data_1XSC
# 
_entry.id   1XSC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XSC         
RCSB  RCSB030711   
WWPDB D_1000030711 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1XSA 'the same protein(E63A) of Apo structure'                     unspecified 
PDB 1XSB 'the same protein(E63A) of ATP structure in complex with ATP' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XSC 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Swarbrick, J.D.' 1 
'Buyya, S.'       2 
'Gunawardana, D.' 3 
'Gayler, K.R.'    4 
'McLennan, A.G.'  5 
'Gooley, P.R.'    6 
# 
_citation.id                        primary 
_citation.title                     'Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                8471 
_citation.page_last                 8481 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15596429 
_citation.pdbx_database_id_DOI      10.1074/jbc.M412318200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Swarbrick, J.D.' 1 
primary 'Buyya, S.'       2 
primary 'Gunawardana, D.' 3 
primary 'Gayler, K.R.'    4 
primary 'McLennan, A.G.'  5 
primary 'Gooley, P.R.'    6 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man "Bis(5'-nucleosyl)-tetraphosphatase" 17317.809 1 3.6.1.17 E63A ? ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"          507.181   1 ?        ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase, Diadenosine tetraphosphatase, Ap4A hydrolase, Ap4AASE
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEG
FKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEAL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRATQEEAGIEAGQLTIIEG
FKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEAL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   ALA n 
1 8   LEU n 
1 9   ARG n 
1 10  ALA n 
1 11  CYS n 
1 12  GLY n 
1 13  LEU n 
1 14  ILE n 
1 15  ILE n 
1 16  PHE n 
1 17  ARG n 
1 18  ARG n 
1 19  CYS n 
1 20  LEU n 
1 21  ILE n 
1 22  PRO n 
1 23  LYS n 
1 24  VAL n 
1 25  ASP n 
1 26  ASN n 
1 27  ASN n 
1 28  ALA n 
1 29  ILE n 
1 30  GLU n 
1 31  PHE n 
1 32  LEU n 
1 33  LEU n 
1 34  LEU n 
1 35  GLN n 
1 36  ALA n 
1 37  SER n 
1 38  ASP n 
1 39  GLY n 
1 40  ILE n 
1 41  HIS n 
1 42  HIS n 
1 43  TRP n 
1 44  THR n 
1 45  PRO n 
1 46  PRO n 
1 47  LYS n 
1 48  GLY n 
1 49  HIS n 
1 50  VAL n 
1 51  GLU n 
1 52  PRO n 
1 53  GLY n 
1 54  GLU n 
1 55  ASP n 
1 56  ASP n 
1 57  LEU n 
1 58  GLU n 
1 59  THR n 
1 60  ALA n 
1 61  LEU n 
1 62  ARG n 
1 63  ALA n 
1 64  THR n 
1 65  GLN n 
1 66  GLU n 
1 67  GLU n 
1 68  ALA n 
1 69  GLY n 
1 70  ILE n 
1 71  GLU n 
1 72  ALA n 
1 73  GLY n 
1 74  GLN n 
1 75  LEU n 
1 76  THR n 
1 77  ILE n 
1 78  ILE n 
1 79  GLU n 
1 80  GLY n 
1 81  PHE n 
1 82  LYS n 
1 83  ARG n 
1 84  GLU n 
1 85  LEU n 
1 86  ASN n 
1 87  TYR n 
1 88  VAL n 
1 89  ALA n 
1 90  ARG n 
1 91  ASN n 
1 92  LYS n 
1 93  PRO n 
1 94  LYS n 
1 95  THR n 
1 96  VAL n 
1 97  ILE n 
1 98  TYR n 
1 99  TRP n 
1 100 LEU n 
1 101 ALA n 
1 102 GLU n 
1 103 VAL n 
1 104 LYS n 
1 105 ASP n 
1 106 TYR n 
1 107 ASP n 
1 108 VAL n 
1 109 GLU n 
1 110 ILE n 
1 111 ARG n 
1 112 LEU n 
1 113 SER n 
1 114 HIS n 
1 115 GLU n 
1 116 HIS n 
1 117 GLN n 
1 118 ALA n 
1 119 TYR n 
1 120 ARG n 
1 121 TRP n 
1 122 LEU n 
1 123 GLY n 
1 124 LEU n 
1 125 GLU n 
1 126 GLU n 
1 127 ALA n 
1 128 CYS n 
1 129 GLN n 
1 130 LEU n 
1 131 ALA n 
1 132 GLN n 
1 133 PHE n 
1 134 LYS n 
1 135 GLU n 
1 136 MET n 
1 137 LYS n 
1 138 ALA n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 GLU n 
1 143 GLY n 
1 144 HIS n 
1 145 GLN n 
1 146 PHE n 
1 147 LEU n 
1 148 CYS n 
1 149 SER n 
1 150 ILE n 
1 151 GLU n 
1 152 ALA n 
1 153 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6-P3 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AP4A_HUMAN 
_struct_ref.pdbx_db_accession          P50583 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELN
YVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XSC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 7 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 152 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P50583 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       7 
_struct_ref_seq.pdbx_auth_seq_align_end       152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XSC GLY A 1   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 1   1 
1 1XSC PRO A 2   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 2   2 
1 1XSC LEU A 3   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 3   3 
1 1XSC GLY A 4   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 4   4 
1 1XSC SER A 5   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 5   5 
1 1XSC MET A 6   ? UNP P50583 ?   ?  'CLONING ARTIFACT' 6   6 
1 1XSC ALA A 63  ? UNP P50583 GLU 57 ENGINEERED         63  7 
1 1XSC LEU A 153 ? UNP P50583 ?   ?  'CLONING ARTIFACT' 153 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY             
2 2 1 '13C noesy over Aromatic/Anomeric' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      51mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.0mM human AP4A hydrolase, 13C 15N ATP' 
'20mM MgCl2, 20mM imidazole, pH 6.5, 90% H2O 10% D2O, 10mM DTT, 1mM EDTA, 1.5mM ATP (13C,15N labelled)' 
2 '1.0mM human AP4A hydrolase, 13C 15N ATP' 
'20mM MgCl2, 20mM imidazole, pH 6.5, 100% D2O, 10mM DTT, 1mM EDTA, 1.5mM ATP (13C, 15N labelled)'       
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Varian INOVA 600 
2 ? Varian INOVA 500 
# 
_pdbx_nmr_refine.entry_id           1XSC 
_pdbx_nmr_refine.method             
'CNS from a starting structure with ATP 20A from binding site, Refine against NOE/CACB no RAMA potential' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1XSC 
_pdbx_nmr_details.text       
;This calcualtion includes ATP constraints.   
Slow cooling, Lower temperature (20000K rather than 50000K) ATP starts 20A from lowest energy conformer 
Residues 1 and 2 are changed from GP to Alanine in the calculations. These are from the non native precission cleavage site and are unstructrued.
;
# 
_pdbx_nmr_ensemble.entry_id                                      1XSC 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             25 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1XSC 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.name             CNS 
_pdbx_nmr_software.version          1.0 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.authors          ? 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1XSC 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1XSC 
_struct.title                     
'Structure of the nudix enzyme AP4A hydrolase from homo sapiens (E63A mutant) in complex with ATP' 
_struct.pdbx_descriptor           "Bis(5'-nucleosyl)-tetraphosphatase(E.C.3.6.1.17)" 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XSC 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'nudix enzyme, human AP4A ATP hydrolase, alpha-beta, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 55  ? ALA A 68  ? ASP A 55  ALA A 68  1 ? 14 
HELX_P HELX_P2 2 GLU A 71  ? LEU A 75  ? GLU A 71  LEU A 75  5 ? 5  
HELX_P HELX_P3 3 GLY A 123 ? ALA A 131 ? GLY A 123 ALA A 131 1 ? 9  
HELX_P HELX_P4 4 PHE A 133 ? CYS A 148 ? PHE A 133 CYS A 148 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 47  ? GLY A 48  ? LYS A 47  GLY A 48  
A 2 LEU A 8   ? ILE A 15  ? LEU A 8   ILE A 15  
A 3 PRO A 93  ? ALA A 101 ? PRO A 93  ALA A 101 
A 4 ARG A 83  ? VAL A 88  ? ARG A 83  VAL A 88  
B 1 TRP A 43  ? THR A 44  ? TRP A 43  THR A 44  
B 2 PHE A 31  ? ALA A 36  ? PHE A 31  ALA A 36  
B 3 HIS A 116 ? LEU A 122 ? HIS A 116 LEU A 122 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 48 ? N GLY A 48 O CYS A 11  ? O CYS A 11  
A 2 3 N LEU A 8  ? N LEU A 8  O PRO A 93  ? O PRO A 93  
A 3 4 N TYR A 98 ? N TYR A 98 O ARG A 83  ? O ARG A 83  
B 1 2 N THR A 44 ? N THR A 44 O LEU A 34  ? O LEU A 34  
B 2 3 O GLN A 35 ? O GLN A 35 N GLN A 117 ? N GLN A 117 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE ATP A 154' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 HIS A 42  ? HIS A 42  . ? 1_555 ? 
2 AC1 5 TYR A 87  ? TYR A 87  . ? 1_555 ? 
3 AC1 5 ALA A 89  ? ALA A 89  . ? 1_555 ? 
4 AC1 5 PHE A 133 ? PHE A 133 . ? 1_555 ? 
5 AC1 5 GLU A 135 ? GLU A 135 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XSC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XSC 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N      . GLY A 1 1   ? 23.905  -15.425 -26.445 1.00 0.00  ? 1   GLY A N      1  
ATOM   2     C CA     . GLY A 1 1   ? 23.749  -14.038 -26.055 1.00 0.00  ? 1   GLY A CA     1  
ATOM   3     C C      . GLY A 1 1   ? 23.230  -13.947 -24.627 1.00 0.00  ? 1   GLY A C      1  
ATOM   4     O O      . GLY A 1 1   ? 22.118  -14.384 -24.339 1.00 0.00  ? 1   GLY A O      1  
ATOM   5     H H1     . GLY A 1 1   ? 24.245  -15.628 -27.374 1.00 0.00  ? 1   GLY A H1     1  
ATOM   6     H HA2    . GLY A 1 1   ? 24.714  -13.535 -26.120 1.00 0.00  ? 1   GLY A HA2    1  
ATOM   7     H HA3    . GLY A 1 1   ? 23.043  -13.552 -26.727 1.00 0.00  ? 1   GLY A HA3    1  
ATOM   8     N N      . PRO A 1 2   ? 24.039  -13.376 -23.732 1.00 0.00  ? 2   PRO A N      1  
ATOM   9     C CA     . PRO A 1 2   ? 23.714  -13.201 -22.333 1.00 0.00  ? 2   PRO A CA     1  
ATOM   10    C C      . PRO A 1 2   ? 22.664  -12.109 -22.185 1.00 0.00  ? 2   PRO A C      1  
ATOM   11    O O      . PRO A 1 2   ? 23.001  -10.932 -22.077 1.00 0.00  ? 2   PRO A O      1  
ATOM   12    C CB     . PRO A 1 2   ? 25.028  -12.789 -21.674 1.00 0.00  ? 2   PRO A CB     1  
ATOM   13    C CG     . PRO A 1 2   ? 25.754  -12.052 -22.798 1.00 0.00  ? 2   PRO A CG     1  
ATOM   14    C CD     . PRO A 1 2   ? 25.353  -12.851 -24.036 1.00 0.00  ? 2   PRO A CD     1  
ATOM   15    H HA     . PRO A 1 2   ? 23.345  -14.130 -21.897 1.00 0.00  ? 2   PRO A HA     1  
ATOM   16    H HB2    . PRO A 1 2   ? 24.873  -12.160 -20.797 1.00 0.00  ? 2   PRO A HB2    1  
ATOM   17    H HB3    . PRO A 1 2   ? 25.593  -13.684 -21.411 1.00 0.00  ? 2   PRO A HB3    1  
ATOM   18    H HG2    . PRO A 1 2   ? 25.355  -11.041 -22.879 1.00 0.00  ? 2   PRO A HG2    1  
ATOM   19    H HG3    . PRO A 1 2   ? 26.834  -12.031 -22.652 1.00 0.00  ? 2   PRO A HG3    1  
ATOM   20    H HD2    . PRO A 1 2   ? 25.335  -12.215 -24.921 1.00 0.00  ? 2   PRO A HD2    1  
ATOM   21    H HD3    . PRO A 1 2   ? 26.044  -13.682 -24.180 1.00 0.00  ? 2   PRO A HD3    1  
ATOM   22    N N      . LEU A 1 3   ? 21.394  -12.503 -22.183 1.00 0.00  ? 3   LEU A N      1  
ATOM   23    C CA     . LEU A 1 3   ? 20.295  -11.552 -22.051 1.00 0.00  ? 3   LEU A CA     1  
ATOM   24    C C      . LEU A 1 3   ? 20.369  -10.811 -20.718 1.00 0.00  ? 3   LEU A C      1  
ATOM   25    O O      . LEU A 1 3   ? 20.848  -11.353 -19.721 1.00 0.00  ? 3   LEU A O      1  
ATOM   26    C CB     . LEU A 1 3   ? 18.953  -12.275 -22.179 1.00 0.00  ? 3   LEU A CB     1  
ATOM   27    C CG     . LEU A 1 3   ? 18.125  -11.887 -23.404 1.00 0.00  ? 3   LEU A CG     1  
ATOM   28    C CD1    . LEU A 1 3   ? 17.868  -10.387 -23.420 1.00 0.00  ? 3   LEU A CD1    1  
ATOM   29    C CD2    . LEU A 1 3   ? 18.823  -12.328 -24.684 1.00 0.00  ? 3   LEU A CD2    1  
ATOM   30    H H      . LEU A 1 3   ? 21.189  -13.458 -22.276 1.00 0.00  ? 3   LEU A H      1  
ATOM   31    H HA     . LEU A 1 3   ? 20.382  -10.833 -22.852 1.00 0.00  ? 3   LEU A HA     1  
ATOM   32    H HB2    . LEU A 1 3   ? 19.143  -13.338 -22.219 1.00 0.00  ? 3   LEU A HB2    1  
ATOM   33    H HB3    . LEU A 1 3   ? 18.366  -12.066 -21.294 1.00 0.00  ? 3   LEU A HB3    1  
ATOM   34    H HG     . LEU A 1 3   ? 17.168  -12.386 -23.355 1.00 0.00  ? 3   LEU A HG     1  
ATOM   35    H HD11   . LEU A 1 3   ? 18.723  -9.880  -23.846 1.00 0.00  ? 3   LEU A HD11   1  
ATOM   36    H HD12   . LEU A 1 3   ? 17.711  -10.038 -22.411 1.00 0.00  ? 3   LEU A HD12   1  
ATOM   37    H HD13   . LEU A 1 3   ? 16.992  -10.177 -24.015 1.00 0.00  ? 3   LEU A HD13   1  
ATOM   38    H HD21   . LEU A 1 3   ? 19.753  -12.823 -24.436 1.00 0.00  ? 3   LEU A HD21   1  
ATOM   39    H HD22   . LEU A 1 3   ? 19.029  -11.465 -25.299 1.00 0.00  ? 3   LEU A HD22   1  
ATOM   40    H HD23   . LEU A 1 3   ? 18.185  -13.010 -25.225 1.00 0.00  ? 3   LEU A HD23   1  
ATOM   41    N N      . GLY A 1 4   ? 19.898  -9.567  -20.710 1.00 0.00  ? 4   GLY A N      1  
ATOM   42    C CA     . GLY A 1 4   ? 19.924  -8.774  -19.495 1.00 0.00  ? 4   GLY A CA     1  
ATOM   43    C C      . GLY A 1 4   ? 18.634  -8.005  -19.249 1.00 0.00  ? 4   GLY A C      1  
ATOM   44    O O      . GLY A 1 4   ? 18.401  -7.516  -18.144 1.00 0.00  ? 4   GLY A O      1  
ATOM   45    H H      . GLY A 1 4   ? 19.534  -9.187  -21.536 1.00 0.00  ? 4   GLY A H      1  
ATOM   46    H HA2    . GLY A 1 4   ? 20.100  -9.430  -18.656 1.00 0.00  ? 4   GLY A HA2    1  
ATOM   47    H HA3    . GLY A 1 4   ? 20.741  -8.068  -19.559 1.00 0.00  ? 4   GLY A HA3    1  
ATOM   48    N N      . SER A 1 5   ? 17.793  -7.893  -20.276 1.00 0.00  ? 5   SER A N      1  
ATOM   49    C CA     . SER A 1 5   ? 16.529  -7.174  -20.154 1.00 0.00  ? 5   SER A CA     1  
ATOM   50    C C      . SER A 1 5   ? 15.432  -8.083  -19.609 1.00 0.00  ? 5   SER A C      1  
ATOM   51    O O      . SER A 1 5   ? 14.992  -9.014  -20.284 1.00 0.00  ? 5   SER A O      1  
ATOM   52    C CB     . SER A 1 5   ? 16.111  -6.608  -21.511 1.00 0.00  ? 5   SER A CB     1  
ATOM   53    O OG     . SER A 1 5   ? 16.344  -7.547  -22.548 1.00 0.00  ? 5   SER A OG     1  
ATOM   54    H H      . SER A 1 5   ? 18.028  -8.299  -21.135 1.00 0.00  ? 5   SER A H      1  
ATOM   55    H HA     . SER A 1 5   ? 16.679  -6.357  -19.464 1.00 0.00  ? 5   SER A HA     1  
ATOM   56    H HB2    . SER A 1 5   ? 15.059  -6.367  -21.491 1.00 0.00  ? 5   SER A HB2    1  
ATOM   57    H HB3    . SER A 1 5   ? 16.681  -5.715  -21.718 1.00 0.00  ? 5   SER A HB3    1  
ATOM   58    H HG     . SER A 1 5   ? 17.146  -7.311  -23.019 1.00 0.00  ? 5   SER A HG     1  
ATOM   59    N N      . MET A 1 6   ? 14.988  -7.804  -18.387 1.00 0.00  ? 6   MET A N      1  
ATOM   60    C CA     . MET A 1 6   ? 13.939  -8.597  -17.759 1.00 0.00  ? 6   MET A CA     1  
ATOM   61    C C      . MET A 1 6   ? 12.556  -8.064  -18.128 1.00 0.00  ? 6   MET A C      1  
ATOM   62    O O      . MET A 1 6   ? 12.258  -6.889  -17.915 1.00 0.00  ? 6   MET A O      1  
ATOM   63    C CB     . MET A 1 6   ? 14.109  -8.601  -16.237 1.00 0.00  ? 6   MET A CB     1  
ATOM   64    C CG     . MET A 1 6   ? 13.148  -9.536  -15.522 1.00 0.00  ? 6   MET A CG     1  
ATOM   65    S SD     . MET A 1 6   ? 13.509  -11.275 -15.837 1.00 0.00  ? 6   MET A SD     1  
ATOM   66    C CE     . MET A 1 6   ? 12.036  -11.772 -16.725 1.00 0.00  ? 6   MET A CE     1  
ATOM   67    H H      . MET A 1 6   ? 15.375  -7.047  -17.900 1.00 0.00  ? 6   MET A H      1  
ATOM   68    H HA     . MET A 1 6   ? 14.027  -9.609  -18.122 1.00 0.00  ? 6   MET A HA     1  
ATOM   69    H HB2    . MET A 1 6   ? 15.119  -8.906  -16.001 1.00 0.00  ? 6   MET A HB2    1  
ATOM   70    H HB3    . MET A 1 6   ? 13.949  -7.600  -15.865 1.00 0.00  ? 6   MET A HB3    1  
ATOM   71    H HG2    . MET A 1 6   ? 13.216  -9.356  -14.459 1.00 0.00  ? 6   MET A HG2    1  
ATOM   72    H HG3    . MET A 1 6   ? 12.144  -9.324  -15.857 1.00 0.00  ? 6   MET A HG3    1  
ATOM   73    H HE1    . MET A 1 6   ? 12.315  -12.397 -17.562 1.00 0.00  ? 6   MET A HE1    1  
ATOM   74    H HE2    . MET A 1 6   ? 11.521  -10.895 -17.087 1.00 0.00  ? 6   MET A HE2    1  
ATOM   75    H HE3    . MET A 1 6   ? 11.387  -12.325 -16.064 1.00 0.00  ? 6   MET A HE3    1  
ATOM   76    N N      . ALA A 1 7   ? 11.718  -8.936  -18.680 1.00 0.00  ? 7   ALA A N      1  
ATOM   77    C CA     . ALA A 1 7   ? 10.365  -8.557  -19.075 1.00 0.00  ? 7   ALA A CA     1  
ATOM   78    C C      . ALA A 1 7   ? 10.377  -7.647  -20.295 1.00 0.00  ? 7   ALA A C      1  
ATOM   79    O O      . ALA A 1 7   ? 11.421  -7.129  -20.695 1.00 0.00  ? 7   ALA A O      1  
ATOM   80    C CB     . ALA A 1 7   ? 9.638   -7.880  -17.919 1.00 0.00  ? 7   ALA A CB     1  
ATOM   81    H H      . ALA A 1 7   ? 12.013  -9.859  -18.822 1.00 0.00  ? 7   ALA A H      1  
ATOM   82    H HA     . ALA A 1 7   ? 9.827   -9.461  -19.327 1.00 0.00  ? 7   ALA A HA     1  
ATOM   83    H HB1    . ALA A 1 7   ? 8.636   -8.274  -17.842 1.00 0.00  ? 7   ALA A HB1    1  
ATOM   84    H HB2    . ALA A 1 7   ? 9.593   -6.815  -18.094 1.00 0.00  ? 7   ALA A HB2    1  
ATOM   85    H HB3    . ALA A 1 7   ? 10.171  -8.071  -16.998 1.00 0.00  ? 7   ALA A HB3    1  
ATOM   86    N N      . LEU A 1 8   ? 9.202   -7.461  -20.883 1.00 0.00  ? 8   LEU A N      1  
ATOM   87    C CA     . LEU A 1 8   ? 9.057   -6.617  -22.061 1.00 0.00  ? 8   LEU A CA     1  
ATOM   88    C C      . LEU A 1 8   ? 8.374   -5.300  -21.703 1.00 0.00  ? 8   LEU A C      1  
ATOM   89    O O      . LEU A 1 8   ? 7.428   -5.276  -20.918 1.00 0.00  ? 8   LEU A O      1  
ATOM   90    C CB     . LEU A 1 8   ? 8.254   -7.340  -23.146 1.00 0.00  ? 8   LEU A CB     1  
ATOM   91    C CG     . LEU A 1 8   ? 8.388   -8.866  -23.162 1.00 0.00  ? 8   LEU A CG     1  
ATOM   92    C CD1    . LEU A 1 8   ? 7.588   -9.480  -22.025 1.00 0.00  ? 8   LEU A CD1    1  
ATOM   93    C CD2    . LEU A 1 8   ? 7.919   -9.419  -24.495 1.00 0.00  ? 8   LEU A CD2    1  
ATOM   94    H H      . LEU A 1 8   ? 8.412   -7.903  -20.509 1.00 0.00  ? 8   LEU A H      1  
ATOM   95    H HA     . LEU A 1 8   ? 10.046  -6.405  -22.439 1.00 0.00  ? 8   LEU A HA     1  
ATOM   96    H HB2    . LEU A 1 8   ? 7.214   -7.096  -23.011 1.00 0.00  ? 8   LEU A HB2    1  
ATOM   97    H HB3    . LEU A 1 8   ? 8.573   -6.964  -24.108 1.00 0.00  ? 8   LEU A HB3    1  
ATOM   98    H HG     . LEU A 1 8   ? 9.426   -9.135  -23.028 1.00 0.00  ? 8   LEU A HG     1  
ATOM   99    H HD11   . LEU A 1 8   ? 6.951   -8.724  -21.595 1.00 0.00  ? 8   LEU A HD11   1  
ATOM   100   H HD12   . LEU A 1 8   ? 8.262   -9.858  -21.265 1.00 0.00  ? 8   LEU A HD12   1  
ATOM   101   H HD13   . LEU A 1 8   ? 6.980   -10.286 -22.402 1.00 0.00  ? 8   LEU A HD13   1  
ATOM   102   H HD21   . LEU A 1 8   ? 8.601   -9.112  -25.272 1.00 0.00  ? 8   LEU A HD21   1  
ATOM   103   H HD22   . LEU A 1 8   ? 6.928   -9.043  -24.712 1.00 0.00  ? 8   LEU A HD22   1  
ATOM   104   H HD23   . LEU A 1 8   ? 7.892   -10.498 -24.445 1.00 0.00  ? 8   LEU A HD23   1  
ATOM   105   N N      . ARG A 1 9   ? 8.862   -4.208  -22.281 1.00 0.00  ? 9   ARG A N      1  
ATOM   106   C CA     . ARG A 1 9   ? 8.298   -2.890  -22.019 1.00 0.00  ? 9   ARG A CA     1  
ATOM   107   C C      . ARG A 1 9   ? 7.123   -2.600  -22.948 1.00 0.00  ? 9   ARG A C      1  
ATOM   108   O O      . ARG A 1 9   ? 7.252   -2.672  -24.171 1.00 0.00  ? 9   ARG A O      1  
ATOM   109   C CB     . ARG A 1 9   ? 9.370   -1.808  -22.178 1.00 0.00  ? 9   ARG A CB     1  
ATOM   110   C CG     . ARG A 1 9   ? 9.414   -0.823  -21.021 1.00 0.00  ? 9   ARG A CG     1  
ATOM   111   C CD     . ARG A 1 9   ? 10.773  -0.818  -20.339 1.00 0.00  ? 9   ARG A CD     1  
ATOM   112   N NE     . ARG A 1 9   ? 11.200  0.530   -19.977 1.00 0.00  ? 9   ARG A NE     1  
ATOM   113   C CZ     . ARG A 1 9   ? 10.775  1.178   -18.893 1.00 0.00  ? 9   ARG A CZ     1  
ATOM   114   N NH1    . ARG A 1 9   ? 9.914   0.603   -18.062 1.00 0.00  ? 9   ARG A NH1    1  
ATOM   115   N NH2    . ARG A 1 9   ? 11.211  2.404   -18.639 1.00 0.00  ? 9   ARG A NH2    1  
ATOM   116   H H      . ARG A 1 9   ? 9.618   -4.289  -22.897 1.00 0.00  ? 9   ARG A H      1  
ATOM   117   H HA     . ARG A 1 9   ? 7.944   -2.881  -21.000 1.00 0.00  ? 9   ARG A HA     1  
ATOM   118   H HB2    . ARG A 1 9   ? 10.335  -2.281  -22.259 1.00 0.00  ? 9   ARG A HB2    1  
ATOM   119   H HB3    . ARG A 1 9   ? 9.175   -1.254  -23.085 1.00 0.00  ? 9   ARG A HB3    1  
ATOM   120   H HG2    . ARG A 1 9   ? 9.209   0.168   -21.396 1.00 0.00  ? 9   ARG A HG2    1  
ATOM   121   H HG3    . ARG A 1 9   ? 8.660   -1.099  -20.298 1.00 0.00  ? 9   ARG A HG3    1  
ATOM   122   H HD2    . ARG A 1 9   ? 10.716  -1.422  -19.444 1.00 0.00  ? 9   ARG A HD2    1  
ATOM   123   H HD3    . ARG A 1 9   ? 11.502  -1.247  -21.014 1.00 0.00  ? 9   ARG A HD3    1  
ATOM   124   H HE     . ARG A 1 9   ? 11.837  0.979   -20.572 1.00 0.00  ? 9   ARG A HE     1  
ATOM   125   H HH11   . ARG A 1 9   ? 9.580   -0.321  -18.245 1.00 0.00  ? 9   ARG A HH11   1  
ATOM   126   H HH12   . ARG A 1 9   ? 9.599   1.095   -17.250 1.00 0.00  ? 9   ARG A HH12   1  
ATOM   127   H HH21   . ARG A 1 9   ? 11.860  2.844   -19.263 1.00 0.00  ? 9   ARG A HH21   1  
ATOM   128   H HH22   . ARG A 1 9   ? 10.893  2.890   -17.826 1.00 0.00  ? 9   ARG A HH22   1  
ATOM   129   N N      . ALA A 1 10  ? 5.981   -2.260  -22.360 1.00 0.00  ? 10  ALA A N      1  
ATOM   130   C CA     . ALA A 1 10  ? 4.783   -1.946  -23.131 1.00 0.00  ? 10  ALA A CA     1  
ATOM   131   C C      . ALA A 1 10  ? 4.093   -0.708  -22.575 1.00 0.00  ? 10  ALA A C      1  
ATOM   132   O O      . ALA A 1 10  ? 4.404   -0.257  -21.473 1.00 0.00  ? 10  ALA A O      1  
ATOM   133   C CB     . ALA A 1 10  ? 3.824   -3.128  -23.129 1.00 0.00  ? 10  ALA A CB     1  
ATOM   134   H H      . ALA A 1 10  ? 5.943   -2.212  -21.383 1.00 0.00  ? 10  ALA A H      1  
ATOM   135   H HA     . ALA A 1 10  ? 5.081   -1.755  -24.152 1.00 0.00  ? 10  ALA A HA     1  
ATOM   136   H HB1    . ALA A 1 10  ? 4.229   -3.918  -22.515 1.00 0.00  ? 10  ALA A HB1    1  
ATOM   137   H HB2    . ALA A 1 10  ? 3.693   -3.486  -24.139 1.00 0.00  ? 10  ALA A HB2    1  
ATOM   138   H HB3    . ALA A 1 10  ? 2.868   -2.814  -22.730 1.00 0.00  ? 10  ALA A HB3    1  
ATOM   139   N N      . CYS A 1 11  ? 3.151   -0.163  -23.338 1.00 0.00  ? 11  CYS A N      1  
ATOM   140   C CA     . CYS A 1 11  ? 2.420   1.020   -22.905 1.00 0.00  ? 11  CYS A CA     1  
ATOM   141   C C      . CYS A 1 11  ? 1.084   1.138   -23.630 1.00 0.00  ? 11  CYS A C      1  
ATOM   142   O O      . CYS A 1 11  ? 1.029   1.173   -24.859 1.00 0.00  ? 11  CYS A O      1  
ATOM   143   C CB     . CYS A 1 11  ? 3.255   2.278   -23.150 1.00 0.00  ? 11  CYS A CB     1  
ATOM   144   S SG     . CYS A 1 11  ? 4.448   2.643   -21.838 1.00 0.00  ? 11  CYS A SG     1  
ATOM   145   H H      . CYS A 1 11  ? 2.942   -0.566  -24.204 1.00 0.00  ? 11  CYS A H      1  
ATOM   146   H HA     . CYS A 1 11  ? 2.232   0.924   -21.847 1.00 0.00  ? 11  CYS A HA     1  
ATOM   147   H HB2    . CYS A 1 11  ? 3.806   2.163   -24.069 1.00 0.00  ? 11  CYS A HB2    1  
ATOM   148   H HB3    . CYS A 1 11  ? 2.592   3.126   -23.236 1.00 0.00  ? 11  CYS A HB3    1  
ATOM   149   H HG     . CYS A 1 11  ? 4.401   1.934   -21.191 1.00 0.00  ? 11  CYS A HG     1  
ATOM   150   N N      . GLY A 1 12  ? 0.012   1.212   -22.852 1.00 0.00  ? 12  GLY A N      1  
ATOM   151   C CA     . GLY A 1 12  ? -1.317  1.341   -23.420 1.00 0.00  ? 12  GLY A CA     1  
ATOM   152   C C      . GLY A 1 12  ? -1.976  2.647   -23.032 1.00 0.00  ? 12  GLY A C      1  
ATOM   153   O O      . GLY A 1 12  ? -1.473  3.369   -22.172 1.00 0.00  ? 12  GLY A O      1  
ATOM   154   H H      . GLY A 1 12  ? 0.126   1.184   -21.879 1.00 0.00  ? 12  GLY A H      1  
ATOM   155   H HA2    . GLY A 1 12  ? -1.244  1.294   -24.494 1.00 0.00  ? 12  GLY A HA2    1  
ATOM   156   H HA3    . GLY A 1 12  ? -1.926  0.522   -23.072 1.00 0.00  ? 12  GLY A HA3    1  
ATOM   157   N N      . LEU A 1 13  ? -3.103  2.959   -23.666 1.00 0.00  ? 13  LEU A N      1  
ATOM   158   C CA     . LEU A 1 13  ? -3.814  4.197   -23.375 1.00 0.00  ? 13  LEU A CA     1  
ATOM   159   C C      . LEU A 1 13  ? -5.263  3.933   -22.984 1.00 0.00  ? 13  LEU A C      1  
ATOM   160   O O      . LEU A 1 13  ? -6.052  3.443   -23.793 1.00 0.00  ? 13  LEU A O      1  
ATOM   161   C CB     . LEU A 1 13  ? -3.778  5.129   -24.596 1.00 0.00  ? 13  LEU A CB     1  
ATOM   162   C CG     . LEU A 1 13  ? -3.127  6.494   -24.359 1.00 0.00  ? 13  LEU A CG     1  
ATOM   163   C CD1    . LEU A 1 13  ? -3.405  7.435   -25.519 1.00 0.00  ? 13  LEU A CD1    1  
ATOM   164   C CD2    . LEU A 1 13  ? -3.613  7.100   -23.053 1.00 0.00  ? 13  LEU A CD2    1  
ATOM   165   H H      . LEU A 1 13  ? -3.456  2.347   -24.346 1.00 0.00  ? 13  LEU A H      1  
ATOM   166   H HA     . LEU A 1 13  ? -3.314  4.681   -22.549 1.00 0.00  ? 13  LEU A HA     1  
ATOM   167   H HB2    . LEU A 1 13  ? -3.238  4.630   -25.385 1.00 0.00  ? 13  LEU A HB2    1  
ATOM   168   H HB3    . LEU A 1 13  ? -4.792  5.296   -24.929 1.00 0.00  ? 13  LEU A HB3    1  
ATOM   169   H HG     . LEU A 1 13  ? -2.059  6.364   -24.290 1.00 0.00  ? 13  LEU A HG     1  
ATOM   170   H HD11   . LEU A 1 13  ? -3.409  8.455   -25.161 1.00 0.00  ? 13  LEU A HD11   1  
ATOM   171   H HD12   . LEU A 1 13  ? -4.370  7.202   -25.950 1.00 0.00  ? 13  LEU A HD12   1  
ATOM   172   H HD13   . LEU A 1 13  ? -2.639  7.320   -26.270 1.00 0.00  ? 13  LEU A HD13   1  
ATOM   173   H HD21   . LEU A 1 13  ? -3.879  8.136   -23.213 1.00 0.00  ? 13  LEU A HD21   1  
ATOM   174   H HD22   . LEU A 1 13  ? -2.824  7.041   -22.320 1.00 0.00  ? 13  LEU A HD22   1  
ATOM   175   H HD23   . LEU A 1 13  ? -4.475  6.556   -22.702 1.00 0.00  ? 13  LEU A HD23   1  
ATOM   176   N N      . ILE A 1 14  ? -5.621  4.302   -21.758 1.00 0.00  ? 14  ILE A N      1  
ATOM   177   C CA     . ILE A 1 14  ? -6.991  4.138   -21.297 1.00 0.00  ? 14  ILE A CA     1  
ATOM   178   C C      . ILE A 1 14  ? -7.796  5.356   -21.722 1.00 0.00  ? 14  ILE A C      1  
ATOM   179   O O      . ILE A 1 14  ? -7.834  6.372   -21.029 1.00 0.00  ? 14  ILE A O      1  
ATOM   180   C CB     . ILE A 1 14  ? -7.078  3.955   -19.764 1.00 0.00  ? 14  ILE A CB     1  
ATOM   181   C CG1    . ILE A 1 14  ? -6.308  2.700   -19.340 1.00 0.00  ? 14  ILE A CG1    1  
ATOM   182   C CG2    . ILE A 1 14  ? -8.535  3.868   -19.319 1.00 0.00  ? 14  ILE A CG2    1  
ATOM   183   C CD1    . ILE A 1 14  ? -6.485  2.331   -17.881 1.00 0.00  ? 14  ILE A CD1    1  
ATOM   184   H H      . ILE A 1 14  ? -4.959  4.716   -21.165 1.00 0.00  ? 14  ILE A H      1  
ATOM   185   H HA     . ILE A 1 14  ? -7.404  3.262   -21.776 1.00 0.00  ? 14  ILE A HA     1  
ATOM   186   H HB     . ILE A 1 14  ? -6.633  4.819   -19.294 1.00 0.00  ? 14  ILE A HB     1  
ATOM   187   H HG12   . ILE A 1 14  ? -6.646  1.864   -19.933 1.00 0.00  ? 14  ILE A HG12   1  
ATOM   188   H HG13   . ILE A 1 14  ? -5.254  2.855   -19.519 1.00 0.00  ? 14  ILE A HG13   1  
ATOM   189   H HG21   . ILE A 1 14  ? -8.589  3.386   -18.353 1.00 0.00  ? 14  ILE A HG21   1  
ATOM   190   H HG22   . ILE A 1 14  ? -9.097  3.293   -20.039 1.00 0.00  ? 14  ILE A HG22   1  
ATOM   191   H HG23   . ILE A 1 14  ? -8.950  4.863   -19.248 1.00 0.00  ? 14  ILE A HG23   1  
ATOM   192   H HD11   . ILE A 1 14  ? -6.960  1.363   -17.810 1.00 0.00  ? 14  ILE A HD11   1  
ATOM   193   H HD12   . ILE A 1 14  ? -7.103  3.072   -17.395 1.00 0.00  ? 14  ILE A HD12   1  
ATOM   194   H HD13   . ILE A 1 14  ? -5.521  2.294   -17.397 1.00 0.00  ? 14  ILE A HD13   1  
ATOM   195   N N      . ILE A 1 15  ? -8.409  5.248   -22.889 1.00 0.00  ? 15  ILE A N      1  
ATOM   196   C CA     . ILE A 1 15  ? -9.187  6.336   -23.455 1.00 0.00  ? 15  ILE A CA     1  
ATOM   197   C C      . ILE A 1 15  ? -10.592 6.383   -22.884 1.00 0.00  ? 15  ILE A C      1  
ATOM   198   O O      . ILE A 1 15  ? -11.178 5.353   -22.570 1.00 0.00  ? 15  ILE A O      1  
ATOM   199   C CB     . ILE A 1 15  ? -9.255  6.197   -24.979 1.00 0.00  ? 15  ILE A CB     1  
ATOM   200   C CG1    . ILE A 1 15  ? -7.839  6.197   -25.549 1.00 0.00  ? 15  ILE A CG1    1  
ATOM   201   C CG2    . ILE A 1 15  ? -10.099 7.299   -25.599 1.00 0.00  ? 15  ILE A CG2    1  
ATOM   202   C CD1    . ILE A 1 15  ? -7.729  5.467   -26.864 1.00 0.00  ? 15  ILE A CD1    1  
ATOM   203   H H      . ILE A 1 15  ? -8.314  4.418   -23.399 1.00 0.00  ? 15  ILE A H      1  
ATOM   204   H HA     . ILE A 1 15  ? -8.683  7.260   -23.225 1.00 0.00  ? 15  ILE A HA     1  
ATOM   205   H HB     . ILE A 1 15  ? -9.721  5.253   -25.208 1.00 0.00  ? 15  ILE A HB     1  
ATOM   206   H HG12   . ILE A 1 15  ? -7.515  7.215   -25.696 1.00 0.00  ? 15  ILE A HG12   1  
ATOM   207   H HG13   . ILE A 1 15  ? -7.177  5.715   -24.845 1.00 0.00  ? 15  ILE A HG13   1  
ATOM   208   H HG21   . ILE A 1 15  ? -10.233 7.098   -26.652 1.00 0.00  ? 15  ILE A HG21   1  
ATOM   209   H HG22   . ILE A 1 15  ? -9.602  8.249   -25.472 1.00 0.00  ? 15  ILE A HG22   1  
ATOM   210   H HG23   . ILE A 1 15  ? -11.063 7.329   -25.114 1.00 0.00  ? 15  ILE A HG23   1  
ATOM   211   H HD11   . ILE A 1 15  ? -7.602  6.181   -27.664 1.00 0.00  ? 15  ILE A HD11   1  
ATOM   212   H HD12   . ILE A 1 15  ? -8.631  4.895   -27.029 1.00 0.00  ? 15  ILE A HD12   1  
ATOM   213   H HD13   . ILE A 1 15  ? -6.876  4.802   -26.834 1.00 0.00  ? 15  ILE A HD13   1  
ATOM   214   N N      . PHE A 1 16  ? -11.117 7.594   -22.746 1.00 0.00  ? 16  PHE A N      1  
ATOM   215   C CA     . PHE A 1 16  ? -12.448 7.793   -22.203 1.00 0.00  ? 16  PHE A CA     1  
ATOM   216   C C      . PHE A 1 16  ? -13.112 9.042   -22.779 1.00 0.00  ? 16  PHE A C      1  
ATOM   217   O O      . PHE A 1 16  ? -12.567 10.139  -22.693 1.00 0.00  ? 16  PHE A O      1  
ATOM   218   C CB     . PHE A 1 16  ? -12.367 7.909   -20.679 1.00 0.00  ? 16  PHE A CB     1  
ATOM   219   C CG     . PHE A 1 16  ? -11.685 9.164   -20.208 1.00 0.00  ? 16  PHE A CG     1  
ATOM   220   C CD1    . PHE A 1 16  ? -12.407 10.329  -20.007 1.00 0.00  ? 16  PHE A CD1    1  
ATOM   221   C CD2    . PHE A 1 16  ? -10.318 9.177   -19.971 1.00 0.00  ? 16  PHE A CD2    1  
ATOM   222   C CE1    . PHE A 1 16  ? -11.780 11.484  -19.579 1.00 0.00  ? 16  PHE A CE1    1  
ATOM   223   C CE2    . PHE A 1 16  ? -9.687  10.329  -19.542 1.00 0.00  ? 16  PHE A CE2    1  
ATOM   224   C CZ     . PHE A 1 16  ? -10.419 11.484  -19.347 1.00 0.00  ? 16  PHE A CZ     1  
ATOM   225   H H      . PHE A 1 16  ? -10.592 8.377   -23.012 1.00 0.00  ? 16  PHE A H      1  
ATOM   226   H HA     . PHE A 1 16  ? -13.040 6.930   -22.461 1.00 0.00  ? 16  PHE A HA     1  
ATOM   227   H HB2    . PHE A 1 16  ? -13.363 7.899   -20.270 1.00 0.00  ? 16  PHE A HB2    1  
ATOM   228   H HB3    . PHE A 1 16  ? -11.815 7.068   -20.291 1.00 0.00  ? 16  PHE A HB3    1  
ATOM   229   H HD1    . PHE A 1 16  ? -13.471 10.330  -20.190 1.00 0.00  ? 16  PHE A HD1    1  
ATOM   230   H HD2    . PHE A 1 16  ? -9.745  8.276   -20.126 1.00 0.00  ? 16  PHE A HD2    1  
ATOM   231   H HE1    . PHE A 1 16  ? -12.356 12.384  -19.426 1.00 0.00  ? 16  PHE A HE1    1  
ATOM   232   H HE2    . PHE A 1 16  ? -8.622  10.325  -19.357 1.00 0.00  ? 16  PHE A HE2    1  
ATOM   233   H HZ     . PHE A 1 16  ? -9.927  12.385  -19.012 1.00 0.00  ? 16  PHE A HZ     1  
ATOM   234   N N      . ARG A 1 17  ? -14.303 8.877   -23.347 1.00 0.00  ? 17  ARG A N      1  
ATOM   235   C CA     . ARG A 1 17  ? -15.035 10.008  -23.908 1.00 0.00  ? 17  ARG A CA     1  
ATOM   236   C C      . ARG A 1 17  ? -15.911 10.655  -22.840 1.00 0.00  ? 17  ARG A C      1  
ATOM   237   O O      . ARG A 1 17  ? -16.863 10.047  -22.353 1.00 0.00  ? 17  ARG A O      1  
ATOM   238   C CB     . ARG A 1 17  ? -15.900 9.559   -25.088 1.00 0.00  ? 17  ARG A CB     1  
ATOM   239   C CG     . ARG A 1 17  ? -16.006 10.599  -26.193 1.00 0.00  ? 17  ARG A CG     1  
ATOM   240   C CD     . ARG A 1 17  ? -16.912 11.755  -25.793 1.00 0.00  ? 17  ARG A CD     1  
ATOM   241   N NE     . ARG A 1 17  ? -16.587 12.980  -26.522 1.00 0.00  ? 17  ARG A NE     1  
ATOM   242   C CZ     . ARG A 1 17  ? -17.447 13.978  -26.720 1.00 0.00  ? 17  ARG A CZ     1  
ATOM   243   N NH1    . ARG A 1 17  ? -18.685 13.903  -26.249 1.00 0.00  ? 17  ARG A NH1    1  
ATOM   244   N NH2    . ARG A 1 17  ? -17.063 15.058  -27.389 1.00 0.00  ? 17  ARG A NH2    1  
ATOM   245   H H      . ARG A 1 17  ? -14.701 7.983   -23.376 1.00 0.00  ? 17  ARG A H      1  
ATOM   246   H HA     . ARG A 1 17  ? -14.311 10.731  -24.256 1.00 0.00  ? 17  ARG A HA     1  
ATOM   247   H HB2    . ARG A 1 17  ? -15.478 8.659   -25.509 1.00 0.00  ? 17  ARG A HB2    1  
ATOM   248   H HB3    . ARG A 1 17  ? -16.897 9.346   -24.728 1.00 0.00  ? 17  ARG A HB3    1  
ATOM   249   H HG2    . ARG A 1 17  ? -15.021 10.987  -26.402 1.00 0.00  ? 17  ARG A HG2    1  
ATOM   250   H HG3    . ARG A 1 17  ? -16.405 10.129  -27.079 1.00 0.00  ? 17  ARG A HG3    1  
ATOM   251   H HD2    . ARG A 1 17  ? -17.935 11.482  -26.004 1.00 0.00  ? 17  ARG A HD2    1  
ATOM   252   H HD3    . ARG A 1 17  ? -16.800 11.936  -24.737 1.00 0.00  ? 17  ARG A HD3    1  
ATOM   253   H HE     . ARG A 1 17  ? -15.680 13.064  -26.881 1.00 0.00  ? 17  ARG A HE     1  
ATOM   254   H HH11   . ARG A 1 17  ? -18.981 13.094  -25.742 1.00 0.00  ? 17  ARG A HH11   1  
ATOM   255   H HH12   . ARG A 1 17  ? -19.325 14.656  -26.404 1.00 0.00  ? 17  ARG A HH12   1  
ATOM   256   H HH21   . ARG A 1 17  ? -16.129 15.120  -27.744 1.00 0.00  ? 17  ARG A HH21   1  
ATOM   257   H HH22   . ARG A 1 17  ? -17.707 15.808  -27.538 1.00 0.00  ? 17  ARG A HH22   1  
ATOM   258   N N      . ARG A 1 18  ? -15.580 11.889  -22.476 1.00 0.00  ? 18  ARG A N      1  
ATOM   259   C CA     . ARG A 1 18  ? -16.337 12.614  -21.459 1.00 0.00  ? 18  ARG A CA     1  
ATOM   260   C C      . ARG A 1 18  ? -17.483 13.406  -22.082 1.00 0.00  ? 18  ARG A C      1  
ATOM   261   O O      . ARG A 1 18  ? -17.260 14.315  -22.884 1.00 0.00  ? 18  ARG A O      1  
ATOM   262   C CB     . ARG A 1 18  ? -15.417 13.552  -20.676 1.00 0.00  ? 18  ARG A CB     1  
ATOM   263   C CG     . ARG A 1 18  ? -16.127 14.310  -19.569 1.00 0.00  ? 18  ARG A CG     1  
ATOM   264   C CD     . ARG A 1 18  ? -15.139 15.017  -18.656 1.00 0.00  ? 18  ARG A CD     1  
ATOM   265   N NE     . ARG A 1 18  ? -14.528 16.176  -19.307 1.00 0.00  ? 18  ARG A NE     1  
ATOM   266   C CZ     . ARG A 1 18  ? -14.519 17.406  -18.796 1.00 0.00  ? 18  ARG A CZ     1  
ATOM   267   N NH1    . ARG A 1 18  ? -15.075 17.653  -17.614 1.00 0.00  ? 18  ARG A NH1    1  
ATOM   268   N NH2    . ARG A 1 18  ? -13.944 18.394  -19.467 1.00 0.00  ? 18  ARG A NH2    1  
ATOM   269   H H      . ARG A 1 18  ? -14.808 12.322  -22.896 1.00 0.00  ? 18  ARG A H      1  
ATOM   270   H HA     . ARG A 1 18  ? -16.752 11.884  -20.779 1.00 0.00  ? 18  ARG A HA     1  
ATOM   271   H HB2    . ARG A 1 18  ? -14.622 12.970  -20.232 1.00 0.00  ? 18  ARG A HB2    1  
ATOM   272   H HB3    . ARG A 1 18  ? -14.988 14.271  -21.359 1.00 0.00  ? 18  ARG A HB3    1  
ATOM   273   H HG2    . ARG A 1 18  ? -16.783 15.045  -20.012 1.00 0.00  ? 18  ARG A HG2    1  
ATOM   274   H HG3    . ARG A 1 18  ? -16.708 13.613  -18.983 1.00 0.00  ? 18  ARG A HG3    1  
ATOM   275   H HD2    . ARG A 1 18  ? -15.659 15.342  -17.770 1.00 0.00  ? 18  ARG A HD2    1  
ATOM   276   H HD3    . ARG A 1 18  ? -14.362 14.320  -18.381 1.00 0.00  ? 18  ARG A HD3    1  
ATOM   277   H HE     . ARG A 1 18  ? -14.101 16.030  -20.177 1.00 0.00  ? 18  ARG A HE     1  
ATOM   278   H HH11   . ARG A 1 18  ? -15.505 16.916  -17.097 1.00 0.00  ? 18  ARG A HH11   1  
ATOM   279   H HH12   . ARG A 1 18  ? -15.062 18.580  -17.242 1.00 0.00  ? 18  ARG A HH12   1  
ATOM   280   H HH21   . ARG A 1 18  ? -13.518 18.213  -20.354 1.00 0.00  ? 18  ARG A HH21   1  
ATOM   281   H HH22   . ARG A 1 18  ? -13.941 19.320  -19.090 1.00 0.00  ? 18  ARG A HH22   1  
ATOM   282   N N      . CYS A 1 19  ? -18.711 13.061  -21.705 1.00 0.00  ? 19  CYS A N      1  
ATOM   283   C CA     . CYS A 1 19  ? -19.893 13.744  -22.219 1.00 0.00  ? 19  CYS A CA     1  
ATOM   284   C C      . CYS A 1 19  ? -20.026 15.134  -21.601 1.00 0.00  ? 19  CYS A C      1  
ATOM   285   O O      . CYS A 1 19  ? -19.440 15.416  -20.557 1.00 0.00  ? 19  CYS A O      1  
ATOM   286   C CB     . CYS A 1 19  ? -21.151 12.920  -21.933 1.00 0.00  ? 19  CYS A CB     1  
ATOM   287   S SG     . CYS A 1 19  ? -21.921 12.212  -23.408 1.00 0.00  ? 19  CYS A SG     1  
ATOM   288   H H      . CYS A 1 19  ? -18.824 12.332  -21.059 1.00 0.00  ? 19  CYS A H      1  
ATOM   289   H HA     . CYS A 1 19  ? -19.777 13.848  -23.288 1.00 0.00  ? 19  CYS A HA     1  
ATOM   290   H HB2    . CYS A 1 19  ? -20.895 12.103  -21.274 1.00 0.00  ? 19  CYS A HB2    1  
ATOM   291   H HB3    . CYS A 1 19  ? -21.883 13.548  -21.448 1.00 0.00  ? 19  CYS A HB3    1  
ATOM   292   H HG     . CYS A 1 19  ? -21.422 12.512  -24.173 1.00 0.00  ? 19  CYS A HG     1  
ATOM   293   N N      . LEU A 1 20  ? -20.794 16.000  -22.258 1.00 0.00  ? 20  LEU A N      1  
ATOM   294   C CA     . LEU A 1 20  ? -20.996 17.362  -21.774 1.00 0.00  ? 20  LEU A CA     1  
ATOM   295   C C      . LEU A 1 20  ? -21.521 17.371  -20.338 1.00 0.00  ? 20  LEU A C      1  
ATOM   296   O O      . LEU A 1 20  ? -20.750 17.523  -19.391 1.00 0.00  ? 20  LEU A O      1  
ATOM   297   C CB     . LEU A 1 20  ? -21.957 18.117  -22.699 1.00 0.00  ? 20  LEU A CB     1  
ATOM   298   C CG     . LEU A 1 20  ? -22.194 19.583  -22.333 1.00 0.00  ? 20  LEU A CG     1  
ATOM   299   C CD1    . LEU A 1 20  ? -20.871 20.328  -22.226 1.00 0.00  ? 20  LEU A CD1    1  
ATOM   300   C CD2    . LEU A 1 20  ? -23.100 20.248  -23.358 1.00 0.00  ? 20  LEU A CD2    1  
ATOM   301   H H      . LEU A 1 20  ? -21.230 15.718  -23.087 1.00 0.00  ? 20  LEU A H      1  
ATOM   302   H HA     . LEU A 1 20  ? -20.036 17.859  -21.791 1.00 0.00  ? 20  LEU A HA     1  
ATOM   303   H HB2    . LEU A 1 20  ? -21.558 18.079  -23.703 1.00 0.00  ? 20  LEU A HB2    1  
ATOM   304   H HB3    . LEU A 1 20  ? -22.909 17.608  -22.690 1.00 0.00  ? 20  LEU A HB3    1  
ATOM   305   H HG     . LEU A 1 20  ? -22.682 19.634  -21.372 1.00 0.00  ? 20  LEU A HG     1  
ATOM   306   H HD11   . LEU A 1 20  ? -20.167 19.915  -22.936 1.00 0.00  ? 20  LEU A HD11   1  
ATOM   307   H HD12   . LEU A 1 20  ? -20.478 20.222  -21.227 1.00 0.00  ? 20  LEU A HD12   1  
ATOM   308   H HD13   . LEU A 1 20  ? -21.029 21.374  -22.444 1.00 0.00  ? 20  LEU A HD13   1  
ATOM   309   H HD21   . LEU A 1 20  ? -22.873 21.303  -23.410 1.00 0.00  ? 20  LEU A HD21   1  
ATOM   310   H HD22   . LEU A 1 20  ? -24.131 20.116  -23.067 1.00 0.00  ? 20  LEU A HD22   1  
ATOM   311   H HD23   . LEU A 1 20  ? -22.938 19.797  -24.328 1.00 0.00  ? 20  LEU A HD23   1  
ATOM   312   N N      . ILE A 1 21  ? -22.834 17.206  -20.179 1.00 0.00  ? 21  ILE A N      1  
ATOM   313   C CA     . ILE A 1 21  ? -23.446 17.194  -18.854 1.00 0.00  ? 21  ILE A CA     1  
ATOM   314   C C      . ILE A 1 21  ? -23.961 15.802  -18.491 1.00 0.00  ? 21  ILE A C      1  
ATOM   315   O O      . ILE A 1 21  ? -24.246 14.988  -19.369 1.00 0.00  ? 21  ILE A O      1  
ATOM   316   C CB     . ILE A 1 21  ? -24.610 18.204  -18.750 1.00 0.00  ? 21  ILE A CB     1  
ATOM   317   C CG1    . ILE A 1 21  ? -25.615 17.999  -19.888 1.00 0.00  ? 21  ILE A CG1    1  
ATOM   318   C CG2    . ILE A 1 21  ? -24.077 19.629  -18.760 1.00 0.00  ? 21  ILE A CG2    1  
ATOM   319   C CD1    . ILE A 1 21  ? -26.658 16.946  -19.588 1.00 0.00  ? 21  ILE A CD1    1  
ATOM   320   H H      . ILE A 1 21  ? -23.398 17.086  -20.968 1.00 0.00  ? 21  ILE A H      1  
ATOM   321   H HA     . ILE A 1 21  ? -22.689 17.481  -18.140 1.00 0.00  ? 21  ILE A HA     1  
ATOM   322   H HB     . ILE A 1 21  ? -25.110 18.044  -17.806 1.00 0.00  ? 21  ILE A HB     1  
ATOM   323   H HG12   . ILE A 1 21  ? -26.130 18.930  -20.074 1.00 0.00  ? 21  ILE A HG12   1  
ATOM   324   H HG13   . ILE A 1 21  ? -25.087 17.701  -20.779 1.00 0.00  ? 21  ILE A HG13   1  
ATOM   325   H HG21   . ILE A 1 21  ? -23.790 19.900  -19.764 1.00 0.00  ? 21  ILE A HG21   1  
ATOM   326   H HG22   . ILE A 1 21  ? -23.218 19.696  -18.108 1.00 0.00  ? 21  ILE A HG22   1  
ATOM   327   H HG23   . ILE A 1 21  ? -24.846 20.302  -18.410 1.00 0.00  ? 21  ILE A HG23   1  
ATOM   328   H HD11   . ILE A 1 21  ? -27.078 17.122  -18.609 1.00 0.00  ? 21  ILE A HD11   1  
ATOM   329   H HD12   . ILE A 1 21  ? -26.199 15.968  -19.612 1.00 0.00  ? 21  ILE A HD12   1  
ATOM   330   H HD13   . ILE A 1 21  ? -27.442 16.993  -20.330 1.00 0.00  ? 21  ILE A HD13   1  
ATOM   331   N N      . PRO A 1 22  ? -24.089 15.511  -17.183 1.00 0.00  ? 22  PRO A N      1  
ATOM   332   C CA     . PRO A 1 22  ? -24.574 14.212  -16.704 1.00 0.00  ? 22  PRO A CA     1  
ATOM   333   C C      . PRO A 1 22  ? -26.030 13.967  -17.082 1.00 0.00  ? 22  PRO A C      1  
ATOM   334   O O      . PRO A 1 22  ? -26.784 14.907  -17.334 1.00 0.00  ? 22  PRO A O      1  
ATOM   335   C CB     . PRO A 1 22  ? -24.431 14.302  -15.176 1.00 0.00  ? 22  PRO A CB     1  
ATOM   336   C CG     . PRO A 1 22  ? -23.544 15.475  -14.928 1.00 0.00  ? 22  PRO A CG     1  
ATOM   337   C CD     . PRO A 1 22  ? -23.773 16.419  -16.072 1.00 0.00  ? 22  PRO A CD     1  
ATOM   338   H HA     . PRO A 1 22  ? -23.967 13.401  -17.078 1.00 0.00  ? 22  PRO A HA     1  
ATOM   339   H HB2    . PRO A 1 22  ? -25.405 14.446  -14.731 1.00 0.00  ? 22  PRO A HB2    1  
ATOM   340   H HB3    . PRO A 1 22  ? -23.991 13.390  -14.802 1.00 0.00  ? 22  PRO A HB3    1  
ATOM   341   H HG2    . PRO A 1 22  ? -23.809 15.945  -13.993 1.00 0.00  ? 22  PRO A HG2    1  
ATOM   342   H HG3    . PRO A 1 22  ? -22.511 15.155  -14.907 1.00 0.00  ? 22  PRO A HG3    1  
ATOM   343   H HD2    . PRO A 1 22  ? -24.603 17.077  -15.858 1.00 0.00  ? 22  PRO A HD2    1  
ATOM   344   H HD3    . PRO A 1 22  ? -22.878 16.986  -16.277 1.00 0.00  ? 22  PRO A HD3    1  
ATOM   345   N N      . LYS A 1 23  ? -26.422 12.697  -17.118 1.00 0.00  ? 23  LYS A N      1  
ATOM   346   C CA     . LYS A 1 23  ? -27.790 12.328  -17.463 1.00 0.00  ? 23  LYS A CA     1  
ATOM   347   C C      . LYS A 1 23  ? -28.559 11.872  -16.227 1.00 0.00  ? 23  LYS A C      1  
ATOM   348   O O      . LYS A 1 23  ? -29.355 12.624  -15.666 1.00 0.00  ? 23  LYS A O      1  
ATOM   349   C CB     . LYS A 1 23  ? -27.795 11.222  -18.520 1.00 0.00  ? 23  LYS A CB     1  
ATOM   350   C CG     . LYS A 1 23  ? -27.330 11.687  -19.891 1.00 0.00  ? 23  LYS A CG     1  
ATOM   351   C CD     . LYS A 1 23  ? -28.261 12.743  -20.469 1.00 0.00  ? 23  LYS A CD     1  
ATOM   352   C CE     . LYS A 1 23  ? -27.498 13.977  -20.922 1.00 0.00  ? 23  LYS A CE     1  
ATOM   353   N NZ     . LYS A 1 23  ? -27.966 14.466  -22.247 1.00 0.00  ? 23  LYS A NZ     1  
ATOM   354   H H      . LYS A 1 23  ? -25.776 11.990  -16.906 1.00 0.00  ? 23  LYS A H      1  
ATOM   355   H HA     . LYS A 1 23  ? -28.275 13.201  -17.869 1.00 0.00  ? 23  LYS A HA     1  
ATOM   356   H HB2    . LYS A 1 23  ? -27.141 10.425  -18.195 1.00 0.00  ? 23  LYS A HB2    1  
ATOM   357   H HB3    . LYS A 1 23  ? -28.798 10.834  -18.616 1.00 0.00  ? 23  LYS A HB3    1  
ATOM   358   H HG2    . LYS A 1 23  ? -26.340 12.105  -19.802 1.00 0.00  ? 23  LYS A HG2    1  
ATOM   359   H HG3    . LYS A 1 23  ? -27.305 10.838  -20.560 1.00 0.00  ? 23  LYS A HG3    1  
ATOM   360   H HD2    . LYS A 1 23  ? -28.781 12.325  -21.318 1.00 0.00  ? 23  LYS A HD2    1  
ATOM   361   H HD3    . LYS A 1 23  ? -28.977 13.034  -19.713 1.00 0.00  ? 23  LYS A HD3    1  
ATOM   362   H HE2    . LYS A 1 23  ? -27.639 14.758  -20.189 1.00 0.00  ? 23  LYS A HE2    1  
ATOM   363   H HE3    . LYS A 1 23  ? -26.448 13.731  -20.987 1.00 0.00  ? 23  LYS A HE3    1  
ATOM   364   H HZ1    . LYS A 1 23  ? -27.898 13.705  -22.954 1.00 0.00  ? 23  LYS A HZ1    1  
ATOM   365   H HZ2    . LYS A 1 23  ? -27.382 15.265  -22.560 1.00 0.00  ? 23  LYS A HZ2    1  
ATOM   366   H HZ3    . LYS A 1 23  ? -28.956 14.778  -22.183 1.00 0.00  ? 23  LYS A HZ3    1  
ATOM   367   N N      . VAL A 1 24  ? -28.313 10.636  -15.809 1.00 0.00  ? 24  VAL A N      1  
ATOM   368   C CA     . VAL A 1 24  ? -28.979 10.073  -14.639 1.00 0.00  ? 24  VAL A CA     1  
ATOM   369   C C      . VAL A 1 24  ? -28.150 10.278  -13.372 1.00 0.00  ? 24  VAL A C      1  
ATOM   370   O O      . VAL A 1 24  ? -28.431 9.678   -12.335 1.00 0.00  ? 24  VAL A O      1  
ATOM   371   C CB     . VAL A 1 24  ? -29.260 8.570   -14.819 1.00 0.00  ? 24  VAL A CB     1  
ATOM   372   C CG1    . VAL A 1 24  ? -30.136 8.049   -13.690 1.00 0.00  ? 24  VAL A CG1    1  
ATOM   373   C CG2    . VAL A 1 24  ? -29.907 8.301   -16.171 1.00 0.00  ? 24  VAL A CG2    1  
ATOM   374   H H      . VAL A 1 24  ? -27.668 10.087  -16.299 1.00 0.00  ? 24  VAL A H      1  
ATOM   375   H HA     . VAL A 1 24  ? -29.927 10.582  -14.521 1.00 0.00  ? 24  VAL A HA     1  
ATOM   376   H HB     . VAL A 1 24  ? -28.317 8.043   -14.785 1.00 0.00  ? 24  VAL A HB     1  
ATOM   377   H HG11   . VAL A 1 24  ? -30.726 8.860   -13.290 1.00 0.00  ? 24  VAL A HG11   1  
ATOM   378   H HG12   . VAL A 1 24  ? -29.512 7.638   -12.910 1.00 0.00  ? 24  VAL A HG12   1  
ATOM   379   H HG13   . VAL A 1 24  ? -30.791 7.280   -14.068 1.00 0.00  ? 24  VAL A HG13   1  
ATOM   380   H HG21   . VAL A 1 24  ? -30.978 8.398   -16.083 1.00 0.00  ? 24  VAL A HG21   1  
ATOM   381   H HG22   . VAL A 1 24  ? -29.663 7.300   -16.492 1.00 0.00  ? 24  VAL A HG22   1  
ATOM   382   H HG23   . VAL A 1 24  ? -29.539 9.011   -16.897 1.00 0.00  ? 24  VAL A HG23   1  
ATOM   383   N N      . ASP A 1 25  ? -27.129 11.126  -13.459 1.00 0.00  ? 25  ASP A N      1  
ATOM   384   C CA     . ASP A 1 25  ? -26.263 11.404  -12.317 1.00 0.00  ? 25  ASP A CA     1  
ATOM   385   C C      . ASP A 1 25  ? -25.467 10.162  -11.908 1.00 0.00  ? 25  ASP A C      1  
ATOM   386   O O      . ASP A 1 25  ? -24.897 10.116  -10.818 1.00 0.00  ? 25  ASP A O      1  
ATOM   387   C CB     . ASP A 1 25  ? -27.090 11.910  -11.131 1.00 0.00  ? 25  ASP A CB     1  
ATOM   388   C CG     . ASP A 1 25  ? -26.480 13.140  -10.486 1.00 0.00  ? 25  ASP A CG     1  
ATOM   389   O OD1    . ASP A 1 25  ? -25.249 13.155  -10.282 1.00 0.00  ? 25  ASP A OD1    1  
ATOM   390   O OD2    . ASP A 1 25  ? -27.238 14.086  -10.182 1.00 0.00  ? 25  ASP A OD2    1  
ATOM   391   H H      . ASP A 1 25  ? -26.951 11.577  -14.311 1.00 0.00  ? 25  ASP A H      1  
ATOM   392   H HA     . ASP A 1 25  ? -25.569 12.175  -12.613 1.00 0.00  ? 25  ASP A HA     1  
ATOM   393   H HB2    . ASP A 1 25  ? -28.082 12.162  -11.473 1.00 0.00  ? 25  ASP A HB2    1  
ATOM   394   H HB3    . ASP A 1 25  ? -27.158 11.131  -10.386 1.00 0.00  ? 25  ASP A HB3    1  
ATOM   395   H HD2    . ASP A 1 25  ? -26.787 14.831  -9.779  1.00 0.00  ? 25  ASP A HD2    1  
ATOM   396   N N      . ASN A 1 26  ? -25.431 9.162   -12.785 1.00 0.00  ? 26  ASN A N      1  
ATOM   397   C CA     . ASN A 1 26  ? -24.698 7.933   -12.508 1.00 0.00  ? 26  ASN A CA     1  
ATOM   398   C C      . ASN A 1 26  ? -23.487 7.814   -13.425 1.00 0.00  ? 26  ASN A C      1  
ATOM   399   O O      . ASN A 1 26  ? -22.351 8.033   -13.005 1.00 0.00  ? 26  ASN A O      1  
ATOM   400   C CB     . ASN A 1 26  ? -25.610 6.715   -12.672 1.00 0.00  ? 26  ASN A CB     1  
ATOM   401   C CG     . ASN A 1 26  ? -25.446 5.714   -11.544 1.00 0.00  ? 26  ASN A CG     1  
ATOM   402   O OD1    . ASN A 1 26  ? -24.332 5.302   -11.222 1.00 0.00  ? 26  ASN A OD1    1  
ATOM   403   N ND2    . ASN A 1 26  ? -26.560 5.316   -10.940 1.00 0.00  ? 26  ASN A ND2    1  
ATOM   404   H H      . ASN A 1 26  ? -25.899 9.255   -13.640 1.00 0.00  ? 26  ASN A H      1  
ATOM   405   H HA     . ASN A 1 26  ? -24.353 7.976   -11.488 1.00 0.00  ? 26  ASN A HA     1  
ATOM   406   H HB2    . ASN A 1 26  ? -26.638 7.043   -12.689 1.00 0.00  ? 26  ASN A HB2    1  
ATOM   407   H HB3    . ASN A 1 26  ? -25.380 6.219   -13.603 1.00 0.00  ? 26  ASN A HB3    1  
ATOM   408   H HD21   . ASN A 1 26  ? -27.414 5.686   -11.251 1.00 0.00  ? 26  ASN A HD21   1  
ATOM   409   H HD22   . ASN A 1 26  ? -26.483 4.668   -10.209 1.00 0.00  ? 26  ASN A HD22   1  
ATOM   410   N N      . ASN A 1 27  ? -23.739 7.478   -14.684 1.00 0.00  ? 27  ASN A N      1  
ATOM   411   C CA     . ASN A 1 27  ? -22.671 7.345   -15.668 1.00 0.00  ? 27  ASN A CA     1  
ATOM   412   C C      . ASN A 1 27  ? -22.399 8.682   -16.344 1.00 0.00  ? 27  ASN A C      1  
ATOM   413   O O      . ASN A 1 27  ? -23.093 9.669   -16.091 1.00 0.00  ? 27  ASN A O      1  
ATOM   414   C CB     . ASN A 1 27  ? -23.035 6.292   -16.717 1.00 0.00  ? 27  ASN A CB     1  
ATOM   415   C CG     . ASN A 1 27  ? -23.190 4.907   -16.118 1.00 0.00  ? 27  ASN A CG     1  
ATOM   416   O OD1    . ASN A 1 27  ? -24.228 4.574   -15.549 1.00 0.00  ? 27  ASN A OD1    1  
ATOM   417   N ND2    . ASN A 1 27  ? -22.150 4.091   -16.245 1.00 0.00  ? 27  ASN A ND2    1  
ATOM   418   H H      . ASN A 1 27  ? -24.665 7.327   -14.959 1.00 0.00  ? 27  ASN A H      1  
ATOM   419   H HA     . ASN A 1 27  ? -21.779 7.030   -15.148 1.00 0.00  ? 27  ASN A HA     1  
ATOM   420   H HB2    . ASN A 1 27  ? -23.969 6.566   -17.184 1.00 0.00  ? 27  ASN A HB2    1  
ATOM   421   H HB3    . ASN A 1 27  ? -22.259 6.257   -17.466 1.00 0.00  ? 27  ASN A HB3    1  
ATOM   422   H HD21   . ASN A 1 27  ? -21.354 4.422   -16.711 1.00 0.00  ? 27  ASN A HD21   1  
ATOM   423   H HD22   . ASN A 1 27  ? -22.220 3.188   -15.867 1.00 0.00  ? 27  ASN A HD22   1  
ATOM   424   N N      . ALA A 1 28  ? -21.389 8.716   -17.206 1.00 0.00  ? 28  ALA A N      1  
ATOM   425   C CA     . ALA A 1 28  ? -21.033 9.941   -17.915 1.00 0.00  ? 28  ALA A CA     1  
ATOM   426   C C      . ALA A 1 28  ? -19.804 9.734   -18.787 1.00 0.00  ? 28  ALA A C      1  
ATOM   427   O O      . ALA A 1 28  ? -19.704 10.289  -19.881 1.00 0.00  ? 28  ALA A O      1  
ATOM   428   C CB     . ALA A 1 28  ? -20.787 11.073  -16.925 1.00 0.00  ? 28  ALA A CB     1  
ATOM   429   H H      . ALA A 1 28  ? -20.870 7.901   -17.369 1.00 0.00  ? 28  ALA A H      1  
ATOM   430   H HA     . ALA A 1 28  ? -21.866 10.218  -18.542 1.00 0.00  ? 28  ALA A HA     1  
ATOM   431   H HB1    . ALA A 1 28  ? -21.355 11.942  -17.223 1.00 0.00  ? 28  ALA A HB1    1  
ATOM   432   H HB2    . ALA A 1 28  ? -19.734 11.319  -16.913 1.00 0.00  ? 28  ALA A HB2    1  
ATOM   433   H HB3    . ALA A 1 28  ? -21.095 10.764  -15.938 1.00 0.00  ? 28  ALA A HB3    1  
ATOM   434   N N      . ILE A 1 29  ? -18.861 8.942   -18.288 1.00 0.00  ? 29  ILE A N      1  
ATOM   435   C CA     . ILE A 1 29  ? -17.629 8.676   -19.014 1.00 0.00  ? 29  ILE A CA     1  
ATOM   436   C C      . ILE A 1 29  ? -17.613 7.271   -19.610 1.00 0.00  ? 29  ILE A C      1  
ATOM   437   O O      . ILE A 1 29  ? -18.183 6.333   -19.053 1.00 0.00  ? 29  ILE A O      1  
ATOM   438   C CB     . ILE A 1 29  ? -16.402 8.866   -18.098 1.00 0.00  ? 29  ILE A CB     1  
ATOM   439   C CG1    . ILE A 1 29  ? -16.426 10.262  -17.479 1.00 0.00  ? 29  ILE A CG1    1  
ATOM   440   C CG2    . ILE A 1 29  ? -15.111 8.654   -18.875 1.00 0.00  ? 29  ILE A CG2    1  
ATOM   441   C CD1    . ILE A 1 29  ? -16.019 10.290  -16.023 1.00 0.00  ? 29  ILE A CD1    1  
ATOM   442   H H      . ILE A 1 29  ? -18.993 8.539   -17.404 1.00 0.00  ? 29  ILE A H      1  
ATOM   443   H HA     . ILE A 1 29  ? -17.559 9.394   -19.818 1.00 0.00  ? 29  ILE A HA     1  
ATOM   444   H HB     . ILE A 1 29  ? -16.445 8.128   -17.312 1.00 0.00  ? 29  ILE A HB     1  
ATOM   445   H HG12   . ILE A 1 29  ? -15.747 10.901  -18.024 1.00 0.00  ? 29  ILE A HG12   1  
ATOM   446   H HG13   . ILE A 1 29  ? -17.426 10.660  -17.556 1.00 0.00  ? 29  ILE A HG13   1  
ATOM   447   H HG21   . ILE A 1 29  ? -14.711 7.675   -18.646 1.00 0.00  ? 29  ILE A HG21   1  
ATOM   448   H HG22   . ILE A 1 29  ? -14.394 9.411   -18.591 1.00 0.00  ? 29  ILE A HG22   1  
ATOM   449   H HG23   . ILE A 1 29  ? -15.311 8.726   -19.932 1.00 0.00  ? 29  ILE A HG23   1  
ATOM   450   H HD11   . ILE A 1 29  ? -15.019 10.692  -15.938 1.00 0.00  ? 29  ILE A HD11   1  
ATOM   451   H HD12   . ILE A 1 29  ? -16.040 9.287   -15.624 1.00 0.00  ? 29  ILE A HD12   1  
ATOM   452   H HD13   . ILE A 1 29  ? -16.706 10.913  -15.468 1.00 0.00  ? 29  ILE A HD13   1  
ATOM   453   N N      . GLU A 1 30  ? -16.948 7.147   -20.752 1.00 0.00  ? 30  GLU A N      1  
ATOM   454   C CA     . GLU A 1 30  ? -16.831 5.874   -21.457 1.00 0.00  ? 30  GLU A CA     1  
ATOM   455   C C      . GLU A 1 30  ? -15.361 5.515   -21.637 1.00 0.00  ? 30  GLU A C      1  
ATOM   456   O O      . GLU A 1 30  ? -14.487 6.308   -21.304 1.00 0.00  ? 30  GLU A O      1  
ATOM   457   C CB     . GLU A 1 30  ? -17.523 5.952   -22.819 1.00 0.00  ? 30  GLU A CB     1  
ATOM   458   C CG     . GLU A 1 30  ? -18.879 5.265   -22.850 1.00 0.00  ? 30  GLU A CG     1  
ATOM   459   C CD     . GLU A 1 30  ? -19.585 5.426   -24.183 1.00 0.00  ? 30  GLU A CD     1  
ATOM   460   O OE1    . GLU A 1 30  ? -18.947 5.916   -25.139 1.00 0.00  ? 30  GLU A OE1    1  
ATOM   461   O OE2    . GLU A 1 30  ? -20.777 5.063   -24.270 1.00 0.00  ? 30  GLU A OE2    1  
ATOM   462   H H      . GLU A 1 30  ? -16.518 7.939   -21.134 1.00 0.00  ? 30  GLU A H      1  
ATOM   463   H HA     . GLU A 1 30  ? -17.308 5.114   -20.857 1.00 0.00  ? 30  GLU A HA     1  
ATOM   464   H HB2    . GLU A 1 30  ? -17.665 6.990   -23.080 1.00 0.00  ? 30  GLU A HB2    1  
ATOM   465   H HB3    . GLU A 1 30  ? -16.891 5.487   -23.561 1.00 0.00  ? 30  GLU A HB3    1  
ATOM   466   H HG2    . GLU A 1 30  ? -18.738 4.211   -22.660 1.00 0.00  ? 30  GLU A HG2    1  
ATOM   467   H HG3    . GLU A 1 30  ? -19.501 5.690   -22.076 1.00 0.00  ? 30  GLU A HG3    1  
ATOM   468   H HE2    . GLU A 1 30  ? -21.161 5.193   -25.140 1.00 0.00  ? 30  GLU A HE2    1  
ATOM   469   N N      . PHE A 1 31  ? -15.088 4.318   -22.151 1.00 0.00  ? 31  PHE A N      1  
ATOM   470   C CA     . PHE A 1 31  ? -13.712 3.878   -22.357 1.00 0.00  ? 31  PHE A CA     1  
ATOM   471   C C      . PHE A 1 31  ? -13.554 3.153   -23.692 1.00 0.00  ? 31  PHE A C      1  
ATOM   472   O O      . PHE A 1 31  ? -14.353 2.281   -24.030 1.00 0.00  ? 31  PHE A O      1  
ATOM   473   C CB     . PHE A 1 31  ? -13.270 2.953   -21.218 1.00 0.00  ? 31  PHE A CB     1  
ATOM   474   C CG     . PHE A 1 31  ? -13.194 3.628   -19.878 1.00 0.00  ? 31  PHE A CG     1  
ATOM   475   C CD1    . PHE A 1 31  ? -12.453 4.785   -19.712 1.00 0.00  ? 31  PHE A CD1    1  
ATOM   476   C CD2    . PHE A 1 31  ? -13.862 3.102   -18.784 1.00 0.00  ? 31  PHE A CD2    1  
ATOM   477   C CE1    . PHE A 1 31  ? -12.381 5.412   -18.481 1.00 0.00  ? 31  PHE A CE1    1  
ATOM   478   C CE2    . PHE A 1 31  ? -13.794 3.720   -17.549 1.00 0.00  ? 31  PHE A CE2    1  
ATOM   479   C CZ     . PHE A 1 31  ? -13.053 4.878   -17.399 1.00 0.00  ? 31  PHE A CZ     1  
ATOM   480   H H      . PHE A 1 31  ? -15.826 3.719   -22.390 1.00 0.00  ? 31  PHE A H      1  
ATOM   481   H HA     . PHE A 1 31  ? -13.084 4.754   -22.361 1.00 0.00  ? 31  PHE A HA     1  
ATOM   482   H HB2    . PHE A 1 31  ? -13.972 2.135   -21.137 1.00 0.00  ? 31  PHE A HB2    1  
ATOM   483   H HB3    . PHE A 1 31  ? -12.291 2.555   -21.447 1.00 0.00  ? 31  PHE A HB3    1  
ATOM   484   H HD1    . PHE A 1 31  ? -11.930 5.202   -20.556 1.00 0.00  ? 31  PHE A HD1    1  
ATOM   485   H HD2    . PHE A 1 31  ? -14.442 2.198   -18.900 1.00 0.00  ? 31  PHE A HD2    1  
ATOM   486   H HE1    . PHE A 1 31  ? -11.799 6.316   -18.365 1.00 0.00  ? 31  PHE A HE1    1  
ATOM   487   H HE2    . PHE A 1 31  ? -14.318 3.300   -16.706 1.00 0.00  ? 31  PHE A HE2    1  
ATOM   488   H HZ     . PHE A 1 31  ? -13.002 5.364   -16.434 1.00 0.00  ? 31  PHE A HZ     1  
ATOM   489   N N      . LEU A 1 32  ? -12.510 3.508   -24.444 1.00 0.00  ? 32  LEU A N      1  
ATOM   490   C CA     . LEU A 1 32  ? -12.252 2.870   -25.732 1.00 0.00  ? 32  LEU A CA     1  
ATOM   491   C C      . LEU A 1 32  ? -11.640 1.491   -25.520 1.00 0.00  ? 32  LEU A C      1  
ATOM   492   O O      . LEU A 1 32  ? -10.712 1.331   -24.726 1.00 0.00  ? 32  LEU A O      1  
ATOM   493   C CB     . LEU A 1 32  ? -11.316 3.720   -26.602 1.00 0.00  ? 32  LEU A CB     1  
ATOM   494   C CG     . LEU A 1 32  ? -10.913 3.073   -27.931 1.00 0.00  ? 32  LEU A CG     1  
ATOM   495   C CD1    . LEU A 1 32  ? -12.145 2.691   -28.737 1.00 0.00  ? 32  LEU A CD1    1  
ATOM   496   C CD2    . LEU A 1 32  ? -10.018 4.001   -28.736 1.00 0.00  ? 32  LEU A CD2    1  
ATOM   497   H H      . LEU A 1 32  ? -11.899 4.202   -24.120 1.00 0.00  ? 32  LEU A H      1  
ATOM   498   H HA     . LEU A 1 32  ? -13.199 2.756   -26.237 1.00 0.00  ? 32  LEU A HA     1  
ATOM   499   H HB2    . LEU A 1 32  ? -11.800 4.659   -26.816 1.00 0.00  ? 32  LEU A HB2    1  
ATOM   500   H HB3    . LEU A 1 32  ? -10.420 3.923   -26.042 1.00 0.00  ? 32  LEU A HB3    1  
ATOM   501   H HG     . LEU A 1 32  ? -10.357 2.167   -27.727 1.00 0.00  ? 32  LEU A HG     1  
ATOM   502   H HD11   . LEU A 1 32  ? -12.110 1.639   -28.974 1.00 0.00  ? 32  LEU A HD11   1  
ATOM   503   H HD12   . LEU A 1 32  ? -12.166 3.266   -29.652 1.00 0.00  ? 32  LEU A HD12   1  
ATOM   504   H HD13   . LEU A 1 32  ? -13.034 2.902   -28.163 1.00 0.00  ? 32  LEU A HD13   1  
ATOM   505   H HD21   . LEU A 1 32  ? -10.280 3.938   -29.782 1.00 0.00  ? 32  LEU A HD21   1  
ATOM   506   H HD22   . LEU A 1 32  ? -8.985  3.707   -28.606 1.00 0.00  ? 32  LEU A HD22   1  
ATOM   507   H HD23   . LEU A 1 32  ? -10.149 5.017   -28.390 1.00 0.00  ? 32  LEU A HD23   1  
ATOM   508   N N      . LEU A 1 33  ? -12.161 0.496   -26.229 1.00 0.00  ? 33  LEU A N      1  
ATOM   509   C CA     . LEU A 1 33  ? -11.658 -0.866  -26.107 1.00 0.00  ? 33  LEU A CA     1  
ATOM   510   C C      . LEU A 1 33  ? -11.434 -1.491  -27.479 1.00 0.00  ? 33  LEU A C      1  
ATOM   511   O O      . LEU A 1 33  ? -12.182 -1.234  -28.422 1.00 0.00  ? 33  LEU A O      1  
ATOM   512   C CB     . LEU A 1 33  ? -12.634 -1.716  -25.289 1.00 0.00  ? 33  LEU A CB     1  
ATOM   513   C CG     . LEU A 1 33  ? -12.354 -1.746  -23.785 1.00 0.00  ? 33  LEU A CG     1  
ATOM   514   C CD1    . LEU A 1 33  ? -13.621 -2.080  -23.013 1.00 0.00  ? 33  LEU A CD1    1  
ATOM   515   C CD2    . LEU A 1 33  ? -11.249 -2.746  -23.464 1.00 0.00  ? 33  LEU A CD2    1  
ATOM   516   H H      . LEU A 1 33  ? -12.900 0.682   -26.844 1.00 0.00  ? 33  LEU A H      1  
ATOM   517   H HA     . LEU A 1 33  ? -10.713 -0.820  -25.588 1.00 0.00  ? 33  LEU A HA     1  
ATOM   518   H HB2    . LEU A 1 33  ? -13.631 -1.329  -25.441 1.00 0.00  ? 33  LEU A HB2    1  
ATOM   519   H HB3    . LEU A 1 33  ? -12.599 -2.729  -25.658 1.00 0.00  ? 33  LEU A HB3    1  
ATOM   520   H HG     . LEU A 1 33  ? -12.021 -0.766  -23.469 1.00 0.00  ? 33  LEU A HG     1  
ATOM   521   H HD11   . LEU A 1 33  ? -13.365 -2.636  -22.124 1.00 0.00  ? 33  LEU A HD11   1  
ATOM   522   H HD12   . LEU A 1 33  ? -14.275 -2.675  -23.634 1.00 0.00  ? 33  LEU A HD12   1  
ATOM   523   H HD13   . LEU A 1 33  ? -14.123 -1.166  -22.734 1.00 0.00  ? 33  LEU A HD13   1  
ATOM   524   H HD21   . LEU A 1 33  ? -10.967 -3.273  -24.363 1.00 0.00  ? 33  LEU A HD21   1  
ATOM   525   H HD22   . LEU A 1 33  ? -11.605 -3.454  -22.728 1.00 0.00  ? 33  LEU A HD22   1  
ATOM   526   H HD23   . LEU A 1 33  ? -10.393 -2.220  -23.070 1.00 0.00  ? 33  LEU A HD23   1  
ATOM   527   N N      . LEU A 1 34  ? -10.392 -2.311  -27.580 1.00 0.00  ? 34  LEU A N      1  
ATOM   528   C CA     . LEU A 1 34  ? -10.059 -2.977  -28.836 1.00 0.00  ? 34  LEU A CA     1  
ATOM   529   C C      . LEU A 1 34  ? -10.022 -4.494  -28.658 1.00 0.00  ? 34  LEU A C      1  
ATOM   530   O O      . LEU A 1 34  ? -9.198  -5.018  -27.911 1.00 0.00  ? 34  LEU A O      1  
ATOM   531   C CB     . LEU A 1 34  ? -8.708  -2.477  -29.351 1.00 0.00  ? 34  LEU A CB     1  
ATOM   532   C CG     . LEU A 1 34  ? -8.584  -0.957  -29.472 1.00 0.00  ? 34  LEU A CG     1  
ATOM   533   C CD1    . LEU A 1 34  ? -7.229  -0.577  -30.048 1.00 0.00  ? 34  LEU A CD1    1  
ATOM   534   C CD2    . LEU A 1 34  ? -9.707  -0.393  -30.331 1.00 0.00  ? 34  LEU A CD2    1  
ATOM   535   H H      . LEU A 1 34  ? -9.833  -2.472  -26.792 1.00 0.00  ? 34  LEU A H      1  
ATOM   536   H HA     . LEU A 1 34  ? -10.823 -2.727  -29.556 1.00 0.00  ? 34  LEU A HA     1  
ATOM   537   H HB2    . LEU A 1 34  ? -7.936  -2.829  -28.680 1.00 0.00  ? 34  LEU A HB2    1  
ATOM   538   H HB3    . LEU A 1 34  ? -8.538  -2.908  -30.325 1.00 0.00  ? 34  LEU A HB3    1  
ATOM   539   H HG     . LEU A 1 34  ? -8.662  -0.516  -28.487 1.00 0.00  ? 34  LEU A HG     1  
ATOM   540   H HD11   . LEU A 1 34  ? -6.457  -0.795  -29.325 1.00 0.00  ? 34  LEU A HD11   1  
ATOM   541   H HD12   . LEU A 1 34  ? -7.221  0.480   -30.276 1.00 0.00  ? 34  LEU A HD12   1  
ATOM   542   H HD13   . LEU A 1 34  ? -7.051  -1.142  -30.949 1.00 0.00  ? 34  LEU A HD13   1  
ATOM   543   H HD21   . LEU A 1 34  ? -10.442 0.079   -29.695 1.00 0.00  ? 34  LEU A HD21   1  
ATOM   544   H HD22   . LEU A 1 34  ? -10.172 -1.193  -30.888 1.00 0.00  ? 34  LEU A HD22   1  
ATOM   545   H HD23   . LEU A 1 34  ? -9.304  0.337   -31.018 1.00 0.00  ? 34  LEU A HD23   1  
ATOM   546   N N      . GLN A 1 35  ? -10.918 -5.192  -29.349 1.00 0.00  ? 35  GLN A N      1  
ATOM   547   C CA     . GLN A 1 35  ? -10.984 -6.649  -29.263 1.00 0.00  ? 35  GLN A CA     1  
ATOM   548   C C      . GLN A 1 35  ? -9.836  -7.299  -30.029 1.00 0.00  ? 35  GLN A C      1  
ATOM   549   O O      . GLN A 1 35  ? -9.565  -6.946  -31.177 1.00 0.00  ? 35  GLN A O      1  
ATOM   550   C CB     . GLN A 1 35  ? -12.318 -7.159  -29.809 1.00 0.00  ? 35  GLN A CB     1  
ATOM   551   C CG     . GLN A 1 35  ? -12.655 -8.577  -29.375 1.00 0.00  ? 35  GLN A CG     1  
ATOM   552   C CD     . GLN A 1 35  ? -13.736 -9.210  -30.229 1.00 0.00  ? 35  GLN A CD     1  
ATOM   553   O OE1    . GLN A 1 35  ? -14.926 -9.042  -29.968 1.00 0.00  ? 35  GLN A OE1    1  
ATOM   554   N NE2    . GLN A 1 35  ? -13.324 -9.944  -31.257 1.00 0.00  ? 35  GLN A NE2    1  
ATOM   555   H H      . GLN A 1 35  ? -11.552 -4.716  -29.929 1.00 0.00  ? 35  GLN A H      1  
ATOM   556   H HA     . GLN A 1 35  ? -10.904 -6.924  -28.221 1.00 0.00  ? 35  GLN A HA     1  
ATOM   557   H HB2    . GLN A 1 35  ? -13.105 -6.505  -29.468 1.00 0.00  ? 35  GLN A HB2    1  
ATOM   558   H HB3    . GLN A 1 35  ? -12.284 -7.135  -30.888 1.00 0.00  ? 35  GLN A HB3    1  
ATOM   559   H HG2    . GLN A 1 35  ? -11.762 -9.181  -29.443 1.00 0.00  ? 35  GLN A HG2    1  
ATOM   560   H HG3    . GLN A 1 35  ? -12.994 -8.553  -28.349 1.00 0.00  ? 35  GLN A HG3    1  
ATOM   561   H HE21   . GLN A 1 35  ? -12.359 -10.036 -31.405 1.00 0.00  ? 35  GLN A HE21   1  
ATOM   562   H HE22   . GLN A 1 35  ? -14.002 -10.366 -31.824 1.00 0.00  ? 35  GLN A HE22   1  
ATOM   563   N N      . ALA A 1 36  ? -9.171  -8.256  -29.387 1.00 0.00  ? 36  ALA A N      1  
ATOM   564   C CA     . ALA A 1 36  ? -8.057  -8.963  -30.011 1.00 0.00  ? 36  ALA A CA     1  
ATOM   565   C C      . ALA A 1 36  ? -8.486  -9.612  -31.321 1.00 0.00  ? 36  ALA A C      1  
ATOM   566   O O      . ALA A 1 36  ? -9.651  -9.975  -31.492 1.00 0.00  ? 36  ALA A O      1  
ATOM   567   C CB     . ALA A 1 36  ? -7.499  -10.011 -29.059 1.00 0.00  ? 36  ALA A CB     1  
ATOM   568   H H      . ALA A 1 36  ? -9.439  -8.495  -28.477 1.00 0.00  ? 36  ALA A H      1  
ATOM   569   H HA     . ALA A 1 36  ? -7.278  -8.244  -30.214 1.00 0.00  ? 36  ALA A HA     1  
ATOM   570   H HB1    . ALA A 1 36  ? -7.299  -9.556  -28.100 1.00 0.00  ? 36  ALA A HB1    1  
ATOM   571   H HB2    . ALA A 1 36  ? -6.582  -10.413 -29.464 1.00 0.00  ? 36  ALA A HB2    1  
ATOM   572   H HB3    . ALA A 1 36  ? -8.219  -10.806 -28.937 1.00 0.00  ? 36  ALA A HB3    1  
ATOM   573   N N      . SER A 1 37  ? -7.544  -9.755  -32.246 1.00 0.00  ? 37  SER A N      1  
ATOM   574   C CA     . SER A 1 37  ? -7.830  -10.359 -33.543 1.00 0.00  ? 37  SER A CA     1  
ATOM   575   C C      . SER A 1 37  ? -7.791  -11.885 -33.469 1.00 0.00  ? 37  SER A C      1  
ATOM   576   O O      . SER A 1 37  ? -7.983  -12.564 -34.478 1.00 0.00  ? 37  SER A O      1  
ATOM   577   C CB     . SER A 1 37  ? -6.833  -9.865  -34.589 1.00 0.00  ? 37  SER A CB     1  
ATOM   578   O OG     . SER A 1 37  ? -5.542  -9.700  -34.027 1.00 0.00  ? 37  SER A OG     1  
ATOM   579   H H      . SER A 1 37  ? -6.634  -9.445  -32.053 1.00 0.00  ? 37  SER A H      1  
ATOM   580   H HA     . SER A 1 37  ? -8.823  -10.051 -33.833 1.00 0.00  ? 37  SER A HA     1  
ATOM   581   H HB2    . SER A 1 37  ? -6.773  -10.583 -35.393 1.00 0.00  ? 37  SER A HB2    1  
ATOM   582   H HB3    . SER A 1 37  ? -7.167  -8.914  -34.982 1.00 0.00  ? 37  SER A HB3    1  
ATOM   583   H HG     . SER A 1 37  ? -5.268  -8.784  -34.118 1.00 0.00  ? 37  SER A HG     1  
ATOM   584   N N      . ASP A 1 38  ? -7.542  -12.421 -32.277 1.00 0.00  ? 38  ASP A N      1  
ATOM   585   C CA     . ASP A 1 38  ? -7.480  -13.867 -32.089 1.00 0.00  ? 38  ASP A CA     1  
ATOM   586   C C      . ASP A 1 38  ? -7.403  -14.221 -30.607 1.00 0.00  ? 38  ASP A C      1  
ATOM   587   O O      . ASP A 1 38  ? -7.485  -13.345 -29.746 1.00 0.00  ? 38  ASP A O      1  
ATOM   588   C CB     . ASP A 1 38  ? -6.270  -14.446 -32.826 1.00 0.00  ? 38  ASP A CB     1  
ATOM   589   C CG     . ASP A 1 38  ? -6.617  -14.919 -34.224 1.00 0.00  ? 38  ASP A CG     1  
ATOM   590   O OD1    . ASP A 1 38  ? -7.803  -15.225 -34.470 1.00 0.00  ? 38  ASP A OD1    1  
ATOM   591   O OD2    . ASP A 1 38  ? -5.703  -14.983 -35.073 1.00 0.00  ? 38  ASP A OD2    1  
ATOM   592   H H      . ASP A 1 38  ? -7.396  -11.836 -31.507 1.00 0.00  ? 38  ASP A H      1  
ATOM   593   H HA     . ASP A 1 38  ? -8.380  -14.294 -32.503 1.00 0.00  ? 38  ASP A HA     1  
ATOM   594   H HB2    . ASP A 1 38  ? -5.505  -13.687 -32.902 1.00 0.00  ? 38  ASP A HB2    1  
ATOM   595   H HB3    . ASP A 1 38  ? -5.884  -15.286 -32.268 1.00 0.00  ? 38  ASP A HB3    1  
ATOM   596   H HD2    . ASP A 1 38  ? -5.993  -15.289 -35.936 1.00 0.00  ? 38  ASP A HD2    1  
ATOM   597   N N      . GLY A 1 39  ? -7.245  -15.507 -30.320 1.00 0.00  ? 39  GLY A N      1  
ATOM   598   C CA     . GLY A 1 39  ? -7.159  -15.956 -28.942 1.00 0.00  ? 39  GLY A CA     1  
ATOM   599   C C      . GLY A 1 39  ? -8.505  -15.949 -28.244 1.00 0.00  ? 39  GLY A C      1  
ATOM   600   O O      . GLY A 1 39  ? -9.487  -16.473 -28.769 1.00 0.00  ? 39  GLY A O      1  
ATOM   601   H H      . GLY A 1 39  ? -7.185  -16.161 -31.049 1.00 0.00  ? 39  GLY A H      1  
ATOM   602   H HA2    . GLY A 1 39  ? -6.763  -16.959 -28.926 1.00 0.00  ? 39  GLY A HA2    1  
ATOM   603   H HA3    . GLY A 1 39  ? -6.484  -15.305 -28.405 1.00 0.00  ? 39  GLY A HA3    1  
ATOM   604   N N      . ILE A 1 40  ? -8.550  -15.353 -27.057 1.00 0.00  ? 40  ILE A N      1  
ATOM   605   C CA     . ILE A 1 40  ? -9.783  -15.277 -26.284 1.00 0.00  ? 40  ILE A CA     1  
ATOM   606   C C      . ILE A 1 40  ? -10.645 -14.093 -26.727 1.00 0.00  ? 40  ILE A C      1  
ATOM   607   O O      . ILE A 1 40  ? -11.742 -13.883 -26.209 1.00 0.00  ? 40  ILE A O      1  
ATOM   608   C CB     . ILE A 1 40  ? -9.481  -15.159 -24.774 1.00 0.00  ? 40  ILE A CB     1  
ATOM   609   C CG1    . ILE A 1 40  ? -10.774 -15.139 -23.954 1.00 0.00  ? 40  ILE A CG1    1  
ATOM   610   C CG2    . ILE A 1 40  ? -8.655  -13.911 -24.495 1.00 0.00  ? 40  ILE A CG2    1  
ATOM   611   C CD1    . ILE A 1 40  ? -10.543 -15.127 -22.459 1.00 0.00  ? 40  ILE A CD1    1  
ATOM   612   H H      . ILE A 1 40  ? -7.732  -14.953 -26.693 1.00 0.00  ? 40  ILE A H      1  
ATOM   613   H HA     . ILE A 1 40  ? -10.335 -16.191 -26.448 1.00 0.00  ? 40  ILE A HA     1  
ATOM   614   H HB     . ILE A 1 40  ? -8.894  -16.016 -24.482 1.00 0.00  ? 40  ILE A HB     1  
ATOM   615   H HG12   . ILE A 1 40  ? -11.340 -14.256 -24.204 1.00 0.00  ? 40  ILE A HG12   1  
ATOM   616   H HG13   . ILE A 1 40  ? -11.358 -16.017 -24.193 1.00 0.00  ? 40  ILE A HG13   1  
ATOM   617   H HG21   . ILE A 1 40  ? -8.997  -13.107 -25.123 1.00 0.00  ? 40  ILE A HG21   1  
ATOM   618   H HG22   . ILE A 1 40  ? -7.614  -14.115 -24.702 1.00 0.00  ? 40  ILE A HG22   1  
ATOM   619   H HG23   . ILE A 1 40  ? -8.767  -13.631 -23.457 1.00 0.00  ? 40  ILE A HG23   1  
ATOM   620   H HD11   . ILE A 1 40  ? -11.369 -15.610 -21.961 1.00 0.00  ? 40  ILE A HD11   1  
ATOM   621   H HD12   . ILE A 1 40  ? -10.464 -14.104 -22.117 1.00 0.00  ? 40  ILE A HD12   1  
ATOM   622   H HD13   . ILE A 1 40  ? -9.627  -15.653 -22.232 1.00 0.00  ? 40  ILE A HD13   1  
ATOM   623   N N      . HIS A 1 41  ? -10.149 -13.317 -27.692 1.00 0.00  ? 41  HIS A N      1  
ATOM   624   C CA     . HIS A 1 41  ? -10.884 -12.160 -28.189 1.00 0.00  ? 41  HIS A CA     1  
ATOM   625   C C      . HIS A 1 41  ? -11.136 -11.165 -27.063 1.00 0.00  ? 41  HIS A C      1  
ATOM   626   O O      . HIS A 1 41  ? -12.175 -10.505 -27.020 1.00 0.00  ? 41  HIS A O      1  
ATOM   627   C CB     . HIS A 1 41  ? -12.212 -12.597 -28.808 1.00 0.00  ? 41  HIS A CB     1  
ATOM   628   C CG     . HIS A 1 41  ? -12.130 -12.897 -30.274 1.00 0.00  ? 41  HIS A CG     1  
ATOM   629   N ND1    . HIS A 1 41  ? -11.009 -12.647 -31.038 1.00 0.00  ? 41  HIS A ND1    1  
ATOM   630   C CD2    . HIS A 1 41  ? -13.045 -13.432 -31.119 1.00 0.00  ? 41  HIS A CD2    1  
ATOM   631   C CE1    . HIS A 1 41  ? -11.238 -13.013 -32.288 1.00 0.00  ? 41  HIS A CE1    1  
ATOM   632   N NE2    . HIS A 1 41  ? -12.465 -13.492 -32.363 1.00 0.00  ? 41  HIS A NE2    1  
ATOM   633   H H      . HIS A 1 41  ? -9.272  -13.526 -28.074 1.00 0.00  ? 41  HIS A H      1  
ATOM   634   H HA     . HIS A 1 41  ? -10.281 -11.683 -28.946 1.00 0.00  ? 41  HIS A HA     1  
ATOM   635   H HB2    . HIS A 1 41  ? -12.557 -13.489 -28.308 1.00 0.00  ? 41  HIS A HB2    1  
ATOM   636   H HB3    . HIS A 1 41  ? -12.941 -11.811 -28.670 1.00 0.00  ? 41  HIS A HB3    1  
ATOM   637   H HD1    . HIS A 1 41  ? -10.170 -12.258 -30.717 1.00 0.00  ? 41  HIS A HD1    1  
ATOM   638   H HD2    . HIS A 1 41  ? -14.045 -13.753 -30.862 1.00 0.00  ? 41  HIS A HD2    1  
ATOM   639   H HE1    . HIS A 1 41  ? -10.541 -12.932 -33.109 1.00 0.00  ? 41  HIS A HE1    1  
ATOM   640   H HE2    . HIS A 1 41  ? -12.859 -13.916 -33.153 1.00 0.00  ? 41  HIS A HE2    1  
ATOM   641   N N      . HIS A 1 42  ? -10.176 -11.068 -26.150 1.00 0.00  ? 42  HIS A N      1  
ATOM   642   C CA     . HIS A 1 42  ? -10.284 -10.159 -25.017 1.00 0.00  ? 42  HIS A CA     1  
ATOM   643   C C      . HIS A 1 42  ? -10.295 -8.709  -25.486 1.00 0.00  ? 42  HIS A C      1  
ATOM   644   O O      . HIS A 1 42  ? -9.837  -8.399  -26.586 1.00 0.00  ? 42  HIS A O      1  
ATOM   645   C CB     . HIS A 1 42  ? -9.123  -10.390 -24.048 1.00 0.00  ? 42  HIS A CB     1  
ATOM   646   C CG     . HIS A 1 42  ? -7.780  -10.110 -24.647 1.00 0.00  ? 42  HIS A CG     1  
ATOM   647   N ND1    . HIS A 1 42  ? -6.859  -11.099 -24.927 1.00 0.00  ? 42  HIS A ND1    1  
ATOM   648   C CD2    . HIS A 1 42  ? -7.203  -8.944  -25.027 1.00 0.00  ? 42  HIS A CD2    1  
ATOM   649   C CE1    . HIS A 1 42  ? -5.775  -10.555 -25.452 1.00 0.00  ? 42  HIS A CE1    1  
ATOM   650   N NE2    . HIS A 1 42  ? -5.961  -9.250  -25.524 1.00 0.00  ? 42  HIS A NE2    1  
ATOM   651   H H      . HIS A 1 42  ? -9.375  -11.622 -26.242 1.00 0.00  ? 42  HIS A H      1  
ATOM   652   H HA     . HIS A 1 42  ? -11.212 -10.371 -24.509 1.00 0.00  ? 42  HIS A HA     1  
ATOM   653   H HB2    . HIS A 1 42  ? -9.246  -9.748  -23.189 1.00 0.00  ? 42  HIS A HB2    1  
ATOM   654   H HB3    . HIS A 1 42  ? -9.135  -11.421 -23.726 1.00 0.00  ? 42  HIS A HB3    1  
ATOM   655   H HD1    . HIS A 1 42  ? -6.983  -12.058 -24.763 1.00 0.00  ? 42  HIS A HD1    1  
ATOM   656   H HD2    . HIS A 1 42  ? -7.641  -7.960  -24.954 1.00 0.00  ? 42  HIS A HD2    1  
ATOM   657   H HE1    . HIS A 1 42  ? -4.892  -11.086 -25.773 1.00 0.00  ? 42  HIS A HE1    1  
ATOM   658   H HE2    . HIS A 1 42  ? -5.285  -8.599  -25.809 1.00 0.00  ? 42  HIS A HE2    1  
ATOM   659   N N      . TRP A 1 43  ? -10.822 -7.825  -24.647 1.00 0.00  ? 43  TRP A N      1  
ATOM   660   C CA     . TRP A 1 43  ? -10.894 -6.409  -24.982 1.00 0.00  ? 43  TRP A CA     1  
ATOM   661   C C      . TRP A 1 43  ? -9.901  -5.599  -24.157 1.00 0.00  ? 43  TRP A C      1  
ATOM   662   O O      . TRP A 1 43  ? -9.929  -5.628  -22.927 1.00 0.00  ? 43  TRP A O      1  
ATOM   663   C CB     . TRP A 1 43  ? -12.312 -5.884  -24.757 1.00 0.00  ? 43  TRP A CB     1  
ATOM   664   C CG     . TRP A 1 43  ? -13.329 -6.540  -25.640 1.00 0.00  ? 43  TRP A CG     1  
ATOM   665   C CD1    . TRP A 1 43  ? -13.898 -7.766  -25.464 1.00 0.00  ? 43  TRP A CD1    1  
ATOM   666   C CD2    . TRP A 1 43  ? -13.895 -6.001  -26.840 1.00 0.00  ? 43  TRP A CD2    1  
ATOM   667   N NE1    . TRP A 1 43  ? -14.787 -8.025  -26.481 1.00 0.00  ? 43  TRP A NE1    1  
ATOM   668   C CE2    . TRP A 1 43  ? -14.802 -6.958  -27.337 1.00 0.00  ? 43  TRP A CE2    1  
ATOM   669   C CE3    . TRP A 1 43  ? -13.724 -4.807  -27.540 1.00 0.00  ? 43  TRP A CE3    1  
ATOM   670   C CZ2    . TRP A 1 43  ? -15.533 -6.751  -28.505 1.00 0.00  ? 43  TRP A CZ2    1  
ATOM   671   C CZ3    . TRP A 1 43  ? -14.451 -4.605  -28.696 1.00 0.00  ? 43  TRP A CZ3    1  
ATOM   672   C CH2    . TRP A 1 43  ? -15.345 -5.571  -29.169 1.00 0.00  ? 43  TRP A CH2    1  
ATOM   673   H H      . TRP A 1 43  ? -11.172 -8.130  -23.785 1.00 0.00  ? 43  TRP A H      1  
ATOM   674   H HA     . TRP A 1 43  ? -10.644 -6.302  -26.027 1.00 0.00  ? 43  TRP A HA     1  
ATOM   675   H HB2    . TRP A 1 43  ? -12.596 -6.060  -23.731 1.00 0.00  ? 43  TRP A HB2    1  
ATOM   676   H HB3    . TRP A 1 43  ? -12.331 -4.821  -24.954 1.00 0.00  ? 43  TRP A HB3    1  
ATOM   677   H HD1    . TRP A 1 43  ? -13.677 -8.426  -24.639 1.00 0.00  ? 43  TRP A HD1    1  
ATOM   678   H HE1    . TRP A 1 43  ? -15.321 -8.841  -26.576 1.00 0.00  ? 43  TRP A HE1    1  
ATOM   679   H HE3    . TRP A 1 43  ? -13.039 -4.048  -27.192 1.00 0.00  ? 43  TRP A HE3    1  
ATOM   680   H HZ2    . TRP A 1 43  ? -16.228 -7.489  -28.881 1.00 0.00  ? 43  TRP A HZ2    1  
ATOM   681   H HZ3    . TRP A 1 43  ? -14.328 -3.689  -29.249 1.00 0.00  ? 43  TRP A HZ3    1  
ATOM   682   H HH2    . TRP A 1 43  ? -15.892 -5.370  -30.080 1.00 0.00  ? 43  TRP A HH2    1  
ATOM   683   N N      . THR A 1 44  ? -9.026  -4.877  -24.845 1.00 0.00  ? 44  THR A N      1  
ATOM   684   C CA     . THR A 1 44  ? -8.022  -4.055  -24.185 1.00 0.00  ? 44  THR A CA     1  
ATOM   685   C C      . THR A 1 44  ? -7.724  -2.804  -25.005 1.00 0.00  ? 44  THR A C      1  
ATOM   686   O O      . THR A 1 44  ? -7.845  -2.813  -26.231 1.00 0.00  ? 44  THR A O      1  
ATOM   687   C CB     . THR A 1 44  ? -6.736  -4.857  -23.972 1.00 0.00  ? 44  THR A CB     1  
ATOM   688   O OG1    . THR A 1 44  ? -6.245  -5.357  -25.203 1.00 0.00  ? 44  THR A OG1    1  
ATOM   689   C CG2    . THR A 1 44  ? -6.911  -6.034  -23.037 1.00 0.00  ? 44  THR A CG2    1  
ATOM   690   H H      . THR A 1 44  ? -9.057  -4.896  -25.826 1.00 0.00  ? 44  THR A H      1  
ATOM   691   H HA     . THR A 1 44  ? -8.414  -3.758  -23.225 1.00 0.00  ? 44  THR A HA     1  
ATOM   692   H HB     . THR A 1 44  ? -5.985  -4.206  -23.547 1.00 0.00  ? 44  THR A HB     1  
ATOM   693   H HG1    . THR A 1 44  ? -6.060  -4.625  -25.796 1.00 0.00  ? 44  THR A HG1    1  
ATOM   694   H HG21   . THR A 1 44  ? -5.973  -6.560  -22.939 1.00 0.00  ? 44  THR A HG21   1  
ATOM   695   H HG22   . THR A 1 44  ? -7.660  -6.702  -23.436 1.00 0.00  ? 44  THR A HG22   1  
ATOM   696   H HG23   . THR A 1 44  ? -7.229  -5.679  -22.067 1.00 0.00  ? 44  THR A HG23   1  
ATOM   697   N N      . PRO A 1 45  ? -7.324  -1.711  -24.340 1.00 0.00  ? 45  PRO A N      1  
ATOM   698   C CA     . PRO A 1 45  ? -7.004  -0.450  -25.017 1.00 0.00  ? 45  PRO A CA     1  
ATOM   699   C C      . PRO A 1 45  ? -5.761  -0.575  -25.893 1.00 0.00  ? 45  PRO A C      1  
ATOM   700   O O      . PRO A 1 45  ? -5.035  -1.567  -25.818 1.00 0.00  ? 45  PRO A O      1  
ATOM   701   C CB     . PRO A 1 45  ? -6.756  0.526   -23.864 1.00 0.00  ? 45  PRO A CB     1  
ATOM   702   C CG     . PRO A 1 45  ? -6.370  -0.338  -22.716 1.00 0.00  ? 45  PRO A CG     1  
ATOM   703   C CD     . PRO A 1 45  ? -7.146  -1.614  -22.881 1.00 0.00  ? 45  PRO A CD     1  
ATOM   704   H HA     . PRO A 1 45  ? -7.833  -0.103  -25.618 1.00 0.00  ? 45  PRO A HA     1  
ATOM   705   H HB2    . PRO A 1 45  ? -5.961  1.210   -24.131 1.00 0.00  ? 45  PRO A HB2    1  
ATOM   706   H HB3    . PRO A 1 45  ? -7.661  1.079   -23.655 1.00 0.00  ? 45  PRO A HB3    1  
ATOM   707   H HG2    . PRO A 1 45  ? -5.312  -0.538  -22.747 1.00 0.00  ? 45  PRO A HG2    1  
ATOM   708   H HG3    . PRO A 1 45  ? -6.636  0.144   -21.786 1.00 0.00  ? 45  PRO A HG3    1  
ATOM   709   H HD2    . PRO A 1 45  ? -6.577  -2.450  -22.508 1.00 0.00  ? 45  PRO A HD2    1  
ATOM   710   H HD3    . PRO A 1 45  ? -8.099  -1.547  -22.379 1.00 0.00  ? 45  PRO A HD3    1  
ATOM   711   N N      . PRO A 1 46  ? -5.504  0.429   -26.746 1.00 0.00  ? 46  PRO A N      1  
ATOM   712   C CA     . PRO A 1 46  ? -4.346  0.424   -27.646 1.00 0.00  ? 46  PRO A CA     1  
ATOM   713   C C      . PRO A 1 46  ? -3.018  0.359   -26.899 1.00 0.00  ? 46  PRO A C      1  
ATOM   714   O O      . PRO A 1 46  ? -2.521  1.374   -26.411 1.00 0.00  ? 46  PRO A O      1  
ATOM   715   C CB     . PRO A 1 46  ? -4.463  1.751   -28.398 1.00 0.00  ? 46  PRO A CB     1  
ATOM   716   C CG     . PRO A 1 46  ? -5.880  2.178   -28.233 1.00 0.00  ? 46  PRO A CG     1  
ATOM   717   C CD     . PRO A 1 46  ? -6.323  1.641   -26.904 1.00 0.00  ? 46  PRO A CD     1  
ATOM   718   H HA     . PRO A 1 46  ? -4.399  -0.396  -28.348 1.00 0.00  ? 46  PRO A HA     1  
ATOM   719   H HB2    . PRO A 1 46  ? -3.783  2.472   -27.969 1.00 0.00  ? 46  PRO A HB2    1  
ATOM   720   H HB3    . PRO A 1 46  ? -4.219  1.597   -29.438 1.00 0.00  ? 46  PRO A HB3    1  
ATOM   721   H HG2    . PRO A 1 46  ? -5.942  3.257   -28.241 1.00 0.00  ? 46  PRO A HG2    1  
ATOM   722   H HG3    . PRO A 1 46  ? -6.484  1.762   -29.024 1.00 0.00  ? 46  PRO A HG3    1  
ATOM   723   H HD2    . PRO A 1 46  ? -6.114  2.355   -26.119 1.00 0.00  ? 46  PRO A HD2    1  
ATOM   724   H HD3    . PRO A 1 46  ? -7.373  1.396   -26.926 1.00 0.00  ? 46  PRO A HD3    1  
ATOM   725   N N      . LYS A 1 47  ? -2.445  -0.836  -26.822 1.00 0.00  ? 47  LYS A N      1  
ATOM   726   C CA     . LYS A 1 47  ? -1.166  -1.028  -26.147 1.00 0.00  ? 47  LYS A CA     1  
ATOM   727   C C      . LYS A 1 47  ? -0.053  -1.263  -27.160 1.00 0.00  ? 47  LYS A C      1  
ATOM   728   O O      . LYS A 1 47  ? -0.247  -1.957  -28.158 1.00 0.00  ? 47  LYS A O      1  
ATOM   729   C CB     . LYS A 1 47  ? -1.243  -2.199  -25.169 1.00 0.00  ? 47  LYS A CB     1  
ATOM   730   C CG     . LYS A 1 47  ? -1.941  -3.422  -25.737 1.00 0.00  ? 47  LYS A CG     1  
ATOM   731   C CD     . LYS A 1 47  ? -1.987  -4.555  -24.724 1.00 0.00  ? 47  LYS A CD     1  
ATOM   732   C CE     . LYS A 1 47  ? -1.743  -5.903  -25.384 1.00 0.00  ? 47  LYS A CE     1  
ATOM   733   N NZ     . LYS A 1 47  ? -2.782  -6.901  -25.009 1.00 0.00  ? 47  LYS A NZ     1  
ATOM   734   H H      . LYS A 1 47  ? -2.884  -1.607  -27.238 1.00 0.00  ? 47  LYS A H      1  
ATOM   735   H HA     . LYS A 1 47  ? -0.946  -0.126  -25.598 1.00 0.00  ? 47  LYS A HA     1  
ATOM   736   H HB2    . LYS A 1 47  ? -0.240  -2.483  -24.885 1.00 0.00  ? 47  LYS A HB2    1  
ATOM   737   H HB3    . LYS A 1 47  ? -1.778  -1.882  -24.288 1.00 0.00  ? 47  LYS A HB3    1  
ATOM   738   H HG2    . LYS A 1 47  ? -2.950  -3.155  -26.010 1.00 0.00  ? 47  LYS A HG2    1  
ATOM   739   H HG3    . LYS A 1 47  ? -1.403  -3.756  -26.613 1.00 0.00  ? 47  LYS A HG3    1  
ATOM   740   H HD2    . LYS A 1 47  ? -1.227  -4.388  -23.978 1.00 0.00  ? 47  LYS A HD2    1  
ATOM   741   H HD3    . LYS A 1 47  ? -2.960  -4.564  -24.255 1.00 0.00  ? 47  LYS A HD3    1  
ATOM   742   H HE2    . LYS A 1 47  ? -1.752  -5.775  -26.455 1.00 0.00  ? 47  LYS A HE2    1  
ATOM   743   H HE3    . LYS A 1 47  ? -0.776  -6.271  -25.074 1.00 0.00  ? 47  LYS A HE3    1  
ATOM   744   H HZ1    . LYS A 1 47  ? -3.061  -7.457  -25.842 1.00 0.00  ? 47  LYS A HZ1    1  
ATOM   745   H HZ2    . LYS A 1 47  ? -3.622  -6.419  -24.629 1.00 0.00  ? 47  LYS A HZ2    1  
ATOM   746   H HZ3    . LYS A 1 47  ? -2.412  -7.549  -24.282 1.00 0.00  ? 47  LYS A HZ3    1  
ATOM   747   N N      . GLY A 1 48  ? 1.109   -0.677  -26.901 1.00 0.00  ? 48  GLY A N      1  
ATOM   748   C CA     . GLY A 1 48  ? 2.234   -0.833  -27.806 1.00 0.00  ? 48  GLY A CA     1  
ATOM   749   C C      . GLY A 1 48  ? 3.483   -1.330  -27.104 1.00 0.00  ? 48  GLY A C      1  
ATOM   750   O O      . GLY A 1 48  ? 3.486   -1.529  -25.891 1.00 0.00  ? 48  GLY A O      1  
ATOM   751   H H      . GLY A 1 48  ? 1.205   -0.132  -26.092 1.00 0.00  ? 48  GLY A H      1  
ATOM   752   H HA2    . GLY A 1 48  ? 1.965   -1.537  -28.577 1.00 0.00  ? 48  GLY A HA2    1  
ATOM   753   H HA3    . GLY A 1 48  ? 2.448   0.121   -28.264 1.00 0.00  ? 48  GLY A HA3    1  
ATOM   754   N N      . HIS A 1 49  ? 4.546   -1.528  -27.876 1.00 0.00  ? 49  HIS A N      1  
ATOM   755   C CA     . HIS A 1 49  ? 5.812   -2.004  -27.333 1.00 0.00  ? 49  HIS A CA     1  
ATOM   756   C C      . HIS A 1 49  ? 6.814   -0.863  -27.227 1.00 0.00  ? 49  HIS A C      1  
ATOM   757   O O      . HIS A 1 49  ? 7.516   -0.549  -28.189 1.00 0.00  ? 49  HIS A O      1  
ATOM   758   C CB     . HIS A 1 49  ? 6.379   -3.115  -28.219 1.00 0.00  ? 49  HIS A CB     1  
ATOM   759   C CG     . HIS A 1 49  ? 7.051   -4.213  -27.454 1.00 0.00  ? 49  HIS A CG     1  
ATOM   760   N ND1    . HIS A 1 49  ? 6.736   -5.546  -27.617 1.00 0.00  ? 49  HIS A ND1    1  
ATOM   761   C CD2    . HIS A 1 49  ? 8.031   -4.173  -26.520 1.00 0.00  ? 49  HIS A CD2    1  
ATOM   762   C CE1    . HIS A 1 49  ? 7.492   -6.276  -26.817 1.00 0.00  ? 49  HIS A CE1    1  
ATOM   763   N NE2    . HIS A 1 49  ? 8.289   -5.468  -26.140 1.00 0.00  ? 49  HIS A NE2    1  
ATOM   764   H H      . HIS A 1 49  ? 4.477   -1.351  -28.839 1.00 0.00  ? 49  HIS A H      1  
ATOM   765   H HA     . HIS A 1 49  ? 5.624   -2.401  -26.348 1.00 0.00  ? 49  HIS A HA     1  
ATOM   766   H HB2    . HIS A 1 49  ? 5.576   -3.555  -28.792 1.00 0.00  ? 49  HIS A HB2    1  
ATOM   767   H HB3    . HIS A 1 49  ? 7.104   -2.689  -28.896 1.00 0.00  ? 49  HIS A HB3    1  
ATOM   768   H HD1    . HIS A 1 49  ? 6.056   -5.902  -28.227 1.00 0.00  ? 49  HIS A HD1    1  
ATOM   769   H HD2    . HIS A 1 49  ? 8.521   -3.285  -26.144 1.00 0.00  ? 49  HIS A HD2    1  
ATOM   770   H HE1    . HIS A 1 49  ? 7.468   -7.353  -26.732 1.00 0.00  ? 49  HIS A HE1    1  
ATOM   771   H HE2    . HIS A 1 49  ? 9.048   -5.756  -25.594 1.00 0.00  ? 49  HIS A HE2    1  
ATOM   772   N N      . VAL A 1 50  ? 6.880   -0.240  -26.054 1.00 0.00  ? 50  VAL A N      1  
ATOM   773   C CA     . VAL A 1 50  ? 7.802   0.868   -25.835 1.00 0.00  ? 50  VAL A CA     1  
ATOM   774   C C      . VAL A 1 50  ? 9.247   0.382   -25.817 1.00 0.00  ? 50  VAL A C      1  
ATOM   775   O O      . VAL A 1 50  ? 9.580   -0.594  -25.147 1.00 0.00  ? 50  VAL A O      1  
ATOM   776   C CB     . VAL A 1 50  ? 7.490   1.625   -24.520 1.00 0.00  ? 50  VAL A CB     1  
ATOM   777   C CG1    . VAL A 1 50  ? 7.218   0.652   -23.385 1.00 0.00  ? 50  VAL A CG1    1  
ATOM   778   C CG2    . VAL A 1 50  ? 8.625   2.576   -24.156 1.00 0.00  ? 50  VAL A CG2    1  
ATOM   779   H H      . VAL A 1 50  ? 6.297   -0.533  -25.323 1.00 0.00  ? 50  VAL A H      1  
ATOM   780   H HA     . VAL A 1 50  ? 7.682   1.559   -26.657 1.00 0.00  ? 50  VAL A HA     1  
ATOM   781   H HB     . VAL A 1 50  ? 6.599   2.210   -24.671 1.00 0.00  ? 50  VAL A HB     1  
ATOM   782   H HG11   . VAL A 1 50  ? 7.768   0.957   -22.508 1.00 0.00  ? 50  VAL A HG11   1  
ATOM   783   H HG12   . VAL A 1 50  ? 7.525   -0.337  -23.680 1.00 0.00  ? 50  VAL A HG12   1  
ATOM   784   H HG13   . VAL A 1 50  ? 6.160   0.651   -23.164 1.00 0.00  ? 50  VAL A HG13   1  
ATOM   785   H HG21   . VAL A 1 50  ? 8.255   3.338   -23.486 1.00 0.00  ? 50  VAL A HG21   1  
ATOM   786   H HG22   . VAL A 1 50  ? 9.008   3.038   -25.054 1.00 0.00  ? 50  VAL A HG22   1  
ATOM   787   H HG23   . VAL A 1 50  ? 9.415   2.022   -23.670 1.00 0.00  ? 50  VAL A HG23   1  
ATOM   788   N N      . GLU A 1 51  ? 10.099  1.077   -26.560 1.00 0.00  ? 51  GLU A N      1  
ATOM   789   C CA     . GLU A 1 51  ? 11.511  0.735   -26.637 1.00 0.00  ? 51  GLU A CA     1  
ATOM   790   C C      . GLU A 1 51  ? 12.310  1.572   -25.638 1.00 0.00  ? 51  GLU A C      1  
ATOM   791   O O      . GLU A 1 51  ? 11.908  2.681   -25.288 1.00 0.00  ? 51  GLU A O      1  
ATOM   792   C CB     . GLU A 1 51  ? 12.007  0.931   -28.078 1.00 0.00  ? 51  GLU A CB     1  
ATOM   793   C CG     . GLU A 1 51  ? 13.516  1.065   -28.242 1.00 0.00  ? 51  GLU A CG     1  
ATOM   794   C CD     . GLU A 1 51  ? 13.899  2.071   -29.309 1.00 0.00  ? 51  GLU A CD     1  
ATOM   795   O OE1    . GLU A 1 51  ? 13.578  3.267   -29.137 1.00 0.00  ? 51  GLU A OE1    1  
ATOM   796   O OE2    . GLU A 1 51  ? 14.520  1.666   -30.313 1.00 0.00  ? 51  GLU A OE2    1  
ATOM   797   H H      . GLU A 1 51  ? 9.768   1.847   -27.069 1.00 0.00  ? 51  GLU A H      1  
ATOM   798   H HA     . GLU A 1 51  ? 11.612  -0.308  -26.369 1.00 0.00  ? 51  GLU A HA     1  
ATOM   799   H HB2    . GLU A 1 51  ? 11.694  0.079   -28.657 1.00 0.00  ? 51  GLU A HB2    1  
ATOM   800   H HB3    . GLU A 1 51  ? 11.543  1.819   -28.484 1.00 0.00  ? 51  GLU A HB3    1  
ATOM   801   H HG2    . GLU A 1 51  ? 13.945  1.376   -27.308 1.00 0.00  ? 51  GLU A HG2    1  
ATOM   802   H HG3    . GLU A 1 51  ? 13.920  0.101   -28.515 1.00 0.00  ? 51  GLU A HG3    1  
ATOM   803   H HE2    . GLU A 1 51  ? 14.730  2.356   -30.947 1.00 0.00  ? 51  GLU A HE2    1  
ATOM   804   N N      . PRO A 1 52  ? 13.444  1.043   -25.152 1.00 0.00  ? 52  PRO A N      1  
ATOM   805   C CA     . PRO A 1 52  ? 14.286  1.738   -24.177 1.00 0.00  ? 52  PRO A CA     1  
ATOM   806   C C      . PRO A 1 52  ? 14.593  3.176   -24.587 1.00 0.00  ? 52  PRO A C      1  
ATOM   807   O O      . PRO A 1 52  ? 14.716  4.060   -23.737 1.00 0.00  ? 52  PRO A O      1  
ATOM   808   C CB     . PRO A 1 52  ? 15.571  0.898   -24.115 1.00 0.00  ? 52  PRO A CB     1  
ATOM   809   C CG     . PRO A 1 52  ? 15.451  -0.132  -25.193 1.00 0.00  ? 52  PRO A CG     1  
ATOM   810   C CD     . PRO A 1 52  ? 13.988  -0.274  -25.505 1.00 0.00  ? 52  PRO A CD     1  
ATOM   811   H HA     . PRO A 1 52  ? 13.819  1.748   -23.204 1.00 0.00  ? 52  PRO A HA     1  
ATOM   812   H HB2    . PRO A 1 52  ? 16.426  1.537   -24.280 1.00 0.00  ? 52  PRO A HB2    1  
ATOM   813   H HB3    . PRO A 1 52  ? 15.649  0.437   -23.140 1.00 0.00  ? 52  PRO A HB3    1  
ATOM   814   H HG2    . PRO A 1 52  ? 15.987  0.195   -26.071 1.00 0.00  ? 52  PRO A HG2    1  
ATOM   815   H HG3    . PRO A 1 52  ? 15.850  -1.074  -24.842 1.00 0.00  ? 52  PRO A HG3    1  
ATOM   816   H HD2    . PRO A 1 52  ? 13.846  -0.482  -26.553 1.00 0.00  ? 52  PRO A HD2    1  
ATOM   817   H HD3    . PRO A 1 52  ? 13.539  -1.049  -24.907 1.00 0.00  ? 52  PRO A HD3    1  
ATOM   818   N N      . GLY A 1 53  ? 14.705  3.408   -25.888 1.00 0.00  ? 53  GLY A N      1  
ATOM   819   C CA     . GLY A 1 53  ? 14.984  4.741   -26.385 1.00 0.00  ? 53  GLY A CA     1  
ATOM   820   C C      . GLY A 1 53  ? 13.717  5.530   -26.664 1.00 0.00  ? 53  GLY A C      1  
ATOM   821   O O      . GLY A 1 53  ? 13.763  6.746   -26.847 1.00 0.00  ? 53  GLY A O      1  
ATOM   822   H H      . GLY A 1 53  ? 14.594  2.669   -26.518 1.00 0.00  ? 53  GLY A H      1  
ATOM   823   H HA2    . GLY A 1 53  ? 15.573  5.272   -25.651 1.00 0.00  ? 53  GLY A HA2    1  
ATOM   824   H HA3    . GLY A 1 53  ? 15.554  4.661   -27.299 1.00 0.00  ? 53  GLY A HA3    1  
ATOM   825   N N      . GLU A 1 54  ? 12.581  4.836   -26.689 1.00 0.00  ? 54  GLU A N      1  
ATOM   826   C CA     . GLU A 1 54  ? 11.296  5.478   -26.941 1.00 0.00  ? 54  GLU A CA     1  
ATOM   827   C C      . GLU A 1 54  ? 10.687  5.984   -25.639 1.00 0.00  ? 54  GLU A C      1  
ATOM   828   O O      . GLU A 1 54  ? 11.119  5.596   -24.554 1.00 0.00  ? 54  GLU A O      1  
ATOM   829   C CB     . GLU A 1 54  ? 10.335  4.498   -27.618 1.00 0.00  ? 54  GLU A CB     1  
ATOM   830   C CG     . GLU A 1 54  ? 9.207   5.178   -28.376 1.00 0.00  ? 54  GLU A CG     1  
ATOM   831   C CD     . GLU A 1 54  ? 8.468   4.227   -29.299 1.00 0.00  ? 54  GLU A CD     1  
ATOM   832   O OE1    . GLU A 1 54  ? 9.059   3.198   -29.688 1.00 0.00  ? 54  GLU A OE1    1  
ATOM   833   O OE2    . GLU A 1 54  ? 7.299   4.513   -29.632 1.00 0.00  ? 54  GLU A OE2    1  
ATOM   834   H H      . GLU A 1 54  ? 12.606  3.869   -26.532 1.00 0.00  ? 54  GLU A H      1  
ATOM   835   H HA     . GLU A 1 54  ? 11.465  6.318   -27.599 1.00 0.00  ? 54  GLU A HA     1  
ATOM   836   H HB2    . GLU A 1 54  ? 10.891  3.886   -28.310 1.00 0.00  ? 54  GLU A HB2    1  
ATOM   837   H HB3    . GLU A 1 54  ? 9.897   3.860   -26.861 1.00 0.00  ? 54  GLU A HB3    1  
ATOM   838   H HG2    . GLU A 1 54  ? 8.503   5.582   -27.665 1.00 0.00  ? 54  GLU A HG2    1  
ATOM   839   H HG3    . GLU A 1 54  ? 9.622   5.980   -28.968 1.00 0.00  ? 54  GLU A HG3    1  
ATOM   840   H HE2    . GLU A 1 54  ? 6.891   3.868   -30.216 1.00 0.00  ? 54  GLU A HE2    1  
ATOM   841   N N      . ASP A 1 55  ? 9.681   6.847   -25.747 1.00 0.00  ? 55  ASP A N      1  
ATOM   842   C CA     . ASP A 1 55  ? 9.025   7.390   -24.568 1.00 0.00  ? 55  ASP A CA     1  
ATOM   843   C C      . ASP A 1 55  ? 7.973   6.423   -24.044 1.00 0.00  ? 55  ASP A C      1  
ATOM   844   O O      . ASP A 1 55  ? 7.521   5.525   -24.759 1.00 0.00  ? 55  ASP A O      1  
ATOM   845   C CB     . ASP A 1 55  ? 8.378   8.736   -24.885 1.00 0.00  ? 55  ASP A CB     1  
ATOM   846   C CG     . ASP A 1 55  ? 7.651   9.336   -23.694 1.00 0.00  ? 55  ASP A CG     1  
ATOM   847   O OD1    . ASP A 1 55  ? 8.328   9.719   -22.717 1.00 0.00  ? 55  ASP A OD1    1  
ATOM   848   O OD2    . ASP A 1 55  ? 6.406   9.419   -23.740 1.00 0.00  ? 55  ASP A OD2    1  
ATOM   849   H H      . ASP A 1 55  ? 9.374   7.120   -26.640 1.00 0.00  ? 55  ASP A H      1  
ATOM   850   H HA     . ASP A 1 55  ? 9.777   7.532   -23.806 1.00 0.00  ? 55  ASP A HA     1  
ATOM   851   H HB2    . ASP A 1 55  ? 9.136   9.430   -25.203 1.00 0.00  ? 55  ASP A HB2    1  
ATOM   852   H HB3    . ASP A 1 55  ? 7.672   8.602   -25.680 1.00 0.00  ? 55  ASP A HB3    1  
ATOM   853   H HD2    . ASP A 1 55  ? 6.012   9.806   -22.954 1.00 0.00  ? 55  ASP A HD2    1  
ATOM   854   N N      . ASP A 1 56  ? 7.587   6.613   -22.792 1.00 0.00  ? 56  ASP A N      1  
ATOM   855   C CA     . ASP A 1 56  ? 6.591   5.761   -22.158 1.00 0.00  ? 56  ASP A CA     1  
ATOM   856   C C      . ASP A 1 56  ? 5.194   6.043   -22.710 1.00 0.00  ? 56  ASP A C      1  
ATOM   857   O O      . ASP A 1 56  ? 4.568   5.178   -23.322 1.00 0.00  ? 56  ASP A O      1  
ATOM   858   C CB     . ASP A 1 56  ? 6.613   5.973   -20.642 1.00 0.00  ? 56  ASP A CB     1  
ATOM   859   C CG     . ASP A 1 56  ? 6.741   4.670   -19.875 1.00 0.00  ? 56  ASP A CG     1  
ATOM   860   O OD1    . ASP A 1 56  ? 6.010   4.494   -18.879 1.00 0.00  ? 56  ASP A OD1    1  
ATOM   861   O OD2    . ASP A 1 56  ? 7.573   3.828   -20.273 1.00 0.00  ? 56  ASP A OD2    1  
ATOM   862   H H      . ASP A 1 56  ? 7.987   7.346   -22.278 1.00 0.00  ? 56  ASP A H      1  
ATOM   863   H HA     . ASP A 1 56  ? 6.847   4.733   -22.373 1.00 0.00  ? 56  ASP A HA     1  
ATOM   864   H HB2    . ASP A 1 56  ? 7.455   6.600   -20.388 1.00 0.00  ? 56  ASP A HB2    1  
ATOM   865   H HB3    . ASP A 1 56  ? 5.702   6.462   -20.338 1.00 0.00  ? 56  ASP A HB3    1  
ATOM   866   H HD2    . ASP A 1 56  ? 7.601   3.028   -19.743 1.00 0.00  ? 56  ASP A HD2    1  
ATOM   867   N N      . LEU A 1 57  ? 4.713   7.261   -22.484 1.00 0.00  ? 57  LEU A N      1  
ATOM   868   C CA     . LEU A 1 57  ? 3.391   7.651   -22.954 1.00 0.00  ? 57  LEU A CA     1  
ATOM   869   C C      . LEU A 1 57  ? 3.298   7.589   -24.475 1.00 0.00  ? 57  LEU A C      1  
ATOM   870   O O      . LEU A 1 57  ? 2.286   7.155   -25.021 1.00 0.00  ? 57  LEU A O      1  
ATOM   871   C CB     . LEU A 1 57  ? 3.047   9.061   -22.468 1.00 0.00  ? 57  LEU A CB     1  
ATOM   872   C CG     . LEU A 1 57  ? 1.675   9.585   -22.909 1.00 0.00  ? 57  LEU A CG     1  
ATOM   873   C CD1    . LEU A 1 57  ? 0.592   8.543   -22.671 1.00 0.00  ? 57  LEU A CD1    1  
ATOM   874   C CD2    . LEU A 1 57  ? 1.343   10.873  -22.179 1.00 0.00  ? 57  LEU A CD2    1  
ATOM   875   H H      . LEU A 1 57  ? 5.257   7.907   -21.988 1.00 0.00  ? 57  LEU A H      1  
ATOM   876   H HA     . LEU A 1 57  ? 2.678   6.959   -22.537 1.00 0.00  ? 57  LEU A HA     1  
ATOM   877   H HB2    . LEU A 1 57  ? 3.083   9.064   -21.391 1.00 0.00  ? 57  LEU A HB2    1  
ATOM   878   H HB3    . LEU A 1 57  ? 3.802   9.740   -22.838 1.00 0.00  ? 57  LEU A HB3    1  
ATOM   879   H HG     . LEU A 1 57  ? 1.705   9.799   -23.967 1.00 0.00  ? 57  LEU A HG     1  
ATOM   880   H HD11   . LEU A 1 57  ? 0.409   8.447   -21.610 1.00 0.00  ? 57  LEU A HD11   1  
ATOM   881   H HD12   . LEU A 1 57  ? 0.910   7.591   -23.068 1.00 0.00  ? 57  LEU A HD12   1  
