 ALA A HB2  4  
ATOM 9593  H HB3  . ALA A 1 139 ? -0.208  6.265   10.228  1.00 0.00 ? 139 ALA A HB3  4  
ATOM 9594  N N    . LEU A 1 140 ? -2.874  8.803   11.013  1.00 0.00 ? 140 LEU A N    4  
ATOM 9595  C CA   . LEU A 1 140 ? -4.196  9.455   11.157  1.00 0.00 ? 140 LEU A CA   4  
ATOM 9596  C C    . LEU A 1 140 ? -3.965  10.966  11.195  1.00 0.00 ? 140 LEU A C    4  
ATOM 9597  O O    . LEU A 1 140 ? -4.788  11.754  10.769  1.00 0.00 ? 140 LEU A O    4  
ATOM 9598  C CB   . LEU A 1 140 ? -4.834  8.991   12.469  1.00 0.00 ? 140 LEU A CB   4  
ATOM 9599  C CG   . LEU A 1 140 ? -4.936  7.460   12.473  1.00 0.00 ? 140 LEU A CG   4  
ATOM 9600  C CD1  . LEU A 1 140 ? -4.919  6.938   13.911  1.00 0.00 ? 140 LEU A CD1  4  
ATOM 9601  C CD2  . LEU A 1 140 ? -6.243  7.033   11.808  1.00 0.00 ? 140 LEU A CD2  4  
ATOM 9602  H H    . LEU A 1 140 ? -2.518  8.253   11.741  1.00 0.00 ? 140 LEU A H    4  
ATOM 9603  H HA   . LEU A 1 140 ? -4.831  9.192   10.324  1.00 0.00 ? 140 LEU A HA   4  
ATOM 9604  H HB2  . LEU A 1 140 ? -4.222  9.318   13.297  1.00 0.00 ? 140 LEU A HB2  4  
ATOM 9605  H HB3  . LEU A 1 140 ? -5.822  9.417   12.561  1.00 0.00 ? 140 LEU A HB3  4  
ATOM 9606  H HG   . LEU A 1 140 ? -4.101  7.043   11.930  1.00 0.00 ? 140 LEU A HG   4  
ATOM 9607  H HD11 . LEU A 1 140 ? -4.946  7.768   14.601  1.00 0.00 ? 140 LEU A HD11 4  
ATOM 9608  H HD12 . LEU A 1 140 ? -4.018  6.365   14.071  1.00 0.00 ? 140 LEU A HD12 4  
ATOM 9609  H HD13 . LEU A 1 140 ? -5.780  6.308   14.073  1.00 0.00 ? 140 LEU A HD13 4  
ATOM 9610  H HD21 . LEU A 1 140 ? -6.575  7.808   11.131  1.00 0.00 ? 140 LEU A HD21 4  
ATOM 9611  H HD22 . LEU A 1 140 ? -6.995  6.868   12.566  1.00 0.00 ? 140 LEU A HD22 4  
ATOM 9612  H HD23 . LEU A 1 140 ? -6.083  6.118   11.257  1.00 0.00 ? 140 LEU A HD23 4  
ATOM 9613  N N    . GLN A 1 141 ? -2.833  11.365  11.716  1.00 0.00 ? 141 GLN A N    4  
ATOM 9614  C CA   . GLN A 1 141 ? -2.496  12.814  11.814  1.00 0.00 ? 141 GLN A CA   4  
ATOM 9615  C C    . GLN A 1 141 ? -2.107  13.366  10.442  1.00 0.00 ? 141 GLN A C    4  
ATOM 9616  O O    . GLN A 1 141 ? -2.619  14.378  10.003  1.00 0.00 ? 141 GLN A O    4  
ATOM 9617  C CB   . GLN A 1 141 ? -1.303  12.972  12.756  1.00 0.00 ? 141 GLN A CB   4  
ATOM 9618  C CG   . GLN A 1 141 ? -1.783  13.450  14.126  1.00 0.00 ? 141 GLN A CG   4  
ATOM 9619  C CD   . GLN A 1 141 ? -1.934  14.972  14.110  1.00 0.00 ? 141 GLN A CD   4  
ATOM 9620  O OE1  . GLN A 1 141 ? -1.474  15.647  15.008  1.00 0.00 ? 141 GLN A OE1  4  
ATOM 9621  N NE2  . GLN A 1 141 ? -2.557  15.545  13.117  1.00 0.00 ? 141 GLN A NE2  4  
ATOM 9622  H H    . GLN A 1 141 ? -2.196  10.699  12.051  1.00 0.00 ? 141 GLN A H    4  
ATOM 9623  H HA   . GLN A 1 141 ? -3.341  13.361  12.203  1.00 0.00 ? 141 GLN A HA   4  
ATOM 9624  H HB2  . GLN A 1 141 ? -0.813  12.024  12.860  1.00 0.00 ? 141 GLN A HB2  4  
ATOM 9625  H HB3  . GLN A 1 141 ? -0.606  13.688  12.349  1.00 0.00 ? 141 GLN A HB3  4  
ATOM 9626  H HG2  . GLN A 1 141 ? -2.732  12.991  14.351  1.00 0.00 ? 141 GLN A HG2  4  
ATOM 9627  H HG3  . GLN A 1 141 ? -1.061  13.170  14.877  1.00 0.00 ? 141 GLN A HG3  4  
ATOM 9628  H HE21 . GLN A 1 141 ? -2.924  15.001  12.388  1.00 0.00 ? 141 GLN A HE21 4  
ATOM 9629  H HE22 . GLN A 1 141 ? -2.658  16.520  13.098  1.00 0.00 ? 141 GLN A HE22 4  
ATOM 9630  N N    . GLU A 1 142 ? -1.192  12.725  9.772   1.00 0.00 ? 142 GLU A N    4  
ATOM 9631  C CA   . GLU A 1 142 ? -0.760  13.234  8.441   1.00 0.00 ? 142 GLU A CA   4  
ATOM 9632  C C    . GLU A 1 142 ? -1.944  13.203  7.474   1.00 0.00 ? 142 GLU A C    4  
ATOM 9633  O O    . GLU A 1 142 ? -2.117  14.093  6.668   1.00 0.00 ? 142 GLU A O    4  
ATOM 9634  C CB   . GLU A 1 142 ? 0.375   12.361  7.903   1.00 0.00 ? 142 GLU A CB   4  
ATOM 9635  C CG   . GLU A 1 142 ? 1.573   12.440  8.851   1.00 0.00 ? 142 GLU A CG   4  
ATOM 9636  C CD   . GLU A 1 142 ? 2.742   11.647  8.267   1.00 0.00 ? 142 GLU A CD   4  
ATOM 9637  O OE1  . GLU A 1 142 ? 2.533   10.961  7.279   1.00 0.00 ? 142 GLU A OE1  4  
ATOM 9638  O OE2  . GLU A 1 142 ? 3.828   11.736  8.816   1.00 0.00 ? 142 GLU A OE2  4  
ATOM 9639  H H    . GLU A 1 142 ? -0.779  11.920  10.148  1.00 0.00 ? 142 GLU A H    4  
ATOM 9640  H HA   . GLU A 1 142 ? -0.412  14.252  8.545   1.00 0.00 ? 142 GLU A HA   4  
ATOM 9641  H HB2  . GLU A 1 142 ? 0.039   11.335  7.829   1.00 0.00 ? 142 GLU A HB2  4  
ATOM 9642  H HB3  . GLU A 1 142 ? 0.670   12.716  6.929   1.00 0.00 ? 142 GLU A HB3  4  
ATOM 9643  H HG2  . GLU A 1 142 ? 1.864   13.474  8.976   1.00 0.00 ? 142 GLU A HG2  4  
ATOM 9644  H HG3  . GLU A 1 142 ? 1.302   12.025  9.810   1.00 0.00 ? 142 GLU A HG3  4  
ATOM 9645  H HE2  . GLU A 1 142 ? 4.514   11.212  8.396   1.00 0.00 ? 142 GLU A HE2  4  
ATOM 9646  N N    . GLY A 1 143 ? -2.773  12.197  7.556   1.00 0.00 ? 143 GLY A N    4  
ATOM 9647  C CA   . GLY A 1 143 ? -3.948  12.142  6.644   1.00 0.00 ? 143 GLY A CA   4  
ATOM 9648  C C    . GLY A 1 143 ? -4.785  13.401  6.855   1.00 0.00 ? 143 GLY A C    4  
ATOM 9649  O O    . GLY A 1 143 ? -5.158  14.079  5.920   1.00 0.00 ? 143 GLY A O    4  
ATOM 9650  H H    . GLY A 1 143 ? -2.629  11.492  8.218   1.00 0.00 ? 143 GLY A H    4  
ATOM 9651  H HA2  . GLY A 1 143 ? -3.608  12.095  5.619   1.00 0.00 ? 143 GLY A HA2  4  
ATOM 9652  H HA3  . GLY A 1 143 ? -4.544  11.271  6.871   1.00 0.00 ? 143 GLY A HA3  4  
ATOM 9653  N N    . HIS A 1 144 ? -5.067  13.731  8.086   1.00 0.00 ? 144 HIS A N    4  
ATOM 9654  C CA   . HIS A 1 144 ? -5.861  14.958  8.367   1.00 0.00 ? 144 HIS A CA   4  
ATOM 9655  C C    . HIS A 1 144 ? -5.064  16.180  7.908   1.00 0.00 ? 144 HIS A C    4  
ATOM 9656  O O    . HIS A 1 144 ? -5.597  17.100  7.320   1.00 0.00 ? 144 HIS A O    4  
ATOM 9657  C CB   . HIS A 1 144 ? -6.127  15.056  9.872   1.00 0.00 ? 144 HIS A CB   4  
ATOM 9658  C CG   . HIS A 1 144 ? -6.940  16.287  10.161  1.00 0.00 ? 144 HIS A CG   4  
ATOM 9659  N ND1  . HIS A 1 144 ? -6.360  17.540  10.302  1.00 0.00 ? 144 HIS A ND1  4  
ATOM 9660  C CD2  . HIS A 1 144 ? -8.288  16.476  10.348  1.00 0.00 ? 144 HIS A CD2  4  
ATOM 9661  C CE1  . HIS A 1 144 ? -7.347  18.419  10.559  1.00 0.00 ? 144 HIS A CE1  4  
ATOM 9662  N NE2  . HIS A 1 144 ? -8.538  17.821  10.597  1.00 0.00 ? 144 HIS A NE2  4  
ATOM 9663  H H    . HIS A 1 144 ? -4.741  13.177  8.827   1.00 0.00 ? 144 HIS A H    4  
ATOM 9664  H HA   . HIS A 1 144 ? -6.799  14.914  7.834   1.00 0.00 ? 144 HIS A HA   4  
ATOM 9665  H HB2  . HIS A 1 144 ? -6.670  14.181  10.198  1.00 0.00 ? 144 HIS A HB2  4  
ATOM 9666  H HB3  . HIS A 1 144 ? -5.187  15.114  10.400  1.00 0.00 ? 144 HIS A HB3  4  
ATOM 9667  H HD1  . HIS A 1 144 ? -5.405  17.747  10.226  1.00 0.00 ? 144 HIS A HD1  4  
ATOM 9668  H HD2  . HIS A 1 144 ? -9.037  15.699  10.307  1.00 0.00 ? 144 HIS A HD2  4  
ATOM 9669  H HE1  . HIS A 1 144 ? -7.192  19.476  10.717  1.00 0.00 ? 144 HIS A HE1  4  
ATOM 9670  H HE2  . HIS A 1 144 ? -9.407  18.241  10.766  1.00 0.00 ? 144 HIS A HE2  4  
ATOM 9671  N N    . GLN A 1 145 ? -3.788  16.192  8.182   1.00 0.00 ? 145 GLN A N    4  
ATOM 9672  C CA   . GLN A 1 145 ? -2.941  17.349  7.774   1.00 0.00 ? 145 GLN A CA   4  
ATOM 9673  C C    . GLN A 1 145 ? -2.974  17.517  6.255   1.00 0.00 ? 145 GLN A C    4  
ATOM 9674  O O    . GLN A 1 145 ? -3.078  18.613  5.741   1.00 0.00 ? 145 GLN A O    4  
ATOM 9675  C CB   . GLN A 1 145 ? -1.497  17.090  8.211   1.00 0.00 ? 145 GLN A CB   4  
ATOM 9676  C CG   . GLN A 1 145 ? -0.653  18.344  7.970   1.00 0.00 ? 145 GLN A CG   4  
ATOM 9677  C CD   . GLN A 1 145 ? -1.049  19.428  8.974   1.00 0.00 ? 145 GLN A CD   4  
ATOM 9678  O OE1  . GLN A 1 145 ? -1.297  19.143  10.129  1.00 0.00 ? 145 GLN A OE1  4  
ATOM 9679  N NE2  . GLN A 1 145 ? -1.115  20.671  8.580   1.00 0.00 ? 145 GLN A NE2  4  
ATOM 9680  H H    . GLN A 1 145 ? -3.384  15.439  8.660   1.00 0.00 ? 145 GLN A H    4  
ATOM 9681  H HA   . GLN A 1 145 ? -3.302  18.250  8.248   1.00 0.00 ? 145 GLN A HA   4  
ATOM 9682  H HB2  . GLN A 1 145 ? -1.476  16.835  9.261   1.00 0.00 ? 145 GLN A HB2  4  
ATOM 9683  H HB3  . GLN A 1 145 ? -1.090  16.272  7.637   1.00 0.00 ? 145 GLN A HB3  4  
ATOM 9684  H HG2  . GLN A 1 145 ? 0.393   18.102  8.093   1.00 0.00 ? 145 GLN A HG2  4  
ATOM 9685  H HG3  . GLN A 1 145 ? -0.824  18.704  6.966   1.00 0.00 ? 145 GLN A HG3  4  
ATOM 9686  H HE21 . GLN A 1 145 ? -0.913  20.901  7.649   1.00 0.00 ? 145 GLN A HE21 4  
ATOM 9687  H HE22 . GLN A 1 145 ? -1.368  21.373  9.216   1.00 0.00 ? 145 GLN A HE22 4  
ATOM 9688  N N    . PHE A 1 146 ? -2.871  16.438  5.529   1.00 0.00 ? 146 PHE A N    4  
ATOM 9689  C CA   . PHE A 1 146 ? -2.879  16.536  4.042   1.00 0.00 ? 146 PHE A CA   4  
ATOM 9690  C C    . PHE A 1 146 ? -4.285  16.856  3.522   1.00 0.00 ? 146 PHE A C    4  
ATOM 9691  O O    . PHE A 1 146 ? -4.470  17.765  2.738   1.00 0.00 ? 146 PHE A O    4  
ATOM 9692  C CB   . PHE A 1 146 ? -2.409  15.211  3.446   1.00 0.00 ? 146 PHE A CB   4  
ATOM 9693  C CG   . PHE A 1 146 ? -2.405  15.319  1.942   1.00 0.00 ? 146 PHE A CG   4  
ATOM 9694  C CD1  . PHE A 1 146 ? -3.582  15.085  1.227   1.00 0.00 ? 146 PHE A CD1  4  
ATOM 9695  C CD2  . PHE A 1 146 ? -1.229  15.662  1.264   1.00 0.00 ? 146 PHE A CD2  4  
ATOM 9696  C CE1  . PHE A 1 146 ? -3.587  15.190  -0.165  1.00 0.00 ? 146 PHE A CE1  4  
ATOM 9697  C CE2  . PHE A 1 146 ? -1.233  15.770  -0.131  1.00 0.00 ? 146 PHE A CE2  4  
ATOM 9698  C CZ   . PHE A 1 146 ? -2.414  15.534  -0.847  1.00 0.00 ? 146 PHE A CZ   4  
ATOM 9699  H H    . PHE A 1 146 ? -2.776  15.563  5.961   1.00 0.00 ? 146 PHE A H    4  
ATOM 9700  H HA   . PHE A 1 146 ? -2.200  17.317  3.736   1.00 0.00 ? 146 PHE A HA   4  
ATOM 9701  H HB2  . PHE A 1 146 ? -1.410  14.996  3.798   1.00 0.00 ? 146 PHE A HB2  4  
ATOM 9702  H HB3  . PHE A 1 146 ? -3.079  14.420  3.749   1.00 0.00 ? 146 PHE A HB3  4  
ATOM 9703  H HD1  . PHE A 1 146 ? -4.487  14.823  1.752   1.00 0.00 ? 146 PHE A HD1  4  
ATOM 9704  H HD2  . PHE A 1 146 ? -0.319  15.844  1.818   1.00 0.00 ? 146 PHE A HD2  4  
ATOM 9705  H HE1  . PHE A 1 146 ? -4.499  15.009  -0.715  1.00 0.00 ? 146 PHE A HE1  4  
ATOM 9706  H HE2  . PHE A 1 146 ? -0.327  16.034  -0.656  1.00 0.00 ? 146 PHE A HE2  4  
ATOM 9707  H HZ   . PHE A 1 146 ? -2.418  15.615  -1.925  1.00 0.00 ? 146 PHE A HZ   4  
ATOM 9708  N N    . LEU A 1 147 ? -5.274  16.112  3.937   1.00 0.00 ? 147 LEU A N    4  
ATOM 9709  C CA   . LEU A 1 147 ? -6.655  16.378  3.444   1.00 0.00 ? 147 LEU A CA   4  
ATOM 9710  C C    . LEU A 1 147 ? -7.030  17.835  3.713   1.00 0.00 ? 147 LEU A C    4  
ATOM 9711  O O    . LEU A 1 147 ? -7.680  18.475  2.910   1.00 0.00 ? 147 LEU A O    4  
ATOM 9712  C CB   . LEU A 1 147 ? -7.646  15.449  4.149   1.00 0.00 ? 147 LEU A CB   4  
ATOM 9713  C CG   . LEU A 1 147 ? -7.348  14.002  3.752   1.00 0.00 ? 147 LEU A CG   4  
ATOM 9714  C CD1  . LEU A 1 147 ? -8.327  13.065  4.454   1.00 0.00 ? 147 LEU A CD1  4  
ATOM 9715  C CD2  . LEU A 1 147 ? -7.510  13.842  2.241   1.00 0.00 ? 147 LEU A CD2  4  
ATOM 9716  H H    . LEU A 1 147 ? -5.107  15.375  4.558   1.00 0.00 ? 147 LEU A H    4  
ATOM 9717  H HA   . LEU A 1 147 ? -6.691  16.195  2.383   1.00 0.00 ? 147 LEU A HA   4  
ATOM 9718  H HB2  . LEU A 1 147 ? -7.545  15.560  5.219   1.00 0.00 ? 147 LEU A HB2  4  
ATOM 9719  H HB3  . LEU A 1 147 ? -8.652  15.703  3.853   1.00 0.00 ? 147 LEU A HB3  4  
ATOM 9720  H HG   . LEU A 1 147 ? -6.337  13.750  4.038   1.00 0.00 ? 147 LEU A HG   4  
ATOM 9721  H HD11 . LEU A 1 147 ? -7.857  12.637  5.327   1.00 0.00 ? 147 LEU A HD11 4  
ATOM 9722  H HD12 . LEU A 1 147 ? -8.610  12.276  3.773   1.00 0.00 ? 147 LEU A HD12 4  
ATOM 9723  H HD13 . LEU A 1 147 ? -9.205  13.618  4.750   1.00 0.00 ? 147 LEU A HD13 4  
ATOM 9724  H HD21 . LEU A 1 147 ? -6.574  14.064  1.753   1.00 0.00 ? 147 LEU A HD21 4  
ATOM 9725  H HD22 . LEU A 1 147 ? -8.272  14.521  1.887   1.00 0.00 ? 147 LEU A HD22 4  
ATOM 9726  H HD23 . LEU A 1 147 ? -7.800  12.826  2.018   1.00 0.00 ? 147 LEU A HD23 4  
ATOM 9727  N N    . CYS A 1 148 ? -6.614  18.373  4.822   1.00 0.00 ? 148 CYS A N    4  
ATOM 9728  C CA   . CYS A 1 148 ? -6.941  19.794  5.116   1.00 0.00 ? 148 CYS A CA   4  
ATOM 9729  C C    . CYS A 1 148 ? -6.077  20.688  4.224   1.00 0.00 ? 148 CYS A C    4  
ATOM 9730  O O    . CYS A 1 148 ? -6.286  21.881  4.130   1.00 0.00 ? 148 CYS A O    4  
ATOM 9731  C CB   . CYS A 1 148 ? -6.644  20.096  6.587   1.00 0.00 ? 148 CYS A CB   4  
ATOM 9732  S SG   . CYS A 1 148 ? -6.095  21.813  6.753   1.00 0.00 ? 148 CYS A SG   4  
ATOM 9733  H H    . CYS A 1 148 ? -6.080  17.848  5.455   1.00 0.00 ? 148 CYS A H    4  
ATOM 9734  H HA   . CYS A 1 148 ? -7.985  19.976  4.911   1.00 0.00 ? 148 CYS A HA   4  
ATOM 9735  H HB2  . CYS A 1 148 ? -7.539  19.944  7.173   1.00 0.00 ? 148 CYS A HB2  4  
ATOM 9736  H HB3  . CYS A 1 148 ? -5.866  19.433  6.940   1.00 0.00 ? 148 CYS A HB3  4  
ATOM 9737  H HG   . CYS A 1 148 ? -5.138  21.812  6.819   1.00 0.00 ? 148 CYS A HG   4  
ATOM 9738  N N    . SER A 1 149 ? -5.104  20.112  3.572   1.00 0.00 ? 149 SER A N    4  
ATOM 9739  C CA   . SER A 1 149 ? -4.211  20.912  2.685   1.00 0.00 ? 149 SER A CA   4  
ATOM 9740  C C    . SER A 1 149 ? -4.768  20.946  1.260   1.00 0.00 ? 149 SER A C    4  
ATOM 9741  O O    . SER A 1 149 ? -4.314  21.707  0.429   1.00 0.00 ? 149 SER A O    4  
ATOM 9742  C CB   . SER A 1 149 ? -2.824  20.276  2.657   1.00 0.00 ? 149 SER A CB   4  
ATOM 9743  O OG   . SER A 1 149 ? -1.850  21.250  3.005   1.00 0.00 ? 149 SER A OG   4  
ATOM 9744  H H    . SER A 1 149 ? -4.955  19.148  3.667   1.00 0.00 ? 149 SER A H    4  
ATOM 9745  H HA   . SER A 1 149 ? -4.135  21.920  3.066   1.00 0.00 ? 149 SER A HA   4  
ATOM 9746  H HB2  . SER A 1 149 ? -2.784  19.465  3.364   1.00 0.00 ? 149 SER A HB2  4  
ATOM 9747  H HB3  . SER A 1 149 ? -2.629  19.892  1.663   1.00 0.00 ? 149 SER A HB3  4  
ATOM 9748  H HG   . SER A 1 149 ? -2.197  22.115  2.770   1.00 0.00 ? 149 SER A HG   4  
ATOM 9749  N N    . ILE A 1 150 ? -5.739  20.127  0.961   1.00 0.00 ? 150 ILE A N    4  
ATOM 9750  C CA   . ILE A 1 150 ? -6.293  20.124  -0.418  1.00 0.00 ? 150 ILE A CA   4  
ATOM 9751  C C    . ILE A 1 150 ? -7.246  21.307  -0.580  1.00 0.00 ? 150 ILE A C    4  
ATOM 9752  O O    . ILE A 1 150 ? -6.908  22.437  -0.289  1.00 0.00 ? 150 ILE A O    4  
ATOM 9753  C CB   . ILE A 1 150 ? -7.047  18.817  -0.679  1.00 0.00 ? 150 ILE A CB   4  
ATOM 9754  C CG1  . ILE A 1 150 ? -6.381  17.665  0.080   1.00 0.00 ? 150 ILE A CG1  4  
ATOM 9755  C CG2  . ILE A 1 150 ? -7.010  18.514  -2.176  1.00 0.00 ? 150 ILE A CG2  4  
ATOM 9756  C CD1  . ILE A 1 150 ? -7.227  16.397  -0.076  1.00 0.00 ? 150 ILE A CD1  4  
ATOM 9757  H H    . ILE A 1 150 ? -6.095  19.514  1.633   1.00 0.00 ? 150 ILE A H    4  
ATOM 9758  H HA   . ILE A 1 150 ? -5.487  20.218  -1.128  1.00 0.00 ? 150 ILE A HA   4  
ATOM 9759  H HB   . ILE A 1 150 ? -8.073  18.917  -0.354  1.00 0.00 ? 150 ILE A HB   4  
ATOM 9760  H HG12 . ILE A 1 150 ? -5.394  17.488  -0.320  1.00 0.00 ? 150 ILE A HG12 4  
ATOM 9761  H HG13 . ILE A 1 150 ? -6.308  17.918  1.125   1.00 0.00 ? 150 ILE A HG13 4  
ATOM 9762  H HG21 . ILE A 1 150 ? -7.425  19.348  -2.722  1.00 0.00 ? 150 ILE A HG21 4  
ATOM 9763  H HG22 . ILE A 1 150 ? -7.590  17.626  -2.379  1.00 0.00 ? 150 ILE A HG22 4  
ATOM 9764  H HG23 . ILE A 1 150 ? -5.987  18.354  -2.482  1.00 0.00 ? 150 ILE A HG23 4  
ATOM 9765  H HD11 . ILE A 1 150 ? -6.612  15.532  0.114   1.00 0.00 ? 150 ILE A HD11 4  
ATOM 9766  H HD12 . ILE A 1 150 ? -7.620  16.346  -1.079  1.00 0.00 ? 150 ILE A HD12 4  
ATOM 9767  H HD13 . ILE A 1 150 ? -8.044  16.421  0.629   1.00 0.00 ? 150 ILE A HD13 4  
ATOM 9768  N N    . GLU A 1 151 ? -8.434  21.052  -1.043  1.00 0.00 ? 151 GLU A N    4  
ATOM 9769  C CA   . GLU A 1 151 ? -9.417  22.154  -1.227  1.00 0.00 ? 151 GLU A CA   4  
ATOM 9770  C C    . GLU A 1 151 ? -10.795 21.695  -0.744  1.00 0.00 ? 151 GLU A C    4  
ATOM 9771  O O    . GLU A 1 151 ? -11.171 21.916  0.389   1.00 0.00 ? 151 GLU A O    4  
ATOM 9772  C CB   . GLU A 1 151 ? -9.491  22.531  -2.709  1.00 0.00 ? 151 GLU A CB   4  
ATOM 9773  C CG   . GLU A 1 151 ? -10.377 23.763  -2.883  1.00 0.00 ? 151 GLU A CG   4  
ATOM 9774  C CD   . GLU A 1 151 ? -10.530 24.080  -4.373  1.00 0.00 ? 151 GLU A CD   4  
ATOM 9775  O OE1  . GLU A 1 151 ? -11.178 25.065  -4.685  1.00 0.00 ? 151 GLU A OE1  4  
ATOM 9776  O OE2  . GLU A 1 151 ? -9.996  23.330  -5.174  1.00 0.00 ? 151 GLU A OE2  4  
ATOM 9777  H H    . GLU A 1 151 ? -8.679  20.133  -1.268  1.00 0.00 ? 151 GLU A H    4  
ATOM 9778  H HA   . GLU A 1 151 ? -9.105  23.015  -0.655  1.00 0.00 ? 151 GLU A HA   4  
ATOM 9779  H HB2  . GLU A 1 151 ? -8.497  22.745  -3.075  1.00 0.00 ? 151 GLU A HB2  4  
ATOM 9780  H HB3  . GLU A 1 151 ? -9.910  21.707  -3.270  1.00 0.00 ? 151 GLU A HB3  4  
ATOM 9781  H HG2  . GLU A 1 151 ? -11.351 23.573  -2.453  1.00 0.00 ? 151 GLU A HG2  4  
ATOM 9782  H HG3  . GLU A 1 151 ? -9.922  24.607  -2.383  1.00 0.00 ? 151 GLU A HG3  4  
ATOM 9783  H HE2  . GLU A 1 151 ? -10.133 23.589  -6.088  1.00 0.00 ? 151 GLU A HE2  4  
ATOM 9784  N N    . ALA A 1 152 ? -11.551 21.054  -1.596  1.00 0.00 ? 152 ALA A N    4  
ATOM 9785  C CA   . ALA A 1 152 ? -12.903 20.581  -1.181  1.00 0.00 ? 152 ALA A CA   4  
ATOM 9786  C C    . ALA A 1 152 ? -12.866 19.075  -0.918  1.00 0.00 ? 152 ALA A C    4  
ATOM 9787  O O    . ALA A 1 152 ? -13.126 18.618  0.178   1.00 0.00 ? 152 ALA A O    4  
ATOM 9788  C CB   . ALA A 1 152 ? -13.910 20.877  -2.294  1.00 0.00 ? 152 ALA A CB   4  
ATOM 9789  H H    . ALA A 1 152 ? -11.231 20.884  -2.505  1.00 0.00 ? 152 ALA A H    4  
ATOM 9790  H HA   . ALA A 1 152 ? -13.203 21.095  -0.281  1.00 0.00 ? 152 ALA A HA   4  
ATOM 9791  H HB1  . ALA A 1 152 ? -14.691 20.133  -2.280  1.00 0.00 ? 152 ALA A HB1  4  
ATOM 9792  H HB2  . ALA A 1 152 ? -13.407 20.854  -3.250  1.00 0.00 ? 152 ALA A HB2  4  
ATOM 9793  H HB3  . ALA A 1 152 ? -14.341 21.856  -2.139  1.00 0.00 ? 152 ALA A HB3  4  
ATOM 9794  N N    . LEU A 1 153 ? -12.545 18.296  -1.917  1.00 0.00 ? 153 LEU A N    4  
ATOM 9795  C CA   . LEU A 1 153 ? -12.495 16.819  -1.723  1.00 0.00 ? 153 LEU A CA   4  
ATOM 9796  C C    . LEU A 1 153 ? -11.123 16.423  -1.173  1.00 0.00 ? 153 LEU A C    4  
ATOM 9797  O O    . LEU A 1 153 ? -10.267 17.275  -0.945  1.00 0.00 ? 153 LEU A O    4  
ATOM 9798  C CB   . LEU A 1 153 ? -12.731 16.122  -3.066  1.00 0.00 ? 153 LEU A CB   4  
ATOM 9799  C CG   . LEU A 1 153 ? -12.927 14.623  -2.837  1.00 0.00 ? 153 LEU A CG   4  
ATOM 9800  C CD1  . LEU A 1 153 ? -14.331 14.364  -2.283  1.00 0.00 ? 153 LEU A CD1  4  
ATOM 9801  C CD2  . LEU A 1 153 ? -12.762 13.880  -4.163  1.00 0.00 ? 153 LEU A CD2  4  
ATOM 9802  H H    . LEU A 1 153 ? -12.342 18.683  -2.793  1.00 0.00 ? 153 LEU A H    4  
ATOM 9803  H HA   . LEU A 1 153 ? -13.262 16.523  -1.023  1.00 0.00 ? 153 LEU A HA   4  
ATOM 9804  H HB2  . LEU A 1 153 ? -13.610 16.536  -3.537  1.00 0.00 ? 153 LEU A HB2  4  
ATOM 9805  H HB3  . LEU A 1 153 ? -11.872 16.277  -3.704  1.00 0.00 ? 153 LEU A HB3  4  
ATOM 9806  H HG   . LEU A 1 153 ? -12.192 14.268  -2.129  1.00 0.00 ? 153 LEU A HG   4  
ATOM 9807  H HD11 . LEU A 1 153 ? -14.898 13.788  -2.998  1.00 0.00 ? 153 LEU A HD11 4  
ATOM 9808  H HD12 . LEU A 1 153 ? -14.829 15.307  -2.106  1.00 0.00 ? 153 LEU A HD12 4  
ATOM 9809  H HD13 . LEU A 1 153 ? -14.258 13.817  -1.355  1.00 0.00 ? 153 LEU A HD13 4  
ATOM 9810  H HD21 . LEU A 1 153 ? -13.530 13.126  -4.253  1.00 0.00 ? 153 LEU A HD21 4  
ATOM 9811  H HD22 . LEU A 1 153 ? -11.790 13.408  -4.194  1.00 0.00 ? 153 LEU A HD22 4  
ATOM 9812  H HD23 . LEU A 1 153 ? -12.849 14.580  -4.980  1.00 0.00 ? 153 LEU A HD23 4  
ATOM 9813  N N    . GLY A 1 1   ? 19.975  -3.606  -1.734  1.00 0.00 ? 1   GLY A N    5  
ATOM 9814  C CA   . GLY A 1 1   ? 19.128  -2.442  -1.573  1.00 0.00 ? 1   GLY A CA   5  
ATOM 9815  C C    . GLY A 1 1   ? 18.218  -2.614  -0.365  1.00 0.00 ? 1   GLY A C    5  
ATOM 9816  O O    . GLY A 1 1   ? 18.208  -3.671  0.262   1.00 0.00 ? 1   GLY A O    5  
ATOM 9817  H H1   . GLY A 1 1   ? 19.882  -4.364  -1.073  1.00 0.00 ? 1   GLY A H1   5  
ATOM 9818  H HA2  . GLY A 1 1   ? 19.751  -1.559  -1.432  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 9819  H HA3  . GLY A 1 1   ? 18.518  -2.313  -2.468  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 9820  N N    . PRO A 1 2   ? 17.451  -1.571  -0.041  1.00 0.00 ? 2   PRO A N    5  
ATOM 9821  C CA   . PRO A 1 2   ? 16.530  -1.551  1.075   1.00 0.00 ? 2   PRO A CA   5  
ATOM 9822  C C    . PRO A 1 2   ? 15.326  -2.427  0.759   1.00 0.00 ? 2   PRO A C    5  
ATOM 9823  O O    . PRO A 1 2   ? 14.741  -3.029  1.657   1.00 0.00 ? 2   PRO A O    5  
ATOM 9824  C CB   . PRO A 1 2   ? 16.119  -0.087  1.218   1.00 0.00 ? 2   PRO A CB   5  
ATOM 9825  C CG   . PRO A 1 2   ? 16.219  0.434   -0.216  1.00 0.00 ? 2   PRO A CG   5  
ATOM 9826  C CD   . PRO A 1 2   ? 17.433  -0.315  -0.760  1.00 0.00 ? 2   PRO A CD   5  
ATOM 9827  H HA   . PRO A 1 2   ? 17.012  -1.900  1.988   1.00 0.00 ? 2   PRO A HA   5  
ATOM 9828  H HB2  . PRO A 1 2   ? 15.116  0.023   1.631   1.00 0.00 ? 2   PRO A HB2  5  
ATOM 9829  H HB3  . PRO A 1 2   ? 16.851  0.432   1.837   1.00 0.00 ? 2   PRO A HB3  5  
ATOM 9830  H HG2  . PRO A 1 2   ? 15.331  0.128   -0.769  1.00 0.00 ? 2   PRO A HG2  5  
ATOM 9831  H HG3  . PRO A 1 2   ? 16.347  1.515   -0.257  1.00 0.00 ? 2   PRO A HG3  5  
ATOM 9832  H HD2  . PRO A 1 2   ? 17.344  -0.471  -1.835  1.00 0.00 ? 2   PRO A HD2  5  