ATOM   882   H HD13   . LEU A 1 57  ? -0.317  8.852   -23.164 1.00 0.00  ? 57  LEU A HD13   1  
ATOM   883   H HD21   . LEU A 1 57  ? 0.412   11.270  -22.556 1.00 0.00  ? 57  LEU A HD21   1  
ATOM   884   H HD22   . LEU A 1 57  ? 2.132   11.593  -22.337 1.00 0.00  ? 57  LEU A HD22   1  
ATOM   885   H HD23   . LEU A 1 57  ? 1.247   10.673  -21.122 1.00 0.00  ? 57  LEU A HD23   1  
ATOM   886   N N      . GLU A 1 58  ? 4.358   8.018   -25.156 1.00 0.00  ? 58  GLU A N      1  
ATOM   887   C CA     . GLU A 1 58  ? 4.380   8.004   -26.620 1.00 0.00  ? 58  GLU A CA     1  
ATOM   888   C C      . GLU A 1 58  ? 3.979   6.632   -27.148 1.00 0.00  ? 58  GLU A C      1  
ATOM   889   O O      . GLU A 1 58  ? 3.102   6.524   -28.004 1.00 0.00  ? 58  GLU A O      1  
ATOM   890   C CB     . GLU A 1 58  ? 5.768   8.372   -27.140 1.00 0.00  ? 58  GLU A CB     1  
ATOM   891   C CG     . GLU A 1 58  ? 5.904   9.827   -27.564 1.00 0.00  ? 58  GLU A CG     1  
ATOM   892   C CD     . GLU A 1 58  ? 7.170   10.480  -27.043 1.00 0.00  ? 58  GLU A CD     1  
ATOM   893   O OE1    . GLU A 1 58  ? 7.075   11.288  -26.094 1.00 0.00  ? 58  GLU A OE1    1  
ATOM   894   O OE2    . GLU A 1 58  ? 8.255   10.180  -27.583 1.00 0.00  ? 58  GLU A OE2    1  
ATOM   895   H H      . GLU A 1 58  ? 5.140   8.351   -24.668 1.00 0.00  ? 58  GLU A H      1  
ATOM   896   H HA     . GLU A 1 58  ? 3.664   8.734   -26.972 1.00 0.00  ? 58  GLU A HA     1  
ATOM   897   H HB2    . GLU A 1 58  ? 6.486   8.176   -26.365 1.00 0.00  ? 58  GLU A HB2    1  
ATOM   898   H HB3    . GLU A 1 58  ? 5.999   7.751   -27.992 1.00 0.00  ? 58  GLU A HB3    1  
ATOM   899   H HG2    . GLU A 1 58  ? 5.918   9.870   -28.642 1.00 0.00  ? 58  GLU A HG2    1  
ATOM   900   H HG3    . GLU A 1 58  ? 5.054   10.378  -27.193 1.00 0.00  ? 58  GLU A HG3    1  
ATOM   901   H HE2    . GLU A 1 58  ? 9.014   10.629  -27.204 1.00 0.00  ? 58  GLU A HE2    1  
ATOM   902   N N      . THR A 1 59  ? 4.606   5.583   -26.625 1.00 0.00  ? 59  THR A N      1  
ATOM   903   C CA     . THR A 1 59  ? 4.279   4.228   -27.046 1.00 0.00  ? 59  THR A CA     1  
ATOM   904   C C      . THR A 1 59  ? 2.785   3.989   -26.871 1.00 0.00  ? 59  THR A C      1  
ATOM   905   O O      . THR A 1 59  ? 2.148   3.331   -27.693 1.00 0.00  ? 59  THR A O      1  
ATOM   906   C CB     . THR A 1 59  ? 5.085   3.208   -26.244 1.00 0.00  ? 59  THR A CB     1  
ATOM   907   O OG1    . THR A 1 59  ? 6.471   3.380   -26.480 1.00 0.00  ? 59  THR A OG1    1  
ATOM   908   C CG2    . THR A 1 59  ? 4.739   1.772   -26.577 1.00 0.00  ? 59  THR A CG2    1  
ATOM   909   H H      . THR A 1 59  ? 5.288   5.722   -25.936 1.00 0.00  ? 59  THR A H      1  
ATOM   910   H HA     . THR A 1 59  ? 4.527   4.134   -28.093 1.00 0.00  ? 59  THR A HA     1  
ATOM   911   H HB     . THR A 1 59  ? 4.899   3.357   -25.189 1.00 0.00  ? 59  THR A HB     1  
ATOM   912   H HG1    . THR A 1 59  ? 6.837   3.969   -25.819 1.00 0.00  ? 59  THR A HG1    1  
ATOM   913   H HG21   . THR A 1 59  ? 3.828   1.747   -27.156 1.00 0.00  ? 59  THR A HG21   1  
ATOM   914   H HG22   . THR A 1 59  ? 4.600   1.214   -25.662 1.00 0.00  ? 59  THR A HG22   1  
ATOM   915   H HG23   . THR A 1 59  ? 5.541   1.332   -27.149 1.00 0.00  ? 59  THR A HG23   1  
ATOM   916   N N      . ALA A 1 60  ? 2.229   4.555   -25.805 1.00 0.00  ? 60  ALA A N      1  
ATOM   917   C CA     . ALA A 1 60  ? 0.805   4.430   -25.536 1.00 0.00  ? 60  ALA A CA     1  
ATOM   918   C C      . ALA A 1 60  ? 0.014   5.333   -26.477 1.00 0.00  ? 60  ALA A C      1  
ATOM   919   O O      . ALA A 1 60  ? -1.108  5.013   -26.867 1.00 0.00  ? 60  ALA A O      1  
ATOM   920   C CB     . ALA A 1 60  ? 0.508   4.774   -24.085 1.00 0.00  ? 60  ALA A CB     1  
ATOM   921   H H      . ALA A 1 60  ? 2.788   5.086   -25.196 1.00 0.00  ? 60  ALA A H      1  
ATOM   922   H HA     . ALA A 1 60  ? 0.521   3.402   -25.710 1.00 0.00  ? 60  ALA A HA     1  
ATOM   923   H HB1    . ALA A 1 60  ? -0.310  5.483   -24.037 1.00 0.00  ? 60  ALA A HB1    1  
ATOM   924   H HB2    . ALA A 1 60  ? 1.386   5.207   -23.631 1.00 0.00  ? 60  ALA A HB2    1  
ATOM   925   H HB3    . ALA A 1 60  ? 0.234   3.874   -23.552 1.00 0.00  ? 60  ALA A HB3    1  
ATOM   926   N N      . LEU A 1 61  ? 0.619   6.462   -26.839 1.00 0.00  ? 61  LEU A N      1  
ATOM   927   C CA     . LEU A 1 61  ? -0.007  7.424   -27.738 1.00 0.00  ? 61  LEU A CA     1  
ATOM   928   C C      . LEU A 1 61  ? -0.042  6.885   -29.160 1.00 0.00  ? 61  LEU A C      1  
ATOM   929   O O      . LEU A 1 61  ? -1.094  6.836   -29.795 1.00 0.00  ? 61  LEU A O      1  
ATOM   930   C CB     . LEU A 1 61  ? 0.775   8.735   -27.715 1.00 0.00  ? 61  LEU A CB     1  
ATOM   931   C CG     . LEU A 1 61  ? 0.743   9.485   -26.388 1.00 0.00  ? 61  LEU A CG     1  
ATOM   932   C CD1    . LEU A 1 61  ? 1.620   10.721  -26.477 1.00 0.00  ? 61  LEU A CD1    1  
ATOM   933   C CD2    . LEU A 1 61  ? -0.686  9.853   -26.017 1.00 0.00  ? 61  LEU A CD2    1  
ATOM   934   H H      . LEU A 1 61  ? 1.516   6.652   -26.492 1.00 0.00  ? 61  LEU A H      1  
ATOM   935   H HA     . LEU A 1 61  ? -1.015  7.605   -27.398 1.00 0.00  ? 61  LEU A HA     1  
ATOM   936   H HB2    . LEU A 1 61  ? 1.805   8.517   -27.956 1.00 0.00  ? 61  LEU A HB2    1  
ATOM   937   H HB3    . LEU A 1 61  ? 0.378   9.384   -28.479 1.00 0.00  ? 61  LEU A HB3    1  
ATOM   938   H HG     . LEU A 1 61  ? 1.141   8.850   -25.612 1.00 0.00  ? 61  LEU A HG     1  
ATOM   939   H HD11   . LEU A 1 61  ? 2.409   10.547  -27.195 1.00 0.00  ? 61  LEU A HD11   1  
ATOM   940   H HD12   . LEU A 1 61  ? 2.055   10.925  -25.509 1.00 0.00  ? 61  LEU A HD12   1  
ATOM   941   H HD13   . LEU A 1 61  ? 1.027   11.565  -26.793 1.00 0.00  ? 61  LEU A HD13   1  
ATOM   942   H HD21   . LEU A 1 61  ? -0.687  10.384  -25.077 1.00 0.00  ? 61  LEU A HD21   1  
ATOM   943   H HD22   . LEU A 1 61  ? -1.277  8.952   -25.923 1.00 0.00  ? 61  LEU A HD22   1  
ATOM   944   H HD23   . LEU A 1 61  ? -1.109  10.479  -26.787 1.00 0.00  ? 61  LEU A HD23   1  
ATOM   945   N N      . ARG A 1 62  ? 1.124   6.472   -29.650 1.00 0.00  ? 62  ARG A N      1  
ATOM   946   C CA     . ARG A 1 62  ? 1.237   5.923   -30.996 1.00 0.00  ? 62  ARG A CA     1  
ATOM   947   C C      . ARG A 1 62  ? 0.344   4.698   -31.147 1.00 0.00  ? 62  ARG A C      1  
ATOM   948   O O      . ARG A 1 62  ? -0.354  4.545   -32.149 1.00 0.00  ? 62  ARG A O      1  
ATOM   949   C CB     . ARG A 1 62  ? 2.689   5.554   -31.303 1.00 0.00  ? 62  ARG A CB     1  
ATOM   950   C CG     . ARG A 1 62  ? 3.016   5.551   -32.789 1.00 0.00  ? 62  ARG A CG     1  
ATOM   951   C CD     . ARG A 1 62  ? 4.387   6.150   -33.061 1.00 0.00  ? 62  ARG A CD     1  
ATOM   952   N NE     . ARG A 1 62  ? 4.711   6.153   -34.486 1.00 0.00  ? 62  ARG A NE     1  
ATOM   953   C CZ     . ARG A 1 62  ? 5.206   5.103   -35.138 1.00 0.00  ? 62  ARG A CZ     1  
ATOM   954   N NH1    . ARG A 1 62  ? 5.434   3.963   -34.499 1.00 0.00  ? 62  ARG A NH1    1  
ATOM   955   N NH2    . ARG A 1 62  ? 5.475   5.198   -36.434 1.00 0.00  ? 62  ARG A NH2    1  
ATOM   956   H H      . ARG A 1 62  ? 1.925   6.536   -29.088 1.00 0.00  ? 62  ARG A H      1  
ATOM   957   H HA     . ARG A 1 62  ? 0.908   6.681   -31.693 1.00 0.00  ? 62  ARG A HA     1  
ATOM   958   H HB2    . ARG A 1 62  ? 3.339   6.263   -30.815 1.00 0.00  ? 62  ARG A HB2    1  
ATOM   959   H HB3    . ARG A 1 62  ? 2.888   4.566   -30.912 1.00 0.00  ? 62  ARG A HB3    1  
ATOM   960   H HG2    . ARG A 1 62  ? 3.000   4.534   -33.150 1.00 0.00  ? 62  ARG A HG2    1  
ATOM   961   H HG3    . ARG A 1 62  ? 2.269   6.131   -33.311 1.00 0.00  ? 62  ARG A HG3    1  
ATOM   962   H HD2    . ARG A 1 62  ? 4.399   7.167   -32.698 1.00 0.00  ? 62  ARG A HD2    1  
ATOM   963   H HD3    . ARG A 1 62  ? 5.130   5.570   -32.533 1.00 0.00  ? 62  ARG A HD3    1  
ATOM   964   H HE     . ARG A 1 62  ? 4.553   6.983   -34.984 1.00 0.00  ? 62  ARG A HE     1  
ATOM   965   H HH11   . ARG A 1 62  ? 5.231   3.885   -33.525 1.00 0.00  ? 62  ARG A HH11   1  
ATOM   966   H HH12   . ARG A 1 62  ? 5.809   3.180   -34.995 1.00 0.00  ? 62  ARG A HH12   1  
ATOM   967   H HH21   . ARG A 1 62  ? 5.307   6.055   -36.916 1.00 0.00  ? 62  ARG A HH21   1  
ATOM   968   H HH22   . ARG A 1 62  ? 5.847   4.411   -36.925 1.00 0.00  ? 62  ARG A HH22   1  
ATOM   969   N N      . ALA A 1 63  ? 0.359   3.833   -30.138 1.00 0.00  ? 63  ALA A N      1  
ATOM   970   C CA     . ALA A 1 63  ? -0.462  2.631   -30.156 1.00 0.00  ? 63  ALA A CA     1  
ATOM   971   C C      . ALA A 1 63  ? -1.934  2.999   -30.292 1.00 0.00  ? 63  ALA A C      1  
ATOM   972   O O      . ALA A 1 63  ? -2.711  2.284   -30.924 1.00 0.00  ? 63  ALA A O      1  
ATOM   973   C CB     . ALA A 1 63  ? -0.233  1.812   -28.893 1.00 0.00  ? 63  ALA A CB     1  
ATOM   974   H H      . ALA A 1 63  ? 0.929   4.013   -29.360 1.00 0.00  ? 63  ALA A H      1  
ATOM   975   H HA     . ALA A 1 63  ? -0.168  2.033   -31.008 1.00 0.00  ? 63  ALA A HA     1  
ATOM   976   H HB1    . ALA A 1 63  ? -0.943  1.000   -28.858 1.00 0.00  ? 63  ALA A HB1    1  
ATOM   977   H HB2    . ALA A 1 63  ? -0.363  2.442   -28.027 1.00 0.00  ? 63  ALA A HB2    1  
ATOM   978   H HB3    . ALA A 1 63  ? 0.771   1.412   -28.903 1.00 0.00  ? 63  ALA A HB3    1  
ATOM   979   N N      . THR A 1 64  ? -2.303  4.133   -29.703 1.00 0.00  ? 64  THR A N      1  
ATOM   980   C CA     . THR A 1 64  ? -3.674  4.619   -29.762 1.00 0.00  ? 64  THR A CA     1  
ATOM   981   C C      . THR A 1 64  ? -4.067  4.919   -31.201 1.00 0.00  ? 64  THR A C      1  
ATOM   982   O O      . THR A 1 64  ? -5.071  4.415   -31.700 1.00 0.00  ? 64  THR A O      1  
ATOM   983   C CB     . THR A 1 64  ? -3.838  5.872   -28.898 1.00 0.00  ? 64  THR A CB     1  
ATOM   984   O OG1    . THR A 1 64  ? -3.351  5.650   -27.586 1.00 0.00  ? 64  THR A OG1    1  
ATOM   985   C CG2    . THR A 1 64  ? -5.274  6.323   -28.770 1.00 0.00  ? 64  THR A CG2    1  
ATOM   986   H H      . THR A 1 64  ? -1.630  4.662   -29.226 1.00 0.00  ? 64  THR A H      1  
ATOM   987   H HA     . THR A 1 64  ? -4.319  3.844   -29.382 1.00 0.00  ? 64  THR A HA     1  
ATOM   988   H HB     . THR A 1 64  ? -3.274  6.679   -29.340 1.00 0.00  ? 64  THR A HB     1  
ATOM   989   H HG1    . THR A 1 64  ? -2.585  5.074   -27.617 1.00 0.00  ? 64  THR A HG1    1  
ATOM   990   H HG21   . THR A 1 64  ? -5.873  5.508   -28.399 1.00 0.00  ? 64  THR A HG21   1  
ATOM   991   H HG22   . THR A 1 64  ? -5.645  6.631   -29.736 1.00 0.00  ? 64  THR A HG22   1  
ATOM   992   H HG23   . THR A 1 64  ? -5.329  7.154   -28.080 1.00 0.00  ? 64  THR A HG23   1  
ATOM   993   N N      . GLN A 1 65  ? -3.261  5.738   -31.867 1.00 0.00  ? 65  GLN A N      1  
ATOM   994   C CA     . GLN A 1 65  ? -3.521  6.097   -33.251 1.00 0.00  ? 65  GLN A CA     1  
ATOM   995   C C      . GLN A 1 65  ? -3.191  4.932   -34.183 1.00 0.00  ? 65  GLN A C      1  
ATOM   996   O O      . GLN A 1 65  ? -3.718  4.845   -35.292 1.00 0.00  ? 65  GLN A O      1  
ATOM   997   C CB     . GLN A 1 65  ? -2.720  7.339   -33.642 1.00 0.00  ? 65  GLN A CB     1  
ATOM   998   C CG     . GLN A 1 65  ? -1.248  7.258   -33.274 1.00 0.00  ? 65  GLN A CG     1  
ATOM   999   C CD     . GLN A 1 65  ? -0.383  8.151   -34.141 1.00 0.00  ? 65  GLN A CD     1  
ATOM   1000  O OE1    . GLN A 1 65  ? 0.098   9.192   -33.694 1.00 0.00  ? 65  GLN A OE1    1  
ATOM   1001  N NE2    . GLN A 1 65  ? -0.182  7.746   -35.390 1.00 0.00  ? 65  GLN A NE2    1  
ATOM   1002  H H      . GLN A 1 65  ? -2.471  6.104   -31.416 1.00 0.00  ? 65  GLN A H      1  
ATOM   1003  H HA     . GLN A 1 65  ? -4.570  6.317   -33.338 1.00 0.00  ? 65  GLN A HA     1  
ATOM   1004  H HB2    . GLN A 1 65  ? -2.795  7.481   -34.711 1.00 0.00  ? 65  GLN A HB2    1  
ATOM   1005  H HB3    . GLN A 1 65  ? -3.147  8.198   -33.145 1.00 0.00  ? 65  GLN A HB3    1  
ATOM   1006  H HG2    . GLN A 1 65  ? -1.130  7.558   -32.244 1.00 0.00  ? 65  GLN A HG2    1  
ATOM   1007  H HG3    . GLN A 1 65  ? -0.920  6.238   -33.391 1.00 0.00  ? 65  GLN A HG3    1  
ATOM   1008  H HE21   . GLN A 1 65  ? -0.597  6.906   -35.677 1.00 0.00  ? 65  GLN A HE21   1  
ATOM   1009  H HE22   . GLN A 1 65  ? 0.372   8.304   -35.974 1.00 0.00  ? 65  GLN A HE22   1  
ATOM   1010  N N      . GLU A 1 66  ? -2.328  4.034   -33.722 1.00 0.00  ? 66  GLU A N      1  
ATOM   1011  C CA     . GLU A 1 66  ? -1.943  2.871   -34.511 1.00 0.00  ? 66  GLU A CA     1  
ATOM   1012  C C      . GLU A 1 66  ? -3.013  1.787   -34.439 1.00 0.00  ? 66  GLU A C      1  
ATOM   1013  O O      . GLU A 1 66  ? -3.281  1.100   -35.425 1.00 0.00  ? 66  GLU A O      1  
ATOM   1014  C CB     . GLU A 1 66  ? -0.605  2.315   -34.019 1.00 0.00  ? 66  GLU A CB     1  
ATOM   1015  C CG     . GLU A 1 66  ? 0.601   2.931   -34.706 1.00 0.00  ? 66  GLU A CG     1  
ATOM   1016  C CD     . GLU A 1 66  ? 1.239   1.996   -35.716 1.00 0.00  ? 66  GLU A CD     1  
ATOM   1017  O OE1    . GLU A 1 66  ? 1.584   2.465   -36.820 1.00 0.00  ? 66  GLU A OE1    1  
ATOM   1018  O OE2    . GLU A 1 66  ? 1.392   0.797   -35.402 1.00 0.00  ? 66  GLU A OE2    1  
ATOM   1019  H H      . GLU A 1 66  ? -1.945  4.152   -32.827 1.00 0.00  ? 66  GLU A H      1  
ATOM   1020  H HA     . GLU A 1 66  ? -1.835  3.189   -35.536 1.00 0.00  ? 66  GLU A HA     1  
ATOM   1021  H HB2    . GLU A 1 66  ? -0.521  2.494   -32.958 1.00 0.00  ? 66  GLU A HB2    1  
ATOM   1022  H HB3    . GLU A 1 66  ? -0.589  1.248   -34.195 1.00 0.00  ? 66  GLU A HB3    1  
ATOM   1023  H HG2    . GLU A 1 66  ? 0.289   3.829   -35.216 1.00 0.00  ? 66  GLU A HG2    1  
ATOM   1024  H HG3    . GLU A 1 66  ? 1.337   3.182   -33.956 1.00 0.00  ? 66  GLU A HG3    1  
ATOM   1025  H HE2    . GLU A 1 66  ? 1.801   0.264   -36.088 1.00 0.00  ? 66  GLU A HE2    1  
ATOM   1026  N N      . GLU A 1 67  ? -3.620  1.635   -33.263 1.00 0.00  ? 67  GLU A N      1  
ATOM   1027  C CA     . GLU A 1 67  ? -4.654  0.625   -33.062 1.00 0.00  ? 67  GLU A CA     1  
ATOM   1028  C C      . GLU A 1 67  ? -6.038  1.255   -32.887 1.00 0.00  ? 67  GLU A C      1  
ATOM   1029  O O      . GLU A 1 67  ? -6.992  0.569   -32.530 1.00 0.00  ? 67  GLU A O      1  
ATOM   1030  C CB     . GLU A 1 67  ? -4.326  -0.236  -31.842 1.00 0.00  ? 67  GLU A CB     1  
ATOM   1031  C CG     . GLU A 1 67  ? -3.080  -1.092  -32.017 1.00 0.00  ? 67  GLU A CG     1  
ATOM   1032  C CD     . GLU A 1 67  ? -1.879  -0.528  -31.283 1.00 0.00  ? 67  GLU A CD     1  
ATOM   1033  O OE1    . GLU A 1 67  ? -1.052  0.148   -31.929 1.00 0.00  ? 67  GLU A OE1    1  
ATOM   1034  O OE2    . GLU A 1 67  ? -1.767  -0.763  -30.060 1.00 0.00  ? 67  GLU A OE2    1  
ATOM   1035  H H      . GLU A 1 67  ? -3.359  2.209   -32.514 1.00 0.00  ? 67  GLU A H      1  
ATOM   1036  H HA     . GLU A 1 67  ? -4.673  -0.006  -33.938 1.00 0.00  ? 67  GLU A HA     1  
ATOM   1037  H HB2    . GLU A 1 67  ? -4.175  0.408   -30.989 1.00 0.00  ? 67  GLU A HB2    1  
ATOM   1038  H HB3    . GLU A 1 67  ? -5.160  -0.892  -31.643 1.00 0.00  ? 67  GLU A HB3    1  
ATOM   1039  H HG2    . GLU A 1 67  ? -3.283  -2.082  -31.635 1.00 0.00  ? 67  GLU A HG2    1  
ATOM   1040  H HG3    . GLU A 1 67  ? -2.844  -1.152  -33.069 1.00 0.00  ? 67  GLU A HG3    1  
ATOM   1041  H HE2    . GLU A 1 67  ? -0.985  -0.377  -29.659 1.00 0.00  ? 67  GLU A HE2    1  
ATOM   1042  N N      . ALA A 1 68  ? -6.142  2.559   -33.139 1.00 0.00  ? 68  ALA A N      1  
ATOM   1043  C CA     . ALA A 1 68  ? -7.420  3.258   -33.007 1.00 0.00  ? 68  ALA A CA     1  
ATOM   1044  C C      . ALA A 1 68  ? -7.501  4.482   -33.911 1.00 0.00  ? 68  ALA A C      1  
ATOM   1045  O O      . ALA A 1 68  ? -8.582  5.031   -34.120 1.00 0.00  ? 68  ALA A O      1  
ATOM   1046  C CB     . ALA A 1 68  ? -7.664  3.674   -31.567 1.00 0.00  ? 68  ALA A CB     1  
ATOM   1047  H H      . ALA A 1 68  ? -5.350  3.055   -33.418 1.00 0.00  ? 68  ALA A H      1  
ATOM   1048  H HA     . ALA A 1 68  ? -8.204  2.569   -33.289 1.00 0.00  ? 68  ALA A HA     1  
ATOM   1049  H HB1    . ALA A 1 68  ? -8.627  3.307   -31.246 1.00 0.00  ? 68  ALA A HB1    1  
ATOM   1050  H HB2    . ALA A 1 68  ? -7.652  4.755   -31.501 1.00 0.00  ? 68  ALA A HB2    1  
ATOM   1051  H HB3    . ALA A 1 68  ? -6.890  3.265   -30.935 1.00 0.00  ? 68  ALA A HB3    1  
ATOM   1052  N N      . GLY A 1 69  ? -6.366  4.920   -34.441 1.00 0.00  ? 69  GLY A N      1  
ATOM   1053  C CA     . GLY A 1 69  ? -6.360  6.084   -35.307 1.00 0.00  ? 69  GLY A CA     1  
ATOM   1054  C C      . GLY A 1 69  ? -6.396  7.392   -34.535 1.00 0.00  ? 69  GLY A C      1  
ATOM   1055  O O      . GLY A 1 69  ? -6.275  8.466   -35.123 1.00 0.00  ? 69  GLY A O      1  
ATOM   1056  H H      . GLY A 1 69  ? -5.530  4.458   -34.243 1.00 0.00  ? 69  GLY A H      1  
ATOM   1057  H HA2    . GLY A 1 69  ? -5.469  6.061   -35.914 1.00 0.00  ? 69  GLY A HA2    1  
ATOM   1058  H HA3    . GLY A 1 69  ? -7.223  6.036   -35.949 1.00 0.00  ? 69  GLY A HA3    1  
ATOM   1059  N N      . ILE A 1 70  ? -6.560  7.306   -33.216 1.00 0.00  ? 70  ILE A N      1  
ATOM   1060  C CA     . ILE A 1 70  ? -6.607  8.492   -32.377 1.00 0.00  ? 70  ILE A CA     1  
ATOM   1061  C C      . ILE A 1 70  ? -5.249  8.758   -31.731 1.00 0.00  ? 70  ILE A C      1  
ATOM   1062  O O      . ILE A 1 70  ? -4.664  7.877   -31.105 1.00 0.00  ? 70  ILE A O      1  
ATOM   1063  C CB     . ILE A 1 70  ? -7.681  8.376   -31.274 1.00 0.00  ? 70  ILE A CB     1  
ATOM   1064  C CG1    . ILE A 1 70  ? -8.946  7.697   -31.813 1.00 0.00  ? 70  ILE A CG1    1  
ATOM   1065  C CG2    . ILE A 1 70  ? -8.018  9.752   -30.728 1.00 0.00  ? 70  ILE A CG2    1  
ATOM   1066  C CD1    . ILE A 1 70  ? -9.706  6.918   -30.764 1.00 0.00  ? 70  ILE A CD1    1  
ATOM   1067  H H      . ILE A 1 70  ? -6.650  6.426   -32.798 1.00 0.00  ? 70  ILE A H      1  
ATOM   1068  H HA     . ILE A 1 70  ? -6.859  9.329   -33.006 1.00 0.00  ? 70  ILE A HA     1  
ATOM   1069  H HB     . ILE A 1 70  ? -7.277  7.783   -30.468 1.00 0.00  ? 70  ILE A HB     1  
ATOM   1070  H HG12   . ILE A 1 70  ? -9.609  8.452   -32.209 1.00 0.00  ? 70  ILE A HG12   1  
ATOM   1071  H HG13   . ILE A 1 70  ? -8.675  7.012   -32.603 1.00 0.00  ? 70  ILE A HG13   1  
ATOM   1072  H HG21   . ILE A 1 70  ? -8.430  10.361  -31.517 1.00 0.00  ? 70  ILE A HG21   1  
ATOM   1073  H HG22   . ILE A 1 70  ? -7.121  10.217  -30.345 1.00 0.00  ? 70  ILE A HG22   1  
ATOM   1074  H HG23   . ILE A 1 70  ? -8.742  9.656   -29.933 1.00 0.00  ? 70  ILE A HG23   1  
ATOM   1075  H HD11   . ILE A 1 70  ? -9.560  5.860   -30.924 1.00 0.00  ? 70  ILE A HD11   1  
ATOM   1076  H HD12   . ILE A 1 70  ? -10.759 7.151   -30.835 1.00 0.00  ? 70  ILE A HD12   1  
ATOM   1077  H HD13   . ILE A 1 70  ? -9.346  7.187   -29.782 1.00 0.00  ? 70  ILE A HD13   1  
ATOM   1078  N N      . GLU A 1 71  ? -4.753  9.979   -31.895 1.00 0.00  ? 71  GLU A N      1  
ATOM   1079  C CA     . GLU A 1 71  ? -3.462  10.364  -31.332 1.00 0.00  ? 71  GLU A CA     1  
ATOM   1080  C C      . GLU A 1 71  ? -3.647  11.304  -30.147 1.00 0.00  ? 71  GLU A C      1  
ATOM   1081  O O      . GLU A 1 71  ? -4.747  11.790  -29.898 1.00 0.00  ? 71  GLU A O      1  
ATOM   1082  C CB     . GLU A 1 71  ? -2.600  11.041  -32.396 1.00 0.00  ? 71  GLU A CB     1  
ATOM   1083  C CG     . GLU A 1 71  ? -3.158  12.373  -32.866 1.00 0.00  ? 71  GLU A CG     1  
ATOM   1084  C CD     . GLU A 1 71  ? -2.071  13.364  -33.233 1.00 0.00  ? 71  GLU A CD     1  
ATOM   1085  O OE1    . GLU A 1 71  ? -2.065  14.476  -32.662 1.00 0.00  ? 71  GLU A OE1    1  
ATOM   1086  O OE2    . GLU A 1 71  ? -1.227  13.029  -34.089 1.00 0.00  ? 71  GLU A OE2    1  
ATOM   1087  H H      . GLU A 1 71  ? -5.268  10.638  -32.406 1.00 0.00  ? 71  GLU A H      1  
ATOM   1088  H HA     . GLU A 1 71  ? -2.965  9.468   -30.991 1.00 0.00  ? 71  GLU A HA     1  
ATOM   1089  H HB2    . GLU A 1 71  ? -1.614  11.212  -31.989 1.00 0.00  ? 71  GLU A HB2    1  
ATOM   1090  H HB3    . GLU A 1 71  ? -2.521  10.386  -33.250 1.00 0.00  ? 71  GLU A HB3    1  
ATOM   1091  H HG2    . GLU A 1 71  ? -3.777  12.204  -33.734 1.00 0.00  ? 71  GLU A HG2    1  
ATOM   1092  H HG3    . GLU A 1 71  ? -3.759  12.797  -32.073 1.00 0.00  ? 71  GLU A HG3    1  
ATOM   1093  H HE2    . GLU A 1 71  ? -0.569  13.704  -34.273 1.00 0.00  ? 71  GLU A HE2    1  
ATOM   1094  N N      . ALA A 1 72  ? -2.561  11.567  -29.426 1.00 0.00  ? 72  ALA A N      1  
ATOM   1095  C CA     . ALA A 1 72  ? -2.608  12.462  -28.275 1.00 0.00  ? 72  ALA A CA     1  
ATOM   1096  C C      . ALA A 1 72  ? -3.303  13.771  -28.632 1.00 0.00  ? 72  ALA A C      1  
ATOM   1097  O O      . ALA A 1 72  ? -3.957  14.391  -27.793 1.00 0.00  ? 72  ALA A O      1  
ATOM   1098  C CB     . ALA A 1 72  ? -1.206  12.722  -27.753 1.00 0.00  ? 72  ALA A CB     1  
ATOM   1099  H H      . ALA A 1 72  ? -1.709  11.157  -29.679 1.00 0.00  ? 72  ALA A H      1  
ATOM   1100  H HA     . ALA A 1 72  ? -3.169  11.973  -27.494 1.00 0.00  ? 72  ALA A HA     1  
ATOM   1101  H HB1    . ALA A 1 72  ? -0.582  11.869  -27.968 1.00 0.00  ? 72  ALA A HB1    1  
ATOM   1102  H HB2    . ALA A 1 72  ? -1.246  12.882  -26.687 1.00 0.00  ? 72  ALA A HB2    1  
ATOM   1103  H HB3    . ALA A 1 72  ? -0.799  13.598  -28.237 1.00 0.00  ? 72  ALA A HB3    1  
ATOM   1104  N N      . GLY A 1 73  ? -3.165  14.181  -29.891 1.00 0.00  ? 73  GLY A N      1  
ATOM   1105  C CA     . GLY A 1 73  ? -3.793  15.406  -30.345 1.00 0.00  ? 73  GLY A CA     1  
ATOM   1106  C C      . GLY A 1 73  ? -5.297  15.262  -30.482 1.00 0.00  ? 73  GLY A C      1  
ATOM   1107  O O      . GLY A 1 73  ? -6.025  16.255  -30.470 1.00 0.00  ? 73  GLY A O      1  
ATOM   1108  H H      . GLY A 1 73  ? -2.638  13.640  -30.517 1.00 0.00  ? 73  GLY A H      1  
ATOM   1109  H HA2    . GLY A 1 73  ? -3.578  16.193  -29.638 1.00 0.00  ? 73  GLY A HA2    1  
ATOM   1110  H HA3    . GLY A 1 73  ? -3.380  15.677  -31.306 1.00 0.00  ? 73  GLY A HA3    1  
ATOM   1111  N N      . GLN A 1 74  ? -5.763  14.022  -30.606 1.00 0.00  ? 74  GLN A N      1  
ATOM   1112  C CA     . GLN A 1 74  ? -7.190  13.751  -30.738 1.00 0.00  ? 74  GLN A CA     1  
ATOM   1113  C C      . GLN A 1 74  ? -7.803  13.371  -29.393 1.00 0.00  ? 74  GLN A C      1  
ATOM   1114  O O      . GLN A 1 74  ? -9.018  13.216  -29.279 1.00 0.00  ? 74  GLN A O      1  
ATOM   1115  C CB     . GLN A 1 74  ? -7.433  12.634  -31.755 1.00 0.00  ? 74  GLN A CB     1  
ATOM   1116  C CG     . GLN A 1 74  ? -7.154  13.045  -33.191 1.00 0.00  ? 74  GLN A CG     1  
ATOM   1117  C CD     . GLN A 1 74  ? -8.313  13.790  -33.823 1.00 0.00  ? 74  GLN A CD     1  
ATOM   1118  O OE1    . GLN A 1 74  ? -8.157  14.915  -34.299 1.00 0.00  ? 74  GLN A OE1    1  
ATOM   1119  N NE2    . GLN A 1 74  ? -9.484  13.166  -33.828 1.00 0.00  ? 74  GLN A NE2    1  
ATOM   1120  H H      . GLN A 1 74  ? -5.134  13.271  -30.603 1.00 0.00  ? 74  GLN A H      1  
ATOM   1121  H HA     . GLN A 1 74  ? -7.665  14.656  -31.088 1.00 0.00  ? 74  GLN A HA     1  
ATOM   1122  H HB2    . GLN A 1 74  ? -6.796  11.798  -31.513 1.00 0.00  ? 74  GLN A HB2    1  
ATOM   1123  H HB3    . GLN A 1 74  ? -8.465  12.321  -31.687 1.00 0.00  ? 74  GLN A HB3    1  
ATOM   1124  H HG2    . GLN A 1 74  ? -6.282  13.682  -33.209 1.00 0.00  ? 74  GLN A HG2    1  
ATOM   1125  H HG3    . GLN A 1 74  ? -6.959  12.154  -33.773 1.00 0.00  ? 74  GLN A HG3    1  
ATOM   1126  H HE21   . GLN A 1 74  ? -9.532  12.271  -33.431 1.00 0.00  ? 74  GLN A HE21   1  
ATOM   1127  H HE22   . GLN A 1 74  ? -10.251 13.625  -34.227 1.00 0.00  ? 74  GLN A HE22   1  
ATOM   1128  N N      . LEU A 1 75  ? -6.961  13.233  -28.372 1.00 0.00  ? 75  LEU A N      1  
ATOM   1129  C CA     . LEU A 1 75  ? -7.435  12.892  -27.040 1.00 0.00  ? 75  LEU A CA     1  
ATOM   1130  C C      . LEU A 1 75  ? -6.832  13.837  -26.006 1.00 0.00  ? 75  LEU A C      1  
ATOM   1131  O O      . LEU A 1 75  ? -6.247  14.862  -26.355 1.00 0.00  ? 75  LEU A O      1  
ATOM   1132  C CB     . LEU A 1 75  ? -7.119  11.428  -26.675 1.00 0.00  ? 75  LEU A CB     1  
ATOM   1133  C CG     . LEU A 1 75  ? -6.318  10.626  -27.708 1.00 0.00  ? 75  LEU A CG     1  
ATOM   1134  C CD1    . LEU A 1 75  ? -4.899  10.389  -27.215 1.00 0.00  ? 75  LEU A CD1    1  
ATOM   1135  C CD2    . LEU A 1 75  ? -6.996  9.298   -27.999 1.00 0.00  ? 75  LEU A CD2    1  
ATOM   1136  H H      . LEU A 1 75  ? -6.003  13.378  -28.513 1.00 0.00  ? 75  LEU A H      1  
ATOM   1137  H HA     . LEU A 1 75  ? -8.504  13.027  -27.036 1.00 0.00  ? 75  LEU A HA     1  
ATOM   1138  H HB2    . LEU A 1 75  ? -6.565  11.424  -25.747 1.00 0.00  ? 75  LEU A HB2    1  
ATOM   1139  H HB3    . LEU A 1 75  ? -8.056  10.917  -26.508 1.00 0.00  ? 75  LEU A HB3    1  
ATOM   1140  H HG     . LEU A 1 75  ? -6.265  11.183  -28.629 1.00 0.00  ? 75  LEU A HG     1  
ATOM   1141  H HD11   . LEU A 1 75  ? -4.217  10.419  -28.050 1.00 0.00  ? 75  LEU A HD11   1  
ATOM   1142  H HD12   . LEU A 1 75  ? -4.843  9.420   -26.737 1.00 0.00  ? 75  LEU A HD12   1  
ATOM   1143  H HD13   . LEU A 1 75  ? -4.634  11.158  -26.504 1.00 0.00  ? 75  LEU A HD13   1  
ATOM   1144  H HD21   . LEU A 1 75  ? -6.838  8.623   -27.169 1.00 0.00  ? 75  LEU A HD21   1  
ATOM   1145  H HD22   . LEU A 1 75  ? -6.577  8.867   -28.898 1.00 0.00  ? 75  LEU A HD22   1  
ATOM   1146  H HD23   . LEU A 1 75  ? -8.054  9.458   -28.137 1.00 0.00  ? 75  LEU A HD23   1  
ATOM   1147  N N      . THR A 1 76  ? -6.980  13.487  -24.737 1.00 0.00  ? 76  THR A N      1  
ATOM   1148  C CA     . THR A 1 76  ? -6.455  14.304  -23.648 1.00 0.00  ? 76  THR A CA     1  
ATOM   1149  C C      . THR A 1 76  ? -5.858  13.432  -22.555 1.00 0.00  ? 76  THR A C      1  
ATOM   1150  O O      . THR A 1 76  ? -6.575  12.926  -21.690 1.00 0.00  ? 76  THR A O      1  
ATOM   1151  C CB     . THR A 1 76  ? -7.556  15.182  -23.060 1.00 0.00  ? 76  THR A CB     1  
ATOM   1152  O OG1    . THR A 1 76  ? -8.162  15.973  -24.065 1.00 0.00  ? 76  THR A OG1    1  
ATOM   1153  C CG2    . THR A 1 76  ? -7.046  16.110  -21.981 1.00 0.00  ? 76  THR A CG2    1  
ATOM   1154  H H      . THR A 1 76  ? -7.456  12.660  -24.526 1.00 0.00  ? 76  THR A H      1  
ATOM   1155  H HA     . THR A 1 76  ? -5.678  14.936  -24.053 1.00 0.00  ? 76  THR A HA     1  
ATOM   1156  H HB     . THR A 1 76  ? -8.312  14.548  -22.621 1.00 0.00  ? 76  THR A HB     1  
ATOM   1157  H HG1    . THR A 1 76  ? -8.586  15.402  -24.711 1.00 0.00  ? 76  THR A HG1    1  
ATOM   1158  H HG21   . THR A 1 76  ? -5.981  15.965  -21.859 1.00 0.00  ? 76  THR A HG21   1  
ATOM   1159  H HG22   . THR A 1 76  ? -7.550  15.891  -21.052 1.00 0.00  ? 76  THR A HG22   1  
ATOM   1160  H HG23   . THR A 1 76  ? -7.241  17.133  -22.266 1.00 0.00  ? 76  THR A HG23   1  
ATOM   1161  N N      . ILE A 1 77  ? -4.543  13.267  -22.592 1.00 0.00  ? 77  ILE A N      1  
ATOM   1162  C CA     . ILE A 1 77  ? -3.852  12.457  -21.601 1.00 0.00  ? 77  ILE A CA     1  
ATOM   1163  C C      . ILE A 1 77  ? -3.843  13.145  -20.244 1.00 0.00  ? 77  ILE A C      1  
ATOM   1164  O O      . ILE A 1 77  ? -3.211  14.185  -20.066 1.00 0.00  ? 77  ILE A O      1  
ATOM   1165  C CB     . ILE A 1 77  ? -2.399  12.145  -22.013 1.00 0.00  ? 77  ILE A CB     1  
ATOM   1166  C CG1    . ILE A 1 77  ? -2.307  11.822  -23.506 1.00 0.00  ? 77  ILE A CG1    1  
ATOM   1167  C CG2    . ILE A 1 77  ? -1.871  10.980  -21.191 1.00 0.00  ? 77  ILE A CG2    1  
ATOM   1168  C CD1    . ILE A 1 77  ? -3.049  10.561  -23.894 1.00 0.00  ? 77  ILE A CD1    1  
ATOM   1169  H H      . ILE A 1 77  ? -4.030  13.705  -23.298 1.00 0.00  ? 77  ILE A H      1  
ATOM   1170  H HA     . ILE A 1 77  ? -4.383  11.521  -21.514 1.00 0.00  ? 77  ILE A HA     1  
ATOM   1171  H HB     . ILE A 1 77  ? -1.791  13.011  -21.798 1.00 0.00  ? 77  ILE A HB     1  
ATOM   1172  H HG12   . ILE A 1 77  ? -2.721  12.639  -24.077 1.00 0.00  ? 77  ILE A HG12   1  
ATOM   1173  H HG13   . ILE A 1 77  ? -1.271  11.692  -23.776 1.00 0.00  ? 77  ILE A HG13   1  
ATOM   1174  H HG21   . ILE A 1 77  ? -2.387  10.945  -20.244 1.00 0.00  ? 77  ILE A HG21   1  
ATOM   1175  H HG22   . ILE A 1 77  ? -0.814  11.108  -21.020 1.00 0.00  ? 77  ILE A HG22   1  
ATOM   1176  H HG23   . ILE A 1 77  ? -2.041  10.055  -21.727 1.00 0.00  ? 77  ILE A HG23   1  
ATOM   1177  H HD11   . ILE A 1 77  ? -3.633  10.220  -23.052 1.00 0.00  ? 77  ILE A HD11   1  
ATOM   1178  H HD12   . ILE A 1 77  ? -2.340  9.797   -24.173 1.00 0.00  ? 77  ILE A HD12   1  
ATOM   1179  H HD13   . ILE A 1 77  ? -3.703  10.768  -24.727 1.00 0.00  ? 77  ILE A HD13   1  
ATOM   1180  N N      . ILE A 1 78  ? -4.553  12.557  -19.289 1.00 0.00  ? 78  ILE A N      1  
ATOM   1181  C CA     . ILE A 1 78  ? -4.631  13.112  -17.946 1.00 0.00  ? 78  ILE A CA     1  
ATOM   1182  C C      . ILE A 1 78  ? -3.334  12.860  -17.184 1.00 0.00  ? 78  ILE A C      1  
ATOM   1183  O O      . ILE A 1 78  ? -2.786  11.758  -17.213 1.00 0.00  ? 78  ILE A O      1  
ATOM   1184  C CB     . ILE A 1 78  ? -5.840  12.527  -17.172 1.00 0.00  ? 78  ILE A CB     1  
ATOM   1185  C CG1    . ILE A 1 78  ? -6.892  13.612  -16.941 1.00 0.00  ? 78  ILE A CG1    1  
ATOM   1186  C CG2    . ILE A 1 78  ? -5.417  11.907  -15.847 1.00 0.00  ? 78  ILE A CG2    1  
ATOM   1187  C CD1    . ILE A 1 78  ? -7.590  14.053  -18.206 1.00 0.00  ? 78  ILE A CD1    1  
ATOM   1188  H H      . ILE A 1 78  ? -5.037  11.730  -19.491 1.00 0.00  ? 78  ILE A H      1  
ATOM   1189  H HA     . ILE A 1 78  ? -4.775  14.179  -18.041 1.00 0.00  ? 78  ILE A HA     1  
ATOM   1190  H HB     . ILE A 1 78  ? -6.275  11.748  -17.777 1.00 0.00  ? 78  ILE A HB     1  
ATOM   1191  H HG12   . ILE A 1 78  ? -7.639  13.237  -16.262 1.00 0.00  ? 78  ILE A HG12   1  
ATOM   1192  H HG13   . ILE A 1 78  ? -6.419  14.475  -16.502 1.00 0.00  ? 78  ILE A HG13   1  
ATOM   1193  H HG21   . ILE A 1 78  ? -4.735  11.091  -16.033 1.00 0.00  ? 78  ILE A HG21   1  
ATOM   1194  H HG22   . ILE A 1 78  ? -6.289  11.537  -15.327 1.00 0.00  ? 78  ILE A HG22   1  
ATOM   1195  H HG23   . ILE A 1 78  ? -4.928  12.655  -15.239 1.00 0.00  ? 78  ILE A HG23   1  
ATOM   1196  H HD11   . ILE A 1 78  ? -8.303  14.829  -17.973 1.00 0.00  ? 78  ILE A HD11   1  
ATOM   1197  H HD12   . ILE A 1 78  ? -8.103  13.212  -18.649 1.00 0.00  ? 78  ILE A HD12   1  
ATOM   1198  H HD13   . ILE A 1 78  ? -6.859  14.436  -18.905 1.00 0.00  ? 78  ILE A HD13   1  
ATOM   1199  N N      . GLU A 1 79  ? -2.846  13.895  -16.512 1.00 0.00  ? 79  GLU A N      1  
ATOM   1200  C CA     . GLU A 1 79  ? -1.606  13.795  -15.748 1.00 0.00  ? 79  GLU A CA     1  
ATOM   1201  C C      . GLU A 1 79  ? -1.880  13.463  -14.286 1.00 0.00  ? 79  GLU A C      1  
ATOM   1202  O O      . GLU A 1 79  ? -2.929  13.811  -13.744 1.00 0.00  ? 79  GLU A O      1  
ATOM   1203  C CB     . GLU A 1 79  ? -0.812  15.097  -15.845 1.00 0.00  ? 79  GLU A CB     1  
ATOM   1204  C CG     . GLU A 1 79  ? -0.472  15.500  -17.271 1.00 0.00  ? 79  GLU A CG     1  
ATOM   1205  C CD     . GLU A 1 79  ? 0.058   16.917  -17.367 1.00 0.00  ? 79  GLU A CD     1  
ATOM   1206  O OE1    . GLU A 1 79  ? 1.186   17.097  -17.871 1.00 0.00  ? 79  GLU A OE1    1  
ATOM   1207  O OE2    . GLU A 1 79  ? -0.656  17.847  -16.934 1.00 0.00  ? 79  GLU A OE2    1  
ATOM   1208  H H      . GLU A 1 79  ? -3.331  14.746  -16.533 1.00 0.00  ? 79  GLU A H      1  
ATOM   1209  H HA     . GLU A 1 79  ? -1.018  12.998  -16.180 1.00 0.00  ? 79  GLU A HA     1  
ATOM   1210  H HB2    . GLU A 1 79  ? -1.389  15.891  -15.397 1.00 0.00  ? 79  GLU A HB2    1  
ATOM   1211  H HB3    . GLU A 1 79  ? 0.111   14.982  -15.298 1.00 0.00  ? 79  GLU A HB3    1  
ATOM   1212  H HG2    . GLU A 1 79  ? 0.280   14.826  -17.654 1.00 0.00  ? 79  GLU A HG2    1  
ATOM   1213  H HG3    . GLU A 1 79  ? -1.364  15.423  -17.876 1.00 0.00  ? 79  GLU A HG3    1  
ATOM   1214  H HE2    . GLU A 1 79  ? -0.260  18.717  -17.026 1.00 0.00  ? 79  GLU A HE2    1  
ATOM   1215  N N      . GLY A 1 80  ? -0.927  12.789  -13.654 1.00 0.00  ? 80  GLY A N      1  
ATOM   1216  C CA     . GLY A 1 80  ? -1.077  12.422  -12.260 1.00 0.00  ? 80  GLY A CA     1  
ATOM   1217  C C      . GLY A 1 80  ? -1.467  10.968  -12.081 1.00 0.00  ? 80  GLY A C      1  
ATOM   1218  O O      . GLY A 1 80  ? -1.251  10.386  -11.018 1.00 0.00  ? 80  GLY A O      1  
ATOM   1219  H H      . GLY A 1 80  ? -0.112  12.540  -14.138 1.00 0.00  ? 80  GLY A H      1  
ATOM   1220  H HA2    . GLY A 1 80  ? -0.142  12.598  -11.750 1.00 0.00  ? 80  GLY A HA2    1  
ATOM   1221  H HA3    . GLY A 1 80  ? -1.841  13.044  -11.815 1.00 0.00  ? 80  GLY A HA3    1  
ATOM   1222  N N      . PHE A 1 81  ? -2.044  10.378  -13.124 1.00 0.00  ? 81  PHE A N      1  
ATOM   1223  C CA     . PHE A 1 81  ? -2.465  8.985   -13.076 1.00 0.00  ? 81  PHE A CA     1  
ATOM   1224  C C      . PHE A 1 81  ? -1.526  8.105   -13.895 1.00 0.00  ? 81  PHE A C      1  
ATOM   1225  O O      . PHE A 1 81  ? -1.280  8.370   -15.071 1.00 0.00  ? 81  PHE A O      1  
ATOM   1226  C CB     . PHE A 1 81  ? -3.896  8.848   -13.598 1.00 0.00  ? 81  PHE A CB     1  
ATOM   1227  C CG     . PHE A 1 81  ? -4.398  7.435   -13.606 1.00 0.00  ? 81  PHE A CG     1  
ATOM   1228  C CD1    . PHE A 1 81  ? -3.988  6.545   -14.585 1.00 0.00  ? 81  PHE A CD1    1  
ATOM   1229  C CD2    . PHE A 1 81  ? -5.280  6.997   -12.634 1.00 0.00  ? 81  PHE A CD2    1  
ATOM   1230  C CE1    . PHE A 1 81  ? -4.451  5.243   -14.594 1.00 0.00  ? 81  PHE A CE1    1  
ATOM   1231  C CE2    . PHE A 1 81  ? -5.746  5.698   -12.637 1.00 0.00  ? 81  PHE A CE2    1  
ATOM   1232  C CZ     . PHE A 1 81  ? -5.331  4.818   -13.617 1.00 0.00  ? 81  PHE A CZ     1  
ATOM   1233  H H      . PHE A 1 81  ? -2.192  10.895  -13.944 1.00 0.00  ? 81  PHE A H      1  
ATOM   1234  H HA     . PHE A 1 81  ? -2.435  8.664   -12.045 1.00 0.00  ? 81  PHE A HA     1  
ATOM   1235  H HB2    . PHE A 1 81  ? -4.557  9.433   -12.973 1.00 0.00  ? 81  PHE A HB2    1  
ATOM   1236  H HB3    . PHE A 1 81  ? -3.939  9.225   -14.610 1.00 0.00  ? 81  PHE A HB3    1  
ATOM   1237  H HD1    . PHE A 1 81  ? -3.300  6.876   -15.348 1.00 0.00  ? 81  PHE A HD1    1  
ATOM   1238  H HD2    . PHE A 1 81  ? -5.604  7.682   -11.866 1.00 0.00  ? 81  PHE A HD2    1  
ATOM   1239  H HE1    . PHE A 1 81  ? -4.123  4.559   -15.362 1.00 0.00  ? 81  PHE A HE1    1  
ATOM   1240  H HE2    . PHE A 1 81  ? -6.433  5.370   -11.873 1.00 0.00  ? 81  PHE A HE2    1  
ATOM   1241  H HZ     . PHE A 1 81  ? -5.694  3.801   -13.623 1.00 0.00  ? 81  PHE A HZ     1  
ATOM   1242  N N      . LYS A 1 82  ? -1.003  7.055   -13.266 1.00 0.00  ? 82  LYS A N      1  
ATOM   1243  C CA     . LYS A 1 82  ? -0.094  6.141   -13.944 1.00 0.00  ? 82  LYS A CA     1  
ATOM   1244  C C      . LYS A 1 82  ? -0.057  4.777   -13.260 1.00 0.00  ? 82  LYS A C      1  
ATOM   1245  O O      . LYS A 1 82  ? 0.204   4.674   -12.062 1.00 0.00  ? 82  LYS A O      1  
ATOM   1246  C CB     . LYS A 1 82  ? 1.316   6.727   -13.999 1.00 0.00  ? 82  LYS A CB     1  
ATOM   1247  C CG     . LYS A 1 82  ? 1.934   6.676   -15.385 1.00 0.00  ? 82  LYS A CG     1  
ATOM   1248  C CD     . LYS A 1 82  ? 3.435   6.912   -15.341 1.00 0.00  ? 82  LYS A CD     1  
ATOM   1249  C CE     . LYS A 1 82  ? 4.159   5.797   -14.605 1.00 0.00  ? 82  LYS A CE     1  
ATOM   1250  N NZ     . LYS A 1 82  ? 5.034   6.317   -13.518 1.00 0.00  ? 82  LYS A NZ     1  
ATOM   1251  H H      . LYS A 1 82  ? -1.237  6.894   -12.328 1.00 0.00  ? 82  LYS A H      1  
ATOM   1252  H HA     . LYS A 1 82  ? -0.454  6.010   -14.953 1.00 0.00  ? 82  LYS A HA     1  
ATOM   1253  H HB2    . LYS A 1 82  ? 1.279   7.758   -13.679 1.00 0.00  ? 82  LYS A HB2    1  
ATOM   1254  H HB3    . LYS A 1 82  ? 1.951   6.170   -13.326 1.00 0.00  ? 82  LYS A HB3    1  
ATOM   1255  H HG2    . LYS A 1 82  ? 1.748   5.704   -15.815 1.00 0.00  ? 82  LYS A HG2    1  
ATOM   1256  H HG3    . LYS A 1 82  ? 1.477   7.436   -15.998 1.00 0.00  ? 82  LYS A HG3    1  
ATOM   1257  H HD2    . LYS A 1 82  ? 3.810   6.963   -16.354 1.00 0.00  ? 82  LYS A HD2    1  
ATOM   1258  H HD3    . LYS A 1 82  ? 3.628   7.850   -14.838 1.00 0.00  ? 82  LYS A HD3    1  
ATOM   1259  H HE2    . LYS A 1 82  ? 3.425   5.130   -14.174 1.00 0.00  ? 82  LYS A HE2    1  
ATOM   1260  H HE3    . LYS A 1 82  ? 4.765   5.251   -15.313 1.00 0.00  ? 82  LYS A HE3    1  
ATOM   1261  H HZ1    . LYS A 1 82  ? 5.993   5.928   -13.614 1.00 0.00  ? 82  LYS A HZ1    1  
ATOM   1262  H HZ2    . LYS A 1 82  ? 4.652   6.043   -12.590 1.00 0.00  ? 82  LYS A HZ2    1  
ATOM   1263  H HZ3    . LYS A 1 82  ? 5.085   7.356   -13.566 1.00 0.00  ? 82  LYS A HZ3    1  
ATOM   1264  N N      . ARG A 1 83  ? -0.304  3.736   -14.043 1.00 0.00  ? 83  ARG A N      1  
ATOM   1265  C CA     . ARG A 1 83  ? -0.290  2.368   -13.541 1.00 0.00  ? 83  ARG A CA     1  
ATOM   1266  C C      . ARG A 1 83  ? 0.073   1.407   -14.665 1.00 0.00  ? 83  ARG A C      1  
ATOM   1267  O O      . ARG A 1 83  ? -0.424  1.537   -15.784 1.00 0.00  ? 83  ARG A O      1  
ATOM   1268  C CB     . ARG A 1 83  ? -1.650  1.995   -12.951 1.00 0.00  ? 83  ARG A CB     1  
ATOM   1269  C CG     . ARG A 1 83  ? -1.625  0.720   -12.125 1.00 0.00  ? 83  ARG A CG     1  
ATOM   1270  C CD     . ARG A 1 83  ? -1.400  1.013   -10.651 1.00 0.00  ? 83  ARG A CD     1  
ATOM   1271  N NE     . ARG A 1 83  ? -0.957  -0.171  -9.918  1.00 0.00  ? 83  ARG A NE     1  
ATOM   1272  C CZ     . ARG A 1 83  ? 0.282   -0.651  -9.964  1.00 0.00  ? 83  ARG A CZ     1  
ATOM   1273  N NH1    . ARG A 1 83  ? 1.207   -0.051  -10.702 1.00 0.00  ? 83  ARG A NH1    1  
ATOM   1274  N NH2    . ARG A 1 83  ? 0.600   -1.736  -9.268  1.00 0.00  ? 83  ARG A NH2    1  
ATOM   1275  H H      . ARG A 1 83  ? -0.492  3.892   -14.991 1.00 0.00  ? 83  ARG A H      1  
ATOM   1276  H HA     . ARG A 1 83  ? 0.462   2.304   -12.768 1.00 0.00  ? 83  ARG A HA     1  
ATOM   1277  H HB2    . ARG A 1 83  ? -1.989  2.803   -12.318 1.00 0.00  ? 83  ARG A HB2    1  
ATOM   1278  H HB3    . ARG A 1 83  ? -2.356  1.862   -13.757 1.00 0.00  ? 83  ARG A HB3    1  
ATOM   1279  H HG2    . ARG A 1 83  ? -2.570  0.209   -12.239 1.00 0.00  ? 83  ARG A HG2    1  
ATOM   1280  H HG3    . ARG A 1 83  ? -0.826  0.087   -12.485 1.00 0.00  ? 83  ARG A HG3    1  
ATOM   1281  H HD2    . ARG A 1 83  ? -0.646  1.781   -10.561 1.00 0.00  ? 83  ARG A HD2    1  
ATOM   1282  H HD3    . ARG A 1 83  ? -2.326  1.366   -10.223 1.00 0.00  ? 83  ARG A HD3    1  
ATOM   1283  H HE     . ARG A 1 83  ? -1.620  -0.633  -9.363  1.00 0.00  ? 83  ARG A HE     1  
ATOM   1284  H HH11   . ARG A 1 83  ? 0.976   0.767   -11.228 1.00 0.00  ? 83  ARG A HH11   1  
ATOM   1285  H HH12   . ARG A 1 83  ? 2.137   -0.419  -10.735 1.00 0.00  ? 83  ARG A HH12   1  
ATOM   1286  H HH21   . ARG A 1 83  ? -0.093  -2.191  -8.710  1.00 0.00  ? 83  ARG A HH21   1  
ATOM   1287  H HH22   . ARG A 1 83  ? 1.532   -2.096  -9.303  1.00 0.00  ? 83  ARG A HH22   1  
ATOM   1288  N N      . GLU A 1 84  ? 0.942   0.444   -14.372 1.00 0.00  ? 84  GLU A N      1  
ATOM   1289  C CA     . GLU A 1 84  ? 1.358   -0.522  -15.382 1.00 0.00  ? 84  GLU A CA     1  
ATOM   1290  C C      . GLU A 1 84  ? 0.984   -1.944  -14.987 1.00 0.00  ? 84  GLU A C      1  
ATOM   1291  O O      . GLU A 1 84  ? 1.041   -2.314  -13.813 1.00 0.00  ? 84  GLU A O      1  
ATOM   1292  C CB     . GLU A 1 84  ? 2.867   -0.427  -15.645 1.00 0.00  ? 84  GLU A CB     1  
ATOM   1293  C CG     . GLU A 1 84  ? 3.737   -0.969  -14.522 1.00 0.00  ? 84  GLU A CG     1  
ATOM   1294  C CD     . GLU A 1 84  ? 3.620   -0.162  -13.243 1.00 0.00  ? 84  GLU A CD     1  
ATOM   1295  O OE1    . GLU A 1 84  ? 3.783   1.074   -13.304 1.00 0.00  ? 84  GLU A OE1    1  
ATOM   1296  O OE2    . GLU A 1 84  ? 3.364   -0.768  -12.182 1.00 0.00  ? 84  GLU A OE2    1  
ATOM   1297  H H      . GLU A 1 84  ? 1.310   0.387   -13.467 1.00 0.00  ? 84  GLU A H      1  
ATOM   1298  H HA     . GLU A 1 84  ? 0.838   -0.272  -16.291 1.00 0.00  ? 84  GLU A HA     1  
ATOM   1299  H HB2    . GLU A 1 84  ? 3.097   -0.982  -16.541 1.00 0.00  ? 84  GLU A HB2    1  
ATOM   1300  H HB3    . GLU A 1 84  ? 3.124   0.602   -15.801 1.00 0.00  ? 84  GLU A HB3    1  
ATOM   1301  H HG2    . GLU A 1 84  ? 3.444   -1.982  -14.319 1.00 0.00  ? 84  GLU A HG2    1  
ATOM   1302  H HG3    . GLU A 1 84  ? 4.768   -0.952  -14.845 1.00 0.00  ? 84  GLU A HG3    1  
ATOM   1303  H HE2    . GLU A 1 84  ? 3.304   -0.198  -11.412 1.00 0.00  ? 84  GLU A HE2    1  
ATOM   1304  N N      . LEU A 1 85  ? 0.612   -2.742  -15.982 1.00 0.00  ? 85  LEU A N      1  
ATOM   1305  C CA     . LEU A 1 85  ? 0.239   -4.129  -15.751 1.00 0.00  ? 85  LEU A CA     1  
ATOM   1306  C C      . LEU A 1 85  ? 1.399   -5.051  -16.109 1.00 0.00  ? 85  LEU A C      1  
ATOM   1307  O O      . LEU A 1 85  ? 1.922   -5.005  -17.222 1.00 0.00  ? 85  LEU A O      1  
ATOM   1308  C CB     . LEU A 1 85  ? -0.999  -4.500  -16.574 1.00 0.00  ? 85  LEU A CB     1  
ATOM   1309  C CG     . LEU A 1 85  ? -2.150  -3.483  -16.542 1.00 0.00  ? 85  LEU A CG     1  
ATOM   1310  C CD1    . LEU A 1 85  ? -3.471  -4.169  -16.853 1.00 0.00  ? 85  LEU A CD1    1  
ATOM   1311  C CD2    . LEU A 1 85  ? -2.223  -2.779  -15.192 1.00 0.00  ? 85  LEU A CD2    1  
ATOM   1312  H H      . LEU A 1 85  ? 0.595   -2.391  -16.897 1.00 0.00  ? 85  LEU A H      1  
ATOM   1313  H HA     . LEU A 1 85  ? 0.013   -4.243  -14.706 1.00 0.00  ? 85  LEU A HA     1  
ATOM   1314  H HB2    . LEU A 1 85  ? -0.695  -4.629  -17.602 1.00 0.00  ? 85  LEU A HB2    1  
ATOM   1315  H HB3    . LEU A 1 85  ? -1.377  -5.443  -16.210 1.00 0.00  ? 85  LEU A HB3    1  
ATOM   1316  H HG     . LEU A 1 85  ? -1.977  -2.732  -17.302 1.00 0.00  ? 85  LEU A HG     1  
ATOM   1317  H HD11   . LEU A 1 85  ? -3.326  -5.236  -16.879 1.00 0.00  ? 85  LEU A HD11   1  
ATOM   1318  H HD12   . LEU A 1 85  ? -3.834  -3.838  -17.812 1.00 0.00  ? 85  LEU A HD12   1  
ATOM   1319  H HD13   . LEU A 1 85  ? -4.195  -3.923  -16.090 1.00 0.00  ? 85  LEU A HD13   1  
ATOM   1320  H HD21   . LEU A 1 85  ? -3.197  -2.326  -15.074 1.00 0.00  ? 85  LEU A HD21   1  
ATOM   1321  H HD22   . LEU A 1 85  ? -1.463  -2.012  -15.143 1.00 0.00  ? 85  LEU A HD22   1  
ATOM   1322  H HD23   . LEU A 1 85  ? -2.062  -3.496  -14.401 1.00 0.00  ? 85  LEU A HD23   1  
ATOM   1323  N N      . ASN A 1 86  ? 1.805   -5.882  -15.155 1.00 0.00  ? 86  ASN A N      1  
ATOM   1324  C CA     . ASN A 1 86  ? 2.913   -6.804  -15.370 1.00 0.00  ? 86  ASN A CA     1  
ATOM   1325  C C      . ASN A 1 86  ? 2.438   -8.251  -15.318 1.00 0.00  ? 86  ASN A C      1  
ATOM   1326  O O      . ASN A 1 86  ? 1.902   -8.705  -14.307 1.00 0.00  ? 86  ASN A O      1  
ATOM   1327  C CB     . ASN A 1 86  ? 4.000   -6.575  -14.320 1.00 0.00  ? 86  ASN A CB     1  
ATOM   1328  C CG     . ASN A 1 86  ? 4.914   -5.419  -14.677 1.00 0.00  ? 86  ASN A CG     1  
ATOM   1329  O OD1    . ASN A 1 86  ? 6.118   -5.600  -14.863 1.00 0.00  ? 86  ASN A OD1    1  
ATOM   1330  N ND2    . ASN A 1 86  ? 4.346   -4.225  -14.777 1.00 0.00  ? 86  ASN A ND2    1  
ATOM   1331  H H      . ASN A 1 86  ? 1.354   -5.869  -14.284 1.00 0.00  ? 86  ASN A H      1  
ATOM   1332  H HA     . ASN A 1 86  ? 3.323   -6.608  -16.349 1.00 0.00  ? 86  ASN A HA     1  
ATOM   1333  H HB2    . ASN A 1 86  ? 3.535   -6.360  -13.369 1.00 0.00  ? 86  ASN A HB2    1  
ATOM   1334  H HB3    . ASN A 1 86  ? 4.599   -7.470  -14.227 1.00 0.00  ? 86  ASN A HB3    1  
ATOM   1335  H HD21   . ASN A 1 86  ? 3.381   -4.155  -14.614 1.00 0.00  ? 86  ASN A HD21   1  
ATOM   1336  H HD22   . ASN A 1 86  ? 4.914   -3.459  -15.007 1.00 0.00  ? 86  ASN A HD22   1  
ATOM   1337  N N      . TYR A 1 87  ? 2.639   -8.968  -16.418 1.00 0.00  ? 87  TYR A N      1  
ATOM   1338  C CA     . TYR A 1 87  ? 2.234   -10.365 -16.508 1.00 0.00  ? 87  TYR A CA     1  
ATOM   1339  C C      . TYR A 1 87  ? 2.850   -11.037 -17.726 1.00 0.00  ? 87  TYR A C      1  
ATOM   1340  O O      . TYR A 1 87  ? 3.008   -10.418 -18.780 1.00 0.00  ? 87  TYR A O      1  
ATOM   1341  C CB     . TYR A 1 87  ? 0.716   -10.477 -16.581 1.00 0.00  ? 87  TYR A CB     1  
ATOM   1342  C CG     . TYR A 1 87  ? 0.101   -9.599  -17.647 1.00 0.00  ? 87  TYR A CG     1  
ATOM   1343  C CD1    . TYR A 1 87  ? 0.265   -9.895  -18.994 1.00 0.00  ? 87  TYR A CD1    1  
ATOM   1344  C CD2    . TYR A 1 87  ? -0.638  -8.471  -17.309 1.00 0.00  ? 87  TYR A CD2    1  
ATOM   1345  C CE1    . TYR A 1 87  ? -0.290  -9.097  -19.975 1.00 0.00  ? 87  TYR A CE1    1  
ATOM   1346  C CE2    . TYR A 1 87  ? -1.197  -7.666  -18.284 1.00 0.00  ? 87  TYR A CE2    1  
ATOM   1347  C CZ     . TYR A 1 87  ? -1.021  -7.984  -19.616 1.00 0.00  ? 87  TYR A CZ     1  
ATOM   1348  O OH     . TYR A 1 87  ? -1.576  -7.184  -20.590 1.00 0.00  ? 87  TYR A OH     1  
ATOM   1349  H H      . TYR A 1 87  ? 3.070   -8.546  -17.191 1.00 0.00  ? 87  TYR A H      1  
ATOM   1350  H HA     . TYR A 1 87  ? 2.580   -10.870 -15.619 1.00 0.00  ? 87  TYR A HA     1  
ATOM   1351  H HB2    . TYR A 1 87  ? 0.448   -11.500 -16.800 1.00 0.00  ? 87  TYR A HB2    1  
ATOM   1352  H HB3    . TYR A 1 87  ? 0.297   -10.199 -15.631 1.00 0.00  ? 87  TYR A HB3    1  
ATOM   1353  H HD1    . TYR A 1 87  ? 0.838   -10.769 -19.273 1.00 0.00  ? 87  TYR A HD1    1  
ATOM   1354  H HD2    . TYR A 1 87  ? -0.775  -8.225  -16.265 1.00 0.00  ? 87  TYR A HD2    1  
ATOM   1355  H HE1    . TYR A 1 87  ? -0.153  -9.348  -21.018 1.00 0.00  ? 87  TYR A HE1    1  
ATOM   1356  H HE2    . TYR A 1 87  ? -1.768  -6.794  -18.003 1.00 0.00  ? 87  TYR A HE2    1  
ATOM   1357  H HH     . TYR A 1 87  ? -2.530  -7.164  -20.484 1.00 0.00  ? 87  TYR A HH     1  
ATOM   1358  N N      . VAL A 1 88  ? 3.185   -12.309 -17.573 1.00 0.00  ? 88  VAL A N      1  
ATOM   1359  C CA     . VAL A 1 88  ? 3.776   -13.077 -18.662 1.00 0.00  ? 88  VAL A CA     1  
ATOM   1360  C C      . VAL A 1 88  ? 2.691   -13.633 -19.579 1.00 0.00  ? 88  VAL A C      1  
ATOM   1361  O O      . VAL A 1 88  ? 1.938   -14.532 -19.205 1.00 0.00  ? 88  VAL A O      1  
ATOM   1362  C CB     . VAL A 1 88  ? 4.651   -14.227 -18.123 1.00 0.00  ? 88  VAL A CB     1  
ATOM   1363  C CG1    . VAL A 1 88  ? 3.805   -15.273 -17.421 1.00 0.00  ? 88  VAL A CG1    1  
ATOM   1364  C CG2    . VAL A 1 88  ? 5.459   -14.855 -19.245 1.00 0.00  ? 88  VAL A CG2    1  
ATOM   1365  H H      . VAL A 1 88  ? 3.021   -12.740 -16.710 1.00 0.00  ? 88  VAL A H      1  
ATOM   1366  H HA     . VAL A 1 88  ? 4.403   -12.414 -19.235 1.00 0.00  ? 88  VAL A HA     1  
ATOM   1367  H HB     . VAL A 1 88  ? 5.341   -13.815 -17.401 1.00 0.00  ? 88  VAL A HB     1  
ATOM   1368  H HG11   . VAL A 1 88  ? 4.216   -15.464 -16.438 1.00 0.00  ? 88  VAL A HG11   1  
ATOM   1369  H HG12   . VAL A 1 88  ? 3.813   -16.185 -18.001 1.00 0.00  ? 88  VAL A HG12   1  
ATOM   1370  H HG13   . VAL A 1 88  ? 2.788   -14.912 -17.330 1.00 0.00  ? 88  VAL A HG13   1  
ATOM   1371  H HG21   . VAL A 1 88  ? 5.738   -15.861 -18.968 1.00 0.00  ? 88  VAL A HG21   1  
ATOM   1372  H HG22   . VAL A 1 88  ? 6.349   -14.268 -19.417 1.00 0.00  ? 88  VAL A HG22   1  
ATOM   1373  H HG23   . VAL A 1 88  ? 4.864   -14.880 -20.144 1.00 0.00  ? 88  VAL A HG23   1  
ATOM   1374  N N      . ALA A 1 89  ? 2.601   -13.078 -20.781 1.00 0.00  ? 89  ALA A N      1  
ATOM   1375  C CA     . ALA A 1 89  ? 1.594   -13.508 -21.741 1.00 0.00  ? 89  ALA A CA     1  
ATOM   1376  C C      . ALA A 1 89  ? 1.900   -14.904 -22.290 1.00 0.00  ? 89  ALA A C      1  
ATOM   1377  O O      . ALA A 1 89  ? 1.522   -15.908 -21.687 1.00 0.00  ? 89  ALA A O      1  
ATOM   1378  C CB     . ALA A 1 89  ? 1.472   -12.487 -22.863 1.00 0.00  ? 89  ALA A CB     1  
ATOM   1379  H H      . ALA A 1 89  ? 3.217   -12.356 -21.023 1.00 0.00  ? 89  ALA A H      1  
ATOM   1380  H HA     . ALA A 1 89  ? 0.649   -13.546 -21.218 1.00 0.00  ? 89  ALA A HA     1  
ATOM   1381  H HB1    . ALA A 1 89  ? 0.627   -11.842 -22.673 1.00 0.00  ? 89  ALA A HB1    1  
ATOM   1382  H HB2    . ALA A 1 89  ? 1.330   -12.997 -23.802 1.00 0.00  ? 89  ALA A HB2    1  
ATOM   1383  H HB3    . ALA A 1 89  ? 2.374   -11.892 -22.910 1.00 0.00  ? 89  ALA A HB3    1  
ATOM   1384  N N      . ARG A 1 90  ? 2.587   -14.968 -23.428 1.00 0.00  ? 90  ARG A N      1  
ATOM   1385  C CA     . ARG A 1 90  ? 2.931   -16.252 -24.033 1.00 0.00  ? 90  ARG A CA     1  
ATOM   1386  C C      . ARG A 1 90  ? 4.064   -16.917 -23.258 1.00 0.00  ? 90  ARG A C      1  
ATOM   1387  O O      . ARG A 1 90  ? 3.984   -18.095 -22.909 1.00 0.00  ? 90  ARG A O      1  
ATOM   1388  C CB     . ARG A 1 90  ? 3.322   -16.084 -25.507 1.00 0.00  ? 90  ARG A CB     1  
ATOM   1389  C CG     . ARG A 1 90  ? 4.252   -14.909 -25.784 1.00 0.00  ? 90  ARG A CG     1  
ATOM   1390  C CD     . ARG A 1 90  ? 4.215   -14.508 -27.251 1.00 0.00  ? 90  ARG A CD     1  
ATOM   1391  N NE     . ARG A 1 90  ? 5.199   -13.474 -27.562 1.00 0.00  ? 90  ARG A NE     1  
ATOM   1392  C CZ     . ARG A 1 90  ? 6.336   -13.695 -28.221 1.00 0.00  ? 90  ARG A CZ     1  
ATOM   1393  N NH1    . ARG A 1 90  ? 6.652   -14.917 -28.639 1.00 0.00  ? 90  ARG A NH1    1  
ATOM   1394  N NH2    . ARG A 1 90  ? 7.165   -12.689 -28.464 1.00 0.00  ? 90  ARG A NH2    1  
ATOM   1395  H H      . ARG A 1 90  ? 2.868   -14.142 -23.868 1.00 0.00  ? 90  ARG A H      1  
ATOM   1396  H HA     . ARG A 1 90  ? 2.057   -16.885 -23.974 1.00 0.00  ? 90  ARG A HA     1  
ATOM   1397  H HB2    . ARG A 1 90  ? 3.815   -16.985 -25.840 1.00 0.00  ? 90  ARG A HB2    1  
ATOM   1398  H HB3    . ARG A 1 90  ? 2.422   -15.945 -26.089 1.00 0.00  ? 90  ARG A HB3    1  
ATOM   1399  H HG2    . ARG A 1 90  ? 3.946   -14.066 -25.186 1.00 0.00  ? 90  ARG A HG2    1  
ATOM   1400  H HG3    . ARG A 1 90  ? 5.260   -15.191 -25.525 1.00 0.00  ? 90  ARG A HG3    1  
ATOM   1401  H HD2    . ARG A 1 90  ? 4.413   -15.378 -27.856 1.00 0.00  ? 90  ARG A HD2    1  
ATOM   1402  H HD3    . ARG A 1 90  ? 3.228   -14.131 -27.481 1.00 0.00  ? 90  ARG A HD3    1  
ATOM   1403  H HE     . ARG A 1 90  ? 5.001   -12.559 -27.267 1.00 0.00  ? 90  ARG A HE     1  
ATOM   1404  H HH11   . ARG A 1 90  ? 6.039   -15.684 -28.459 1.00 0.00  ? 90  ARG A HH11   1  
ATOM   1405  H HH12   . ARG A 1 90  ? 7.506   -15.068 -29.135 1.00 0.00  ? 90  ARG A HH12   1  
ATOM   1406  H HH21   . ARG A 1 90  ? 6.934   -11.767 -28.151 1.00 0.00  ? 90  ARG A HH21   1  
ATOM   1407  H HH22   . ARG A 1 90  ? 8.019   -12.851 -28.957 1.00 0.00  ? 90  ARG A HH22   1  
ATOM   1408  N N      . ASN A 1 91  ? 5.111   -16.149 -22.982 1.00 0.00  ? 91  ASN A N      1  
ATOM   1409  C CA     . ASN A 1 91  ? 6.256   -16.654 -22.235 1.00 0.00  ? 91  ASN A CA     1  
ATOM   1410  C C      . ASN A 1 91  ? 7.211   -15.518 -21.880 1.00 0.00  ? 91  ASN A C      1  
ATOM   1411  O O      . ASN A 1 91  ? 8.418   -15.721 -21.762 1.00 0.00  ? 91  ASN A O      1  
ATOM   1412  C CB     . ASN A 1 91  ? 6.992   -17.728 -23.041 1.00 0.00  ? 91  ASN A CB     1  
ATOM   1413  C CG     . ASN A 1 91  ? 7.565   -17.192 -24.340 1.00 0.00  ? 91  ASN A CG     1  
ATOM   1414  O OD1    . ASN A 1 91  ? 6.875   -16.525 -25.106 1.00 0.00  ? 91  ASN A OD1    1  
ATOM   1415  N ND2    . ASN A 1 91  ? 8.834   -17.488 -24.593 1.00 0.00  ? 91  ASN A ND2    1  
ATOM   1416  H H      . ASN A 1 91  ? 5.107   -15.215 -23.282 1.00 0.00  ? 91  ASN A H      1  
ATOM   1417  H HA     . ASN A 1 91  ? 5.884   -17.093 -21.320 1.00 0.00  ? 91  ASN A HA     1  
ATOM   1418  H HB2    . ASN A 1 91  ? 7.804   -18.119 -22.446 1.00 0.00  ? 91  ASN A HB2    1  
ATOM   1419  H HB3    . ASN A 1 91  ? 6.304   -18.528 -23.274 1.00 0.00  ? 91  ASN A HB3    1  
ATOM   1420  H HD21   . ASN A 1 91  ? 9.324   -18.025 -23.939 1.00 0.00  ? 91  ASN A HD21   1  
ATOM   1421  H HD22   . ASN A 1 91  ? 9.227   -17.156 -25.428 1.00 0.00  ? 91  ASN A HD22   1  
ATOM   1422  N N      . LYS A 1 92  ? 6.656   -14.324 -21.704 1.00 0.00  ? 92  LYS A N      1  
ATOM   1423  C CA     . LYS A 1 92  ? 7.446   -13.152 -21.354 1.00 0.00  ? 92  LYS A CA     1  
ATOM   1424  C C      . LYS A 1 92  ? 6.563   -12.083 -20.703 1.00 0.00  ? 92  LYS A C      1  
ATOM   1425  O O      . LYS A 1 92  ? 5.544   -11.681 -21.265 1.00 0.00  ? 92  LYS A O      1  
ATOM   1426  C CB     . LYS A 1 92  ? 8.135   -12.595 -22.600 1.00 0.00  ? 92  LYS A CB     1  
ATOM   1427  C CG     . LYS A 1 92  ? 9.546   -12.087 -22.344 1.00 0.00  ? 92  LYS A CG     1  
ATOM   1428  C CD     . LYS A 1 92  ? 10.590  -12.964 -23.021 1.00 0.00  ? 92  LYS A CD     1  
ATOM   1429  C CE     . LYS A 1 92  ? 11.522  -12.146 -23.905 1.00 0.00  ? 92  LYS A CE     1  
ATOM   1430  N NZ     . LYS A 1 92  ? 10.781  -11.420 -24.973 1.00 0.00  ? 92  LYS A NZ     1  
ATOM   1431  H H      . LYS A 1 92  ? 5.686   -14.227 -21.806 1.00 0.00  ? 92  LYS A H      1  
ATOM   1432  H HA     . LYS A 1 92  ? 8.200   -13.462 -20.645 1.00 0.00  ? 92  LYS A HA     1  
ATOM   1433  H HB2    . LYS A 1 92  ? 8.185   -13.376 -23.344 1.00 0.00  ? 92  LYS A HB2    1  
ATOM   1434  H HB3    . LYS A 1 92  ? 7.545   -11.782 -22.986 1.00 0.00  ? 92  LYS A HB3    1  
ATOM   1435  H HG2    . LYS A 1 92  ? 9.631   -11.081 -22.728 1.00 0.00  ? 92  LYS A HG2    1  
ATOM   1436  H HG3    . LYS A 1 92  ? 9.729   -12.085 -21.280 1.00 0.00  ? 92  LYS A HG3    1  
ATOM   1437  H HD2    . LYS A 1 92  ? 11.176  -13.460 -22.263 1.00 0.00  ? 92  LYS A HD2    1  
ATOM   1438  H HD3    . LYS A 1 92  ? 10.089  -13.702 -23.632 1.00 0.00  ? 92  LYS A HD3    1  
ATOM   1439  H HE2    . LYS A 1 92  ? 12.042  -11.429 -23.288 1.00 0.00  ? 92  LYS A HE2    1  
ATOM   1440  H HE3    . LYS A 1 92  ? 12.239  -12.813 -24.363 1.00 0.00  ? 92  LYS A HE3    1  
ATOM   1441  H HZ1    . LYS A 1 92  ? 11.181  -10.469 -25.100 1.00 0.00  ? 92  LYS A HZ1    1  
ATOM   1442  H HZ2    . LYS A 1 92  ? 9.778   -11.331 -24.718 1.00 0.00  ? 92  LYS A HZ2    1  
ATOM   1443  H HZ3    . LYS A 1 92  ? 10.854  -11.938 -25.872 1.00 0.00  ? 92  LYS A HZ3    1  
ATOM   1444  N N      . PRO A 1 93  ? 6.944   -11.622 -19.499 1.00 0.00  ? 93  PRO A N      1  
ATOM   1445  C CA     . PRO A 1 93  ? 6.191   -10.605 -18.749 1.00 0.00  ? 93  PRO A CA     1  
ATOM   1446  C C      . PRO A 1 93  ? 6.227   -9.244  -19.408 1.00 0.00  ? 93  PRO A C      1  
ATOM   1447  O O      . PRO A 1 93  ? 7.284   -8.638  -19.560 1.00 0.00  ? 93  PRO A O      1  
ATOM   1448  C CB     . PRO A 1 93  ? 6.903   -10.547 -17.409 1.00 0.00  ? 93  PRO A CB     1  
ATOM   1449  C CG     . PRO A 1 93  ? 8.285   -11.012 -17.711 1.00 0.00  ? 93  PRO A CG     1  
ATOM   1450  C CD     . PRO A 1 93  ? 8.139   -12.060 -18.770 1.00 0.00  ? 93  PRO A CD     1  
ATOM   1451  H HA     . PRO A 1 93  ? 5.166   -10.904 -18.599 1.00 0.00  ? 93  PRO A HA     1  
ATOM   1452  H HB2    . PRO A 1 93  ? 6.890   -9.531  -17.043 1.00 0.00  ? 93  PRO A HB2    1  
ATOM   1453  H HB3    . PRO A 1 93  ? 6.405   -11.198 -16.714 1.00 0.00  ? 93  PRO A HB3    1  
ATOM   1454  H HG2    . PRO A 1 93  ? 8.872   -10.190 -18.078 1.00 0.00  ? 93  PRO A HG2    1  
ATOM   1455  H HG3    . PRO A 1 93  ? 8.739   -11.427 -16.836 1.00 0.00  ? 93  PRO A HG3    1  
ATOM   1456  H HD2    . PRO A 1 93  ? 9.002   -12.073 -19.414 1.00 0.00  ? 93  PRO A HD2    1  
ATOM   1457  H HD3    . PRO A 1 93  ? 7.984   -13.027 -18.328 1.00 0.00  ? 93  PRO A HD3    1  
ATOM   1458  N N      . LYS A 1 94  ? 5.053   -8.775  -19.789 1.00 0.00  ? 94  LYS A N      1  
ATOM   1459  C CA     . LYS A 1 94  ? 4.915   -7.482  -20.451 1.00 0.00  ? 94  LYS A CA     1  
ATOM   1460  C C      . LYS A 1 94  ? 4.427   -6.403  -19.488 1.00 0.00  ? 94  LYS A C      1  
ATOM   1461  O O      . LYS A 1 94  ? 3.365   -6.538  -18.880 1.00 0.00  ? 94  LYS A O      1  
ATOM   1462  C CB     . LYS A 1 94  ? 3.930   -7.597  -21.619 1.00 0.00  ? 94  LYS A CB     1  
ATOM   1463  C CG     . LYS A 1 94  ? 4.532   -8.174  -22.891 1.00 0.00  ? 94  LYS A CG     1  
ATOM   1464  C CD     . LYS A 1 94  ? 4.911   -7.080  -23.876 1.00 0.00  ? 94  LYS A CD     1  
ATOM   1465  C CE     . LYS A 1 94  ? 3.681   -6.442  -24.496 1.00 0.00  ? 94  LYS A CE     1  
ATOM   1466  N NZ     . LYS A 1 94  ? 3.844   -6.210  -25.958 1.00 0.00  ? 94  LYS A NZ     1  
ATOM   1467  H H      . LYS A 1 94  ? 4.258   -9.317  -19.621 1.00 0.00  ? 94  LYS A H      1  
ATOM   1468  H HA     . LYS A 1 94  ? 5.882   -7.198  -20.836 1.00 0.00  ? 94  LYS A HA     1  
ATOM   1469  H HB2    . LYS A 1 94  ? 3.112   -8.233  -21.319 1.00 0.00  ? 94  LYS A HB2    1  
ATOM   1470  H HB3    . LYS A 1 94  ? 3.543   -6.615  -21.844 1.00 0.00  ? 94  LYS A HB3    1  
ATOM   1471  H HG2    . LYS A 1 94  ? 5.412   -8.738  -22.638 1.00 0.00  ? 94  LYS A HG2    1  
ATOM   1472  H HG3    . LYS A 1 94  ? 3.808   -8.825  -23.356 1.00 0.00  ? 94  LYS A HG3    1  
ATOM   1473  H HD2    . LYS A 1 94  ? 5.473   -6.317  -23.356 1.00 0.00  ? 94  LYS A HD2    1  
ATOM   1474  H HD3    . LYS A 1 94  ? 5.519   -7.508  -24.660 1.00 0.00  ? 94  LYS A HD3    1  
ATOM   1475  H HE2    . LYS A 1 94  ? 2.838   -7.099  -24.339 1.00 0.00  ? 94  LYS A HE2    1  
ATOM   1476  H HE3    . LYS A 1 94  ? 3.498   -5.497  -24.008 1.00 0.00  ? 94  LYS A HE3    1  
ATOM   1477  H HZ1    . LYS A 1 94  ? 4.824   -6.407  -26.247 1.00 0.00  ? 94  LYS A HZ1    1  
ATOM   1478  H HZ2    . LYS A 1 94  ? 3.619   -5.220  -26.190 1.00 0.00  ? 94  LYS A HZ2    1  
ATOM   1479  H HZ3    . LYS A 1 94  ? 3.203   -6.833  -26.493 1.00 0.00  ? 94  LYS A HZ3    1  
ATOM   1480  N N      . THR A 1 95  ? 5.186   -5.317  -19.383 1.00 0.00  ? 95  THR A N      1  
ATOM   1481  C CA     . THR A 1 95  ? 4.792   -4.205  -18.526 1.00 0.00  ? 95  THR A CA     1  
ATOM   1482  C C      . THR A 1 95  ? 3.966   -3.226  -19.343 1.00 0.00  ? 95  THR A C      1  
ATOM   1483  O O      . THR A 1 95  ? 4.473   -2.591  -20.269 1.00 0.00  ? 95  THR A O      1  
ATOM   1484  C CB     . THR A 1 95  ? 6.017   -3.500  -17.933 1.00 0.00  ? 95  THR A CB     1  
ATOM   1485  O OG1    . THR A 1 95  ? 6.690   -4.347  -17.019 1.00 0.00  ? 95  THR A OG1    1  
ATOM   1486  C CG2    . THR A 1 95  ? 5.676   -2.214  -17.198 1.00 0.00  ? 95  THR A CG2    1  
ATOM   1487  H H      . THR A 1 95  ? 6.007   -5.248  -19.912 1.00 0.00  ? 95  THR A H      1  
ATOM   1488  H HA     . THR A 1 95  ? 4.183   -4.599  -17.725 1.00 0.00  ? 95  THR A HA     1  
ATOM   1489  H HB     . THR A 1 95  ? 6.698   -3.251  -18.733 1.00 0.00  ? 95  THR A HB     1  
ATOM   1490  H HG1    . THR A 1 95  ? 7.434   -3.878  -16.636 1.00 0.00  ? 95  THR A HG1    1  
ATOM   1491  H HG21   . THR A 1 95  ? 4.629   -2.215  -16.928 1.00 0.00  ? 95  THR A HG21   1  
ATOM   1492  H HG22   . THR A 1 95  ? 5.881   -1.367  -17.838 1.00 0.00  ? 95  THR A HG22   1  
ATOM   1493  H HG23   . THR A 1 95  ? 6.278   -2.140  -16.305 1.00 0.00  ? 95  THR A HG23   1  
ATOM   1494  N N      . VAL A 1 96  ? 2.687   -3.130  -19.018 1.00 0.00  ? 96  VAL A N      1  
ATOM   1495  C CA     . VAL A 1 96  ? 1.786   -2.253  -19.750 1.00 0.00  ? 96  VAL A CA     1  
ATOM   1496  C C      . VAL A 1 96  ? 1.379   -1.048  -18.919 1.00 0.00  ? 96  VAL A C      1  
ATOM   1497  O O      . VAL A 1 96  ? 0.599   -1.170  -17.981 1.00 0.00  ? 96  VAL A O      1  
ATOM   1498  C CB     . VAL A 1 96  ? 0.514   -3.009  -20.174 1.00 0.00  ? 96  VAL A CB     1  
ATOM   1499  C CG1    . VAL A 1 96  ? -0.361  -2.137  -21.064 1.00 0.00  ? 96  VAL A CG1    1  
ATOM   1500  C CG2    . VAL A 1 96  ? 0.870   -4.311  -20.876 1.00 0.00  ? 96  VAL A CG2    1  
ATOM   1501  H H      . VAL A 1 96  ? 2.333   -3.677  -18.287 1.00 0.00  ? 96  VAL A H      1  
ATOM   1502  H HA     . VAL A 1 96  ? 2.295   -1.916  -20.641 1.00 0.00  ? 96  VAL A HA     1  
ATOM   1503  H HB     . VAL A 1 96  ? -0.047  -3.250  -19.281 1.00 0.00  ? 96  VAL A HB     1  
ATOM   1504  H HG11   . VAL A 1 96  ? 0.080   -1.154  -21.154 1.00 0.00  ? 96  VAL A HG11   1  
ATOM   1505  H HG12   . VAL A 1 96  ? -1.345  -2.051  -20.627 1.00 0.00  ? 96  VAL A HG12   1  
ATOM   1506  H HG13   . VAL A 1 96  ? -0.442  -2.586  -22.045 1.00 0.00  ? 96  VAL A HG13   1  
ATOM   1507  H HG21   . VAL A 1 96  ? 0.852   -4.161  -21.945 1.00 0.00  ? 96  VAL A HG21   1  
ATOM   1508  H HG22   . VAL A 1 96  ? 0.152   -5.073  -20.608 1.00 0.00  ? 96  VAL A HG22   1  
ATOM   1509  H HG23   . VAL A 1 96  ? 1.858   -4.626  -20.574 1.00 0.00  ? 96  VAL A HG23   1  
ATOM   1510  N N      . ILE A 1 97  ? 1.889   0.121   -19.292 1.00 0.00  ? 97  ILE A N      1  
ATOM   1511  C CA     . ILE A 1 97  ? 1.555   1.352   -18.593 1.00 0.00  ? 97  ILE A CA     1  
ATOM   1512  C C      . ILE A 1 97  ? 0.268   1.927   -19.165 1.00 0.00  ? 97  ILE A C      1  
ATOM   1513  O O      . ILE A 1 97  ? 0.020   1.828   -20.364 1.00 0.00  ? 97  ILE A O      1  
ATOM   1514  C CB     . ILE A 1 97  ? 2.683   2.397   -18.717 1.00 0.00  ? 97  ILE A CB     1  
ATOM   1515  C CG1    . ILE A 1 97  ? 4.021   1.788   -18.262 1.00 0.00  ? 97  ILE A CG1    1  
ATOM   1516  C CG2    . ILE A 1 97  ? 2.336   3.655   -17.926 1.00 0.00  ? 97  ILE A CG2    1  
ATOM   1517  C CD1    . ILE A 1 97  ? 4.432   2.136   -16.843 1.00 0.00  ? 97  ILE A CD1    1  
ATOM   1518  H H      . ILE A 1 97  ? 2.490   0.156   -20.065 1.00 0.00  ? 97  ILE A H      1  
ATOM   1519  H HA     . ILE A 1 97  ? 1.408   1.121   -17.548 1.00 0.00  ? 97  ILE A HA     1  
ATOM   1520  H HB     . ILE A 1 97  ? 2.762   2.675   -19.757 1.00 0.00  ? 97  ILE A HB     1  
ATOM   1521  H HG12   . ILE A 1 97  ? 3.953   0.711   -18.323 1.00 0.00  ? 97  ILE A HG12   1  
ATOM   1522  H HG13   . ILE A 1 97  ? 4.802   2.129   -18.926 1.00 0.00  ? 97  ILE A HG13   1  
ATOM   1523  H HG21   . ILE A 1 97  ? 1.637   4.254   -18.491 1.00 0.00  ? 97  ILE A HG21   1  
ATOM   1524  H HG22   . ILE A 1 97  ? 3.235   4.228   -17.746 1.00 0.00  ? 97  ILE A HG22   1  
ATOM   1525  H HG23   . ILE A 1 97  ? 1.892   3.378   -16.982 1.00 0.00  ? 97  ILE A HG23   1  
ATOM   1526  H HD11   . ILE A 1 97  ? 3.565   2.449   -16.281 1.00 0.00  ? 97  ILE A HD11   1  
ATOM   1527  H HD12   . ILE A 1 97  ? 5.157   2.935   -16.863 1.00 0.00  ? 97  ILE A HD12   1  
ATOM   1528  H HD13   . ILE A 1 97  ? 4.867   1.265   -16.373 1.00 0.00  ? 97  ILE A HD13   1  
ATOM   1529  N N      . TYR A 1 98  ? -0.565  2.501   -18.308 1.00 0.00  ? 98  TYR A N      1  
ATOM   1530  C CA     . TYR A 1 98  ? -1.835  3.049   -18.762 1.00 0.00  ? 98  TYR A CA     1  
ATOM   1531  C C      . TYR A 1 98  ? -2.028  4.503   -18.353 1.00 0.00  ? 98  TYR A C      1  
ATOM   1532  O O      . TYR A 1 98  ? -1.813  4.877   -17.199 1.00 0.00  ? 98  TYR A O      1  
ATOM   1533  C CB     . TYR A 1 98  ? -2.985  2.207   -18.220 1.00 0.00  ? 98  TYR A CB     1  
ATOM   1534  C CG     . TYR A 1 98  ? -3.243  0.954   -19.023 1.00 0.00  ? 98  TYR A CG     1  
ATOM   1535  C CD1    . TYR A 1 98  ? -3.268  0.990   -20.414 1.00 0.00  ? 98  TYR A CD1    1  
ATOM   1536  C CD2    . TYR A 1 98  ? -3.456  -0.266  -18.396 1.00 0.00  ? 98  TYR A CD2    1  
ATOM   1537  C CE1    . TYR A 1 98  ? -3.500  -0.154  -21.150 1.00 0.00  ? 98  TYR A CE1    1  
ATOM   1538  C CE2    . TYR A 1 98  ? -3.687  -1.413  -19.128 1.00 0.00  ? 98  TYR A CE2    1  
ATOM   1539  C CZ     . TYR A 1 98  ? -3.709  -1.352  -20.504 1.00 0.00  ? 98  TYR A CZ     1  
ATOM   1540  O OH     . TYR A 1 98  ? -3.939  -2.495  -21.236 1.00 0.00  ? 98  TYR A OH     1  
ATOM   1541  H H      . TYR A 1 98  ? -0.334  2.534   -17.354 1.00 0.00  ? 98  TYR A H      1  
ATOM   1542  H HA     . TYR A 1 98  ? -1.848  2.993   -19.839 1.00 0.00  ? 98  TYR A HA     1  
ATOM   1543  H HB2    . TYR A 1 98  ? -2.760  1.909   -17.206 1.00 0.00  ? 98  TYR A HB2    1  
ATOM   1544  H HB3    . TYR A 1 98  ? -3.887  2.797   -18.224 1.00 0.00  ? 98  TYR A HB3    1  
ATOM   1545  H HD1    . TYR A 1 98  ? -3.104  1.931   -20.918 1.00 0.00  ? 98  TYR A HD1    1  
ATOM   1546  H HD2    . TYR A 1 98  ? -3.438  -0.311  -17.317 1.00 0.00  ? 98  TYR A HD2    1  
ATOM   1547  H HE1    . TYR A 1 98  ? -3.516  -0.107  -22.229 1.00 0.00  ? 98  TYR A HE1    1  
ATOM   1548  H HE2    . TYR A 1 98  ? -3.850  -2.348  -18.622 1.00 0.00  ? 98  TYR A HE2    1  
ATOM   1549  H HH     . TYR A 1 98  ? -3.282  -3.160  -21.011 1.00 0.00  ? 98  TYR A HH     1  
ATOM   1550  N N      . TRP A 1 99  ? -2.463  5.306   -19.316 1.00 0.00  ? 99  TRP A N      1  
ATOM   1551  C CA     . TRP A 1 99  ? -2.731  6.718   -19.093 1.00 0.00  ? 99  TRP A CA     1  
ATOM   1552  C C      . TRP A 1 99  ? -4.166  7.031   -19.494 1.00 0.00  ? 99  TRP A C      1  
ATOM   1553  O O      . TRP A 1 99  ? -4.678  6.475   -20.466 1.00 0.00  ? 99  TRP A O      1  
ATOM   1554  C CB     . TRP A 1 99  ? -1.769  7.585   -19.907 1.00 0.00  ? 99  TRP A CB     1  
ATOM   1555  C CG     . TRP A 1 99  ? -0.405  7.699   -19.303 1.00 0.00  ? 99  TRP A CG     1  
ATOM   1556  C CD1    . TRP A 1 99  ? -0.011  8.551   -18.313 1.00 0.00  ? 99  TRP A CD1    1  
ATOM   1557  C CD2    . TRP A 1 99  ? 0.749   6.933   -19.660 1.00 0.00  ? 99  TRP A CD2    1  
ATOM   1558  N NE1    . TRP A 1 99  ? 1.320   8.361   -18.031 1.00 0.00  ? 99  TRP A NE1    1  
ATOM   1559  C CE2    . TRP A 1 99  ? 1.809   7.371   -18.843 1.00 0.00  ? 99  TRP A CE2    1  
ATOM   1560  C CE3    . TRP A 1 99  ? 0.987   5.918   -20.589 1.00 0.00  ? 99  TRP A CE3    1  
ATOM   1561  C CZ2    . TRP A 1 99  ? 3.087   6.826   -18.931 1.00 0.00  ? 99  TRP A CZ2    1  
ATOM   1562  C CZ3    . TRP A 1 99  ? 2.256   5.379   -20.673 1.00 0.00  ? 99  TRP A CZ3    1  
ATOM   1563  C CH2    . TRP A 1 99  ? 3.291   5.833   -19.848 1.00 0.00  ? 99  TRP A CH2    1  
ATOM   1564  H H      . TRP A 1 99  ? -2.629  4.928   -20.204 1.00 0.00  ? 99  TRP A H      1  
ATOM   1565  H HA     . TRP A 1 99  ? -2.601  6.926   -18.042 1.00 0.00  ? 99  TRP A HA     1  
ATOM   1566  H HB2    . TRP A 1 99  ? -1.658  7.159   -20.891 1.00 0.00  ? 99  TRP A HB2    1  
ATOM   1567  H HB3    . TRP A 1 99  ? -2.180  8.581   -19.995 1.00 0.00  ? 99  TRP A HB3    1  
ATOM   1568  H HD1    . TRP A 1 99  ? -0.661  9.267   -17.830 1.00 0.00  ? 99  TRP A HD1    1  
ATOM   1569  H HE1    . TRP A 1 99  ? 1.836   8.851   -17.357 1.00 0.00  ? 99  TRP A HE1    1  
ATOM   1570  H HE3    . TRP A 1 99  ? 0.201   5.555   -21.233 1.00 0.00  ? 99  TRP A HE3    1  
ATOM   1571  H HZ2    . TRP A 1 99  ? 3.897   7.165   -18.302 1.00 0.00  ? 99  TRP A HZ2    1  
ATOM   1572  H HZ3    . TRP A 1 99  ? 2.458   4.596   -21.385 1.00 0.00  ? 99  TRP A HZ3    1  
ATOM   1573  H HH2    . TRP A 1 99  ? 4.265   5.378   -19.948 1.00 0.00  ? 99  TRP A HH2    1  
ATOM   1574  N N      . LEU A 1 100 ? -4.815  7.917   -18.753 1.00 0.00  ? 100 LEU A N      1  
ATOM   1575  C CA     . LEU A 1 100 ? -6.190  8.286   -19.061 1.00 0.00  ? 100 LEU A CA     1  
ATOM   1576  C C      . LEU A 1 100 ? -6.220  9.317   -20.181 1.00 0.00  ? 100 LEU A C      1  
ATOM   1577  O O      . LEU A 1 100 ? -5.533  10.333  -20.113 1.00 0.00  ? 100 LEU A O      1  
ATOM   1578  C CB     . LEU A 1 100 ? -6.897  8.839   -17.819 1.00 0.00  ? 100 LEU A CB     1  
ATOM   1579  C CG     . LEU A 1 100 ? -6.385  8.305   -16.478 1.00 0.00  ? 100 LEU A CG     1  
ATOM   1580  C CD1    . LEU A 1 100 ? -7.321  8.723   -15.357 1.00 0.00  ? 100 LEU A CD1    1  
ATOM   1581  C CD2    . LEU A 1 100 ? -6.245  6.792   -16.518 1.00 0.00  ? 100 LEU A CD2    1  
ATOM   1582  H H      . LEU A 1 100 ? -4.362  8.337   -17.990 1.00 0.00  ? 100 LEU A H      1  
ATOM   1583  H HA     . LEU A 1 100 ? -6.705  7.396   -19.391 1.00 0.00  ? 100 LEU A HA     1  
ATOM   1584  H HB2    . LEU A 1 100 ? -6.787  9.913   -17.820 1.00 0.00  ? 100 LEU A HB2    1  
ATOM   1585  H HB3    . LEU A 1 100 ? -7.947  8.602   -17.895 1.00 0.00  ? 100 LEU A HB3    1  
ATOM   1586  H HG     . LEU A 1 100 ? -5.411  8.730   -16.276 1.00 0.00  ? 100 LEU A HG     1  
ATOM   1587  H HD11   . LEU A 1 100 ? -7.308  7.972   -14.582 1.00 0.00  ? 100 LEU A HD11   1  
ATOM   1588  H HD12   . LEU A 1 100 ? -8.321  8.821   -15.748 1.00 0.00  ? 100 LEU A HD12   1  
ATOM   1589  H HD13   . LEU A 1 100 ? -6.998  9.668   -14.950 1.00 0.00  ? 100 LEU A HD13   1  
ATOM   1590  H HD21   . LEU A 1 100 ? -6.917  6.388   -17.263 1.00 0.00  ? 100 LEU A HD21   1  
ATOM   1591  H HD22   . LEU A 1 100 ? -6.491  6.382   -15.550 1.00 0.00  ? 100 LEU A HD22   1  
ATOM   1592  H HD23   . LEU A 1 100 ? -5.226  6.531   -16.773 1.00 0.00  ? 100 LEU A HD23   1  
ATOM   1593  N N      . ALA A 1 101 ? -7.014  9.051   -21.213 1.00 0.00  ? 101 ALA A N      1  
ATOM   1594  C CA     . ALA A 1 101 ? -7.113  9.964   -22.342 1.00 0.00  ? 101 ALA A CA     1  
ATOM   1595  C C      . ALA A 1 101 ? -8.564  10.186  -22.744 1.00 0.00  ? 101 ALA A C      1  
ATOM   1596  O O      . ALA A 1 101 ? -9.369  9.263   -22.714 1.00 0.00  ? 101 ALA A O      1  
ATOM   1597  C CB     . ALA A 1 101 ? -6.316  9.426   -23.520 1.00 0.00  ? 101 ALA A CB     1  
ATOM   1598  H H      . ALA A 1 101 ? -7.535  8.222   -21.220 1.00 0.00  ? 101 ALA A H      1  
ATOM   1599  H HA     . ALA A 1 101 ? -6.682  10.906  -22.047 1.00 0.00  ? 101 ALA A HA     1  
ATOM   1600  H HB1    . ALA A 1 101 ? -6.089  8.383   -23.356 1.00 0.00  ? 101 ALA A HB1    1  
ATOM   1601  H HB2    . ALA A 1 101 ? -5.399  9.982   -23.617 1.00 0.00  ? 101 ALA A HB2    1  
ATOM   1602  H HB3    . ALA A 1 101 ? -6.896  9.530   -24.426 1.00 0.00  ? 101 ALA A HB3    1  
ATOM   1603  N N      . GLU A 1 102 ? -8.889  11.415  -23.125 1.00 0.00  ? 102 GLU A N      1  
ATOM   1604  C CA     . GLU A 1 102 ? -10.245 11.751  -23.539 1.00 0.00  ? 102 GLU A CA     1  
ATOM   1605  C C      . GLU A 1 102 ? -10.259 12.251  -24.979 1.00 0.00  ? 102 GLU A C      1  
ATOM   1606  O O      . GLU A 1 102 ? -9.691  13.298  -25.282 1.00 0.00  ? 102 GLU A O      1  
ATOM   1607  C CB     . GLU A 1 102 ? -10.836 12.817  -22.615 1.00 0.00  ? 102 GLU A CB     1  
ATOM   1608  C CG     . GLU A 1 102 ? -12.311 13.088  -22.859 1.00 0.00  ? 102 GLU A CG     1  
ATOM   1609  C CD     . GLU A 1 102 ? -12.701 14.520  -22.549 1.00 0.00  ? 102 GLU A CD     1  
ATOM   1610  O OE1    . GLU A 1 102 ? -12.165 15.079  -21.568 1.00 0.00  ? 102 GLU A OE1    1  
ATOM   1611  O OE2    . GLU A 1 102 ? -13.539 15.081  -23.283 1.00 0.00  ? 102 GLU A OE2    1  
ATOM   1612  H H      . GLU A 1 102 ? -8.202  12.110  -23.126 1.00 0.00  ? 102 GLU A H      1  
ATOM   1613  H HA     . GLU A 1 102 ? -10.842 10.857  -23.476 1.00 0.00  ? 102 GLU A HA     1  
ATOM   1614  H HB2    . GLU A 1 102 ? -10.717 12.496  -21.591 1.00 0.00  ? 102 GLU A HB2    1  
ATOM   1615  H HB3    . GLU A 1 102 ? -10.295 13.741  -22.756 1.00 0.00  ? 102 GLU A HB3    1  
ATOM   1616  H HG2    . GLU A 1 102 ? -12.533 12.891  -23.898 1.00 0.00  ? 102 GLU A HG2    1  
ATOM   1617  H HG3    . GLU A 1 102 ? -12.895 12.427  -22.237 1.00 0.00  ? 102 GLU A HG3    1  
ATOM   1618  H HE2    . GLU A 1 102 ? -13.737 15.985  -23.028 1.00 0.00  ? 102 GLU A HE2    1  
ATOM   1619  N N      . VAL A 1 103 ? -10.913 11.498  -25.863 1.00 0.00  ? 103 VAL A N      1  
ATOM   1620  C CA     . VAL A 1 103 ? -10.986 11.880  -27.267 1.00 0.00  ? 103 VAL A CA     1  
ATOM   1621  C C      . VAL A 1 103 ? -11.917 13.075  -27.452 1.00 0.00  ? 103 VAL A C      1  
ATOM   1622  O O      . VAL A 1 103 ? -13.040 13.095  -26.948 1.00 0.00  ? 103 VAL A O      1  
ATOM   1623  C CB     . VAL A 1 103 ? -11.415 10.691  -28.163 1.00 0.00  ? 103 VAL A CB     1  
ATOM   1624  C CG1    . VAL A 1 103 ? -10.520 9.493   -27.900 1.00 0.00  ? 103 VAL A CG1    1  
ATOM   1625  C CG2    . VAL A 1 103 ? -12.869 10.303  -27.944 1.00 0.00  ? 103 VAL A CG2    1  
ATOM   1626  H H      . VAL A 1 103 ? -11.348 10.672  -25.567 1.00 0.00  ? 103 VAL A H      1  
ATOM   1627  H HA     . VAL A 1 103 ? -9.993  12.177  -27.570 1.00 0.00  ? 103 VAL A HA     1  
ATOM   1628  H HB     . VAL A 1 103 ? -11.293 10.983  -29.196 1.00 0.00  ? 103 VAL A HB     1  
ATOM   1629  H HG11   . VAL A 1 103 ? -9.633  9.817   -27.382 1.00 0.00  ? 103 VAL A HG11   1  
ATOM   1630  H HG12   . VAL A 1 103 ? -10.246 9.035   -28.839 1.00 0.00  ? 103 VAL A HG12   1  
ATOM   1631  H HG13   . VAL A 1 103 ? -11.052 8.780   -27.290 1.00 0.00  ? 103 VAL A HG13   1  
ATOM   1632  H HG21   . VAL A 1 103 ? -13.371 11.073  -27.379 1.00 0.00  ? 103 VAL A HG21   1  
ATOM   1633  H HG22   . VAL A 1 103 ? -12.913 9.368   -27.400 1.00 0.00  ? 103 VAL A HG22   1  
ATOM   1634  H HG23   . VAL A 1 103 ? -13.353 10.183  -28.902 1.00 0.00  ? 103 VAL A HG23   1  
ATOM   1635  N N      . LYS A 1 104 ? -11.416 14.092  -28.148 1.00 0.00  ? 104 LYS A N      1  
ATOM   1636  C CA     . LYS A 1 104 ? -12.176 15.324  -28.372 1.00 0.00  ? 104 LYS A CA     1  
ATOM   1637  C C      . LYS A 1 104 ? -13.457 15.064  -29.155 1.00 0.00  ? 104 LYS A C      1  
ATOM   1638  O O      . LYS A 1 104 ? -14.425 15.816  -29.039 1.00 0.00  ? 104 LYS A O      1  
ATOM   1639  C CB     . LYS A 1 104 ? -11.338 16.378  -29.120 1.00 0.00  ? 104 LYS A CB     1  
ATOM   1640  C CG     . LYS A 1 104 ? -9.831  16.166  -29.057 1.00 0.00  ? 104 LYS A CG     1  
ATOM   1641  C CD     . LYS A 1 104 ? -9.347  15.946  -27.634 1.00 0.00  ? 104 LYS A CD     1  
ATOM   1642  C CE     . LYS A 1 104 ? -8.410  17.057  -27.181 1.00 0.00  ? 104 LYS A CE     1  
ATOM   1643  N NZ     . LYS A 1 104 ? -8.834  17.649  -25.882 1.00 0.00  ? 104 LYS A NZ     1  
ATOM   1644  H H      . LYS A 1 104 ? -10.506 14.021  -28.497 1.00 0.00  ? 104 LYS A H      1  
ATOM   1645  H HA     . LYS A 1 104 ? -12.442 15.719  -27.405 1.00 0.00  ? 104 LYS A HA     1  
ATOM   1646  H HB2    . LYS A 1 104 ? -11.631 16.377  -30.158 1.00 0.00  ? 104 LYS A HB2    1  
ATOM   1647  H HB3    . LYS A 1 104 ? -11.556 17.348  -28.699 1.00 0.00  ? 104 LYS A HB3    1  
ATOM   1648  H HG2    . LYS A 1 104 ? -9.576  15.300  -29.651 1.00 0.00  ? 104 LYS A HG2    1  
ATOM   1649  H HG3    . LYS A 1 104 ? -9.340  17.037  -29.466 1.00 0.00  ? 104 LYS A HG3    1  
ATOM   1650  H HD2    . LYS A 1 104 ? -10.202 15.916  -26.975 1.00 0.00  ? 104 LYS A HD2    1  
ATOM   1651  H HD3    . LYS A 1 104 ? -8.821  15.003  -27.586 1.00 0.00  ? 104 LYS A HD3    1  
ATOM   1652  H HE2    . LYS A 1 104 ? -7.416  16.650  -27.074 1.00 0.00  ? 104 LYS A HE2    1  
ATOM   1653  H HE3    . LYS A 1 104 ? -8.401  17.832  -27.934 1.00 0.00  ? 104 LYS A HE3    1  
ATOM   1654  H HZ1    . LYS A 1 104 ? -8.003  17.813  -25.276 1.00 0.00  ? 104 LYS A HZ1    1  
ATOM   1655  H HZ2    . LYS A 1 104 ? -9.485  17.005  -25.391 1.00 0.00  ? 104 LYS A HZ2    1  
ATOM   1656  H HZ3    . LYS A 1 104 ? -9.317  18.555  -26.044 1.00 0.00  ? 104 LYS A HZ3    1  
ATOM   1657  N N      . ASP A 1 105 ? -13.458 14.017  -29.966 1.00 0.00  ? 105 ASP A N      1  
ATOM   1658  C CA     . ASP A 1 105 ? -14.626 13.696  -30.777 1.00 0.00  ? 105 ASP A CA     1  
ATOM   1659  C C      . ASP A 1 105 ? -15.373 12.482  -30.244 1.00 0.00  ? 105 ASP A C      1  
ATOM   1660  O O      . ASP A 1 105 ? -14.777 11.446  -29.954 1.00 0.00  ? 105 ASP A O      1  
ATOM   1661  C CB     . ASP A 1 105 ? -14.212 13.455  -32.228 1.00 0.00  ? 105 ASP A CB     1  
ATOM   1662  C CG     . ASP A 1 105 ? -14.293 14.712  -33.069 1.00 0.00  ? 105 ASP A CG     1  
ATOM   1663  O OD1    . ASP A 1 105 ? -13.941 15.795  -32.553 1.00 0.00  ? 105 ASP A OD1    1  
ATOM   1664  O OD2    . ASP A 1 105 ? -14.709 14.617  -34.241 1.00 0.00  ? 105 ASP A OD2    1  
ATOM   1665  H H      . ASP A 1 105 ? -12.653 13.457  -30.033 1.00 0.00  ? 105 ASP A H      1  
ATOM   1666  H HA     . ASP A 1 105 ? -15.289 14.544  -30.746 1.00 0.00  ? 105 ASP A HA     1  
ATOM   1667  H HB2    . ASP A 1 105 ? -13.195 13.098  -32.247 1.00 0.00  ? 105 ASP A HB2    1  
ATOM   1668  H HB3    . ASP A 1 105 ? -14.860 12.708  -32.664 1.00 0.00  ? 105 ASP A HB3    1  
ATOM   1669  H HD2    . ASP A 1 105 ? -14.734 15.452  -34.715 1.00 0.00  ? 105 ASP A HD2    1  
ATOM   1670  N N      . TYR A 1 106 ? -16.690 12.617  -30.142 1.00 0.00  ? 106 TYR A N      1  
ATOM   1671  C CA     . TYR A 1 106 ? -17.540 11.533  -29.671 1.00 0.00  ? 106 TYR A CA     1  
ATOM   1672  C C      . TYR A 1 106 ? -17.566 10.421  -30.710 1.00 0.00  ? 106 TYR A C      1  
ATOM   1673  O O      . TYR A 1 106 ? -17.457 9.240   -30.383 1.00 0.00  ? 106 TYR A O      1  
ATOM   1674  C CB     . TYR A 1 106 ? -18.958 12.038  -29.407 1.00 0.00  ? 106 TYR A CB     1  
ATOM   1675  C CG     . TYR A 1 106 ? -19.862 11.004  -28.775 1.00 0.00  ? 106 TYR A CG     1  
ATOM   1676  C CD1    . TYR A 1 106 ? -19.400 10.176  -27.761 1.00 0.00  ? 106 TYR A CD1    1  
ATOM   1677  C CD2    . TYR A 1 106 ? -21.179 10.860  -29.193 1.00 0.00  ? 106 TYR A CD2    1  
ATOM   1678  C CE1    . TYR A 1 106 ? -20.222 9.232   -27.180 1.00 0.00  ? 106 TYR A CE1    1  
ATOM   1679  C CE2    . TYR A 1 106 ? -22.008 9.917   -28.617 1.00 0.00  ? 106 TYR A CE2    1  
ATOM   1680  C CZ     . TYR A 1 106 ? -21.524 9.106   -27.611 1.00 0.00  ? 106 TYR A CZ     1  
ATOM   1681  O OH     . TYR A 1 106 ? -22.348 8.165   -27.033 1.00 0.00  ? 106 TYR A OH     1  
ATOM   1682  H H      . TYR A 1 106 ? -17.099 13.464  -30.409 1.00 0.00  ? 106 TYR A H      1  
ATOM   1683  H HA     . TYR A 1 106 ? -17.118 11.148  -28.754 1.00 0.00  ? 106 TYR A HA     1  
ATOM   1684  H HB2    . TYR A 1 106 ? -18.911 12.888  -28.743 1.00 0.00  ? 106 TYR A HB2    1  
ATOM   1685  H HB3    . TYR A 1 106 ? -19.402 12.343  -30.344 1.00 0.00  ? 106 TYR A HB3    1  
ATOM   1686  H HD1    . TYR A 1 106 ? -18.380 10.276  -27.427 1.00 0.00  ? 106 TYR A HD1    1  
ATOM   1687  H HD2    . TYR A 1 106 ? -21.553 11.495  -29.982 1.00 0.00  ? 106 TYR A HD2    1  
ATOM   1688  H HE1    . TYR A 1 106 ? -19.844 8.599   -26.392 1.00 0.00  ? 106 TYR A HE1    1  
ATOM   1689  H HE2    . TYR A 1 106 ? -23.030 9.819   -28.956 1.00 0.00  ? 106 TYR A HE2    1  
ATOM   1690  H HH     . TYR A 1 106 ? -23.254 8.492   -27.025 1.00 0.00  ? 106 TYR A HH     1  
ATOM   1691  N N      . ASP A 1 107 ? -17.689 10.820  -31.971 1.00 0.00  ? 107 ASP A N      1  
ATOM   1692  C CA     . ASP A 1 107 ? -17.704 9.880   -33.079 1.00 0.00  ? 107 ASP A CA     1  
ATOM   1693  C C      . ASP A 1 107 ? -16.330 9.840   -33.742 1.00 0.00  ? 107 ASP A C      1  
ATOM   1694  O O      . ASP A 1 107 ? -16.203 9.484   -34.914 1.00 0.00  ? 107 ASP A O      1  
ATOM   1695  C CB     . ASP A 1 107 ? -18.771 10.275  -34.101 1.00 0.00  ? 107 ASP A CB     1  
ATOM   1696  C CG     . ASP A 1 107 ? -19.328 9.080   -34.848 1.00 0.00  ? 107 ASP A CG     1  
ATOM   1697  O OD1    . ASP A 1 107 ? -19.608 9.215   -36.059 1.00 0.00  ? 107 ASP A OD1    1  
ATOM   1698  O OD2    . ASP A 1 107 ? -19.484 8.009   -34.224 1.00 0.00  ? 107 ASP A OD2    1  
ATOM   1699  H H      . ASP A 1 107 ? -17.752 11.780  -32.160 1.00 0.00  ? 107 ASP A H      1  
ATOM   1700  H HA     . ASP A 1 107 ? -17.934 8.901   -32.683 1.00 0.00  ? 107 ASP A HA     1  
ATOM   1701  H HB2    . ASP A 1 107 ? -19.585 10.767  -33.589 1.00 0.00  ? 107 ASP A HB2    1  
ATOM   1702  H HB3    . ASP A 1 107 ? -18.337 10.956  -34.817 1.00 0.00  ? 107 ASP A HB3    1  
ATOM   1703  H HD2    . ASP A 1 107 ? -19.839 7.295   -34.758 1.00 0.00  ? 107 ASP A HD2    1  
ATOM   1704  N N      . VAL A 1 108 ? -15.304 10.210  -32.973 1.00 0.00  ? 108 VAL A N      1  
ATOM   1705  C CA     . VAL A 1 108 ? -13.927 10.227  -33.457 1.00 0.00  ? 108 VAL A CA     1  
ATOM   1706  C C      . VAL A 1 108 ? -13.626 8.994   -34.302 1.00 0.00  ? 108 VAL A C      1  
ATOM   1707  O O      . VAL A 1 108 ? -14.173 7.917   -34.064 1.00 0.00  ? 108 VAL A O      1  
ATOM   1708  C CB     . VAL A 1 108 ? -12.941 10.303  -32.270 1.00 0.00  ? 108 VAL A CB     1  
ATOM   1709  C CG1    . VAL A 1 108 ? -13.267 9.232   -31.248 1.00 0.00  ? 108 VAL A CG1    1  
ATOM   1710  C CG2    . VAL A 1 108 ? -11.495 10.187  -32.729 1.00 0.00  ? 108 VAL A CG2    1  
ATOM   1711  H H      . VAL A 1 108 ? -15.477 10.481  -32.048 1.00 0.00  ? 108 VAL A H      1  
ATOM   1712  H HA     . VAL A 1 108 ? -13.795 11.111  -34.064 1.00 0.00  ? 108 VAL A HA     1  
ATOM   1713  H HB     . VAL A 1 108 ? -13.066 11.264  -31.792 1.00 0.00  ? 108 VAL A HB     1  
ATOM   1714  H HG11   . VAL A 1 108 ? -14.226 9.446   -30.799 1.00 0.00  ? 108 VAL A HG11   1  
ATOM   1715  H HG12   . VAL A 1 108 ? -12.506 9.218   -30.484 1.00 0.00  ? 108 VAL A HG12   1  
ATOM   1716  H HG13   . VAL A 1 108 ? -13.306 8.270   -31.739 1.00 0.00  ? 108 VAL A HG13   1  
ATOM   1717  H HG21   . VAL A 1 108 ? -11.241 11.039  -33.342 1.00 0.00  ? 108 VAL A HG21   1  
ATOM   1718  H HG22   . VAL A 1 108 ? -11.370 9.280   -33.302 1.00 0.00  ? 108 VAL A HG22   1  
ATOM   1719  H HG23   . VAL A 1 108 ? -10.846 10.159  -31.864 1.00 0.00  ? 108 VAL A HG23   1  
ATOM   1720  N N      . GLU A 1 109 ? -12.764 9.159   -35.298 1.00 0.00  ? 109 GLU A N      1  
ATOM   1721  C CA     . GLU A 1 109 ? -12.408 8.064   -36.181 1.00 0.00  ? 109 GLU A CA     1  
ATOM   1722  C C      . GLU A 1 109 ? -11.745 6.939   -35.404 1.00 0.00  ? 109 GLU A C      1  
ATOM   1723  O O      . GLU A 1 109 ? -11.011 7.171   -34.444 1.00 0.00  ? 109 GLU A O      1  
ATOM   1724  C CB     . GLU A 1 109 ? -11.500 8.553   -37.322 1.00 0.00  ? 109 GLU A CB     1  
ATOM   1725  C CG     . GLU A 1 109 ? -10.012 8.576   -36.994 1.00 0.00  ? 109 GLU A CG     1  
ATOM   1726  C CD     . GLU A 1 109 ? -9.447  9.981   -36.937 1.00 0.00  ? 109 GLU A CD     1  
ATOM   1727  O OE1    . GLU A 1 109 ? -8.706  10.362  -37.868 1.00 0.00  ? 109 GLU A OE1    1  
ATOM   1728  O OE2    . GLU A 1 109 ? -9.746  10.702  -35.961 1.00 0.00  ? 109 GLU A OE2    1  
ATOM   1729  H H      . GLU A 1 109 ? -12.366 10.037  -35.444 1.00 0.00  ? 109 GLU A H      1  
ATOM   1730  H HA     . GLU A 1 109 ? -13.325 7.685   -36.610 1.00 0.00  ? 109 GLU A HA     1  
ATOM   1731  H HB2    . GLU A 1 109 ? -11.644 7.908   -38.175 1.00 0.00  ? 109 GLU A HB2    1  
ATOM   1732  H HB3    . GLU A 1 109 ? -11.801 9.556   -37.591 1.00 0.00  ? 109 GLU A HB3    1  
ATOM   1733  H HG2    . GLU A 1 109 ? -9.857  8.104   -36.035 1.00 0.00  ? 109 GLU A HG2    1  
ATOM   1734  H HG3    . GLU A 1 109 ? -9.482  8.019   -37.755 1.00 0.00  ? 109 GLU A HG3    1  
ATOM   1735  H HE2    . GLU A 1 109 ? -9.354  11.578  -35.990 1.00 0.00  ? 109 GLU A HE2    1  
ATOM   1736  N N      . ILE A 1 110 ? -12.021 5.721   -35.827 1.00 0.00  ? 110 ILE A N      1  
ATOM   1737  C CA     . ILE A 1 110 ? -11.467 4.543   -35.185 1.00 0.00  ? 110 ILE A CA     1  
ATOM   1738  C C      . ILE A 1 110 ? -10.721 3.676   -36.190 1.00 0.00  ? 110 ILE A C      1  
ATOM   1739  O O      . ILE A 1 110 ? -11.319 2.876   -36.911 1.00 0.00  ? 110 ILE A O      1  
ATOM   1740  C CB     . ILE A 1 110 ? -12.563 3.724   -34.482 1.00 0.00  ? 110 ILE A CB     1  
ATOM   1741  C CG1    . ILE A 1 110 ? -13.194 4.560   -33.367 1.00 0.00  ? 110 ILE A CG1    1  
ATOM   1742  C CG2    . ILE A 1 110 ? -11.975 2.441   -33.921 1.00 0.00  ? 110 ILE A CG2    1  
ATOM   1743  C CD1    . ILE A 1 110 ? -12.253 4.815   -32.210 1.00 0.00  ? 110 ILE A CD1    1  
ATOM   1744  H H      . ILE A 1 110 ? -12.616 5.613   -36.594 1.00 0.00  ? 110 ILE A H      1  
ATOM   1745  H HA     . ILE A 1 110 ? -10.765 4.873   -34.433 1.00 0.00  ? 110 ILE A HA     1  
ATOM   1746  H HB     . ILE A 1 110 ? -13.317 3.465   -35.208 1.00 0.00  ? 110 ILE A HB     1  
ATOM   1747  H HG12   . ILE A 1 110 ? -13.492 5.516   -33.769 1.00 0.00  ? 110 ILE A HG12   1  
ATOM   1748  H HG13   . ILE A 1 110 ? -14.061 4.047   -32.986 1.00 0.00  ? 110 ILE A HG13   1  
ATOM   1749  H HG21   . ILE A 1 110 ? -10.906 2.559   -33.811 1.00 0.00  ? 110 ILE A HG21   1  
ATOM   1750  H HG22   . ILE A 1 110 ? -12.180 1.626   -34.595 1.00 0.00  ? 110 ILE A HG22   1  
ATOM   1751  H HG23   . ILE A 1 110 ? -12.415 2.235   -32.956 1.00 0.00  ? 110 ILE A HG23   1  
ATOM   1752  H HD11   . ILE A 1 110 ? -12.635 4.335   -31.322 1.00 0.00  ? 110 ILE A HD11   1  
ATOM   1753  H HD12   . ILE A 1 110 ? -12.168 5.877   -32.039 1.00 0.00  ? 110 ILE A HD12   1  
ATOM   1754  H HD13   . ILE A 1 110 ? -11.277 4.409   -32.448 1.00 0.00  ? 110 ILE A HD13   1  
ATOM   1755  N N      . ARG A 1 111 ? -9.409  3.858   -36.231 1.00 0.00  ? 111 ARG A N      1  
ATOM   1756  C CA     . ARG A 1 111 ? -8.548  3.116   -37.144 1.00 0.00  ? 111 ARG A CA     1  
ATOM   1757  C C      . ARG A 1 111 ? -7.734  2.067   -36.395 1.00 0.00  ? 111 ARG A C      1  
ATOM   1758  O O      . ARG A 1 111 ? -6.719  2.376   -35.770 1.00 0.00  ? 111 ARG A O      1  
ATOM   1759  C CB     . ARG A 1 111 ? -7.623  4.084   -37.888 1.00 0.00  ? 111 ARG A CB     1  
ATOM   1760  C CG     . ARG A 1 111 ? -8.372  5.217   -38.576 1.00 0.00  ? 111 ARG A CG     1  
ATOM   1761  C CD     . ARG A 1 111 ? -7.629  6.540   -38.469 1.00 0.00  ? 111 ARG A CD     1  
ATOM   1762  N NE     . ARG A 1 111 ? -6.219  6.414   -38.831 1.00 0.00  ? 111 ARG A NE     1  
ATOM   1763  C CZ     . ARG A 1 111 ? -5.285  7.301   -38.496 1.00 0.00  ? 111 ARG A CZ     1  
ATOM   1764  N NH1    . ARG A 1 111 ? -5.606  8.378   -37.792 1.00 0.00  ? 111 ARG A NH1    1  
ATOM   1765  N NH2    . ARG A 1 111 ? -4.026  7.110   -38.867 1.00 0.00  ? 111 ARG A NH2    1  
ATOM   1766  H H      . ARG A 1 111 ? -9.007  4.515   -35.625 1.00 0.00  ? 111 ARG A H      1  
ATOM   1767  H HA     . ARG A 1 111 ? -9.182  2.617   -37.862 1.00 0.00  ? 111 ARG A HA     1  
ATOM   1768  H HB2    . ARG A 1 111 ? -6.926  4.514   -37.185 1.00 0.00  ? 111 ARG A HB2    1  
ATOM   1769  H HB3    . ARG A 1 111 ? -7.074  3.536   -38.639 1.00 0.00  ? 111 ARG A HB3    1  
ATOM   1770  H HG2    . ARG A 1 111 ? -8.498  4.975   -39.619 1.00 0.00  ? 111 ARG A HG2    1  
ATOM   1771  H HG3    . ARG A 1 111 ? -9.341  5.320   -38.112 1.00 0.00  ? 111 ARG A HG3    1  
ATOM   1772  H HD2    . ARG A 1 111 ? -8.096  7.254   -39.132 1.00 0.00  ? 111 ARG A HD2    1  
ATOM   1773  H HD3    . ARG A 1 111 ? -7.699  6.900   -37.453 1.00 0.00  ? 111 ARG A HD3    1  
ATOM   1774  H HE     . ARG A 1 111 ? -5.955  5.626   -39.353 1.00 0.00  ? 111 ARG A HE     1  
ATOM   1775  H HH11   . ARG A 1 111 ? -6.554  8.530   -37.507 1.00 0.00  ? 111 ARG A HH11   1  
ATOM   1776  H HH12   . ARG A 1 111 ? -4.899  9.041   -37.543 1.00 0.00  ? 111 ARG A HH12   1  
ATOM   1777  H HH21   . ARG A 1 111 ? -3.778  6.301   -39.400 1.00 0.00  ? 111 ARG A HH21   1  
ATOM   1778  H HH22   . ARG A 1 111 ? -3.326  7.777   -38.616 1.00 0.00  ? 111 ARG A HH22   1  
ATOM   1779  N N      . LEU A 1 112 ? -8.198  0.823   -36.455 1.00 0.00  ? 112 LEU A N      1  
ATOM   1780  C CA     . LEU A 1 112 ? -7.530  -0.286  -35.778 1.00 0.00  ? 112 LEU A CA     1  
ATOM   1781  C C      . LEU A 1 112 ? -6.419  -0.879  -36.638 1.00 0.00  ? 112 LEU A C      1  
ATOM   1782  O O      . LEU A 1 112 ? -6.257  -0.516  -37.804 1.00 0.00  ? 112 LEU A O      1  
ATOM   1783  C CB     . LEU A 1 112 ? -8.544  -1.376  -35.419 1.00 0.00  ? 112 LEU A CB     1  
ATOM   1784  C CG     . LEU A 1 112 ? -9.912  -0.868  -34.962 1.00 0.00  ? 112 LEU A CG     1  
ATOM   1785  C CD1    . LEU A 1 112 ? -10.885 -2.026  -34.804 1.00 0.00  ? 112 LEU A CD1    1  
ATOM   1786  C CD2    . LEU A 1 112 ? -9.781  -0.093  -33.660 1.00 0.00  ? 112 LEU A CD2    1  
ATOM   1787  H H      . LEU A 1 112 ? -9.017  0.648   -36.965 1.00 0.00  ? 112 LEU A H      1  
ATOM   1788  H HA     . LEU A 1 112 ? -7.095  0.099   -34.868 1.00 0.00  ? 112 LEU A HA     1  
ATOM   1789  H HB2    . LEU A 1 112 ? -8.687  -2.004  -36.286 1.00 0.00  ? 112 LEU A HB2    1  
ATOM   1790  H HB3    . LEU A 1 112 ? -8.126  -1.977  -34.625 1.00 0.00  ? 112 LEU A HB3    1  
ATOM   1791  H HG     . LEU A 1 112 ? -10.310 -0.199  -35.711 1.00 0.00  ? 112 LEU A HG     1  
ATOM   1792  H HD11   . LEU A 1 112 ? -11.270 -2.041  -33.795 1.00 0.00  ? 112 LEU A HD11   1  
ATOM   1793  H HD12   . LEU A 1 112 ? -10.377 -2.958  -35.008 1.00 0.00  ? 112 LEU A HD12   1  
ATOM   1794  H HD13   . LEU A 1 112 ? -11.705 -1.905  -35.498 1.00 0.00  ? 112 LEU A HD13   1  
ATOM   1795  H HD21   . LEU A 1 112 ? -10.465 0.739   -33.664 1.00 0.00  ? 112 LEU A HD21   1  
ATOM   1796  H HD22   . LEU A 1 112 ? -8.773  0.274   -33.560 1.00 0.00  ? 112 LEU A HD22   1  
ATOM   1797  H HD23   . LEU A 1 112 ? -10.012 -0.744  -32.829 1.00 0.00  ? 112 LEU A HD23   1  
ATOM   1798  N N      . SER A 1 113 ? -5.655  -1.797  -36.051 1.00 0.00  ? 113 SER A N      1  
ATOM   1799  C CA     . SER A 1 113 ? -4.555  -2.452  -36.753 1.00 0.00  ? 113 SER A CA     1  
ATOM   1800  C C      . SER A 1 113 ? -4.781  -3.961  -36.830 1.00 0.00  ? 113 SER A C      1  
ATOM   1801  O O      . SER A 1 113 ? -5.844  -4.458  -36.460 1.00 0.00  ? 113 SER A O      1  
ATOM   1802  C CB     . SER A 1 113 ? -3.228  -2.158  -36.050 1.00 0.00  ? 113 SER A CB     1  
ATOM   1803  O OG     . SER A 1 113 ? -2.561  -1.064  -36.655 1.00 0.00  ? 113 SER A OG     1  
ATOM   1804  H H      . SER A 1 113 ? -5.837  -2.043  -35.120 1.00 0.00  ? 113 SER A H      1  
ATOM   1805  H HA     . SER A 1 113 ? -4.518  -2.054  -37.756 1.00 0.00  ? 113 SER A HA     1  
ATOM   1806  H HB2    . SER A 1 113 ? -3.418  -1.918  -35.015 1.00 0.00  ? 113 SER A HB2    1  
ATOM   1807  H HB3    . SER A 1 113 ? -2.593  -3.028  -36.104 1.00 0.00  ? 113 SER A HB3    1  
ATOM   1808  H HG     . SER A 1 113 ? -1.618  -1.134  -36.489 1.00 0.00  ? 113 SER A HG     1  
ATOM   1809  N N      . HIS A 1 114 ? -3.776  -4.683  -37.314 1.00 0.00  ? 114 HIS A N      1  
ATOM   1810  C CA     . HIS A 1 114 ? -3.864  -6.136  -37.441 1.00 0.00  ? 114 HIS A CA     1  
ATOM   1811  C C      . HIS A 1 114 ? -4.097  -6.794  -36.084 1.00 0.00  ? 114 HIS A C      1  
ATOM   1812  O O      . HIS A 1 114 ? -4.708  -7.860  -35.998 1.00 0.00  ? 114 HIS A O      1  
ATOM   1813  C CB     . HIS A 1 114 ? -2.584  -6.693  -38.068 1.00 0.00  ? 114 HIS A CB     1  
ATOM   1814  C CG     . HIS A 1 114 ? -2.182  -6.002  -39.334 1.00 0.00  ? 114 HIS A CG     1  
ATOM   1815  N ND1    . HIS A 1 114 ? -2.417  -6.526  -40.587 1.00 0.00  ? 114 HIS A ND1    1  
ATOM   1816  C CD2    . HIS A 1 114 ? -1.549  -4.821  -39.536 1.00 0.00  ? 114 HIS A CD2    1  
ATOM   1817  C CE1    . HIS A 1 114 ? -1.947  -5.699  -41.505 1.00 0.00  ? 114 HIS A CE1    1  
ATOM   1818  N NE2    . HIS A 1 114 ? -1.416  -4.656  -40.893 1.00 0.00  ? 114 HIS A NE2    1  
ATOM   1819  H H      . HIS A 1 114 ? -2.954  -4.230  -37.595 1.00 0.00  ? 114 HIS A H      1  
ATOM   1820  H HA     . HIS A 1 114 ? -4.698  -6.361  -38.086 1.00 0.00  ? 114 HIS A HA     1  
ATOM   1821  H HB2    . HIS A 1 114 ? -1.773  -6.594  -37.364 1.00 0.00  ? 114 HIS A HB2    1  
ATOM   1822  H HB3    . HIS A 1 114 ? -2.730  -7.740  -38.293 1.00 0.00  ? 114 HIS A HB3    1  
ATOM   1823  H HD1    . HIS A 1 114 ? -2.862  -7.379  -40.777 1.00 0.00  ? 114 HIS A HD1    1  
ATOM   1824  H HD2    . HIS A 1 114 ? -1.213  -4.135  -38.771 1.00 0.00  ? 114 HIS A HD2    1  
ATOM   1825  H HE1    . HIS A 1 114 ? -1.990  -5.849  -42.574 1.00 0.00  ? 114 HIS A HE1    1  
ATOM   1826  H HE2    . HIS A 1 114 ? -1.015  -3.881  -41.338 1.00 0.00  ? 114 HIS A HE2    1  
ATOM   1827  N N      . GLU A 1 115 ? -3.600  -6.158  -35.028 1.00 0.00  ? 115 GLU A N      1  
ATOM   1828  C CA     . GLU A 1 115 ? -3.742  -6.687  -33.675 1.00 0.00  ? 115 GLU A CA     1  
ATOM   1829  C C      . GLU A 1 115 ? -5.161  -6.496  -33.137 1.00 0.00  ? 115 GLU A C      1  
ATOM   1830  O O      . GLU A 1 115 ? -5.494  -6.996  -32.063 1.00 0.00  ? 115 GLU A O      1  
ATOM   1831  C CB     . GLU A 1 115 ? -2.738  -6.011  -32.740 1.00 0.00  ? 115 GLU A CB     1  
ATOM   1832  C CG     . GLU A 1 115 ? -1.293  -6.178  -33.178 1.00 0.00  ? 115 GLU A CG     1  
ATOM   1833  C CD     . GLU A 1 115 ? -0.364  -5.179  -32.518 1.00 0.00  ? 115 GLU A CD     1  
ATOM   1834  O OE1    . GLU A 1 115 ? -0.654  -4.764  -31.376 1.00 0.00  ? 115 GLU A OE1    1  
ATOM   1835  O OE2    . GLU A 1 115 ? 0.653   -4.810  -33.142 1.00 0.00  ? 115 GLU A OE2    1  
ATOM   1836  H H      . GLU A 1 115 ? -3.117  -5.316  -35.163 1.00 0.00  ? 115 GLU A H      1  
ATOM   1837  H HA     . GLU A 1 115 ? -3.527  -7.743  -33.711 1.00 0.00  ? 115 GLU A HA     1  
ATOM   1838  H HB2    . GLU A 1 115 ? -2.959  -4.956  -32.694 1.00 0.00  ? 115 GLU A HB2    1  
ATOM   1839  H HB3    . GLU A 1 115 ? -2.844  -6.435  -31.751 1.00 0.00  ? 115 GLU A HB3    1  
ATOM   1840  H HG2    . GLU A 1 115 ? -0.966  -7.173  -32.922 1.00 0.00  ? 115 GLU A HG2    1  
ATOM   1841  H HG3    . GLU A 1 115 ? -1.237  -6.047  -34.249 1.00 0.00  ? 115 GLU A HG3    1  
ATOM   1842  H HE2    . GLU A 1 115 ? 1.195   -4.177  -32.665 1.00 0.00  ? 115 GLU A HE2    1  
ATOM   1843  N N      . HIS A 1 116 ? -5.996  -5.775  -33.879 1.00 0.00  ? 116 HIS A N      1  
ATOM   1844  C CA     . HIS A 1 116 ? -7.370  -5.531  -33.457 1.00 0.00  ? 116 HIS A CA     1  
ATOM   1845  C C      . HIS A 1 116 ? -8.322  -5.567  -34.648 1.00 0.00  ? 116 HIS A C      1  
ATOM   1846  O O      . HIS A 1 116 ? -8.108  -4.890  -35.650 1.00 0.00  ? 116 HIS A O      1  
ATOM   1847  C CB     . HIS A 1 116 ? -7.472  -4.186  -32.739 1.00 0.00  ? 116 HIS A CB     1  
ATOM   1848  C CG     . HIS A 1 116 ? -6.672  -4.126  -31.472 1.00 0.00  ? 116 HIS A CG     1  
ATOM   1849  N ND1    . HIS A 1 116 ? -5.522  -3.377  -31.341 1.00 0.00  ? 116 HIS A ND1    1  