ATOM 9833  H HD3  . PRO A 1 2   ? 18.343  0.240   -0.531  1.00 0.00 ? 2   PRO A HD3  5  
ATOM 9834  N N    . LEU A 1 3   ? 14.933  -2.523  -0.473  1.00 0.00 ? 3   LEU A N    5  
ATOM 9835  C CA   . LEU A 1 3   ? 13.758  -3.366  -0.833  1.00 0.00 ? 3   LEU A CA   5  
ATOM 9836  C C    . LEU A 1 3   ? 14.242  -4.779  -1.157  1.00 0.00 ? 3   LEU A C    5  
ATOM 9837  O O    . LEU A 1 3   ? 15.139  -4.970  -1.953  1.00 0.00 ? 3   LEU A O    5  
ATOM 9838  C CB   . LEU A 1 3   ? 13.058  -2.771  -2.055  1.00 0.00 ? 3   LEU A CB   5  
ATOM 9839  C CG   . LEU A 1 3   ? 11.784  -3.565  -2.361  1.00 0.00 ? 3   LEU A CG   5  
ATOM 9840  C CD1  . LEU A 1 3   ? 10.693  -3.204  -1.346  1.00 0.00 ? 3   LEU A CD1  5  
ATOM 9841  C CD2  . LEU A 1 3   ? 11.300  -3.224  -3.773  1.00 0.00 ? 3   LEU A CD2  5  
ATOM 9842  H H    . LEU A 1 3   ? 15.421  -2.038  -1.169  1.00 0.00 ? 3   LEU A H    5  
ATOM 9843  H HA   . LEU A 1 3   ? 13.070  -3.402  -0.001  1.00 0.00 ? 3   LEU A HA   5  
ATOM 9844  H HB2  . LEU A 1 3   ? 12.800  -1.741  -1.855  1.00 0.00 ? 3   LEU A HB2  5  
ATOM 9845  H HB3  . LEU A 1 3   ? 13.721  -2.817  -2.907  1.00 0.00 ? 3   LEU A HB3  5  
ATOM 9846  H HG   . LEU A 1 3   ? 11.995  -4.622  -2.298  1.00 0.00 ? 3   LEU A HG   5  
ATOM 9847  H HD11 . LEU A 1 3   ? 10.868  -3.738  -0.423  1.00 0.00 ? 3   LEU A HD11 5  
ATOM 9848  H HD12 . LEU A 1 3   ? 9.728   -3.480  -1.743  1.00 0.00 ? 3   LEU A HD12 5  
ATOM 9849  H HD13 . LEU A 1 3   ? 10.714  -2.142  -1.157  1.00 0.00 ? 3   LEU A HD13 5  
ATOM 9850  H HD21 . LEU A 1 3   ? 11.756  -2.298  -4.096  1.00 0.00 ? 3   LEU A HD21 5  
ATOM 9851  H HD22 . LEU A 1 3   ? 10.227  -3.112  -3.770  1.00 0.00 ? 3   LEU A HD22 5  
ATOM 9852  H HD23 . LEU A 1 3   ? 11.577  -4.017  -4.451  1.00 0.00 ? 3   LEU A HD23 5  
ATOM 9853  N N    . GLY A 1 4   ? 13.658  -5.772  -0.546  1.00 0.00 ? 4   GLY A N    5  
ATOM 9854  C CA   . GLY A 1 4   ? 14.096  -7.168  -0.822  1.00 0.00 ? 4   GLY A CA   5  
ATOM 9855  C C    . GLY A 1 4   ? 12.938  -8.132  -0.562  1.00 0.00 ? 4   GLY A C    5  
ATOM 9856  O O    . GLY A 1 4   ? 11.825  -7.721  -0.296  1.00 0.00 ? 4   GLY A O    5  
ATOM 9857  H H    . GLY A 1 4   ? 12.938  -5.600  0.096   1.00 0.00 ? 4   GLY A H    5  
ATOM 9858  H HA2  . GLY A 1 4   ? 14.409  -7.248  -1.852  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 9859  H HA3  . GLY A 1 4   ? 14.921  -7.422  -0.173  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 9860  N N    . SER A 1 5   ? 13.189  -9.409  -0.643  1.00 0.00 ? 5   SER A N    5  
ATOM 9861  C CA   . SER A 1 5   ? 12.103  -10.400 -0.400  1.00 0.00 ? 5   SER A CA   5  
ATOM 9862  C C    . SER A 1 5   ? 11.877  -10.544 1.104   1.00 0.00 ? 5   SER A C    5  
ATOM 9863  O O    . SER A 1 5   ? 11.095  -11.362 1.551   1.00 0.00 ? 5   SER A O    5  
ATOM 9864  C CB   . SER A 1 5   ? 12.511  -11.752 -0.985  1.00 0.00 ? 5   SER A CB   5  
ATOM 9865  O OG   . SER A 1 5   ? 12.607  -11.645 -2.400  1.00 0.00 ? 5   SER A OG   5  
ATOM 9866  H H    . SER A 1 5   ? 14.094  -9.718  -0.860  1.00 0.00 ? 5   SER A H    5  
ATOM 9867  H HA   . SER A 1 5   ? 11.192  -10.061 -0.873  1.00 0.00 ? 5   SER A HA   5  
ATOM 9868  H HB2  . SER A 1 5   ? 13.468  -12.043 -0.587  1.00 0.00 ? 5   SER A HB2  5  
ATOM 9869  H HB3  . SER A 1 5   ? 11.771  -12.496 -0.720  1.00 0.00 ? 5   SER A HB3  5  
ATOM 9870  H HG   . SER A 1 5   ? 11.752  -11.370 -2.737  1.00 0.00 ? 5   SER A HG   5  
ATOM 9871  N N    . MET A 1 6   ? 12.558  -9.757  1.890   1.00 0.00 ? 6   MET A N    5  
ATOM 9872  C CA   . MET A 1 6   ? 12.387  -9.845  3.365   1.00 0.00 ? 6   MET A CA   5  
ATOM 9873  C C    . MET A 1 6   ? 11.183  -9.011  3.802   1.00 0.00 ? 6   MET A C    5  
ATOM 9874  O O    . MET A 1 6   ? 10.531  -8.368  3.005   1.00 0.00 ? 6   MET A O    5  
ATOM 9875  C CB   . MET A 1 6   ? 13.639  -9.312  4.062   1.00 0.00 ? 6   MET A CB   5  
ATOM 9876  C CG   . MET A 1 6   ? 14.145  -10.342 5.074   1.00 0.00 ? 6   MET A CG   5  
ATOM 9877  S SD   . MET A 1 6   ? 15.177  -9.513  6.305   1.00 0.00 ? 6   MET A SD   5  
ATOM 9878  C CE   . MET A 1 6   ? 13.859  -8.539  7.078   1.00 0.00 ? 6   MET A CE   5  
ATOM 9879  H H    . MET A 1 6   ? 13.181  -9.107  1.512   1.00 0.00 ? 6   MET A H    5  
ATOM 9880  H HA   . MET A 1 6   ? 12.231  -10.875 3.648   1.00 0.00 ? 6   MET A HA   5  
ATOM 9881  H HB2  . MET A 1 6   ? 14.406  -9.123  3.325   1.00 0.00 ? 6   MET A HB2  5  
ATOM 9882  H HB3  . MET A 1 6   ? 13.400  -8.393  4.577   1.00 0.00 ? 6   MET A HB3  5  
ATOM 9883  H HG2  . MET A 1 6   ? 13.304  -10.812 5.564   1.00 0.00 ? 6   MET A HG2  5  
ATOM 9884  H HG3  . MET A 1 6   ? 14.728  -11.093 4.562   1.00 0.00 ? 6   MET A HG3  5  
ATOM 9885  H HE1  . MET A 1 6   ? 13.964  -7.501  6.790   1.00 0.00 ? 6   MET A HE1  5  
ATOM 9886  H HE2  . MET A 1 6   ? 13.932  -8.620  8.150   1.00 0.00 ? 6   MET A HE2  5  
ATOM 9887  H HE3  . MET A 1 6   ? 12.898  -8.912  6.753   1.00 0.00 ? 6   MET A HE3  5  
ATOM 9888  N N    . ALA A 1 7   ? 10.895  -9.019  5.072   1.00 0.00 ? 7   ALA A N    5  
ATOM 9889  C CA   . ALA A 1 7   ? 9.743   -8.235  5.597   1.00 0.00 ? 7   ALA A CA   5  
ATOM 9890  C C    . ALA A 1 7   ? 8.466   -8.602  4.842   1.00 0.00 ? 7   ALA A C    5  
ATOM 9891  O O    . ALA A 1 7   ? 8.501   -9.158  3.761   1.00 0.00 ? 7   ALA A O    5  
ATOM 9892  C CB   . ALA A 1 7   ? 10.021  -6.737  5.445   1.00 0.00 ? 7   ALA A CB   5  
ATOM 9893  H H    . ALA A 1 7   ? 11.445  -9.546  5.688   1.00 0.00 ? 7   ALA A H    5  
ATOM 9894  H HA   . ALA A 1 7   ? 9.608   -8.469  6.642   1.00 0.00 ? 7   ALA A HA   5  
ATOM 9895  H HB1  . ALA A 1 7   ? 11.011  -6.516  5.816   1.00 0.00 ? 7   ALA A HB1  5  
ATOM 9896  H HB2  . ALA A 1 7   ? 9.291   -6.178  6.012   1.00 0.00 ? 7   ALA A HB2  5  
ATOM 9897  H HB3  . ALA A 1 7   ? 9.956   -6.462  4.401   1.00 0.00 ? 7   ALA A HB3  5  
ATOM 9898  N N    . LEU A 1 8   ? 7.340   -8.299  5.418   1.00 0.00 ? 8   LEU A N    5  
ATOM 9899  C CA   . LEU A 1 8   ? 6.042   -8.630  4.758   1.00 0.00 ? 8   LEU A CA   5  
ATOM 9900  C C    . LEU A 1 8   ? 5.446   -7.373  4.122   1.00 0.00 ? 8   LEU A C    5  
ATOM 9901  O O    . LEU A 1 8   ? 5.438   -6.313  4.713   1.00 0.00 ? 8   LEU A O    5  
ATOM 9902  C CB   . LEU A 1 8   ? 5.047   -9.170  5.792   1.00 0.00 ? 8   LEU A CB   5  
ATOM 9903  C CG   . LEU A 1 8   ? 5.788   -9.834  6.954   1.00 0.00 ? 8   LEU A CG   5  
ATOM 9904  C CD1  . LEU A 1 8   ? 6.528   -8.773  7.763   1.00 0.00 ? 8   LEU A CD1  5  
ATOM 9905  C CD2  . LEU A 1 8   ? 4.775   -10.534 7.862   1.00 0.00 ? 8   LEU A CD2  5  
ATOM 9906  H H    . LEU A 1 8   ? 7.349   -7.853  6.293   1.00 0.00 ? 8   LEU A H    5  
ATOM 9907  H HA   . LEU A 1 8   ? 6.207   -9.375  3.994   1.00 0.00 ? 8   LEU A HA   5  
ATOM 9908  H HB2  . LEU A 1 8   ? 4.447   -8.355  6.170   1.00 0.00 ? 8   LEU A HB2  5  
ATOM 9909  H HB3  . LEU A 1 8   ? 4.402   -9.897  5.321   1.00 0.00 ? 8   LEU A HB3  5  
ATOM 9910  H HG   . LEU A 1 8   ? 6.494   -10.557 6.573   1.00 0.00 ? 8   LEU A HG   5  
ATOM 9911  H HD11 . LEU A 1 8   ? 6.251   -7.797  7.399   1.00 0.00 ? 8   LEU A HD11 5  
ATOM 9912  H HD12 . LEU A 1 8   ? 7.597   -8.909  7.653   1.00 0.00 ? 8   LEU A HD12 5  
ATOM 9913  H HD13 . LEU A 1 8   ? 6.261   -8.857  8.802   1.00 0.00 ? 8   LEU A HD13 5  
ATOM 9914  H HD21 . LEU A 1 8   ? 4.289   -11.327 7.315   1.00 0.00 ? 8   LEU A HD21 5  
ATOM 9915  H HD22 . LEU A 1 8   ? 4.035   -9.817  8.194   1.00 0.00 ? 8   LEU A HD22 5  
ATOM 9916  H HD23 . LEU A 1 8   ? 5.286   -10.947 8.719   1.00 0.00 ? 8   LEU A HD23 5  
ATOM 9917  N N    . ARG A 1 9   ? 4.922   -7.490  2.934   1.00 0.00 ? 9   ARG A N    5  
ATOM 9918  C CA   . ARG A 1 9   ? 4.298   -6.306  2.280   1.00 0.00 ? 9   ARG A CA   5  
ATOM 9919  C C    . ARG A 1 9   ? 2.850   -6.208  2.765   1.00 0.00 ? 9   ARG A C    5  
ATOM 9920  O O    . ARG A 1 9   ? 2.139   -7.191  2.807   1.00 0.00 ? 9   ARG A O    5  
ATOM 9921  C CB   . ARG A 1 9   ? 4.326   -6.487  0.758   1.00 0.00 ? 9   ARG A CB   5  
ATOM 9922  C CG   . ARG A 1 9   ? 3.999   -5.158  0.074   1.00 0.00 ? 9   ARG A CG   5  
ATOM 9923  C CD   . ARG A 1 9   ? 4.014   -5.348  -1.444  1.00 0.00 ? 9   ARG A CD   5  
ATOM 9924  N NE   . ARG A 1 9   ? 3.855   -4.027  -2.113  1.00 0.00 ? 9   ARG A NE   5  
ATOM 9925  C CZ   . ARG A 1 9   ? 4.904   -3.299  -2.382  1.00 0.00 ? 9   ARG A CZ   5  
ATOM 9926  N NH1  . ARG A 1 9   ? 6.094   -3.723  -2.053  1.00 0.00 ? 9   ARG A NH1  5  
ATOM 9927  N NH2  . ARG A 1 9   ? 4.765   -2.148  -2.976  1.00 0.00 ? 9   ARG A NH2  5  
ATOM 9928  H H    . ARG A 1 9   ? 4.918   -8.359  2.482   1.00 0.00 ? 9   ARG A H    5  
ATOM 9929  H HA   . ARG A 1 9   ? 4.836   -5.411  2.553   1.00 0.00 ? 9   ARG A HA   5  
ATOM 9930  H HB2  . ARG A 1 9   ? 5.308   -6.816  0.453   1.00 0.00 ? 9   ARG A HB2  5  
ATOM 9931  H HB3  . ARG A 1 9   ? 3.593   -7.224  0.471   1.00 0.00 ? 9   ARG A HB3  5  
ATOM 9932  H HG2  . ARG A 1 9   ? 3.019   -4.824  0.387   1.00 0.00 ? 9   ARG A HG2  5  
ATOM 9933  H HG3  . ARG A 1 9   ? 4.737   -4.419  0.349   1.00 0.00 ? 9   ARG A HG3  5  
ATOM 9934  H HD2  . ARG A 1 9   ? 4.951   -5.794  -1.742  1.00 0.00 ? 9   ARG A HD2  5  
ATOM 9935  H HD3  . ARG A 1 9   ? 3.201   -5.998  -1.733  1.00 0.00 ? 9   ARG A HD3  5  
ATOM 9936  H HE   . ARG A 1 9   ? 2.961   -3.706  -2.356  1.00 0.00 ? 9   ARG A HE   5  
ATOM 9937  H HH11 . ARG A 1 9   ? 6.203   -4.607  -1.597  1.00 0.00 ? 9   ARG A HH11 5  
ATOM 9938  H HH12 . ARG A 1 9   ? 6.897   -3.164  -2.260  1.00 0.00 ? 9   ARG A HH12 5  
ATOM 9939  H HH21 . ARG A 1 9   ? 3.854   -1.823  -3.228  1.00 0.00 ? 9   ARG A HH21 5  
ATOM 9940  H HH22 . ARG A 1 9   ? 5.569   -1.593  -3.182  1.00 0.00 ? 9   ARG A HH22 5  
ATOM 9941  N N    . ALA A 1 10  ? 2.403   -5.041  3.145   1.00 0.00 ? 10  ALA A N    5  
ATOM 9942  C CA   . ALA A 1 10  ? 1.002   -4.922  3.638   1.00 0.00 ? 10  ALA A CA   5  
ATOM 9943  C C    . ALA A 1 10  ? 0.378   -3.615  3.157   1.00 0.00 ? 10  ALA A C    5  
ATOM 9944  O O    . ALA A 1 10  ? 1.063   -2.654  2.868   1.00 0.00 ? 10  ALA A O    5  
ATOM 9945  C CB   . ALA A 1 10  ? 0.997   -4.936  5.165   1.00 0.00 ? 10  ALA A CB   5  
ATOM 9946  H H    . ALA A 1 10  ? 2.988   -4.254  3.117   1.00 0.00 ? 10  ALA A H    5  
ATOM 9947  H HA   . ALA A 1 10  ? 0.419   -5.752  3.273   1.00 0.00 ? 10  ALA A HA   5  
ATOM 9948  H HB1  . ALA A 1 10  ? 2.004   -4.788  5.530   1.00 0.00 ? 10  ALA A HB1  5  
ATOM 9949  H HB2  . ALA A 1 10  ? 0.624   -5.886  5.516   1.00 0.00 ? 10  ALA A HB2  5  
ATOM 9950  H HB3  . ALA A 1 10  ? 0.361   -4.141  5.530   1.00 0.00 ? 10  ALA A HB3  5  
ATOM 9951  N N    . CYS A 1 11  ? -0.922  -3.570  3.084   1.00 0.00 ? 11  CYS A N    5  
ATOM 9952  C CA   . CYS A 1 11  ? -1.598  -2.327  2.638   1.00 0.00 ? 11  CYS A CA   5  
ATOM 9953  C C    . CYS A 1 11  ? -2.924  -2.180  3.385   1.00 0.00 ? 11  CYS A C    5  
ATOM 9954  O O    . CYS A 1 11  ? -3.771  -3.049  3.346   1.00 0.00 ? 11  CYS A O    5  
ATOM 9955  C CB   . CYS A 1 11  ? -1.868  -2.404  1.134   1.00 0.00 ? 11  CYS A CB   5  
ATOM 9956  S SG   . CYS A 1 11  ? -0.441  -1.750  0.233   1.00 0.00 ? 11  CYS A SG   5  
ATOM 9957  H H    . CYS A 1 11  ? -1.453  -4.356  3.334   1.00 0.00 ? 11  CYS A H    5  
ATOM 9958  H HA   . CYS A 1 11  ? -0.968  -1.475  2.849   1.00 0.00 ? 11  CYS A HA   5  
ATOM 9959  H HB2  . CYS A 1 11  ? -2.035  -3.433  0.849   1.00 0.00 ? 11  CYS A HB2  5  
ATOM 9960  H HB3  . CYS A 1 11  ? -2.744  -1.818  0.894   1.00 0.00 ? 11  CYS A HB3  5  
ATOM 9961  H HG   . CYS A 1 11  ? 0.334   -1.853  0.791   1.00 0.00 ? 11  CYS A HG   5  
ATOM 9962  N N    . GLY A 1 12  ? -3.112  -1.080  4.056   1.00 0.00 ? 12  GLY A N    5  
ATOM 9963  C CA   . GLY A 1 12  ? -4.387  -0.864  4.797   1.00 0.00 ? 12  GLY A CA   5  
ATOM 9964  C C    . GLY A 1 12  ? -5.036  0.417   4.281   1.00 0.00 ? 12  GLY A C    5  
ATOM 9965  O O    . GLY A 1 12  ? -4.454  1.134   3.493   1.00 0.00 ? 12  GLY A O    5  
ATOM 9966  H H    . GLY A 1 12  ? -2.415  -0.392  4.069   1.00 0.00 ? 12  GLY A H    5  
ATOM 9967  H HA2  . GLY A 1 12  ? -5.046  -1.701  4.630   1.00 0.00 ? 12  GLY A HA2  5  
ATOM 9968  H HA3  . GLY A 1 12  ? -4.184  -0.766  5.853   1.00 0.00 ? 12  GLY A HA3  5  
ATOM 9969  N N    . LEU A 1 13  ? -6.236  0.715   4.701   1.00 0.00 ? 13  LEU A N    5  
ATOM 9970  C CA   . LEU A 1 13  ? -6.893  1.954   4.199   1.00 0.00 ? 13  LEU A CA   5  
ATOM 9971  C C    . LEU A 1 13  ? -7.235  2.894   5.355   1.00 0.00 ? 13  LEU A C    5  
ATOM 9972  O O    . LEU A 1 13  ? -8.058  2.584   6.195   1.00 0.00 ? 13  LEU A O    5  
ATOM 9973  C CB   . LEU A 1 13  ? -8.200  1.589   3.478   1.00 0.00 ? 13  LEU A CB   5  
ATOM 9974  C CG   . LEU A 1 13  ? -8.097  1.914   1.985   1.00 0.00 ? 13  LEU A CG   5  
ATOM 9975  C CD1  . LEU A 1 13  ? -9.470  1.761   1.328   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 9976  C CD2  . LEU A 1 13  ? -7.612  3.350   1.796   1.00 0.00 ? 13  LEU A CD2  5  
ATOM 9977  H H    . LEU A 1 13  ? -6.703  0.126   5.332   1.00 0.00 ? 13  LEU A H    5  
ATOM 9978  H HA   . LEU A 1 13  ? -6.231  2.457   3.515   1.00 0.00 ? 13  LEU A HA   5  
ATOM 9979  H HB2  . LEU A 1 13  ? -8.395  0.536   3.604   1.00 0.00 ? 13  LEU A HB2  5  
ATOM 9980  H HB3  . LEU A 1 13  ? -9.014  2.156   3.907   1.00 0.00 ? 13  LEU A HB3  5  
ATOM 9981  H HG   . LEU A 1 13  ? -7.404  1.231   1.523   1.00 0.00 ? 13  LEU A HG   5  
ATOM 9982  H HD11 . LEU A 1 13  ? -10.223 1.631   2.091   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 9983  H HD12 . LEU A 1 13  ? -9.464  0.901   0.675   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 9984  H HD13 . LEU A 1 13  ? -9.690  2.650   0.753   1.00 0.00 ? 13  LEU A HD13 5  
ATOM 9985  H HD21 . LEU A 1 13  ? -8.171  3.816   0.997   1.00 0.00 ? 13  LEU A HD21 5  
ATOM 9986  H HD22 . LEU A 1 13  ? -6.563  3.344   1.545   1.00 0.00 ? 13  LEU A HD22 5  
ATOM 9987  H HD23 . LEU A 1 13  ? -7.761  3.906   2.710   1.00 0.00 ? 13  LEU A HD23 5  
ATOM 9988  N N    . ILE A 1 14  ? -6.663  4.068   5.371   1.00 0.00 ? 14  ILE A N    5  
ATOM 9989  C CA   . ILE A 1 14  ? -7.031  5.037   6.434   1.00 0.00 ? 14  ILE A CA   5  
ATOM 9990  C C    . ILE A 1 14  ? -8.289  5.734   5.941   1.00 0.00 ? 14  ILE A C    5  
ATOM 9991  O O    . ILE A 1 14  ? -8.251  6.623   5.115   1.00 0.00 ? 14  ILE A O    5  
ATOM 9992  C CB   . ILE A 1 14  ? -5.902  6.043   6.671   1.00 0.00 ? 14  ILE A CB   5  
ATOM 9993  C CG1  . ILE A 1 14  ? -4.738  5.331   7.364   1.00 0.00 ? 14  ILE A CG1  5  
ATOM 9994  C CG2  . ILE A 1 14  ? -6.407  7.178   7.566   1.00 0.00 ? 14  ILE A CG2  5  
ATOM 9995  C CD1  . ILE A 1 14  ? -3.541  6.276   7.474   1.00 0.00 ? 14  ILE A CD1  5  
ATOM 9996  H H    . ILE A 1 14  ? -6.040  4.325   4.659   1.00 0.00 ? 14  ILE A H    5  
ATOM 9997  H HA   . ILE A 1 14  ? -7.249  4.502   7.348   1.00 0.00 ? 14  ILE A HA   5  
ATOM 9998  H HB   . ILE A 1 14  ? -5.573  6.447   5.725   1.00 0.00 ? 14  ILE A HB   5  
ATOM 9999  H HG12 . ILE A 1 14  ? -5.047  5.025   8.355   1.00 0.00 ? 14  ILE A HG12 5  
ATOM 10000 H HG13 . ILE A 1 14  ? -4.463  4.463   6.793   1.00 0.00 ? 14  ILE A HG13 5  
ATOM 10001 H HG21 . ILE A 1 14  ? -7.300  6.860   8.080   1.00 0.00 ? 14  ILE A HG21 5  
ATOM 10002 H HG22 . ILE A 1 14  ? -6.629  8.043   6.959   1.00 0.00 ? 14  ILE A HG22 5  
ATOM 10003 H HG23 . ILE A 1 14  ? -5.644  7.430   8.289   1.00 0.00 ? 14  ILE A HG23 5  
ATOM 10004 H HD11 . ILE A 1 14  ? -3.647  6.892   8.356   1.00 0.00 ? 14  ILE A HD11 5  
ATOM 10005 H HD12 . ILE A 1 14  ? -3.493  6.904   6.599   1.00 0.00 ? 14  ILE A HD12 5  
ATOM 10006 H HD13 . ILE A 1 14  ? -2.633  5.696   7.552   1.00 0.00 ? 14  ILE A HD13 5  
ATOM 10007 N N    . ILE A 1 15  ? -9.408  5.279   6.407   1.00 0.00 ? 15  ILE A N    5  
ATOM 10008 C CA   . ILE A 1 15  ? -10.704 5.830   5.949   1.00 0.00 ? 15  ILE A CA   5  
ATOM 10009 C C    . ILE A 1 15  ? -11.102 7.037   6.786   1.00 0.00 ? 15  ILE A C    5  
ATOM 10010 O O    . ILE A 1 15  ? -10.944 7.052   7.988   1.00 0.00 ? 15  ILE A O    5  
ATOM 10011 C CB   . ILE A 1 15  ? -11.734 4.717   6.104   1.00 0.00 ? 15  ILE A CB   5  
ATOM 10012 C CG1  . ILE A 1 15  ? -11.333 3.553   5.199   1.00 0.00 ? 15  ILE A CG1  5  
ATOM 10013 C CG2  . ILE A 1 15  ? -13.130 5.207   5.733   1.00 0.00 ? 15  ILE A CG2  5  
ATOM 10014 C CD1  . ILE A 1 15  ? -12.072 2.286   5.622   1.00 0.00 ? 15  ILE A CD1  5  
ATOM 10015 H H    . ILE A 1 15  ? -9.399  4.528   7.038   1.00 0.00 ? 15  ILE A H    5  
ATOM 10016 H HA   . ILE A 1 15  ? -10.635 6.113   4.910   1.00 0.00 ? 15  ILE A HA   5  
ATOM 10017 H HB   . ILE A 1 15  ? -11.734 4.387   7.127   1.00 0.00 ? 15  ILE A HB   5  
ATOM 10018 H HG12 . ILE A 1 15  ? -11.585 3.791   4.176   1.00 0.00 ? 15  ILE A HG12 5  
ATOM 10019 H HG13 . ILE A 1 15  ? -10.270 3.390   5.278   1.00 0.00 ? 15  ILE A HG13 5  
ATOM 10020 H HG21 . ILE A 1 15  ? -13.842 4.802   6.436   1.00 0.00 ? 15  ILE A HG21 5  
ATOM 10021 H HG22 . ILE A 1 15  ? -13.375 4.872   4.736   1.00 0.00 ? 15  ILE A HG22 5  
ATOM 10022 H HG23 . ILE A 1 15  ? -13.160 6.285   5.770   1.00 0.00 ? 15  ILE A HG23 5  
ATOM 10023 H HD11 . ILE A 1 15  ? -11.351 1.513   5.848   1.00 0.00 ? 15  ILE A HD11 5  
ATOM 10024 H HD12 . ILE A 1 15  ? -12.709 1.957   4.816   1.00 0.00 ? 15  ILE A HD12 5  
ATOM 10025 H HD13 . ILE A 1 15  ? -12.669 2.490   6.496   1.00 0.00 ? 15  ILE A HD13 5  
ATOM 10026 N N    . PHE A 1 16  ? -11.624 8.051   6.150   1.00 0.00 ? 16  PHE A N    5  
ATOM 10027 C CA   . PHE A 1 16  ? -12.044 9.261   6.898   1.00 0.00 ? 16  PHE A CA   5  
ATOM 10028 C C    . PHE A 1 16  ? -13.398 9.736   6.375   1.00 0.00 ? 16  PHE A C    5  
ATOM 10029 O O    . PHE A 1 16  ? -13.549 10.039  5.211   1.00 0.00 ? 16  PHE A O    5  
ATOM 10030 C CB   . PHE A 1 16  ? -11.006 10.366  6.698   1.00 0.00 ? 16  PHE A CB   5  
ATOM 10031 C CG   . PHE A 1 16  ? -11.037 10.848  5.268   1.00 0.00 ? 16  PHE A CG   5  
ATOM 10032 C CD1  . PHE A 1 16  ? -11.888 11.899  4.903   1.00 0.00 ? 16  PHE A CD1  5  
ATOM 10033 C CD2  . PHE A 1 16  ? -10.211 10.250  4.308   1.00 0.00 ? 16  PHE A CD2  5  
ATOM 10034 C CE1  . PHE A 1 16  ? -11.910 12.352  3.579   1.00 0.00 ? 16  PHE A CE1  5  
ATOM 10035 C CE2  . PHE A 1 16  ? -10.232 10.703  2.985   1.00 0.00 ? 16  PHE A CE2  5  
ATOM 10036 C CZ   . PHE A 1 16  ? -11.083 11.755  2.619   1.00 0.00 ? 16  PHE A CZ   5  
ATOM 10037 H H    . PHE A 1 16  ? -11.742 8.010   5.178   1.00 0.00 ? 16  PHE A H    5  
ATOM 10038 H HA   . PHE A 1 16  ? -12.123 9.027   7.942   1.00 0.00 ? 16  PHE A HA   5  
ATOM 10039 H HB2  . PHE A 1 16  ? -11.224 11.187  7.361   1.00 0.00 ? 16  PHE A HB2  5  
ATOM 10040 H HB3  . PHE A 1 16  ? -10.026 9.974   6.920   1.00 0.00 ? 16  PHE A HB3  5  
ATOM 10041 H HD1  . PHE A 1 16  ? -12.527 12.360  5.642   1.00 0.00 ? 16  PHE A HD1  5  
ATOM 10042 H HD2  . PHE A 1 16  ? -9.555  9.440   4.591   1.00 0.00 ? 16  PHE A HD2  5  
ATOM 10043 H HE1  . PHE A 1 16  ? -12.566 13.165  3.297   1.00 0.00 ? 16  PHE A HE1  5  
ATOM 10044 H HE2  . PHE A 1 16  ? -9.592  10.243  2.243   1.00 0.00 ? 16  PHE A HE2  5  
ATOM 10045 H HZ   . PHE A 1 16  ? -11.102 12.105  1.597   1.00 0.00 ? 16  PHE A HZ   5  
ATOM 10046 N N    . ARG A 1 17  ? -14.385 9.817   7.224   1.00 0.00 ? 17  ARG A N    5  
ATOM 10047 C CA   . ARG A 1 17  ? -15.716 10.286  6.754   1.00 0.00 ? 17  ARG A CA   5  
ATOM 10048 C C    . ARG A 1 17  ? -15.780 11.809  6.863   1.00 0.00 ? 17  ARG A C    5  
ATOM 10049 O O    . ARG A 1 17  ? -15.716 12.364  7.943   1.00 0.00 ? 17  ARG A O    5  
ATOM 10050 C CB   . ARG A 1 17  ? -16.822 9.674   7.614   1.00 0.00 ? 17  ARG A CB   5  
ATOM 10051 C CG   . ARG A 1 17  ? -18.177 10.024  6.999   1.00 0.00 ? 17  ARG A CG   5  
ATOM 10052 C CD   . ARG A 1 17  ? -19.305 9.475   7.872   1.00 0.00 ? 17  ARG A CD   5  
ATOM 10053 N NE   . ARG A 1 17  ? -19.430 10.301  9.107   1.00 0.00 ? 17  ARG A NE   5  
ATOM 10054 C CZ   . ARG A 1 17  ? -18.805 9.953   10.198  1.00 0.00 ? 17  ARG A CZ   5  
ATOM 10055 N NH1  . ARG A 1 17  ? -18.056 8.885   10.213  1.00 0.00 ? 17  ARG A NH1  5  
ATOM 10056 N NH2  . ARG A 1 17  ? -18.928 10.678  11.277  1.00 0.00 ? 17  ARG A NH2  5  
ATOM 10057 H H    . ARG A 1 17  ? -14.252 9.575   8.164   1.00 0.00 ? 17  ARG A H    5  
ATOM 10058 H HA   . ARG A 1 17  ? -15.859 9.990   5.724   1.00 0.00 ? 17  ARG A HA   5  
ATOM 10059 H HB2  . ARG A 1 17  ? -16.702 8.600   7.647   1.00 0.00 ? 17  ARG A HB2  5  
ATOM 10060 H HB3  . ARG A 1 17  ? -16.766 10.076  8.615   1.00 0.00 ? 17  ARG A HB3  5  
ATOM 10061 H HG2  . ARG A 1 17  ? -18.274 11.097  6.925   1.00 0.00 ? 17  ARG A HG2  5  
ATOM 10062 H HG3  . ARG A 1 17  ? -18.246 9.589   6.014   1.00 0.00 ? 17  ARG A HG3  5  
ATOM 10063 H HD2  . ARG A 1 17  ? -20.231 9.511   7.320   1.00 0.00 ? 17  ARG A HD2  5  
ATOM 10064 H HD3  . ARG A 1 17  ? -19.089 8.451   8.141   1.00 0.00 ? 17  ARG A HD3  5  
ATOM 10065 H HE   . ARG A 1 17  ? -19.988 11.107  9.099   1.00 0.00 ? 17  ARG A HE   5  
ATOM 10066 H HH11 . ARG A 1 17  ? -17.960 8.330   9.387   1.00 0.00 ? 17  ARG A HH11 5  
ATOM 10067 H HH12 . ARG A 1 17  ? -17.578 8.621   11.051  1.00 0.00 ? 17  ARG A HH12 5  
ATOM 10068 H HH21 . ARG A 1 17  ? -19.502 11.497  11.266  1.00 0.00 ? 17  ARG A HH21 5  
ATOM 10069 H HH22 . ARG A 1 17  ? -18.451 10.414  12.115  1.00 0.00 ? 17  ARG A HH22 5  
ATOM 10070 N N    . ARG A 1 18  ? -15.909 12.491  5.760   1.00 0.00 ? 18  ARG A N    5  
ATOM 10071 C CA   . ARG A 1 18  ? -15.982 13.976  5.815   1.00 0.00 ? 18  ARG A CA   5  
ATOM 10072 C C    . ARG A 1 18  ? -17.442 14.405  5.959   1.00 0.00 ? 18  ARG A C    5  