ATOM   1850  C CD2    . HIS A 1 116 ? -6.862  -4.733  -30.276 1.00 0.00  ? 116 HIS A CD2    1  
ATOM   1851  C CE1    . HIS A 1 116 ? -5.039  -3.525  -30.120 1.00 0.00  ? 116 HIS A CE1    1  
ATOM   1852  N NE2    . HIS A 1 116 ? -5.834  -4.341  -29.455 1.00 0.00  ? 116 HIS A NE2    1  
ATOM   1853  H H      . HIS A 1 116 ? -5.682  -5.397  -34.727 1.00 0.00  ? 116 HIS A H      1  
ATOM   1854  H HA     . HIS A 1 116 ? -7.646  -6.316  -32.768 1.00 0.00  ? 116 HIS A HA     1  
ATOM   1855  H HB2    . HIS A 1 116 ? -7.112  -3.408  -33.395 1.00 0.00  ? 116 HIS A HB2    1  
ATOM   1856  H HB3    . HIS A 1 116 ? -8.506  -3.993  -32.491 1.00 0.00  ? 116 HIS A HB3    1  
ATOM   1857  H HD1    . HIS A 1 116 ? -5.120  -2.822  -32.041 1.00 0.00  ? 116 HIS A HD1    1  
ATOM   1858  H HD2    . HIS A 1 116 ? -7.672  -5.400  -30.017 1.00 0.00  ? 116 HIS A HD2    1  
ATOM   1859  H HE1    . HIS A 1 116 ? -4.148  -3.054  -29.732 1.00 0.00  ? 116 HIS A HE1    1  
ATOM   1860  H HE2    . HIS A 1 116 ? -5.718  -4.606  -28.518 1.00 0.00  ? 116 HIS A HE2    1  
ATOM   1861  N N      . GLN A 1 117 ? -9.376  -6.369  -34.527 1.00 0.00  ? 117 GLN A N      1  
ATOM   1862  C CA     . GLN A 1 117 ? -10.362 -6.500  -35.596 1.00 0.00  ? 117 GLN A CA     1  
ATOM   1863  C C      . GLN A 1 117 ? -11.616 -5.684  -35.303 1.00 0.00  ? 117 GLN A C      1  
ATOM   1864  O O      . GLN A 1 117 ? -12.398 -5.389  -36.209 1.00 0.00  ? 117 GLN A O      1  
ATOM   1865  C CB     . GLN A 1 117 ? -10.736 -7.970  -35.784 1.00 0.00  ? 117 GLN A CB     1  
ATOM   1866  C CG     . GLN A 1 117 ? -11.262 -8.627  -34.517 1.00 0.00  ? 117 GLN A CG     1  
ATOM   1867  C CD     . GLN A 1 117 ? -12.693 -9.105  -34.656 1.00 0.00  ? 117 GLN A CD     1  
ATOM   1868  O OE1    . GLN A 1 117 ? -13.624 -8.474  -34.153 1.00 0.00  ? 117 GLN A OE1    1  
ATOM   1869  N NE2    . GLN A 1 117 ? -12.878 -10.228 -35.342 1.00 0.00  ? 117 GLN A NE2    1  
ATOM   1870  H H      . GLN A 1 117 ? -9.492  -6.887  -33.705 1.00 0.00  ? 117 GLN A H      1  
ATOM   1871  H HA     . GLN A 1 117 ? -9.912  -6.135  -36.506 1.00 0.00  ? 117 GLN A HA     1  
ATOM   1872  H HB2    . GLN A 1 117 ? -11.499 -8.041  -36.546 1.00 0.00  ? 117 GLN A HB2    1  
ATOM   1873  H HB3    . GLN A 1 117 ? -9.862  -8.515  -36.110 1.00 0.00  ? 117 GLN A HB3    1  
ATOM   1874  H HG2    . GLN A 1 117 ? -10.638 -9.475  -34.283 1.00 0.00  ? 117 GLN A HG2    1  
ATOM   1875  H HG3    . GLN A 1 117 ? -11.214 -7.911  -33.711 1.00 0.00  ? 117 GLN A HG3    1  
ATOM   1876  H HE21   . GLN A 1 117 ? -12.091 -10.677 -35.713 1.00 0.00  ? 117 GLN A HE21   1  
ATOM   1877  H HE22   . GLN A 1 117 ? -13.794 -10.561 -35.446 1.00 0.00  ? 117 GLN A HE22   1  
ATOM   1878  N N      . ALA A 1 118 ? -11.812 -5.322  -34.039 1.00 0.00  ? 118 ALA A N      1  
ATOM   1879  C CA     . ALA A 1 118 ? -12.981 -4.547  -33.644 1.00 0.00  ? 118 ALA A CA     1  
ATOM   1880  C C      . ALA A 1 118 ? -12.717 -3.750  -32.370 1.00 0.00  ? 118 ALA A C      1  
ATOM   1881  O O      . ALA A 1 118 ? -11.760 -4.019  -31.645 1.00 0.00  ? 118 ALA A O      1  
ATOM   1882  C CB     . ALA A 1 118 ? -14.180 -5.465  -33.453 1.00 0.00  ? 118 ALA A CB     1  
ATOM   1883  H H      . ALA A 1 118 ? -11.161 -5.587  -33.357 1.00 0.00  ? 118 ALA A H      1  
ATOM   1884  H HA     . ALA A 1 118 ? -13.210 -3.858  -34.445 1.00 0.00  ? 118 ALA A HA     1  
ATOM   1885  H HB1    . ALA A 1 118 ? -14.146 -5.898  -32.466 1.00 0.00  ? 118 ALA A HB1    1  
ATOM   1886  H HB2    . ALA A 1 118 ? -14.151 -6.251  -34.193 1.00 0.00  ? 118 ALA A HB2    1  
ATOM   1887  H HB3    . ALA A 1 118 ? -15.090 -4.895  -33.568 1.00 0.00  ? 118 ALA A HB3    1  
ATOM   1888  N N      . TYR A 1 119 ? -13.573 -2.768  -32.111 1.00 0.00  ? 119 TYR A N      1  
ATOM   1889  C CA     . TYR A 1 119 ? -13.439 -1.923  -30.929 1.00 0.00  ? 119 TYR A CA     1  
ATOM   1890  C C      . TYR A 1 119 ? -14.803 -1.670  -30.288 1.00 0.00  ? 119 TYR A C      1  
ATOM   1891  O O      . TYR A 1 119 ? -15.831 -2.081  -30.821 1.00 0.00  ? 119 TYR A O      1  
ATOM   1892  C CB     . TYR A 1 119 ? -12.790 -0.596  -31.305 1.00 0.00  ? 119 TYR A CB     1  
ATOM   1893  C CG     . TYR A 1 119 ? -13.691 0.295   -32.130 1.00 0.00  ? 119 TYR A CG     1  
ATOM   1894  C CD1    . TYR A 1 119 ? -13.778 0.140   -33.507 1.00 0.00  ? 119 TYR A CD1    1  
ATOM   1895  C CD2    . TYR A 1 119 ? -14.458 1.283   -31.529 1.00 0.00  ? 119 TYR A CD2    1  
ATOM   1896  C CE1    . TYR A 1 119 ? -14.605 0.948   -34.264 1.00 0.00  ? 119 TYR A CE1    1  
ATOM   1897  C CE2    . TYR A 1 119 ? -15.289 2.094   -32.277 1.00 0.00  ? 119 TYR A CE2    1  
ATOM   1898  C CZ     . TYR A 1 119 ? -15.357 1.922   -33.645 1.00 0.00  ? 119 TYR A CZ     1  
ATOM   1899  O OH     . TYR A 1 119 ? -16.182 2.729   -34.395 1.00 0.00  ? 119 TYR A OH     1  
ATOM   1900  H H      . TYR A 1 119 ? -14.314 -2.603  -32.730 1.00 0.00  ? 119 TYR A H      1  
ATOM   1901  H HA     . TYR A 1 119 ? -12.808 -2.439  -30.220 1.00 0.00  ? 119 TYR A HA     1  
ATOM   1902  H HB2    . TYR A 1 119 ? -12.526 -0.063  -30.404 1.00 0.00  ? 119 TYR A HB2    1  
ATOM   1903  H HB3    . TYR A 1 119 ? -11.894 -0.788  -31.879 1.00 0.00  ? 119 TYR A HB3    1  
ATOM   1904  H HD1    . TYR A 1 119 ? -13.187 -0.627  -33.987 1.00 0.00  ? 119 TYR A HD1    1  
ATOM   1905  H HD2    . TYR A 1 119 ? -14.401 1.415   -30.458 1.00 0.00  ? 119 TYR A HD2    1  
ATOM   1906  H HE1    . TYR A 1 119 ? -14.656 0.812   -35.335 1.00 0.00  ? 119 TYR A HE1    1  
ATOM   1907  H HE2    . TYR A 1 119 ? -15.878 2.858   -31.794 1.00 0.00  ? 119 TYR A HE2    1  
ATOM   1908  H HH     . TYR A 1 119 ? -16.958 2.233   -34.667 1.00 0.00  ? 119 TYR A HH     1  
ATOM   1909  N N      . ARG A 1 120 ? -14.803 -0.994  -29.144 1.00 0.00  ? 120 ARG A N      1  
ATOM   1910  C CA     . ARG A 1 120 ? -16.045 -0.700  -28.440 1.00 0.00  ? 120 ARG A CA     1  
ATOM   1911  C C      . ARG A 1 120 ? -15.882 0.481   -27.487 1.00 0.00  ? 120 ARG A C      1  
ATOM   1912  O O      . ARG A 1 120 ? -14.774 0.808   -27.063 1.00 0.00  ? 120 ARG A O      1  
ATOM   1913  C CB     . ARG A 1 120 ? -16.510 -1.921  -27.647 1.00 0.00  ? 120 ARG A CB     1  
ATOM   1914  C CG     . ARG A 1 120 ? -17.277 -2.941  -28.474 1.00 0.00  ? 120 ARG A CG     1  
ATOM   1915  C CD     . ARG A 1 120 ? -17.855 -4.043  -27.598 1.00 0.00  ? 120 ARG A CD     1  
ATOM   1916  N NE     . ARG A 1 120 ? -19.291 -4.218  -27.810 1.00 0.00  ? 120 ARG A NE     1  
ATOM   1917  C CZ     . ARG A 1 120 ? -19.815 -5.061  -28.697 1.00 0.00  ? 120 ARG A CZ     1  
ATOM   1918  N NH1    . ARG A 1 120 ? -19.031 -5.801  -29.472 1.00 0.00  ? 120 ARG A NH1    1  
ATOM   1919  N NH2    . ARG A 1 120 ? -21.132 -5.163  -28.811 1.00 0.00  ? 120 ARG A NH2    1  
ATOM   1920  H H      . ARG A 1 120 ? -13.952 -0.692  -28.762 1.00 0.00  ? 120 ARG A H      1  
ATOM   1921  H HA     . ARG A 1 120 ? -16.795 -0.453  -29.176 1.00 0.00  ? 120 ARG A HA     1  
ATOM   1922  H HB2    . ARG A 1 120 ? -15.644 -2.410  -27.226 1.00 0.00  ? 120 ARG A HB2    1  
ATOM   1923  H HB3    . ARG A 1 120 ? -17.150 -1.590  -26.843 1.00 0.00  ? 120 ARG A HB3    1  
ATOM   1924  H HG2    . ARG A 1 120 ? -18.083 -2.441  -28.986 1.00 0.00  ? 120 ARG A HG2    1  
ATOM   1925  H HG3    . ARG A 1 120 ? -16.604 -3.383  -29.196 1.00 0.00  ? 120 ARG A HG3    1  
ATOM   1926  H HD2    . ARG A 1 120 ? -17.350 -4.969  -27.827 1.00 0.00  ? 120 ARG A HD2    1  
ATOM   1927  H HD3    . ARG A 1 120 ? -17.684 -3.789  -26.562 1.00 0.00  ? 120 ARG A HD3    1  
ATOM   1928  H HE     . ARG A 1 120 ? -19.896 -3.681  -27.259 1.00 0.00  ? 120 ARG A HE     1  
ATOM   1929  H HH11   . ARG A 1 120 ? -18.037 -5.728  -29.395 1.00 0.00  ? 120 ARG A HH11   1  
ATOM   1930  H HH12   . ARG A 1 120 ? -19.435 -6.434  -30.133 1.00 0.00  ? 120 ARG A HH12   1  
ATOM   1931  H HH21   . ARG A 1 120 ? -21.729 -4.608  -28.232 1.00 0.00  ? 120 ARG A HH21   1  
ATOM   1932  H HH22   . ARG A 1 120 ? -21.529 -5.796  -29.476 1.00 0.00  ? 120 ARG A HH22   1  
ATOM   1933  N N      . TRP A 1 121 ? -17.007 1.099   -27.144 1.00 0.00  ? 121 TRP A N      1  
ATOM   1934  C CA     . TRP A 1 121 ? -17.024 2.230   -26.226 1.00 0.00  ? 121 TRP A CA     1  
ATOM   1935  C C      . TRP A 1 121 ? -18.016 1.961   -25.101 1.00 0.00  ? 121 TRP A C      1  
ATOM   1936  O O      . TRP A 1 121 ? -19.228 1.987   -25.314 1.00 0.00  ? 121 TRP A O      1  
ATOM   1937  C CB     . TRP A 1 121 ? -17.403 3.518   -26.963 1.00 0.00  ? 121 TRP A CB     1  
ATOM   1938  C CG     . TRP A 1 121 ? -16.310 4.044   -27.842 1.00 0.00  ? 121 TRP A CG     1  
ATOM   1939  C CD1    . TRP A 1 121 ? -16.103 3.752   -29.158 1.00 0.00  ? 121 TRP A CD1    1  
ATOM   1940  C CD2    . TRP A 1 121 ? -15.274 4.958   -27.465 1.00 0.00  ? 121 TRP A CD2    1  
ATOM   1941  N NE1    . TRP A 1 121 ? -15.001 4.427   -29.624 1.00 0.00  ? 121 TRP A NE1    1  
ATOM   1942  C CE2    . TRP A 1 121 ? -14.474 5.175   -28.604 1.00 0.00  ? 121 TRP A CE2    1  
ATOM   1943  C CE3    . TRP A 1 121 ? -14.943 5.616   -26.278 1.00 0.00  ? 121 TRP A CE3    1  
ATOM   1944  C CZ2    . TRP A 1 121 ? -13.369 6.019   -28.588 1.00 0.00  ? 121 TRP A CZ2    1  
ATOM   1945  C CZ3    . TRP A 1 121 ? -13.845 6.454   -26.262 1.00 0.00  ? 121 TRP A CZ3    1  
ATOM   1946  C CH2    . TRP A 1 121 ? -13.069 6.650   -27.412 1.00 0.00  ? 121 TRP A CH2    1  
ATOM   1947  H H      . TRP A 1 121 ? -17.855 0.773   -27.510 1.00 0.00  ? 121 TRP A H      1  
ATOM   1948  H HA     . TRP A 1 121 ? -16.035 2.337   -25.805 1.00 0.00  ? 121 TRP A HA     1  
ATOM   1949  H HB2    . TRP A 1 121 ? -18.267 3.328   -27.584 1.00 0.00  ? 121 TRP A HB2    1  
ATOM   1950  H HB3    . TRP A 1 121 ? -17.647 4.280   -26.237 1.00 0.00  ? 121 TRP A HB3    1  
ATOM   1951  H HD1    . TRP A 1 121 ? -16.724 3.084   -29.737 1.00 0.00  ? 121 TRP A HD1    1  
ATOM   1952  H HE1    . TRP A 1 121 ? -14.651 4.383   -30.539 1.00 0.00  ? 121 TRP A HE1    1  
ATOM   1953  H HE3    . TRP A 1 121 ? -15.529 5.478   -25.381 1.00 0.00  ? 121 TRP A HE3    1  
ATOM   1954  H HZ2    . TRP A 1 121 ? -12.760 6.183   -29.466 1.00 0.00  ? 121 TRP A HZ2    1  
ATOM   1955  H HZ3    . TRP A 1 121 ? -13.574 6.970   -25.353 1.00 0.00  ? 121 TRP A HZ3    1  
ATOM   1956  H HH2    . TRP A 1 121 ? -12.219 7.311   -27.354 1.00 0.00  ? 121 TRP A HH2    1  
ATOM   1957  N N      . LEU A 1 122 ? -17.500 1.674   -23.908 1.00 0.00  ? 122 LEU A N      1  
ATOM   1958  C CA     . LEU A 1 122 ? -18.357 1.372   -22.766 1.00 0.00  ? 122 LEU A CA     1  
ATOM   1959  C C      . LEU A 1 122 ? -17.851 2.039   -21.494 1.00 0.00  ? 122 LEU A C      1  
ATOM   1960  O O      . LEU A 1 122 ? -16.723 2.525   -21.438 1.00 0.00  ? 122 LEU A O      1  
ATOM   1961  C CB     . LEU A 1 122 ? -18.437 -0.144  -22.549 1.00 0.00  ? 122 LEU A CB     1  
ATOM   1962  C CG     . LEU A 1 122 ? -18.162 -1.003  -23.789 1.00 0.00  ? 122 LEU A CG     1  
ATOM   1963  C CD1    . LEU A 1 122 ? -16.738 -1.540  -23.762 1.00 0.00  ? 122 LEU A CD1    1  
ATOM   1964  C CD2    . LEU A 1 122 ? -19.163 -2.145  -23.879 1.00 0.00  ? 122 LEU A CD2    1  
ATOM   1965  H H      . LEU A 1 122 ? -16.528 1.651   -23.799 1.00 0.00  ? 122 LEU A H      1  
ATOM   1966  H HA     . LEU A 1 122 ? -19.346 1.747   -22.984 1.00 0.00  ? 122 LEU A HA     1  
ATOM   1967  H HB2    . LEU A 1 122 ? -17.720 -0.413  -21.786 1.00 0.00  ? 122 LEU A HB2    1  
ATOM   1968  H HB3    . LEU A 1 122 ? -19.426 -0.381  -22.187 1.00 0.00  ? 122 LEU A HB3    1  
ATOM   1969  H HG     . LEU A 1 122 ? -18.271 -0.395  -24.673 1.00 0.00  ? 122 LEU A HG     1  
ATOM   1970  H HD11   . LEU A 1 122 ? -16.619 -2.198  -22.913 1.00 0.00  ? 122 LEU A HD11   1  
ATOM   1971  H HD12   . LEU A 1 122 ? -16.044 -0.717  -23.678 1.00 0.00  ? 122 LEU A HD12   1  
ATOM   1972  H HD13   . LEU A 1 122 ? -16.541 -2.086  -24.674 1.00 0.00  ? 122 LEU A HD13   1  
ATOM   1973  H HD21   . LEU A 1 122 ? -18.875 -2.933  -23.202 1.00 0.00  ? 122 LEU A HD21   1  
ATOM   1974  H HD22   . LEU A 1 122 ? -19.180 -2.529  -24.891 1.00 0.00  ? 122 LEU A HD22   1  
ATOM   1975  H HD23   . LEU A 1 122 ? -20.146 -1.785  -23.616 1.00 0.00  ? 122 LEU A HD23   1  
ATOM   1976  N N      . GLY A 1 123 ? -18.692 2.038   -20.463 1.00 0.00  ? 123 GLY A N      1  
ATOM   1977  C CA     . GLY A 1 123 ? -18.311 2.629   -19.195 1.00 0.00  ? 123 GLY A CA     1  
ATOM   1978  C C      . GLY A 1 123 ? -17.334 1.753   -18.440 1.00 0.00  ? 123 GLY A C      1  
ATOM   1979  O O      . GLY A 1 123 ? -16.600 0.976   -19.046 1.00 0.00  ? 123 GLY A O      1  
ATOM   1980  H H      . GLY A 1 123 ? -19.572 1.621   -20.564 1.00 0.00  ? 123 GLY A H      1  
ATOM   1981  H HA2    . GLY A 1 123 ? -17.855 3.591   -19.378 1.00 0.00  ? 123 GLY A HA2    1  
ATOM   1982  H HA3    . GLY A 1 123 ? -19.197 2.767   -18.593 1.00 0.00  ? 123 GLY A HA3    1  
ATOM   1983  N N      . LEU A 1 124 ? -17.323 1.869   -17.118 1.00 0.00  ? 124 LEU A N      1  
ATOM   1984  C CA     . LEU A 1 124 ? -16.423 1.067   -16.300 1.00 0.00  ? 124 LEU A CA     1  
ATOM   1985  C C      . LEU A 1 124 ? -16.941 -0.362  -16.164 1.00 0.00  ? 124 LEU A C      1  
ATOM   1986  O O      . LEU A 1 124 ? -16.186 -1.321  -16.323 1.00 0.00  ? 124 LEU A O      1  
ATOM   1987  C CB     . LEU A 1 124 ? -16.251 1.695   -14.914 1.00 0.00  ? 124 LEU A CB     1  
ATOM   1988  C CG     . LEU A 1 124 ? -15.363 0.904   -13.946 1.00 0.00  ? 124 LEU A CG     1  
ATOM   1989  C CD1    . LEU A 1 124 ? -14.096 0.428   -14.643 1.00 0.00  ? 124 LEU A CD1    1  
ATOM   1990  C CD2    . LEU A 1 124 ? -15.013 1.752   -12.735 1.00 0.00  ? 124 LEU A CD2    1  
ATOM   1991  H H      . LEU A 1 124 ? -17.934 2.503   -16.685 1.00 0.00  ? 124 LEU A H      1  
ATOM   1992  H HA     . LEU A 1 124 ? -15.464 1.043   -16.794 1.00 0.00  ? 124 LEU A HA     1  
ATOM   1993  H HB2    . LEU A 1 124 ? -15.825 2.679   -15.039 1.00 0.00  ? 124 LEU A HB2    1  
ATOM   1994  H HB3    . LEU A 1 124 ? -17.229 1.800   -14.466 1.00 0.00  ? 124 LEU A HB3    1  
ATOM   1995  H HG     . LEU A 1 124 ? -15.902 0.033   -13.603 1.00 0.00  ? 124 LEU A HG     1  
ATOM   1996  H HD11   . LEU A 1 124 ? -13.521 -0.183  -13.963 1.00 0.00  ? 124 LEU A HD11   1  
ATOM   1997  H HD12   . LEU A 1 124 ? -13.508 1.280   -14.946 1.00 0.00  ? 124 LEU A HD12   1  
ATOM   1998  H HD13   . LEU A 1 124 ? -14.361 -0.154  -15.513 1.00 0.00  ? 124 LEU A HD13   1  
ATOM   1999  H HD21   . LEU A 1 124 ? -14.543 2.669   -13.058 1.00 0.00  ? 124 LEU A HD21   1  
ATOM   2000  H HD22   . LEU A 1 124 ? -14.332 1.204   -12.099 1.00 0.00  ? 124 LEU A HD22   1  
ATOM   2001  H HD23   . LEU A 1 124 ? -15.912 1.982   -12.183 1.00 0.00  ? 124 LEU A HD23   1  
ATOM   2002  N N      . GLU A 1 125 ? -18.228 -0.495  -15.865 1.00 0.00  ? 125 GLU A N      1  
ATOM   2003  C CA     . GLU A 1 125 ? -18.846 -1.809  -15.699 1.00 0.00  ? 125 GLU A CA     1  
ATOM   2004  C C      . GLU A 1 125 ? -18.654 -2.677  -16.934 1.00 0.00  ? 125 GLU A C      1  
ATOM   2005  O O      . GLU A 1 125 ? -18.246 -3.834  -16.830 1.00 0.00  ? 125 GLU A O      1  
ATOM   2006  C CB     . GLU A 1 125 ? -20.343 -1.666  -15.396 1.00 0.00  ? 125 GLU A CB     1  
ATOM   2007  C CG     . GLU A 1 125 ? -21.159 -1.105  -16.555 1.00 0.00  ? 125 GLU A CG     1  
ATOM   2008  C CD     . GLU A 1 125 ? -22.631 -0.974  -16.218 1.00 0.00  ? 125 GLU A CD     1  
ATOM   2009  O OE1    . GLU A 1 125 ? -23.293 -2.016  -16.035 1.00 0.00  ? 125 GLU A OE1    1  
ATOM   2010  O OE2    . GLU A 1 125 ? -23.121 0.173   -16.139 1.00 0.00  ? 125 GLU A OE2    1  
ATOM   2011  H H      . GLU A 1 125 ? -18.777 0.308   -15.748 1.00 0.00  ? 125 GLU A H      1  
ATOM   2012  H HA     . GLU A 1 125 ? -18.365 -2.293  -14.864 1.00 0.00  ? 125 GLU A HA     1  
ATOM   2013  H HB2    . GLU A 1 125 ? -20.739 -2.637  -15.142 1.00 0.00  ? 125 GLU A HB2    1  
ATOM   2014  H HB3    . GLU A 1 125 ? -20.464 -1.005  -14.550 1.00 0.00  ? 125 GLU A HB3    1  
ATOM   2015  H HG2    . GLU A 1 125 ? -20.776 -0.129  -16.810 1.00 0.00  ? 125 GLU A HG2    1  
ATOM   2016  H HG3    . GLU A 1 125 ? -21.059 -1.764  -17.411 1.00 0.00  ? 125 GLU A HG3    1  
ATOM   2017  H HE2    . GLU A 1 125 ? -24.056 0.182   -15.922 1.00 0.00  ? 125 GLU A HE2    1  
ATOM   2018  N N      . GLU A 1 126 ? -18.958 -2.124  -18.102 1.00 0.00  ? 126 GLU A N      1  
ATOM   2019  C CA     . GLU A 1 126 ? -18.820 -2.872  -19.338 1.00 0.00  ? 126 GLU A CA     1  
ATOM   2020  C C      . GLU A 1 126 ? -17.356 -3.037  -19.700 1.00 0.00  ? 126 GLU A C      1  
ATOM   2021  O O      . GLU A 1 126 ? -16.892 -4.148  -19.947 1.00 0.00  ? 126 GLU A O      1  
ATOM   2022  C CB     . GLU A 1 126 ? -19.582 -2.185  -20.468 1.00 0.00  ? 126 GLU A CB     1  
ATOM   2023  C CG     . GLU A 1 126 ? -20.954 -2.790  -20.722 1.00 0.00  ? 126 GLU A CG     1  
ATOM   2024  C CD     . GLU A 1 126 ? -21.725 -3.061  -19.445 1.00 0.00  ? 126 GLU A CD     1  
ATOM   2025  O OE1    . GLU A 1 126 ? -22.638 -2.272  -19.123 1.00 0.00  ? 126 GLU A OE1    1  
ATOM   2026  O OE2    . GLU A 1 126 ? -21.416 -4.063  -18.764 1.00 0.00  ? 126 GLU A OE2    1  
ATOM   2027  H H      . GLU A 1 126 ? -19.285 -1.202  -18.129 1.00 0.00  ? 126 GLU A H      1  
ATOM   2028  H HA     . GLU A 1 126 ? -19.246 -3.848  -19.172 1.00 0.00  ? 126 GLU A HA     1  
ATOM   2029  H HB2    . GLU A 1 126 ? -19.712 -1.141  -20.218 1.00 0.00  ? 126 GLU A HB2    1  
ATOM   2030  H HB3    . GLU A 1 126 ? -19.005 -2.260  -21.376 1.00 0.00  ? 126 GLU A HB3    1  
ATOM   2031  H HG2    . GLU A 1 126 ? -21.526 -2.102  -21.322 1.00 0.00  ? 126 GLU A HG2    1  
ATOM   2032  H HG3    . GLU A 1 126 ? -20.828 -3.724  -21.256 1.00 0.00  ? 126 GLU A HG3    1  
ATOM   2033  H HE2    . GLU A 1 126 ? -21.944 -4.173  -17.970 1.00 0.00  ? 126 GLU A HE2    1  
ATOM   2034  N N      . ALA A 1 127 ? -16.616 -1.937  -19.703 1.00 0.00  ? 127 ALA A N      1  
ATOM   2035  C CA     . ALA A 1 127 ? -15.194 -1.998  -20.004 1.00 0.00  ? 127 ALA A CA     1  
ATOM   2036  C C      . ALA A 1 127 ? -14.540 -3.073  -19.144 1.00 0.00  ? 127 ALA A C      1  
ATOM   2037  O O      . ALA A 1 127 ? -13.559 -3.701  -19.543 1.00 0.00  ? 127 ALA A O      1  
ATOM   2038  C CB     . ALA A 1 127 ? -14.547 -0.647  -19.760 1.00 0.00  ? 127 ALA A CB     1  
ATOM   2039  H H      . ALA A 1 127 ? -17.027 -1.076  -19.477 1.00 0.00  ? 127 ALA A H      1  
ATOM   2040  H HA     . ALA A 1 127 ? -15.077 -2.256  -21.046 1.00 0.00  ? 127 ALA A HA     1  
ATOM   2041  H HB1    . ALA A 1 127 ? -15.059 0.104   -20.345 1.00 0.00  ? 127 ALA A HB1    1  
ATOM   2042  H HB2    . ALA A 1 127 ? -13.509 -0.687  -20.051 1.00 0.00  ? 127 ALA A HB2    1  
ATOM   2043  H HB3    . ALA A 1 127 ? -14.620 -0.400  -18.712 1.00 0.00  ? 127 ALA A HB3    1  
ATOM   2044  N N      . CYS A 1 128 ? -15.117 -3.282  -17.962 1.00 0.00  ? 128 CYS A N      1  
ATOM   2045  C CA     . CYS A 1 128 ? -14.633 -4.286  -17.033 1.00 0.00  ? 128 CYS A CA     1  
ATOM   2046  C C      . CYS A 1 128 ? -15.210 -5.656  -17.382 1.00 0.00  ? 128 CYS A C      1  
ATOM   2047  O O      . CYS A 1 128 ? -14.556 -6.681  -17.202 1.00 0.00  ? 128 CYS A O      1  
ATOM   2048  C CB     . CYS A 1 128 ? -15.018 -3.902  -15.604 1.00 0.00  ? 128 CYS A CB     1  
ATOM   2049  S SG     . CYS A 1 128 ? -13.808 -2.852  -14.769 1.00 0.00  ? 128 CYS A SG     1  
ATOM   2050  H H      . CYS A 1 128 ? -15.905 -2.753  -17.716 1.00 0.00  ? 128 CYS A H      1  
ATOM   2051  H HA     . CYS A 1 128 ? -13.557 -4.329  -17.110 1.00 0.00  ? 128 CYS A HA     1  
ATOM   2052  H HB2    . CYS A 1 128 ? -15.957 -3.371  -15.625 1.00 0.00  ? 128 CYS A HB2    1  
ATOM   2053  H HB3    . CYS A 1 128 ? -15.136 -4.798  -15.020 1.00 0.00  ? 128 CYS A HB3    1  
ATOM   2054  H HG     . CYS A 1 128 ? -13.663 -2.076  -15.315 1.00 0.00  ? 128 CYS A HG     1  
ATOM   2055  N N      . GLN A 1 129 ? -16.449 -5.665  -17.880 1.00 0.00  ? 129 GLN A N      1  
ATOM   2056  C CA     . GLN A 1 129 ? -17.111 -6.910  -18.256 1.00 0.00  ? 129 GLN A CA     1  
ATOM   2057  C C      . GLN A 1 129 ? -16.390 -7.568  -19.426 1.00 0.00  ? 129 GLN A C      1  
ATOM   2058  O O      . GLN A 1 129 ? -16.196 -8.782  -19.447 1.00 0.00  ? 129 GLN A O      1  
ATOM   2059  C CB     . GLN A 1 129 ? -18.593 -6.662  -18.589 1.00 0.00  ? 129 GLN A CB     1  
ATOM   2060  C CG     . GLN A 1 129 ? -18.865 -6.116  -19.986 1.00 0.00  ? 129 GLN A CG     1  
ATOM   2061  C CD     . GLN A 1 129 ? -19.539 -7.121  -20.895 1.00 0.00  ? 129 GLN A CD     1  
ATOM   2062  O OE1    . GLN A 1 129 ? -20.764 -7.151  -21.006 1.00 0.00  ? 129 GLN A OE1    1  
ATOM   2063  N NE2    . GLN A 1 129 ? -18.741 -7.951  -21.549 1.00 0.00  ? 129 GLN A NE2    1  
ATOM   2064  H H      . GLN A 1 129 ? -16.923 -4.816  -18.000 1.00 0.00  ? 129 GLN A H      1  
ATOM   2065  H HA     . GLN A 1 129 ? -17.054 -7.574  -17.405 1.00 0.00  ? 129 GLN A HA     1  
ATOM   2066  H HB2    . GLN A 1 129 ? -19.120 -7.589  -18.496 1.00 0.00  ? 129 GLN A HB2    1  
ATOM   2067  H HB3    . GLN A 1 129 ? -18.994 -5.961  -17.871 1.00 0.00  ? 129 GLN A HB3    1  
ATOM   2068  H HG2    . GLN A 1 129 ? -19.511 -5.258  -19.900 1.00 0.00  ? 129 GLN A HG2    1  
ATOM   2069  H HG3    . GLN A 1 129 ? -17.937 -5.818  -20.435 1.00 0.00  ? 129 GLN A HG3    1  
ATOM   2070  H HE21   . GLN A 1 129 ? -17.774 -7.874  -21.406 1.00 0.00  ? 129 GLN A HE21   1  
ATOM   2071  H HE22   . GLN A 1 129 ? -19.146 -8.593  -22.161 1.00 0.00  ? 129 GLN A HE22   1  
ATOM   2072  N N      . LEU A 1 130 ? -15.982 -6.753  -20.388 1.00 0.00  ? 130 LEU A N      1  
ATOM   2073  C CA     . LEU A 1 130 ? -15.264 -7.247  -21.552 1.00 0.00  ? 130 LEU A CA     1  
ATOM   2074  C C      . LEU A 1 130 ? -13.815 -7.525  -21.186 1.00 0.00  ? 130 LEU A C      1  
ATOM   2075  O O      . LEU A 1 130 ? -13.263 -8.566  -21.540 1.00 0.00  ? 130 LEU A O      1  
ATOM   2076  C CB     . LEU A 1 130 ? -15.337 -6.236  -22.699 1.00 0.00  ? 130 LEU A CB     1  
ATOM   2077  C CG     . LEU A 1 130 ? -16.724 -6.052  -23.320 1.00 0.00  ? 130 LEU A CG     1  
ATOM   2078  C CD1    . LEU A 1 130 ? -17.035 -4.578  -23.515 1.00 0.00  ? 130 LEU A CD1    1  
ATOM   2079  C CD2    . LEU A 1 130 ? -16.814 -6.791  -24.646 1.00 0.00  ? 130 LEU A CD2    1  
ATOM   2080  H H      . LEU A 1 130 ? -16.158 -5.795  -20.304 1.00 0.00  ? 130 LEU A H      1  
ATOM   2081  H HA     . LEU A 1 130 ? -15.729 -8.171  -21.863 1.00 0.00  ? 130 LEU A HA     1  
ATOM   2082  H HB2    . LEU A 1 130 ? -15.000 -5.280  -22.328 1.00 0.00  ? 130 LEU A HB2    1  
ATOM   2083  H HB3    . LEU A 1 130 ? -14.662 -6.561  -23.473 1.00 0.00  ? 130 LEU A HB3    1  
ATOM   2084  H HG     . LEU A 1 130 ? -17.467 -6.463  -22.657 1.00 0.00  ? 130 LEU A HG     1  
ATOM   2085  H HD11   . LEU A 1 130 ? -16.255 -4.120  -24.105 1.00 0.00  ? 130 LEU A HD11   1  
ATOM   2086  H HD12   . LEU A 1 130 ? -17.090 -4.093  -22.551 1.00 0.00  ? 130 LEU A HD12   1  
ATOM   2087  H HD13   . LEU A 1 130 ? -17.980 -4.475  -24.025 1.00 0.00  ? 130 LEU A HD13   1  
ATOM   2088  H HD21   . LEU A 1 130 ? -16.658 -7.847  -24.482 1.00 0.00  ? 130 LEU A HD21   1  
ATOM   2089  H HD22   . LEU A 1 130 ? -16.059 -6.413  -25.316 1.00 0.00  ? 130 LEU A HD22   1  
ATOM   2090  H HD23   . LEU A 1 130 ? -17.791 -6.634  -25.079 1.00 0.00  ? 130 LEU A HD23   1  
ATOM   2091  N N      . ALA A 1 131 ? -13.207 -6.599  -20.451 1.00 0.00  ? 131 ALA A N      1  
ATOM   2092  C CA     . ALA A 1 131 ? -11.830 -6.762  -20.007 1.00 0.00  ? 131 ALA A CA     1  
ATOM   2093  C C      . ALA A 1 131 ? -11.776 -7.677  -18.790 1.00 0.00  ? 131 ALA A C      1  
ATOM   2094  O O      . ALA A 1 131 ? -11.216 -7.318  -17.753 1.00 0.00  ? 131 ALA A O      1  
ATOM   2095  C CB     . ALA A 1 131 ? -11.199 -5.417  -19.691 1.00 0.00  ? 131 ALA A CB     1  
ATOM   2096  H H      . ALA A 1 131 ? -13.705 -5.797  -20.182 1.00 0.00  ? 131 ALA A H      1  
ATOM   2097  H HA     . ALA A 1 131 ? -11.271 -7.218  -20.814 1.00 0.00  ? 131 ALA A HA     1  
ATOM   2098  H HB1    . ALA A 1 131 ? -11.747 -4.943  -18.892 1.00 0.00  ? 131 ALA A HB1    1  
ATOM   2099  H HB2    . ALA A 1 131 ? -11.230 -4.790  -20.570 1.00 0.00  ? 131 ALA A HB2    1  
ATOM   2100  H HB3    . ALA A 1 131 ? -10.171 -5.564  -19.386 1.00 0.00  ? 131 ALA A HB3    1  
ATOM   2101  N N      . GLN A 1 132 ? -12.378 -8.856  -18.926 1.00 0.00  ? 132 GLN A N      1  
ATOM   2102  C CA     . GLN A 1 132 ? -12.430 -9.849  -17.846 1.00 0.00  ? 132 GLN A CA     1  
ATOM   2103  C C      . GLN A 1 132 ? -11.126 -9.874  -17.060 1.00 0.00  ? 132 GLN A C      1  
ATOM   2104  O O      . GLN A 1 132 ? -11.120 -10.093 -15.849 1.00 0.00  ? 132 GLN A O      1  
ATOM   2105  C CB     . GLN A 1 132 ? -12.722 -11.261 -18.387 1.00 0.00  ? 132 GLN A CB     1  
ATOM   2106  C CG     . GLN A 1 132 ? -12.801 -11.372 -19.908 1.00 0.00  ? 132 GLN A CG     1  
ATOM   2107  C CD     . GLN A 1 132 ? -14.223 -11.285 -20.436 1.00 0.00  ? 132 GLN A CD     1  
ATOM   2108  O OE1    . GLN A 1 132 ? -14.471 -10.687 -21.483 1.00 0.00  ? 132 GLN A OE1    1  
ATOM   2109  N NE2    . GLN A 1 132 ? -15.167 -11.888 -19.721 1.00 0.00  ? 132 GLN A NE2    1  
ATOM   2110  H H      . GLN A 1 132 ? -12.810 -9.060  -19.776 1.00 0.00  ? 132 GLN A H      1  
ATOM   2111  H HA     . GLN A 1 132 ? -13.228 -9.563  -17.178 1.00 0.00  ? 132 GLN A HA     1  
ATOM   2112  H HB2    . GLN A 1 132 ? -11.939 -11.925 -18.052 1.00 0.00  ? 132 GLN A HB2    1  
ATOM   2113  H HB3    . GLN A 1 132 ? -13.659 -11.595 -17.975 1.00 0.00  ? 132 GLN A HB3    1  
ATOM   2114  H HG2    . GLN A 1 132 ? -12.221 -10.579 -20.350 1.00 0.00  ? 132 GLN A HG2    1  
ATOM   2115  H HG3    . GLN A 1 132 ? -12.384 -12.318 -20.204 1.00 0.00  ? 132 GLN A HG3    1  
ATOM   2116  H HE21   . GLN A 1 132 ? -14.902 -12.350 -18.900 1.00 0.00  ? 132 GLN A HE21   1  
ATOM   2117  H HE22   . GLN A 1 132 ? -16.090 -11.849 -20.047 1.00 0.00  ? 132 GLN A HE22   1  
ATOM   2118  N N      . PHE A 1 133 ? -10.028 -9.639  -17.758 1.00 0.00  ? 133 PHE A N      1  
ATOM   2119  C CA     . PHE A 1 133 ? -8.716  -9.620  -17.131 1.00 0.00  ? 133 PHE A CA     1  
ATOM   2120  C C      . PHE A 1 133 ? -8.704  -8.631  -15.967 1.00 0.00  ? 133 PHE A C      1  
ATOM   2121  O O      . PHE A 1 133 ? -8.863  -7.425  -16.162 1.00 0.00  ? 133 PHE A O      1  
ATOM   2122  C CB     . PHE A 1 133 ? -7.646  -9.259  -18.165 1.00 0.00  ? 133 PHE A CB     1  
ATOM   2123  C CG     . PHE A 1 133 ? -7.453  -10.322 -19.212 1.00 0.00  ? 133 PHE A CG     1  
ATOM   2124  C CD1    . PHE A 1 133 ? -8.442  -10.576 -20.151 1.00 0.00  ? 133 PHE A CD1    1  
ATOM   2125  C CD2    . PHE A 1 133 ? -6.289  -11.073 -19.256 1.00 0.00  ? 133 PHE A CD2    1  
ATOM   2126  C CE1    . PHE A 1 133 ? -8.274  -11.554 -21.109 1.00 0.00  ? 133 PHE A CE1    1  
ATOM   2127  C CE2    . PHE A 1 133 ? -6.116  -12.054 -20.213 1.00 0.00  ? 133 PHE A CE2    1  
ATOM   2128  C CZ     . PHE A 1 133 ? -7.110  -12.296 -21.140 1.00 0.00  ? 133 PHE A CZ     1  
ATOM   2129  H H      . PHE A 1 133 ? -10.103 -9.467  -18.718 1.00 0.00  ? 133 PHE A H      1  
ATOM   2130  H HA     . PHE A 1 133 ? -8.516  -10.609 -16.748 1.00 0.00  ? 133 PHE A HA     1  
ATOM   2131  H HB2    . PHE A 1 133 ? -7.931  -8.345  -18.665 1.00 0.00  ? 133 PHE A HB2    1  
ATOM   2132  H HB3    . PHE A 1 133 ? -6.702  -9.111  -17.663 1.00 0.00  ? 133 PHE A HB3    1  
ATOM   2133  H HD1    . PHE A 1 133 ? -9.350  -9.996  -20.135 1.00 0.00  ? 133 PHE A HD1    1  
ATOM   2134  H HD2    . PHE A 1 133 ? -5.511  -10.885 -18.530 1.00 0.00  ? 133 PHE A HD2    1  
ATOM   2135  H HE1    . PHE A 1 133 ? -9.056  -11.742 -21.828 1.00 0.00  ? 133 PHE A HE1    1  
ATOM   2136  H HE2    . PHE A 1 133 ? -5.202  -12.633 -20.234 1.00 0.00  ? 133 PHE A HE2    1  
ATOM   2137  H HZ     . PHE A 1 133 ? -6.979  -13.064 -21.887 1.00 0.00  ? 133 PHE A HZ     1  
ATOM   2138  N N      . LYS A 1 134 ? -8.531  -9.155  -14.757 1.00 0.00  ? 134 LYS A N      1  
ATOM   2139  C CA     . LYS A 1 134 ? -8.519  -8.332  -13.547 1.00 0.00  ? 134 LYS A CA     1  
ATOM   2140  C C      . LYS A 1 134 ? -7.657  -7.090  -13.725 1.00 0.00  ? 134 LYS A C      1  
ATOM   2141  O O      . LYS A 1 134 ? -8.087  -5.972  -13.443 1.00 0.00  ? 134 LYS A O      1  
ATOM   2142  C CB     . LYS A 1 134 ? -7.991  -9.150  -12.368 1.00 0.00  ? 134 LYS A CB     1  
ATOM   2143  C CG     . LYS A 1 134 ? -7.876  -8.360  -11.072 1.00 0.00  ? 134 LYS A CG     1  
ATOM   2144  C CD     . LYS A 1 134 ? -6.493  -8.496  -10.454 1.00 0.00  ? 134 LYS A CD     1  
ATOM   2145  C CE     . LYS A 1 134 ? -6.182  -7.338  -9.521  1.00 0.00  ? 134 LYS A CE     1  
ATOM   2146  N NZ     . LYS A 1 134 ? -5.052  -7.649  -8.602  1.00 0.00  ? 134 LYS A NZ     1  
ATOM   2147  H H      . LYS A 1 134 ? -8.424  -10.125 -14.670 1.00 0.00  ? 134 LYS A H      1  
ATOM   2148  H HA     . LYS A 1 134 ? -9.534  -8.028  -13.338 1.00 0.00  ? 134 LYS A HA     1  
ATOM   2149  H HB2    . LYS A 1 134 ? -8.654  -9.986  -12.197 1.00 0.00  ? 134 LYS A HB2    1  
ATOM   2150  H HB3    . LYS A 1 134 ? -7.009  -9.526  -12.625 1.00 0.00  ? 134 LYS A HB3    1  
ATOM   2151  H HG2    . LYS A 1 134 ? -8.064  -7.318  -11.280 1.00 0.00  ? 134 LYS A HG2    1  
ATOM   2152  H HG3    . LYS A 1 134 ? -8.612  -8.728  -10.371 1.00 0.00  ? 134 LYS A HG3    1  
ATOM   2153  H HD2    . LYS A 1 134 ? -6.449  -9.418  -9.893  1.00 0.00  ? 134 LYS A HD2    1  
ATOM   2154  H HD3    . LYS A 1 134 ? -5.755  -8.518  -11.244 1.00 0.00  ? 134 LYS A HD3    1  
ATOM   2155  H HE2    . LYS A 1 134 ? -5.921  -6.473  -10.114 1.00 0.00  ? 134 LYS A HE2    1  
ATOM   2156  H HE3    . LYS A 1 134 ? -7.062  -7.118  -8.934  1.00 0.00  ? 134 LYS A HE3    1  
ATOM   2157  H HZ1    . LYS A 1 134 ? -4.454  -6.807  -8.471  1.00 0.00  ? 134 LYS A HZ1    1  
ATOM   2158  H HZ2    . LYS A 1 134 ? -4.471  -8.415  -8.996  1.00 0.00  ? 134 LYS A HZ2    1  
ATOM   2159  H HZ3    . LYS A 1 134 ? -5.417  -7.949  -7.674  1.00 0.00  ? 134 LYS A HZ3    1  
ATOM   2160  N N      . GLU A 1 135 ? -6.435  -7.302  -14.187 1.00 0.00  ? 135 GLU A N      1  
ATOM   2161  C CA     . GLU A 1 135 ? -5.489  -6.216  -14.402 1.00 0.00  ? 135 GLU A CA     1  
ATOM   2162  C C      . GLU A 1 135 ? -6.138  -5.040  -15.126 1.00 0.00  ? 135 GLU A C      1  
ATOM   2163  O O      . GLU A 1 135 ? -5.977  -3.889  -14.723 1.00 0.00  ? 135 GLU A O      1  
ATOM   2164  C CB     . GLU A 1 135 ? -4.287  -6.718  -15.197 1.00 0.00  ? 135 GLU A CB     1  
ATOM   2165  C CG     . GLU A 1 135 ? -3.733  -8.042  -14.694 1.00 0.00  ? 135 GLU A CG     1  
ATOM   2166  C CD     . GLU A 1 135 ? -4.302  -9.241  -15.426 1.00 0.00  ? 135 GLU A CD     1  
ATOM   2167  O OE1    . GLU A 1 135 ? -5.461  -9.163  -15.880 1.00 0.00  ? 135 GLU A OE1    1  
ATOM   2168  O OE2    . GLU A 1 135 ? -3.588  -10.259 -15.541 1.00 0.00  ? 135 GLU A OE2    1  
ATOM   2169  H H      . GLU A 1 135 ? -6.159  -8.219  -14.383 1.00 0.00  ? 135 GLU A H      1  
ATOM   2170  H HA     . GLU A 1 135 ? -5.150  -5.881  -13.433 1.00 0.00  ? 135 GLU A HA     1  
ATOM   2171  H HB2    . GLU A 1 135 ? -4.576  -6.842  -16.232 1.00 0.00  ? 135 GLU A HB2    1  
ATOM   2172  H HB3    . GLU A 1 135 ? -3.500  -5.981  -15.138 1.00 0.00  ? 135 GLU A HB3    1  
ATOM   2173  H HG2    . GLU A 1 135 ? -2.668  -8.037  -14.827 1.00 0.00  ? 135 GLU A HG2    1  
ATOM   2174  H HG3    . GLU A 1 135 ? -3.963  -8.137  -13.642 1.00 0.00  ? 135 GLU A HG3    1  
ATOM   2175  H HE2    . GLU A 1 135 ? -4.011  -10.980 -16.014 1.00 0.00  ? 135 GLU A HE2    1  
ATOM   2176  N N      . MET A 1 136 ? -6.870  -5.331  -16.196 1.00 0.00  ? 136 MET A N      1  
ATOM   2177  C CA     . MET A 1 136 ? -7.533  -4.285  -16.964 1.00 0.00  ? 136 MET A CA     1  
ATOM   2178  C C      . MET A 1 136 ? -8.703  -3.705  -16.184 1.00 0.00  ? 136 MET A C      1  
ATOM   2179  O O      . MET A 1 136 ? -8.868  -2.486  -16.116 1.00 0.00  ? 136 MET A O      1  
ATOM   2180  C CB     . MET A 1 136 ? -8.014  -4.829  -18.306 1.00 0.00  ? 136 MET A CB     1  
ATOM   2181  C CG     . MET A 1 136 ? -6.879  -5.243  -19.224 1.00 0.00  ? 136 MET A CG     1  
ATOM   2182  S SD     . MET A 1 136 ? -6.351  -3.923  -20.338 1.00 0.00  ? 136 MET A SD     1  
ATOM   2183  C CE     . MET A 1 136 ? -6.530  -2.470  -19.300 1.00 0.00  ? 136 MET A CE     1  
ATOM   2184  H H      . MET A 1 136 ? -6.966  -6.265  -16.475 1.00 0.00  ? 136 MET A H      1  
ATOM   2185  H HA     . MET A 1 136 ? -6.815  -3.502  -17.139 1.00 0.00  ? 136 MET A HA     1  
ATOM   2186  H HB2    . MET A 1 136 ? -8.639  -5.692  -18.126 1.00 0.00  ? 136 MET A HB2    1  
ATOM   2187  H HB3    . MET A 1 136 ? -8.597  -4.071  -18.805 1.00 0.00  ? 136 MET A HB3    1  
ATOM   2188  H HG2    . MET A 1 136 ? -6.038  -5.544  -18.615 1.00 0.00  ? 136 MET A HG2    1  
ATOM   2189  H HG3    . MET A 1 136 ? -7.209  -6.085  -19.817 1.00 0.00  ? 136 MET A HG3    1  
ATOM   2190  H HE1    . MET A 1 136 ? -6.350  -1.583  -19.888 1.00 0.00  ? 136 MET A HE1    1  
ATOM   2191  H HE2    . MET A 1 136 ? -5.815  -2.516  -18.491 1.00 0.00  ? 136 MET A HE2    1  
ATOM   2192  H HE3    . MET A 1 136 ? -7.530  -2.436  -18.894 1.00 0.00  ? 136 MET A HE3    1  
ATOM   2193  N N      . LYS A 1 137 ? -9.507  -4.578  -15.589 1.00 0.00  ? 137 LYS A N      1  
ATOM   2194  C CA     . LYS A 1 137 ? -10.651 -4.136  -14.803 1.00 0.00  ? 137 LYS A CA     1  
ATOM   2195  C C      . LYS A 1 137 ? -10.215 -3.080  -13.795 1.00 0.00  ? 137 LYS A C      1  
ATOM   2196  O O      . LYS A 1 137 ? -10.986 -2.189  -13.442 1.00 0.00  ? 137 LYS A O      1  
ATOM   2197  C CB     . LYS A 1 137 ? -11.294 -5.322  -14.084 1.00 0.00  ? 137 LYS A CB     1  
ATOM   2198  C CG     . LYS A 1 137 ? -12.435 -5.954  -14.864 1.00 0.00  ? 137 LYS A CG     1  
ATOM   2199  C CD     . LYS A 1 137 ? -12.164 -7.420  -15.169 1.00 0.00  ? 137 LYS A CD     1  
ATOM   2200  C CE     . LYS A 1 137 ? -12.664 -8.326  -14.053 1.00 0.00  ? 137 LYS A CE     1  
ATOM   2201  N NZ     . LYS A 1 137 ? -12.403 -7.750  -12.705 1.00 0.00  ? 137 LYS A NZ     1  
ATOM   2202  H H      . LYS A 1 137 ? -9.322  -5.537  -15.670 1.00 0.00  ? 137 LYS A H      1  
ATOM   2203  H HA     . LYS A 1 137 ? -11.370 -3.699  -15.480 1.00 0.00  ? 137 LYS A HA     1  
ATOM   2204  H HB2    . LYS A 1 137 ? -10.540 -6.076  -13.912 1.00 0.00  ? 137 LYS A HB2    1  
ATOM   2205  H HB3    . LYS A 1 137 ? -11.680 -4.988  -13.133 1.00 0.00  ? 137 LYS A HB3    1  
ATOM   2206  H HG2    . LYS A 1 137 ? -13.342 -5.880  -14.283 1.00 0.00  ? 137 LYS A HG2    1  
ATOM   2207  H HG3    . LYS A 1 137 ? -12.560 -5.421  -15.797 1.00 0.00  ? 137 LYS A HG3    1  
ATOM   2208  H HD2    . LYS A 1 137 ? -12.666 -7.686  -16.086 1.00 0.00  ? 137 LYS A HD2    1  
ATOM   2209  H HD3    . LYS A 1 137 ? -11.098 -7.561  -15.284 1.00 0.00  ? 137 LYS A HD3    1  
ATOM   2210  H HE2    . LYS A 1 137 ? -13.728 -8.467  -14.175 1.00 0.00  ? 137 LYS A HE2    1  
ATOM   2211  H HE3    . LYS A 1 137 ? -12.164 -9.279  -14.131 1.00 0.00  ? 137 LYS A HE3    1  
ATOM   2212  H HZ1    . LYS A 1 137 ? -12.727 -8.406  -11.967 1.00 0.00  ? 137 LYS A HZ1    1  
ATOM   2213  H HZ2    . LYS A 1 137 ? -12.909 -6.847  -12.596 1.00 0.00  ? 137 LYS A HZ2    1  
ATOM   2214  H HZ3    . LYS A 1 137 ? -11.385 -7.579  -12.581 1.00 0.00  ? 137 LYS A HZ3    1  
ATOM   2215  N N      . ALA A 1 138 ? -8.964  -3.183  -13.350 1.00 0.00  ? 138 ALA A N      1  
ATOM   2216  C CA     . ALA A 1 138 ? -8.407  -2.236  -12.397 1.00 0.00  ? 138 ALA A CA     1  
ATOM   2217  C C      . ALA A 1 138 ? -7.976  -0.952  -13.097 1.00 0.00  ? 138 ALA A C      1  
ATOM   2218  O O      . ALA A 1 138 ? -8.290  0.149   -12.644 1.00 0.00  ? 138 ALA A O      1  
ATOM   2219  C CB     . ALA A 1 138 ? -7.232  -2.853  -11.660 1.00 0.00  ? 138 ALA A CB     1  
ATOM   2220  H H      . ALA A 1 138 ? -8.399  -3.912  -13.681 1.00 0.00  ? 138 ALA A H      1  
ATOM   2221  H HA     . ALA A 1 138 ? -9.171  -2.003  -11.672 1.00 0.00  ? 138 ALA A HA     1  
ATOM   2222  H HB1    . ALA A 1 138 ? -6.436  -3.060  -12.362 1.00 0.00  ? 138 ALA A HB1    1  
ATOM   2223  H HB2    . ALA A 1 138 ? -7.548  -3.772  -11.190 1.00 0.00  ? 138 ALA A HB2    1  
ATOM   2224  H HB3    . ALA A 1 138 ? -6.881  -2.165  -10.905 1.00 0.00  ? 138 ALA A HB3    1  
ATOM   2225  N N      . ALA A 1 139 ? -7.259  -1.100  -14.212 1.00 0.00  ? 139 ALA A N      1  
ATOM   2226  C CA     . ALA A 1 139 ? -6.793  0.052   -14.981 1.00 0.00  ? 139 ALA A CA     1  
ATOM   2227  C C      . ALA A 1 139 ? -7.949  0.993   -15.280 1.00 0.00  ? 139 ALA A C      1  
ATOM   2228  O O      . ALA A 1 139 ? -7.851  2.203   -15.077 1.00 0.00  ? 139 ALA A O      1  
ATOM   2229  C CB     . ALA A 1 139 ? -6.135  -0.401  -16.277 1.00 0.00  ? 139 ALA A CB     1  
ATOM   2230  H H      . ALA A 1 139 ? -7.043  -2.004  -14.526 1.00 0.00  ? 139 ALA A H      1  
ATOM   2231  H HA     . ALA A 1 139 ? -6.054  0.575   -14.389 1.00 0.00  ? 139 ALA A HA     1  
ATOM   2232  H HB1    . ALA A 1 139 ? -6.899  -0.635  -17.003 1.00 0.00  ? 139 ALA A HB1    1  
ATOM   2233  H HB2    . ALA A 1 139 ? -5.535  -1.278  -16.090 1.00 0.00  ? 139 ALA A HB2    1  
ATOM   2234  H HB3    . ALA A 1 139 ? -5.508  0.392   -16.657 1.00 0.00  ? 139 ALA A HB3    1  
ATOM   2235  N N      . LEU A 1 140 ? -9.052  0.421   -15.748 1.00 0.00  ? 140 LEU A N      1  
ATOM   2236  C CA     . LEU A 1 140 ? -10.240 1.202   -16.055 1.00 0.00  ? 140 LEU A CA     1  
ATOM   2237  C C      . LEU A 1 140 ? -10.930 1.633   -14.764 1.00 0.00  ? 140 LEU A C      1  
ATOM   2238  O O      . LEU A 1 140 ? -11.601 2.665   -14.717 1.00 0.00  ? 140 LEU A O      1  
ATOM   2239  C CB     . LEU A 1 140 ? -11.201 0.387   -16.925 1.00 0.00  ? 140 LEU A CB     1  
ATOM   2240  C CG     . LEU A 1 140 ? -10.538 -0.389  -18.068 1.00 0.00  ? 140 LEU A CG     1  
ATOM   2241  C CD1    . LEU A 1 140 ? -10.922 -1.861  -18.015 1.00 0.00  ? 140 LEU A CD1    1  
ATOM   2242  C CD2    . LEU A 1 140 ? -10.914 0.212   -19.417 1.00 0.00  ? 140 LEU A CD2    1  
ATOM   2243  H H      . LEU A 1 140 ? -9.071  -0.549  -15.877 1.00 0.00  ? 140 LEU A H      1  
ATOM   2244  H HA     . LEU A 1 140 ? -9.927  2.081   -16.600 1.00 0.00  ? 140 LEU A HA     1  
ATOM   2245  H HB2    . LEU A 1 140 ? -11.718 -0.316  -16.288 1.00 0.00  ? 140 LEU A HB2    1  
ATOM   2246  H HB3    . LEU A 1 140 ? -11.929 1.063   -17.350 1.00 0.00  ? 140 LEU A HB3    1  
ATOM   2247  H HG     . LEU A 1 140 ? -9.465  -0.323  -17.962 1.00 0.00  ? 140 LEU A HG     1  
ATOM   2248  H HD11   . LEU A 1 140 ? -11.879 -2.002  -18.495 1.00 0.00  ? 140 LEU A HD11   1  
ATOM   2249  H HD12   . LEU A 1 140 ? -10.986 -2.179  -16.985 1.00 0.00  ? 140 LEU A HD12   1  
ATOM   2250  H HD13   . LEU A 1 140 ? -10.173 -2.448  -18.526 1.00 0.00  ? 140 LEU A HD13   1  
ATOM   2251  H HD21   . LEU A 1 140 ? -11.476 1.123   -19.263 1.00 0.00  ? 140 LEU A HD21   1  
ATOM   2252  H HD22   . LEU A 1 140 ? -11.515 -0.492  -19.972 1.00 0.00  ? 140 LEU A HD22   1  
ATOM   2253  H HD23   . LEU A 1 140 ? -10.016 0.434   -19.973 1.00 0.00  ? 140 LEU A HD23   1  
ATOM   2254  N N      . GLN A 1 141 ? -10.748 0.832   -13.714 1.00 0.00  ? 141 GLN A N      1  
ATOM   2255  C CA     . GLN A 1 141 ? -11.340 1.120   -12.412 1.00 0.00  ? 141 GLN A CA     1  
ATOM   2256  C C      . GLN A 1 141 ? -10.716 2.368   -11.803 1.00 0.00  ? 141 GLN A C      1  
ATOM   2257  O O      . GLN A 1 141 ? -11.418 3.290   -11.386 1.00 0.00  ? 141 GLN A O      1  
ATOM   2258  C CB     . GLN A 1 141 ? -11.136 -0.071  -11.470 1.00 0.00  ? 141 GLN A CB     1  
ATOM   2259  C CG     . GLN A 1 141 ? -12.415 -0.821  -11.146 1.00 0.00  ? 141 GLN A CG     1  
ATOM   2260  C CD     . GLN A 1 141 ? -13.142 -0.254  -9.941  1.00 0.00  ? 141 GLN A CD     1  
ATOM   2261  O OE1    . GLN A 1 141 ? -13.520 -0.989  -9.029  1.00 0.00  ? 141 GLN A OE1    1  
ATOM   2262  N NE2    . GLN A 1 141 ? -13.343 1.060   -9.931  1.00 0.00  ? 141 GLN A NE2    1  
ATOM   2263  H H      . GLN A 1 141 ? -10.200 0.029   -13.817 1.00 0.00  ? 141 GLN A H      1  
ATOM   2264  H HA     . GLN A 1 141 ? -12.397 1.286   -12.553 1.00 0.00  ? 141 GLN A HA     1  
ATOM   2265  H HB2    . GLN A 1 141 ? -10.449 -0.759  -11.931 1.00 0.00  ? 141 GLN A HB2    1  
ATOM   2266  H HB3    . GLN A 1 141 ? -10.706 0.281   -10.544 1.00 0.00  ? 141 GLN A HB3    1  
ATOM   2267  H HG2    . GLN A 1 141 ? -13.071 -0.772  -12.002 1.00 0.00  ? 141 GLN A HG2    1  
ATOM   2268  H HG3    . GLN A 1 141 ? -12.172 -1.853  -10.946 1.00 0.00  ? 141 GLN A HG3    1  
ATOM   2269  H HE21   . GLN A 1 141 ? -13.016 1.584   -10.690 1.00 0.00  ? 141 GLN A HE21   1  
ATOM   2270  H HE22   . GLN A 1 141 ? -13.809 1.450   -9.162  1.00 0.00  ? 141 GLN A HE22   1  
ATOM   2271  N N      . GLU A 1 142 ? -9.390  2.389   -11.756 1.00 0.00  ? 142 GLU A N      1  
ATOM   2272  C CA     . GLU A 1 142 ? -8.663  3.519   -11.199 1.00 0.00  ? 142 GLU A CA     1  
ATOM   2273  C C      . GLU A 1 142 ? -8.844  4.754   -12.072 1.00 0.00  ? 142 GLU A C      1  
ATOM   2274  O O      . GLU A 1 142 ? -8.839  5.883   -11.579 1.00 0.00  ? 142 GLU A O      1  
ATOM   2275  C CB     . GLU A 1 142 ? -7.177  3.180   -11.065 1.00 0.00  ? 142 GLU A CB     1  
ATOM   2276  C CG     . GLU A 1 142 ? -6.914  1.864   -10.352 1.00 0.00  ? 142 GLU A CG     1  
ATOM   2277  C CD     . GLU A 1 142 ? -5.588  1.244   -10.744 1.00 0.00  ? 142 GLU A CD     1  
ATOM   2278  O OE1    . GLU A 1 142 ? -4.548  1.667   -10.193 1.00 0.00  ? 142 GLU A OE1    1  
ATOM   2279  O OE2    . GLU A 1 142 ? -5.586  0.333   -11.599 1.00 0.00  ? 142 GLU A OE2    1  
ATOM   2280  H H      . GLU A 1 142 ? -8.888  1.623   -12.106 1.00 0.00  ? 142 GLU A H      1  
ATOM   2281  H HA     . GLU A 1 142 ? -9.067  3.724   -10.219 1.00 0.00  ? 142 GLU A HA     1  
ATOM   2282  H HB2    . GLU A 1 142 ? -6.742  3.123   -12.053 1.00 0.00  ? 142 GLU A HB2    1  
ATOM   2283  H HB3    . GLU A 1 142 ? -6.688  3.969   -10.510 1.00 0.00  ? 142 GLU A HB3    1  
ATOM   2284  H HG2    . GLU A 1 142 ? -6.911  2.040   -9.287  1.00 0.00  ? 142 GLU A HG2    1  
ATOM   2285  H HG3    . GLU A 1 142 ? -7.705  1.171   -10.598 1.00 0.00  ? 142 GLU A HG3    1  
ATOM   2286  H HE2    . GLU A 1 142 ? -4.713  -0.013  -11.798 1.00 0.00  ? 142 GLU A HE2    1  
ATOM   2287  N N      . GLY A 1 143 ? -9.015  4.533   -13.375 1.00 0.00  ? 143 GLY A N      1  
ATOM   2288  C CA     . GLY A 1 143 ? -9.206  5.641   -14.294 1.00 0.00  ? 143 GLY A CA     1  
ATOM   2289  C C      . GLY A 1 143 ? -10.369 6.522   -13.885 1.00 0.00  ? 143 GLY A C      1  
ATOM   2290  O O      . GLY A 1 143 ? -10.204 7.725   -13.676 1.00 0.00  ? 143 GLY A O      1  
ATOM   2291  H H      . GLY A 1 143 ? -9.017  3.614   -13.710 1.00 0.00  ? 143 GLY A H      1  
ATOM   2292  H HA2    . GLY A 1 143 ? -8.306  6.237   -14.318 1.00 0.00  ? 143 GLY A HA2    1  
ATOM   2293  H HA3    . GLY A 1 143 ? -9.397  5.248   -15.281 1.00 0.00  ? 143 GLY A HA3    1  
ATOM   2294  N N      . HIS A 1 144 ? -11.545 5.919   -13.754 1.00 0.00  ? 144 HIS A N      1  
ATOM   2295  C CA     . HIS A 1 144 ? -12.739 6.650   -13.350 1.00 0.00  ? 144 HIS A CA     1  
ATOM   2296  C C      . HIS A 1 144 ? -12.614 7.117   -11.903 1.00 0.00  ? 144 HIS A C      1  
ATOM   2297  O O      . HIS A 1 144 ? -13.193 8.130   -11.517 1.00 0.00  ? 144 HIS A O      1  
ATOM   2298  C CB     . HIS A 1 144 ? -13.981 5.770   -13.511 1.00 0.00  ? 144 HIS A CB     1  
ATOM   2299  C CG     . HIS A 1 144 ? -15.267 6.496   -13.257 1.00 0.00  ? 144 HIS A CG     1  
ATOM   2300  N ND1    . HIS A 1 144 ? -15.622 6.987   -12.017 1.00 0.00  ? 144 HIS A ND1    1  
ATOM   2301  C CD2    . HIS A 1 144 ? -16.284 6.813   -14.091 1.00 0.00  ? 144 HIS A CD2    1  
ATOM   2302  C CE1    . HIS A 1 144 ? -16.803 7.573   -12.102 1.00 0.00  ? 144 HIS A CE1    1  
ATOM   2303  N NE2    . HIS A 1 144 ? -17.226 7.481   -13.349 1.00 0.00  ? 144 HIS A NE2    1  
ATOM   2304  H H      . HIS A 1 144 ? -11.609 4.955   -13.923 1.00 0.00  ? 144 HIS A H      1  
ATOM   2305  H HA     . HIS A 1 144 ? -12.833 7.513   -13.990 1.00 0.00  ? 144 HIS A HA     1  
ATOM   2306  H HB2    . HIS A 1 144 ? -14.013 5.384   -14.519 1.00 0.00  ? 144 HIS A HB2    1  
ATOM   2307  H HB3    . HIS A 1 144 ? -13.922 4.945   -12.816 1.00 0.00  ? 144 HIS A HB3    1  
ATOM   2308  H HD1    . HIS A 1 144 ? -15.089 6.915   -11.199 1.00 0.00  ? 144 HIS A HD1    1  
ATOM   2309  H HD2    . HIS A 1 144 ? -16.344 6.584   -15.147 1.00 0.00  ? 144 HIS A HD2    1  
ATOM   2310  H HE1    . HIS A 1 144 ? -17.334 8.046   -11.288 1.00 0.00  ? 144 HIS A HE1    1  
ATOM   2311  H HE2    . HIS A 1 144 ? -18.115 7.749   -13.665 1.00 0.00  ? 144 HIS A HE2    1  
ATOM   2312  N N      . GLN A 1 145 ? -11.850 6.370   -11.112 1.00 0.00  ? 145 GLN A N      1  
ATOM   2313  C CA     . GLN A 1 145 ? -11.640 6.702   -9.708  1.00 0.00  ? 145 GLN A CA     1  
ATOM   2314  C C      . GLN A 1 145 ? -10.811 7.975   -9.568  1.00 0.00  ? 145 GLN A C      1  
ATOM   2315  O O      . GLN A 1 145 ? -11.116 8.842   -8.750  1.00 0.00  ? 145 GLN A O      1  
ATOM   2316  C CB     . GLN A 1 145 ? -10.934 5.548   -8.993  1.00 0.00  ? 145 GLN A CB     1  
ATOM   2317  C CG     . GLN A 1 145 ? -10.716 5.793   -7.509  1.00 0.00  ? 145 GLN A CG     1  
ATOM   2318  C CD     . GLN A 1 145 ? -12.015 5.865   -6.732  1.00 0.00  ? 145 GLN A CD     1  
ATOM   2319  O OE1    . GLN A 1 145 ? -12.403 4.909   -6.060  1.00 0.00  ? 145 GLN A OE1    1  
ATOM   2320  N NE2    . GLN A 1 145 ? -12.695 7.002   -6.818  1.00 0.00  ? 145 GLN A NE2    1  
ATOM   2321  H H      . GLN A 1 145 ? -11.413 5.574   -11.482 1.00 0.00  ? 145 GLN A H      1  
ATOM   2322  H HA     . GLN A 1 145 ? -12.607 6.861   -9.253  1.00 0.00  ? 145 GLN A HA     1  
ATOM   2323  H HB2    . GLN A 1 145 ? -11.527 4.652   -9.105  1.00 0.00  ? 145 GLN A HB2    1  
ATOM   2324  H HB3    . GLN A 1 145 ? -9.971  5.390   -9.455  1.00 0.00  ? 145 GLN A HB3    1  
ATOM   2325  H HG2    . GLN A 1 145 ? -10.119 4.987   -7.109  1.00 0.00  ? 145 GLN A HG2    1  
ATOM   2326  H HG3    . GLN A 1 145 ? -10.187 6.727   -7.386  1.00 0.00  ? 145 GLN A HG3    1  
ATOM   2327  H HE21   . GLN A 1 145 ? -12.327 7.723   -7.371  1.00 0.00  ? 145 GLN A HE21   1  
ATOM   2328  H HE22   . GLN A 1 145 ? -13.541 7.076   -6.326  1.00 0.00  ? 145 GLN A HE22   1  
ATOM   2329  N N      . PHE A 1 146 ? -9.759  8.071   -10.372 1.00 0.00  ? 146 PHE A N      1  
ATOM   2330  C CA     . PHE A 1 146 ? -8.874  9.230   -10.342 1.00 0.00  ? 146 PHE A CA     1  
ATOM   2331  C C      . PHE A 1 146 ? -9.545  10.455  -10.959 1.00 0.00  ? 146 PHE A C      1  
ATOM   2332  O O      . PHE A 1 146 ? -9.588  11.522  -10.347 1.00 0.00  ? 146 PHE A O      1  
ATOM   2333  C CB     . PHE A 1 146 ? -7.573  8.909   -11.085 1.00 0.00  ? 146 PHE A CB     1  
ATOM   2334  C CG     . PHE A 1 146 ? -6.626  10.071  -11.178 1.00 0.00  ? 146 PHE A CG     1  
ATOM   2335  C CD1    . PHE A 1 146 ? -5.679  10.291  -10.191 1.00 0.00  ? 146 PHE A CD1    1  
ATOM   2336  C CD2    . PHE A 1 146 ? -6.681  10.939  -12.254 1.00 0.00  ? 146 PHE A CD2    1  
ATOM   2337  C CE1    . PHE A 1 146 ? -4.806  11.359  -10.277 1.00 0.00  ? 146 PHE A CE1    1  
ATOM   2338  C CE2    . PHE A 1 146 ? -5.810  12.008  -12.345 1.00 0.00  ? 146 PHE A CE2    1  
ATOM   2339  C CZ     . PHE A 1 146 ? -4.871  12.218  -11.355 1.00 0.00  ? 146 PHE A CZ     1  
ATOM   2340  H H      . PHE A 1 146 ? -9.568  7.342   -10.998 1.00 0.00  ? 146 PHE A H      1  
ATOM   2341  H HA     . PHE A 1 146 ? -8.643  9.443   -9.309  1.00 0.00  ? 146 PHE A HA     1  
ATOM   2342  H HB2    . PHE A 1 146 ? -7.065  8.108   -10.573 1.00 0.00  ? 146 PHE A HB2    1  
ATOM   2343  H HB3    . PHE A 1 146 ? -7.811  8.592   -12.090 1.00 0.00  ? 146 PHE A HB3    1  
ATOM   2344  H HD1    . PHE A 1 146 ? -5.627  9.620   -9.346  1.00 0.00  ? 146 PHE A HD1    1  
ATOM   2345  H HD2    . PHE A 1 146 ? -7.416  10.777  -13.029 1.00 0.00  ? 146 PHE A HD2    1  
ATOM   2346  H HE1    . PHE A 1 146 ? -4.072  11.522  -9.500  1.00 0.00  ? 146 PHE A HE1    1  
ATOM   2347  H HE2    . PHE A 1 146 ? -5.866  12.678  -13.191 1.00 0.00  ? 146 PHE A HE2    1  
ATOM   2348  H HZ     . PHE A 1 146 ? -4.190  13.053  -11.425 1.00 0.00  ? 146 PHE A HZ     1  
ATOM   2349  N N      . LEU A 1 147 ? -10.057 10.298  -12.176 1.00 0.00  ? 147 LEU A N      1  
ATOM   2350  C CA     . LEU A 1 147 ? -10.716 11.397  -12.877 1.00 0.00  ? 147 LEU A CA     1  
ATOM   2351  C C      . LEU A 1 147 ? -11.798 12.038  -12.013 1.00 0.00  ? 147 LEU A C      1  
ATOM   2352  O O      . LEU A 1 147 ? -12.009 13.249  -12.068 1.00 0.00  ? 147 LEU A O      1  
ATOM   2353  C CB     . LEU A 1 147 ? -11.314 10.907  -14.195 1.00 0.00  ? 147 LEU A CB     1  
ATOM   2354  C CG     . LEU A 1 147 ? -10.289 10.452  -15.235 1.00 0.00  ? 147 LEU A CG     1  
ATOM   2355  C CD1    . LEU A 1 147 ? -10.960 10.208  -16.577 1.00 0.00  ? 147 LEU A CD1    1  
ATOM   2356  C CD2    . LEU A 1 147 ? -9.176  11.481  -15.378 1.00 0.00  ? 147 LEU A CD2    1  
ATOM   2357  H H      . LEU A 1 147 ? -9.984  9.427   -12.616 1.00 0.00  ? 147 LEU A H      1  
ATOM   2358  H HA     . LEU A 1 147 ? -9.964  12.140  -13.093 1.00 0.00  ? 147 LEU A HA     1  
ATOM   2359  H HB2    . LEU A 1 147 ? -11.975 10.078  -13.982 1.00 0.00  ? 147 LEU A HB2    1  
ATOM   2360  H HB3    . LEU A 1 147 ? -11.896 11.709  -14.623 1.00 0.00  ? 147 LEU A HB3    1  
ATOM   2361  H HG     . LEU A 1 147 ? -9.846  9.523   -14.910 1.00 0.00  ? 147 LEU A HG     1  
ATOM   2362  H HD11   . LEU A 1 147 ? -11.154 11.156  -17.057 1.00 0.00  ? 147 LEU A HD11   1  
ATOM   2363  H HD12   . LEU A 1 147 ? -11.892 9.681   -16.426 1.00 0.00  ? 147 LEU A HD12   1  
ATOM   2364  H HD13   . LEU A 1 147 ? -10.308 9.612   -17.203 1.00 0.00  ? 147 LEU A HD13   1  
ATOM   2365  H HD21   . LEU A 1 147 ? -8.569  11.481  -14.484 1.00 0.00  ? 147 LEU A HD21   1  
ATOM   2366  H HD22   . LEU A 1 147 ? -9.607  12.461  -15.519 1.00 0.00  ? 147 LEU A HD22   1  
ATOM   2367  H HD23   . LEU A 1 147 ? -8.562  11.231  -16.231 1.00 0.00  ? 147 LEU A HD23   1  
ATOM   2368  N N      . CYS A 1 148 ? -12.473 11.223  -11.210 1.00 0.00  ? 148 CYS A N      1  
ATOM   2369  C CA     . CYS A 1 148 ? -13.522 11.728  -10.332 1.00 0.00  ? 148 CYS A CA     1  
ATOM   2370  C C      . CYS A 1 148 ? -12.928 12.605  -9.232  1.00 0.00  ? 148 CYS A C      1  
ATOM   2371  O O      . CYS A 1 148 ? -13.643 13.368  -8.580  1.00 0.00  ? 148 CYS A O      1  
ATOM   2372  C CB     . CYS A 1 148 ? -14.306 10.569  -9.713  1.00 0.00  ? 148 CYS A CB     1  
ATOM   2373  S SG     . CYS A 1 148 ? -16.090 10.853  -9.618  1.00 0.00  ? 148 CYS A SG     1  
ATOM   2374  H H      . CYS A 1 148 ? -12.257 10.268  -11.202 1.00 0.00  ? 148 CYS A H      1  
ATOM   2375  H HA     . CYS A 1 148 ? -14.193 12.326  -10.930 1.00 0.00  ? 148 CYS A HA     1  
ATOM   2376  H HB2    . CYS A 1 148 ? -14.147 9.681   -10.303 1.00 0.00  ? 148 CYS A HB2    1  
ATOM   2377  H HB3    . CYS A 1 148 ? -13.947 10.395  -8.709  1.00 0.00  ? 148 CYS A HB3    1  
ATOM   2378  H HG     . CYS A 1 148 ? -16.511 10.316  -10.291 1.00 0.00  ? 148 CYS A HG     1  
ATOM   2379  N N      . SER A 1 149 ? -11.616 12.492  -9.030  1.00 0.00  ? 149 SER A N      1  
ATOM   2380  C CA     . SER A 1 149 ? -10.926 13.273  -8.010  1.00 0.00  ? 149 SER A CA     1  
ATOM   2381  C C      . SER A 1 149 ? -10.417 14.600  -8.577  1.00 0.00  ? 149 SER A C      1  
ATOM   2382  O O      . SER A 1 149 ? -9.990  15.477  -7.824  1.00 0.00  ? 149 SER A O      1  
ATOM   2383  C CB     . SER A 1 149 ? -9.762  12.474  -7.425  1.00 0.00  ? 149 SER A CB     1  
ATOM   2384  O OG     . SER A 1 149 ? -9.282  13.070  -6.233  1.00 0.00  ? 149 SER A OG     1  
ATOM   2385  H H      . SER A 1 149 ? -11.099 11.868  -9.579  1.00 0.00  ? 149 SER A H      1  
ATOM   2386  H HA     . SER A 1 149 ? -11.634 13.484  -7.223  1.00 0.00  ? 149 SER A HA     1  
ATOM   2387  H HB2    . SER A 1 149 ? -10.092 11.470  -7.202  1.00 0.00  ? 149 SER A HB2    1  
ATOM   2388  H HB3    . SER A 1 149 ? -8.955  12.437  -8.143  1.00 0.00  ? 149 SER A HB3    1  
ATOM   2389  H HG     . SER A 1 149 ? -9.383  12.454  -5.503  1.00 0.00  ? 149 SER A HG     1  
ATOM   2390  N N      . ILE A 1 150 ? -10.467 14.748  -9.899  1.00 0.00  ? 150 ILE A N      1  
ATOM   2391  C CA     . ILE A 1 150 ? -10.015 15.971  -10.540 1.00 0.00  ? 150 ILE A CA     1  
ATOM   2392  C C      . ILE A 1 150 ? -11.208 16.902  -10.788 1.00 0.00  ? 150 ILE A C      1  
ATOM   2393  O O      . ILE A 1 150 ? -12.117 16.980  -9.961  1.00 0.00  ? 150 ILE A O      1  
ATOM   2394  C CB     . ILE A 1 150 ? -9.268  15.690  -11.874 1.00 0.00  ? 150 ILE A CB     1  
ATOM   2395  C CG1    . ILE A 1 150 ? -8.825  14.229  -11.982 1.00 0.00  ? 150 ILE A CG1    1  
ATOM   2396  C CG2    . ILE A 1 150 ? -8.064  16.612  -12.003 1.00 0.00  ? 150 ILE A CG2    1  
ATOM   2397  C CD1    . ILE A 1 150 ? -8.268  13.874  -13.346 1.00 0.00  ? 150 ILE A CD1    1  
ATOM   2398  H H      . ILE A 1 150 ? -10.822 14.030  -10.455 1.00 0.00  ? 150 ILE A H      1  
ATOM   2399  H HA     . ILE A 1 150 ? -9.329  16.462  -9.863  1.00 0.00  ? 150 ILE A HA     1  
ATOM   2400  H HB     . ILE A 1 150 ? -9.940  15.908  -12.691 1.00 0.00  ? 150 ILE A HB     1  
ATOM   2401  H HG12   . ILE A 1 150 ? -8.056  14.031  -11.252 1.00 0.00  ? 150 ILE A HG12   1  
ATOM   2402  H HG13   . ILE A 1 150 ? -9.670  13.585  -11.794 1.00 0.00  ? 150 ILE A HG13   1  
ATOM   2403  H HG21   . ILE A 1 150 ? -8.370  17.542  -12.459 1.00 0.00  ? 150 ILE A HG21   1  
ATOM   2404  H HG22   . ILE A 1 150 ? -7.313  16.139  -12.617 1.00 0.00  ? 150 ILE A HG22   1  
ATOM   2405  H HG23   . ILE A 1 150 ? -7.656  16.810  -11.022 1.00 0.00  ? 150 ILE A HG23   1  
ATOM   2406  H HD11   . ILE A 1 150 ? -9.059  13.921  -14.079 1.00 0.00  ? 150 ILE A HD11   1  
ATOM   2407  H HD12   . ILE A 1 150 ? -7.859  12.877  -13.319 1.00 0.00  ? 150 ILE A HD12   1  
ATOM   2408  H HD13   . ILE A 1 150 ? -7.492  14.576  -13.610 1.00 0.00  ? 150 ILE A HD13   1  
ATOM   2409  N N      . GLU A 1 151 ? -11.207 17.598  -11.918 1.00 0.00  ? 151 GLU A N      1  
ATOM   2410  C CA     . GLU A 1 151 ? -12.292 18.510  -12.258 1.00 0.00  ? 151 GLU A CA     1  
ATOM   2411  C C      . GLU A 1 151 ? -12.579 18.463  -13.754 1.00 0.00  ? 151 GLU A C      1  
ATOM   2412  O O      . GLU A 1 151 ? -13.629 17.985  -14.182 1.00 0.00  ? 151 GLU A O      1  
ATOM   2413  C CB     . GLU A 1 151 ? -11.947 19.942  -11.837 1.00 0.00  ? 151 GLU A CB     1  
ATOM   2414  C CG     . GLU A 1 151 ? -11.089 20.025  -10.585 1.00 0.00  ? 151 GLU A CG     1  
ATOM   2415  C CD     . GLU A 1 151 ? -9.635  19.686  -10.847 1.00 0.00  ? 151 GLU A CD     1  
ATOM   2416  O OE1    . GLU A 1 151 ? -8.965  19.186  -9.919  1.00 0.00  ? 151 GLU A OE1    1  
ATOM   2417  O OE2    . GLU A 1 151 ? -9.167  19.920  -11.981 1.00 0.00  ? 151 GLU A OE2    1  
ATOM   2418  H H      . GLU A 1 151 ? -10.463 17.495  -12.539 1.00 0.00  ? 151 GLU A H      1  
ATOM   2419  H HA     . GLU A 1 151 ? -13.175 18.188  -11.723 1.00 0.00  ? 151 GLU A HA     1  
ATOM   2420  H HB2    . GLU A 1 151 ? -11.414 20.424  -12.643 1.00 0.00  ? 151 GLU A HB2    1  
ATOM   2421  H HB3    . GLU A 1 151 ? -12.865 20.481  -11.654 1.00 0.00  ? 151 GLU A HB3    1  
ATOM   2422  H HG2    . GLU A 1 151 ? -11.142 21.030  -10.196 1.00 0.00  ? 151 GLU A HG2    1  
ATOM   2423  H HG3    . GLU A 1 151 ? -11.478 19.335  -9.851  1.00 0.00  ? 151 GLU A HG3    1  
ATOM   2424  H HE2    . GLU A 1 151 ? -8.242  19.681  -12.078 1.00 0.00  ? 151 GLU A HE2    1  
ATOM   2425  N N      . ALA A 1 152 ? -11.634 18.963  -14.543 1.00 0.00  ? 152 ALA A N      1  
ATOM   2426  C CA     . ALA A 1 152 ? -11.779 18.976  -15.995 1.00 0.00  ? 152 ALA A CA     1  
ATOM   2427  C C      . ALA A 1 152 ? -10.436 19.219  -16.679 1.00 0.00  ? 152 ALA A C      1  
ATOM   2428  O O      . ALA A 1 152 ? -10.112 18.572  -17.674 1.00 0.00  ? 152 ALA A O      1  
ATOM   2429  C CB     . ALA A 1 152 ? -12.785 20.037  -16.415 1.00 0.00  ? 152 ALA A CB     1  
ATOM   2430  H H      . ALA A 1 152 ? -10.818 19.327  -14.138 1.00 0.00  ? 152 ALA A H      1  
ATOM   2431  H HA     . ALA A 1 152 ? -12.158 18.013  -16.299 1.00 0.00  ? 152 ALA A HA     1  
ATOM   2432  H HB1    . ALA A 1 152 ? -13.388 19.657  -17.226 1.00 0.00  ? 152 ALA A HB1    1  
ATOM   2433  H HB2    . ALA A 1 152 ? -12.261 20.922  -16.740 1.00 0.00  ? 152 ALA A HB2    1  
ATOM   2434  H HB3    . ALA A 1 152 ? -13.423 20.281  -15.578 1.00 0.00  ? 152 ALA A HB3    1  
ATOM   2435  N N      . LEU A 1 153 ? -9.661  20.154  -16.137 1.00 0.00  ? 153 LEU A N      1  
ATOM   2436  C CA     . LEU A 1 153 ? -8.352  20.486  -16.694 1.00 0.00  ? 153 LEU A CA     1  
ATOM   2437  C C      . LEU A 1 153 ? -8.494  21.169  -18.052 1.00 0.00  ? 153 LEU A C      1  
ATOM   2438  C CB     . LEU A 1 153 ? -7.493  19.227  -16.832 1.00 0.00  ? 153 LEU A CB     1  
ATOM   2439  C CG     . LEU A 1 153 ? -5.983  19.483  -16.926 1.00 0.00  ? 153 LEU A CG     1  
ATOM   2440  C CD1    . LEU A 1 153 ? -5.245  18.794  -15.785 1.00 0.00  ? 153 LEU A CD1    1  
ATOM   2441  C CD2    . LEU A 1 153 ? -5.439  19.025  -18.274 1.00 0.00  ? 153 LEU A CD2    1  
ATOM   2442  H H      . LEU A 1 153 ? -9.976  20.635  -15.344 1.00 0.00  ? 153 LEU A H      1  
ATOM   2443  H HA     . LEU A 1 153 ? -7.868  21.168  -16.013 1.00 0.00  ? 153 LEU A HA     1  
ATOM   2444  H HB2    . LEU A 1 153 ? -7.681  18.593  -15.978 1.00 0.00  ? 153 LEU A HB2    1  
ATOM   2445  H HB3    . LEU A 1 153 ? -7.802  18.701  -17.723 1.00 0.00  ? 153 LEU A HB3    1  
ATOM   2446  H HG     . LEU A 1 153 ? -5.803  20.546  -16.839 1.00 0.00  ? 153 LEU A HG     1  
ATOM   2447  H HD11   . LEU A 1 153 ? -4.657  17.978  -16.179 1.00 0.00  ? 153 LEU A HD11   1  
ATOM   2448  H HD12   . LEU A 1 153 ? -5.959  18.410  -15.072 1.00 0.00  ? 153 LEU A HD12   1  
ATOM   2449  H HD13   . LEU A 1 153 ? -4.594  19.503  -15.297 1.00 0.00  ? 153 LEU A HD13   1  
ATOM   2450  H HD21   . LEU A 1 153 ? -6.252  18.675  -18.891 1.00 0.00  ? 153 LEU A HD21   1  
ATOM   2451  H HD22   . LEU A 1 153 ? -4.731  18.223  -18.122 1.00 0.00  ? 153 LEU A HD22   1  
ATOM   2452  H HD23   . LEU A 1 153 ? -4.945  19.850  -18.762 1.00 0.00  ? 153 LEU A HD23   1  
HETATM 2453  P PG     . ATP B 2 .   ? -1.760  -10.484 -30.856 1.00 0.00  ? 154 ATP A PG     1  
HETATM 2454  O O1G    . ATP B 2 .   ? -3.242  -10.563 -30.870 1.00 0.00  ? 154 ATP A O1G    1  
HETATM 2455  O O2G    . ATP B 2 .   ? -1.389  -11.911 -31.037 1.00 0.00  ? 154 ATP A O2G    1  
HETATM 2456  O O3G    . ATP B 2 .   ? -1.049  -9.663  -31.869 1.00 0.00  ? 154 ATP A O3G    1  
HETATM 2457  P PB     . ATP B 2 .   ? 0.041   -9.617  -29.016 1.00 0.00  ? 154 ATP A PB     1  
HETATM 2458  O O1B    . ATP B 2 .   ? -0.059  -8.173  -28.681 1.00 0.00  ? 154 ATP A O1B    1  
HETATM 2459  O O2B    . ATP B 2 .   ? 1.068   -10.085 -29.979 1.00 0.00  ? 154 ATP A O2B    1  
HETATM 2460  O O3B    . ATP B 2 .   ? -1.296  -10.008 -29.529 1.00 0.00  ? 154 ATP A O3B    1  
HETATM 2461  P PA     . ATP B 2 .   ? 0.596   -11.616 -27.225 1.00 0.00  ? 154 ATP A PA     1  
HETATM 2462  O O1A    . ATP B 2 .   ? 0.495   -12.709 -28.225 1.00 0.00  ? 154 ATP A O1A    1  
HETATM 2463  O O2A    . ATP B 2 .   ? 1.763   -11.595 -26.306 1.00 0.00  ? 154 ATP A O2A    1  
HETATM 2464  O O3A    . ATP B 2 .   ? 0.360   -10.229 -27.700 1.00 0.00  ? 154 ATP A O3A    1  
HETATM 2465  O "O5'"  . ATP B 2 .   ? -0.743  -11.765 -26.374 1.00 0.00  ? 154 ATP A "O5'"  1  
HETATM 2466  C "C5'"  . ATP B 2 .   ? -0.753  -11.499 -24.975 1.00 0.00  ? 154 ATP A "C5'"  1  
HETATM 2467  C "C4'"  . ATP B 2 .   ? -1.198  -12.725 -24.216 1.00 0.00  ? 154 ATP A "C4'"  1  
HETATM 2468  O "O4'"  . ATP B 2 .   ? -1.450  -12.348 -22.834 1.00 0.00  ? 154 ATP A "O4'"  1  
HETATM 2469  C "C3'"  . ATP B 2 .   ? -2.496  -13.356 -24.709 1.00 0.00  ? 154 ATP A "C3'"  1  
HETATM 2470  O "O3'"  . ATP B 2 .   ? -2.492  -14.765 -24.527 1.00 0.00  ? 154 ATP A "O3'"  1  
HETATM 2471  C "C2'"  . ATP B 2 .   ? -3.554  -12.670 -23.854 1.00 0.00  ? 154 ATP A "C2'"  1  
HETATM 2472  O "O2'"  . ATP B 2 .   ? -4.680  -13.506 -23.662 1.00 0.00  ? 154 ATP A "O2'"  1  
HETATM 2473  C "C1'"  . ATP B 2 .   ? -2.817  -12.536 -22.527 1.00 0.00  ? 154 ATP A "C1'"  1  
HETATM 2474  N N9     . ATP B 2 .   ? -3.257  -11.411 -21.705 1.00 0.00  ? 154 ATP A N9     1  
HETATM 2475  C C8     . ATP B 2 .   ? -4.040  -10.344 -22.068 1.00 0.00  ? 154 ATP A C8     1  
HETATM 2476  N N7     . ATP B 2 .   ? -4.251  -9.490  -21.096 1.00 0.00  ? 154 ATP A N7     1  
HETATM 2477  C C5     . ATP B 2 .   ? -3.563  -10.033 -20.019 1.00 0.00  ? 154 ATP A C5     1  
HETATM 2478  C C6     . ATP B 2 .   ? -3.389  -9.605  -18.694 1.00 0.00  ? 154 ATP A C6     1  
HETATM 2479  N N6     . ATP B 2 .   ? -3.917  -8.483  -18.203 1.00 0.00  ? 154 ATP A N6     1  
HETATM 2480  N N1     . ATP B 2 .   ? -2.644  -10.382 -17.877 1.00 0.00  ? 154 ATP A N1     1  
HETATM 2481  C C2     . ATP B 2 .   ? -2.111  -11.508 -18.371 1.00 0.00  ? 154 ATP A C2     1  
HETATM 2482  N N3     . ATP B 2 .   ? -2.200  -12.012 -19.597 1.00 0.00  ? 154 ATP A N3     1  
HETATM 2483  C C4     . ATP B 2 .   ? -2.949  -11.218 -20.381 1.00 0.00  ? 154 ATP A C4     1  
HETATM 2484  H "H5'1" . ATP B 2 .   ? -1.437  -10.677 -24.762 1.00 0.00  ? 154 ATP A "H5'1" 1  
HETATM 2485  H "H5'2" . ATP B 2 .   ? 0.246   -11.221 -24.644 1.00 0.00  ? 154 ATP A "H5'2" 1  
HETATM 2486  H "H4'"  . ATP B 2 .   ? -0.419  -13.482 -24.326 1.00 0.00  ? 154 ATP A "H4'"  1  
HETATM 2487  H "H3'"  . ATP B 2 .   ? -2.646  -13.190 -25.776 1.00 0.00  ? 154 ATP A "H3'"  1  
HETATM 2488  H "H2'"  . ATP B 2 .   ? -3.817  -11.695 -24.270 1.00 0.00  ? 154 ATP A "H2'"  1  
HETATM 2489  H "HO2'" . ATP B 2 .   ? -4.354  -14.360 -23.375 1.00 0.00  ? 154 ATP A "HO2'" 1  
HETATM 2490  H "H1'"  . ATP B 2 .   ? -2.884  -13.443 -21.923 1.00 0.00  ? 154 ATP A "H1'"  1  
HETATM 2491  H H8     . ATP B 2 .   ? -4.445  -10.220 -23.061 1.00 0.00  ? 154 ATP A H8     1  
HETATM 2492  H HN61   . ATP B 2 .   ? -4.478  -7.886  -18.796 1.00 0.00  ? 154 ATP A HN61   1  
HETATM 2493  H HN62   . ATP B 2 .   ? -3.750  -8.221  -17.243 1.00 0.00  ? 154 ATP A HN62   1  
HETATM 2494  H H2     . ATP B 2 .   ? -1.518  -12.094 -17.668 1.00 0.00  ? 154 ATP A H2     1  
ATOM   2495  N N      . GLY A 1 1   ? 14.013  -11.599 -10.314 1.00 0.00  ? 1   GLY A N      2  
ATOM   2496  C CA     . GLY A 1 1   ? 12.779  -10.883 -10.060 1.00 0.00  ? 1   GLY A CA     2  
ATOM   2497  C C      . GLY A 1 1   ? 12.237  -10.291 -11.354 1.00 0.00  ? 1   GLY A C      2  
ATOM   2498  O O      . GLY A 1 1   ? 12.841  -10.448 -12.412 1.00 0.00  ? 1   GLY A O      2  
ATOM   2499  H H1     . GLY A 1 1   ? 14.480  -12.043 -9.536  1.00 0.00  ? 1   GLY A H1     2  
ATOM   2500  H HA2    . GLY A 1 1   ? 12.042  -11.570 -9.643  1.00 0.00  ? 1   GLY A HA2    2  
ATOM   2501  H HA3    . GLY A 1 1   ? 12.967  -10.080 -9.348  1.00 0.00  ? 1   GLY A HA3    2  
ATOM   2502  N N      . PRO A 1 2   ? 11.094  -9.608  -11.266 1.00 0.00  ? 2   PRO A N      2  
ATOM   2503  C CA     . PRO A 1 2   ? 10.434  -8.973  -12.387 1.00 0.00  ? 2   PRO A CA     2  
ATOM   2504  C C      . PRO A 1 2   ? 11.219  -7.741  -12.811 1.00 0.00  ? 2   PRO A C      2  
ATOM   2505  O O      . PRO A 1 2   ? 11.317  -7.443  -14.000 1.00 0.00  ? 2   PRO A O      2  
ATOM   2506  C CB     . PRO A 1 2   ? 9.053   -8.588  -11.861 1.00 0.00  ? 2   PRO A CB     2  
ATOM   2507  C CG     . PRO A 1 2   ? 9.313   -8.342  -10.376 1.00 0.00  ? 2   PRO A CG     2  
ATOM   2508  C CD     . PRO A 1 2   ? 10.356  -9.405  -10.038 1.00 0.00  ? 2   PRO A CD     2  
ATOM   2509  H HA     . PRO A 1 2   ? 10.342  -9.661  -13.227 1.00 0.00  ? 2   PRO A HA     2  
ATOM   2510  H HB2    . PRO A 1 2   ? 8.649   -7.709  -12.364 1.00 0.00  ? 2   PRO A HB2    2  
ATOM   2511  H HB3    . PRO A 1 2   ? 8.378   -9.438  -11.969 1.00 0.00  ? 2   PRO A HB3    2  
ATOM   2512  H HG2    . PRO A 1 2   ? 9.753   -7.353  -10.249 1.00 0.00  ? 2   PRO A HG2    2  
ATOM   2513  H HG3    . PRO A 1 2   ? 8.409   -8.442  -9.773  1.00 0.00  ? 2   PRO A HG3    2  
ATOM   2514  H HD2    . PRO A 1 2   ? 11.006  -9.068  -9.230  1.00 0.00  ? 2   PRO A HD2    2  
ATOM   2515  H HD3    . PRO A 1 2   ? 9.860   -10.335 -9.762  1.00 0.00  ? 2   PRO A HD3    2  
ATOM   2516  N N      . LEU A 1 3   ? 11.776  -7.029  -11.836 1.00 0.00  ? 3   LEU A N      2  
ATOM   2517  C CA     . LEU A 1 3   ? 12.555  -5.827  -12.116 1.00 0.00  ? 3   LEU A CA     2  
ATOM   2518  C C      . LEU A 1 3   ? 13.819  -6.163  -12.905 1.00 0.00  ? 3   LEU A C      2  
ATOM   2519  O O      . LEU A 1 3   ? 14.451  -7.194  -12.674 1.00 0.00  ? 3   LEU A O      2  
ATOM   2520  C CB     . LEU A 1 3   ? 12.931  -5.123  -10.810 1.00 0.00  ? 3   LEU A CB     2  
ATOM   2521  C CG     . LEU A 1 3   ? 13.886  -5.906  -9.904  1.00 0.00  ? 3   LEU A CG     2  
ATOM   2522  C CD1    . LEU A 1 3   ? 15.117  -5.075  -9.568  1.00 0.00  ? 3   LEU A CD1    2  
ATOM   2523  C CD2    . LEU A 1 3   ? 13.174  -6.342  -8.630  1.00 0.00  ? 3   LEU A CD2    2  
ATOM   2524  H H      . LEU A 1 3   ? 11.661  -7.316  -10.909 1.00 0.00  ? 3   LEU A H      2  
ATOM   2525  H HA     . LEU A 1 3   ? 11.943  -5.165  -12.708 1.00 0.00  ? 3   LEU A HA     2  
ATOM   2526  H HB2    . LEU A 1 3   ? 13.390  -4.176  -11.057 1.00 0.00  ? 3   LEU A HB2    2  
ATOM   2527  H HB3    . LEU A 1 3   ? 12.023  -4.928  -10.259 1.00 0.00  ? 3   LEU A HB3    2  
ATOM   2528  H HG     . LEU A 1 3   ? 14.214  -6.794  -10.422 1.00 0.00  ? 3   LEU A HG     2  
ATOM   2529  H HD11   . LEU A 1 3   ? 15.052  -4.729  -8.548  1.00 0.00  ? 3   LEU A HD11   2  
ATOM   2530  H HD12   . LEU A 1 3   ? 15.171  -4.225  -10.234 1.00 0.00  ? 3   LEU A HD12   2  
ATOM   2531  H HD13   . LEU A 1 3   ? 16.003  -5.682  -9.687  1.00 0.00  ? 3   LEU A HD13   2  
ATOM   2532  H HD21   . LEU A 1 3   ? 13.617  -7.258  -8.266  1.00 0.00  ? 3   LEU A HD21   2  
ATOM   2533  H HD22   . LEU A 1 3   ? 12.128  -6.507  -8.839  1.00 0.00  ? 3   LEU A HD22   2  
ATOM   2534  H HD23   . LEU A 1 3   ? 13.275  -5.572  -7.880  1.00 0.00  ? 3   LEU A HD23   2  
ATOM   2535  N N      . GLY A 1 4   ? 14.181  -5.283  -13.833 1.00 0.00  ? 4   GLY A N      2  
ATOM   2536  C CA     . GLY A 1 4   ? 15.369  -5.501  -14.640 1.00 0.00  ? 4   GLY A CA     2  
ATOM   2537  C C      . GLY A 1 4   ? 15.084  -5.424  -16.127 1.00 0.00  ? 4   GLY A C      2  
ATOM   2538  O O      . GLY A 1 4   ? 14.354  -4.543  -16.582 1.00 0.00  ? 4   GLY A O      2  
ATOM   2539  H H      . GLY A 1 4   ? 13.640  -4.479  -13.972 1.00 0.00  ? 4   GLY A H      2  
ATOM   2540  H HA2    . GLY A 1 4   ? 16.105  -4.754  -14.388 1.00 0.00  ? 4   GLY A HA2    2  
ATOM   2541  H HA3    . GLY A 1 4   ? 15.770  -6.479  -14.415 1.00 0.00  ? 4   GLY A HA3    2  
ATOM   2542  N N      . SER A 1 5   ? 15.659  -6.350  -16.886 1.00 0.00  ? 5   SER A N      2  
ATOM   2543  C CA     . SER A 1 5   ? 15.463  -6.385  -18.331 1.00 0.00  ? 5   SER A CA     2  
ATOM   2544  C C      . SER A 1 5   ? 14.396  -7.405  -18.713 1.00 0.00  ? 5   SER A C      2  
ATOM   2545  O O      . SER A 1 5   ? 13.838  -7.353  -19.809 1.00 0.00  ? 5   SER A O      2  
ATOM   2546  C CB     . SER A 1 5   ? 16.778  -6.720  -19.041 1.00 0.00  ? 5   SER A CB     2  
ATOM   2547  O OG     . SER A 1 5   ? 17.766  -5.740  -18.773 1.00 0.00  ? 5   SER A OG     2  
ATOM   2548  H H      . SER A 1 5   ? 16.230  -7.027  -16.466 1.00 0.00  ? 5   SER A H      2  
ATOM   2549  H HA     . SER A 1 5   ? 15.136  -5.406  -18.643 1.00 0.00  ? 5   SER A HA     2  
ATOM   2550  H HB2    . SER A 1 5   ? 17.136  -7.677  -18.697 1.00 0.00  ? 5   SER A HB2    2  
ATOM   2551  H HB3    . SER A 1 5   ? 16.608  -6.758  -20.108 1.00 0.00  ? 5   SER A HB3    2  
ATOM   2552  H HG     . SER A 1 5   ? 17.772  -5.539  -17.834 1.00 0.00  ? 5   SER A HG     2  
ATOM   2553  N N      . MET A 1 6   ? 14.108  -8.329  -17.799 1.00 0.00  ? 6   MET A N      2  
ATOM   2554  C CA     . MET A 1 6   ? 13.104  -9.351  -18.041 1.00 0.00  ? 6   MET A CA     2  
ATOM   2555  C C      . MET A 1 6   ? 11.755  -8.714  -18.345 1.00 0.00  ? 6   MET A C      2  
ATOM   2556  O O      . MET A 1 6   ? 11.591  -7.499  -18.239 1.00 0.00  ? 6   MET A O      2  
ATOM   2557  C CB     . MET A 1 6   ? 12.987  -10.281 -16.832 1.00 0.00  ? 6   MET A CB     2  
ATOM   2558  C CG     . MET A 1 6   ? 13.531  -11.678 -17.086 1.00 0.00  ? 6   MET A CG     2  
ATOM   2559  S SD     . MET A 1 6   ? 12.428  -12.975 -16.494 1.00 0.00  ? 6   MET A SD     2  
ATOM   2560  C CE     . MET A 1 6   ? 11.284  -13.097 -17.865 1.00 0.00  ? 6   MET A CE     2  
ATOM   2561  H H      . MET A 1 6   ? 14.578  -8.320  -16.943 1.00 0.00  ? 6   MET A H      2  
ATOM   2562  H HA     . MET A 1 6   ? 13.418  -9.928  -18.899 1.00 0.00  ? 6   MET A HA     2  
ATOM   2563  H HB2    . MET A 1 6   ? 13.533  -9.852  -16.007 1.00 0.00  ? 6   MET A HB2    2  
ATOM   2564  H HB3    . MET A 1 6   ? 11.947  -10.369 -16.556 1.00 0.00  ? 6   MET A HB3    2  
ATOM   2565  H HG2    . MET A 1 6   ? 13.672  -11.806 -18.150 1.00 0.00  ? 6   MET A HG2    2  
ATOM   2566  H HG3    . MET A 1 6   ? 14.482  -11.775 -16.584 1.00 0.00  ? 6   MET A HG3    2  
ATOM   2567  H HE1    . MET A 1 6   ? 10.546  -12.309 -17.790 1.00 0.00  ? 6   MET A HE1    2  
ATOM   2568  H HE2    . MET A 1 6   ? 10.790  -14.056 -17.838 1.00 0.00  ? 6   MET A HE2    2  
ATOM   2569  H HE3    . MET A 1 6   ? 11.823  -12.995 -18.794 1.00 0.00  ? 6   MET A HE3    2  
ATOM   2570  N N      . ALA A 1 7   ? 10.795  -9.544  -18.726 1.00 0.00  ? 7   ALA A N      2  
ATOM   2571  C CA     . ALA A 1 7   ? 9.458   -9.064  -19.051 1.00 0.00  ? 7   ALA A CA     2  
ATOM   2572  C C      . ALA A 1 7   ? 9.479   -8.209  -20.307 1.00 0.00  ? 7   ALA A C      2  
ATOM   2573  O O      . ALA A 1 7   ? 10.535  -7.752  -20.746 1.00 0.00  ? 7   ALA A O      2  
ATOM   2574  C CB     . ALA A 1 7   ? 8.871   -8.280  -17.884 1.00 0.00  ? 7   ALA A CB     2  
ATOM   2575  H H      . ALA A 1 7   ? 10.991  -10.500 -18.792 1.00 0.00  ? 7   ALA A H      2  
ATOM   2576  H HA     . ALA A 1 7   ? 8.830   -9.928  -19.230 1.00 0.00  ? 7   ALA A HA     2  
ATOM   2577  H HB1    . ALA A 1 7   ? 9.471   -8.445  -17.001 1.00 0.00  ? 7   ALA A HB1    2  
ATOM   2578  H HB2    . ALA A 1 7   ? 7.859   -8.611  -17.699 1.00 0.00  ? 7   ALA A HB2    2  
ATOM   2579  H HB3    . ALA A 1 7   ? 8.868   -7.227  -18.123 1.00 0.00  ? 7   ALA A HB3    2  
ATOM   2580  N N      . LEU A 1 8   ? 8.307   -8.002  -20.882 1.00 0.00  ? 8   LEU A N      2  
ATOM   2581  C CA     . LEU A 1 8   ? 8.180   -7.206  -22.096 1.00 0.00  ? 8   LEU A CA     2  
ATOM   2582  C C      . LEU A 1 8   ? 7.615   -5.821  -21.789 1.00 0.00  ? 8   LEU A C      2  
ATOM   2583  O O      . LEU A 1 8   ? 6.575   -5.693  -21.142 1.00 0.00  ? 8   LEU A O      2  
ATOM   2584  C CB     . LEU A 1 8   ? 7.285   -7.921  -23.113 1.00 0.00  ? 8   LEU A CB     2  
ATOM   2585  C CG     . LEU A 1 8   ? 7.267   -9.449  -23.008 1.00 0.00  ? 8   LEU A CG     2  
ATOM   2586  C CD1    . LEU A 1 8   ? 6.421   -9.898  -21.826 1.00 0.00  ? 8   LEU A CD1    2  
ATOM   2587  C CD2    . LEU A 1 8   ? 6.740   -10.061 -24.293 1.00 0.00  ? 8   LEU A CD2    2  
ATOM   2588  H H      . LEU A 1 8   ? 7.506   -8.398  -20.478 1.00 0.00  ? 8   LEU A H      2  
ATOM   2589  H HA     . LEU A 1 8   ? 9.165   -7.089  -22.520 1.00 0.00  ? 8   LEU A HA     2  
ATOM   2590  H HB2    . LEU A 1 8   ? 6.277   -7.562  -22.986 1.00 0.00  ? 8   LEU A HB2    2  
ATOM   2591  H HB3    . LEU A 1 8   ? 7.621   -7.656  -24.105 1.00 0.00  ? 8   LEU A HB3    2  
ATOM   2592  H HG     . LEU A 1 8   ? 8.276   -9.804  -22.856 1.00 0.00  ? 8   LEU A HG     2  
ATOM   2593  H HD11   . LEU A 1 8   ? 5.728   -10.660 -22.143 1.00 0.00  ? 8   LEU A HD11   2  
ATOM   2594  H HD12   . LEU A 1 8   ? 5.873   -9.053  -21.441 1.00 0.00  ? 8   LEU A HD12   2  
ATOM   2595  H HD13   . LEU A 1 8   ? 7.065   -10.294 -21.046 1.00 0.00  ? 8   LEU A HD13   2  
ATOM   2596  H HD21   . LEU A 1 8   ? 6.873   -11.133 -24.260 1.00 0.00  ? 8   LEU A HD21   2  
ATOM   2597  H HD22   . LEU A 1 8   ? 7.281   -9.655  -25.135 1.00 0.00  ? 8   LEU A HD22   2  
ATOM   2598  H HD23   . LEU A 1 8   ? 5.688   -9.833  -24.393 1.00 0.00  ? 8   LEU A HD23   2  
ATOM   2599  N N      . ARG A 1 9   ? 8.309   -4.790  -22.257 1.00 0.00  ? 9   ARG A N      2  
ATOM   2600  C CA     . ARG A 1 9   ? 7.879   -3.413  -22.032 1.00 0.00  ? 9   ARG A CA     2  
ATOM   2601  C C      . ARG A 1 9   ? 6.769   -3.020  -23.004 1.00 0.00  ? 9   ARG A C      2  
ATOM   2602  O O      . ARG A 1 9   ? 6.947   -3.074  -24.220 1.00 0.00  ? 9   ARG A O      2  
ATOM   2603  C CB     . ARG A 1 9   ? 9.064   -2.456  -22.179 1.00 0.00  ? 9   ARG A CB     2  
ATOM   2604  C CG     . ARG A 1 9   ? 9.091   -1.358  -21.126 1.00 0.00  ? 9   ARG A CG     2  
ATOM   2605  C CD     . ARG A 1 9   ? 10.509  -1.069  -20.654 1.00 0.00  ? 9   ARG A CD     2  
ATOM   2606  N NE     . ARG A 1 9   ? 10.899  0.316   -20.911 1.00 0.00  ? 9   ARG A NE     2  
ATOM   2607  C CZ     . ARG A 1 9   ? 11.613  0.710   -21.964 1.00 0.00  ? 9   ARG A CZ     2  
ATOM   2608  N NH1    . ARG A 1 9   ? 12.023  -0.169  -22.873 1.00 0.00  ? 9   ARG A NH1    2  
ATOM   2609  N NH2    . ARG A 1 9   ? 11.919  1.991   -22.112 1.00 0.00  ? 9   ARG A NH2    2  
ATOM   2610  H H      . ARG A 1 9   ? 9.128   -4.956  -22.765 1.00 0.00  ? 9   ARG A H      2  
ATOM   2611  H HA     . ARG A 1 9   ? 7.499   -3.347  -21.024 1.00 0.00  ? 9   ARG A HA     2  
ATOM   2612  H HB2    . ARG A 1 9   ? 9.980   -3.018  -22.106 1.00 0.00  ? 9   ARG A HB2    2  
ATOM   2613  H HB3    . ARG A 1 9   ? 9.016   -1.987  -23.152 1.00 0.00  ? 9   ARG A HB3    2  
ATOM   2614  H HG2    . ARG A 1 9   ? 8.672   -0.457  -21.546 1.00 0.00  ? 9   ARG A HG2    2  
ATOM   2615  H HG3    . ARG A 1 9   ? 8.498   -1.673  -20.278 1.00 0.00  ? 9   ARG A HG3    2  
ATOM   2616  H HD2    . ARG A 1 9   ? 10.564  -1.256  -19.592 1.00 0.00  ? 9   ARG A HD2    2  
ATOM   2617  H HD3    . ARG A 1 9   ? 11.190  -1.730  -21.167 1.00 0.00  ? 9   ARG A HD3    2  
ATOM   2618  H HE     . ARG A 1 9   ? 10.614  0.992   -20.261 1.00 0.00  ? 9   ARG A HE     2  
ATOM   2619  H HH11   . ARG A 1 9   ? 11.796  -1.137  -22.772 1.00 0.00  ? 9   ARG A HH11   2  
ATOM   2620  H HH12   . ARG A 1 9   ? 12.558  0.138   -23.659 1.00 0.00  ? 9   ARG A HH12   2  
ATOM   2621  H HH21   . ARG A 1 9   ? 11.613  2.659   -21.433 1.00 0.00  ? 9   ARG A HH21   2  
ATOM   2622  H HH22   . ARG A 1 9   ? 12.454  2.289   -22.901 1.00 0.00  ? 9   ARG A HH22   2  
ATOM   2623  N N      . ALA A 1 10  ? 5.628   -2.622  -22.455 1.00 0.00  ? 10  ALA A N      2  
ATOM   2624  C CA     . ALA A 1 10  ? 4.489   -2.213  -23.265 1.00 0.00  ? 10  ALA A CA     2  
ATOM   2625  C C      . ALA A 1 10  ? 3.815   -0.986  -22.670 1.00 0.00  ? 10  ALA A C      2  
ATOM   2626  O O      . ALA A 1 10  ? 3.989   -0.684  -21.490 1.00 0.00  ? 10  ALA A O      2  
ATOM   2627  C CB     . ALA A 1 10  ? 3.488   -3.352  -23.393 1.00 0.00  ? 10  ALA A CB     2  
ATOM   2628  H H      . ALA A 1 10  ? 5.549   -2.599  -21.478 1.00 0.00  ? 10  ALA A H      2  
ATOM   2629  H HA     . ALA A 1 10  ? 4.852   -1.972  -24.255 1.00 0.00  ? 10  ALA A HA     2  
ATOM   2630  H HB1    . ALA A 1 10  ? 2.502   -2.997  -23.124 1.00 0.00  ? 10  ALA A HB1    2  
ATOM   2631  H HB2    . ALA A 1 10  ? 3.774   -4.156  -22.732 1.00 0.00  ? 10  ALA A HB2    2  
ATOM   2632  H HB3    . ALA A 1 10  ? 3.476   -3.710  -24.412 1.00 0.00  ? 10  ALA A HB3    2  
ATOM   2633  N N      . CYS A 1 11  ? 3.042   -0.284  -23.489 1.00 0.00  ? 11  CYS A N      2  
ATOM   2634  C CA     . CYS A 1 11  ? 2.342   0.903   -23.027 1.00 0.00  ? 11  CYS A CA     2  
ATOM   2635  C C      . CYS A 1 11  ? 1.020   1.081   -23.760 1.00 0.00  ? 11  CYS A C      2  
ATOM   2636  O O      . CYS A 1 11  ? 0.976   1.156   -24.987 1.00 0.00  ? 11  CYS A O      2  
ATOM   2637  C CB     . CYS A 1 11  ? 3.213   2.144   -23.227 1.00 0.00  ? 11  CYS A CB     2  
ATOM   2638  S SG     . CYS A 1 11  ? 4.530   2.326   -22.000 1.00 0.00  ? 11  CYS A SG     2  
ATOM   2639  H H      . CYS A 1 11  ? 2.936   -0.576  -24.418 1.00 0.00  ? 11  CYS A H      2  
ATOM   2640  H HA     . CYS A 1 11  ? 2.140   0.782   -21.974 1.00 0.00  ? 11  CYS A HA     2  
ATOM   2641  H HB2    . CYS A 1 11  ? 3.677   2.096   -24.200 1.00 0.00  ? 11  CYS A HB2    2  
ATOM   2642  H HB3    . CYS A 1 11  ? 2.589   3.025   -23.174 1.00 0.00  ? 11  CYS A HB3    2  
ATOM   2643  H HG     . CYS A 1 11  ? 4.453   1.601   -21.375 1.00 0.00  ? 11  CYS A HG     2  
ATOM   2644  N N      . GLY A 1 12  ? -0.055  1.156   -22.989 1.00 0.00  ? 12  GLY A N      2  
ATOM   2645  C CA     . GLY A 1 12  ? -1.372  1.339   -23.560 1.00 0.00  ? 12  GLY A CA     2  
ATOM   2646  C C      . GLY A 1 12  ? -1.973  2.668   -23.163 1.00 0.00  ? 12  GLY A C      2  
ATOM   2647  O O      . GLY A 1 12  ? -1.430  3.366   -22.307 1.00 0.00  ? 12  GLY A O      2  
ATOM   2648  H H      . GLY A 1 12  ? 0.051   1.095   -22.016 1.00 0.00  ? 12  GLY A H      2  
ATOM   2649  H HA2    . GLY A 1 12  ? -1.300  1.291   -24.636 1.00 0.00  ? 12  GLY A HA2    2  
ATOM   2650  H HA3    . GLY A 1 12  ? -2.017  0.544   -23.215 1.00 0.00  ? 12  GLY A HA3    2  
ATOM   2651  N N      . LEU A 1 13  ? -3.095  3.024   -23.775 1.00 0.00  ? 13  LEU A N      2  
ATOM   2652  C CA     . LEU A 1 13  ? -3.752  4.285   -23.456 1.00 0.00  ? 13  LEU A CA     2  
ATOM   2653  C C      . LEU A 1 13  ? -5.198  4.052   -23.046 1.00 0.00  ? 13  LEU A C      2  
ATOM   2654  O O      . LEU A 1 13  ? -6.014  3.593   -23.844 1.00 0.00  ? 13  LEU A O      2  
ATOM   2655  C CB     . LEU A 1 13  ? -3.702  5.235   -24.664 1.00 0.00  ? 13  LEU A CB     2  
ATOM   2656  C CG     . LEU A 1 13  ? -3.113  6.620   -24.384 1.00 0.00  ? 13  LEU A CG     2  
ATOM   2657  C CD1    . LEU A 1 13  ? -3.489  7.594   -25.490 1.00 0.00  ? 13  LEU A CD1    2  
ATOM   2658  C CD2    . LEU A 1 13  ? -3.579  7.143   -23.036 1.00 0.00  ? 13  LEU A CD2    2  
ATOM   2659  H H      . LEU A 1 13  ? -3.489  2.430   -24.445 1.00 0.00  ? 13  LEU A H      2  
ATOM   2660  H HA     . LEU A 1 13  ? -3.223  4.736   -22.632 1.00 0.00  ? 13  LEU A HA     2  
ATOM   2661  H HB2    . LEU A 1 13  ? -3.111  4.767   -25.437 1.00 0.00  ? 13  LEU A HB2    2  
ATOM   2662  H HB3    . LEU A 1 13  ? -4.707  5.370   -25.036 1.00 0.00  ? 13  LEU A HB3    2  
ATOM   2663  H HG     . LEU A 1 13  ? -2.039  6.545   -24.363 1.00 0.00  ? 13  LEU A HG     2  
ATOM   2664  H HD11   . LEU A 1 13  ? -3.564  8.590   -25.078 1.00 0.00  ? 13  LEU A HD11   2  
ATOM   2665  H HD12   . LEU A 1 13  ? -4.440  7.307   -25.914 1.00 0.00  ? 13  LEU A HD12   2  
ATOM   2666  H HD13   . LEU A 1 13  ? -2.733  7.579   -26.258 1.00 0.00  ? 13  LEU A HD13   2  
ATOM   2667  H HD21   . LEU A 1 13  ? -2.988  6.689   -22.254 1.00 0.00  ? 13  LEU A HD21   2  
ATOM   2668  H HD22   . LEU A 1 13  ? -4.620  6.892   -22.893 1.00 0.00  ? 13  LEU A HD22   2  
ATOM   2669  H HD23   . LEU A 1 13  ? -3.459  8.214   -23.003 1.00 0.00  ? 13  LEU A HD23   2  
ATOM   2670  N N      . ILE A 1 14  ? -5.521  4.401   -21.803 1.00 0.00  ? 14  ILE A N      2  
ATOM   2671  C CA     . ILE A 1 14  ? -6.882  4.253   -21.317 1.00 0.00  ? 14  ILE A CA     2  
ATOM   2672  C C      . ILE A 1 14  ? -7.696  5.451   -21.757 1.00 0.00  ? 14  ILE A C      2  
ATOM   2673  O O      . ILE A 1 14  ? -7.726  6.484   -21.091 1.00 0.00  ? 14  ILE A O      2  
ATOM   2674  C CB     . ILE A 1 14  ? -6.945  4.114   -19.782 1.00 0.00  ? 14  ILE A CB     2  
ATOM   2675  C CG1    . ILE A 1 14  ? -6.177  2.873   -19.337 1.00 0.00  ? 14  ILE A CG1    2  
ATOM   2676  C CG2    . ILE A 1 14  ? -8.389  4.036   -19.309 1.00 0.00  ? 14  ILE A CG2    2  
ATOM   2677  C CD1    . ILE A 1 14  ? -6.193  2.657   -17.842 1.00 0.00  ? 14  ILE A CD1    2  
ATOM   2678  H H      . ILE A 1 14  ? -4.837  4.783   -21.215 1.00 0.00  ? 14  ILE A H      2  
ATOM   2679  H HA     . ILE A 1 14  ? -7.302  3.360   -21.760 1.00 0.00  ? 14  ILE A HA     2  
ATOM   2680  H HB     . ILE A 1 14  ? -6.491  4.988   -19.341 1.00 0.00  ? 14  ILE A HB     2  
ATOM   2681  H HG12   . ILE A 1 14  ? -6.618  2.001   -19.800 1.00 0.00  ? 14  ILE A HG12   2  
ATOM   2682  H HG13   . ILE A 1 14  ? -5.150  2.962   -19.654 1.00 0.00  ? 14  ILE A HG13   2  
ATOM   2683  H HG21   . ILE A 1 14  ? -8.941  3.363   -19.948 1.00 0.00  ? 14  ILE A HG21   2  
ATOM   2684  H HG22   . ILE A 1 14  ? -8.838  5.018   -19.346 1.00 0.00  ? 14  ILE A HG22   2  
ATOM   2685  H HG23   . ILE A 1 14  ? -8.416  3.665   -18.292 1.00 0.00  ? 14  ILE A HG23   2  
ATOM   2686  H HD11   . ILE A 1 14  ? -6.383  1.618   -17.633 1.00 0.00  ? 14  ILE A HD11   2  
ATOM   2687  H HD12   . ILE A 1 14  ? -6.974  3.261   -17.401 1.00 0.00  ? 14  ILE A HD12   2  
ATOM   2688  H HD13   . ILE A 1 14  ? -5.241  2.943   -17.423 1.00 0.00  ? 14  ILE A HD13   2  
ATOM   2689  N N      . ILE A 1 15  ? -8.332  5.307   -22.900 1.00 0.00  ? 15  ILE A N      2  
ATOM   2690  C CA     . ILE A 1 15  ? -9.129  6.372   -23.468 1.00 0.00  ? 15  ILE A CA     2  
ATOM   2691  C C      . ILE A 1 15  ? -10.515 6.405   -22.856 1.00 0.00  ? 15  ILE A C      2  
ATOM   2692  O O      . ILE A 1 15  ? -11.074 5.372   -22.500 1.00 0.00  ? 15  ILE A O      2  
ATOM   2693  C CB     . ILE A 1 15  ? -9.219  6.213   -24.986 1.00 0.00  ? 15  ILE A CB     2  
ATOM   2694  C CG1    . ILE A 1 15  ? -7.813  6.189   -25.571 1.00 0.00  ? 15  ILE A CG1    2  
ATOM   2695  C CG2    . ILE A 1 15  ? -10.046 7.323   -25.608 1.00 0.00  ? 15  ILE A CG2    2  
ATOM   2696  C CD1    . ILE A 1 15  ? -7.726  5.461   -26.888 1.00 0.00  ? 15  ILE A CD1    2  
ATOM   2697  H H      . ILE A 1 15  ? -8.250  4.461   -23.390 1.00 0.00  ? 15  ILE A H      2  
ATOM   2698  H HA     . ILE A 1 15  ? -8.631  7.307   -23.256 1.00 0.00  ? 15  ILE A HA     2  
ATOM   2699  H HB     . ILE A 1 15  ? -9.703  5.274   -25.199 1.00 0.00  ? 15  ILE A HB     2  
ATOM   2700  H HG12   . ILE A 1 15  ? -7.474  7.202   -25.720 1.00 0.00  ? 15  ILE A HG12   2  
ATOM   2701  H HG13   . ILE A 1 15  ? -7.151  5.695   -24.875 1.00 0.00  ? 15  ILE A HG13   2  
ATOM   2702  H HG21   . ILE A 1 15  ? -11.009 7.373   -25.119 1.00 0.00  ? 15  ILE A HG21   2  
ATOM   2703  H HG22   . ILE A 1 15  ? -10.185 7.118   -26.659 1.00 0.00  ? 15  ILE A HG22   2  
ATOM   2704  H HG23   . ILE A 1 15  ? -9.531  8.266   -25.488 1.00 0.00  ? 15  ILE A HG23   2  
ATOM   2705  H HD11   . ILE A 1 15  ? -8.618  4.865   -27.021 1.00 0.00  ? 15  ILE A HD11   2  
ATOM   2706  H HD12   . ILE A 1 15  ? -6.857  4.819   -26.886 1.00 0.00  ? 15  ILE A HD12   2  
ATOM   2707  H HD13   . ILE A 1 15  ? -7.646  6.176   -27.690 1.00 0.00  ? 15  ILE A HD13   2  
ATOM   2708  N N      . PHE A 1 16  ? -11.047 7.609   -22.720 1.00 0.00  ? 16  PHE A N      2  
ATOM   2709  C CA     . PHE A 1 16  ? -12.357 7.807   -22.131 1.00 0.00  ? 16  PHE A CA     2  
ATOM   2710  C C      . PHE A 1 16  ? -13.040 9.037   -22.726 1.00 0.00  ? 16  PHE A C      2  
ATOM   2711  O O      . PHE A 1 16  ? -12.493 10.135  -22.686 1.00 0.00  ? 16  PHE A O      2  
ATOM   2712  C CB     . PHE A 1 16  ? -12.208 7.971   -20.615 1.00 0.00  ? 16  PHE A CB     2  
ATOM   2713  C CG     . PHE A 1 16  ? -11.606 9.287   -20.201 1.00 0.00  ? 16  PHE A CG     2  
ATOM   2714  C CD1    . PHE A 1 16  ? -12.397 10.417  -20.067 1.00 0.00  ? 16  PHE A CD1    2  
ATOM   2715  C CD2    . PHE A 1 16  ? -10.248 9.392   -19.948 1.00 0.00  ? 16  PHE A CD2    2  
ATOM   2716  C CE1    . PHE A 1 16  ? -11.845 11.627  -19.691 1.00 0.00  ? 16  PHE A CE1    2  
ATOM   2717  C CE2    . PHE A 1 16  ? -9.689  10.600  -19.570 1.00 0.00  ? 16  PHE A CE2    2  
ATOM   2718  C CZ     . PHE A 1 16  ? -10.489 11.718  -19.444 1.00 0.00  ? 16  PHE A CZ     2  
ATOM   2719  H H      . PHE A 1 16  ? -10.537 8.389   -23.012 1.00 0.00  ? 16  PHE A H      2  
ATOM   2720  H HA     . PHE A 1 16  ? -12.951 6.934   -22.336 1.00 0.00  ? 16  PHE A HA     2  
ATOM   2721  H HB2    . PHE A 1 16  ? -13.176 7.888   -20.158 1.00 0.00  ? 16  PHE A HB2    2  
ATOM   2722  H HB3    . PHE A 1 16  ? -11.572 7.185   -20.240 1.00 0.00  ? 16  PHE A HB3    2  
ATOM   2723  H HD1    . PHE A 1 16  ? -13.458 10.348  -20.260 1.00 0.00  ? 16  PHE A HD1    2  
ATOM   2724  H HD2    . PHE A 1 16  ? -9.621  8.520   -20.049 1.00 0.00  ? 16  PHE A HD2    2  
ATOM   2725  H HE1    . PHE A 1 16  ? -12.472 12.500  -19.592 1.00 0.00  ? 16  PHE A HE1    2  
ATOM   2726  H HE2    . PHE A 1 16  ? -8.629  10.668  -19.374 1.00 0.00  ? 16  PHE A HE2    2  
ATOM   2727  H HZ     . PHE A 1 16  ? -10.055 12.663  -19.150 1.00 0.00  ? 16  PHE A HZ     2  
ATOM   2728  N N      . ARG A 1 17  ? -14.234 8.857   -23.272 1.00 0.00  ? 17  ARG A N      2  
ATOM   2729  C CA     . ARG A 1 17  ? -14.963 9.976   -23.855 1.00 0.00  ? 17  ARG A CA     2  
ATOM   2730  C C      . ARG A 1 17  ? -15.793 10.689  -22.793 1.00 0.00  ? 17  ARG A C      2  
ATOM   2731  O O      . ARG A 1 17  ? -16.741 10.126  -22.248 1.00 0.00  ? 17  ARG A O      2  
ATOM   2732  C CB     . ARG A 1 17  ? -15.864 9.499   -24.991 1.00 0.00  ? 17  ARG A CB     2  
ATOM   2733  C CG     . ARG A 1 17  ? -15.992 10.511  -26.119 1.00 0.00  ? 17  ARG A CG     2  
ATOM   2734  C CD     . ARG A 1 17  ? -16.728 11.761  -25.665 1.00 0.00  ? 17  ARG A CD     2  
ATOM   2735  N NE     . ARG A 1 17  ? -17.214 12.553  -26.794 1.00 0.00  ? 17  ARG A NE     2  
ATOM   2736  C CZ     . ARG A 1 17  ? -18.010 13.613  -26.669 1.00 0.00  ? 17  ARG A CZ     2  
ATOM   2737  N NH1    . ARG A 1 17  ? -18.410 14.013  -25.467 1.00 0.00  ? 17  ARG A NH1    2  
ATOM   2738  N NH2    . ARG A 1 17  ? -18.407 14.277  -27.745 1.00 0.00  ? 17  ARG A NH2    2  
ATOM   2739  H H      . ARG A 1 17  ? -14.633 7.963   -23.280 1.00 0.00  ? 17  ARG A H      2  
ATOM   2740  H HA     . ARG A 1 17  ? -14.236 10.669  -24.252 1.00 0.00  ? 17  ARG A HA     2  
ATOM   2741  H HB2    . ARG A 1 17  ? -15.458 8.586   -25.399 1.00 0.00  ? 17  ARG A HB2    2  
ATOM   2742  H HB3    . ARG A 1 17  ? -16.850 9.304   -24.599 1.00 0.00  ? 17  ARG A HB3    2  
ATOM   2743  H HG2    . ARG A 1 17  ? -15.003 10.789  -26.453 1.00 0.00  ? 17  ARG A HG2    2  
ATOM   2744  H HG3    . ARG A 1 17  ? -16.534 10.057  -26.929 1.00 0.00  ? 17  ARG A HG3    2  
ATOM   2745  H HD2    . ARG A 1 17  ? -17.569 11.467  -25.056 1.00 0.00  ? 17  ARG A HD2    2  
ATOM   2746  H HD3    . ARG A 1 17  ? -16.054 12.366  -25.077 1.00 0.00  ? 17  ARG A HD3    2  
ATOM   2747  H HE     . ARG A 1 17  ? -16.933 12.280  -27.692 1.00 0.00  ? 17  ARG A HE     2  
ATOM   2748  H HH11   . ARG A 1 17  ? -18.114 13.517  -24.650 1.00 0.00  ? 17  ARG A HH11   2  
ATOM   2749  H HH12   . ARG A 1 17  ? -19.008 14.809  -25.380 1.00 0.00  ? 17  ARG A HH12   2  
ATOM   2750  H HH21   . ARG A 1 17  ? -18.106 13.982  -28.654 1.00 0.00  ? 17  ARG A HH21   2  
ATOM   2751  H HH22   . ARG A 1 17  ? -19.005 15.073  -27.651 1.00 0.00  ? 17  ARG A HH22   2  
ATOM   2752  N N      . ARG A 1 18  ? -15.421 11.932  -22.501 1.00 0.00  ? 18  ARG A N      2  
ATOM   2753  C CA     . ARG A 1 18  ? -16.124 12.726  -21.499 1.00 0.00  ? 18  ARG A CA     2  
ATOM   2754  C C      . ARG A 1 18  ? -17.311 13.461  -22.108 1.00 0.00  ? 18  ARG A C      2  
ATOM   2755  O O      . ARG A 1 18  ? -17.141 14.359  -22.933 1.00 0.00  ? 18  ARG A O      2  
ATOM   2756  C CB     . ARG A 1 18  ? -15.167 13.730  -20.854 1.00 0.00  ? 18  ARG A CB     2  
ATOM   2757  C CG     . ARG A 1 18  ? -15.806 14.549  -19.743 1.00 0.00  ? 18  ARG A CG     2  
ATOM   2758  C CD     . ARG A 1 18  ? -14.907 14.631  -18.521 1.00 0.00  ? 18  ARG A CD     2  
ATOM   2759  N NE     . ARG A 1 18  ? -13.587 15.170  -18.848 1.00 0.00  ? 18  ARG A NE     2  
ATOM   2760  C CZ     . ARG A 1 18  ? -13.148 16.367  -18.462 1.00 0.00  ? 18  ARG A CZ     2  
ATOM   2761  N NH1    . ARG A 1 18  ? -13.918 17.172  -17.736 1.00 0.00  ? 18  ARG A NH1    2  
ATOM   2762  N NH2    . ARG A 1 18  ? -11.932 16.765  -18.809 1.00 0.00  ? 18  ARG A NH2    2  
ATOM   2763  H H      . ARG A 1 18  ? -14.654 12.323  -22.968 1.00 0.00  ? 18  ARG A H      2  
ATOM   2764  H HA     . ARG A 1 18  ? -16.486 12.051  -20.738 1.00 0.00  ? 18  ARG A HA     2  
ATOM   2765  H HB2    . ARG A 1 18  ? -14.325 13.193  -20.440 1.00 0.00  ? 18  ARG A HB2    2  
ATOM   2766  H HB3    . ARG A 1 18  ? -14.810 14.409  -21.613 1.00 0.00  ? 18  ARG A HB3    2  
ATOM   2767  H HG2    . ARG A 1 18  ? -15.993 15.547  -20.109 1.00 0.00  ? 18  ARG A HG2    2  
ATOM   2768  H HG3    . ARG A 1 18  ? -16.739 14.086  -19.462 1.00 0.00  ? 18  ARG A HG3    2  
ATOM   2769  H HD2    . ARG A 1 18  ? -15.376 15.266  -17.787 1.00 0.00  ? 18  ARG A HD2    2  
ATOM   2770  H HD3    . ARG A 1 18  ? -14.787 13.639  -18.112 1.00 0.00  ? 18  ARG A HD3    2  
ATOM   2771  H HE     . ARG A 1 18  ? -12.992 14.606  -19.388 1.00 0.00  ? 18  ARG A HE     2  
ATOM   2772  H HH11   . ARG A 1 18  ? -14.837 16.885  -17.475 1.00 0.00  ? 18  ARG A HH11   2  
ATOM   2773  H HH12   . ARG A 1 18  ? -13.576 18.067  -17.453 1.00 0.00  ? 18  ARG A HH12   2  
ATOM   2774  H HH21   . ARG A 1 18  ? -11.348 16.167  -19.358 1.00 0.00  ? 18  ARG A HH21   2  
ATOM   2775  H HH22   . ARG A 1 18  ? -11.599 17.662  -18.521 1.00 0.00  ? 18  ARG A HH22   2  
ATOM   2776  N N      . CYS A 1 19  ? -18.516 13.078  -21.696 1.00 0.00  ? 19  CYS A N      2  
ATOM   2777  C CA     . CYS A 1 19  ? -19.730 13.708  -22.199 1.00 0.00  ? 19  CYS A CA     2  
ATOM   2778  C C      . CYS A 1 19  ? -19.882 15.115  -21.628 1.00 0.00  ? 19  CYS A C      2  
ATOM   2779  O O      . CYS A 1 19  ? -19.281 15.447  -20.608 1.00 0.00  ? 19  CYS A O      2  
ATOM   2780  C CB     . CYS A 1 19  ? -20.954 12.863  -21.843 1.00 0.00  ? 19  CYS A CB     2  
ATOM   2781  S SG     . CYS A 1 19  ? -20.924 11.191  -22.530 1.00 0.00  ? 19  CYS A SG     2  
ATOM   2782  H H      . CYS A 1 19  ? -18.588 12.359  -21.034 1.00 0.00  ? 19  CYS A H      2  
ATOM   2783  H HA     . CYS A 1 19  ? -19.649 13.774  -23.273 1.00 0.00  ? 19  CYS A HA     2  
ATOM   2784  H HB2    . CYS A 1 19  ? -21.023 12.775  -20.769 1.00 0.00  ? 19  CYS A HB2    2  
ATOM   2785  H HB3    . CYS A 1 19  ? -21.842 13.355  -22.216 1.00 0.00  ? 19  CYS A HB3    2  
ATOM   2786  H HG     . CYS A 1 19  ? -20.586 11.244  -23.426 1.00 0.00  ? 19  CYS A HG     2  
ATOM   2787  N N      . LEU A 1 20  ? -20.686 15.939  -22.294 1.00 0.00  ? 20  LEU A N      2  
ATOM   2788  C CA     . LEU A 1 20  ? -20.907 17.311  -21.850 1.00 0.00  ? 20  LEU A CA     2  
ATOM   2789  C C      . LEU A 1 20  ? -21.502 17.338  -20.442 1.00 0.00  ? 20  LEU A C      2  
ATOM   2790  O O      . LEU A 1 20  ? -20.779 17.506  -19.459 1.00 0.00  ? 20  LEU A O      2  
ATOM   2791  C CB     . LEU A 1 20  ? -21.821 18.050  -22.831 1.00 0.00  ? 20  LEU A CB     2  
ATOM   2792  C CG     . LEU A 1 20  ? -22.132 19.503  -22.458 1.00 0.00  ? 20  LEU A CG     2  
ATOM   2793  C CD1    . LEU A 1 20  ? -21.173 20.450  -23.160 1.00 0.00  ? 20  LEU A CD1    2  
ATOM   2794  C CD2    . LEU A 1 20  ? -23.574 19.845  -22.808 1.00 0.00  ? 20  LEU A CD2    2  
ATOM   2795  H H      . LEU A 1 20  ? -21.137 15.620  -23.104 1.00 0.00  ? 20  LEU A H      2  
ATOM   2796  H HA     . LEU A 1 20  ? -19.947 17.806  -21.827 1.00 0.00  ? 20  LEU A HA     2  
ATOM   2797  H HB2    . LEU A 1 20  ? -21.349 18.044  -23.802 1.00 0.00  ? 20  LEU A HB2    2  
ATOM   2798  H HB3    . LEU A 1 20  ? -22.753 17.511  -22.900 1.00 0.00  ? 20  LEU A HB3    2  
ATOM   2799  H HG     . LEU A 1 20  ? -22.006 19.629  -21.392 1.00 0.00  ? 20  LEU A HG     2  
ATOM   2800  H HD11   . LEU A 1 20  ? -20.255 20.520  -22.592 1.00 0.00  ? 20  LEU A HD11   2  
ATOM   2801  H HD12   . LEU A 1 20  ? -21.624 21.428  -23.239 1.00 0.00  ? 20  LEU A HD12   2  
ATOM   2802  H HD13   . LEU A 1 20  ? -20.954 20.074  -24.150 1.00 0.00  ? 20  LEU A HD13   2  
ATOM   2803  H HD21   . LEU A 1 20  ? -23.915 20.652  -22.174 1.00 0.00  ? 20  LEU A HD21   2  
ATOM   2804  H HD22   . LEU A 1 20  ? -24.197 18.978  -22.655 1.00 0.00  ? 20  LEU A HD22   2  
ATOM   2805  H HD23   . LEU A 1 20  ? -23.630 20.153  -23.841 1.00 0.00  ? 20  LEU A HD23   2  
ATOM   2806  N N      . ILE A 1 21  ? -22.817 17.164  -20.346 1.00 0.00  ? 21  ILE A N      2  
ATOM   2807  C CA     . ILE A 1 21  ? -23.493 17.161  -19.052 1.00 0.00  ? 21  ILE A CA     2  
ATOM   2808  C C      . ILE A 1 21  ? -24.090 15.788  -18.747 1.00 0.00  ? 21  ILE A C      2  
ATOM   2809  O O      . ILE A 1 21  ? -24.488 15.062  -19.655 1.00 0.00  ? 21  ILE A O      2  
ATOM   2810  C CB     . ILE A 1 21  ? -24.599 18.234  -18.968 1.00 0.00  ? 21  ILE A CB     2  
ATOM   2811  C CG1    . ILE A 1 21  ? -25.461 18.245  -20.235 1.00 0.00  ? 21  ILE A CG1    2  
ATOM   2812  C CG2    . ILE A 1 21  ? -23.983 19.607  -18.735 1.00 0.00  ? 21  ILE A CG2    2  
ATOM   2813  C CD1    . ILE A 1 21  ? -26.670 17.342  -20.150 1.00 0.00  ? 21  ILE A CD1    2  
ATOM   2814  H H      . ILE A 1 21  ? -23.341 17.025  -21.160 1.00 0.00  ? 21  ILE A H      2  
ATOM   2815  H HA     . ILE A 1 21  ? -22.751 17.388  -18.301 1.00 0.00  ? 21  ILE A HA     2  
ATOM   2816  H HB     . ILE A 1 21  ? -25.226 18.004  -18.119 1.00 0.00  ? 21  ILE A HB     2  
ATOM   2817  H HG12   . ILE A 1 21  ? -25.812 19.250  -20.414 1.00 0.00  ? 21  ILE A HG12   2  
ATOM   2818  H HG13   . ILE A 1 21  ? -24.865 17.925  -21.076 1.00 0.00  ? 21  ILE A HG13   2  
ATOM   2819  H HG21   . ILE A 1 21  ? -23.589 19.657  -17.731 1.00 0.00  ? 21  ILE A HG21   2  
ATOM   2820  H HG22   . ILE A 1 21  ? -24.739 20.369  -18.864 1.00 0.00  ? 21  ILE A HG22   2  
ATOM   2821  H HG23   . ILE A 1 21  ? -23.186 19.768  -19.444 1.00 0.00  ? 21  ILE A HG23   2  
ATOM   2822  H HD11   . ILE A 1 21  ? -27.422 17.804  -19.527 1.00 0.00  ? 21  ILE A HD11   2  
ATOM   2823  H HD12   . ILE A 1 21  ? -26.381 16.393  -19.723 1.00 0.00  ? 21  ILE A HD12   2  
ATOM   2824  H HD13   . ILE A 1 21  ? -27.072 17.185  -21.141 1.00 0.00  ? 21  ILE A HD13   2  
ATOM   2825  N N      . PRO A 1 22  ? -24.150 15.410  -17.456 1.00 0.00  ? 22  PRO A N      2  
ATOM   2826  C CA     . PRO A 1 22  ? -24.689 14.113  -17.031 1.00 0.00  ? 22  PRO A CA     2  
ATOM   2827  C C      . PRO A 1 22  ? -26.205 14.027  -17.171 1.00 0.00  ? 22  PRO A C      2  
ATOM   2828  O O      . PRO A 1 22  ? -26.897 15.044  -17.210 1.00 0.00  ? 22  PRO A O      2  
ATOM   2829  C CB     . PRO A 1 22  ? -24.291 14.014  -15.549 1.00 0.00  ? 22  PRO A CB     2  
ATOM   2830  C CG     . PRO A 1 22  ? -23.349 15.146  -15.301 1.00 0.00  ? 22  PRO A CG     2  
ATOM   2831  C CD     . PRO A 1 22  ? -23.691 16.203  -16.309 1.00 0.00  ? 22  PRO A CD     2  
ATOM   2832  H HA     . PRO A 1 22  ? -24.234 13.301  -17.581 1.00 0.00  ? 22  PRO A HA     2  
ATOM   2833  H HB2    . PRO A 1 22  ? -25.173 14.098  -14.934 1.00 0.00  ? 22  PRO A HB2    2  
ATOM   2834  H HB3    . PRO A 1 22  ? -23.814 13.061  -15.369 1.00 0.00  ? 22  PRO A HB3    2  
ATOM   2835  H HG2    . PRO A 1 22  ? -23.487 15.526  -14.299 1.00 0.00  ? 22  PRO A HG2    2  
ATOM   2836  H HG3    . PRO A 1 22  ? -22.330 14.814  -15.440 1.00 0.00  ? 22  PRO A HG3    2  
ATOM   2837  H HD2    . PRO A 1 22  ? -24.480 16.840  -15.936 1.00 0.00  ? 22  PRO A HD2    2  
ATOM   2838  H HD3    . PRO A 1 22  ? -22.818 16.783  -16.562 1.00 0.00  ? 22  PRO A HD3    2  
ATOM   2839  N N      . LYS A 1 23  ? -26.713 12.800  -17.234 1.00 0.00  ? 23  LYS A N      2  
ATOM   2840  C CA     . LYS A 1 23  ? -28.148 12.565  -17.355 1.00 0.00  ? 23  LYS A CA     2  
ATOM   2841  C C      . LYS A 1 23  ? -28.700 11.954  -16.071 1.00 0.00  ? 23  LYS A C      2  
ATOM   2842  O O      . LYS A 1 23  ? -29.304 12.647  -15.251 1.00 0.00  ? 23  LYS A O      2  
ATOM   2843  C CB     . LYS A 1 23  ? -28.436 11.639  -18.543 1.00 0.00  ? 23  LYS A CB     2  
ATOM   2844  C CG     . LYS A 1 23  ? -29.065 12.349  -19.730 1.00 0.00  ? 23  LYS A CG     2  
ATOM   2845  C CD     . LYS A 1 23  ? -28.234 13.545  -20.172 1.00 0.00  ? 23  LYS A CD     2  
ATOM   2846  C CE     . LYS A 1 23  ? -29.038 14.834  -20.116 1.00 0.00  ? 23  LYS A CE     2  
ATOM   2847  N NZ     . LYS A 1 23  ? -29.514 15.252  -21.465 1.00 0.00  ? 23  LYS A NZ     2  
ATOM   2848  H H      . LYS A 1 23  ? -26.108 12.030  -17.187 1.00 0.00  ? 23  LYS A H      2  
ATOM   2849  H HA     . LYS A 1 23  ? -28.628 13.516  -17.526 1.00 0.00  ? 23  LYS A HA     2  
ATOM   2850  H HB2    . LYS A 1 23  ? -27.509 11.192  -18.867 1.00 0.00  ? 23  LYS A HB2    2  
ATOM   2851  H HB3    . LYS A 1 23  ? -29.110 10.857  -18.220 1.00 0.00  ? 23  LYS A HB3    2  
ATOM   2852  H HG2    . LYS A 1 23  ? -29.141 11.655  -20.552 1.00 0.00  ? 23  LYS A HG2    2  
ATOM   2853  H HG3    . LYS A 1 23  ? -30.052 12.689  -19.452 1.00 0.00  ? 23  LYS A HG3    2  
ATOM   2854  H HD2    . LYS A 1 23  ? -27.379 13.638  -19.520 1.00 0.00  ? 23  LYS A HD2    2  
ATOM   2855  H HD3    . LYS A 1 23  ? -27.899 13.382  -21.186 1.00 0.00  ? 23  LYS A HD3    2  
ATOM   2856  H HE2    . LYS A 1 23  ? -29.893 14.684  -19.474 1.00 0.00  ? 23  LYS A HE2    2  
ATOM   2857  H HE3    . LYS A 1 23  ? -28.413 15.615  -19.704 1.00 0.00  ? 23  LYS A HE3    2  
ATOM   2858  H HZ1    . LYS A 1 23  ? -28.950 16.055  -21.808 1.00 0.00  ? 23  LYS A HZ1    2  
ATOM   2859  H HZ2    . LYS A 1 23  ? -30.512 15.539  -21.418 1.00 0.00  ? 23  LYS A HZ2    2  
ATOM   2860  H HZ3    . LYS A 1 23  ? -29.423 14.463  -22.137 1.00 0.00  ? 23  LYS A HZ3    2  
ATOM   2861  N N      . VAL A 1 24  ? -28.483 10.656  -15.903 1.00 0.00  ? 24  VAL A N      2  
ATOM   2862  C CA     . VAL A 1 24  ? -28.947 9.946   -14.718 1.00 0.00  ? 24  VAL A CA     2  
ATOM   2863  C C      . VAL A 1 24  ? -27.912 10.001  -13.594 1.00 0.00  ? 24  VAL A C      2  
ATOM   2864  O O      . VAL A 1 24  ? -28.099 9.398   -12.538 1.00 0.00  ? 24  VAL A O      2  
ATOM   2865  C CB     . VAL A 1 24  ? -29.261 8.469   -15.032 1.00 0.00  ? 24  VAL A CB     2  
ATOM   2866  C CG1    . VAL A 1 24  ? -29.953 7.808   -13.850 1.00 0.00  ? 24  VAL A CG1    2  
ATOM   2867  C CG2    . VAL A 1 24  ? -30.113 8.356   -16.289 1.00 0.00  ? 24  VAL A CG2    2  
ATOM   2868  H H      . VAL A 1 24  ? -27.991 10.163  -16.592 1.00 0.00  ? 24  VAL A H      2  
ATOM   2869  H HA     . VAL A 1 24  ? -29.858 10.422  -14.379 1.00 0.00  ? 24  VAL A HA     2  
ATOM   2870  H HB     . VAL A 1 24  ? -28.328 7.954   -15.207 1.00 0.00  ? 24  VAL A HB     2  
ATOM   2871  H HG11   . VAL A 1 24  ? -30.454 8.559   -13.258 1.00 0.00  ? 24  VAL A HG11   2  
ATOM   2872  H HG12   . VAL A 1 24  ? -29.220 7.301   -13.242 1.00 0.00  ? 24  VAL A HG12   2  
ATOM   2873  H HG13   . VAL A 1 24  ? -30.677 7.092   -14.210 1.00 0.00  ? 24  VAL A HG13   2  
ATOM   2874  H HG21   . VAL A 1 24  ? -29.727 7.564   -16.913 1.00 0.00  ? 24  VAL A HG21   2  
ATOM   2875  H HG22   . VAL A 1 24  ? -30.083 9.289   -16.833 1.00 0.00  ? 24  VAL A HG22   2  
ATOM   2876  H HG23   . VAL A 1 24  ? -31.132 8.132   -16.015 1.00 0.00  ? 24  VAL A HG23   2  
ATOM   2877  N N      . ASP A 1 25  ? -26.819 10.726  -13.830 1.00 0.00  ? 25  ASP A N      2  
ATOM   2878  C CA     . ASP A 1 25  ? -25.753 10.859  -12.842 1.00 0.00  ? 25  ASP A CA     2  
ATOM   2879  C C      . ASP A 1 25  ? -25.084 9.514   -12.565 1.00 0.00  ? 25  ASP A C      2  
ATOM   2880  O O      . ASP A 1 25  ? -24.422 9.341   -11.543 1.00 0.00  ? 25  ASP A O      2  
ATOM   2881  C CB     . ASP A 1 25  ? -26.303 11.445  -11.539 1.00 0.00  ? 25  ASP A CB     2  
ATOM   2882  C CG     . ASP A 1 25  ? -26.775 12.876  -11.706 1.00 0.00  ? 25  ASP A CG     2  
ATOM   2883  O OD1    . ASP A 1 25  ? -25.954 13.798  -11.516 1.00 0.00  ? 25  ASP A OD1    2  
ATOM   2884  O OD2    . ASP A 1 25  ? -27.964 13.074  -12.026 1.00 0.00  ? 25  ASP A OD2    2  
ATOM   2885  H H      . ASP A 1 25  ? -26.724 11.182  -14.693 1.00 0.00  ? 25  ASP A H      2  
ATOM   2886  H HA     . ASP A 1 25  ? -25.015 11.534  -13.244 1.00 0.00  ? 25  ASP A HA     2  
ATOM   2887  H HB2    . ASP A 1 25  ? -27.135 10.847  -11.202 1.00 0.00  ? 25  ASP A HB2    2  
ATOM   2888  H HB3    . ASP A 1 25  ? -25.525 11.426  -10.789 1.00 0.00  ? 25  ASP A HB3    2  
ATOM   2889  H HD2    . ASP A 1 25  ? -28.195 14.001  -12.115 1.00 0.00  ? 25  ASP A HD2    2  
ATOM   2890  N N      . ASN A 1 26  ? -25.254 8.566   -13.483 1.00 0.00  ? 26  ASN A N      2  
ATOM   2891  C CA     . ASN A 1 26  ? -24.657 7.243   -13.333 1.00 0.00  ? 26  ASN A CA     2  
ATOM   2892  C C      . ASN A 1 26  ? -23.546 7.032   -14.354 1.00 0.00  ? 26  ASN A C      2  
ATOM   2893  O O      . ASN A 1 26  ? -22.365 7.022   -14.009 1.00 0.00  ? 26  ASN A O      2  
ATOM   2894  C CB     . ASN A 1 26  ? -25.725 6.155   -13.479 1.00 0.00  ? 26  ASN A CB     2  
ATOM   2895  C CG     . ASN A 1 26  ? -25.282 4.829   -12.893 1.00 0.00  ? 26  ASN A CG     2  
ATOM   2896  O OD1    . ASN A 1 26  ? -24.088 4.556   -12.776 1.00 0.00  ? 26  ASN A OD1    2  
ATOM   2897  N ND2    . ASN A 1 26  ? -26.248 3.994   -12.522 1.00 0.00  ? 26  ASN A ND2    2  
ATOM   2898  H H      . ASN A 1 26  ? -25.787 8.760   -14.283 1.00 0.00  ? 26  ASN A H      2  
ATOM   2899  H HA     . ASN A 1 26  ? -24.232 7.183   -12.345 1.00 0.00  ? 26  ASN A HA     2  
ATOM   2900  H HB2    . ASN A 1 26  ? -26.622 6.471   -12.968 1.00 0.00  ? 26  ASN A HB2    2  
ATOM   2901  H HB3    . ASN A 1 26  ? -25.945 6.010   -14.526 1.00 0.00  ? 26  ASN A HB3    2  
ATOM   2902  H HD21   . ASN A 1 26  ? -27.178 4.278   -12.647 1.00 0.00  ? 26  ASN A HD21   2  
ATOM   2903  H HD22   . ASN A 1 26  ? -25.989 3.132   -12.134 1.00 0.00  ? 26  ASN A HD22   2  
ATOM   2904  N N      . ASN A 1 27  ? -23.932 6.874   -15.613 1.00 0.00  ? 27  ASN A N      2  
ATOM   2905  C CA     . ASN A 1 27  ? -22.970 6.674   -16.689 1.00 0.00  ? 27  ASN A CA     2  
ATOM   2906  C C      . ASN A 1 27  ? -22.655 8.000   -17.375 1.00 0.00  ? 27  ASN A C      2  
ATOM   2907  O O      . ASN A 1 27  ? -23.543 8.642   -17.941 1.00 0.00  ? 27  ASN A O      2  
ATOM   2908  C CB     . ASN A 1 27  ? -23.509 5.672   -17.711 1.00 0.00  ? 27  ASN A CB     2  
ATOM   2909  C CG     . ASN A 1 27  ? -24.860 6.079   -18.267 1.00 0.00  ? 27  ASN A CG     2  
ATOM   2910  O OD1    . ASN A 1 27  ? -24.943 6.755   -19.291 1.00 0.00  ? 27  ASN A OD1    2  
ATOM   2911  N ND2    . ASN A 1 27  ? -25.926 5.672   -17.588 1.00 0.00  ? 27  ASN A ND2    2  
ATOM   2912  H H      . ASN A 1 27  ? -24.887 6.902   -15.823 1.00 0.00  ? 27  ASN A H      2  
ATOM   2913  H HA     . ASN A 1 27  ? -22.063 6.283   -16.256 1.00 0.00  ? 27  ASN A HA     2  
ATOM   2914  H HB2    . ASN A 1 27  ? -22.814 5.593   -18.533 1.00 0.00  ? 27  ASN A HB2    2  
ATOM   2915  H HB3    . ASN A 1 27  ? -23.612 4.706   -17.237 1.00 0.00  ? 27  ASN A HB3    2  
ATOM   2916  H HD21   . ASN A 1 27  ? -25.783 5.139   -16.779 1.00 0.00  ? 27  ASN A HD21   2  
ATOM   2917  H HD22   . ASN A 1 27  ? -26.812 5.924   -17.923 1.00 0.00  ? 27  ASN A HD22   2  
ATOM   2918  N N      . ALA A 1 28  ? -21.394 8.409   -17.317 1.00 0.00  ? 28  ALA A N      2  
ATOM   2919  C CA     . ALA A 1 28  ? -20.972 9.663   -17.926 1.00 0.00  ? 28  ALA A CA     2  
ATOM   2920  C C      . ALA A 1 28  ? -19.779 9.459   -18.852 1.00 0.00  ? 28  ALA A C      2  
ATOM   2921  O O      . ALA A 1 28  ? -19.769 9.938   -19.984 1.00 0.00  ? 28  ALA A O      2  
ATOM   2922  C CB     . ALA A 1 28  ? -20.634 10.681  -16.847 1.00 0.00  ? 28  ALA A CB     2  
ATOM   2923  H H      . ALA A 1 28  ? -20.734 7.858   -16.847 1.00 0.00  ? 28  ALA A H      2  
ATOM   2924  H HA     . ALA A 1 28  ? -21.800 10.049  -18.503 1.00 0.00  ? 28  ALA A HA     2  
ATOM   2925  H HB1    . ALA A 1 28  ? -21.275 11.543  -16.952 1.00 0.00  ? 28  ALA A HB1    2  
ATOM   2926  H HB2    . ALA A 1 28  ? -19.601 10.985  -16.949 1.00 0.00  ? 28  ALA A HB2    2  
ATOM   2927  H HB3    . ALA A 1 28  ? -20.783 10.237  -15.874 1.00 0.00  ? 28  ALA A HB3    2  
ATOM   2928  N N      . ILE A 1 29  ? -18.769 8.753   -18.357 1.00 0.00  ? 29  ILE A N      2  
ATOM   2929  C CA     . ILE A 1 29  ? -17.568 8.498   -19.137 1.00 0.00  ? 29  ILE A CA     2  
ATOM   2930  C C      . ILE A 1 29  ? -17.569 7.090   -19.727 1.00 0.00  ? 29  ILE A C      2  
ATOM   2931  O O      . ILE A 1 29  ? -18.105 6.153   -19.136 1.00 0.00  ? 29  ILE A O      2  
ATOM   2932  C CB     . ILE A 1 29  ? -16.297 8.691   -18.281 1.00 0.00  ? 29  ILE A CB     2  
ATOM   2933  C CG1    . ILE A 1 29  ? -16.209 10.133  -17.779 1.00 0.00  ? 29  ILE A CG1    2  
ATOM   2934  C CG2    . ILE A 1 29  ? -15.055 8.333   -19.076 1.00 0.00  ? 29  ILE A CG2    2  
ATOM   2935  C CD1    . ILE A 1 29  ? -15.685 10.250  -16.364 1.00 0.00  ? 29  ILE A CD1    2  
ATOM   2936  H H      . ILE A 1 29  ? -18.831 8.403   -17.443 1.00 0.00  ? 29  ILE A H      2  
ATOM   2937  H HA     . ILE A 1 29  ? -17.540 9.214   -19.945 1.00 0.00  ? 29  ILE A HA     2  
ATOM   2938  H HB     . ILE A 1 29  ? -16.355 8.025   -17.433 1.00 0.00  ? 29  ILE A HB     2  
ATOM   2939  H HG12   . ILE A 1 29  ? -15.547 10.691  -18.424 1.00 0.00  ? 29  ILE A HG12   2  
ATOM   2940  H HG13   . ILE A 1 29  ? -17.192 10.576  -17.810 1.00 0.00  ? 29  ILE A HG13   2  
ATOM   2941  H HG21   . ILE A 1 29  ? -15.084 7.286   -19.339 1.00 0.00  ? 29  ILE A HG21   2  
ATOM   2942  H HG22   . ILE A 1 29  ? -14.175 8.533   -18.481 1.00 0.00  ? 29  ILE A HG22   2  
ATOM   2943  H HG23   . ILE A 1 29  ? -15.022 8.928   -19.977 1.00 0.00  ? 29  ILE A HG23   2  
ATOM   2944  H HD11   . ILE A 1 29  ? -16.509 10.424  -15.688 1.00 0.00  ? 29  ILE A HD11   2  
ATOM   2945  H HD12   . ILE A 1 29  ? -14.989 11.074  -16.305 1.00 0.00  ? 29  ILE A HD12   2  
ATOM   2946  H HD13   . ILE A 1 29  ? -15.181 9.335   -16.090 1.00 0.00  ? 29  ILE A HD13   2  
ATOM   2947  N N      . GLU A 1 30  ? -16.952 6.959   -20.896 1.00 0.00  ? 30  GLU A N      2  
ATOM   2948  C CA     . GLU A 1 30  ? -16.855 5.675   -21.584 1.00 0.00  ? 30  GLU A CA     2  
ATOM   2949  C C      . GLU A 1 30  ? -15.436 5.472   -22.095 1.00 0.00  ? 30  GLU A C      2  
ATOM   2950  O O      . GLU A 1 30  ? -14.842 6.387   -22.661 1.00 0.00  ? 30  GLU A O      2  
ATOM   2951  C CB     . GLU A 1 30  ? -17.844 5.614   -22.748 1.00 0.00  ? 30  GLU A CB     2  
ATOM   2952  C CG     . GLU A 1 30  ? -19.290 5.444   -22.311 1.00 0.00  ? 30  GLU A CG     2  
ATOM   2953  C CD     . GLU A 1 30  ? -19.967 6.768   -22.012 1.00 0.00  ? 30  GLU A CD     2  
ATOM   2954  O OE1    . GLU A 1 30  ? -20.752 6.828   -21.043 1.00 0.00  ? 30  GLU A OE1    2  
ATOM   2955  O OE2    . GLU A 1 30  ? -19.711 7.745   -22.748 1.00 0.00  ? 30  GLU A OE2    2  
ATOM   2956  H H      . GLU A 1 30  ? -16.539 7.750   -21.303 1.00 0.00  ? 30  GLU A H      2  
ATOM   2957  H HA     . GLU A 1 30  ? -17.089 4.897   -20.873 1.00 0.00  ? 30  GLU A HA     2  
ATOM   2958  H HB2    . GLU A 1 30  ? -17.768 6.528   -23.319 1.00 0.00  ? 30  GLU A HB2    2  
ATOM   2959  H HB3    . GLU A 1 30  ? -17.583 4.781   -23.384 1.00 0.00  ? 30  GLU A HB3    2  
ATOM   2960  H HG2    . GLU A 1 30  ? -19.835 4.951   -23.102 1.00 0.00  ? 30  GLU A HG2    2  
ATOM   2961  H HG3    . GLU A 1 30  ? -19.314 4.835   -21.421 1.00 0.00  ? 30  GLU A HG3    2  
ATOM   2962  H HE2    . GLU A 1 30  ? -20.174 8.549   -22.501 1.00 0.00  ? 30  GLU A HE2    2  
ATOM   2963  N N      . PHE A 1 31  ? -14.887 4.280   -21.878 1.00 0.00  ? 31  PHE A N      2  
ATOM   2964  C CA     . PHE A 1 31  ? -13.523 3.984   -22.304 1.00 0.00  ? 31  PHE A CA     2  
ATOM   2965  C C      . PHE A 1 31  ? -13.480 3.274   -23.653 1.00 0.00  ? 31  PHE A C      2  
ATOM   2966  O O      . PHE A 1 31  ? -14.393 2.525   -24.000 1.00 0.00  ? 31  PHE A O      2  
ATOM   2967  C CB     . PHE A 1 31  ? -12.823 3.130   -21.245 1.00 0.00  ? 31  PHE A CB     2  
ATOM   2968  C CG     . PHE A 1 31  ? -12.866 3.727   -19.866 1.00 0.00  ? 31  PHE A CG     2  
ATOM   2969  C CD1    . PHE A 1 31  ? -12.150 4.877   -19.578 1.00 0.00  ? 31  PHE A CD1    2  
ATOM   2970  C CD2    . PHE A 1 31  ? -13.626 3.147   -18.863 1.00 0.00  ? 31  PHE A CD2    2  
ATOM   2971  C CE1    . PHE A 1 31  ? -12.188 5.436   -18.316 1.00 0.00  ? 31  PHE A CE1    2  
ATOM   2972  C CE2    . PHE A 1 31  ? -13.669 3.701   -17.598 1.00 0.00  ? 31  PHE A CE2    2  
ATOM   2973  C CZ     . PHE A 1 31  ? -12.949 4.849   -17.324 1.00 0.00  ? 31  PHE A CZ     2  
ATOM   2974  H H      . PHE A 1 31  ? -15.402 3.594   -21.410 1.00 0.00  ? 31  PHE A H      2  
ATOM   2975  H HA     . PHE A 1 31  ? -13.001 4.924   -22.391 1.00 0.00  ? 31  PHE A HA     2  
ATOM   2976  H HB2    . PHE A 1 31  ? -13.299 2.161   -21.200 1.00 0.00  ? 31  PHE A HB2    2  
ATOM   2977  H HB3    . PHE A 1 31  ? -11.786 3.002   -21.521 1.00 0.00  ? 31  PHE A HB3    2  
ATOM   2978  H HD1    . PHE A 1 31  ? -11.553 5.333   -20.351 1.00 0.00  ? 31  PHE A HD1    2  
ATOM   2979  H HD2    . PHE A 1 31  ? -14.188 2.249   -19.078 1.00 0.00  ? 31  PHE A HD2    2  
ATOM   2980  H HE1    . PHE A 1 31  ? -11.625 6.334   -18.106 1.00 0.00  ? 31  PHE A HE1    2  
ATOM   2981  H HE2    . PHE A 1 31  ? -14.264 3.240   -16.825 1.00 0.00  ? 31  PHE A HE2    2  
ATOM   2982  H HZ     . PHE A 1 31  ? -12.982 5.285   -16.338 1.00 0.00  ? 31  PHE A HZ     2  
ATOM   2983  N N      . LEU A 1 32  ? -12.399 3.500   -24.402 1.00 0.00  ? 32  LEU A N      2  
ATOM   2984  C CA     . LEU A 1 32  ? -12.224 2.865   -25.704 1.00 0.00  ? 32  LEU A CA     2  
ATOM   2985  C C      . LEU A 1 32  ? -11.655 1.461   -25.530 1.00 0.00  ? 32  LEU A C      2  
ATOM   2986  O O      . LEU A 1 32  ? -10.735 1.250   -24.741 1.00 0.00  ? 32  LEU A O      2  
ATOM   2987  C CB     . LEU A 1 32  ? -11.294 3.689   -26.608 1.00 0.00  ? 32  LEU A CB     2  
ATOM   2988  C CG     . LEU A 1 32  ? -10.924 3.016   -27.935 1.00 0.00  ? 32  LEU A CG     2  
ATOM   2989  C CD1    . LEU A 1 32  ? -12.166 2.762   -28.776 1.00 0.00  ? 32  LEU A CD1    2  
ATOM   2990  C CD2    . LEU A 1 32  ? -9.921  3.861   -28.705 1.00 0.00  ? 32  LEU A CD2    2  
ATOM   2991  H H      . LEU A 1 32  ? -11.697 4.097   -24.064 1.00 0.00  ? 32  LEU A H      2  
ATOM   2992  H HA     . LEU A 1 32  ? -13.195 2.791   -26.171 1.00 0.00  ? 32  LEU A HA     2  
ATOM   2993  H HB2    . LEU A 1 32  ? -11.769 4.633   -26.825 1.00 0.00  ? 32  LEU A HB2    2  
ATOM   2994  H HB3    . LEU A 1 32  ? -10.384 3.886   -26.066 1.00 0.00  ? 32  LEU A HB3    2  
ATOM   2995  H HG     . LEU A 1 32  ? -10.464 2.059   -27.728 1.00 0.00  ? 32  LEU A HG     2  
ATOM   2996  H HD11   . LEU A 1 32  ? -12.425 1.714   -28.727 1.00 0.00  ? 32  LEU A HD11   2  
ATOM   2997  H HD12   . LEU A 1 32  ? -11.969 3.035   -29.801 1.00 0.00  ? 32  LEU A HD12   2  
ATOM   2998  H HD13   . LEU A 1 32  ? -12.985 3.355   -28.396 1.00 0.00  ? 32  LEU A HD13   2  
ATOM   2999  H HD21   . LEU A 1 32  ? -10.112 3.768   -29.764 1.00 0.00  ? 32  LEU A HD21   2  
ATOM   3000  H HD22   . LEU A 1 32  ? -8.920  3.518   -28.488 1.00 0.00  ? 32  LEU A HD22   2  
ATOM   3001  H HD23   . LEU A 1 32  ? -10.020 4.895   -28.411 1.00 0.00  ? 32  LEU A HD23   2  
ATOM   3002  N N      . LEU A 1 33  ? -12.209 0.508   -26.263 1.00 0.00  ? 33  LEU A N      2  
ATOM   3003  C CA     . LEU A 1 33  ? -11.755 -0.873  -26.183 1.00 0.00  ? 33  LEU A CA     2  
ATOM   3004  C C      . LEU A 1 33  ? -11.618 -1.480  -27.572 1.00 0.00  ? 33  LEU A C      2  
ATOM   3005  O O      . LEU A 1 33  ? -12.417 -1.199  -28.460 1.00 0.00  ? 33  LEU A O      2  
ATOM   3006  C CB     . LEU A 1 33  ? -12.731 -1.693  -25.340 1.00 0.00  ? 33  LEU A CB     2  
ATOM   3007  C CG     . LEU A 1 33  ? -12.402 -1.746  -23.851 1.00 0.00  ? 33  LEU A CG     2  
ATOM   3008  C CD1    . LEU A 1 33  ? -13.656 -2.015  -23.042 1.00 0.00  ? 33  LEU A CD1    2  
ATOM   3009  C CD2    . LEU A 1 33  ? -11.348 -2.807  -23.574 1.00 0.00  ? 33  LEU A CD2    2  
ATOM   3010  H H      . LEU A 1 33  ? -12.941 0.736   -26.874 1.00 0.00  ? 33  LEU A H      2  
ATOM   3011  H HA     . LEU A 1 33  ? -10.788 -0.876  -25.703 1.00 0.00  ? 33  LEU A HA     2  
ATOM   3012  H HB2    . LEU A 1 33  ? -13.717 -1.268  -25.455 1.00 0.00  ? 33  LEU A HB2    2  
ATOM   3013  H HB3    . LEU A 1 33  ? -12.747 -2.702  -25.718 1.00 0.00  ? 33  LEU A HB3    2  
ATOM   3014  H HG     . LEU A 1 33  ? -12.006 -0.791  -23.541 1.00 0.00  ? 33  LEU A HG     2  
ATOM   3015  H HD11   . LEU A 1 33  ? -13.387 -2.453  -22.092 1.00 0.00  ? 33  LEU A HD11   2  
ATOM   3016  H HD12   . LEU A 1 33  ? -14.292 -2.696  -23.584 1.00 0.00  ? 33  LEU A HD12   2  
ATOM   3017  H HD13   . LEU A 1 33  ? -14.182 -1.086  -22.875 1.00 0.00  ? 33  LEU A HD13   2  
ATOM   3018  H HD21   . LEU A 1 33  ? -11.378 -3.556  -24.353 1.00 0.00  ? 33  LEU A HD21   2  
ATOM   3019  H HD22   . LEU A 1 33  ? -11.548 -3.275  -22.621 1.00 0.00  ? 33  LEU A HD22   2  
ATOM   3020  H HD23   . LEU A 1 33  ? -10.370 -2.349  -23.553 1.00 0.00  ? 33  LEU A HD23   2  
ATOM   3021  N N      . LEU A 1 34  ? -10.595 -2.308  -27.754 1.00 0.00  ? 34  LEU A N      2  
ATOM   3022  C CA     . LEU A 1 34  ? -10.351 -2.947  -29.041 1.00 0.00  ? 34  LEU A CA     2  
ATOM   3023  C C      . LEU A 1 34  ? -10.318 -4.466  -28.902 1.00 0.00  ? 34  LEU A C      2  
ATOM   3024  O O      . LEU A 1 34  ? -9.421  -5.022  -28.268 1.00 0.00  ? 34  LEU A O      2  
ATOM   3025  C CB     . LEU A 1 34  ? -9.030  -2.449  -29.636 1.00 0.00  ? 34  LEU A CB     2  
ATOM   3026  C CG     . LEU A 1 34  ? -8.743  -0.962  -29.419 1.00 0.00  ? 34  LEU A CG     2  
ATOM   3027  C CD1    . LEU A 1 34  ? -7.328  -0.625  -29.858 1.00 0.00  ? 34  LEU A CD1    2  
ATOM   3028  C CD2    . LEU A 1 34  ? -9.753  -0.110  -30.171 1.00 0.00  ? 34  LEU A CD2    2  
ATOM   3029  H H      . LEU A 1 34  ? -9.987  -2.489  -27.006 1.00 0.00  ? 34  LEU A H      2  
ATOM   3030  H HA     . LEU A 1 34  ? -11.158 -2.676  -29.704 1.00 0.00  ? 34  LEU A HA     2  
ATOM   3031  H HB2    . LEU A 1 34  ? -8.225  -3.019  -29.196 1.00 0.00  ? 34  LEU A HB2    2  
ATOM   3032  H HB3    . LEU A 1 34  ? -9.045  -2.640  -30.698 1.00 0.00  ? 34  LEU A HB3    2  
ATOM   3033  H HG     . LEU A 1 34  ? -8.831  -0.732  -28.367 1.00 0.00  ? 34  LEU A HG     2  
ATOM   3034  H HD11   . LEU A 1 34  ? -7.054  -1.244  -30.699 1.00 0.00  ? 34  LEU A HD11   2  
ATOM   3035  H HD12   . LEU A 1 34  ? -6.645  -0.801  -29.040 1.00 0.00  ? 34  LEU A HD12   2  
ATOM   3036  H HD13   . LEU A 1 34  ? -7.281  0.416   -30.146 1.00 0.00  ? 34  LEU A HD13   2  
ATOM   3037  H HD21   . LEU A 1 34  ? -10.150 -0.673  -31.003 1.00 0.00  ? 34  LEU A HD21   2  
ATOM   3038  H HD22   . LEU A 1 34  ? -9.268  0.783   -30.538 1.00 0.00  ? 34  LEU A HD22   2  
ATOM   3039  H HD23   . LEU A 1 34  ? -10.558 0.165   -29.505 1.00 0.00  ? 34  LEU A HD23   2  
ATOM   3040  N N      . GLN A 1 35  ? -11.300 -5.132  -29.502 1.00 0.00  ? 35  GLN A N      2  
ATOM   3041  C CA     . GLN A 1 35  ? -11.374 -6.589  -29.445 1.00 0.00  ? 35  GLN A CA     2  
ATOM   3042  C C      . GLN A 1 35  ? -10.248 -7.221  -30.250 1.00 0.00  ? 35  GLN A C      2  
ATOM   3043  O O      . GLN A 1 35  ? -10.120 -6.981  -31.450 1.00 0.00  ? 35  GLN A O      2  
ATOM   3044  C CB     . GLN A 1 35  ? -12.720 -7.086  -29.975 1.00 0.00  ? 35  GLN A CB     2  
ATOM   3045  C CG     . GLN A 1 35  ? -13.067 -8.496  -29.518 1.00 0.00  ? 35  GLN A CG     2  
ATOM   3046  C CD     . GLN A 1 35  ? -14.128 -9.156  -30.382 1.00 0.00  ? 35  GLN A CD     2  
ATOM   3047  O OE1    . GLN A 1 35  ? -14.118 -10.372 -30.571 1.00 0.00  ? 35  GLN A OE1    2  
ATOM   3048  N NE2    . GLN A 1 35  ? -15.050 -8.360  -30.915 1.00 0.00  ? 35  GLN A NE2    2  
ATOM   3049  H H      . GLN A 1 35  ? -11.985 -4.637  -29.996 1.00 0.00  ? 35  GLN A H      2  
ATOM   3050  H HA     . GLN A 1 35  ? -11.272 -6.886  -28.412 1.00 0.00  ? 35  GLN A HA     2  
ATOM   3051  H HB2    . GLN A 1 35  ? -13.497 -6.420  -29.639 1.00 0.00  ? 35  GLN A HB2    2  
ATOM   3052  H HB3    . GLN A 1 35  ? -12.692 -7.078  -31.055 1.00 0.00  ? 35  GLN A HB3    2  
ATOM   3053  H HG2    . GLN A 1 35  ? -12.173 -9.100  -29.551 1.00 0.00  ? 35  GLN A HG2    2  
ATOM   3054  H HG3    . GLN A 1 35  ? -13.430 -8.452  -28.502 1.00 0.00  ? 35  GLN A HG3    2  
ATOM   3055  H HE21   . GLN A 1 35  ? -15.001 -7.400  -30.726 1.00 0.00  ? 35  GLN A HE21   2  
ATOM   3056  H HE22   . GLN A 1 35  ? -15.743 -8.768  -31.475 1.00 0.00  ? 35  GLN A HE22   2  
ATOM   3057  N N      . ALA A 1 36  ? -9.442  -8.040  -29.587 1.00 0.00  ? 36  ALA A N      2  
ATOM   3058  C CA     . ALA A 1 36  ? -8.337  -8.716  -30.249 1.00 0.00  ? 36  ALA A CA     2  
ATOM   3059  C C      . ALA A 1 36  ? -8.850  -9.569  -31.403 1.00 0.00  ? 36  ALA A C      2  
ATOM   3060  O O      . ALA A 1 36  ? -9.787  -10.349 -31.237 1.00 0.00  ? 36  ALA A O      2  
ATOM   3061  C CB     . ALA A 1 36  ? -7.565  -9.570  -29.253 1.00 0.00  ? 36  ALA A CB     2  
ATOM   3062  H H      . ALA A 1 36  ? -9.599  -8.199  -28.634 1.00 0.00  ? 36  ALA A H      2  
ATOM   3063  H HA     . ALA A 1 36  ? -7.667  -7.962  -30.639 1.00 0.00  ? 36  ALA A HA     2  
ATOM   3064  H HB1    . ALA A 1 36  ? -8.110  -10.484 -29.065 1.00 0.00  ? 36  ALA A HB1    2  
ATOM   3065  H HB2    . ALA A 1 36  ? -7.446  -9.025  -28.329 1.00 0.00  ? 36  ALA A HB2    2  
ATOM   3066  H HB3    . ALA A 1 36  ? -6.593  -9.806  -29.660 1.00 0.00  ? 36  ALA A HB3    2  
ATOM   3067  N N      . SER A 1 37  ? -8.236  -9.416  -32.570 1.00 0.00  ? 37  SER A N      2  
ATOM   3068  C CA     . SER A 1 37  ? -8.642  -10.175 -33.748 1.00 0.00  ? 37  SER A CA     2  
ATOM   3069  C C      . SER A 1 37  ? -8.209  -11.639 -33.649 1.00 0.00  ? 37  SER A C      2  
ATOM   3070  O O      . SER A 1 37  ? -8.466  -12.431 -34.555 1.00 0.00  ? 37  SER A O      2  
ATOM   3071  C CB     . SER A 1 37  ? -8.060  -9.541  -35.011 1.00 0.00  ? 37  SER A CB     2  
ATOM   3072  O OG     . SER A 1 37  ? -6.642  -9.572  -34.993 1.00 0.00  ? 37  SER A OG     2  
ATOM   3073  H H      . SER A 1 37  ? -7.496  -8.777  -32.643 1.00 0.00  ? 37  SER A H      2  
ATOM   3074  H HA     . SER A 1 37  ? -9.720  -10.138 -33.806 1.00 0.00  ? 37  SER A HA     2  
ATOM   3075  H HB2    . SER A 1 37  ? -8.407  -10.084 -35.878 1.00 0.00  ? 37  SER A HB2    2  
ATOM   3076  H HB3    . SER A 1 37  ? -8.383  -8.512  -35.078 1.00 0.00  ? 37  SER A HB3    2  
ATOM   3077  H HG     . SER A 1 37  ? -6.304  -8.684  -34.859 1.00 0.00  ? 37  SER A HG     2  
ATOM   3078  N N      . ASP A 1 38  ? -7.557  -11.995 -32.544 1.00 0.00  ? 38  ASP A N      2  
ATOM   3079  C CA     . ASP A 1 38  ? -7.101  -13.361 -32.331 1.00 0.00  ? 38  ASP A CA     2  
ATOM   3080  C C      . ASP A 1 38  ? -7.163  -13.720 -30.848 1.00 0.00  ? 38  ASP A C      2  
ATOM   3081  O O      . ASP A 1 38  ? -7.799  -13.020 -30.060 1.00 0.00  ? 38  ASP A O      2  
ATOM   3082  C CB     . ASP A 1 38  ? -5.674  -13.532 -32.855 1.00 0.00  ? 38  ASP A CB     2  
ATOM   3083  C CG     . ASP A 1 38  ? -5.496  -12.966 -34.251 1.00 0.00  ? 38  ASP A CG     2  
ATOM   3084  O OD1    . ASP A 1 38  ? -5.621  -13.737 -35.224 1.00 0.00  ? 38  ASP A OD1    2  
ATOM   3085  O OD2    . ASP A 1 38  ? -5.234  -11.750 -34.369 1.00 0.00  ? 38  ASP A OD2    2  
ATOM   3086  H H      . ASP A 1 38  ? -7.380  -11.326 -31.854 1.00 0.00  ? 38  ASP A H      2  
ATOM   3087  H HA     . ASP A 1 38  ? -7.757  -14.021 -32.877 1.00 0.00  ? 38  ASP A HA     2  
ATOM   3088  H HB2    . ASP A 1 38  ? -4.991  -13.024 -32.192 1.00 0.00  ? 38  ASP A HB2    2  
ATOM   3089  H HB3    . ASP A 1 38  ? -5.429  -14.584 -32.880 1.00 0.00  ? 38  ASP A HB3    2  
ATOM   3090  H HD2    . ASP A 1 38  ? -5.135  -11.459 -35.278 1.00 0.00  ? 38  ASP A HD2    2  
ATOM   3091  N N      . GLY A 1 39  ? -6.497  -14.807 -30.473 1.00 0.00  ? 39  GLY A N      2  
ATOM   3092  C CA     . GLY A 1 39  ? -6.491  -15.227 -29.084 1.00 0.00  ? 39  GLY A CA     2  
ATOM   3093  C C      . GLY A 1 39  ? -7.862  -15.660 -28.601 1.00 0.00  ? 39  GLY A C      2  
ATOM   3094  O O      . GLY A 1 39  ? -8.530  -16.467 -29.248 1.00 0.00  ? 39  GLY A O      2  
ATOM   3095  H H      . GLY A 1 39  ? -6.003  -15.324 -31.142 1.00 0.00  ? 39  GLY A H      2  
ATOM   3096  H HA2    . GLY A 1 39  ? -5.805  -16.054 -28.973 1.00 0.00  ? 39  GLY A HA2    2  
ATOM   3097  H HA3    . GLY A 1 39  ? -6.148  -14.406 -28.472 1.00 0.00  ? 39  GLY A HA3    2  
ATOM   3098  N N      . ILE A 1 40  ? -8.281  -15.123 -27.460 1.00 0.00  ? 40  ILE A N      2  
ATOM   3099  C CA     . ILE A 1 40  ? -9.581  -15.457 -26.884 1.00 0.00  ? 40  ILE A CA     2  
ATOM   3100  C C      . ILE A 1 40  ? -10.644 -14.434 -27.277 1.00 0.00  ? 40  ILE A C      2  
ATOM   3101  O O      . ILE A 1 40  ? -11.746 -14.436 -26.729 1.00 0.00  ? 40  ILE A O      2  
ATOM   3102  C CB     . ILE A 1 40  ? -9.509  -15.556 -25.335 1.00 0.00  ? 40  ILE A CB     2  
ATOM   3103  C CG1    . ILE A 1 40  ? -9.567  -14.171 -24.672 1.00 0.00  ? 40  ILE A CG1    2  
ATOM   3104  C CG2    . ILE A 1 40  ? -8.240  -16.276 -24.911 1.00 0.00  ? 40  ILE A CG2    2  
ATOM   3105  C CD1    . ILE A 1 40  ? -10.329 -14.156 -23.366 1.00 0.00  ? 40  ILE A CD1    2  
ATOM   3106  H H      . ILE A 1 40  ? -7.701  -14.488 -26.991 1.00 0.00  ? 40  ILE A H      2  
ATOM   3107  H HA     . ILE A 1 40  ? -9.871  -16.425 -27.268 1.00 0.00  ? 40  ILE A HA     2  
ATOM   3108  H HB     . ILE A 1 40  ? -10.352 -16.141 -24.998 1.00 0.00  ? 40  ILE A HB     2  
ATOM   3109  H HG12   . ILE A 1 40  ? -8.563  -13.834 -24.471 1.00 0.00  ? 40  ILE A HG12   2  
ATOM   3110  H HG13   . ILE A 1 40  ? -10.046 -13.472 -25.341 1.00 0.00  ? 40  ILE A HG13   2  
ATOM   3111  H HG21   . ILE A 1 40  ? -8.436  -16.857 -24.022 1.00 0.00  ? 40  ILE A HG21   2  
ATOM   3112  H HG22   . ILE A 1 40  ? -7.467  -15.549 -24.703 1.00 0.00  ? 40  ILE A HG22   2  
ATOM   3113  H HG23   . ILE A 1 40  ? -7.915  -16.931 -25.706 1.00 0.00  ? 40  ILE A HG23   2  
ATOM   3114  H HD11   . ILE A 1 40  ? -11.298 -13.704 -23.520 1.00 0.00  ? 40  ILE A HD11   2  
ATOM   3115  H HD12   . ILE A 1 40  ? -9.778  -13.586 -22.633 1.00 0.00  ? 40  ILE A HD12   2  
ATOM   3116  H HD13   . ILE A 1 40  ? -10.457 -15.169 -23.012 1.00 0.00  ? 40  ILE A HD13   2  
ATOM   3117  N N      . HIS A 1 41  ? -10.302 -13.538 -28.202 1.00 0.00  ? 41  HIS A N      2  
ATOM   3118  C CA     . HIS A 1 41  ? -11.230 -12.496 -28.621 1.00 0.00  ? 41  HIS A CA     2  
ATOM   3119  C C      . HIS A 1 41  ? -11.528 -11.596 -27.432 1.00 0.00  ? 41  HIS A C      2  
ATOM   3120  O O      . HIS A 1 41  ? -12.678 -11.434 -27.021 1.00 0.00  ? 41  HIS A O      2  
ATOM   3121  C CB     . HIS A 1 41  ? -12.521 -13.104 -29.178 1.00 0.00  ? 41  HIS A CB     2  
ATOM   3122  C CG     . HIS A 1 41  ? -12.433 -13.444 -30.633 1.00 0.00  ? 41  HIS A CG     2  
ATOM   3123  N ND1    . HIS A 1 41  ? -11.261 -13.361 -31.355 1.00 0.00  ? 41  HIS A ND1    2  
ATOM   3124  C CD2    . HIS A 1 41  ? -13.382 -13.869 -31.503 1.00 0.00  ? 41  HIS A CD2    2  
ATOM   3125  C CE1    . HIS A 1 41  ? -11.491 -13.718 -32.605 1.00 0.00  ? 41  HIS A CE1    2  
ATOM   3126  N NE2    . HIS A 1 41  ? -12.769 -14.031 -32.721 1.00 0.00  ? 41  HIS A NE2    2  
ATOM   3127  H H      . HIS A 1 41  ? -9.403  -13.562 -28.590 1.00 0.00  ? 41  HIS A H      2  
ATOM   3128  H HA     . HIS A 1 41  ? -10.749 -11.911 -29.393 1.00 0.00  ? 41  HIS A HA     2  
ATOM   3129  H HB2    . HIS A 1 41  ? -12.747 -14.010 -28.636 1.00 0.00  ? 41  HIS A HB2    2  
ATOM   3130  H HB3    . HIS A 1 41  ? -13.328 -12.400 -29.046 1.00 0.00  ? 41  HIS A HB3    2  
ATOM   3131  H HD1    . HIS A 1 41  ? -10.391 -13.081 -31.003 1.00 0.00  ? 41  HIS A HD1    2  
ATOM   3132  H HD2    . HIS A 1 41  ? -14.423 -14.050 -31.280 1.00 0.00  ? 41  HIS A HD2    2  
ATOM   3133  H HE1    . HIS A 1 41  ? -10.757 -13.748 -33.400 1.00 0.00  ? 41  HIS A HE1    2  
ATOM   3134  H HE2    . HIS A 1 41  ? -13.220 -14.262 -33.560 1.00 0.00  ? 41  HIS A HE2    2  
ATOM   3135  N N      . HIS A 1 42  ? -10.465 -11.032 -26.874 1.00 0.00  ? 42  HIS A N      2  
ATOM   3136  C CA     . HIS A 1 42  ? -10.566 -10.160 -25.714 1.00 0.00  ? 42  HIS A CA     2  
ATOM   3137  C C      . HIS A 1 42  ? -10.320 -8.710  -26.104 1.00 0.00  ? 42  HIS A C      2  
ATOM   3138  O O      . HIS A 1 42  ? -9.592  -8.428  -27.054 1.00 0.00  ? 42  HIS A O      2  
ATOM   3139  C CB     . HIS A 1 42  ? -9.565  -10.599 -24.638 1.00 0.00  ? 42  HIS A CB     2  
ATOM   3140  C CG     . HIS A 1 42  ? -8.217  -10.977 -25.179 1.00 0.00  ? 42  HIS A CG     2  
ATOM   3141  N ND1    . HIS A 1 42  ? -8.013  -12.038 -26.038 1.00 0.00  ? 42  HIS A ND1    2  
ATOM   3142  C CD2    . HIS A 1 42  ? -6.998  -10.425 -24.978 1.00 0.00  ? 42  HIS A CD2    2  
ATOM   3143  C CE1    . HIS A 1 42  ? -6.730  -12.119 -26.339 1.00 0.00  ? 42  HIS A CE1    2  
ATOM   3144  N NE2    . HIS A 1 42  ? -6.091  -11.150 -25.711 1.00 0.00  ? 42  HIS A NE2    2  
ATOM   3145  H H      . HIS A 1 42  ? -9.582  -11.217 -27.252 1.00 0.00  ? 42  HIS A H      2  
ATOM   3146  H HA     . HIS A 1 42  ? -11.566 -10.249 -25.319 1.00 0.00  ? 42  HIS A HA     2  
ATOM   3147  H HB2    . HIS A 1 42  ? -9.424  -9.789  -23.939 1.00 0.00  ? 42  HIS A HB2    2  
ATOM   3148  H HB3    . HIS A 1 42  ? -9.966  -11.454 -24.113 1.00 0.00  ? 42  HIS A HB3    2  
ATOM   3149  H HD1    . HIS A 1 42  ? -8.704  -12.639 -26.381 1.00 0.00  ? 42  HIS A HD1    2  
ATOM   3150  H HD2    . HIS A 1 42  ? -6.780  -9.576  -24.351 1.00 0.00  ? 42  HIS A HD2    2  
ATOM   3151  H HE1    . HIS A 1 42  ? -6.278  -12.855 -26.987 1.00 0.00  ? 42  HIS A HE1    2  
ATOM   3152  H HE2    . HIS A 1 42  ? -5.179  -10.863 -25.916 1.00 0.00  ? 42  HIS A HE2    2  
ATOM   3153  N N      . TRP A 1 43  ? -10.940 -7.795  -25.372 1.00 0.00  ? 43  TRP A N      2  
ATOM   3154  C CA     . TRP A 1 43  ? -10.799 -6.373  -25.657 1.00 0.00  ? 43  TRP A CA     2  
ATOM   3155  C C      . TRP A 1 43  ? -9.721  -5.731  -24.794 1.00 0.00  ? 43  TRP A C      2  
ATOM   3156  O O      . TRP A 1 43  ? -9.601  -6.017  -23.602 1.00 0.00  ? 43  TRP A O      2  
ATOM   3157  C CB     . TRP A 1 43  ? -12.134 -5.665  -25.444 1.00 0.00  ? 43  TRP A CB     2  
ATOM   3158  C CG     . TRP A 1 43  ? -13.281 -6.361  -26.112 1.00 0.00  ? 43  TRP A CG     2  
ATOM   3159  C CD1    . TRP A 1 43  ? -13.798 -7.581  -25.793 1.00 0.00  ? 43  TRP A CD1    2  
ATOM   3160  C CD2    . TRP A 1 43  ? -14.048 -5.876  -27.217 1.00 0.00  ? 43  TRP A CD2    2  
ATOM   3161  N NE1    . TRP A 1 43  ? -14.846 -7.884  -26.627 1.00 0.00  ? 43  TRP A NE1    2  
ATOM   3162  C CE2    . TRP A 1 43  ? -15.017 -6.852  -27.512 1.00 0.00  ? 43  TRP A CE2    2  
ATOM   3163  C CE3    . TRP A 1 43  ? -14.010 -4.710  -27.983 1.00 0.00  ? 43  TRP A CE3    2  
ATOM   3164  C CZ2    . TRP A 1 43  ? -15.941 -6.698  -28.541 1.00 0.00  ? 43  TRP A CZ2    2  
ATOM   3165  C CZ3    . TRP A 1 43  ? -14.927 -4.558  -29.006 1.00 0.00  ? 43  TRP A CZ3    2  
ATOM   3166  C CH2    . TRP A 1 43  ? -15.882 -5.547  -29.275 1.00 0.00  ? 43  TRP A CH2    2  
ATOM   3167  H H      . TRP A 1 43  ? -11.515 -8.081  -24.633 1.00 0.00  ? 43  TRP A H      2  
ATOM   3168  H HA     . TRP A 1 43  ? -10.515 -6.274  -26.692 1.00 0.00  ? 43  TRP A HA     2  
ATOM   3169  H HB2    . TRP A 1 43  ? -12.345 -5.612  -24.387 1.00 0.00  ? 43  TRP A HB2    2  
ATOM   3170  H HB3    . TRP A 1 43  ? -12.071 -4.664  -25.845 1.00 0.00  ? 43  TRP A HB3    2  
ATOM   3171  H HD1    . TRP A 1 43  ? -13.433 -8.205  -24.992 1.00 0.00  ? 43  TRP A HD1    2  
ATOM   3172  H HE1    . TRP A 1 43  ? -15.381 -8.704  -26.595 1.00 0.00  ? 43  TRP A HE1    2  
ATOM   3173  H HE3    . TRP A 1 43  ? -13.281 -3.938  -27.789 1.00 0.00  ? 43  TRP A HE3    2  
ATOM   3174  H HZ2    . TRP A 1 43  ? -16.684 -7.451  -28.760 1.00 0.00  ? 43  TRP A HZ2    2  
ATOM   3175  H HZ3    . TRP A 1 43  ? -14.914 -3.665  -29.609 1.00 0.00  ? 43  TRP A HZ3    2  
ATOM   3176  H HH2    . TRP A 1 43  ? -16.582 -5.382  -30.081 1.00 0.00  ? 43  TRP A HH2    2  
ATOM   3177  N N      . THR A 1 44  ? -8.945  -4.854  -25.416 1.00 0.00  ? 44  THR A N      2  
ATOM   3178  C CA     . THR A 1 44  ? -7.869  -4.147  -24.736 1.00 0.00  ? 44  THR A CA     2  
ATOM   3179  C C      . THR A 1 44  ? -7.580  -2.835  -25.455 1.00 0.00  ? 44  THR A C      2  
ATOM   3180  O O      . THR A 1 44  ? -7.512  -2.805  -26.684 1.00 0.00  ? 44  THR A O      2  
ATOM   3181  C CB     . THR A 1 44  ? -6.606  -5.010  -24.705 1.00 0.00  ? 44  THR A CB     2  
ATOM   3182  O OG1    . THR A 1 44  ? -6.571  -5.890  -25.814 1.00 0.00  ? 44  THR A OG1    2  
ATOM   3183  C CG2    . THR A 1 44  ? -6.478  -5.849  -23.451 1.00 0.00  ? 44  THR A CG2    2  
ATOM   3184  H H      . THR A 1 44  ? -9.101  -4.674  -26.367 1.00 0.00  ? 44  THR A H      2  
ATOM   3185  H HA     . THR A 1 44  ? -8.186  -3.938  -23.726 1.00 0.00  ? 44  THR A HA     2  
ATOM   3186  H HB     . THR A 1 44  ? -5.741  -4.364  -24.758 1.00 0.00  ? 44  THR A HB     2  
ATOM   3187  H HG1    . THR A 1 44  ? -5.786  -5.716  -26.337 1.00 0.00  ? 44  THR A HG1    2  
ATOM   3188  H HG21   . THR A 1 44  ? -7.401  -6.380  -23.278 1.00 0.00  ? 44  THR A HG21   2  
ATOM   3189  H HG22   . THR A 1 44  ? -6.267  -5.208  -22.609 1.00 0.00  ? 44  THR A HG22   2  
ATOM   3190  H HG23   . THR A 1 44  ? -5.672  -6.557  -23.573 1.00 0.00  ? 44  THR A HG23   2  
ATOM   3191  N N      . PRO A 1 45  ? -7.387  -1.731  -24.715 1.00 0.00  ? 45  PRO A N      2  
ATOM   3192  C CA     . PRO A 1 45  ? -7.090  -0.437  -25.326 1.00 0.00  ? 45  PRO A CA     2  
ATOM   3193  C C      . PRO A 1 45  ? -5.967  -0.560  -26.347 1.00 0.00  ? 45  PRO A C      2  
ATOM   3194  O O      . PRO A 1 45  ? -5.307  -1.595  -26.427 1.00 0.00  ? 45  PRO A O      2  
ATOM   3195  C CB     . PRO A 1 45  ? -6.665  0.427   -24.138 1.00 0.00  ? 45  PRO A CB     2  
ATOM   3196  C CG     . PRO A 1 45  ? -7.371  -0.175  -22.972 1.00 0.00  ? 45  PRO A CG     2  
ATOM   3197  C CD     . PRO A 1 45  ? -7.423  -1.656  -23.244 1.00 0.00  ? 45  PRO A CD     2  
ATOM   3198  H HA     . PRO A 1 45  ? -7.964  -0.011  -25.798 1.00 0.00  ? 45  PRO A HA     2  
ATOM   3199  H HB2    . PRO A 1 45  ? -5.593  0.384   -24.018 1.00 0.00  ? 45  PRO A HB2    2  
ATOM   3200  H HB3    . PRO A 1 45  ? -6.975  1.448   -24.302 1.00 0.00  ? 45  PRO A HB3    2  
ATOM   3201  H HG2    . PRO A 1 45  ? -6.819  0.022   -22.065 1.00 0.00  ? 45  PRO A HG2    2  
ATOM   3202  H HG3    . PRO A 1 45  ? -8.371  0.226   -22.899 1.00 0.00  ? 45  PRO A HG3    2  
ATOM   3203  H HD2    . PRO A 1 45  ? -6.563  -2.145  -22.813 1.00 0.00  ? 45  PRO A HD2    2  
ATOM   3204  H HD3    . PRO A 1 45  ? -8.337  -2.081  -22.858 1.00 0.00  ? 45  PRO A HD3    2  
ATOM   3205  N N      . PRO A 1 46  ? -5.729  0.483   -27.150 1.00 0.00  ? 46  PRO A N      2  
ATOM   3206  C CA     . PRO A 1 46  ? -4.684  0.455   -28.162 1.00 0.00  ? 46  PRO A CA     2  
ATOM   3207  C C      . PRO A 1 46  ? -3.299  0.675   -27.564 1.00 0.00  ? 46  PRO A C      2  
ATOM   3208  O O      . PRO A 1 46  ? -2.911  1.804   -27.264 1.00 0.00  ? 46  PRO A O      2  
ATOM   3209  C CB     . PRO A 1 46  ? -5.051  1.595   -29.119 1.00 0.00  ? 46  PRO A CB     2  
ATOM   3210  C CG     . PRO A 1 46  ? -6.242  2.297   -28.529 1.00 0.00  ? 46  PRO A CG     2  
ATOM   3211  C CD     . PRO A 1 46  ? -6.453  1.757   -27.140 1.00 0.00  ? 46  PRO A CD     2  
ATOM   3212  H HA     . PRO A 1 46  ? -4.690  -0.481  -28.702 1.00 0.00  ? 46  PRO A HA     2  
ATOM   3213  H HB2    . PRO A 1 46  ? -4.212  2.265   -29.209 1.00 0.00  ? 46  PRO A HB2    2  
ATOM   3214  H HB3    . PRO A 1 46  ? -5.285  1.183   -30.088 1.00 0.00  ? 46  PRO A HB3    2  
ATOM   3215  H HG2    . PRO A 1 46  ? -6.051  3.358   -28.484 1.00 0.00  ? 46  PRO A HG2    2  
ATOM   3216  H HG3    . PRO A 1 46  ? -7.113  2.104   -29.138 1.00 0.00  ? 46  PRO A HG3    2  
ATOM   3217  H HD2    . PRO A 1 46  ? -6.036  2.431   -26.406 1.00 0.00  ? 46  PRO A HD2    2  
ATOM   3218  H HD3    . PRO A 1 46  ? -7.506  1.599   -26.954 1.00 0.00  ? 46  PRO A HD3    2  
ATOM   3219  N N      . LYS A 1 47  ? -2.562  -0.416  -27.392 1.00 0.00  ? 47  LYS A N      2  
ATOM   3220  C CA     . LYS A 1 47  ? -1.218  -0.354  -26.831 1.00 0.00  ? 47  LYS A CA     2  
ATOM   3221  C C      . LYS A 1 47  ? -0.191  -0.921  -27.806 1.00 0.00  ? 47  LYS A C      2  
ATOM   3222  O O      . LYS A 1 47  ? -0.516  -1.240  -28.949 1.00 0.00  ? 47  LYS A O      2  
ATOM   3223  C CB     . LYS A 1 47  ? -1.164  -1.119  -25.508 1.00 0.00  ? 47  LYS A CB     2  
ATOM   3224  C CG     . LYS A 1 47  ? -1.437  -2.606  -25.657 1.00 0.00  ? 47  LYS A CG     2  
ATOM   3225  C CD     . LYS A 1 47  ? -2.561  -3.061  -24.739 1.00 0.00  ? 47  LYS A CD     2  
ATOM   3226  C CE     . LYS A 1 47  ? -2.744  -4.568  -24.792 1.00 0.00  ? 47  LYS A CE     2  
ATOM   3227  N NZ     . LYS A 1 47  ? -2.917  -5.058  -26.187 1.00 0.00  ? 47  LYS A NZ     2  
ATOM   3228  H H      . LYS A 1 47  ? -2.931  -1.288  -27.651 1.00 0.00  ? 47  LYS A H      2  
ATOM   3229  H HA     . LYS A 1 47  ? -0.985  0.684   -26.644 1.00 0.00  ? 47  LYS A HA     2  
ATOM   3230  H HB2    . LYS A 1 47  ? -0.182  -0.997  -25.076 1.00 0.00  ? 47  LYS A HB2    2  
ATOM   3231  H HB3    . LYS A 1 47  ? -1.898  -0.704  -24.835 1.00 0.00  ? 47  LYS A HB3    2  
ATOM   3232  H HG2    . LYS A 1 47  ? -1.718  -2.810  -26.679 1.00 0.00  ? 47  LYS A HG2    2  
ATOM   3233  H HG3    . LYS A 1 47  ? -0.539  -3.154  -25.413 1.00 0.00  ? 47  LYS A HG3    2  
ATOM   3234  H HD2    . LYS A 1 47  ? -2.322  -2.773  -23.727 1.00 0.00  ? 47  LYS A HD2    2  
ATOM   3235  H HD3    . LYS A 1 47  ? -3.480  -2.584  -25.047 1.00 0.00  ? 47  LYS A HD3    2  
ATOM   3236  H HE2    . LYS A 1 47  ? -1.873  -5.040  -24.359 1.00 0.00  ? 47  LYS A HE2    2  
ATOM   3237  H HE3    . LYS A 1 47  ? -3.619  -4.832  -24.215 1.00 0.00  ? 47  LYS A HE3    2  
ATOM   3238  H HZ1    . LYS A 1 47  ? -3.779  -4.653  -26.603 1.00 0.00  ? 47  LYS A HZ1    2  
ATOM   3239  H HZ2    . LYS A 1 47  ? -2.994  -6.094  -26.196 1.00 0.00  ? 47  LYS A HZ2    2  
ATOM   3240  H HZ3    . LYS A 1 47  ? -2.100  -4.779  -26.768 1.00 0.00  ? 47  LYS A HZ3    2  
ATOM   3241  N N      . GLY A 1 48  ? 1.049   -1.046  -27.345 1.00 0.00  ? 48  GLY A N      2  
ATOM   3242  C CA     . GLY A 1 48  ? 2.105   -1.576  -28.187 1.00 0.00  ? 48  GLY A CA     2  
ATOM   3243  C C      . GLY A 1 48  ? 3.354   -1.920  -27.398 1.00 0.00  ? 48  GLY A C      2  
ATOM   3244  O O      . GLY A 1 48  ? 3.272   -2.454  -26.293 1.00 0.00  ? 48  GLY A O      2  
ATOM   3245  H H      . GLY A 1 48  ? 1.249   -0.776  -26.424 1.00 0.00  ? 48  GLY A H      2  
ATOM   3246  H HA2    . GLY A 1 48  ? 1.747   -2.467  -28.679 1.00 0.00  ? 48  GLY A HA2    2  
ATOM   3247  H HA3    . GLY A 1 48  ? 2.357   -0.840  -28.935 1.00 0.00  ? 48  GLY A HA3    2  
ATOM   3248  N N      . HIS A 1 49  ? 4.514   -1.608  -27.968 1.00 0.00  ? 49  HIS A N      2  
ATOM   3249  C CA     . HIS A 1 49  ? 5.786   -1.886  -27.311 1.00 0.00  ? 49  HIS A CA     2  
ATOM   3250  C C      . HIS A 1 49  ? 6.687   -0.654  -27.343 1.00 0.00  ? 49  HIS A C      2  
ATOM   3251  O O      . HIS A 1 49  ? 6.930   -0.081  -28.405 1.00 0.00  ? 49  HIS A O      2  
ATOM   3252  C CB     . HIS A 1 49  ? 6.491   -3.065  -27.989 1.00 0.00  ? 49  HIS A CB     2  
ATOM   3253  C CG     . HIS A 1 49  ? 5.577   -4.206  -28.321 1.00 0.00  ? 49  HIS A CG     2  
ATOM   3254  N ND1    . HIS A 1 49  ? 5.168   -4.495  -29.607 1.00 0.00  ? 49  HIS A ND1    2  
ATOM   3255  C CD2    . HIS A 1 49  ? 4.997   -5.138  -27.527 1.00 0.00  ? 49  HIS A CD2    2  
ATOM   3256  C CE1    . HIS A 1 49  ? 4.379   -5.553  -29.589 1.00 0.00  ? 49  HIS A CE1    2  
ATOM   3257  N NE2    . HIS A 1 49  ? 4.259   -5.962  -28.341 1.00 0.00  ? 49  HIS A NE2    2  
ATOM   3258  H H      . HIS A 1 49  ? 4.514   -1.182  -28.848 1.00 0.00  ? 49  HIS A H      2  
ATOM   3259  H HA     . HIS A 1 49  ? 5.580   -2.141  -26.283 1.00 0.00  ? 49  HIS A HA     2  
ATOM   3260  H HB2    . HIS A 1 49  ? 6.941   -2.724  -28.908 1.00 0.00  ? 49  HIS A HB2    2  
ATOM   3261  H HB3    . HIS A 1 49  ? 7.263   -3.438  -27.332 1.00 0.00  ? 49  HIS A HB3    2  
ATOM   3262  H HD1    . HIS A 1 49  ? 5.421   -3.996  -30.412 1.00 0.00  ? 49  HIS A HD1    2  
ATOM   3263  H HD2    . HIS A 1 49  ? 5.098   -5.218  -26.453 1.00 0.00  ? 49  HIS A HD2    2  
ATOM   3264  H HE1    . HIS A 1 49  ? 3.912   -6.009  -30.452 1.00 0.00  ? 49  HIS A HE1    2  
ATOM   3265  H HE2    . HIS A 1 49  ? 3.773   -6.763  -28.052 1.00 0.00  ? 49  HIS A HE2    2  
ATOM   3266  N N      . VAL A 1 50  ? 7.185   -0.252  -26.176 1.00 0.00  ? 50  VAL A N      2  
ATOM   3267  C CA     . VAL A 1 50  ? 8.065   0.914   -26.085 1.00 0.00  ? 50  VAL A CA     2  
ATOM   3268  C C      . VAL A 1 50  ? 9.499   0.535   -26.451 1.00 0.00  ? 50  VAL A C      2  
ATOM   3269  O O      . VAL A 1 50  ? 10.012  -0.496  -26.016 1.00 0.00  ? 50  VAL A O      2  
ATOM   3270  C CB     . VAL A 1 50  ? 8.030   1.588   -24.678 1.00 0.00  ? 50  VAL A CB     2  
ATOM   3271  C CG1    . VAL A 1 50  ? 7.412   0.680   -23.628 1.00 0.00  ? 50  VAL A CG1    2  
ATOM   3272  C CG2    . VAL A 1 50  ? 9.418   2.037   -24.237 1.00 0.00  ? 50  VAL A CG2    2  
ATOM   3273  H H      . VAL A 1 50  ? 6.962   -0.752  -25.366 1.00 0.00  ? 50  VAL A H      2  
ATOM   3274  H HA     . VAL A 1 50  ? 7.712   1.637   -26.809 1.00 0.00  ? 50  VAL A HA     2  
ATOM   3275  H HB     . VAL A 1 50  ? 7.410   2.466   -24.750 1.00 0.00  ? 50  VAL A HB     2  
ATOM   3276  H HG11   . VAL A 1 50  ? 7.503   1.145   -22.657 1.00 0.00  ? 50  VAL A HG11   2  
ATOM   3277  H HG12   . VAL A 1 50  ? 7.926   -0.270  -23.625 1.00 0.00  ? 50  VAL A HG12   2  
ATOM   3278  H HG13   . VAL A 1 50  ? 6.369   0.526   -23.856 1.00 0.00  ? 50  VAL A HG13   2  
ATOM   3279  H HG21   . VAL A 1 50  ? 9.894   2.582   -25.039 1.00 0.00  ? 50  VAL A HG21   2  
ATOM   3280  H HG22   . VAL A 1 50  ? 10.013  1.171   -23.987 1.00 0.00  ? 50  VAL A HG22   2  
ATOM   3281  H HG23   . VAL A 1 50  ? 9.329   2.675   -23.370 1.00 0.00  ? 50  VAL A HG23   2  
ATOM   3282  N N      . GLU A 1 51  ? 10.136  1.377   -27.260 1.00 0.00  ? 51  GLU A N      2  
ATOM   3283  C CA     . GLU A 1 51  ? 11.507  1.136   -27.695 1.00 0.00  ? 51  GLU A CA     2  
ATOM   3284  C C      . GLU A 1 51  ? 12.510  1.706   -26.689 1.00 0.00  ? 51  GLU A C      2  
ATOM   3285  O O      . GLU A 1 51  ? 12.133  2.423   -25.762 1.00 0.00  ? 51  GLU A O      2  
ATOM   3286  C CB     . GLU A 1 51  ? 11.721  1.729   -29.100 1.00 0.00  ? 51  GLU A CB     2  
ATOM   3287  C CG     . GLU A 1 51  ? 12.584  2.987   -29.152 1.00 0.00  ? 51  GLU A CG     2  
ATOM   3288  C CD     . GLU A 1 51  ? 12.133  3.957   -30.227 1.00 0.00  ? 51  GLU A CD     2  
ATOM   3289  O OE1    . GLU A 1 51  ? 10.961  3.873   -30.650 1.00 0.00  ? 51  GLU A OE1    2  
ATOM   3290  O OE2    . GLU A 1 51  ? 12.953  4.805   -30.642 1.00 0.00  ? 51  GLU A OE2    2  
ATOM   3291  H H      . GLU A 1 51  ? 9.670   2.179   -27.574 1.00 0.00  ? 51  GLU A H      2  
ATOM   3292  H HA     . GLU A 1 51  ? 11.647  0.066   -27.745 1.00 0.00  ? 51  GLU A HA     2  
ATOM   3293  H HB2    . GLU A 1 51  ? 12.189  0.980   -29.721 1.00 0.00  ? 51  GLU A HB2    2  
ATOM   3294  H HB3    . GLU A 1 51  ? 10.753  1.971   -29.518 1.00 0.00  ? 51  GLU A HB3    2  
ATOM   3295  H HG2    . GLU A 1 51  ? 12.533  3.488   -28.198 1.00 0.00  ? 51  GLU A HG2    2  
ATOM   3296  H HG3    . GLU A 1 51  ? 13.606  2.702   -29.352 1.00 0.00  ? 51  GLU A HG3    2  
ATOM   3297  H HE2    . GLU A 1 51  ? 12.601  5.387   -31.321 1.00 0.00  ? 51  GLU A HE2    2  
ATOM   3298  N N      . PRO A 1 52  ? 13.804  1.387   -26.858 1.00 0.00  ? 52  PRO A N      2  
ATOM   3299  C CA     . PRO A 1 52  ? 14.863  1.863   -25.962 1.00 0.00  ? 52  PRO A CA     2  
ATOM   3300  C C      . PRO A 1 52  ? 14.805  3.367   -25.723 1.00 0.00  ? 52  PRO A C      2  
ATOM   3301  O O      . PRO A 1 52  ? 14.610  3.820   -24.595 1.00 0.00  ? 52  PRO A O      2  
ATOM   3302  C CB     . PRO A 1 52  ? 16.148  1.498   -26.706 1.00 0.00  ? 52  PRO A CB     2  
ATOM   3303  C CG     . PRO A 1 52  ? 15.779  0.335   -27.557 1.00 0.00  ? 52  PRO A CG     2  
ATOM   3304  C CD     . PRO A 1 52  ? 14.337  0.527   -27.936 1.00 0.00  ? 52  PRO A CD     2  
ATOM   3305  H HA     . PRO A 1 52  ? 14.836  1.348   -25.013 1.00 0.00  ? 52  PRO A HA     2  
ATOM   3306  H HB2    . PRO A 1 52  ? 16.471  2.338   -27.305 1.00 0.00  ? 52  PRO A HB2    2  
ATOM   3307  H HB3    . PRO A 1 52  ? 16.918  1.239   -25.994 1.00 0.00  ? 52  PRO A HB3    2  
ATOM   3308  H HG2    . PRO A 1 52  ? 16.400  0.315   -28.439 1.00 0.00  ? 52  PRO A HG2    2  
ATOM   3309  H HG3    . PRO A 1 52  ? 15.896  -0.577  -26.994 1.00 0.00  ? 52  PRO A HG3    2  
ATOM   3310  H HD2    . PRO A 1 52  ? 14.263  1.020   -28.893 1.00 0.00  ? 52  PRO A HD2    2  
ATOM   3311  H HD3    . PRO A 1 52  ? 13.823  -0.422  -27.960 1.00 0.00  ? 52  PRO A HD3    2  
ATOM   3312  N N      . GLY A 1 53  ? 14.992  4.138   -26.788 1.00 0.00  ? 53  GLY A N      2  
ATOM   3313  C CA     . GLY A 1 53  ? 14.976  5.586   -26.669 1.00 0.00  ? 53  GLY A CA     2  
ATOM   3314  C C      . GLY A 1 53  ? 13.596  6.192   -26.855 1.00 0.00  ? 53  GLY A C      2  
ATOM   3315  O O      . GLY A 1 53  ? 13.474  7.386   -27.127 1.00 0.00  ? 53  GLY A O      2  
ATOM   3316  H H      . GLY A 1 53  ? 15.155  3.719   -27.660 1.00 0.00  ? 53  GLY A H      2  
ATOM   3317  H HA2    . GLY A 1 53  ? 15.342  5.855   -25.690 1.00 0.00  ? 53  GLY A HA2    2  
ATOM   3318  H HA3    . GLY A 1 53  ? 15.640  6.001   -27.415 1.00 0.00  ? 53  GLY A HA3    2  
ATOM   3319  N N      . GLU A 1 54  ? 12.555  5.379   -26.704 1.00 0.00  ? 54  GLU A N      2  
ATOM   3320  C CA     . GLU A 1 54  ? 11.188  5.867   -26.855 1.00 0.00  ? 54  GLU A CA     2  
ATOM   3321  C C      . GLU A 1 54  ? 10.636  6.345   -25.521 1.00 0.00  ? 54  GLU A C      2  
ATOM   3322  O O      . GLU A 1 54  ? 11.139  5.977   -24.461 1.00 0.00  ? 54  GLU A O      2  
ATOM   3323  C CB     . GLU A 1 54  ? 10.279  4.774   -27.416 1.00 0.00  ? 54  GLU A CB     2  
ATOM   3324  C CG     . GLU A 1 54  ? 8.939   5.298   -27.902 1.00 0.00  ? 54  GLU A CG     2  
ATOM   3325  C CD     . GLU A 1 54  ? 8.192   4.292   -28.757 1.00 0.00  ? 54  GLU A CD     2  
ATOM   3326  O OE1    . GLU A 1 54  ? 8.274   3.082   -28.459 1.00 0.00  ? 54  GLU A OE1    2  
ATOM   3327  O OE2    . GLU A 1 54  ? 7.526   4.716   -29.725 1.00 0.00  ? 54  GLU A OE2    2  
ATOM   3328  H H      . GLU A 1 54  ? 12.707  4.438   -26.482 1.00 0.00  ? 54  GLU A H      2  
ATOM   3329  H HA     . GLU A 1 54  ? 11.206  6.697   -27.544 1.00 0.00  ? 54  GLU A HA     2  
ATOM   3330  H HB2    . GLU A 1 54  ? 10.774  4.298   -28.245 1.00 0.00  ? 54  GLU A HB2    2  
ATOM   3331  H HB3    . GLU A 1 54  ? 10.095  4.041   -26.646 1.00 0.00  ? 54  GLU A HB3    2  
ATOM   3332  H HG2    . GLU A 1 54  ? 8.331   5.541   -27.045 1.00 0.00  ? 54  GLU A HG2    2  
ATOM   3333  H HG3    . GLU A 1 54  ? 9.107   6.191   -28.488 1.00 0.00  ? 54  GLU A HG3    2  
ATOM   3334  H HE2    . GLU A 1 54  ? 7.079   4.026   -30.223 1.00 0.00  ? 54  GLU A HE2    2  
ATOM   3335  N N      . ASP A 1 55  ? 9.588   7.158   -25.579 1.00 0.00  ? 55  ASP A N      2  
ATOM   3336  C CA     . ASP A 1 55  ? 8.963   7.670   -24.370 1.00 0.00  ? 55  ASP A CA     2  
ATOM   3337  C C      . ASP A 1 55  ? 7.941   6.669   -23.846 1.00 0.00  ? 55  ASP A C      2  
ATOM   3338  O O      . ASP A 1 55  ? 7.506   5.774   -24.571 1.00 0.00  ? 55  ASP A O      2  
ATOM   3339  C CB     . ASP A 1 55  ? 8.289   9.011   -24.653 1.00 0.00  ? 55  ASP A CB     2  
ATOM   3340  C CG     . ASP A 1 55  ? 7.496   9.536   -23.469 1.00 0.00  ? 55  ASP A CG     2  
ATOM   3341  O OD1    . ASP A 1 55  ? 8.021   9.494   -22.337 1.00 0.00  ? 55  ASP A OD1    2  
ATOM   3342  O OD2    . ASP A 1 55  ? 6.349   9.988   -23.675 1.00 0.00  ? 55  ASP A OD2    2  
ATOM   3343  H H      . ASP A 1 55  ? 9.219   7.411   -26.453 1.00 0.00  ? 55  ASP A H      2  
ATOM   3344  H HA     . ASP A 1 55  ? 9.733   7.809   -23.627 1.00 0.00  ? 55  ASP A HA     2  
ATOM   3345  H HB2    . ASP A 1 55  ? 9.038   9.739   -24.909 1.00 0.00  ? 55  ASP A HB2    2  
ATOM   3346  H HB3    . ASP A 1 55  ? 7.621   8.890   -25.482 1.00 0.00  ? 55  ASP A HB3    2  
ATOM   3347  H HD2    . ASP A 1 55  ? 5.906   10.301  -22.884 1.00 0.00  ? 55  ASP A HD2    2  
ATOM   3348  N N      . ASP A 1 56  ? 7.560   6.828   -22.591 1.00 0.00  ? 56  ASP A N      2  
ATOM   3349  C CA     . ASP A 1 56  ? 6.587   5.938   -21.971 1.00 0.00  ? 56  ASP A CA     2  
ATOM   3350  C C      . ASP A 1 56  ? 5.185   6.198   -22.525 1.00 0.00  ? 56  ASP A C      2  
ATOM   3351  O O      . ASP A 1 56  ? 4.574   5.325   -23.149 1.00 0.00  ? 56  ASP A O      2  
ATOM   3352  C CB     . ASP A 1 56  ? 6.601   6.131   -20.454 1.00 0.00  ? 56  ASP A CB     2  
ATOM   3353  C CG     . ASP A 1 56  ? 7.203   4.949   -19.721 1.00 0.00  ? 56  ASP A CG     2  
ATOM   3354  O OD1    . ASP A 1 56  ? 7.897   5.171   -18.706 1.00 0.00  ? 56  ASP A OD1    2  
ATOM   3355  O OD2    . ASP A 1 56  ? 6.980   3.800   -20.158 1.00 0.00  ? 56  ASP A OD2    2  
ATOM   3356  H H      . ASP A 1 56  ? 7.942   7.563   -22.065 1.00 0.00  ? 56  ASP A H      2  
ATOM   3357  H HA     . ASP A 1 56  ? 6.872   4.918   -22.202 1.00 0.00  ? 56  ASP A HA     2  
ATOM   3358  H HB2    . ASP A 1 56  ? 7.180   7.010   -20.216 1.00 0.00  ? 56  ASP A HB2    2  
ATOM   3359  H HB3    . ASP A 1 56  ? 5.591   6.271   -20.107 1.00 0.00  ? 56  ASP A HB3    2  
ATOM   3360  H HD2    . ASP A 1 56  ? 7.391   3.100   -19.645 1.00 0.00  ? 56  ASP A HD2    2  
ATOM   3361  N N      . LEU A 1 57  ? 4.677   7.405   -22.293 1.00 0.00  ? 57  LEU A N      2  
ATOM   3362  C CA     . LEU A 1 57  ? 3.347   7.776   -22.765 1.00 0.00  ? 57  LEU A CA     2  
ATOM   3363  C C      . LEU A 1 57  ? 3.265   7.726   -24.286 1.00 0.00  ? 57  LEU A C      2  
ATOM   3364  O O      . LEU A 1 57  ? 2.279   7.246   -24.845 1.00 0.00  ? 57  LEU A O      2  
ATOM   3365  C CB     . LEU A 1 57  ? 2.967   9.174   -22.274 1.00 0.00  ? 57  LEU A CB     2  
ATOM   3366  C CG     . LEU A 1 57  ? 1.614   9.685   -22.776 1.00 0.00  ? 57  LEU A CG     2  
ATOM   3367  C CD1    . LEU A 1 57  ? 0.527   8.647   -22.545 1.00 0.00  ? 57  LEU A CD1    2  
ATOM   3368  C CD2    . LEU A 1 57  ? 1.249   10.998  -22.101 1.00 0.00  ? 57  LEU A CD2    2  
ATOM   3369  H H      . LEU A 1 57  ? 5.207   8.060   -21.791 1.00 0.00  ? 57  LEU A H      2  
ATOM   3370  H HA     . LEU A 1 57  ? 2.646   7.063   -22.358 1.00 0.00  ? 57  LEU A HA     2  
ATOM   3371  H HB2    . LEU A 1 57  ? 2.949   9.163   -21.194 1.00 0.00  ? 57  LEU A HB2    2  
ATOM   3372  H HB3    . LEU A 1 57  ? 3.730   9.866   -22.596 1.00 0.00  ? 57  LEU A HB3    2  
ATOM   3373  H HG     . LEU A 1 57  ? 1.681   9.863   -23.838 1.00 0.00  ? 57  LEU A HG     2  
ATOM   3374  H HD11   . LEU A 1 57  ? -0.375  8.949   -23.056 1.00 0.00  ? 57  LEU A HD11   2  
ATOM   3375  H HD12   . LEU A 1 57  ? 0.329   8.562   -21.486 1.00 0.00  ? 57  LEU A HD12   2  
ATOM   3376  H HD13   . LEU A 1 57  ? 0.852   7.691   -22.928 1.00 0.00  ? 57  LEU A HD13   2  
ATOM   3377  H HD21   . LEU A 1 57  ? 1.272   10.871  -21.031 1.00 0.00  ? 57  LEU A HD21   2  
ATOM   3378  H HD22   . LEU A 1 57  ? 0.256   11.294  -22.409 1.00 0.00  ? 57  LEU A HD22   2  
ATOM   3379  H HD23   . LEU A 1 57  ? 1.958   11.760  -22.391 1.00 0.00  ? 57  LEU A HD23   2  
ATOM   3380  N N      . GLU A 1 58  ? 4.300   8.226   -24.954 1.00 0.00  ? 58  GLU A N      2  
ATOM   3381  C CA     . GLU A 1 58  ? 4.333   8.236   -26.415 1.00 0.00  ? 58  GLU A CA     2  
ATOM   3382  C C      . GLU A 1 58  ? 4.007   6.856   -26.965 1.00 0.00  ? 58  GLU A C      2  
ATOM   3383  O O      . GLU A 1 58  ? 3.185   6.718   -27.868 1.00 0.00  ? 58  GLU A O      2  
ATOM   3384  C CB     . GLU A 1 58  ? 5.709   8.678   -26.914 1.00 0.00  ? 58  GLU A CB     2  
ATOM   3385  C CG     . GLU A 1 58  ? 5.799   10.157  -27.248 1.00 0.00  ? 58  GLU A CG     2  
ATOM   3386  C CD     . GLU A 1 58  ? 7.081   10.799  -26.756 1.00 0.00  ? 58  GLU A CD     2  
ATOM   3387  O OE1    . GLU A 1 58  ? 7.001   11.720  -25.916 1.00 0.00  ? 58  GLU A OE1    2  
ATOM   3388  O OE2    . GLU A 1 58  ? 8.167   10.380  -27.210 1.00 0.00  ? 58  GLU A OE2    2  
ATOM   3389  H H      . GLU A 1 58  ? 5.058   8.596   -24.454 1.00 0.00  ? 58  GLU A H      2  
ATOM   3390  H HA     . GLU A 1 58  ? 3.587   8.938   -26.763 1.00 0.00  ? 58  GLU A HA     2  
ATOM   3391  H HB2    . GLU A 1 58  ? 6.434   8.457   -26.151 1.00 0.00  ? 58  GLU A HB2    2  
ATOM   3392  H HB3    . GLU A 1 58  ? 5.957   8.115   -27.800 1.00 0.00  ? 58  GLU A HB3    2  
ATOM   3393  H HG2    . GLU A 1 58  ? 5.753   10.270  -28.318 1.00 0.00  ? 58  GLU A HG2    2  
ATOM   3394  H HG3    . GLU A 1 58  ? 4.961   10.667  -26.796 1.00 0.00  ? 58  GLU A HG3    2  
ATOM   3395  H HE2    . GLU A 1 58  ? 8.937   10.830  -26.855 1.00 0.00  ? 58  GLU A HE2    2  
ATOM   3396  N N      . THR A 1 59  ? 4.638   5.829   -26.404 1.00 0.00  ? 59  THR A N      2  
ATOM   3397  C CA     . THR A 1 59  ? 4.385   4.462   -26.838 1.00 0.00  ? 59  THR A CA     2  
ATOM   3398  C C      . THR A 1 59  ? 2.895   4.171   -26.756 1.00 0.00  ? 59  THR A C      2  
ATOM   3399  O O      . THR A 1 59  ? 2.330   3.499   -27.619 1.00 0.00  ? 59  THR A O      2  
ATOM   3400  C CB     . THR A 1 59  ? 5.172   3.475   -25.979 1.00 0.00  ? 59  THR A CB     2  
ATOM   3401  O OG1    . THR A 1 59  ? 6.557   3.759   -26.050 1.00 0.00  ? 59  THR A OG1    2  
ATOM   3402  C CG2    . THR A 1 59  ? 4.974   2.031   -26.388 1.00 0.00  ? 59  THR A CG2    2  
ATOM   3403  H H      . THR A 1 59  ? 5.274   5.994   -25.677 1.00 0.00  ? 59  THR A H      2  
ATOM   3404  H HA     . THR A 1 59  ? 4.703   4.373   -27.866 1.00 0.00  ? 59  THR A HA     2  
ATOM   3405  H HB     . THR A 1 59  ? 4.856   3.575   -24.951 1.00 0.00  ? 59  THR A HB     2  
ATOM   3406  H HG1    . THR A 1 59  ? 6.779   4.429   -25.398 1.00 0.00  ? 59  THR A HG1    2  
ATOM   3407  H HG21   . THR A 1 59  ? 5.536   1.390   -25.727 1.00 0.00  ? 59  THR A HG21   2  
ATOM   3408  H HG22   . THR A 1 59  ? 5.318   1.893   -27.403 1.00 0.00  ? 59  THR A HG22   2  
ATOM   3409  H HG23   . THR A 1 59  ? 3.925   1.780   -26.329 1.00 0.00  ? 59  THR A HG23   2  
ATOM   3410  N N      . ALA A 1 60  ? 2.259   4.712   -25.722 1.00 0.00  ? 60  ALA A N      2  
ATOM   3411  C CA     . ALA A 1 60  ? 0.825   4.541   -25.537 1.00 0.00  ? 60  ALA A CA     2  
ATOM   3412  C C      . ALA A 1 60  ? 0.060   5.477   -26.469 1.00 0.00  ? 60  ALA A C      2  
ATOM   3413  O O      . ALA A 1 60  ? -1.023  5.146   -26.941 1.00 0.00  ? 60  ALA A O      2  
ATOM   3414  C CB     . ALA A 1 60  ? 0.436   4.793   -24.088 1.00 0.00  ? 60  ALA A CB     2  
ATOM   3415  H H      . ALA A 1 60  ? 2.766   5.254   -25.077 1.00 0.00  ? 60  ALA A H      2  
ATOM   3416  H HA     . ALA A 1 60  ? 0.576   3.518   -25.785 1.00 0.00  ? 60  ALA A HA     2  
ATOM   3417  H HB1    . ALA A 1 60  ? -0.560  5.214   -24.049 1.00 0.00  ? 60  ALA A HB1    2  
ATOM   3418  H HB2    . ALA A 1 60  ? 1.137   5.483   -23.641 1.00 0.00  ? 60  ALA A HB2    2  
ATOM   3419  H HB3    . ALA A 1 60  ? 0.452   3.860   -23.545 1.00 0.00  ? 60  ALA A HB3    2  
ATOM   3420  N N      . LEU A 1 61  ? 0.643   6.648   -26.731 1.00 0.00  ? 61  LEU A N      2  
ATOM   3421  C CA     . LEU A 1 61  ? 0.025   7.637   -27.612 1.00 0.00  ? 61  LEU A CA     2  
ATOM   3422  C C      . LEU A 1 61  ? 0.062   7.172   -29.058 1.00 0.00  ? 61  LEU A C      2  
ATOM   3423  O O      . LEU A 1 61  ? -0.963  7.123   -29.738 1.00 0.00  ? 61  LEU A O      2  
ATOM   3424  C CB     . LEU A 1 61  ? 0.768   8.969   -27.506 1.00 0.00  ? 61  LEU A CB     2  
ATOM   3425  C CG     . LEU A 1 61  ? 0.684   9.663   -26.153 1.00 0.00  ? 61  LEU A CG     2  
ATOM   3426  C CD1    . LEU A 1 61  ? 1.548   10.915  -26.162 1.00 0.00  ? 61  LEU A CD1    2  
ATOM   3427  C CD2    . LEU A 1 61  ? -0.760  10.000  -25.810 1.00 0.00  ? 61  LEU A CD2    2  
ATOM   3428  H H      . LEU A 1 61  ? 1.513   6.849   -26.326 1.00 0.00  ? 61  LEU A H      2  
ATOM   3429  H HA     . LEU A 1 61  ? -1.001  7.774   -27.305 1.00 0.00  ? 61  LEU A HA     2  
ATOM   3430  H HB2    . LEU A 1 61  ? 1.809   8.789   -27.728 1.00 0.00  ? 61  LEU A HB2    2  
ATOM   3431  H HB3    . LEU A 1 61  ? 0.371   9.637   -28.253 1.00 0.00  ? 61  LEU A HB3    2  
ATOM   3432  H HG     . LEU A 1 61  ? 1.065   9.001   -25.392 1.00 0.00  ? 61  LEU A HG     2  
ATOM   3433  H HD11   . LEU A 1 61  ? 1.757   11.220  -25.149 1.00 0.00  ? 61  LEU A HD11   2  
ATOM   3434  H HD12   . LEU A 1 61  ? 1.026   11.708  -26.676 1.00 0.00  ? 61  LEU A HD12   2  
ATOM   3435  H HD13   . LEU A 1 61  ? 2.475   10.703  -26.674 1.00 0.00  ? 61  LEU A HD13   2  
ATOM   3436  H HD21   . LEU A 1 61  ? -0.893  11.073  -25.812 1.00 0.00  ? 61  LEU A HD21   2  
ATOM   3437  H HD22   . LEU A 1 61  ? -0.996  9.613   -24.829 1.00 0.00  ? 61  LEU A HD22   2  
ATOM   3438  H HD23   . LEU A 1 61  ? -1.421  9.554   -26.540 1.00 0.00  ? 61  LEU A HD23   2  
ATOM   3439  N N      . ARG A 1 62  ? 1.257   6.826   -29.521 1.00 0.00  ? 62  ARG A N      2  
ATOM   3440  C CA     . ARG A 1 62  ? 1.442   6.354   -30.884 1.00 0.00  ? 62  ARG A CA     2  
ATOM   3441  C C      . ARG A 1 62  ? 0.651   5.073   -31.104 1.00 0.00  ? 62  ARG A C      2  
ATOM   3442  O O      . ARG A 1 62  ? 0.051   4.871   -32.158 1.00 0.00  ? 62  ARG A O      2  
ATOM   3443  C CB     . ARG A 1 62  ? 2.927   6.123   -31.169 1.00 0.00  ? 62  ARG A CB     2  
ATOM   3444  C CG     . ARG A 1 62  ? 3.534   7.159   -32.103 1.00 0.00  ? 62  ARG A CG     2  
ATOM   3445  C CD     . ARG A 1 62  ? 4.637   6.557   -32.958 1.00 0.00  ? 62  ARG A CD     2  
ATOM   3446  N NE     . ARG A 1 62  ? 4.104   5.867   -34.132 1.00 0.00  ? 62  ARG A NE     2  
ATOM   3447  C CZ     . ARG A 1 62  ? 4.070   6.392   -35.357 1.00 0.00  ? 62  ARG A CZ     2  
ATOM   3448  N NH1    . ARG A 1 62  ? 4.528   7.617   -35.582 1.00 0.00  ? 62  ARG A NH1    2  
ATOM   3449  N NH2    . ARG A 1 62  ? 3.572   5.685   -36.362 1.00 0.00  ? 62  ARG A NH2    2  
ATOM   3450  H H      . ARG A 1 62  ? 2.034   6.890   -28.924 1.00 0.00  ? 62  ARG A H      2  
ATOM   3451  H HA     . ARG A 1 62  ? 1.066   7.116   -31.553 1.00 0.00  ? 62  ARG A HA     2  
ATOM   3452  H HB2    . ARG A 1 62  ? 3.468   6.153   -30.235 1.00 0.00  ? 62  ARG A HB2    2  
ATOM   3453  H HB3    . ARG A 1 62  ? 3.051   5.148   -31.617 1.00 0.00  ? 62  ARG A HB3    2  
ATOM   3454  H HG2    . ARG A 1 62  ? 2.761   7.544   -32.751 1.00 0.00  ? 62  ARG A HG2    2  
ATOM   3455  H HG3    . ARG A 1 62  ? 3.947   7.962   -31.513 1.00 0.00  ? 62  ARG A HG3    2  
ATOM   3456  H HD2    . ARG A 1 62  ? 5.298   7.346   -33.280 1.00 0.00  ? 62  ARG A HD2    2  
ATOM   3457  H HD3    . ARG A 1 62  ? 5.191   5.850   -32.358 1.00 0.00  ? 62  ARG A HD3    2  
ATOM   3458  H HE     . ARG A 1 62  ? 3.753   4.962   -34.002 1.00 0.00  ? 62  ARG A HE     2  
ATOM   3459  H HH11   . ARG A 1 62  ? 4.902   8.159   -34.833 1.00 0.00  ? 62  ARG A HH11   2  
ATOM   3460  H HH12   . ARG A 1 62  ? 4.499   7.998   -36.507 1.00 0.00  ? 62  ARG A HH12   2  
ATOM   3461  H HH21   . ARG A 1 62  ? 3.222   4.763   -36.200 1.00 0.00  ? 62  ARG A HH21   2  
ATOM   3462  H HH22   . ARG A 1 62  ? 3.546   6.074   -37.283 1.00 0.00  ? 62  ARG A HH22   2  
ATOM   3463  N N      . ALA A 1 63  ? 0.640   4.217   -30.087 1.00 0.00  ? 63  ALA A N      2  
ATOM   3464  C CA     . ALA A 1 63  ? -0.092  2.964   -30.159 1.00 0.00  ? 63  ALA A CA     2  
ATOM   3465  C C      . ALA A 1 63  ? -1.586  3.238   -30.275 1.00 0.00  ? 63  ALA A C      2  
ATOM   3466  O O      . ALA A 1 63  ? -2.316  2.499   -30.938 1.00 0.00  ? 63  ALA A O      2  
ATOM   3467  C CB     . ALA A 1 63  ? 0.199   2.106   -28.939 1.00 0.00  ? 63  ALA A CB     2  
ATOM   3468  H H      . ALA A 1 63  ? 1.128   4.441   -29.267 1.00 0.00  ? 63  ALA A H      2  
ATOM   3469  H HA     . ALA A 1 63  ? 0.239   2.429   -31.038 1.00 0.00  ? 63  ALA A HA     2  
ATOM   3470  H HB1    . ALA A 1 63  ? -0.108  2.632   -28.048 1.00 0.00  ? 63  ALA A HB1    2  
ATOM   3471  H HB2    . ALA A 1 63  ? 1.258   1.898   -28.890 1.00 0.00  ? 63  ALA A HB2    2  
ATOM   3472  H HB3    . ALA A 1 63  ? -0.347  1.179   -29.015 1.00 0.00  ? 63  ALA A HB3    2  
ATOM   3473  N N      . THR A 1 64  ? -2.033  4.314   -29.631 1.00 0.00  ? 64  THR A N      2  
ATOM   3474  C CA     . THR A 1 64  ? -3.437  4.701   -29.667 1.00 0.00  ? 64  THR A CA     2  
ATOM   3475  C C      . THR A 1 64  ? -3.886  4.936   -31.103 1.00 0.00  ? 64  THR A C      2  
ATOM   3476  O O      . THR A 1 64  ? -4.882  4.374   -31.553 1.00 0.00  ? 64  THR A O      2  
ATOM   3477  C CB     . THR A 1 64  ? -3.668  5.959   -28.827 1.00 0.00  ? 64  THR A CB     2  
ATOM   3478  O OG1    . THR A 1 64  ? -3.287  5.743   -27.479 1.00 0.00  ? 64  THR A OG1    2  
ATOM   3479  C CG2    . THR A 1 64  ? -5.109  6.419   -28.818 1.00 0.00  ? 64  THR A CG2    2  
ATOM   3480  H H      . THR A 1 64  ? -1.398  4.864   -29.127 1.00 0.00  ? 64  THR A H      2  
ATOM   3481  H HA     . THR A 1 64  ? -4.014  3.893   -29.250 1.00 0.00  ? 64  THR A HA     2  
ATOM   3482  H HB     . THR A 1 64  ? -3.069  6.763   -29.226 1.00 0.00  ? 64  THR A HB     2  
ATOM   3483  H HG1    . THR A 1 64  ? -2.571  5.105   -27.443 1.00 0.00  ? 64  THR A HG1    2  
ATOM   3484  H HG21   . THR A 1 64  ? -5.525  6.317   -29.809 1.00 0.00  ? 64  THR A HG21   2  
ATOM   3485  H HG22   . THR A 1 64  ? -5.153  7.453   -28.512 1.00 0.00  ? 64  THR A HG22   2  
ATOM   3486  H HG23   . THR A 1 64  ? -5.672  5.813   -28.125 1.00 0.00  ? 64  THR A HG23   2  
ATOM   3487  N N      . GLN A 1 65  ? -3.139  5.761   -31.824 1.00 0.00  ? 65  GLN A N      2  
ATOM   3488  C CA     . GLN A 1 65  ? -3.460  6.055   -33.213 1.00 0.00  ? 65  GLN A CA     2  
ATOM   3489  C C      . GLN A 1 65  ? -3.147  4.859   -34.110 1.00 0.00  ? 65  GLN A C      2  
ATOM   3490  O O      . GLN A 1 65  ? -3.682  4.746   -35.213 1.00 0.00  ? 65  GLN A O      2  
ATOM   3491  C CB     . GLN A 1 65  ? -2.707  7.297   -33.693 1.00 0.00  ? 65  GLN A CB     2  
ATOM   3492  C CG     . GLN A 1 65  ? -1.200  7.112   -33.757 1.00 0.00  ? 65  GLN A CG     2  
ATOM   3493  C CD     . GLN A 1 65  ? -0.594  7.693   -35.019 1.00 0.00  ? 65  GLN A CD     2  
ATOM   3494  O OE1    . GLN A 1 65  ? 0.248   7.067   -35.662 1.00 0.00  ? 65  GLN A OE1    2  
ATOM   3495  N NE2    . GLN A 1 65  ? -1.021  8.898   -35.382 1.00 0.00  ? 65  GLN A NE2    2  
ATOM   3496  H H      . GLN A 1 65  ? -2.348  6.176   -31.416 1.00 0.00  ? 65  GLN A H      2  
ATOM   3497  H HA     . GLN A 1 65  ? -4.517  6.248   -33.263 1.00 0.00  ? 65  GLN A HA     2  
ATOM   3498  H HB2    . GLN A 1 65  ? -3.059  7.555   -34.681 1.00 0.00  ? 65  GLN A HB2    2  
ATOM   3499  H HB3    . GLN A 1 65  ? -2.923  8.115   -33.020 1.00 0.00  ? 65  GLN A HB3    2  
ATOM   3500  H HG2    . GLN A 1 65  ? -0.754  7.599   -32.903 1.00 0.00  ? 65  GLN A HG2    2  
ATOM   3501  H HG3    . GLN A 1 65  ? -0.980  6.055   -33.724 1.00 0.00  ? 65  GLN A HG3    2  
ATOM   3502  H HE21   . GLN A 1 65  ? -1.696  9.337   -34.820 1.00 0.00  ? 65  GLN A HE21   2  
ATOM   3503  H HE22   . GLN A 1 65  ? -0.648  9.297   -36.194 1.00 0.00  ? 65  GLN A HE22   2  
ATOM   3504  N N      . GLU A 1 66  ? -2.282  3.970   -33.633 1.00 0.00  ? 66  GLU A N      2  
ATOM   3505  C CA     . GLU A 1 66  ? -1.907  2.786   -34.399 1.00 0.00  ? 66  GLU A CA     2  
ATOM   3506  C C      . GLU A 1 66  ? -2.986  1.709   -34.313 1.00 0.00  ? 66  GLU A C      2  
ATOM   3507  O O      . GLU A 1 66  ? -3.309  1.061   -35.308 1.00 0.00  ? 66  GLU A O      2  
ATOM   3508  C CB     . GLU A 1 66  ? -0.573  2.229   -33.900 1.00 0.00  ? 66  GLU A CB     2  
ATOM   3509  C CG     . GLU A 1 66  ? 0.637   2.951   -34.469 1.00 0.00  ? 66  GLU A CG     2  
ATOM   3510  C CD     . GLU A 1 66  ? 0.664   2.939   -35.984 1.00 0.00  ? 66  GLU A CD     2  
ATOM   3511  O OE1    . GLU A 1 66  ? -0.019  3.787   -36.598 1.00 0.00  ? 66  GLU A OE1    2  
ATOM   3512  O OE2    . GLU A 1 66  ? 1.368   2.083   -36.558 1.00 0.00  ? 66  GLU A OE2    2  
ATOM   3513  H H      . GLU A 1 66  ? -1.887  4.110   -32.748 1.00 0.00  ? 66  GLU A H      2  
ATOM   3514  H HA     . GLU A 1 66  ? -1.797  3.083   -35.432 1.00 0.00  ? 66  GLU A HA     2  
ATOM   3515  H HB2    . GLU A 1 66  ? -0.542  2.309   -32.825 1.00 0.00  ? 66  GLU A HB2    2  
ATOM   3516  H HB3    . GLU A 1 66  ? -0.506  1.187   -34.178 1.00 0.00  ? 66  GLU A HB3    2  
ATOM   3517  H HG2    . GLU A 1 66  ? 0.617   3.978   -34.133 1.00 0.00  ? 66  GLU A HG2    2  
ATOM   3518  H HG3    . GLU A 1 66  ? 1.532   2.471   -34.103 1.00 0.00  ? 66  GLU A HG3    2  
ATOM   3519  H HE2    . GLU A 1 66  ? 1.338   2.133   -37.516 1.00 0.00  ? 66  GLU A HE2    2  
ATOM   3520  N N      . GLU A 1 67  ? -3.541  1.519   -33.117 1.00 0.00  ? 67  GLU A N      2  
ATOM   3521  C CA     . GLU A 1 67  ? -4.581  0.514   -32.914 1.00 0.00  ? 67  GLU A CA     2  
ATOM   3522  C C      . GLU A 1 67  ? -5.954  1.158   -32.702 1.00 0.00  ? 67  GLU A C      2  
ATOM   3523  O O      . GLU A 1 67  ? -6.930  0.467   -32.406 1.00 0.00  ? 67  GLU A O      2  
ATOM   3524  C CB     . GLU A 1 67  ? -4.230  -0.378  -31.721 1.00 0.00  ? 67  GLU A CB     2  
ATOM   3525  C CG     . GLU A 1 67  ? -3.569  -1.690  -32.122 1.00 0.00  ? 67  GLU A CG     2  
ATOM   3526  C CD     . GLU A 1 67  ? -2.846  -2.359  -30.970 1.00 0.00  ? 67  GLU A CD     2  
ATOM   3527  O OE1    . GLU A 1 67  ? -2.036  -3.273  -31.228 1.00 0.00  ? 67  GLU A OE1    2  
ATOM   3528  O OE2    . GLU A 1 67  ? -3.090  -1.967  -29.807 1.00 0.00  ? 67  GLU A OE2    2  
ATOM   3529  H H      . GLU A 1 67  ? -3.244  2.061   -32.358 1.00 0.00  ? 67  GLU A H      2  
ATOM   3530  H HA     . GLU A 1 67  ? -4.623  -0.097  -33.802 1.00 0.00  ? 67  GLU A HA     2  
ATOM   3531  H HB2    . GLU A 1 67  ? -3.555  0.157   -31.072 1.00 0.00  ? 67  GLU A HB2    2  
ATOM   3532  H HB3    . GLU A 1 67  ? -5.133  -0.607  -31.177 1.00 0.00  ? 67  GLU A HB3    2  
ATOM   3533  H HG2    . GLU A 1 67  ? -4.330  -2.363  -32.488 1.00 0.00  ? 67  GLU A HG2    2  
ATOM   3534  H HG3    . GLU A 1 67  ? -2.857  -1.491  -32.909 1.00 0.00  ? 67  GLU A HG3    2  
ATOM   3535  H HE2    . GLU A 1 67  ? -2.597  -2.434  -29.128 1.00 0.00  ? 67  GLU A HE2    2  
ATOM   3536  N N      . ALA A 1 68  ? -6.030  2.479   -32.860 1.00 0.00  ? 68  ALA A N      2  
ATOM   3537  C CA     . ALA A 1 68  ? -7.293  3.194   -32.690 1.00 0.00  ? 68  ALA A CA     2  
ATOM   3538  C C      . ALA A 1 68  ? -7.392  4.417   -33.595 1.00 0.00  ? 68  ALA A C      2  
ATOM   3539  O O      . ALA A 1 68  ? -8.445  5.044   -33.677 1.00 0.00  ? 68  ALA A O      2  
ATOM   3540  C CB     . ALA A 1 68  ? -7.481  3.618   -31.245 1.00 0.00  ? 68  ALA A CB     2  
ATOM   3541  H H      . ALA A 1 68  ? -5.224  2.979   -33.097 1.00 0.00  ? 68  ALA A H      2  
ATOM   3542  H HA     . ALA A 1 68  ? -8.094  2.513   -32.941 1.00 0.00  ? 68  ALA A HA     2  
ATOM   3543  H HB1    . ALA A 1 68  ? -8.317  3.082   -30.820 1.00 0.00  ? 68  ALA A HB1    2  
ATOM   3544  H HB2    . ALA A 1 68  ? -7.679  4.682   -31.208 1.00 0.00  ? 68  ALA A HB2    2  
ATOM   3545  H HB3    . ALA A 1 68  ? -6.588  3.398   -30.686 1.00 0.00  ? 68  ALA A HB3    2  
ATOM   3546  N N      . GLY A 1 69  ? -6.307  4.767   -34.272 1.00 0.00  ? 69  GLY A N      2  
ATOM   3547  C CA     . GLY A 1 69  ? -6.337  5.920   -35.149 1.00 0.00  ? 69  GLY A CA     2  
ATOM   3548  C C      . GLY A 1 69  ? -6.410  7.244   -34.399 1.00 0.00  ? 69  GLY A C      2  
ATOM   3549  O O      . GLY A 1 69  ? -6.397  8.308   -35.016 1.00 0.00  ? 69  GLY A O      2  
ATOM   3550  H H      . GLY A 1 69  ? -5.486  4.246   -34.180 1.00 0.00  ? 69  GLY A H      2  
ATOM   3551  H HA2    . GLY A 1 69  ? -5.451  5.916   -35.764 1.00 0.00  ? 69  GLY A HA2    2  
ATOM   3552  H HA3    . GLY A 1 69  ? -7.202  5.838   -35.788 1.00 0.00  ? 69  GLY A HA3    2  
ATOM   3553  N N      . ILE A 1 70  ? -6.477  7.184   -33.067 1.00 0.00  ? 70  ILE A N      2  
ATOM   3554  C CA     . ILE A 1 70  ? -6.542  8.395   -32.255 1.00 0.00  ? 70  ILE A CA     2  
ATOM   3555  C C      . ILE A 1 70  ? -5.177  8.721   -31.658 1.00 0.00  ? 70  ILE A C      2  
ATOM   3556  O O      . ILE A 1 70  ? -4.543  7.873   -31.033 1.00 0.00  ? 70  ILE A O      2  
ATOM   3557  C CB     . ILE A 1 70  ? -7.581  8.283   -31.117 1.00 0.00  ? 70  ILE A CB     2  
ATOM   3558  C CG1    . ILE A 1 70  ? -8.820  7.504   -31.572 1.00 0.00  ? 70  ILE A CG1    2  
ATOM   3559  C CG2    . ILE A 1 70  ? -7.983  9.671   -30.645 1.00 0.00  ? 70  ILE A CG2    2  
ATOM   3560  C CD1    . ILE A 1 70  ? -9.570  6.842   -30.434 1.00 0.00  ? 70  ILE A CD1    2  
ATOM   3561  H H      . ILE A 1 70  ? -6.477  6.314   -32.622 1.00 0.00  ? 70  ILE A H      2  
ATOM   3562  H HA     . ILE A 1 70  ? -6.835  9.205   -32.902 1.00 0.00  ? 70  ILE A HA     2  
ATOM   3563  H HB     . ILE A 1 70  ? -7.121  7.765   -30.289 1.00 0.00  ? 70  ILE A HB     2  
ATOM   3564  H HG12   . ILE A 1 70  ? -9.501  8.181   -32.063 1.00 0.00  ? 70  ILE A HG12   2  
ATOM   3565  H HG13   . ILE A 1 70  ? -8.524  6.734   -32.266 1.00 0.00  ? 70  ILE A HG13   2  
ATOM   3566  H HG21   . ILE A 1 70  ? -7.098  10.269  -30.487 1.00 0.00  ? 70  ILE A HG21   2  
ATOM   3567  H HG22   . ILE A 1 70  ? -8.531  9.593   -29.720 1.00 0.00  ? 70  ILE A HG22   2  
ATOM   3568  H HG23   . ILE A 1 70  ? -8.605  10.140  -31.393 1.00 0.00  ? 70  ILE A HG23   2  
ATOM   3569  H HD11   . ILE A 1 70  ? -10.628 7.029   -30.545 1.00 0.00  ? 70  ILE A HD11   2  
ATOM   3570  H HD12   . ILE A 1 70  ? -9.230  7.247   -29.494 1.00 0.00  ? 70  ILE A HD12   2  
ATOM   3571  H HD13   . ILE A 1 70  ? -9.390  5.777   -30.455 1.00 0.00  ? 70  ILE A HD13   2  
ATOM   3572  N N      . GLU A 1 71  ? -4.727  9.955   -31.863 1.00 0.00  ? 71  GLU A N      2  
ATOM   3573  C CA     . GLU A 1 71  ? -3.431  10.394  -31.353 1.00 0.00  ? 71  GLU A CA     2  
ATOM   3574  C C      . GLU A 1 71  ? -3.599  11.370  -30.191 1.00 0.00  ? 71  GLU A C      2  
ATOM   3575  O O      . GLU A 1 71  ? -4.688  11.885  -29.954 1.00 0.00  ? 71  GLU A O      2  
ATOM   3576  C CB     . GLU A 1 71  ? -2.619  11.050  -32.469 1.00 0.00  ? 71  GLU A CB     2  
ATOM   3577  C CG     . GLU A 1 71  ? -3.234  12.339  -32.984 1.00 0.00  ? 71  GLU A CG     2  
ATOM   3578  C CD     . GLU A 1 71  ? -4.006  12.141  -34.275 1.00 0.00  ? 71  GLU A CD     2  
ATOM   3579  O OE1    . GLU A 1 71  ? -3.488  12.529  -35.342 1.00 0.00  ? 71  GLU A OE1    2  
ATOM   3580  O OE2    . GLU A 1 71  ? -5.129  11.596  -34.216 1.00 0.00  ? 71  GLU A OE2    2  
ATOM   3581  H H      . GLU A 1 71  ? -5.277  10.583  -32.373 1.00 0.00  ? 71  GLU A H      2  
ATOM   3582  H HA     . GLU A 1 71  ? -2.902  9.523   -31.000 1.00 0.00  ? 71  GLU A HA     2  
ATOM   3583  H HB2    . GLU A 1 71  ? -1.630  11.268  -32.099 1.00 0.00  ? 71  GLU A HB2    2  
ATOM   3584  H HB3    . GLU A 1 71  ? -2.540  10.358  -33.295 1.00 0.00  ? 71  GLU A HB3    2  
ATOM   3585  H HG2    . GLU A 1 71  ? -3.906  12.726  -32.233 1.00 0.00  ? 71  GLU A HG2    2  
ATOM   3586  H HG3    . GLU A 1 71  ? -2.443  13.054  -33.161 1.00 0.00  ? 71  GLU A HG3    2  
ATOM   3587  H HE2    . GLU A 1 71  ? -5.560  11.501  -35.068 1.00 0.00  ? 71  GLU A HE2    2  
ATOM   3588  N N      . ALA A 1 72  ? -2.505  11.620  -29.473 1.00 0.00  ? 72  ALA A N      2  
ATOM   3589  C CA     . ALA A 1 72  ? -2.524  12.537  -28.333 1.00 0.00  ? 72  ALA A CA     2  
ATOM   3590  C C      . ALA A 1 72  ? -3.245  13.838  -28.667 1.00 0.00  ? 72  ALA A C      2  
ATOM   3591  O O      . ALA A 1 72  ? -3.912  14.424  -27.814 1.00 0.00  ? 72  ALA A O      2  
ATOM   3592  C CB     . ALA A 1 72  ? -1.109  12.817  -27.865 1.00 0.00  ? 72  ALA A CB     2  
ATOM   3593  H H      . ALA A 1 72  ? -1.664  11.177  -29.714 1.00 0.00  ? 72  ALA A H      2  
ATOM   3594  H HA     . ALA A 1 72  ? -3.045  12.050  -27.527 1.00 0.00  ? 72  ALA A HA     2  
ATOM   3595  H HB1    . ALA A 1 72  ? -0.605  11.881  -27.674 1.00 0.00  ? 72  ALA A HB1    2  
ATOM   3596  H HB2    . ALA A 1 72  ? -1.140  13.400  -26.956 1.00 0.00  ? 72  ALA A HB2    2  
ATOM   3597  H HB3    . ALA A 1 72  ? -0.577  13.364  -28.629 1.00 0.00  ? 72  ALA A HB3    2  
ATOM   3598  N N      . GLY A 1 73  ? -3.113  14.285  -29.912 1.00 0.00  ? 73  GLY A N      2  
ATOM   3599  C CA     . GLY A 1 73  ? -3.766  15.512  -30.328 1.00 0.00  ? 73  GLY A CA     2  
ATOM   3600  C C      . GLY A 1 73  ? -5.271  15.359  -30.422 1.00 0.00  ? 73  GLY A C      2  
ATOM   3601  O O      . GLY A 1 73  ? -6.011  16.338  -30.323 1.00 0.00  ? 73  GLY A O      2  
ATOM   3602  H H      . GLY A 1 73  ? -2.572  13.775  -30.552 1.00 0.00  ? 73  GLY A H      2  
ATOM   3603  H HA2    . GLY A 1 73  ? -3.537  16.290  -29.613 1.00 0.00  ? 73  GLY A HA2    2  
ATOM   3604  H HA3    . GLY A 1 73  ? -3.383  15.802  -31.296 1.00 0.00  ? 73  GLY A HA3    2  
ATOM   3605  N N      . GLN A 1 74  ? -5.725  14.123  -30.608 1.00 0.00  ? 74  GLN A N      2  
ATOM   3606  C CA     . GLN A 1 74  ? -7.152  13.837  -30.712 1.00 0.00  ? 74  GLN A CA     2  
ATOM   3607  C C      . GLN A 1 74  ? -7.739  13.451  -29.356 1.00 0.00  ? 74  GLN A C      2  
ATOM   3608  O O      . GLN A 1 74  ? -8.952  13.302  -29.223 1.00 0.00  ? 74  GLN A O      2  
ATOM   3609  C CB     . GLN A 1 74  ? -7.394  12.714  -31.723 1.00 0.00  ? 74  GLN A CB     2  
ATOM   3610  C CG     . GLN A 1 74  ? -7.781  13.209  -33.107 1.00 0.00  ? 74  GLN A CG     2  
ATOM   3611  C CD     . GLN A 1 74  ? -9.175  13.800  -33.143 1.00 0.00  ? 74  GLN A CD     2  
ATOM   3612  O OE1    . GLN A 1 74  ? -9.513  14.670  -32.340 1.00 0.00  ? 74  GLN A OE1    2  
ATOM   3613  N NE2    . GLN A 1 74  ? -9.994  13.328  -34.076 1.00 0.00  ? 74  GLN A NE2    2  
ATOM   3614  H H      . GLN A 1 74  ? -5.086  13.385  -30.676 1.00 0.00  ? 74  GLN A H      2  
ATOM   3615  H HA     . GLN A 1 74  ? -7.648  14.736  -31.057 1.00 0.00  ? 74  GLN A HA     2  
ATOM   3616  H HB2    . GLN A 1 74  ? -6.491  12.128  -31.814 1.00 0.00  ? 74  GLN A HB2    2  
ATOM   3617  H HB3    . GLN A 1 74  ? -8.188  12.080  -31.356 1.00 0.00  ? 74  GLN A HB3    2  
ATOM   3618  H HG2    . GLN A 1 74  ? -7.076  13.966  -33.416 1.00 0.00  ? 74  GLN A HG2    2  
ATOM   3619  H HG3    . GLN A 1 74  ? -7.742  12.377  -33.795 1.00 0.00  ? 74  GLN A HG3    2  
ATOM   3620  H HE21   . GLN A 1 74  ? -9.655  12.635  -34.680 1.00 0.00  ? 74  GLN A HE21   2  
ATOM   3621  H HE22   . GLN A 1 74  ? -10.902 13.691  -34.119 1.00 0.00  ? 74  GLN A HE22   2  
ATOM   3622  N N      . LEU A 1 75  ? -6.884  13.315  -28.345 1.00 0.00  ? 75  LEU A N      2  
ATOM   3623  C CA     . LEU A 1 75  ? -7.350  12.975  -27.007 1.00 0.00  ? 75  LEU A CA     2  
ATOM   3624  C C      . LEU A 1 75  ? -6.718  13.893  -25.969 1.00 0.00  ? 75  LEU A C      2  
ATOM   3625  O O      . LEU A 1 75  ? -6.060  14.876  -26.309 1.00 0.00  ? 75  LEU A O      2  
ATOM   3626  C CB     . LEU A 1 75  ? -7.074  11.503  -26.651 1.00 0.00  ? 75  LEU A CB     2  
ATOM   3627  C CG     . LEU A 1 75  ? -6.233  10.707  -27.652 1.00 0.00  ? 75  LEU A CG     2  
ATOM   3628  C CD1    . LEU A 1 75  ? -4.802  10.568  -27.154 1.00 0.00  ? 75  LEU A CD1    2  
ATOM   3629  C CD2    . LEU A 1 75  ? -6.844  9.335   -27.886 1.00 0.00  ? 75  LEU A CD2    2  
ATOM   3630  H H      . LEU A 1 75  ? -5.927  13.462  -28.495 1.00 0.00  ? 75  LEU A H      2  
ATOM   3631  H HA     . LEU A 1 75  ? -8.417  13.138  -26.993 1.00 0.00  ? 75  LEU A HA     2  
ATOM   3632  H HB2    . LEU A 1 75  ? -6.569  11.479  -25.697 1.00 0.00  ? 75  LEU A HB2    2  
ATOM   3633  H HB3    . LEU A 1 75  ? -8.025  11.005  -26.543 1.00 0.00  ? 75  LEU A HB3    2  
ATOM   3634  H HG     . LEU A 1 75  ? -6.210  11.228  -28.595 1.00 0.00  ? 75  LEU A HG     2  
ATOM   3635  H HD11   . LEU A 1 75  ? -4.557  11.412  -26.525 1.00 0.00  ? 75  LEU A HD11   2  
ATOM   3636  H HD12   . LEU A 1 75  ? -4.128  10.541  -27.998 1.00 0.00  ? 75  LEU A HD12   2  
ATOM   3637  H HD13   . LEU A 1 75  ? -4.707  9.653   -26.584 1.00 0.00  ? 75  LEU A HD13   2  
ATOM   3638  H HD21   . LEU A 1 75  ? -6.542  8.666   -27.095 1.00 0.00  ? 75  LEU A HD21   2  
ATOM   3639  H HD22   . LEU A 1 75  ? -6.505  8.947   -28.835 1.00 0.00  ? 75  LEU A HD22   2  
ATOM   3640  H HD23   . LEU A 1 75  ? -7.921  9.420   -27.894 1.00 0.00  ? 75  LEU A HD23   2  
ATOM   3641  N N      . THR A 1 76  ? -6.926  13.569  -24.699 1.00 0.00  ? 76  THR A N      2  
ATOM   3642  C CA     . THR A 1 76  ? -6.387  14.364  -23.603 1.00 0.00  ? 76  THR A CA     2  
ATOM   3643  C C      . THR A 1 76  ? -5.854  13.473  -22.490 1.00 0.00  ? 76  THR A C      2  
ATOM   3644  O O      . THR A 1 76  ? -6.608  12.984  -21.653 1.00 0.00  ? 76  THR A O      2  
ATOM   3645  C CB     . THR A 1 76  ? -7.458  15.302  -23.049 1.00 0.00  ? 76  THR A CB     2  
ATOM   3646  O OG1    . THR A 1 76  ? -7.946  16.162  -24.062 1.00 0.00  ? 76  THR A OG1    2  
ATOM   3647  C CG2    . THR A 1 76  ? -6.957  16.167  -21.913 1.00 0.00  ? 76  THR A CG2    2  
ATOM   3648  H H      . THR A 1 76  ? -7.459  12.775  -24.496 1.00 0.00  ? 76  THR A H      2  
ATOM   3649  H HA     . THR A 1 76  ? -5.573  14.955  -23.992 1.00 0.00  ? 76  THR A HA     2  
ATOM   3650  H HB     . THR A 1 76  ? -8.283  14.713  -22.677 1.00 0.00  ? 76  THR A HB     2  
ATOM   3651  H HG1    . THR A 1 76  ? -8.253  15.637  -24.805 1.00 0.00  ? 76  THR A HG1    2  
ATOM   3652  H HG21   . THR A 1 76  ? -7.538  15.965  -21.025 1.00 0.00  ? 76  THR A HG21   2  
ATOM   3653  H HG22   . THR A 1 76  ? -7.059  17.208  -22.181 1.00 0.00  ? 76  THR A HG22   2  
ATOM   3654  H HG23   . THR A 1 76  ? -5.918  15.941  -21.724 1.00 0.00  ? 76  THR A HG23   2  
ATOM   3655  N N      . ILE A 1 77  ? -4.541  13.280  -22.488 1.00 0.00  ? 77  ILE A N      2  
ATOM   3656  C CA     . ILE A 1 77  ? -3.886  12.454  -21.481 1.00 0.00  ? 77  ILE A CA     2  
ATOM   3657  C C      . ILE A 1 77  ? -3.881  13.148  -20.127 1.00 0.00  ? 77  ILE A C      2  
ATOM   3658  O O      . ILE A 1 77  ? -3.338  14.242  -19.981 1.00 0.00  ? 77  ILE A O      2  
ATOM   3659  C CB     . ILE A 1 77  ? -2.430  12.119  -21.878 1.00 0.00  ? 77  ILE A CB     2  
ATOM   3660  C CG1    . ILE A 1 77  ? -2.326  11.848  -23.379 1.00 0.00  ? 77  ILE A CG1    2  
ATOM   3661  C CG2    . ILE A 1 77  ? -1.934  10.919  -21.088 1.00 0.00  ? 77  ILE A CG2    2  
ATOM   3662  C CD1    . ILE A 1 77  ? -3.175  10.682  -23.836 1.00 0.00  ? 77  ILE A CD1    2  
ATOM   3663  H H      . ILE A 1 77  ? -3.998  13.710  -23.178 1.00 0.00  ? 77  ILE A H      2  
ATOM   3664  H HA     . ILE A 1 77  ? -4.435  11.527  -21.399 1.00 0.00  ? 77  ILE A HA     2  
ATOM   3665  H HB     . ILE A 1 77  ? -1.809  12.966  -21.627 1.00 0.00  ? 77  ILE A HB     2  
ATOM   3666  H HG12   . ILE A 1 77  ? -2.642  12.722  -23.925 1.00 0.00  ? 77  ILE A HG12   2  
ATOM   3667  H HG13   . ILE A 1 77  ? -1.299  11.626  -23.627 1.00 0.00  ? 77  ILE A HG13   2  
ATOM   3668  H HG21   . ILE A 1 77  ? -2.518  10.813  -20.187 1.00 0.00  ? 77  ILE A HG21   2  
ATOM   3669  H HG22   . ILE A 1 77  ? -0.894  11.063  -20.831 1.00 0.00  ? 77  ILE A HG22   2  
ATOM   3670  H HG23   . ILE A 1 77  ? -2.035  10.027  -21.692 1.00 0.00  ? 77  ILE A HG23   2  
ATOM   3671  H HD11   . ILE A 1 77  ? -2.608  9.769   -23.742 1.00 0.00  ? 77  ILE A HD11   2  
ATOM   3672  H HD12   . ILE A 1 77  ? -3.458  10.827  -24.869 1.00 0.00  ? 77  ILE A HD12   2  
ATOM   3673  H HD13   . ILE A 1 77  ? -4.060  10.622  -23.224 1.00 0.00  ? 77  ILE A HD13   2  
ATOM   3674  N N      . ILE A 1 78  ? -4.492  12.507  -19.136 1.00 0.00  ? 78  ILE A N      2  
ATOM   3675  C CA     . ILE A 1 78  ? -4.554  13.073  -17.799 1.00 0.00  ? 78  ILE A CA     2  
ATOM   3676  C C      . ILE A 1 78  ? -3.253  12.835  -17.047 1.00 0.00  ? 78  ILE A C      2  
ATOM   3677  O O      . ILE A 1 78  ? -2.729  11.720  -17.014 1.00 0.00  ? 78  ILE A O      2  
ATOM   3678  C CB     . ILE A 1 78  ? -5.754  12.510  -16.997 1.00 0.00  ? 78  ILE A CB     2  
ATOM   3679  C CG1    . ILE A 1 78  ? -6.806  13.601  -16.815 1.00 0.00  ? 78  ILE A CG1    2  
ATOM   3680  C CG2    . ILE A 1 78  ? -5.320  11.956  -15.644 1.00 0.00  ? 78  ILE A CG2    2  
ATOM   3681  C CD1    . ILE A 1 78  ? -7.518  13.972  -18.097 1.00 0.00  ? 78  ILE A CD1    2  
ATOM   3682  H H      . ILE A 1 78  ? -4.910  11.639  -19.312 1.00 0.00  ? 78  ILE A H      2  
ATOM   3683  H HA     . ILE A 1 78  ? -4.695  14.140  -17.904 1.00 0.00  ? 78  ILE A HA     2  
ATOM   3684  H HB     . ILE A 1 78  ? -6.186  11.701  -17.565 1.00 0.00  ? 78  ILE A HB     2  
ATOM   3685  H HG12   . ILE A 1 78  ? -7.542  13.264  -16.108 1.00 0.00  ? 78  ILE A HG12   2  
ATOM   3686  H HG13   . ILE A 1 78  ? -6.332  14.488  -16.431 1.00 0.00  ? 78  ILE A HG13   2  
ATOM   3687  H HG21   . ILE A 1 78  ? -4.630  11.139  -15.794 1.00 0.00  ? 78  ILE A HG21   2  
ATOM   3688  H HG22   . ILE A 1 78  ? -6.186  11.603  -15.105 1.00 0.00  ? 78  ILE A HG22   2  
ATOM   3689  H HG23   . ILE A 1 78  ? -4.835  12.736  -15.075 1.00 0.00  ? 78  ILE A HG23   2  
ATOM   3690  H HD11   . ILE A 1 78  ? -6.788  14.245  -18.847 1.00 0.00  ? 78  ILE A HD11   2  
ATOM   3691  H HD12   . ILE A 1 78  ? -8.178  14.807  -17.914 1.00 0.00  ? 78  ILE A HD12   2  
ATOM   3692  H HD13   . ILE A 1 78  ? -8.094  13.128  -18.445 1.00 0.00  ? 78  ILE A HD13   2  
ATOM   3693  N N      . GLU A 1 79  ? -2.739  13.899  -16.452 1.00 0.00  ? 79  GLU A N      2  
ATOM   3694  C CA     . GLU A 1 79  ? -1.493  13.833  -15.701 1.00 0.00  ? 79  GLU A CA     2  
ATOM   3695  C C      . GLU A 1 79  ? -1.750  13.514  -14.234 1.00 0.00  ? 79  GLU A C      2  
ATOM   3696  O O      . GLU A 1 79  ? -2.785  13.886  -13.681 1.00 0.00  ? 79  GLU A O      2  
ATOM   3697  C CB     . GLU A 1 79  ? -0.733  15.152  -15.827 1.00 0.00  ? 79  GLU A CB     2  
ATOM   3698  C CG     . GLU A 1 79  ? -0.561  15.609  -17.264 1.00 0.00  ? 79  GLU A CG     2  
ATOM   3699  C CD     . GLU A 1 79  ? -0.285  17.095  -17.374 1.00 0.00  ? 79  GLU A CD     2  
ATOM   3700  O OE1    . GLU A 1 79  ? 0.598   17.479  -18.171 1.00 0.00  ? 79  GLU A OE1    2  
ATOM   3701  O OE2    . GLU A 1 79  ? -0.953  17.876  -16.665 1.00 0.00  ? 79  GLU A OE2    2  
ATOM   3702  H H      . GLU A 1 79  ? -3.212  14.755  -16.522 1.00 0.00  ? 79  GLU A H      2  
ATOM   3703  H HA     . GLU A 1 79  ? -0.892  13.043  -16.126 1.00 0.00  ? 79  GLU A HA     2  
ATOM   3704  H HB2    . GLU A 1 79  ? -1.273  15.916  -15.290 1.00 0.00  ? 79  GLU A HB2    2  
ATOM   3705  H HB3    . GLU A 1 79  ? 0.246   15.036  -15.387 1.00 0.00  ? 79  GLU A HB3    2  
ATOM   3706  H HG2    . GLU A 1 79  ? 0.266   15.070  -17.702 1.00 0.00  ? 79  GLU A HG2    2  
ATOM   3707  H HG3    . GLU A 1 79  ? -1.465  15.382  -17.812 1.00 0.00  ? 79  GLU A HG3    2  
ATOM   3708  H HE2    . GLU A 1 79  ? -0.727  18.801  -16.786 1.00 0.00  ? 79  GLU A HE2    2  
ATOM   3709  N N      . GLY A 1 80  ? -0.804  12.822  -13.612 1.00 0.00  ? 80  GLY A N      2  
ATOM   3710  C CA     . GLY A 1 80  ? -0.951  12.462  -12.214 1.00 0.00  ? 80  GLY A CA     2  
ATOM   3711  C C      . GLY A 1 80  ? -1.325  11.004  -12.032 1.00 0.00  ? 80  GLY A C      2  
ATOM   3712  O O      . GLY A 1 80  ? -1.064  10.416  -10.981 1.00 0.00  ? 80  GLY A O      2  
ATOM   3713  H H      . GLY A 1 80  ? -0.003  12.551  -14.105 1.00 0.00  ? 80  GLY A H      2  
ATOM   3714  H HA2    . GLY A 1 80  ? -0.017  12.651  -11.706 1.00 0.00  ? 80  GLY A HA2    2  
ATOM   3715  H HA3    . GLY A 1 80  ? -1.720  13.080  -11.773 1.00 0.00  ? 80  GLY A HA3    2  
ATOM   3716  N N      . PHE A 1 81  ? -1.937  10.420  -13.058 1.00 0.00  ? 81  PHE A N      2  
ATOM   3717  C CA     . PHE A 1 81  ? -2.350  9.025   -13.012 1.00 0.00  ? 81  PHE A CA     2  
ATOM   3718  C C      . PHE A 1 81  ? -1.401  8.151   -13.823 1.00 0.00  ? 81  PHE A C      2  
ATOM   3719  O O      . PHE A 1 81  ? -1.168  8.405   -15.004 1.00 0.00  ? 81  PHE A O      2  
ATOM   3720  C CB     . PHE A 1 81  ? -3.773  8.879   -13.550 1.00 0.00  ? 81  PHE A CB     2  
ATOM   3721  C CG     . PHE A 1 81  ? -4.273  7.463   -13.552 1.00 0.00  ? 81  PHE A CG     2  
ATOM   3722  C CD1    . PHE A 1 81  ? -3.835  6.555   -14.503 1.00 0.00  ? 81  PHE A CD1    2  
ATOM   3723  C CD2    . PHE A 1 81  ? -5.183  7.044   -12.601 1.00 0.00  ? 81  PHE A CD2    2  
ATOM   3724  C CE1    . PHE A 1 81  ? -4.298  5.254   -14.501 1.00 0.00  ? 81  PHE A CE1    2  
ATOM   3725  C CE2    . PHE A 1 81  ? -5.650  5.745   -12.594 1.00 0.00  ? 81  PHE A CE2    2  
ATOM   3726  C CZ     . PHE A 1 81  ? -5.207  4.848   -13.545 1.00 0.00  ? 81  PHE A CZ     2  
ATOM   3727  H H      . PHE A 1 81  ? -2.118  10.943  -13.867 1.00 0.00  ? 81  PHE A H      2  
ATOM   3728  H HA     . PHE A 1 81  ? -2.329  8.704   -11.980 1.00 0.00  ? 81  PHE A HA     2  
ATOM   3729  H HB2    . PHE A 1 81  ? -4.444  9.467   -12.943 1.00 0.00  ? 81  PHE A HB2    2  
ATOM   3730  H HB3    . PHE A 1 81  ? -3.804  9.242   -14.567 1.00 0.00  ? 81  PHE A HB3    2  
ATOM   3731  H HD1    . PHE A 1 81  ? -3.123  6.873   -15.249 1.00 0.00  ? 81  PHE A HD1    2  
ATOM   3732  H HD2    . PHE A 1 81  ? -5.529  7.741   -11.856 1.00 0.00  ? 81  PHE A HD2    2  
ATOM   3733  H HE1    . PHE A 1 81  ? -3.948  4.555   -15.247 1.00 0.00  ? 81  PHE A HE1    2  
ATOM   3734  H HE2    . PHE A 1 81  ? -6.362  5.434   -11.846 1.00 0.00  ? 81  PHE A HE2    2  
ATOM   3735  H HZ     . PHE A 1 81  ? -5.571  3.831   -13.542 1.00 0.00  ? 81  PHE A HZ     2  
ATOM   3736  N N      . LYS A 1 82  ? -0.862  7.118   -13.187 1.00 0.00  ? 82  LYS A N      2  
ATOM   3737  C CA     . LYS A 1 82  ? 0.051   6.211   -13.863 1.00 0.00  ? 82  LYS A CA     2  
ATOM   3738  C C      . LYS A 1 82  ? 0.116   4.861   -13.160 1.00 0.00  ? 82  LYS A C      2  
ATOM   3739  O O      . LYS A 1 82  ? 0.433   4.773   -11.973 1.00 0.00  ? 82  LYS A O      2  
ATOM   3740  C CB     . LYS A 1 82  ? 1.449   6.819   -13.950 1.00 0.00  ? 82  LYS A CB     2  
ATOM   3741  C CG     . LYS A 1 82  ? 2.079   6.689   -15.327 1.00 0.00  ? 82  LYS A CG     2  
ATOM   3742  C CD     . LYS A 1 82  ? 3.563   7.022   -15.295 1.00 0.00  ? 82  LYS A CD     2  
ATOM   3743  C CE     . LYS A 1 82  ? 4.349   5.992   -14.505 1.00 0.00  ? 82  LYS A CE     2  
ATOM   3744  N NZ     . LYS A 1 82  ? 5.368   6.628   -13.623 1.00 0.00  ? 82  LYS A NZ     2  
ATOM   3745  H H      . LYS A 1 82  ? -1.088  6.960   -12.246 1.00 0.00  ? 82  LYS A H      2  
ATOM   3746  H HA     . LYS A 1 82  ? -0.322  6.058   -14.864 1.00 0.00  ? 82  LYS A HA     2  
ATOM   3747  H HB2    . LYS A 1 82  ? 1.391   7.867   -13.697 1.00 0.00  ? 82  LYS A HB2    2  
ATOM   3748  H HB3    . LYS A 1 82  ? 2.085   6.319   -13.239 1.00 0.00  ? 82  LYS A HB3    2  
ATOM   3749  H HG2    . LYS A 1 82  ? 1.957   5.676   -15.674 1.00 0.00  ? 82  LYS A HG2    2  
ATOM   3750  H HG3    . LYS A 1 82  ? 1.580   7.368   -16.005 1.00 0.00  ? 82  LYS A HG3    2  
ATOM   3751  H HD2    . LYS A 1 82  ? 3.939   7.044   -16.302 1.00 0.00  ? 82  LYS A HD2    2  
ATOM   3752  H HD3    . LYS A 1 82  ? 3.694   7.992   -14.837 1.00 0.00  ? 82  LYS A HD3    2  
ATOM   3753  H HE2    . LYS A 1 82  ? 3.663   5.423   -13.896 1.00 0.00  ? 82  LYS A HE2    2  
ATOM   3754  H HE3    . LYS A 1 82  ? 4.846   5.330   -15.196 1.00 0.00  ? 82  LYS A HE3    2  
ATOM   3755  H HZ1    . LYS A 1 82  ? 6.116   7.063   -14.201 1.00 0.00  ? 82  LYS A HZ1    2  
ATOM   3756  H HZ2    . LYS A 1 82  ? 5.797   5.914   -13.001 1.00 0.00  ? 82  LYS A HZ2    2  
ATOM   3757  H HZ3    . LYS A 1 82  ? 4.924   7.363   -13.036 1.00 0.00  ? 82  LYS A HZ3    2  
ATOM   3758  N N      . ARG A 1 83  ? -0.174  3.814   -13.917 1.00 0.00  ? 83  ARG A N      2  
ATOM   3759  C CA     . ARG A 1 83  ? -0.147  2.452   -13.405 1.00 0.00  ? 83  ARG A CA     2  
ATOM   3760  C C      . ARG A 1 83  ? 0.159   1.484   -14.539 1.00 0.00  ? 83  ARG A C      2  
ATOM   3761  O O      . ARG A 1 83  ? -0.360  1.634   -15.644 1.00 0.00  ? 83  ARG A O      2  
ATOM   3762  C CB     . ARG A 1 83  ? -1.485  2.093   -12.756 1.00 0.00  ? 83  ARG A CB     2  
ATOM   3763  C CG     . ARG A 1 83  ? -1.511  0.697   -12.145 1.00 0.00  ? 83  ARG A CG     2  
ATOM   3764  C CD     . ARG A 1 83  ? -1.588  0.752   -10.626 1.00 0.00  ? 83  ARG A CD     2  
ATOM   3765  N NE     . ARG A 1 83  ? -1.818  -0.567  -10.040 1.00 0.00  ? 83  ARG A NE     2  
ATOM   3766  C CZ     . ARG A 1 83  ? -0.885  -1.514  -9.955  1.00 0.00  ? 83  ARG A CZ     2  
ATOM   3767  N NH1    . ARG A 1 83  ? 0.339   -1.294  -10.418 1.00 0.00  ? 83  ARG A NH1    2  
ATOM   3768  N NH2    . ARG A 1 83  ? -1.178  -2.684  -9.401  1.00 0.00  ? 83  ARG A NH2    2  
ATOM   3769  H H      . ARG A 1 83  ? -0.404  3.964   -14.855 1.00 0.00  ? 83  ARG A H      2  
ATOM   3770  H HA     . ARG A 1 83  ? 0.638   2.388   -12.664 1.00 0.00  ? 83  ARG A HA     2  
ATOM   3771  H HB2    . ARG A 1 83  ? -1.699  2.807   -11.976 1.00 0.00  ? 83  ARG A HB2    2  
ATOM   3772  H HB3    . ARG A 1 83  ? -2.261  2.147   -13.505 1.00 0.00  ? 83  ARG A HB3    2  
ATOM   3773  H HG2    . ARG A 1 83  ? -2.374  0.168   -12.521 1.00 0.00  ? 83  ARG A HG2    2  
ATOM   3774  H HG3    . ARG A 1 83  ? -0.612  0.173   -12.433 1.00 0.00  ? 83  ARG A HG3    2  
ATOM   3775  H HD2    . ARG A 1 83  ? -0.658  1.147   -10.246 1.00 0.00  ? 83  ARG A HD2    2  
ATOM   3776  H HD3    . ARG A 1 83  ? -2.399  1.407   -10.344 1.00 0.00  ? 83  ARG A HD3    2  
ATOM   3777  H HE     . ARG A 1 83  ? -2.714  -0.757  -9.691  1.00 0.00  ? 83  ARG A HE     2  
ATOM   3778  H HH11   . ARG A 1 83  ? 0.566   -0.414  -10.835 1.00 0.00  ? 83  ARG A HH11   2  
ATOM   3779  H HH12   . ARG A 1 83  ? 1.035   -2.009  -10.350 1.00 0.00  ? 83  ARG A HH12   2  
ATOM   3780  H HH21   . ARG A 1 83  ? -2.098  -2.854  -9.050  1.00 0.00  ? 83  ARG A HH21   2  
ATOM   3781  H HH22   . ARG A 1 83  ? -0.477  -3.396  -9.337  1.00 0.00  ? 83  ARG A HH22   2  
ATOM   3782  N N      . GLU A 1 84  ? 1.006   0.497   -14.274 1.00 0.00  ? 84  GLU A N      2  
ATOM   3783  C CA     . GLU A 1 84  ? 1.363   -0.473  -15.300 1.00 0.00  ? 84  GLU A CA     2  
ATOM   3784  C C      . GLU A 1 84  ? 0.869   -1.867  -14.943 1.00 0.00  ? 84  GLU A C      2  
ATOM   3785  O O      . GLU A 1 84  ? 1.036   -2.329  -13.815 1.00 0.00  ? 84  GLU A O      2  
ATOM   3786  C CB     . GLU A 1 84  ? 2.875   -0.489  -15.542 1.00 0.00  ? 84  GLU A CB     2  