ATOM 10073 O O    . ARG A 1 18  ? -18.324 13.875  5.311   1.00 0.00 ? 18  ARG A O    5  
ATOM 10074 C CB   . ARG A 1 18  ? -15.383 14.566  4.536   1.00 0.00 ? 18  ARG A CB   5  
ATOM 10075 C CG   . ARG A 1 18  ? -15.341 16.090  4.649   1.00 0.00 ? 18  ARG A CG   5  
ATOM 10076 C CD   . ARG A 1 18  ? -14.378 16.651  3.600   1.00 0.00 ? 18  ARG A CD   5  
ATOM 10077 N NE   . ARG A 1 18  ? -14.827 16.241  2.240   1.00 0.00 ? 18  ARG A NE   5  
ATOM 10078 C CZ   . ARG A 1 18  ? -14.122 16.576  1.193   1.00 0.00 ? 18  ARG A CZ   5  
ATOM 10079 N NH1  . ARG A 1 18  ? -13.029 17.273  1.341   1.00 0.00 ? 18  ARG A NH1  5  
ATOM 10080 N NH2  . ARG A 1 18  ? -14.507 16.210  0.002   1.00 0.00 ? 18  ARG A NH2  5  
ATOM 10081 H H    . ARG A 1 18  ? -15.963 12.028  4.899   1.00 0.00 ? 18  ARG A H    5  
ATOM 10082 H HA   . ARG A 1 18  ? -15.422 14.329  6.668   1.00 0.00 ? 18  ARG A HA   5  
ATOM 10083 H HB2  . ARG A 1 18  ? -14.380 14.186  4.397   1.00 0.00 ? 18  ARG A HB2  5  
ATOM 10084 H HB3  . ARG A 1 18  ? -15.992 14.289  3.689   1.00 0.00 ? 18  ARG A HB3  5  
ATOM 10085 H HG2  . ARG A 1 18  ? -16.330 16.491  4.483   1.00 0.00 ? 18  ARG A HG2  5  
ATOM 10086 H HG3  . ARG A 1 18  ? -14.999 16.367  5.633   1.00 0.00 ? 18  ARG A HG3  5  
ATOM 10087 H HD2  . ARG A 1 18  ? -14.365 17.729  3.667   1.00 0.00 ? 18  ARG A HD2  5  
ATOM 10088 H HD3  . ARG A 1 18  ? -13.386 16.268  3.782   1.00 0.00 ? 18  ARG A HD3  5  
ATOM 10089 H HE   . ARG A 1 18  ? -15.649 15.717  2.131   1.00 0.00 ? 18  ARG A HE   5  
ATOM 10090 H HH11 . ARG A 1 18  ? -12.732 17.549  2.254   1.00 0.00 ? 18  ARG A HH11 5  
ATOM 10091 H HH12 . ARG A 1 18  ? -12.489 17.531  0.541   1.00 0.00 ? 18  ARG A HH12 5  
ATOM 10092 H HH21 . ARG A 1 18  ? -15.344 15.674  -0.112  1.00 0.00 ? 18  ARG A HH21 5  
ATOM 10093 H HH22 . ARG A 1 18  ? -13.968 16.468  -0.798  1.00 0.00 ? 18  ARG A HH22 5  
ATOM 10094 N N    . CYS A 1 19  ? -17.710 15.355  6.813   1.00 0.00 ? 19  CYS A N    5  
ATOM 10095 C CA   . CYS A 1 19  ? -19.115 15.811  7.010   1.00 0.00 ? 19  CYS A CA   5  
ATOM 10096 C C    . CYS A 1 19  ? -19.351 17.101  6.221   1.00 0.00 ? 19  CYS A C    5  
ATOM 10097 O O    . CYS A 1 19  ? -18.503 17.969  6.166   1.00 0.00 ? 19  CYS A O    5  
ATOM 10098 C CB   . CYS A 1 19  ? -19.358 16.075  8.496   1.00 0.00 ? 19  CYS A CB   5  
ATOM 10099 S SG   . CYS A 1 19  ? -20.872 15.233  9.018   1.00 0.00 ? 19  CYS A SG   5  
ATOM 10100 H H    . CYS A 1 19  ? -16.986 15.763  7.332   1.00 0.00 ? 19  CYS A H    5  
ATOM 10101 H HA   . CYS A 1 19  ? -19.796 15.048  6.664   1.00 0.00 ? 19  CYS A HA   5  
ATOM 10102 H HB2  . CYS A 1 19  ? -18.522 15.703  9.070   1.00 0.00 ? 19  CYS A HB2  5  
ATOM 10103 H HB3  . CYS A 1 19  ? -19.463 17.137  8.661   1.00 0.00 ? 19  CYS A HB3  5  
ATOM 10104 H HG   . CYS A 1 19  ? -21.527 15.346  8.328   1.00 0.00 ? 19  CYS A HG   5  
ATOM 10105 N N    . LEU A 1 20  ? -20.498 17.232  5.608   1.00 0.00 ? 20  LEU A N    5  
ATOM 10106 C CA   . LEU A 1 20  ? -20.785 18.466  4.825   1.00 0.00 ? 20  LEU A CA   5  
ATOM 10107 C C    . LEU A 1 20  ? -20.603 19.685  5.726   1.00 0.00 ? 20  LEU A C    5  
ATOM 10108 O O    . LEU A 1 20  ? -19.999 20.670  5.347   1.00 0.00 ? 20  LEU A O    5  
ATOM 10109 C CB   . LEU A 1 20  ? -22.231 18.421  4.326   1.00 0.00 ? 20  LEU A CB   5  
ATOM 10110 C CG   . LEU A 1 20  ? -22.484 17.093  3.614   1.00 0.00 ? 20  LEU A CG   5  
ATOM 10111 C CD1  . LEU A 1 20  ? -23.910 17.077  3.058   1.00 0.00 ? 20  LEU A CD1  5  
ATOM 10112 C CD2  . LEU A 1 20  ? -21.483 16.929  2.467   1.00 0.00 ? 20  LEU A CD2  5  
ATOM 10113 H H    . LEU A 1 20  ? -21.167 16.519  5.666   1.00 0.00 ? 20  LEU A H    5  
ATOM 10114 H HA   . LEU A 1 20  ? -20.112 18.530  3.983   1.00 0.00 ? 20  LEU A HA   5  
ATOM 10115 H HB2  . LEU A 1 20  ? -22.905 18.515  5.168   1.00 0.00 ? 20  LEU A HB2  5  
ATOM 10116 H HB3  . LEU A 1 20  ? -22.400 19.236  3.639   1.00 0.00 ? 20  LEU A HB3  5  
ATOM 10117 H HG   . LEU A 1 20  ? -22.363 16.283  4.320   1.00 0.00 ? 20  LEU A HG   5  
ATOM 10118 H HD11 . LEU A 1 20  ? -23.987 16.323  2.288   1.00 0.00 ? 20  LEU A HD11 5  
ATOM 10119 H HD12 . LEU A 1 20  ? -24.144 18.042  2.638   1.00 0.00 ? 20  LEU A HD12 5  
ATOM 10120 H HD13 . LEU A 1 20  ? -24.604 16.850  3.853   1.00 0.00 ? 20  LEU A HD13 5  
ATOM 10121 H HD21 . LEU A 1 20  ? -20.597 16.431  2.831   1.00 0.00 ? 20  LEU A HD21 5  
ATOM 10122 H HD22 . LEU A 1 20  ? -21.216 17.901  2.081   1.00 0.00 ? 20  LEU A HD22 5  
ATOM 10123 H HD23 . LEU A 1 20  ? -21.930 16.339  1.679   1.00 0.00 ? 20  LEU A HD23 5  
ATOM 10124 N N    . ILE A 1 21  ? -21.114 19.624  6.926   1.00 0.00 ? 21  ILE A N    5  
ATOM 10125 C CA   . ILE A 1 21  ? -20.967 20.773  7.863   1.00 0.00 ? 21  ILE A CA   5  
ATOM 10126 C C    . ILE A 1 21  ? -20.797 20.241  9.289   1.00 0.00 ? 21  ILE A C    5  
ATOM 10127 O O    . ILE A 1 21  ? -21.136 19.110  9.576   1.00 0.00 ? 21  ILE A O    5  
ATOM 10128 C CB   . ILE A 1 21  ? -22.211 21.665  7.792   1.00 0.00 ? 21  ILE A CB   5  
ATOM 10129 C CG1  . ILE A 1 21  ? -23.464 20.805  7.590   1.00 0.00 ? 21  ILE A CG1  5  
ATOM 10130 C CG2  . ILE A 1 21  ? -22.077 22.644  6.625   1.00 0.00 ? 21  ILE A CG2  5  
ATOM 10131 C CD1  . ILE A 1 21  ? -23.761 20.014  8.867   1.00 0.00 ? 21  ILE A CD1  5  
ATOM 10132 H H    . ILE A 1 21  ? -21.591 18.815  7.213   1.00 0.00 ? 21  ILE A H    5  
ATOM 10133 H HA   . ILE A 1 21  ? -20.098 21.344  7.582   1.00 0.00 ? 21  ILE A HA   5  
ATOM 10134 H HB   . ILE A 1 21  ? -22.304 22.221  8.714   1.00 0.00 ? 21  ILE A HB   5  
ATOM 10135 H HG12 . ILE A 1 21  ? -24.304 21.446  7.359   1.00 0.00 ? 21  ILE A HG12 5  
ATOM 10136 H HG13 . ILE A 1 21  ? -23.303 20.118  6.772   1.00 0.00 ? 21  ILE A HG13 5  
ATOM 10137 H HG21 . ILE A 1 21  ? -23.050 23.043  6.380   1.00 0.00 ? 21  ILE A HG21 5  
ATOM 10138 H HG22 . ILE A 1 21  ? -21.671 22.130  5.768   1.00 0.00 ? 21  ILE A HG22 5  
ATOM 10139 H HG23 . ILE A 1 21  ? -21.417 23.452  6.908   1.00 0.00 ? 21  ILE A HG23 5  
ATOM 10140 H HD11 . ILE A 1 21  ? -23.390 20.557  9.724   1.00 0.00 ? 21  ILE A HD11 5  
ATOM 10141 H HD12 . ILE A 1 21  ? -23.279 19.050  8.816   1.00 0.00 ? 21  ILE A HD12 5  
ATOM 10142 H HD13 . ILE A 1 21  ? -24.829 19.877  8.965   1.00 0.00 ? 21  ILE A HD13 5  
ATOM 10143 N N    . PRO A 1 22  ? -20.278 21.049  10.182  1.00 0.00 ? 22  PRO A N    5  
ATOM 10144 C CA   . PRO A 1 22  ? -20.069 20.649  11.598  1.00 0.00 ? 22  PRO A CA   5  
ATOM 10145 C C    . PRO A 1 22  ? -21.374 20.633  12.395  1.00 0.00 ? 22  PRO A C    5  
ATOM 10146 O O    . PRO A 1 22  ? -22.354 21.246  12.022  1.00 0.00 ? 22  PRO A O    5  
ATOM 10147 C CB   . PRO A 1 22  ? -19.118 21.701  12.171  1.00 0.00 ? 22  PRO A CB   5  
ATOM 10148 C CG   . PRO A 1 22  ? -18.829 22.680  11.072  1.00 0.00 ? 22  PRO A CG   5  
ATOM 10149 C CD   . PRO A 1 22  ? -19.837 22.428  9.950   1.00 0.00 ? 22  PRO A CD   5  
ATOM 10150 H HA   . PRO A 1 22  ? -19.598 19.680  11.642  1.00 0.00 ? 22  PRO A HA   5  
ATOM 10151 H HB2  . PRO A 1 22  ? -19.589 22.203  13.003  1.00 0.00 ? 22  PRO A HB2  5  
ATOM 10152 H HB3  . PRO A 1 22  ? -18.201 21.234  12.495  1.00 0.00 ? 22  PRO A HB3  5  
ATOM 10153 H HG2  . PRO A 1 22  ? -18.935 23.689  11.445  1.00 0.00 ? 22  PRO A HG2  5  
ATOM 10154 H HG3  . PRO A 1 22  ? -17.829 22.528  10.699  1.00 0.00 ? 22  PRO A HG3  5  
ATOM 10155 H HD2  . PRO A 1 22  ? -20.670 23.115  10.027  1.00 0.00 ? 22  PRO A HD2  5  
ATOM 10156 H HD3  . PRO A 1 22  ? -19.357 22.515  8.992   1.00 0.00 ? 22  PRO A HD3  5  
ATOM 10157 N N    . LYS A 1 23  ? -21.384 19.939  13.496  1.00 0.00 ? 23  LYS A N    5  
ATOM 10158 C CA   . LYS A 1 23  ? -22.612 19.874  14.338  1.00 0.00 ? 23  LYS A CA   5  
ATOM 10159 C C    . LYS A 1 23  ? -22.212 20.046  15.801  1.00 0.00 ? 23  LYS A C    5  
ATOM 10160 O O    . LYS A 1 23  ? -22.367 21.101  16.382  1.00 0.00 ? 23  LYS A O    5  
ATOM 10161 C CB   . LYS A 1 23  ? -23.277 18.514  14.145  1.00 0.00 ? 23  LYS A CB   5  
ATOM 10162 C CG   . LYS A 1 23  ? -23.786 18.397  12.707  1.00 0.00 ? 23  LYS A CG   5  
ATOM 10163 C CD   . LYS A 1 23  ? -24.035 16.925  12.374  1.00 0.00 ? 23  LYS A CD   5  
ATOM 10164 C CE   . LYS A 1 23  ? -22.698 16.179  12.373  1.00 0.00 ? 23  LYS A CE   5  
ATOM 10165 N NZ   . LYS A 1 23  ? -22.691 15.173  11.275  1.00 0.00 ? 23  LYS A NZ   5  
ATOM 10166 H H    . LYS A 1 23  ? -20.576 19.459  13.775  1.00 0.00 ? 23  LYS A H    5  
ATOM 10167 H HA   . LYS A 1 23  ? -23.292 20.660  14.051  1.00 0.00 ? 23  LYS A HA   5  
ATOM 10168 H HB2  . LYS A 1 23  ? -22.559 17.732  14.339  1.00 0.00 ? 23  LYS A HB2  5  
ATOM 10169 H HB3  . LYS A 1 23  ? -24.109 18.419  14.829  1.00 0.00 ? 23  LYS A HB3  5  
ATOM 10170 H HG2  . LYS A 1 23  ? -24.709 18.950  12.607  1.00 0.00 ? 23  LYS A HG2  5  
ATOM 10171 H HG3  . LYS A 1 23  ? -23.050 18.800  12.029  1.00 0.00 ? 23  LYS A HG3  5  
ATOM 10172 H HD2  . LYS A 1 23  ? -24.692 16.493  13.117  1.00 0.00 ? 23  LYS A HD2  5  
ATOM 10173 H HD3  . LYS A 1 23  ? -24.489 16.848  11.399  1.00 0.00 ? 23  LYS A HD3  5  
ATOM 10174 H HE2  . LYS A 1 23  ? -21.890 16.884  12.223  1.00 0.00 ? 23  LYS A HE2  5  
ATOM 10175 H HE3  . LYS A 1 23  ? -22.564 15.681  13.322  1.00 0.00 ? 23  LYS A HE3  5  
ATOM 10176 H HZ1  . LYS A 1 23  ? -23.462 14.494  11.425  1.00 0.00 ? 23  LYS A HZ1  5  
ATOM 10177 H HZ2  . LYS A 1 23  ? -21.780 14.671  11.274  1.00 0.00 ? 23  LYS A HZ2  5  
ATOM 10178 H HZ3  . LYS A 1 23  ? -22.826 15.654  10.364  1.00 0.00 ? 23  LYS A HZ3  5  
ATOM 10179 N N    . VAL A 1 24  ? -21.680 19.015  16.390  1.00 0.00 ? 24  VAL A N    5  
ATOM 10180 C CA   . VAL A 1 24  ? -21.243 19.105  17.810  1.00 0.00 ? 24  VAL A CA   5  
ATOM 10181 C C    . VAL A 1 24  ? -20.053 20.063  17.897  1.00 0.00 ? 24  VAL A C    5  
ATOM 10182 O O    . VAL A 1 24  ? -19.568 20.374  18.967  1.00 0.00 ? 24  VAL A O    5  
ATOM 10183 C CB   . VAL A 1 24  ? -20.830 17.719  18.305  1.00 0.00 ? 24  VAL A CB   5  
ATOM 10184 C CG1  . VAL A 1 24  ? -20.290 17.821  19.731  1.00 0.00 ? 24  VAL A CG1  5  
ATOM 10185 C CG2  . VAL A 1 24  ? -22.046 16.792  18.285  1.00 0.00 ? 24  VAL A CG2  5  
ATOM 10186 H H    . VAL A 1 24  ? -21.556 18.181  15.891  1.00 0.00 ? 24  VAL A H    5  
ATOM 10187 H HA   . VAL A 1 24  ? -22.054 19.481  18.417  1.00 0.00 ? 24  VAL A HA   5  
ATOM 10188 H HB   . VAL A 1 24  ? -20.061 17.319  17.658  1.00 0.00 ? 24  VAL A HB   5  
ATOM 10189 H HG11 . VAL A 1 24  ? -19.213 17.881  19.703  1.00 0.00 ? 24  VAL A HG11 5  
ATOM 10190 H HG12 . VAL A 1 24  ? -20.588 16.946  20.291  1.00 0.00 ? 24  VAL A HG12 5  
ATOM 10191 H HG13 . VAL A 1 24  ? -20.688 18.706  20.205  1.00 0.00 ? 24  VAL A HG13 5  
ATOM 10192 H HG21 . VAL A 1 24  ? -21.740 15.789  18.543  1.00 0.00 ? 24  VAL A HG21 5  
ATOM 10193 H HG22 . VAL A 1 24  ? -22.480 16.794  17.296  1.00 0.00 ? 24  VAL A HG22 5  
ATOM 10194 H HG23 . VAL A 1 24  ? -22.776 17.140  19.000  1.00 0.00 ? 24  VAL A HG23 5  
ATOM 10195 N N    . ASP A 1 25  ? -19.578 20.522  16.768  1.00 0.00 ? 25  ASP A N    5  
ATOM 10196 C CA   . ASP A 1 25  ? -18.415 21.454  16.755  1.00 0.00 ? 25  ASP A CA   5  
ATOM 10197 C C    . ASP A 1 25  ? -17.212 20.780  17.408  1.00 0.00 ? 25  ASP A C    5  
ATOM 10198 O O    . ASP A 1 25  ? -16.517 21.363  18.216  1.00 0.00 ? 25  ASP A O    5  
ATOM 10199 C CB   . ASP A 1 25  ? -18.763 22.738  17.517  1.00 0.00 ? 25  ASP A CB   5  
ATOM 10200 C CG   . ASP A 1 25  ? -19.861 23.494  16.765  1.00 0.00 ? 25  ASP A CG   5  
ATOM 10201 O OD1  . ASP A 1 25  ? -20.429 24.405  17.345  1.00 0.00 ? 25  ASP A OD1  5  
ATOM 10202 O OD2  . ASP A 1 25  ? -20.113 23.152  15.623  1.00 0.00 ? 25  ASP A OD2  5  
ATOM 10203 H H    . ASP A 1 25  ? -19.989 20.246  15.923  1.00 0.00 ? 25  ASP A H    5  
ATOM 10204 H HA   . ASP A 1 25  ? -18.169 21.701  15.735  1.00 0.00 ? 25  ASP A HA   5  
ATOM 10205 H HB2  . ASP A 1 25  ? -19.111 22.486  18.508  1.00 0.00 ? 25  ASP A HB2  5  
ATOM 10206 H HB3  . ASP A 1 25  ? -17.885 23.360  17.591  1.00 0.00 ? 25  ASP A HB3  5  
ATOM 10207 H HD2  . ASP A 1 25  ? -20.811 23.670  15.214  1.00 0.00 ? 25  ASP A HD2  5  
ATOM 10208 N N    . ASN A 1 26  ? -16.955 19.552  17.051  1.00 0.00 ? 26  ASN A N    5  
ATOM 10209 C CA   . ASN A 1 26  ? -15.797 18.826  17.634  1.00 0.00 ? 26  ASN A CA   5  
ATOM 10210 C C    . ASN A 1 26  ? -14.858 18.390  16.512  1.00 0.00 ? 26  ASN A C    5  
ATOM 10211 O O    . ASN A 1 26  ? -13.946 19.099  16.139  1.00 0.00 ? 26  ASN A O    5  
ATOM 10212 C CB   . ASN A 1 26  ? -16.293 17.594  18.392  1.00 0.00 ? 26  ASN A CB   5  
ATOM 10213 C CG   . ASN A 1 26  ? -15.098 16.754  18.845  1.00 0.00 ? 26  ASN A CG   5  
ATOM 10214 O OD1  . ASN A 1 26  ? -14.956 15.616  18.446  1.00 0.00 ? 26  ASN A OD1  5  
ATOM 10215 N ND2  . ASN A 1 26  ? -14.221 17.275  19.658  1.00 0.00 ? 26  ASN A ND2  5  
ATOM 10216 H H    . ASN A 1 26  ? -17.529 19.107  16.393  1.00 0.00 ? 26  ASN A H    5  
ATOM 10217 H HA   . ASN A 1 26  ? -15.266 19.477  18.312  1.00 0.00 ? 26  ASN A HA   5  
ATOM 10218 H HB2  . ASN A 1 26  ? -16.861 17.909  19.256  1.00 0.00 ? 26  ASN A HB2  5  
ATOM 10219 H HB3  . ASN A 1 26  ? -16.922 17.002  17.744  1.00 0.00 ? 26  ASN A HB3  5  
ATOM 10220 H HD21 . ASN A 1 26  ? -14.333 18.195  19.975  1.00 0.00 ? 26  ASN A HD21 5  
ATOM 10221 H HD22 . ASN A 1 26  ? -13.451 16.746  19.953  1.00 0.00 ? 26  ASN A HD22 5  
ATOM 10222 N N    . ASN A 1 27  ? -15.079 17.226  15.974  1.00 0.00 ? 27  ASN A N    5  
ATOM 10223 C CA   . ASN A 1 27  ? -14.203 16.734  14.873  1.00 0.00 ? 27  ASN A CA   5  
ATOM 10224 C C    . ASN A 1 27  ? -14.981 16.721  13.557  1.00 0.00 ? 27  ASN A C    5  
ATOM 10225 O O    . ASN A 1 27  ? -15.929 15.979  13.394  1.00 0.00 ? 27  ASN A O    5  
ATOM 10226 C CB   . ASN A 1 27  ? -13.726 15.318  15.197  1.00 0.00 ? 27  ASN A CB   5  
ATOM 10227 C CG   . ASN A 1 27  ? -12.859 15.349  16.456  1.00 0.00 ? 27  ASN A CG   5  
ATOM 10228 O OD1  . ASN A 1 27  ? -13.109 14.622  17.398  1.00 0.00 ? 27  ASN A OD1  5  
ATOM 10229 N ND2  . ASN A 1 27  ? -11.839 16.163  16.511  1.00 0.00 ? 27  ASN A ND2  5  
ATOM 10230 H H    . ASN A 1 27  ? -15.822 16.675  16.294  1.00 0.00 ? 27  ASN A H    5  
ATOM 10231 H HA   . ASN A 1 27  ? -13.347 17.386  14.777  1.00 0.00 ? 27  ASN A HA   5  
ATOM 10232 H HB2  . ASN A 1 27  ? -14.583 14.680  15.365  1.00 0.00 ? 27  ASN A HB2  5  
ATOM 10233 H HB3  . ASN A 1 27  ? -13.146 14.936  14.372  1.00 0.00 ? 27  ASN A HB3  5  
ATOM 10234 H HD21 . ASN A 1 27  ? -11.637 16.745  15.750  1.00 0.00 ? 27  ASN A HD21 5  
ATOM 10235 H HD22 . ASN A 1 27  ? -11.277 16.191  17.312  1.00 0.00 ? 27  ASN A HD22 5  
ATOM 10236 N N    . ALA A 1 28  ? -14.585 17.532  12.616  1.00 0.00 ? 28  ALA A N    5  
ATOM 10237 C CA   . ALA A 1 28  ? -15.297 17.559  11.308  1.00 0.00 ? 28  ALA A CA   5  
ATOM 10238 C C    . ALA A 1 28  ? -15.052 16.247  10.563  1.00 0.00 ? 28  ALA A C    5  
ATOM 10239 O O    . ALA A 1 28  ? -15.905 15.757  9.849   1.00 0.00 ? 28  ALA A O    5  
ATOM 10240 C CB   . ALA A 1 28  ? -14.767 18.719  10.464  1.00 0.00 ? 28  ALA A CB   5  
ATOM 10241 H H    . ALA A 1 28  ? -13.814 18.118  12.767  1.00 0.00 ? 28  ALA A H    5  
ATOM 10242 H HA   . ALA A 1 28  ? -16.357 17.689  11.476  1.00 0.00 ? 28  ALA A HA   5  
ATOM 10243 H HB1  . ALA A 1 28  ? -15.542 19.057  9.789   1.00 0.00 ? 28  ALA A HB1  5  
ATOM 10244 H HB2  . ALA A 1 28  ? -13.913 18.384  9.893   1.00 0.00 ? 28  ALA A HB2  5  
ATOM 10245 H HB3  . ALA A 1 28  ? -14.473 19.531  11.112  1.00 0.00 ? 28  ALA A HB3  5  
ATOM 10246 N N    . ILE A 1 29  ? -13.884 15.685  10.713  1.00 0.00 ? 29  ILE A N    5  
ATOM 10247 C CA   . ILE A 1 29  ? -13.567 14.413  10.008  1.00 0.00 ? 29  ILE A CA   5  
ATOM 10248 C C    . ILE A 1 29  ? -13.317 13.289  11.012  1.00 0.00 ? 29  ILE A C    5  
ATOM 10249 O O    . ILE A 1 29  ? -12.673 13.471  12.026  1.00 0.00 ? 29  ILE A O    5  
ATOM 10250 C CB   . ILE A 1 29  ? -12.322 14.614  9.145   1.00 0.00 ? 29  ILE A CB   5  
ATOM 10251 C CG1  . ILE A 1 29  ? -12.694 15.434  7.908   1.00 0.00 ? 29  ILE A CG1  5  
ATOM 10252 C CG2  . ILE A 1 29  ? -11.766 13.257  8.717   1.00 0.00 ? 29  ILE A CG2  5  
ATOM 10253 C CD1  . ILE A 1 29  ? -11.446 16.121  7.350   1.00 0.00 ? 29  ILE A CD1  5  
ATOM 10254 H H    . ILE A 1 29  ? -13.210 16.106  11.286  1.00 0.00 ? 29  ILE A H    5  
ATOM 10255 H HA   . ILE A 1 29  ? -14.397 14.140  9.371   1.00 0.00 ? 29  ILE A HA   5  
ATOM 10256 H HB   . ILE A 1 29  ? -11.573 15.144  9.715   1.00 0.00 ? 29  ILE A HB   5  
ATOM 10257 H HG12 . ILE A 1 29  ? -13.110 14.777  7.156   1.00 0.00 ? 29  ILE A HG12 5  
ATOM 10258 H HG13 . ILE A 1 29  ? -13.427 16.178  8.179   1.00 0.00 ? 29  ILE A HG13 5  
ATOM 10259 H HG21 . ILE A 1 29  ? -11.144 13.381  7.843   1.00 0.00 ? 29  ILE A HG21 5  
ATOM 10260 H HG22 . ILE A 1 29  ? -12.582 12.591  8.488   1.00 0.00 ? 29  ILE A HG22 5  
ATOM 10261 H HG23 . ILE A 1 29  ? -11.177 12.840  9.522   1.00 0.00 ? 29  ILE A HG23 5  
ATOM 10262 H HD11 . ILE A 1 29  ? -10.745 15.374  7.011   1.00 0.00 ? 29  ILE A HD11 5  
ATOM 10263 H HD12 . ILE A 1 29  ? -10.988 16.716  8.124   1.00 0.00 ? 29  ILE A HD12 5  
ATOM 10264 H HD13 . ILE A 1 29  ? -11.724 16.757  6.524   1.00 0.00 ? 29  ILE A HD13 5  
ATOM 10265 N N    . GLU A 1 30  ? -13.820 12.123  10.720  1.00 0.00 ? 30  GLU A N    5  
ATOM 10266 C CA   . GLU A 1 30  ? -13.619 10.958  11.629  1.00 0.00 ? 30  GLU A CA   5  
ATOM 10267 C C    . GLU A 1 30  ? -12.997 9.820   10.823  1.00 0.00 ? 30  GLU A C    5  
ATOM 10268 O O    . GLU A 1 30  ? -13.089 9.799   9.612   1.00 0.00 ? 30  GLU A O    5  
ATOM 10269 C CB   . GLU A 1 30  ? -14.967 10.510  12.196  1.00 0.00 ? 30  GLU A CB   5  
ATOM 10270 C CG   . GLU A 1 30  ? -15.621 11.676  12.943  1.00 0.00 ? 30  GLU A CG   5  
ATOM 10271 C CD   . GLU A 1 30  ? -16.924 11.200  13.589  1.00 0.00 ? 30  GLU A CD   5  
ATOM 10272 O OE1  . GLU A 1 30  ? -17.512 11.973  14.326  1.00 0.00 ? 30  GLU A OE1  5  
ATOM 10273 O OE2  . GLU A 1 30  ? -17.306 10.068  13.339  1.00 0.00 ? 30  GLU A OE2  5  
ATOM 10274 H H    . GLU A 1 30  ? -14.324 12.010  9.887   1.00 0.00 ? 30  GLU A H    5  
ATOM 10275 H HA   . GLU A 1 30  ? -12.958 11.235  12.435  1.00 0.00 ? 30  GLU A HA   5  
ATOM 10276 H HB2  . GLU A 1 30  ? -15.611 10.193  11.387  1.00 0.00 ? 30  GLU A HB2  5  
ATOM 10277 H HB3  . GLU A 1 30  ? -14.816 9.687   12.878  1.00 0.00 ? 30  GLU A HB3  5  
ATOM 10278 H HG2  . GLU A 1 30  ? -14.949 12.034  13.708  1.00 0.00 ? 30  GLU A HG2  5  
ATOM 10279 H HG3  . GLU A 1 30  ? -15.836 12.473  12.249  1.00 0.00 ? 30  GLU A HG3  5  
ATOM 10280 H HE2  . GLU A 1 30  ? -18.128 9.838   13.779  1.00 0.00 ? 30  GLU A HE2  5  
ATOM 10281 N N    . PHE A 1 31  ? -12.354 8.884   11.467  1.00 0.00 ? 31  PHE A N    5  
ATOM 10282 C CA   . PHE A 1 31  ? -11.718 7.769   10.707  1.00 0.00 ? 31  PHE A CA   5  
ATOM 10283 C C    . PHE A 1 31  ? -12.331 6.427   11.111  1.00 0.00 ? 31  PHE A C    5  
ATOM 10284 O O    . PHE A 1 31  ? -12.808 6.255   12.215  1.00 0.00 ? 31  PHE A O    5  
ATOM 10285 C CB   . PHE A 1 31  ? -10.215 7.746   11.000  1.00 0.00 ? 31  PHE A CB   5  
ATOM 10286 C CG   . PHE A 1 31  ? -9.599  9.069   10.611  1.00 0.00 ? 31  PHE A CG   5  
ATOM 10287 C CD1  . PHE A 1 31  ? -9.171  9.287   9.294   1.00 0.00 ? 31  PHE A CD1  5  
ATOM 10288 C CD2  . PHE A 1 31  ? -9.445  10.076  11.571  1.00 0.00 ? 31  PHE A CD2  5  
ATOM 10289 C CE1  . PHE A 1 31  ? -8.596  10.513  8.939   1.00 0.00 ? 31  PHE A CE1  5  
ATOM 10290 C CE2  . PHE A 1 31  ? -8.872  11.303  11.213  1.00 0.00 ? 31  PHE A CE2  5  
ATOM 10291 C CZ   . PHE A 1 31  ? -8.445  11.519  9.899   1.00 0.00 ? 31  PHE A CZ   5  
ATOM 10292 H H    . PHE A 1 31  ? -12.279 8.922   12.444  1.00 0.00 ? 31  PHE A H    5  
ATOM 10293 H HA   . PHE A 1 31  ? -11.870 7.922   9.654   1.00 0.00 ? 31  PHE A HA   5  
ATOM 10294 H HB2  . PHE A 1 31  ? -10.058 7.573   12.055  1.00 0.00 ? 31  PHE A HB2  5  
ATOM 10295 H HB3  . PHE A 1 31  ? -9.750  6.954   10.434  1.00 0.00 ? 31  PHE A HB3  5  
ATOM 10296 H HD1  . PHE A 1 31  ? -9.287  8.511   8.552   1.00 0.00 ? 31  PHE A HD1  5  
ATOM 10297 H HD2  . PHE A 1 31  ? -9.773  9.911   12.585  1.00 0.00 ? 31  PHE A HD2  5  
ATOM 10298 H HE1  . PHE A 1 31  ? -8.264  10.686  7.927   1.00 0.00 ? 31  PHE A HE1  5  
ATOM 10299 H HE2  . PHE A 1 31  ? -8.752  12.081  11.954  1.00 0.00 ? 31  PHE A HE2  5  
ATOM 10300 H HZ   . PHE A 1 31  ? -8.005  12.463  9.624   1.00 0.00 ? 31  PHE A HZ   5  
ATOM 10301 N N    . LEU A 1 32  ? -12.301 5.467   10.223  1.00 0.00 ? 32  LEU A N    5  
ATOM 10302 C CA   . LEU A 1 32  ? -12.862 4.125   10.550  1.00 0.00 ? 32  LEU A CA   5  
ATOM 10303 C C    . LEU A 1 32  ? -11.793 3.310   11.275  1.00 0.00 ? 32  LEU A C    5  
ATOM 10304 O O    . LEU A 1 32  ? -10.680 3.174   10.807  1.00 0.00 ? 32  LEU A O    5  
ATOM 10305 C CB   . LEU A 1 32  ? -13.270 3.395   9.262   1.00 0.00 ? 32  LEU A CB   5  
ATOM 10306 C CG   . LEU A 1 32  ? -13.664 1.952   9.587   1.00 0.00 ? 32  LEU A CG   5  
ATOM 10307 C CD1  . LEU A 1 32  ? -14.799 1.945   10.609  1.00 0.00 ? 32  LEU A CD1  5  
ATOM 10308 C CD2  . LEU A 1 32  ? -14.130 1.251   8.310   1.00 0.00 ? 32  LEU A CD2  5  
ATOM 10309 H H    . LEU A 1 32  ? -11.899 5.627   9.344   1.00 0.00 ? 32  LEU A H    5  
ATOM 10310 H HA   . LEU A 1 32  ? -13.723 4.240   11.190  1.00 0.00 ? 32  LEU A HA   5  
ATOM 10311 H HB2  . LEU A 1 32  ? -14.106 3.905   8.805   1.00 0.00 ? 32  LEU A HB2  5  
ATOM 10312 H HB3  . LEU A 1 32  ? -12.443 3.389   8.578   1.00 0.00 ? 32  LEU A HB3  5  
ATOM 10313 H HG   . LEU A 1 32  ? -12.812 1.429   9.994   1.00 0.00 ? 32  LEU A HG   5  
ATOM 10314 H HD11 . LEU A 1 32  ? -15.349 1.020   10.529  1.00 0.00 ? 32  LEU A HD11 5  
ATOM 10315 H HD12 . LEU A 1 32  ? -15.459 2.776   10.419  1.00 0.00 ? 32  LEU A HD12 5  
ATOM 10316 H HD13 . LEU A 1 32  ? -14.387 2.032   11.603  1.00 0.00 ? 32  LEU A HD13 5  
ATOM 10317 H HD21 . LEU A 1 32  ? -13.288 0.764   7.839   1.00 0.00 ? 32  LEU A HD21 5  
ATOM 10318 H HD22 . LEU A 1 32  ? -14.551 1.977   7.633   1.00 0.00 ? 32  LEU A HD22 5  
ATOM 10319 H HD23 . LEU A 1 32  ? -14.880 0.513   8.557   1.00 0.00 ? 32  LEU A HD23 5  
ATOM 10320 N N    . LEU A 1 33  ? -12.122 2.771   12.411  1.00 0.00 ? 33  LEU A N    5  
ATOM 10321 C CA   . LEU A 1 33  ? -11.128 1.966   13.170  1.00 0.00 ? 33  LEU A CA   5  
ATOM 10322 C C    . LEU A 1 33  ? -11.707 0.586   13.470  1.00 0.00 ? 33  LEU A C    5  
ATOM 10323 O O    . LEU A 1 33  ? -12.839 0.455   13.889  1.00 0.00 ? 33  LEU A O    5  
ATOM 10324 C CB   . LEU A 1 33  ? -10.789 2.679   14.480  1.00 0.00 ? 33  LEU A CB   5  
ATOM 10325 C CG   . LEU A 1 33  ? -9.681  3.703   14.229  1.00 0.00 ? 33  LEU A CG   5  
ATOM 10326 C CD1  . LEU A 1 33  ? -9.651  4.717   15.373  1.00 0.00 ? 33  LEU A CD1  5  
ATOM 10327 C CD2  . LEU A 1 33  ? -8.334  2.981   14.159  1.00 0.00 ? 33  LEU A CD2  5  
ATOM 10328 H H    . LEU A 1 33  ? -13.026 2.895   12.768  1.00 0.00 ? 33  LEU A H    5  
ATOM 10329 H HA   . LEU A 1 33  ? -10.230 1.855   12.580  1.00 0.00 ? 33  LEU A HA   5  
ATOM 10330 H HB2  . LEU A 1 33  ? -11.669 3.183   14.852  1.00 0.00 ? 33  LEU A HB2  5  
ATOM 10331 H HB3  . LEU A 1 33  ? -10.454 1.958   15.206  1.00 0.00 ? 33  LEU A HB3  5  
ATOM 10332 H HG   . LEU A 1 33  ? -9.867  4.217   13.297  1.00 0.00 ? 33  LEU A HG   5  
ATOM 10333 H HD11 . LEU A 1 33  ? -9.987  5.676   15.011  1.00 0.00 ? 33  LEU A HD11 5  
ATOM 10334 H HD12 . LEU A 1 33  ? -8.643  4.805   15.747  1.00 0.00 ? 33  LEU A HD12 5  
ATOM 10335 H HD13 . LEU A 1 33  ? -10.303 4.384   16.170  1.00 0.00 ? 33  LEU A HD13 5  
ATOM 10336 H HD21 . LEU A 1 33  ? -7.762  3.364   13.327  1.00 0.00 ? 33  LEU A HD21 5  
ATOM 10337 H HD22 . LEU A 1 33  ? -8.498  1.924   14.024  1.00 0.00 ? 33  LEU A HD22 5  
ATOM 10338 H HD23 . LEU A 1 33  ? -7.787  3.146   15.076  1.00 0.00 ? 33  LEU A HD23 5  
ATOM 10339 N N    . LEU A 1 34  ? -10.936 -0.441  13.256  1.00 0.00 ? 34  LEU A N    5  
ATOM 10340 C CA   . LEU A 1 34  ? -11.429 -1.817  13.527  1.00 0.00 ? 34  LEU A CA   5  
ATOM 10341 C C    . LEU A 1 34  ? -10.736 -2.362  14.775  1.00 0.00 ? 34  LEU A C    5  
ATOM 10342 O O    . LEU A 1 34  ? -9.563  -2.134  14.991  1.00 0.00 ? 34  LEU A O    5  
ATOM 10343 C CB   . LEU A 1 34  ? -11.113 -2.709  12.324  1.00 0.00 ? 34  LEU A CB   5  
ATOM 10344 C CG   . LEU A 1 34  ? -11.646 -2.044  11.050  1.00 0.00 ? 34  LEU A CG   5  
ATOM 10345 C CD1  . LEU A 1 34  ? -11.410 -2.964  9.854   1.00 0.00 ? 34  LEU A CD1  5  
ATOM 10346 C CD2  . LEU A 1 34  ? -13.144 -1.784  11.198  1.00 0.00 ? 34  LEU A CD2  5  
ATOM 10347 H H    . LEU A 1 34  ? -10.027 -0.306  12.917  1.00 0.00 ? 34  LEU A H    5  
ATOM 10348 H HA   . LEU A 1 34  ? -12.497 -1.795  13.688  1.00 0.00 ? 34  LEU A HA   5  
ATOM 10349 H HB2  . LEU A 1 34  ? -10.044 -2.840  12.246  1.00 0.00 ? 34  LEU A HB2  5  
ATOM 10350 H HB3  . LEU A 1 34  ? -11.588 -3.669  12.453  1.00 0.00 ? 34  LEU A HB3  5  
ATOM 10351 H HG   . LEU A 1 34  ? -11.131 -1.107  10.891  1.00 0.00 ? 34  LEU A HG   5  
ATOM 10352 H HD11 . LEU A 1 34  ? -11.552 -3.990  10.154  1.00 0.00 ? 34  LEU A HD11 5  
ATOM 10353 H HD12 . LEU A 1 34  ? -10.402 -2.830  9.491   1.00 0.00 ? 34  LEU A HD12 5  
ATOM 10354 H HD13 . LEU A 1 34  ? -12.111 -2.717  9.069   1.00 0.00 ? 34  LEU A HD13 5  
ATOM 10355 H HD21 . LEU A 1 34  ? -13.298 -0.861  11.735  1.00 0.00 ? 34  LEU A HD21 5  
ATOM 10356 H HD22 . LEU A 1 34  ? -13.598 -2.597  11.745  1.00 0.00 ? 34  LEU A HD22 5  
ATOM 10357 H HD23 . LEU A 1 34  ? -13.595 -1.712  10.220  1.00 0.00 ? 34  LEU A HD23 5  
ATOM 10358 N N    . GLN A 1 35  ? -11.449 -3.076  15.602  1.00 0.00 ? 35  GLN A N    5  
ATOM 10359 C CA   . GLN A 1 35  ? -10.823 -3.628  16.838  1.00 0.00 ? 35  GLN A CA   5  
ATOM 10360 C C    . GLN A 1 35  ? -10.337 -5.051  16.574  1.00 0.00 ? 35  GLN A C    5  
ATOM 10361 O O    . GLN A 1 35  ? -11.102 -5.922  16.215  1.00 0.00 ? 35  GLN A O    5  
ATOM 10362 C CB   . GLN A 1 35  ? -11.853 -3.648  17.969  1.00 0.00 ? 35  GLN A CB   5  
ATOM 10363 C CG   . GLN A 1 35  ? -11.222 -4.245  19.232  1.00 0.00 ? 35  GLN A CG   5  
ATOM 10364 C CD   . GLN A 1 35  ? -10.152 -3.294  19.767  1.00 0.00 ? 35  GLN A CD   5  
ATOM 10365 O OE1  . GLN A 1 35  ? -10.459 -2.343  20.456  1.00 0.00 ? 35  GLN A OE1  5  
ATOM 10366 N NE2  . GLN A 1 35  ? -8.899  -3.510  19.475  1.00 0.00 ? 35  GLN A NE2  5  
ATOM 10367 H H    . GLN A 1 35  ? -12.395 -3.248  15.412  1.00 0.00 ? 35  GLN A H    5  
ATOM 10368 H HA   . GLN A 1 35  ? -9.986  -3.011  17.124  1.00 0.00 ? 35  GLN A HA   5  
ATOM 10369 H HB2  . GLN A 1 35  ? -12.183 -2.642  18.174  1.00 0.00 ? 35  GLN A HB2  5  
ATOM 10370 H HB3  . GLN A 1 35  ? -12.698 -4.252  17.675  1.00 0.00 ? 35  GLN A HB3  5  
ATOM 10371 H HG2  . GLN A 1 35  ? -11.984 -4.382  19.983  1.00 0.00 ? 35  GLN A HG2  5  
ATOM 10372 H HG3  . GLN A 1 35  ? -10.772 -5.197  19.000  1.00 0.00 ? 35  GLN A HG3  5  
ATOM 10373 H HE21 . GLN A 1 35  ? -8.650  -4.275  18.917  1.00 0.00 ? 35  GLN A HE21 5  
ATOM 10374 H HE22 . GLN A 1 35  ? -8.205  -2.907  19.813  1.00 0.00 ? 35  GLN A HE22 5  
ATOM 10375 N N    . ALA A 1 36  ? -9.070  -5.295  16.763  1.00 0.00 ? 36  ALA A N    5  
ATOM 10376 C CA   . ALA A 1 36  ? -8.536  -6.666  16.534  1.00 0.00 ? 36  ALA A CA   5  
ATOM 10377 C C    . ALA A 1 36  ? -9.324  -7.652  17.397  1.00 0.00 ? 36  ALA A C    5  
ATOM 10378 O O    . ALA A 1 36  ? -9.734  -7.338  18.496  1.00 0.00 ? 36  ALA A O    5  
ATOM 10379 C CB   . ALA A 1 36  ? -7.056  -6.712  16.923  1.00 0.00 ? 36  ALA A CB   5  
ATOM 10380 H H    . ALA A 1 36  ? -8.472  -4.580  17.062  1.00 0.00 ? 36  ALA A H    5  
ATOM 10381 H HA   . ALA A 1 36  ? -8.645  -6.926  15.492  1.00 0.00 ? 36  ALA A HA   5  
ATOM 10382 H HB1  . ALA A 1 36  ? -6.462  -6.278  16.133  1.00 0.00 ? 36  ALA A HB1  5  
ATOM 10383 H HB2  . ALA A 1 36  ? -6.757  -7.737  17.075  1.00 0.00 ? 36  ALA A HB2  5  
ATOM 10384 H HB3  . ALA A 1 36  ? -6.905  -6.153  17.837  1.00 0.00 ? 36  ALA A HB3  5  
ATOM 10385 N N    . SER A 1 37  ? -9.547  -8.841  16.910  1.00 0.00 ? 37  SER A N    5  
ATOM 10386 C CA   . SER A 1 37  ? -10.312 -9.839  17.708  1.00 0.00 ? 37  SER A CA   5  
ATOM 10387 C C    . SER A 1 37  ? -9.400  -10.457 18.768  1.00 0.00 ? 37  SER A C    5  
ATOM 10388 O O    . SER A 1 37  ? -9.825  -11.262 19.574  1.00 0.00 ? 37  SER A O    5  
ATOM 10389 C CB   . SER A 1 37  ? -10.836 -10.935 16.781  1.00 0.00 ? 37  SER A CB   5  
ATOM 10390 O OG   . SER A 1 37  ? -9.740  -11.695 16.289  1.00 0.00 ? 37  SER A OG   5  
ATOM 10391 H H    . SER A 1 37  ? -9.211  -9.077  16.019  1.00 0.00 ? 37  SER A H    5  
ATOM 10392 H HA   . SER A 1 37  ? -11.146 -9.349  18.190  1.00 0.00 ? 37  SER A HA   5  
ATOM 10393 H HB2  . SER A 1 37  ? -11.502 -11.584 17.326  1.00 0.00 ? 37  SER A HB2  5  
ATOM 10394 H HB3  . SER A 1 37  ? -11.373 -10.482 15.958  1.00 0.00 ? 37  SER A HB3  5  
ATOM 10395 H HG   . SER A 1 37  ? -10.014 -12.614 16.239  1.00 0.00 ? 37  SER A HG   5  
ATOM 10396 N N    . ASP A 1 38  ? -8.150  -10.085 18.776  1.00 0.00 ? 38  ASP A N    5  
ATOM 10397 C CA   . ASP A 1 38  ? -7.212  -10.648 19.788  1.00 0.00 ? 38  ASP A CA   5  
ATOM 10398 C C    . ASP A 1 38  ? -6.035  -9.690  19.987  1.00 0.00 ? 38  ASP A C    5  
ATOM 10399 O O    . ASP A 1 38  ? -5.992  -8.617  19.418  1.00 0.00 ? 38  ASP A O    5  
ATOM 10400 C CB   . ASP A 1 38  ? -6.693  -12.004 19.303  1.00 0.00 ? 38  ASP A CB   5  
ATOM 10401 C CG   . ASP A 1 38  ? -5.990  -11.831 17.958  1.00 0.00 ? 38  ASP A CG   5  
ATOM 10402 O OD1  . ASP A 1 38  ? -5.747  -10.696 17.579  1.00 0.00 ? 38  ASP A OD1  5  
ATOM 10403 O OD2  . ASP A 1 38  ? -5.707  -12.835 17.325  1.00 0.00 ? 38  ASP A OD2  5  
ATOM 10404 H H    . ASP A 1 38  ? -7.829  -9.432  18.120  1.00 0.00 ? 38  ASP A H    5  
ATOM 10405 H HA   . ASP A 1 38  ? -7.730  -10.779 20.725  1.00 0.00 ? 38  ASP A HA   5  
ATOM 10406 H HB2  . ASP A 1 38  ? -5.995  -12.399 20.026  1.00 0.00 ? 38  ASP A HB2  5  
ATOM 10407 H HB3  . ASP A 1 38  ? -7.520  -12.687 19.190  1.00 0.00 ? 38  ASP A HB3  5  
ATOM 10408 H HD2  . ASP A 1 38  ? -5.269  -12.651 16.491  1.00 0.00 ? 38  ASP A HD2  5  
ATOM 10409 N N    . GLY A 1 39  ? -5.081  -10.067 20.793  1.00 0.00 ? 39  GLY A N    5  
ATOM 10410 C CA   . GLY A 1 39  ? -3.909  -9.175  21.028  1.00 0.00 ? 39  GLY A CA   5  
ATOM 10411 C C    . GLY A 1 39  ? -4.248  -8.161  22.122  1.00 0.00 ? 39  GLY A C    5  
ATOM 10412 O O    . GLY A 1 39  ? -5.168  -8.350  22.894  1.00 0.00 ? 39  GLY A O    5  
ATOM 10413 H H    . GLY A 1 39  ? -5.137  -10.936 21.243  1.00 0.00 ? 39  GLY A H    5  
ATOM 10414 H HA2  . GLY A 1 39  ? -3.062  -9.771  21.339  1.00 0.00 ? 39  GLY A HA2  5  
ATOM 10415 H HA3  . GLY A 1 39  ? -3.664  -8.650  20.120  1.00 0.00 ? 39  GLY A HA3  5  
ATOM 10416 N N    . ILE A 1 40  ? -3.513  -7.085  22.197  1.00 0.00 ? 40  ILE A N    5  
ATOM 10417 C CA   . ILE A 1 40  ? -3.795  -6.060  23.240  1.00 0.00 ? 40  ILE A CA   5  
ATOM 10418 C C    . ILE A 1 40  ? -5.087  -5.320  22.886  1.00 0.00 ? 40  ILE A C    5  
ATOM 10419 O O    . ILE A 1 40  ? -5.503  -4.412  23.575  1.00 0.00 ? 40  ILE A O    5  
ATOM 10420 C CB   . ILE A 1 40  ? -2.630  -5.068  23.312  1.00 0.00 ? 40  ILE A CB   5  
ATOM 10421 C CG1  . ILE A 1 40  ? -2.714  -4.080  22.141  1.00 0.00 ? 40  ILE A CG1  5  
ATOM 10422 C CG2  . ILE A 1 40  ? -1.308  -5.835  23.231  1.00 0.00 ? 40  ILE A CG2  5  
ATOM 10423 C CD1  . ILE A 1 40  ? -3.365  -2.769  22.601  1.00 0.00 ? 40  ILE A CD1  5  
ATOM 10424 H H    . ILE A 1 40  ? -2.775  -6.951  21.564  1.00 0.00 ? 40  ILE A H    5  
ATOM 10425 H HA   . ILE A 1 40  ? -3.914  -6.547  24.197  1.00 0.00 ? 40  ILE A HA   5  
ATOM 10426 H HB   . ILE A 1 40  ? -2.671  -4.532  24.249  1.00 0.00 ? 40  ILE A HB   5  
ATOM 10427 H HG12 . ILE A 1 40  ? -1.719  -3.876  21.774  1.00 0.00 ? 40  ILE A HG12 5  
ATOM 10428 H HG13 . ILE A 1 40  ? -3.304  -4.514  21.347  1.00 0.00 ? 40  ILE A HG13 5  
ATOM 10429 H HG21 . ILE A 1 40  ? -1.267  -6.567  24.024  1.00 0.00 ? 40  ILE A HG21 5  
ATOM 10430 H HG22 . ILE A 1 40  ? -0.484  -5.147  23.332  1.00 0.00 ? 40  ILE A HG22 5  
ATOM 10431 H HG23 . ILE A 1 40  ? -1.243  -6.337  22.276  1.00 0.00 ? 40  ILE A HG23 5  
ATOM 10432 H HD11 . ILE A 1 40  ? -2.616  -1.993  22.640  1.00 0.00 ? 40  ILE A HD11 5  
ATOM 10433 H HD12 . ILE A 1 40  ? -3.799  -2.900  23.580  1.00 0.00 ? 40  ILE A HD12 5  
ATOM 10434 H HD13 . ILE A 1 40  ? -4.139  -2.488  21.901  1.00 0.00 ? 40  ILE A HD13 5  
ATOM 10435 N N    . HIS A 1 41  ? -5.724  -5.712  21.814  1.00 0.00 ? 41  HIS A N    5  
ATOM 10436 C CA   . HIS A 1 41  ? -6.992  -5.045  21.403  1.00 0.00 ? 41  HIS A CA   5  
ATOM 10437 C C    . HIS A 1 41  ? -6.689  -3.641  20.874  1.00 0.00 ? 41  HIS A C    5  
ATOM 10438 O O    . HIS A 1 41  ? -7.409  -2.699  21.143  1.00 0.00 ? 41  HIS A O    5  
ATOM 10439 C CB   . HIS A 1 41  ? -7.933  -4.947  22.607  1.00 0.00 ? 41  HIS A CB   5  
ATOM 10440 C CG   . HIS A 1 41  ? -7.858  -6.223  23.399  1.00 0.00 ? 41  HIS A CG   5  
ATOM 10441 N ND1  . HIS A 1 41  ? -8.536  -7.372  23.014  1.00 0.00 ? 41  HIS A ND1  5  
ATOM 10442 C CD2  . HIS A 1 41  ? -7.187  -6.551  24.552  1.00 0.00 ? 41  HIS A CD2  5  
ATOM 10443 C CE1  . HIS A 1 41  ? -8.259  -8.328  23.920  1.00 0.00 ? 41  HIS A CE1  5  
ATOM 10444 N NE2  . HIS A 1 41  ? -7.441  -7.879  24.874  1.00 0.00 ? 41  HIS A NE2  5  
ATOM 10445 H H    . HIS A 1 41  ? -5.366  -6.449  21.278  1.00 0.00 ? 41  HIS A H    5  
ATOM 10446 H HA   . HIS A 1 41  ? -7.466  -5.626  20.626  1.00 0.00 ? 41  HIS A HA   5  
ATOM 10447 H HB2  . HIS A 1 41  ? -7.644  -4.113  23.229  1.00 0.00 ? 41  HIS A HB2  5  
ATOM 10448 H HB3  . HIS A 1 41  ? -8.947  -4.800  22.259  1.00 0.00 ? 41  HIS A HB3  5  
ATOM 10449 H HD1  . HIS A 1 41  ? -9.108  -7.469  22.225  1.00 0.00 ? 41  HIS A HD1  5  
ATOM 10450 H HD2  . HIS A 1 41  ? -6.555  -5.883  25.117  1.00 0.00 ? 41  HIS A HD2  5  
ATOM 10451 H HE1  . HIS A 1 41  ? -8.649  -9.334  23.878  1.00 0.00 ? 41  HIS A HE1  5  
ATOM 10452 H HE2  . HIS A 1 41  ? -7.092  -8.380  25.639  1.00 0.00 ? 41  HIS A HE2  5  
ATOM 10453 N N    . HIS A 1 42  ? -5.637  -3.494  20.118  1.00 0.00 ? 42  HIS A N    5  
ATOM 10454 C CA   . HIS A 1 42  ? -5.300  -2.150  19.566  1.00 0.00 ? 42  HIS A CA   5  
ATOM 10455 C C    . HIS A 1 42  ? -6.239  -1.837  18.401  1.00 0.00 ? 42  HIS A C    5  
ATOM 10456 O O    . HIS A 1 42  ? -6.803  -2.727  17.794  1.00 0.00 ? 42  HIS A O    5  
ATOM 10457 C CB   . HIS A 1 42  ? -3.853  -2.144  19.070  1.00 0.00 ? 42  HIS A CB   5  
ATOM 10458 C CG   . HIS A 1 42  ? -3.718  -3.081  17.904  1.00 0.00 ? 42  HIS A CG   5  
ATOM 10459 N ND1  . HIS A 1 42  ? -3.566  -4.451  18.066  1.00 0.00 ? 42  HIS A ND1  5  
ATOM 10460 C CD2  . HIS A 1 42  ? -3.709  -2.862  16.547  1.00 0.00 ? 42  HIS A CD2  5  
ATOM 10461 C CE1  . HIS A 1 42  ? -3.474  -4.999  16.838  1.00 0.00 ? 42  HIS A CE1  5  
ATOM 10462 N NE2  . HIS A 1 42  ? -3.557  -4.073  15.882  1.00 0.00 ? 42  HIS A NE2  5  
ATOM 10463 H H    . HIS A 1 42  ? -5.074  -4.268  19.905  1.00 0.00 ? 42  HIS A H    5  
ATOM 10464 H HA   . HIS A 1 42  ? -5.421  -1.403  20.336  1.00 0.00 ? 42  HIS A HA   5  
ATOM 10465 H HB2  . HIS A 1 42  ? -3.583  -1.144  18.762  1.00 0.00 ? 42  HIS A HB2  5  
ATOM 10466 H HB3  . HIS A 1 42  ? -3.196  -2.463  19.865  1.00 0.00 ? 42  HIS A HB3  5  
ATOM 10467 H HD1  . HIS A 1 42  ? -3.535  -4.934  18.919  1.00 0.00 ? 42  HIS A HD1  5  
ATOM 10468 H HD2  . HIS A 1 42  ? -3.811  -1.897  16.071  1.00 0.00 ? 42  HIS A HD2  5  
ATOM 10469 H HE1  . HIS A 1 42  ? -3.347  -6.055  16.653  1.00 0.00 ? 42  HIS A HE1  5  
ATOM 10470 H HE2  . HIS A 1 42  ? -3.517  -4.217  14.914  1.00 0.00 ? 42  HIS A HE2  5  
ATOM 10471 N N    . TRP A 1 43  ? -6.415  -0.586  18.085  1.00 0.00 ? 43  TRP A N    5  
ATOM 10472 C CA   . TRP A 1 43  ? -7.322  -0.226  16.959  1.00 0.00 ? 43  TRP A CA   5  
ATOM 10473 C C    . TRP A 1 43  ? -6.487  0.129   15.725  1.00 0.00 ? 43  TRP A C    5  
ATOM 10474 O O    . TRP A 1 43  ? -5.512  0.851   15.811  1.00 0.00 ? 43  TRP A O    5  
ATOM 10475 C CB   . TRP A 1 43  ? -8.168  0.980   17.358  1.00 0.00 ? 43  TRP A CB   5  
ATOM 10476 C CG   . TRP A 1 43  ? -9.007  0.636   18.547  1.00 0.00 ? 43  TRP A CG   5  
ATOM 10477 C CD1  . TRP A 1 43  ? -8.561  0.589   19.824  1.00 0.00 ? 43  TRP A CD1  5  
ATOM 10478 C CD2  . TRP A 1 43  ? -10.423 0.294   18.596  1.00 0.00 ? 43  TRP A CD2  5  
ATOM 10479 N NE1  . TRP A 1 43  ? -9.612  0.245   20.653  1.00 0.00 ? 43  TRP A NE1  5  
ATOM 10480 C CE2  . TRP A 1 43  ? -10.780 0.050   19.943  1.00 0.00 ? 43  TRP A CE2  5  
ATOM 10481 C CE3  . TRP A 1 43  ? -11.420 0.171   17.615  1.00 0.00 ? 43  TRP A CE3  5  
ATOM 10482 C CZ2  . TRP A 1 43  ? -12.081 -0.299  20.303  1.00 0.00 ? 43  TRP A CZ2  5  
ATOM 10483 C CZ3  . TRP A 1 43  ? -12.731 -0.181  17.972  1.00 0.00 ? 43  TRP A CZ3  5  
ATOM 10484 C CH2  . TRP A 1 43  ? -13.061 -0.416  19.315  1.00 0.00 ? 43  TRP A CH2  5  
ATOM 10485 H H    . TRP A 1 43  ? -5.953  0.117   18.587  1.00 0.00 ? 43  TRP A H    5  
ATOM 10486 H HA   . TRP A 1 43  ? -7.967  -1.062  16.731  1.00 0.00 ? 43  TRP A HA   5  
ATOM 10487 H HB2  . TRP A 1 43  ? -7.520  1.809   17.605  1.00 0.00 ? 43  TRP A HB2  5  
ATOM 10488 H HB3  . TRP A 1 43  ? -8.809  1.258   16.535  1.00 0.00 ? 43  TRP A HB3  5  
ATOM 10489 H HD1  . TRP A 1 43  ? -7.549  0.792   20.142  1.00 0.00 ? 43  TRP A HD1  5  
ATOM 10490 H HE1  . TRP A 1 43  ? -9.556  0.144   21.625  1.00 0.00 ? 43  TRP A HE1  5  
ATOM 10491 H HE3  . TRP A 1 43  ? -11.177 0.349   16.579  1.00 0.00 ? 43  TRP A HE3  5  
ATOM 10492 H HZ2  . TRP A 1 43  ? -12.328 -0.480  21.338  1.00 0.00 ? 43  TRP A HZ2  5  
ATOM 10493 H HZ3  . TRP A 1 43  ? -13.489 -0.271  17.210  1.00 0.00 ? 43  TRP A HZ3  5  
ATOM 10494 H HH2  . TRP A 1 43  ? -14.072 -0.686  19.584  1.00 0.00 ? 43  TRP A HH2  5  
ATOM 10495 N N    . THR A 1 44  ? -6.860  -0.366  14.575  1.00 0.00 ? 44  THR A N    5  
ATOM 10496 C CA   . THR A 1 44  ? -6.082  -0.045  13.345  1.00 0.00 ? 44  THR A CA   5  
ATOM 10497 C C    . THR A 1 44  ? -6.987  -0.171  12.115  1.00 0.00 ? 44  THR A C    5  
ATOM 10498 O O    . THR A 1 44  ? -8.011  -0.823  12.158  1.00 0.00 ? 44  THR A O    5  
ATOM 10499 C CB   . THR A 1 44  ? -4.908  -1.018  13.216  1.00 0.00 ? 44  THR A CB   5  
ATOM 10500 O OG1  . THR A 1 44  ? -5.066  -2.073  14.154  1.00 0.00 ? 44  THR A OG1  5  
ATOM 10501 C CG2  . THR A 1 44  ? -3.596  -0.280  13.488  1.00 0.00 ? 44  THR A CG2  5  
ATOM 10502 H H    . THR A 1 44  ? -7.651  -0.944  14.521  1.00 0.00 ? 44  THR A H    5  
ATOM 10503 H HA   . THR A 1 44  ? -5.707  0.963   13.421  1.00 0.00 ? 44  THR A HA   5  
ATOM 10504 H HB   . THR A 1 44  ? -4.886  -1.425  12.216  1.00 0.00 ? 44  THR A HB   5  
ATOM 10505 H HG1  . THR A 1 44  ? -5.278  -1.682  15.005  1.00 0.00 ? 44  THR A HG1  5  
ATOM 10506 H HG21 . THR A 1 44  ? -2.767  -0.956  13.341  1.00 0.00 ? 44  THR A HG21 5  
ATOM 10507 H HG22 . THR A 1 44  ? -3.591  0.078   14.507  1.00 0.00 ? 44  THR A HG22 5  
ATOM 10508 H HG23 . THR A 1 44  ? -3.505  0.555   12.811  1.00 0.00 ? 44  THR A HG23 5  
ATOM 10509 N N    . PRO A 1 45  ? -6.610  0.446   11.020  1.00 0.00 ? 45  PRO A N    5  
ATOM 10510 C CA   . PRO A 1 45  ? -7.397  0.392   9.757   1.00 0.00 ? 45  PRO A CA   5  
ATOM 10511 C C    . PRO A 1 45  ? -7.313  -0.984  9.085   1.00 0.00 ? 45  PRO A C    5  
ATOM 10512 O O    . PRO A 1 45  ? -6.399  -1.745  9.328   1.00 0.00 ? 45  PRO A O    5  
ATOM 10513 C CB   . PRO A 1 45  ? -6.758  1.456   8.852   1.00 0.00 ? 45  PRO A CB   5  
ATOM 10514 C CG   . PRO A 1 45  ? -5.727  2.161   9.676   1.00 0.00 ? 45  PRO A CG   5  
ATOM 10515 C CD   . PRO A 1 45  ? -5.399  1.257   10.860  1.00 0.00 ? 45  PRO A CD   5  
ATOM 10516 H HA   . PRO A 1 45  ? -8.423  0.653   9.948   1.00 0.00 ? 45  PRO A HA   5  
ATOM 10517 H HB2  . PRO A 1 45  ? -6.290  0.982   8.000   1.00 0.00 ? 45  PRO A HB2  5  
ATOM 10518 H HB3  . PRO A 1 45  ? -7.506  2.159   8.521   1.00 0.00 ? 45  PRO A HB3  5  
ATOM 10519 H HG2  . PRO A 1 45  ? -4.840  2.333   9.082   1.00 0.00 ? 45  PRO A HG2  5  
ATOM 10520 H HG3  . PRO A 1 45  ? -6.120  3.101   10.033  1.00 0.00 ? 45  PRO A HG3  5  
ATOM 10521 H HD2  . PRO A 1 45  ? -4.545  0.632   10.636  1.00 0.00 ? 45  PRO A HD2  5  
ATOM 10522 H HD3  . PRO A 1 45  ? -5.222  1.845   11.743  1.00 0.00 ? 45  PRO A HD3  5  
ATOM 10523 N N    . PRO A 1 46  ? -8.261  -1.293  8.239   1.00 0.00 ? 46  PRO A N    5  
ATOM 10524 C CA   . PRO A 1 46  ? -8.298  -2.592  7.511   1.00 0.00 ? 46  PRO A CA   5  
ATOM 10525 C C    . PRO A 1 46  ? -6.925  -2.991  6.963   1.00 0.00 ? 46  PRO A C    5  
ATOM 10526 O O    . PRO A 1 46  ? -6.596  -2.706  5.830   1.00 0.00 ? 46  PRO A O    5  
ATOM 10527 C CB   . PRO A 1 46  ? -9.269  -2.328  6.360   1.00 0.00 ? 46  PRO A CB   5  
ATOM 10528 C CG   . PRO A 1 46  ? -10.173 -1.238  6.836   1.00 0.00 ? 46  PRO A CG   5  
ATOM 10529 C CD   . PRO A 1 46  ? -9.401  -0.434  7.883   1.00 0.00 ? 46  PRO A CD   5  
ATOM 10530 H HA   . PRO A 1 46  ? -8.692  -3.369  8.144   1.00 0.00 ? 46  PRO A HA   5  
ATOM 10531 H HB2  . PRO A 1 46  ? -8.727  -2.009  5.482   1.00 0.00 ? 46  PRO A HB2  5  
ATOM 10532 H HB3  . PRO A 1 46  ? -9.844  -3.214  6.145   1.00 0.00 ? 46  PRO A HB3  5  
ATOM 10533 H HG2  . PRO A 1 46  ? -10.446 -0.602  6.005   1.00 0.00 ? 46  PRO A HG2  5  
ATOM 10534 H HG3  . PRO A 1 46  ? -11.058 -1.662  7.283   1.00 0.00 ? 46  PRO A HG3  5  
ATOM 10535 H HD2  . PRO A 1 46  ? -9.058  0.502   7.462   1.00 0.00 ? 46  PRO A HD2  5  
ATOM 10536 H HD3  . PRO A 1 46  ? -10.019 -0.256  8.750   1.00 0.00 ? 46  PRO A HD3  5  
ATOM 10537 N N    . LYS A 1 47  ? -6.121  -3.650  7.754   1.00 0.00 ? 47  LYS A N    5  
ATOM 10538 C CA   . LYS A 1 47  ? -4.771  -4.062  7.269   1.00 0.00 ? 47  LYS A CA   5  
ATOM 10539 C C    . LYS A 1 47  ? -4.827  -5.471  6.676   1.00 0.00 ? 47  LYS A C    5  
ATOM 10540 O O    . LYS A 1 47  ? -5.476  -6.355  7.199   1.00 0.00 ? 47  LYS A O    5  
ATOM 10541 C CB   . LYS A 1 47  ? -3.778  -4.052  8.433   1.00 0.00 ? 47  LYS A CB   5  
ATOM 10542 C CG   . LYS A 1 47  ? -3.300  -2.624  8.694   1.00 0.00 ? 47  LYS A CG   5  
ATOM 10543 C CD   . LYS A 1 47  ? -2.366  -2.615  9.905   1.00 0.00 ? 47  LYS A CD   5  
ATOM 10544 C CE   . LYS A 1 47  ? -1.183  -3.551  9.652   1.00 0.00 ? 47  LYS A CE   5  
ATOM 10545 N NZ   . LYS A 1 47  ? -0.831  -3.538  8.204   1.00 0.00 ? 47  LYS A NZ   5  
ATOM 10546 H H    . LYS A 1 47  ? -6.403  -3.872  8.665   1.00 0.00 ? 47  LYS A H    5  
ATOM 10547 H HA   . LYS A 1 47  ? -4.437  -3.371  6.511   1.00 0.00 ? 47  LYS A HA   5  
ATOM 10548 H HB2  . LYS A 1 47  ? -4.264  -4.435  9.320   1.00 0.00 ? 47  LYS A HB2  5  
ATOM 10549 H HB3  . LYS A 1 47  ? -2.932  -4.675  8.191   1.00 0.00 ? 47  LYS A HB3  5  
ATOM 10550 H HG2  . LYS A 1 47  ? -2.771  -2.257  7.826   1.00 0.00 ? 47  LYS A HG2  5  
ATOM 10551 H HG3  . LYS A 1 47  ? -4.151  -1.989  8.894   1.00 0.00 ? 47  LYS A HG3  5  
ATOM 10552 H HD2  . LYS A 1 47  ? -2.001  -1.613  10.074  1.00 0.00 ? 47  LYS A HD2  5  
ATOM 10553 H HD3  . LYS A 1 47  ? -2.905  -2.950  10.776  1.00 0.00 ? 47  LYS A HD3  5  