ATOM   3787  C CG     . GLU A 1 84  ? 3.684   -1.096  -14.410 1.00 0.00  ? 84  GLU A CG     2  
ATOM   3788  C CD     . GLU A 1 84  ? 3.712   -0.221  -13.171 1.00 0.00  ? 84  GLU A CD     2  
ATOM   3789  O OE1    . GLU A 1 84  ? 3.154   -0.641  -12.135 1.00 0.00  ? 84  GLU A OE1    2  
ATOM   3790  O OE2    . GLU A 1 84  ? 4.291   0.885   -13.238 1.00 0.00  ? 84  GLU A OE2    2  
ATOM   3791  H H      . GLU A 1 84  ? 1.395   0.422   -13.378 1.00 0.00  ? 84  GLU A H      2  
ATOM   3792  H HA     . GLU A 1 84  ? 0.875   -0.164  -16.210 1.00 0.00  ? 84  GLU A HA     2  
ATOM   3793  H HB2    . GLU A 1 84  ? 3.078   -1.054  -16.437 1.00 0.00  ? 84  GLU A HB2    2  
ATOM   3794  H HB3    . GLU A 1 84  ? 3.210   0.520   -15.687 1.00 0.00  ? 84  GLU A HB3    2  
ATOM   3795  H HG2    . GLU A 1 84  ? 3.254   -2.046  -14.152 1.00 0.00  ? 84  GLU A HG2    2  
ATOM   3796  H HG3    . GLU A 1 84  ? 4.699   -1.243  -14.750 1.00 0.00  ? 84  GLU A HG3    2  
ATOM   3797  H HE2    . GLU A 1 84  ? 4.269   1.385   -12.419 1.00 0.00  ? 84  GLU A HE2    2  
ATOM   3798  N N      . LEU A 1 85  ? 0.266   -2.533  -15.920 1.00 0.00  ? 85  LEU A N      2  
ATOM   3799  C CA     . LEU A 1 85  ? -0.250  -3.876  -15.720 1.00 0.00  ? 85  LEU A CA     2  
ATOM   3800  C C      . LEU A 1 85  ? 0.808   -4.914  -16.078 1.00 0.00  ? 85  LEU A C      2  
ATOM   3801  O O      . LEU A 1 85  ? 1.323   -4.928  -17.195 1.00 0.00  ? 85  LEU A O      2  
ATOM   3802  C CB     . LEU A 1 85  ? -1.514  -4.089  -16.558 1.00 0.00  ? 85  LEU A CB     2  
ATOM   3803  C CG     . LEU A 1 85  ? -2.527  -2.938  -16.512 1.00 0.00  ? 85  LEU A CG     2  
ATOM   3804  C CD1    . LEU A 1 85  ? -3.874  -3.393  -17.048 1.00 0.00  ? 85  LEU A CD1    2  
ATOM   3805  C CD2    . LEU A 1 85  ? -2.675  -2.403  -15.093 1.00 0.00  ? 85  LEU A CD2    2  
ATOM   3806  H H      . LEU A 1 85  ? 0.168   -2.109  -16.799 1.00 0.00  ? 85  LEU A H      2  
ATOM   3807  H HA     . LEU A 1 85  ? -0.500  -3.981  -14.680 1.00 0.00  ? 85  LEU A HA     2  
ATOM   3808  H HB2    . LEU A 1 85  ? -1.217  -4.239  -17.587 1.00 0.00  ? 85  LEU A HB2    2  
ATOM   3809  H HB3    . LEU A 1 85  ? -2.006  -4.985  -16.210 1.00 0.00  ? 85  LEU A HB3    2  
ATOM   3810  H HG     . LEU A 1 85  ? -2.174  -2.132  -17.139 1.00 0.00  ? 85  LEU A HG     2  
ATOM   3811  H HD11   . LEU A 1 85  ? -3.736  -4.233  -17.709 1.00 0.00  ? 85  LEU A HD11   2  
ATOM   3812  H HD12   . LEU A 1 85  ? -4.339  -2.581  -17.586 1.00 0.00  ? 85  LEU A HD12   2  
ATOM   3813  H HD13   . LEU A 1 85  ? -4.506  -3.683  -16.222 1.00 0.00  ? 85  LEU A HD13   2  
ATOM   3814  H HD21   . LEU A 1 85  ? -2.288  -3.129  -14.392 1.00 0.00  ? 85  LEU A HD21   2  
ATOM   3815  H HD22   . LEU A 1 85  ? -3.717  -2.222  -14.882 1.00 0.00  ? 85  LEU A HD22   2  
ATOM   3816  H HD23   . LEU A 1 85  ? -2.122  -1.480  -14.997 1.00 0.00  ? 85  LEU A HD23   2  
ATOM   3817  N N      . ASN A 1 86  ? 1.137   -5.772  -15.118 1.00 0.00  ? 86  ASN A N      2  
ATOM   3818  C CA     . ASN A 1 86  ? 2.145   -6.804  -15.330 1.00 0.00  ? 86  ASN A CA     2  
ATOM   3819  C C      . ASN A 1 86  ? 1.538   -8.200  -15.236 1.00 0.00  ? 86  ASN A C      2  
ATOM   3820  O O      . ASN A 1 86  ? 0.932   -8.560  -14.226 1.00 0.00  ? 86  ASN A O      2  
ATOM   3821  C CB     . ASN A 1 86  ? 3.273   -6.657  -14.305 1.00 0.00  ? 86  ASN A CB     2  
ATOM   3822  C CG     . ASN A 1 86  ? 4.516   -6.024  -14.899 1.00 0.00  ? 86  ASN A CG     2  
ATOM   3823  O OD1    . ASN A 1 86  ? 5.282   -6.679  -15.606 1.00 0.00  ? 86  ASN A OD1    2  
ATOM   3824  N ND2    . ASN A 1 86  ? 4.724   -4.745  -14.612 1.00 0.00  ? 86  ASN A ND2    2  
ATOM   3825  H H      . ASN A 1 86  ? 0.697   -5.705  -14.244 1.00 0.00  ? 86  ASN A H      2  
ATOM   3826  H HA     . ASN A 1 86  ? 2.554   -6.669  -16.320 1.00 0.00  ? 86  ASN A HA     2  
ATOM   3827  H HB2    . ASN A 1 86  ? 2.932   -6.037  -13.490 1.00 0.00  ? 86  ASN A HB2    2  
ATOM   3828  H HB3    . ASN A 1 86  ? 3.535   -7.633  -13.923 1.00 0.00  ? 86  ASN A HB3    2  
ATOM   3829  H HD21   . ASN A 1 86  ? 4.072   -4.287  -14.041 1.00 0.00  ? 86  ASN A HD21   2  
ATOM   3830  H HD22   . ASN A 1 86  ? 5.519   -4.311  -14.982 1.00 0.00  ? 86  ASN A HD22   2  
ATOM   3831  N N      . TYR A 1 87  ? 1.710   -8.978  -16.296 1.00 0.00  ? 87  TYR A N      2  
ATOM   3832  C CA     . TYR A 1 87  ? 1.191   -10.339 -16.345 1.00 0.00  ? 87  TYR A CA     2  
ATOM   3833  C C      . TYR A 1 87  ? 1.789   -11.103 -17.513 1.00 0.00  ? 87  TYR A C      2  
ATOM   3834  O O      . TYR A 1 87  ? 1.981   -10.553 -18.597 1.00 0.00  ? 87  TYR A O      2  
ATOM   3835  C CB     . TYR A 1 87  ? -0.332  -10.338 -16.466 1.00 0.00  ? 87  TYR A CB     2  
ATOM   3836  C CG     . TYR A 1 87  ? -0.853  -9.369  -17.504 1.00 0.00  ? 87  TYR A CG     2  
ATOM   3837  C CD1    . TYR A 1 87  ? -0.981  -9.751  -18.833 1.00 0.00  ? 87  TYR A CD1    2  
ATOM   3838  C CD2    . TYR A 1 87  ? -1.215  -8.075  -17.156 1.00 0.00  ? 87  TYR A CD2    2  
ATOM   3839  C CE1    . TYR A 1 87  ? -1.454  -8.872  -19.788 1.00 0.00  ? 87  TYR A CE1    2  
ATOM   3840  C CE2    . TYR A 1 87  ? -1.689  -7.187  -18.106 1.00 0.00  ? 87  TYR A CE2    2  
ATOM   3841  C CZ     . TYR A 1 87  ? -1.807  -7.590  -19.419 1.00 0.00  ? 87  TYR A CZ     2  
ATOM   3842  O OH     . TYR A 1 87  ? -2.279  -6.710  -20.366 1.00 0.00  ? 87  TYR A OH     2  
ATOM   3843  H H      . TYR A 1 87  ? 2.207   -8.632  -17.068 1.00 0.00  ? 87  TYR A H      2  
ATOM   3844  H HA     . TYR A 1 87  ? 1.468   -10.833 -15.426 1.00 0.00  ? 87  TYR A HA     2  
ATOM   3845  H HB2    . TYR A 1 87  ? -0.664  -11.327 -16.744 1.00 0.00  ? 87  TYR A HB2    2  
ATOM   3846  H HB3    . TYR A 1 87  ? -0.759  -10.074 -15.514 1.00 0.00  ? 87  TYR A HB3    2  
ATOM   3847  H HD1    . TYR A 1 87  ? -0.704  -10.756 -19.119 1.00 0.00  ? 87  TYR A HD1    2  
ATOM   3848  H HD2    . TYR A 1 87  ? -1.122  -7.761  -16.127 1.00 0.00  ? 87  TYR A HD2    2  
ATOM   3849  H HE1    . TYR A 1 87  ? -1.546  -9.188  -20.816 1.00 0.00  ? 87  TYR A HE1    2  
ATOM   3850  H HE2    . TYR A 1 87  ? -1.965  -6.185  -17.815 1.00 0.00  ? 87  TYR A HE2    2  
ATOM   3851  H HH     . TYR A 1 87  ? -1.829  -6.865  -21.200 1.00 0.00  ? 87  TYR A HH     2  
ATOM   3852  N N      . VAL A 1 88  ? 2.069   -12.377 -17.291 1.00 0.00  ? 88  VAL A N      2  
ATOM   3853  C CA     . VAL A 1 88  ? 2.634   -13.220 -18.335 1.00 0.00  ? 88  VAL A CA     2  
ATOM   3854  C C      . VAL A 1 88  ? 1.531   -13.731 -19.255 1.00 0.00  ? 88  VAL A C      2  
ATOM   3855  O O      . VAL A 1 88  ? 0.696   -14.543 -18.859 1.00 0.00  ? 88  VAL A O      2  
ATOM   3856  C CB     . VAL A 1 88  ? 3.425   -14.404 -17.745 1.00 0.00  ? 88  VAL A CB     2  
ATOM   3857  C CG1    . VAL A 1 88  ? 2.504   -15.390 -17.050 1.00 0.00  ? 88  VAL A CG1    2  
ATOM   3858  C CG2    . VAL A 1 88  ? 4.227   -15.097 -18.829 1.00 0.00  ? 88  VAL A CG2    2  
ATOM   3859  H H      . VAL A 1 88  ? 1.881   -12.760 -16.407 1.00 0.00  ? 88  VAL A H      2  
ATOM   3860  H HA     . VAL A 1 88  ? 3.314   -12.613 -18.915 1.00 0.00  ? 88  VAL A HA     2  
ATOM   3861  H HB     . VAL A 1 88  ? 4.117   -14.016 -17.012 1.00 0.00  ? 88  VAL A HB     2  
ATOM   3862  H HG11   . VAL A 1 88  ? 2.433   -16.291 -17.643 1.00 0.00  ? 88  VAL A HG11   2  
ATOM   3863  H HG12   . VAL A 1 88  ? 1.523   -14.951 -16.941 1.00 0.00  ? 88  VAL A HG12   2  
ATOM   3864  H HG13   . VAL A 1 88  ? 2.903   -15.629 -16.076 1.00 0.00  ? 88  VAL A HG13   2  
ATOM   3865  H HG21   . VAL A 1 88  ? 3.679   -15.060 -19.759 1.00 0.00  ? 88  VAL A HG21   2  
ATOM   3866  H HG22   . VAL A 1 88  ? 4.396   -16.126 -18.551 1.00 0.00  ? 88  VAL A HG22   2  
ATOM   3867  H HG23   . VAL A 1 88  ? 5.175   -14.594 -18.951 1.00 0.00  ? 88  VAL A HG23   2  
ATOM   3868  N N      . ALA A 1 89  ? 1.514   -13.227 -20.483 1.00 0.00  ? 89  ALA A N      2  
ATOM   3869  C CA     . ALA A 1 89  ? 0.497   -13.614 -21.447 1.00 0.00  ? 89  ALA A CA     2  
ATOM   3870  C C      . ALA A 1 89  ? 0.775   -14.993 -22.052 1.00 0.00  ? 89  ALA A C      2  
ATOM   3871  O O      . ALA A 1 89  ? 0.460   -16.015 -21.442 1.00 0.00  ? 89  ALA A O      2  
ATOM   3872  C CB     . ALA A 1 89  ? 0.377   -12.551 -22.531 1.00 0.00  ? 89  ALA A CB     2  
ATOM   3873  H H      . ALA A 1 89  ? 2.192   -12.566 -20.739 1.00 0.00  ? 89  ALA A H      2  
ATOM   3874  H HA     . ALA A 1 89  ? -0.446  -13.656 -20.919 1.00 0.00  ? 89  ALA A HA     2  
ATOM   3875  H HB1    . ALA A 1 89  ? 1.350   -12.124 -22.725 1.00 0.00  ? 89  ALA A HB1    2  
ATOM   3876  H HB2    . ALA A 1 89  ? -0.297  -11.776 -22.202 1.00 0.00  ? 89  ALA A HB2    2  
ATOM   3877  H HB3    . ALA A 1 89  ? -0.005  -13.002 -23.436 1.00 0.00  ? 89  ALA A HB3    2  
ATOM   3878  N N      . ARG A 1 90  ? 1.358   -15.023 -23.249 1.00 0.00  ? 90  ARG A N      2  
ATOM   3879  C CA     . ARG A 1 90  ? 1.660   -16.284 -23.919 1.00 0.00  ? 90  ARG A CA     2  
ATOM   3880  C C      . ARG A 1 90  ? 2.741   -17.055 -23.168 1.00 0.00  ? 90  ARG A C      2  
ATOM   3881  O O      . ARG A 1 90  ? 2.681   -18.281 -23.062 1.00 0.00  ? 90  ARG A O      2  
ATOM   3882  C CB     . ARG A 1 90  ? 2.093   -16.031 -25.367 1.00 0.00  ? 90  ARG A CB     2  
ATOM   3883  C CG     . ARG A 1 90  ? 3.313   -15.131 -25.496 1.00 0.00  ? 90  ARG A CG     2  
ATOM   3884  C CD     . ARG A 1 90  ? 3.013   -13.892 -26.327 1.00 0.00  ? 90  ARG A CD     2  
ATOM   3885  N NE     . ARG A 1 90  ? 4.120   -12.937 -26.303 1.00 0.00  ? 90  ARG A NE     2  
ATOM   3886  C CZ     . ARG A 1 90  ? 5.051   -12.845 -27.253 1.00 0.00  ? 90  ARG A CZ     2  
ATOM   3887  N NH1    . ARG A 1 90  ? 5.021   -13.646 -28.310 1.00 0.00  ? 90  ARG A NH1    2  
ATOM   3888  N NH2    . ARG A 1 90  ? 6.019   -11.945 -27.142 1.00 0.00  ? 90  ARG A NH2    2  
ATOM   3889  H H      . ARG A 1 90  ? 1.585   -14.182 -23.696 1.00 0.00  ? 90  ARG A H      2  
ATOM   3890  H HA     . ARG A 1 90  ? 0.756   -16.875 -23.925 1.00 0.00  ? 90  ARG A HA     2  
ATOM   3891  H HB2    . ARG A 1 90  ? 2.322   -16.980 -25.831 1.00 0.00  ? 90  ARG A HB2    2  
ATOM   3892  H HB3    . ARG A 1 90  ? 1.275   -15.570 -25.898 1.00 0.00  ? 90  ARG A HB3    2  
ATOM   3893  H HG2    . ARG A 1 90  ? 3.627   -14.820 -24.513 1.00 0.00  ? 90  ARG A HG2    2  
ATOM   3894  H HG3    . ARG A 1 90  ? 4.110   -15.687 -25.970 1.00 0.00  ? 90  ARG A HG3    2  
ATOM   3895  H HD2    . ARG A 1 90  ? 2.830   -14.194 -27.347 1.00 0.00  ? 90  ARG A HD2    2  
ATOM   3896  H HD3    . ARG A 1 90  ? 2.130   -13.416 -25.931 1.00 0.00  ? 90  ARG A HD3    2  
ATOM   3897  H HE     . ARG A 1 90  ? 4.173   -12.329 -25.535 1.00 0.00  ? 90  ARG A HE     2  
ATOM   3898  H HH11   . ARG A 1 90  ? 4.299   -14.329 -28.402 1.00 0.00  ? 90  ARG A HH11   2  
ATOM   3899  H HH12   . ARG A 1 90  ? 5.725   -13.566 -29.016 1.00 0.00  ? 90  ARG A HH12   2  
ATOM   3900  H HH21   . ARG A 1 90  ? 6.051   -11.339 -26.347 1.00 0.00  ? 90  ARG A HH21   2  
ATOM   3901  H HH22   . ARG A 1 90  ? 6.720   -11.875 -27.852 1.00 0.00  ? 90  ARG A HH22   2  
ATOM   3902  N N      . ASN A 1 91  ? 3.723   -16.328 -22.645 1.00 0.00  ? 91  ASN A N      2  
ATOM   3903  C CA     . ASN A 1 91  ? 4.821   -16.938 -21.898 1.00 0.00  ? 91  ASN A CA     2  
ATOM   3904  C C      . ASN A 1 91  ? 5.848   -15.890 -21.478 1.00 0.00  ? 91  ASN A C      2  
ATOM   3905  O O      . ASN A 1 91  ? 7.029   -16.198 -21.313 1.00 0.00  ? 91  ASN A O      2  
ATOM   3906  C CB     . ASN A 1 91  ? 5.506   -18.022 -22.738 1.00 0.00  ? 91  ASN A CB     2  
ATOM   3907  C CG     . ASN A 1 91  ? 5.990   -19.190 -21.900 1.00 0.00  ? 91  ASN A CG     2  
ATOM   3908  O OD1    . ASN A 1 91  ? 7.194   -19.406 -21.753 1.00 0.00  ? 91  ASN A OD1    2  
ATOM   3909  N ND2    . ASN A 1 91  ? 5.053   -19.953 -21.349 1.00 0.00  ? 91  ASN A ND2    2  
ATOM   3910  H H      . ASN A 1 91  ? 3.710   -15.357 -22.762 1.00 0.00  ? 91  ASN A H      2  
ATOM   3911  H HA     . ASN A 1 91  ? 4.404   -17.392 -21.007 1.00 0.00  ? 91  ASN A HA     2  
ATOM   3912  H HB2    . ASN A 1 91  ? 4.812   -18.395 -23.472 1.00 0.00  ? 91  ASN A HB2    2  
ATOM   3913  H HB3    . ASN A 1 91  ? 6.357   -17.589 -23.243 1.00 0.00  ? 91  ASN A HB3    2  
ATOM   3914  H HD21   . ASN A 1 91  ? 4.115   -19.720 -21.511 1.00 0.00  ? 91  ASN A HD21   2  
ATOM   3915  H HD22   . ASN A 1 91  ? 5.338   -20.715 -20.804 1.00 0.00  ? 91  ASN A HD22   2  
ATOM   3916  N N      . LYS A 1 92  ? 5.396   -14.653 -21.306 1.00 0.00  ? 92  LYS A N      2  
ATOM   3917  C CA     . LYS A 1 92  ? 6.278   -13.566 -20.907 1.00 0.00  ? 92  LYS A CA     2  
ATOM   3918  C C      . LYS A 1 92  ? 5.471   -12.422 -20.284 1.00 0.00  ? 92  LYS A C      2  
ATOM   3919  O O      . LYS A 1 92  ? 4.469   -11.980 -20.846 1.00 0.00  ? 92  LYS A O      2  
ATOM   3920  C CB     . LYS A 1 92  ? 7.077   -13.069 -22.111 1.00 0.00  ? 92  LYS A CB     2  
ATOM   3921  C CG     . LYS A 1 92  ? 8.477   -12.586 -21.764 1.00 0.00  ? 92  LYS A CG     2  
ATOM   3922  C CD     . LYS A 1 92  ? 9.546   -13.391 -22.488 1.00 0.00  ? 92  LYS A CD     2  
ATOM   3923  C CE     . LYS A 1 92  ? 9.902   -12.770 -23.828 1.00 0.00  ? 92  LYS A CE     2  
ATOM   3924  N NZ     . LYS A 1 92  ? 10.641  -13.722 -24.703 1.00 0.00  ? 92  LYS A NZ     2  
ATOM   3925  H H      . LYS A 1 92  ? 4.446   -14.464 -21.448 1.00 0.00  ? 92  LYS A H      2  
ATOM   3926  H HA     . LYS A 1 92  ? 6.963   -13.952 -20.165 1.00 0.00  ? 92  LYS A HA     2  
ATOM   3927  H HB2    . LYS A 1 92  ? 7.166   -13.877 -22.822 1.00 0.00  ? 92  LYS A HB2    2  
ATOM   3928  H HB3    . LYS A 1 92  ? 6.542   -12.256 -22.570 1.00 0.00  ? 92  LYS A HB3    2  
ATOM   3929  H HG2    . LYS A 1 92  ? 8.569   -11.548 -22.048 1.00 0.00  ? 92  LYS A HG2    2  
ATOM   3930  H HG3    . LYS A 1 92  ? 8.629   -12.682 -20.702 1.00 0.00  ? 92  LYS A HG3    2  
ATOM   3931  H HD2    . LYS A 1 92  ? 10.434  -13.425 -21.873 1.00 0.00  ? 92  LYS A HD2    2  
ATOM   3932  H HD3    . LYS A 1 92  ? 9.180   -14.394 -22.650 1.00 0.00  ? 92  LYS A HD3    2  
ATOM   3933  H HE2    . LYS A 1 92  ? 8.992   -12.472 -24.327 1.00 0.00  ? 92  LYS A HE2    2  
ATOM   3934  H HE3    . LYS A 1 92  ? 10.521  -11.901 -23.656 1.00 0.00  ? 92  LYS A HE3    2  
ATOM   3935  H HZ1    . LYS A 1 92  ? 11.394  -14.195 -24.162 1.00 0.00  ? 92  LYS A HZ1    2  
ATOM   3936  H HZ2    . LYS A 1 92  ? 11.072  -13.216 -25.503 1.00 0.00  ? 92  LYS A HZ2    2  
ATOM   3937  H HZ3    . LYS A 1 92  ? 9.991   -14.446 -25.074 1.00 0.00  ? 92  LYS A HZ3    2  
ATOM   3938  N N      . PRO A 1 93  ? 5.901   -11.939 -19.107 1.00 0.00  ? 93  PRO A N      2  
ATOM   3939  C CA     . PRO A 1 93  ? 5.223   -10.853 -18.381 1.00 0.00  ? 93  PRO A CA     2  
ATOM   3940  C C      . PRO A 1 93  ? 5.286   -9.524  -19.108 1.00 0.00  ? 93  PRO A C      2  
ATOM   3941  O O      . PRO A 1 93  ? 6.366   -8.995  -19.372 1.00 0.00  ? 93  PRO A O      2  
ATOM   3942  C CB     . PRO A 1 93  ? 5.997   -10.757 -17.076 1.00 0.00  ? 93  PRO A CB     2  
ATOM   3943  C CG     . PRO A 1 93  ? 7.339   -11.307 -17.413 1.00 0.00  ? 93  PRO A CG     2  
ATOM   3944  C CD     . PRO A 1 93  ? 7.076   -12.422 -18.375 1.00 0.00  ? 93  PRO A CD     2  
ATOM   3945  H HA     . PRO A 1 93  ? 4.194   -11.100 -18.174 1.00 0.00  ? 93  PRO A HA     2  
ATOM   3946  H HB2    . PRO A 1 93  ? 6.054   -9.723  -16.766 1.00 0.00  ? 93  PRO A HB2    2  
ATOM   3947  H HB3    . PRO A 1 93  ? 5.503   -11.341 -16.322 1.00 0.00  ? 93  PRO A HB3    2  
ATOM   3948  H HG2    . PRO A 1 93  ? 7.940   -10.547 -17.877 1.00 0.00  ? 93  PRO A HG2    2  
ATOM   3949  H HG3    . PRO A 1 93  ? 7.821   -11.679 -16.538 1.00 0.00  ? 93  PRO A HG3    2  
ATOM   3950  H HD2    . PRO A 1 93  ? 7.914   -12.560 -19.034 1.00 0.00  ? 93  PRO A HD2    2  
ATOM   3951  H HD3    . PRO A 1 93  ? 6.851   -13.331 -17.850 1.00 0.00  ? 93  PRO A HD3    2  
ATOM   3952  N N      . LYS A 1 94  ? 4.120   -8.993  -19.417 1.00 0.00  ? 94  LYS A N      2  
ATOM   3953  C CA     . LYS A 1 94  ? 4.016   -7.721  -20.122 1.00 0.00  ? 94  LYS A CA     2  
ATOM   3954  C C      . LYS A 1 94  ? 3.683   -6.575  -19.175 1.00 0.00  ? 94  LYS A C      2  
ATOM   3955  O O      . LYS A 1 94  ? 2.656   -6.596  -18.498 1.00 0.00  ? 94  LYS A O      2  
ATOM   3956  C CB     . LYS A 1 94  ? 2.935   -7.803  -21.204 1.00 0.00  ? 94  LYS A CB     2  
ATOM   3957  C CG     . LYS A 1 94  ? 3.295   -8.692  -22.383 1.00 0.00  ? 94  LYS A CG     2  
ATOM   3958  C CD     . LYS A 1 94  ? 3.788   -7.872  -23.565 1.00 0.00  ? 94  LYS A CD     2  
ATOM   3959  C CE     . LYS A 1 94  ? 2.646   -7.148  -24.257 1.00 0.00  ? 94  LYS A CE     2  
ATOM   3960  N NZ     . LYS A 1 94  ? 2.780   -7.183  -25.739 1.00 0.00  ? 94  LYS A NZ     2  
ATOM   3961  H H      . LYS A 1 94  ? 3.307   -9.472  -19.163 1.00 0.00  ? 94  LYS A H      2  
ATOM   3962  H HA     . LYS A 1 94  ? 4.966   -7.522  -20.593 1.00 0.00  ? 94  LYS A HA     2  
ATOM   3963  H HB2    . LYS A 1 94  ? 2.030   -8.187  -20.761 1.00 0.00  ? 94  LYS A HB2    2  
ATOM   3964  H HB3    . LYS A 1 94  ? 2.747   -6.809  -21.579 1.00 0.00  ? 94  LYS A HB3    2  
ATOM   3965  H HG2    . LYS A 1 94  ? 4.071   -9.378  -22.081 1.00 0.00  ? 94  LYS A HG2    2  
ATOM   3966  H HG3    . LYS A 1 94  ? 2.418   -9.247  -22.682 1.00 0.00  ? 94  LYS A HG3    2  
ATOM   3967  H HD2    . LYS A 1 94  ? 4.498   -7.142  -23.212 1.00 0.00  ? 94  LYS A HD2    2  
ATOM   3968  H HD3    . LYS A 1 94  ? 4.266   -8.531  -24.275 1.00 0.00  ? 94  LYS A HD3    2  
ATOM   3969  H HE2    . LYS A 1 94  ? 1.716   -7.618  -23.977 1.00 0.00  ? 94  LYS A HE2    2  
ATOM   3970  H HE3    . LYS A 1 94  ? 2.639   -6.118  -23.929 1.00 0.00  ? 94  LYS A HE3    2  
ATOM   3971  H HZ1    . LYS A 1 94  ? 1.840   -7.153  -26.185 1.00 0.00  ? 94  LYS A HZ1    2  
ATOM   3972  H HZ2    . LYS A 1 94  ? 3.263   -8.054  -26.035 1.00 0.00  ? 94  LYS A HZ2    2  
ATOM   3973  H HZ3    . LYS A 1 94  ? 3.333   -6.367  -26.069 1.00 0.00  ? 94  LYS A HZ3    2  
ATOM   3974  N N      . THR A 1 95  ? 4.535   -5.553  -19.164 1.00 0.00  ? 95  THR A N      2  
ATOM   3975  C CA     . THR A 1 95  ? 4.300   -4.378  -18.333 1.00 0.00  ? 95  THR A CA     2  
ATOM   3976  C C      . THR A 1 95  ? 3.621   -3.315  -19.178 1.00 0.00  ? 95  THR A C      2  
ATOM   3977  O O      . THR A 1 95  ? 4.230   -2.745  -20.083 1.00 0.00  ? 95  THR A O      2  
ATOM   3978  C CB     . THR A 1 95  ? 5.609   -3.833  -17.756 1.00 0.00  ? 95  THR A CB     2  
ATOM   3979  O OG1    . THR A 1 95  ? 6.224   -4.793  -16.913 1.00 0.00  ? 95  THR A OG1    2  
ATOM   3980  C CG2    . THR A 1 95  ? 5.423   -2.563  -16.946 1.00 0.00  ? 95  THR A CG2    2  
ATOM   3981  H H      . THR A 1 95  ? 5.322   -5.577  -19.748 1.00 0.00  ? 95  THR A H      2  
ATOM   3982  H HA     . THR A 1 95  ? 3.641   -4.662  -17.526 1.00 0.00  ? 95  THR A HA     2  
ATOM   3983  H HB     . THR A 1 95  ? 6.285   -3.612  -18.568 1.00 0.00  ? 95  THR A HB     2  
ATOM   3984  H HG1    . THR A 1 95  ? 7.140   -4.550  -16.767 1.00 0.00  ? 95  THR A HG1    2  
ATOM   3985  H HG21   . THR A 1 95  ? 6.389   -2.178  -16.652 1.00 0.00  ? 95  THR A HG21   2  
ATOM   3986  H HG22   . THR A 1 95  ? 4.837   -2.778  -16.064 1.00 0.00  ? 95  THR A HG22   2  
ATOM   3987  H HG23   . THR A 1 95  ? 4.910   -1.823  -17.546 1.00 0.00  ? 95  THR A HG23   2  
ATOM   3988  N N      . VAL A 1 96  ? 2.347   -3.076  -18.905 1.00 0.00  ? 96  VAL A N      2  
ATOM   3989  C CA     . VAL A 1 96  ? 1.581   -2.109  -19.673 1.00 0.00  ? 96  VAL A CA     2  
ATOM   3990  C C      . VAL A 1 96  ? 1.286   -0.850  -18.871 1.00 0.00  ? 96  VAL A C      2  
ATOM   3991  O O      . VAL A 1 96  ? 0.455   -0.862  -17.969 1.00 0.00  ? 96  VAL A O      2  
ATOM   3992  C CB     . VAL A 1 96  ? 0.244   -2.721  -20.133 1.00 0.00  ? 96  VAL A CB     2  
ATOM   3993  C CG1    . VAL A 1 96  ? -0.481  -1.775  -21.080 1.00 0.00  ? 96  VAL A CG1    2  
ATOM   3994  C CG2    . VAL A 1 96  ? 0.467   -4.078  -20.790 1.00 0.00  ? 96  VAL A CG2    2  
ATOM   3995  H H      . VAL A 1 96  ? 1.907   -3.581  -18.189 1.00 0.00  ? 96  VAL A H      2  
ATOM   3996  H HA     . VAL A 1 96  ? 2.152   -1.847  -20.550 1.00 0.00  ? 96  VAL A HA     2  
ATOM   3997  H HB     . VAL A 1 96  ? -0.379  -2.868  -19.257 1.00 0.00  ? 96  VAL A HB     2  
ATOM   3998  H HG11   . VAL A 1 96  ? -0.918  -0.966  -20.515 1.00 0.00  ? 96  VAL A HG11   2  
ATOM   3999  H HG12   . VAL A 1 96  ? -1.260  -2.315  -21.600 1.00 0.00  ? 96  VAL A HG12   2  
ATOM   4000  H HG13   . VAL A 1 96  ? 0.221   -1.377  -21.798 1.00 0.00  ? 96  VAL A HG13   2  
ATOM   4001  H HG21   . VAL A 1 96  ? 0.274   -4.003  -21.849 1.00 0.00  ? 96  VAL A HG21   2  
ATOM   4002  H HG22   . VAL A 1 96  ? -0.201  -4.803  -20.353 1.00 0.00  ? 96  VAL A HG22   2  
ATOM   4003  H HG23   . VAL A 1 96  ? 1.490   -4.393  -20.633 1.00 0.00  ? 96  VAL A HG23   2  
ATOM   4004  N N      . ILE A 1 97  ? 1.945   0.246   -19.239 1.00 0.00  ? 97  ILE A N      2  
ATOM   4005  C CA     . ILE A 1 97  ? 1.725   1.525   -18.578 1.00 0.00  ? 97  ILE A CA     2  
ATOM   4006  C C      . ILE A 1 97  ? 0.544   2.218   -19.245 1.00 0.00  ? 97  ILE A C      2  
ATOM   4007  O O      . ILE A 1 97  ? 0.517   2.369   -20.466 1.00 0.00  ? 97  ILE A O      2  
ATOM   4008  C CB     . ILE A 1 97  ? 2.975   2.427   -18.650 1.00 0.00  ? 97  ILE A CB     2  
ATOM   4009  C CG1    . ILE A 1 97  ? 4.205   1.669   -18.119 1.00 0.00  ? 97  ILE A CG1    2  
ATOM   4010  C CG2    . ILE A 1 97  ? 2.744   3.724   -17.882 1.00 0.00  ? 97  ILE A CG2    2  
ATOM   4011  C CD1    . ILE A 1 97  ? 4.587   2.003   -16.688 1.00 0.00  ? 97  ILE A CD1    2  
ATOM   4012  H H      . ILE A 1 97  ? 2.574   0.199   -19.988 1.00 0.00  ? 97  ILE A H      2  
ATOM   4013  H HA     . ILE A 1 97  ? 1.488   1.335   -17.540 1.00 0.00  ? 97  ILE A HA     2  
ATOM   4014  H HB     . ILE A 1 97  ? 3.141   2.683   -19.686 1.00 0.00  ? 97  ILE A HB     2  
ATOM   4015  H HG12   . ILE A 1 97  ? 4.009   0.609   -18.163 1.00 0.00  ? 97  ILE A HG12   2  
ATOM   4016  H HG13   . ILE A 1 97  ? 5.055   1.896   -18.748 1.00 0.00  ? 97  ILE A HG13   2  
ATOM   4017  H HG21   . ILE A 1 97  ? 2.532   3.497   -16.848 1.00 0.00  ? 97  ILE A HG21   2  
ATOM   4018  H HG22   . ILE A 1 97  ? 1.905   4.253   -18.312 1.00 0.00  ? 97  ILE A HG22   2  
ATOM   4019  H HG23   . ILE A 1 97  ? 3.627   4.341   -17.942 1.00 0.00  ? 97  ILE A HG23   2  
ATOM   4020  H HD11   . ILE A 1 97  ? 5.327   2.789   -16.685 1.00 0.00  ? 97  ILE A HD11   2  
ATOM   4021  H HD12   . ILE A 1 97  ? 4.996   1.121   -16.212 1.00 0.00  ? 97  ILE A HD12   2  
ATOM   4022  H HD13   . ILE A 1 97  ? 3.712   2.328   -16.146 1.00 0.00  ? 97  ILE A HD13   2  
ATOM   4023  N N      . TYR A 1 98  ? -0.452  2.592   -18.452 1.00 0.00  ? 98  TYR A N      2  
ATOM   4024  C CA     . TYR A 1 98  ? -1.653  3.210   -18.999 1.00 0.00  ? 98  TYR A CA     2  
ATOM   4025  C C      . TYR A 1 98  ? -1.795  4.678   -18.612 1.00 0.00  ? 98  TYR A C      2  
ATOM   4026  O O      . TYR A 1 98  ? -1.120  5.171   -17.709 1.00 0.00  ? 98  TYR A O      2  
ATOM   4027  C CB     . TYR A 1 98  ? -2.881  2.430   -18.537 1.00 0.00  ? 98  TYR A CB     2  
ATOM   4028  C CG     . TYR A 1 98  ? -3.145  1.182   -19.352 1.00 0.00  ? 98  TYR A CG     2  
ATOM   4029  C CD1    . TYR A 1 98  ? -3.541  1.268   -20.682 1.00 0.00  ? 98  TYR A CD1    2  
ATOM   4030  C CD2    . TYR A 1 98  ? -2.994  -0.082  -18.795 1.00 0.00  ? 98  TYR A CD2    2  
ATOM   4031  C CE1    . TYR A 1 98  ? -3.779  0.131   -21.432 1.00 0.00  ? 98  TYR A CE1    2  
ATOM   4032  C CE2    . TYR A 1 98  ? -3.230  -1.224  -19.540 1.00 0.00  ? 98  TYR A CE2    2  
ATOM   4033  C CZ     . TYR A 1 98  ? -3.621  -1.112  -20.855 1.00 0.00  ? 98  TYR A CZ     2  
ATOM   4034  O OH     . TYR A 1 98  ? -3.856  -2.247  -21.600 1.00 0.00  ? 98  TYR A OH     2  
ATOM   4035  H H      . TYR A 1 98  ? -0.397  2.413   -17.490 1.00 0.00  ? 98  TYR A H      2  
ATOM   4036  H HA     . TYR A 1 98  ? -1.592  3.144   -20.074 1.00 0.00  ? 98  TYR A HA     2  
ATOM   4037  H HB2    . TYR A 1 98  ? -2.744  2.130   -17.509 1.00 0.00  ? 98  TYR A HB2    2  
ATOM   4038  H HB3    . TYR A 1 98  ? -3.748  3.066   -18.609 1.00 0.00  ? 98  TYR A HB3    2  
ATOM   4039  H HD1    . TYR A 1 98  ? -3.663  2.243   -21.131 1.00 0.00  ? 98  TYR A HD1    2  
ATOM   4040  H HD2    . TYR A 1 98  ? -2.688  -0.168  -17.762 1.00 0.00  ? 98  TYR A HD2    2  
ATOM   4041  H HE1    . TYR A 1 98  ? -4.085  0.219   -22.465 1.00 0.00  ? 98  TYR A HE1    2  
ATOM   4042  H HE2    . TYR A 1 98  ? -3.107  -2.198  -19.087 1.00 0.00  ? 98  TYR A HE2    2  
ATOM   4043  H HH     . TYR A 1 98  ? -3.224  -2.927  -21.356 1.00 0.00  ? 98  TYR A HH     2  
ATOM   4044  N N      . TRP A 1 99  ? -2.691  5.360   -19.319 1.00 0.00  ? 99  TRP A N      2  
ATOM   4045  C CA     . TRP A 1 99  ? -2.963  6.774   -19.087 1.00 0.00  ? 99  TRP A CA     2  
ATOM   4046  C C      . TRP A 1 99  ? -4.390  7.112   -19.499 1.00 0.00  ? 99  TRP A C      2  
ATOM   4047  O O      . TRP A 1 99  ? -4.871  6.652   -20.533 1.00 0.00  ? 99  TRP A O      2  
ATOM   4048  C CB     . TRP A 1 99  ? -1.993  7.650   -19.880 1.00 0.00  ? 99  TRP A CB     2  
ATOM   4049  C CG     . TRP A 1 99  ? -0.697  7.894   -19.178 1.00 0.00  ? 99  TRP A CG     2  
ATOM   4050  C CD1    . TRP A 1 99  ? -0.451  8.806   -18.193 1.00 0.00  ? 99  TRP A CD1    2  
ATOM   4051  C CD2    . TRP A 1 99  ? 0.533   7.212   -19.412 1.00 0.00  ? 99  TRP A CD2    2  
ATOM   4052  N NE1    . TRP A 1 99  ? 0.863   8.730   -17.801 1.00 0.00  ? 99  TRP A NE1    2  
ATOM   4053  C CE2    . TRP A 1 99  ? 1.488   7.756   -18.536 1.00 0.00  ? 99  TRP A CE2    2  
ATOM   4054  C CE3    . TRP A 1 99  ? 0.919   6.188   -20.281 1.00 0.00  ? 99  TRP A CE3    2  
ATOM   4055  C CZ2    . TRP A 1 99  ? 2.804   7.315   -18.505 1.00 0.00  ? 99  TRP A CZ2    2  
ATOM   4056  C CZ3    . TRP A 1 99  ? 2.227   5.747   -20.247 1.00 0.00  ? 99  TRP A CZ3    2  
ATOM   4057  C CH2    . TRP A 1 99  ? 3.154   6.310   -19.363 1.00 0.00  ? 99  TRP A CH2    2  
ATOM   4058  H H      . TRP A 1 99  ? -3.190  4.895   -20.023 1.00 0.00  ? 99  TRP A H      2  
ATOM   4059  H HA     . TRP A 1 99  ? -2.842  6.972   -18.032 1.00 0.00  ? 99  TRP A HA     2  
ATOM   4060  H HB2    . TRP A 1 99  ? -1.774  7.171   -20.821 1.00 0.00  ? 99  TRP A HB2    2  
ATOM   4061  H HB3    . TRP A 1 99  ? -2.456  8.607   -20.070 1.00 0.00  ? 99  TRP A HB3    2  
ATOM   4062  H HD1    . TRP A 1 99  ? -1.189  9.485   -17.791 1.00 0.00  ? 99  TRP A HD1    2  
ATOM   4063  H HE1    . TRP A 1 99  ? 1.286   9.279   -17.108 1.00 0.00  ? 99  TRP A HE1    2  
ATOM   4064  H HE3    . TRP A 1 99  ? 0.216   5.746   -20.970 1.00 0.00  ? 99  TRP A HE3    2  
ATOM   4065  H HZ2    . TRP A 1 99  ? 3.533   7.739   -17.834 1.00 0.00  ? 99  TRP A HZ2    2  
ATOM   4066  H HZ3    . TRP A 1 99  ? 2.545   4.956   -20.910 1.00 0.00  ? 99  TRP A HZ3    2  
ATOM   4067  H HH2    . TRP A 1 99  ? 4.164   5.933   -19.366 1.00 0.00  ? 99  TRP A HH2    2  
ATOM   4068  N N      . LEU A 1 100 ? -5.058  7.922   -18.692 1.00 0.00  ? 100 LEU A N      2  
ATOM   4069  C CA     . LEU A 1 100 ? -6.426  8.323   -18.989 1.00 0.00  ? 100 LEU A CA     2  
ATOM   4070  C C      . LEU A 1 100 ? -6.430  9.371   -20.096 1.00 0.00  ? 100 LEU A C      2  
ATOM   4071  O O      . LEU A 1 100 ? -5.761  10.396  -19.987 1.00 0.00  ? 100 LEU A O      2  
ATOM   4072  C CB     . LEU A 1 100 ? -7.113  8.876   -17.734 1.00 0.00  ? 100 LEU A CB     2  
ATOM   4073  C CG     . LEU A 1 100 ? -6.568  8.362   -16.396 1.00 0.00  ? 100 LEU A CG     2  
ATOM   4074  C CD1    . LEU A 1 100 ? -7.526  8.700   -15.265 1.00 0.00  ? 100 LEU A CD1    2  
ATOM   4075  C CD2    . LEU A 1 100 ? -6.319  6.860   -16.451 1.00 0.00  ? 100 LEU A CD2    2  
ATOM   4076  H H      . LEU A 1 100 ? -4.621  8.264   -17.884 1.00 0.00  ? 100 LEU A H      2  
ATOM   4077  H HA     . LEU A 1 100 ? -6.961  7.450   -19.329 1.00 0.00  ? 100 LEU A HA     2  
ATOM   4078  H HB2    . LEU A 1 100 ? -7.018  9.952   -17.745 1.00 0.00  ? 100 LEU A HB2    2  
ATOM   4079  H HB3    . LEU A 1 100 ? -8.163  8.627   -17.788 1.00 0.00  ? 100 LEU A HB3    2  
ATOM   4080  H HG     . LEU A 1 100 ? -5.626  8.850   -16.189 1.00 0.00  ? 100 LEU A HG     2  
ATOM   4081  H HD11   . LEU A 1 100 ? -8.479  8.225   -15.446 1.00 0.00  ? 100 LEU A HD11   2  
ATOM   4082  H HD12   . LEU A 1 100 ? -7.662  9.770   -15.217 1.00 0.00  ? 100 LEU A HD12   2  
ATOM   4083  H HD13   . LEU A 1 100 ? -7.119  8.344   -14.330 1.00 0.00  ? 100 LEU A HD13   2  
ATOM   4084  H HD21   . LEU A 1 100 ? -6.865  6.434   -17.279 1.00 0.00  ? 100 LEU A HD21   2  
ATOM   4085  H HD22   . LEU A 1 100 ? -6.647  6.404   -15.530 1.00 0.00  ? 100 LEU A HD22   2  
ATOM   4086  H HD23   . LEU A 1 100 ? -5.262  6.677   -16.586 1.00 0.00  ? 100 LEU A HD23   2  
ATOM   4087  N N      . ALA A 1 101 ? -7.172  9.107   -21.168 1.00 0.00  ? 101 ALA A N      2  
ATOM   4088  C CA     . ALA A 1 101 ? -7.232  10.034  -22.289 1.00 0.00  ? 101 ALA A CA     2  
ATOM   4089  C C      . ALA A 1 101 ? -8.672  10.300  -22.713 1.00 0.00  ? 101 ALA A C      2  
ATOM   4090  O O      . ALA A 1 101 ? -9.510  9.409   -22.676 1.00 0.00  ? 101 ALA A O      2  
ATOM   4091  C CB     . ALA A 1 101 ? -6.430  9.484   -23.457 1.00 0.00  ? 101 ALA A CB     2  
ATOM   4092  H H      . ALA A 1 101 ? -7.678  8.267   -21.212 1.00 0.00  ? 101 ALA A H      2  
ATOM   4093  H HA     . ALA A 1 101 ? -6.780  10.960  -21.977 1.00 0.00  ? 101 ALA A HA     2  
ATOM   4094  H HB1    . ALA A 1 101 ? -6.932  8.618   -23.863 1.00 0.00  ? 101 ALA A HB1    2  
ATOM   4095  H HB2    . ALA A 1 101 ? -5.444  9.202   -23.116 1.00 0.00  ? 101 ALA A HB2    2  
ATOM   4096  H HB3    . ALA A 1 101 ? -6.345  10.241  -24.222 1.00 0.00  ? 101 ALA A HB3    2  
ATOM   4097  N N      . GLU A 1 102 ? -8.947  11.536  -23.116 1.00 0.00  ? 102 GLU A N      2  
ATOM   4098  C CA     . GLU A 1 102 ? -10.287 11.920  -23.550 1.00 0.00  ? 102 GLU A CA     2  
ATOM   4099  C C      . GLU A 1 102 ? -10.278 12.355  -25.011 1.00 0.00  ? 102 GLU A C      2  
ATOM   4100  O O      . GLU A 1 102 ? -9.720  13.399  -25.350 1.00 0.00  ? 102 GLU A O      2  
ATOM   4101  C CB     . GLU A 1 102 ? -10.828 13.047  -22.668 1.00 0.00  ? 102 GLU A CB     2  
ATOM   4102  C CG     . GLU A 1 102 ? -12.225 13.513  -23.055 1.00 0.00  ? 102 GLU A CG     2  
ATOM   4103  C CD     . GLU A 1 102 ? -12.302 15.012  -23.276 1.00 0.00  ? 102 GLU A CD     2  
ATOM   4104  O OE1    . GLU A 1 102 ? -11.251 15.627  -23.550 1.00 0.00  ? 102 GLU A OE1    2  
ATOM   4105  O OE2    . GLU A 1 102 ? -13.415 15.569  -23.172 1.00 0.00  ? 102 GLU A OE2    2  
ATOM   4106  H H      . GLU A 1 102 ? -8.236  12.205  -23.118 1.00 0.00  ? 102 GLU A H      2  
ATOM   4107  H HA     . GLU A 1 102 ? -10.925 11.058  -23.450 1.00 0.00  ? 102 GLU A HA     2  
ATOM   4108  H HB2    . GLU A 1 102 ? -10.860 12.704  -21.648 1.00 0.00  ? 102 GLU A HB2    2  
ATOM   4109  H HB3    . GLU A 1 102 ? -10.159 13.891  -22.733 1.00 0.00  ? 102 GLU A HB3    2  
ATOM   4110  H HG2    . GLU A 1 102 ? -12.515 13.016  -23.968 1.00 0.00  ? 102 GLU A HG2    2  
ATOM   4111  H HG3    . GLU A 1 102 ? -12.910 13.243  -22.266 1.00 0.00  ? 102 GLU A HG3    2  
ATOM   4112  H HE2    . GLU A 1 102 ? -13.391 16.517  -23.323 1.00 0.00  ? 102 GLU A HE2    2  
ATOM   4113  N N      . VAL A 1 103 ? -10.889 11.544  -25.875 1.00 0.00  ? 103 VAL A N      2  
ATOM   4114  C CA     . VAL A 1 103 ? -10.933 11.845  -27.301 1.00 0.00  ? 103 VAL A CA     2  
ATOM   4115  C C      . VAL A 1 103 ? -11.879 13.001  -27.601 1.00 0.00  ? 103 VAL A C      2  
ATOM   4116  O O      . VAL A 1 103 ? -12.910 13.172  -26.949 1.00 0.00  ? 103 VAL A O      2  
ATOM   4117  C CB     . VAL A 1 103 ? -11.315 10.601  -28.136 1.00 0.00  ? 103 VAL A CB     2  
ATOM   4118  C CG1    . VAL A 1 103 ? -10.416 9.431   -27.776 1.00 0.00  ? 103 VAL A CG1    2  
ATOM   4119  C CG2    . VAL A 1 103 ? -12.775 10.210  -27.942 1.00 0.00  ? 103 VAL A CG2    2  
ATOM   4120  H H      . VAL A 1 103 ? -11.309 10.722  -25.544 1.00 0.00  ? 103 VAL A H      2  
ATOM   4121  H HA     . VAL A 1 103 ? -9.939  12.149  -27.596 1.00 0.00  ? 103 VAL A HA     2  
ATOM   4122  H HB     . VAL A 1 103 ? -11.160 10.832  -29.180 1.00 0.00  ? 103 VAL A HB     2  
ATOM   4123  H HG11   . VAL A 1 103 ? -9.659  9.759   -27.076 1.00 0.00  ? 103 VAL A HG11   2  
ATOM   4124  H HG12   . VAL A 1 103 ? -9.942  9.051   -28.668 1.00 0.00  ? 103 VAL A HG12   2  
ATOM   4125  H HG13   . VAL A 1 103 ? -11.009 8.655   -27.325 1.00 0.00  ? 103 VAL A HG13   2  
ATOM   4126  H HG21   . VAL A 1 103 ? -13.327 11.048  -27.544 1.00 0.00  ? 103 VAL A HG21   2  
ATOM   4127  H HG22   . VAL A 1 103 ? -12.835 9.377   -27.255 1.00 0.00  ? 103 VAL A HG22   2  
ATOM   4128  H HG23   . VAL A 1 103 ? -13.193 9.921   -28.895 1.00 0.00  ? 103 VAL A HG23   2  
ATOM   4129  N N      . LYS A 1 104 ? -11.483 13.813  -28.572 1.00 0.00  ? 104 LYS A N      2  
ATOM   4130  C CA     . LYS A 1 104 ? -12.239 14.995  -28.963 1.00 0.00  ? 104 LYS A CA     2  
ATOM   4131  C C      . LYS A 1 104 ? -13.535 14.655  -29.701 1.00 0.00  ? 104 LYS A C      2  
ATOM   4132  O O      . LYS A 1 104 ? -14.382 15.530  -29.898 1.00 0.00  ? 104 LYS A O      2  
ATOM   4133  C CB     . LYS A 1 104 ? -11.365 15.891  -29.839 1.00 0.00  ? 104 LYS A CB     2  
ATOM   4134  C CG     . LYS A 1 104 ? -10.366 16.732  -29.055 1.00 0.00  ? 104 LYS A CG     2  
ATOM   4135  C CD     . LYS A 1 104 ? -9.328  15.880  -28.346 1.00 0.00  ? 104 LYS A CD     2  
ATOM   4136  C CE     . LYS A 1 104 ? -8.572  16.681  -27.299 1.00 0.00  ? 104 LYS A CE     2  
ATOM   4137  N NZ     . LYS A 1 104 ? -9.470  17.190  -26.229 1.00 0.00  ? 104 LYS A NZ     2  
ATOM   4138  H H      . LYS A 1 104 ? -10.635 13.625  -29.026 1.00 0.00  ? 104 LYS A H      2  
ATOM   4139  H HA     . LYS A 1 104 ? -12.489 15.535  -28.064 1.00 0.00  ? 104 LYS A HA     2  
ATOM   4140  H HB2    . LYS A 1 104 ? -10.814 15.271  -30.530 1.00 0.00  ? 104 LYS A HB2    2  
ATOM   4141  H HB3    . LYS A 1 104 ? -12.001 16.559  -30.400 1.00 0.00  ? 104 LYS A HB3    2  
ATOM   4142  H HG2    . LYS A 1 104 ? -9.855  17.388  -29.741 1.00 0.00  ? 104 LYS A HG2    2  
ATOM   4143  H HG3    . LYS A 1 104 ? -10.900 17.313  -28.322 1.00 0.00  ? 104 LYS A HG3    2  
ATOM   4144  H HD2    . LYS A 1 104 ? -9.819  15.052  -27.862 1.00 0.00  ? 104 LYS A HD2    2  
ATOM   4145  H HD3    . LYS A 1 104 ? -8.628  15.513  -29.076 1.00 0.00  ? 104 LYS A HD3    2  
ATOM   4146  H HE2    . LYS A 1 104 ? -7.820  16.049  -26.852 1.00 0.00  ? 104 LYS A HE2    2  
ATOM   4147  H HE3    . LYS A 1 104 ? -8.091  17.520  -27.784 1.00 0.00  ? 104 LYS A HE3    2  
ATOM   4148  H HZ1    . LYS A 1 104 ? -8.924  17.388  -25.365 1.00 0.00  ? 104 LYS A HZ1    2  
ATOM   4149  H HZ2    . LYS A 1 104 ? -10.200 16.483  -26.007 1.00 0.00  ? 104 LYS A HZ2    2  
ATOM   4150  H HZ3    . LYS A 1 104 ? -9.936  18.066  -26.537 1.00 0.00  ? 104 LYS A HZ3    2  
ATOM   4151  N N      . ASP A 1 105 ? -13.696 13.405  -30.120 1.00 0.00  ? 105 ASP A N      2  
ATOM   4152  C CA     . ASP A 1 105 ? -14.903 13.007  -30.840 1.00 0.00  ? 105 ASP A CA     2  
ATOM   4153  C C      . ASP A 1 105 ? -15.483 11.709  -30.302 1.00 0.00  ? 105 ASP A C      2  
ATOM   4154  O O      . ASP A 1 105 ? -14.786 10.699  -30.201 1.00 0.00  ? 105 ASP A O      2  
ATOM   4155  C CB     . ASP A 1 105 ? -14.615 12.873  -32.334 1.00 0.00  ? 105 ASP A CB     2  
ATOM   4156  C CG     . ASP A 1 105 ? -15.869 12.982  -33.177 1.00 0.00  ? 105 ASP A CG     2  
ATOM   4157  O OD1    . ASP A 1 105 ? -16.688 12.041  -33.145 1.00 0.00  ? 105 ASP A OD1    2  
ATOM   4158  O OD2    . ASP A 1 105 ? -16.031 14.008  -33.872 1.00 0.00  ? 105 ASP A OD2    2  
ATOM   4159  H H      . ASP A 1 105 ? -12.994 12.742  -29.950 1.00 0.00  ? 105 ASP A H      2  
ATOM   4160  H HA     . ASP A 1 105 ? -15.634 13.786  -30.701 1.00 0.00  ? 105 ASP A HA     2  
ATOM   4161  H HB2    . ASP A 1 105 ? -13.935 13.653  -32.633 1.00 0.00  ? 105 ASP A HB2    2  
ATOM   4162  H HB3    . ASP A 1 105 ? -14.159 11.915  -32.524 1.00 0.00  ? 105 ASP A HB3    2  
ATOM   4163  H HD2    . ASP A 1 105 ? -16.846 14.010  -34.379 1.00 0.00  ? 105 ASP A HD2    2  
ATOM   4164  N N      . TYR A 1 106 ? -16.771 11.738  -29.973 1.00 0.00  ? 106 TYR A N      2  
ATOM   4165  C CA     . TYR A 1 106 ? -17.453 10.555  -29.462 1.00 0.00  ? 106 TYR A CA     2  
ATOM   4166  C C      . TYR A 1 106 ? -17.445 9.459   -30.514 1.00 0.00  ? 106 TYR A C      2  
ATOM   4167  O O      . TYR A 1 106 ? -17.258 8.282   -30.204 1.00 0.00  ? 106 TYR A O      2  
ATOM   4168  C CB     . TYR A 1 106 ? -18.889 10.886  -29.054 1.00 0.00  ? 106 TYR A CB     2  
ATOM   4169  C CG     . TYR A 1 106 ? -19.593 9.750   -28.342 1.00 0.00  ? 106 TYR A CG     2  
ATOM   4170  C CD1    . TYR A 1 106 ? -19.212 9.362   -27.064 1.00 0.00  ? 106 TYR A CD1    2  
ATOM   4171  C CD2    . TYR A 1 106 ? -20.641 9.069   -28.949 1.00 0.00  ? 106 TYR A CD2    2  
ATOM   4172  C CE1    . TYR A 1 106 ? -19.850 8.325   -26.411 1.00 0.00  ? 106 TYR A CE1    2  
ATOM   4173  C CE2    . TYR A 1 106 ? -21.285 8.029   -28.302 1.00 0.00  ? 106 TYR A CE2    2  
ATOM   4174  C CZ     . TYR A 1 106 ? -20.885 7.661   -27.035 1.00 0.00  ? 106 TYR A CZ     2  
ATOM   4175  O OH     . TYR A 1 106 ? -21.523 6.627   -26.389 1.00 0.00  ? 106 TYR A OH     2  
ATOM   4176  H H      . TYR A 1 106 ? -17.272 12.571  -30.089 1.00 0.00  ? 106 TYR A H      2  
ATOM   4177  H HA     . TYR A 1 106 ? -16.910 10.209  -28.598 1.00 0.00  ? 106 TYR A HA     2  
ATOM   4178  H HB2    . TYR A 1 106 ? -18.880 11.739  -28.391 1.00 0.00  ? 106 TYR A HB2    2  
ATOM   4179  H HB3    . TYR A 1 106 ? -19.460 11.131  -29.938 1.00 0.00  ? 106 TYR A HB3    2  
ATOM   4180  H HD1    . TYR A 1 106 ? -18.402 9.883   -26.577 1.00 0.00  ? 106 TYR A HD1    2  
ATOM   4181  H HD2    . TYR A 1 106 ? -20.951 9.356   -29.941 1.00 0.00  ? 106 TYR A HD2    2  
ATOM   4182  H HE1    . TYR A 1 106 ? -19.537 8.036   -25.419 1.00 0.00  ? 106 TYR A HE1    2  
ATOM   4183  H HE2    . TYR A 1 106 ? -22.097 7.510   -28.791 1.00 0.00  ? 106 TYR A HE2    2  
ATOM   4184  H HH     . TYR A 1 106 ? -20.971 5.843   -26.420 1.00 0.00  ? 106 TYR A HH     2  
ATOM   4185  N N      . ASP A 1 107 ? -17.618 9.862   -31.766 1.00 0.00  ? 107 ASP A N      2  
ATOM   4186  C CA     . ASP A 1 107 ? -17.598 8.926   -32.879 1.00 0.00  ? 107 ASP A CA     2  
ATOM   4187  C C      . ASP A 1 107 ? -16.239 8.976   -33.568 1.00 0.00  ? 107 ASP A C      2  
ATOM   4188  O O      . ASP A 1 107 ? -16.103 8.586   -34.729 1.00 0.00  ? 107 ASP A O      2  
ATOM   4189  C CB     . ASP A 1 107 ? -18.717 9.241   -33.876 1.00 0.00  ? 107 ASP A CB     2  
ATOM   4190  C CG     . ASP A 1 107 ? -18.782 10.714  -34.228 1.00 0.00  ? 107 ASP A CG     2  
ATOM   4191  O OD1    . ASP A 1 107 ? -18.156 11.113  -35.231 1.00 0.00  ? 107 ASP A OD1    2  
ATOM   4192  O OD2    . ASP A 1 107 ? -19.460 11.468  -33.500 1.00 0.00  ? 107 ASP A OD2    2  
ATOM   4193  H H      . ASP A 1 107 ? -17.736 10.817  -31.948 1.00 0.00  ? 107 ASP A H      2  
ATOM   4194  H HA     . ASP A 1 107 ? -17.749 7.933   -32.478 1.00 0.00  ? 107 ASP A HA     2  
ATOM   4195  H HB2    . ASP A 1 107 ? -18.549 8.683   -34.784 1.00 0.00  ? 107 ASP A HB2    2  
ATOM   4196  H HB3    . ASP A 1 107 ? -19.664 8.949   -33.448 1.00 0.00  ? 107 ASP A HB3    2  
ATOM   4197  H HD2    . ASP A 1 107 ? -19.459 12.385  -33.780 1.00 0.00  ? 107 ASP A HD2    2  
ATOM   4198  N N      . VAL A 1 108 ? -15.235 9.461   -32.832 1.00 0.00  ? 108 VAL A N      2  
ATOM   4199  C CA     . VAL A 1 108 ? -13.872 9.571   -33.339 1.00 0.00  ? 108 VAL A CA     2  
ATOM   4200  C C      . VAL A 1 108 ? -13.484 8.317   -34.112 1.00 0.00  ? 108 VAL A C      2  
ATOM   4201  O O      . VAL A 1 108 ? -13.918 7.216   -33.779 1.00 0.00  ? 108 VAL A O      2  
ATOM   4202  C CB     . VAL A 1 108 ? -12.880 9.792   -32.176 1.00 0.00  ? 108 VAL A CB     2  
ATOM   4203  C CG1    . VAL A 1 108 ? -13.023 8.688   -31.144 1.00 0.00  ? 108 VAL A CG1    2  
ATOM   4204  C CG2    . VAL A 1 108 ? -11.448 9.885   -32.677 1.00 0.00  ? 108 VAL A CG2    2  
ATOM   4205  H H      . VAL A 1 108 ? -15.418 9.748   -31.914 1.00 0.00  ? 108 VAL A H      2  
ATOM   4206  H HA     . VAL A 1 108 ? -13.824 10.424  -33.998 1.00 0.00  ? 108 VAL A HA     2  
ATOM   4207  H HB     . VAL A 1 108 ? -13.127 10.725  -31.694 1.00 0.00  ? 108 VAL A HB     2  
ATOM   4208  H HG11   . VAL A 1 108 ? -12.307 8.844   -30.351 1.00 0.00  ? 108 VAL A HG11   2  
ATOM   4209  H HG12   . VAL A 1 108 ? -12.840 7.733   -31.613 1.00 0.00  ? 108 VAL A HG12   2  
ATOM   4210  H HG13   . VAL A 1 108 ? -14.022 8.705   -30.737 1.00 0.00  ? 108 VAL A HG13   2  
ATOM   4211  H HG21   . VAL A 1 108 ? -11.327 10.791  -33.254 1.00 0.00  ? 108 VAL A HG21   2  
ATOM   4212  H HG22   . VAL A 1 108 ? -11.226 9.030   -33.298 1.00 0.00  ? 108 VAL A HG22   2  
ATOM   4213  H HG23   . VAL A 1 108 ? -10.774 9.905   -31.832 1.00 0.00  ? 108 VAL A HG23   2  
ATOM   4214  N N      . GLU A 1 109 ? -12.678 8.485   -35.152 1.00 0.00  ? 109 GLU A N      2  
ATOM   4215  C CA     . GLU A 1 109 ? -12.262 7.356   -35.961 1.00 0.00  ? 109 GLU A CA     2  
ATOM   4216  C C      . GLU A 1 109 ? -11.473 6.361   -35.126 1.00 0.00  ? 109 GLU A C      2  
ATOM   4217  O O      . GLU A 1 109 ? -10.657 6.737   -34.284 1.00 0.00  ? 109 GLU A O      2  
ATOM   4218  C CB     . GLU A 1 109 ? -11.454 7.817   -37.188 1.00 0.00  ? 109 GLU A CB     2  
ATOM   4219  C CG     . GLU A 1 109 ? -9.941  7.892   -36.984 1.00 0.00  ? 109 GLU A CG     2  
ATOM   4220  C CD     . GLU A 1 109 ? -9.414  9.312   -37.042 1.00 0.00  ? 109 GLU A CD     2  
ATOM   4221  O OE1    . GLU A 1 109 ? -8.925  9.721   -38.116 1.00 0.00  ? 109 GLU A OE1    2  
ATOM   4222  O OE2    . GLU A 1 109 ? -9.492  10.016  -36.013 1.00 0.00  ? 109 GLU A OE2    2  
ATOM   4223  H H      . GLU A 1 109 ? -12.367 9.382   -35.381 1.00 0.00  ? 109 GLU A H      2  
ATOM   4224  H HA     . GLU A 1 109 ? -13.159 6.867   -36.309 1.00 0.00  ? 109 GLU A HA     2  
ATOM   4225  H HB2    . GLU A 1 109 ? -11.645 7.129   -37.997 1.00 0.00  ? 109 GLU A HB2    2  
ATOM   4226  H HB3    . GLU A 1 109 ? -11.802 8.797   -37.480 1.00 0.00  ? 109 GLU A HB3    2  
ATOM   4227  H HG2    . GLU A 1 109 ? -9.696  7.476   -36.023 1.00 0.00  ? 109 GLU A HG2    2  
ATOM   4228  H HG3    . GLU A 1 109 ? -9.458  7.310   -37.759 1.00 0.00  ? 109 GLU A HG3    2  
ATOM   4229  H HE2    . GLU A 1 109 ? -9.140  10.903  -36.120 1.00 0.00  ? 109 GLU A HE2    2  
ATOM   4230  N N      . ILE A 1 110 ? -11.726 5.095   -35.376 1.00 0.00  ? 110 ILE A N      2  
ATOM   4231  C CA     . ILE A 1 110 ? -11.048 4.025   -34.671 1.00 0.00  ? 110 ILE A CA     2  
ATOM   4232  C C      . ILE A 1 110 ? -10.365 3.101   -35.667 1.00 0.00  ? 110 ILE A C      2  
ATOM   4233  O O      . ILE A 1 110 ? -10.981 2.197   -36.231 1.00 0.00  ? 110 ILE A O      2  
ATOM   4234  C CB     . ILE A 1 110 ? -12.004 3.234   -33.765 1.00 0.00  ? 110 ILE A CB     2  
ATOM   4235  C CG1    . ILE A 1 110 ? -12.459 4.118   -32.603 1.00 0.00  ? 110 ILE A CG1    2  
ATOM   4236  C CG2    . ILE A 1 110 ? -11.320 1.983   -33.241 1.00 0.00  ? 110 ILE A CG2    2  
ATOM   4237  C CD1    . ILE A 1 110 ? -11.313 4.609   -31.745 1.00 0.00  ? 110 ILE A CD1    2  
ATOM   4238  H H      . ILE A 1 110 ? -12.384 4.873   -36.066 1.00 0.00  ? 110 ILE A H      2  
ATOM   4239  H HA     . ILE A 1 110 ? -10.291 4.473   -34.048 1.00 0.00  ? 110 ILE A HA     2  
ATOM   4240  H HB     . ILE A 1 110 ? -12.859 2.940   -34.347 1.00 0.00  ? 110 ILE A HB     2  
ATOM   4241  H HG12   . ILE A 1 110 ? -12.977 4.982   -32.993 1.00 0.00  ? 110 ILE A HG12   2  
ATOM   4242  H HG13   . ILE A 1 110 ? -13.131 3.557   -31.970 1.00 0.00  ? 110 ILE A HG13   2  
ATOM   4243  H HG21   . ILE A 1 110 ? -11.525 1.156   -33.902 1.00 0.00  ? 110 ILE A HG21   2  
ATOM   4244  H HG22   . ILE A 1 110 ? -11.688 1.756   -32.252 1.00 0.00  ? 110 ILE A HG22   2  
ATOM   4245  H HG23   . ILE A 1 110 ? -10.252 2.152   -33.199 1.00 0.00  ? 110 ILE A HG23   2  
ATOM   4246  H HD11   . ILE A 1 110 ? -10.539 3.855   -31.713 1.00 0.00  ? 110 ILE A HD11   2  
ATOM   4247  H HD12   . ILE A 1 110 ? -11.670 4.802   -30.745 1.00 0.00  ? 110 ILE A HD12   2  
ATOM   4248  H HD13   . ILE A 1 110 ? -10.911 5.519   -32.166 1.00 0.00  ? 110 ILE A HD13   2  
ATOM   4249  N N      . ARG A 1 111 ? -9.090  3.367   -35.890 1.00 0.00  ? 111 ARG A N      2  
ATOM   4250  C CA     . ARG A 1 111 ? -8.293  2.600   -36.836 1.00 0.00  ? 111 ARG A CA     2  
ATOM   4251  C C      . ARG A 1 111 ? -7.520  1.491   -36.132 1.00 0.00  ? 111 ARG A C      2  
ATOM   4252  O O      . ARG A 1 111 ? -6.500  1.737   -35.491 1.00 0.00  ? 111 ARG A O      2  
ATOM   4253  C CB     . ARG A 1 111 ? -7.341  3.540   -37.580 1.00 0.00  ? 111 ARG A CB     2  
ATOM   4254  C CG     . ARG A 1 111 ? -8.069  4.586   -38.416 1.00 0.00  ? 111 ARG A CG     2  
ATOM   4255  C CD     . ARG A 1 111 ? -7.344  5.924   -38.421 1.00 0.00  ? 111 ARG A CD     2  
ATOM   4256  N NE     . ARG A 1 111 ? -5.946  5.797   -38.829 1.00 0.00  ? 111 ARG A NE     2  
ATOM   4257  C CZ     . ARG A 1 111 ? -5.455  6.269   -39.973 1.00 0.00  ? 111 ARG A CZ     2  
ATOM   4258  N NH1    . ARG A 1 111 ? -6.248  6.866   -40.856 1.00 0.00  ? 111 ARG A NH1    2  
ATOM   4259  N NH2    . ARG A 1 111 ? -4.163  6.137   -40.243 1.00 0.00  ? 111 ARG A NH2    2  
ATOM   4260  H H      . ARG A 1 111 ? -8.673  4.112   -35.413 1.00 0.00  ? 111 ARG A H      2  
ATOM   4261  H HA     . ARG A 1 111 ? -8.970  2.152   -37.549 1.00 0.00  ? 111 ARG A HA     2  
ATOM   4262  H HB2    . ARG A 1 111 ? -6.722  4.052   -36.857 1.00 0.00  ? 111 ARG A HB2    2  
ATOM   4263  H HB3    . ARG A 1 111 ? -6.712  2.960   -38.235 1.00 0.00  ? 111 ARG A HB3    2  
ATOM   4264  H HG2    . ARG A 1 111 ? -8.149  4.233   -39.430 1.00 0.00  ? 111 ARG A HG2    2  
ATOM   4265  H HG3    . ARG A 1 111 ? -9.059  4.728   -38.009 1.00 0.00  ? 111 ARG A HG3    2  
ATOM   4266  H HD2    . ARG A 1 111 ? -7.850  6.586   -39.103 1.00 0.00  ? 111 ARG A HD2    2  
ATOM   4267  H HD3    . ARG A 1 111 ? -7.382  6.342   -37.428 1.00 0.00  ? 111 ARG A HD3    2  
ATOM   4268  H HE     . ARG A 1 111 ? -5.335  5.344   -38.209 1.00 0.00  ? 111 ARG A HE     2  
ATOM   4269  H HH11   . ARG A 1 111 ? -7.225  6.965   -40.670 1.00 0.00  ? 111 ARG A HH11   2  
ATOM   4270  H HH12   . ARG A 1 111 ? -5.866  7.217   -41.711 1.00 0.00  ? 111 ARG A HH12   2  
ATOM   4271  H HH21   . ARG A 1 111 ? -3.559  5.683   -39.587 1.00 0.00  ? 111 ARG A HH21   2  
ATOM   4272  H HH22   . ARG A 1 111 ? -3.791  6.493   -41.101 1.00 0.00  ? 111 ARG A HH22   2  
ATOM   4273  N N      . LEU A 1 112 ? -8.028  0.267   -36.255 1.00 0.00  ? 112 LEU A N      2  
ATOM   4274  C CA     . LEU A 1 112 ? -7.400  -0.892  -35.631 1.00 0.00  ? 112 LEU A CA     2  
ATOM   4275  C C      . LEU A 1 112 ? -6.393  -1.545  -36.573 1.00 0.00  ? 112 LEU A C      2  
ATOM   4276  O O      . LEU A 1 112 ? -6.597  -1.589  -37.787 1.00 0.00  ? 112 LEU A O      2  
ATOM   4277  C CB     . LEU A 1 112 ? -8.464  -1.912  -35.214 1.00 0.00  ? 112 LEU A CB     2  
ATOM   4278  C CG     . LEU A 1 112 ? -9.733  -1.318  -34.589 1.00 0.00  ? 112 LEU A CG     2  
ATOM   4279  C CD1    . LEU A 1 112 ? -10.669 -2.427  -34.123 1.00 0.00  ? 112 LEU A CD1    2  
ATOM   4280  C CD2    . LEU A 1 112 ? -9.386  -0.392  -33.433 1.00 0.00  ? 112 LEU A CD2    2  
ATOM   4281  H H      . LEU A 1 112 ? -8.847  0.142   -36.777 1.00 0.00  ? 112 LEU A H      2  
ATOM   4282  H HA     . LEU A 1 112 ? -6.877  -0.550  -34.750 1.00 0.00  ? 112 LEU A HA     2  
ATOM   4283  H HB2    . LEU A 1 112 ? -8.750  -2.478  -36.087 1.00 0.00  ? 112 LEU A HB2    2  
ATOM   4284  H HB3    . LEU A 1 112 ? -8.023  -2.587  -34.497 1.00 0.00  ? 112 LEU A HB3    2  
ATOM   4285  H HG     . LEU A 1 112 ? -10.254 -0.739  -35.338 1.00 0.00  ? 112 LEU A HG     2  
ATOM   4286  H HD11   . LEU A 1 112 ? -11.549 -2.441  -34.750 1.00 0.00  ? 112 LEU A HD11   2  
ATOM   4287  H HD12   . LEU A 1 112 ? -10.961 -2.245  -33.098 1.00 0.00  ? 112 LEU A HD12   2  
ATOM   4288  H HD13   . LEU A 1 112 ? -10.163 -3.378  -34.190 1.00 0.00  ? 112 LEU A HD13   2  
ATOM   4289  H HD21   . LEU A 1 112 ? -8.920  0.505   -33.815 1.00 0.00  ? 112 LEU A HD21   2  
ATOM   4290  H HD22   . LEU A 1 112 ? -8.705  -0.893  -32.760 1.00 0.00  ? 112 LEU A HD22   2  
ATOM   4291  H HD23   . LEU A 1 112 ? -10.289 -0.129  -32.902 1.00 0.00  ? 112 LEU A HD23   2  
ATOM   4292  N N      . SER A 1 113 ? -5.305  -2.055  -36.003 1.00 0.00  ? 113 SER A N      2  
ATOM   4293  C CA     . SER A 1 113 ? -4.259  -2.709  -36.780 1.00 0.00  ? 113 SER A CA     2  
ATOM   4294  C C      . SER A 1 113 ? -4.550  -4.204  -36.934 1.00 0.00  ? 113 SER A C      2  
ATOM   4295  O O      . SER A 1 113 ? -5.701  -4.630  -36.840 1.00 0.00  ? 113 SER A O      2  
ATOM   4296  C CB     . SER A 1 113 ? -2.902  -2.495  -36.101 1.00 0.00  ? 113 SER A CB     2  
ATOM   4297  O OG     . SER A 1 113 ? -2.794  -3.272  -34.920 1.00 0.00  ? 113 SER A OG     2  
ATOM   4298  H H      . SER A 1 113 ? -5.205  -1.987  -35.029 1.00 0.00  ? 113 SER A H      2  
ATOM   4299  H HA     . SER A 1 113 ? -4.238  -2.253  -37.759 1.00 0.00  ? 113 SER A HA     2  
ATOM   4300  H HB2    . SER A 1 113 ? -2.113  -2.782  -36.780 1.00 0.00  ? 113 SER A HB2    2  
ATOM   4301  H HB3    . SER A 1 113 ? -2.792  -1.452  -35.842 1.00 0.00  ? 113 SER A HB3    2  
ATOM   4302  H HG     . SER A 1 113 ? -3.511  -3.043  -34.322 1.00 0.00  ? 113 SER A HG     2  
ATOM   4303  N N      . HIS A 1 114 ? -3.505  -4.996  -37.171 1.00 0.00  ? 114 HIS A N      2  
ATOM   4304  C CA     . HIS A 1 114 ? -3.659  -6.438  -37.335 1.00 0.00  ? 114 HIS A CA     2  
ATOM   4305  C C      . HIS A 1 114 ? -3.768  -7.147  -35.982 1.00 0.00  ? 114 HIS A C      2  
ATOM   4306  O O      . HIS A 1 114 ? -3.769  -8.376  -35.920 1.00 0.00  ? 114 HIS A O      2  
ATOM   4307  C CB     . HIS A 1 114 ? -2.476  -7.008  -38.126 1.00 0.00  ? 114 HIS A CB     2  
ATOM   4308  C CG     . HIS A 1 114 ? -2.813  -7.365  -39.541 1.00 0.00  ? 114 HIS A CG     2  
ATOM   4309  N ND1    . HIS A 1 114 ? -2.202  -8.399  -40.221 1.00 0.00  ? 114 HIS A ND1    2  
ATOM   4310  C CD2    . HIS A 1 114 ? -3.699  -6.821  -40.406 1.00 0.00  ? 114 HIS A CD2    2  
ATOM   4311  C CE1    . HIS A 1 114 ? -2.699  -8.473  -41.443 1.00 0.00  ? 114 HIS A CE1    2  
ATOM   4312  N NE2    . HIS A 1 114 ? -3.610  -7.527  -41.580 1.00 0.00  ? 114 HIS A NE2    2  
ATOM   4313  H H      . HIS A 1 114 ? -2.610  -4.603  -37.238 1.00 0.00  ? 114 HIS A H      2  
ATOM   4314  H HA     . HIS A 1 114 ? -4.566  -6.612  -37.892 1.00 0.00  ? 114 HIS A HA     2  
ATOM   4315  H HB2    . HIS A 1 114 ? -1.683  -6.276  -38.150 1.00 0.00  ? 114 HIS A HB2    2  
ATOM   4316  H HB3    . HIS A 1 114 ? -2.119  -7.902  -37.632 1.00 0.00  ? 114 HIS A HB3    2  
ATOM   4317  H HD1    . HIS A 1 114 ? -1.508  -8.988  -39.862 1.00 0.00  ? 114 HIS A HD1    2  
ATOM   4318  H HD2    . HIS A 1 114 ? -4.358  -5.985  -40.209 1.00 0.00  ? 114 HIS A HD2    2  
ATOM   4319  H HE1    . HIS A 1 114 ? -2.409  -9.185  -42.201 1.00 0.00  ? 114 HIS A HE1    2  
ATOM   4320  H HE2    . HIS A 1 114 ? -4.064  -7.298  -42.419 1.00 0.00  ? 114 HIS A HE2    2  
ATOM   4321  N N      . GLU A 1 115 ? -3.854  -6.372  -34.901 1.00 0.00  ? 115 GLU A N      2  
ATOM   4322  C CA     . GLU A 1 115 ? -3.959  -6.939  -33.561 1.00 0.00  ? 115 GLU A CA     2  
ATOM   4323  C C      . GLU A 1 115 ? -5.408  -6.946  -33.079 1.00 0.00  ? 115 GLU A C      2  
ATOM   4324  O O      . GLU A 1 115 ? -5.807  -7.808  -32.297 1.00 0.00  ? 115 GLU A O      2  
ATOM   4325  C CB     . GLU A 1 115 ? -3.086  -6.145  -32.586 1.00 0.00  ? 115 GLU A CB     2  
ATOM   4326  C CG     . GLU A 1 115 ? -2.897  -6.833  -31.243 1.00 0.00  ? 115 GLU A CG     2  
ATOM   4327  C CD     . GLU A 1 115 ? -1.437  -6.953  -30.850 1.00 0.00  ? 115 GLU A CD     2  
ATOM   4328  O OE1    . GLU A 1 115 ? -1.097  -6.573  -29.710 1.00 0.00  ? 115 GLU A OE1    2  
ATOM   4329  O OE2    . GLU A 1 115 ? -0.637  -7.429  -31.679 1.00 0.00  ? 115 GLU A OE2    2  
ATOM   4330  H H      . GLU A 1 115 ? -3.845  -5.400  -35.004 1.00 0.00  ? 115 GLU A H      2  
ATOM   4331  H HA     . GLU A 1 115 ? -3.603  -7.955  -33.604 1.00 0.00  ? 115 GLU A HA     2  
ATOM   4332  H HB2    . GLU A 1 115 ? -2.114  -5.997  -33.030 1.00 0.00  ? 115 GLU A HB2    2  
ATOM   4333  H HB3    . GLU A 1 115 ? -3.545  -5.183  -32.411 1.00 0.00  ? 115 GLU A HB3    2  
ATOM   4334  H HG2    . GLU A 1 115 ? -3.412  -6.262  -30.485 1.00 0.00  ? 115 GLU A HG2    2  
ATOM   4335  H HG3    . GLU A 1 115 ? -3.323  -7.825  -31.298 1.00 0.00  ? 115 GLU A HG3    2  
ATOM   4336  H HE2    . GLU A 1 115 ? 0.269   -7.477  -31.365 1.00 0.00  ? 115 GLU A HE2    2  
ATOM   4337  N N      . HIS A 1 116 ? -6.192  -5.980  -33.550 1.00 0.00  ? 116 HIS A N      2  
ATOM   4338  C CA     . HIS A 1 116 ? -7.597  -5.881  -33.165 1.00 0.00  ? 116 HIS A CA     2  
ATOM   4339  C C      . HIS A 1 116 ? -8.502  -5.970  -34.389 1.00 0.00  ? 116 HIS A C      2  
ATOM   4340  O O      . HIS A 1 116 ? -8.072  -5.698  -35.511 1.00 0.00  ? 116 HIS A O      2  
ATOM   4341  C CB     . HIS A 1 116 ? -7.855  -4.570  -32.421 1.00 0.00  ? 116 HIS A CB     2  
ATOM   4342  C CG     . HIS A 1 116 ? -7.144  -4.476  -31.107 1.00 0.00  ? 116 HIS A CG     2  
ATOM   4343  N ND1    . HIS A 1 116 ? -6.226  -3.491  -30.819 1.00 0.00  ? 116 HIS A ND1    2  
ATOM   4344  C CD2    . HIS A 1 116 ? -7.218  -5.256  -30.004 1.00 0.00  ? 116 HIS A CD2    2  
ATOM   4345  C CE1    . HIS A 1 116 ? -5.764  -3.668  -29.593 1.00 0.00  ? 116 HIS A CE1    2  
ATOM   4346  N NE2    . HIS A 1 116 ? -6.350  -4.732  -29.076 1.00 0.00  ? 116 HIS A NE2    2  
ATOM   4347  H H      . HIS A 1 116 ? -5.819  -5.321  -34.170 1.00 0.00  ? 116 HIS A H      2  
ATOM   4348  H HA     . HIS A 1 116 ? -7.821  -6.706  -32.506 1.00 0.00  ? 116 HIS A HA     2  
ATOM   4349  H HB2    . HIS A 1 116 ? -7.525  -3.746  -33.035 1.00 0.00  ? 116 HIS A HB2    2  
ATOM   4350  H HB3    . HIS A 1 116 ? -8.914  -4.471  -32.235 1.00 0.00  ? 116 HIS A HB3    2  
ATOM   4351  H HD1    . HIS A 1 116 ? -5.951  -2.767  -31.421 1.00 0.00  ? 116 HIS A HD1    2  
ATOM   4352  H HD2    . HIS A 1 116 ? -7.844  -6.127  -29.875 1.00 0.00  ? 116 HIS A HD2    2  
ATOM   4353  H HE1    . HIS A 1 116 ? -5.031  -3.048  -29.098 1.00 0.00  ? 116 HIS A HE1    2  
ATOM   4354  H HE2    . HIS A 1 116 ? -6.092  -5.163  -28.237 1.00 0.00  ? 116 HIS A HE2    2  
ATOM   4355  N N      . GLN A 1 117 ? -9.756  -6.356  -34.171 1.00 0.00  ? 117 GLN A N      2  
ATOM   4356  C CA     . GLN A 1 117 ? -10.715 -6.483  -35.263 1.00 0.00  ? 117 GLN A CA     2  
ATOM   4357  C C      . GLN A 1 117 ? -11.922 -5.565  -35.065 1.00 0.00  ? 117 GLN A C      2  
ATOM   4358  O O      . GLN A 1 117 ? -12.619 -5.236  -36.024 1.00 0.00  ? 117 GLN A O      2  
ATOM   4359  C CB     . GLN A 1 117 ? -11.179 -7.934  -35.402 1.00 0.00  ? 117 GLN A CB     2  
ATOM   4360  C CG     . GLN A 1 117 ? -11.783 -8.510  -34.131 1.00 0.00  ? 117 GLN A CG     2  
ATOM   4361  C CD     . GLN A 1 117 ? -12.329 -9.910  -34.334 1.00 0.00  ? 117 GLN A CD     2  
ATOM   4362  O OE1    . GLN A 1 117 ? -12.124 -10.524 -35.381 1.00 0.00  ? 117 GLN A OE1    2  
ATOM   4363  N NE2    . GLN A 1 117 ? -13.032 -10.422 -33.331 1.00 0.00  ? 117 GLN A NE2    2  
ATOM   4364  H H      . GLN A 1 117 ? -10.041 -6.564  -33.256 1.00 0.00  ? 117 GLN A H      2  
ATOM   4365  H HA     . GLN A 1 117 ? -10.211 -6.193  -36.174 1.00 0.00  ? 117 GLN A HA     2  
ATOM   4366  H HB2    . GLN A 1 117 ? -11.923 -7.988  -36.183 1.00 0.00  ? 117 GLN A HB2    2  
ATOM   4367  H HB3    . GLN A 1 117 ? -10.333 -8.546  -35.680 1.00 0.00  ? 117 GLN A HB3    2  
ATOM   4368  H HG2    . GLN A 1 117 ? -11.018 -8.546  -33.368 1.00 0.00  ? 117 GLN A HG2    2  
ATOM   4369  H HG3    . GLN A 1 117 ? -12.588 -7.868  -33.806 1.00 0.00  ? 117 GLN A HG3    2  
ATOM   4370  H HE21   . GLN A 1 117 ? -13.155 -9.876  -32.528 1.00 0.00  ? 117 GLN A HE21   2  
ATOM   4371  H HE22   . GLN A 1 117 ? -13.398 -11.324 -33.435 1.00 0.00  ? 117 GLN A HE22   2  
ATOM   4372  N N      . ALA A 1 118 ? -12.167 -5.151  -33.825 1.00 0.00  ? 118 ALA A N      2  
ATOM   4373  C CA     . ALA A 1 118 ? -13.296 -4.274  -33.528 1.00 0.00  ? 118 ALA A CA     2  
ATOM   4374  C C      . ALA A 1 118 ? -13.049 -3.452  -32.267 1.00 0.00  ? 118 ALA A C      2  
ATOM   4375  O O      . ALA A 1 118 ? -12.012 -3.585  -31.619 1.00 0.00  ? 118 ALA A O      2  
ATOM   4376  C CB     . ALA A 1 118 ? -14.574 -5.086  -33.387 1.00 0.00  ? 118 ALA A CB     2  
ATOM   4377  H H      . ALA A 1 118 ? -11.585 -5.442  -33.095 1.00 0.00  ? 118 ALA A H      2  
ATOM   4378  H HA     . ALA A 1 118 ? -13.420 -3.600  -34.364 1.00 0.00  ? 118 ALA A HA     2  
ATOM   4379  H HB1    . ALA A 1 118 ? -15.057 -5.168  -34.349 1.00 0.00  ? 118 ALA A HB1    2  
ATOM   4380  H HB2    . ALA A 1 118 ? -15.238 -4.596  -32.691 1.00 0.00  ? 118 ALA A HB2    2  
ATOM   4381  H HB3    . ALA A 1 118 ? -14.332 -6.073  -33.020 1.00 0.00  ? 118 ALA A HB3    2  
ATOM   4382  N N      . TYR A 1 119 ? -14.013 -2.599  -31.930 1.00 0.00  ? 119 TYR A N      2  
ATOM   4383  C CA     . TYR A 1 119 ? -13.906 -1.748  -30.750 1.00 0.00  ? 119 TYR A CA     2  
ATOM   4384  C C      . TYR A 1 119 ? -15.286 -1.320  -30.262 1.00 0.00  ? 119 TYR A C      2  
ATOM   4385  O O      . TYR A 1 119 ? -16.261 -1.375  -31.012 1.00 0.00  ? 119 TYR A O      2  
ATOM   4386  C CB     . TYR A 1 119 ? -13.075 -0.509  -31.078 1.00 0.00  ? 119 TYR A CB     2  
ATOM   4387  C CG     . TYR A 1 119 ? -13.760 0.409   -32.061 1.00 0.00  ? 119 TYR A CG     2  
ATOM   4388  C CD1    . TYR A 1 119 ? -13.693 0.164   -33.425 1.00 0.00  ? 119 TYR A CD1    2  
ATOM   4389  C CD2    . TYR A 1 119 ? -14.483 1.510   -31.624 1.00 0.00  ? 119 TYR A CD2    2  
ATOM   4390  C CE1    . TYR A 1 119 ? -14.327 0.990   -34.329 1.00 0.00  ? 119 TYR A CE1    2  
ATOM   4391  C CE2    . TYR A 1 119 ? -15.122 2.344   -32.523 1.00 0.00  ? 119 TYR A CE2    2  
ATOM   4392  C CZ     . TYR A 1 119 ? -15.040 2.080   -33.874 1.00 0.00  ? 119 TYR A CZ     2  
ATOM   4393  O OH     . TYR A 1 119 ? -15.676 2.907   -34.772 1.00 0.00  ? 119 TYR A OH     2  
ATOM   4394  H H      . TYR A 1 119 ? -14.814 -2.538  -32.490 1.00 0.00  ? 119 TYR A H      2  
ATOM   4395  H HA     . TYR A 1 119 ? -13.414 -2.313  -29.973 1.00 0.00  ? 119 TYR A HA     2  
ATOM   4396  H HB2    . TYR A 1 119 ? -12.892 0.047   -30.172 1.00 0.00  ? 119 TYR A HB2    2  
ATOM   4397  H HB3    . TYR A 1 119 ? -12.132 -0.816  -31.507 1.00 0.00  ? 119 TYR A HB3    2  
ATOM   4398  H HD1    . TYR A 1 119 ? -13.133 -0.688  -33.777 1.00 0.00  ? 119 TYR A HD1    2  
ATOM   4399  H HD2    . TYR A 1 119 ? -14.543 1.715   -30.566 1.00 0.00  ? 119 TYR A HD2    2  
ATOM   4400  H HE1    . TYR A 1 119 ? -14.258 0.783   -35.384 1.00 0.00  ? 119 TYR A HE1    2  
ATOM   4401  H HE2    . TYR A 1 119 ? -15.676 3.198   -32.164 1.00 0.00  ? 119 TYR A HE2    2  
ATOM   4402  H HH     . TYR A 1 119 ? -16.619 2.906   -34.596 1.00 0.00  ? 119 TYR A HH     2  
ATOM   4403  N N      . ARG A 1 120 ? -15.361 -0.884  -29.008 1.00 0.00  ? 120 ARG A N      2  
ATOM   4404  C CA     . ARG A 1 120 ? -16.625 -0.438  -28.429 1.00 0.00  ? 120 ARG A CA     2  
ATOM   4405  C C      . ARG A 1 120 ? -16.405 0.653   -27.388 1.00 0.00  ? 120 ARG A C      2  
ATOM   4406  O O      . ARG A 1 120 ? -15.397 0.663   -26.683 1.00 0.00  ? 120 ARG A O      2  
ATOM   4407  C CB     . ARG A 1 120 ? -17.363 -1.605  -27.768 1.00 0.00  ? 120 ARG A CB     2  
ATOM   4408  C CG     . ARG A 1 120 ? -17.617 -2.782  -28.692 1.00 0.00  ? 120 ARG A CG     2  
ATOM   4409  C CD     . ARG A 1 120 ? -18.993 -3.388  -28.471 1.00 0.00  ? 120 ARG A CD     2  
ATOM   4410  N NE     . ARG A 1 120 ? -19.852 -3.234  -29.641 1.00 0.00  ? 120 ARG A NE     2  
ATOM   4411  C CZ     . ARG A 1 120 ? -20.982 -3.913  -29.826 1.00 0.00  ? 120 ARG A CZ     2  
ATOM   4412  N NH1    . ARG A 1 120 ? -21.396 -4.787  -28.916 1.00 0.00  ? 120 ARG A NH1    2  
ATOM   4413  N NH2    . ARG A 1 120 ? -21.700 -3.715  -30.924 1.00 0.00  ? 120 ARG A NH2    2  
ATOM   4414  H H      . ARG A 1 120 ? -14.547 -0.857  -28.464 1.00 0.00  ? 120 ARG A H      2  
ATOM   4415  H HA     . ARG A 1 120 ? -17.237 -0.044  -29.226 1.00 0.00  ? 120 ARG A HA     2  
ATOM   4416  H HB2    . ARG A 1 120 ? -16.777 -1.956  -26.932 1.00 0.00  ? 120 ARG A HB2    2  
ATOM   4417  H HB3    . ARG A 1 120 ? -18.315 -1.252  -27.400 1.00 0.00  ? 120 ARG A HB3    2  
ATOM   4418  H HG2    . ARG A 1 120 ? -17.545 -2.450  -29.714 1.00 0.00  ? 120 ARG A HG2    2  
ATOM   4419  H HG3    . ARG A 1 120 ? -16.875 -3.532  -28.501 1.00 0.00  ? 120 ARG A HG3    2  
ATOM   4420  H HD2    . ARG A 1 120 ? -18.876 -4.441  -28.255 1.00 0.00  ? 120 ARG A HD2    2  
ATOM   4421  H HD3    . ARG A 1 120 ? -19.454 -2.900  -27.628 1.00 0.00  ? 120 ARG A HD3    2  
ATOM   4422  H HE     . ARG A 1 120 ? -19.572 -2.593  -30.326 1.00 0.00  ? 120 ARG A HE     2  
ATOM   4423  H HH11   . ARG A 1 120 ? -20.860 -4.937  -28.087 1.00 0.00  ? 120 ARG A HH11   2  
ATOM   4424  H HH12   . ARG A 1 120 ? -22.246 -5.295  -29.062 1.00 0.00  ? 120 ARG A HH12   2  
ATOM   4425  H HH21   . ARG A 1 120 ? -21.394 -3.057  -31.609 1.00 0.00  ? 120 ARG A HH21   2  
ATOM   4426  H HH22   . ARG A 1 120 ? -22.548 -4.225  -31.062 1.00 0.00  ? 120 ARG A HH22   2  
ATOM   4427  N N      . TRP A 1 121 ? -17.377 1.553   -27.278 1.00 0.00  ? 121 TRP A N      2  
ATOM   4428  C CA     . TRP A 1 121 ? -17.319 2.630   -26.303 1.00 0.00  ? 121 TRP A CA     2  
ATOM   4429  C C      . TRP A 1 121 ? -18.288 2.332   -25.167 1.00 0.00  ? 121 TRP A C      2  
ATOM   4430  O O      . TRP A 1 121 ? -19.504 2.406   -25.343 1.00 0.00  ? 121 TRP A O      2  
ATOM   4431  C CB     . TRP A 1 121 ? -17.664 3.967   -26.960 1.00 0.00  ? 121 TRP A CB     2  
ATOM   4432  C CG     . TRP A 1 121 ? -16.535 4.542   -27.756 1.00 0.00  ? 121 TRP A CG     2  
ATOM   4433  C CD1    . TRP A 1 121 ? -16.345 4.443   -29.104 1.00 0.00  ? 121 TRP A CD1    2  
ATOM   4434  C CD2    . TRP A 1 121 ? -15.435 5.302   -27.250 1.00 0.00  ? 121 TRP A CD2    2  
ATOM   4435  N NE1    . TRP A 1 121 ? -15.193 5.096   -29.467 1.00 0.00  ? 121 TRP A NE1    2  
ATOM   4436  C CE2    . TRP A 1 121 ? -14.617 5.632   -28.345 1.00 0.00  ? 121 TRP A CE2    2  
ATOM   4437  C CE3    . TRP A 1 121 ? -15.062 5.737   -25.974 1.00 0.00  ? 121 TRP A CE3    2  
ATOM   4438  C CZ2    . TRP A 1 121 ? -13.449 6.377   -28.204 1.00 0.00  ? 121 TRP A CZ2    2  
ATOM   4439  C CZ3    . TRP A 1 121 ? -13.903 6.476   -25.835 1.00 0.00  ? 121 TRP A CZ3    2  
ATOM   4440  C CH2    . TRP A 1 121 ? -13.110 6.789   -26.944 1.00 0.00  ? 121 TRP A CH2    2  
ATOM   4441  H H      . TRP A 1 121 ? -18.166 1.473   -27.855 1.00 0.00  ? 121 TRP A H      2  
ATOM   4442  H HA     . TRP A 1 121 ? -16.315 2.674   -25.907 1.00 0.00  ? 121 TRP A HA     2  
ATOM   4443  H HB2    . TRP A 1 121 ? -18.505 3.828   -27.624 1.00 0.00  ? 121 TRP A HB2    2  
ATOM   4444  H HB3    . TRP A 1 121 ? -17.931 4.678   -26.191 1.00 0.00  ? 121 TRP A HB3    2  
ATOM   4445  H HD1    . TRP A 1 121 ? -17.012 3.923   -29.774 1.00 0.00  ? 121 TRP A HD1    2  
ATOM   4446  H HE1    . TRP A 1 121 ? -14.842 5.168   -30.379 1.00 0.00  ? 121 TRP A HE1    2  
ATOM   4447  H HE3    . TRP A 1 121 ? -15.664 5.505   -25.108 1.00 0.00  ? 121 TRP A HE3    2  
ATOM   4448  H HZ2    . TRP A 1 121 ? -12.824 6.628   -29.049 1.00 0.00  ? 121 TRP A HZ2    2  
ATOM   4449  H HZ3    . TRP A 1 121 ? -13.599 6.820   -24.858 1.00 0.00  ? 121 TRP A HZ3    2  
ATOM   4450  H HH2    . TRP A 1 121 ? -12.214 7.367   -26.787 1.00 0.00  ? 121 TRP A HH2    2  
ATOM   4451  N N      . LEU A 1 122 ? -17.750 1.961   -24.012 1.00 0.00  ? 122 LEU A N      2  
ATOM   4452  C CA     . LEU A 1 122 ? -18.584 1.615   -22.868 1.00 0.00  ? 122 LEU A CA     2  
ATOM   4453  C C      . LEU A 1 122 ? -18.066 2.247   -21.583 1.00 0.00  ? 122 LEU A C      2  
ATOM   4454  O O      . LEU A 1 122 ? -16.958 2.785   -21.542 1.00 0.00  ? 122 LEU A O      2  
ATOM   4455  C CB     . LEU A 1 122 ? -18.645 0.093   -22.700 1.00 0.00  ? 122 LEU A CB     2  
ATOM   4456  C CG     . LEU A 1 122 ? -18.316 -0.722  -23.959 1.00 0.00  ? 122 LEU A CG     2  
ATOM   4457  C CD1    . LEU A 1 122 ? -16.898 -1.273  -23.883 1.00 0.00  ? 122 LEU A CD1    2  
ATOM   4458  C CD2    . LEU A 1 122 ? -19.321 -1.849  -24.145 1.00 0.00  ? 122 LEU A CD2    2  
ATOM   4459  H H      . LEU A 1 122 ? -16.775 1.894   -23.934 1.00 0.00  ? 122 LEU A H      2  
ATOM   4460  H HA     . LEU A 1 122 ? -19.579 1.986   -23.059 1.00 0.00  ? 122 LEU A HA     2  
ATOM   4461  H HB2    . LEU A 1 122 ? -17.949 -0.190  -21.922 1.00 0.00  ? 122 LEU A HB2    2  
ATOM   4462  H HB3    . LEU A 1 122 ? -19.642 -0.173  -22.379 1.00 0.00  ? 122 LEU A HB3    2  
ATOM   4463  H HG     . LEU A 1 122 ? -18.376 -0.079  -24.823 1.00 0.00  ? 122 LEU A HG     2  
ATOM   4464  H HD11   . LEU A 1 122 ? -16.767 -1.806  -22.954 1.00 0.00  ? 122 LEU A HD11   2  
ATOM   4465  H HD12   . LEU A 1 122 ? -16.191 -0.458  -23.934 1.00 0.00  ? 122 LEU A HD12   2  
ATOM   4466  H HD13   . LEU A 1 122 ? -16.728 -1.947  -24.712 1.00 0.00  ? 122 LEU A HD13   2  
ATOM   4467  H HD21   . LEU A 1 122 ? -19.028 -2.697  -23.545 1.00 0.00  ? 122 LEU A HD21   2  
ATOM   4468  H HD22   . LEU A 1 122 ? -19.352 -2.136  -25.185 1.00 0.00  ? 122 LEU A HD22   2  
ATOM   4469  H HD23   . LEU A 1 122 ? -20.300 -1.512  -23.836 1.00 0.00  ? 122 LEU A HD23   2  
ATOM   4470  N N      . GLY A 1 123 ? -18.873 2.165   -20.532 1.00 0.00  ? 123 GLY A N      2  
ATOM   4471  C CA     . GLY A 1 123 ? -18.483 2.720   -19.251 1.00 0.00  ? 123 GLY A CA     2  
ATOM   4472  C C      . GLY A 1 123 ? -17.474 1.841   -18.542 1.00 0.00  ? 123 GLY A C      2  
ATOM   4473  O O      . GLY A 1 123 ? -16.711 1.125   -19.186 1.00 0.00  ? 123 GLY A O      2  
ATOM   4474  H H      . GLY A 1 123 ? -19.739 1.716   -20.624 1.00 0.00  ? 123 GLY A H      2  
ATOM   4475  H HA2    . GLY A 1 123 ? -18.050 3.696   -19.408 1.00 0.00  ? 123 GLY A HA2    2  
ATOM   4476  H HA3    . GLY A 1 123 ? -19.361 2.820   -18.629 1.00 0.00  ? 123 GLY A HA3    2  
ATOM   4477  N N      . LEU A 1 124 ? -17.469 1.889   -17.215 1.00 0.00  ? 124 LEU A N      2  
ATOM   4478  C CA     . LEU A 1 124 ? -16.541 1.083   -16.434 1.00 0.00  ? 124 LEU A CA     2  
ATOM   4479  C C      . LEU A 1 124 ? -16.999 -0.371  -16.354 1.00 0.00  ? 124 LEU A C      2  
ATOM   4480  O O      . LEU A 1 124 ? -16.203 -1.292  -16.530 1.00 0.00  ? 124 LEU A O      2  
ATOM   4481  C CB     . LEU A 1 124 ? -16.386 1.661   -15.025 1.00 0.00  ? 124 LEU A CB     2  
ATOM   4482  C CG     . LEU A 1 124 ? -15.389 0.926   -14.125 1.00 0.00  ? 124 LEU A CG     2  
ATOM   4483  C CD1    . LEU A 1 124 ? -14.111 0.605   -14.889 1.00 0.00  ? 124 LEU A CD1    2  
ATOM   4484  C CD2    . LEU A 1 124 ? -15.078 1.755   -12.887 1.00 0.00  ? 124 LEU A CD2    2  
ATOM   4485  H H      . LEU A 1 124 ? -18.104 2.478   -16.754 1.00 0.00  ? 124 LEU A H      2  
ATOM   4486  H HA     . LEU A 1 124 ? -15.582 1.116   -16.930 1.00 0.00  ? 124 LEU A HA     2  
ATOM   4487  H HB2    . LEU A 1 124 ? -16.068 2.689   -15.113 1.00 0.00  ? 124 LEU A HB2    2  
ATOM   4488  H HB3    . LEU A 1 124 ? -17.353 1.641   -14.542 1.00 0.00  ? 124 LEU A HB3    2  
ATOM   4489  H HG     . LEU A 1 124 ? -15.826 -0.007  -13.800 1.00 0.00  ? 124 LEU A HG     2  
ATOM   4490  H HD11   . LEU A 1 124 ? -13.596 1.521   -15.129 1.00 0.00  ? 124 LEU A HD11   2  
ATOM   4491  H HD12   . LEU A 1 124 ? -14.361 0.083   -15.801 1.00 0.00  ? 124 LEU A HD12   2  
ATOM   4492  H HD13   . LEU A 1 124 ? -13.475 -0.020  -14.281 1.00 0.00  ? 124 LEU A HD13   2  
ATOM   4493  H HD21   . LEU A 1 124 ? -15.989 2.189   -12.507 1.00 0.00  ? 124 LEU A HD21   2  
ATOM   4494  H HD22   . LEU A 1 124 ? -14.384 2.542   -13.147 1.00 0.00  ? 124 LEU A HD22   2  
ATOM   4495  H HD23   . LEU A 1 124 ? -14.635 1.122   -12.132 1.00 0.00  ? 124 LEU A HD23   2  
ATOM   4496  N N      . GLU A 1 125 ? -18.285 -0.569  -16.079 1.00 0.00  ? 125 GLU A N      2  
ATOM   4497  C CA     . GLU A 1 125 ? -18.849 -1.911  -15.963 1.00 0.00  ? 125 GLU A CA     2  
ATOM   4498  C C      . GLU A 1 125 ? -18.656 -2.718  -17.240 1.00 0.00  ? 125 GLU A C      2  
ATOM   4499  O O      . GLU A 1 125 ? -18.156 -3.841  -17.203 1.00 0.00  ? 125 GLU A O      2  
ATOM   4500  C CB     . GLU A 1 125 ? -20.340 -1.841  -15.619 1.00 0.00  ? 125 GLU A CB     2  
ATOM   4501  C CG     . GLU A 1 125 ? -21.176 -1.084  -16.644 1.00 0.00  ? 125 GLU A CG     2  
ATOM   4502  C CD     . GLU A 1 125 ? -22.607 -0.886  -16.187 1.00 0.00  ? 125 GLU A CD     2  
ATOM   4503  O OE1    . GLU A 1 125 ? -22.858 0.059   -15.411 1.00 0.00  ? 125 GLU A OE1    2  
ATOM   4504  O OE2    . GLU A 1 125 ? -23.480 -1.676  -16.608 1.00 0.00  ? 125 GLU A OE2    2  
ATOM   4505  H H      . GLU A 1 125 ? -18.865 0.206   -15.940 1.00 0.00  ? 125 GLU A H      2  
ATOM   4506  H HA     . GLU A 1 125 ? -18.330 -2.415  -15.158 1.00 0.00  ? 125 GLU A HA     2  
ATOM   4507  H HB2    . GLU A 1 125 ? -20.727 -2.847  -15.546 1.00 0.00  ? 125 GLU A HB2    2  
ATOM   4508  H HB3    . GLU A 1 125 ? -20.454 -1.352  -14.663 1.00 0.00  ? 125 GLU A HB3    2  
ATOM   4509  H HG2    . GLU A 1 125 ? -20.731 -0.114  -16.807 1.00 0.00  ? 125 GLU A HG2    2  
ATOM   4510  H HG3    . GLU A 1 125 ? -21.183 -1.640  -17.575 1.00 0.00  ? 125 GLU A HG3    2  
ATOM   4511  H HE2    . GLU A 1 125 ? -24.363 -1.492  -16.280 1.00 0.00  ? 125 GLU A HE2    2  
ATOM   4512  N N      . GLU A 1 126 ? -19.062 -2.149  -18.367 1.00 0.00  ? 126 GLU A N      2  
ATOM   4513  C CA     . GLU A 1 126 ? -18.934 -2.835  -19.643 1.00 0.00  ? 126 GLU A CA     2  
ATOM   4514  C C      . GLU A 1 126 ? -17.474 -2.954  -20.040 1.00 0.00  ? 126 GLU A C      2  
ATOM   4515  O O      . GLU A 1 126 ? -17.014 -4.027  -20.429 1.00 0.00  ? 126 GLU A O      2  
ATOM   4516  C CB     . GLU A 1 126 ? -19.730 -2.108  -20.723 1.00 0.00  ? 126 GLU A CB     2  
ATOM   4517  C CG     . GLU A 1 126 ? -21.129 -2.670  -20.928 1.00 0.00  ? 126 GLU A CG     2  
ATOM   4518  C CD     . GLU A 1 126 ? -21.853 -2.944  -19.623 1.00 0.00  ? 126 GLU A CD     2  
ATOM   4519  O OE1    . GLU A 1 126 ? -21.472 -3.903  -18.921 1.00 0.00  ? 126 GLU A OE1    2  
ATOM   4520  O OE2    . GLU A 1 126 ? -22.804 -2.198  -19.306 1.00 0.00  ? 126 GLU A OE2    2  
ATOM   4521  H H      . GLU A 1 126 ? -19.457 -1.253  -18.342 1.00 0.00  ? 126 GLU A H      2  
ATOM   4522  H HA     . GLU A 1 126 ? -19.339 -3.827  -19.516 1.00 0.00  ? 126 GLU A HA     2  
ATOM   4523  H HB2    . GLU A 1 126 ? -19.820 -1.067  -20.452 1.00 0.00  ? 126 GLU A HB2    2  
ATOM   4524  H HB3    . GLU A 1 126 ? -19.196 -2.180  -21.659 1.00 0.00  ? 126 GLU A HB3    2  
ATOM   4525  H HG2    . GLU A 1 126 ? -21.705 -1.957  -21.491 1.00 0.00  ? 126 GLU A HG2    2  
ATOM   4526  H HG3    . GLU A 1 126 ? -21.053 -3.597  -21.484 1.00 0.00  ? 126 GLU A HG3    2  
ATOM   4527  H HE2    . GLU A 1 126 ? -23.216 -2.426  -18.470 1.00 0.00  ? 126 GLU A HE2    2  
ATOM   4528  N N      . ALA A 1 127 ? -16.738 -1.856  -19.924 1.00 0.00  ? 127 ALA A N      2  
ATOM   4529  C CA     . ALA A 1 127 ? -15.324 -1.866  -20.251 1.00 0.00  ? 127 ALA A CA     2  
ATOM   4530  C C      . ALA A 1 127 ? -14.613 -2.927  -19.426 1.00 0.00  ? 127 ALA A C      2  
ATOM   4531  O O      . ALA A 1 127 ? -13.634 -3.531  -19.867 1.00 0.00  ? 127 ALA A O      2  
ATOM   4532  C CB     . ALA A 1 127 ? -14.710 -0.499  -20.005 1.00 0.00  ? 127 ALA A CB     2  
ATOM   4533  H H      . ALA A 1 127 ? -17.153 -1.031  -19.592 1.00 0.00  ? 127 ALA A H      2  
ATOM   4534  H HA     . ALA A 1 127 ? -15.225 -2.105  -21.299 1.00 0.00  ? 127 ALA A HA     2  
ATOM   4535  H HB1    . ALA A 1 127 ? -15.237 0.241   -20.590 1.00 0.00  ? 127 ALA A HB1    2  
ATOM   4536  H HB2    . ALA A 1 127 ? -13.669 -0.514  -20.292 1.00 0.00  ? 127 ALA A HB2    2  
ATOM   4537  H HB3    . ALA A 1 127 ? -14.790 -0.256  -18.955 1.00 0.00  ? 127 ALA A HB3    2  
ATOM   4538  N N      . CYS A 1 128 ? -15.134 -3.154  -18.226 1.00 0.00  ? 128 CYS A N      2  
ATOM   4539  C CA     . CYS A 1 128 ? -14.586 -4.149  -17.321 1.00 0.00  ? 128 CYS A CA     2  
ATOM   4540  C C      . CYS A 1 128 ? -15.117 -5.533  -17.677 1.00 0.00  ? 128 CYS A C      2  
ATOM   4541  O O      . CYS A 1 128 ? -14.440 -6.540  -17.481 1.00 0.00  ? 128 CYS A O      2  
ATOM   4542  C CB     . CYS A 1 128 ? -14.953 -3.801  -15.878 1.00 0.00  ? 128 CYS A CB     2  
ATOM   4543  S SG     . CYS A 1 128 ? -13.842 -2.607  -15.097 1.00 0.00  ? 128 CYS A SG     2  
ATOM   4544  H H      . CYS A 1 128 ? -15.922 -2.644  -17.945 1.00 0.00  ? 128 CYS A H      2  
ATOM   4545  H HA     . CYS A 1 128 ? -13.511 -4.145  -17.427 1.00 0.00  ? 128 CYS A HA     2  
ATOM   4546  H HB2    . CYS A 1 128 ? -15.948 -3.383  -15.859 1.00 0.00  ? 128 CYS A HB2    2  
ATOM   4547  H HB3    . CYS A 1 128 ? -14.939 -4.699  -15.287 1.00 0.00  ? 128 CYS A HB3    2  
ATOM   4548  H HG     . CYS A 1 128 ? -13.877 -1.794  -15.606 1.00 0.00  ? 128 CYS A HG     2  
ATOM   4549  N N      . GLN A 1 129 ? -16.342 -5.573  -18.205 1.00 0.00  ? 129 GLN A N      2  
ATOM   4550  C CA     . GLN A 1 129 ? -16.967 -6.834  -18.588 1.00 0.00  ? 129 GLN A CA     2  
ATOM   4551  C C      . GLN A 1 129 ? -16.210 -7.483  -19.745 1.00 0.00  ? 129 GLN A C      2  
ATOM   4552  O O      . GLN A 1 129 ? -15.958 -8.687  -19.739 1.00 0.00  ? 129 GLN A O      2  
ATOM   4553  C CB     . GLN A 1 129 ? -18.451 -6.618  -18.938 1.00 0.00  ? 129 GLN A CB     2  
ATOM   4554  C CG     . GLN A 1 129 ? -18.731 -6.171  -20.368 1.00 0.00  ? 129 GLN A CG     2  
ATOM   4555  C CD     . GLN A 1 129 ? -19.541 -7.181  -21.155 1.00 0.00  ? 129 GLN A CD     2  
ATOM   4556  O OE1    . GLN A 1 129 ? -20.702 -7.442  -20.843 1.00 0.00  ? 129 GLN A OE1    2  
ATOM   4557  N NE2    . GLN A 1 129 ? -18.929 -7.762  -22.179 1.00 0.00  ? 129 GLN A NE2    2  
ATOM   4558  H H      . GLN A 1 129 ? -16.833 -4.735  -18.336 1.00 0.00  ? 129 GLN A H      2  
ATOM   4559  H HA     . GLN A 1 129 ? -16.907 -7.495  -17.735 1.00 0.00  ? 129 GLN A HA     2  
ATOM   4560  H HB2    . GLN A 1 129 ? -18.971 -7.542  -18.781 1.00 0.00  ? 129 GLN A HB2    2  
ATOM   4561  H HB3    . GLN A 1 129 ? -18.857 -5.875  -18.268 1.00 0.00  ? 129 GLN A HB3    2  
ATOM   4562  H HG2    . GLN A 1 129 ? -19.286 -5.249  -20.339 1.00 0.00  ? 129 GLN A HG2    2  
ATOM   4563  H HG3    . GLN A 1 129 ? -17.801 -6.007  -20.873 1.00 0.00  ? 129 GLN A HG3    2  
ATOM   4564  H HE21   . GLN A 1 129 ? -18.000 -7.517  -22.366 1.00 0.00  ? 129 GLN A HE21   2  
ATOM   4565  H HE22   . GLN A 1 129 ? -19.436 -8.400  -22.716 1.00 0.00  ? 129 GLN A HE22   2  
ATOM   4566  N N      . LEU A 1 130 ? -15.841 -6.670  -20.727 1.00 0.00  ? 130 LEU A N      2  
ATOM   4567  C CA     . LEU A 1 130 ? -15.100 -7.156  -21.883 1.00 0.00  ? 130 LEU A CA     2  
ATOM   4568  C C      . LEU A 1 130 ? -13.634 -7.357  -21.522 1.00 0.00  ? 130 LEU A C      2  
ATOM   4569  O O      . LEU A 1 130 ? -13.001 -8.314  -21.967 1.00 0.00  ? 130 LEU A O      2  
ATOM   4570  C CB     . LEU A 1 130 ? -15.219 -6.182  -23.058 1.00 0.00  ? 130 LEU A CB     2  
ATOM   4571  C CG     . LEU A 1 130 ? -16.637 -5.696  -23.371 1.00 0.00  ? 130 LEU A CG     2  
ATOM   4572  C CD1    . LEU A 1 130 ? -16.649 -4.193  -23.577 1.00 0.00  ? 130 LEU A CD1    2  
ATOM   4573  C CD2    . LEU A 1 130 ? -17.187 -6.403  -24.601 1.00 0.00  ? 130 LEU A CD2    2  
ATOM   4574  H H      . LEU A 1 130 ? -16.067 -5.720  -20.666 1.00 0.00  ? 130 LEU A H      2  
ATOM   4575  H HA     . LEU A 1 130 ? -15.516 -8.113  -22.170 1.00 0.00  ? 130 LEU A HA     2  
ATOM   4576  H HB2    . LEU A 1 130 ? -14.602 -5.322  -22.847 1.00 0.00  ? 130 LEU A HB2    2  
ATOM   4577  H HB3    . LEU A 1 130 ? -14.836 -6.671  -23.935 1.00 0.00  ? 130 LEU A HB3    2  
ATOM   4578  H HG     . LEU A 1 130 ? -17.280 -5.918  -22.539 1.00 0.00  ? 130 LEU A HG     2  
ATOM   4579  H HD11   . LEU A 1 130 ? -17.545 -3.778  -23.144 1.00 0.00  ? 130 LEU A HD11   2  
ATOM   4580  H HD12   . LEU A 1 130 ? -16.624 -3.973  -24.634 1.00 0.00  ? 130 LEU A HD12   2  
ATOM   4581  H HD13   . LEU A 1 130 ? -15.785 -3.758  -23.099 1.00 0.00  ? 130 LEU A HD13   2  
ATOM   4582  H HD21   . LEU A 1 130 ? -18.233 -6.627  -24.450 1.00 0.00  ? 130 LEU A HD21   2  
ATOM   4583  H HD22   . LEU A 1 130 ? -16.641 -7.323  -24.759 1.00 0.00  ? 130 LEU A HD22   2  
ATOM   4584  H HD23   . LEU A 1 130 ? -17.075 -5.765  -25.464 1.00 0.00  ? 130 LEU A HD23   2  
ATOM   4585  N N      . ALA A 1 131 ? -13.105 -6.460  -20.695 1.00 0.00  ? 131 ALA A N      2  
ATOM   4586  C CA     . ALA A 1 131 ? -11.719 -6.556  -20.257 1.00 0.00  ? 131 ALA A CA     2  
ATOM   4587  C C      . ALA A 1 131 ? -11.591 -7.594  -19.151 1.00 0.00  ? 131 ALA A C      2  
ATOM   4588  O O      . ALA A 1 131 ? -11.121 -7.299  -18.052 1.00 0.00  ? 131 ALA A O      2  
ATOM   4589  C CB     . ALA A 1 131 ? -11.210 -5.205  -19.782 1.00 0.00  ? 131 ALA A CB     2  
ATOM   4590  H H      . ALA A 1 131 ? -13.664 -5.728  -20.361 1.00 0.00  ? 131 ALA A H      2  
ATOM   4591  H HA     . ALA A 1 131 ? -11.121 -6.866  -21.101 1.00 0.00  ? 131 ALA A HA     2  
ATOM   4592  H HB1    . ALA A 1 131 ? -11.658 -4.968  -18.830 1.00 0.00  ? 131 ALA A HB1    2  
ATOM   4593  H HB2    . ALA A 1 131 ? -11.472 -4.445  -20.502 1.00 0.00  ? 131 ALA A HB2    2  
ATOM   4594  H HB3    . ALA A 1 131 ? -10.134 -5.243  -19.674 1.00 0.00  ? 131 ALA A HB3    2  
ATOM   4595  N N      . GLN A 1 132 ? -12.027 -8.812  -19.461 1.00 0.00  ? 132 GLN A N      2  
ATOM   4596  C CA     . GLN A 1 132 ? -11.992 -9.933  -18.515 1.00 0.00  ? 132 GLN A CA     2  
ATOM   4597  C C      . GLN A 1 132 ? -10.730 -9.895  -17.659 1.00 0.00  ? 132 GLN A C      2  
ATOM   4598  O O      . GLN A 1 132 ? -10.752 -10.264 -16.487 1.00 0.00  ? 132 GLN A O      2  
ATOM   4599  C CB     . GLN A 1 132 ? -12.081 -11.291 -19.240 1.00 0.00  ? 132 GLN A CB     2  
ATOM   4600  C CG     . GLN A 1 132 ? -12.162 -11.218 -20.762 1.00 0.00  ? 132 GLN A CG     2  
ATOM   4601  C CD     . GLN A 1 132 ? -13.556 -11.493 -21.288 1.00 0.00  ? 132 GLN A CD     2  
ATOM   4602  O OE1    . GLN A 1 132 ? -13.742 -12.315 -22.187 1.00 0.00  ? 132 GLN A OE1    2  
ATOM   4603  N NE2    . GLN A 1 132 ? -14.548 -10.808 -20.731 1.00 0.00  ? 132 GLN A NE2    2  
ATOM   4604  H H      . GLN A 1 132 ? -12.395 -8.955  -20.349 1.00 0.00  ? 132 GLN A H      2  
ATOM   4605  H HA     . GLN A 1 132 ? -12.849 -9.832  -17.863 1.00 0.00  ? 132 GLN A HA     2  
ATOM   4606  H HB2    . GLN A 1 132 ? -11.209 -11.875 -18.985 1.00 0.00  ? 132 GLN A HB2    2  
ATOM   4607  H HB3    . GLN A 1 132 ? -12.959 -11.812 -18.883 1.00 0.00  ? 132 GLN A HB3    2  
ATOM   4608  H HG2    . GLN A 1 132 ? -11.857 -10.239 -21.088 1.00 0.00  ? 132 GLN A HG2    2  
ATOM   4609  H HG3    . GLN A 1 132 ? -11.490 -11.949 -21.178 1.00 0.00  ? 132 GLN A HG3    2  
ATOM   4610  H HE21   . GLN A 1 132 ? -14.326 -10.169 -20.020 1.00 0.00  ? 132 GLN A HE21   2  
ATOM   4611  H HE22   . GLN A 1 132 ? -15.459 -10.967 -21.054 1.00 0.00  ? 132 GLN A HE22   2  
ATOM   4612  N N      . PHE A 1 133 ? -9.635  -9.434  -18.251 1.00 0.00  ? 133 PHE A N      2  
ATOM   4613  C CA     . PHE A 1 133 ? -8.372  -9.336  -17.537 1.00 0.00  ? 133 PHE A CA     2  
ATOM   4614  C C      . PHE A 1 133 ? -8.522  -8.420  -16.324 1.00 0.00  ? 133 PHE A C      2  
ATOM   4615  O O      . PHE A 1 133 ? -8.783  -7.225  -16.462 1.00 0.00  ? 133 PHE A O      2  
ATOM   4616  C CB     . PHE A 1 133 ? -7.274  -8.813  -18.468 1.00 0.00  ? 133 PHE A CB     2  
ATOM   4617  C CG     . PHE A 1 133 ? -6.912  -9.777  -19.564 1.00 0.00  ? 133 PHE A CG     2  
ATOM   4618  C CD1    . PHE A 1 133 ? -7.769  -9.985  -20.633 1.00 0.00  ? 133 PHE A CD1    2  
ATOM   4619  C CD2    . PHE A 1 133 ? -5.719  -10.478 -19.522 1.00 0.00  ? 133 PHE A CD2    2  
ATOM   4620  C CE1    . PHE A 1 133 ? -7.443  -10.874 -21.639 1.00 0.00  ? 133 PHE A CE1    2  
ATOM   4621  C CE2    . PHE A 1 133 ? -5.385  -11.369 -20.526 1.00 0.00  ? 133 PHE A CE2    2  
ATOM   4622  C CZ     . PHE A 1 133 ? -6.250  -11.568 -21.585 1.00 0.00  ? 133 PHE A CZ     2  
ATOM   4623  H H      . PHE A 1 133 ? -9.684  -9.147  -19.186 1.00 0.00  ? 133 PHE A H      2  
ATOM   4624  H HA     . PHE A 1 133 ? -8.105  -10.325 -17.197 1.00 0.00  ? 133 PHE A HA     2  
ATOM   4625  H HB2    . PHE A 1 133 ? -7.606  -7.895  -18.928 1.00 0.00  ? 133 PHE A HB2    2  
ATOM   4626  H HB3    . PHE A 1 133 ? -6.382  -8.619  -17.888 1.00 0.00  ? 133 PHE A HB3    2  
ATOM   4627  H HD1    . PHE A 1 133 ? -8.701  -9.443  -20.681 1.00 0.00  ? 133 PHE A HD1    2  
ATOM   4628  H HD2    . PHE A 1 133 ? -5.043  -10.326 -18.694 1.00 0.00  ? 133 PHE A HD2    2  
ATOM   4629  H HE1    . PHE A 1 133 ? -8.122  -11.028 -22.466 1.00 0.00  ? 133 PHE A HE1    2  
ATOM   4630  H HE2    . PHE A 1 133 ? -4.451  -11.911 -20.480 1.00 0.00  ? 133 PHE A HE2    2  
ATOM   4631  H HZ     . PHE A 1 133 ? -5.995  -12.263 -22.370 1.00 0.00  ? 133 PHE A HZ     2  
ATOM   4632  N N      . LYS A 1 134 ? -8.365  -8.996  -15.135 1.00 0.00  ? 134 LYS A N      2  
ATOM   4633  C CA     . LYS A 1 134 ? -8.493  -8.246  -13.885 1.00 0.00  ? 134 LYS A CA     2  
ATOM   4634  C C      . LYS A 1 134 ? -7.732  -6.927  -13.948 1.00 0.00  ? 134 LYS A C      2  
ATOM   4635  O O      . LYS A 1 134 ? -8.238  -5.883  -13.539 1.00 0.00  ? 134 LYS A O      2  
ATOM   4636  C CB     . LYS A 1 134 ? -7.965  -9.083  -12.721 1.00 0.00  ? 134 LYS A CB     2  
ATOM   4637  C CG     . LYS A 1 134 ? -7.991  -8.360  -11.383 1.00 0.00  ? 134 LYS A CG     2  
ATOM   4638  C CD     . LYS A 1 134 ? -6.628  -8.382  -10.712 1.00 0.00  ? 134 LYS A CD     2  
ATOM   4639  C CE     . LYS A 1 134 ? -6.685  -7.788  -9.313  1.00 0.00  ? 134 LYS A CE     2  
ATOM   4640  N NZ     . LYS A 1 134 ? -7.017  -8.812  -8.283  1.00 0.00  ? 134 LYS A NZ     2  
ATOM   4641  H H      . LYS A 1 134 ? -8.167  -9.955  -15.093 1.00 0.00  ? 134 LYS A H      2  
ATOM   4642  H HA     . LYS A 1 134 ? -9.541  -8.041  -13.724 1.00 0.00  ? 134 LYS A HA     2  
ATOM   4643  H HB2    . LYS A 1 134 ? -8.565  -9.978  -12.635 1.00 0.00  ? 134 LYS A HB2    2  
ATOM   4644  H HB3    . LYS A 1 134 ? -6.942  -9.365  -12.937 1.00 0.00  ? 134 LYS A HB3    2  
ATOM   4645  H HG2    . LYS A 1 134 ? -8.283  -7.333  -11.547 1.00 0.00  ? 134 LYS A HG2    2  
ATOM   4646  H HG3    . LYS A 1 134 ? -8.711  -8.842  -10.738 1.00 0.00  ? 134 LYS A HG3    2  
ATOM   4647  H HD2    . LYS A 1 134 ? -6.286  -9.405  -10.644 1.00 0.00  ? 134 LYS A HD2    2  
ATOM   4648  H HD3    . LYS A 1 134 ? -5.933  -7.809  -11.309 1.00 0.00  ? 134 LYS A HD3    2  
ATOM   4649  H HE2    . LYS A 1 134 ? -5.724  -7.356  -9.081  1.00 0.00  ? 134 LYS A HE2    2  
ATOM   4650  H HE3    . LYS A 1 134 ? -7.440  -7.016  -9.296  1.00 0.00  ? 134 LYS A HE3    2  
ATOM   4651  H HZ1    . LYS A 1 134 ? -7.197  -9.732  -8.736  1.00 0.00  ? 134 LYS A HZ1    2  
ATOM   4652  H HZ2    . LYS A 1 134 ? -7.866  -8.527  -7.754  1.00 0.00  ? 134 LYS A HZ2    2  
ATOM   4653  H HZ3    . LYS A 1 134 ? -6.226  -8.916  -7.616  1.00 0.00  ? 134 LYS A HZ3    2  
ATOM   4654  N N      . GLU A 1 135 ? -6.512  -6.988  -14.460 1.00 0.00  ? 135 GLU A N      2  
ATOM   4655  C CA     . GLU A 1 135 ? -5.670  -5.802  -14.575 1.00 0.00  ? 135 GLU A CA     2  
ATOM   4656  C C      . GLU A 1 135 ? -6.426  -4.648  -15.224 1.00 0.00  ? 135 GLU A C      2  
ATOM   4657  O O      . GLU A 1 135 ? -6.588  -3.587  -14.624 1.00 0.00  ? 135 GLU A O      2  
ATOM   4658  C CB     . GLU A 1 135 ? -4.414  -6.119  -15.391 1.00 0.00  ? 135 GLU A CB     2  
ATOM   4659  C CG     . GLU A 1 135 ? -3.849  -7.503  -15.125 1.00 0.00  ? 135 GLU A CG     2  
ATOM   4660  C CD     . GLU A 1 135 ? -4.204  -8.497  -16.212 1.00 0.00  ? 135 GLU A CD     2  
ATOM   4661  O OE1    . GLU A 1 135 ? -4.222  -8.097  -17.395 1.00 0.00  ? 135 GLU A OE1    2  
ATOM   4662  O OE2    . GLU A 1 135 ? -4.467  -9.672  -15.881 1.00 0.00  ? 135 GLU A OE2    2  
ATOM   4663  H H      . GLU A 1 135 ? -6.168  -7.851  -14.764 1.00 0.00  ? 135 GLU A H      2  
ATOM   4664  H HA     . GLU A 1 135 ? -5.375  -5.508  -13.578 1.00 0.00  ? 135 GLU A HA     2  
ATOM   4665  H HB2    . GLU A 1 135 ? -4.654  -6.048  -16.440 1.00 0.00  ? 135 GLU A HB2    2  
ATOM   4666  H HB3    . GLU A 1 135 ? -3.653  -5.391  -15.153 1.00 0.00  ? 135 GLU A HB3    2  
ATOM   4667  H HG2    . GLU A 1 135 ? -2.775  -7.434  -15.061 1.00 0.00  ? 135 GLU A HG2    2  
ATOM   4668  H HG3    . GLU A 1 135 ? -4.240  -7.865  -14.184 1.00 0.00  ? 135 GLU A HG3    2  
ATOM   4669  H HE2    . GLU A 1 135 ? -4.684  -10.245 -16.619 1.00 0.00  ? 135 GLU A HE2    2  
ATOM   4670  N N      . MET A 1 136 ? -6.881  -4.860  -16.456 1.00 0.00  ? 136 MET A N      2  
ATOM   4671  C CA     . MET A 1 136 ? -7.611  -3.834  -17.187 1.00 0.00  ? 136 MET A CA     2  
ATOM   4672  C C      . MET A 1 136 ? -8.800  -3.334  -16.380 1.00 0.00  ? 136 MET A C      2  
ATOM   4673  O O      . MET A 1 136 ? -9.077  -2.135  -16.345 1.00 0.00  ? 136 MET A O      2  
ATOM   4674  C CB     . MET A 1 136 ? -8.075  -4.376  -18.536 1.00 0.00  ? 136 MET A CB     2  
ATOM   4675  C CG     . MET A 1 136 ? -6.928  -4.787  -19.443 1.00 0.00  ? 136 MET A CG     2  
ATOM   4676  S SD     . MET A 1 136 ? -6.455  -3.489  -20.604 1.00 0.00  ? 136 MET A SD     2  
ATOM   4677  C CE     . MET A 1 136 ? -6.549  -2.031  -19.566 1.00 0.00  ? 136 MET A CE     2  
ATOM   4678  H H      . MET A 1 136 ? -6.720  -5.728  -16.883 1.00 0.00  ? 136 MET A H      2  
ATOM   4679  H HA     . MET A 1 136 ? -6.937  -3.008  -17.354 1.00 0.00  ? 136 MET A HA     2  
ATOM   4680  H HB2    . MET A 1 136 ? -8.702  -5.239  -18.367 1.00 0.00  ? 136 MET A HB2    2  
ATOM   4681  H HB3    . MET A 1 136 ? -8.652  -3.614  -19.041 1.00 0.00  ? 136 MET A HB3    2  
ATOM   4682  H HG2    . MET A 1 136 ? -6.073  -5.030  -18.828 1.00 0.00  ? 136 MET A HG2    2  
ATOM   4683  H HG3    . MET A 1 136 ? -7.227  -5.661  -20.003 1.00 0.00  ? 136 MET A HG3    2  
ATOM   4684  H HE1    . MET A 1 136 ? -7.538  -1.958  -19.138 1.00 0.00  ? 136 MET A HE1    2  
ATOM   4685  H HE2    . MET A 1 136 ? -6.346  -1.153  -20.160 1.00 0.00  ? 136 MET A HE2    2  
ATOM   4686  H HE3    . MET A 1 136 ? -5.819  -2.105  -18.773 1.00 0.00  ? 136 MET A HE3    2  
ATOM   4687  N N      . LYS A 1 137 ? -9.488  -4.254  -15.712 1.00 0.00  ? 137 LYS A N      2  
ATOM   4688  C CA     . LYS A 1 137 ? -10.631 -3.888  -14.889 1.00 0.00  ? 137 LYS A CA     2  
ATOM   4689  C C      . LYS A 1 137 ? -10.225 -2.801  -13.903 1.00 0.00  ? 137 LYS A C      2  
ATOM   4690  O O      . LYS A 1 137 ? -10.973 -1.858  -13.654 1.00 0.00  ? 137 LYS A O      2  
ATOM   4691  C CB     . LYS A 1 137 ? -11.164 -5.107  -14.137 1.00 0.00  ? 137 LYS A CB     2  
ATOM   4692  C CG     . LYS A 1 137 ? -12.364 -5.764  -14.801 1.00 0.00  ? 137 LYS A CG     2  
ATOM   4693  C CD     . LYS A 1 137 ? -11.993 -7.095  -15.439 1.00 0.00  ? 137 LYS A CD     2  
ATOM   4694  C CE     . LYS A 1 137 ? -12.371 -8.273  -14.550 1.00 0.00  ? 137 LYS A CE     2  
ATOM   4695  N NZ     . LYS A 1 137 ? -11.899 -8.106  -13.145 1.00 0.00  ? 137 LYS A NZ     2  
ATOM   4696  H H      . LYS A 1 137 ? -9.213  -5.192  -15.764 1.00 0.00  ? 137 LYS A H      2  
ATOM   4697  H HA     . LYS A 1 137 ? -11.403 -3.504  -15.541 1.00 0.00  ? 137 LYS A HA     2  
ATOM   4698  H HB2    . LYS A 1 137 ? -10.376 -5.840  -14.063 1.00 0.00  ? 137 LYS A HB2    2  
ATOM   4699  H HB3    . LYS A 1 137 ? -11.454 -4.804  -13.141 1.00 0.00  ? 137 LYS A HB3    2  
ATOM   4700  H HG2    . LYS A 1 137 ? -13.126 -5.933  -14.056 1.00 0.00  ? 137 LYS A HG2    2  
ATOM   4701  H HG3    . LYS A 1 137 ? -12.745 -5.103  -15.566 1.00 0.00  ? 137 LYS A HG3    2  
ATOM   4702  H HD2    . LYS A 1 137 ? -12.519 -7.188  -16.378 1.00 0.00  ? 137 LYS A HD2    2  
ATOM   4703  H HD3    . LYS A 1 137 ? -10.926 -7.114  -15.620 1.00 0.00  ? 137 LYS A HD3    2  
ATOM   4704  H HE2    . LYS A 1 137 ? -13.446 -8.373  -14.547 1.00 0.00  ? 137 LYS A HE2    2  
ATOM   4705  H HE3    . LYS A 1 137 ? -11.930 -9.169  -14.961 1.00 0.00  ? 137 LYS A HE3    2  
ATOM   4706  H HZ1    . LYS A 1 137 ? -11.275 -8.895  -12.881 1.00 0.00  ? 137 LYS A HZ1    2  
ATOM   4707  H HZ2    . LYS A 1 137 ? -12.711 -8.091  -12.495 1.00 0.00  ? 137 LYS A HZ2    2  
ATOM   4708  H HZ3    . LYS A 1 137 ? -11.376 -7.215  -13.043 1.00 0.00  ? 137 LYS A HZ3    2  
ATOM   4709  N N      . ALA A 1 138 ? -9.016  -2.941  -13.365 1.00 0.00  ? 138 ALA A N      2  
ATOM   4710  C CA     . ALA A 1 138 ? -8.477  -1.975  -12.422 1.00 0.00  ? 138 ALA A CA     2  
ATOM   4711  C C      . ALA A 1 138 ? -7.993  -0.732  -13.155 1.00 0.00  ? 138 ALA A C      2  
ATOM   4712  O O      . ALA A 1 138 ? -8.263  0.394   -12.739 1.00 0.00  ? 138 ALA A O      2  
ATOM   4713  C CB     . ALA A 1 138 ? -7.344  -2.594  -11.625 1.00 0.00  ? 138 ALA A CB     2  
ATOM   4714  H H      . ALA A 1 138 ? -8.467  -3.713  -13.622 1.00 0.00  ? 138 ALA A H      2  
ATOM   4715  H HA     . ALA A 1 138 ? -9.262  -1.700  -11.735 1.00 0.00  ? 138 ALA A HA     2  
ATOM   4716  H HB1    . ALA A 1 138 ? -6.466  -2.675  -12.251 1.00 0.00  ? 138 ALA A HB1    2  
ATOM   4717  H HB2    . ALA A 1 138 ? -7.637  -3.575  -11.287 1.00 0.00  ? 138 ALA A HB2    2  
ATOM   4718  H HB3    . ALA A 1 138 ? -7.123  -1.969  -10.773 1.00 0.00  ? 138 ALA A HB3    2  
ATOM   4719  N N      . ALA A 1 139 ? -7.286  -0.947  -14.262 1.00 0.00  ? 139 ALA A N      2  
ATOM   4720  C CA     . ALA A 1 139 ? -6.778  0.155   -15.070 1.00 0.00  ? 139 ALA A CA     2  
ATOM   4721  C C      . ALA A 1 139 ? -7.904  1.120   -15.412 1.00 0.00  ? 139 ALA A C      2  
ATOM   4722  O O      . ALA A 1 139 ? -7.744  2.337   -15.338 1.00 0.00  ? 139 ALA A O      2  
ATOM   4723  C CB     . ALA A 1 139 ? -6.129  -0.375  -16.340 1.00 0.00  ? 139 ALA A CB     2  
ATOM   4724  H H      . ALA A 1 139 ? -7.113  -1.868  -14.549 1.00 0.00  ? 139 ALA A H      2  
ATOM   4725  H HA     . ALA A 1 139 ? -6.026  0.676   -14.495 1.00 0.00  ? 139 ALA A HA     2  
ATOM   4726  H HB1    . ALA A 1 139 ? -5.227  0.183   -16.544 1.00 0.00  ? 139 ALA A HB1    2  
ATOM   4727  H HB2    . ALA A 1 139 ? -6.814  -0.261  -17.168 1.00 0.00  ? 139 ALA A HB2    2  
ATOM   4728  H HB3    . ALA A 1 139 ? -5.887  -1.420  -16.213 1.00 0.00  ? 139 ALA A HB3    2  
ATOM   4729  N N      . LEU A 1 140 ? -9.052  0.553   -15.770 1.00 0.00  ? 140 LEU A N      2  
ATOM   4730  C CA     . LEU A 1 140 ? -10.226 1.344   -16.105 1.00 0.00  ? 140 LEU A CA     2  
ATOM   4731  C C      . LEU A 1 140 ? -10.921 1.813   -14.830 1.00 0.00  ? 140 LEU A C      2  
ATOM   4732  O O      . LEU A 1 140 ? -11.550 2.870   -14.805 1.00 0.00  ? 140 LEU A O      2  
ATOM   4733  C CB     . LEU A 1 140 ? -11.190 0.520   -16.963 1.00 0.00  ? 140 LEU A CB     2  
ATOM   4734  C CG     . LEU A 1 140 ? -10.535 -0.279  -18.094 1.00 0.00  ? 140 LEU A CG     2  
ATOM   4735  C CD1    . LEU A 1 140 ? -11.092 -1.696  -18.150 1.00 0.00  ? 140 LEU A CD1    2  
ATOM   4736  C CD2    . LEU A 1 140 ? -10.733 0.423   -19.428 1.00 0.00  ? 140 LEU A CD2    2  
ATOM   4737  H H      . LEU A 1 140 ? -9.112  -0.425  -15.794 1.00 0.00  ? 140 LEU A H      2  
ATOM   4738  H HA     . LEU A 1 140 ? -9.898  2.206   -16.665 1.00 0.00  ? 140 LEU A HA     2  
ATOM   4739  H HB2    . LEU A 1 140 ? -11.713 -0.169  -16.315 1.00 0.00  ? 140 LEU A HB2    2  
ATOM   4740  H HB3    . LEU A 1 140 ? -11.914 1.193   -17.400 1.00 0.00  ? 140 LEU A HB3    2  
ATOM   4741  H HG     . LEU A 1 140 ? -9.473  -0.350  -17.907 1.00 0.00  ? 140 LEU A HG     2  
ATOM   4742  H HD11   . LEU A 1 140 ? -10.283 -2.395  -18.299 1.00 0.00  ? 140 LEU A HD11   2  
ATOM   4743  H HD12   . LEU A 1 140 ? -11.793 -1.774  -18.967 1.00 0.00  ? 140 LEU A HD12   2  
ATOM   4744  H HD13   . LEU A 1 140 ? -11.596 -1.921  -17.220 1.00 0.00  ? 140 LEU A HD13   2  
ATOM   4745  H HD21   . LEU A 1 140 ? -11.697 0.908   -19.439 1.00 0.00  ? 140 LEU A HD21   2  
ATOM   4746  H HD22   . LEU A 1 140 ? -10.686 -0.302  -20.227 1.00 0.00  ? 140 LEU A HD22   2  
ATOM   4747  H HD23   . LEU A 1 140 ? -9.957  1.161   -19.566 1.00 0.00  ? 140 LEU A HD23   2  
ATOM   4748  N N      . GLN A 1 141 ? -10.793 1.015   -13.771 1.00 0.00  ? 141 GLN A N      2  
ATOM   4749  C CA     . GLN A 1 141 ? -11.397 1.338   -12.483 1.00 0.00  ? 141 GLN A CA     2  
ATOM   4750  C C      . GLN A 1 141 ? -10.740 2.569   -11.870 1.00 0.00  ? 141 GLN A C      2  
ATOM   4751  O O      . GLN A 1 141 ? -11.417 3.527   -11.492 1.00 0.00  ? 141 GLN A O      2  
ATOM   4752  C CB     . GLN A 1 141 ? -11.255 0.152   -11.528 1.00 0.00  ? 141 GLN A CB     2  
ATOM   4753  C CG     . GLN A 1 141 ? -12.569 -0.542  -11.211 1.00 0.00  ? 141 GLN A CG     2  
ATOM   4754  C CD     . GLN A 1 141 ? -13.265 0.056   -10.002 1.00 0.00  ? 141 GLN A CD     2  