ATOM 10554 H HE2  . LYS A 1 47  ? -0.333  -3.218  10.230  1.00 0.00 ? 47  LYS A HE2  5  
ATOM 10555 H HE3  . LYS A 1 47  ? -1.449  -4.553  9.950   1.00 0.00 ? 47  LYS A HE3  5  
ATOM 10556 H HZ1  . LYS A 1 47  ? -1.697  -3.616  7.635   1.00 0.00 ? 47  LYS A HZ1  5  
ATOM 10557 H HZ2  . LYS A 1 47  ? -0.205  -4.344  7.994   1.00 0.00 ? 47  LYS A HZ2  5  
ATOM 10558 H HZ3  . LYS A 1 47  ? -0.343  -2.651  7.972   1.00 0.00 ? 47  LYS A HZ3  5  
ATOM 10559 N N    . GLY A 1 48  ? -4.137  -5.683  5.589   1.00 0.00 ? 48  GLY A N    5  
ATOM 10560 C CA   . GLY A 1 48  ? -4.124  -7.031  4.952   1.00 0.00 ? 48  GLY A CA   5  
ATOM 10561 C C    . GLY A 1 48  ? -2.789  -7.227  4.230   1.00 0.00 ? 48  GLY A C    5  
ATOM 10562 O O    . GLY A 1 48  ? -1.954  -6.345  4.204   1.00 0.00 ? 48  GLY A O    5  
ATOM 10563 H H    . GLY A 1 48  ? -3.617  -4.954  5.191   1.00 0.00 ? 48  GLY A H    5  
ATOM 10564 H HA2  . GLY A 1 48  ? -4.244  -7.791  5.712   1.00 0.00 ? 48  GLY A HA2  5  
ATOM 10565 H HA3  . GLY A 1 48  ? -4.929  -7.100  4.237   1.00 0.00 ? 48  GLY A HA3  5  
ATOM 10566 N N    . HIS A 1 49  ? -2.581  -8.371  3.641   1.00 0.00 ? 49  HIS A N    5  
ATOM 10567 C CA   . HIS A 1 49  ? -1.299  -8.616  2.917   1.00 0.00 ? 49  HIS A CA   5  
ATOM 10568 C C    . HIS A 1 49  ? -1.553  -8.553  1.411   1.00 0.00 ? 49  HIS A C    5  
ATOM 10569 O O    . HIS A 1 49  ? -2.554  -9.035  0.921   1.00 0.00 ? 49  HIS A O    5  
ATOM 10570 C CB   . HIS A 1 49  ? -0.754  -9.995  3.288   1.00 0.00 ? 49  HIS A CB   5  
ATOM 10571 C CG   . HIS A 1 49  ? -0.195  -9.959  4.684   1.00 0.00 ? 49  HIS A CG   5  
ATOM 10572 N ND1  . HIS A 1 49  ? 1.133   -9.650  4.941   1.00 0.00 ? 49  HIS A ND1  5  
ATOM 10573 C CD2  . HIS A 1 49  ? -0.771  -10.190 5.910   1.00 0.00 ? 49  HIS A CD2  5  
ATOM 10574 C CE1  . HIS A 1 49  ? 1.312   -9.704  6.274   1.00 0.00 ? 49  HIS A CE1  5  
ATOM 10575 N NE2  . HIS A 1 49  ? 0.185   -10.027 6.908   1.00 0.00 ? 49  HIS A NE2  5  
ATOM 10576 H H    . HIS A 1 49  ? -3.269  -9.070  3.671   1.00 0.00 ? 49  HIS A H    5  
ATOM 10577 H HA   . HIS A 1 49  ? -0.581  -7.858  3.193   1.00 0.00 ? 49  HIS A HA   5  
ATOM 10578 H HB2  . HIS A 1 49  ? -1.551  -10.722 3.237   1.00 0.00 ? 49  HIS A HB2  5  
ATOM 10579 H HB3  . HIS A 1 49  ? 0.028   -10.269 2.594   1.00 0.00 ? 49  HIS A HB3  5  
ATOM 10580 H HD1  . HIS A 1 49  ? 1.817   -9.435  4.273   1.00 0.00 ? 49  HIS A HD1  5  
ATOM 10581 H HD2  . HIS A 1 49  ? -1.802  -10.463 6.076   1.00 0.00 ? 49  HIS A HD2  5  
ATOM 10582 H HE1  . HIS A 1 49  ? 2.253   -9.510  6.768   1.00 0.00 ? 49  HIS A HE1  5  
ATOM 10583 H HE2  . HIS A 1 49  ? 0.056   -10.130 7.874   1.00 0.00 ? 49  HIS A HE2  5  
ATOM 10584 N N    . VAL A 1 50  ? -0.656  -7.959  0.669   1.00 0.00 ? 50  VAL A N    5  
ATOM 10585 C CA   . VAL A 1 50  ? -0.863  -7.864  -0.803  1.00 0.00 ? 50  VAL A CA   5  
ATOM 10586 C C    . VAL A 1 50  ? -0.221  -9.067  -1.500  1.00 0.00 ? 50  VAL A C    5  
ATOM 10587 O O    . VAL A 1 50  ? 0.887   -9.465  -1.197  1.00 0.00 ? 50  VAL A O    5  
ATOM 10588 C CB   . VAL A 1 50  ? -0.247  -6.561  -1.329  1.00 0.00 ? 50  VAL A CB   5  
ATOM 10589 C CG1  . VAL A 1 50  ? 0.539   -5.870  -0.218  1.00 0.00 ? 50  VAL A CG1  5  
ATOM 10590 C CG2  . VAL A 1 50  ? 0.686   -6.857  -2.506  1.00 0.00 ? 50  VAL A CG2  5  
ATOM 10591 H H    . VAL A 1 50  ? 0.143   -7.571  1.081   1.00 0.00 ? 50  VAL A H    5  
ATOM 10592 H HA   . VAL A 1 50  ? -1.923  -7.864  -1.012  1.00 0.00 ? 50  VAL A HA   5  
ATOM 10593 H HB   . VAL A 1 50  ? -1.037  -5.904  -1.658  1.00 0.00 ? 50  VAL A HB   5  
ATOM 10594 H HG11 . VAL A 1 50  ? 1.360   -6.499  0.091   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 10595 H HG12 . VAL A 1 50  ? -0.114  -5.687  0.624   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 10596 H HG13 . VAL A 1 50  ? 0.924   -4.928  -0.583  1.00 0.00 ? 50  VAL A HG13 5  
ATOM 10597 H HG21 . VAL A 1 50  ? 1.509   -7.472  -2.173  1.00 0.00 ? 50  VAL A HG21 5  
ATOM 10598 H HG22 . VAL A 1 50  ? 1.070   -5.927  -2.900  1.00 0.00 ? 50  VAL A HG22 5  
ATOM 10599 H HG23 . VAL A 1 50  ? 0.136   -7.374  -3.281  1.00 0.00 ? 50  VAL A HG23 5  
ATOM 10600 N N    . GLU A 1 51  ? -0.920  -9.642  -2.437  1.00 0.00 ? 51  GLU A N    5  
ATOM 10601 C CA   . GLU A 1 51  ? -0.386  -10.817 -3.183  1.00 0.00 ? 51  GLU A CA   5  
ATOM 10602 C C    . GLU A 1 51  ? 0.751   -10.342 -4.103  1.00 0.00 ? 51  GLU A C    5  
ATOM 10603 O O    . GLU A 1 51  ? 1.144   -9.195  -4.054  1.00 0.00 ? 51  GLU A O    5  
ATOM 10604 C CB   . GLU A 1 51  ? -1.530  -11.424 -4.002  1.00 0.00 ? 51  GLU A CB   5  
ATOM 10605 C CG   . GLU A 1 51  ? -1.741  -12.896 -3.629  1.00 0.00 ? 51  GLU A CG   5  
ATOM 10606 C CD   . GLU A 1 51  ? -2.800  -12.993 -2.527  1.00 0.00 ? 51  GLU A CD   5  
ATOM 10607 O OE1  . GLU A 1 51  ? -2.597  -12.395 -1.483  1.00 0.00 ? 51  GLU A OE1  5  
ATOM 10608 O OE2  . GLU A 1 51  ? -3.795  -13.663 -2.750  1.00 0.00 ? 51  GLU A OE2  5  
ATOM 10609 H H    . GLU A 1 51  ? -1.809  -9.294  -2.659  1.00 0.00 ? 51  GLU A H    5  
ATOM 10610 H HA   . GLU A 1 51  ? -0.005  -11.544 -2.483  1.00 0.00 ? 51  GLU A HA   5  
ATOM 10611 H HB2  . GLU A 1 51  ? -2.430  -10.882 -3.792  1.00 0.00 ? 51  GLU A HB2  5  
ATOM 10612 H HB3  . GLU A 1 51  ? -1.310  -11.338 -5.052  1.00 0.00 ? 51  GLU A HB3  5  
ATOM 10613 H HG2  . GLU A 1 51  ? -2.079  -13.443 -4.498  1.00 0.00 ? 51  GLU A HG2  5  
ATOM 10614 H HG3  . GLU A 1 51  ? -0.817  -13.322 -3.273  1.00 0.00 ? 51  GLU A HG3  5  
ATOM 10615 H HE2  . GLU A 1 51  ? -4.415  -13.679 -2.017  1.00 0.00 ? 51  GLU A HE2  5  
ATOM 10616 N N    . PRO A 1 52  ? 1.297   -11.209 -4.923  1.00 0.00 ? 52  PRO A N    5  
ATOM 10617 C CA   . PRO A 1 52  ? 2.420   -10.838 -5.835  1.00 0.00 ? 52  PRO A CA   5  
ATOM 10618 C C    . PRO A 1 52  ? 1.960   -9.949  -6.994  1.00 0.00 ? 52  PRO A C    5  
ATOM 10619 O O    . PRO A 1 52  ? 2.283   -8.778  -7.056  1.00 0.00 ? 52  PRO A O    5  
ATOM 10620 C CB   . PRO A 1 52  ? 2.932   -12.181 -6.357  1.00 0.00 ? 52  PRO A CB   5  
ATOM 10621 C CG   . PRO A 1 52  ? 1.786   -13.127 -6.229  1.00 0.00 ? 52  PRO A CG   5  
ATOM 10622 C CD   . PRO A 1 52  ? 0.912   -12.622 -5.079  1.00 0.00 ? 52  PRO A CD   5  
ATOM 10623 H HA   . PRO A 1 52  ? 3.203   -10.347 -5.279  1.00 0.00 ? 52  PRO A HA   5  
ATOM 10624 H HB2  . PRO A 1 52  ? 3.231   -12.090 -7.391  1.00 0.00 ? 52  PRO A HB2  5  
ATOM 10625 H HB3  . PRO A 1 52  ? 3.760   -12.525 -5.756  1.00 0.00 ? 52  PRO A HB3  5  
ATOM 10626 H HG2  . PRO A 1 52  ? 1.217   -13.142 -7.149  1.00 0.00 ? 52  PRO A HG2  5  
ATOM 10627 H HG3  . PRO A 1 52  ? 2.145   -14.118 -6.001  1.00 0.00 ? 52  PRO A HG3  5  
ATOM 10628 H HD2  . PRO A 1 52  ? -0.128  -12.708 -5.348  1.00 0.00 ? 52  PRO A HD2  5  
ATOM 10629 H HD3  . PRO A 1 52  ? 1.118   -13.167 -4.174  1.00 0.00 ? 52  PRO A HD3  5  
ATOM 10630 N N    . GLY A 1 53  ? 1.204   -10.490 -7.908  1.00 0.00 ? 53  GLY A N    5  
ATOM 10631 C CA   . GLY A 1 53  ? 0.722   -9.669  -9.056  1.00 0.00 ? 53  GLY A CA   5  
ATOM 10632 C C    . GLY A 1 53  ? -0.478  -8.837  -8.603  1.00 0.00 ? 53  GLY A C    5  
ATOM 10633 O O    . GLY A 1 53  ? -1.216  -8.303  -9.407  1.00 0.00 ? 53  GLY A O    5  
ATOM 10634 H H    . GLY A 1 53  ? 0.950   -11.433 -7.840  1.00 0.00 ? 53  GLY A H    5  
ATOM 10635 H HA2  . GLY A 1 53  ? 1.515   -9.013  -9.386  1.00 0.00 ? 53  GLY A HA2  5  
ATOM 10636 H HA3  . GLY A 1 53  ? 0.424   -10.317 -9.865  1.00 0.00 ? 53  GLY A HA3  5  
ATOM 10637 N N    . GLU A 1 54  ? -0.679  -8.726  -7.319  1.00 0.00 ? 54  GLU A N    5  
ATOM 10638 C CA   . GLU A 1 54  ? -1.835  -7.937  -6.806  1.00 0.00 ? 54  GLU A CA   5  
ATOM 10639 C C    . GLU A 1 54  ? -1.461  -6.456  -6.740  1.00 0.00 ? 54  GLU A C    5  
ATOM 10640 O O    . GLU A 1 54  ? -0.316  -6.102  -6.543  1.00 0.00 ? 54  GLU A O    5  
ATOM 10641 C CB   . GLU A 1 54  ? -2.206  -8.426  -5.407  1.00 0.00 ? 54  GLU A CB   5  
ATOM 10642 C CG   . GLU A 1 54  ? -3.500  -7.752  -4.961  1.00 0.00 ? 54  GLU A CG   5  
ATOM 10643 C CD   . GLU A 1 54  ? -3.827  -8.157  -3.522  1.00 0.00 ? 54  GLU A CD   5  
ATOM 10644 O OE1  . GLU A 1 54  ? -3.029  -8.861  -2.929  1.00 0.00 ? 54  GLU A OE1  5  
ATOM 10645 O OE2  . GLU A 1 54  ? -4.876  -7.760  -3.040  1.00 0.00 ? 54  GLU A OE2  5  
ATOM 10646 H H    . GLU A 1 54  ? -0.073  -9.170  -6.689  1.00 0.00 ? 54  GLU A H    5  
ATOM 10647 H HA   . GLU A 1 54  ? -2.679  -8.067  -7.466  1.00 0.00 ? 54  GLU A HA   5  
ATOM 10648 H HB2  . GLU A 1 54  ? -2.345  -9.493  -5.429  1.00 0.00 ? 54  GLU A HB2  5  
ATOM 10649 H HB3  . GLU A 1 54  ? -1.415  -8.178  -4.717  1.00 0.00 ? 54  GLU A HB3  5  
ATOM 10650 H HG2  . GLU A 1 54  ? -3.378  -6.683  -5.015  1.00 0.00 ? 54  GLU A HG2  5  
ATOM 10651 H HG3  . GLU A 1 54  ? -4.304  -8.055  -5.612  1.00 0.00 ? 54  GLU A HG3  5  
ATOM 10652 H HE2  . GLU A 1 54  ? -5.016  -8.053  -2.137  1.00 0.00 ? 54  GLU A HE2  5  
ATOM 10653 N N    . ASP A 1 55  ? -2.422  -5.585  -6.908  1.00 0.00 ? 55  ASP A N    5  
ATOM 10654 C CA   . ASP A 1 55  ? -2.125  -4.126  -6.859  1.00 0.00 ? 55  ASP A CA   5  
ATOM 10655 C C    . ASP A 1 55  ? -1.828  -3.702  -5.426  1.00 0.00 ? 55  ASP A C    5  
ATOM 10656 O O    . ASP A 1 55  ? -2.155  -4.388  -4.477  1.00 0.00 ? 55  ASP A O    5  
ATOM 10657 C CB   . ASP A 1 55  ? -3.330  -3.332  -7.337  1.00 0.00 ? 55  ASP A CB   5  
ATOM 10658 C CG   . ASP A 1 55  ? -2.906  -1.895  -7.643  1.00 0.00 ? 55  ASP A CG   5  
ATOM 10659 O OD1  . ASP A 1 55  ? -3.776  -1.096  -7.946  1.00 0.00 ? 55  ASP A OD1  5  
ATOM 10660 O OD2  . ASP A 1 55  ? -1.721  -1.617  -7.560  1.00 0.00 ? 55  ASP A OD2  5  
ATOM 10661 H H    . ASP A 1 55  ? -3.340  -5.892  -7.070  1.00 0.00 ? 55  ASP A H    5  
ATOM 10662 H HA   . ASP A 1 55  ? -1.275  -3.906  -7.489  1.00 0.00 ? 55  ASP A HA   5  
ATOM 10663 H HB2  . ASP A 1 55  ? -3.747  -3.788  -8.215  1.00 0.00 ? 55  ASP A HB2  5  
ATOM 10664 H HB3  . ASP A 1 55  ? -4.063  -3.322  -6.559  1.00 0.00 ? 55  ASP A HB3  5  
ATOM 10665 H HD2  . ASP A 1 55  ? -1.530  -0.698  -7.763  1.00 0.00 ? 55  ASP A HD2  5  
ATOM 10666 N N    . ASP A 1 56  ? -1.229  -2.559  -5.269  1.00 0.00 ? 56  ASP A N    5  
ATOM 10667 C CA   . ASP A 1 56  ? -0.922  -2.053  -3.900  1.00 0.00 ? 56  ASP A CA   5  
ATOM 10668 C C    . ASP A 1 56  ? -2.207  -1.514  -3.263  1.00 0.00 ? 56  ASP A C    5  
ATOM 10669 O O    . ASP A 1 56  ? -2.687  -2.032  -2.274  1.00 0.00 ? 56  ASP A O    5  
ATOM 10670 C CB   . ASP A 1 56  ? 0.108   -0.928  -3.991  1.00 0.00 ? 56  ASP A CB   5  
ATOM 10671 C CG   . ASP A 1 56  ? 1.408   -1.475  -4.585  1.00 0.00 ? 56  ASP A CG   5  
ATOM 10672 O OD1  . ASP A 1 56  ? 1.527   -2.684  -4.681  1.00 0.00 ? 56  ASP A OD1  5  
ATOM 10673 O OD2  . ASP A 1 56  ? 2.259   -0.674  -4.932  1.00 0.00 ? 56  ASP A OD2  5  
ATOM 10674 H H    . ASP A 1 56  ? -1.000  -2.023  -6.056  1.00 0.00 ? 56  ASP A H    5  
ATOM 10675 H HA   . ASP A 1 56  ? -0.528  -2.858  -3.295  1.00 0.00 ? 56  ASP A HA   5  
ATOM 10676 H HB2  . ASP A 1 56  ? -0.274  -0.138  -4.623  1.00 0.00 ? 56  ASP A HB2  5  
ATOM 10677 H HB3  . ASP A 1 56  ? 0.303   -0.540  -3.004  1.00 0.00 ? 56  ASP A HB3  5  
ATOM 10678 H HD2  . ASP A 1 56  ? 3.046   -1.088  -5.294  1.00 0.00 ? 56  ASP A HD2  5  
ATOM 10679 N N    . LEU A 1 57  ? -2.766  -0.476  -3.830  1.00 0.00 ? 57  LEU A N    5  
ATOM 10680 C CA   . LEU A 1 57  ? -4.023  0.102   -3.271  1.00 0.00 ? 57  LEU A CA   5  
ATOM 10681 C C    . LEU A 1 57  ? -5.145  -0.936  -3.349  1.00 0.00 ? 57  LEU A C    5  
ATOM 10682 O O    . LEU A 1 57  ? -5.920  -1.096  -2.427  1.00 0.00 ? 57  LEU A O    5  
ATOM 10683 C CB   . LEU A 1 57  ? -4.413  1.347   -4.082  1.00 0.00 ? 57  LEU A CB   5  
ATOM 10684 C CG   . LEU A 1 57  ? -5.759  1.899   -3.597  1.00 0.00 ? 57  LEU A CG   5  
ATOM 10685 C CD1  . LEU A 1 57  ? -5.637  2.386   -2.151  1.00 0.00 ? 57  LEU A CD1  5  
ATOM 10686 C CD2  . LEU A 1 57  ? -6.174  3.073   -4.487  1.00 0.00 ? 57  LEU A CD2  5  
ATOM 10687 H H    . LEU A 1 57  ? -2.362  -0.079  -4.629  1.00 0.00 ? 57  LEU A H    5  
ATOM 10688 H HA   . LEU A 1 57  ? -3.862  0.381   -2.241  1.00 0.00 ? 57  LEU A HA   5  
ATOM 10689 H HB2  . LEU A 1 57  ? -3.651  2.103   -3.964  1.00 0.00 ? 57  LEU A HB2  5  
ATOM 10690 H HB3  . LEU A 1 57  ? -4.493  1.081   -5.125  1.00 0.00 ? 57  LEU A HB3  5  
ATOM 10691 H HG   . LEU A 1 57  ? -6.507  1.126   -3.654  1.00 0.00 ? 57  LEU A HG   5  
ATOM 10692 H HD11 . LEU A 1 57  ? -6.504  2.980   -1.899  1.00 0.00 ? 57  LEU A HD11 5  
ATOM 10693 H HD12 . LEU A 1 57  ? -4.749  2.985   -2.048  1.00 0.00 ? 57  LEU A HD12 5  
ATOM 10694 H HD13 . LEU A 1 57  ? -5.580  1.535   -1.488  1.00 0.00 ? 57  LEU A HD13 5  
ATOM 10695 H HD21 . LEU A 1 57  ? -5.474  3.885   -4.364  1.00 0.00 ? 57  LEU A HD21 5  
ATOM 10696 H HD22 . LEU A 1 57  ? -7.163  3.405   -4.205  1.00 0.00 ? 57  LEU A HD22 5  
ATOM 10697 H HD23 . LEU A 1 57  ? -6.182  2.756   -5.520  1.00 0.00 ? 57  LEU A HD23 5  
ATOM 10698 N N    . GLU A 1 58  ? -5.235  -1.644  -4.441  1.00 0.00 ? 58  GLU A N    5  
ATOM 10699 C CA   . GLU A 1 58  ? -6.307  -2.672  -4.578  1.00 0.00 ? 58  GLU A CA   5  
ATOM 10700 C C    . GLU A 1 58  ? -6.271  -3.583  -3.353  1.00 0.00 ? 58  GLU A C    5  
ATOM 10701 O O    . GLU A 1 58  ? -7.295  -3.940  -2.805  1.00 0.00 ? 58  GLU A O    5  
ATOM 10702 C CB   . GLU A 1 58  ? -6.043  -3.493  -5.841  1.00 0.00 ? 58  GLU A CB   5  
ATOM 10703 C CG   . GLU A 1 58  ? -7.236  -4.372  -6.167  1.00 0.00 ? 58  GLU A CG   5  
ATOM 10704 C CD   . GLU A 1 58  ? -6.909  -5.236  -7.385  1.00 0.00 ? 58  GLU A CD   5  
ATOM 10705 O OE1  . GLU A 1 58  ? -7.771  -5.993  -7.799  1.00 0.00 ? 58  GLU A OE1  5  
ATOM 10706 O OE2  . GLU A 1 58  ? -5.802  -5.124  -7.888  1.00 0.00 ? 58  GLU A OE2  5  
ATOM 10707 H H    . GLU A 1 58  ? -4.596  -1.500  -5.172  1.00 0.00 ? 58  GLU A H    5  
ATOM 10708 H HA   . GLU A 1 58  ? -7.275  -2.189  -4.648  1.00 0.00 ? 58  GLU A HA   5  
ATOM 10709 H HB2  . GLU A 1 58  ? -5.861  -2.827  -6.671  1.00 0.00 ? 58  GLU A HB2  5  
ATOM 10710 H HB3  . GLU A 1 58  ? -5.182  -4.120  -5.678  1.00 0.00 ? 58  GLU A HB3  5  
ATOM 10711 H HG2  . GLU A 1 58  ? -7.448  -5.003  -5.325  1.00 0.00 ? 58  GLU A HG2  5  
ATOM 10712 H HG3  . GLU A 1 58  ? -8.083  -3.750  -6.389  1.00 0.00 ? 58  GLU A HG3  5  
ATOM 10713 H HE2  . GLU A 1 58  ? -5.668  -5.695  -8.648  1.00 0.00 ? 58  GLU A HE2  5  
ATOM 10714 N N    . THR A 1 59  ? -5.101  -3.942  -2.896  1.00 0.00 ? 59  THR A N    5  
ATOM 10715 C CA   . THR A 1 59  ? -5.022  -4.802  -1.685  1.00 0.00 ? 59  THR A CA   5  
ATOM 10716 C C    . THR A 1 59  ? -5.693  -4.060  -0.531  1.00 0.00 ? 59  THR A C    5  
ATOM 10717 O O    . THR A 1 59  ? -6.450  -4.627  0.231   1.00 0.00 ? 59  THR A O    5  
ATOM 10718 C CB   . THR A 1 59  ? -3.557  -5.089  -1.351  1.00 0.00 ? 59  THR A CB   5  
ATOM 10719 O OG1  . THR A 1 59  ? -2.976  -5.823  -2.419  1.00 0.00 ? 59  THR A OG1  5  
ATOM 10720 C CG2  . THR A 1 59  ? -3.465  -5.896  -0.052  1.00 0.00 ? 59  THR A CG2  5  
ATOM 10721 H H    . THR A 1 59  ? -4.283  -3.629  -3.335  1.00 0.00 ? 59  THR A H    5  
ATOM 10722 H HA   . THR A 1 59  ? -5.543  -5.730  -1.868  1.00 0.00 ? 59  THR A HA   5  
ATOM 10723 H HB   . THR A 1 59  ? -3.026  -4.159  -1.226  1.00 0.00 ? 59  THR A HB   5  
ATOM 10724 H HG1  . THR A 1 59  ? -2.529  -5.201  -2.997  1.00 0.00 ? 59  THR A HG1  5  
ATOM 10725 H HG21 . THR A 1 59  ? -2.426  -6.049  0.204   1.00 0.00 ? 59  THR A HG21 5  
ATOM 10726 H HG22 . THR A 1 59  ? -3.948  -6.853  -0.186  1.00 0.00 ? 59  THR A HG22 5  
ATOM 10727 H HG23 . THR A 1 59  ? -3.954  -5.354  0.744   1.00 0.00 ? 59  THR A HG23 5  
ATOM 10728 N N    . ALA A 1 60  ? -5.443  -2.784  -0.420  1.00 0.00 ? 60  ALA A N    5  
ATOM 10729 C CA   . ALA A 1 60  ? -6.094  -1.998  0.661   1.00 0.00 ? 60  ALA A CA   5  
ATOM 10730 C C    . ALA A 1 60  ? -7.595  -1.969  0.378   1.00 0.00 ? 60  ALA A C    5  
ATOM 10731 O O    . ALA A 1 60  ? -8.412  -2.111  1.265   1.00 0.00 ? 60  ALA A O    5  
ATOM 10732 C CB   . ALA A 1 60  ? -5.538  -0.573  0.662   1.00 0.00 ? 60  ALA A CB   5  
ATOM 10733 H H    . ALA A 1 60  ? -4.848  -2.341  -1.059  1.00 0.00 ? 60  ALA A H    5  
ATOM 10734 H HA   . ALA A 1 60  ? -5.908  -2.465  1.616   1.00 0.00 ? 60  ALA A HA   5  
ATOM 10735 H HB1  . ALA A 1 60  ? -5.487  -0.203  1.676   1.00 0.00 ? 60  ALA A HB1  5  
ATOM 10736 H HB2  . ALA A 1 60  ? -6.185  0.064   0.080   1.00 0.00 ? 60  ALA A HB2  5  
ATOM 10737 H HB3  . ALA A 1 60  ? -4.549  -0.571  0.230   1.00 0.00 ? 60  ALA A HB3  5  
ATOM 10738 N N    . LEU A 1 61  ? -7.959  -1.807  -0.868  1.00 0.00 ? 61  LEU A N    5  
ATOM 10739 C CA   . LEU A 1 61  ? -9.404  -1.788  -1.233  1.00 0.00 ? 61  LEU A CA   5  
ATOM 10740 C C    . LEU A 1 61  ? -10.031 -3.122  -0.844  1.00 0.00 ? 61  LEU A C    5  
ATOM 10741 O O    . LEU A 1 61  ? -11.038 -3.177  -0.166  1.00 0.00 ? 61  LEU A O    5  
ATOM 10742 C CB   . LEU A 1 61  ? -9.524  -1.616  -2.745  1.00 0.00 ? 61  LEU A CB   5  
ATOM 10743 C CG   . LEU A 1 61  ? -8.903  -0.288  -3.157  1.00 0.00 ? 61  LEU A CG   5  
ATOM 10744 C CD1  . LEU A 1 61  ? -8.926  -0.178  -4.679  1.00 0.00 ? 61  LEU A CD1  5  
ATOM 10745 C CD2  . LEU A 1 61  ? -9.703  0.863   -2.547  1.00 0.00 ? 61  LEU A CD2  5  
ATOM 10746 H H    . LEU A 1 61  ? -7.278  -1.711  -1.566  1.00 0.00 ? 61  LEU A H    5  
ATOM 10747 H HA   . LEU A 1 61  ? -9.907  -0.977  -0.731  1.00 0.00 ? 61  LEU A HA   5  
ATOM 10748 H HB2  . LEU A 1 61  ? -9.004  -2.424  -3.238  1.00 0.00 ? 61  LEU A HB2  5  
ATOM 10749 H HB3  . LEU A 1 61  ? -10.561 -1.631  -3.031  1.00 0.00 ? 61  LEU A HB3  5  
ATOM 10750 H HG   . LEU A 1 61  ? -7.885  -0.247  -2.805  1.00 0.00 ? 61  LEU A HG   5  
ATOM 10751 H HD11 . LEU A 1 61  ? -9.250  -1.120  -5.099  1.00 0.00 ? 61  LEU A HD11 5  
ATOM 10752 H HD12 . LEU A 1 61  ? -7.937  0.056   -5.040  1.00 0.00 ? 61  LEU A HD12 5  
ATOM 10753 H HD13 . LEU A 1 61  ? -9.612  0.602   -4.972  1.00 0.00 ? 61  LEU A HD13 5  
ATOM 10754 H HD21 . LEU A 1 61  ? -9.211  1.207   -1.650  1.00 0.00 ? 61  LEU A HD21 5  
ATOM 10755 H HD22 . LEU A 1 61  ? -10.697 0.521   -2.303  1.00 0.00 ? 61  LEU A HD22 5  
ATOM 10756 H HD23 . LEU A 1 61  ? -9.764  1.675   -3.258  1.00 0.00 ? 61  LEU A HD23 5  
ATOM 10757 N N    . ARG A 1 62  ? -9.432  -4.200  -1.269  1.00 0.00 ? 62  ARG A N    5  
ATOM 10758 C CA   . ARG A 1 62  ? -9.981  -5.539  -0.925  1.00 0.00 ? 62  ARG A CA   5  
ATOM 10759 C C    . ARG A 1 62  ? -9.959  -5.718  0.592   1.00 0.00 ? 62  ARG A C    5  
ATOM 10760 O O    . ARG A 1 62  ? -10.901 -6.202  1.185   1.00 0.00 ? 62  ARG A O    5  
ATOM 10761 C CB   . ARG A 1 62  ? -9.123  -6.626  -1.582  1.00 0.00 ? 62  ARG A CB   5  
ATOM 10762 C CG   . ARG A 1 62  ? -9.786  -7.992  -1.384  1.00 0.00 ? 62  ARG A CG   5  
ATOM 10763 C CD   . ARG A 1 62  ? -8.860  -9.094  -1.907  1.00 0.00 ? 62  ARG A CD   5  
ATOM 10764 N NE   . ARG A 1 62  ? -8.627  -8.905  -3.367  1.00 0.00 ? 62  ARG A NE   5  
ATOM 10765 C CZ   . ARG A 1 62  ? -8.171  -9.894  -4.087  1.00 0.00 ? 62  ARG A CZ   5  
ATOM 10766 N NH1  . ARG A 1 62  ? -7.922  -11.046 -3.527  1.00 0.00 ? 62  ARG A NH1  5  
ATOM 10767 N NH2  . ARG A 1 62  ? -7.963  -9.731  -5.366  1.00 0.00 ? 62  ARG A NH2  5  
ATOM 10768 H H    . ARG A 1 62  ? -8.621  -4.124  -1.814  1.00 0.00 ? 62  ARG A H    5  
ATOM 10769 H HA   . ARG A 1 62  ? -10.996 -5.617  -1.283  1.00 0.00 ? 62  ARG A HA   5  
ATOM 10770 H HB2  . ARG A 1 62  ? -9.026  -6.419  -2.637  1.00 0.00 ? 62  ARG A HB2  5  
ATOM 10771 H HB3  . ARG A 1 62  ? -8.144  -6.635  -1.125  1.00 0.00 ? 62  ARG A HB3  5  
ATOM 10772 H HG2  . ARG A 1 62  ? -9.979  -8.151  -0.333  1.00 0.00 ? 62  ARG A HG2  5  
ATOM 10773 H HG3  . ARG A 1 62  ? -10.717 -8.021  -1.929  1.00 0.00 ? 62  ARG A HG3  5  
ATOM 10774 H HD2  . ARG A 1 62  ? -7.914  -9.047  -1.385  1.00 0.00 ? 62  ARG A HD2  5  
ATOM 10775 H HD3  . ARG A 1 62  ? -9.316  -10.058 -1.736  1.00 0.00 ? 62  ARG A HD3  5  
ATOM 10776 H HE   . ARG A 1 62  ? -8.815  -8.039  -3.785  1.00 0.00 ? 62  ARG A HE   5  
ATOM 10777 H HH11 . ARG A 1 62  ? -8.078  -11.170 -2.547  1.00 0.00 ? 62  ARG A HH11 5  
ATOM 10778 H HH12 . ARG A 1 62  ? -7.571  -11.803 -4.077  1.00 0.00 ? 62  ARG A HH12 5  
ATOM 10779 H HH21 . ARG A 1 62  ? -8.154  -8.848  -5.796  1.00 0.00 ? 62  ARG A HH21 5  
ATOM 10780 H HH22 . ARG A 1 62  ? -7.613  -10.490 -5.917  1.00 0.00 ? 62  ARG A HH22 5  
ATOM 10781 N N    . ALA A 1 63  ? -8.892  -5.323  1.229   1.00 0.00 ? 63  ALA A N    5  
ATOM 10782 C CA   . ALA A 1 63  ? -8.814  -5.465  2.709   1.00 0.00 ? 63  ALA A CA   5  
ATOM 10783 C C    . ALA A 1 63  ? -9.840  -4.539  3.360   1.00 0.00 ? 63  ALA A C    5  
ATOM 10784 O O    . ALA A 1 63  ? -10.428 -4.858  4.372   1.00 0.00 ? 63  ALA A O    5  
ATOM 10785 C CB   . ALA A 1 63  ? -7.409  -5.086  3.183   1.00 0.00 ? 63  ALA A CB   5  
ATOM 10786 H H    . ALA A 1 63  ? -8.144  -4.927  0.734   1.00 0.00 ? 63  ALA A H    5  
ATOM 10787 H HA   . ALA A 1 63  ? -9.027  -6.490  2.985   1.00 0.00 ? 63  ALA A HA   5  
ATOM 10788 H HB1  . ALA A 1 63  ? -6.675  -5.526  2.523   1.00 0.00 ? 63  ALA A HB1  5  
ATOM 10789 H HB2  . ALA A 1 63  ? -7.255  -5.455  4.187   1.00 0.00 ? 63  ALA A HB2  5  
ATOM 10790 H HB3  . ALA A 1 63  ? -7.303  -4.012  3.173   1.00 0.00 ? 63  ALA A HB3  5  
ATOM 10791 N N    . THR A 1 64  ? -10.056 -3.389  2.782   1.00 0.00 ? 64  THR A N    5  
ATOM 10792 C CA   . THR A 1 64  ? -11.040 -2.434  3.364   1.00 0.00 ? 64  THR A CA   5  
ATOM 10793 C C    . THR A 1 64  ? -12.424 -3.082  3.430   1.00 0.00 ? 64  THR A C    5  
ATOM 10794 O O    . THR A 1 64  ? -13.116 -2.993  4.423   1.00 0.00 ? 64  THR A O    5  