ATOM   4755  O OE1    . GLN A 1 141 ? -13.615 -0.655  -9.060  1.00 0.00  ? 141 GLN A OE1    2  
ATOM   4756  N NE2    . GLN A 1 141 ? -13.467 1.367   -10.025 1.00 0.00  ? 141 GLN A NE2    2  
ATOM   4757  H H      . GLN A 1 141 ? -10.274 0.189   -13.857 1.00 0.00  ? 141 GLN A H      2  
ATOM   4758  H HA     . GLN A 1 141 ? -12.446 1.541   -12.644 1.00 0.00  ? 141 GLN A HA     2  
ATOM   4759  H HB2    . GLN A 1 141 ? -10.595 -0.570  -11.973 1.00 0.00  ? 141 GLN A HB2    2  
ATOM   4760  H HB3    . GLN A 1 141 ? -10.823 0.497   -10.600 1.00 0.00  ? 141 GLN A HB3    2  
ATOM   4761  H HG2    . GLN A 1 141 ? -13.220 -0.454  -12.064 1.00 0.00  ? 141 GLN A HG2    2  
ATOM   4762  H HG3    . GLN A 1 141 ? -12.372 -1.585  -11.015 1.00 0.00  ? 141 GLN A HG3    2  
ATOM   4763  H HE21   . GLN A 1 141 ? -13.161 1.870   -10.807 1.00 0.00  ? 141 GLN A HE21   2  
ATOM   4764  H HE22   . GLN A 1 141 ? -13.916 1.779   -9.256  1.00 0.00  ? 141 GLN A HE22   2  
ATOM   4765  N N      . GLU A 1 142 ? -9.413  2.539   -11.780 1.00 0.00  ? 142 GLU A N      2  
ATOM   4766  C CA     . GLU A 1 142 ? -8.663  3.654   -11.220 1.00 0.00  ? 142 GLU A CA     2  
ATOM   4767  C C      . GLU A 1 142 ? -8.788  4.880   -12.113 1.00 0.00  ? 142 GLU A C      2  
ATOM   4768  O O      . GLU A 1 142 ? -8.726  6.015   -11.638 1.00 0.00  ? 142 GLU A O      2  
ATOM   4769  C CB     . GLU A 1 142 ? -7.193  3.270   -11.040 1.00 0.00  ? 142 GLU A CB     2  
ATOM   4770  C CG     . GLU A 1 142 ? -6.987  2.019   -10.204 1.00 0.00  ? 142 GLU A CG     2  
ATOM   4771  C CD     . GLU A 1 142 ? -5.527  1.622   -10.100 1.00 0.00  ? 142 GLU A CD     2  
ATOM   4772  O OE1    . GLU A 1 142 ? -5.108  1.186   -9.007  1.00 0.00  ? 142 GLU A OE1    2  
ATOM   4773  O OE2    . GLU A 1 142 ? -4.804  1.744   -11.111 1.00 0.00  ? 142 GLU A OE2    2  
ATOM   4774  H H      . GLU A 1 142 ? -8.931  1.750   -12.102 1.00 0.00  ? 142 GLU A H      2  
ATOM   4775  H HA     . GLU A 1 142 ? -9.087  3.883   -10.252 1.00 0.00  ? 142 GLU A HA     2  
ATOM   4776  H HB2    . GLU A 1 142 ? -6.754  3.104   -12.013 1.00 0.00  ? 142 GLU A HB2    2  
ATOM   4777  H HB3    . GLU A 1 142 ? -6.677  4.086   -10.556 1.00 0.00  ? 142 GLU A HB3    2  
ATOM   4778  H HG2    . GLU A 1 142 ? -7.366  2.198   -9.209  1.00 0.00  ? 142 GLU A HG2    2  
ATOM   4779  H HG3    . GLU A 1 142 ? -7.534  1.204   -10.656 1.00 0.00  ? 142 GLU A HG3    2  
ATOM   4780  H HE2    . GLU A 1 142 ? -3.893  1.474   -10.973 1.00 0.00  ? 142 GLU A HE2    2  
ATOM   4781  N N      . GLY A 1 143 ? -8.975  4.645   -13.409 1.00 0.00  ? 143 GLY A N      2  
ATOM   4782  C CA     . GLY A 1 143 ? -9.119  5.744   -14.346 1.00 0.00  ? 143 GLY A CA     2  
ATOM   4783  C C      . GLY A 1 143 ? -10.263 6.661   -13.967 1.00 0.00  ? 143 GLY A C      2  
ATOM   4784  O O      . GLY A 1 143 ? -10.078 7.868   -13.827 1.00 0.00  ? 143 GLY A O      2  
ATOM   4785  H H      . GLY A 1 143 ? -9.022  3.722   -13.729 1.00 0.00  ? 143 GLY A H      2  
ATOM   4786  H HA2    . GLY A 1 143 ? -8.203  6.313   -14.361 1.00 0.00  ? 143 GLY A HA2    2  
ATOM   4787  H HA3    . GLY A 1 143 ? -9.303  5.343   -15.332 1.00 0.00  ? 143 GLY A HA3    2  
ATOM   4788  N N      . HIS A 1 144 ? -11.446 6.086   -13.787 1.00 0.00  ? 144 HIS A N      2  
ATOM   4789  C CA     . HIS A 1 144 ? -12.619 6.860   -13.407 1.00 0.00  ? 144 HIS A CA     2  
ATOM   4790  C C      . HIS A 1 144 ? -12.493 7.327   -11.960 1.00 0.00  ? 144 HIS A C      2  
ATOM   4791  O O      . HIS A 1 144 ? -13.002 8.385   -11.590 1.00 0.00  ? 144 HIS A O      2  
ATOM   4792  C CB     . HIS A 1 144 ? -13.891 6.030   -13.579 1.00 0.00  ? 144 HIS A CB     2  
ATOM   4793  C CG     . HIS A 1 144 ? -15.103 6.853   -13.887 1.00 0.00  ? 144 HIS A CG     2  
ATOM   4794  N ND1    . HIS A 1 144 ? -15.730 7.646   -12.948 1.00 0.00  ? 144 HIS A ND1    2  
ATOM   4795  C CD2    . HIS A 1 144 ? -15.803 7.009   -15.035 1.00 0.00  ? 144 HIS A CD2    2  
ATOM   4796  C CE1    . HIS A 1 144 ? -16.762 8.254   -13.506 1.00 0.00  ? 144 HIS A CE1    2  
ATOM   4797  N NE2    . HIS A 1 144 ? -16.828 7.884   -14.772 1.00 0.00  ? 144 HIS A NE2    2  
ATOM   4798  H H      . HIS A 1 144 ? -11.530 5.115   -13.903 1.00 0.00  ? 144 HIS A H      2  
ATOM   4799  H HA     . HIS A 1 144 ? -12.669 7.725   -14.049 1.00 0.00  ? 144 HIS A HA     2  
ATOM   4800  H HB2    . HIS A 1 144 ? -13.749 5.332   -14.390 1.00 0.00  ? 144 HIS A HB2    2  
ATOM   4801  H HB3    . HIS A 1 144 ? -14.082 5.481   -12.668 1.00 0.00  ? 144 HIS A HB3    2  
ATOM   4802  H HD1    . HIS A 1 144 ? -15.460 7.748   -12.011 1.00 0.00  ? 144 HIS A HD1    2  
ATOM   4803  H HD2    . HIS A 1 144 ? -15.593 6.534   -15.983 1.00 0.00  ? 144 HIS A HD2    2  
ATOM   4804  H HE1    . HIS A 1 144 ? -17.437 8.935   -13.012 1.00 0.00  ? 144 HIS A HE1    2  
ATOM   4805  H HE2    . HIS A 1 144 ? -17.532 8.144   -15.401 1.00 0.00  ? 144 HIS A HE2    2  
ATOM   4806  N N      . GLN A 1 145 ? -11.799 6.532   -11.150 1.00 0.00  ? 145 GLN A N      2  
ATOM   4807  C CA     . GLN A 1 145 ? -11.591 6.861   -9.746  1.00 0.00  ? 145 GLN A CA     2  
ATOM   4808  C C      . GLN A 1 145 ? -10.750 8.125   -9.617  1.00 0.00  ? 145 GLN A C      2  
ATOM   4809  O O      . GLN A 1 145 ? -11.114 9.059   -8.901  1.00 0.00  ? 145 GLN A O      2  
ATOM   4810  C CB     . GLN A 1 145 ? -10.900 5.700   -9.027  1.00 0.00  ? 145 GLN A CB     2  
ATOM   4811  C CG     . GLN A 1 145 ? -10.674 5.948   -7.544  1.00 0.00  ? 145 GLN A CG     2  
ATOM   4812  C CD     . GLN A 1 145 ? -11.920 5.707   -6.716  1.00 0.00  ? 145 GLN A CD     2  
ATOM   4813  O OE1    . GLN A 1 145 ? -12.899 6.446   -6.817  1.00 0.00  ? 145 GLN A OE1    2  
ATOM   4814  N NE2    . GLN A 1 145 ? -11.890 4.666   -5.891  1.00 0.00  ? 145 GLN A NE2    2  
ATOM   4815  H H      . GLN A 1 145 ? -11.412 5.705   -11.507 1.00 0.00  ? 145 GLN A H      2  
ATOM   4816  H HA     . GLN A 1 145 ? -12.558 7.032   -9.295  1.00 0.00  ? 145 GLN A HA     2  
ATOM   4817  H HB2    . GLN A 1 145 ? -11.505 4.813   -9.134  1.00 0.00  ? 145 GLN A HB2    2  
ATOM   4818  H HB3    . GLN A 1 145 ? -9.938  5.527   -9.491  1.00 0.00  ? 145 GLN A HB3    2  
ATOM   4819  H HG2    . GLN A 1 145 ? -9.896  5.283   -7.198  1.00 0.00  ? 145 GLN A HG2    2  
ATOM   4820  H HG3    . GLN A 1 145 ? -10.362 6.971   -7.407  1.00 0.00  ? 145 GLN A HG3    2  
ATOM   4821  H HE21   . GLN A 1 145 ? -11.076 4.121   -5.864  1.00 0.00  ? 145 GLN A HE21   2  
ATOM   4822  H HE22   . GLN A 1 145 ? -12.684 4.485   -5.344  1.00 0.00  ? 145 GLN A HE22   2  
ATOM   4823  N N      . PHE A 1 146 ? -9.625  8.146   -10.323 1.00 0.00  ? 146 PHE A N      2  
ATOM   4824  C CA     . PHE A 1 146 ? -8.724  9.290   -10.305 1.00 0.00  ? 146 PHE A CA     2  
ATOM   4825  C C      . PHE A 1 146 ? -9.417  10.532  -10.856 1.00 0.00  ? 146 PHE A C      2  
ATOM   4826  O O      . PHE A 1 146 ? -9.428  11.582  -10.215 1.00 0.00  ? 146 PHE A O      2  
ATOM   4827  C CB     . PHE A 1 146 ? -7.470  8.975   -11.118 1.00 0.00  ? 146 PHE A CB     2  
ATOM   4828  C CG     . PHE A 1 146 ? -6.514  10.129  -11.243 1.00 0.00  ? 146 PHE A CG     2  
ATOM   4829  C CD1    . PHE A 1 146 ? -6.666  11.060  -12.256 1.00 0.00  ? 146 PHE A CD1    2  
ATOM   4830  C CD2    . PHE A 1 146 ? -5.462  10.276  -10.353 1.00 0.00  ? 146 PHE A CD2    2  
ATOM   4831  C CE1    . PHE A 1 146 ? -5.789  12.119  -12.379 1.00 0.00  ? 146 PHE A CE1    2  
ATOM   4832  C CE2    . PHE A 1 146 ? -4.580  11.333  -10.471 1.00 0.00  ? 146 PHE A CE2    2  
ATOM   4833  C CZ     . PHE A 1 146 ? -4.743  12.256  -11.484 1.00 0.00  ? 146 PHE A CZ     2  
ATOM   4834  H H      . PHE A 1 146 ? -9.397  7.370   -10.877 1.00 0.00  ? 146 PHE A H      2  
ATOM   4835  H HA     . PHE A 1 146 ? -8.442  9.474   -9.279  1.00 0.00  ? 146 PHE A HA     2  
ATOM   4836  H HB2    . PHE A 1 146 ? -6.942  8.161   -10.646 1.00 0.00  ? 146 PHE A HB2    2  
ATOM   4837  H HB3    . PHE A 1 146 ? -7.762  8.677   -12.114 1.00 0.00  ? 146 PHE A HB3    2  
ATOM   4838  H HD1    . PHE A 1 146 ? -7.482  10.955  -12.956 1.00 0.00  ? 146 PHE A HD1    2  
ATOM   4839  H HD2    . PHE A 1 146 ? -5.336  9.554   -9.561  1.00 0.00  ? 146 PHE A HD2    2  
ATOM   4840  H HE1    . PHE A 1 146 ? -5.917  12.840  -13.173 1.00 0.00  ? 146 PHE A HE1    2  
ATOM   4841  H HE2    . PHE A 1 146 ? -3.766  11.436  -9.770  1.00 0.00  ? 146 PHE A HE2    2  
ATOM   4842  H HZ     . PHE A 1 146 ? -4.056  13.084  -11.578 1.00 0.00  ? 146 PHE A HZ     2  
ATOM   4843  N N      . LEU A 1 147 ? -9.999  10.402  -12.043 1.00 0.00  ? 147 LEU A N      2  
ATOM   4844  C CA     . LEU A 1 147 ? -10.700 11.515  -12.678 1.00 0.00  ? 147 LEU A CA     2  
ATOM   4845  C C      . LEU A 1 147 ? -11.773 12.078  -11.753 1.00 0.00  ? 147 LEU A C      2  
ATOM   4846  O O      . LEU A 1 147 ? -12.074 13.271  -11.788 1.00 0.00  ? 147 LEU A O      2  
ATOM   4847  C CB     . LEU A 1 147 ? -11.317 11.066  -14.001 1.00 0.00  ? 147 LEU A CB     2  
ATOM   4848  C CG     . LEU A 1 147 ? -10.299 10.679  -15.077 1.00 0.00  ? 147 LEU A CG     2  
ATOM   4849  C CD1    . LEU A 1 147 ? -10.997 10.319  -16.379 1.00 0.00  ? 147 LEU A CD1    2  
ATOM   4850  C CD2    . LEU A 1 147 ? -9.306  11.810  -15.301 1.00 0.00  ? 147 LEU A CD2    2  
ATOM   4851  H H      . LEU A 1 147 ? -9.959  9.538   -12.504 1.00 0.00  ? 147 LEU A H      2  
ATOM   4852  H HA     . LEU A 1 147 ? -9.975  12.287  -12.876 1.00 0.00  ? 147 LEU A HA     2  
ATOM   4853  H HB2    . LEU A 1 147 ? -11.953 10.214  -13.811 1.00 0.00  ? 147 LEU A HB2    2  
ATOM   4854  H HB3    . LEU A 1 147 ? -11.923 11.872  -14.386 1.00 0.00  ? 147 LEU A HB3    2  
ATOM   4855  H HG     . LEU A 1 147 ? -9.746  9.814   -14.745 1.00 0.00  ? 147 LEU A HG     2  
ATOM   4856  H HD11   . LEU A 1 147 ? -12.056 10.498  -16.283 1.00 0.00  ? 147 LEU A HD11   2  
ATOM   4857  H HD12   . LEU A 1 147 ? -10.824 9.276   -16.601 1.00 0.00  ? 147 LEU A HD12   2  
ATOM   4858  H HD13   . LEU A 1 147 ? -10.598 10.926  -17.177 1.00 0.00  ? 147 LEU A HD13   2  
ATOM   4859  H HD21   . LEU A 1 147 ? -8.427  11.642  -14.695 1.00 0.00  ? 147 LEU A HD21   2  
ATOM   4860  H HD22   . LEU A 1 147 ? -9.761  12.748  -15.021 1.00 0.00  ? 147 LEU A HD22   2  
ATOM   4861  H HD23   . LEU A 1 147 ? -9.025  11.840  -16.344 1.00 0.00  ? 147 LEU A HD23   2  
ATOM   4862  N N      . CYS A 1 148 ? -12.332 11.216  -10.910 1.00 0.00  ? 148 CYS A N      2  
ATOM   4863  C CA     . CYS A 1 148 ? -13.355 11.631  -9.958  1.00 0.00  ? 148 CYS A CA     2  
ATOM   4864  C C      . CYS A 1 148 ? -12.714 12.231  -8.708  1.00 0.00  ? 148 CYS A C      2  
ATOM   4865  O O      . CYS A 1 148 ? -13.402 12.780  -7.847  1.00 0.00  ? 148 CYS A O      2  
ATOM   4866  C CB     . CYS A 1 148 ? -14.234 10.440  -9.571  1.00 0.00  ? 148 CYS A CB     2  
ATOM   4867  S SG     . CYS A 1 148 ? -15.876 10.897  -8.966  1.00 0.00  ? 148 CYS A SG     2  
ATOM   4868  H H      . CYS A 1 148 ? -12.040 10.281  -10.920 1.00 0.00  ? 148 CYS A H      2  
ATOM   4869  H HA     . CYS A 1 148 ? -13.968 12.383  -10.433 1.00 0.00  ? 148 CYS A HA     2  
ATOM   4870  H HB2    . CYS A 1 148 ? -14.369 9.805   -10.435 1.00 0.00  ? 148 CYS A HB2    2  
ATOM   4871  H HB3    . CYS A 1 148 ? -13.741 9.878   -8.791  1.00 0.00  ? 148 CYS A HB3    2  
ATOM   4872  H HG     . CYS A 1 148 ? -16.231 10.151  -8.479  1.00 0.00  ? 148 CYS A HG     2  
ATOM   4873  N N      . SER A 1 149 ? -11.389 12.118  -8.614  1.00 0.00  ? 149 SER A N      2  
ATOM   4874  C CA     . SER A 1 149 ? -10.647 12.641  -7.474  1.00 0.00  ? 149 SER A CA     2  
ATOM   4875  C C      . SER A 1 149 ? -9.967  13.965  -7.815  1.00 0.00  ? 149 SER A C      2  
ATOM   4876  O O      . SER A 1 149 ? -9.653  14.755  -6.924  1.00 0.00  ? 149 SER A O      2  
ATOM   4877  C CB     . SER A 1 149 ? -9.601  11.624  -7.015  1.00 0.00  ? 149 SER A CB     2  
ATOM   4878  O OG     . SER A 1 149 ? -9.692  11.390  -5.619  1.00 0.00  ? 149 SER A OG     2  
ATOM   4879  H H      . SER A 1 149 ? -10.898 11.669  -9.329  1.00 0.00  ? 149 SER A H      2  
ATOM   4880  H HA     . SER A 1 149 ? -11.349 12.806  -6.671  1.00 0.00  ? 149 SER A HA     2  
ATOM   4881  H HB2    . SER A 1 149 ? -9.758  10.689  -7.534  1.00 0.00  ? 149 SER A HB2    2  
ATOM   4882  H HB3    . SER A 1 149 ? -8.612  11.998  -7.240  1.00 0.00  ? 149 SER A HB3    2  
ATOM   4883  H HG     . SER A 1 149 ? -9.650  12.227  -5.152  1.00 0.00  ? 149 SER A HG     2  
ATOM   4884  N N      . ILE A 1 150 ? -9.741  14.206  -9.105  1.00 0.00  ? 150 ILE A N      2  
ATOM   4885  C CA     . ILE A 1 150 ? -9.098  15.439  -9.541  1.00 0.00  ? 150 ILE A CA     2  
ATOM   4886  C C      . ILE A 1 150 ? -10.013 16.639  -9.269  1.00 0.00  ? 150 ILE A C      2  
ATOM   4887  O O      . ILE A 1 150 ? -10.452 16.843  -8.137  1.00 0.00  ? 150 ILE A O      2  
ATOM   4888  C CB     . ILE A 1 150 ? -8.687  15.399  -11.041 1.00 0.00  ? 150 ILE A CB     2  
ATOM   4889  C CG1    . ILE A 1 150 ? -8.506  13.967  -11.553 1.00 0.00  ? 150 ILE A CG1    2  
ATOM   4890  C CG2    . ILE A 1 150 ? -7.406  16.193  -11.245 1.00 0.00  ? 150 ILE A CG2    2  
ATOM   4891  C CD1    . ILE A 1 150 ? -8.155  13.901  -13.024 1.00 0.00  ? 150 ILE A CD1    2  
ATOM   4892  H H      . ILE A 1 150 ? -10.016 13.547  -9.770  1.00 0.00  ? 150 ILE A H      2  
ATOM   4893  H HA     . ILE A 1 150 ? -8.200  15.563  -8.955  1.00 0.00  ? 150 ILE A HA     2  
ATOM   4894  H HB     . ILE A 1 150 ? -9.465  15.873  -11.618 1.00 0.00  ? 150 ILE A HB     2  
ATOM   4895  H HG12   . ILE A 1 150 ? -7.713  13.486  -11.002 1.00 0.00  ? 150 ILE A HG12   2  
ATOM   4896  H HG13   . ILE A 1 150 ? -9.424  13.421  -11.409 1.00 0.00  ? 150 ILE A HG13   2  
ATOM   4897  H HG21   . ILE A 1 150 ? -6.882  15.813  -12.109 1.00 0.00  ? 150 ILE A HG21   2  
ATOM   4898  H HG22   . ILE A 1 150 ? -6.780  16.094  -10.372 1.00 0.00  ? 150 ILE A HG22   2  
ATOM   4899  H HG23   . ILE A 1 150 ? -7.647  17.233  -11.400 1.00 0.00  ? 150 ILE A HG23   2  
ATOM   4900  H HD11   . ILE A 1 150 ? -8.978  14.285  -13.607 1.00 0.00  ? 150 ILE A HD11   2  
ATOM   4901  H HD12   . ILE A 1 150 ? -7.966  12.876  -13.302 1.00 0.00  ? 150 ILE A HD12   2  
ATOM   4902  H HD13   . ILE A 1 150 ? -7.273  14.495  -13.211 1.00 0.00  ? 150 ILE A HD13   2  
ATOM   4903  N N      . GLU A 1 151 ? -10.308 17.424  -10.300 1.00 0.00  ? 151 GLU A N      2  
ATOM   4904  C CA     . GLU A 1 151 ? -11.174 18.584  -10.159 1.00 0.00  ? 151 GLU A CA     2  
ATOM   4905  C C      . GLU A 1 151 ? -12.599 18.232  -10.572 1.00 0.00  ? 151 GLU A C      2  
ATOM   4906  O O      . GLU A 1 151 ? -13.530 18.322  -9.771  1.00 0.00  ? 151 GLU A O      2  
ATOM   4907  C CB     . GLU A 1 151 ? -10.652 19.741  -11.011 1.00 0.00  ? 151 GLU A CB     2  
ATOM   4908  C CG     . GLU A 1 151 ? -11.381 21.053  -10.774 1.00 0.00  ? 151 GLU A CG     2  
ATOM   4909  C CD     . GLU A 1 151 ? -10.667 21.942  -9.776  1.00 0.00  ? 151 GLU A CD     2  
ATOM   4910  O OE1    . GLU A 1 151 ? -11.166 22.083  -8.641  1.00 0.00  ? 151 GLU A OE1    2  
ATOM   4911  O OE2    . GLU A 1 151 ? -9.606  22.499  -10.130 1.00 0.00  ? 151 GLU A OE2    2  
ATOM   4912  H H      . GLU A 1 151 ? -9.939  17.216  -11.177 1.00 0.00  ? 151 GLU A H      2  
ATOM   4913  H HA     . GLU A 1 151 ? -11.173 18.878  -9.120  1.00 0.00  ? 151 GLU A HA     2  
ATOM   4914  H HB2    . GLU A 1 151 ? -9.604  19.891  -10.791 1.00 0.00  ? 151 GLU A HB2    2  
ATOM   4915  H HB3    . GLU A 1 151 ? -10.757 19.479  -12.054 1.00 0.00  ? 151 GLU A HB3    2  
ATOM   4916  H HG2    . GLU A 1 151 ? -11.460 21.581  -11.712 1.00 0.00  ? 151 GLU A HG2    2  
ATOM   4917  H HG3    . GLU A 1 151 ? -12.370 20.837  -10.398 1.00 0.00  ? 151 GLU A HG3    2  
ATOM   4918  H HE2    . GLU A 1 151 ? -9.208  23.047  -9.451  1.00 0.00  ? 151 GLU A HE2    2  
ATOM   4919  N N      . ALA A 1 152 ? -12.760 17.824  -11.828 1.00 0.00  ? 152 ALA A N      2  
ATOM   4920  C CA     . ALA A 1 152 ? -14.067 17.450  -12.352 1.00 0.00  ? 152 ALA A CA     2  
ATOM   4921  C C      . ALA A 1 152 ? -14.702 16.347  -11.509 1.00 0.00  ? 152 ALA A C      2  
ATOM   4922  O O      . ALA A 1 152 ? -14.158 15.248  -11.395 1.00 0.00  ? 152 ALA A O      2  
ATOM   4923  C CB     . ALA A 1 152 ? -13.944 17.006  -13.804 1.00 0.00  ? 152 ALA A CB     2  
ATOM   4924  H H      . ALA A 1 152 ? -11.978 17.771  -12.415 1.00 0.00  ? 152 ALA A H      2  
ATOM   4925  H HA     . ALA A 1 152 ? -14.701 18.325  -12.321 1.00 0.00  ? 152 ALA A HA     2  
ATOM   4926  H HB1    . ALA A 1 152 ? -12.903 17.018  -14.095 1.00 0.00  ? 152 ALA A HB1    2  
ATOM   4927  H HB2    . ALA A 1 152 ? -14.502 17.680  -14.435 1.00 0.00  ? 152 ALA A HB2    2  
ATOM   4928  H HB3    . ALA A 1 152 ? -14.335 16.006  -13.912 1.00 0.00  ? 152 ALA A HB3    2  
ATOM   4929  N N      . LEU A 1 153 ? -15.853 16.650  -10.919 1.00 0.00  ? 153 LEU A N      2  
ATOM   4930  C CA     . LEU A 1 153 ? -16.560 15.685  -10.084 1.00 0.00  ? 153 LEU A CA     2  
ATOM   4931  C C      . LEU A 1 153 ? -17.524 14.848  -10.919 1.00 0.00  ? 153 LEU A C      2  
ATOM   4932  C CB     . LEU A 1 153 ? -17.323 16.407  -8.972  1.00 0.00  ? 153 LEU A CB     2  
ATOM   4933  C CG     . LEU A 1 153 ? -17.422 15.638  -7.651  1.00 0.00  ? 153 LEU A CG     2  
ATOM   4934  C CD1    . LEU A 1 153 ? -17.060 16.537  -6.474  1.00 0.00  ? 153 LEU A CD1    2  
ATOM   4935  C CD2    . LEU A 1 153 ? -18.819 15.059  -7.476  1.00 0.00  ? 153 LEU A CD2    2  
ATOM   4936  H H      . LEU A 1 153 ? -16.235 17.543  -11.047 1.00 0.00  ? 153 LEU A H      2  
ATOM   4937  H HA     . LEU A 1 153 ? -15.827 15.030  -9.639  1.00 0.00  ? 153 LEU A HA     2  
ATOM   4938  H HB2    . LEU A 1 153 ? -16.833 17.351  -8.785  1.00 0.00  ? 153 LEU A HB2    2  
ATOM   4939  H HB3    . LEU A 1 153 ? -18.325 16.606  -9.324  1.00 0.00  ? 153 LEU A HB3    2  
ATOM   4940  H HG     . LEU A 1 153 ? -16.720 14.817  -7.668  1.00 0.00  ? 153 LEU A HG     2  
ATOM   4941  H HD11   . LEU A 1 153 ? -16.778 17.514  -6.837  1.00 0.00  ? 153 LEU A HD11   2  
ATOM   4942  H HD12   . LEU A 1 153 ? -16.234 16.103  -5.932  1.00 0.00  ? 153 LEU A HD12   2  
ATOM   4943  H HD13   . LEU A 1 153 ? -17.912 16.630  -5.816  1.00 0.00  ? 153 LEU A HD13   2  
ATOM   4944  H HD21   . LEU A 1 153 ? -18.960 14.243  -8.168  1.00 0.00  ? 153 LEU A HD21   2  
ATOM   4945  H HD22   . LEU A 1 153 ? -19.555 15.825  -7.669  1.00 0.00  ? 153 LEU A HD22   2  
ATOM   4946  H HD23   . LEU A 1 153 ? -18.935 14.698  -6.464  1.00 0.00  ? 153 LEU A HD23   2  
HETATM 4947  P PG     . ATP B 2 .   ? 0.766   -9.907  -27.772 1.00 0.00  ? 154 ATP A PG     2  
HETATM 4948  O O1G    . ATP B 2 .   ? 1.052   -11.317 -27.406 1.00 0.00  ? 154 ATP A O1G    2  
HETATM 4949  O O2G    . ATP B 2 .   ? 2.055   -9.252  -27.438 1.00 0.00  ? 154 ATP A O2G    2  
HETATM 4950  O O3G    . ATP B 2 .   ? 0.390   -9.561  -29.167 1.00 0.00  ? 154 ATP A O3G    2  
HETATM 4951  P PB     . ATP B 2 .   ? -0.863  -9.830  -25.600 1.00 0.00  ? 154 ATP A PB     2  
HETATM 4952  O O1B    . ATP B 2 .   ? 0.298   -9.922  -24.680 1.00 0.00  ? 154 ATP A O1B    2  
HETATM 4953  O O2B    . ATP B 2 .   ? -1.714  -11.022 -25.845 1.00 0.00  ? 154 ATP A O2B    2  
HETATM 4954  O O3B    . ATP B 2 .   ? -0.313  -9.374  -26.902 1.00 0.00  ? 154 ATP A O3B    2  
HETATM 4955  P PA     . ATP B 2 .   ? -3.149  -8.717  -24.566 1.00 0.00  ? 154 ATP A PA     2  
HETATM 4956  O O1A    . ATP B 2 .   ? -3.568  -7.567  -23.723 1.00 0.00  ? 154 ATP A O1A    2  
HETATM 4957  O O2A    . ATP B 2 .   ? -3.958  -9.057  -25.764 1.00 0.00  ? 154 ATP A O2A    2  
HETATM 4958  O O3A    . ATP B 2 .   ? -1.713  -8.806  -24.936 1.00 0.00  ? 154 ATP A O3A    2  
HETATM 4959  O "O5'"  . ATP B 2 .   ? -3.169  -9.943  -23.549 1.00 0.00  ? 154 ATP A "O5'"  2  
HETATM 4960  C "C5'"  . ATP B 2 .   ? -3.693  -11.213 -23.940 1.00 0.00  ? 154 ATP A "C5'"  2  
HETATM 4961  C "C4'"  . ATP B 2 .   ? -2.873  -12.322 -23.329 1.00 0.00  ? 154 ATP A "C4'"  2  
HETATM 4962  O "O4'"  . ATP B 2 .   ? -3.311  -12.517 -21.959 1.00 0.00  ? 154 ATP A "O4'"  2  
HETATM 4963  C "C3'"  . ATP B 2 .   ? -3.002  -13.683 -24.017 1.00 0.00  ? 154 ATP A "C3'"  2  
HETATM 4964  O "O3'"  . ATP B 2 .   ? -1.724  -14.247 -24.285 1.00 0.00  ? 154 ATP A "O3'"  2  
HETATM 4965  C "C2'"  . ATP B 2 .   ? -3.797  -14.530 -23.022 1.00 0.00  ? 154 ATP A "C2'"  2  
HETATM 4966  O "O2'"  . ATP B 2 .   ? -3.360  -15.875 -23.031 1.00 0.00  ? 154 ATP A "O2'"  2  
HETATM 4967  C "C1'"  . ATP B 2 .   ? -3.388  -13.895 -21.699 1.00 0.00  ? 154 ATP A "C1'"  2  
HETATM 4968  N N9     . ATP B 2 .   ? -4.323  -14.116 -20.596 1.00 0.00  ? 154 ATP A N9     2  
HETATM 4969  C C8     . ATP B 2 .   ? -5.630  -14.536 -20.658 1.00 0.00  ? 154 ATP A C8     2  
HETATM 4970  N N7     . ATP B 2 .   ? -6.206  -14.644 -19.484 1.00 0.00  ? 154 ATP A N7     2  
HETATM 4971  C C5     . ATP B 2 .   ? -5.212  -14.268 -18.591 1.00 0.00  ? 154 ATP A C5     2  
HETATM 4972  C C6     . ATP B 2 .   ? -5.189  -14.169 -17.188 1.00 0.00  ? 154 ATP A C6     2  
HETATM 4973  N N6     . ATP B 2 .   ? -6.232  -14.453 -16.407 1.00 0.00  ? 154 ATP A N6     2  
HETATM 4974  N N1     . ATP B 2 .   ? -4.037  -13.760 -16.609 1.00 0.00  ? 154 ATP A N1     2  
HETATM 4975  C C2     . ATP B 2 .   ? -2.989  -13.475 -17.392 1.00 0.00  ? 154 ATP A C2     2  
HETATM 4976  N N3     . ATP B 2 .   ? -2.890  -13.531 -18.718 1.00 0.00  ? 154 ATP A N3     2  
HETATM 4977  C C4     . ATP B 2 .   ? -4.048  -13.940 -19.262 1.00 0.00  ? 154 ATP A C4     2  
HETATM 4978  H "H5'1" . ATP B 2 .   ? -3.666  -11.303 -25.024 1.00 0.00  ? 154 ATP A "H5'1" 2  
HETATM 4979  H "H5'2" . ATP B 2 .   ? -4.724  -11.307 -23.600 1.00 0.00  ? 154 ATP A "H5'2" 2  
HETATM 4980  H "H4'"  . ATP B 2 .   ? -1.825  -12.032 -23.411 1.00 0.00  ? 154 ATP A "H4'"  2  
HETATM 4981  H "H3'"  . ATP B 2 .   ? -3.498  -13.599 -24.983 1.00 0.00  ? 154 ATP A "H3'"  2  
HETATM 4982  H "H2'"  . ATP B 2 .   ? -4.870  -14.431 -23.202 1.00 0.00  ? 154 ATP A "H2'"  2  
HETATM 4983  H "HO2'" . ATP B 2 .   ? -3.765  -16.300 -23.789 1.00 0.00  ? 154 ATP A "HO2'" 2  
HETATM 4984  H "H1'"  . ATP B 2 .   ? -2.398  -14.212 -21.376 1.00 0.00  ? 154 ATP A "H1'"  2  
HETATM 4985  H H8     . ATP B 2 .   ? -6.135  -14.759 -21.587 1.00 0.00  ? 154 ATP A H8     2  
HETATM 4986  H HN61   . ATP B 2 .   ? -7.102  -14.761 -16.818 1.00 0.00  ? 154 ATP A HN61   2  
HETATM 4987  H HN62   . ATP B 2 .   ? -6.154  -14.361 -15.405 1.00 0.00  ? 154 ATP A HN62   2  
HETATM 4988  H H2     . ATP B 2 .   ? -2.089  -13.150 -16.871 1.00 0.00  ? 154 ATP A H2     2  
ATOM   4989  N N      . GLY A 1 1   ? 11.594  -8.075  -8.483  1.00 0.00  ? 1   GLY A N      3  
ATOM   4990  C CA     . GLY A 1 1   ? 12.547  -8.934  -9.157  1.00 0.00  ? 1   GLY A CA     3  
ATOM   4991  C C      . GLY A 1 1   ? 13.951  -8.356  -9.042  1.00 0.00  ? 1   GLY A C      3  
ATOM   4992  O O      . GLY A 1 1   ? 14.118  -7.188  -8.698  1.00 0.00  ? 1   GLY A O      3  
ATOM   4993  H H1     . GLY A 1 1   ? 10.620  -8.343  -8.484  1.00 0.00  ? 1   GLY A H1     3  
ATOM   4994  H HA2    . GLY A 1 1   ? 12.526  -9.924  -8.701  1.00 0.00  ? 1   GLY A HA2    3  
ATOM   4995  H HA3    . GLY A 1 1   ? 12.277  -9.016  -10.210 1.00 0.00  ? 1   GLY A HA3    3  
ATOM   4996  N N      . PRO A 1 2   ? 14.961  -9.180  -9.330  1.00 0.00  ? 2   PRO A N      3  
ATOM   4997  C CA     . PRO A 1 2   ? 16.358  -8.806  -9.280  1.00 0.00  ? 2   PRO A CA     3  
ATOM   4998  C C      . PRO A 1 2   ? 16.683  -7.884  -10.447 1.00 0.00  ? 2   PRO A C      3  
ATOM   4999  O O      . PRO A 1 2   ? 17.826  -7.826  -10.895 1.00 0.00  ? 2   PRO A O      3  
ATOM   5000  C CB     . PRO A 1 2   ? 17.121  -10.124 -9.394  1.00 0.00  ? 2   PRO A CB     3  
ATOM   5001  C CG     . PRO A 1 2   ? 16.179  -10.988 -10.233 1.00 0.00  ? 2   PRO A CG     3  
ATOM   5002  C CD     . PRO A 1 2   ? 14.801  -10.560 -9.735  1.00 0.00  ? 2   PRO A CD     3  
ATOM   5003  H HA     . PRO A 1 2   ? 16.597  -8.310  -8.339  1.00 0.00  ? 2   PRO A HA     3  
ATOM   5004  H HB2    . PRO A 1 2   ? 18.097  -9.998  -9.863  1.00 0.00  ? 2   PRO A HB2    3  
ATOM   5005  H HB3    . PRO A 1 2   ? 17.223  -10.567 -8.403  1.00 0.00  ? 2   PRO A HB3    3  
ATOM   5006  H HG2    . PRO A 1 2   ? 16.283  -10.714 -11.282 1.00 0.00  ? 2   PRO A HG2    3  
ATOM   5007  H HG3    . PRO A 1 2   ? 16.358  -12.054 -10.092 1.00 0.00  ? 2   PRO A HG3    3  
ATOM   5008  H HD2    . PRO A 1 2   ? 14.054  -10.662 -10.523 1.00 0.00  ? 2   PRO A HD2    3  
ATOM   5009  H HD3    . PRO A 1 2   ? 14.519  -11.155 -8.867  1.00 0.00  ? 2   PRO A HD3    3  
ATOM   5010  N N      . LEU A 1 3   ? 15.677  -7.167  -10.938 1.00 0.00  ? 3   LEU A N      3  
ATOM   5011  C CA     . LEU A 1 3   ? 15.868  -6.250  -12.058 1.00 0.00  ? 3   LEU A CA     3  
ATOM   5012  C C      . LEU A 1 3   ? 16.376  -6.988  -13.292 1.00 0.00  ? 3   LEU A C      3  
ATOM   5013  O O      . LEU A 1 3   ? 16.506  -8.213  -13.289 1.00 0.00  ? 3   LEU A O      3  
ATOM   5014  C CB     . LEU A 1 3   ? 16.850  -5.144  -11.672 1.00 0.00  ? 3   LEU A CB     3  
ATOM   5015  C CG     . LEU A 1 3   ? 16.257  -4.014  -10.831 1.00 0.00  ? 3   LEU A CG     3  
ATOM   5016  C CD1    . LEU A 1 3   ? 16.147  -4.436  -9.373  1.00 0.00  ? 3   LEU A CD1    3  
ATOM   5017  C CD2    . LEU A 1 3   ? 17.100  -2.753  -10.965 1.00 0.00  ? 3   LEU A CD2    3  
ATOM   5018  H H      . LEU A 1 3   ? 14.785  -7.252  -10.535 1.00 0.00  ? 3   LEU A H      3  
ATOM   5019  H HA     . LEU A 1 3   ? 14.913  -5.804  -12.287 1.00 0.00  ? 3   LEU A HA     3  
ATOM   5020  H HB2    . LEU A 1 3   ? 17.661  -5.591  -11.113 1.00 0.00  ? 3   LEU A HB2    3  
ATOM   5021  H HB3    . LEU A 1 3   ? 17.254  -4.715  -12.574 1.00 0.00  ? 3   LEU A HB3    3  
ATOM   5022  H HG     . LEU A 1 3   ? 15.263  -3.792  -11.191 1.00 0.00  ? 3   LEU A HG     3  
ATOM   5023  H HD11   . LEU A 1 3   ? 15.258  -4.003  -8.939  1.00 0.00  ? 3   LEU A HD11   3  
ATOM   5024  H HD12   . LEU A 1 3   ? 17.017  -4.093  -8.833  1.00 0.00  ? 3   LEU A HD12   3  
ATOM   5025  H HD13   . LEU A 1 3   ? 16.088  -5.514  -9.314  1.00 0.00  ? 3   LEU A HD13   3  
ATOM   5026  H HD21   . LEU A 1 3   ? 16.607  -2.060  -11.631 1.00 0.00  ? 3   LEU A HD21   3  
ATOM   5027  H HD22   . LEU A 1 3   ? 18.070  -3.009  -11.365 1.00 0.00  ? 3   LEU A HD22   3  
ATOM   5028  H HD23   . LEU A 1 3   ? 17.219  -2.295  -9.993  1.00 0.00  ? 3   LEU A HD23   3  
ATOM   5029  N N      . GLY A 1 4   ? 16.663  -6.232  -14.349 1.00 0.00  ? 4   GLY A N      3  
ATOM   5030  C CA     . GLY A 1 4   ? 17.155  -6.822  -15.579 1.00 0.00  ? 4   GLY A CA     3  
ATOM   5031  C C      . GLY A 1 4   ? 16.316  -6.431  -16.779 1.00 0.00  ? 4   GLY A C      3  
ATOM   5032  O O      . GLY A 1 4   ? 15.355  -5.673  -16.648 1.00 0.00  ? 4   GLY A O      3  
ATOM   5033  H H      . GLY A 1 4   ? 16.535  -5.262  -14.291 1.00 0.00  ? 4   GLY A H      3  
ATOM   5034  H HA2    . GLY A 1 4   ? 18.170  -6.495  -15.741 1.00 0.00  ? 4   GLY A HA2    3  
ATOM   5035  H HA3    . GLY A 1 4   ? 17.143  -7.899  -15.480 1.00 0.00  ? 4   GLY A HA3    3  
ATOM   5036  N N      . SER A 1 5   ? 16.673  -6.950  -17.948 1.00 0.00  ? 5   SER A N      3  
ATOM   5037  C CA     . SER A 1 5   ? 15.939  -6.647  -19.171 1.00 0.00  ? 5   SER A CA     3  
ATOM   5038  C C      . SER A 1 5   ? 14.809  -7.650  -19.397 1.00 0.00  ? 5   SER A C      3  
ATOM   5039  O O      . SER A 1 5   ? 14.291  -7.774  -20.506 1.00 0.00  ? 5   SER A O      3  
ATOM   5040  C CB     . SER A 1 5   ? 16.882  -6.642  -20.374 1.00 0.00  ? 5   SER A CB     3  
ATOM   5041  O OG     . SER A 1 5   ? 16.468  -5.695  -21.344 1.00 0.00  ? 5   SER A OG     3  
ATOM   5042  H H      . SER A 1 5   ? 17.446  -7.550  -17.989 1.00 0.00  ? 5   SER A H      3  
ATOM   5043  H HA     . SER A 1 5   ? 15.508  -5.661  -19.061 1.00 0.00  ? 5   SER A HA     3  
ATOM   5044  H HB2    . SER A 1 5   ? 17.879  -6.389  -20.046 1.00 0.00  ? 5   SER A HB2    3  
ATOM   5045  H HB3    . SER A 1 5   ? 16.890  -7.623  -20.826 1.00 0.00  ? 5   SER A HB3    3  
ATOM   5046  H HG     . SER A 1 5   ? 15.510  -5.713  -21.424 1.00 0.00  ? 5   SER A HG     3  
ATOM   5047  N N      . MET A 1 6   ? 14.426  -8.362  -18.338 1.00 0.00  ? 6   MET A N      3  
ATOM   5048  C CA     . MET A 1 6   ? 13.358  -9.342  -18.427 1.00 0.00  ? 6   MET A CA     3  
ATOM   5049  C C      . MET A 1 6   ? 12.054  -8.678  -18.837 1.00 0.00  ? 6   MET A C      3  
ATOM   5050  O O      . MET A 1 6   ? 11.941  -7.451  -18.841 1.00 0.00  ? 6   MET A O      3  
ATOM   5051  C CB     . MET A 1 6   ? 13.177  -10.051 -17.084 1.00 0.00  ? 6   MET A CB     3  
ATOM   5052  C CG     . MET A 1 6   ? 13.080  -9.100  -15.903 1.00 0.00  ? 6   MET A CG     3  
ATOM   5053  S SD     . MET A 1 6   ? 12.064  -9.753  -14.565 1.00 0.00  ? 6   MET A SD     3  
ATOM   5054  C CE     . MET A 1 6   ? 10.477  -9.891  -15.381 1.00 0.00  ? 6   MET A CE     3  
ATOM   5055  H H      . MET A 1 6   ? 14.867  -8.221  -17.481 1.00 0.00  ? 6   MET A H      3  
ATOM   5056  H HA     . MET A 1 6   ? 13.635  -10.070 -19.176 1.00 0.00  ? 6   MET A HA     3  
ATOM   5057  H HB2    . MET A 1 6   ? 12.273  -10.640 -17.121 1.00 0.00  ? 6   MET A HB2    3  
ATOM   5058  H HB3    . MET A 1 6   ? 14.019  -10.709 -16.918 1.00 0.00  ? 6   MET A HB3    3  
ATOM   5059  H HG2    . MET A 1 6   ? 14.074  -8.914  -15.524 1.00 0.00  ? 6   MET A HG2    3  
ATOM   5060  H HG3    . MET A 1 6   ? 12.648  -8.169  -16.245 1.00 0.00  ? 6   MET A HG3    3  
ATOM   5061  H HE1    . MET A 1 6   ? 10.520  -9.395  -16.340 1.00 0.00  ? 6   MET A HE1    3  
ATOM   5062  H HE2    . MET A 1 6   ? 9.715   -9.427  -14.772 1.00 0.00  ? 6   MET A HE2    3  
ATOM   5063  H HE3    . MET A 1 6   ? 10.236  -10.934 -15.528 1.00 0.00  ? 6   MET A HE3    3  
ATOM   5064  N N      . ALA A 1 7   ? 11.071  -9.497  -19.182 1.00 0.00  ? 7   ALA A N      3  
ATOM   5065  C CA     . ALA A 1 7   ? 9.767   -8.993  -19.590 1.00 0.00  ? 7   ALA A CA     3  
ATOM   5066  C C      . ALA A 1 7   ? 9.879   -8.086  -20.806 1.00 0.00  ? 7   ALA A C      3  
ATOM   5067  O O      . ALA A 1 7   ? 10.971  -7.665  -21.187 1.00 0.00  ? 7   ALA A O      3  
ATOM   5068  C CB     . ALA A 1 7   ? 9.102   -8.251  -18.440 1.00 0.00  ? 7   ALA A CB     3  
ATOM   5069  H H      . ALA A 1 7   ? 11.227  -10.462 -19.154 1.00 0.00  ? 7   ALA A H      3  
ATOM   5070  H HA     . ALA A 1 7   ? 9.148   -9.842  -19.848 1.00 0.00  ? 7   ALA A HA     3  
ATOM   5071  H HB1    . ALA A 1 7   ? 8.259   -8.818  -18.078 1.00 0.00  ? 7   ALA A HB1    3  
ATOM   5072  H HB2    . ALA A 1 7   ? 8.762   -7.283  -18.782 1.00 0.00  ? 7   ALA A HB2    3  
ATOM   5073  H HB3    . ALA A 1 7   ? 9.814   -8.116  -17.639 1.00 0.00  ? 7   ALA A HB3    3  
ATOM   5074  N N      . LEU A 1 8   ? 8.735   -7.789  -21.403 1.00 0.00  ? 8   LEU A N      3  
ATOM   5075  C CA     . LEU A 1 8   ? 8.681   -6.926  -22.574 1.00 0.00  ? 8   LEU A CA     3  
ATOM   5076  C C      . LEU A 1 8   ? 8.047   -5.585  -22.221 1.00 0.00  ? 8   LEU A C      3  
ATOM   5077  O O      . LEU A 1 8   ? 7.103   -5.522  -21.435 1.00 0.00  ? 8   LEU A O      3  
ATOM   5078  C CB     . LEU A 1 8   ? 7.890   -7.592  -23.706 1.00 0.00  ? 8   LEU A CB     3  
ATOM   5079  C CG     . LEU A 1 8   ? 7.845   -9.124  -23.681 1.00 0.00  ? 8   LEU A CG     3  
ATOM   5080  C CD1    . LEU A 1 8   ? 6.961   -9.621  -22.546 1.00 0.00  ? 8   LEU A CD1    3  
ATOM   5081  C CD2    . LEU A 1 8   ? 7.336   -9.656  -25.010 1.00 0.00  ? 8   LEU A CD2    3  
ATOM   5082  H H      . LEU A 1 8   ? 7.903   -8.153  -21.039 1.00 0.00  ? 8   LEU A H      3  
ATOM   5083  H HA     . LEU A 1 8   ? 9.693   -6.756  -22.907 1.00 0.00  ? 8   LEU A HA     3  
ATOM   5084  H HB2    . LEU A 1 8   ? 6.878   -7.227  -23.668 1.00 0.00  ? 8   LEU A HB2    3  
ATOM   5085  H HB3    . LEU A 1 8   ? 8.328   -7.286  -24.645 1.00 0.00  ? 8   LEU A HB3    3  
ATOM   5086  H HG     . LEU A 1 8   ? 8.842   -9.509  -23.524 1.00 0.00  ? 8   LEU A HG     3  
ATOM   5087  H HD11   . LEU A 1 8   ? 6.294   -10.386 -22.913 1.00 0.00  ? 8   LEU A HD11   3  
ATOM   5088  H HD12   . LEU A 1 8   ? 6.380   -8.797  -22.161 1.00 0.00  ? 8   LEU A HD12   3  
ATOM   5089  H HD13   . LEU A 1 8   ? 7.579   -10.028 -21.755 1.00 0.00  ? 8   LEU A HD13   3  
ATOM   5090  H HD21   . LEU A 1 8   ? 7.186   -10.722 -24.936 1.00 0.00  ? 8   LEU A HD21   3  
ATOM   5091  H HD22   . LEU A 1 8   ? 8.058   -9.444  -25.783 1.00 0.00  ? 8   LEU A HD22   3  
ATOM   5092  H HD23   . LEU A 1 8   ? 6.395   -9.176  -25.250 1.00 0.00  ? 8   LEU A HD23   3  
ATOM   5093  N N      . ARG A 1 9   ? 8.570   -4.517  -22.807 1.00 0.00  ? 9   ARG A N      3  
ATOM   5094  C CA     . ARG A 1 9   ? 8.052   -3.180  -22.551 1.00 0.00  ? 9   ARG A CA     3  
ATOM   5095  C C      . ARG A 1 9   ? 6.771   -2.939  -23.343 1.00 0.00  ? 9   ARG A C      3  
ATOM   5096  O O      . ARG A 1 9   ? 6.677   -3.310  -24.513 1.00 0.00  ? 9   ARG A O      3  
ATOM   5097  C CB     . ARG A 1 9   ? 9.101   -2.127  -22.912 1.00 0.00  ? 9   ARG A CB     3  
ATOM   5098  C CG     . ARG A 1 9   ? 9.687   -1.414  -21.706 1.00 0.00  ? 9   ARG A CG     3  
ATOM   5099  C CD     . ARG A 1 9   ? 10.440  -0.158  -22.113 1.00 0.00  ? 9   ARG A CD     3  
ATOM   5100  N NE     . ARG A 1 9   ? 11.476  0.190   -21.145 1.00 0.00  ? 9   ARG A NE     3  
ATOM   5101  C CZ     . ARG A 1 9   ? 11.860  1.438   -20.880 1.00 0.00  ? 9   ARG A CZ     3  
ATOM   5102  N NH1    . ARG A 1 9   ? 11.309  2.463   -21.518 1.00 0.00  ? 9   ARG A NH1    3  
ATOM   5103  N NH2    . ARG A 1 9   ? 12.804  1.662   -19.976 1.00 0.00  ? 9   ARG A NH2    3  
ATOM   5104  H H      . ARG A 1 9   ? 9.323   -4.628  -23.425 1.00 0.00  ? 9   ARG A H      3  
ATOM   5105  H HA     . ARG A 1 9   ? 7.830   -3.107  -21.498 1.00 0.00  ? 9   ARG A HA     3  
ATOM   5106  H HB2    . ARG A 1 9   ? 9.909   -2.607  -23.447 1.00 0.00  ? 9   ARG A HB2    3  
ATOM   5107  H HB3    . ARG A 1 9   ? 8.648   -1.390  -23.554 1.00 0.00  ? 9   ARG A HB3    3  
ATOM   5108  H HG2    . ARG A 1 9   ? 8.884   -1.139  -21.038 1.00 0.00  ? 9   ARG A HG2    3  
ATOM   5109  H HG3    . ARG A 1 9   ? 10.367  -2.083  -21.202 1.00 0.00  ? 9   ARG A HG3    3  
ATOM   5110  H HD2    . ARG A 1 9   ? 10.900  -0.324  -23.077 1.00 0.00  ? 9   ARG A HD2    3  
ATOM   5111  H HD3    . ARG A 1 9   ? 9.738   0.659   -22.186 1.00 0.00  ? 9   ARG A HD3    3  
ATOM   5112  H HE     . ARG A 1 9   ? 11.908  -0.546  -20.661 1.00 0.00  ? 9   ARG A HE     3  
ATOM   5113  H HH11   . ARG A 1 9   ? 10.602  2.305   -22.204 1.00 0.00  ? 9   ARG A HH11   3  
ATOM   5114  H HH12   . ARG A 1 9   ? 11.604  3.395   -21.310 1.00 0.00  ? 9   ARG A HH12   3  
ATOM   5115  H HH21   . ARG A 1 9   ? 13.227  0.895   -19.494 1.00 0.00  ? 9   ARG A HH21   3  
ATOM   5116  H HH22   . ARG A 1 9   ? 13.090  2.598   -19.777 1.00 0.00  ? 9   ARG A HH22   3  
ATOM   5117  N N      . ALA A 1 10  ? 5.790   -2.318  -22.699 1.00 0.00  ? 10  ALA A N      3  
ATOM   5118  C CA     . ALA A 1 10  ? 4.513   -2.026  -23.342 1.00 0.00  ? 10  ALA A CA     3  
ATOM   5119  C C      . ALA A 1 10  ? 3.893   -0.759  -22.769 1.00 0.00  ? 10  ALA A C      3  
ATOM   5120  O O      . ALA A 1 10  ? 4.272   -0.306  -21.687 1.00 0.00  ? 10  ALA A O      3  
ATOM   5121  C CB     . ALA A 1 10  ? 3.556   -3.194  -23.182 1.00 0.00  ? 10  ALA A CB     3  
ATOM   5122  H H      . ALA A 1 10  ? 5.928   -2.048  -21.768 1.00 0.00  ? 10  ALA A H      3  
ATOM   5123  H HA     . ALA A 1 10  ? 4.696   -1.880  -24.396 1.00 0.00  ? 10  ALA A HA     3  
ATOM   5124  H HB1    . ALA A 1 10  ? 4.086   -4.042  -22.776 1.00 0.00  ? 10  ALA A HB1    3  
ATOM   5125  H HB2    . ALA A 1 10  ? 3.142   -3.453  -24.145 1.00 0.00  ? 10  ALA A HB2    3  
ATOM   5126  H HB3    . ALA A 1 10  ? 2.754   -2.913  -22.511 1.00 0.00  ? 10  ALA A HB3    3  
ATOM   5127  N N      . CYS A 1 11  ? 2.934   -0.192  -23.492 1.00 0.00  ? 11  CYS A N      3  
ATOM   5128  C CA     . CYS A 1 11  ? 2.266   1.019   -23.039 1.00 0.00  ? 11  CYS A CA     3  
ATOM   5129  C C      . CYS A 1 11  ? 0.884   1.165   -23.668 1.00 0.00  ? 11  CYS A C      3  
ATOM   5130  O O      . CYS A 1 11  ? 0.740   1.193   -24.890 1.00 0.00  ? 11  CYS A O      3  
ATOM   5131  C CB     . CYS A 1 11  ? 3.117   2.248   -23.367 1.00 0.00  ? 11  CYS A CB     3  
ATOM   5132  S SG     . CYS A 1 11  ? 4.441   2.570   -22.177 1.00 0.00  ? 11  CYS A SG     3  
ATOM   5133  H H      . CYS A 1 11  ? 2.670   -0.600  -24.344 1.00 0.00  ? 11  CYS A H      3  
ATOM   5134  H HA     . CYS A 1 11  ? 2.149   0.950   -21.968 1.00 0.00  ? 11  CYS A HA     3  
ATOM   5135  H HB2    . CYS A 1 11  ? 3.575   2.112   -24.334 1.00 0.00  ? 11  CYS A HB2    3  
ATOM   5136  H HB3    . CYS A 1 11  ? 2.481   3.121   -23.393 1.00 0.00  ? 11  CYS A HB3    3  
ATOM   5137  H HG     . CYS A 1 11  ? 4.320   1.975   -21.433 1.00 0.00  ? 11  CYS A HG     3  
ATOM   5138  N N      . GLY A 1 12  ? -0.123  1.280   -22.812 1.00 0.00  ? 12  GLY A N      3  
ATOM   5139  C CA     . GLY A 1 12  ? -1.489  1.448   -23.273 1.00 0.00  ? 12  GLY A CA     3  
ATOM   5140  C C      . GLY A 1 12  ? -2.036  2.814   -22.908 1.00 0.00  ? 12  GLY A C      3  
ATOM   5141  O O      . GLY A 1 12  ? -1.349  3.606   -22.261 1.00 0.00  ? 12  GLY A O      3  
ATOM   5142  H H      . GLY A 1 12  ? 0.066   1.260   -21.850 1.00 0.00  ? 12  GLY A H      3  
ATOM   5143  H HA2    . GLY A 1 12  ? -1.515  1.333   -24.347 1.00 0.00  ? 12  GLY A HA2    3  
ATOM   5144  H HA3    . GLY A 1 12  ? -2.107  0.687   -22.821 1.00 0.00  ? 12  GLY A HA3    3  
ATOM   5145  N N      . LEU A 1 13  ? -3.269  3.100   -23.315 1.00 0.00  ? 13  LEU A N      3  
ATOM   5146  C CA     . LEU A 1 13  ? -3.879  4.391   -23.016 1.00 0.00  ? 13  LEU A CA     3  
ATOM   5147  C C      . LEU A 1 13  ? -5.318  4.239   -22.529 1.00 0.00  ? 13  LEU A C      3  
ATOM   5148  O O      . LEU A 1 13  ? -6.184  3.778   -23.271 1.00 0.00  ? 13  LEU A O      3  
ATOM   5149  C CB     . LEU A 1 13  ? -3.861  5.290   -24.261 1.00 0.00  ? 13  LEU A CB     3  
ATOM   5150  C CG     . LEU A 1 13  ? -3.037  6.572   -24.139 1.00 0.00  ? 13  LEU A CG     3  
ATOM   5151  C CD1    . LEU A 1 13  ? -3.316  7.502   -25.308 1.00 0.00  ? 13  LEU A CD1    3  
ATOM   5152  C CD2    . LEU A 1 13  ? -3.330  7.279   -22.823 1.00 0.00  ? 13  LEU A CD2    3  
ATOM   5153  H H      . LEU A 1 13  ? -3.773  2.435   -23.828 1.00 0.00  ? 13  LEU A H      3  
ATOM   5154  H HA     . LEU A 1 13  ? -3.299  4.859   -22.238 1.00 0.00  ? 13  LEU A HA     3  
ATOM   5155  H HB2    . LEU A 1 13  ? -3.468  4.717   -25.086 1.00 0.00  ? 13  LEU A HB2    3  
ATOM   5156  H HB3    . LEU A 1 13  ? -4.879  5.570   -24.497 1.00 0.00  ? 13  LEU A HB3    3  
ATOM   5157  H HG     . LEU A 1 13  ? -1.992  6.318   -24.159 1.00 0.00  ? 13  LEU A HG     3  
ATOM   5158  H HD11   . LEU A 1 13  ? -3.151  8.525   -25.001 1.00 0.00  ? 13  LEU A HD11   3  
ATOM   5159  H HD12   . LEU A 1 13  ? -4.341  7.384   -25.626 1.00 0.00  ? 13  LEU A HD12   3  
ATOM   5160  H HD13   . LEU A 1 13  ? -2.656  7.261   -26.125 1.00 0.00  ? 13  LEU A HD13   3  
ATOM   5161  H HD21   . LEU A 1 13  ? -2.863  8.250   -22.828 1.00 0.00  ? 13  LEU A HD21   3  
ATOM   5162  H HD22   . LEU A 1 13  ? -2.936  6.696   -22.006 1.00 0.00  ? 13  LEU A HD22   3  
ATOM   5163  H HD23   . LEU A 1 13  ? -4.398  7.394   -22.707 1.00 0.00  ? 13  LEU A HD23   3  
ATOM   5164  N N      . ILE A 1 14  ? -5.579  4.671   -21.296 1.00 0.00  ? 14  ILE A N      3  
ATOM   5165  C CA     . ILE A 1 14  ? -6.930  4.618   -20.763 1.00 0.00  ? 14  ILE A CA     3  
ATOM   5166  C C      . ILE A 1 14  ? -7.735  5.735   -21.393 1.00 0.00  ? 14  ILE A C      3  
ATOM   5167  O O      . ILE A 1 14  ? -7.761  6.858   -20.894 1.00 0.00  ? 14  ILE A O      3  
ATOM   5168  C CB     . ILE A 1 14  ? -6.974  4.789   -19.228 1.00 0.00  ? 14  ILE A CB     3  
ATOM   5169  C CG1    . ILE A 1 14  ? -5.883  3.956   -18.557 1.00 0.00  ? 14  ILE A CG1    3  
ATOM   5170  C CG2    . ILE A 1 14  ? -8.347  4.410   -18.695 1.00 0.00  ? 14  ILE A CG2    3  
ATOM   5171  C CD1    . ILE A 1 14  ? -6.102  2.463   -18.671 1.00 0.00  ? 14  ILE A CD1    3  
ATOM   5172  H H      . ILE A 1 14  ? -4.861  5.065   -20.759 1.00 0.00  ? 14  ILE A H      3  
ATOM   5173  H HA     . ILE A 1 14  ? -7.368  3.665   -21.024 1.00 0.00  ? 14  ILE A HA     3  
ATOM   5174  H HB     . ILE A 1 14  ? -6.806  5.830   -19.004 1.00 0.00  ? 14  ILE A HB     3  
ATOM   5175  H HG12   . ILE A 1 14  ? -4.933  4.187   -19.013 1.00 0.00  ? 14  ILE A HG12   3  
ATOM   5176  H HG13   . ILE A 1 14  ? -5.843  4.207   -17.507 1.00 0.00  ? 14  ILE A HG13   3  
ATOM   5177  H HG21   . ILE A 1 14  ? -8.367  4.550   -17.623 1.00 0.00  ? 14  ILE A HG21   3  
ATOM   5178  H HG22   . ILE A 1 14  ? -8.551  3.374   -18.926 1.00 0.00  ? 14  ILE A HG22   3  
ATOM   5179  H HG23   . ILE A 1 14  ? -9.096  5.037   -19.153 1.00 0.00  ? 14  ILE A HG23   3  
ATOM   5180  H HD11   . ILE A 1 14  ? -5.773  2.124   -19.642 1.00 0.00  ? 14  ILE A HD11   3  
ATOM   5181  H HD12   . ILE A 1 14  ? -7.152  2.243   -18.548 1.00 0.00  ? 14  ILE A HD12   3  
ATOM   5182  H HD13   . ILE A 1 14  ? -5.535  1.957   -17.903 1.00 0.00  ? 14  ILE A HD13   3  
ATOM   5183  N N      . ILE A 1 15  ? -8.376  5.426   -22.506 1.00 0.00  ? 15  ILE A N      3  
ATOM   5184  C CA     . ILE A 1 15  ? -9.161  6.412   -23.224 1.00 0.00  ? 15  ILE A CA     3  
ATOM   5185  C C      . ILE A 1 15  ? -10.561 6.505   -22.649 1.00 0.00  ? 15  ILE A C      3  
ATOM   5186  O O      . ILE A 1 15  ? -11.174 5.492   -22.328 1.00 0.00  ? 15  ILE A O      3  
ATOM   5187  C CB     . ILE A 1 15  ? -9.218  6.072   -24.717 1.00 0.00  ? 15  ILE A CB     3  
ATOM   5188  C CG1    . ILE A 1 15  ? -7.798  5.888   -25.248 1.00 0.00  ? 15  ILE A CG1    3  
ATOM   5189  C CG2    . ILE A 1 15  ? -9.945  7.158   -25.493 1.00 0.00  ? 15  ILE A CG2    3  
ATOM   5190  C CD1    . ILE A 1 15  ? -7.730  5.114   -26.541 1.00 0.00  ? 15  ILE A CD1    3  
ATOM   5191  H H      . ILE A 1 15  ? -8.306  4.517   -22.863 1.00 0.00  ? 15  ILE A H      3  
ATOM   5192  H HA     . ILE A 1 15  ? -8.673  7.367   -23.111 1.00 0.00  ? 15  ILE A HA     3  
ATOM   5193  H HB     . ILE A 1 15  ? -9.762  5.149   -24.837 1.00 0.00  ? 15  ILE A HB     3  
ATOM   5194  H HG12   . ILE A 1 15  ? -7.352  6.859   -25.412 1.00 0.00  ? 15  ILE A HG12   3  
ATOM   5195  H HG13   . ILE A 1 15  ? -7.215  5.353   -24.511 1.00 0.00  ? 15  ILE A HG13   3  
ATOM   5196  H HG21   . ILE A 1 15  ? -10.109 6.826   -26.506 1.00 0.00  ? 15  ILE A HG21   3  
ATOM   5197  H HG22   . ILE A 1 15  ? -9.348  8.059   -25.498 1.00 0.00  ? 15  ILE A HG22   3  
ATOM   5198  H HG23   . ILE A 1 15  ? -10.896 7.360   -25.022 1.00 0.00  ? 15  ILE A HG23   3  
ATOM   5199  H HD11   . ILE A 1 15  ? -7.719  5.802   -27.372 1.00 0.00  ? 15  ILE A HD11   3  
ATOM   5200  H HD12   . ILE A 1 15  ? -8.591  4.466   -26.619 1.00 0.00  ? 15  ILE A HD12   3  
ATOM   5201  H HD13   . ILE A 1 15  ? -6.826  4.519   -26.553 1.00 0.00  ? 15  ILE A HD13   3  
ATOM   5202  N N      . PHE A 1 16  ? -11.046 7.730   -22.491 1.00 0.00  ? 16  PHE A N      3  
ATOM   5203  C CA     . PHE A 1 16  ? -12.360 7.961   -21.914 1.00 0.00  ? 16  PHE A CA     3  
ATOM   5204  C C      . PHE A 1 16  ? -13.042 9.182   -22.526 1.00 0.00  ? 16  PHE A C      3  
ATOM   5205  O O      . PHE A 1 16  ? -12.502 10.286  -22.487 1.00 0.00  ? 16  PHE A O      3  
ATOM   5206  C CB     . PHE A 1 16  ? -12.214 8.154   -20.406 1.00 0.00  ? 16  PHE A CB     3  
ATOM   5207  C CG     . PHE A 1 16  ? -11.427 9.377   -20.026 1.00 0.00  ? 16  PHE A CG     3  
ATOM   5208  C CD1    . PHE A 1 16  ? -10.045 9.326   -19.925 1.00 0.00  ? 16  PHE A CD1    3  
ATOM   5209  C CD2    . PHE A 1 16  ? -12.069 10.578  -19.771 1.00 0.00  ? 16  PHE A CD2    3  
ATOM   5210  C CE1    . PHE A 1 16  ? -9.318  10.449  -19.581 1.00 0.00  ? 16  PHE A CE1    3  
ATOM   5211  C CE2    . PHE A 1 16  ? -11.348 11.706  -19.425 1.00 0.00  ? 16  PHE A CE2    3  
ATOM   5212  C CZ     . PHE A 1 16  ? -9.971  11.641  -19.331 1.00 0.00  ? 16  PHE A CZ     3  
ATOM   5213  H H      . PHE A 1 16  ? -10.496 8.499   -22.745 1.00 0.00  ? 16  PHE A H      3  
ATOM   5214  H HA     . PHE A 1 16  ? -12.960 7.089   -22.099 1.00 0.00  ? 16  PHE A HA     3  
ATOM   5215  H HB2    . PHE A 1 16  ? -13.188 8.240   -19.969 1.00 0.00  ? 16  PHE A HB2    3  
ATOM   5216  H HB3    . PHE A 1 16  ? -11.713 7.296   -19.989 1.00 0.00  ? 16  PHE A HB3    3  
ATOM   5217  H HD1    . PHE A 1 16  ? -9.533  8.395   -20.122 1.00 0.00  ? 16  PHE A HD1    3  
ATOM   5218  H HD2    . PHE A 1 16  ? -13.144 10.628  -19.845 1.00 0.00  ? 16  PHE A HD2    3  
ATOM   5219  H HE1    . PHE A 1 16  ? -8.240  10.394  -19.501 1.00 0.00  ? 16  PHE A HE1    3  
ATOM   5220  H HE2    . PHE A 1 16  ? -11.860 12.636  -19.231 1.00 0.00  ? 16  PHE A HE2    3  
ATOM   5221  H HZ     . PHE A 1 16  ? -9.405  12.522  -19.063 1.00 0.00  ? 16  PHE A HZ     3  
ATOM   5222  N N      . ARG A 1 17  ? -14.243 8.987   -23.066 1.00 0.00  ? 17  ARG A N      3  
ATOM   5223  C CA     . ARG A 1 17  ? -14.992 10.090  -23.659 1.00 0.00  ? 17  ARG A CA     3  
ATOM   5224  C C      . ARG A 1 17  ? -15.688 10.895  -22.566 1.00 0.00  ? 17  ARG A C      3  
ATOM   5225  O O      . ARG A 1 17  ? -16.593 10.398  -21.895 1.00 0.00  ? 17  ARG A O      3  
ATOM   5226  C CB     . ARG A 1 17  ? -16.025 9.567   -24.659 1.00 0.00  ? 17  ARG A CB     3  
ATOM   5227  C CG     . ARG A 1 17  ? -15.415 9.023   -25.940 1.00 0.00  ? 17  ARG A CG     3  
ATOM   5228  C CD     . ARG A 1 17  ? -16.242 9.396   -27.161 1.00 0.00  ? 17  ARG A CD     3  
ATOM   5229  N NE     . ARG A 1 17  ? -16.833 8.222   -27.799 1.00 0.00  ? 17  ARG A NE     3  
ATOM   5230  C CZ     . ARG A 1 17  ? -17.890 7.572   -27.322 1.00 0.00  ? 17  ARG A CZ     3  
ATOM   5231  N NH1    . ARG A 1 17  ? -18.477 7.979   -26.204 1.00 0.00  ? 17  ARG A NH1    3  
ATOM   5232  N NH2    . ARG A 1 17  ? -18.357 6.509   -27.963 1.00 0.00  ? 17  ARG A NH2    3  
ATOM   5233  H H      . ARG A 1 17  ? -14.635 8.090   -23.055 1.00 0.00  ? 17  ARG A H      3  
ATOM   5234  H HA     . ARG A 1 17  ? -14.293 10.732  -24.173 1.00 0.00  ? 17  ARG A HA     3  
ATOM   5235  H HB2    . ARG A 1 17  ? -16.591 8.774   -24.192 1.00 0.00  ? 17  ARG A HB2    3  
ATOM   5236  H HB3    . ARG A 1 17  ? -16.698 10.373  -24.918 1.00 0.00  ? 17  ARG A HB3    3  
ATOM   5237  H HG2    . ARG A 1 17  ? -14.421 9.426   -26.054 1.00 0.00  ? 17  ARG A HG2    3  
ATOM   5238  H HG3    . ARG A 1 17  ? -15.362 7.949   -25.869 1.00 0.00  ? 17  ARG A HG3    3  
ATOM   5239  H HD2    . ARG A 1 17  ? -17.033 10.064  -26.857 1.00 0.00  ? 17  ARG A HD2    3  
ATOM   5240  H HD3    . ARG A 1 17  ? -15.603 9.897   -27.874 1.00 0.00  ? 17  ARG A HD3    3  
ATOM   5241  H HE     . ARG A 1 17  ? -16.417 7.898   -28.626 1.00 0.00  ? 17  ARG A HE     3  
ATOM   5242  H HH11   . ARG A 1 17  ? -18.124 8.775   -25.716 1.00 0.00  ? 17  ARG A HH11   3  
ATOM   5243  H HH12   . ARG A 1 17  ? -19.273 7.489   -25.852 1.00 0.00  ? 17  ARG A HH12   3  
ATOM   5244  H HH21   . ARG A 1 17  ? -17.914 6.196   -28.802 1.00 0.00  ? 17  ARG A HH21   3  
ATOM   5245  H HH22   . ARG A 1 17  ? -19.155 6.022   -27.609 1.00 0.00  ? 17  ARG A HH22   3  
ATOM   5246  N N      . ARG A 1 18  ? -15.255 12.137  -22.383 1.00 0.00  ? 18  ARG A N      3  
ATOM   5247  C CA     . ARG A 1 18  ? -15.827 13.005  -21.361 1.00 0.00  ? 18  ARG A CA     3  
ATOM   5248  C C      . ARG A 1 18  ? -16.931 13.890  -21.935 1.00 0.00  ? 18  ARG A C      3  
ATOM   5249  O O      . ARG A 1 18  ? -16.686 14.717  -22.813 1.00 0.00  ? 18  ARG A O      3  
ATOM   5250  C CB     . ARG A 1 18  ? -14.729 13.866  -20.734 1.00 0.00  ? 18  ARG A CB     3  
ATOM   5251  C CG     . ARG A 1 18  ? -15.224 14.772  -19.619 1.00 0.00  ? 18  ARG A CG     3  
ATOM   5252  C CD     . ARG A 1 18  ? -14.225 14.848  -18.478 1.00 0.00  ? 18  ARG A CD     3  
ATOM   5253  N NE     . ARG A 1 18  ? -13.062 15.663  -18.825 1.00 0.00  ? 18  ARG A NE     3  
ATOM   5254  C CZ     . ARG A 1 18  ? -11.850 15.494  -18.304 1.00 0.00  ? 18  ARG A CZ     3  
ATOM   5255  N NH1    . ARG A 1 18  ? -11.629 14.541  -17.408 1.00 0.00  ? 18  ARG A NH1    3  
ATOM   5256  N NH2    . ARG A 1 18  ? -10.853 16.283  -18.682 1.00 0.00  ? 18  ARG A NH2    3  
ATOM   5257  H H      . ARG A 1 18  ? -14.525 12.474  -22.944 1.00 0.00  ? 18  ARG A H      3  
ATOM   5258  H HA     . ARG A 1 18  ? -16.254 12.375  -20.596 1.00 0.00  ? 18  ARG A HA     3  
ATOM   5259  H HB2    . ARG A 1 18  ? -13.969 13.216  -20.327 1.00 0.00  ? 18  ARG A HB2    3  
ATOM   5260  H HB3    . ARG A 1 18  ? -14.288 14.484  -21.502 1.00 0.00  ? 18  ARG A HB3    3  
ATOM   5261  H HG2    . ARG A 1 18  ? -15.377 15.764  -20.016 1.00 0.00  ? 18  ARG A HG2    3  
ATOM   5262  H HG3    . ARG A 1 18  ? -16.159 14.385  -19.242 1.00 0.00  ? 18  ARG A HG3    3  
ATOM   5263  H HD2    . ARG A 1 18  ? -14.713 15.281  -17.617 1.00 0.00  ? 18  ARG A HD2    3  
ATOM   5264  H HD3    . ARG A 1 18  ? -13.895 13.848  -18.239 1.00 0.00  ? 18  ARG A HD3    3  
ATOM   5265  H HE     . ARG A 1 18  ? -13.192 16.376  -19.484 1.00 0.00  ? 18  ARG A HE     3  
ATOM   5266  H HH11   . ARG A 1 18  ? -12.374 13.944  -17.117 1.00 0.00  ? 18  ARG A HH11   3  
ATOM   5267  H HH12   . ARG A 1 18  ? -10.713 14.420  -17.021 1.00 0.00  ? 18  ARG A HH12   3  
ATOM   5268  H HH21   . ARG A 1 18  ? -11.014 17.002  -19.357 1.00 0.00  ? 18  ARG A HH21   3  
ATOM   5269  H HH22   . ARG A 1 18  ? -9.940  16.161  -18.292 1.00 0.00  ? 18  ARG A HH22   3  
ATOM   5270  N N      . CYS A 1 19  ? -18.148 13.712  -21.429 1.00 0.00  ? 19  CYS A N      3  
ATOM   5271  C CA     . CYS A 1 19  ? -19.293 14.495  -21.884 1.00 0.00  ? 19  CYS A CA     3  
ATOM   5272  C C      . CYS A 1 19  ? -19.311 15.871  -21.226 1.00 0.00  ? 19  CYS A C      3  
ATOM   5273  O O      . CYS A 1 19  ? -18.679 16.081  -20.190 1.00 0.00  ? 19  CYS A O      3  
ATOM   5274  C CB     . CYS A 1 19  ? -20.596 13.752  -21.584 1.00 0.00  ? 19  CYS A CB     3  
ATOM   5275  S SG     . CYS A 1 19  ? -21.716 13.624  -22.997 1.00 0.00  ? 19  CYS A SG     3  
ATOM   5276  H H      . CYS A 1 19  ? -18.281 13.038  -20.728 1.00 0.00  ? 19  CYS A H      3  
ATOM   5277  H HA     . CYS A 1 19  ? -19.201 14.620  -22.954 1.00 0.00  ? 19  CYS A HA     3  
ATOM   5278  H HB2    . CYS A 1 19  ? -20.366 12.750  -21.255 1.00 0.00  ? 19  CYS A HB2    3  
ATOM   5279  H HB3    . CYS A 1 19  ? -21.122 14.270  -20.792 1.00 0.00  ? 19  CYS A HB3    3  
ATOM   5280  H HG     . CYS A 1 19  ? -21.367 12.954  -23.588 1.00 0.00  ? 19  CYS A HG     3  
ATOM   5281  N N      . LEU A 1 20  ? -20.036 16.807  -21.833 1.00 0.00  ? 20  LEU A N      3  
ATOM   5282  C CA     . LEU A 1 20  ? -20.133 18.162  -21.302 1.00 0.00  ? 20  LEU A CA     3  
ATOM   5283  C C      . LEU A 1 20  ? -20.707 18.156  -19.886 1.00 0.00  ? 20  LEU A C      3  
ATOM   5284  O O      . LEU A 1 20  ? -19.963 18.228  -18.908 1.00 0.00  ? 20  LEU A O      3  
ATOM   5285  C CB     . LEU A 1 20  ? -20.990 19.037  -22.225 1.00 0.00  ? 20  LEU A CB     3  
ATOM   5286  C CG     . LEU A 1 20  ? -20.644 18.945  -23.711 1.00 0.00  ? 20  LEU A CG     3  
ATOM   5287  C CD1    . LEU A 1 20  ? -21.591 19.804  -24.531 1.00 0.00  ? 20  LEU A CD1    3  
ATOM   5288  C CD2    . LEU A 1 20  ? -19.198 19.357  -23.954 1.00 0.00  ? 20  LEU A CD2    3  
ATOM   5289  H H      . LEU A 1 20  ? -20.517 16.578  -22.656 1.00 0.00  ? 20  LEU A H      3  
ATOM   5290  H HA     . LEU A 1 20  ? -19.133 18.570  -21.265 1.00 0.00  ? 20  LEU A HA     3  
ATOM   5291  H HB2    . LEU A 1 20  ? -22.024 18.756  -22.101 1.00 0.00  ? 20  LEU A HB2    3  
ATOM   5292  H HB3    . LEU A 1 20  ? -20.875 20.066  -21.916 1.00 0.00  ? 20  LEU A HB3    3  
ATOM   5293  H HG     . LEU A 1 20  ? -20.758 17.922  -24.036 1.00 0.00  ? 20  LEU A HG     3  
ATOM   5294  H HD11   . LEU A 1 20  ? -21.414 19.634  -25.582 1.00 0.00  ? 20  LEU A HD11   3  
ATOM   5295  H HD12   . LEU A 1 20  ? -21.423 20.846  -24.301 1.00 0.00  ? 20  LEU A HD12   3  
ATOM   5296  H HD13   . LEU A 1 20  ? -22.611 19.543  -24.290 1.00 0.00  ? 20  LEU A HD13   3  
ATOM   5297  H HD21   . LEU A 1 20  ? -18.667 19.386  -23.015 1.00 0.00  ? 20  LEU A HD21   3  
ATOM   5298  H HD22   . LEU A 1 20  ? -19.173 20.335  -24.412 1.00 0.00  ? 20  LEU A HD22   3  
ATOM   5299  H HD23   . LEU A 1 20  ? -18.726 18.641  -24.611 1.00 0.00  ? 20  LEU A HD23   3  
ATOM   5300  N N      . ILE A 1 21  ? -22.032 18.063  -19.775 1.00 0.00  ? 21  ILE A N      3  
ATOM   5301  C CA     . ILE A 1 21  ? -22.687 18.039  -18.470 1.00 0.00  ? 21  ILE A CA     3  
ATOM   5302  C C      . ILE A 1 21  ? -23.300 16.667  -18.185 1.00 0.00  ? 21  ILE A C      3  
ATOM   5303  O O      . ILE A 1 21  ? -23.768 15.987  -19.098 1.00 0.00  ? 21  ILE A O      3  
ATOM   5304  C CB     . ILE A 1 21  ? -23.785 19.119  -18.356 1.00 0.00  ? 21  ILE A CB     3  
ATOM   5305  C CG1    . ILE A 1 21  ? -24.795 18.990  -19.500 1.00 0.00  ? 21  ILE A CG1    3  
ATOM   5306  C CG2    . ILE A 1 21  ? -23.164 20.508  -18.350 1.00 0.00  ? 21  ILE A CG2    3  
ATOM   5307  C CD1    . ILE A 1 21  ? -25.806 17.885  -19.293 1.00 0.00  ? 21  ILE A CD1    3  
ATOM   5308  H H      . ILE A 1 21  ? -22.575 17.998  -20.585 1.00 0.00  ? 21  ILE A H      3  
ATOM   5309  H HA     . ILE A 1 21  ? -21.935 18.245  -17.724 1.00 0.00  ? 21  ILE A HA     3  
ATOM   5310  H HB     . ILE A 1 21  ? -24.297 18.979  -17.416 1.00 0.00  ? 21  ILE A HB     3  
ATOM   5311  H HG12   . ILE A 1 21  ? -25.335 19.919  -19.601 1.00 0.00  ? 21  ILE A HG12   3  
ATOM   5312  H HG13   . ILE A 1 21  ? -24.263 18.787  -20.418 1.00 0.00  ? 21  ILE A HG13   3  
ATOM   5313  H HG21   . ILE A 1 21  ? -23.828 21.204  -18.841 1.00 0.00  ? 21  ILE A HG21   3  
ATOM   5314  H HG22   . ILE A 1 21  ? -22.218 20.482  -18.873 1.00 0.00  ? 21  ILE A HG22   3  
ATOM   5315  H HG23   . ILE A 1 21  ? -23.000 20.826  -17.331 1.00 0.00  ? 21  ILE A HG23   3  
ATOM   5316  H HD11   . ILE A 1 21  ? -25.817 17.592  -18.254 1.00 0.00  ? 21  ILE A HD11   3  
ATOM   5317  H HD12   . ILE A 1 21  ? -25.536 17.037  -19.902 1.00 0.00  ? 21  ILE A HD12   3  
ATOM   5318  H HD13   . ILE A 1 21  ? -26.786 18.235  -19.579 1.00 0.00  ? 21  ILE A HD13   3  
ATOM   5319  N N      . PRO A 1 22  ? -23.300 16.236  -16.908 1.00 0.00  ? 22  PRO A N      3  
ATOM   5320  C CA     . PRO A 1 22  ? -23.848 14.936  -16.505 1.00 0.00  ? 22  PRO A CA     3  
ATOM   5321  C C      . PRO A 1 22  ? -25.373 14.910  -16.528 1.00 0.00  ? 22  PRO A C      3  
ATOM   5322  O O      . PRO A 1 22  ? -26.024 15.954  -16.473 1.00 0.00  ? 22  PRO A O      3  
ATOM   5323  C CB     . PRO A 1 22  ? -23.338 14.750  -15.067 1.00 0.00  ? 22  PRO A CB     3  
ATOM   5324  C CG     . PRO A 1 22  ? -22.368 15.860  -14.826 1.00 0.00  ? 22  PRO A CG     3  
ATOM   5325  C CD     . PRO A 1 22  ? -22.759 16.967  -15.757 1.00 0.00  ? 22  PRO A CD     3  
ATOM   5326  H HA     . PRO A 1 22  ? -23.470 14.139  -17.126 1.00 0.00  ? 22  PRO A HA     3  
ATOM   5327  H HB2    . PRO A 1 22  ? -24.171 14.803  -14.380 1.00 0.00  ? 22  PRO A HB2    3  
ATOM   5328  H HB3    . PRO A 1 22  ? -22.858 13.786  -14.977 1.00 0.00  ? 22  PRO A HB3    3  
ATOM   5329  H HG2    . PRO A 1 22  ? -22.437 16.193  -13.802 1.00 0.00  ? 22  PRO A HG2    3  
ATOM   5330  H HG3    . PRO A 1 22  ? -21.366 15.524  -15.046 1.00 0.00  ? 22  PRO A HG3    3  
ATOM   5331  H HD2    . PRO A 1 22  ? -23.515 17.595  -15.307 1.00 0.00  ? 22  PRO A HD2    3  
ATOM   5332  H HD3    . PRO A 1 22  ? -21.897 17.552  -16.037 1.00 0.00  ? 22  PRO A HD3    3  
ATOM   5333  N N      . LYS A 1 23  ? -25.938 13.708  -16.601 1.00 0.00  ? 23  LYS A N      3  
ATOM   5334  C CA     . LYS A 1 23  ? -27.386 13.540  -16.624 1.00 0.00  ? 23  LYS A CA     3  
ATOM   5335  C C      . LYS A 1 23  ? -27.876 12.906  -15.325 1.00 0.00  ? 23  LYS A C      3  
ATOM   5336  O O      . LYS A 1 23  ? -28.385 13.592  -14.439 1.00 0.00  ? 23  LYS A O      3  
ATOM   5337  C CB     . LYS A 1 23  ? -27.806 12.682  -17.820 1.00 0.00  ? 23  LYS A CB     3  
ATOM   5338  C CG     . LYS A 1 23  ? -28.159 13.493  -19.057 1.00 0.00  ? 23  LYS A CG     3  
ATOM   5339  C CD     . LYS A 1 23  ? -26.990 13.565  -20.027 1.00 0.00  ? 23  LYS A CD     3  
ATOM   5340  C CE     . LYS A 1 23  ? -26.682 14.997  -20.431 1.00 0.00  ? 23  LYS A CE     3  
ATOM   5341  N NZ     . LYS A 1 23  ? -27.045 15.269  -21.847 1.00 0.00  ? 23  LYS A NZ     3  
ATOM   5342  H H      . LYS A 1 23  ? -25.366 12.913  -16.637 1.00 0.00  ? 23  LYS A H      3  
ATOM   5343  H HA     . LYS A 1 23  ? -27.830 14.517  -16.719 1.00 0.00  ? 23  LYS A HA     3  
ATOM   5344  H HB2    . LYS A 1 23  ? -26.993 12.017  -18.072 1.00 0.00  ? 23  LYS A HB2    3  
ATOM   5345  H HB3    . LYS A 1 23  ? -28.668 12.093  -17.543 1.00 0.00  ? 23  LYS A HB3    3  
ATOM   5346  H HG2    . LYS A 1 23  ? -28.997 13.028  -19.551 1.00 0.00  ? 23  LYS A HG2    3  
ATOM   5347  H HG3    . LYS A 1 23  ? -28.428 14.494  -18.752 1.00 0.00  ? 23  LYS A HG3    3  
ATOM   5348  H HD2    . LYS A 1 23  ? -26.116 13.143  -19.556 1.00 0.00  ? 23  LYS A HD2    3  
ATOM   5349  H HD3    . LYS A 1 23  ? -27.234 12.998  -20.912 1.00 0.00  ? 23  LYS A HD3    3  
ATOM   5350  H HE2    . LYS A 1 23  ? -27.235 15.668  -19.791 1.00 0.00  ? 23  LYS A HE2    3  
ATOM   5351  H HE3    . LYS A 1 23  ? -25.623 15.169  -20.301 1.00 0.00  ? 23  LYS A HE3    3  
ATOM   5352  H HZ1    . LYS A 1 23  ? -27.491 16.208  -21.926 1.00 0.00  ? 23  LYS A HZ1    3  
ATOM   5353  H HZ2    . LYS A 1 23  ? -27.713 14.550  -22.190 1.00 0.00  ? 23  LYS A HZ2    3  
ATOM   5354  H HZ3    . LYS A 1 23  ? -26.195 15.250  -22.445 1.00 0.00  ? 23  LYS A HZ3    3  
ATOM   5355  N N      . VAL A 1 24  ? -27.712 11.591  -15.220 1.00 0.00  ? 24  VAL A N      3  
ATOM   5356  C CA     . VAL A 1 24  ? -28.132 10.859  -14.029 1.00 0.00  ? 24  VAL A CA     3  
ATOM   5357  C C      . VAL A 1 24  ? -26.933 10.367  -13.220 1.00 0.00  ? 24  VAL A C      3  
ATOM   5358  O O      . VAL A 1 24  ? -27.100 9.721   -12.185 1.00 0.00  ? 24  VAL A O      3  
ATOM   5359  C CB     . VAL A 1 24  ? -29.025 9.656   -14.392 1.00 0.00  ? 24  VAL A CB     3  
ATOM   5360  C CG1    . VAL A 1 24  ? -29.648 9.057   -13.139 1.00 0.00  ? 24  VAL A CG1    3  
ATOM   5361  C CG2    . VAL A 1 24  ? -30.098 10.064  -15.389 1.00 0.00  ? 24  VAL A CG2    3  
ATOM   5362  H H      . VAL A 1 24  ? -27.296 11.103  -15.960 1.00 0.00  ? 24  VAL A H      3  
ATOM   5363  H HA     . VAL A 1 24  ? -28.710 11.533  -13.415 1.00 0.00  ? 24  VAL A HA     3  
ATOM   5364  H HB     . VAL A 1 24  ? -28.406 8.899   -14.851 1.00 0.00  ? 24  VAL A HB     3  
ATOM   5365  H HG11   . VAL A 1 24  ? -30.548 8.523   -13.404 1.00 0.00  ? 24  VAL A HG11   3  
ATOM   5366  H HG12   . VAL A 1 24  ? -29.892 9.850   -12.447 1.00 0.00  ? 24  VAL A HG12   3  
ATOM   5367  H HG13   . VAL A 1 24  ? -28.948 8.378   -12.676 1.00 0.00  ? 24  VAL A HG13   3  
ATOM   5368  H HG21   . VAL A 1 24  ? -29.649 10.642  -16.183 1.00 0.00  ? 24  VAL A HG21   3  
ATOM   5369  H HG22   . VAL A 1 24  ? -30.846 10.660  -14.888 1.00 0.00  ? 24  VAL A HG22   3  
ATOM   5370  H HG23   . VAL A 1 24  ? -30.559 9.181   -15.805 1.00 0.00  ? 24  VAL A HG23   3  
ATOM   5371  N N      . ASP A 1 25  ? -25.726 10.673  -13.692 1.00 0.00  ? 25  ASP A N      3  
ATOM   5372  C CA     . ASP A 1 25  ? -24.510 10.260  -13.005 1.00 0.00  ? 25  ASP A CA     3  
ATOM   5373  C C      . ASP A 1 25  ? -24.390 8.737   -12.971 1.00 0.00  ? 25  ASP A C      3  
ATOM   5374  O O      . ASP A 1 25  ? -24.107 8.147   -11.930 1.00 0.00  ? 25  ASP A O      3  
ATOM   5375  C CB     . ASP A 1 25  ? -24.482 10.824  -11.582 1.00 0.00  ? 25  ASP A CB     3  
ATOM   5376  C CG     . ASP A 1 25  ? -23.177 11.528  -11.267 1.00 0.00  ? 25  ASP A CG     3  
ATOM   5377  O OD1    . ASP A 1 25  ? -22.124 10.855  -11.270 1.00 0.00  ? 25  ASP A OD1    3  
ATOM   5378  O OD2    . ASP A 1 25  ? -23.206 12.752  -11.021 1.00 0.00  ? 25  ASP A OD2    3  
ATOM   5379  H H      . ASP A 1 25  ? -25.652 11.192  -14.520 1.00 0.00  ? 25  ASP A H      3  
ATOM   5380  H HA     . ASP A 1 25  ? -23.670 10.659  -13.554 1.00 0.00  ? 25  ASP A HA     3  
ATOM   5381  H HB2    . ASP A 1 25  ? -25.287 11.534  -11.468 1.00 0.00  ? 25  ASP A HB2    3  
ATOM   5382  H HB3    . ASP A 1 25  ? -24.615 10.019  -10.876 1.00 0.00  ? 25  ASP A HB3    3  
ATOM   5383  H HD2    . ASP A 1 25  ? -22.345 13.132  -10.831 1.00 0.00  ? 25  ASP A HD2    3  
ATOM   5384  N N      . ASN A 1 26  ? -24.605 8.112   -14.123 1.00 0.00  ? 26  ASN A N      3  
ATOM   5385  C CA     . ASN A 1 26  ? -24.519 6.658   -14.230 1.00 0.00  ? 26  ASN A CA     3  
ATOM   5386  C C      . ASN A 1 26  ? -23.356 6.254   -15.125 1.00 0.00  ? 26  ASN A C      3  
ATOM   5387  O O      . ASN A 1 26  ? -22.513 5.443   -14.744 1.00 0.00  ? 26  ASN A O      3  
ATOM   5388  C CB     . ASN A 1 26  ? -25.824 6.078   -14.775 1.00 0.00  ? 26  ASN A CB     3  
ATOM   5389  C CG     . ASN A 1 26  ? -26.197 6.645   -16.131 1.00 0.00  ? 26  ASN A CG     3  
ATOM   5390  O OD1    . ASN A 1 26  ? -26.114 5.956   -17.149 1.00 0.00  ? 26  ASN A OD1    3  
ATOM   5391  N ND2    . ASN A 1 26  ? -26.604 7.908   -16.154 1.00 0.00  ? 26  ASN A ND2    3  
ATOM   5392  H H      . ASN A 1 26  ? -24.822 8.639   -14.919 1.00 0.00  ? 26  ASN A H      3  
ATOM   5393  H HA     . ASN A 1 26  ? -24.345 6.266   -13.242 1.00 0.00  ? 26  ASN A HA     3  
ATOM   5394  H HB2    . ASN A 1 26  ? -25.715 5.010   -14.874 1.00 0.00  ? 26  ASN A HB2    3  
ATOM   5395  H HB3    . ASN A 1 26  ? -26.624 6.293   -14.081 1.00 0.00  ? 26  ASN A HB3    3  
ATOM   5396  H HD21   . ASN A 1 26  ? -26.636 8.400   -15.308 1.00 0.00  ? 26  ASN A HD21   3  
ATOM   5397  H HD22   . ASN A 1 26  ? -26.856 8.297   -17.018 1.00 0.00  ? 26  ASN A HD22   3  
ATOM   5398  N N      . ASN A 1 27  ? -23.318 6.835   -16.315 1.00 0.00  ? 27  ASN A N      3  
ATOM   5399  C CA     . ASN A 1 27  ? -22.259 6.555   -17.274 1.00 0.00  ? 27  ASN A CA     3  
ATOM   5400  C C      . ASN A 1 27  ? -21.360 7.773   -17.434 1.00 0.00  ? 27  ASN A C      3  
ATOM   5401  O O      . ASN A 1 27  ? -20.247 7.810   -16.906 1.00 0.00  ? 27  ASN A O      3  
ATOM   5402  C CB     . ASN A 1 27  ? -22.852 6.157   -18.625 1.00 0.00  ? 27  ASN A CB     3  
ATOM   5403  C CG     . ASN A 1 27  ? -23.565 4.820   -18.569 1.00 0.00  ? 27  ASN A CG     3  
ATOM   5404  O OD1    . ASN A 1 27  ? -24.097 4.433   -17.531 1.00 0.00  ? 27  ASN A OD1    3  
ATOM   5405  N ND2    . ASN A 1 27  ? -23.578 4.108   -19.690 1.00 0.00  ? 27  ASN A ND2    3  
ATOM   5406  H H      . ASN A 1 27  ? -24.017 7.478   -16.550 1.00 0.00  ? 27  ASN A H      3  
ATOM   5407  H HA     . ASN A 1 27  ? -21.671 5.738   -16.892 1.00 0.00  ? 27  ASN A HA     3  
ATOM   5408  H HB2    . ASN A 1 27  ? -23.561 6.911   -18.937 1.00 0.00  ? 27  ASN A HB2    3  
ATOM   5409  H HB3    . ASN A 1 27  ? -22.060 6.093   -19.356 1.00 0.00  ? 27  ASN A HB3    3  
ATOM   5410  H HD21   . ASN A 1 27  ? -23.133 4.477   -20.480 1.00 0.00  ? 27  ASN A HD21   3  
ATOM   5411  H HD22   . ASN A 1 27  ? -24.038 3.242   -19.679 1.00 0.00  ? 27  ASN A HD22   3  
ATOM   5412  N N      . ALA A 1 28  ? -21.859 8.770   -18.155 1.00 0.00  ? 28  ALA A N      3  
ATOM   5413  C CA     . ALA A 1 28  ? -21.116 10.003  -18.388 1.00 0.00  ? 28  ALA A CA     3  
ATOM   5414  C C      . ALA A 1 28  ? -19.868 9.753   -19.222 1.00 0.00  ? 28  ALA A C      3  
ATOM   5415  O O      . ALA A 1 28  ? -19.758 10.229  -20.353 1.00 0.00  ? 28  ALA A O      3  
ATOM   5416  C CB     . ALA A 1 28  ? -20.743 10.658  -17.065 1.00 0.00  ? 28  ALA A CB     3  
ATOM   5417  H H      . ALA A 1 28  ? -22.753 8.673   -18.537 1.00 0.00  ? 28  ALA A H      3  
ATOM   5418  H HA     . ALA A 1 28  ? -21.763 10.681  -18.924 1.00 0.00  ? 28  ALA A HA     3  
ATOM   5419  H HB1    . ALA A 1 28  ? -20.224 11.585  -17.256 1.00 0.00  ? 28  ALA A HB1    3  
ATOM   5420  H HB2    . ALA A 1 28  ? -20.102 9.995   -16.503 1.00 0.00  ? 28  ALA A HB2    3  
ATOM   5421  H HB3    . ALA A 1 28  ? -21.640 10.859  -16.496 1.00 0.00  ? 28  ALA A HB3    3  
ATOM   5422  N N      . ILE A 1 29  ? -18.923 9.009   -18.655 1.00 0.00  ? 29  ILE A N      3  
ATOM   5423  C CA     . ILE A 1 29  ? -17.677 8.701   -19.338 1.00 0.00  ? 29  ILE A CA     3  
ATOM   5424  C C      . ILE A 1 29  ? -17.677 7.275   -19.886 1.00 0.00  ? 29  ILE A C      3  
ATOM   5425  O O      . ILE A 1 29  ? -18.264 6.367   -19.299 1.00 0.00  ? 29  ILE A O      3  
ATOM   5426  C CB     . ILE A 1 29  ? -16.467 8.884   -18.397 1.00 0.00  ? 29  ILE A CB     3  
ATOM   5427  C CG1    . ILE A 1 29  ? -16.361 10.343  -17.955 1.00 0.00  ? 29  ILE A CG1    3  
ATOM   5428  C CG2    . ILE A 1 29  ? -15.180 8.449   -19.076 1.00 0.00  ? 29  ILE A CG2    3  
ATOM   5429  C CD1    . ILE A 1 29  ? -15.851 10.515  -16.540 1.00 0.00  ? 29  ILE A CD1    3  
ATOM   5430  H H      . ILE A 1 29  ? -19.067 8.663   -17.748 1.00 0.00  ? 29  ILE A H      3  
ATOM   5431  H HA     . ILE A 1 29  ? -17.569 9.390   -20.163 1.00 0.00  ? 29  ILE A HA     3  
ATOM   5432  H HB     . ILE A 1 29  ? -16.613 8.263   -17.529 1.00 0.00  ? 29  ILE A HB     3  
ATOM   5433  H HG12   . ILE A 1 29  ? -15.681 10.862  -18.613 1.00 0.00  ? 29  ILE A HG12   3  
ATOM   5434  H HG13   . ILE A 1 29  ? -17.335 10.801  -18.016 1.00 0.00  ? 29  ILE A HG13   3  
ATOM   5435  H HG21   . ILE A 1 29  ? -14.342 8.946   -18.609 1.00 0.00  ? 29  ILE A HG21   3  
ATOM   5436  H HG22   . ILE A 1 29  ? -15.217 8.714   -20.122 1.00 0.00  ? 29  ILE A HG22   3  
ATOM   5437  H HG23   . ILE A 1 29  ? -15.063 7.380   -18.978 1.00 0.00  ? 29  ILE A HG23   3  
ATOM   5438  H HD11   . ILE A 1 29  ? -16.518 11.163  -15.995 1.00 0.00  ? 29  ILE A HD11   3  
ATOM   5439  H HD12   . ILE A 1 29  ? -14.864 10.953  -16.565 1.00 0.00  ? 29  ILE A HD12   3  
ATOM   5440  H HD13   . ILE A 1 29  ? -15.802 9.553   -16.055 1.00 0.00  ? 29  ILE A HD13   3  
ATOM   5441  N N      . GLU A 1 30  ? -16.994 7.094   -21.009 1.00 0.00  ? 30  GLU A N      3  
ATOM   5442  C CA     . GLU A 1 30  ? -16.887 5.787   -21.648 1.00 0.00  ? 30  GLU A CA     3  
ATOM   5443  C C      . GLU A 1 30  ? -15.448 5.547   -22.086 1.00 0.00  ? 30  GLU A C      3  
ATOM   5444  O O      . GLU A 1 30  ? -14.772 6.470   -22.535 1.00 0.00  ? 30  GLU A O      3  
ATOM   5445  C CB     . GLU A 1 30  ? -17.823 5.696   -22.854 1.00 0.00  ? 30  GLU A CB     3  
ATOM   5446  C CG     . GLU A 1 30  ? -19.294 5.818   -22.491 1.00 0.00  ? 30  GLU A CG     3  
ATOM   5447  C CD     . GLU A 1 30  ? -19.824 7.226   -22.672 1.00 0.00  ? 30  GLU A CD     3  
ATOM   5448  O OE1    . GLU A 1 30  ? -19.539 7.837   -23.726 1.00 0.00  ? 30  GLU A OE1    3  
ATOM   5449  O OE2    . GLU A 1 30  ? -20.522 7.719   -21.763 1.00 0.00  ? 30  GLU A OE2    3  
ATOM   5450  H H      . GLU A 1 30  ? -16.541 7.862   -21.416 1.00 0.00  ? 30  GLU A H      3  
ATOM   5451  H HA     . GLU A 1 30  ? -17.163 5.036   -20.923 1.00 0.00  ? 30  GLU A HA     3  
ATOM   5452  H HB2    . GLU A 1 30  ? -17.578 6.489   -23.546 1.00 0.00  ? 30  GLU A HB2    3  
ATOM   5453  H HB3    . GLU A 1 30  ? -17.670 4.745   -23.340 1.00 0.00  ? 30  GLU A HB3    3  
ATOM   5454  H HG2    . GLU A 1 30  ? -19.864 5.152   -23.123 1.00 0.00  ? 30  GLU A HG2    3  
ATOM   5455  H HG3    . GLU A 1 30  ? -19.422 5.529   -21.458 1.00 0.00  ? 30  GLU A HG3    3  
ATOM   5456  H HE2    . GLU A 1 30  ? -20.824 8.612   -21.943 1.00 0.00  ? 30  GLU A HE2    3  
ATOM   5457  N N      . PHE A 1 31  ? -14.974 4.314   -21.938 1.00 0.00  ? 31  PHE A N      3  
ATOM   5458  C CA     . PHE A 1 31  ? -13.601 3.979   -22.302 1.00 0.00  ? 31  PHE A CA     3  
ATOM   5459  C C      . PHE A 1 31  ? -13.528 3.226   -23.627 1.00 0.00  ? 31  PHE A C      3  
ATOM   5460  O O      . PHE A 1 31  ? -14.447 2.493   -23.989 1.00 0.00  ? 31  PHE A O      3  
ATOM   5461  C CB     . PHE A 1 31  ? -12.955 3.150   -21.190 1.00 0.00  ? 31  PHE A CB     3  
ATOM   5462  C CG     . PHE A 1 31  ? -13.037 3.803   -19.840 1.00 0.00  ? 31  PHE A CG     3  
ATOM   5463  C CD1    . PHE A 1 31  ? -12.340 4.969   -19.580 1.00 0.00  ? 31  PHE A CD1    3  
ATOM   5464  C CD2    . PHE A 1 31  ? -13.817 3.255   -18.835 1.00 0.00  ? 31  PHE A CD2    3  
ATOM   5465  C CE1    . PHE A 1 31  ? -12.418 5.580   -18.345 1.00 0.00  ? 31  PHE A CE1    3  
ATOM   5466  C CE2    . PHE A 1 31  ? -13.901 3.864   -17.596 1.00 0.00  ? 31  PHE A CE2    3  
ATOM   5467  C CZ     . PHE A 1 31  ? -13.199 5.027   -17.354 1.00 0.00  ? 31  PHE A CZ     3  
ATOM   5468  H H      . PHE A 1 31  ? -15.552 3.620   -21.562 1.00 0.00  ? 31  PHE A H      3  
ATOM   5469  H HA     . PHE A 1 31  ? -13.060 4.904   -22.402 1.00 0.00  ? 31  PHE A HA     3  
ATOM   5470  H HB2    . PHE A 1 31  ? -13.451 2.194   -21.127 1.00 0.00  ? 31  PHE A HB2    3  
ATOM   5471  H HB3    . PHE A 1 31  ? -11.911 2.995   -21.424 1.00 0.00  ? 31  PHE A HB3    3  
ATOM   5472  H HD1    . PHE A 1 31  ? -11.727 5.401   -20.353 1.00 0.00  ? 31  PHE A HD1    3  
ATOM   5473  H HD2    . PHE A 1 31  ? -14.365 2.345   -19.023 1.00 0.00  ? 31  PHE A HD2    3  
ATOM   5474  H HE1    . PHE A 1 31  ? -11.868 6.491   -18.158 1.00 0.00  ? 31  PHE A HE1    3  
ATOM   5475  H HE2    . PHE A 1 31  ? -14.512 3.426   -16.818 1.00 0.00  ? 31  PHE A HE2    3  
ATOM   5476  H HZ     . PHE A 1 31  ? -13.262 5.507   -16.392 1.00 0.00  ? 31  PHE A HZ     3  
ATOM   5477  N N      . LEU A 1 32  ? -12.419 3.416   -24.341 1.00 0.00  ? 32  LEU A N      3  
ATOM   5478  C CA     . LEU A 1 32  ? -12.212 2.759   -25.628 1.00 0.00  ? 32  LEU A CA     3  
ATOM   5479  C C      . LEU A 1 32  ? -11.656 1.353   -25.433 1.00 0.00  ? 32  LEU A C      3  
ATOM   5480  O O      . LEU A 1 32  ? -10.757 1.137   -24.622 1.00 0.00  ? 32  LEU A O      3  
ATOM   5481  C CB     . LEU A 1 32  ? -11.256 3.575   -26.504 1.00 0.00  ? 32  LEU A CB     3  
ATOM   5482  C CG     . LEU A 1 32  ? -10.894 2.931   -27.845 1.00 0.00  ? 32  LEU A CG     3  
ATOM   5483  C CD1    . LEU A 1 32  ? -12.151 2.610   -28.641 1.00 0.00  ? 32  LEU A CD1    3  
ATOM   5484  C CD2    . LEU A 1 32  ? -9.970  3.839   -28.644 1.00 0.00  ? 32  LEU A CD2    3  
ATOM   5485  H H      . LEU A 1 32  ? -11.726 4.013   -23.994 1.00 0.00  ? 32  LEU A H      3  
ATOM   5486  H HA     . LEU A 1 32  ? -13.169 2.690   -26.122 1.00 0.00  ? 32  LEU A HA     3  
ATOM   5487  H HB2    . LEU A 1 32  ? -11.707 4.533   -26.700 1.00 0.00  ? 32  LEU A HB2    3  
ATOM   5488  H HB3    . LEU A 1 32  ? -10.344 3.738   -25.954 1.00 0.00  ? 32  LEU A HB3    3  
ATOM   5489  H HG     . LEU A 1 32  ? -10.373 2.002   -27.659 1.00 0.00  ? 32  LEU A HG     3  
ATOM   5490  H HD11   . LEU A 1 32  ? -12.903 2.209   -27.979 1.00 0.00  ? 32  LEU A HD11   3  
ATOM   5491  H HD12   . LEU A 1 32  ? -11.916 1.882   -29.404 1.00 0.00  ? 32  LEU A HD12   3  
ATOM   5492  H HD13   . LEU A 1 32  ? -12.523 3.511   -29.105 1.00 0.00  ? 32  LEU A HD13   3  
ATOM   5493  H HD21   . LEU A 1 32  ? -10.392 4.014   -29.623 1.00 0.00  ? 32  LEU A HD21   3  
ATOM   5494  H HD22   . LEU A 1 32  ? -9.004  3.366   -28.747 1.00 0.00  ? 32  LEU A HD22   3  
ATOM   5495  H HD23   . LEU A 1 32  ? -9.855  4.782   -28.128 1.00 0.00  ? 32  LEU A HD23   3  
ATOM   5496  N N      . LEU A 1 33  ? -12.193 0.402   -26.188 1.00 0.00  ? 33  LEU A N      3  
ATOM   5497  C CA     . LEU A 1 33  ? -11.749 -0.981  -26.104 1.00 0.00  ? 33  LEU A CA     3  
ATOM   5498  C C      . LEU A 1 33  ? -11.611 -1.586  -27.497 1.00 0.00  ? 33  LEU A C      3  
ATOM   5499  O O      . LEU A 1 33  ? -12.405 -1.291  -28.390 1.00 0.00  ? 33  LEU A O      3  
ATOM   5500  C CB     . LEU A 1 33  ? -12.732 -1.805  -25.272 1.00 0.00  ? 33  LEU A CB     3  
ATOM   5501  C CG     . LEU A 1 33  ? -12.379 -1.920  -23.791 1.00 0.00  ? 33  LEU A CG     3  
ATOM   5502  C CD1    . LEU A 1 33  ? -13.628 -2.157  -22.962 1.00 0.00  ? 33  LEU A CD1    3  
ATOM   5503  C CD2    . LEU A 1 33  ? -11.369 -3.038  -23.570 1.00 0.00  ? 33  LEU A CD2    3  
ATOM   5504  H H      . LEU A 1 33  ? -12.904 0.639   -26.820 1.00 0.00  ? 33  LEU A H      3  
ATOM   5505  H HA     . LEU A 1 33  ? -10.783 -0.992  -25.624 1.00 0.00  ? 33  LEU A HA     3  
ATOM   5506  H HB2    . LEU A 1 33  ? -13.710 -1.354  -25.353 1.00 0.00  ? 33  LEU A HB2    3  
ATOM   5507  H HB3    . LEU A 1 33  ? -12.778 -2.802  -25.685 1.00 0.00  ? 33  LEU A HB3    3  
ATOM   5508  H HG     . LEU A 1 33  ? -11.931 -0.995  -23.461 1.00 0.00  ? 33  LEU A HG     3  
ATOM   5509  H HD11   . LEU A 1 33  ? -14.392 -2.610  -23.580 1.00 0.00  ? 33  LEU A HD11   3  
ATOM   5510  H HD12   . LEU A 1 33  ? -13.989 -1.214  -22.578 1.00 0.00  ? 33  LEU A HD12   3  
ATOM   5511  H HD13   . LEU A 1 33  ? -13.396 -2.815  -22.138 1.00 0.00  ? 33  LEU A HD13   3  
ATOM   5512  H HD21   . LEU A 1 33  ? -10.547 -2.922  -24.261 1.00 0.00  ? 33  LEU A HD21   3  
ATOM   5513  H HD22   . LEU A 1 33  ? -11.847 -3.992  -23.736 1.00 0.00  ? 33  LEU A HD22   3  
ATOM   5514  H HD23   . LEU A 1 33  ? -10.998 -2.992  -22.558 1.00 0.00  ? 33  LEU A HD23   3  
ATOM   5515  N N      . LEU A 1 34  ? -10.600 -2.427  -27.674 1.00 0.00  ? 34  LEU A N      3  
ATOM   5516  C CA     . LEU A 1 34  ? -10.356 -3.071  -28.958 1.00 0.00  ? 34  LEU A CA     3  
ATOM   5517  C C      . LEU A 1 34  ? -10.394 -4.591  -28.817 1.00 0.00  ? 34  LEU A C      3  
ATOM   5518  O O      . LEU A 1 34  ? -9.531  -5.187  -28.171 1.00 0.00  ? 34  LEU A O      3  
ATOM   5519  C CB     . LEU A 1 34  ? -9.008  -2.621  -29.526 1.00 0.00  ? 34  LEU A CB     3  
ATOM   5520  C CG     . LEU A 1 34  ? -8.735  -1.115  -29.429 1.00 0.00  ? 34  LEU A CG     3  
ATOM   5521  C CD1    . LEU A 1 34  ? -7.359  -0.783  -29.986 1.00 0.00  ? 34  LEU A CD1    3  
ATOM   5522  C CD2    . LEU A 1 34  ? -9.811  -0.330  -30.162 1.00 0.00  ? 34  LEU A CD2    3  
ATOM   5523  H H      . LEU A 1 34  ? -10.001 -2.619  -26.924 1.00 0.00  ? 34  LEU A H      3  
ATOM   5524  H HA     . LEU A 1 34  ? -11.140 -2.768  -29.634 1.00 0.00  ? 34  LEU A HA     3  
ATOM   5525  H HB2    . LEU A 1 34  ? -8.226  -3.140  -28.991 1.00 0.00  ? 34  LEU A HB2    3  
ATOM   5526  H HB3    . LEU A 1 34  ? -8.964  -2.905  -30.565 1.00 0.00  ? 34  LEU A HB3    3  
ATOM   5527  H HG     . LEU A 1 34  ? -8.754  -0.816  -28.391 1.00 0.00  ? 34  LEU A HG     3  
ATOM   5528  H HD11   . LEU A 1 34  ? -6.604  -1.070  -29.269 1.00 0.00  ? 34  LEU A HD11   3  
ATOM   5529  H HD12   . LEU A 1 34  ? -7.292  0.279   -30.171 1.00 0.00  ? 34  LEU A HD12   3  
ATOM   5530  H HD13   . LEU A 1 34  ? -7.204  -1.321  -30.908 1.00 0.00  ? 34  LEU A HD13   3  
ATOM   5531  H HD21   . LEU A 1 34  ? -10.049 -0.823  -31.093 1.00 0.00  ? 34  LEU A HD21   3  
ATOM   5532  H HD22   . LEU A 1 34  ? -9.453  0.669   -30.365 1.00 0.00  ? 34  LEU A HD22   3  
ATOM   5533  H HD23   . LEU A 1 34  ? -10.698 -0.277  -29.547 1.00 0.00  ? 34  LEU A HD23   3  
ATOM   5534  N N      . GLN A 1 35  ? -11.407 -5.210  -29.415 1.00 0.00  ? 35  GLN A N      3  
ATOM   5535  C CA     . GLN A 1 35  ? -11.569 -6.659  -29.351 1.00 0.00  ? 35  GLN A CA     3  
ATOM   5536  C C      . GLN A 1 35  ? -10.374 -7.378  -29.967 1.00 0.00  ? 35  GLN A C      3  
ATOM   5537  O O      . GLN A 1 35  ? -9.916  -7.022  -31.052 1.00 0.00  ? 35  GLN A O      3  
ATOM   5538  C CB     . GLN A 1 35  ? -12.849 -7.081  -30.069 1.00 0.00  ? 35  GLN A CB     3  
ATOM   5539  C CG     . GLN A 1 35  ? -13.215 -8.540  -29.851 1.00 0.00  ? 35  GLN A CG     3  
ATOM   5540  C CD     . GLN A 1 35  ? -14.513 -8.924  -30.537 1.00 0.00  ? 35  GLN A CD     3  
ATOM   5541  O OE1    . GLN A 1 35  ? -14.936 -8.281  -31.496 1.00 0.00  ? 35  GLN A OE1    3  
ATOM   5542  N NE2    . GLN A 1 35  ? -15.148 -9.984  -30.047 1.00 0.00  ? 35  GLN A NE2    3  
ATOM   5543  H H      . GLN A 1 35  ? -12.065 -4.678  -29.909 1.00 0.00  ? 35  GLN A H      3  
ATOM   5544  H HA     . GLN A 1 35  ? -11.643 -6.937  -28.313 1.00 0.00  ? 35  GLN A HA     3  
ATOM   5545  H HB2    . GLN A 1 35  ? -13.664 -6.471  -29.715 1.00 0.00  ? 35  GLN A HB2    3  
ATOM   5546  H HB3    . GLN A 1 35  ? -12.724 -6.920  -31.130 1.00 0.00  ? 35  GLN A HB3    3  
ATOM   5547  H HG2    . GLN A 1 35  ? -12.421 -9.159  -30.241 1.00 0.00  ? 35  GLN A HG2    3  
ATOM   5548  H HG3    . GLN A 1 35  ? -13.322 -8.716  -28.791 1.00 0.00  ? 35  GLN A HG3    3  
ATOM   5549  H HE21   . GLN A 1 35  ? -14.749 -10.450 -29.282 1.00 0.00  ? 35  GLN A HE21   3  
ATOM   5550  H HE22   . GLN A 1 35  ? -15.989 -10.256 -30.471 1.00 0.00  ? 35  GLN A HE22   3  
ATOM   5551  N N      . ALA A 1 36  ? -9.883  -8.396  -29.271 1.00 0.00  ? 36  ALA A N      3  
ATOM   5552  C CA     . ALA A 1 36  ? -8.750  -9.174  -29.750 1.00 0.00  ? 36  ALA A CA     3  
ATOM   5553  C C      . ALA A 1 36  ? -9.146  -10.009 -30.961 1.00 0.00  ? 36  ALA A C      3  
ATOM   5554  O O      . ALA A 1 36  ? -10.186 -10.668 -30.958 1.00 0.00  ? 36  ALA A O      3  
ATOM   5555  C CB     . ALA A 1 36  ? -8.215  -10.067 -28.641 1.00 0.00  ? 36  ALA A CB     3  
ATOM   5556  H H      . ALA A 1 36  ? -10.297 -8.634  -28.415 1.00 0.00  ? 36  ALA A H      3  
ATOM   5557  H HA     . ALA A 1 36  ? -7.968  -8.486  -30.036 1.00 0.00  ? 36  ALA A HA     3  
ATOM   5558  H HB1    . ALA A 1 36  ? -7.141  -10.138 -28.721 1.00 0.00  ? 36  ALA A HB1    3  
ATOM   5559  H HB2    . ALA A 1 36  ? -8.649  -11.051 -28.730 1.00 0.00  ? 36  ALA A HB2    3  
ATOM   5560  H HB3    . ALA A 1 36  ? -8.477  -9.644  -27.681 1.00 0.00  ? 36  ALA A HB3    3  
ATOM   5561  N N      . SER A 1 37  ? -8.313  -9.981  -31.996 1.00 0.00  ? 37  SER A N      3  
ATOM   5562  C CA     . SER A 1 37  ? -8.583  -10.738 -33.213 1.00 0.00  ? 37  SER A CA     3  
ATOM   5563  C C      . SER A 1 37  ? -8.188  -12.208 -33.059 1.00 0.00  ? 37  SER A C      3  
ATOM   5564  O O      . SER A 1 37  ? -8.248  -12.978 -34.017 1.00 0.00  ? 37  SER A O      3  
ATOM   5565  C CB     . SER A 1 37  ? -7.839  -10.119 -34.396 1.00 0.00  ? 37  SER A CB     3  
ATOM   5566  O OG     . SER A 1 37  ? -6.447  -10.365 -34.311 1.00 0.00  ? 37  SER A OG     3  
ATOM   5567  H H      . SER A 1 37  ? -7.498  -9.437  -31.941 1.00 0.00  ? 37  SER A H      3  
ATOM   5568  H HA     . SER A 1 37  ? -9.645  -10.683 -33.403 1.00 0.00  ? 37  SER A HA     3  
ATOM   5569  H HB2    . SER A 1 37  ? -8.209  -10.545 -35.316 1.00 0.00  ? 37  SER A HB2    3  
ATOM   5570  H HB3    . SER A 1 37  ? -8.006  -9.051  -34.404 1.00 0.00  ? 37  SER A HB3    3  
ATOM   5571  H HG     . SER A 1 37  ? -6.020  -10.088 -35.125 1.00 0.00  ? 37  SER A HG     3  
ATOM   5572  N N      . ASP A 1 38  ? -7.784  -12.594 -31.851 1.00 0.00  ? 38  ASP A N      3  
ATOM   5573  C CA     . ASP A 1 38  ? -7.382  -13.969 -31.580 1.00 0.00  ? 38  ASP A CA     3  
ATOM   5574  C C      . ASP A 1 38  ? -7.240  -14.202 -30.080 1.00 0.00  ? 38  ASP A C      3  
ATOM   5575  O O      . ASP A 1 38  ? -7.504  -13.307 -29.276 1.00 0.00  ? 38  ASP A O      3  
ATOM   5576  C CB     . ASP A 1 38  ? -6.060  -14.281 -32.284 1.00 0.00  ? 38  ASP A CB     3  
ATOM   5577  C CG     . ASP A 1 38  ? -4.974  -13.280 -31.944 1.00 0.00  ? 38  ASP A CG     3  
ATOM   5578  O OD1    . ASP A 1 38  ? -4.718  -13.068 -30.739 1.00 0.00  ? 38  ASP A OD1    3  
ATOM   5579  O OD2    . ASP A 1 38  ? -4.378  -12.709 -32.881 1.00 0.00  ? 38  ASP A OD2    3  
ATOM   5580  H H      . ASP A 1 38  ? -7.756  -11.943 -31.122 1.00 0.00  ? 38  ASP A H      3  
ATOM   5581  H HA     . ASP A 1 38  ? -8.150  -14.623 -31.963 1.00 0.00  ? 38  ASP A HA     3  
ATOM   5582  H HB2    . ASP A 1 38  ? -5.724  -15.262 -31.986 1.00 0.00  ? 38  ASP A HB2    3  
ATOM   5583  H HB3    . ASP A 1 38  ? -6.217  -14.266 -33.352 1.00 0.00  ? 38  ASP A HB3    3  
ATOM   5584  H HD2    . ASP A 1 38  ? -3.704  -12.088 -32.594 1.00 0.00  ? 38  ASP A HD2    3  
ATOM   5585  N N      . GLY A 1 39  ? -6.817  -15.404 -29.709 1.00 0.00  ? 39  GLY A N      3  
ATOM   5586  C CA     . GLY A 1 39  ? -6.642  -15.730 -28.306 1.00 0.00  ? 39  GLY A CA     3  
ATOM   5587  C C      . GLY A 1 39  ? -7.942  -16.145 -27.635 1.00 0.00  ? 39  GLY A C      3  
ATOM   5588  O O      . GLY A 1 39  ? -8.563  -17.133 -28.026 1.00 0.00  ? 39  GLY A O      3  
ATOM   5589  H H      . GLY A 1 39  ? -6.618  -16.077 -30.395 1.00 0.00  ? 39  GLY A H      3  
ATOM   5590  H HA2    . GLY A 1 39  ? -5.934  -16.540 -28.222 1.00 0.00  ? 39  GLY A HA2    3  
ATOM   5591  H HA3    . GLY A 1 39  ? -6.246  -14.868 -27.794 1.00 0.00  ? 39  GLY A HA3    3  
ATOM   5592  N N      . ILE A 1 40  ? -8.348  -15.390 -26.617 1.00 0.00  ? 40  ILE A N      3  
ATOM   5593  C CA     . ILE A 1 40  ? -9.576  -15.689 -25.885 1.00 0.00  ? 40  ILE A CA     3  
ATOM   5594  C C      . ILE A 1 40  ? -10.733 -14.795 -26.342 1.00 0.00  ? 40  ILE A C      3  
ATOM   5595  O O      . ILE A 1 40  ? -11.790 -14.771 -25.714 1.00 0.00  ? 40  ILE A O      3  
ATOM   5596  C CB     . ILE A 1 40  ? -9.373  -15.541 -24.353 1.00 0.00  ? 40  ILE A CB     3  
ATOM   5597  C CG1    . ILE A 1 40  ? -9.436  -14.078 -23.905 1.00 0.00  ? 40  ILE A CG1    3  
ATOM   5598  C CG2    . ILE A 1 40  ? -8.036  -16.135 -23.941 1.00 0.00  ? 40  ILE A CG2    3  
ATOM   5599  C CD1    . ILE A 1 40  ? -9.790  -13.909 -22.441 1.00 0.00  ? 40  ILE A CD1    3  
ATOM   5600  H H      . ILE A 1 40  ? -7.808  -14.619 -26.349 1.00 0.00  ? 40  ILE A H      3  
ATOM   5601  H HA     . ILE A 1 40  ? -9.838  -16.717 -26.089 1.00 0.00  ? 40  ILE A HA     3  
ATOM   5602  H HB     . ILE A 1 40  ? -10.152 -16.097 -23.854 1.00 0.00  ? 40  ILE A HB     3  
ATOM   5603  H HG12   . ILE A 1 40  ? -8.472  -13.625 -24.060 1.00 0.00  ? 40  ILE A HG12   3  
ATOM   5604  H HG13   . ILE A 1 40  ? -10.178 -13.552 -24.488 1.00 0.00  ? 40  ILE A HG13   3  
ATOM   5605  H HG21   . ILE A 1 40  ? -7.777  -16.943 -24.608 1.00 0.00  ? 40  ILE A HG21   3  
ATOM   5606  H HG22   . ILE A 1 40  ? -8.104  -16.508 -22.931 1.00 0.00  ? 40  ILE A HG22   3  
ATOM   5607  H HG23   . ILE A 1 40  ? -7.275  -15.368 -23.991 1.00 0.00  ? 40  ILE A HG23   3  
ATOM   5608  H HD11   . ILE A 1 40  ? -10.864 -13.881 -22.332 1.00 0.00  ? 40  ILE A HD11   3  
ATOM   5609  H HD12   . ILE A 1 40  ? -9.367  -12.984 -22.076 1.00 0.00  ? 40  ILE A HD12   3  
ATOM   5610  H HD13   . ILE A 1 40  ? -9.390  -14.737 -21.876 1.00 0.00  ? 40  ILE A HD13   3  
ATOM   5611  N N      . HIS A 1 41  ? -10.522 -14.046 -27.424 1.00 0.00  ? 41  HIS A N      3  
ATOM   5612  C CA     . HIS A 1 41  ? -11.549 -13.142 -27.932 1.00 0.00  ? 41  HIS A CA     3  
ATOM   5613  C C      . HIS A 1 41  ? -11.872 -12.091 -26.879 1.00 0.00  ? 41  HIS A C      3  
ATOM   5614  O O      . HIS A 1 41  ? -13.021 -11.689 -26.705 1.00 0.00  ? 41  HIS A O      3  
ATOM   5615  C CB     . HIS A 1 41  ? -12.813 -13.916 -28.315 1.00 0.00  ? 41  HIS A CB     3  
ATOM   5616  C CG     . HIS A 1 41  ? -12.745 -14.539 -29.676 1.00 0.00  ? 41  HIS A CG     3  
ATOM   5617  N ND1    . HIS A 1 41  ? -11.827 -14.164 -30.634 1.00 0.00  ? 41  HIS A ND1    3  
ATOM   5618  C CD2    . HIS A 1 41  ? -13.491 -15.520 -30.237 1.00 0.00  ? 41  HIS A CD2    3  
ATOM   5619  C CE1    . HIS A 1 41  ? -12.013 -14.886 -31.726 1.00 0.00  ? 41  HIS A CE1    3  
ATOM   5620  N NE2    . HIS A 1 41  ? -13.015 -15.716 -31.511 1.00 0.00  ? 41  HIS A NE2    3  
ATOM   5621  H H      . HIS A 1 41  ? -9.656  -14.090 -27.880 1.00 0.00  ? 41  HIS A H      3  
ATOM   5622  H HA     . HIS A 1 41  ? -11.156 -12.646 -28.808 1.00 0.00  ? 41  HIS A HA     3  
ATOM   5623  H HB2    . HIS A 1 41  ? -12.973 -14.706 -27.596 1.00 0.00  ? 41  HIS A HB2    3  
ATOM   5624  H HB3    . HIS A 1 41  ? -13.657 -13.243 -28.299 1.00 0.00  ? 41  HIS A HB3    3  
ATOM   5625  H HD1    . HIS A 1 41  ? -11.140 -13.473 -30.531 1.00 0.00  ? 41  HIS A HD1    3  
ATOM   5626  H HD2    . HIS A 1 41  ? -14.310 -16.051 -29.770 1.00 0.00  ? 41  HIS A HD2    3  
ATOM   5627  H HE1    . HIS A 1 41  ? -11.441 -14.808 -32.639 1.00 0.00  ? 41  HIS A HE1    3  
ATOM   5628  H HE2    . HIS A 1 41  ? -13.325 -16.403 -32.136 1.00 0.00  ? 41  HIS A HE2    3  
ATOM   5629  N N      . HIS A 1 42  ? -10.830 -11.663 -26.178 1.00 0.00  ? 42  HIS A N      3  
ATOM   5630  C CA     . HIS A 1 42  ? -10.956 -10.663 -25.128 1.00 0.00  ? 42  HIS A CA     3  
ATOM   5631  C C      . HIS A 1 42  ? -10.879 -9.260  -25.711 1.00 0.00  ? 42  HIS A C      3  
ATOM   5632  O O      . HIS A 1 42  ? -10.573 -9.084  -26.888 1.00 0.00  ? 42  HIS A O      3  
ATOM   5633  C CB     . HIS A 1 42  ? -9.858  -10.857 -24.073 1.00 0.00  ? 42  HIS A CB     3  
ATOM   5634  C CG     . HIS A 1 42  ? -8.470  -10.962 -24.638 1.00 0.00  ? 42  HIS A CG     3  
ATOM   5635  N ND1    . HIS A 1 42  ? -8.064  -11.974 -25.486 1.00 0.00  ? 42  HIS A ND1    3  
ATOM   5636  C CD2    . HIS A 1 42  ? -7.387  -10.167 -24.468 1.00 0.00  ? 42  HIS A CD2    3  
ATOM   5637  C CE1    . HIS A 1 42  ? -6.798  -11.792 -25.816 1.00 0.00  ? 42  HIS A CE1    3  
ATOM   5638  N NE2    . HIS A 1 42  ? -6.365  -10.702 -25.213 1.00 0.00  ? 42  HIS A NE2    3  
ATOM   5639  H H      . HIS A 1 42  ? -9.954  -12.031 -26.379 1.00 0.00  ? 42  HIS A H      3  
ATOM   5640  H HA     . HIS A 1 42  ? -11.919 -10.794 -24.660 1.00 0.00  ? 42  HIS A HA     3  
ATOM   5641  H HB2    . HIS A 1 42  ? -9.874  -10.018 -23.396 1.00 0.00  ? 42  HIS A HB2    3  
ATOM   5642  H HB3    . HIS A 1 42  ? -10.062 -11.757 -23.518 1.00 0.00  ? 42  HIS A HB3    3  
ATOM   5643  H HD1    . HIS A 1 42  ? -8.613  -12.722 -25.788 1.00 0.00  ? 42  HIS A HD1    3  
ATOM   5644  H HD2    . HIS A 1 42  ? -7.326  -9.299  -23.836 1.00 0.00  ? 42  HIS A HD2    3  
ATOM   5645  H HE1    . HIS A 1 42  ? -6.216  -12.431 -26.464 1.00 0.00  ? 42  HIS A HE1    3  
ATOM   5646  H HE2    . HIS A 1 42  ? -5.488  -10.287 -25.359 1.00 0.00  ? 42  HIS A HE2    3  
ATOM   5647  N N      . TRP A 1 43  ? -11.165 -8.263  -24.885 1.00 0.00  ? 43  TRP A N      3  
ATOM   5648  C CA     . TRP A 1 43  ? -11.134 -6.879  -25.335 1.00 0.00  ? 43  TRP A CA     3  
ATOM   5649  C C      . TRP A 1 43  ? -10.052 -6.087  -24.612 1.00 0.00  ? 43  TRP A C      3  
ATOM   5650  O O      . TRP A 1 43  ? -10.143 -5.843  -23.410 1.00 0.00  ? 43  TRP A O      3  
ATOM   5651  C CB     . TRP A 1 43  ? -12.497 -6.226  -25.115 1.00 0.00  ? 43  TRP A CB     3  
ATOM   5652  C CG     . TRP A 1 43  ? -13.574 -6.811  -25.975 1.00 0.00  ? 43  TRP A CG     3  
ATOM   5653  C CD1    . TRP A 1 43  ? -14.120 -8.057  -25.876 1.00 0.00  ? 43  TRP A CD1    3  
ATOM   5654  C CD2    . TRP A 1 43  ? -14.232 -6.171  -27.071 1.00 0.00  ? 43  TRP A CD2    3  
ATOM   5655  N NE1    . TRP A 1 43  ? -15.083 -8.230  -26.841 1.00 0.00  ? 43  TRP A NE1    3  
ATOM   5656  C CE2    . TRP A 1 43  ? -15.170 -7.085  -27.588 1.00 0.00  ? 43  TRP A CE2    3  
ATOM   5657  C CE3    . TRP A 1 43  ? -14.120 -4.914  -27.663 1.00 0.00  ? 43  TRP A CE3    3  
ATOM   5658  C CZ2    . TRP A 1 43  ? -15.992 -6.776  -28.672 1.00 0.00  ? 43  TRP A CZ2    3  
ATOM   5659  C CZ3    . TRP A 1 43  ? -14.934 -4.607  -28.735 1.00 0.00  ? 43  TRP A CZ3    3  
ATOM   5660  C CH2    . TRP A 1 43  ? -15.860 -5.534  -29.231 1.00 0.00  ? 43  TRP A CH2    3  
ATOM   5661  H H      . TRP A 1 43  ? -11.409 -8.463  -23.957 1.00 0.00  ? 43  TRP A H      3  
ATOM   5662  H HA     . TRP A 1 43  ? -10.915 -6.881  -26.391 1.00 0.00  ? 43  TRP A HA     3  
ATOM   5663  H HB2    . TRP A 1 43  ? -12.786 -6.354  -24.082 1.00 0.00  ? 43  TRP A HB2    3  
ATOM   5664  H HB3    . TRP A 1 43  ? -12.425 -5.172  -25.337 1.00 0.00  ? 43  TRP A HB3    3  
ATOM   5665  H HD1    . TRP A 1 43  ? -13.828 -8.789  -25.138 1.00 0.00  ? 43  TRP A HD1    3  
ATOM   5666  H HE1    . TRP A 1 43  ? -15.618 -9.042  -26.971 1.00 0.00  ? 43  TRP A HE1    3  
ATOM   5667  H HE3    . TRP A 1 43  ? -13.412 -4.185  -27.296 1.00 0.00  ? 43  TRP A HE3    3  
ATOM   5668  H HZ2    . TRP A 1 43  ? -16.712 -7.481  -29.063 1.00 0.00  ? 43  TRP A HZ2    3  
ATOM   5669  H HZ3    . TRP A 1 43  ? -14.859 -3.641  -29.204 1.00 0.00  ? 43  TRP A HZ3    3  
ATOM   5670  H HH2    . TRP A 1 43  ? -16.475 -5.251  -30.072 1.00 0.00  ? 43  TRP A HH2    3  
ATOM   5671  N N      . THR A 1 44  ? -9.031  -5.681  -25.361 1.00 0.00  ? 44  THR A N      3  
ATOM   5672  C CA     . THR A 1 44  ? -7.930  -4.905  -24.800 1.00 0.00  ? 44  THR A CA     3  
ATOM   5673  C C      . THR A 1 44  ? -7.735  -3.613  -25.588 1.00 0.00  ? 44  THR A C      3  
ATOM   5674  O O      . THR A 1 44  ? -7.898  -3.594  -26.808 1.00 0.00  ? 44  THR A O      3  
ATOM   5675  C CB     . THR A 1 44  ? -6.636  -5.721  -24.806 1.00 0.00  ? 44  THR A CB     3  
ATOM   5676  O OG1    . THR A 1 44  ? -6.683  -6.737  -25.794 1.00 0.00  ? 44  THR A OG1    3  
ATOM   5677  C CG2    . THR A 1 44  ? -6.340  -6.385  -23.480 1.00 0.00  ? 44  THR A CG2    3  
ATOM   5678  H H      . THR A 1 44  ? -9.021  -5.903  -26.314 1.00 0.00  ? 44  THR A H      3  
ATOM   5679  H HA     . THR A 1 44  ? -8.186  -4.658  -23.781 1.00 0.00  ? 44  THR A HA     3  
ATOM   5680  H HB     . THR A 1 44  ? -5.810  -5.066  -25.039 1.00 0.00  ? 44  THR A HB     3  
ATOM   5681  H HG1    . THR A 1 44  ? -5.877  -7.254  -25.758 1.00 0.00  ? 44  THR A HG1    3  
ATOM   5682  H HG21   . THR A 1 44  ? -7.166  -7.022  -23.206 1.00 0.00  ? 44  THR A HG21   3  
ATOM   5683  H HG22   . THR A 1 44  ? -6.202  -5.627  -22.722 1.00 0.00  ? 44  THR A HG22   3  
ATOM   5684  H HG23   . THR A 1 44  ? -5.442  -6.976  -23.568 1.00 0.00  ? 44  THR A HG23   3  
ATOM   5685  N N      . PRO A 1 45  ? -7.379  -2.511  -24.905 1.00 0.00  ? 45  PRO A N      3  
ATOM   5686  C CA     . PRO A 1 45  ? -7.164  -1.221  -25.563 1.00 0.00  ? 45  PRO A CA     3  
ATOM   5687  C C      . PRO A 1 45  ? -5.937  -1.240  -26.469 1.00 0.00  ? 45  PRO A C      3  
ATOM   5688  O O      . PRO A 1 45  ? -5.167  -2.199  -26.465 1.00 0.00  ? 45  PRO A O      3  
ATOM   5689  C CB     . PRO A 1 45  ? -6.955  -0.249  -24.398 1.00 0.00  ? 45  PRO A CB     3  
ATOM   5690  C CG     . PRO A 1 45  ? -6.494  -1.100  -23.265 1.00 0.00  ? 45  PRO A CG     3  
ATOM   5691  C CD     . PRO A 1 45  ? -7.156  -2.438  -23.450 1.00 0.00  ? 45  PRO A CD     3  
ATOM   5692  H HA     . PRO A 1 45  ? -8.030  -0.922  -26.135 1.00 0.00  ? 45  PRO A HA     3  
ATOM   5693  H HB2    . PRO A 1 45  ? -6.209  0.485   -24.670 1.00 0.00  ? 45  PRO A HB2    3  
ATOM   5694  H HB3    . PRO A 1 45  ? -7.886  0.245   -24.167 1.00 0.00  ? 45  PRO A HB3    3  
ATOM   5695  H HG2    . PRO A 1 45  ? -5.420  -1.204  -23.297 1.00 0.00  ? 45  PRO A HG2    3  
ATOM   5696  H HG3    . PRO A 1 45  ? -6.800  -0.657  -22.329 1.00 0.00  ? 45  PRO A HG3    3  
ATOM   5697  H HD2    . PRO A 1 45  ? -6.501  -3.230  -23.124 1.00 0.00  ? 45  PRO A HD2    3  
ATOM   5698  H HD3    . PRO A 1 45  ? -8.092  -2.473  -22.913 1.00 0.00  ? 45  PRO A HD3    3  
ATOM   5699  N N      . PRO A 1 46  ? -5.739  -0.174  -27.261 1.00 0.00  ? 46  PRO A N      3  
ATOM   5700  C CA     . PRO A 1 46  ? -4.595  -0.073  -28.172 1.00 0.00  ? 46  PRO A CA     3  
ATOM   5701  C C      . PRO A 1 46  ? -3.264  -0.096  -27.427 1.00 0.00  ? 46  PRO A C      3  
ATOM   5702  O O      . PRO A 1 46  ? -2.801  0.932   -26.934 1.00 0.00  ? 46  PRO A O      3  
ATOM   5703  C CB     . PRO A 1 46  ? -4.802  1.278   -28.866 1.00 0.00  ? 46  PRO A CB     3  
ATOM   5704  C CG     . PRO A 1 46  ? -5.720  2.039   -27.973 1.00 0.00  ? 46  PRO A CG     3  
ATOM   5705  C CD     . PRO A 1 46  ? -6.605  1.016   -27.326 1.00 0.00  ? 46  PRO A CD     3  
ATOM   5706  H HA     . PRO A 1 46  ? -4.608  -0.864  -28.908 1.00 0.00  ? 46  PRO A HA     3  
ATOM   5707  H HB2    . PRO A 1 46  ? -3.851  1.778   -28.971 1.00 0.00  ? 46  PRO A HB2    3  
ATOM   5708  H HB3    . PRO A 1 46  ? -5.240  1.122   -29.841 1.00 0.00  ? 46  PRO A HB3    3  
ATOM   5709  H HG2    . PRO A 1 46  ? -5.150  2.571   -27.226 1.00 0.00  ? 46  PRO A HG2    3  
ATOM   5710  H HG3    . PRO A 1 46  ? -6.312  2.729   -28.558 1.00 0.00  ? 46  PRO A HG3    3  
ATOM   5711  H HD2    . PRO A 1 46  ? -6.894  1.337   -26.336 1.00 0.00  ? 46  PRO A HD2    3  
ATOM   5712  H HD3    . PRO A 1 46  ? -7.475  0.826   -27.935 1.00 0.00  ? 46  PRO A HD3    3  
ATOM   5713  N N      . LYS A 1 47  ? -2.657  -1.277  -27.345 1.00 0.00  ? 47  LYS A N      3  
ATOM   5714  C CA     . LYS A 1 47  ? -1.381  -1.438  -26.657 1.00 0.00  ? 47  LYS A CA     3  
ATOM   5715  C C      . LYS A 1 47  ? -0.215  -1.146  -27.599 1.00 0.00  ? 47  LYS A C      3  
ATOM   5716  O O      . LYS A 1 47  ? -0.404  -0.992  -28.804 1.00 0.00  ? 47  LYS A O      3  
ATOM   5717  C CB     . LYS A 1 47  ? -1.258  -2.855  -26.092 1.00 0.00  ? 47  LYS A CB     3  
ATOM   5718  C CG     . LYS A 1 47  ? -1.670  -2.963  -24.633 1.00 0.00  ? 47  LYS A CG     3  
ATOM   5719  C CD     . LYS A 1 47  ? -2.256  -4.330  -24.316 1.00 0.00  ? 47  LYS A CD     3  
ATOM   5720  C CE     . LYS A 1 47  ? -2.224  -4.617  -22.824 1.00 0.00  ? 47  LYS A CE     3  
ATOM   5721  N NZ     . LYS A 1 47  ? -3.492  -5.236  -22.347 1.00 0.00  ? 47  LYS A NZ     3  
ATOM   5722  H H      . LYS A 1 47  ? -3.080  -2.059  -27.756 1.00 0.00  ? 47  LYS A H      3  