ATOM 10795 C CB   . THR A 1 64  ? -11.108 -1.188  2.479   1.00 0.00 ? 64  THR A CB   5  
ATOM 10796 O OG1  . THR A 1 64  ? -9.800  -0.673  2.292   1.00 0.00 ? 64  THR A OG1  5  
ATOM 10797 C CG2  . THR A 1 64  ? -11.978 -0.128  3.148   1.00 0.00 ? 64  THR A CG2  5  
ATOM 10798 H H    . THR A 1 64  ? -9.568  -3.152  1.966   1.00 0.00 ? 64  THR A H    5  
ATOM 10799 H HA   . THR A 1 64  ? -10.727 -2.152  4.356   1.00 0.00 ? 64  THR A HA   5  
ATOM 10800 H HB   . THR A 1 64  ? -11.534 -1.446  1.521   1.00 0.00 ? 64  THR A HB   5  
ATOM 10801 H HG1  . THR A 1 64  ? -9.199  -1.417  2.198   1.00 0.00 ? 64  THR A HG1  5  
ATOM 10802 H HG21 . THR A 1 64  ? -12.222 0.639   2.431   1.00 0.00 ? 64  THR A HG21 5  
ATOM 10803 H HG22 . THR A 1 64  ? -11.435 0.309   3.972   1.00 0.00 ? 64  THR A HG22 5  
ATOM 10804 H HG23 . THR A 1 64  ? -12.886 -0.583  3.515   1.00 0.00 ? 64  THR A HG23 5  
ATOM 10805 N N    . GLN A 1 65  ? -12.835 -3.726  2.373   1.00 0.00 ? 65  GLN A N    5  
ATOM 10806 C CA   . GLN A 1 65  ? -14.175 -4.372  2.369   1.00 0.00 ? 65  GLN A CA   5  
ATOM 10807 C C    . GLN A 1 65  ? -14.127 -5.704  3.119   1.00 0.00 ? 65  GLN A C    5  
ATOM 10808 O O    . GLN A 1 65  ? -15.041 -6.054  3.839   1.00 0.00 ? 65  GLN A O    5  
ATOM 10809 C CB   . GLN A 1 65  ? -14.622 -4.599  0.922   1.00 0.00 ? 65  GLN A CB   5  
ATOM 10810 C CG   . GLN A 1 65  ? -15.278 -5.976  0.786   1.00 0.00 ? 65  GLN A CG   5  
ATOM 10811 C CD   . GLN A 1 65  ? -15.885 -6.116  -0.610  1.00 0.00 ? 65  GLN A CD   5  
ATOM 10812 O OE1  . GLN A 1 65  ? -16.104 -5.137  -1.292  1.00 0.00 ? 65  GLN A OE1  5  
ATOM 10813 N NE2  . GLN A 1 65  ? -16.166 -7.305  -1.066  1.00 0.00 ? 65  GLN A NE2  5  
ATOM 10814 H H    . GLN A 1 65  ? -12.261 -3.781  1.580   1.00 0.00 ? 65  GLN A H    5  
ATOM 10815 H HA   . GLN A 1 65  ? -14.879 -3.721  2.857   1.00 0.00 ? 65  GLN A HA   5  
ATOM 10816 H HB2  . GLN A 1 65  ? -15.334 -3.834  0.645   1.00 0.00 ? 65  GLN A HB2  5  
ATOM 10817 H HB3  . GLN A 1 65  ? -13.765 -4.545  0.268   1.00 0.00 ? 65  GLN A HB3  5  
ATOM 10818 H HG2  . GLN A 1 65  ? -14.534 -6.747  0.934   1.00 0.00 ? 65  GLN A HG2  5  
ATOM 10819 H HG3  . GLN A 1 65  ? -16.057 -6.079  1.527   1.00 0.00 ? 65  GLN A HG3  5  
ATOM 10820 H HE21 . GLN A 1 65  ? -15.988 -8.096  -0.514  1.00 0.00 ? 65  GLN A HE21 5  
ATOM 10821 H HE22 . GLN A 1 65  ? -16.554 -7.410  -1.959  1.00 0.00 ? 65  GLN A HE22 5  
ATOM 10822 N N    . GLU A 1 66  ? -13.079 -6.458  2.953   1.00 0.00 ? 66  GLU A N    5  
ATOM 10823 C CA   . GLU A 1 66  ? -12.988 -7.772  3.649   1.00 0.00 ? 66  GLU A CA   5  
ATOM 10824 C C    . GLU A 1 66  ? -12.987 -7.574  5.168   1.00 0.00 ? 66  GLU A C    5  
ATOM 10825 O O    . GLU A 1 66  ? -13.569 -8.346  5.901   1.00 0.00 ? 66  GLU A O    5  
ATOM 10826 C CB   . GLU A 1 66  ? -11.699 -8.479  3.224   1.00 0.00 ? 66  GLU A CB   5  
ATOM 10827 C CG   . GLU A 1 66  ? -11.812 -8.915  1.762   1.00 0.00 ? 66  GLU A CG   5  
ATOM 10828 C CD   . GLU A 1 66  ? -12.914 -9.968  1.627   1.00 0.00 ? 66  GLU A CD   5  
ATOM 10829 O OE1  . GLU A 1 66  ? -13.302 -10.523 2.642   1.00 0.00 ? 66  GLU A OE1  5  
ATOM 10830 O OE2  . GLU A 1 66  ? -13.351 -10.199 0.512   1.00 0.00 ? 66  GLU A OE2  5  
ATOM 10831 H H    . GLU A 1 66  ? -12.354 -6.165  2.361   1.00 0.00 ? 66  GLU A H    5  
ATOM 10832 H HA   . GLU A 1 66  ? -13.837 -8.382  3.371   1.00 0.00 ? 66  GLU A HA   5  
ATOM 10833 H HB2  . GLU A 1 66  ? -10.867 -7.800  3.334   1.00 0.00 ? 66  GLU A HB2  5  
ATOM 10834 H HB3  . GLU A 1 66  ? -11.542 -9.346  3.846   1.00 0.00 ? 66  GLU A HB3  5  
ATOM 10835 H HG2  . GLU A 1 66  ? -12.056 -8.062  1.149   1.00 0.00 ? 66  GLU A HG2  5  
ATOM 10836 H HG3  . GLU A 1 66  ? -10.873 -9.337  1.439   1.00 0.00 ? 66  GLU A HG3  5  
ATOM 10837 H HE2  . GLU A 1 66  ? -14.039 -10.868 0.502   1.00 0.00 ? 66  GLU A HE2  5  
ATOM 10838 N N    . GLU A 1 67  ? -12.330 -6.554  5.651   1.00 0.00 ? 67  GLU A N    5  
ATOM 10839 C CA   . GLU A 1 67  ? -12.291 -6.328  7.127   1.00 0.00 ? 67  GLU A CA   5  
ATOM 10840 C C    . GLU A 1 67  ? -13.258 -5.207  7.528   1.00 0.00 ? 67  GLU A C    5  
ATOM 10841 O O    . GLU A 1 67  ? -13.317 -4.815  8.676   1.00 0.00 ? 67  GLU A O    5  
ATOM 10842 C CB   . GLU A 1 67  ? -10.871 -5.949  7.545   1.00 0.00 ? 67  GLU A CB   5  
ATOM 10843 C CG   . GLU A 1 67  ? -9.926  -7.118  7.267   1.00 0.00 ? 67  GLU A CG   5  
ATOM 10844 C CD   . GLU A 1 67  ? -10.332 -8.316  8.125   1.00 0.00 ? 67  GLU A CD   5  
ATOM 10845 O OE1  . GLU A 1 67  ? -11.052 -8.111  9.088   1.00 0.00 ? 67  GLU A OE1  5  
ATOM 10846 O OE2  . GLU A 1 67  ? -9.916  -9.418  7.806   1.00 0.00 ? 67  GLU A OE2  5  
ATOM 10847 H H    . GLU A 1 67  ? -11.858 -5.942  5.047   1.00 0.00 ? 67  GLU A H    5  
ATOM 10848 H HA   . GLU A 1 67  ? -12.578 -7.237  7.633   1.00 0.00 ? 67  GLU A HA   5  
ATOM 10849 H HB2  . GLU A 1 67  ? -10.548 -5.085  6.984   1.00 0.00 ? 67  GLU A HB2  5  
ATOM 10850 H HB3  . GLU A 1 67  ? -10.854 -5.719  8.599   1.00 0.00 ? 67  GLU A HB3  5  
ATOM 10851 H HG2  . GLU A 1 67  ? -9.986  -7.386  6.222   1.00 0.00 ? 67  GLU A HG2  5  
ATOM 10852 H HG3  . GLU A 1 67  ? -8.914  -6.831  7.508   1.00 0.00 ? 67  GLU A HG3  5  
ATOM 10853 H HE2  . GLU A 1 67  ? -10.210 -10.121 8.390   1.00 0.00 ? 67  GLU A HE2  5  
ATOM 10854 N N    . ALA A 1 68  ? -14.011 -4.684  6.601   1.00 0.00 ? 68  ALA A N    5  
ATOM 10855 C CA   . ALA A 1 68  ? -14.962 -3.588  6.951   1.00 0.00 ? 68  ALA A CA   5  
ATOM 10856 C C    . ALA A 1 68  ? -16.204 -3.676  6.069   1.00 0.00 ? 68  ALA A C    5  
ATOM 10857 O O    . ALA A 1 68  ? -17.267 -3.216  6.430   1.00 0.00 ? 68  ALA A O    5  
ATOM 10858 C CB   . ALA A 1 68  ? -14.285 -2.235  6.734   1.00 0.00 ? 68  ALA A CB   5  
ATOM 10859 H H    . ALA A 1 68  ? -13.950 -5.006  5.677   1.00 0.00 ? 68  ALA A H    5  
ATOM 10860 H HA   . ALA A 1 68  ? -15.249 -3.680  7.989   1.00 0.00 ? 68  ALA A HA   5  
ATOM 10861 H HB1  . ALA A 1 68  ? -14.517 -1.581  7.560   1.00 0.00 ? 68  ALA A HB1  5  
ATOM 10862 H HB2  . ALA A 1 68  ? -14.648 -1.797  5.815   1.00 0.00 ? 68  ALA A HB2  5  
ATOM 10863 H HB3  . ALA A 1 68  ? -13.217 -2.373  6.669   1.00 0.00 ? 68  ALA A HB3  5  
ATOM 10864 N N    . GLY A 1 69  ? -16.081 -4.251  4.908   1.00 0.00 ? 69  GLY A N    5  
ATOM 10865 C CA   . GLY A 1 69  ? -17.262 -4.355  4.008   1.00 0.00 ? 69  GLY A CA   5  
ATOM 10866 C C    . GLY A 1 69  ? -17.322 -3.116  3.120   1.00 0.00 ? 69  GLY A C    5  
ATOM 10867 O O    . GLY A 1 69  ? -18.204 -2.974  2.297   1.00 0.00 ? 69  GLY A O    5  
ATOM 10868 H H    . GLY A 1 69  ? -15.214 -4.612  4.629   1.00 0.00 ? 69  GLY A H    5  
ATOM 10869 H HA2  . GLY A 1 69  ? -17.173 -5.239  3.394   1.00 0.00 ? 69  GLY A HA2  5  
ATOM 10870 H HA3  . GLY A 1 69  ? -18.163 -4.414  4.599   1.00 0.00 ? 69  GLY A HA3  5  
ATOM 10871 N N    . ILE A 1 70  ? -16.391 -2.215  3.279   1.00 0.00 ? 70  ILE A N    5  
ATOM 10872 C CA   . ILE A 1 70  ? -16.399 -0.988  2.442   1.00 0.00 ? 70  ILE A CA   5  
ATOM 10873 C C    . ILE A 1 70  ? -15.274 -1.082  1.405   1.00 0.00 ? 70  ILE A C    5  
ATOM 10874 O O    . ILE A 1 70  ? -14.122 -1.279  1.740   1.00 0.00 ? 70  ILE A O    5  
ATOM 10875 C CB   . ILE A 1 70  ? -16.174 0.246   3.318   1.00 0.00 ? 70  ILE A CB   5  
ATOM 10876 C CG1  . ILE A 1 70  ? -16.990 0.142   4.611   1.00 0.00 ? 70  ILE A CG1  5  
ATOM 10877 C CG2  . ILE A 1 70  ? -16.647 1.473   2.545   1.00 0.00 ? 70  ILE A CG2  5  
ATOM 10878 C CD1  . ILE A 1 70  ? -16.423 1.107   5.661   1.00 0.00 ? 70  ILE A CD1  5  
ATOM 10879 H H    . ILE A 1 70  ? -15.689 -2.348  3.949   1.00 0.00 ? 70  ILE A H    5  
ATOM 10880 H HA   . ILE A 1 70  ? -17.345 -0.904  1.936   1.00 0.00 ? 70  ILE A HA   5  
ATOM 10881 H HB   . ILE A 1 70  ? -15.122 0.340   3.550   1.00 0.00 ? 70  ILE A HB   5  
ATOM 10882 H HG12 . ILE A 1 70  ? -18.011 0.409   4.404   1.00 0.00 ? 70  ILE A HG12 5  
ATOM 10883 H HG13 . ILE A 1 70  ? -16.947 -0.866  4.992   1.00 0.00 ? 70  ILE A HG13 5  
ATOM 10884 H HG21 . ILE A 1 70  ? -16.082 1.562   1.634   1.00 0.00 ? 70  ILE A HG21 5  
ATOM 10885 H HG22 . ILE A 1 70  ? -16.511 2.355   3.147   1.00 0.00 ? 70  ILE A HG22 5  
ATOM 10886 H HG23 . ILE A 1 70  ? -17.693 1.363   2.308   1.00 0.00 ? 70  ILE A HG23 5  
ATOM 10887 H HD11 . ILE A 1 70  ? -15.543 1.596   5.270   1.00 0.00 ? 70  ILE A HD11 5  
ATOM 10888 H HD12 . ILE A 1 70  ? -16.159 0.555   6.551   1.00 0.00 ? 70  ILE A HD12 5  
ATOM 10889 H HD13 . ILE A 1 70  ? -17.169 1.848   5.906   1.00 0.00 ? 70  ILE A HD13 5  
ATOM 10890 N N    . GLU A 1 71  ? -15.602 -0.940  0.150   1.00 0.00 ? 71  GLU A N    5  
ATOM 10891 C CA   . GLU A 1 71  ? -14.562 -1.017  -0.916  1.00 0.00 ? 71  GLU A CA   5  
ATOM 10892 C C    . GLU A 1 71  ? -14.492 0.319   -1.655  1.00 0.00 ? 71  GLU A C    5  
ATOM 10893 O O    . GLU A 1 71  ? -15.329 1.181   -1.480  1.00 0.00 ? 71  GLU A O    5  
ATOM 10894 C CB   . GLU A 1 71  ? -14.906 -2.153  -1.889  1.00 0.00 ? 71  GLU A CB   5  
ATOM 10895 C CG   . GLU A 1 71  ? -14.266 -1.907  -3.257  1.00 0.00 ? 71  GLU A CG   5  
ATOM 10896 C CD   . GLU A 1 71  ? -14.599 -3.070  -4.190  1.00 0.00 ? 71  GLU A CD   5  
ATOM 10897 O OE1  . GLU A 1 71  ? -14.179 -3.024  -5.336  1.00 0.00 ? 71  GLU A OE1  5  
ATOM 10898 O OE2  . GLU A 1 71  ? -15.265 -3.990  -3.746  1.00 0.00 ? 71  GLU A OE2  5  
ATOM 10899 H H    . GLU A 1 71  ? -16.536 -0.781  -0.094  1.00 0.00 ? 71  GLU A H    5  
ATOM 10900 H HA   . GLU A 1 71  ? -13.601 -1.218  -0.461  1.00 0.00 ? 71  GLU A HA   5  
ATOM 10901 H HB2  . GLU A 1 71  ? -14.534 -3.082  -1.489  1.00 0.00 ? 71  GLU A HB2  5  
ATOM 10902 H HB3  . GLU A 1 71  ? -15.979 -2.215  -2.002  1.00 0.00 ? 71  GLU A HB3  5  
ATOM 10903 H HG2  . GLU A 1 71  ? -14.657 -0.995  -3.680  1.00 0.00 ? 71  GLU A HG2  5  
ATOM 10904 H HG3  . GLU A 1 71  ? -13.195 -1.826  -3.151  1.00 0.00 ? 71  GLU A HG3  5  
ATOM 10905 H HE2  . GLU A 1 71  ? -15.435 -4.684  -4.387  1.00 0.00 ? 71  GLU A HE2  5  
ATOM 10906 N N    . ALA A 1 72  ? -13.494 0.496   -2.473  1.00 0.00 ? 72  ALA A N    5  
ATOM 10907 C CA   . ALA A 1 72  ? -13.364 1.780   -3.221  1.00 0.00 ? 72  ALA A CA   5  
ATOM 10908 C C    . ALA A 1 72  ? -14.717 2.162   -3.812  1.00 0.00 ? 72  ALA A C    5  
ATOM 10909 O O    . ALA A 1 72  ? -15.091 3.317   -3.834  1.00 0.00 ? 72  ALA A O    5  
ATOM 10910 C CB   . ALA A 1 72  ? -12.341 1.614   -4.338  1.00 0.00 ? 72  ALA A CB   5  
ATOM 10911 H H    . ALA A 1 72  ? -12.830 -0.215  -2.594  1.00 0.00 ? 72  ALA A H    5  
ATOM 10912 H HA   . ALA A 1 72  ? -13.038 2.557   -2.555  1.00 0.00 ? 72  ALA A HA   5  
ATOM 10913 H HB1  . ALA A 1 72  ? -11.835 0.668   -4.223  1.00 0.00 ? 72  ALA A HB1  5  
ATOM 10914 H HB2  . ALA A 1 72  ? -11.620 2.416   -4.282  1.00 0.00 ? 72  ALA A HB2  5  
ATOM 10915 H HB3  . ALA A 1 72  ? -12.841 1.644   -5.293  1.00 0.00 ? 72  ALA A HB3  5  
ATOM 10916 N N    . GLY A 1 73  ? -15.464 1.203   -4.269  1.00 0.00 ? 73  GLY A N    5  
ATOM 10917 C CA   . GLY A 1 73  ? -16.800 1.514   -4.833  1.00 0.00 ? 73  GLY A CA   5  
ATOM 10918 C C    . GLY A 1 73  ? -17.652 2.153   -3.739  1.00 0.00 ? 73  GLY A C    5  
ATOM 10919 O O    . GLY A 1 73  ? -18.632 2.820   -4.007  1.00 0.00 ? 73  GLY A O    5  
ATOM 10920 H H    . GLY A 1 73  ? -15.155 0.277   -4.225  1.00 0.00 ? 73  GLY A H    5  
ATOM 10921 H HA2  . GLY A 1 73  ? -16.693 2.202   -5.661  1.00 0.00 ? 73  GLY A HA2  5  
ATOM 10922 H HA3  . GLY A 1 73  ? -17.274 0.606   -5.171  1.00 0.00 ? 73  GLY A HA3  5  
ATOM 10923 N N    . GLN A 1 74  ? -17.290 1.940   -2.500  1.00 0.00 ? 74  GLN A N    5  
ATOM 10924 C CA   . GLN A 1 74  ? -18.085 2.520   -1.384  1.00 0.00 ? 74  GLN A CA   5  
ATOM 10925 C C    . GLN A 1 74  ? -17.353 3.711   -0.745  1.00 0.00 ? 74  GLN A C    5  
ATOM 10926 O O    . GLN A 1 74  ? -17.945 4.470   -0.004  1.00 0.00 ? 74  GLN A O    5  
ATOM 10927 C CB   . GLN A 1 74  ? -18.341 1.437   -0.334  1.00 0.00 ? 74  GLN A CB   5  
ATOM 10928 C CG   . GLN A 1 74  ? -19.198 0.330   -0.950  1.00 0.00 ? 74  GLN A CG   5  
ATOM 10929 C CD   . GLN A 1 74  ? -19.491 -0.740  0.104   1.00 0.00 ? 74  GLN A CD   5  
ATOM 10930 O OE1  . GLN A 1 74  ? -18.714 -1.655  0.291   1.00 0.00 ? 74  GLN A OE1  5  
ATOM 10931 N NE2  . GLN A 1 74  ? -20.589 -0.662  0.806   1.00 0.00 ? 74  GLN A NE2  5  
ATOM 10932 H H    . GLN A 1 74  ? -16.502 1.388   -2.307  1.00 0.00 ? 74  GLN A H    5  
ATOM 10933 H HA   . GLN A 1 74  ? -19.031 2.861   -1.770  1.00 0.00 ? 74  GLN A HA   5  
ATOM 10934 H HB2  . GLN A 1 74  ? -17.400 1.024   -0.007  1.00 0.00 ? 74  GLN A HB2  5  
ATOM 10935 H HB3  . GLN A 1 74  ? -18.863 1.867   0.507   1.00 0.00 ? 74  GLN A HB3  5  
ATOM 10936 H HG2  . GLN A 1 74  ? -20.129 0.752   -1.304  1.00 0.00 ? 74  GLN A HG2  5  
ATOM 10937 H HG3  . GLN A 1 74  ? -18.668 -0.117  -1.777  1.00 0.00 ? 74  GLN A HG3  5  
ATOM 10938 H HE21 . GLN A 1 74  ? -21.216 0.076   0.656   1.00 0.00 ? 74  GLN A HE21 5  
ATOM 10939 H HE22 . GLN A 1 74  ? -20.785 -1.342  1.486   1.00 0.00 ? 74  GLN A HE22 5  
ATOM 10940 N N    . LEU A 1 75  ? -16.086 3.909   -1.034  1.00 0.00 ? 75  LEU A N    5  
ATOM 10941 C CA   . LEU A 1 75  ? -15.378 5.087   -0.436  1.00 0.00 ? 75  LEU A CA   5  
ATOM 10942 C C    . LEU A 1 75  ? -14.678 5.878   -1.532  1.00 0.00 ? 75  LEU A C    5  
ATOM 10943 O O    . LEU A 1 75  ? -14.755 5.558   -2.702  1.00 0.00 ? 75  LEU A O    5  
ATOM 10944 C CB   . LEU A 1 75  ? -14.322 4.684   0.612   1.00 0.00 ? 75  LEU A CB   5  
ATOM 10945 C CG   . LEU A 1 75  ? -14.098 3.171   0.644   1.00 0.00 ? 75  LEU A CG   5  
ATOM 10946 C CD1  . LEU A 1 75  ? -12.814 2.835   -0.112  1.00 0.00 ? 75  LEU A CD1  5  
ATOM 10947 C CD2  . LEU A 1 75  ? -13.943 2.713   2.092   1.00 0.00 ? 75  LEU A CD2  5  
ATOM 10948 H H    . LEU A 1 75  ? -15.616 3.306   -1.644  1.00 0.00 ? 75  LEU A H    5  
ATOM 10949 H HA   . LEU A 1 75  ? -16.109 5.727   0.031   1.00 0.00 ? 75  LEU A HA   5  
ATOM 10950 H HB2  . LEU A 1 75  ? -13.389 5.171   0.377   1.00 0.00 ? 75  LEU A HB2  5  
ATOM 10951 H HB3  . LEU A 1 75  ? -14.648 5.015   1.584   1.00 0.00 ? 75  LEU A HB3  5  
ATOM 10952 H HG   . LEU A 1 75  ? -14.934 2.666   0.192   1.00 0.00 ? 75  LEU A HG   5  
ATOM 10953 H HD11 . LEU A 1 75  ? -11.975 2.877   0.570   1.00 0.00 ? 75  LEU A HD11 5  
ATOM 10954 H HD12 . LEU A 1 75  ? -12.668 3.551   -0.906  1.00 0.00 ? 75  LEU A HD12 5  
ATOM 10955 H HD13 . LEU A 1 75  ? -12.890 1.841   -0.526  1.00 0.00 ? 75  LEU A HD13 5  
ATOM 10956 H HD21 . LEU A 1 75  ? -14.711 3.160   2.696   1.00 0.00 ? 75  LEU A HD21 5  
ATOM 10957 H HD22 . LEU A 1 75  ? -12.974 3.011   2.462   1.00 0.00 ? 75  LEU A HD22 5  
ATOM 10958 H HD23 . LEU A 1 75  ? -14.030 1.640   2.137   1.00 0.00 ? 75  LEU A HD23 5  
ATOM 10959 N N    . THR A 1 76  ? -13.984 6.910   -1.146  1.00 0.00 ? 76  THR A N    5  
ATOM 10960 C CA   . THR A 1 76  ? -13.255 7.743   -2.135  1.00 0.00 ? 76  THR A CA   5  
ATOM 10961 C C    . THR A 1 76  ? -11.784 7.813   -1.723  1.00 0.00 ? 76  THR A C    5  
ATOM 10962 O O    . THR A 1 76  ? -11.443 8.395   -0.716  1.00 0.00 ? 76  THR A O    5  
ATOM 10963 C CB   . THR A 1 76  ? -13.857 9.150   -2.144  1.00 0.00 ? 76  THR A CB   5  
ATOM 10964 O OG1  . THR A 1 76  ? -15.156 9.104   -2.719  1.00 0.00 ? 76  THR A OG1  5  
ATOM 10965 C CG2  . THR A 1 76  ? -12.965 10.089  -2.952  1.00 0.00 ? 76  THR A CG2  5  
ATOM 10966 H H    . THR A 1 76  ? -13.937 7.131   -0.194  1.00 0.00 ? 76  THR A H    5  
ATOM 10967 H HA   . THR A 1 76  ? -13.339 7.303   -3.117  1.00 0.00 ? 76  THR A HA   5  
ATOM 10968 H HB   . THR A 1 76  ? -13.929 9.515   -1.131  1.00 0.00 ? 76  THR A HB   5  
ATOM 10969 H HG1  . THR A 1 76  ? -15.321 8.203   -3.005  1.00 0.00 ? 76  THR A HG1  5  
ATOM 10970 H HG21 . THR A 1 76  ? -12.423 10.735  -2.279  1.00 0.00 ? 76  THR A HG21 5  
ATOM 10971 H HG22 . THR A 1 76  ? -13.577 10.689  -3.610  1.00 0.00 ? 76  THR A HG22 5  
ATOM 10972 H HG23 . THR A 1 76  ? -12.268 9.509   -3.538  1.00 0.00 ? 76  THR A HG23 5  
ATOM 10973 N N    . ILE A 1 77  ? -10.911 7.229   -2.495  1.00 0.00 ? 77  ILE A N    5  
ATOM 10974 C CA   . ILE A 1 77  ? -9.467  7.261   -2.134  1.00 0.00 ? 77  ILE A CA   5  
ATOM 10975 C C    . ILE A 1 77  ? -8.872  8.597   -2.589  1.00 0.00 ? 77  ILE A C    5  
ATOM 10976 O O    . ILE A 1 77  ? -9.041  9.010   -3.718  1.00 0.00 ? 77  ILE A O    5  
ATOM 10977 C CB   . ILE A 1 77  ? -8.741  6.110   -2.837  1.00 0.00 ? 77  ILE A CB   5  
ATOM 10978 C CG1  . ILE A 1 77  ? -9.569  4.822   -2.716  1.00 0.00 ? 77  ILE A CG1  5  
ATOM 10979 C CG2  . ILE A 1 77  ? -7.369  5.894   -2.190  1.00 0.00 ? 77  ILE A CG2  5  
ATOM 10980 C CD1  . ILE A 1 77  ? -9.545  4.304   -1.275  1.00 0.00 ? 77  ILE A CD1  5  
ATOM 10981 H H    . ILE A 1 77  ? -11.205 6.763   -3.304  1.00 0.00 ? 77  ILE A H    5  
ATOM 10982 H HA   . ILE A 1 77  ? -9.355  7.164   -1.066  1.00 0.00 ? 77  ILE A HA   5  
ATOM 10983 H HB   . ILE A 1 77  ? -8.607  6.354   -3.882  1.00 0.00 ? 77  ILE A HB   5  
ATOM 10984 H HG12 . ILE A 1 77  ? -10.589 5.023   -3.006  1.00 0.00 ? 77  ILE A HG12 5  
ATOM 10985 H HG13 . ILE A 1 77  ? -9.155  4.070   -3.371  1.00 0.00 ? 77  ILE A HG13 5  
ATOM 10986 H HG21 . ILE A 1 77  ? -6.835  6.832   -2.164  1.00 0.00 ? 77  ILE A HG21 5  
ATOM 10987 H HG22 . ILE A 1 77  ? -6.809  5.173   -2.767  1.00 0.00 ? 77  ILE A HG22 5  
ATOM 10988 H HG23 . ILE A 1 77  ? -7.500  5.525   -1.184  1.00 0.00 ? 77  ILE A HG23 5  
ATOM 10989 H HD11 . ILE A 1 77  ? -9.127  5.058   -0.626  1.00 0.00 ? 77  ILE A HD11 5  
ATOM 10990 H HD12 . ILE A 1 77  ? -8.937  3.412   -1.225  1.00 0.00 ? 77  ILE A HD12 5  
ATOM 10991 H HD13 . ILE A 1 77  ? -10.551 4.073   -0.957  1.00 0.00 ? 77  ILE A HD13 5  
ATOM 10992 N N    . ILE A 1 78  ? -8.187  9.282   -1.714  1.00 0.00 ? 78  ILE A N    5  
ATOM 10993 C CA   . ILE A 1 78  ? -7.597  10.594  -2.100  1.00 0.00 ? 78  ILE A CA   5  
ATOM 10994 C C    . ILE A 1 78  ? -6.220  10.381  -2.726  1.00 0.00 ? 78  ILE A C    5  
ATOM 10995 O O    . ILE A 1 78  ? -5.460  9.523   -2.321  1.00 0.00 ? 78  ILE A O    5  
ATOM 10996 C CB   . ILE A 1 78  ? -7.487  11.497  -0.870  1.00 0.00 ? 78  ILE A CB   5  
ATOM 10997 C CG1  . ILE A 1 78  ? -8.541  12.603  -0.971  1.00 0.00 ? 78  ILE A CG1  5  
ATOM 10998 C CG2  . ILE A 1 78  ? -6.092  12.126  -0.797  1.00 0.00 ? 78  ILE A CG2  5  
ATOM 10999 C CD1  . ILE A 1 78  ? -9.936  11.978  -1.014  1.00 0.00 ? 78  ILE A CD1  5  
ATOM 11000 H H    . ILE A 1 78  ? -8.066  8.937   -0.804  1.00 0.00 ? 78  ILE A H    5  
ATOM 11001 H HA   . ILE A 1 78  ? -8.242  11.066  -2.828  1.00 0.00 ? 78  ILE A HA   5  
ATOM 11002 H HB   . ILE A 1 78  ? -7.664  10.913  0.018   1.00 0.00 ? 78  ILE A HB   5  
ATOM 11003 H HG12 . ILE A 1 78  ? -8.464  13.253  -0.117  1.00 0.00 ? 78  ILE A HG12 5  
ATOM 11004 H HG13 . ILE A 1 78  ? -8.378  13.173  -1.868  1.00 0.00 ? 78  ILE A HG13 5  
ATOM 11005 H HG21 . ILE A 1 78  ? -5.871  12.624  -1.728  1.00 0.00 ? 78  ILE A HG21 5  
ATOM 11006 H HG22 . ILE A 1 78  ? -5.358  11.357  -0.615  1.00 0.00 ? 78  ILE A HG22 5  
ATOM 11007 H HG23 . ILE A 1 78  ? -6.065  12.846  0.010   1.00 0.00 ? 78  ILE A HG23 5  
ATOM 11008 H HD11 . ILE A 1 78  ? -10.644 12.645  -0.546  1.00 0.00 ? 78  ILE A HD11 5  
ATOM 11009 H HD12 . ILE A 1 78  ? -9.927  11.035  -0.487  1.00 0.00 ? 78  ILE A HD12 5  
ATOM 11010 H HD13 . ILE A 1 78  ? -10.225 11.811  -2.041  1.00 0.00 ? 78  ILE A HD13 5  
ATOM 11011 N N    . GLU A 1 79  ? -5.910  11.148  -3.730  1.00 0.00 ? 79  GLU A N    5  
ATOM 11012 C CA   . GLU A 1 79  ? -4.598  10.999  -4.422  1.00 0.00 ? 79  GLU A CA   5  
ATOM 11013 C C    . GLU A 1 79  ? -3.642  12.123  -4.017  1.00 0.00 ? 79  GLU A C    5  
ATOM 11014 O O    . GLU A 1 79  ? -4.055  13.217  -3.684  1.00 0.00 ? 79  GLU A O    5  
ATOM 11015 C CB   . GLU A 1 79  ? -4.825  11.051  -5.929  1.00 0.00 ? 79  GLU A CB   5  
ATOM 11016 C CG   . GLU A 1 79  ? -5.795  9.940   -6.335  1.00 0.00 ? 79  GLU A CG   5  
ATOM 11017 C CD   . GLU A 1 79  ? -5.981  9.955   -7.852  1.00 0.00 ? 79  GLU A CD   5  
ATOM 11018 O OE1  . GLU A 1 79  ? -6.586  9.029   -8.365  1.00 0.00 ? 79  GLU A OE1  5  
ATOM 11019 O OE2  . GLU A 1 79  ? -5.511  10.894  -8.477  1.00 0.00 ? 79  GLU A OE2  5  
ATOM 11020 H H    . GLU A 1 79  ? -6.552  11.822  -4.041  1.00 0.00 ? 79  GLU A H    5  
ATOM 11021 H HA   . GLU A 1 79  ? -4.161  10.046  -4.162  1.00 0.00 ? 79  GLU A HA   5  
ATOM 11022 H HB2  . GLU A 1 79  ? -5.239  12.012  -6.195  1.00 0.00 ? 79  GLU A HB2  5  
ATOM 11023 H HB3  . GLU A 1 79  ? -3.885  10.911  -6.441  1.00 0.00 ? 79  GLU A HB3  5  
ATOM 11024 H HG2  . GLU A 1 79  ? -5.396  8.984   -6.030  1.00 0.00 ? 79  GLU A HG2  5  
ATOM 11025 H HG3  . GLU A 1 79  ? -6.749  10.103  -5.855  1.00 0.00 ? 79  GLU A HG3  5  
ATOM 11026 H HE2  . GLU A 1 79  ? -5.665  10.838  -9.423  1.00 0.00 ? 79  GLU A HE2  5  
ATOM 11027 N N    . GLY A 1 80  ? -2.364  11.863  -4.060  1.00 0.00 ? 80  GLY A N    5  
ATOM 11028 C CA   . GLY A 1 80  ? -1.372  12.912  -3.693  1.00 0.00 ? 80  GLY A CA   5  
ATOM 11029 C C    . GLY A 1 80  ? -0.777  12.602  -2.322  1.00 0.00 ? 80  GLY A C    5  
ATOM 11030 O O    . GLY A 1 80  ? 0.330   12.998  -2.013  1.00 0.00 ? 80  GLY A O    5  
ATOM 11031 H H    . GLY A 1 80  ? -2.056  10.976  -4.342  1.00 0.00 ? 80  GLY A H    5  
ATOM 11032 H HA2  . GLY A 1 80  ? -0.583  12.933  -4.432  1.00 0.00 ? 80  GLY A HA2  5  
ATOM 11033 H HA3  . GLY A 1 80  ? -1.861  13.873  -3.661  1.00 0.00 ? 80  GLY A HA3  5  
ATOM 11034 N N    . PHE A 1 81  ? -1.497  11.894  -1.495  1.00 0.00 ? 81  PHE A N    5  
ATOM 11035 C CA   . PHE A 1 81  ? -0.961  11.558  -0.146  1.00 0.00 ? 81  PHE A CA   5  