ATOM   5723  H HA     . LYS A 1 47  ? -1.352  -0.730  -25.841 1.00 0.00  ? 47  LYS A HA     3  
ATOM   5724  H HB2    . LYS A 1 47  ? -1.886  -3.516  -26.670 1.00 0.00  ? 47  LYS A HB2    3  
ATOM   5725  H HB3    . LYS A 1 47  ? -0.231  -3.180  -26.177 1.00 0.00  ? 47  LYS A HB3    3  
ATOM   5726  H HG2    . LYS A 1 47  ? -0.802  -2.802  -24.012 1.00 0.00  ? 47  LYS A HG2    3  
ATOM   5727  H HG3    . LYS A 1 47  ? -2.412  -2.206  -24.423 1.00 0.00  ? 47  LYS A HG3    3  
ATOM   5728  H HD2    . LYS A 1 47  ? -3.281  -4.361  -24.655 1.00 0.00  ? 47  LYS A HD2    3  
ATOM   5729  H HD3    . LYS A 1 47  ? -1.681  -5.085  -24.831 1.00 0.00  ? 47  LYS A HD3    3  
ATOM   5730  H HE2    . LYS A 1 47  ? -1.405  -5.290  -22.616 1.00 0.00  ? 47  LYS A HE2    3  
ATOM   5731  H HE3    . LYS A 1 47  ? -2.068  -3.691  -22.295 1.00 0.00  ? 47  LYS A HE3    3  
ATOM   5732  H HZ1    . LYS A 1 47  ? -3.571  -5.140  -21.315 1.00 0.00  ? 47  LYS A HZ1    3  
ATOM   5733  H HZ2    . LYS A 1 47  ? -3.513  -6.246  -22.593 1.00 0.00  ? 47  LYS A HZ2    3  
ATOM   5734  H HZ3    . LYS A 1 47  ? -4.306  -4.767  -22.790 1.00 0.00  ? 47  LYS A HZ3    3  
ATOM   5735  N N      . GLY A 1 48  ? 0.991   -1.071  -27.040 1.00 0.00  ? 48  GLY A N      3  
ATOM   5736  C CA     . GLY A 1 48  ? 2.165   -0.796  -27.848 1.00 0.00  ? 48  GLY A CA     3  
ATOM   5737  C C      . GLY A 1 48  ? 3.460   -1.067  -27.109 1.00 0.00  ? 48  GLY A C      3  
ATOM   5738  O O      . GLY A 1 48  ? 3.662   -0.581  -25.997 1.00 0.00  ? 48  GLY A O      3  
ATOM   5739  H H      . GLY A 1 48  ? 1.083   -1.202  -26.073 1.00 0.00  ? 48  GLY A H      3  
ATOM   5740  H HA2    . GLY A 1 48  ? 2.134   -1.413  -28.731 1.00 0.00  ? 48  GLY A HA2    3  
ATOM   5741  H HA3    . GLY A 1 48  ? 2.147   0.240   -28.146 1.00 0.00  ? 48  GLY A HA3    3  
ATOM   5742  N N      . HIS A 1 49  ? 4.341   -1.842  -27.731 1.00 0.00  ? 49  HIS A N      3  
ATOM   5743  C CA     . HIS A 1 49  ? 5.627   -2.172  -27.130 1.00 0.00  ? 49  HIS A CA     3  
ATOM   5744  C C      . HIS A 1 49  ? 6.570   -0.975  -27.169 1.00 0.00  ? 49  HIS A C      3  
ATOM   5745  O O      . HIS A 1 49  ? 7.039   -0.576  -28.235 1.00 0.00  ? 49  HIS A O      3  
ATOM   5746  C CB     . HIS A 1 49  ? 6.263   -3.361  -27.856 1.00 0.00  ? 49  HIS A CB     3  
ATOM   5747  C CG     . HIS A 1 49  ? 7.468   -3.909  -27.160 1.00 0.00  ? 49  HIS A CG     3  
ATOM   5748  N ND1    . HIS A 1 49  ? 8.624   -3.181  -26.964 1.00 0.00  ? 49  HIS A ND1    3  
ATOM   5749  C CD2    . HIS A 1 49  ? 7.695   -5.125  -26.610 1.00 0.00  ? 49  HIS A CD2    3  
ATOM   5750  C CE1    . HIS A 1 49  ? 9.507   -3.926  -26.325 1.00 0.00  ? 49  HIS A CE1    3  
ATOM   5751  N NE2    . HIS A 1 49  ? 8.969   -5.108  -26.098 1.00 0.00  ? 49  HIS A NE2    3  
ATOM   5752  H H      . HIS A 1 49  ? 4.124   -2.195  -28.619 1.00 0.00  ? 49  HIS A H      3  
ATOM   5753  H HA     . HIS A 1 49  ? 5.450   -2.444  -26.103 1.00 0.00  ? 49  HIS A HA     3  
ATOM   5754  H HB2    . HIS A 1 49  ? 5.537   -4.155  -27.934 1.00 0.00  ? 49  HIS A HB2    3  
ATOM   5755  H HB3    . HIS A 1 49  ? 6.560   -3.052  -28.848 1.00 0.00  ? 49  HIS A HB3    3  
ATOM   5756  H HD1    . HIS A 1 49  ? 8.774   -2.256  -27.252 1.00 0.00  ? 49  HIS A HD1    3  
ATOM   5757  H HD2    . HIS A 1 49  ? 7.001   -5.954  -26.580 1.00 0.00  ? 49  HIS A HD2    3  
ATOM   5758  H HE1    . HIS A 1 49  ? 10.502  -3.618  -26.036 1.00 0.00  ? 49  HIS A HE1    3  
ATOM   5759  H HE2    . HIS A 1 49  ? 9.445   -5.886  -25.734 1.00 0.00  ? 49  HIS A HE2    3  
ATOM   5760  N N      . VAL A 1 50  ? 6.839   -0.401  -26.000 1.00 0.00  ? 50  VAL A N      3  
ATOM   5761  C CA     . VAL A 1 50  ? 7.725   0.756   -25.906 1.00 0.00  ? 50  VAL A CA     3  
ATOM   5762  C C      . VAL A 1 50  ? 9.192   0.333   -25.963 1.00 0.00  ? 50  VAL A C      3  
ATOM   5763  O O      . VAL A 1 50  ? 9.595   -0.646  -25.339 1.00 0.00  ? 50  VAL A O      3  
ATOM   5764  C CB     . VAL A 1 50  ? 7.465   1.595   -24.622 1.00 0.00  ? 50  VAL A CB     3  
ATOM   5765  C CG1    . VAL A 1 50  ? 7.175   0.715   -23.419 1.00 0.00  ? 50  VAL A CG1    3  
ATOM   5766  C CG2    . VAL A 1 50  ? 8.636   2.526   -24.331 1.00 0.00  ? 50  VAL A CG2    3  
ATOM   5767  H H      . VAL A 1 50  ? 6.433   -0.764  -25.190 1.00 0.00  ? 50  VAL A H      3  
ATOM   5768  H HA     . VAL A 1 50  ? 7.520   1.386   -26.760 1.00 0.00  ? 50  VAL A HA     3  
ATOM   5769  H HB     . VAL A 1 50  ? 6.597   2.206   -24.791 1.00 0.00  ? 50  VAL A HB     3  
ATOM   5770  H HG11   . VAL A 1 50  ? 8.074   0.204   -23.122 1.00 0.00  ? 50  VAL A HG11   3  
ATOM   5771  H HG12   . VAL A 1 50  ? 6.412   -0.005  -23.668 1.00 0.00  ? 50  VAL A HG12   3  
ATOM   5772  H HG13   . VAL A 1 50  ? 6.829   1.331   -22.602 1.00 0.00  ? 50  VAL A HG13   3  
ATOM   5773  H HG21   . VAL A 1 50  ? 8.359   3.218   -23.548 1.00 0.00  ? 50  VAL A HG21   3  
ATOM   5774  H HG22   . VAL A 1 50  ? 8.889   3.079   -25.226 1.00 0.00  ? 50  VAL A HG22   3  
ATOM   5775  H HG23   . VAL A 1 50  ? 9.486   1.944   -24.013 1.00 0.00  ? 50  VAL A HG23   3  
ATOM   5776  N N      . GLU A 1 51  ? 9.983   1.085   -26.725 1.00 0.00  ? 51  GLU A N      3  
ATOM   5777  C CA     . GLU A 1 51  ? 11.407  0.803   -26.878 1.00 0.00  ? 51  GLU A CA     3  
ATOM   5778  C C      . GLU A 1 51  ? 12.222  1.638   -25.889 1.00 0.00  ? 51  GLU A C      3  
ATOM   5779  O O      . GLU A 1 51  ? 11.803  2.723   -25.488 1.00 0.00  ? 51  GLU A O      3  
ATOM   5780  C CB     . GLU A 1 51  ? 11.829  1.068   -28.332 1.00 0.00  ? 51  GLU A CB     3  
ATOM   5781  C CG     . GLU A 1 51  ? 13.325  1.237   -28.561 1.00 0.00  ? 51  GLU A CG     3  
ATOM   5782  C CD     . GLU A 1 51  ? 13.633  2.242   -29.654 1.00 0.00  ? 51  GLU A CD     3  
ATOM   5783  O OE1    . GLU A 1 51  ? 14.263  3.277   -29.349 1.00 0.00  ? 51  GLU A OE1    3  
ATOM   5784  O OE2    . GLU A 1 51  ? 13.246  1.993   -30.814 1.00 0.00  ? 51  GLU A OE2    3  
ATOM   5785  H H      . GLU A 1 51  ? 9.597   1.850   -27.198 1.00 0.00  ? 51  GLU A H      3  
ATOM   5786  H HA     . GLU A 1 51  ? 11.561  -0.244  -26.653 1.00 0.00  ? 51  GLU A HA     3  
ATOM   5787  H HB2    . GLU A 1 51  ? 11.502  0.234   -28.929 1.00 0.00  ? 51  GLU A HB2    3  
ATOM   5788  H HB3    . GLU A 1 51  ? 11.329  1.962   -28.678 1.00 0.00  ? 51  GLU A HB3    3  
ATOM   5789  H HG2    . GLU A 1 51  ? 13.785  1.571   -27.650 1.00 0.00  ? 51  GLU A HG2    3  
ATOM   5790  H HG3    . GLU A 1 51  ? 13.743  0.283   -28.845 1.00 0.00  ? 51  GLU A HG3    3  
ATOM   5791  H HE2    . GLU A 1 51  ? 13.474  2.671   -31.455 1.00 0.00  ? 51  GLU A HE2    3  
ATOM   5792  N N      . PRO A 1 52  ? 13.396  1.131   -25.470 1.00 0.00  ? 52  PRO A N      3  
ATOM   5793  C CA     . PRO A 1 52  ? 14.261  1.824   -24.508 1.00 0.00  ? 52  PRO A CA     3  
ATOM   5794  C C      . PRO A 1 52  ? 14.571  3.262   -24.917 1.00 0.00  ? 52  PRO A C      3  
ATOM   5795  O O      . PRO A 1 52  ? 14.759  4.128   -24.063 1.00 0.00  ? 52  PRO A O      3  
ATOM   5796  C CB     . PRO A 1 52  ? 15.543  0.979   -24.475 1.00 0.00  ? 52  PRO A CB     3  
ATOM   5797  C CG     . PRO A 1 52  ? 15.425  -0.002  -25.595 1.00 0.00  ? 52  PRO A CG     3  
ATOM   5798  C CD     . PRO A 1 52  ? 13.960  -0.160  -25.887 1.00 0.00  ? 52  PRO A CD     3  
ATOM   5799  H HA     . PRO A 1 52  ? 13.812  1.832   -23.527 1.00 0.00  ? 52  PRO A HA     3  
ATOM   5800  H HB2    . PRO A 1 52  ? 16.400  1.620   -24.607 1.00 0.00  ? 52  PRO A HB2    3  
ATOM   5801  H HB3    . PRO A 1 52  ? 15.616  0.475   -23.521 1.00 0.00  ? 52  PRO A HB3    3  
ATOM   5802  H HG2    . PRO A 1 52  ? 15.937  0.377   -26.466 1.00 0.00  ? 52  PRO A HG2    3  
ATOM   5803  H HG3    . PRO A 1 52  ? 15.851  -0.950  -25.298 1.00 0.00  ? 52  PRO A HG3    3  
ATOM   5804  H HD2    . PRO A 1 52  ? 13.805  -0.330  -26.939 1.00 0.00  ? 52  PRO A HD2    3  
ATOM   5805  H HD3    . PRO A 1 52  ? 13.539  -0.967  -25.312 1.00 0.00  ? 52  PRO A HD3    3  
ATOM   5806  N N      . GLY A 1 53  ? 14.623  3.516   -26.217 1.00 0.00  ? 53  GLY A N      3  
ATOM   5807  C CA     . GLY A 1 53  ? 14.902  4.854   -26.700 1.00 0.00  ? 53  GLY A CA     3  
ATOM   5808  C C      . GLY A 1 53  ? 13.640  5.667   -26.920 1.00 0.00  ? 53  GLY A C      3  
ATOM   5809  O O      . GLY A 1 53  ? 13.698  6.886   -27.087 1.00 0.00  ? 53  GLY A O      3  
ATOM   5810  H H      . GLY A 1 53  ? 14.465  2.795   -26.854 1.00 0.00  ? 53  GLY A H      3  
ATOM   5811  H HA2    . GLY A 1 53  ? 15.523  5.363   -25.976 1.00 0.00  ? 53  GLY A HA2    3  
ATOM   5812  H HA3    . GLY A 1 53  ? 15.442  4.786   -27.634 1.00 0.00  ? 53  GLY A HA3    3  
ATOM   5813  N N      . GLU A 1 54  ? 12.493  4.990   -26.917 1.00 0.00  ? 54  GLU A N      3  
ATOM   5814  C CA     . GLU A 1 54  ? 11.208  5.654   -27.116 1.00 0.00  ? 54  GLU A CA     3  
ATOM   5815  C C      . GLU A 1 54  ? 10.652  6.159   -25.790 1.00 0.00  ? 54  GLU A C      3  
ATOM   5816  O O      . GLU A 1 54  ? 11.065  5.702   -24.724 1.00 0.00  ? 54  GLU A O      3  
ATOM   5817  C CB     . GLU A 1 54  ? 10.210  4.688   -27.756 1.00 0.00  ? 54  GLU A CB     3  
ATOM   5818  C CG     . GLU A 1 54  ? 9.029   5.378   -28.415 1.00 0.00  ? 54  GLU A CG     3  
ATOM   5819  C CD     . GLU A 1 54  ? 8.181   4.428   -29.238 1.00 0.00  ? 54  GLU A CD     3  
ATOM   5820  O OE1    . GLU A 1 54  ? 6.951   4.639   -29.306 1.00 0.00  ? 54  GLU A OE1    3  
ATOM   5821  O OE2    . GLU A 1 54  ? 8.745   3.474   -29.812 1.00 0.00  ? 54  GLU A OE2    3  
ATOM   5822  H H      . GLU A 1 54  ? 12.510  4.021   -26.777 1.00 0.00  ? 54  GLU A H      3  
ATOM   5823  H HA     . GLU A 1 54  ? 11.362  6.494   -27.778 1.00 0.00  ? 54  GLU A HA     3  
ATOM   5824  H HB2    . GLU A 1 54  ? 10.722  4.100   -28.504 1.00 0.00  ? 54  GLU A HB2    3  
ATOM   5825  H HB3    . GLU A 1 54  ? 9.830   4.024   -26.992 1.00 0.00  ? 54  GLU A HB3    3  
ATOM   5826  H HG2    . GLU A 1 54  ? 8.409   5.815   -27.646 1.00 0.00  ? 54  GLU A HG2    3  
ATOM   5827  H HG3    . GLU A 1 54  ? 9.400   6.158   -29.063 1.00 0.00  ? 54  GLU A HG3    3  
ATOM   5828  H HE2    . GLU A 1 54  ? 8.150   2.913   -30.313 1.00 0.00  ? 54  GLU A HE2    3  
ATOM   5829  N N      . ASP A 1 55  ? 9.708   7.093   -25.857 1.00 0.00  ? 55  ASP A N      3  
ATOM   5830  C CA     . ASP A 1 55  ? 9.103   7.631   -24.646 1.00 0.00  ? 55  ASP A CA     3  
ATOM   5831  C C      . ASP A 1 55  ? 8.070   6.659   -24.093 1.00 0.00  ? 55  ASP A C      3  
ATOM   5832  O O      . ASP A 1 55  ? 7.590   5.775   -24.805 1.00 0.00  ? 55  ASP A O      3  
ATOM   5833  C CB     . ASP A 1 55  ? 8.448   8.983   -24.917 1.00 0.00  ? 55  ASP A CB     3  
ATOM   5834  C CG     . ASP A 1 55  ? 7.822   9.591   -23.676 1.00 0.00  ? 55  ASP A CG     3  
ATOM   5835  O OD1    . ASP A 1 55  ? 8.573   10.111  -22.826 1.00 0.00  ? 55  ASP A OD1    3  
ATOM   5836  O OD2    . ASP A 1 55  ? 6.580   9.544   -23.556 1.00 0.00  ? 55  ASP A OD2    3  
ATOM   5837  H H      . ASP A 1 55  ? 9.406   7.417   -26.731 1.00 0.00  ? 55  ASP A H      3  
ATOM   5838  H HA     . ASP A 1 55  ? 9.886   7.761   -23.915 1.00 0.00  ? 55  ASP A HA     3  
ATOM   5839  H HB2    . ASP A 1 55  ? 9.188   9.667   -25.294 1.00 0.00  ? 55  ASP A HB2    3  
ATOM   5840  H HB3    . ASP A 1 55  ? 7.681   8.855   -25.655 1.00 0.00  ? 55  ASP A HB3    3  
ATOM   5841  H HD2    . ASP A 1 55  ? 6.252   9.947   -22.747 1.00 0.00  ? 55  ASP A HD2    3  
ATOM   5842  N N      . ASP A 1 56  ? 7.738   6.826   -22.824 1.00 0.00  ? 56  ASP A N      3  
ATOM   5843  C CA     . ASP A 1 56  ? 6.766   5.955   -22.174 1.00 0.00  ? 56  ASP A CA     3  
ATOM   5844  C C      . ASP A 1 56  ? 5.352   6.229   -22.680 1.00 0.00  ? 56  ASP A C      3  
ATOM   5845  O O      . ASP A 1 56  ? 4.710   5.349   -23.259 1.00 0.00  ? 56  ASP A O      3  
ATOM   5846  C CB     . ASP A 1 56  ? 6.820   6.129   -20.655 1.00 0.00  ? 56  ASP A CB     3  
ATOM   5847  C CG     . ASP A 1 56  ? 8.109   5.604   -20.055 1.00 0.00  ? 56  ASP A CG     3  
ATOM   5848  O OD1    . ASP A 1 56  ? 8.200   4.379   -19.826 1.00 0.00  ? 56  ASP A OD1    3  
ATOM   5849  O OD2    . ASP A 1 56  ? 9.027   6.415   -19.811 1.00 0.00  ? 56  ASP A OD2    3  
ATOM   5850  H H      . ASP A 1 56  ? 8.159   7.547   -22.312 1.00 0.00  ? 56  ASP A H      3  
ATOM   5851  H HA     . ASP A 1 56  ? 7.027   4.936   -22.415 1.00 0.00  ? 56  ASP A HA     3  
ATOM   5852  H HB2    . ASP A 1 56  ? 6.732   7.179   -20.414 1.00 0.00  ? 56  ASP A HB2    3  
ATOM   5853  H HB3    . ASP A 1 56  ? 5.997   5.591   -20.213 1.00 0.00  ? 56  ASP A HB3    3  
ATOM   5854  H HD2    . ASP A 1 56  ? 9.811   6.014   -19.431 1.00 0.00  ? 56  ASP A HD2    3  
ATOM   5855  N N      . LEU A 1 57  ? 4.864   7.444   -22.455 1.00 0.00  ? 57  LEU A N      3  
ATOM   5856  C CA     . LEU A 1 57  ? 3.520   7.814   -22.889 1.00 0.00  ? 57  LEU A CA     3  
ATOM   5857  C C      . LEU A 1 57  ? 3.388   7.740   -24.405 1.00 0.00  ? 57  LEU A C      3  
ATOM   5858  O O      . LEU A 1 57  ? 2.369   7.287   -24.922 1.00 0.00  ? 57  LEU A O      3  
ATOM   5859  C CB     . LEU A 1 57  ? 3.163   9.224   -22.406 1.00 0.00  ? 57  LEU A CB     3  
ATOM   5860  C CG     . LEU A 1 57  ? 1.786   9.734   -22.852 1.00 0.00  ? 57  LEU A CG     3  
ATOM   5861  C CD1    . LEU A 1 57  ? 0.700   8.716   -22.533 1.00 0.00  ? 57  LEU A CD1    3  
ATOM   5862  C CD2    . LEU A 1 57  ? 1.467   11.070  -22.199 1.00 0.00  ? 57  LEU A CD2    3  
ATOM   5863  H H      . LEU A 1 57  ? 5.414   8.104   -21.985 1.00 0.00  ? 57  LEU A H      3  
ATOM   5864  H HA     . LEU A 1 57  ? 2.831   7.113   -22.449 1.00 0.00  ? 57  LEU A HA     3  
ATOM   5865  H HB2    . LEU A 1 57  ? 3.195   9.229   -21.328 1.00 0.00  ? 57  LEU A HB2    3  
ATOM   5866  H HB3    . LEU A 1 57  ? 3.910   9.907   -22.777 1.00 0.00  ? 57  LEU A HB3    3  
ATOM   5867  H HG     . LEU A 1 57  ? 1.796   9.879   -23.920 1.00 0.00  ? 57  LEU A HG     3  
ATOM   5868  H HD11   . LEU A 1 57  ? 0.455   8.772   -21.486 1.00 0.00  ? 57  LEU A HD11   3  
ATOM   5869  H HD12   . LEU A 1 57  ? 1.055   7.724   -22.768 1.00 0.00  ? 57  LEU A HD12   3  
ATOM   5870  H HD13   . LEU A 1 57  ? -0.179  8.933   -23.121 1.00 0.00  ? 57  LEU A HD13   3  
ATOM   5871  H HD21   . LEU A 1 57  ? 0.462   11.367  -22.462 1.00 0.00  ? 57  LEU A HD21   3  
ATOM   5872  H HD22   . LEU A 1 57  ? 2.166   11.818  -22.544 1.00 0.00  ? 57  LEU A HD22   3  
ATOM   5873  H HD23   . LEU A 1 57  ? 1.543   10.973  -21.126 1.00 0.00  ? 57  LEU A HD23   3  
ATOM   5874  N N      . GLU A 1 58  ? 4.421   8.185   -25.113 1.00 0.00  ? 58  GLU A N      3  
ATOM   5875  C CA     . GLU A 1 58  ? 4.409   8.167   -26.576 1.00 0.00  ? 58  GLU A CA     3  
ATOM   5876  C C      . GLU A 1 58  ? 4.010   6.792   -27.095 1.00 0.00  ? 58  GLU A C      3  
ATOM   5877  O O      . GLU A 1 58  ? 3.184   6.682   -27.997 1.00 0.00  ? 58  GLU A O      3  
ATOM   5878  C CB     . GLU A 1 58  ? 5.782   8.554   -27.128 1.00 0.00  ? 58  GLU A CB     3  
ATOM   5879  C CG     . GLU A 1 58  ? 5.893   10.014  -27.543 1.00 0.00  ? 58  GLU A CG     3  
ATOM   5880  C CD     . GLU A 1 58  ? 7.201   10.656  -27.116 1.00 0.00  ? 58  GLU A CD     3  
ATOM   5881  O OE1    . GLU A 1 58  ? 8.251   10.307  -27.698 1.00 0.00  ? 58  GLU A OE1    3  
ATOM   5882  O OE2    . GLU A 1 58  ? 7.175   11.507  -26.203 1.00 0.00  ? 58  GLU A OE2    3  
ATOM   5883  H H      . GLU A 1 58  ? 5.206   8.535   -24.645 1.00 0.00  ? 58  GLU A H      3  
ATOM   5884  H HA     . GLU A 1 58  ? 3.676   8.891   -26.911 1.00 0.00  ? 58  GLU A HA     3  
ATOM   5885  H HB2    . GLU A 1 58  ? 6.522   8.358   -26.373 1.00 0.00  ? 58  GLU A HB2    3  
ATOM   5886  H HB3    . GLU A 1 58  ? 5.998   7.942   -27.990 1.00 0.00  ? 58  GLU A HB3    3  
ATOM   5887  H HG2    . GLU A 1 58  ? 5.821   10.073  -28.616 1.00 0.00  ? 58  GLU A HG2    3  
ATOM   5888  H HG3    . GLU A 1 58  ? 5.078   10.564  -27.096 1.00 0.00  ? 58  GLU A HG3    3  
ATOM   5889  H HE2    . GLU A 1 58  ? 8.036   11.872  -25.986 1.00 0.00  ? 58  GLU A HE2    3  
ATOM   5890  N N      . THR A 1 59  ? 4.583   5.741   -26.515 1.00 0.00  ? 59  THR A N      3  
ATOM   5891  C CA     . THR A 1 59  ? 4.250   4.385   -26.930 1.00 0.00  ? 59  THR A CA     3  
ATOM   5892  C C      . THR A 1 59  ? 2.763   4.134   -26.720 1.00 0.00  ? 59  THR A C      3  
ATOM   5893  O O      . THR A 1 59  ? 2.092   3.557   -27.576 1.00 0.00  ? 59  THR A O      3  
ATOM   5894  C CB     . THR A 1 59  ? 5.089   3.357   -26.165 1.00 0.00  ? 59  THR A CB     3  
ATOM   5895  O OG1    . THR A 1 59  ? 6.464   3.540   -26.447 1.00 0.00  ? 59  THR A OG1    3  
ATOM   5896  C CG2    . THR A 1 59  ? 4.744   1.922   -26.508 1.00 0.00  ? 59  THR A CG2    3  
ATOM   5897  H H      . THR A 1 59  ? 5.230   5.881   -25.790 1.00 0.00  ? 59  THR A H      3  
ATOM   5898  H HA     . THR A 1 59  ? 4.469   4.302   -27.984 1.00 0.00  ? 59  THR A HA     3  
ATOM   5899  H HB     . THR A 1 59  ? 4.937   3.491   -25.103 1.00 0.00  ? 59  THR A HB     3  
ATOM   5900  H HG1    . THR A 1 59  ? 6.632   3.333   -27.369 1.00 0.00  ? 59  THR A HG1    3  
ATOM   5901  H HG21   . THR A 1 59  ? 5.057   1.708   -27.519 1.00 0.00  ? 59  THR A HG21   3  
ATOM   5902  H HG22   . THR A 1 59  ? 3.679   1.775   -26.422 1.00 0.00  ? 59  THR A HG22   3  
ATOM   5903  H HG23   . THR A 1 59  ? 5.254   1.257   -25.827 1.00 0.00  ? 59  THR A HG23   3  
ATOM   5904  N N      . ALA A 1 60  ? 2.246   4.604   -25.588 1.00 0.00  ? 60  ALA A N      3  
ATOM   5905  C CA     . ALA A 1 60  ? 0.828   4.461   -25.287 1.00 0.00  ? 60  ALA A CA     3  
ATOM   5906  C C      . ALA A 1 60  ? 0.011   5.343   -26.222 1.00 0.00  ? 60  ALA A C      3  
ATOM   5907  O O      . ALA A 1 60  ? -1.117  5.010   -26.581 1.00 0.00  ? 60  ALA A O      3  
ATOM   5908  C CB     . ALA A 1 60  ? 0.550   4.821   -23.832 1.00 0.00  ? 60  ALA A CB     3  
ATOM   5909  H H      . ALA A 1 60  ? 2.828   5.079   -24.954 1.00 0.00  ? 60  ALA A H      3  
ATOM   5910  H HA     . ALA A 1 60  ? 0.552   3.427   -25.441 1.00 0.00  ? 60  ALA A HA     3  
ATOM   5911  H HB1    . ALA A 1 60  ? -0.455  5.209   -23.743 1.00 0.00  ? 60  ALA A HB1    3  
ATOM   5912  H HB2    . ALA A 1 60  ? 1.256   5.570   -23.506 1.00 0.00  ? 60  ALA A HB2    3  
ATOM   5913  H HB3    . ALA A 1 60  ? 0.651   3.940   -23.217 1.00 0.00  ? 60  ALA A HB3    3  
ATOM   5914  N N      . LEU A 1 61  ? 0.603   6.466   -26.619 1.00 0.00  ? 61  LEU A N      3  
ATOM   5915  C CA     . LEU A 1 61  ? -0.045  7.406   -27.524 1.00 0.00  ? 61  LEU A CA     3  
ATOM   5916  C C      . LEU A 1 61  ? -0.074  6.853   -28.941 1.00 0.00  ? 61  LEU A C      3  
ATOM   5917  O O      . LEU A 1 61  ? -1.125  6.789   -29.580 1.00 0.00  ? 61  LEU A O      3  
ATOM   5918  C CB     . LEU A 1 61  ? 0.712   8.730   -27.518 1.00 0.00  ? 61  LEU A CB     3  
ATOM   5919  C CG     . LEU A 1 61  ? 0.668   9.504   -26.206 1.00 0.00  ? 61  LEU A CG     3  
ATOM   5920  C CD1    . LEU A 1 61  ? 1.575   10.719  -26.301 1.00 0.00  ? 61  LEU A CD1    3  
ATOM   5921  C CD2    . LEU A 1 61  ? -0.760  9.906   -25.865 1.00 0.00  ? 61  LEU A CD2    3  
ATOM   5922  H H      . LEU A 1 61  ? 1.508   6.665   -26.301 1.00 0.00  ? 61  LEU A H      3  
ATOM   5923  H HA     . LEU A 1 61  ? -1.056  7.574   -27.183 1.00 0.00  ? 61  LEU A HA     3  
ATOM   5924  H HB2    . LEU A 1 61  ? 1.747   8.525   -27.748 1.00 0.00  ? 61  LEU A HB2    3  
ATOM   5925  H HB3    . LEU A 1 61  ? 0.312   9.361   -28.294 1.00 0.00  ? 61  LEU A HB3    3  
ATOM   5926  H HG     . LEU A 1 61  ? 1.036   8.875   -25.412 1.00 0.00  ? 61  LEU A HG     3  
ATOM   5927  H HD11   . LEU A 1 61  ? 1.011   11.562  -26.666 1.00 0.00  ? 61  LEU A HD11   3  
ATOM   5928  H HD12   . LEU A 1 61  ? 2.385   10.502  -26.984 1.00 0.00  ? 61  LEU A HD12   3  
ATOM   5929  H HD13   . LEU A 1 61  ? 1.978   10.948  -25.327 1.00 0.00  ? 61  LEU A HD13   3  
ATOM   5930  H HD21   . LEU A 1 61  ? -1.008  9.540   -24.881 1.00 0.00  ? 61  LEU A HD21   3  
ATOM   5931  H HD22   . LEU A 1 61  ? -1.440  9.479   -26.589 1.00 0.00  ? 61  LEU A HD22   3  
ATOM   5932  H HD23   . LEU A 1 61  ? -0.847  10.981  -25.882 1.00 0.00  ? 61  LEU A HD23   3  
ATOM   5933  N N      . ARG A 1 62  ? 1.096   6.445   -29.420 1.00 0.00  ? 62  ARG A N      3  
ATOM   5934  C CA     . ARG A 1 62  ? 1.230   5.887   -30.758 1.00 0.00  ? 62  ARG A CA     3  
ATOM   5935  C C      . ARG A 1 62  ? 0.359   4.644   -30.910 1.00 0.00  ? 62  ARG A C      3  
ATOM   5936  O O      . ARG A 1 62  ? -0.333  4.480   -31.914 1.00 0.00  ? 62  ARG A O      3  
ATOM   5937  C CB     . ARG A 1 62  ? 2.695   5.546   -31.040 1.00 0.00  ? 62  ARG A CB     3  
ATOM   5938  C CG     . ARG A 1 62  ? 3.350   6.470   -32.055 1.00 0.00  ? 62  ARG A CG     3  
ATOM   5939  C CD     . ARG A 1 62  ? 4.827   6.149   -32.230 1.00 0.00  ? 62  ARG A CD     3  
ATOM   5940  N NE     . ARG A 1 62  ? 5.108   5.567   -33.540 1.00 0.00  ? 62  ARG A NE     3  
ATOM   5941  C CZ     . ARG A 1 62  ? 6.121   4.735   -33.785 1.00 0.00  ? 62  ARG A CZ     3  
ATOM   5942  N NH1    . ARG A 1 62  ? 6.954   4.387   -32.811 1.00 0.00  ? 62  ARG A NH1    3  
ATOM   5943  N NH2    . ARG A 1 62  ? 6.302   4.253   -35.007 1.00 0.00  ? 62  ARG A NH2    3  
ATOM   5944  H H      . ARG A 1 62  ? 1.892   6.526   -28.855 1.00 0.00  ? 62  ARG A H      3  
ATOM   5945  H HA     . ARG A 1 62  ? 0.901   6.633   -31.466 1.00 0.00  ? 62  ARG A HA     3  
ATOM   5946  H HB2    . ARG A 1 62  ? 3.249   5.611   -30.116 1.00 0.00  ? 62  ARG A HB2    3  
ATOM   5947  H HB3    . ARG A 1 62  ? 2.754   4.534   -31.415 1.00 0.00  ? 62  ARG A HB3    3  
ATOM   5948  H HG2    . ARG A 1 62  ? 2.854   6.356   -33.007 1.00 0.00  ? 62  ARG A HG2    3  
ATOM   5949  H HG3    . ARG A 1 62  ? 3.252   7.490   -31.716 1.00 0.00  ? 62  ARG A HG3    3  
ATOM   5950  H HD2    . ARG A 1 62  ? 5.396   7.061   -32.122 1.00 0.00  ? 62  ARG A HD2    3  
ATOM   5951  H HD3    . ARG A 1 62  ? 5.122   5.450   -31.464 1.00 0.00  ? 62  ARG A HD3    3  
ATOM   5952  H HE     . ARG A 1 62  ? 4.509   5.806   -34.280 1.00 0.00  ? 62  ARG A HE     3  
ATOM   5953  H HH11   . ARG A 1 62  ? 6.827   4.746   -31.887 1.00 0.00  ? 62  ARG A HH11   3  
ATOM   5954  H HH12   . ARG A 1 62  ? 7.712   3.762   -33.004 1.00 0.00  ? 62  ARG A HH12   3  
ATOM   5955  H HH21   . ARG A 1 62  ? 5.678   4.514   -35.744 1.00 0.00  ? 62  ARG A HH21   3  
ATOM   5956  H HH22   . ARG A 1 62  ? 7.062   3.631   -35.191 1.00 0.00  ? 62  ARG A HH22   3  
ATOM   5957  N N      . ALA A 1 63  ? 0.383   3.778   -29.901 1.00 0.00  ? 63  ALA A N      3  
ATOM   5958  C CA     . ALA A 1 63  ? -0.421  2.565   -29.928 1.00 0.00  ? 63  ALA A CA     3  
ATOM   5959  C C      . ALA A 1 63  ? -1.895  2.919   -30.068 1.00 0.00  ? 63  ALA A C      3  
ATOM   5960  O O      . ALA A 1 63  ? -2.649  2.235   -30.759 1.00 0.00  ? 63  ALA A O      3  
ATOM   5961  C CB     . ALA A 1 63  ? -0.186  1.745   -28.670 1.00 0.00  ? 63  ALA A CB     3  
ATOM   5962  H H      . ALA A 1 63  ? 0.945   3.965   -29.121 1.00 0.00  ? 63  ALA A H      3  
ATOM   5963  H HA     . ALA A 1 63  ? -0.118  1.976   -30.781 1.00 0.00  ? 63  ALA A HA     3  
ATOM   5964  H HB1    . ALA A 1 63  ? 0.654   1.086   -28.826 1.00 0.00  ? 63  ALA A HB1    3  
ATOM   5965  H HB2    . ALA A 1 63  ? -1.066  1.159   -28.451 1.00 0.00  ? 63  ALA A HB2    3  
ATOM   5966  H HB3    . ALA A 1 63  ? 0.024   2.406   -27.843 1.00 0.00  ? 63  ALA A HB3    3  
ATOM   5967  N N      . THR A 1 64  ? -2.291  4.008   -29.414 1.00 0.00  ? 64  THR A N      3  
ATOM   5968  C CA     . THR A 1 64  ? -3.668  4.476   -29.467 1.00 0.00  ? 64  THR A CA     3  
ATOM   5969  C C      . THR A 1 64  ? -4.061  4.801   -30.903 1.00 0.00  ? 64  THR A C      3  
ATOM   5970  O O      . THR A 1 64  ? -5.053  4.290   -31.418 1.00 0.00  ? 64  THR A O      3  
ATOM   5971  C CB     . THR A 1 64  ? -3.846  5.717   -28.588 1.00 0.00  ? 64  THR A CB     3  
ATOM   5972  O OG1    . THR A 1 64  ? -3.390  5.471   -27.271 1.00 0.00  ? 64  THR A OG1    3  
ATOM   5973  C CG2    . THR A 1 64  ? -5.280  6.184   -28.491 1.00 0.00  ? 64  THR A CG2    3  
ATOM   5974  H H      . THR A 1 64  ? -1.634  4.511   -28.889 1.00 0.00  ? 64  THR A H      3  
ATOM   5975  H HA     . THR A 1 64  ? -4.305  3.689   -29.100 1.00 0.00  ? 64  THR A HA     3  
ATOM   5976  H HB     . THR A 1 64  ? -3.264  6.526   -29.005 1.00 0.00  ? 64  THR A HB     3  
ATOM   5977  H HG1    . THR A 1 64  ? -2.454  5.676   -27.214 1.00 0.00  ? 64  THR A HG1    3  
ATOM   5978  H HG21   . THR A 1 64  ? -5.320  7.109   -27.935 1.00 0.00  ? 64  THR A HG21   3  
ATOM   5979  H HG22   . THR A 1 64  ? -5.864  5.433   -27.985 1.00 0.00  ? 64  THR A HG22   3  
ATOM   5980  H HG23   . THR A 1 64  ? -5.678  6.341   -29.481 1.00 0.00  ? 64  THR A HG23   3  
ATOM   5981  N N      . GLN A 1 65  ? -3.267  5.649   -31.548 1.00 0.00  ? 65  GLN A N      3  
ATOM   5982  C CA     . GLN A 1 65  ? -3.525  6.037   -32.928 1.00 0.00  ? 65  GLN A CA     3  
ATOM   5983  C C      . GLN A 1 65  ? -3.193  4.896   -33.886 1.00 0.00  ? 65  GLN A C      3  
ATOM   5984  O O      . GLN A 1 65  ? -3.694  4.854   -35.011 1.00 0.00  ? 65  GLN A O      3  
ATOM   5985  C CB     . GLN A 1 65  ? -2.723  7.288   -33.295 1.00 0.00  ? 65  GLN A CB     3  
ATOM   5986  C CG     . GLN A 1 65  ? -1.262  7.220   -32.877 1.00 0.00  ? 65  GLN A CG     3  
ATOM   5987  C CD     . GLN A 1 65  ? -0.407  8.251   -33.587 1.00 0.00  ? 65  GLN A CD     3  
ATOM   5988  O OE1    . GLN A 1 65  ? -0.511  8.432   -34.800 1.00 0.00  ? 65  GLN A OE1    3  
ATOM   5989  N NE2    . GLN A 1 65  ? 0.448   8.931   -32.832 1.00 0.00  ? 65  GLN A NE2    3  
ATOM   5990  H H      . GLN A 1 65  ? -2.488  6.018   -31.084 1.00 0.00  ? 65  GLN A H      3  
ATOM   5991  H HA     . GLN A 1 65  ? -4.574  6.259   -33.013 1.00 0.00  ? 65  GLN A HA     3  
ATOM   5992  H HB2    . GLN A 1 65  ? -2.765  7.425   -34.364 1.00 0.00  ? 65  GLN A HB2    3  
ATOM   5993  H HB3    . GLN A 1 65  ? -3.176  8.144   -32.812 1.00 0.00  ? 65  GLN A HB3    3  
ATOM   5994  H HG2    . GLN A 1 65  ? -1.194  7.387   -31.814 1.00 0.00  ? 65  GLN A HG2    3  
ATOM   5995  H HG3    . GLN A 1 65  ? -0.882  6.238   -33.111 1.00 0.00  ? 65  GLN A HG3    3  
ATOM   5996  H HE21   . GLN A 1 65  ? 0.478   8.733   -31.873 1.00 0.00  ? 65  GLN A HE21   3  
ATOM   5997  H HE22   . GLN A 1 65  ? 1.013   9.605   -33.265 1.00 0.00  ? 65  GLN A HE22   3  
ATOM   5998  N N      . GLU A 1 66  ? -2.350  3.971   -33.437 1.00 0.00  ? 66  GLU A N      3  
ATOM   5999  C CA     . GLU A 1 66  ? -1.959  2.831   -34.257 1.00 0.00  ? 66  GLU A CA     3  
ATOM   6000  C C      . GLU A 1 66  ? -3.040  1.753   -34.256 1.00 0.00  ? 66  GLU A C      3  
ATOM   6001  O O      . GLU A 1 66  ? -3.336  1.161   -35.295 1.00 0.00  ? 66  GLU A O      3  
ATOM   6002  C CB     . GLU A 1 66  ? -0.639  2.244   -33.751 1.00 0.00  ? 66  GLU A CB     3  
ATOM   6003  C CG     . GLU A 1 66  ? 0.591   2.896   -34.359 1.00 0.00  ? 66  GLU A CG     3  
ATOM   6004  C CD     . GLU A 1 66  ? 0.904   2.369   -35.744 1.00 0.00  ? 66  GLU A CD     3  
ATOM   6005  O OE1    . GLU A 1 66  ? 0.842   1.137   -35.940 1.00 0.00  ? 66  GLU A OE1    3  
ATOM   6006  O OE2    . GLU A 1 66  ? 1.212   3.189   -36.637 1.00 0.00  ? 66  GLU A OE2    3  
ATOM   6007  H H      . GLU A 1 66  ? -1.983  4.058   -32.531 1.00 0.00  ? 66  GLU A H      3  
ATOM   6008  H HA     . GLU A 1 66  ? -1.819  3.184   -35.268 1.00 0.00  ? 66  GLU A HA     3  
ATOM   6009  H HB2    . GLU A 1 66  ? -0.593  2.363   -32.680 1.00 0.00  ? 66  GLU A HB2    3  
ATOM   6010  H HB3    . GLU A 1 66  ? -0.615  1.190   -33.989 1.00 0.00  ? 66  GLU A HB3    3  
ATOM   6011  H HG2    . GLU A 1 66  ? 0.424   3.963   -34.424 1.00 0.00  ? 66  GLU A HG2    3  
ATOM   6012  H HG3    . GLU A 1 66  ? 1.438   2.706   -33.716 1.00 0.00  ? 66  GLU A HG3    3  
ATOM   6013  H HE2    . GLU A 1 66  ? 1.397   2.786   -37.488 1.00 0.00  ? 66  GLU A HE2    3  
ATOM   6014  N N      . GLU A 1 67  ? -3.623  1.498   -33.086 1.00 0.00  ? 67  GLU A N      3  
ATOM   6015  C CA     . GLU A 1 67  ? -4.665  0.483   -32.959 1.00 0.00  ? 67  GLU A CA     3  
ATOM   6016  C C      . GLU A 1 67  ? -6.052  1.112   -32.793 1.00 0.00  ? 67  GLU A C      3  
ATOM   6017  O O      . GLU A 1 67  ? -7.042  0.400   -32.622 1.00 0.00  ? 67  GLU A O      3  
ATOM   6018  C CB     . GLU A 1 67  ? -4.369  -0.434  -31.771 1.00 0.00  ? 67  GLU A CB     3  
ATOM   6019  C CG     . GLU A 1 67  ? -3.362  -1.528  -32.082 1.00 0.00  ? 67  GLU A CG     3  
ATOM   6020  C CD     . GLU A 1 67  ? -1.948  -0.998  -32.206 1.00 0.00  ? 67  GLU A CD     3  
ATOM   6021  O OE1    . GLU A 1 67  ? -1.211  -1.472  -33.096 1.00 0.00  ? 67  GLU A OE1    3  
ATOM   6022  O OE2    . GLU A 1 67  ? -1.578  -0.106  -31.415 1.00 0.00  ? 67  GLU A OE2    3  
ATOM   6023  H H      . GLU A 1 67  ? -3.340  1.997   -32.294 1.00 0.00  ? 67  GLU A H      3  
ATOM   6024  H HA     . GLU A 1 67  ? -4.662  -0.107  -33.862 1.00 0.00  ? 67  GLU A HA     3  
ATOM   6025  H HB2    . GLU A 1 67  ? -3.980  0.160   -30.960 1.00 0.00  ? 67  GLU A HB2    3  
ATOM   6026  H HB3    . GLU A 1 67  ? -5.290  -0.902  -31.454 1.00 0.00  ? 67  GLU A HB3    3  
ATOM   6027  H HG2    . GLU A 1 67  ? -3.386  -2.258  -31.286 1.00 0.00  ? 67  GLU A HG2    3  
ATOM   6028  H HG3    . GLU A 1 67  ? -3.638  -2.003  -33.013 1.00 0.00  ? 67  GLU A HG3    3  
ATOM   6029  H HE2    . GLU A 1 67  ? -0.673  0.183   -31.550 1.00 0.00  ? 67  GLU A HE2    3  
ATOM   6030  N N      . ALA A 1 68  ? -6.125  2.441   -32.840 1.00 0.00  ? 68  ALA A N      3  
ATOM   6031  C CA     . ALA A 1 68  ? -7.403  3.131   -32.694 1.00 0.00  ? 68  ALA A CA     3  
ATOM   6032  C C      . ALA A 1 68  ? -7.489  4.383   -33.562 1.00 0.00  ? 68  ALA A C      3  
ATOM   6033  O O      . ALA A 1 68  ? -8.553  4.986   -33.674 1.00 0.00  ? 68  ALA A O      3  
ATOM   6034  C CB     . ALA A 1 68  ? -7.649  3.504   -31.245 1.00 0.00  ? 68  ALA A CB     3  
ATOM   6035  H H      . ALA A 1 68  ? -5.307  2.961   -32.971 1.00 0.00  ? 68  ALA A H      3  
ATOM   6036  H HA     . ALA A 1 68  ? -8.183  2.447   -32.995 1.00 0.00  ? 68  ALA A HA     3  
ATOM   6037  H HB1    . ALA A 1 68  ? -8.558  3.031   -30.903 1.00 0.00  ? 68  ALA A HB1    3  
ATOM   6038  H HB2    . ALA A 1 68  ? -7.749  4.577   -31.164 1.00 0.00  ? 68  ALA A HB2    3  
ATOM   6039  H HB3    . ALA A 1 68  ? -6.820  3.172   -30.640 1.00 0.00  ? 68  ALA A HB3    3  
ATOM   6040  N N      . GLY A 1 69  ? -6.380  4.783   -34.170 1.00 0.00  ? 69  GLY A N      3  
ATOM   6041  C CA     . GLY A 1 69  ? -6.389  5.969   -35.006 1.00 0.00  ? 69  GLY A CA     3  
ATOM   6042  C C      . GLY A 1 69  ? -6.491  7.258   -34.205 1.00 0.00  ? 69  GLY A C      3  
ATOM   6043  O O      . GLY A 1 69  ? -6.521  8.347   -34.780 1.00 0.00  ? 69  GLY A O      3  
ATOM   6044  H H      . GLY A 1 69  ? -5.553  4.279   -34.051 1.00 0.00  ? 69  GLY A H      3  
ATOM   6045  H HA2    . GLY A 1 69  ? -5.481  5.992   -35.590 1.00 0.00  ? 69  GLY A HA2    3  
ATOM   6046  H HA3    . GLY A 1 69  ? -7.233  5.909   -35.674 1.00 0.00  ? 69  GLY A HA3    3  
ATOM   6047  N N      . ILE A 1 70  ? -6.536  7.142   -32.878 1.00 0.00  ? 70  ILE A N      3  
ATOM   6048  C CA     . ILE A 1 70  ? -6.622  8.312   -32.014 1.00 0.00  ? 70  ILE A CA     3  
ATOM   6049  C C      . ILE A 1 70  ? -5.272  8.610   -31.368 1.00 0.00  ? 70  ILE A C      3  
ATOM   6050  O O      . ILE A 1 70  ? -4.694  7.763   -30.689 1.00 0.00  ? 70  ILE A O      3  
ATOM   6051  C CB     . ILE A 1 70  ? -7.692  8.141   -30.911 1.00 0.00  ? 70  ILE A CB     3  
ATOM   6052  C CG1    . ILE A 1 70  ? -8.946  7.452   -31.461 1.00 0.00  ? 70  ILE A CG1    3  
ATOM   6053  C CG2    . ILE A 1 70  ? -8.055  9.494   -30.323 1.00 0.00  ? 70  ILE A CG2    3  
ATOM   6054  C CD1    . ILE A 1 70  ? -9.748  6.714   -30.410 1.00 0.00  ? 70  ILE A CD1    3  
ATOM   6055  H H      . ILE A 1 70  ? -6.499  6.255   -32.470 1.00 0.00  ? 70  ILE A H      3  
ATOM   6056  H HA     . ILE A 1 70  ? -6.902  9.152   -32.626 1.00 0.00  ? 70  ILE A HA     3  
ATOM   6057  H HB     . ILE A 1 70  ? -7.272  7.534   -30.122 1.00 0.00  ? 70  ILE A HB     3  
ATOM   6058  H HG12   . ILE A 1 70  ? -9.593  8.197   -31.902 1.00 0.00  ? 70  ILE A HG12   3  
ATOM   6059  H HG13   . ILE A 1 70  ? -8.658  6.741   -32.221 1.00 0.00  ? 70  ILE A HG13   3  
ATOM   6060  H HG21   . ILE A 1 70  ? -8.751  9.358   -29.510 1.00 0.00  ? 70  ILE A HG21   3  
ATOM   6061  H HG22   . ILE A 1 70  ? -8.508  10.108  -31.087 1.00 0.00  ? 70  ILE A HG22   3  
ATOM   6062  H HG23   . ILE A 1 70  ? -7.162  9.978   -29.957 1.00 0.00  ? 70  ILE A HG23   3  
ATOM   6063  H HD11   . ILE A 1 70  ? -10.797 6.937   -30.534 1.00 0.00  ? 70  ILE A HD11   3  
ATOM   6064  H HD12   . ILE A 1 70  ? -9.427  7.023   -29.426 1.00 0.00  ? 70  ILE A HD12   3  
ATOM   6065  H HD13   . ILE A 1 70  ? -9.593  5.650   -30.521 1.00 0.00  ? 70  ILE A HD13   3  
ATOM   6066  N N      . GLU A 1 71  ? -4.764  9.817   -31.597 1.00 0.00  ? 71  GLU A N      3  
ATOM   6067  C CA     . GLU A 1 71  ? -3.475  10.221  -31.049 1.00 0.00  ? 71  GLU A CA     3  
ATOM   6068  C C      . GLU A 1 71  ? -3.642  11.223  -29.913 1.00 0.00  ? 71  GLU A C      3  
ATOM   6069  O O      . GLU A 1 71  ? -4.726  11.762  -29.702 1.00 0.00  ? 71  GLU A O      3  
ATOM   6070  C CB     . GLU A 1 71  ? -2.605  10.827  -32.151 1.00 0.00  ? 71  GLU A CB     3  
ATOM   6071  C CG     . GLU A 1 71  ? -3.138  12.144  -32.690 1.00 0.00  ? 71  GLU A CG     3  
ATOM   6072  C CD     . GLU A 1 71  ? -2.160  12.836  -33.620 1.00 0.00  ? 71  GLU A CD     3  
ATOM   6073  O OE1    . GLU A 1 71  ? -2.589  13.287  -34.704 1.00 0.00  ? 71  GLU A OE1    3  
ATOM   6074  O OE2    . GLU A 1 71  ? -0.967  12.925  -33.267 1.00 0.00  ? 71  GLU A OE2    3  
ATOM   6075  H H      . GLU A 1 71  ? -5.265  10.446  -32.152 1.00 0.00  ? 71  GLU A H      3  
ATOM   6076  H HA     . GLU A 1 71  ? -2.989  9.338   -30.667 1.00 0.00  ? 71  GLU A HA     3  
ATOM   6077  H HB2    . GLU A 1 71  ? -1.615  10.999  -31.756 1.00 0.00  ? 71  GLU A HB2    3  
ATOM   6078  H HB3    . GLU A 1 71  ? -2.539  10.125  -32.969 1.00 0.00  ? 71  GLU A HB3    3  
ATOM   6079  H HG2    . GLU A 1 71  ? -4.054  11.951  -33.234 1.00 0.00  ? 71  GLU A HG2    3  
ATOM   6080  H HG3    . GLU A 1 71  ? -3.348  12.799  -31.857 1.00 0.00  ? 71  GLU A HG3    3  
ATOM   6081  H HE2    . GLU A 1 71  ? -0.405  13.374  -33.902 1.00 0.00  ? 71  GLU A HE2    3  
ATOM   6082  N N      . ALA A 1 72  ? -2.553  11.476  -29.190 1.00 0.00  ? 72  ALA A N      3  
ATOM   6083  C CA     . ALA A 1 72  ? -2.565  12.420  -28.076 1.00 0.00  ? 72  ALA A CA     3  
ATOM   6084  C C      . ALA A 1 72  ? -3.252  13.727  -28.458 1.00 0.00  ? 72  ALA A C      3  
ATOM   6085  O O      . ALA A 1 72  ? -3.944  14.334  -27.643 1.00 0.00  ? 72  ALA A O      3  
ATOM   6086  C CB     . ALA A 1 72  ? -1.150  12.680  -27.603 1.00 0.00  ? 72  ALA A CB     3  
ATOM   6087  H H      . ALA A 1 72  ? -1.716  11.018  -29.414 1.00 0.00  ? 72  ALA A H      3  
ATOM   6088  H HA     . ALA A 1 72  ? -3.105  11.971  -27.261 1.00 0.00  ? 72  ALA A HA     3  
ATOM   6089  H HB1    . ALA A 1 72  ? -0.579  11.767  -27.682 1.00 0.00  ? 72  ALA A HB1    3  
ATOM   6090  H HB2    . ALA A 1 72  ? -1.171  13.002  -26.573 1.00 0.00  ? 72  ALA A HB2    3  
ATOM   6091  H HB3    . ALA A 1 72  ? -0.697  13.443  -28.215 1.00 0.00  ? 72  ALA A HB3    3  
ATOM   6092  N N      . GLY A 1 73  ? -3.065  14.151  -29.704 1.00 0.00  ? 73  GLY A N      3  
ATOM   6093  C CA     . GLY A 1 73  ? -3.689  15.377  -30.167 1.00 0.00  ? 73  GLY A CA     3  
ATOM   6094  C C      . GLY A 1 73  ? -5.185  15.217  -30.365 1.00 0.00  ? 73  GLY A C      3  
ATOM   6095  O O      . GLY A 1 73  ? -5.934  16.194  -30.340 1.00 0.00  ? 73  GLY A O      3  
ATOM   6096  H H      . GLY A 1 73  ? -2.509  13.624  -30.313 1.00 0.00  ? 73  GLY A H      3  
ATOM   6097  H HA2    . GLY A 1 73  ? -3.512  16.157  -29.441 1.00 0.00  ? 73  GLY A HA2    3  
ATOM   6098  H HA3    . GLY A 1 73  ? -3.241  15.665  -31.107 1.00 0.00  ? 73  GLY A HA3    3  
ATOM   6099  N N      . GLN A 1 74  ? -5.622  13.973  -30.556 1.00 0.00  ? 74  GLN A N      3  
ATOM   6100  C CA     . GLN A 1 74  ? -7.037  13.672  -30.751 1.00 0.00  ? 74  GLN A CA     3  
ATOM   6101  C C      . GLN A 1 74  ? -7.721  13.362  -29.420 1.00 0.00  ? 74  GLN A C      3  
ATOM   6102  O O      . GLN A 1 74  ? -8.942  13.220  -29.359 1.00 0.00  ? 74  GLN A O      3  
ATOM   6103  C CB     . GLN A 1 74  ? -7.203  12.492  -31.712 1.00 0.00  ? 74  GLN A CB     3  
ATOM   6104  C CG     . GLN A 1 74  ? -8.517  12.508  -32.475 1.00 0.00  ? 74  GLN A CG     3  
ATOM   6105  C CD     . GLN A 1 74  ? -8.323  12.410  -33.976 1.00 0.00  ? 74  GLN A CD     3  
ATOM   6106  O OE1    . GLN A 1 74  ? -8.813  13.250  -34.733 1.00 0.00  ? 74  GLN A OE1    3  
ATOM   6107  N NE2    . GLN A 1 74  ? -7.604  11.383  -34.416 1.00 0.00  ? 74  GLN A NE2    3  
ATOM   6108  H H      . GLN A 1 74  ? -4.978  13.236  -30.560 1.00 0.00  ? 74  GLN A H      3  
ATOM   6109  H HA     . GLN A 1 74  ? -7.503  14.544  -31.185 1.00 0.00  ? 74  GLN A HA     3  
ATOM   6110  H HB2    . GLN A 1 74  ? -6.394  12.512  -32.429 1.00 0.00  ? 74  GLN A HB2    3  
ATOM   6111  H HB3    . GLN A 1 74  ? -7.149  11.576  -31.147 1.00 0.00  ? 74  GLN A HB3    3  
ATOM   6112  H HG2    . GLN A 1 74  ? -9.118  11.672  -32.150 1.00 0.00  ? 74  GLN A HG2    3  
ATOM   6113  H HG3    . GLN A 1 74  ? -9.037  13.430  -32.253 1.00 0.00  ? 74  GLN A HG3    3  
ATOM   6114  H HE21   . GLN A 1 74  ? -7.244  10.754  -33.757 1.00 0.00  ? 74  GLN A HE21   3  
ATOM   6115  H HE22   . GLN A 1 74  ? -7.464  11.296  -35.382 1.00 0.00  ? 74  GLN A HE22   3  
ATOM   6116  N N      . LEU A 1 75  ? -6.929  13.278  -28.351 1.00 0.00  ? 75  LEU A N      3  
ATOM   6117  C CA     . LEU A 1 75  ? -7.463  13.012  -27.021 1.00 0.00  ? 75  LEU A CA     3  
ATOM   6118  C C      . LEU A 1 75  ? -6.810  13.934  -25.996 1.00 0.00  ? 75  LEU A C      3  
ATOM   6119  O O      . LEU A 1 75  ? -6.011  14.801  -26.346 1.00 0.00  ? 75  LEU A O      3  
ATOM   6120  C CB     . LEU A 1 75  ? -7.268  11.542  -26.600 1.00 0.00  ? 75  LEU A CB     3  
ATOM   6121  C CG     . LEU A 1 75  ? -6.348  10.694  -27.485 1.00 0.00  ? 75  LEU A CG     3  
ATOM   6122  C CD1    . LEU A 1 75  ? -4.948  10.642  -26.900 1.00 0.00  ? 75  LEU A CD1    3  
ATOM   6123  C CD2    . LEU A 1 75  ? -6.907  9.289   -27.635 1.00 0.00  ? 75  LEU A CD2    3  
ATOM   6124  H H      . LEU A 1 75  ? -5.966  13.416  -28.456 1.00 0.00  ? 75  LEU A H      3  
ATOM   6125  H HA     . LEU A 1 75  ? -8.521  13.227  -27.050 1.00 0.00  ? 75  LEU A HA     3  
ATOM   6126  H HB2    . LEU A 1 75  ? -6.867  11.532  -25.599 1.00 0.00  ? 75  LEU A HB2    3  
ATOM   6127  H HB3    . LEU A 1 75  ? -8.238  11.071  -26.578 1.00 0.00  ? 75  LEU A HB3    3  
ATOM   6128  H HG     . LEU A 1 75  ? -6.286  11.136  -28.465 1.00 0.00  ? 75  LEU A HG     3  
ATOM   6129  H HD11   . LEU A 1 75  ? -4.862  9.786   -26.241 1.00 0.00  ? 75  LEU A HD11   3  
ATOM   6130  H HD12   . LEU A 1 75  ? -4.756  11.546  -26.343 1.00 0.00  ? 75  LEU A HD12   3  
ATOM   6131  H HD13   . LEU A 1 75  ? -4.227  10.552  -27.699 1.00 0.00  ? 75  LEU A HD13   3  
ATOM   6132  H HD21   . LEU A 1 75  ? -6.668  8.710   -26.756 1.00 0.00  ? 75  LEU A HD21   3  
ATOM   6133  H HD22   . LEU A 1 75  ? -6.472  8.820   -28.507 1.00 0.00  ? 75  LEU A HD22   3  
ATOM   6134  H HD23   . LEU A 1 75  ? -7.976  9.342   -27.751 1.00 0.00  ? 75  LEU A HD23   3  
ATOM   6135  N N      . THR A 1 76  ? -7.155  13.737  -24.733 1.00 0.00  ? 76  THR A N      3  
ATOM   6136  C CA     . THR A 1 76  ? -6.607  14.545  -23.648 1.00 0.00  ? 76  THR A CA     3  
ATOM   6137  C C      . THR A 1 76  ? -5.959  13.658  -22.588 1.00 0.00  ? 76  THR A C      3  
ATOM   6138  O O      . THR A 1 76  ? -6.651  13.035  -21.786 1.00 0.00  ? 76  THR A O      3  
ATOM   6139  C CB     . THR A 1 76  ? -7.704  15.401  -23.015 1.00 0.00  ? 76  THR A CB     3  
ATOM   6140  O OG1    . THR A 1 76  ? -8.277  16.273  -23.969 1.00 0.00  ? 76  THR A OG1    3  
ATOM   6141  C CG2    . THR A 1 76  ? -7.216  16.245  -21.859 1.00 0.00  ? 76  THR A CG2    3  
ATOM   6142  H H      . THR A 1 76  ? -7.794  13.030  -24.524 1.00 0.00  ? 76  THR A H      3  
ATOM   6143  H HA     . THR A 1 76  ? -5.851  15.194  -24.066 1.00 0.00  ? 76  THR A HA     3  
ATOM   6144  H HB     . THR A 1 76  ? -8.481  14.750  -22.641 1.00 0.00  ? 76  THR A HB     3  
ATOM   6145  H HG1    . THR A 1 76  ? -9.121  16.597  -23.641 1.00 0.00  ? 76  THR A HG1    3  
ATOM   6146  H HG21   . THR A 1 76  ? -7.348  17.290  -22.095 1.00 0.00  ? 76  THR A HG21   3  
ATOM   6147  H HG22   . THR A 1 76  ? -6.170  16.046  -21.684 1.00 0.00  ? 76  THR A HG22   3  
ATOM   6148  H HG23   . THR A 1 76  ? -7.781  16.001  -20.972 1.00 0.00  ? 76  THR A HG23   3  
ATOM   6149  N N      . ILE A 1 77  ? -4.632  13.603  -22.593 1.00 0.00  ? 77  ILE A N      3  
ATOM   6150  C CA     . ILE A 1 77  ? -3.901  12.784  -21.633 1.00 0.00  ? 77  ILE A CA     3  
ATOM   6151  C C      . ILE A 1 77  ? -3.835  13.451  -20.262 1.00 0.00  ? 77  ILE A C      3  
ATOM   6152  O O      . ILE A 1 77  ? -3.147  14.455  -20.080 1.00 0.00  ? 77  ILE A O      3  
ATOM   6153  C CB     . ILE A 1 77  ? -2.467  12.482  -22.119 1.00 0.00  ? 77  ILE A CB     3  
ATOM   6154  C CG1    . ILE A 1 77  ? -2.481  12.069  -23.593 1.00 0.00  ? 77  ILE A CG1    3  
ATOM   6155  C CG2    . ILE A 1 77  ? -1.836  11.391  -21.267 1.00 0.00  ? 77  ILE A CG2    3  
ATOM   6156  C CD1    . ILE A 1 77  ? -3.175  10.749  -23.842 1.00 0.00  ? 77  ILE A CD1    3  
ATOM   6157  H H      . ILE A 1 77  ? -4.133  14.122  -23.257 1.00 0.00  ? 77  ILE A H      3  
ATOM   6158  H HA     . ILE A 1 77  ? -4.425  11.845  -21.536 1.00 0.00  ? 77  ILE A HA     3  
ATOM   6159  H HB     . ILE A 1 77  ? -1.876  13.378  -22.009 1.00 0.00  ? 77  ILE A HB     3  
ATOM   6160  H HG12   . ILE A 1 77  ? -2.990  12.826  -24.171 1.00 0.00  ? 77  ILE A HG12   3  
ATOM   6161  H HG13   . ILE A 1 77  ? -1.462  11.980  -23.945 1.00 0.00  ? 77  ILE A HG13   3  
ATOM   6162  H HG21   . ILE A 1 77  ? -0.816  11.659  -21.039 1.00 0.00  ? 77  ILE A HG21   3  
ATOM   6163  H HG22   . ILE A 1 77  ? -1.850  10.454  -21.808 1.00 0.00  ? 77  ILE A HG22   3  
ATOM   6164  H HG23   . ILE A 1 77  ? -2.393  11.282  -20.347 1.00 0.00  ? 77  ILE A HG23   3  
ATOM   6165  H HD11   . ILE A 1 77  ? -3.503  10.700  -24.871 1.00 0.00  ? 77  ILE A HD11   3  
ATOM   6166  H HD12   . ILE A 1 77  ? -4.030  10.667  -23.190 1.00 0.00  ? 77  ILE A HD12   3  
ATOM   6167  H HD13   . ILE A 1 77  ? -2.488  9.939   -23.642 1.00 0.00  ? 77  ILE A HD13   3  
ATOM   6168  N N      . ILE A 1 78  ? -4.557  12.882  -19.299 1.00 0.00  ? 78  ILE A N      3  
ATOM   6169  C CA     . ILE A 1 78  ? -4.583  13.419  -17.942 1.00 0.00  ? 78  ILE A CA     3  
ATOM   6170  C C      . ILE A 1 78  ? -3.261  13.146  -17.228 1.00 0.00  ? 78  ILE A C      3  
ATOM   6171  O O      . ILE A 1 78  ? -2.687  12.064  -17.347 1.00 0.00  ? 78  ILE A O      3  
ATOM   6172  C CB     . ILE A 1 78  ? -5.776  12.846  -17.132 1.00 0.00  ? 78  ILE A CB     3  
ATOM   6173  C CG1    . ILE A 1 78  ? -6.863  13.908  -16.981 1.00 0.00  ? 78  ILE A CG1    3  
ATOM   6174  C CG2    . ILE A 1 78  ? -5.344  12.333  -15.760 1.00 0.00  ? 78  ILE A CG2    3  
ATOM   6175  C CD1    . ILE A 1 78  ? -7.449  14.369  -18.296 1.00 0.00  ? 78  ILE A CD1    3  
ATOM   6176  H H      . ILE A 1 78  ? -5.082  12.082  -19.505 1.00 0.00  ? 78  ILE A H      3  
ATOM   6177  H HA     . ILE A 1 78  ? -4.713  14.488  -18.021 1.00 0.00  ? 78  ILE A HA     3  
ATOM   6178  H HB     . ILE A 1 78  ? -6.183  12.014  -17.685 1.00 0.00  ? 78  ILE A HB     3  
ATOM   6179  H HG12   . ILE A 1 78  ? -7.662  13.509  -16.382 1.00 0.00  ? 78  ILE A HG12   3  
ATOM   6180  H HG13   . ILE A 1 78  ? -6.450  14.767  -16.482 1.00 0.00  ? 78  ILE A HG13   3  
ATOM   6181  H HG21   . ILE A 1 78  ? -6.217  12.034  -15.199 1.00 0.00  ? 78  ILE A HG21   3  
ATOM   6182  H HG22   . ILE A 1 78  ? -4.828  13.117  -15.229 1.00 0.00  ? 78  ILE A HG22   3  
ATOM   6183  H HG23   . ILE A 1 78  ? -4.687  11.485  -15.882 1.00 0.00  ? 78  ILE A HG23   3  
ATOM   6184  H HD11   . ILE A 1 78  ? -8.359  14.922  -18.112 1.00 0.00  ? 78  ILE A HD11   3  
ATOM   6185  H HD12   . ILE A 1 78  ? -7.669  13.510  -18.912 1.00 0.00  ? 78  ILE A HD12   3  
ATOM   6186  H HD13   . ILE A 1 78  ? -6.738  15.004  -18.803 1.00 0.00  ? 78  ILE A HD13   3  
ATOM   6187  N N      . GLU A 1 79  ? -2.785  14.146  -16.498 1.00 0.00  ? 79  GLU A N      3  
ATOM   6188  C CA     . GLU A 1 79  ? -1.525  14.034  -15.769 1.00 0.00  ? 79  GLU A CA     3  
ATOM   6189  C C      . GLU A 1 79  ? -1.752  13.598  -14.327 1.00 0.00  ? 79  GLU A C      3  
ATOM   6190  O O      . GLU A 1 79  ? -2.776  13.920  -13.723 1.00 0.00  ? 79  GLU A O      3  
ATOM   6191  C CB     . GLU A 1 79  ? -0.778  15.368  -15.795 1.00 0.00  ? 79  GLU A CB     3  
ATOM   6192  C CG     . GLU A 1 79  ? -0.623  15.956  -17.189 1.00 0.00  ? 79  GLU A CG     3  
ATOM   6193  C CD     . GLU A 1 79  ? -0.380  17.452  -17.163 1.00 0.00  ? 79  GLU A CD     3  
ATOM   6194  O OE1    . GLU A 1 79  ? 0.499   17.924  -17.914 1.00 0.00  ? 79  GLU A OE1    3  
ATOM   6195  O OE2    . GLU A 1 79  ? -1.070  18.154  -16.389 1.00 0.00  ? 79  GLU A OE2    3  
ATOM   6196  H H      . GLU A 1 79  ? -3.295  14.984  -16.451 1.00 0.00  ? 79  GLU A H      3  
ATOM   6197  H HA     . GLU A 1 79  ? -0.923  13.288  -16.265 1.00 0.00  ? 79  GLU A HA     3  
ATOM   6198  H HB2    . GLU A 1 79  ? -1.315  16.080  -15.185 1.00 0.00  ? 79  GLU A HB2    3  
ATOM   6199  H HB3    . GLU A 1 79  ? 0.209   15.224  -15.378 1.00 0.00  ? 79  GLU A HB3    3  
ATOM   6200  H HG2    . GLU A 1 79  ? 0.214   15.480  -17.677 1.00 0.00  ? 79  GLU A HG2    3  
ATOM   6201  H HG3    . GLU A 1 79  ? -1.525  15.760  -17.751 1.00 0.00  ? 79  GLU A HG3    3  
ATOM   6202  H HE2    . GLU A 1 79  ? -0.863  19.090  -16.424 1.00 0.00  ? 79  GLU A HE2    3  
ATOM   6203  N N      . GLY A 1 80  ? -0.787  12.870  -13.775 1.00 0.00  ? 80  GLY A N      3  
ATOM   6204  C CA     . GLY A 1 80  ? -0.897  12.409  -12.404 1.00 0.00  ? 80  GLY A CA     3  
ATOM   6205  C C      . GLY A 1 80  ? -1.276  10.945  -12.307 1.00 0.00  ? 80  GLY A C      3  
ATOM   6206  O O      . GLY A 1 80  ? -1.013  10.296  -11.293 1.00 0.00  ? 80  GLY A O      3  
ATOM   6207  H H      . GLY A 1 80  ? 0.010   12.649  -14.301 1.00 0.00  ? 80  GLY A H      3  
ATOM   6208  H HA2    . GLY A 1 80  ? 0.051   12.557  -11.908 1.00 0.00  ? 80  GLY A HA2    3  
ATOM   6209  H HA3    . GLY A 1 80  ? -1.650  12.998  -11.900 1.00 0.00  ? 80  GLY A HA3    3  
ATOM   6210  N N      . PHE A 1 81  ? -1.900  10.422  -13.356 1.00 0.00  ? 81  PHE A N      3  
ATOM   6211  C CA     . PHE A 1 81  ? -2.319  9.026   -13.375 1.00 0.00  ? 81  PHE A CA     3  
ATOM   6212  C C      . PHE A 1 81  ? -1.344  8.172   -14.177 1.00 0.00  ? 81  PHE A C      3  
ATOM   6213  O O      . PHE A 1 81  ? -1.064  8.457   -15.342 1.00 0.00  ? 81  PHE A O      3  
ATOM   6214  C CB     . PHE A 1 81  ? -3.722  8.905   -13.969 1.00 0.00  ? 81  PHE A CB     3  
ATOM   6215  C CG     . PHE A 1 81  ? -4.271  7.506   -13.945 1.00 0.00  ? 81  PHE A CG     3  
ATOM   6216  C CD1    . PHE A 1 81  ? -3.892  6.582   -14.906 1.00 0.00  ? 81  PHE A CD1    3  
ATOM   6217  C CD2    . PHE A 1 81  ? -5.164  7.118   -12.962 1.00 0.00  ? 81  PHE A CD2    3  
ATOM   6218  C CE1    . PHE A 1 81  ? -4.396  5.295   -14.886 1.00 0.00  ? 81  PHE A CE1    3  
ATOM   6219  C CE2    . PHE A 1 81  ? -5.673  5.834   -12.937 1.00 0.00  ? 81  PHE A CE2    3  
ATOM   6220  C CZ     . PHE A 1 81  ? -5.288  4.920   -13.900 1.00 0.00  ? 81  PHE A CZ     3  
ATOM   6221  H H      . PHE A 1 81  ? -2.088  10.989  -14.134 1.00 0.00  ? 81  PHE A H      3  
ATOM   6222  H HA     . PHE A 1 81  ? -2.337  8.670   -12.354 1.00 0.00  ? 81  PHE A HA     3  
ATOM   6223  H HB2    . PHE A 1 81  ? -4.397  9.535   -13.410 1.00 0.00  ? 81  PHE A HB2    3  
ATOM   6224  H HB3    . PHE A 1 81  ? -3.697  9.237   -14.997 1.00 0.00  ? 81  PHE A HB3    3  
ATOM   6225  H HD1    . PHE A 1 81  ? -3.195  6.875   -15.678 1.00 0.00  ? 81  PHE A HD1    3  
ATOM   6226  H HD2    . PHE A 1 81  ? -5.468  7.831   -12.210 1.00 0.00  ? 81  PHE A HD2    3  
ATOM   6227  H HE1    . PHE A 1 81  ? -4.097  4.581   -15.642 1.00 0.00  ? 81  PHE A HE1    3  
ATOM   6228  H HE2    . PHE A 1 81  ? -6.368  5.546   -12.165 1.00 0.00  ? 81  PHE A HE2    3  
ATOM   6229  H HZ     . PHE A 1 81  ? -5.685  3.916   -13.881 1.00 0.00  ? 81  PHE A HZ     3  
ATOM   6230  N N      . LYS A 1 82  ? -0.831  7.118   -13.549 1.00 0.00  ? 82  LYS A N      3  
ATOM   6231  C CA     . LYS A 1 82  ? 0.108   6.219   -14.209 1.00 0.00  ? 82  LYS A CA     3  
ATOM   6232  C C      . LYS A 1 82  ? 0.124   4.850   -13.542 1.00 0.00  ? 82  LYS A C      3  
ATOM   6233  O O      . LYS A 1 82  ? 0.330   4.732   -12.334 1.00 0.00  ? 82  LYS A O      3  
ATOM   6234  C CB     . LYS A 1 82  ? 1.519   6.808   -14.207 1.00 0.00  ? 82  LYS A CB     3  
ATOM   6235  C CG     . LYS A 1 82  ? 2.229   6.671   -15.542 1.00 0.00  ? 82  LYS A CG     3  
ATOM   6236  C CD     . LYS A 1 82  ? 3.707   7.014   -15.428 1.00 0.00  ? 82  LYS A CD     3  
ATOM   6237  C CE     . LYS A 1 82  ? 4.425   6.096   -14.461 1.00 0.00  ? 82  LYS A CE     3  
ATOM   6238  N NZ     . LYS A 1 82  ? 5.037   6.842   -13.325 1.00 0.00  ? 82  LYS A NZ     3  
ATOM   6239  H H      . LYS A 1 82  ? -1.095  6.937   -12.622 1.00 0.00  ? 82  LYS A H      3  
ATOM   6240  H HA     . LYS A 1 82  ? -0.216  6.101   -15.232 1.00 0.00  ? 82  LYS A HA     3  
ATOM   6241  H HB2    . LYS A 1 82  ? 1.462   7.857   -13.957 1.00 0.00  ? 82  LYS A HB2    3  
ATOM   6242  H HB3    . LYS A 1 82  ? 2.105   6.297   -13.458 1.00 0.00  ? 82  LYS A HB3    3  
ATOM   6243  H HG2    . LYS A 1 82  ? 2.133   5.652   -15.886 1.00 0.00  ? 82  LYS A HG2    3  
ATOM   6244  H HG3    . LYS A 1 82  ? 1.767   7.338   -16.251 1.00 0.00  ? 82  LYS A HG3    3  
ATOM   6245  H HD2    . LYS A 1 82  ? 4.165   6.913   -16.399 1.00 0.00  ? 82  LYS A HD2    3  
ATOM   6246  H HD3    . LYS A 1 82  ? 3.805   8.034   -15.086 1.00 0.00  ? 82  LYS A HD3    3  
ATOM   6247  H HE2    . LYS A 1 82  ? 3.720   5.379   -14.071 1.00 0.00  ? 82  LYS A HE2    3  
ATOM   6248  H HE3    . LYS A 1 82  ? 5.205   5.575   -14.999 1.00 0.00  ? 82  LYS A HE3    3  
ATOM   6249  H HZ1    . LYS A 1 82  ? 4.872   7.864   -13.437 1.00 0.00  ? 82  LYS A HZ1    3  
ATOM   6250  H HZ2    . LYS A 1 82  ? 6.061   6.670   -13.294 1.00 0.00  ? 82  LYS A HZ2    3  
ATOM   6251  H HZ3    . LYS A 1 82  ? 4.618   6.530   -12.426 1.00 0.00  ? 82  LYS A HZ3    3  
ATOM   6252  N N      . ARG A 1 83  ? -0.088  3.821   -14.348 1.00 0.00  ? 83  ARG A N      3  
ATOM   6253  C CA     . ARG A 1 83  ? -0.096  2.450   -13.865 1.00 0.00  ? 83  ARG A CA     3  
ATOM   6254  C C      . ARG A 1 83  ? 0.283   1.494   -14.989 1.00 0.00  ? 83  ARG A C      3  
ATOM   6255  O O      . ARG A 1 83  ? -0.177  1.646   -16.120 1.00 0.00  ? 83  ARG A O      3  
ATOM   6256  C CB     . ARG A 1 83  ? -1.477  2.088   -13.317 1.00 0.00  ? 83  ARG A CB     3  
ATOM   6257  C CG     . ARG A 1 83  ? -1.441  1.041   -12.213 1.00 0.00  ? 83  ARG A CG     3  
ATOM   6258  C CD     . ARG A 1 83  ? -1.612  1.674   -10.841 1.00 0.00  ? 83  ARG A CD     3  
ATOM   6259  N NE     . ARG A 1 83  ? -0.629  1.174   -9.883  1.00 0.00  ? 83  ARG A NE     3  
ATOM   6260  C CZ     . ARG A 1 83  ? -0.154  1.887   -8.863  1.00 0.00  ? 83  ARG A CZ     3  
ATOM   6261  N NH1    . ARG A 1 83  ? -0.578  3.130   -8.653  1.00 0.00  ? 83  ARG A NH1    3  
ATOM   6262  N NH2    . ARG A 1 83  ? 0.743   1.356   -8.046  1.00 0.00  ? 83  ARG A NH2    3  
ATOM   6263  H H      . ARG A 1 83  ? -0.239  3.992   -15.300 1.00 0.00  ? 83  ARG A H      3  
ATOM   6264  H HA     . ARG A 1 83  ? 0.635   2.367   -13.072 1.00 0.00  ? 83  ARG A HA     3  
ATOM   6265  H HB2    . ARG A 1 83  ? -1.940  2.981   -12.922 1.00 0.00  ? 83  ARG A HB2    3  
ATOM   6266  H HB3    . ARG A 1 83  ? -2.085  1.706   -14.124 1.00 0.00  ? 83  ARG A HB3    3  
ATOM   6267  H HG2    . ARG A 1 83  ? -2.239  0.334   -12.375 1.00 0.00  ? 83  ARG A HG2    3  
ATOM   6268  H HG3    . ARG A 1 83  ? -0.490  0.529   -12.247 1.00 0.00  ? 83  ARG A HG3    3  
ATOM   6269  H HD2    . ARG A 1 83  ? -1.499  2.743   -10.936 1.00 0.00  ? 83  ARG A HD2    3  
ATOM   6270  H HD3    . ARG A 1 83  ? -2.604  1.449   -10.478 1.00 0.00  ? 83  ARG A HD3    3  
ATOM   6271  H HE     . ARG A 1 83  ? -0.302  0.259   -10.007 1.00 0.00  ? 83  ARG A HE     3  
ATOM   6272  H HH11   . ARG A 1 83  ? -1.259  3.538   -9.261  1.00 0.00  ? 83  ARG A HH11   3  
ATOM   6273  H HH12   . ARG A 1 83  ? -0.215  3.656   -7.885  1.00 0.00  ? 83  ARG A HH12   3  
ATOM   6274  H HH21   . ARG A 1 83  ? 1.062   0.420   -8.197  1.00 0.00  ? 83  ARG A HH21   3  
ATOM   6275  H HH22   . ARG A 1 83  ? 1.101   1.890   -7.280  1.00 0.00  ? 83  ARG A HH22   3  
ATOM   6276  N N      . GLU A 1 84  ? 1.120   0.509   -14.681 1.00 0.00  ? 84  GLU A N      3  
ATOM   6277  C CA     . GLU A 1 84  ? 1.542   -0.460  -15.688 1.00 0.00  ? 84  GLU A CA     3  
ATOM   6278  C C      . GLU A 1 84  ? 1.107   -1.869  -15.317 1.00 0.00  ? 84  GLU A C      3  
ATOM   6279  O O      . GLU A 1 84  ? 1.267   -2.301  -14.175 1.00 0.00  ? 84  GLU A O      3  
ATOM   6280  C CB     . GLU A 1 84  ? 3.056   -0.414  -15.898 1.00 0.00  ? 84  GLU A CB     3  
ATOM   6281  C CG     . GLU A 1 84  ? 3.863   -0.847  -14.688 1.00 0.00  ? 84  GLU A CG     3  
ATOM   6282  C CD     . GLU A 1 84  ? 3.861   0.187   -13.578 1.00 0.00  ? 84  GLU A CD     3  
ATOM   6283  O OE1    . GLU A 1 84  ? 3.021   0.073   -12.662 1.00 0.00  ? 84  GLU A OE1    3  
ATOM   6284  O OE2    . GLU A 1 84  ? 4.700   1.112   -13.628 1.00 0.00  ? 84  GLU A OE2    3  
ATOM   6285  H H      . GLU A 1 84  ? 1.454   0.430   -13.765 1.00 0.00  ? 84  GLU A H      3  
ATOM   6286  H HA     . GLU A 1 84  ? 1.059   -0.187  -16.608 1.00 0.00  ? 84  GLU A HA     3  
ATOM   6287  H HB2    . GLU A 1 84  ? 3.308   -1.063  -16.722 1.00 0.00  ? 84  GLU A HB2    3  
ATOM   6288  H HB3    . GLU A 1 84  ? 3.336   0.590   -16.149 1.00 0.00  ? 84  GLU A HB3    3  
ATOM   6289  H HG2    . GLU A 1 84  ? 3.444   -1.762  -14.307 1.00 0.00  ? 84  GLU A HG2    3  
ATOM   6290  H HG3    . GLU A 1 84  ? 4.883   -1.022  -14.997 1.00 0.00  ? 84  GLU A HG3    3  
ATOM   6291  H HE2    . GLU A 1 84  ? 4.642   1.729   -12.896 1.00 0.00  ? 84  GLU A HE2    3  
ATOM   6292  N N      . LEU A 1 85  ? 0.564   -2.583  -16.295 1.00 0.00  ? 85  LEU A N      3  
ATOM   6293  C CA     . LEU A 1 85  ? 0.106   -3.946  -16.081 1.00 0.00  ? 85  LEU A CA     3  
ATOM   6294  C C      . LEU A 1 85  ? 1.120   -4.941  -16.629 1.00 0.00  ? 85  LEU A C      3  
ATOM   6295  O O      . LEU A 1 85  ? 1.402   -4.960  -17.826 1.00 0.00  ? 85  LEU A O      3  
ATOM   6296  C CB     . LEU A 1 85  ? -1.262  -4.163  -16.733 1.00 0.00  ? 85  LEU A CB     3  
ATOM   6297  C CG     . LEU A 1 85  ? -2.269  -3.019  -16.555 1.00 0.00  ? 85  LEU A CG     3  
ATOM   6298  C CD1    . LEU A 1 85  ? -3.659  -3.463  -16.986 1.00 0.00  ? 85  LEU A CD1    3  
ATOM   6299  C CD2    . LEU A 1 85  ? -2.299  -2.533  -15.107 1.00 0.00  ? 85  LEU A CD2    3  
ATOM   6300  H H      . LEU A 1 85  ? 0.468   -2.181  -17.184 1.00 0.00  ? 85  LEU A H      3  
ATOM   6301  H HA     . LEU A 1 85  ? 0.015   -4.097  -15.021 1.00 0.00  ? 85  LEU A HA     3  
ATOM   6302  H HB2    . LEU A 1 85  ? -1.109  -4.317  -17.792 1.00 0.00  ? 85  LEU A HB2    3  
ATOM   6303  H HB3    . LEU A 1 85  ? -1.695  -5.060  -16.317 1.00 0.00  ? 85  LEU A HB3    3  
ATOM   6304  H HG     . LEU A 1 85  ? -1.974  -2.190  -17.181 1.00 0.00  ? 85  LEU A HG     3  
ATOM   6305  H HD11   . LEU A 1 85  ? -4.028  -2.799  -17.753 1.00 0.00  ? 85  LEU A HD11   3  
ATOM   6306  H HD12   . LEU A 1 85  ? -4.323  -3.432  -16.136 1.00 0.00  ? 85  LEU A HD12   3  
ATOM   6307  H HD13   . LEU A 1 85  ? -3.613  -4.472  -17.372 1.00 0.00  ? 85  LEU A HD13   3  
ATOM   6308  H HD21   . LEU A 1 85  ? -2.430  -1.462  -15.092 1.00 0.00  ? 85  LEU A HD21   3  
ATOM   6309  H HD22   . LEU A 1 85  ? -1.374  -2.788  -14.617 1.00 0.00  ? 85  LEU A HD22   3  
ATOM   6310  H HD23   . LEU A 1 85  ? -3.121  -3.002  -14.589 1.00 0.00  ? 85  LEU A HD23   3  
ATOM   6311  N N      . ASN A 1 86  ? 1.671   -5.761  -15.740 1.00 0.00  ? 86  ASN A N      3  
ATOM   6312  C CA     . ASN A 1 86  ? 2.660   -6.756  -16.131 1.00 0.00  ? 86  ASN A CA     3  
ATOM   6313  C C      . ASN A 1 86  ? 2.146   -8.167  -15.885 1.00 0.00  ? 86  ASN A C      3  
ATOM   6314  O O      . ASN A 1 86  ? 1.723   -8.506  -14.779 1.00 0.00  ? 86  ASN A O      3  
ATOM   6315  C CB     . ASN A 1 86  ? 3.969   -6.539  -15.367 1.00 0.00  ? 86  ASN A CB     3  
ATOM   6316  C CG     . ASN A 1 86  ? 3.741   -6.210  -13.903 1.00 0.00  ? 86  ASN A CG     3  
ATOM   6317  O OD1    . ASN A 1 86  ? 3.378   -7.078  -13.110 1.00 0.00  ? 86  ASN A OD1    3  
ATOM   6318  N ND2    . ASN A 1 86  ? 3.954   -4.950  -13.542 1.00 0.00  ? 86  ASN A ND2    3  
ATOM   6319  H H      . ASN A 1 86  ? 1.408   -5.692  -14.798 1.00 0.00  ? 86  ASN A H      3  
ATOM   6320  H HA     . ASN A 1 86  ? 2.848   -6.637  -17.185 1.00 0.00  ? 86  ASN A HA     3  
ATOM   6321  H HB2    . ASN A 1 86  ? 4.565   -7.437  -15.426 1.00 0.00  ? 86  ASN A HB2    3  
ATOM   6322  H HB3    . ASN A 1 86  ? 4.512   -5.722  -15.821 1.00 0.00  ? 86  ASN A HB3    3  
ATOM   6323  H HD21   . ASN A 1 86  ? 4.240   -4.313  -14.230 1.00 0.00  ? 86  ASN A HD21   3  
ATOM   6324  H HD22   . ASN A 1 86  ? 3.816   -4.709  -12.603 1.00 0.00  ? 86  ASN A HD22   3  
ATOM   6325  N N      . TYR A 1 87  ? 2.193   -8.985  -16.929 1.00 0.00  ? 87  TYR A N      3  
ATOM   6326  C CA     . TYR A 1 87  ? 1.740   -10.367 -16.848 1.00 0.00  ? 87  TYR A CA     3  
ATOM   6327  C C      . TYR A 1 87  ? 2.200   -11.145 -18.068 1.00 0.00  ? 87  TYR A C      3  
ATOM   6328  O O      . TYR A 1 87  ? 2.178   -10.636 -19.187 1.00 0.00  ? 87  TYR A O      3  
ATOM   6329  C CB     . TYR A 1 87  ? 0.216   -10.436 -16.747 1.00 0.00  ? 87  TYR A CB     3  
ATOM   6330  C CG     . TYR A 1 87  ? -0.494  -9.497  -17.695 1.00 0.00  ? 87  TYR A CG     3  
ATOM   6331  C CD1    . TYR A 1 87  ? -0.754  -9.874  -19.006 1.00 0.00  ? 87  TYR A CD1    3  
ATOM   6332  C CD2    . TYR A 1 87  ? -0.902  -8.233  -17.284 1.00 0.00  ? 87  TYR A CD2    3  
ATOM   6333  C CE1    . TYR A 1 87  ? -1.400  -9.021  -19.880 1.00 0.00  ? 87  TYR A CE1    3  
ATOM   6334  C CE2    . TYR A 1 87  ? -1.550  -7.374  -18.153 1.00 0.00  ? 87  TYR A CE2    3  
ATOM   6335  C CZ     . TYR A 1 87  ? -1.796  -7.773  -19.450 1.00 0.00  ? 87  TYR A CZ     3  
ATOM   6336  O OH     . TYR A 1 87  ? -2.443  -6.923  -20.319 1.00 0.00  ? 87  TYR A OH     3  
ATOM   6337  H H      . TYR A 1 87  ? 2.544   -8.649  -17.779 1.00 0.00  ? 87  TYR A H      3  
ATOM   6338  H HA     . TYR A 1 87  ? 2.173   -10.809 -15.965 1.00 0.00  ? 87  TYR A HA     3  
ATOM   6339  H HB2    . TYR A 1 87  ? -0.105  -11.442 -16.978 1.00 0.00  ? 87  TYR A HB2    3  
ATOM   6340  H HB3    . TYR A 1 87  ? -0.079  -10.194 -15.742 1.00 0.00  ? 87  TYR A HB3    3  
ATOM   6341  H HD1    . TYR A 1 87  ? -0.444  -10.853 -19.340 1.00 0.00  ? 87  TYR A HD1    3  
ATOM   6342  H HD2    . TYR A 1 87  ? -0.709  -7.921  -16.265 1.00 0.00  ? 87  TYR A HD2    3  
ATOM   6343  H HE1    . TYR A 1 87  ? -1.593  -9.336  -20.896 1.00 0.00  ? 87  TYR A HE1    3  
ATOM   6344  H HE2    . TYR A 1 87  ? -1.858  -6.395  -17.814 1.00 0.00  ? 87  TYR A HE2    3  
ATOM   6345  H HH     . TYR A 1 87  ? -2.222  -6.015  -20.102 1.00 0.00  ? 87  TYR A HH     3  
ATOM   6346  N N      . VAL A 1 88  ? 2.612   -12.383 -17.847 1.00 0.00  ? 88  VAL A N      3  
ATOM   6347  C CA     . VAL A 1 88  ? 3.070   -13.231 -18.936 1.00 0.00  ? 88  VAL A CA     3  
ATOM   6348  C C      . VAL A 1 88  ? 1.883   -13.838 -19.678 1.00 0.00  ? 88  VAL A C      3  
ATOM   6349  O O      . VAL A 1 88  ? 1.177   -14.700 -19.153 1.00 0.00  ? 88  VAL A O      3  
ATOM   6350  C CB     . VAL A 1 88  ? 4.014   -14.341 -18.434 1.00 0.00  ? 88  VAL A CB     3  
ATOM   6351  C CG1    . VAL A 1 88  ? 3.271   -15.358 -17.584 1.00 0.00  ? 88  VAL A CG1    3  
ATOM   6352  C CG2    . VAL A 1 88  ? 4.702   -15.017 -19.604 1.00 0.00  ? 88  VAL A CG2    3  
ATOM   6353  H H      . VAL A 1 88  ? 2.599   -12.733 -16.932 1.00 0.00  ? 88  VAL A H      3  
ATOM   6354  H HA     . VAL A 1 88  ? 3.621   -12.608 -19.628 1.00 0.00  ? 88  VAL A HA     3  
ATOM   6355  H HB     . VAL A 1 88  ? 4.776   -13.884 -17.819 1.00 0.00  ? 88  VAL A HB     3  
ATOM   6356  H HG11   . VAL A 1 88  ? 3.792   -15.488 -16.645 1.00 0.00  ? 88  VAL A HG11   3  
ATOM   6357  H HG12   . VAL A 1 88  ? 3.232   -16.301 -18.108 1.00 0.00  ? 88  VAL A HG12   3  
ATOM   6358  H HG13   . VAL A 1 88  ? 2.269   -15.006 -17.395 1.00 0.00  ? 88  VAL A HG13   3  
ATOM   6359  H HG21   . VAL A 1 88  ? 4.021   -15.061 -20.440 1.00 0.00  ? 88  VAL A HG21   3  
ATOM   6360  H HG22   . VAL A 1 88  ? 4.993   -16.017 -19.322 1.00 0.00  ? 88  VAL A HG22   3  
ATOM   6361  H HG23   . VAL A 1 88  ? 5.578   -14.451 -19.881 1.00 0.00  ? 88  VAL A HG23   3  
ATOM   6362  N N      . ALA A 1 89  ? 1.654   -13.365 -20.897 1.00 0.00  ? 89  ALA A N      3  
ATOM   6363  C CA     . ALA A 1 89  ? 0.537   -13.841 -21.700 1.00 0.00  ? 89  ALA A CA     3  
ATOM   6364  C C      . ALA A 1 89  ? 0.824   -15.221 -22.304 1.00 0.00  ? 89  ALA A C      3  
ATOM   6365  O O      . ALA A 1 89  ? 0.609   -16.242 -21.654 1.00 0.00  ? 89  ALA A O      3  
ATOM   6366  C CB     . ALA A 1 89  ? 0.206   -12.822 -22.783 1.00 0.00  ? 89  ALA A CB     3  
ATOM   6367  H H      . ALA A 1 89  ? 2.240   -12.665 -21.255 1.00 0.00  ? 89  ALA A H      3  
ATOM   6368  H HA     . ALA A 1 89  ? -0.321  -13.924 -21.049 1.00 0.00  ? 89  ALA A HA     3  
ATOM   6369  H HB1    . ALA A 1 89  ? -0.206  -13.328 -23.643 1.00 0.00  ? 89  ALA A HB1    3  
ATOM   6370  H HB2    . ALA A 1 89  ? 1.104   -12.297 -23.072 1.00 0.00  ? 89  ALA A HB2    3  
ATOM   6371  H HB3    . ALA A 1 89  ? -0.515  -12.114 -22.400 1.00 0.00  ? 89  ALA A HB3    3  
ATOM   6372  N N      . ARG A 1 90  ? 1.301   -15.249 -23.550 1.00 0.00  ? 90  ARG A N      3  
ATOM   6373  C CA     . ARG A 1 90  ? 1.603   -16.509 -24.222 1.00 0.00  ? 90  ARG A CA     3  
ATOM   6374  C C      . ARG A 1 90  ? 2.823   -17.179 -23.598 1.00 0.00  ? 90  ARG A C      3  
ATOM   6375  O O      . ARG A 1 90  ? 2.857   -18.400 -23.437 1.00 0.00  ? 90  ARG A O      3  
ATOM   6376  C CB     . ARG A 1 90  ? 1.824   -16.278 -25.725 1.00 0.00  ? 90  ARG A CB     3  
ATOM   6377  C CG     . ARG A 1 90  ? 3.017   -15.388 -26.053 1.00 0.00  ? 90  ARG A CG     3  
ATOM   6378  C CD     . ARG A 1 90  ? 2.622   -13.921 -26.143 1.00 0.00  ? 90  ARG A CD     3  
ATOM   6379  N NE     . ARG A 1 90  ? 3.544   -13.151 -26.980 1.00 0.00  ? 90  ARG A NE     3  
ATOM   6380  C CZ     . ARG A 1 90  ? 3.180   -12.458 -28.058 1.00 0.00  ? 90  ARG A CZ     3  
ATOM   6381  N NH1    . ARG A 1 90  ? 1.912   -12.440 -28.456 1.00 0.00  ? 90  ARG A NH1    3  
ATOM   6382  N NH2    . ARG A 1 90  ? 4.089   -11.779 -28.744 1.00 0.00  ? 90  ARG A NH2    3  
ATOM   6383  H H      . ARG A 1 90  ? 1.449   -14.410 -24.025 1.00 0.00  ? 90  ARG A H      3  
ATOM   6384  H HA     . ARG A 1 90  ? 0.750   -17.160 -24.094 1.00 0.00  ? 90  ARG A HA     3  
ATOM   6385  H HB2    . ARG A 1 90  ? 1.975   -17.232 -26.204 1.00 0.00  ? 90  ARG A HB2    3  
ATOM   6386  H HB3    . ARG A 1 90  ? 0.937   -15.818 -26.137 1.00 0.00  ? 90  ARG A HB3    3  
ATOM   6387  H HG2    . ARG A 1 90  ? 3.762   -15.499 -25.284 1.00 0.00  ? 90  ARG A HG2    3  
ATOM   6388  H HG3    . ARG A 1 90  ? 3.432   -15.695 -27.001 1.00 0.00  ? 90  ARG A HG3    3  
ATOM   6389  H HD2    . ARG A 1 90  ? 1.629   -13.854 -26.554 1.00 0.00  ? 90  ARG A HD2    3  
ATOM   6390  H HD3    . ARG A 1 90  ? 2.625   -13.500 -25.146 1.00 0.00  ? 90  ARG A HD3    3  
ATOM   6391  H HE     . ARG A 1 90  ? 4.489   -13.150 -26.719 1.00 0.00  ? 90  ARG A HE     3  
ATOM   6392  H HH11   . ARG A 1 90  ? 1.219   -12.948 -27.951 1.00 0.00  ? 90  ARG A HH11   3  
ATOM   6393  H HH12   . ARG A 1 90  ? 1.653   -11.916 -29.267 1.00 0.00  ? 90  ARG A HH12   3  
ATOM   6394  H HH21   . ARG A 1 90  ? 5.045   -11.789 -28.453 1.00 0.00  ? 90  ARG A HH21   3  
ATOM   6395  H HH22   . ARG A 1 90  ? 3.817   -11.259 -29.555 1.00 0.00  ? 90  ARG A HH22   3  
ATOM   6396  N N      . ASN A 1 91  ? 3.817   -16.374 -23.241 1.00 0.00  ? 91  ASN A N      3  
ATOM   6397  C CA     . ASN A 1 91  ? 5.040   -16.880 -22.624 1.00 0.00  ? 91  ASN A CA     3  
ATOM   6398  C C      . ASN A 1 91  ? 6.043   -15.751 -22.400 1.00 0.00  ? 91  ASN A C      3  
ATOM   6399  O O      . ASN A 1 91  ? 7.252   -15.973 -22.402 1.00 0.00  ? 91  ASN A O      3  
ATOM   6400  C CB     . ASN A 1 91  ? 5.674   -17.969 -23.497 1.00 0.00  ? 91  ASN A CB     3  
ATOM   6401  C CG     . ASN A 1 91  ? 6.303   -19.079 -22.677 1.00 0.00  ? 91  ASN A CG     3  
ATOM   6402  O OD1    . ASN A 1 91  ? 6.723   -18.865 -21.539 1.00 0.00  ? 91  ASN A OD1    3  
ATOM   6403  N ND2    . ASN A 1 91  ? 6.371   -20.275 -23.251 1.00 0.00  ? 91  ASN A ND2    3  
ATOM   6404  H H      . ASN A 1 91  ? 3.723   -15.410 -23.391 1.00 0.00  ? 91  ASN A H      3  
ATOM   6405  H HA     . ASN A 1 91  ? 4.777   -17.306 -21.668 1.00 0.00  ? 91  ASN A HA     3  
ATOM   6406  H HB2    . ASN A 1 91  ? 4.916   -18.401 -24.131 1.00 0.00  ? 91  ASN A HB2    3  
ATOM   6407  H HB3    . ASN A 1 91  ? 6.442   -17.524 -24.113 1.00 0.00  ? 91  ASN A HB3    3  
ATOM   6408  H HD21   . ASN A 1 91  ? 6.016   -20.373 -24.159 1.00 0.00  ? 91  ASN A HD21   3  
ATOM   6409  H HD22   . ASN A 1 91  ? 6.774   -21.013 -22.743 1.00 0.00  ? 91  ASN A HD22   3  
ATOM   6410  N N      . LYS A 1 92  ? 5.530   -14.542 -22.201 1.00 0.00  ? 92  LYS A N      3  
ATOM   6411  C CA     . LYS A 1 92  ? 6.378   -13.383 -21.971 1.00 0.00  ? 92  LYS A CA     3  
ATOM   6412  C C      . LYS A 1 92  ? 5.604   -12.281 -21.246 1.00 0.00  ? 92  LYS A C      3  
ATOM   6413  O O      . LYS A 1 92  ? 4.549   -11.844 -21.707 1.00 0.00  ? 92  LYS A O      3  
ATOM   6414  C CB     . LYS A 1 92  ? 6.932   -12.865 -23.298 1.00 0.00  ? 92  LYS A CB     3  
ATOM   6415  C CG     . LYS A 1 92  ? 8.403   -12.485 -23.237 1.00 0.00  ? 92  LYS A CG     3  
ATOM   6416  C CD     . LYS A 1 92  ? 9.298   -13.702 -23.394 1.00 0.00  ? 92  LYS A CD     3  
ATOM   6417  C CE     . LYS A 1 92  ? 9.166   -14.322 -24.778 1.00 0.00  ? 92  LYS A CE     3  
ATOM   6418  N NZ     . LYS A 1 92  ? 10.458  -14.319 -25.515 1.00 0.00  ? 92  LYS A NZ     3  
ATOM   6419  H H      . LYS A 1 92  ? 4.558   -14.425 -22.204 1.00 0.00  ? 92  LYS A H      3  
ATOM   6420  H HA     . LYS A 1 92  ? 7.201   -13.698 -21.350 1.00 0.00  ? 92  LYS A HA     3  
ATOM   6421  H HB2    . LYS A 1 92  ? 6.814   -13.631 -24.048 1.00 0.00  ? 92  LYS A HB2    3  
ATOM   6422  H HB3    . LYS A 1 92  ? 6.369   -11.995 -23.595 1.00 0.00  ? 92  LYS A HB3    3  
ATOM   6423  H HG2    . LYS A 1 92  ? 8.619   -11.785 -24.030 1.00 0.00  ? 92  LYS A HG2    3  
ATOM   6424  H HG3    . LYS A 1 92  ? 8.604   -12.022 -22.283 1.00 0.00  ? 92  LYS A HG3    3  
ATOM   6425  H HD2    . LYS A 1 92  ? 10.325  -13.404 -23.240 1.00 0.00  ? 92  LYS A HD2    3  
ATOM   6426  H HD3    . LYS A 1 92  ? 9.021   -14.438 -22.652 1.00 0.00  ? 92  LYS A HD3    3  
ATOM   6427  H HE2    . LYS A 1 92  ? 8.829   -15.342 -24.670 1.00 0.00  ? 92  LYS A HE2    3  
ATOM   6428  H HE3    . LYS A 1 92  ? 8.436   -13.761 -25.342 1.00 0.00  ? 92  LYS A HE3    3  
ATOM   6429  H HZ1    . LYS A 1 92  ? 10.528  -15.164 -26.117 1.00 0.00  ? 92  LYS A HZ1    3  
ATOM   6430  H HZ2    . LYS A 1 92  ? 11.254  -14.319 -24.845 1.00 0.00  ? 92  LYS A HZ2    3  
ATOM   6431  H HZ3    . LYS A 1 92  ? 10.525  -13.472 -26.117 1.00 0.00  ? 92  LYS A HZ3    3  
ATOM   6432  N N      . PRO A 1 93  ? 6.116   -11.828 -20.089 1.00 0.00  ? 93  PRO A N      3  
ATOM   6433  C CA     . PRO A 1 93  ? 5.473   -10.783 -19.285 1.00 0.00  ? 93  PRO A CA     3  
ATOM   6434  C C      . PRO A 1 93  ? 5.605   -9.404  -19.899 1.00 0.00  ? 93  PRO A C      3  
ATOM   6435  O O      . PRO A 1 93  ? 6.707   -8.883  -20.064 1.00 0.00  ? 93  PRO A O      3  
ATOM   6436  C CB     . PRO A 1 93  ? 6.219   -10.835 -17.966 1.00 0.00  ? 93  PRO A CB     3  
ATOM   6437  C CG     . PRO A 1 93  ? 7.564   -11.363 -18.321 1.00 0.00  ? 93  PRO A CG     3  
ATOM   6438  C CD     . PRO A 1 93  ? 7.358   -12.309 -19.468 1.00 0.00  ? 93  PRO A CD     3  
ATOM   6439  H HA     . PRO A 1 93  ? 4.430   -11.003 -19.118 1.00 0.00  ? 93  PRO A HA     3  
ATOM   6440  H HB2    . PRO A 1 93  ? 6.277   -9.839  -17.552 1.00 0.00  ? 93  PRO A HB2    3  
ATOM   6441  H HB3    . PRO A 1 93  ? 5.699   -11.485 -17.286 1.00 0.00  ? 93  PRO A HB3    3  
ATOM   6442  H HG2    . PRO A 1 93  ? 8.204   -10.556 -18.617 1.00 0.00  ? 93  PRO A HG2    3  
ATOM   6443  H HG3    . PRO A 1 93  ? 7.990   -11.882 -17.486 1.00 0.00  ? 93  PRO A HG3    3  
ATOM   6444  H HD2    . PRO A 1 93  ? 8.181   -12.247 -20.161 1.00 0.00  ? 93  PRO A HD2    3  
ATOM   6445  H HD3    . PRO A 1 93  ? 7.241   -13.317 -19.110 1.00 0.00  ? 93  PRO A HD3    3  
ATOM   6446  N N      . LYS A 1 94  ? 4.468   -8.828  -20.231 1.00 0.00  ? 94  LYS A N      3  
ATOM   6447  C CA     . LYS A 1 94  ? 4.422   -7.506  -20.849 1.00 0.00  ? 94  LYS A CA     3  
ATOM   6448  C C      . LYS A 1 94  ? 4.017   -6.417  -19.860 1.00 0.00  ? 94  LYS A C      3  
ATOM   6449  O O      . LYS A 1 94  ? 2.926   -6.455  -19.295 1.00 0.00  ? 94  LYS A O      3  
ATOM   6450  C CB     . LYS A 1 94  ? 3.425   -7.512  -22.012 1.00 0.00  ? 94  LYS A CB     3  
ATOM   6451  C CG     . LYS A 1 94  ? 3.948   -8.161  -23.282 1.00 0.00  ? 94  LYS A CG     3  
ATOM   6452  C CD     . LYS A 1 94  ? 4.509   -7.128  -24.243 1.00 0.00  ? 94  LYS A CD     3  
ATOM   6453  C CE     . LYS A 1 94  ? 3.402   -6.324  -24.900 1.00 0.00  ? 94  LYS A CE     3  
ATOM   6454  N NZ     . LYS A 1 94  ? 3.707   -6.005  -26.324 1.00 0.00  ? 94  LYS A NZ     3  
ATOM   6455  H H      . LYS A 1 94  ? 3.634   -9.308  -20.061 1.00 0.00  ? 94  LYS A H      3  
ATOM   6456  H HA     . LYS A 1 94  ? 5.405   -7.282  -21.234 1.00 0.00  ? 94  LYS A HA     3  
ATOM   6457  H HB2    . LYS A 1 94  ? 2.540   -8.047  -21.705 1.00 0.00  ? 94  LYS A HB2    3  
ATOM   6458  H HB3    . LYS A 1 94  ? 3.156   -6.493  -22.241 1.00 0.00  ? 94  LYS A HB3    3  
ATOM   6459  H HG2    . LYS A 1 94  ? 4.726   -8.858  -23.024 1.00 0.00  ? 94  LYS A HG2    3  
ATOM   6460  H HG3    . LYS A 1 94  ? 3.137   -8.685  -23.765 1.00 0.00  ? 94  LYS A HG3    3  
ATOM   6461  H HD2    . LYS A 1 94  ? 5.151   -6.454  -23.697 1.00 0.00  ? 94  LYS A HD2    3  
ATOM   6462  H HD3    . LYS A 1 94  ? 5.080   -7.634  -25.008 1.00 0.00  ? 94  LYS A HD3    3  
ATOM   6463  H HE2    . LYS A 1 94  ? 2.488   -6.892  -24.856 1.00 0.00  ? 94  LYS A HE2    3  
ATOM   6464  H HE3    . LYS A 1 94  ? 3.277   -5.402  -24.355 1.00 0.00  ? 94  LYS A HE3    3  
ATOM   6465  H HZ1    . LYS A 1 94  ? 3.255   -6.700  -26.951 1.00 0.00  ? 94  LYS A HZ1    3  
ATOM   6466  H HZ2    . LYS A 1 94  ? 4.734   -6.026  -26.484 1.00 0.00  ? 94  LYS A HZ2    3  
ATOM   6467  H HZ3    . LYS A 1 94  ? 3.351   -5.056  -26.560 1.00 0.00  ? 94  LYS A HZ3    3  
ATOM   6468  N N      . THR A 1 95  ? 4.886   -5.419  -19.694 1.00 0.00  ? 95  THR A N      3  
ATOM   6469  C CA     . THR A 1 95  ? 4.590   -4.292  -18.815 1.00 0.00  ? 95  THR A CA     3  
ATOM   6470  C C      . THR A 1 95  ? 3.866   -3.227  -19.621 1.00 0.00  ? 95  THR A C      3  
ATOM   6471  O O      . THR A 1 95  ? 4.424   -2.652  -20.554 1.00 0.00  ? 95  THR A O      3  
ATOM   6472  C CB     . THR A 1 95  ? 5.872   -3.713  -18.201 1.00 0.00  ? 95  THR A CB     3  
ATOM   6473  O OG1    . THR A 1 95  ? 6.485   -4.656  -17.337 1.00 0.00  ? 95  THR A OG1    3  
ATOM   6474  C CG2    . THR A 1 95  ? 5.636   -2.443  -17.401 1.00 0.00  ? 95  THR A CG2    3  
ATOM   6475  H H      . THR A 1 95  ? 5.725   -5.423  -20.200 1.00 0.00  ? 95  THR A H      3  
ATOM   6476  H HA     . THR A 1 95  ? 3.941   -4.641  -18.026 1.00 0.00  ? 95  THR A HA     3  
ATOM   6477  H HB     . THR A 1 95  ? 6.565   -3.478  -18.994 1.00 0.00  ? 95  THR A HB     3  
ATOM   6478  H HG1    . THR A 1 95  ? 6.238   -5.545  -17.603 1.00 0.00  ? 95  THR A HG1    3  
ATOM   6479  H HG21   . THR A 1 95  ? 6.322   -2.408  -16.565 1.00 0.00  ? 95  THR A HG21   3  
ATOM   6480  H HG22   . THR A 1 95  ? 4.621   -2.433  -17.031 1.00 0.00  ? 95  THR A HG22   3  
ATOM   6481  H HG23   . THR A 1 95  ? 5.795   -1.579  -18.032 1.00 0.00  ? 95  THR A HG23   3  
ATOM   6482  N N      . VAL A 1 96  ? 2.608   -2.996  -19.284 1.00 0.00  ? 96  VAL A N      3  
ATOM   6483  C CA     . VAL A 1 96  ? 1.798   -2.031  -20.010 1.00 0.00  ? 96  VAL A CA     3  
ATOM   6484  C C      . VAL A 1 96  ? 1.451   -0.816  -19.161 1.00 0.00  ? 96  VAL A C      3  
ATOM   6485  O O      . VAL A 1 96  ? 0.637   -0.905  -18.247 1.00 0.00  ? 96  VAL A O      3  
ATOM   6486  C CB     . VAL A 1 96  ? 0.490   -2.684  -20.498 1.00 0.00  ? 96  VAL A CB     3  
ATOM   6487  C CG1    . VAL A 1 96  ? -0.292  -1.724  -21.383 1.00 0.00  ? 96  VAL A CG1    3  
ATOM   6488  C CG2    . VAL A 1 96  ? 0.780   -3.982  -21.237 1.00 0.00  ? 96  VAL A CG2    3  
ATOM   6489  H H      . VAL A 1 96  ? 2.205   -3.506  -18.551 1.00 0.00  ? 96  VAL A H      3  
ATOM   6490  H HA     . VAL A 1 96  ? 2.355   -1.709  -20.876 1.00 0.00  ? 96  VAL A HA     3  
ATOM   6491  H HB     . VAL A 1 96  ? -0.115  -2.917  -19.628 1.00 0.00  ? 96  VAL A HB     3  
ATOM   6492  H HG11   . VAL A 1 96  ? -0.985  -1.161  -20.778 1.00 0.00  ? 96  VAL A HG11   3  
ATOM   6493  H HG12   . VAL A 1 96  ? -0.835  -2.283  -22.126 1.00 0.00  ? 96  VAL A HG12   3  
ATOM   6494  H HG13   . VAL A 1 96  ? 0.392   -1.048  -21.871 1.00 0.00  ? 96  VAL A HG13   3  
ATOM   6495  H HG21   . VAL A 1 96  ? 0.039   -4.722  -20.970 1.00 0.00  ? 96  VAL A HG21   3  
ATOM   6496  H HG22   . VAL A 1 96  ? 1.761   -4.342  -20.964 1.00 0.00  ? 96  VAL A HG22   3  
ATOM   6497  H HG23   . VAL A 1 96  ? 0.745   -3.807  -22.303 1.00 0.00  ? 96  VAL A HG23   3  
ATOM   6498  N N      . ILE A 1 97  ? 2.050   0.325   -19.494 1.00 0.00  ? 97  ILE A N      3  
ATOM   6499  C CA     . ILE A 1 97  ? 1.784   1.567   -18.777 1.00 0.00  ? 97  ILE A CA     3  
ATOM   6500  C C      . ILE A 1 97  ? 0.543   2.229   -19.362 1.00 0.00  ? 97  ILE A C      3  
ATOM   6501  O O      . ILE A 1 97  ? 0.415   2.350   -20.579 1.00 0.00  ? 97  ILE A O      3  
ATOM   6502  C CB     . ILE A 1 97  ? 2.984   2.534   -18.865 1.00 0.00  ? 97  ILE A CB     3  
ATOM   6503  C CG1    . ILE A 1 97  ? 4.268   1.826   -18.390 1.00 0.00  ? 97  ILE A CG1    3  
ATOM   6504  C CG2    . ILE A 1 97  ? 2.709   3.805   -18.068 1.00 0.00  ? 97  ILE A CG2    3  
ATOM   6505  C CD1    . ILE A 1 97  ? 4.691   2.152   -16.970 1.00 0.00  ? 97  ILE A CD1    3  
ATOM   6506  H H      . ILE A 1 97  ? 2.673   0.334   -20.248 1.00 0.00  ? 97  ILE A H      3  
ATOM   6507  H HA     . ILE A 1 97  ? 1.605   1.330   -17.739 1.00 0.00  ? 97  ILE A HA     3  
ATOM   6508  H HB     . ILE A 1 97  ? 3.105   2.817   -19.899 1.00 0.00  ? 97  ILE A HB     3  
ATOM   6509  H HG12   . ILE A 1 97  ? 4.116   0.758   -18.442 1.00 0.00  ? 97  ILE A HG12   3  
ATOM   6510  H HG13   . ILE A 1 97  ? 5.083   2.097   -19.048 1.00 0.00  ? 97  ILE A HG13   3  
ATOM   6511  H HG21   . ILE A 1 97  ? 1.916   4.362   -18.545 1.00 0.00  ? 97  ILE A HG21   3  
ATOM   6512  H HG22   . ILE A 1 97  ? 3.602   4.412   -18.033 1.00 0.00  ? 97  ILE A HG22   3  
ATOM   6513  H HG23   . ILE A 1 97  ? 2.410   3.545   -17.063 1.00 0.00  ? 97  ILE A HG23   3  
ATOM   6514  H HD11   . ILE A 1 97  ? 5.434   2.933   -16.983 1.00 0.00  ? 97  ILE A HD11   3  
ATOM   6515  H HD12   . ILE A 1 97  ? 5.108   1.265   -16.510 1.00 0.00  ? 97  ILE A HD12   3  
ATOM   6516  H HD13   . ILE A 1 97  ? 3.832   2.479   -16.402 1.00 0.00  ? 97  ILE A HD13   3  
ATOM   6517  N N      . TYR A 1 98  ? -0.391  2.609   -18.498 1.00 0.00  ? 98  TYR A N      3  
ATOM   6518  C CA     . TYR A 1 98  ? -1.641  3.203   -18.951 1.00 0.00  ? 98  TYR A CA     3  
ATOM   6519  C C      . TYR A 1 98  ? -1.806  4.653   -18.495 1.00 0.00  ? 98  TYR A C      3  
ATOM   6520  O O      . TYR A 1 98  ? -1.524  4.997   -17.348 1.00 0.00  ? 98  TYR A O      3  
ATOM   6521  C CB     . TYR A 1 98  ? -2.807  2.362   -18.432 1.00 0.00  ? 98  TYR A CB     3  
ATOM   6522  C CG     . TYR A 1 98  ? -3.072  1.115   -19.245 1.00 0.00  ? 98  TYR A CG     3  
ATOM   6523  C CD1    . TYR A 1 98  ? -3.626  1.195   -20.516 1.00 0.00  ? 98  TYR A CD1    3  
ATOM   6524  C CD2    . TYR A 1 98  ? -2.768  -0.143  -18.739 1.00 0.00  ? 98  TYR A CD2    3  
ATOM   6525  C CE1    . TYR A 1 98  ? -3.873  0.058   -21.260 1.00 0.00  ? 98  TYR A CE1    3  
ATOM   6526  C CE2    . TYR A 1 98  ? -3.013  -1.287  -19.478 1.00 0.00  ? 98  TYR A CE2    3  
ATOM   6527  C CZ     . TYR A 1 98  ? -3.565  -1.181  -20.740 1.00 0.00  ? 98  TYR A CZ     3  
ATOM   6528  O OH     . TYR A 1 98  ? -3.813  -2.315  -21.484 1.00 0.00  ? 98  TYR A OH     3  
ATOM   6529  H H      . TYR A 1 98  ? -0.250  2.456   -17.541 1.00 0.00  ? 98  TYR A H      3  
ATOM   6530  H HA     . TYR A 1 98  ? -1.651  3.175   -20.029 1.00 0.00  ? 98  TYR A HA     3  
ATOM   6531  H HB2    . TYR A 1 98  ? -2.596  2.055   -17.420 1.00 0.00  ? 98  TYR A HB2    3  
ATOM   6532  H HB3    . TYR A 1 98  ? -3.702  2.959   -18.437 1.00 0.00  ? 98  TYR A HB3    3  
ATOM   6533  H HD1    . TYR A 1 98  ? -3.865  2.165   -20.923 1.00 0.00  ? 98  TYR A HD1    3  
ATOM   6534  H HD2    . TYR A 1 98  ? -2.336  -0.221  -17.752 1.00 0.00  ? 98  TYR A HD2    3  
ATOM   6535  H HE1    . TYR A 1 98  ? -4.305  0.141   -22.246 1.00 0.00  ? 98  TYR A HE1    3  
ATOM   6536  H HE2    . TYR A 1 98  ? -2.767  -2.255  -19.068 1.00 0.00  ? 98  TYR A HE2    3  
ATOM   6537  H HH     . TYR A 1 98  ? -3.440  -3.082  -21.043 1.00 0.00  ? 98  TYR A HH     3  
ATOM   6538  N N      . TRP A 1 99  ? -2.290  5.487   -19.414 1.00 0.00  ? 99  TRP A N      3  
ATOM   6539  C CA     . TRP A 1 99  ? -2.528  6.902   -19.136 1.00 0.00  ? 99  TRP A CA     3  
ATOM   6540  C C      . TRP A 1 99  ? -3.967  7.269   -19.480 1.00 0.00  ? 99  TRP A C      3  
ATOM   6541  O O      . TRP A 1 99  ? -4.524  6.767   -20.450 1.00 0.00  ? 99  TRP A O      3  
ATOM   6542  C CB     . TRP A 1 99  ? -1.570  7.782   -19.942 1.00 0.00  ? 99  TRP A CB     3  
ATOM   6543  C CG     . TRP A 1 99  ? -0.285  8.060   -19.232 1.00 0.00  ? 99  TRP A CG     3  
ATOM   6544  C CD1    . TRP A 1 99  ? -0.077  8.974   -18.241 1.00 0.00  ? 99  TRP A CD1    3  
ATOM   6545  C CD2    . TRP A 1 99  ? 0.969   7.419   -19.463 1.00 0.00  ? 99  TRP A CD2    3  
ATOM   6546  N NE1    . TRP A 1 99  ? 1.234   8.934   -17.836 1.00 0.00  ? 99  TRP A NE1    3  
ATOM   6547  C CE2    . TRP A 1 99  ? 1.897   7.986   -18.572 1.00 0.00  ? 99  TRP A CE2    3  
ATOM   6548  C CE3    . TRP A 1 99  ? 1.393   6.416   -20.334 1.00 0.00  ? 99  TRP A CE3    3  
ATOM   6549  C CZ2    . TRP A 1 99  ? 3.226   7.580   -18.528 1.00 0.00  ? 99  TRP A CZ2    3  
ATOM   6550  C CZ3    . TRP A 1 99  ? 2.715   6.015   -20.291 1.00 0.00  ? 99  TRP A CZ3    3  
ATOM   6551  C CH2    . TRP A 1 99  ? 3.616   6.597   -19.392 1.00 0.00  ? 99  TRP A CH2    3  
ATOM   6552  H H      . TRP A 1 99  ? -2.506  5.137   -20.304 1.00 0.00  ? 99  TRP A H      3  
ATOM   6553  H HA     . TRP A 1 99  ? -2.364  7.068   -18.082 1.00 0.00  ? 99  TRP A HA     3  
ATOM   6554  H HB2    . TRP A 1 99  ? -1.337  7.288   -20.875 1.00 0.00  ? 99  TRP A HB2    3  
ATOM   6555  H HB3    . TRP A 1 99  ? -2.050  8.726   -20.150 1.00 0.00  ? 99  TRP A HB3    3  
ATOM   6556  H HD1    . TRP A 1 99  ? -0.841  9.624   -17.844 1.00 0.00  ? 99  TRP A HD1    3  
ATOM   6557  H HE1    . TRP A 1 99  ? 1.631   9.491   -17.134 1.00 0.00  ? 99  TRP A HE1    3  
ATOM   6558  H HE3    . TRP A 1 99  ? 0.709   5.960   -21.038 1.00 0.00  ? 99  TRP A HE3    3  
ATOM   6559  H HZ2    . TRP A 1 99  ? 3.937   8.017   -17.841 1.00 0.00  ? 99  TRP A HZ2    3  
ATOM   6560  H HZ3    . TRP A 1 99  ? 3.064   5.239   -20.955 1.00 0.00  ? 99  TRP A HZ3    3  
ATOM   6561  H HH2    . TRP A 1 99  ? 4.636   6.252   -19.390 1.00 0.00  ? 99  TRP A HH2    3  
ATOM   6562  N N      . LEU A 1 100 ? -4.564  8.153   -18.692 1.00 0.00  ? 100 LEU A N      3  
ATOM   6563  C CA     . LEU A 1 100 ? -5.935  8.577   -18.948 1.00 0.00  ? 100 LEU A CA     3  
ATOM   6564  C C      . LEU A 1 100 ? -5.984  9.542   -20.123 1.00 0.00  ? 100 LEU A C      3  
ATOM   6565  O O      . LEU A 1 100 ? -5.316  10.572  -20.116 1.00 0.00  ? 100 LEU A O      3  
ATOM   6566  C CB     . LEU A 1 100 ? -6.536  9.243   -17.710 1.00 0.00  ? 100 LEU A CB     3  
ATOM   6567  C CG     . LEU A 1 100 ? -6.118  8.634   -16.378 1.00 0.00  ? 100 LEU A CG     3  
ATOM   6568  C CD1    . LEU A 1 100 ? -6.804  9.353   -15.228 1.00 0.00  ? 100 LEU A CD1    3  
ATOM   6569  C CD2    . LEU A 1 100 ? -6.437  7.146   -16.353 1.00 0.00  ? 100 LEU A CD2    3  
ATOM   6570  H H      . LEU A 1 100 ? -4.074  8.533   -17.932 1.00 0.00  ? 100 LEU A H      3  
ATOM   6571  H HA     . LEU A 1 100 ? -6.515  7.699   -19.194 1.00 0.00  ? 100 LEU A HA     3  
ATOM   6572  H HB2    . LEU A 1 100 ? -6.242  10.280  -17.713 1.00 0.00  ? 100 LEU A HB2    3  
ATOM   6573  H HB3    . LEU A 1 100 ? -7.612  9.190   -17.783 1.00 0.00  ? 100 LEU A HB3    3  
ATOM   6574  H HG     . LEU A 1 100 ? -5.054  8.751   -16.259 1.00 0.00  ? 100 LEU A HG     3  
ATOM   6575  H HD11   . LEU A 1 100 ? -7.704  9.827   -15.588 1.00 0.00  ? 100 LEU A HD11   3  
ATOM   6576  H HD12   . LEU A 1 100 ? -6.140  10.104  -14.824 1.00 0.00  ? 100 LEU A HD12   3  
ATOM   6577  H HD13   . LEU A 1 100 ? -7.055  8.643   -14.455 1.00 0.00  ? 100 LEU A HD13   3  
ATOM   6578  H HD21   . LEU A 1 100 ? -7.455  6.992   -16.677 1.00 0.00  ? 100 LEU A HD21   3  
ATOM   6579  H HD22   . LEU A 1 100 ? -6.318  6.768   -15.350 1.00 0.00  ? 100 LEU A HD22   3  
ATOM   6580  H HD23   . LEU A 1 100 ? -5.765  6.623   -17.019 1.00 0.00  ? 100 LEU A HD23   3  
ATOM   6581  N N      . ALA A 1 101 ? -6.780  9.204   -21.131 1.00 0.00  ? 101 ALA A N      3  
ATOM   6582  C CA     . ALA A 1 101 ? -6.917  10.043  -22.311 1.00 0.00  ? 101 ALA A CA     3  
ATOM   6583  C C      . ALA A 1 101 ? -8.386  10.241  -22.654 1.00 0.00  ? 101 ALA A C      3  
ATOM   6584  O O      . ALA A 1 101 ? -9.196  9.338   -22.478 1.00 0.00  ? 101 ALA A O      3  
ATOM   6585  C CB     . ALA A 1 101 ? -6.179  9.419   -23.486 1.00 0.00  ? 101 ALA A CB     3  
ATOM   6586  H H      . ALA A 1 101 ? -7.289  8.371   -21.080 1.00 0.00  ? 101 ALA A H      3  
ATOM   6587  H HA     . ALA A 1 101 ? -6.468  10.999  -22.097 1.00 0.00  ? 101 ALA A HA     3  
ATOM   6588  H HB1    . ALA A 1 101 ? -5.156  9.222   -23.205 1.00 0.00  ? 101 ALA A HB1    3  
ATOM   6589  H HB2    . ALA A 1 101 ? -6.200  10.098  -24.326 1.00 0.00  ? 101 ALA A HB2    3  
ATOM   6590  H HB3    . ALA A 1 101 ? -6.659  8.491   -23.759 1.00 0.00  ? 101 ALA A HB3    3  
ATOM   6591  N N      . GLU A 1 102 ? -8.730  11.425  -23.135 1.00 0.00  ? 102 GLU A N      3  
ATOM   6592  C CA     . GLU A 1 102 ? -10.112 11.726  -23.491 1.00 0.00  ? 102 GLU A CA     3  
ATOM   6593  C C      . GLU A 1 102 ? -10.219 12.175  -24.940 1.00 0.00  ? 102 GLU A C      3  
ATOM   6594  O O      . GLU A 1 102 ? -9.737  13.246  -25.300 1.00 0.00  ? 102 GLU A O      3  
ATOM   6595  C CB     . GLU A 1 102 ? -10.676 12.812  -22.577 1.00 0.00  ? 102 GLU A CB     3  
ATOM   6596  C CG     . GLU A 1 102 ? -12.152 13.093  -22.804 1.00 0.00  ? 102 GLU A CG     3  
ATOM   6597  C CD     . GLU A 1 102 ? -12.418 14.531  -23.198 1.00 0.00  ? 102 GLU A CD     3  
ATOM   6598  O OE1    . GLU A 1 102 ? -12.935 14.757  -24.313 1.00 0.00  ? 102 GLU A OE1    3  
ATOM   6599  O OE2    . GLU A 1 102 ? -12.113 15.433  -22.390 1.00 0.00  ? 102 GLU A OE2    3  
ATOM   6600  H H      . GLU A 1 102 ? -8.044  12.113  -23.246 1.00 0.00  ? 102 GLU A H      3  
ATOM   6601  H HA     . GLU A 1 102 ? -10.687 10.825  -23.364 1.00 0.00  ? 102 GLU A HA     3  
ATOM   6602  H HB2    . GLU A 1 102 ? -10.543 12.508  -21.554 1.00 0.00  ? 102 GLU A HB2    3  
ATOM   6603  H HB3    . GLU A 1 102 ? -10.128 13.727  -22.743 1.00 0.00  ? 102 GLU A HB3    3  
ATOM   6604  H HG2    . GLU A 1 102 ? -12.512 12.445  -23.591 1.00 0.00  ? 102 GLU A HG2    3  
ATOM   6605  H HG3    . GLU A 1 102 ? -12.687 12.880  -21.890 1.00 0.00  ? 102 GLU A HG3    3  
ATOM   6606  H HE2    . GLU A 1 102 ? -12.310 16.319  -22.702 1.00 0.00  ? 102 GLU A HE2    3  
ATOM   6607  N N      . VAL A 1 103 ? -10.861 11.354  -25.767 1.00 0.00  ? 103 VAL A N      3  
ATOM   6608  C CA     . VAL A 1 103 ? -11.029 11.686  -27.174 1.00 0.00  ? 103 VAL A CA     3  
ATOM   6609  C C      . VAL A 1 103 ? -12.059 12.799  -27.338 1.00 0.00  ? 103 VAL A C      3  
ATOM   6610  O O      . VAL A 1 103 ? -13.244 12.633  -27.048 1.00 0.00  ? 103 VAL A O      3  
ATOM   6611  C CB     . VAL A 1 103 ? -11.397 10.441  -28.020 1.00 0.00  ? 103 VAL A CB     3  
ATOM   6612  C CG1    . VAL A 1 103 ? -10.496 9.281   -27.641 1.00 0.00  ? 103 VAL A CG1    3  
ATOM   6613  C CG2    . VAL A 1 103 ? -12.856 10.035  -27.860 1.00 0.00  ? 103 VAL A CG2    3  
ATOM   6614  H H      . VAL A 1 103 ? -11.230 10.515  -25.422 1.00 0.00  ? 103 VAL A H      3  
ATOM   6615  H HA     . VAL A 1 103 ? -10.077 12.056  -27.528 1.00 0.00  ? 103 VAL A HA     3  
ATOM   6616  H HB     . VAL A 1 103 ? -11.221 10.674  -29.058 1.00 0.00  ? 103 VAL A HB     3  
ATOM   6617  H HG11   . VAL A 1 103 ? -10.998 8.671   -26.911 1.00 0.00  ? 103 VAL A HG11   3  
ATOM   6618  H HG12   . VAL A 1 103 ? -9.581  9.662   -27.222 1.00 0.00  ? 103 VAL A HG12   3  
ATOM   6619  H HG13   . VAL A 1 103 ? -10.279 8.690   -28.518 1.00 0.00  ? 103 VAL A HG13   3  
ATOM   6620  H HG21   . VAL A 1 103 ? -13.332 10.665  -27.127 1.00 0.00  ? 103 VAL A HG21   3  
ATOM   6621  H HG22   . VAL A 1 103 ? -12.908 9.005   -27.536 1.00 0.00  ? 103 VAL A HG22   3  
ATOM   6622  H HG23   . VAL A 1 103 ? -13.361 10.137  -28.810 1.00 0.00  ? 103 VAL A HG23   3  
ATOM   6623  N N      . LYS A 1 104 ? -11.576 13.954  -27.777 1.00 0.00  ? 104 LYS A N      3  
ATOM   6624  C CA     . LYS A 1 104 ? -12.416 15.134  -27.957 1.00 0.00  ? 104 LYS A CA     3  
ATOM   6625  C C      . LYS A 1 104 ? -13.477 14.937  -29.036 1.00 0.00  ? 104 LYS A C      3  
ATOM   6626  O O      . LYS A 1 104 ? -14.361 15.778  -29.201 1.00 0.00  ? 104 LYS A O      3  
ATOM   6627  C CB     . LYS A 1 104 ? -11.546 16.344  -28.297 1.00 0.00  ? 104 LYS A CB     3  
ATOM   6628  C CG     . LYS A 1 104 ? -10.617 16.125  -29.482 1.00 0.00  ? 104 LYS A CG     3  
ATOM   6629  C CD     . LYS A 1 104 ? -9.175  15.936  -29.036 1.00 0.00  ? 104 LYS A CD     3  
ATOM   6630  C CE     . LYS A 1 104 ? -8.611  17.202  -28.411 1.00 0.00  ? 104 LYS A CE     3  
ATOM   6631  N NZ     . LYS A 1 104 ? -8.524  18.316  -29.395 1.00 0.00  ? 104 LYS A NZ     3  
ATOM   6632  H H      . LYS A 1 104 ? -10.618 14.020  -27.963 1.00 0.00  ? 104 LYS A H      3  
ATOM   6633  H HA     . LYS A 1 104 ? -12.915 15.324  -27.019 1.00 0.00  ? 104 LYS A HA     3  
ATOM   6634  H HB2    . LYS A 1 104 ? -12.189 17.184  -28.521 1.00 0.00  ? 104 LYS A HB2    3  
ATOM   6635  H HB3    . LYS A 1 104 ? -10.946 16.584  -27.436 1.00 0.00  ? 104 LYS A HB3    3  
ATOM   6636  H HG2    . LYS A 1 104 ? -10.936 15.243  -30.018 1.00 0.00  ? 104 LYS A HG2    3  
ATOM   6637  H HG3    . LYS A 1 104 ? -10.675 16.983  -30.134 1.00 0.00  ? 104 LYS A HG3    3  
ATOM   6638  H HD2    . LYS A 1 104 ? -9.132  15.142  -28.309 1.00 0.00  ? 104 LYS A HD2    3  
ATOM   6639  H HD3    . LYS A 1 104 ? -8.576  15.672  -29.896 1.00 0.00  ? 104 LYS A HD3    3  
ATOM   6640  H HE2    . LYS A 1 104 ? -9.251  17.502  -27.596 1.00 0.00  ? 104 LYS A HE2    3  
ATOM   6641  H HE3    . LYS A 1 104 ? -7.623  16.989  -28.030 1.00 0.00  ? 104 LYS A HE3    3  
ATOM   6642  H HZ1    . LYS A 1 104 ? -8.261  17.946  -30.330 1.00 0.00  ? 104 LYS A HZ1    3  
ATOM   6643  H HZ2    . LYS A 1 104 ? -7.806  19.005  -29.091 1.00 0.00  ? 104 LYS A HZ2    3  
ATOM   6644  H HZ3    . LYS A 1 104 ? -9.440  18.799  -29.470 1.00 0.00  ? 104 LYS A HZ3    3  
ATOM   6645  N N      . ASP A 1 105 ? -13.391 13.838  -29.773 1.00 0.00  ? 105 ASP A N      3  
ATOM   6646  C CA     . ASP A 1 105 ? -14.353 13.560  -30.828 1.00 0.00  ? 105 ASP A CA     3  
ATOM   6647  C C      . ASP A 1 105 ? -15.219 12.354  -30.479 1.00 0.00  ? 105 ASP A C      3  
ATOM   6648  O O      . ASP A 1 105 ? -14.759 11.216  -30.511 1.00 0.00  ? 105 ASP A O      3  
ATOM   6649  C CB     . ASP A 1 105 ? -13.624 13.333  -32.152 1.00 0.00  ? 105 ASP A CB     3  
ATOM   6650  C CG     . ASP A 1 105 ? -12.647 14.446  -32.469 1.00 0.00  ? 105 ASP A CG     3  
ATOM   6651  O OD1    . ASP A 1 105 ? -13.049 15.419  -33.139 1.00 0.00  ? 105 ASP A OD1    3  
ATOM   6652  O OD2    . ASP A 1 105 ? -11.475 14.343  -32.045 1.00 0.00  ? 105 ASP A OD2    3  
ATOM   6653  H H      . ASP A 1 105 ? -12.666 13.200  -29.608 1.00 0.00  ? 105 ASP A H      3  
ATOM   6654  H HA     . ASP A 1 105 ? -14.992 14.422  -30.925 1.00 0.00  ? 105 ASP A HA     3  
ATOM   6655  H HB2    . ASP A 1 105 ? -13.078 12.415  -32.093 1.00 0.00  ? 105 ASP A HB2    3  
ATOM   6656  H HB3    . ASP A 1 105 ? -14.343 13.267  -32.952 1.00 0.00  ? 105 ASP A HB3    3  
ATOM   6657  H HD2    . ASP A 1 105 ? -10.910 15.081  -32.281 1.00 0.00  ? 105 ASP A HD2    3  
ATOM   6658  N N      . TYR A 1 106 ? -16.478 12.616  -30.141 1.00 0.00  ? 106 TYR A N      3  
ATOM   6659  C CA     . TYR A 1 106 ? -17.416 11.553  -29.782 1.00 0.00  ? 106 TYR A CA     3  
ATOM   6660  C C      . TYR A 1 106 ? -17.497 10.522  -30.898 1.00 0.00  ? 106 TYR A C      3  
ATOM   6661  O O      . TYR A 1 106 ? -17.547 9.317   -30.647 1.00 0.00  ? 106 TYR A O      3  
ATOM   6662  C CB     . TYR A 1 106 ? -18.804 12.130  -29.498 1.00 0.00  ? 106 TYR A CB     3  
ATOM   6663  C CG     . TYR A 1 106 ? -19.575 11.370  -28.440 1.00 0.00  ? 106 TYR A CG     3  
ATOM   6664  C CD1    . TYR A 1 106 ? -19.153 11.364  -27.116 1.00 0.00  ? 106 TYR A CD1    3  
ATOM   6665  C CD2    . TYR A 1 106 ? -20.722 10.659  -28.767 1.00 0.00  ? 106 TYR A CD2    3  
ATOM   6666  C CE1    . TYR A 1 106 ? -19.854 10.671  -26.148 1.00 0.00  ? 106 TYR A CE1    3  
ATOM   6667  C CE2    . TYR A 1 106 ? -21.429 9.964   -27.803 1.00 0.00  ? 106 TYR A CE2    3  
ATOM   6668  C CZ     . TYR A 1 106 ? -20.990 9.974   -26.498 1.00 0.00  ? 106 TYR A CZ     3  
ATOM   6669  O OH     . TYR A 1 106 ? -21.690 9.283   -25.536 1.00 0.00  ? 106 TYR A OH     3  
ATOM   6670  H H      . TYR A 1 106 ? -16.784 13.546  -30.134 1.00 0.00  ? 106 TYR A H      3  
ATOM   6671  H HA     . TYR A 1 106 ? -17.045 11.072  -28.891 1.00 0.00  ? 106 TYR A HA     3  
ATOM   6672  H HB2    . TYR A 1 106 ? -18.700 13.150  -29.162 1.00 0.00  ? 106 TYR A HB2    3  
ATOM   6673  H HB3    . TYR A 1 106 ? -19.386 12.113  -30.408 1.00 0.00  ? 106 TYR A HB3    3  
ATOM   6674  H HD1    . TYR A 1 106 ? -18.263 11.910  -26.847 1.00 0.00  ? 106 TYR A HD1    3  
ATOM   6675  H HD2    . TYR A 1 106 ? -21.062 10.653  -29.790 1.00 0.00  ? 106 TYR A HD2    3  
ATOM   6676  H HE1    . TYR A 1 106 ? -19.510 10.678  -25.122 1.00 0.00  ? 106 TYR A HE1    3  
ATOM   6677  H HE2    . TYR A 1 106 ? -22.320 9.417   -28.076 1.00 0.00  ? 106 TYR A HE2    3  
ATOM   6678  H HH     . TYR A 1 106 ? -21.970 8.434   -25.889 1.00 0.00  ? 106 TYR A HH     3  
ATOM   6679  N N      . ASP A 1 107 ? -17.488 11.008  -32.134 1.00 0.00  ? 107 ASP A N      3  
ATOM   6680  C CA     . ASP A 1 107 ? -17.535 10.140  -33.301 1.00 0.00  ? 107 ASP A CA     3  
ATOM   6681  C C      . ASP A 1 107 ? -16.136 9.996   -33.891 1.00 0.00  ? 107 ASP A C      3  
ATOM   6682  O O      . ASP A 1 107 ? -15.971 9.741   -35.083 1.00 0.00  ? 107 ASP A O      3  
ATOM   6683  C CB     . ASP A 1 107 ? -18.495 10.704  -34.349 1.00 0.00  ? 107 ASP A CB     3  
ATOM   6684  C CG     . ASP A 1 107 ? -19.940 10.654  -33.893 1.00 0.00  ? 107 ASP A CG     3  
ATOM   6685  O OD1    . ASP A 1 107 ? -20.704 11.582  -34.233 1.00 0.00  ? 107 ASP A OD1    3  
ATOM   6686  O OD2    . ASP A 1 107 ? -20.309 9.684   -33.196 1.00 0.00  ? 107 ASP A OD2    3  
ATOM   6687  H H      . ASP A 1 107 ? -17.430 11.976  -32.262 1.00 0.00  ? 107 ASP A H      3  
ATOM   6688  H HA     . ASP A 1 107 ? -17.884 9.168   -32.983 1.00 0.00  ? 107 ASP A HA     3  
ATOM   6689  H HB2    . ASP A 1 107 ? -18.237 11.734  -34.549 1.00 0.00  ? 107 ASP A HB2    3  
ATOM   6690  H HB3    . ASP A 1 107 ? -18.403 10.131  -35.259 1.00 0.00  ? 107 ASP A HB3    3  