ATOM 11036 C C    . PHE A 1 81  ? -0.684  10.060  -0.037  1.00 0.00 ? 81  PHE A C    5  
ATOM 11037 O O    . PHE A 1 81  ? -1.551  9.239   -0.264  1.00 0.00 ? 81  PHE A O    5  
ATOM 11038 C CB   . PHE A 1 81  ? -1.976  11.946  0.925   1.00 0.00 ? 81  PHE A CB   5  
ATOM 11039 C CG   . PHE A 1 81  ? -1.514  11.391  2.249   1.00 0.00 ? 81  PHE A CG   5  
ATOM 11040 C CD1  . PHE A 1 81  ? -1.821  10.070  2.594   1.00 0.00 ? 81  PHE A CD1  5  
ATOM 11041 C CD2  . PHE A 1 81  ? -0.772  12.189  3.126   1.00 0.00 ? 81  PHE A CD2  5  
ATOM 11042 C CE1  . PHE A 1 81  ? -1.385  9.548   3.817   1.00 0.00 ? 81  PHE A CE1  5  
ATOM 11043 C CE2  . PHE A 1 81  ? -0.338  11.666  4.346   1.00 0.00 ? 81  PHE A CE2  5  
ATOM 11044 C CZ   . PHE A 1 81  ? -0.645  10.347  4.693   1.00 0.00 ? 81  PHE A CZ   5  
ATOM 11045 H H    . PHE A 1 81  ? -2.388  11.579  -1.761  1.00 0.00 ? 81  PHE A H    5  
ATOM 11046 H HA   . PHE A 1 81  ? -0.043  12.103  0.020   1.00 0.00 ? 81  PHE A HA   5  
ATOM 11047 H HB2  . PHE A 1 81  ? -2.045  13.023  0.988   1.00 0.00 ? 81  PHE A HB2  5  
ATOM 11048 H HB3  . PHE A 1 81  ? -2.942  11.531  0.678   1.00 0.00 ? 81  PHE A HB3  5  
ATOM 11049 H HD1  . PHE A 1 81  ? -2.390  9.453   1.917   1.00 0.00 ? 81  PHE A HD1  5  
ATOM 11050 H HD2  . PHE A 1 81  ? -0.534  13.205  2.860   1.00 0.00 ? 81  PHE A HD2  5  
ATOM 11051 H HE1  . PHE A 1 81  ? -1.622  8.530   4.085   1.00 0.00 ? 81  PHE A HE1  5  
ATOM 11052 H HE2  . PHE A 1 81  ? 0.234   12.280  5.021   1.00 0.00 ? 81  PHE A HE2  5  
ATOM 11053 H HZ   . PHE A 1 81  ? -0.312  9.944   5.637   1.00 0.00 ? 81  PHE A HZ   5  
ATOM 11054 N N    . LYS A 1 82  ? 0.507   9.694   0.344   1.00 0.00 ? 82  LYS A N    5  
ATOM 11055 C CA   . LYS A 1 82  ? 0.820   8.250   0.505   1.00 0.00 ? 82  LYS A CA   5  
ATOM 11056 C C    . LYS A 1 82  ? 1.975   8.089   1.483   1.00 0.00 ? 82  LYS A C    5  
ATOM 11057 O O    . LYS A 1 82  ? 2.951   8.813   1.444   1.00 0.00 ? 82  LYS A O    5  
ATOM 11058 C CB   . LYS A 1 82  ? 1.219   7.618   -0.824  1.00 0.00 ? 82  LYS A CB   5  
ATOM 11059 C CG   . LYS A 1 82  ? 1.208   6.098   -0.658  1.00 0.00 ? 82  LYS A CG   5  
ATOM 11060 C CD   . LYS A 1 82  ? 1.626   5.428   -1.967  1.00 0.00 ? 82  LYS A CD   5  
ATOM 11061 C CE   . LYS A 1 82  ? 3.110   5.688   -2.227  1.00 0.00 ? 82  LYS A CE   5  
ATOM 11062 N NZ   . LYS A 1 82  ? 3.253   6.689   -3.320  1.00 0.00 ? 82  LYS A NZ   5  
ATOM 11063 H H    . LYS A 1 82  ? 1.187   10.370  0.548   1.00 0.00 ? 82  LYS A H    5  
ATOM 11064 H HA   . LYS A 1 82  ? -0.050  7.740   0.894   1.00 0.00 ? 82  LYS A HA   5  
ATOM 11065 H HB2  . LYS A 1 82  ? 0.522   7.913   -1.595  1.00 0.00 ? 82  LYS A HB2  5  
ATOM 11066 H HB3  . LYS A 1 82  ? 2.212   7.940   -1.083  1.00 0.00 ? 82  LYS A HB3  5  
ATOM 11067 H HG2  . LYS A 1 82  ? 1.896   5.816   0.125   1.00 0.00 ? 82  LYS A HG2  5  
ATOM 11068 H HG3  . LYS A 1 82  ? 0.213   5.772   -0.395  1.00 0.00 ? 82  LYS A HG3  5  
ATOM 11069 H HD2  . LYS A 1 82  ? 1.459   4.364   -1.893  1.00 0.00 ? 82  LYS A HD2  5  
ATOM 11070 H HD3  . LYS A 1 82  ? 1.043   5.831   -2.781  1.00 0.00 ? 82  LYS A HD3  5  
ATOM 11071 H HE2  . LYS A 1 82  ? 3.573   6.066   -1.329  1.00 0.00 ? 82  LYS A HE2  5  
ATOM 11072 H HE3  . LYS A 1 82  ? 3.587   4.764   -2.518  1.00 0.00 ? 82  LYS A HE3  5  
ATOM 11073 H HZ1  . LYS A 1 82  ? 3.230   7.646   -2.916  1.00 0.00 ? 82  LYS A HZ1  5  
ATOM 11074 H HZ2  . LYS A 1 82  ? 2.471   6.578   -3.995  1.00 0.00 ? 82  LYS A HZ2  5  
ATOM 11075 H HZ3  . LYS A 1 82  ? 4.159   6.543   -3.808  1.00 0.00 ? 82  LYS A HZ3  5  
ATOM 11076 N N    . ARG A 1 83  ? 1.871   7.139   2.355   1.00 0.00 ? 83  ARG A N    5  
ATOM 11077 C CA   . ARG A 1 83  ? 2.955   6.897   3.343   1.00 0.00 ? 83  ARG A CA   5  
ATOM 11078 C C    . ARG A 1 83  ? 2.810   5.477   3.886   1.00 0.00 ? 83  ARG A C    5  
ATOM 11079 O O    . ARG A 1 83  ? 1.711   4.993   4.070   1.00 0.00 ? 83  ARG A O    5  
ATOM 11080 C CB   . ARG A 1 83  ? 2.831   7.902   4.493   1.00 0.00 ? 83  ARG A CB   5  
ATOM 11081 C CG   . ARG A 1 83  ? 3.956   7.675   5.511   1.00 0.00 ? 83  ARG A CG   5  
ATOM 11082 C CD   . ARG A 1 83  ? 5.267   8.263   4.982   1.00 0.00 ? 83  ARG A CD   5  
ATOM 11083 N NE   . ARG A 1 83  ? 6.354   8.009   5.969   1.00 0.00 ? 83  ARG A NE   5  
ATOM 11084 C CZ   . ARG A 1 83  ? 6.394   8.686   7.082   1.00 0.00 ? 83  ARG A CZ   5  
ATOM 11085 N NH1  . ARG A 1 83  ? 5.490   9.597   7.324   1.00 0.00 ? 83  ARG A NH1  5  
ATOM 11086 N NH2  . ARG A 1 83  ? 7.337   8.457   7.952   1.00 0.00 ? 83  ARG A NH2  5  
ATOM 11087 H H    . ARG A 1 83  ? 1.077   6.568   2.350   1.00 0.00 ? 83  ARG A H    5  
ATOM 11088 H HA   . ARG A 1 83  ? 3.914   7.006   2.861   1.00 0.00 ? 83  ARG A HA   5  
ATOM 11089 H HB2  . ARG A 1 83  ? 2.899   8.906   4.100   1.00 0.00 ? 83  ARG A HB2  5  
ATOM 11090 H HB3  . ARG A 1 83  ? 1.877   7.771   4.981   1.00 0.00 ? 83  ARG A HB3  5  
ATOM 11091 H HG2  . ARG A 1 83  ? 3.696   8.156   6.443   1.00 0.00 ? 83  ARG A HG2  5  
ATOM 11092 H HG3  . ARG A 1 83  ? 4.083   6.617   5.679   1.00 0.00 ? 83  ARG A HG3  5  
ATOM 11093 H HD2  . ARG A 1 83  ? 5.522   7.800   4.041   1.00 0.00 ? 83  ARG A HD2  5  
ATOM 11094 H HD3  . ARG A 1 83  ? 5.153   9.328   4.842   1.00 0.00 ? 83  ARG A HD3  5  
ATOM 11095 H HE   . ARG A 1 83  ? 7.035   7.330   5.783   1.00 0.00 ? 83  ARG A HE   5  
ATOM 11096 H HH11 . ARG A 1 83  ? 4.766   9.774   6.657   1.00 0.00 ? 83  ARG A HH11 5  
ATOM 11097 H HH12 . ARG A 1 83  ? 5.523   10.119  8.177   1.00 0.00 ? 83  ARG A HH12 5  
ATOM 11098 H HH21 . ARG A 1 83  ? 8.031   7.762   7.767   1.00 0.00 ? 83  ARG A HH21 5  
ATOM 11099 H HH22 . ARG A 1 83  ? 7.368   8.979   8.804   1.00 0.00 ? 83  ARG A HH22 5  
ATOM 11100 N N    . GLU A 1 84  ? 3.894   4.805   4.156   1.00 0.00 ? 84  GLU A N    5  
ATOM 11101 C CA   . GLU A 1 84  ? 3.767   3.427   4.697   1.00 0.00 ? 84  GLU A CA   5  
ATOM 11102 C C    . GLU A 1 84  ? 4.411   3.343   6.070   1.00 0.00 ? 84  GLU A C    5  
ATOM 11103 O O    . GLU A 1 84  ? 5.465   3.899   6.311   1.00 0.00 ? 84  GLU A O    5  
ATOM 11104 C CB   . GLU A 1 84  ? 4.431   2.412   3.770   1.00 0.00 ? 84  GLU A CB   5  
ATOM 11105 C CG   . GLU A 1 84  ? 5.851   2.856   3.424   1.00 0.00 ? 84  GLU A CG   5  
ATOM 11106 C CD   . GLU A 1 84  ? 5.810   4.160   2.626   1.00 0.00 ? 84  GLU A CD   5  
ATOM 11107 O OE1  . GLU A 1 84  ? 6.481   5.099   3.025   1.00 0.00 ? 84  GLU A OE1  5  
ATOM 11108 O OE2  . GLU A 1 84  ? 5.104   4.201   1.633   1.00 0.00 ? 84  GLU A OE2  5  
ATOM 11109 H H    . GLU A 1 84  ? 4.775   5.205   4.015   1.00 0.00 ? 84  GLU A H    5  
ATOM 11110 H HA   . GLU A 1 84  ? 2.725   3.188   4.788   1.00 0.00 ? 84  GLU A HA   5  
ATOM 11111 H HB2  . GLU A 1 84  ? 4.464   1.454   4.265   1.00 0.00 ? 84  GLU A HB2  5  
ATOM 11112 H HB3  . GLU A 1 84  ? 3.857   2.323   2.870   1.00 0.00 ? 84  GLU A HB3  5  
ATOM 11113 H HG2  . GLU A 1 84  ? 6.404   3.007   4.335   1.00 0.00 ? 84  GLU A HG2  5  
ATOM 11114 H HG3  . GLU A 1 84  ? 6.335   2.091   2.835   1.00 0.00 ? 84  GLU A HG3  5  
ATOM 11115 H HE2  . GLU A 1 84  ? 5.126   5.049   1.184   1.00 0.00 ? 84  GLU A HE2  5  
ATOM 11116 N N    . LEU A 1 85  ? 3.798   2.634   6.972   1.00 0.00 ? 85  LEU A N    5  
ATOM 11117 C CA   . LEU A 1 85  ? 4.392   2.502   8.322   1.00 0.00 ? 85  LEU A CA   5  
ATOM 11118 C C    . LEU A 1 85  ? 5.171   1.192   8.362   1.00 0.00 ? 85  LEU A C    5  
ATOM 11119 O O    . LEU A 1 85  ? 4.618   0.125   8.191   1.00 0.00 ? 85  LEU A O    5  
ATOM 11120 C CB   . LEU A 1 85  ? 3.285   2.486   9.379   1.00 0.00 ? 85  LEU A CB   5  
ATOM 11121 C CG   . LEU A 1 85  ? 2.305   3.635   9.113   1.00 0.00 ? 85  LEU A CG   5  
ATOM 11122 C CD1  . LEU A 1 85  ? 1.429   3.864   10.345  1.00 0.00 ? 85  LEU A CD1  5  
ATOM 11123 C CD2  . LEU A 1 85  ? 3.074   4.918   8.792   1.00 0.00 ? 85  LEU A CD2  5  
ATOM 11124 H H    . LEU A 1 85  ? 2.955   2.181   6.757   1.00 0.00 ? 85  LEU A H    5  
ATOM 11125 H HA   . LEU A 1 85  ? 5.061   3.326   8.505   1.00 0.00 ? 85  LEU A HA   5  
ATOM 11126 H HB2  . LEU A 1 85  ? 2.758   1.544   9.332   1.00 0.00 ? 85  LEU A HB2  5  
ATOM 11127 H HB3  . LEU A 1 85  ? 3.721   2.606   10.359  1.00 0.00 ? 85  LEU A HB3  5  
ATOM 11128 H HG   . LEU A 1 85  ? 1.678   3.376   8.275   1.00 0.00 ? 85  LEU A HG   5  
ATOM 11129 H HD11 . LEU A 1 85  ? 1.701   4.801   10.810  1.00 0.00 ? 85  LEU A HD11 5  
ATOM 11130 H HD12 . LEU A 1 85  ? 1.575   3.058   11.049  1.00 0.00 ? 85  LEU A HD12 5  
ATOM 11131 H HD13 . LEU A 1 85  ? 0.394   3.901   10.047  1.00 0.00 ? 85  LEU A HD13 5  
ATOM 11132 H HD21 . LEU A 1 85  ? 3.945   4.986   9.426   1.00 0.00 ? 85  LEU A HD21 5  
ATOM 11133 H HD22 . LEU A 1 85  ? 2.432   5.769   8.967   1.00 0.00 ? 85  LEU A HD22 5  
ATOM 11134 H HD23 . LEU A 1 85  ? 3.376   4.904   7.756   1.00 0.00 ? 85  LEU A HD23 5  
ATOM 11135 N N    . ASN A 1 86  ? 6.458   1.267   8.564   1.00 0.00 ? 86  ASN A N    5  
ATOM 11136 C CA   . ASN A 1 86  ? 7.275   0.026   8.587   1.00 0.00 ? 86  ASN A CA   5  
ATOM 11137 C C    . ASN A 1 86  ? 7.869   -0.170  9.980   1.00 0.00 ? 86  ASN A C    5  
ATOM 11138 O O    . ASN A 1 86  ? 8.527   0.700   10.514  1.00 0.00 ? 86  ASN A O    5  
ATOM 11139 C CB   . ASN A 1 86  ? 8.401   0.152   7.560   1.00 0.00 ? 86  ASN A CB   5  
ATOM 11140 C CG   . ASN A 1 86  ? 7.809   0.608   6.223   1.00 0.00 ? 86  ASN A CG   5  
ATOM 11141 O OD1  . ASN A 1 86  ? 6.614   0.781   6.103   1.00 0.00 ? 86  ASN A OD1  5  
ATOM 11142 N ND2  . ASN A 1 86  ? 8.601   0.812   5.206   1.00 0.00 ? 86  ASN A ND2  5  
ATOM 11143 H H    . ASN A 1 86  ? 6.886   2.139   8.681   1.00 0.00 ? 86  ASN A H    5  
ATOM 11144 H HA   . ASN A 1 86  ? 6.656   -0.821  8.338   1.00 0.00 ? 86  ASN A HA   5  
ATOM 11145 H HB2  . ASN A 1 86  ? 9.124   0.878   7.903   1.00 0.00 ? 86  ASN A HB2  5  
ATOM 11146 H HB3  . ASN A 1 86  ? 8.882   -0.805  7.432   1.00 0.00 ? 86  ASN A HB3  5  
ATOM 11147 H HD21 . ASN A 1 86  ? 9.567   0.673   5.301   1.00 0.00 ? 86  ASN A HD21 5  
ATOM 11148 H HD22 . ASN A 1 86  ? 8.231   1.105   4.347   1.00 0.00 ? 86  ASN A HD22 5  
ATOM 11149 N N    . TYR A 1 87  ? 7.637   -1.308  10.574  1.00 0.00 ? 87  TYR A N    5  
ATOM 11150 C CA   . TYR A 1 87  ? 8.182   -1.564  11.928  1.00 0.00 ? 87  TYR A CA   5  
ATOM 11151 C C    . TYR A 1 87  ? 8.072   -3.049  12.245  1.00 0.00 ? 87  TYR A C    5  
ATOM 11152 O O    . TYR A 1 87  ? 7.216   -3.743  11.734  1.00 0.00 ? 87  TYR A O    5  
ATOM 11153 C CB   . TYR A 1 87  ? 7.379   -0.770  12.957  1.00 0.00 ? 87  TYR A CB   5  
ATOM 11154 C CG   . TYR A 1 87  ? 5.909   -1.071  12.786  1.00 0.00 ? 87  TYR A CG   5  
ATOM 11155 C CD1  . TYR A 1 87  ? 5.340   -2.181  13.421  1.00 0.00 ? 87  TYR A CD1  5  
ATOM 11156 C CD2  . TYR A 1 87  ? 5.112   -0.237  11.988  1.00 0.00 ? 87  TYR A CD2  5  
ATOM 11157 C CE1  . TYR A 1 87  ? 3.977   -2.457  13.261  1.00 0.00 ? 87  TYR A CE1  5  
ATOM 11158 C CE2  . TYR A 1 87  ? 3.750   -0.514  11.830  1.00 0.00 ? 87  TYR A CE2  5  
ATOM 11159 C CZ   . TYR A 1 87  ? 3.183   -1.623  12.467  1.00 0.00 ? 87  TYR A CZ   5  
ATOM 11160 O OH   . TYR A 1 87  ? 1.838   -1.895  12.310  1.00 0.00 ? 87  TYR A OH   5  
ATOM 11161 H H    . TYR A 1 87  ? 7.103   -1.997  10.125  1.00 0.00 ? 87  TYR A H    5  
ATOM 11162 H HA   . TYR A 1 87  ? 9.218   -1.260  11.967  1.00 0.00 ? 87  TYR A HA   5  
ATOM 11163 H HB2  . TYR A 1 87  ? 7.691   -1.051  13.953  1.00 0.00 ? 87  TYR A HB2  5  
ATOM 11164 H HB3  . TYR A 1 87  ? 7.551   0.283   12.810  1.00 0.00 ? 87  TYR A HB3  5  
ATOM 11165 H HD1  . TYR A 1 87  ? 5.953   -2.824  14.036  1.00 0.00 ? 87  TYR A HD1  5  
ATOM 11166 H HD2  . TYR A 1 87  ? 5.548   0.622   11.498  1.00 0.00 ? 87  TYR A HD2  5  
ATOM 11167 H HE1  . TYR A 1 87  ? 3.539   -3.313  13.751  1.00 0.00 ? 87  TYR A HE1  5  
ATOM 11168 H HE2  . TYR A 1 87  ? 3.137   0.130   11.217  1.00 0.00 ? 87  TYR A HE2  5  
ATOM 11169 H HH   . TYR A 1 87  ? 1.688   -2.125  11.391  1.00 0.00 ? 87  TYR A HH   5  
ATOM 11170 N N    . VAL A 1 88  ? 8.923   -3.535  13.098  1.00 0.00 ? 88  VAL A N    5  
ATOM 11171 C CA   . VAL A 1 88  ? 8.856   -4.972  13.462  1.00 0.00 ? 88  VAL A CA   5  
ATOM 11172 C C    . VAL A 1 88  ? 8.307   -5.092  14.877  1.00 0.00 ? 88  VAL A C    5  
ATOM 11173 O O    . VAL A 1 88  ? 8.950   -4.727  15.841  1.00 0.00 ? 88  VAL A O    5  
ATOM 11174 C CB   . VAL A 1 88  ? 10.251  -5.593  13.388  1.00 0.00 ? 88  VAL A CB   5  
ATOM 11175 C CG1  . VAL A 1 88  ? 11.147  -4.956  14.445  1.00 0.00 ? 88  VAL A CG1  5  
ATOM 11176 C CG2  . VAL A 1 88  ? 10.147  -7.094  13.651  1.00 0.00 ? 88  VAL A CG2  5  
ATOM 11177 H H    . VAL A 1 88  ? 9.593   -2.949  13.506  1.00 0.00 ? 88  VAL A H    5  
ATOM 11178 H HA   . VAL A 1 88  ? 8.197   -5.485  12.785  1.00 0.00 ? 88  VAL A HA   5  
ATOM 11179 H HB   . VAL A 1 88  ? 10.670  -5.424  12.407  1.00 0.00 ? 88  VAL A HB   5  
ATOM 11180 H HG11 . VAL A 1 88  ? 10.820  -3.944  14.628  1.00 0.00 ? 88  VAL A HG11 5  
ATOM 11181 H HG12 . VAL A 1 88  ? 12.168  -4.949  14.092  1.00 0.00 ? 88  VAL A HG12 5  
ATOM 11182 H HG13 . VAL A 1 88  ? 11.083  -5.527  15.358  1.00 0.00 ? 88  VAL A HG13 5  
ATOM 11183 H HG21 . VAL A 1 88  ? 10.449  -7.637  12.767  1.00 0.00 ? 88  VAL A HG21 5  
ATOM 11184 H HG22 . VAL A 1 88  ? 9.127   -7.339  13.897  1.00 0.00 ? 88  VAL A HG22 5  
ATOM 11185 H HG23 . VAL A 1 88  ? 10.791  -7.361  14.476  1.00 0.00 ? 88  VAL A HG23 5  
ATOM 11186 N N    . ALA A 1 89  ? 7.113   -5.590  15.003  1.00 0.00 ? 89  ALA A N    5  
ATOM 11187 C CA   . ALA A 1 89  ? 6.503   -5.721  16.356  1.00 0.00 ? 89  ALA A CA   5  
ATOM 11188 C C    . ALA A 1 89  ? 7.151   -6.877  17.121  1.00 0.00 ? 89  ALA A C    5  
ATOM 11189 O O    . ALA A 1 89  ? 8.247   -6.756  17.633  1.00 0.00 ? 89  ALA A O    5  
ATOM 11190 C CB   . ALA A 1 89  ? 5.001   -5.979  16.215  1.00 0.00 ? 89  ALA A CB   5  
ATOM 11191 H H    . ALA A 1 89  ? 6.611   -5.863  14.206  1.00 0.00 ? 89  ALA A H    5  
ATOM 11192 H HA   . ALA A 1 89  ? 6.660   -4.802  16.903  1.00 0.00 ? 89  ALA A HA   5  
ATOM 11193 H HB1  . ALA A 1 89  ? 4.618   -6.382  17.141  1.00 0.00 ? 89  ALA A HB1  5  
ATOM 11194 H HB2  . ALA A 1 89  ? 4.833   -6.688  15.419  1.00 0.00 ? 89  ALA A HB2  5  
ATOM 11195 H HB3  . ALA A 1 89  ? 4.495   -5.053  15.988  1.00 0.00 ? 89  ALA A HB3  5  
ATOM 11196 N N    . ARG A 1 90  ? 6.474   -7.989  17.222  1.00 0.00 ? 90  ARG A N    5  
ATOM 11197 C CA   . ARG A 1 90  ? 7.042   -9.141  17.980  1.00 0.00 ? 90  ARG A CA   5  
ATOM 11198 C C    . ARG A 1 90  ? 8.393   -9.554  17.388  1.00 0.00 ? 90  ARG A C    5  
ATOM 11199 O O    . ARG A 1 90  ? 9.332   -9.829  18.110  1.00 0.00 ? 90  ARG A O    5  
ATOM 11200 C CB   . ARG A 1 90  ? 6.077   -10.328 17.920  1.00 0.00 ? 90  ARG A CB   5  
ATOM 11201 C CG   . ARG A 1 90  ? 6.085   -10.934 16.515  1.00 0.00 ? 90  ARG A CG   5  
ATOM 11202 C CD   . ARG A 1 90  ? 4.967   -11.971 16.401  1.00 0.00 ? 90  ARG A CD   5  
ATOM 11203 N NE   . ARG A 1 90  ? 5.074   -12.678 15.095  1.00 0.00 ? 90  ARG A NE   5  
ATOM 11204 C CZ   . ARG A 1 90  ? 4.539   -13.858 14.943  1.00 0.00 ? 90  ARG A CZ   5  
ATOM 11205 N NH1  . ARG A 1 90  ? 3.914   -14.424 15.940  1.00 0.00 ? 90  ARG A NH1  5  
ATOM 11206 N NH2  . ARG A 1 90  ? 4.630   -14.474 13.797  1.00 0.00 ? 90  ARG A NH2  5  
ATOM 11207 H H    . ARG A 1 90  ? 5.585   -8.062  16.817  1.00 0.00 ? 90  ARG A H    5  
ATOM 11208 H HA   . ARG A 1 90  ? 7.182   -8.851  19.011  1.00 0.00 ? 90  ARG A HA   5  
ATOM 11209 H HB2  . ARG A 1 90  ? 6.385   -11.077 18.635  1.00 0.00 ? 90  ARG A HB2  5  
ATOM 11210 H HB3  . ARG A 1 90  ? 5.080   -9.993  18.158  1.00 0.00 ? 90  ARG A HB3  5  
ATOM 11211 H HG2  . ARG A 1 90  ? 5.928   -10.152 15.785  1.00 0.00 ? 90  ARG A HG2  5  
ATOM 11212 H HG3  . ARG A 1 90  ? 7.035   -11.410 16.333  1.00 0.00 ? 90  ARG A HG3  5  
ATOM 11213 H HD2  . ARG A 1 90  ? 5.057   -12.687 17.207  1.00 0.00 ? 90  ARG A HD2  5  
ATOM 11214 H HD3  . ARG A 1 90  ? 4.009   -11.478 16.467  1.00 0.00 ? 90  ARG A HD3  5  
ATOM 11215 H HE   . ARG A 1 90  ? 5.543   -12.256 14.347  1.00 0.00 ? 90  ARG A HE   5  
ATOM 11216 H HH11 . ARG A 1 90  ? 3.846   -13.951 16.819  1.00 0.00 ? 90  ARG A HH11 5  
ATOM 11217 H HH12 . ARG A 1 90  ? 3.507   -15.330 15.825  1.00 0.00 ? 90  ARG A HH12 5  
ATOM 11218 H HH21 . ARG A 1 90  ? 5.108   -14.038 13.032  1.00 0.00 ? 90  ARG A HH21 5  
ATOM 11219 H HH22 . ARG A 1 90  ? 4.220   -15.378 13.680  1.00 0.00 ? 90  ARG A HH22 5  
ATOM 11220 N N    . ASN A 1 91  ? 8.510   -9.604  16.087  1.00 0.00 ? 91  ASN A N    5  
ATOM 11221 C CA   . ASN A 1 91  ? 9.814   -10.007 15.489  1.00 0.00 ? 91  ASN A CA   5  
ATOM 11222 C C    . ASN A 1 91  ? 9.747   -9.969  13.957  1.00 0.00 ? 91  ASN A C    5  
ATOM 11223 O O    . ASN A 1 91  ? 10.598  -10.515 13.286  1.00 0.00 ? 91  ASN A O    5  
ATOM 11224 C CB   . ASN A 1 91  ? 10.156  -11.427 15.943  1.00 0.00 ? 91  ASN A CB   5  
ATOM 11225 C CG   . ASN A 1 91  ? 11.475  -11.412 16.717  1.00 0.00 ? 91  ASN A CG   5  
ATOM 11226 O OD1  . ASN A 1 91  ? 12.482  -10.965 16.211  1.00 0.00 ? 91  ASN A OD1  5  
ATOM 11227 N ND2  . ASN A 1 91  ? 11.508  -11.887 17.932  1.00 0.00 ? 91  ASN A ND2  5  
ATOM 11228 H H    . ASN A 1 91  ? 7.747   -9.381  15.512  1.00 0.00 ? 91  ASN A H    5  
ATOM 11229 H HA   . ASN A 1 91  ? 10.585  -9.333  15.828  1.00 0.00 ? 91  ASN A HA   5  
ATOM 11230 H HB2  . ASN A 1 91  ? 9.367   -11.802 16.581  1.00 0.00 ? 91  ASN A HB2  5  
ATOM 11231 H HB3  . ASN A 1 91  ? 10.255  -12.069 15.080  1.00 0.00 ? 91  ASN A HB3  5  
ATOM 11232 H HD21 . ASN A 1 91  ? 10.694  -12.249 18.341  1.00 0.00 ? 91  ASN A HD21 5  
ATOM 11233 H HD22 . ASN A 1 91  ? 12.348  -11.880 18.437  1.00 0.00 ? 91  ASN A HD22 5  
ATOM 11234 N N    . LYS A 1 92  ? 8.759   -9.327  13.395  1.00 0.00 ? 92  LYS A N    5  
ATOM 11235 C CA   . LYS A 1 92  ? 8.680   -9.265  11.905  1.00 0.00 ? 92  LYS A CA   5  
ATOM 11236 C C    . LYS A 1 92  ? 8.340   -7.830  11.452  1.00 0.00 ? 92  LYS A C    5  
ATOM 11237 O O    . LYS A 1 92  ? 7.404   -7.223  11.932  1.00 0.00 ? 92  LYS A O    5  
ATOM 11238 C CB   . LYS A 1 92  ? 7.611   -10.249 11.405  1.00 0.00 ? 92  LYS A CB   5  
ATOM 11239 C CG   . LYS A 1 92  ? 6.213   -9.719  11.724  1.00 0.00 ? 92  LYS A CG   5  
ATOM 11240 C CD   . LYS A 1 92  ? 5.444   -10.750 12.547  1.00 0.00 ? 92  LYS A CD   5  
ATOM 11241 C CE   . LYS A 1 92  ? 4.041   -10.217 12.838  1.00 0.00 ? 92  LYS A CE   5  
ATOM 11242 N NZ   . LYS A 1 92  ? 3.264   -11.241 13.590  1.00 0.00 ? 92  LYS A NZ   5  
ATOM 11243 H H    . LYS A 1 92  ? 8.079   -8.883  13.945  1.00 0.00 ? 92  LYS A H    5  
ATOM 11244 H HA   . LYS A 1 92  ? 9.636   -9.550  11.497  1.00 0.00 ? 92  LYS A HA   5  
ATOM 11245 H HB2  . LYS A 1 92  ? 7.712   -10.374 10.337  1.00 0.00 ? 92  LYS A HB2  5  
ATOM 11246 H HB3  . LYS A 1 92  ? 7.750   -11.204 11.892  1.00 0.00 ? 92  LYS A HB3  5  
ATOM 11247 H HG2  . LYS A 1 92  ? 6.295   -8.807  12.287  1.00 0.00 ? 92  LYS A HG2  5  
ATOM 11248 H HG3  . LYS A 1 92  ? 5.682   -9.527  10.806  1.00 0.00 ? 92  LYS A HG3  5  
ATOM 11249 H HD2  . LYS A 1 92  ? 5.372   -11.677 11.992  1.00 0.00 ? 92  LYS A HD2  5  
ATOM 11250 H HD3  . LYS A 1 92  ? 5.962   -10.925 13.477  1.00 0.00 ? 92  LYS A HD3  5  
ATOM 11251 H HE2  . LYS A 1 92  ? 4.115   -9.316  13.430  1.00 0.00 ? 92  LYS A HE2  5  
ATOM 11252 H HE3  . LYS A 1 92  ? 3.540   -9.996  11.908  1.00 0.00 ? 92  LYS A HE3  5  
ATOM 11253 H HZ1  . LYS A 1 92  ? 3.203   -10.966 14.589  1.00 0.00 ? 92  LYS A HZ1  5  
ATOM 11254 H HZ2  . LYS A 1 92  ? 3.740   -12.163 13.509  1.00 0.00 ? 92  LYS A HZ2  5  
ATOM 11255 H HZ3  . LYS A 1 92  ? 2.306   -11.310 13.192  1.00 0.00 ? 92  LYS A HZ3  5  
ATOM 11256 N N    . PRO A 1 93  ? 9.100   -7.298  10.527  1.00 0.00 ? 93  PRO A N    5  
ATOM 11257 C CA   . PRO A 1 93  ? 8.896   -5.922  9.982   1.00 0.00 ? 93  PRO A CA   5  
ATOM 11258 C C    . PRO A 1 93  ? 7.753   -5.887  8.987   1.00 0.00 ? 93  PRO A C    5  
ATOM 11259 O O    . PRO A 1 93  ? 7.696   -6.690  8.087   1.00 0.00 ? 93  PRO A O    5  
ATOM 11260 C CB   . PRO A 1 93  ? 10.198  -5.626  9.259   1.00 0.00 ? 93  PRO A CB   5  
ATOM 11261 C CG   . PRO A 1 93  ? 10.675  -6.961  8.809   1.00 0.00 ? 93  PRO A CG   5  
ATOM 11262 C CD   . PRO A 1 93  ? 10.240  -7.955  9.883   1.00 0.00 ? 93  PRO A CD   5  
ATOM 11263 H HA   . PRO A 1 93  ? 8.742   -5.209  10.772  1.00 0.00 ? 93  PRO A HA   5  
ATOM 11264 H HB2  . PRO A 1 93  ? 10.013  -4.980  8.410   1.00 0.00 ? 93  PRO A HB2  5  
ATOM 11265 H HB3  . PRO A 1 93  ? 10.906  -5.178  9.926   1.00 0.00 ? 93  PRO A HB3  5  
ATOM 11266 H HG2  . PRO A 1 93  ? 10.221  -7.208  7.867   1.00 0.00 ? 93  PRO A HG2  5  
ATOM 11267 H HG3  . PRO A 1 93  ? 11.743  -6.970  8.720   1.00 0.00 ? 93  PRO A HG3  5  
ATOM 11268 H HD2  . PRO A 1 93  ? 9.933   -8.887  9.439   1.00 0.00 ? 93  PRO A HD2  5  
ATOM 11269 H HD3  . PRO A 1 93  ? 11.028  -8.112  10.594  1.00 0.00 ? 93  PRO A HD3  5  
ATOM 11270 N N    . LYS A 1 94  ? 6.854   -4.969  9.126   1.00 0.00 ? 94  LYS A N    5  
ATOM 11271 C CA   . LYS A 1 94  ? 5.724   -4.915  8.163   1.00 0.00 ? 94  LYS A CA   5  
ATOM 11272 C C    . LYS A 1 94  ? 5.594   -3.525  7.549   1.00 0.00 ? 94  LYS A C    5  
ATOM 11273 O O    . LYS A 1 94  ? 5.324   -2.555  8.227   1.00 0.00 ? 94  LYS A O    5  
ATOM 11274 C CB   . LYS A 1 94  ? 4.424   -5.263  8.887   1.00 0.00 ? 94  LYS A CB   5  
ATOM 11275 C CG   . LYS A 1 94  ? 4.401   -6.757  9.215   1.00 0.00 ? 94  LYS A CG   5  
ATOM 11276 C CD   . LYS A 1 94  ? 3.118   -7.093  9.974   1.00 0.00 ? 94  LYS A CD   5  
ATOM 11277 C CE   . LYS A 1 94  ? 1.936   -7.090  9.003   1.00 0.00 ? 94  LYS A CE   5  
ATOM 11278 N NZ   . LYS A 1 94  ? 1.473   -8.487  8.774   1.00 0.00 ? 94  LYS A NZ   5  
ATOM 11279 H H    . LYS A 1 94  ? 6.926   -4.320  9.856   1.00 0.00 ? 94  LYS A H    5  
ATOM 11280 H HA   . LYS A 1 94  ? 5.890   -5.631  7.376   1.00 0.00 ? 94  LYS A HA   5  
ATOM 11281 H HB2  . LYS A 1 94  ? 4.359   -4.692  9.801   1.00 0.00 ? 94  LYS A HB2  5  
ATOM 11282 H HB3  . LYS A 1 94  ? 3.588   -5.024  8.250   1.00 0.00 ? 94  LYS A HB3  5  
ATOM 11283 H HG2  . LYS A 1 94  ? 4.431   -7.325  8.298   1.00 0.00 ? 94  LYS A HG2  5  
ATOM 11284 H HG3  . LYS A 1 94  ? 5.256   -7.008  9.825   1.00 0.00 ? 94  LYS A HG3  5  
ATOM 11285 H HD2  . LYS A 1 94  ? 3.212   -8.069  10.426  1.00 0.00 ? 94  LYS A HD2  5  
ATOM 11286 H HD3  . LYS A 1 94  ? 2.952   -6.353  10.742  1.00 0.00 ? 94  LYS A HD3  5  
ATOM 11287 H HE2  . LYS A 1 94  ? 1.130   -6.507  9.418   1.00 0.00 ? 94  LYS A HE2  5  
ATOM 11288 H HE3  . LYS A 1 94  ? 2.242   -6.655  8.061   1.00 0.00 ? 94  LYS A HE3  5  
ATOM 11289 H HZ1  . LYS A 1 94  ? 0.975   -8.830  9.620   1.00 0.00 ? 94  LYS A HZ1  5  
ATOM 11290 H HZ2  . LYS A 1 94  ? 2.293   -9.098  8.582   1.00 0.00 ? 94  LYS A HZ2  5  
ATOM 11291 H HZ3  . LYS A 1 94  ? 0.823   -8.510  7.961   1.00 0.00 ? 94  LYS A HZ3  5  
ATOM 11292 N N    . THR A 1 95  ? 5.742   -3.432  6.256   1.00 0.00 ? 95  THR A N    5  
ATOM 11293 C CA   . THR A 1 95  ? 5.580   -2.117  5.592   1.00 0.00 ? 95  THR A CA   5  
ATOM 11294 C C    . THR A 1 95  ? 4.096   -1.947  5.302   1.00 0.00 ? 95  THR A C    5  
ATOM 11295 O O    . THR A 1 95  ? 3.498   -2.742  4.602   1.00 0.00 ? 95  THR A O    5  
ATOM 11296 C CB   . THR A 1 95  ? 6.380   -2.086  4.285   1.00 0.00 ? 95  THR A CB   5  
ATOM 11297 O OG1  . THR A 1 95  ? 7.757   -1.884  4.580   1.00 0.00 ? 95  THR A OG1  5  
ATOM 11298 C CG2  . THR A 1 95  ? 5.878   -0.948  3.389   1.00 0.00 ? 95  THR A CG2  5  
ATOM 11299 H H    . THR A 1 95  ? 5.923   -4.232  5.723   1.00 0.00 ? 95  THR A H    5  
ATOM 11300 H HA   . THR A 1 95  ? 5.914   -1.331  6.252   1.00 0.00 ? 95  THR A HA   5  
ATOM 11301 H HB   . THR A 1 95  ? 6.261   -3.028  3.767   1.00 0.00 ? 95  THR A HB   5  
ATOM 11302 H HG1  . THR A 1 95  ? 8.178   -2.745  4.639   1.00 0.00 ? 95  THR A HG1  5  
ATOM 11303 H HG21 . THR A 1 95  ? 5.931   -0.015  3.932   1.00 0.00 ? 95  THR A HG21 5  
ATOM 11304 H HG22 . THR A 1 95  ? 4.855   -1.137  3.096   1.00 0.00 ? 95  THR A HG22 5  
ATOM 11305 H HG23 . THR A 1 95  ? 6.496   -0.884  2.508   1.00 0.00 ? 95  THR A HG23 5  
ATOM 11306 N N    . VAL A 1 96  ? 3.486   -0.940  5.847   1.00 0.00 ? 96  VAL A N    5  
ATOM 11307 C CA   . VAL A 1 96  ? 2.032   -0.752  5.618   1.00 0.00 ? 96  VAL A CA   5  
ATOM 11308 C C    . VAL A 1 96  ? 1.802   0.542   4.847   1.00 0.00 ? 96  VAL A C    5  
ATOM 11309 O O    . VAL A 1 96  ? 2.140   1.607   5.309   1.00 0.00 ? 96  VAL A O    5  
ATOM 11310 C CB   . VAL A 1 96  ? 1.339   -0.670  6.980   1.00 0.00 ? 96  VAL A CB   5  
ATOM 11311 C CG1  . VAL A 1 96  ? -0.177  -0.610  6.791   1.00 0.00 ? 96  VAL A CG1  5  
ATOM 11312 C CG2  . VAL A 1 96  ? 1.700   -1.908  7.808   1.00 0.00 ? 96  VAL A CG2  5  
ATOM 11313 H H    . VAL A 1 96  ? 3.978   -0.321  6.425   1.00 0.00 ? 96  VAL A H    5  
ATOM 11314 H HA   . VAL A 1 96  ? 1.636   -1.585  5.058   1.00 0.00 ? 96  VAL A HA   5  
ATOM 11315 H HB   . VAL A 1 96  ? 1.676   0.221   7.500   1.00 0.00 ? 96  VAL A HB   5  
ATOM 11316 H HG11 . VAL A 1 96  ? -0.477  -1.341  6.056   1.00 0.00 ? 96  VAL A HG11 5  
ATOM 11317 H HG12 . VAL A 1 96  ? -0.458  0.377   6.455   1.00 0.00 ? 96  VAL A HG12 5  
ATOM 11318 H HG13 . VAL A 1 96  ? -0.665  -0.825  7.732   1.00 0.00 ? 96  VAL A HG13 5  
ATOM 11319 H HG21 . VAL A 1 96  ? 1.090   -1.935  8.698   1.00 0.00 ? 96  VAL A HG21 5  
ATOM 11320 H HG22 . VAL A 1 96  ? 2.742   -1.864  8.087   1.00 0.00 ? 96  VAL A HG22 5  
ATOM 11321 H HG23 . VAL A 1 96  ? 1.522   -2.801  7.223   1.00 0.00 ? 96  VAL A HG23 5  
ATOM 11322 N N    . ILE A 1 97  ? 1.215   0.459   3.684   1.00 0.00 ? 97  ILE A N    5  
ATOM 11323 C CA   . ILE A 1 97  ? 0.955   1.693   2.889   1.00 0.00 ? 97  ILE A CA   5  
ATOM 11324 C C    . ILE A 1 97  ? -0.474  2.151   3.165   1.00 0.00 ? 97  ILE A C    5  
ATOM 11325 O O    . ILE A 1 97  ? -1.409  1.379   3.072   1.00 0.00 ? 97  ILE A O    5  
ATOM 11326 C CB   . ILE A 1 97  ? 1.129   1.386   1.396   1.00 0.00 ? 97  ILE A CB   5  
ATOM 11327 C CG1  . ILE A 1 97  ? 2.526   0.780   1.165   1.00 0.00 ? 97  ILE A CG1  5  
ATOM 11328 C CG2  . ILE A 1 97  ? 0.967   2.671   0.579   1.00 0.00 ? 97  ILE A CG2  5  
ATOM 11329 C CD1  . ILE A 1 97  ? 3.478   1.833   0.580   1.00 0.00 ? 97  ILE A CD1  5  
ATOM 11330 H H    . ILE A 1 97  ? 0.939   -0.415  3.336   1.00 0.00 ? 97  ILE A H    5  
ATOM 11331 H HA   . ILE A 1 97  ? 1.642   2.468   3.180   1.00 0.00 ? 97  ILE A HA   5  
ATOM 11332 H HB   . ILE A 1 97  ? 0.375   0.674   1.091   1.00 0.00 ? 97  ILE A HB   5  
ATOM 11333 H HG12 . ILE A 1 97  ? 2.923   0.425   2.105   1.00 0.00 ? 97  ILE A HG12 5  
ATOM 11334 H HG13 . ILE A 1 97  ? 2.445   -0.047  0.475   1.00 0.00 ? 97  ILE A HG13 5  
ATOM 11335 H HG21 . ILE A 1 97  ? 1.284   2.495   -0.440  1.00 0.00 ? 97  ILE A HG21 5  
ATOM 11336 H HG22 . ILE A 1 97  ? 1.574   3.453   1.012   1.00 0.00 ? 97  ILE A HG22 5  
ATOM 11337 H HG23 . ILE A 1 97  ? -0.069  2.975   0.586   1.00 0.00 ? 97  ILE A HG23 5  
ATOM 11338 H HD11 . ILE A 1 97  ? 4.495   1.571   0.836   1.00 0.00 ? 97  ILE A HD11 5  
ATOM 11339 H HD12 . ILE A 1 97  ? 3.246   2.805   0.990   1.00 0.00 ? 97  ILE A HD12 5  
ATOM 11340 H HD13 . ILE A 1 97  ? 3.372   1.857   -0.492  1.00 0.00 ? 97  ILE A HD13 5  
ATOM 11341 N N    . TYR A 1 98  ? -0.652  3.388   3.536   1.00 0.00 ? 98  TYR A N    5  
ATOM 11342 C CA   . TYR A 1 98  ? -2.026  3.867   3.852   1.00 0.00 ? 98  TYR A CA   5  
ATOM 11343 C C    . TYR A 1 98  ? -2.477  4.961   2.885   1.00 0.00 ? 98  TYR A C    5  
ATOM 11344 O O    . TYR A 1 98  ? -1.770  5.911   2.618   1.00 0.00 ? 98  TYR A O    5  
ATOM 11345 C CB   . TYR A 1 98  ? -2.045  4.452   5.263   1.00 0.00 ? 98  TYR A CB   5  
ATOM 11346 C CG   . TYR A 1 98  ? -2.023  3.350   6.291   1.00 0.00 ? 98  TYR A CG   5  
ATOM 11347 C CD1  . TYR A 1 98  ? -3.095  2.456   6.386   1.00 0.00 ? 98  TYR A CD1  5  
ATOM 11348 C CD2  . TYR A 1 98  ? -0.938  3.236   7.166   1.00 0.00 ? 98  TYR A CD2  5  
ATOM 11349 C CE1  . TYR A 1 98  ? -3.082  1.450   7.358   1.00 0.00 ? 98  TYR A CE1  5  
ATOM 11350 C CE2  . TYR A 1 98  ? -0.922  2.225   8.134   1.00 0.00 ? 98  TYR A CE2  5  
ATOM 11351 C CZ   . TYR A 1 98  ? -1.995  1.333   8.231   1.00 0.00 ? 98  TYR A CZ   5  
ATOM 11352 O OH   . TYR A 1 98  ? -1.985  0.343   9.189   1.00 0.00 ? 98  TYR A OH   5  
ATOM 11353 H H    . TYR A 1 98  ? 0.115   3.992   3.631   1.00 0.00 ? 98  TYR A H    5  
ATOM 11354 H HA   . TYR A 1 98  ? -2.715  3.040   3.804   1.00 0.00 ? 98  TYR A HA   5  
ATOM 11355 H HB2  . TYR A 1 98  ? -1.179  5.082   5.397   1.00 0.00 ? 98  TYR A HB2  5  
ATOM 11356 H HB3  . TYR A 1 98  ? -2.936  5.043   5.388   1.00 0.00 ? 98  TYR A HB3  5  
ATOM 11357 H HD1  . TYR A 1 98  ? -3.933  2.543   5.710   1.00 0.00 ? 98  TYR A HD1  5  
ATOM 11358 H HD2  . TYR A 1 98  ? -0.110  3.927   7.090   1.00 0.00 ? 98  TYR A HD2  5  
ATOM 11359 H HE1  . TYR A 1 98  ? -3.910  0.762   7.433   1.00 0.00 ? 98  TYR A HE1  5  
ATOM 11360 H HE2  . TYR A 1 98  ? -0.083  2.133   8.808   1.00 0.00 ? 98  TYR A HE2  5  
ATOM 11361 H HH   . TYR A 1 98  ? -2.038  0.763   10.051  1.00 0.00 ? 98  TYR A HH   5  
ATOM 11362 N N    . TRP A 1 99  ? -3.683  4.847   2.408   1.00 0.00 ? 99  TRP A N    5  
ATOM 11363 C CA   . TRP A 1 99  ? -4.248  5.885   1.510   1.00 0.00 ? 99  TRP A CA   5  
ATOM 11364 C C    . TRP A 1 99  ? -5.455  6.490   2.223   1.00 0.00 ? 99  TRP A C    5  
ATOM 11365 O O    . TRP A 1 99  ? -6.185  5.796   2.903   1.00 0.00 ? 99  TRP A O    5  
ATOM 11366 C CB   . TRP A 1 99  ? -4.700  5.258   0.191   1.00 0.00 ? 99  TRP A CB   5  
ATOM 11367 C CG   . TRP A 1 99  ? -3.559  5.203   -0.770  1.00 0.00 ? 99  TRP A CG   5  
ATOM 11368 C CD1  . TRP A 1 99  ? -3.118  6.240   -1.517  1.00 0.00 ? 99  TRP A CD1  5  
ATOM 11369 C CD2  . TRP A 1 99  ? -2.715  4.068   -1.106  1.00 0.00 ? 99  TRP A CD2  5  
ATOM 11370 N NE1  . TRP A 1 99  ? -2.058  5.811   -2.294  1.00 0.00 ? 99  TRP A NE1  5  
ATOM 11371 C CE2  . TRP A 1 99  ? -1.773  4.478   -2.075  1.00 0.00 ? 99  TRP A CE2  5  
ATOM 11372 C CE3  . TRP A 1 99  ? -2.680  2.732   -0.667  1.00 0.00 ? 99  TRP A CE3  5  
ATOM 11373 C CZ2  . TRP A 1 99  ? -0.827  3.596   -2.593  1.00 0.00 ? 99  TRP A CZ2  5  
ATOM 11374 C CZ3  . TRP A 1 99  ? -1.728  1.841   -1.184  1.00 0.00 ? 99  TRP A CZ3  5  
ATOM 11375 C CH2  . TRP A 1 99  ? -0.804  2.271   -2.146  1.00 0.00 ? 99  TRP A CH2  5  
ATOM 11376 H H    . TRP A 1 99  ? -4.240  4.088   2.680   1.00 0.00 ? 99  TRP A H    5  
ATOM 11377 H HA   . TRP A 1 99  ? -3.510  6.652   1.323   1.00 0.00 ? 99  TRP A HA   5  
ATOM 11378 H HB2  . TRP A 1 99  ? -5.059  4.258   0.372   1.00 0.00 ? 99  TRP A HB2  5  
ATOM 11379 H HB3  . TRP A 1 99  ? -5.495  5.854   -0.233  1.00 0.00 ? 99  TRP A HB3  5  
ATOM 11380 H HD1  . TRP A 1 99  ? -3.528  7.240   -1.511  1.00 0.00 ? 99  TRP A HD1  5  
ATOM 11381 H HE1  . TRP A 1 99  ? -1.559  6.366   -2.928  1.00 0.00 ? 99  TRP A HE1  5  
ATOM 11382 H HE3  . TRP A 1 99  ? -3.391  2.392   0.074   1.00 0.00 ? 99  TRP A HE3  5  
ATOM 11383 H HZ2  . TRP A 1 99  ? -0.119  3.930   -3.336  1.00 0.00 ? 99  TRP A HZ2  5  
ATOM 11384 H HZ3  . TRP A 1 99  ? -1.707  0.817   -0.841  1.00 0.00 ? 99  TRP A HZ3  5  
ATOM 11385 H HH2  . TRP A 1 99  ? -0.074  1.584   -2.541  1.00 0.00 ? 99  TRP A HH2  5  
ATOM 11386 N N    . LEU A 1 100 ? -5.682  7.762   2.093   1.00 0.00 ? 100 LEU A N    5  
ATOM 11387 C CA   . LEU A 1 100 ? -6.856  8.359   2.789   1.00 0.00 ? 100 LEU A CA   5  
ATOM 11388 C C    . LEU A 1 100 ? -8.118  8.009   2.004   1.00 0.00 ? 100 LEU A C    5  
ATOM 11389 O O    . LEU A 1 100 ? -8.156  8.116   0.795   1.00 0.00 ? 100 LEU A O    5  
ATOM 11390 C CB   . LEU A 1 100 ? -6.692  9.879   2.864   1.00 0.00 ? 100 LEU A CB   5  
ATOM 11391 C CG   . LEU A 1 100 ? -5.206  10.235  2.801   1.00 0.00 ? 100 LEU A CG   5  
ATOM 11392 C CD1  . LEU A 1 100 ? -5.025  11.723  3.088   1.00 0.00 ? 100 LEU A CD1  5  
ATOM 11393 C CD2  . LEU A 1 100 ? -4.438  9.424   3.846   1.00 0.00 ? 100 LEU A CD2  5  
ATOM 11394 H H    . LEU A 1 100 ? -5.091  8.320   1.547   1.00 0.00 ? 100 LEU A H    5  
ATOM 11395 H HA   . LEU A 1 100 ? -6.928  7.952   3.788   1.00 0.00 ? 100 LEU A HA   5  
ATOM 11396 H HB2  . LEU A 1 100 ? -7.210  10.336  2.037   1.00 0.00 ? 100 LEU A HB2  5  
ATOM 11397 H HB3  . LEU A 1 100 ? -7.108  10.240  3.794   1.00 0.00 ? 100 LEU A HB3  5  
ATOM 11398 H HG   . LEU A 1 100 ? -4.829  10.010  1.815   1.00 0.00 ? 100 LEU A HG   5  
ATOM 11399 H HD11 . LEU A 1 100 ? -5.251  11.920  4.125   1.00 0.00 ? 100 LEU A HD11 5  
ATOM 11400 H HD12 . LEU A 1 100 ? -5.690  12.295  2.459   1.00 0.00 ? 100 LEU A HD12 5  
ATOM 11401 H HD13 . LEU A 1 100 ? -4.003  12.007  2.882   1.00 0.00 ? 100 LEU A HD13 5  
ATOM 11402 H HD21 . LEU A 1 100 ? -3.744  10.070  4.359   1.00 0.00 ? 100 LEU A HD21 5  
ATOM 11403 H HD22 . LEU A 1 100 ? -3.898  8.627   3.357   1.00 0.00 ? 100 LEU A HD22 5  
ATOM 11404 H HD23 . LEU A 1 100 ? -5.132  9.004   4.557   1.00 0.00 ? 100 LEU A HD23 5  
ATOM 11405 N N    . ALA A 1 101 ? -9.148  7.575   2.677   1.00 0.00 ? 101 ALA A N    5  
ATOM 11406 C CA   . ALA A 1 101 ? -10.396 7.203   1.956   1.00 0.00 ? 101 ALA A CA   5  
ATOM 11407 C C    . ALA A 1 101 ? -11.609 7.780   2.682   1.00 0.00 ? 101 ALA A C    5  
ATOM 11408 O O    . ALA A 1 101 ? -11.562 8.059   3.863   1.00 0.00 ? 101 ALA A O    5  
ATOM 11409 C CB   . ALA A 1 101 ? -10.516 5.678   1.899   1.00 0.00 ? 101 ALA A CB   5  
ATOM 11410 H H    . ALA A 1 101 ? -9.094  7.482   3.653   1.00 0.00 ? 101 ALA A H    5  
ATOM 11411 H HA   . ALA A 1 101 ? -10.359 7.595   0.953   1.00 0.00 ? 101 ALA A HA   5  
ATOM 11412 H HB1  . ALA A 1 101 ? -11.281 5.354   2.586   1.00 0.00 ? 101 ALA A HB1  5  
ATOM 11413 H HB2  . ALA A 1 101 ? -9.572  5.233   2.176   1.00 0.00 ? 101 ALA A HB2  5  
ATOM 11414 H HB3  . ALA A 1 101 ? -10.778 5.373   0.898   1.00 0.00 ? 101 ALA A HB3  5  
ATOM 11415 N N    . GLU A 1 102 ? -12.693 7.965   1.982   1.00 0.00 ? 102 GLU A N    5  
ATOM 11416 C CA   . GLU A 1 102 ? -13.910 8.531   2.627   1.00 0.00 ? 102 GLU A CA   5  
ATOM 11417 C C    . GLU A 1 102 ? -15.131 7.679   2.279   1.00 0.00 ? 102 GLU A C    5  
ATOM 11418 O O    . GLU A 1 102 ? -15.491 7.548   1.126   1.00 0.00 ? 102 GLU A O    5  
ATOM 11419 C CB   . GLU A 1 102 ? -14.132 9.953   2.103   1.00 0.00 ? 102 GLU A CB   5  
ATOM 11420 C CG   . GLU A 1 102 ? -15.356 10.574  2.779   1.00 0.00 ? 102 GLU A CG   5  
ATOM 11421 C CD   . GLU A 1 102 ? -15.680 11.912  2.114   1.00 0.00 ? 102 GLU A CD   5  
ATOM 11422 O OE1  . GLU A 1 102 ? -14.928 12.315  1.243   1.00 0.00 ? 102 GLU A OE1  5  
ATOM 11423 O OE2  . GLU A 1 102 ? -16.678 12.507  2.484   1.00 0.00 ? 102 GLU A OE2  5  
ATOM 11424 H H    . GLU A 1 102 ? -12.704 7.737   1.029   1.00 0.00 ? 102 GLU A H    5  
ATOM 11425 H HA   . GLU A 1 102 ? -13.777 8.554   3.695   1.00 0.00 ? 102 GLU A HA   5  
ATOM 11426 H HB2  . GLU A 1 102 ? -13.261 10.555  2.320   1.00 0.00 ? 102 GLU A HB2  5  
ATOM 11427 H HB3  . GLU A 1 102 ? -14.290 9.923   1.037   1.00 0.00 ? 102 GLU A HB3  5  
ATOM 11428 H HG2  . GLU A 1 102 ? -16.201 9.907   2.682   1.00 0.00 ? 102 GLU A HG2  5  
ATOM 11429 H HG3  . GLU A 1 102 ? -15.146 10.738  3.823   1.00 0.00 ? 102 GLU A HG3  5  
ATOM 11430 H HE2  . GLU A 1 102 ? -16.820 13.337  2.024   1.00 0.00 ? 102 GLU A HE2  5  
ATOM 11431 N N    . VAL A 1 103 ? -15.795 7.121   3.258   1.00 0.00 ? 103 VAL A N    5  
ATOM 11432 C CA   . VAL A 1 103 ? -17.005 6.316   2.944   1.00 0.00 ? 103 VAL A CA   5  
ATOM 11433 C C    . VAL A 1 103 ? -18.161 7.276   2.687   1.00 0.00 ? 103 VAL A C    5  
ATOM 11434 O O    . VAL A 1 103 ? -18.552 8.053   3.537   1.00 0.00 ? 103 VAL A O    5  
ATOM 11435 C CB   . VAL A 1 103 ? -17.329 5.367   4.099   1.00 0.00 ? 103 VAL A CB   5  
ATOM 11436 C CG1  . VAL A 1 103 ? -16.055 4.653   4.517   1.00 0.00 ? 103 VAL A CG1  5  
ATOM 11437 C CG2  . VAL A 1 103 ? -17.879 6.145   5.293   1.00 0.00 ? 103 VAL A CG2  5  
ATOM 11438 H H    . VAL A 1 103 ? -15.511 7.248   4.187   1.00 0.00 ? 103 VAL A H    5  
ATOM 11439 H HA   . VAL A 1 103 ? -16.824 5.738   2.051   1.00 0.00 ? 103 VAL A HA   5  
ATOM 11440 H HB   . VAL A 1 103 ? -18.054 4.638   3.772   1.00 0.00 ? 103 VAL A HB   5  
ATOM 11441 H HG11 . VAL A 1 103 ? -15.592 5.197   5.321   1.00 0.00 ? 103 VAL A HG11 5  
ATOM 11442 H HG12 . VAL A 1 103 ? -15.380 4.614   3.677   1.00 0.00 ? 103 VAL A HG12 5  
ATOM 11443 H HG13 . VAL A 1 103 ? -16.291 3.650   4.844   1.00 0.00 ? 103 VAL A HG13 5  
ATOM 11444 H HG21 . VAL A 1 103 ? -17.806 5.533   6.181   1.00 0.00 ? 103 VAL A HG21 5  
ATOM 11445 H HG22 . VAL A 1 103 ? -18.911 6.400   5.111   1.00 0.00 ? 103 VAL A HG22 5  
ATOM 11446 H HG23 . VAL A 1 103 ? -17.302 7.048   5.432   1.00 0.00 ? 103 VAL A HG23 5  
ATOM 11447 N N    . LYS A 1 104 ? -18.677 7.249   1.497   1.00 0.00 ? 104 LYS A N    5  
ATOM 11448 C CA   . LYS A 1 104 ? -19.779 8.175   1.115   1.00 0.00 ? 104 LYS A CA   5  
ATOM 11449 C C    . LYS A 1 104 ? -21.019 7.966   1.991   1.00 0.00 ? 104 LYS A C    5  
ATOM 11450 O O    . LYS A 1 104 ? -21.794 8.879   2.195   1.00 0.00 ? 104 LYS A O    5  
ATOM 11451 C CB   . LYS A 1 104 ? -20.140 7.921   -0.347  1.00 0.00 ? 104 LYS A CB   5  
ATOM 11452 C CG   . LYS A 1 104 ? -20.386 6.424   -0.556  1.00 0.00 ? 104 LYS A CG   5  
ATOM 11453 C CD   . LYS A 1 104 ? -20.106 6.055   -2.013  1.00 0.00 ? 104 LYS A CD   5  
ATOM 11454 C CE   . LYS A 1 104 ? -18.605 6.181   -2.296  1.00 0.00 ? 104 LYS A CE   5  
ATOM 11455 N NZ   . LYS A 1 104 ? -18.127 4.957   -2.998  1.00 0.00 ? 104 LYS A NZ   5  
ATOM 11456 H H    . LYS A 1 104 ? -18.314 6.629   0.831   1.00 0.00 ? 104 LYS A H    5  
ATOM 11457 H HA   . LYS A 1 104 ? -19.437 9.192   1.221   1.00 0.00 ? 104 LYS A HA   5  
ATOM 11458 H HB2  . LYS A 1 104 ? -21.034 8.472   -0.600  1.00 0.00 ? 104 LYS A HB2  5  
ATOM 11459 H HB3  . LYS A 1 104 ? -19.327 8.241   -0.981  1.00 0.00 ? 104 LYS A HB3  5  
ATOM 11460 H HG2  . LYS A 1 104 ? -19.735 5.857   0.092   1.00 0.00 ? 104 LYS A HG2  5  
ATOM 11461 H HG3  . LYS A 1 104 ? -21.415 6.195   -0.321  1.00 0.00 ? 104 LYS A HG3  5  
ATOM 11462 H HD2  . LYS A 1 104 ? -20.422 5.037   -2.187  1.00 0.00 ? 104 LYS A HD2  5  
ATOM 11463 H HD3  . LYS A 1 104 ? -20.650 6.720   -2.665  1.00 0.00 ? 104 LYS A HD3  5  
ATOM 11464 H HE2  . LYS A 1 104 ? -18.426 7.044   -2.920  1.00 0.00 ? 104 LYS A HE2  5  
ATOM 11465 H HE3  . LYS A 1 104 ? -18.069 6.293   -1.365  1.00 0.00 ? 104 LYS A HE3  5  
ATOM 11466 H HZ1  . LYS A 1 104 ? -18.831 4.200   -2.898  1.00 0.00 ? 104 LYS A HZ1  5  
ATOM 11467 H HZ2  . LYS A 1 104 ? -17.221 4.649   -2.585  1.00 0.00 ? 104 LYS A HZ2  5  
ATOM 11468 H HZ3  . LYS A 1 104 ? -17.991 5.169   -4.007  1.00 0.00 ? 104 LYS A HZ3  5  
ATOM 11469 N N    . ASP A 1 105 ? -21.241 6.783   2.495   1.00 0.00 ? 105 ASP A N    5  
ATOM 11470 C CA   . ASP A 1 105 ? -22.461 6.564   3.326   1.00 0.00 ? 105 ASP A CA   5  
ATOM 11471 C C    . ASP A 1 105 ? -22.141 6.641   4.815   1.00 0.00 ? 105 ASP A C    5  
ATOM 11472 O O    . ASP A 1 105 ? -21.250 5.983   5.312   1.00 0.00 ? 105 ASP A O    5  
ATOM 11473 C CB   . ASP A 1 105 ? -23.050 5.193   3.015   1.00 0.00 ? 105 ASP A CB   5  
ATOM 11474 C CG   . ASP A 1 105 ? -24.379 5.363   2.277   1.00 0.00 ? 105 ASP A CG   5  
ATOM 11475 O OD1  . ASP A 1 105 ? -24.638 4.579   1.380   1.00 0.00 ? 105 ASP A OD1  5  
ATOM 11476 O OD2  . ASP A 1 105 ? -25.116 6.274   2.619   1.00 0.00 ? 105 ASP A OD2  5  
ATOM 11477 H H    . ASP A 1 105 ? -20.622 6.042   2.314   1.00 0.00 ? 105 ASP A H    5  
ATOM 11478 H HA   . ASP A 1 105 ? -23.189 7.319   3.087   1.00 0.00 ? 105 ASP A HA   5  
ATOM 11479 H HB2  . ASP A 1 105 ? -22.361 4.643   2.399   1.00 0.00 ? 105 ASP A HB2  5  
ATOM 11480 H HB3  . ASP A 1 105 ? -23.217 4.657   3.936   1.00 0.00 ? 105 ASP A HB3  5  
ATOM 11481 H HD2  . ASP A 1 105 ? -25.930 6.319   2.113   1.00 0.00 ? 105 ASP A HD2  5  
ATOM 11482 N N    . TYR A 1 106 ? -22.897 7.425   5.533   1.00 0.00 ? 106 TYR A N    5  
ATOM 11483 C CA   . TYR A 1 106 ? -22.689 7.540   7.006   1.00 0.00 ? 106 TYR A CA   5  
ATOM 11484 C C    . TYR A 1 106 ? -23.026 6.197   7.649   1.00 0.00 ? 106 TYR A C    5  
ATOM 11485 O O    . TYR A 1 106 ? -22.345 5.730   8.537   1.00 0.00 ? 106 TYR A O    5  
ATOM 11486 C CB   . TYR A 1 106 ? -23.608 8.633   7.568   1.00 0.00 ? 106 TYR A CB   5  
ATOM 11487 C CG   . TYR A 1 106 ? -23.530 8.653   9.079   1.00 0.00 ? 106 TYR A CG   5  
ATOM 11488 C CD1  . TYR A 1 106 ? -22.293 8.779   9.725   1.00 0.00 ? 106 TYR A CD1  5  
ATOM 11489 C CD2  . TYR A 1 106 ? -24.703 8.548   9.834   1.00 0.00 ? 106 TYR A CD2  5  
ATOM 11490 C CE1  . TYR A 1 106 ? -22.233 8.797   11.124  1.00 0.00 ? 106 TYR A CE1  5  
ATOM 11491 C CE2  . TYR A 1 106 ? -24.643 8.568   11.232  1.00 0.00 ? 106 TYR A CE2  5  
ATOM 11492 C CZ   . TYR A 1 106 ? -23.408 8.693   11.877  1.00 0.00 ? 106 TYR A CZ   5  
ATOM 11493 O OH   . TYR A 1 106 ? -23.349 8.712   13.257  1.00 0.00 ? 106 TYR A OH   5  
ATOM 11494 H H    . TYR A 1 106 ? -23.622 7.919   5.100   1.00 0.00 ? 106 TYR A H    5  
ATOM 11495 H HA   . TYR A 1 106 ? -21.659 7.789   7.206   1.00 0.00 ? 106 TYR A HA   5  
ATOM 11496 H HB2  . TYR A 1 106 ? -23.299 9.593   7.180   1.00 0.00 ? 106 TYR A HB2  5  
ATOM 11497 H HB3  . TYR A 1 106 ? -24.625 8.436   7.264   1.00 0.00 ? 106 TYR A HB3  5  
ATOM 11498 H HD1  . TYR A 1 106 ? -21.387 8.860   9.146   1.00 0.00 ? 106 TYR A HD1  5  
ATOM 11499 H HD2  . TYR A 1 106 ? -25.659 8.452   9.337   1.00 0.00 ? 106 TYR A HD2  5  
ATOM 11500 H HE1  . TYR A 1 106 ? -21.278 8.894   11.623  1.00 0.00 ? 106 TYR A HE1  5  
ATOM 11501 H HE2  . TYR A 1 106 ? -25.549 8.487   11.813  1.00 0.00 ? 106 TYR A HE2  5  
ATOM 11502 H HH   . TYR A 1 106 ? -24.086 9.236   13.579  1.00 0.00 ? 106 TYR A HH   5  
ATOM 11503 N N    . ASP A 1 107 ? -24.071 5.571   7.181   1.00 0.00 ? 107 ASP A N    5  
ATOM 11504 C CA   . ASP A 1 107 ? -24.468 4.247   7.729   1.00 0.00 ? 107 ASP A CA   5  
ATOM 11505 C C    . ASP A 1 107 ? -23.869 3.156   6.845   1.00 0.00 ? 107 ASP A C    5  
ATOM 11506 O O    . ASP A 1 107 ? -24.288 2.015   6.874   1.00 0.00 ? 107 ASP A O    5  
ATOM 11507 C CB   . ASP A 1 107 ? -25.994 4.128   7.738   1.00 0.00 ? 107 ASP A CB   5  
ATOM 11508 C CG   . ASP A 1 107 ? -26.524 4.148   6.301   1.00 0.00 ? 107 ASP A CG   5  
ATOM 11509 O OD1  . ASP A 1 107 ? -27.723 4.294   6.135   1.00 0.00 ? 107 ASP A OD1  5  
ATOM 11510 O OD2  . ASP A 1 107 ? -25.721 4.016   5.390   1.00 0.00 ? 107 ASP A OD2  5  
ATOM 11511 H H    . ASP A 1 107 ? -24.589 5.970   6.454   1.00 0.00 ? 107 ASP A H    5  
ATOM 11512 H HA   . ASP A 1 107 ? -24.091 4.145   8.736   1.00 0.00 ? 107 ASP A HA   5  
ATOM 11513 H HB2  . ASP A 1 107 ? -26.280 3.203   8.213   1.00 0.00 ? 107 ASP A HB2  5  
ATOM 11514 H HB3  . ASP A 1 107 ? -26.417 4.959   8.284   1.00 0.00 ? 107 ASP A HB3  5  
ATOM 11515 H HD2  . ASP A 1 107 ? -26.125 4.039   4.519   1.00 0.00 ? 107 ASP A HD2  5  
ATOM 11516 N N    . VAL A 1 108 ? -22.889 3.505   6.058   1.00 0.00 ? 108 VAL A N    5  
ATOM 11517