ATOM   6691  H HD2    . ASP A 1 107 ? -21.234 9.715   -32.942 1.00 0.00  ? 107 ASP A HD2    3  
ATOM   6692  N N      . VAL A 1 108 ? -15.135 10.168  -33.031 1.00 0.00  ? 108 VAL A N      3  
ATOM   6693  C CA     . VAL A 1 108 ? -13.738 10.069  -33.427 1.00 0.00  ? 108 VAL A CA     3  
ATOM   6694  C C      . VAL A 1 108 ? -13.483 8.813   -34.254 1.00 0.00  ? 108 VAL A C      3  
ATOM   6695  O O      . VAL A 1 108 ? -14.113 7.776   -34.036 1.00 0.00  ? 108 VAL A O      3  
ATOM   6696  C CB     . VAL A 1 108 ? -12.825 10.065  -32.187 1.00 0.00  ? 108 VAL A CB     3  
ATOM   6697  C CG1    . VAL A 1 108 ? -13.238 8.975   -31.225 1.00 0.00  ? 108 VAL A CG1    3  
ATOM   6698  C CG2    . VAL A 1 108 ? -11.364 9.931   -32.572 1.00 0.00  ? 108 VAL A CG2    3  
ATOM   6699  H H      . VAL A 1 108 ? -15.343 10.370  -32.097 1.00 0.00  ? 108 VAL A H      3  
ATOM   6700  H HA     . VAL A 1 108 ? -13.497 10.936  -34.024 1.00 0.00  ? 108 VAL A HA     3  
ATOM   6701  H HB     . VAL A 1 108 ? -12.948 11.004  -31.680 1.00 0.00  ? 108 VAL A HB     3  
ATOM   6702  H HG11   . VAL A 1 108 ? -14.247 9.162   -30.885 1.00 0.00  ? 108 VAL A HG11   3  
ATOM   6703  H HG12   . VAL A 1 108 ? -12.567 8.973   -30.378 1.00 0.00  ? 108 VAL A HG12   3  
ATOM   6704  H HG13   . VAL A 1 108 ? -13.197 8.021   -31.726 1.00 0.00  ? 108 VAL A HG13   3  
ATOM   6705  H HG21   . VAL A 1 108 ? -11.054 10.811  -33.114 1.00 0.00  ? 108 VAL A HG21   3  
ATOM   6706  H HG22   . VAL A 1 108 ? -11.233 9.058   -33.193 1.00 0.00  ? 108 VAL A HG22   3  
ATOM   6707  H HG23   . VAL A 1 108 ? -10.768 9.831   -31.676 1.00 0.00  ? 108 VAL A HG23   3  
ATOM   6708  N N      . GLU A 1 109 ? -12.559 8.912   -35.202 1.00 0.00  ? 109 GLU A N      3  
ATOM   6709  C CA     . GLU A 1 109 ? -12.226 7.788   -36.057 1.00 0.00  ? 109 GLU A CA     3  
ATOM   6710  C C      . GLU A 1 109 ? -11.524 6.700   -35.259 1.00 0.00  ? 109 GLU A C      3  
ATOM   6711  O O      . GLU A 1 109 ? -10.728 6.981   -34.365 1.00 0.00  ? 109 GLU A O      3  
ATOM   6712  C CB     . GLU A 1 109 ? -11.358 8.240   -37.245 1.00 0.00  ? 109 GLU A CB     3  
ATOM   6713  C CG     . GLU A 1 109 ? -9.857  8.288   -36.966 1.00 0.00  ? 109 GLU A CG     3  
ATOM   6714  C CD     . GLU A 1 109 ? -9.335  9.702   -36.805 1.00 0.00  ? 109 GLU A CD     3  
ATOM   6715  O OE1    . GLU A 1 109 ? -8.130  9.921   -37.058 1.00 0.00  ? 109 GLU A OE1    3  
ATOM   6716  O OE2    . GLU A 1 109 ? -10.128 10.589  -36.425 1.00 0.00  ? 109 GLU A OE2    3  
ATOM   6717  H H      . GLU A 1 109 ? -12.093 9.758   -35.327 1.00 0.00  ? 109 GLU A H      3  
ATOM   6718  H HA     . GLU A 1 109 ? -13.152 7.384   -36.439 1.00 0.00  ? 109 GLU A HA     3  
ATOM   6719  H HB2    . GLU A 1 109 ? -11.521 7.559   -38.067 1.00 0.00  ? 109 GLU A HB2    3  
ATOM   6720  H HB3    . GLU A 1 109 ? -11.676 9.229   -37.545 1.00 0.00  ? 109 GLU A HB3    3  
ATOM   6721  H HG2    . GLU A 1 109 ? -9.650  7.744   -36.059 1.00 0.00  ? 109 GLU A HG2    3  
ATOM   6722  H HG3    . GLU A 1 109 ? -9.337  7.817   -37.790 1.00 0.00  ? 109 GLU A HG3    3  
ATOM   6723  H HE2    . GLU A 1 109 ? -9.730  11.458  -36.345 1.00 0.00  ? 109 GLU A HE2    3  
ATOM   6724  N N      . ILE A 1 110 ? -11.824 5.461   -35.598 1.00 0.00  ? 110 ILE A N      3  
ATOM   6725  C CA     . ILE A 1 110 ? -11.221 4.323   -34.926 1.00 0.00  ? 110 ILE A CA     3  
ATOM   6726  C C      . ILE A 1 110 ? -10.471 3.452   -35.922 1.00 0.00  ? 110 ILE A C      3  
ATOM   6727  O O      . ILE A 1 110 ? -11.060 2.620   -36.612 1.00 0.00  ? 110 ILE A O      3  
ATOM   6728  C CB     . ILE A 1 110 ? -12.266 3.487   -34.166 1.00 0.00  ? 110 ILE A CB     3  
ATOM   6729  C CG1    . ILE A 1 110 ? -12.881 4.327   -33.048 1.00 0.00  ? 110 ILE A CG1    3  
ATOM   6730  C CG2    . ILE A 1 110 ? -11.620 2.236   -33.594 1.00 0.00  ? 110 ILE A CG2    3  
ATOM   6731  C CD1    . ILE A 1 110 ? -11.872 4.772   -32.011 1.00 0.00  ? 110 ILE A CD1    3  
ATOM   6732  H H      . ILE A 1 110 ? -12.463 5.308   -36.323 1.00 0.00  ? 110 ILE A H      3  
ATOM   6733  H HA     . ILE A 1 110 ? -10.514 4.707   -34.207 1.00 0.00  ? 110 ILE A HA     3  
ATOM   6734  H HB     . ILE A 1 110 ? -13.039 3.188   -34.858 1.00 0.00  ? 110 ILE A HB     3  
ATOM   6735  H HG12   . ILE A 1 110 ? -13.331 5.211   -33.474 1.00 0.00  ? 110 ILE A HG12   3  
ATOM   6736  H HG13   . ILE A 1 110 ? -13.637 3.748   -32.546 1.00 0.00  ? 110 ILE A HG13   3  
ATOM   6737  H HG21   . ILE A 1 110 ? -10.553 2.391   -33.510 1.00 0.00  ? 110 ILE A HG21   3  
ATOM   6738  H HG22   . ILE A 1 110 ? -11.810 1.401   -34.249 1.00 0.00  ? 110 ILE A HG22   3  
ATOM   6739  H HG23   . ILE A 1 110 ? -12.034 2.032   -32.617 1.00 0.00  ? 110 ILE A HG23   3  
ATOM   6740  H HD11   . ILE A 1 110 ? -10.979 4.169   -32.095 1.00 0.00  ? 110 ILE A HD11   3  
ATOM   6741  H HD12   . ILE A 1 110 ? -12.295 4.655   -31.023 1.00 0.00  ? 110 ILE A HD12   3  
ATOM   6742  H HD13   . ILE A 1 110 ? -11.620 5.811   -32.174 1.00 0.00  ? 110 ILE A HD13   3  
ATOM   6743  N N      . ARG A 1 111 ? -9.164  3.662   -35.990 1.00 0.00  ? 111 ARG A N      3  
ATOM   6744  C CA     . ARG A 1 111 ? -8.310  2.915   -36.903 1.00 0.00  ? 111 ARG A CA     3  
ATOM   6745  C C      . ARG A 1 111 ? -7.557  1.821   -36.153 1.00 0.00  ? 111 ARG A C      3  
ATOM   6746  O O      . ARG A 1 111 ? -6.556  2.082   -35.484 1.00 0.00  ? 111 ARG A O      3  
ATOM   6747  C CB     . ARG A 1 111 ? -7.341  3.866   -37.611 1.00 0.00  ? 111 ARG A CB     3  
ATOM   6748  C CG     . ARG A 1 111 ? -8.053  4.965   -38.389 1.00 0.00  ? 111 ARG A CG     3  
ATOM   6749  C CD     . ARG A 1 111 ? -7.312  6.291   -38.318 1.00 0.00  ? 111 ARG A CD     3  
ATOM   6750  N NE     . ARG A 1 111 ? -5.992  6.224   -38.941 1.00 0.00  ? 111 ARG A NE     3  
ATOM   6751  C CZ     . ARG A 1 111 ? -5.238  7.293   -39.192 1.00 0.00  ? 111 ARG A CZ     3  
ATOM   6752  N NH1    . ARG A 1 111 ? -5.668  8.508   -38.869 1.00 0.00  ? 111 ARG A NH1    3  
ATOM   6753  N NH2    . ARG A 1 111 ? -4.051  7.149   -39.765 1.00 0.00  ? 111 ARG A NH2    3  
ATOM   6754  H H      . ARG A 1 111 ? -8.766  4.342   -35.412 1.00 0.00  ? 111 ARG A H      3  
ATOM   6755  H HA     . ARG A 1 111 ? -8.946  2.450   -37.643 1.00 0.00  ? 111 ARG A HA     3  
ATOM   6756  H HB2    . ARG A 1 111 ? -6.702  4.327   -36.873 1.00 0.00  ? 111 ARG A HB2    3  
ATOM   6757  H HB3    . ARG A 1 111 ? -6.732  3.301   -38.301 1.00 0.00  ? 111 ARG A HB3    3  
ATOM   6758  H HG2    . ARG A 1 111 ? -8.133  4.671   -39.422 1.00 0.00  ? 111 ARG A HG2    3  
ATOM   6759  H HG3    . ARG A 1 111 ? -9.043  5.096   -37.975 1.00 0.00  ? 111 ARG A HG3    3  
ATOM   6760  H HD2    . ARG A 1 111 ? -7.898  7.042   -38.828 1.00 0.00  ? 111 ARG A HD2    3  
ATOM   6761  H HD3    . ARG A 1 111 ? -7.198  6.572   -37.284 1.00 0.00  ? 111 ARG A HD3    3  
ATOM   6762  H HE     . ARG A 1 111 ? -5.651  5.340   -39.187 1.00 0.00  ? 111 ARG A HE     3  
ATOM   6763  H HH11   . ARG A 1 111 ? -6.563  8.623   -38.433 1.00 0.00  ? 111 ARG A HH11   3  
ATOM   6764  H HH12   . ARG A 1 111 ? -5.099  9.307   -39.059 1.00 0.00  ? 111 ARG A HH12   3  
ATOM   6765  H HH21   . ARG A 1 111 ? -3.721  6.238   -40.009 1.00 0.00  ? 111 ARG A HH21   3  
ATOM   6766  H HH22   . ARG A 1 111 ? -3.486  7.953   -39.954 1.00 0.00  ? 111 ARG A HH22   3  
ATOM   6767  N N      . LEU A 1 112 ? -8.066  0.598   -36.257 1.00 0.00  ? 112 LEU A N      3  
ATOM   6768  C CA     . LEU A 1 112 ? -7.472  -0.550  -35.580 1.00 0.00  ? 112 LEU A CA     3  
ATOM   6769  C C      . LEU A 1 112 ? -6.462  -1.269  -36.465 1.00 0.00  ? 112 LEU A C      3  
ATOM   6770  O O      . LEU A 1 112 ? -6.122  -0.798  -37.551 1.00 0.00  ? 112 LEU A O      3  
ATOM   6771  C CB     . LEU A 1 112 ? -8.565  -1.531  -35.141 1.00 0.00  ? 112 LEU A CB     3  
ATOM   6772  C CG     . LEU A 1 112 ? -9.907  -0.893  -34.778 1.00 0.00  ? 112 LEU A CG     3  
ATOM   6773  C CD1    . LEU A 1 112 ? -10.987 -1.955  -34.640 1.00 0.00  ? 112 LEU A CD1    3  
ATOM   6774  C CD2    . LEU A 1 112 ? -9.778  -0.094  -33.493 1.00 0.00  ? 112 LEU A CD2    3  
ATOM   6775  H H      . LEU A 1 112 ? -8.874  0.465   -36.796 1.00 0.00  ? 112 LEU A H      3  
ATOM   6776  H HA     . LEU A 1 112 ? -6.962  -0.187  -34.701 1.00 0.00  ? 112 LEU A HA     3  
ATOM   6777  H HB2    . LEU A 1 112 ? -8.728  -2.237  -35.943 1.00 0.00  ? 112 LEU A HB2    3  
ATOM   6778  H HB3    . LEU A 1 112 ? -8.207  -2.072  -34.277 1.00 0.00  ? 112 LEU A HB3    3  
ATOM   6779  H HG     . LEU A 1 112 ? -10.202 -0.217  -35.567 1.00 0.00  ? 112 LEU A HG     3  
ATOM   6780  H HD11   . LEU A 1 112 ? -11.602 -1.735  -33.780 1.00 0.00  ? 112 LEU A HD11   3  
ATOM   6781  H HD12   . LEU A 1 112 ? -10.528 -2.925  -34.515 1.00 0.00  ? 112 LEU A HD12   3  
ATOM   6782  H HD13   . LEU A 1 112 ? -11.601 -1.962  -35.531 1.00 0.00  ? 112 LEU A HD13   3  
ATOM   6783  H HD21   . LEU A 1 112 ? -9.130  -0.617  -32.807 1.00 0.00  ? 112 LEU A HD21   3  
ATOM   6784  H HD22   . LEU A 1 112 ? -10.753 0.030   -33.047 1.00 0.00  ? 112 LEU A HD22   3  
ATOM   6785  H HD23   . LEU A 1 112 ? -9.358  0.877   -33.715 1.00 0.00  ? 112 LEU A HD23   3  
ATOM   6786  N N      . SER A 1 113 ? -5.985  -2.415  -35.986 1.00 0.00  ? 113 SER A N      3  
ATOM   6787  C CA     . SER A 1 113 ? -5.009  -3.212  -36.719 1.00 0.00  ? 113 SER A CA     3  
ATOM   6788  C C      . SER A 1 113 ? -5.500  -4.647  -36.891 1.00 0.00  ? 113 SER A C      3  
ATOM   6789  O O      . SER A 1 113 ? -6.641  -4.965  -36.559 1.00 0.00  ? 113 SER A O      3  
ATOM   6790  C CB     . SER A 1 113 ? -3.665  -3.204  -35.989 1.00 0.00  ? 113 SER A CB     3  
ATOM   6791  O OG     . SER A 1 113 ? -2.615  -3.621  -36.843 1.00 0.00  ? 113 SER A OG     3  
ATOM   6792  H H      . SER A 1 113 ? -6.296  -2.733  -35.112 1.00 0.00  ? 113 SER A H      3  
ATOM   6793  H HA     . SER A 1 113 ? -4.882  -2.768  -37.696 1.00 0.00  ? 113 SER A HA     3  
ATOM   6794  H HB2    . SER A 1 113 ? -3.453  -2.205  -35.639 1.00 0.00  ? 113 SER A HB2    3  
ATOM   6795  H HB3    . SER A 1 113 ? -3.712  -3.877  -35.144 1.00 0.00  ? 113 SER A HB3    3  
ATOM   6796  H HG     . SER A 1 113 ? -2.375  -2.900  -37.430 1.00 0.00  ? 113 SER A HG     3  
ATOM   6797  N N      . HIS A 1 114 ? -4.630  -5.509  -37.410 1.00 0.00  ? 114 HIS A N      3  
ATOM   6798  C CA     . HIS A 1 114 ? -4.978  -6.910  -37.624 1.00 0.00  ? 114 HIS A CA     3  
ATOM   6799  C C      . HIS A 1 114 ? -5.199  -7.636  -36.299 1.00 0.00  ? 114 HIS A C      3  
ATOM   6800  O O      . HIS A 1 114 ? -5.913  -8.637  -36.242 1.00 0.00  ? 114 HIS A O      3  
ATOM   6801  C CB     . HIS A 1 114 ? -3.879  -7.614  -38.424 1.00 0.00  ? 114 HIS A CB     3  
ATOM   6802  C CG     . HIS A 1 114 ? -3.856  -7.241  -39.873 1.00 0.00  ? 114 HIS A CG     3  
ATOM   6803  N ND1    . HIS A 1 114 ? -2.870  -6.459  -40.434 1.00 0.00  ? 114 HIS A ND1    3  
ATOM   6804  C CD2    . HIS A 1 114 ? -4.708  -7.550  -40.881 1.00 0.00  ? 114 HIS A CD2    3  
ATOM   6805  C CE1    . HIS A 1 114 ? -3.113  -6.301  -41.722 1.00 0.00  ? 114 HIS A CE1    3  
ATOM   6806  N NE2    . HIS A 1 114 ? -4.222  -6.951  -42.020 1.00 0.00  ? 114 HIS A NE2    3  
ATOM   6807  H H      . HIS A 1 114 ? -3.734  -5.196  -37.654 1.00 0.00  ? 114 HIS A H      3  
ATOM   6808  H HA     . HIS A 1 114 ? -5.896  -6.939  -38.193 1.00 0.00  ? 114 HIS A HA     3  
ATOM   6809  H HB2    . HIS A 1 114 ? -2.919  -7.362  -38.002 1.00 0.00  ? 114 HIS A HB2    3  
ATOM   6810  H HB3    . HIS A 1 114 ? -4.025  -8.683  -38.357 1.00 0.00  ? 114 HIS A HB3    3  
ATOM   6811  H HD1    . HIS A 1 114 ? -2.104  -6.077  -39.958 1.00 0.00  ? 114 HIS A HD1    3  
ATOM   6812  H HD2    . HIS A 1 114 ? -5.601  -8.152  -40.806 1.00 0.00  ? 114 HIS A HD2    3  
ATOM   6813  H HE1    . HIS A 1 114 ? -2.510  -5.734  -42.415 1.00 0.00  ? 114 HIS A HE1    3  
ATOM   6814  H HE2    . HIS A 1 114 ? -4.684  -6.913  -42.884 1.00 0.00  ? 114 HIS A HE2    3  
ATOM   6815  N N      . GLU A 1 115 ? -4.580  -7.127  -35.236 1.00 0.00  ? 115 GLU A N      3  
ATOM   6816  C CA     . GLU A 1 115 ? -4.711  -7.732  -33.914 1.00 0.00  ? 115 GLU A CA     3  
ATOM   6817  C C      . GLU A 1 115 ? -6.037  -7.350  -33.258 1.00 0.00  ? 115 GLU A C      3  
ATOM   6818  O O      . GLU A 1 115 ? -6.431  -7.938  -32.250 1.00 0.00  ? 115 GLU A O      3  
ATOM   6819  C CB     . GLU A 1 115 ? -3.548  -7.302  -33.019 1.00 0.00  ? 115 GLU A CB     3  
ATOM   6820  C CG     . GLU A 1 115 ? -2.194  -7.789  -33.510 1.00 0.00  ? 115 GLU A CG     3  
ATOM   6821  C CD     . GLU A 1 115 ? -1.547  -8.774  -32.556 1.00 0.00  ? 115 GLU A CD     3  
ATOM   6822  O OE1    . GLU A 1 115 ? -0.370  -8.565  -32.193 1.00 0.00  ? 115 GLU A OE1    3  
ATOM   6823  O OE2    . GLU A 1 115 ? -2.217  -9.754  -32.169 1.00 0.00  ? 115 GLU A OE2    3  
ATOM   6824  H H      . GLU A 1 115 ? -4.022  -6.329  -35.344 1.00 0.00  ? 115 GLU A H      3  
ATOM   6825  H HA     . GLU A 1 115 ? -4.681  -8.805  -34.036 1.00 0.00  ? 115 GLU A HA     3  
ATOM   6826  H HB2    . GLU A 1 115 ? -3.522  -6.224  -32.975 1.00 0.00  ? 115 GLU A HB2    3  
ATOM   6827  H HB3    . GLU A 1 115 ? -3.708  -7.692  -32.025 1.00 0.00  ? 115 GLU A HB3    3  
ATOM   6828  H HG2    . GLU A 1 115 ? -2.323  -8.272  -34.466 1.00 0.00  ? 115 GLU A HG2    3  
ATOM   6829  H HG3    . GLU A 1 115 ? -1.539  -6.937  -33.623 1.00 0.00  ? 115 GLU A HG3    3  
ATOM   6830  H HE2    . GLU A 1 115 ? -1.746  -10.335 -31.567 1.00 0.00  ? 115 GLU A HE2    3  
ATOM   6831  N N      . HIS A 1 116 ? -6.723  -6.364  -33.831 1.00 0.00  ? 116 HIS A N      3  
ATOM   6832  C CA     . HIS A 1 116 ? -8.004  -5.910  -33.299 1.00 0.00  ? 116 HIS A CA     3  
ATOM   6833  C C      . HIS A 1 116 ? -9.090  -5.981  -34.369 1.00 0.00  ? 116 HIS A C      3  
ATOM   6834  O O      . HIS A 1 116 ? -9.119  -5.167  -35.293 1.00 0.00  ? 116 HIS A O      3  
ATOM   6835  C CB     . HIS A 1 116 ? -7.877  -4.483  -32.765 1.00 0.00  ? 116 HIS A CB     3  
ATOM   6836  C CG     . HIS A 1 116 ? -6.796  -4.329  -31.740 1.00 0.00  ? 116 HIS A CG     3  
ATOM   6837  N ND1    . HIS A 1 116 ? -6.996  -4.546  -30.394 1.00 0.00  ? 116 HIS A ND1    3  
ATOM   6838  C CD2    . HIS A 1 116 ? -5.494  -3.984  -31.875 1.00 0.00  ? 116 HIS A CD2    3  
ATOM   6839  C CE1    . HIS A 1 116 ? -5.865  -4.342  -29.744 1.00 0.00  ? 116 HIS A CE1    3  
ATOM   6840  N NE2    . HIS A 1 116 ? -4.938  -4.000  -30.620 1.00 0.00  ? 116 HIS A NE2    3  
ATOM   6841  H H      . HIS A 1 116 ? -6.361  -5.931  -34.631 1.00 0.00  ? 116 HIS A H      3  
ATOM   6842  H HA     . HIS A 1 116 ? -8.275  -6.566  -32.484 1.00 0.00  ? 116 HIS A HA     3  
ATOM   6843  H HB2    . HIS A 1 116 ? -7.655  -3.818  -33.585 1.00 0.00  ? 116 HIS A HB2    3  
ATOM   6844  H HB3    . HIS A 1 116 ? -8.812  -4.191  -32.312 1.00 0.00  ? 116 HIS A HB3    3  
ATOM   6845  H HD1    . HIS A 1 116 ? -7.842  -4.813  -29.977 1.00 0.00  ? 116 HIS A HD1    3  
ATOM   6846  H HD2    . HIS A 1 116 ? -4.988  -3.742  -32.799 1.00 0.00  ? 116 HIS A HD2    3  
ATOM   6847  H HE1    . HIS A 1 116 ? -5.721  -4.442  -28.679 1.00 0.00  ? 116 HIS A HE1    3  
ATOM   6848  H HE2    . HIS A 1 116 ? -3.980  -3.920  -30.423 1.00 0.00  ? 116 HIS A HE2    3  
ATOM   6849  N N      . GLN A 1 117 ? -9.974  -6.967  -34.244 1.00 0.00  ? 117 GLN A N      3  
ATOM   6850  C CA     . GLN A 1 117 ? -11.055 -7.157  -35.203 1.00 0.00  ? 117 GLN A CA     3  
ATOM   6851  C C      . GLN A 1 117 ? -12.160 -6.116  -35.029 1.00 0.00  ? 117 GLN A C      3  
ATOM   6852  O O      . GLN A 1 117 ? -12.986 -5.926  -35.922 1.00 0.00  ? 117 GLN A O      3  
ATOM   6853  C CB     . GLN A 1 117 ? -11.646 -8.561  -35.064 1.00 0.00  ? 117 GLN A CB     3  
ATOM   6854  C CG     . GLN A 1 117 ? -12.288 -8.817  -33.711 1.00 0.00  ? 117 GLN A CG     3  
ATOM   6855  C CD     . GLN A 1 117 ? -13.509 -9.712  -33.805 1.00 0.00  ? 117 GLN A CD     3  
ATOM   6856  O OE1    . GLN A 1 117 ? -13.610 -10.720 -33.105 1.00 0.00  ? 117 GLN A OE1    3  
ATOM   6857  N NE2    . GLN A 1 117 ? -14.444 -9.348  -34.673 1.00 0.00  ? 117 GLN A NE2    3  
ATOM   6858  H H      . GLN A 1 117 ? -9.891  -7.588  -33.489 1.00 0.00  ? 117 GLN A H      3  
ATOM   6859  H HA     . GLN A 1 117 ? -10.638 -7.055  -36.194 1.00 0.00  ? 117 GLN A HA     3  
ATOM   6860  H HB2    . GLN A 1 117 ? -12.397 -8.700  -35.827 1.00 0.00  ? 117 GLN A HB2    3  
ATOM   6861  H HB3    . GLN A 1 117 ? -10.861 -9.287  -35.208 1.00 0.00  ? 117 GLN A HB3    3  
ATOM   6862  H HG2    . GLN A 1 117 ? -11.563 -9.292  -33.067 1.00 0.00  ? 117 GLN A HG2    3  
ATOM   6863  H HG3    . GLN A 1 117 ? -12.587 -7.872  -33.282 1.00 0.00  ? 117 GLN A HG3    3  
ATOM   6864  H HE21   . GLN A 1 117 ? -14.298 -8.532  -35.198 1.00 0.00  ? 117 GLN A HE21   3  
ATOM   6865  H HE22   . GLN A 1 117 ? -15.243 -9.910  -34.757 1.00 0.00  ? 117 GLN A HE22   3  
ATOM   6866  N N      . ALA A 1 118 ? -12.180 -5.446  -33.881 1.00 0.00  ? 118 ALA A N      3  
ATOM   6867  C CA     . ALA A 1 118 ? -13.200 -4.435  -33.622 1.00 0.00  ? 118 ALA A CA     3  
ATOM   6868  C C      . ALA A 1 118 ? -12.906 -3.651  -32.348 1.00 0.00  ? 118 ALA A C      3  
ATOM   6869  O O      . ALA A 1 118 ? -11.903 -3.886  -31.673 1.00 0.00  ? 118 ALA A O      3  
ATOM   6870  C CB     . ALA A 1 118 ? -14.572 -5.087  -33.533 1.00 0.00  ? 118 ALA A CB     3  
ATOM   6871  H H      . ALA A 1 118 ? -11.503 -5.633  -33.198 1.00 0.00  ? 118 ALA A H      3  
ATOM   6872  H HA     . ALA A 1 118 ? -13.208 -3.751  -34.457 1.00 0.00  ? 118 ALA A HA     3  
ATOM   6873  H HB1    . ALA A 1 118 ? -14.460 -6.121  -33.241 1.00 0.00  ? 118 ALA A HB1    3  
ATOM   6874  H HB2    . ALA A 1 118 ? -15.056 -5.035  -34.497 1.00 0.00  ? 118 ALA A HB2    3  
ATOM   6875  H HB3    . ALA A 1 118 ? -15.172 -4.568  -32.800 1.00 0.00  ? 118 ALA A HB3    3  
ATOM   6876  N N      . TYR A 1 119 ? -13.792 -2.712  -32.030 1.00 0.00  ? 119 TYR A N      3  
ATOM   6877  C CA     . TYR A 1 119 ? -13.643 -1.878  -30.843 1.00 0.00  ? 119 TYR A CA     3  
ATOM   6878  C C      . TYR A 1 119 ? -15.005 -1.548  -30.241 1.00 0.00  ? 119 TYR A C      3  
ATOM   6879  O O      . TYR A 1 119 ? -16.041 -1.841  -30.839 1.00 0.00  ? 119 TYR A O      3  
ATOM   6880  C CB     . TYR A 1 119 ? -12.918 -0.583  -31.205 1.00 0.00  ? 119 TYR A CB     3  
ATOM   6881  C CG     . TYR A 1 119 ? -13.757 0.338   -32.062 1.00 0.00  ? 119 TYR A CG     3  
ATOM   6882  C CD1    . TYR A 1 119 ? -13.787 0.198   -33.443 1.00 0.00  ? 119 TYR A CD1    3  
ATOM   6883  C CD2    . TYR A 1 119 ? -14.529 1.336   -31.483 1.00 0.00  ? 119 TYR A CD2    3  
ATOM   6884  C CE1    . TYR A 1 119 ? -14.562 1.032   -34.225 1.00 0.00  ? 119 TYR A CE1    3  
ATOM   6885  C CE2    . TYR A 1 119 ? -15.309 2.171   -32.256 1.00 0.00  ? 119 TYR A CE2    3  
ATOM   6886  C CZ     . TYR A 1 119 ? -15.322 2.017   -33.626 1.00 0.00  ? 119 TYR A CZ     3  
ATOM   6887  O OH     . TYR A 1 119 ? -16.097 2.848   -34.402 1.00 0.00  ? 119 TYR A OH     3  
ATOM   6888  H H      . TYR A 1 119 ? -14.567 -2.574  -32.612 1.00 0.00  ? 119 TYR A H      3  
ATOM   6889  H HA     . TYR A 1 119 ? -13.057 -2.424  -30.121 1.00 0.00  ? 119 TYR A HA     3  
ATOM   6890  H HB2    . TYR A 1 119 ? -12.661 -0.055  -30.299 1.00 0.00  ? 119 TYR A HB2    3  
ATOM   6891  H HB3    . TYR A 1 119 ? -12.016 -0.820  -31.750 1.00 0.00  ? 119 TYR A HB3    3  
ATOM   6892  H HD1    . TYR A 1 119 ? -13.192 -0.573  -33.906 1.00 0.00  ? 119 TYR A HD1    3  
ATOM   6893  H HD2    . TYR A 1 119 ? -14.514 1.456   -30.410 1.00 0.00  ? 119 TYR A HD2    3  
ATOM   6894  H HE1    . TYR A 1 119 ? -14.571 0.913   -35.300 1.00 0.00  ? 119 TYR A HE1    3  
ATOM   6895  H HE2    . TYR A 1 119 ? -15.900 2.943   -31.788 1.00 0.00  ? 119 TYR A HE2    3  
ATOM   6896  H HH     . TYR A 1 119 ? -15.884 3.763   -34.207 1.00 0.00  ? 119 TYR A HH     3  
ATOM   6897  N N      . ARG A 1 120 ? -15.004 -0.933  -29.061 1.00 0.00  ? 120 ARG A N      3  
ATOM   6898  C CA     . ARG A 1 120 ? -16.251 -0.567  -28.399 1.00 0.00  ? 120 ARG A CA     3  
ATOM   6899  C C      . ARG A 1 120 ? -16.044 0.555   -27.390 1.00 0.00  ? 120 ARG A C      3  
ATOM   6900  O O      . ARG A 1 120 ? -14.962 0.714   -26.825 1.00 0.00  ? 120 ARG A O      3  
ATOM   6901  C CB     . ARG A 1 120 ? -16.854 -1.777  -27.683 1.00 0.00  ? 120 ARG A CB     3  
ATOM   6902  C CG     . ARG A 1 120 ? -17.566 -2.751  -28.608 1.00 0.00  ? 120 ARG A CG     3  
ATOM   6903  C CD     . ARG A 1 120 ? -18.214 -3.883  -27.828 1.00 0.00  ? 120 ARG A CD     3  
ATOM   6904  N NE     . ARG A 1 120 ? -19.229 -4.580  -28.614 1.00 0.00  ? 120 ARG A NE     3  
ATOM   6905  C CZ     . ARG A 1 120 ? -20.220 -5.293  -28.085 1.00 0.00  ? 120 ARG A CZ     3  
ATOM   6906  N NH1    . ARG A 1 120 ? -20.327 -5.420  -26.770 1.00 0.00  ? 120 ARG A NH1    3  
ATOM   6907  N NH2    . ARG A 1 120 ? -21.105 -5.884  -28.876 1.00 0.00  ? 120 ARG A NH2    3  
ATOM   6908  H H      . ARG A 1 120 ? -14.150 -0.718  -28.631 1.00 0.00  ? 120 ARG A H      3  
ATOM   6909  H HA     . ARG A 1 120 ? -16.942 -0.230  -29.156 1.00 0.00  ? 120 ARG A HA     3  
ATOM   6910  H HB2    . ARG A 1 120 ? -16.065 -2.307  -27.176 1.00 0.00  ? 120 ARG A HB2    3  
ATOM   6911  H HB3    . ARG A 1 120 ? -17.565 -1.426  -26.950 1.00 0.00  ? 120 ARG A HB3    3  
ATOM   6912  H HG2    . ARG A 1 120 ? -18.331 -2.220  -29.154 1.00 0.00  ? 120 ARG A HG2    3  
ATOM   6913  H HG3    . ARG A 1 120 ? -16.851 -3.167  -29.301 1.00 0.00  ? 120 ARG A HG3    3  
ATOM   6914  H HD2    . ARG A 1 120 ? -17.450 -4.587  -27.539 1.00 0.00  ? 120 ARG A HD2    3  
ATOM   6915  H HD3    . ARG A 1 120 ? -18.676 -3.472  -26.942 1.00 0.00  ? 120 ARG A HD3    3  
ATOM   6916  H HE     . ARG A 1 120 ? -19.171 -4.509  -29.591 1.00 0.00  ? 120 ARG A HE     3  
ATOM   6917  H HH11   . ARG A 1 120 ? -19.663 -4.982  -26.167 1.00 0.00  ? 120 ARG A HH11   3  
ATOM   6918  H HH12   . ARG A 1 120 ? -21.076 -5.958  -26.380 1.00 0.00  ? 120 ARG A HH12   3  
ATOM   6919  H HH21   . ARG A 1 120 ? -21.028 -5.795  -29.868 1.00 0.00  ? 120 ARG A HH21   3  
ATOM   6920  H HH22   . ARG A 1 120 ? -21.852 -6.420  -28.479 1.00 0.00  ? 120 ARG A HH22   3  
ATOM   6921  N N      . TRP A 1 121 ? -17.107 1.314   -27.158 1.00 0.00  ? 121 TRP A N      3  
ATOM   6922  C CA     . TRP A 1 121 ? -17.084 2.414   -26.199 1.00 0.00  ? 121 TRP A CA     3  
ATOM   6923  C C      . TRP A 1 121 ? -18.088 2.137   -25.089 1.00 0.00  ? 121 TRP A C      3  
ATOM   6924  O O      . TRP A 1 121 ? -19.298 2.208   -25.305 1.00 0.00  ? 121 TRP A O      3  
ATOM   6925  C CB     . TRP A 1 121 ? -17.414 3.736   -26.892 1.00 0.00  ? 121 TRP A CB     3  
ATOM   6926  C CG     . TRP A 1 121 ? -16.299 4.262   -27.744 1.00 0.00  ? 121 TRP A CG     3  
ATOM   6927  C CD1    . TRP A 1 121 ? -16.146 4.089   -29.090 1.00 0.00  ? 121 TRP A CD1    3  
ATOM   6928  C CD2    . TRP A 1 121 ? -15.186 5.049   -27.309 1.00 0.00  ? 121 TRP A CD2    3  
ATOM   6929  N NE1    . TRP A 1 121 ? -15.001 4.719   -29.518 1.00 0.00  ? 121 TRP A NE1    3  
ATOM   6930  C CE2    . TRP A 1 121 ? -14.396 5.317   -28.444 1.00 0.00  ? 121 TRP A CE2    3  
ATOM   6931  C CE3    . TRP A 1 121 ? -14.782 5.555   -26.071 1.00 0.00  ? 121 TRP A CE3    3  
ATOM   6932  C CZ2    . TRP A 1 121 ? -13.226 6.068   -28.374 1.00 0.00  ? 121 TRP A CZ2    3  
ATOM   6933  C CZ3    . TRP A 1 121 ? -13.620 6.299   -26.004 1.00 0.00  ? 121 TRP A CZ3    3  
ATOM   6934  C CH2    . TRP A 1 121 ? -12.855 6.550   -27.150 1.00 0.00  ? 121 TRP A CH2    3  
ATOM   6935  H H      . TRP A 1 121 ? -17.941 1.115   -27.631 1.00 0.00  ? 121 TRP A H      3  
ATOM   6936  H HA     . TRP A 1 121 ? -16.092 2.468   -25.776 1.00 0.00  ? 121 TRP A HA     3  
ATOM   6937  H HB2    . TRP A 1 121 ? -18.279 3.597   -27.526 1.00 0.00  ? 121 TRP A HB2    3  
ATOM   6938  H HB3    . TRP A 1 121 ? -17.641 4.480   -26.141 1.00 0.00  ? 121 TRP A HB3    3  
ATOM   6939  H HD1    . TRP A 1 121 ? -16.829 3.533   -29.714 1.00 0.00  ? 121 TRP A HD1    3  
ATOM   6940  H HE1    . TRP A 1 121 ? -14.675 4.739   -30.442 1.00 0.00  ? 121 TRP A HE1    3  
ATOM   6941  H HE3    . TRP A 1 121 ? -15.361 5.371   -25.178 1.00 0.00  ? 121 TRP A HE3    3  
ATOM   6942  H HZ2    . TRP A 1 121 ? -12.624 6.272   -29.247 1.00 0.00  ? 121 TRP A HZ2    3  
ATOM   6943  H HZ3    . TRP A 1 121 ? -13.292 6.698   -25.056 1.00 0.00  ? 121 TRP A HZ3    3  
ATOM   6944  H HH2    . TRP A 1 121 ? -11.955 7.134   -27.049 1.00 0.00  ? 121 TRP A HH2    3  
ATOM   6945  N N      . LEU A 1 122 ? -17.587 1.795   -23.905 1.00 0.00  ? 122 LEU A N      3  
ATOM   6946  C CA     . LEU A 1 122 ? -18.458 1.477   -22.779 1.00 0.00  ? 122 LEU A CA     3  
ATOM   6947  C C      . LEU A 1 122 ? -17.964 2.115   -21.488 1.00 0.00  ? 122 LEU A C      3  
ATOM   6948  O O      . LEU A 1 122 ? -16.880 2.694   -21.441 1.00 0.00  ? 122 LEU A O      3  
ATOM   6949  C CB     . LEU A 1 122 ? -18.546 -0.041  -22.592 1.00 0.00  ? 122 LEU A CB     3  
ATOM   6950  C CG     . LEU A 1 122 ? -18.207 -0.881  -23.830 1.00 0.00  ? 122 LEU A CG     3  
ATOM   6951  C CD1    . LEU A 1 122 ? -16.780 -1.407  -23.744 1.00 0.00  ? 122 LEU A CD1    3  
ATOM   6952  C CD2    . LEU A 1 122 ? -19.192 -2.029  -23.989 1.00 0.00  ? 122 LEU A CD2    3  
ATOM   6953  H H      . LEU A 1 122 ? -16.616 1.732   -23.794 1.00 0.00  ? 122 LEU A H      3  
ATOM   6954  H HA     . LEU A 1 122 ? -19.441 1.859   -23.002 1.00 0.00  ? 122 LEU A HA     3  
ATOM   6955  H HB2    . LEU A 1 122 ? -17.866 -0.321  -21.796 1.00 0.00  ? 122 LEU A HB2    3  
ATOM   6956  H HB3    . LEU A 1 122 ? -19.552 -0.285  -22.282 1.00 0.00  ? 122 LEU A HB3    3  
ATOM   6957  H HG     . LEU A 1 122 ? -18.275 -0.257  -24.709 1.00 0.00  ? 122 LEU A HG     3  
ATOM   6958  H HD11   . LEU A 1 122 ? -16.541 -1.947  -24.646 1.00 0.00  ? 122 LEU A HD11   3  
ATOM   6959  H HD12   . LEU A 1 122 ? -16.692 -2.068  -22.895 1.00 0.00  ? 122 LEU A HD12   3  
ATOM   6960  H HD13   . LEU A 1 122 ? -16.098 -0.579  -23.627 1.00 0.00  ? 122 LEU A HD13   3  
ATOM   6961  H HD21   . LEU A 1 122 ? -18.800 -2.910  -23.508 1.00 0.00  ? 122 LEU A HD21   3  
ATOM   6962  H HD22   . LEU A 1 122 ? -19.342 -2.231  -25.041 1.00 0.00  ? 122 LEU A HD22   3  
ATOM   6963  H HD23   . LEU A 1 122 ? -20.136 -1.762  -23.537 1.00 0.00  ? 122 LEU A HD23   3  
ATOM   6964  N N      . GLY A 1 123 ? -18.767 1.989   -20.437 1.00 0.00  ? 123 GLY A N      3  
ATOM   6965  C CA     . GLY A 1 123 ? -18.399 2.538   -19.150 1.00 0.00  ? 123 GLY A CA     3  
ATOM   6966  C C      . GLY A 1 123 ? -17.426 1.643   -18.415 1.00 0.00  ? 123 GLY A C      3  
ATOM   6967  O O      . GLY A 1 123 ? -16.676 0.892   -19.039 1.00 0.00  ? 123 GLY A O      3  
ATOM   6968  H H      . GLY A 1 123 ? -19.614 1.506   -20.538 1.00 0.00  ? 123 GLY A H      3  
ATOM   6969  H HA2    . GLY A 1 123 ? -17.945 3.508   -19.297 1.00 0.00  ? 123 GLY A HA2    3  
ATOM   6970  H HA3    . GLY A 1 123 ? -19.289 2.655   -18.548 1.00 0.00  ? 123 GLY A HA3    3  
ATOM   6971  N N      . LEU A 1 124 ? -17.433 1.715   -17.089 1.00 0.00  ? 124 LEU A N      3  
ATOM   6972  C CA     . LEU A 1 124 ? -16.539 0.898   -16.279 1.00 0.00  ? 124 LEU A CA     3  
ATOM   6973  C C      . LEU A 1 124 ? -17.040 -0.541  -16.177 1.00 0.00  ? 124 LEU A C      3  
ATOM   6974  O O      . LEU A 1 124 ? -16.253 -1.487  -16.242 1.00 0.00  ? 124 LEU A O      3  
ATOM   6975  C CB     . LEU A 1 124 ? -16.388 1.499   -14.881 1.00 0.00  ? 124 LEU A CB     3  
ATOM   6976  C CG     . LEU A 1 124 ? -15.425 0.758   -13.947 1.00 0.00  ? 124 LEU A CG     3  
ATOM   6977  C CD1    . LEU A 1 124 ? -14.190 0.287   -14.703 1.00 0.00  ? 124 LEU A CD1    3  
ATOM   6978  C CD2    . LEU A 1 124 ? -15.025 1.652   -12.785 1.00 0.00  ? 124 LEU A CD2    3  
ATOM   6979  H H      . LEU A 1 124 ? -18.053 2.331   -16.647 1.00 0.00  ? 124 LEU A H      3  
ATOM   6980  H HA     . LEU A 1 124 ? -15.573 0.893   -16.761 1.00 0.00  ? 124 LEU A HA     3  
ATOM   6981  H HB2    . LEU A 1 124 ? -16.039 2.518   -14.986 1.00 0.00  ? 124 LEU A HB2    3  
ATOM   6982  H HB3    . LEU A 1 124 ? -17.362 1.518   -14.413 1.00 0.00  ? 124 LEU A HB3    3  
ATOM   6983  H HG     . LEU A 1 124 ? -15.923 -0.112  -13.545 1.00 0.00  ? 124 LEU A HG     3  
ATOM   6984  H HD11   . LEU A 1 124 ? -13.622 1.143   -15.035 1.00 0.00  ? 124 LEU A HD11   3  
ATOM   6985  H HD12   . LEU A 1 124 ? -14.492 -0.301  -15.557 1.00 0.00  ? 124 LEU A HD12   3  
ATOM   6986  H HD13   . LEU A 1 124 ? -13.577 -0.318  -14.049 1.00 0.00  ? 124 LEU A HD13   3  
ATOM   6987  H HD21   . LEU A 1 124 ? -15.895 1.871   -12.183 1.00 0.00  ? 124 LEU A HD21   3  
ATOM   6988  H HD22   . LEU A 1 124 ? -14.611 2.573   -13.168 1.00 0.00  ? 124 LEU A HD22   3  
ATOM   6989  H HD23   . LEU A 1 124 ? -14.288 1.148   -12.181 1.00 0.00  ? 124 LEU A HD23   3  
ATOM   6990  N N      . GLU A 1 125 ? -18.347 -0.704  -16.008 1.00 0.00  ? 125 GLU A N      3  
ATOM   6991  C CA     . GLU A 1 125 ? -18.942 -2.032  -15.885 1.00 0.00  ? 125 GLU A CA     3  
ATOM   6992  C C      . GLU A 1 125 ? -18.701 -2.867  -17.135 1.00 0.00  ? 125 GLU A C      3  
ATOM   6993  O O      . GLU A 1 125 ? -18.219 -3.996  -17.054 1.00 0.00  ? 125 GLU A O      3  
ATOM   6994  C CB     . GLU A 1 125 ? -20.443 -1.934  -15.608 1.00 0.00  ? 125 GLU A CB     3  
ATOM   6995  C CG     . GLU A 1 125 ? -21.245 -1.291  -16.730 1.00 0.00  ? 125 GLU A CG     3  
ATOM   6996  C CD     . GLU A 1 125 ? -22.715 -1.154  -16.383 1.00 0.00  ? 125 GLU A CD     3  
ATOM   6997  O OE1    . GLU A 1 125 ? -23.300 -0.091  -16.684 1.00 0.00  ? 125 GLU A OE1    3  
ATOM   6998  O OE2    . GLU A 1 125 ? -23.280 -2.108  -15.811 1.00 0.00  ? 125 GLU A OE2    3  
ATOM   6999  H H      . GLU A 1 125 ? -18.925 0.086   -15.956 1.00 0.00  ? 125 GLU A H      3  
ATOM   7000  H HA     . GLU A 1 125 ? -18.467 -2.524  -15.049 1.00 0.00  ? 125 GLU A HA     3  
ATOM   7001  H HB2    . GLU A 1 125 ? -20.828 -2.932  -15.450 1.00 0.00  ? 125 GLU A HB2    3  
ATOM   7002  H HB3    . GLU A 1 125 ? -20.591 -1.357  -14.708 1.00 0.00  ? 125 GLU A HB3    3  
ATOM   7003  H HG2    . GLU A 1 125 ? -20.843 -0.308  -16.924 1.00 0.00  ? 125 GLU A HG2    3  
ATOM   7004  H HG3    . GLU A 1 125 ? -21.158 -1.898  -17.622 1.00 0.00  ? 125 GLU A HG3    3  
ATOM   7005  H HE2    . GLU A 1 125 ? -24.209 -1.954  -15.621 1.00 0.00  ? 125 GLU A HE2    3  
ATOM   7006  N N      . GLU A 1 126 ? -19.038 -2.310  -18.292 1.00 0.00  ? 126 GLU A N      3  
ATOM   7007  C CA     . GLU A 1 126 ? -18.857 -3.016  -19.547 1.00 0.00  ? 126 GLU A CA     3  
ATOM   7008  C C      . GLU A 1 126 ? -17.379 -3.154  -19.863 1.00 0.00  ? 126 GLU A C      3  
ATOM   7009  O O      . GLU A 1 126 ? -16.896 -4.245  -20.161 1.00 0.00  ? 126 GLU A O      3  
ATOM   7010  C CB     . GLU A 1 126 ? -19.583 -2.293  -20.681 1.00 0.00  ? 126 GLU A CB     3  
ATOM   7011  C CG     . GLU A 1 126 ? -20.970 -2.850  -20.970 1.00 0.00  ? 126 GLU A CG     3  
ATOM   7012  C CD     . GLU A 1 126 ? -21.769 -3.135  -19.711 1.00 0.00  ? 126 GLU A CD     3  
ATOM   7013  O OE1    . GLU A 1 126 ? -21.454 -4.123  -19.017 1.00 0.00  ? 126 GLU A OE1    3  
ATOM   7014  O OE2    . GLU A 1 126 ? -22.711 -2.368  -19.422 1.00 0.00  ? 126 GLU A OE2    3  
ATOM   7015  H H      . GLU A 1 126 ? -19.417 -1.408  -18.300 1.00 0.00  ? 126 GLU A H      3  
ATOM   7016  H HA     . GLU A 1 126 ? -19.281 -4.003  -19.431 1.00 0.00  ? 126 GLU A HA     3  
ATOM   7017  H HB2    . GLU A 1 126 ? -19.686 -1.249  -20.420 1.00 0.00  ? 126 GLU A HB2    3  
ATOM   7018  H HB3    . GLU A 1 126 ? -18.994 -2.374  -21.581 1.00 0.00  ? 126 GLU A HB3    3  
ATOM   7019  H HG2    . GLU A 1 126 ? -21.513 -2.129  -21.557 1.00 0.00  ? 126 GLU A HG2    3  
ATOM   7020  H HG3    . GLU A 1 126 ? -20.864 -3.769  -21.530 1.00 0.00  ? 126 GLU A HG3    3  
ATOM   7021  H HE2    . GLU A 1 126 ? -23.173 -2.606  -18.615 1.00 0.00  ? 126 GLU A HE2    3  
ATOM   7022  N N      . ALA A 1 127 ? -16.648 -2.052  -19.764 1.00 0.00  ? 127 ALA A N      3  
ATOM   7023  C CA     . ALA A 1 127 ? -15.217 -2.085  -20.012 1.00 0.00  ? 127 ALA A CA     3  
ATOM   7024  C C      . ALA A 1 127 ? -14.570 -3.154  -19.134 1.00 0.00  ? 127 ALA A C      3  
ATOM   7025  O O      . ALA A 1 127 ? -13.543 -3.736  -19.487 1.00 0.00  ? 127 ALA A O      3  
ATOM   7026  C CB     . ALA A 1 127 ? -14.605 -0.716  -19.761 1.00 0.00  ? 127 ALA A CB     3  
ATOM   7027  H H      . ALA A 1 127 ? -17.074 -1.211  -19.501 1.00 0.00  ? 127 ALA A H      3  
ATOM   7028  H HA     . ALA A 1 127 ? -15.065 -2.341  -21.047 1.00 0.00  ? 127 ALA A HA     3  
ATOM   7029  H HB1    . ALA A 1 127 ? -15.128 0.021   -20.355 1.00 0.00  ? 127 ALA A HB1    3  
ATOM   7030  H HB2    . ALA A 1 127 ? -13.561 -0.730  -20.036 1.00 0.00  ? 127 ALA A HB2    3  
ATOM   7031  H HB3    . ALA A 1 127 ? -14.698 -0.465  -18.714 1.00 0.00  ? 127 ALA A HB3    3  
ATOM   7032  N N      . CYS A 1 128 ? -15.210 -3.420  -17.994 1.00 0.00  ? 128 CYS A N      3  
ATOM   7033  C CA     . CYS A 1 128 ? -14.751 -4.433  -17.052 1.00 0.00  ? 128 CYS A CA     3  
ATOM   7034  C C      . CYS A 1 128 ? -15.244 -5.812  -17.488 1.00 0.00  ? 128 CYS A C      3  
ATOM   7035  O O      . CYS A 1 128 ? -14.571 -6.820  -17.273 1.00 0.00  ? 128 CYS A O      3  
ATOM   7036  C CB     . CYS A 1 128 ? -15.270 -4.099  -15.644 1.00 0.00  ? 128 CYS A CB     3  
ATOM   7037  S SG     . CYS A 1 128 ? -15.413 -5.511  -14.516 1.00 0.00  ? 128 CYS A SG     3  
ATOM   7038  H H      . CYS A 1 128 ? -16.032 -2.930  -17.789 1.00 0.00  ? 128 CYS A H      3  
ATOM   7039  H HA     . CYS A 1 128 ? -13.671 -4.430  -17.046 1.00 0.00  ? 128 CYS A HA     3  
ATOM   7040  H HB2    . CYS A 1 128 ? -14.607 -3.385  -15.185 1.00 0.00  ? 128 CYS A HB2    3  
ATOM   7041  H HB3    . CYS A 1 128 ? -16.246 -3.657  -15.731 1.00 0.00  ? 128 CYS A HB3    3  
ATOM   7042  H HG     . CYS A 1 128 ? -16.307 -5.854  -14.583 1.00 0.00  ? 128 CYS A HG     3  
ATOM   7043  N N      . GLN A 1 129 ? -16.427 -5.843  -18.098 1.00 0.00  ? 129 GLN A N      3  
ATOM   7044  C CA     . GLN A 1 129 ? -17.015 -7.096  -18.557 1.00 0.00  ? 129 GLN A CA     3  
ATOM   7045  C C      . GLN A 1 129 ? -16.154 -7.740  -19.645 1.00 0.00  ? 129 GLN A C      3  
ATOM   7046  O O      . GLN A 1 129 ? -15.859 -8.934  -19.589 1.00 0.00  ? 129 GLN A O      3  
ATOM   7047  C CB     . GLN A 1 129 ? -18.462 -6.873  -19.039 1.00 0.00  ? 129 GLN A CB     3  
ATOM   7048  C CG     . GLN A 1 129 ? -18.602 -6.282  -20.436 1.00 0.00  ? 129 GLN A CG     3  
ATOM   7049  C CD     . GLN A 1 129 ? -19.418 -7.155  -21.363 1.00 0.00  ? 129 GLN A CD     3  
ATOM   7050  O OE1    . GLN A 1 129 ? -20.649 -7.126  -21.336 1.00 0.00  ? 129 GLN A OE1    3  
ATOM   7051  N NE2    . GLN A 1 129 ? -18.740 -7.937  -22.192 1.00 0.00  ? 129 GLN A NE2    3  
ATOM   7052  H H      . GLN A 1 129 ? -16.918 -5.005  -18.236 1.00 0.00  ? 129 GLN A H      3  
ATOM   7053  H HA     . GLN A 1 129 ? -17.038 -7.767  -17.710 1.00 0.00  ? 129 GLN A HA     3  
ATOM   7054  H HB2    . GLN A 1 129 ? -18.972 -7.816  -19.033 1.00 0.00  ? 129 GLN A HB2    3  
ATOM   7055  H HB3    . GLN A 1 129 ? -18.955 -6.207  -18.345 1.00 0.00  ? 129 GLN A HB3    3  
ATOM   7056  H HG2    . GLN A 1 129 ? -19.087 -5.325  -20.360 1.00 0.00  ? 129 GLN A HG2    3  
ATOM   7057  H HG3    . GLN A 1 129 ? -17.627 -6.149  -20.859 1.00 0.00  ? 129 GLN A HG3    3  
ATOM   7058  H HE21   . GLN A 1 129 ? -17.763 -7.913  -22.158 1.00 0.00  ? 129 GLN A HE21   3  
ATOM   7059  H HE22   . GLN A 1 129 ? -19.247 -8.505  -22.807 1.00 0.00  ? 129 GLN A HE22   3  
ATOM   7060  N N      . LEU A 1 130 ? -15.742 -6.942  -20.621 1.00 0.00  ? 130 LEU A N      3  
ATOM   7061  C CA     . LEU A 1 130 ? -14.902 -7.434  -21.706 1.00 0.00  ? 130 LEU A CA     3  
ATOM   7062  C C      . LEU A 1 130 ? -13.458 -7.562  -21.246 1.00 0.00  ? 130 LEU A C      3  
ATOM   7063  O O      . LEU A 1 130 ? -12.753 -8.493  -21.632 1.00 0.00  ? 130 LEU A O      3  
ATOM   7064  C CB     . LEU A 1 130 ? -14.975 -6.507  -22.918 1.00 0.00  ? 130 LEU A CB     3  
ATOM   7065  C CG     . LEU A 1 130 ? -16.375 -6.022  -23.308 1.00 0.00  ? 130 LEU A CG     3  
ATOM   7066  C CD1    . LEU A 1 130 ? -16.402 -4.507  -23.429 1.00 0.00  ? 130 LEU A CD1    3  
ATOM   7067  C CD2    . LEU A 1 130 ? -16.815 -6.671  -24.609 1.00 0.00  ? 130 LEU A CD2    3  
ATOM   7068  H H      . LEU A 1 130 ? -15.997 -5.998  -20.605 1.00 0.00  ? 130 LEU A H      3  
ATOM   7069  H HA     . LEU A 1 130 ? -15.261 -8.416  -21.986 1.00 0.00  ? 130 LEU A HA     3  
ATOM   7070  H HB2    . LEU A 1 130 ? -14.358 -5.643  -22.719 1.00 0.00  ? 130 LEU A HB2    3  
ATOM   7071  H HB3    . LEU A 1 130 ? -14.559 -7.034  -23.759 1.00 0.00  ? 130 LEU A HB3    3  
ATOM   7072  H HG     . LEU A 1 130 ? -17.075 -6.303  -22.540 1.00 0.00  ? 130 LEU A HG     3  
ATOM   7073  H HD11   . LEU A 1 130 ? -16.239 -4.226  -24.458 1.00 0.00  ? 130 LEU A HD11   3  
ATOM   7074  H HD12   . LEU A 1 130 ? -15.624 -4.082  -22.812 1.00 0.00  ? 130 LEU A HD12   3  
ATOM   7075  H HD13   . LEU A 1 130 ? -17.363 -4.136  -23.101 1.00 0.00  ? 130 LEU A HD13   3  
ATOM   7076  H HD21   . LEU A 1 130 ? -16.602 -7.729  -24.573 1.00 0.00  ? 130 LEU A HD21   3  
ATOM   7077  H HD22   . LEU A 1 130 ? -16.280 -6.224  -25.435 1.00 0.00  ? 130 LEU A HD22   3  
ATOM   7078  H HD23   . LEU A 1 130 ? -17.876 -6.521  -24.747 1.00 0.00  ? 130 LEU A HD23   3  
ATOM   7079  N N      . ALA A 1 131 ? -13.020 -6.621  -20.415 1.00 0.00  ? 131 ALA A N      3  
ATOM   7080  C CA     . ALA A 1 131 ? -11.657 -6.635  -19.897 1.00 0.00  ? 131 ALA A CA     3  
ATOM   7081  C C      . ALA A 1 131 ? -11.500 -7.695  -18.817 1.00 0.00  ? 131 ALA A C      3  
ATOM   7082  O O      . ALA A 1 131 ? -11.034 -7.413  -17.713 1.00 0.00  ? 131 ALA A O      3  
ATOM   7083  C CB     . ALA A 1 131 ? -11.281 -5.268  -19.360 1.00 0.00  ? 131 ALA A CB     3  
ATOM   7084  H H      . ALA A 1 131 ? -13.629 -5.904  -20.139 1.00 0.00  ? 131 ALA A H      3  
ATOM   7085  H HA     . ALA A 1 131 ? -10.993 -6.869  -20.716 1.00 0.00  ? 131 ALA A HA     3  
ATOM   7086  H HB1    . ALA A 1 131 ? -11.894 -5.037  -18.501 1.00 0.00  ? 131 ALA A HB1    3  
ATOM   7087  H HB2    . ALA A 1 131 ? -11.437 -4.523  -20.126 1.00 0.00  ? 131 ALA A HB2    3  
ATOM   7088  H HB3    . ALA A 1 131 ? -10.242 -5.270  -19.069 1.00 0.00  ? 131 ALA A HB3    3  
ATOM   7089  N N      . GLN A 1 132 ? -11.903 -8.916  -19.152 1.00 0.00  ? 132 GLN A N      3  
ATOM   7090  C CA     . GLN A 1 132 ? -11.831 -10.055 -18.234 1.00 0.00  ? 132 GLN A CA     3  
ATOM   7091  C C      . GLN A 1 132 ? -10.552 -10.025 -17.399 1.00 0.00  ? 132 GLN A C      3  
ATOM   7092  O O      . GLN A 1 132 ? -10.543 -10.459 -16.246 1.00 0.00  ? 132 GLN A O      3  
ATOM   7093  C CB     . GLN A 1 132 ? -11.929 -11.392 -18.996 1.00 0.00  ? 132 GLN A CB     3  
ATOM   7094  C CG     . GLN A 1 132 ? -11.772 -11.290 -20.511 1.00 0.00  ? 132 GLN A CG     3  
ATOM   7095  C CD     . GLN A 1 132 ? -13.093 -11.402 -21.251 1.00 0.00  ? 132 GLN A CD     3  
ATOM   7096  O OE1    . GLN A 1 132 ? -13.227 -12.200 -22.182 1.00 0.00  ? 132 GLN A OE1    3  
ATOM   7097  N NE2    . GLN A 1 132 ? -14.077 -10.608 -20.844 1.00 0.00  ? 132 GLN A NE2    3  
ATOM   7098  H H      . GLN A 1 132 ? -12.265 -9.052  -20.044 1.00 0.00  ? 132 GLN A H      3  
ATOM   7099  H HA     . GLN A 1 132 ? -12.675 -9.981  -17.563 1.00 0.00  ? 132 GLN A HA     3  
ATOM   7100  H HB2    . GLN A 1 132 ? -11.157 -12.053 -18.632 1.00 0.00  ? 132 GLN A HB2    3  
ATOM   7101  H HB3    . GLN A 1 132 ? -12.892 -11.834 -18.789 1.00 0.00  ? 132 GLN A HB3    3  
ATOM   7102  H HG2    . GLN A 1 132 ? -11.318 -10.342 -20.758 1.00 0.00  ? 132 GLN A HG2    3  
ATOM   7103  H HG3    . GLN A 1 132 ? -11.128 -12.085 -20.845 1.00 0.00  ? 132 GLN A HG3    3  
ATOM   7104  H HE21   . GLN A 1 132 ? -13.904 -10.001 -20.096 1.00 0.00  ? 132 GLN A HE21   3  
ATOM   7105  H HE22   . GLN A 1 132 ? -14.938 -10.666 -21.310 1.00 0.00  ? 132 GLN A HE22   3  
ATOM   7106  N N      . PHE A 1 133 ? -9.481  -9.504  -17.984 1.00 0.00  ? 133 PHE A N      3  
ATOM   7107  C CA     . PHE A 1 133 ? -8.203  -9.409  -17.292 1.00 0.00  ? 133 PHE A CA     3  
ATOM   7108  C C      . PHE A 1 133 ? -8.315  -8.488  -16.081 1.00 0.00  ? 133 PHE A C      3  
ATOM   7109  O O      . PHE A 1 133 ? -8.653  -7.311  -16.217 1.00 0.00  ? 133 PHE A O      3  
ATOM   7110  C CB     . PHE A 1 133 ? -7.120  -8.894  -18.245 1.00 0.00  ? 133 PHE A CB     3  
ATOM   7111  C CG     . PHE A 1 133 ? -6.776  -9.854  -19.349 1.00 0.00  ? 133 PHE A CG     3  
ATOM   7112  C CD1    . PHE A 1 133 ? -7.677  -10.103 -20.373 1.00 0.00  ? 133 PHE A CD1    3  
ATOM   7113  C CD2    . PHE A 1 133 ? -5.552  -10.509 -19.364 1.00 0.00  ? 133 PHE A CD2    3  
ATOM   7114  C CE1    . PHE A 1 133 ? -7.367  -10.984 -21.390 1.00 0.00  ? 133 PHE A CE1    3  
ATOM   7115  C CE2    . PHE A 1 133 ? -5.237  -11.391 -20.382 1.00 0.00  ? 133 PHE A CE2    3  
ATOM   7116  C CZ     . PHE A 1 133 ? -6.146  -11.630 -21.395 1.00 0.00  ? 133 PHE A CZ     3  
ATOM   7117  H H      . PHE A 1 133 ? -9.552  -9.171  -18.901 1.00 0.00  ? 133 PHE A H      3  
ATOM   7118  H HA     . PHE A 1 133 ? -7.933  -10.399 -16.954 1.00 0.00  ? 133 PHE A HA     3  
ATOM   7119  H HB2    . PHE A 1 133 ? -7.461  -7.976  -18.699 1.00 0.00  ? 133 PHE A HB2    3  
ATOM   7120  H HB3    . PHE A 1 133 ? -6.219  -8.697  -17.682 1.00 0.00  ? 133 PHE A HB3    3  
ATOM   7121  H HD1    . PHE A 1 133 ? -8.629  -9.598  -20.373 1.00 0.00  ? 133 PHE A HD1    3  
ATOM   7122  H HD2    . PHE A 1 133 ? -4.843  -10.323 -18.572 1.00 0.00  ? 133 PHE A HD2    3  
ATOM   7123  H HE1    . PHE A 1 133 ? -8.081  -11.168 -22.177 1.00 0.00  ? 133 PHE A HE1    3  
ATOM   7124  H HE2    . PHE A 1 133 ? -4.281  -11.894 -20.384 1.00 0.00  ? 133 PHE A HE2    3  
ATOM   7125  H HZ     . PHE A 1 133 ? -5.903  -12.318 -22.189 1.00 0.00  ? 133 PHE A HZ     3  
ATOM   7126  N N      . LYS A 1 134 ? -8.032  -9.029  -14.900 1.00 0.00  ? 134 LYS A N      3  
ATOM   7127  C CA     . LYS A 1 134 ? -8.101  -8.257  -13.661 1.00 0.00  ? 134 LYS A CA     3  
ATOM   7128  C C      . LYS A 1 134 ? -7.387  -6.914  -13.807 1.00 0.00  ? 134 LYS A C      3  
ATOM   7129  O O      . LYS A 1 134 ? -7.930  -5.866  -13.458 1.00 0.00  ? 134 LYS A O      3  
ATOM   7130  C CB     . LYS A 1 134 ? -7.469  -9.051  -12.513 1.00 0.00  ? 134 LYS A CB     3  
ATOM   7131  C CG     . LYS A 1 134 ? -7.454  -8.301  -11.189 1.00 0.00  ? 134 LYS A CG     3  
ATOM   7132  C CD     . LYS A 1 134 ? -6.034  -8.085  -10.677 1.00 0.00  ? 134 LYS A CD     3  
ATOM   7133  C CE     . LYS A 1 134 ? -5.713  -6.606  -10.528 1.00 0.00  ? 134 LYS A CE     3  
ATOM   7134  N NZ     . LYS A 1 134 ? -5.655  -6.190  -9.099  1.00 0.00  ? 134 LYS A NZ     3  
ATOM   7135  H H      . LYS A 1 134 ? -7.771  -9.972  -14.859 1.00 0.00  ? 134 LYS A H      3  
ATOM   7136  H HA     . LYS A 1 134 ? -9.142  -8.079  -13.434 1.00 0.00  ? 134 LYS A HA     3  
ATOM   7137  H HB2    . LYS A 1 134 ? -8.023  -9.969  -12.378 1.00 0.00  ? 134 LYS A HB2    3  
ATOM   7138  H HB3    . LYS A 1 134 ? -6.450  -9.292  -12.781 1.00 0.00  ? 134 LYS A HB3    3  
ATOM   7139  H HG2    . LYS A 1 134 ? -7.926  -7.342  -11.325 1.00 0.00  ? 134 LYS A HG2    3  
ATOM   7140  H HG3    . LYS A 1 134 ? -8.006  -8.874  -10.457 1.00 0.00  ? 134 LYS A HG3    3  
ATOM   7141  H HD2    . LYS A 1 134 ? -5.931  -8.563  -9.714  1.00 0.00  ? 134 LYS A HD2    3  
ATOM   7142  H HD3    . LYS A 1 134 ? -5.337  -8.526  -11.375 1.00 0.00  ? 134 LYS A HD3    3  
ATOM   7143  H HE2    . LYS A 1 134 ? -4.756  -6.411  -10.990 1.00 0.00  ? 134 LYS A HE2    3  
ATOM   7144  H HE3    . LYS A 1 134 ? -6.477  -6.032  -11.031 1.00 0.00  ? 134 LYS A HE3    3  
ATOM   7145  H HZ1    . LYS A 1 134 ? -5.379  -5.188  -9.031  1.00 0.00  ? 134 LYS A HZ1    3  
ATOM   7146  H HZ2    . LYS A 1 134 ? -4.956  -6.763  -8.587  1.00 0.00  ? 134 LYS A HZ2    3  
ATOM   7147  H HZ3    . LYS A 1 134 ? -6.585  -6.312  -8.651  1.00 0.00  ? 134 LYS A HZ3    3  
ATOM   7148  N N      . GLU A 1 135 ? -6.164  -6.966  -14.317 1.00 0.00  ? 135 GLU A N      3  
ATOM   7149  C CA     . GLU A 1 135 ? -5.348  -5.770  -14.511 1.00 0.00  ? 135 GLU A CA     3  
ATOM   7150  C C      . GLU A 1 135 ? -6.138  -4.652  -15.186 1.00 0.00  ? 135 GLU A C      3  
ATOM   7151  O O      . GLU A 1 135 ? -6.182  -3.526  -14.694 1.00 0.00  ? 135 GLU A O      3  
ATOM   7152  C CB     . GLU A 1 135 ? -4.109  -6.100  -15.351 1.00 0.00  ? 135 GLU A CB     3  
ATOM   7153  C CG     . GLU A 1 135 ? -3.487  -7.448  -15.022 1.00 0.00  ? 135 GLU A CG     3  
ATOM   7154  C CD     . GLU A 1 135 ? -3.927  -8.544  -15.974 1.00 0.00  ? 135 GLU A CD     3  
ATOM   7155  O OE1    . GLU A 1 135 ? -3.982  -8.282  -17.196 1.00 0.00  ? 135 GLU A OE1    3  
ATOM   7156  O OE2    . GLU A 1 135 ? -4.216  -9.662  -15.498 1.00 0.00  ? 135 GLU A OE2    3  
ATOM   7157  H H      . GLU A 1 135 ? -5.795  -7.838  -14.566 1.00 0.00  ? 135 GLU A H      3  
ATOM   7158  H HA     . GLU A 1 135 ? -5.028  -5.426  -13.539 1.00 0.00  ? 135 GLU A HA     3  
ATOM   7159  H HB2    . GLU A 1 135 ? -4.384  -6.102  -16.394 1.00 0.00  ? 135 GLU A HB2    3  
ATOM   7160  H HB3    . GLU A 1 135 ? -3.364  -5.336  -15.186 1.00 0.00  ? 135 GLU A HB3    3  
ATOM   7161  H HG2    . GLU A 1 135 ? -2.415  -7.356  -15.078 1.00 0.00  ? 135 GLU A HG2    3  
ATOM   7162  H HG3    . GLU A 1 135 ? -3.773  -7.725  -14.017 1.00 0.00  ? 135 GLU A HG3    3  
ATOM   7163  H HE2    . GLU A 1 135 ? -4.486  -10.307 -16.157 1.00 0.00  ? 135 GLU A HE2    3  
ATOM   7164  N N      . MET A 1 136 ? -6.745  -4.966  -16.324 1.00 0.00  ? 136 MET A N      3  
ATOM   7165  C CA     . MET A 1 136 ? -7.516  -3.981  -17.071 1.00 0.00  ? 136 MET A CA     3  
ATOM   7166  C C      . MET A 1 136 ? -8.665  -3.436  -16.238 1.00 0.00  ? 136 MET A C      3  
ATOM   7167  O O      . MET A 1 136 ? -8.922  -2.231  -16.228 1.00 0.00  ? 136 MET A O      3  
ATOM   7168  C CB     . MET A 1 136 ? -8.046  -4.604  -18.357 1.00 0.00  ? 136 MET A CB     3  
ATOM   7169  C CG     . MET A 1 136 ? -6.950  -5.055  -19.302 1.00 0.00  ? 136 MET A CG     3  
ATOM   7170  S SD     . MET A 1 136 ? -6.612  -3.857  -20.606 1.00 0.00  ? 136 MET A SD     3  
ATOM   7171  C CE     . MET A 1 136 ? -6.715  -2.311  -19.706 1.00 0.00  ? 136 MET A CE     3  
ATOM   7172  H H      . MET A 1 136 ? -6.668  -5.877  -16.676 1.00 0.00  ? 136 MET A H      3  
ATOM   7173  H HA     . MET A 1 136 ? -6.855  -3.167  -17.324 1.00 0.00  ? 136 MET A HA     3  
ATOM   7174  H HB2    . MET A 1 136 ? -8.649  -5.463  -18.104 1.00 0.00  ? 136 MET A HB2    3  
ATOM   7175  H HB3    . MET A 1 136 ? -8.661  -3.879  -18.873 1.00 0.00  ? 136 MET A HB3    3  
ATOM   7176  H HG2    . MET A 1 136 ? -6.046  -5.207  -18.731 1.00 0.00  ? 136 MET A HG2    3  
ATOM   7177  H HG3    . MET A 1 136 ? -7.246  -5.989  -19.757 1.00 0.00  ? 136 MET A HG3    3  
ATOM   7178  H HE1    . MET A 1 136 ? -6.064  -2.352  -18.845 1.00 0.00  ? 136 MET A HE1    3  
ATOM   7179  H HE2    . MET A 1 136 ? -7.735  -2.147  -19.381 1.00 0.00  ? 136 MET A HE2    3  
ATOM   7180  H HE3    . MET A 1 136 ? -6.409  -1.499  -20.350 1.00 0.00  ? 136 MET A HE3    3  
ATOM   7181  N N      . LYS A 1 137 ? -9.353  -4.325  -15.532 1.00 0.00  ? 137 LYS A N      3  
ATOM   7182  C CA     . LYS A 1 137 ? -10.471 -3.923  -14.693 1.00 0.00  ? 137 LYS A CA     3  
ATOM   7183  C C      . LYS A 1 137 ? -10.047 -2.818  -13.738 1.00 0.00  ? 137 LYS A C      3  
ATOM   7184  O O      . LYS A 1 137 ? -10.816 -1.899  -13.457 1.00 0.00  ? 137 LYS A O      3  
ATOM   7185  C CB     . LYS A 1 137 ? -11.007 -5.122  -13.913 1.00 0.00  ? 137 LYS A CB     3  
ATOM   7186  C CG     . LYS A 1 137 ? -12.274 -5.701  -14.512 1.00 0.00  ? 137 LYS A CG     3  
ATOM   7187  C CD     . LYS A 1 137 ? -11.997 -7.011  -15.227 1.00 0.00  ? 137 LYS A CD     3  
ATOM   7188  C CE     . LYS A 1 137 ? -12.296 -8.204  -14.334 1.00 0.00  ? 137 LYS A CE     3  
ATOM   7189  N NZ     . LYS A 1 137 ? -13.710 -8.214  -13.868 1.00 0.00  ? 137 LYS A NZ     3  
ATOM   7190  H H      . LYS A 1 137 ? -9.100  -5.271  -15.576 1.00 0.00  ? 137 LYS A H      3  
ATOM   7191  H HA     . LYS A 1 137 ? -11.251 -3.547  -15.336 1.00 0.00  ? 137 LYS A HA     3  
ATOM   7192  H HB2    . LYS A 1 137 ? -10.253 -5.896  -13.900 1.00 0.00  ? 137 LYS A HB2    3  
ATOM   7193  H HB3    . LYS A 1 137 ? -11.218 -4.818  -12.899 1.00 0.00  ? 137 LYS A HB3    3  
ATOM   7194  H HG2    . LYS A 1 137 ? -12.990 -5.873  -13.722 1.00 0.00  ? 137 LYS A HG2    3  
ATOM   7195  H HG3    . LYS A 1 137 ? -12.682 -4.993  -15.220 1.00 0.00  ? 137 LYS A HG3    3  
ATOM   7196  H HD2    . LYS A 1 137 ? -12.617 -7.066  -16.107 1.00 0.00  ? 137 LYS A HD2    3  
ATOM   7197  H HD3    . LYS A 1 137 ? -10.954 -7.038  -15.513 1.00 0.00  ? 137 LYS A HD3    3  
ATOM   7198  H HE2    . LYS A 1 137 ? -12.106 -9.108  -14.895 1.00 0.00  ? 137 LYS A HE2    3  
ATOM   7199  H HE3    . LYS A 1 137 ? -11.643 -8.169  -13.476 1.00 0.00  ? 137 LYS A HE3    3  
ATOM   7200  H HZ1    . LYS A 1 137 ? -14.347 -7.956  -14.651 1.00 0.00  ? 137 LYS A HZ1    3  
ATOM   7201  H HZ2    . LYS A 1 137 ? -13.838 -7.534  -13.093 1.00 0.00  ? 137 LYS A HZ2    3  
ATOM   7202  H HZ3    . LYS A 1 137 ? -13.968 -9.161  -13.525 1.00 0.00  ? 137 LYS A HZ3    3  
ATOM   7203  N N      . ALA A 1 138 ? -8.811  -2.909  -13.257 1.00 0.00  ? 138 ALA A N      3  
ATOM   7204  C CA     . ALA A 1 138 ? -8.271  -1.909  -12.346 1.00 0.00  ? 138 ALA A CA     3  
ATOM   7205  C C      . ALA A 1 138 ? -7.854  -0.664  -13.117 1.00 0.00  ? 138 ALA A C      3  
ATOM   7206  O O      . ALA A 1 138 ? -8.119  0.461   -12.693 1.00 0.00  ? 138 ALA A O      3  
ATOM   7207  C CB     . ALA A 1 138 ? -7.096  -2.476  -11.570 1.00 0.00  ? 138 ALA A CB     3  
ATOM   7208  H H      . ALA A 1 138 ? -8.245  -3.661  -13.528 1.00 0.00  ? 138 ALA A H      3  
ATOM   7209  H HA     . ALA A 1 138 ? -9.044  -1.646  -11.639 1.00 0.00  ? 138 ALA A HA     3  
ATOM   7210  H HB1    . ALA A 1 138 ? -6.767  -1.754  -10.839 1.00 0.00  ? 138 ALA A HB1    3  
ATOM   7211  H HB2    . ALA A 1 138 ? -6.289  -2.697  -12.253 1.00 0.00  ? 138 ALA A HB2    3  
ATOM   7212  H HB3    . ALA A 1 138 ? -7.403  -3.383  -11.070 1.00 0.00  ? 138 ALA A HB3    3  
ATOM   7213  N N      . ALA A 1 139 ? -7.215  -0.876  -14.265 1.00 0.00  ? 139 ALA A N      3  
ATOM   7214  C CA     . ALA A 1 139 ? -6.776  0.225   -15.114 1.00 0.00  ? 139 ALA A CA     3  
ATOM   7215  C C      . ALA A 1 139 ? -7.959  1.118   -15.456 1.00 0.00  ? 139 ALA A C      3  
ATOM   7216  O O      . ALA A 1 139 ? -7.862  2.344   -15.417 1.00 0.00  ? 139 ALA A O      3  
ATOM   7217  C CB     . ALA A 1 139 ? -6.124  -0.310  -16.379 1.00 0.00  ? 139 ALA A CB     3  
ATOM   7218  H H      . ALA A 1 139 ? -7.046  -1.798  -14.553 1.00 0.00  ? 139 ALA A H      3  
ATOM   7219  H HA     . ALA A 1 139 ? -6.043  0.801   -14.568 1.00 0.00  ? 139 ALA A HA     3  
ATOM   7220  H HB1    . ALA A 1 139 ? -6.436  -1.331  -16.540 1.00 0.00  ? 139 ALA A HB1    3  
ATOM   7221  H HB2    . ALA A 1 139 ? -5.049  -0.276  -16.274 1.00 0.00  ? 139 ALA A HB2    3  
ATOM   7222  H HB3    . ALA A 1 139 ? -6.423  0.294   -17.223 1.00 0.00  ? 139 ALA A HB3    3  
ATOM   7223  N N      . LEU A 1 140 ? -9.083  0.485   -15.773 1.00 0.00  ? 140 LEU A N      3  
ATOM   7224  C CA     . LEU A 1 140 ? -10.302 1.207   -16.101 1.00 0.00  ? 140 LEU A CA     3  
ATOM   7225  C C      . LEU A 1 140 ? -10.976 1.702   -14.822 1.00 0.00  ? 140 LEU A C      3  
ATOM   7226  O O      . LEU A 1 140 ? -11.684 2.711   -14.829 1.00 0.00  ? 140 LEU A O      3  
ATOM   7227  C CB     . LEU A 1 140 ? -11.259 0.306   -16.886 1.00 0.00  ? 140 LEU A CB     3  
ATOM   7228  C CG     . LEU A 1 140 ? -10.648 -0.367  -18.118 1.00 0.00  ? 140 LEU A CG     3  
ATOM   7229  C CD1    . LEU A 1 140 ? -11.029 -1.841  -18.171 1.00 0.00  ? 140 LEU A CD1    3  
ATOM   7230  C CD2    . LEU A 1 140 ? -11.090 0.343   -19.388 1.00 0.00  ? 140 LEU A CD2    3  
ATOM   7231  H H      . LEU A 1 140 ? -9.096  -0.495  -15.769 1.00 0.00  ? 140 LEU A H      3  
ATOM   7232  H HA     . LEU A 1 140 ? -10.032 2.055   -16.711 1.00 0.00  ? 140 LEU A HA     3  
ATOM   7233  H HB2    . LEU A 1 140 ? -11.621 -0.464  -16.221 1.00 0.00  ? 140 LEU A HB2    3  
ATOM   7234  H HB3    . LEU A 1 140 ? -12.099 0.901   -17.209 1.00 0.00  ? 140 LEU A HB3    3  
ATOM   7235  H HG     . LEU A 1 140 ? -9.571  -0.306  -18.058 1.00 0.00  ? 140 LEU A HG     3  
ATOM   7236  H HD11   . LEU A 1 140 ? -11.329 -2.172  -17.186 1.00 0.00  ? 140 LEU A HD11   3  
ATOM   7237  H HD12   . LEU A 1 140 ? -10.182 -2.421  -18.504 1.00 0.00  ? 140 LEU A HD12   3  
ATOM   7238  H HD13   . LEU A 1 140 ? -11.851 -1.975  -18.860 1.00 0.00  ? 140 LEU A HD13   3  
ATOM   7239  H HD21   . LEU A 1 140 ? -10.357 1.086   -19.658 1.00 0.00  ? 140 LEU A HD21   3  
ATOM   7240  H HD22   . LEU A 1 140 ? -12.044 0.822   -19.218 1.00 0.00  ? 140 LEU A HD22   3  
ATOM   7241  H HD23   . LEU A 1 140 ? -11.187 -0.376  -20.189 1.00 0.00  ? 140 LEU A HD23   3  
ATOM   7242  N N      . GLN A 1 141 ? -10.743 0.982   -13.725 1.00 0.00  ? 141 GLN A N      3  
ATOM   7243  C CA     . GLN A 1 141 ? -11.315 1.335   -12.429 1.00 0.00  ? 141 GLN A CA     3  
ATOM   7244  C C      . GLN A 1 141 ? -10.691 2.614   -11.892 1.00 0.00  ? 141 GLN A C      3  
ATOM   7245  O O      . GLN A 1 141 ? -11.393 3.554   -11.522 1.00 0.00  ? 141 GLN A O      3  
ATOM   7246  C CB     . GLN A 1 141 ? -11.091 0.194   -11.431 1.00 0.00  ? 141 GLN A CB     3  
ATOM   7247  C CG     . GLN A 1 141 ? -12.364 -0.525  -11.020 1.00 0.00  ? 141 GLN A CG     3  
ATOM   7248  C CD     . GLN A 1 141 ? -13.056 0.133   -9.844  1.00 0.00  ? 141 GLN A CD     3  
ATOM   7249  O OE1    . GLN A 1 141 ? -13.326 -0.508  -8.829  1.00 0.00  ? 141 GLN A OE1    3  
ATOM   7250  N NE2    . GLN A 1 141 ? -13.347 1.423   -9.972  1.00 0.00  ? 141 GLN A NE2    3  
ATOM   7251  H H      . GLN A 1 141 ? -10.169 0.193   -13.789 1.00 0.00  ? 141 GLN A H      3  
ATOM   7252  H HA     . GLN A 1 141 ? -12.376 1.486   -12.559 1.00 0.00  ? 141 GLN A HA     3  
ATOM   7253  H HB2    . GLN A 1 141 ? -10.426 -0.525  -11.875 1.00 0.00  ? 141 GLN A HB2    3  
ATOM   7254  H HB3    . GLN A 1 141 ? -10.625 0.592   -10.540 1.00 0.00  ? 141 GLN A HB3    3  
ATOM   7255  H HG2    . GLN A 1 141 ? -13.037 -0.534  -11.858 1.00 0.00  ? 141 GLN A HG2    3  
ATOM   7256  H HG3    . GLN A 1 141 ? -12.114 -1.543  -10.751 1.00 0.00  ? 141 GLN A HG3    3  
ATOM   7257  H HE21   . GLN A 1 141 ? -13.101 1.873   -10.807 1.00 0.00  ? 141 GLN A HE21   3  
ATOM   7258  H HE22   . GLN A 1 141 ? -13.792 1.873   -9.225  1.00 0.00  ? 141 GLN A HE22   3  
ATOM   7259  N N      . GLU A 1 142 ? -9.364  2.642   -11.858 1.00 0.00  ? 142 GLU A N      3  
ATOM   7260  C CA     . GLU A 1 142 ? -8.642  3.807   -11.371 1.00 0.00  ? 142 GLU A CA     3  
ATOM   7261  C C      . GLU A 1 142 ? -8.777  4.964   -12.353 1.00 0.00  ? 142 GLU A C      3  
ATOM   7262  O O      . GLU A 1 142 ? -8.767  6.132   -11.959 1.00 0.00  ? 142 GLU A O      3  
ATOM   7263  C CB     . GLU A 1 142 ? -7.167  3.468   -11.153 1.00 0.00  ? 142 GLU A CB     3  
ATOM   7264  C CG     . GLU A 1 142 ? -6.949  2.228   -10.302 1.00 0.00  ? 142 GLU A CG     3  
ATOM   7265  C CD     . GLU A 1 142 ? -5.501  1.781   -10.286 1.00 0.00  ? 142 GLU A CD     3  
ATOM   7266  O OE1    . GLU A 1 142 ? -4.967  1.460   -11.370 1.00 0.00  ? 142 GLU A OE1    3  
ATOM   7267  O OE2    . GLU A 1 142 ? -4.900  1.752   -9.192  1.00 0.00  ? 142 GLU A OE2    3  
ATOM   7268  H H      . GLU A 1 142 ? -8.860  1.862   -12.169 1.00 0.00  ? 142 GLU A H      3  
ATOM   7269  H HA     . GLU A 1 142 ? -9.080  4.099   -10.427 1.00 0.00  ? 142 GLU A HA     3  
ATOM   7270  H HB2    . GLU A 1 142 ? -6.701  3.308   -12.115 1.00 0.00  ? 142 GLU A HB2    3  
ATOM   7271  H HB3    . GLU A 1 142 ? -6.685  4.303   -10.665 1.00 0.00  ? 142 GLU A HB3    3  
ATOM   7272  H HG2    . GLU A 1 142 ? -7.254  2.442   -9.290  1.00 0.00  ? 142 GLU A HG2    3  
ATOM   7273  H HG3    . GLU A 1 142 ? -7.554  1.425   -10.700 1.00 0.00  ? 142 GLU A HG3    3  
ATOM   7274  H HE2    . GLU A 1 142 ? -3.987  1.461   -9.256  1.00 0.00  ? 142 GLU A HE2    3  
ATOM   7275  N N      . GLY A 1 143 ? -8.919  4.632   -13.634 1.00 0.00  ? 143 GLY A N      3  
ATOM   7276  C CA     . GLY A 1 143 ? -9.069  5.656   -14.652 1.00 0.00  ? 143 GLY A CA     3  
ATOM   7277  C C      . GLY A 1 143 ? -10.259 6.554   -14.377 1.00 0.00  ? 143 GLY A C      3  
ATOM   7278  O O      . GLY A 1 143 ? -10.139 7.778   -14.395 1.00 0.00  ? 143 GLY A O      3  
ATOM   7279  H H      . GLY A 1 143 ? -8.928  3.687   -13.888 1.00 0.00  ? 143 GLY A H      3  
ATOM   7280  H HA2    . GLY A 1 143 ? -8.171  6.257   -14.680 1.00 0.00  ? 143 GLY A HA2    3  
ATOM   7281  H HA3    . GLY A 1 143 ? -9.203  5.179   -15.612 1.00 0.00  ? 143 GLY A HA3    3  
ATOM   7282  N N      . HIS A 1 144 ? -11.407 5.940   -14.111 1.00 0.00  ? 144 HIS A N      3  
ATOM   7283  C CA     . HIS A 1 144 ? -12.624 6.685   -13.815 1.00 0.00  ? 144 HIS A CA     3  
ATOM   7284  C C      . HIS A 1 144 ? -12.575 7.233   -12.395 1.00 0.00  ? 144 HIS A C      3  
ATOM   7285  O O      . HIS A 1 144 ? -13.060 8.330   -12.121 1.00 0.00  ? 144 HIS A O      3  
ATOM   7286  C CB     . HIS A 1 144 ? -13.852 5.788   -13.974 1.00 0.00  ? 144 HIS A CB     3  
ATOM   7287  C CG     . HIS A 1 144 ? -15.111 6.544   -14.262 1.00 0.00  ? 144 HIS A CG     3  
ATOM   7288  N ND1    . HIS A 1 144 ? -16.299 5.932   -14.604 1.00 0.00  ? 144 HIS A ND1    3  
ATOM   7289  C CD2    . HIS A 1 144 ? -15.368 7.874   -14.246 1.00 0.00  ? 144 HIS A CD2    3  
ATOM   7290  C CE1    . HIS A 1 144 ? -17.231 6.851   -14.785 1.00 0.00  ? 144 HIS A CE1    3  
ATOM   7291  N NE2    . HIS A 1 144 ? -16.692 8.037   -14.574 1.00 0.00  ? 144 HIS A NE2    3  
ATOM   7292  H H      . HIS A 1 144 ? -11.434 4.961   -14.101 1.00 0.00  ? 144 HIS A H      3  
ATOM   7293  H HA     . HIS A 1 144 ? -12.691 7.509   -14.509 1.00 0.00  ? 144 HIS A HA     3  
ATOM   7294  H HB2    . HIS A 1 144 ? -13.689 5.099   -14.783 1.00 0.00  ? 144 HIS A HB2    3  
ATOM   7295  H HB3    . HIS A 1 144 ? -13.998 5.229   -13.062 1.00 0.00  ? 144 HIS A HB3    3  
ATOM   7296  H HD1    . HIS A 1 144 ? -16.439 4.966   -14.697 1.00 0.00  ? 144 HIS A HD1    3  
ATOM   7297  H HD2    . HIS A 1 144 ? -14.665 8.659   -14.012 1.00 0.00  ? 144 HIS A HD2    3  
ATOM   7298  H HE1    . HIS A 1 144 ? -18.259 6.663   -15.058 1.00 0.00  ? 144 HIS A HE1    3  
ATOM   7299  H HE2    . HIS A 1 144 ? -17.185 8.883   -14.542 1.00 0.00  ? 144 HIS A HE2    3  
ATOM   7300  N N      . GLN A 1 145 ? -11.992 6.451   -11.494 1.00 0.00  ? 145 GLN A N      3  
ATOM   7301  C CA     . GLN A 1 145 ? -11.880 6.839   -10.093 1.00 0.00  ? 145 GLN A CA     3  
ATOM   7302  C C      . GLN A 1 145 ? -11.068 8.120   -9.930  1.00 0.00  ? 145 GLN A C      3  
ATOM   7303  O O      . GLN A 1 145 ? -11.513 9.074   -9.292  1.00 0.00  ? 145 GLN A O      3  
ATOM   7304  C CB     . GLN A 1 145 ? -11.224 5.717   -9.285  1.00 0.00  ? 145 GLN A CB     3  
ATOM   7305  C CG     . GLN A 1 145 ? -11.315 5.919   -7.784  1.00 0.00  ? 145 GLN A CG     3  
ATOM   7306  C CD     . GLN A 1 145 ? -12.742 5.860   -7.274  1.00 0.00  ? 145 GLN A CD     3  
ATOM   7307  O OE1    . GLN A 1 145 ? -13.454 4.881   -7.500  1.00 0.00  ? 145 GLN A OE1    3  
ATOM   7308  N NE2    . GLN A 1 145 ? -13.168 6.911   -6.582  1.00 0.00  ? 145 GLN A NE2    3  
ATOM   7309  H H      . GLN A 1 145 ? -11.630 5.585   -11.777 1.00 0.00  ? 145 GLN A H      3  
ATOM   7310  H HA     . GLN A 1 145 ? -12.874 7.008   -9.715  1.00 0.00  ? 145 GLN A HA     3  
ATOM   7311  H HB2    . GLN A 1 145 ? -11.704 4.781   -9.533  1.00 0.00  ? 145 GLN A HB2    3  
ATOM   7312  H HB3    . GLN A 1 145 ? -10.181 5.658   -9.558  1.00 0.00  ? 145 GLN A HB3    3  
ATOM   7313  H HG2    . GLN A 1 145 ? -10.740 5.147   -7.294  1.00 0.00  ? 145 GLN A HG2    3  
ATOM   7314  H HG3    . GLN A 1 145 ? -10.900 6.887   -7.541  1.00 0.00  ? 145 GLN A HG3    3  
ATOM   7315  H HE21   . GLN A 1 145 ? -12.545 7.656   -6.442  1.00 0.00  ? 145 GLN A HE21   3  
ATOM   7316  H HE22   . GLN A 1 145 ? -14.085 6.897   -6.239  1.00 0.00  ? 145 GLN A HE22   3  
ATOM   7317  N N      . PHE A 1 146 ? -9.869  8.133   -10.504 1.00 0.00  ? 146 PHE A N      3  
ATOM   7318  C CA     . PHE A 1 146 ? -8.993  9.294   -10.415 1.00 0.00  ? 146 PHE A CA     3  
ATOM   7319  C C      . PHE A 1 146 ? -9.640  10.522  -11.045 1.00 0.00  ? 146 PHE A C      3  
ATOM   7320  O O      . PHE A 1 146 ? -9.690  11.594  -10.440 1.00 0.00  ? 146 PHE A O      3  
ATOM   7321  C CB     . PHE A 1 146 ? -7.656  8.994   -11.099 1.00 0.00  ? 146 PHE A CB     3  
ATOM   7322  C CG     . PHE A 1 146 ? -6.719  10.167  -11.134 1.00 0.00  ? 146 PHE A CG     3  
ATOM   7323  C CD1    . PHE A 1 146 ? -6.874  11.164  -12.081 1.00 0.00  ? 146 PHE A CD1    3  
ATOM   7324  C CD2    . PHE A 1 146 ? -5.683  10.275  -10.217 1.00 0.00  ? 146 PHE A CD2    3  
ATOM   7325  C CE1    . PHE A 1 146 ? -6.015  12.246  -12.119 1.00 0.00  ? 146 PHE A CE1    3  
ATOM   7326  C CE2    . PHE A 1 146 ? -4.821  11.354  -10.249 1.00 0.00  ? 146 PHE A CE2    3  
ATOM   7327  C CZ     . PHE A 1 146 ? -4.988  12.342  -11.200 1.00 0.00  ? 146 PHE A CZ     3  
ATOM   7328  H H      . PHE A 1 146 ? -9.567  7.343   -10.994 1.00 0.00  ? 146 PHE A H      3  
ATOM   7329  H HA     . PHE A 1 146 ? -8.814  9.492   -9.370  1.00 0.00  ? 146 PHE A HA     3  
ATOM   7330  H HB2    . PHE A 1 146 ? -7.163  8.190   -10.574 1.00 0.00  ? 146 PHE A HB2    3  
ATOM   7331  H HB3    . PHE A 1 146 ? -7.845  8.688   -12.119 1.00 0.00  ? 146 PHE A HB3    3  
ATOM   7332  H HD1    . PHE A 1 146 ? -7.677  11.091  -12.801 1.00 0.00  ? 146 PHE A HD1    3  
ATOM   7333  H HD2    . PHE A 1 146 ? -5.552  9.503   -9.473  1.00 0.00  ? 146 PHE A HD2    3  
ATOM   7334  H HE1    . PHE A 1 146 ? -6.147  13.016  -12.863 1.00 0.00  ? 146 PHE A HE1    3  
ATOM   7335  H HE2    . PHE A 1 146 ? -4.019  11.428  -9.531  1.00 0.00  ? 146 PHE A HE2    3  
ATOM   7336  H HZ     . PHE A 1 146 ? -4.317  13.187  -11.228 1.00 0.00  ? 146 PHE A HZ     3  
ATOM   7337  N N      . LEU A 1 147 ? -10.126 10.361  -12.268 1.00 0.00  ? 147 LEU A N      3  
ATOM   7338  C CA     . LEU A 1 147 ? -10.765 11.452  -12.995 1.00 0.00  ? 147 LEU A CA     3  
ATOM   7339  C C      . LEU A 1 147 ? -11.937 12.035  -12.218 1.00 0.00  ? 147 LEU A C      3  
ATOM   7340  O O      . LEU A 1 147 ? -12.223 13.230  -12.312 1.00 0.00  ? 147 LEU A O      3  
ATOM   7341  C CB     . LEU A 1 147 ? -11.216 10.967  -14.366 1.00 0.00  ? 147 LEU A CB     3  
ATOM   7342  C CG     . LEU A 1 147 ? -10.068 10.594  -15.299 1.00 0.00  ? 147 LEU A CG     3  
ATOM   7343  C CD1    . LEU A 1 147 ? -10.589 10.038  -16.607 1.00 0.00  ? 147 LEU A CD1    3  
ATOM   7344  C CD2    . LEU A 1 147 ? -9.183  11.802  -15.550 1.00 0.00  ? 147 LEU A CD2    3  
ATOM   7345  H H      . LEU A 1 147 ? -10.051 9.487   -12.700 1.00 0.00  ? 147 LEU A H      3  
ATOM   7346  H HA     . LEU A 1 147 ? -10.030 12.222  -13.129 1.00 0.00  ? 147 LEU A HA     3  
ATOM   7347  H HB2    . LEU A 1 147 ? -11.847 10.100  -14.231 1.00 0.00  ? 147 LEU A HB2    3  
ATOM   7348  H HB3    . LEU A 1 147 ? -11.796 11.748  -14.834 1.00 0.00  ? 147 LEU A HB3    3  
ATOM   7349  H HG     . LEU A 1 147 ? -9.467  9.832   -14.830 1.00 0.00  ? 147 LEU A HG     3  
ATOM   7350  H HD11   . LEU A 1 147 ? -11.511 10.532  -16.869 1.00 0.00  ? 147 LEU A HD11   3  
ATOM   7351  H HD12   . LEU A 1 147 ? -10.762 8.977   -16.506 1.00 0.00  ? 147 LEU A HD12   3  
ATOM   7352  H HD13   . LEU A 1 147 ? -9.855  10.210  -17.375 1.00 0.00  ? 147 LEU A HD13   3  
ATOM   7353  H HD21   . LEU A 1 147 ? -8.515  11.939  -14.712 1.00 0.00  ? 147 LEU A HD21   3  
ATOM   7354  H HD22   . LEU A 1 147 ? -9.798  12.682  -15.669 1.00 0.00  ? 147 LEU A HD22   3  
ATOM   7355  H HD23   . LEU A 1 147 ? -8.603  11.643  -16.448 1.00 0.00  ? 147 LEU A HD23   3  
ATOM   7356  N N      . CYS A 1 148 ? -12.609 11.194  -11.444 1.00 0.00  ? 148 CYS A N      3  
ATOM   7357  C CA     . CYS A 1 148 ? -13.740 11.644  -10.644 1.00 0.00  ? 148 CYS A CA     3  
ATOM   7358  C C      . CYS A 1 148 ? -13.262 12.304  -9.352  1.00 0.00  ? 148 CYS A C      3  
ATOM   7359  O O      . CYS A 1 148 ? -14.066 12.813  -8.571  1.00 0.00  ? 148 CYS A O      3  
ATOM   7360  C CB     . CYS A 1 148 ? -14.663 10.468  -10.318 1.00 0.00  ? 148 CYS A CB     3  
ATOM   7361  S SG     . CYS A 1 148 ? -16.415 10.802  -10.614 1.00 0.00  ? 148 CYS A SG     3  
ATOM   7362  H H      . CYS A 1 148 ? -12.331 10.257  -11.401 1.00 0.00  ? 148 CYS A H      3  
ATOM   7363  H HA     . CYS A 1 148 ? -14.288 12.369  -11.225 1.00 0.00  ? 148 CYS A HA     3  
ATOM   7364  H HB2    . CYS A 1 148 ? -14.384 9.621   -10.926 1.00 0.00  ? 148 CYS A HB2    3  
ATOM   7365  H HB3    . CYS A 1 148 ? -14.550 10.208  -9.276  1.00 0.00  ? 148 CYS A HB3    3  
ATOM   7366  H HG     . CYS A 1 148 ? -16.631 10.487  -11.495 1.00 0.00  ? 148 CYS A HG     3  
ATOM   7367  N N      . SER A 1 149 ? -11.947 12.285  -9.127  1.00 0.00  ? 149 SER A N      3  
ATOM   7368  C CA     . SER A 1 149 ? -11.364 12.871  -7.927  1.00 0.00  ? 149 SER A CA     3  
ATOM   7369  C C      . SER A 1 149 ? -10.527 14.109  -8.249  1.00 0.00  ? 149 SER A C      3  
ATOM   7370  O O      . SER A 1 149 ? -9.829  14.628  -7.378  1.00 0.00  ? 149 SER A O      3  
ATOM   7371  C CB     . SER A 1 149 ? -10.489 11.840  -7.210  1.00 0.00  ? 149 SER A CB     3  
ATOM   7372  O OG     . SER A 1 149 ? -10.910 11.658  -5.869  1.00 0.00  ? 149 SER A OG     3  
ATOM   7373  H H      . SER A 1 149 ? -11.356 11.859  -9.782  1.00 0.00  ? 149 SER A H      3  
ATOM   7374  H HA     . SER A 1 149 ? -12.173 13.158  -7.272  1.00 0.00  ? 149 SER A HA     3  
ATOM   7375  H HB2    . SER A 1 149 ? -10.557 10.896  -7.727  1.00 0.00  ? 149 SER A HB2    3  
ATOM   7376  H HB3    . SER A 1 149 ? -9.463  12.179  -7.213  1.00 0.00  ? 149 SER A HB3    3  
ATOM   7377  H HG     . SER A 1 149 ? -11.798 11.295  -5.856  1.00 0.00  ? 149 SER A HG     3  
ATOM   7378  N N      . ILE A 1 150 ? -10.590 14.581  -9.493  1.00 0.00  ? 150 ILE A N      3  
ATOM   7379  C CA     . ILE A 1 150 ? -9.822  15.752  -9.887  1.00 0.00  ? 150 ILE A CA     3  
ATOM   7380  C C      . ILE A 1 150 ? -10.674 17.021  -9.766  1.00 0.00  ? 150 ILE A C      3  
ATOM   7381  O O      . ILE A 1 150 ? -11.384 17.200  -8.775  1.00 0.00  ? 150 ILE A O      3  
ATOM   7382  C CB     . ILE A 1 150 ? -9.247  15.615  -11.324 1.00 0.00  ? 150 ILE A CB     3  
ATOM   7383  C CG1    . ILE A 1 150 ? -9.146  14.149  -11.758 1.00 0.00  ? 150 ILE A CG1    3  
ATOM   7384  C CG2    . ILE A 1 150 ? -7.879  16.275  -11.392 1.00 0.00  ? 150 ILE A CG2    3  
ATOM   7385  C CD1    . ILE A 1 150 ? -8.577  13.970  -13.150 1.00 0.00  ? 150 ILE A CD1    3  
ATOM   7386  H H      . ILE A 1 150 ? -11.157 14.140  -10.154 1.00 0.00  ? 150 ILE A H      3  
ATOM   7387  H HA     . ILE A 1 150 ? -8.991  15.837  -9.204  1.00 0.00  ? 150 ILE A HA     3  
ATOM   7388  H HB     . ILE A 1 150 ? -9.904  16.134  -12.005 1.00 0.00  ? 150 ILE A HB     3  
ATOM   7389  H HG12   . ILE A 1 150 ? -8.507  13.615  -11.069 1.00 0.00  ? 150 ILE A HG12   3  
ATOM   7390  H HG13   . ILE A 1 150 ? -10.131 13.705  -11.743 1.00 0.00  ? 150 ILE A HG13   3  
ATOM   7391  H HG21   . ILE A 1 150 ? -7.996  17.347  -11.385 1.00 0.00  ? 150 ILE A HG21   3  
ATOM   7392  H HG22   . ILE A 1 150 ? -7.377  15.971  -12.299 1.00 0.00  ? 150 ILE A HG22   3  
ATOM   7393  H HG23   . ILE A 1 150 ? -7.294  15.972  -10.537 1.00 0.00  ? 150 ILE A HG23   3  
ATOM   7394  H HD11   . ILE A 1 150 ? -7.870  14.760  -13.357 1.00 0.00  ? 150 ILE A HD11   3  
ATOM   7395  H HD12   . ILE A 1 150 ? -9.378  14.005  -13.873 1.00 0.00  ? 150 ILE A HD12   3  
ATOM   7396  H HD13   . ILE A 1 150 ? -8.078  13.016  -13.216 1.00 0.00  ? 150 ILE A HD13   3  
ATOM   7397  N N      . GLU A 1 151 ? -10.602 17.906  -10.756 1.00 0.00  ? 151 GLU A N      3  
ATOM   7398  C CA     . GLU A 1 151 ? -11.366 19.150  -10.728 1.00 0.00  ? 151 GLU A CA     3  
ATOM   7399  C C      . GLU A 1 151 ? -12.614 19.058  -11.601 1.00 0.00  ? 151 GLU A C      3  
ATOM   7400  O O      . GLU A 1 151 ? -13.736 19.175  -11.109 1.00 0.00  ? 151 GLU A O      3  
ATOM   7401  C CB     . GLU A 1 151 ? -10.493 20.317  -11.192 1.00 0.00  ? 151 GLU A CB     3  
ATOM   7402  C CG     . GLU A 1 151 ? -11.141 21.677  -10.996 1.00 0.00  ? 151 GLU A CG     3  
ATOM   7403  C CD     . GLU A 1 151 ? -10.945 22.216  -9.593  1.00 0.00  ? 151 GLU A CD     3  
ATOM   7404  O OE1    . GLU A 1 151 ? -11.771 21.892  -8.711  1.00 0.00  ? 151 GLU A OE1    3  
ATOM   7405  O OE2    . GLU A 1 151 ? -9.964  22.956  -9.372  1.00 0.00  ? 151 GLU A OE2    3  
ATOM   7406  H H      . GLU A 1 151 ? -10.022 17.724  -11.519 1.00 0.00  ? 151 GLU A H      3  
ATOM   7407  H HA     . GLU A 1 151 ? -11.671 19.326  -9.708  1.00 0.00  ? 151 GLU A HA     3  
ATOM   7408  H HB2    . GLU A 1 151 ? -9.568  20.300  -10.639 1.00 0.00  ? 151 GLU A HB2    3  
ATOM   7409  H HB3    . GLU A 1 151 ? -10.277 20.194  -12.243 1.00 0.00  ? 151 GLU A HB3    3  
ATOM   7410  H HG2    . GLU A 1 151 ? -10.704 22.374  -11.696 1.00 0.00  ? 151 GLU A HG2    3  
ATOM   7411  H HG3    . GLU A 1 151 ? -12.200 21.591  -11.189 1.00 0.00  ? 151 GLU A HG3    3  
ATOM   7412  H HE2    . GLU A 1 151 ? -9.900  23.259  -8.463  1.00 0.00  ? 151 GLU A HE2    3  
ATOM   7413  N N      . ALA A 1 152 ? -12.412 18.866  -12.901 1.00 0.00  ? 152 ALA A N      3  
ATOM   7414  C CA     . ALA A 1 152 ? -13.525 18.777  -13.841 1.00 0.00  ? 152 ALA A CA     3  
ATOM   7415  C C      . ALA A 1 152 ? -14.123 17.371  -13.877 1.00 0.00  ? 152 ALA A C      3  
ATOM   7416  O O      . ALA A 1 152 ? -13.412 16.389  -14.086 1.00 0.00  ? 152 ALA A O      3  
ATOM   7417  C CB     . ALA A 1 152 ? -13.069 19.191  -15.233 1.00 0.00  ? 152 ALA A CB     3  
ATOM   7418  H H      . ALA A 1 152 ? -11.496 18.791  -13.237 1.00 0.00  ? 152 ALA A H      3  
ATOM   7419  H HA     . ALA A 1 152 ? -14.286 19.471  -13.519 1.00 0.00  ? 152 ALA A HA     3  
ATOM   7420  H HB1    . ALA A 1 152 ? -13.280 18.398  -15.936 1.00 0.00  ? 152 ALA A HB1    3  
ATOM   7421  H HB2    . ALA A 1 152 ? -12.006 19.384  -15.220 1.00 0.00  ? 152 ALA A HB2    3  
ATOM   7422  H HB3    . ALA A 1 152 ? -13.595 20.086  -15.532 1.00 0.00  ? 152 ALA A HB3    3  
ATOM   7423  N N      . LEU A 1 153 ? -15.439 17.288  -13.682 1.00 0.00  ? 153 LEU A N      3  
ATOM   7424  C CA     . LEU A 1 153 ? -16.134 16.005  -13.706 1.00 0.00  ? 153 LEU A CA     3  
ATOM   7425  C C      . LEU A 1 153 ? -17.542 16.161  -14.278 1.00 0.00  ? 153 LEU A C      3  
ATOM   7426  C CB     . LEU A 1 153 ? -16.200 15.395  -12.302 1.00 0.00  ? 153 LEU A CB     3  
ATOM   7427  C CG     . LEU A 1 153 ? -16.872 16.262  -11.237 1.00 0.00  ? 153 LEU A CG     3  
ATOM   7428  C CD1    . LEU A 1 153 ? -17.530 15.393  -10.174 1.00 0.00  ? 153 LEU A CD1    3  
ATOM   7429  C CD2    . LEU A 1 153 ? -15.863 17.207  -10.607 1.00 0.00  ? 153 LEU A CD2    3  
ATOM   7430  H H      . LEU A 1 153 ? -15.952 18.107  -13.530 1.00 0.00  ? 153 LEU A H      3  
ATOM   7431  H HA     . LEU A 1 153 ? -15.574 15.343  -14.348 1.00 0.00  ? 153 LEU A HA     3  
ATOM   7432  H HB2    . LEU A 1 153 ? -16.737 14.460  -12.368 1.00 0.00  ? 153 LEU A HB2    3  
ATOM   7433  H HB3    . LEU A 1 153 ? -15.190 15.186  -11.978 1.00 0.00  ? 153 LEU A HB3    3  
ATOM   7434  H HG     . LEU A 1 153 ? -17.644 16.859  -11.700 1.00 0.00  ? 153 LEU A HG     3  
ATOM   7435  H HD11   . LEU A 1 153 ? -18.603 15.453  -10.274 1.00 0.00  ? 153 LEU A HD11   3  
ATOM   7436  H HD12   . LEU A 1 153 ? -17.240 15.740  -9.192  1.00 0.00  ? 153 LEU A HD12   3  
ATOM   7437  H HD13   . LEU A 1 153 ? -17.215 14.368  -10.301 1.00 0.00  ? 153 LEU A HD13   3  
ATOM   7438  H HD21   . LEU A 1 153 ? -15.316 16.688  -9.833  1.00 0.00  ? 153 LEU A HD21   3  
ATOM   7439  H HD22   . LEU A 1 153 ? -16.382 18.052  -10.175 1.00 0.00  ? 153 LEU A HD22   3  
ATOM   7440  H HD23   . LEU A 1 153 ? -15.176 17.554  -11.361 1.00 0.00  ? 153 LEU A HD23   3  
HETATM 7441  P PG     . ATP B 2 .   ? -0.145  -7.214  -27.497 1.00 0.00  ? 154 ATP A PG     3  
HETATM 7442  O O1G    . ATP B 2 .   ? 0.361   -8.537  -27.047 1.00 0.00  ? 154 ATP A O1G    3  
HETATM 7443  O O2G    . ATP B 2 .   ? 0.319   -6.333  -26.394 1.00 0.00  ? 154 ATP A O2G    3  
HETATM 7444  O O3G    . ATP B 2 .   ? 0.302   -6.646  -28.793 1.00 0.00  ? 154 ATP A O3G    3  
HETATM 7445  P PB     . ATP B 2 .   ? -2.636  -8.153  -26.952 1.00 0.00  ? 154 ATP A PB     3  
HETATM 7446  O O1B    . ATP B 2 .   ? -2.829  -9.232  -27.952 1.00 0.00  ? 154 ATP A O1B    3  
HETATM 7447  O O2B    . ATP B 2 .   ? -3.795  -7.347  -26.494 1.00 0.00  ? 154 ATP A O2B    3  
HETATM 7448  O O3B    . ATP B 2 .   ? -1.628  -7.232  -27.539 1.00 0.00  ? 154 ATP A O3B    3  
HETATM 7449  P PA     . ATP B 2 .   ? -2.692  -9.268  -24.449 1.00 0.00  ? 154 ATP A PA     3  
HETATM 7450  O O1A    . ATP B 2 .   ? -1.747  -9.385  -23.309 1.00 0.00  ? 154 ATP A O1A    3  
HETATM 7451  O O2A    . ATP B 2 .   ? -3.951  -8.504  -24.259 1.00 0.00  ? 154 ATP A O2A    3  
HETATM 7452  O O3A    . ATP B 2 .   ? -2.126  -8.896  -25.771 1.00 0.00  ? 154 ATP A O3A    3  
HETATM 7453  O "O5'"  . ATP B 2 .   ? -3.038  -10.782 -24.803 1.00 0.00  ? 154 ATP A "O5'"  3  
HETATM 7454  C "C5'"  . ATP B 2 .   ? -3.881  -11.557 -23.954 1.00 0.00  ? 154 ATP A "C5'"  3  
HETATM 7455  C "C4'"  . ATP B 2 .   ? -3.100  -12.701 -23.354 1.00 0.00  ? 154 ATP A "C4'"  3  
HETATM 7456  O "O4'"  . ATP B 2 .   ? -3.390  -12.760 -21.930 1.00 0.00  ? 154 ATP A "O4'"  3  
HETATM 7457  C "C3'"  . ATP B 2 .   ? -3.451  -14.083 -23.912 1.00 0.00  ? 154 ATP A "C3'"  3  
HETATM 7458  O "O3'"  . ATP B 2 .   ? -2.280  -14.842 -24.187 1.00 0.00  ? 154 ATP A "O3'"  3  
HETATM 7459  C "C2'"  . ATP B 2 .   ? -4.292  -14.717 -22.807 1.00 0.00  ? 154 ATP A "C2'"  3  
HETATM 7460  O "O2'"  . ATP B 2 .   ? -4.103  -16.118 -22.754 1.00 0.00  ? 154 ATP A "O2'"  3  
HETATM 7461  C "C1'"  . ATP B 2 .   ? -3.660  -14.091 -21.570 1.00 0.00  ? 154 ATP A "C1'"  3  
HETATM 7462  N N9     . ATP B 2 .   ? -4.505  -14.098 -20.376 1.00 0.00  ? 154 ATP A N9     3  
HETATM 7463  C C8     . ATP B 2 .   ? -5.851  -14.346 -20.281 1.00 0.00  ? 154 ATP A C8     3  
HETATM 7464  N N7     . ATP B 2 .   ? -6.314  -14.282 -19.054 1.00 0.00  ? 154 ATP A N7     3  
HETATM 7465  C C5     . ATP B 2 .   ? -5.196  -13.969 -18.293 1.00 0.00  ? 154 ATP A C5     3  
HETATM 7466  C C6     . ATP B 2 .   ? -5.014  -13.760 -16.914 1.00 0.00  ? 154 ATP A C6     3  
HETATM 7467  N N6     . ATP B 2 .   ? -6.000  -13.838 -16.016 1.00 0.00  ? 154 ATP A N6     3  
HETATM 7468  N N1     . ATP B 2 .   ? -3.769  -13.463 -16.483 1.00 0.00  ? 154 ATP A N1     3  
HETATM 7469  C C2     . ATP B 2 .   ? -2.779  -13.382 -17.383 1.00 0.00  ? 154 ATP A C2     3  
HETATM 7470  N N3     . ATP B 2 .   ? -2.826  -13.557 -18.699 1.00 0.00  ? 154 ATP A N3     3  
HETATM 7471  C C4     . ATP B 2 .   ? -4.076  -13.852 -19.095 1.00 0.00  ? 154 ATP A C4     3  
HETATM 7472  H "H5'1" . ATP B 2 .   ? -4.713  -11.958 -24.529 1.00 0.00  ? 154 ATP A "H5'1" 3  
HETATM 7473  H "H5'2" . ATP B 2 .   ? -4.268  -10.935 -23.150 1.00 0.00  ? 154 ATP A "H5'2" 3  
HETATM 7474  H "H4'"  . ATP B 2 .   ? -2.047  -12.533 -23.579 1.00 0.00  ? 154 ATP A "H4'"  3  
HETATM 7475  H "H3'"  . ATP B 2 .   ? -3.989  -14.009 -24.856 1.00 0.00  ? 154 ATP A "H3'"  3  
HETATM 7476  H "H2'"  . ATP B 2 .   ? -5.342  -14.432 -22.909 1.00 0.00  ? 154 ATP A "H2'"  3  
HETATM 7477  H "HO2'" . ATP B 2 .   ? -3.978  -16.353 -21.834 1.00 0.00  ? 154 ATP A "HO2'" 3  
HETATM 7478  H "H1'"  . ATP B 2 .   ? -2.705  -14.550 -21.316 1.00 0.00  ? 154 ATP A "H1'"  3  
HETATM 7479  H H8     . ATP B 2 .   ? -6.474  -14.572 -21.135 1.00 0.00  ? 154 ATP A H8     3  
HETATM 7480  H HN61   . ATP B 2 .   ? -6.939  -14.057 -16.315 1.00 0.00  ? 154 ATP A HN61   3  
HETATM 7481  H HN62   . ATP B 2 .   ? -5.806  -13.678 -15.039 1.00 0.00  ? 154 ATP A HN62   3  
HETATM 7482  H H2     . ATP B 2 .   ? -1.798  -13.138 -16.981 1.00 0.00  ? 154 ATP A H2     3  
ATOM   7483  N N      . GLY A 1 1   ? 20.244  4.299   -15.500 1.00 0.00  ? 1   GLY A N      4  
ATOM   7484  C CA     . GLY A 1 1   ? 21.073  3.288   -14.875 1.00 0.00  ? 1   GLY A CA     4  
ATOM   7485  C C      . GLY A 1 1   ? 20.312  1.974   -14.768 1.00 0.00  ? 1   GLY A C      4  
ATOM   7486  O O      . GLY A 1 1   ? 20.870  0.908   -15.018 1.00 0.00  ? 1   GLY A O      4  
ATOM   7487  H H1     . GLY A 1 1   ? 20.630  5.223   -15.632 1.00 0.00  ? 1   GLY A H1     4  
ATOM   7488  H HA2    . GLY A 1 1   ? 21.971  3.136   -15.474 1.00 0.00  ? 1   GLY A HA2    4  
ATOM   7489  H HA3    . GLY A 1 1   ? 21.358  3.621   -13.877 1.00 0.00  ? 1   GLY A HA3    4  
ATOM   7490  N N      . PRO A 1 2   ? 19.033  2.052   -14.394 1.00 0.00  ? 2   PRO A N      4  
ATOM   7491  C CA     . PRO A 1 2   ? 18.155  0.912   -14.242 1.00 0.00  ? 2   PRO A CA     4  
ATOM   7492  C C      . PRO A 1 2   ? 17.794  0.360   -15.614 1.00 0.00  ? 2   PRO A C      4  
ATOM   7493  O O      . PRO A 1 2   ? 16.800  0.772   -16.208 1.00 0.00  ? 2   PRO A O      4  
ATOM   7494  C CB     . PRO A 1 2   ? 16.920  1.460   -13.530 1.00 0.00  ? 2   PRO A CB     4  
ATOM   7495  C CG     . PRO A 1 2   ? 16.869  2.910   -14.009 1.00 0.00  ? 2   PRO A CG     4  
ATOM   7496  C CD     . PRO A 1 2   ? 18.345  3.289   -14.089 1.00 0.00  ? 2   PRO A CD     4  
ATOM   7497  H HA     . PRO A 1 2   ? 18.625  0.133   -13.642 1.00 0.00  ? 2   PRO A HA     4  
ATOM   7498  H HB2    . PRO A 1 2   ? 16.016  0.906   -13.783 1.00 0.00  ? 2   PRO A HB2    4  
ATOM   7499  H HB3    . PRO A 1 2   ? 17.092  1.447   -12.453 1.00 0.00  ? 2   PRO A HB3    4  
ATOM   7500  H HG2    . PRO A 1 2   ? 16.436  2.940   -15.009 1.00 0.00  ? 2   PRO A HG2    4  
ATOM   7501  H HG3    . PRO A 1 2   ? 16.312  3.553   -13.328 1.00 0.00  ? 2   PRO A HG3    4  
ATOM   7502  H HD2    . PRO A 1 2   ? 18.512  4.041   -14.861 1.00 0.00  ? 2   PRO A HD2    4  
ATOM   7503  H HD3    . PRO A 1 2   ? 18.686  3.657   -13.121 1.00 0.00  ? 2   PRO A HD3    4  
ATOM   7504  N N      . LEU A 1 3   ? 18.604  -0.571  -16.112 1.00 0.00  ? 3   LEU A N      4  
ATOM   7505  C CA     . LEU A 1 3   ? 18.363  -1.174  -17.416 1.00 0.00  ? 3   LEU A CA     4  
ATOM   7506  C C      . LEU A 1 3   ? 17.097  -2.022  -17.393 1.00 0.00  ? 3   LEU A C      4  
ATOM   7507  O O      . LEU A 1 3   ? 16.857  -2.775  -16.449 1.00 0.00  ? 3   LEU A O      4  
ATOM   7508  C CB     . LEU A 1 3   ? 19.555  -2.036  -17.837 1.00 0.00  ? 3   LEU A CB     4  
ATOM   7509  C CG     . LEU A 1 3   ? 20.003  -3.070  -16.799 1.00 0.00  ? 3   LEU A CG     4  
ATOM   7510  C CD1    . LEU A 1 3   ? 20.181  -4.436  -17.446 1.00 0.00  ? 3   LEU A CD1    4  
ATOM   7511  C CD2    . LEU A 1 3   ? 21.293  -2.625  -16.128 1.00 0.00  ? 3   LEU A CD2    4  
ATOM   7512  H H      . LEU A 1 3   ? 19.379  -0.859  -15.586 1.00 0.00  ? 3   LEU A H      4  
ATOM   7513  H HA     . LEU A 1 3   ? 18.235  -0.376  -18.132 1.00 0.00  ? 3   LEU A HA     4  
ATOM   7514  H HB2    . LEU A 1 3   ? 19.292  -2.555  -18.745 1.00 0.00  ? 3   LEU A HB2    4  
ATOM   7515  H HB3    . LEU A 1 3   ? 20.389  -1.381  -18.046 1.00 0.00  ? 3   LEU A HB3    4  
ATOM   7516  H HG     . LEU A 1 3   ? 19.243  -3.157  -16.038 1.00 0.00  ? 3   LEU A HG     4  
ATOM   7517  H HD11   . LEU A 1 3   ? 19.660  -4.458  -18.390 1.00 0.00  ? 3   LEU A HD11   4  
ATOM   7518  H HD12   . LEU A 1 3   ? 19.779  -5.195  -16.793 1.00 0.00  ? 3   LEU A HD12   4  
ATOM   7519  H HD13   . LEU A 1 3   ? 21.232  -4.622  -17.609 1.00 0.00  ? 3   LEU A HD13   4  
ATOM   7520  H HD21   . LEU A 1 3   ? 21.890  -2.062  -16.830 1.00 0.00  ? 3   LEU A HD21   4  
ATOM   7521  H HD22   . LEU A 1 3   ? 21.847  -3.494  -15.802 1.00 0.00  ? 3   LEU A HD22   4  
ATOM   7522  H HD23   . LEU A 1 3   ? 21.061  -2.006  -15.274 1.00 0.00  ? 3   LEU A HD23   4  
ATOM   7523  N N      . GLY A 1 4   ? 16.285  -1.892  -18.437 1.00 0.00  ? 4   GLY A N      4  
ATOM   7524  C CA     . GLY A 1 4   ? 15.049  -2.650  -18.516 1.00 0.00  ? 4   GLY A CA     4  
ATOM   7525  C C      . GLY A 1 4   ? 15.265  -4.081  -18.963 1.00 0.00  ? 4   GLY A C      4  
ATOM   7526  O O      . GLY A 1 4   ? 14.670  -4.527  -19.944 1.00 0.00  ? 4   GLY A O      4  
ATOM   7527  H H      . GLY A 1 4   ? 16.524  -1.276  -19.159 1.00 0.00  ? 4   GLY A H      4  
ATOM   7528  H HA2    . GLY A 1 4   ? 14.583  -2.655  -17.541 1.00 0.00  ? 4   GLY A HA2    4  
ATOM   7529  H HA3    . GLY A 1 4   ? 14.388  -2.160  -19.215 1.00 0.00  ? 4   GLY A HA3    4  
ATOM   7530  N N      . SER A 1 5   ? 16.112  -4.808  -18.241 1.00 0.00  ? 5   SER A N      4  
ATOM   7531  C CA     . SER A 1 5   ? 16.392  -6.199  -18.571 1.00 0.00  ? 5   SER A CA     4  
ATOM   7532  C C      . SER A 1 5   ? 15.199  -7.081  -18.227 1.00 0.00  ? 5   SER A C      4  
ATOM   7533  O O      . SER A 1 5   ? 14.384  -6.730  -17.374 1.00 0.00  ? 5   SER A O      4  
ATOM   7534  C CB     . SER A 1 5   ? 17.632  -6.691  -17.818 1.00 0.00  ? 5   SER A CB     4  
ATOM   7535  O OG     . SER A 1 5   ? 17.474  -6.562  -16.414 1.00 0.00  ? 5   SER A OG     4  
ATOM   7536  H H      . SER A 1 5   ? 16.552  -4.402  -17.466 1.00 0.00  ? 5   SER A H      4  
ATOM   7537  H HA     . SER A 1 5   ? 16.578  -6.258  -19.631 1.00 0.00  ? 5   SER A HA     4  
ATOM   7538  H HB2    . SER A 1 5   ? 17.800  -7.731  -18.053 1.00 0.00  ? 5   SER A HB2    4  
ATOM   7539  H HB3    . SER A 1 5   ? 18.490  -6.111  -18.126 1.00 0.00  ? 5   SER A HB3    4  
ATOM   7540  H HG     . SER A 1 5   ? 16.770  -5.939  -16.221 1.00 0.00  ? 5   SER A HG     4  
ATOM   7541  N N      . MET A 1 6   ? 15.099  -8.222  -18.894 1.00 0.00  ? 6   MET A N      4  
ATOM   7542  C CA     . MET A 1 6   ? 13.999  -9.149  -18.656 1.00 0.00  ? 6   MET A CA     4  
ATOM   7543  C C      . MET A 1 6   ? 12.658  -8.475  -18.928 1.00 0.00  ? 6   MET A C      4  
ATOM   7544  O O      . MET A 1 6   ? 12.557  -7.248  -18.929 1.00 0.00  ? 6   MET A O      4  
ATOM   7545  C CB     . MET A 1 6   ? 14.041  -9.670  -17.215 1.00 0.00  ? 6   MET A CB     4  
ATOM   7546  C CG     . MET A 1 6   ? 13.929  -11.183 -17.114 1.00 0.00  ? 6   MET A CG     4  
ATOM   7547  S SD     . MET A 1 6   ? 12.783  -11.718 -15.828 1.00 0.00  ? 6   MET A SD     4  
ATOM   7548  C CE     . MET A 1 6   ? 11.216  -11.548 -16.679 1.00 0.00  ? 6   MET A CE     4  
ATOM   7549  H H      . MET A 1 6   ? 15.778  -8.449  -19.564 1.00 0.00  ? 6   MET A H      4  
ATOM   7550  H HA     . MET A 1 6   ? 14.114  -9.982  -19.332 1.00 0.00  ? 6   MET A HA     4  
ATOM   7551  H HB2    . MET A 1 6   ? 14.977  -9.369  -16.765 1.00 0.00  ? 6   MET A HB2    4  
ATOM   7552  H HB3    . MET A 1 6   ? 13.227  -9.229  -16.658 1.00 0.00  ? 6   MET A HB3    4  
ATOM   7553  H HG2    . MET A 1 6   ? 13.585  -11.569 -18.061 1.00 0.00  ? 6   MET A HG2    4  
ATOM   7554  H HG3    . MET A 1 6   ? 14.906  -11.589 -16.896 1.00 0.00  ? 6   MET A HG3    4  
ATOM   7555  H HE1    . MET A 1 6   ? 10.497  -12.234 -16.252 1.00 0.00  ? 6   MET A HE1    4  
ATOM   7556  H HE2    . MET A 1 6   ? 11.349  -11.772 -17.726 1.00 0.00  ? 6   MET A HE2    4  
ATOM   7557  H HE3    . MET A 1 6   ? 10.857  -10.536 -16.571 1.00 0.00  ? 6   MET A HE3    4  
ATOM   7558  N N      . ALA A 1 7   ? 11.632  -9.281  -19.163 1.00 0.00  ? 7   ALA A N      4  
ATOM   7559  C CA     . ALA A 1 7   ? 10.302  -8.757  -19.439 1.00 0.00  ? 7   ALA A CA     4  
ATOM   7560  C C      . ALA A 1 7   ? 10.314  -7.850  -20.663 1.00 0.00  ? 7   ALA A C      4  
ATOM   7561  O O      . ALA A 1 7   ? 11.371  -7.413  -21.119 1.00 0.00  ? 7   ALA A O      4  
ATOM   7562  C CB     . ALA A 1 7   ? 9.763   -8.009  -18.225 1.00 0.00  ? 7   ALA A CB     4  
ATOM   7563  H H      . ALA A 1 7   ? 11.773  -10.251 -19.152 1.00 0.00  ? 7   ALA A H      4  
ATOM   7564  H HA     . ALA A 1 7   ? 9.648   -9.595  -19.638 1.00 0.00  ? 7   ALA A HA     4  
ATOM   7565  H HB1    . ALA A 1 7   ? 10.534  -7.945  -17.470 1.00 0.00  ? 7   ALA A HB1    4  
ATOM   7566  H HB2    . ALA A 1 7   ? 8.910   -8.536  -17.822 1.00 0.00  ? 7   ALA A HB2    4  
ATOM   7567  H HB3    . ALA A 1 7   ? 9.464   -7.012  -18.516 1.00 0.00  ? 7   ALA A HB3    4  
ATOM   7568  N N      . LEU A 1 8   ? 9.130   -7.576  -21.187 1.00 0.00  ? 8   LEU A N      4  
ATOM   7569  C CA     . LEU A 1 8   ? 8.992   -6.726  -22.363 1.00 0.00  ? 8   LEU A CA     4  
ATOM   7570  C C      . LEU A 1 8   ? 8.371   -5.384  -21.998 1.00 0.00  ? 8   LEU A C      4  
ATOM   7571  O O      . LEU A 1 8   ? 7.448   -5.312  -21.188 1.00 0.00  ? 8   LEU A O      4  
ATOM   7572  C CB     . LEU A 1 8   ? 8.146   -7.420  -23.432 1.00 0.00  ? 8   LEU A CB     4  
ATOM   7573  C CG     . LEU A 1 8   ? 8.197   -8.952  -23.419 1.00 0.00  ? 8   LEU A CG     4  
ATOM   7574  C CD1    . LEU A 1 8   ? 7.392   -9.503  -22.253 1.00 0.00  ? 8   LEU A CD1    4  
ATOM   7575  C CD2    . LEU A 1 8   ? 7.677   -9.506  -24.733 1.00 0.00  ? 8   LEU A CD2    4  
ATOM   7576  H H      . LEU A 1 8   ? 8.327   -7.957  -20.773 1.00 0.00  ? 8   LEU A H      4  
ATOM   7577  H HA     . LEU A 1 8   ? 9.981   -6.551  -22.759 1.00 0.00  ? 8   LEU A HA     4  
ATOM   7578  H HB2    . LEU A 1 8   ? 7.118   -7.113  -23.304 1.00 0.00  ? 8   LEU A HB2    4  
ATOM   7579  H HB3    . LEU A 1 8   ? 8.484   -7.081  -24.399 1.00 0.00  ? 8   LEU A HB3    4  
ATOM   7580  H HG     . LEU A 1 8   ? 9.223   -9.271  -23.301 1.00 0.00  ? 8   LEU A HG     4  
ATOM   7581  H HD11   . LEU A 1 8   ? 8.060   -9.927  -21.513 1.00 0.00  ? 8   LEU A HD11   4  
ATOM   7582  H HD12   . LEU A 1 8   ? 6.715   -10.266 -22.605 1.00 0.00  ? 8   LEU A HD12   4  
ATOM   7583  H HD13   . LEU A 1 8   ? 6.823   -8.704  -21.806 1.00 0.00  ? 8   LEU A HD13   4  
ATOM   7584  H HD21   . LEU A 1 8   ? 7.778   -10.580 -24.732 1.00 0.00  ? 8   LEU A HD21   4  
ATOM   7585  H HD22   . LEU A 1 8   ? 8.248   -9.090  -25.549 1.00 0.00  ? 8   LEU A HD22   4  
ATOM   7586  H HD23   . LEU A 1 8   ? 6.636   -9.240  -24.846 1.00 0.00  ? 8   LEU A HD23   4  
ATOM   7587  N N      . ARG A 1 9   ? 8.883   -4.320  -22.603 1.00 0.00  ? 9   ARG A N      4  
ATOM   7588  C CA     . ARG A 1 9   ? 8.379   -2.978  -22.348 1.00 0.00  ? 9   ARG A CA     4  
ATOM   7589  C C      . ARG A 1 9   ? 7.156   -2.681  -23.209 1.00 0.00  ? 9   ARG A C      4  
ATOM   7590  O O      . ARG A 1 9   ? 7.209   -2.771  -24.435 1.00 0.00  ? 9   ARG A O      4  
ATOM   7591  C CB     . ARG A 1 9   ? 9.474   -1.948  -22.625 1.00 0.00  ? 9   ARG A CB     4  
ATOM   7592  C CG     . ARG A 1 9   ? 10.054  -1.319  -21.371 1.00 0.00  ? 9   ARG A CG     4  
ATOM   7593  C CD     . ARG A 1 9   ? 11.574  -1.270  -21.425 1.00 0.00  ? 9   ARG A CD     4  
ATOM   7594  N NE     . ARG A 1 9   ? 12.174  -1.174  -20.095 1.00 0.00  ? 9   ARG A NE     4  
ATOM   7595  C CZ     . ARG A 1 9   ? 12.708  -0.059  -19.594 1.00 0.00  ? 9   ARG A CZ     4  
ATOM   7596  N NH1    . ARG A 1 9   ? 12.690  1.072   -20.290 1.00 0.00  ? 9   ARG A NH1    4  
ATOM   7597  N NH2    . ARG A 1 9   ? 13.259  -0.077  -18.387 1.00 0.00  ? 9   ARG A NH2    4  
ATOM   7598  H H      . ARG A 1 9   ? 9.617   -4.441  -23.242 1.00 0.00  ? 9   ARG A H      4  
ATOM   7599  H HA     . ARG A 1 9   ? 8.099   -2.920  -21.308 1.00 0.00  ? 9   ARG A HA     4  
ATOM   7600  H HB2    . ARG A 1 9   ? 10.275  -2.430  -23.165 1.00 0.00  ? 9   ARG A HB2    4  
ATOM   7601  H HB3    . ARG A 1 9   ? 9.066   -1.160  -23.238 1.00 0.00  ? 9   ARG A HB3    4  
ATOM   7602  H HG2    . ARG A 1 9   ? 9.674   -0.311  -21.282 1.00 0.00  ? 9   ARG A HG2    4  
ATOM   7603  H HG3    . ARG A 1 9   ? 9.748   -1.899  -20.512 1.00 0.00  ? 9   ARG A HG3    4  
ATOM   7604  H HD2    . ARG A 1 9   ? 11.931  -2.171  -21.902 1.00 0.00  ? 9   ARG A HD2    4  
ATOM   7605  H HD3    . ARG A 1 9   ? 11.872  -0.415  -22.010 1.00 0.00  ? 9   ARG A HD3    4  
ATOM   7606  H HE     . ARG A 1 9   ? 12.193  -1.987  -19.549 1.00 0.00  ? 9   ARG A HE     4  
ATOM   7607  H HH11   . ARG A 1 9   ? 12.273  1.097   -21.198 1.00 0.00  ? 9   ARG A HH11   4  
ATOM   7608  H HH12   . ARG A 1 9   ? 13.094  1.902   -19.904 1.00 0.00  ? 9   ARG A HH12   4  
ATOM   7609  H HH21   . ARG A 1 9   ? 13.272  -0.923  -17.858 1.00 0.00  ? 9   ARG A HH21   4  
ATOM   7610  H HH22   . ARG A 1 9   ? 13.661  0.759   -18.010 1.00 0.00  ? 9   ARG A HH22   4  
ATOM   7611  N N      . ALA A 1 10  ? 6.056   -2.320  -22.558 1.00 0.00  ? 10  ALA A N      4  
ATOM   7612  C CA     . ALA A 1 10  ? 4.820   -2.000  -23.263 1.00 0.00  ? 10  ALA A CA     4  
ATOM   7613  C C      . ALA A 1 10  ? 4.158   -0.769  -22.667 1.00 0.00  ? 10  ALA A C      4  
ATOM   7614  O O      . ALA A 1 10  ? 4.481   -0.357  -21.553 1.00 0.00  ? 10  ALA A O      4  
ATOM   7615  C CB     . ALA A 1 10  ? 3.861   -3.181  -23.229 1.00 0.00  ? 10  ALA A CB     4  
ATOM   7616  H H      . ALA A 1 10  ? 6.076   -2.260  -21.580 1.00 0.00  ? 10  ALA A H      4  
ATOM   7617  H HA     . ALA A 1 10  ? 5.069   -1.800  -24.295 1.00 0.00  ? 10  ALA A HA     4  
ATOM   7618  H HB1    . ALA A 1 10  ? 2.901   -2.856  -22.853 1.00 0.00  ? 10  ALA A HB1    4  
ATOM   7619  H HB2    . ALA A 1 10  ? 4.259   -3.950  -22.582 1.00 0.00  ? 10  ALA A HB2    4  
ATOM   7620  H HB3    . ALA A 1 10  ? 3.741   -3.577  -24.226 1.00 0.00  ? 10  ALA A HB3    4  
ATOM   7621  N N      . CYS A 1 11  ? 3.230   -0.183  -23.412 1.00 0.00  ? 11  CYS A N      4  
ATOM   7622  C CA     . CYS A 1 11  ? 2.523   1.002   -22.950 1.00 0.00  ? 11  CYS A CA     4  
ATOM   7623  C C      . CYS A 1 11  ? 1.192   1.164   -23.672 1.00 0.00  ? 11  CYS A C      4  
ATOM   7624  O O      . CYS A 1 11  ? 1.140   1.223   -24.900 1.00 0.00  ? 11  CYS A O      4  
ATOM   7625  C CB     . CYS A 1 11  ? 3.387   2.247   -23.162 1.00 0.00  ? 11  CYS A CB     4  
ATOM   7626  S SG     . CYS A 1 11  ? 4.552   2.574   -21.817 1.00 0.00  ? 11  CYS A SG     4  
ATOM   7627  H H      . CYS A 1 11  ? 3.014   -0.558  -24.291 1.00 0.00  ? 11  CYS A H      4  
ATOM   7628  H HA     . CYS A 1 11  ? 2.333   0.883   -21.893 1.00 0.00  ? 11  CYS A HA     4  
ATOM   7629  H HB2    . CYS A 1 11  ? 3.959   2.127   -24.068 1.00 0.00  ? 11  CYS A HB2    4  
ATOM   7630  H HB3    . CYS A 1 11  ? 2.744   3.108   -23.258 1.00 0.00  ? 11  CYS A HB3    4  
ATOM   7631  H HG     . CYS A 1 11  ? 4.682   1.759   -21.330 1.00 0.00  ? 11  CYS A HG     4  
ATOM   7632  N N      . GLY A 1 12  ? 0.117   1.243   -22.896 1.00 0.00  ? 12  GLY A N      4  
ATOM   7633  C CA     . GLY A 1 12  ? -1.205  1.406   -23.466 1.00 0.00  ? 12  GLY A CA     4  
ATOM   7634  C C      . GLY A 1 12  ? -1.851  2.717   -23.066 1.00 0.00  ? 12  GLY A C      4  
ATOM   7635  O O      . GLY A 1 12  ? -1.343  3.423   -22.194 1.00 0.00  ? 12  GLY A O      4  
ATOM   7636  H H      . GLY A 1 12  ? 0.226   1.189   -21.924 1.00 0.00  ? 12  GLY A H      4  
ATOM   7637  H HA2    . GLY A 1 12  ? -1.127  1.374   -24.542 1.00 0.00  ? 12  GLY A HA2    4  
ATOM   7638  H HA3    . GLY A 1 12  ? -1.835  0.593   -23.136 1.00 0.00  ? 12  GLY A HA3    4  
ATOM   7639  N N      . LEU A 1 13  ? -2.973  3.044   -23.700 1.00 0.00  ? 13  LEU A N      4  
ATOM   7640  C CA     . LEU A 1 13  ? -3.681  4.282   -23.395 1.00 0.00  ? 13  LEU A CA     4  
ATOM   7641  C C      . LEU A 1 13  ? -5.121  4.000   -22.992 1.00 0.00  ? 13  LEU A C      4  
ATOM   7642  O O      . LEU A 1 13  ? -5.911  3.496   -23.790 1.00 0.00  ? 13  LEU A O      4  
ATOM   7643  C CB     . LEU A 1 13  ? -3.664  5.232   -24.606 1.00 0.00  ? 13  LEU A CB     4  
ATOM   7644  C CG     . LEU A 1 13  ? -3.079  6.625   -24.350 1.00 0.00  ? 13  LEU A CG     4  
ATOM   7645  C CD1    . LEU A 1 13  ? -3.508  7.600   -25.437 1.00 0.00  ? 13  LEU A CD1    4  
ATOM   7646  C CD2    . LEU A 1 13  ? -3.491  7.149   -22.983 1.00 0.00  ? 13  LEU A CD2    4  
ATOM   7647  H H      . LEU A 1 13  ? -3.331  2.443   -24.385 1.00 0.00  ? 13  LEU A H      4  
ATOM   7648  H HA     . LEU A 1 13  ? -3.175  4.758   -22.570 1.00 0.00  ? 13  LEU A HA     4  
ATOM   7649  H HB2    . LEU A 1 13  ? -3.088  4.767   -25.393 1.00 0.00  ? 13  LEU A HB2    4  
ATOM   7650  H HB3    . LEU A 1 13  ? -4.680  5.356   -24.957 1.00 0.00  ? 13  LEU A HB3    4  
ATOM   7651  H HG     . LEU A 1 13  ? -2.006  6.561   -24.375 1.00 0.00  ? 13  LEU A HG     4  
ATOM   7652  H HD11   . LEU A 1 13  ? -2.681  7.776   -26.109 1.00 0.00  ? 13  LEU A HD11   4  
ATOM   7653  H HD12   . LEU A 1 13  ? -3.808  8.534   -24.983 1.00 0.00  ? 13  LEU A HD12   4  
ATOM   7654  H HD13   . LEU A 1 13  ? -4.337  7.183   -25.989 1.00 0.00  ? 13  LEU A HD13   4  
ATOM   7655  H HD21   . LEU A 1 13  ? -4.535  6.926   -22.812 1.00 0.00  ? 13  LEU A HD21   4  
ATOM   7656  H HD22   . LEU A 1 13  ? -3.341  8.218   -22.947 1.00 0.00  ? 13  LEU A HD22   4  
ATOM   7657  H HD23   . LEU A 1 13  ? -2.891  6.673   -22.220 1.00 0.00  ? 13  LEU A HD23   4  
ATOM   7658  N N      . ILE A 1 14  ? -5.471  4.358   -21.762 1.00 0.00  ? 14  ILE A N      4  
ATOM   7659  C CA     . ILE A 1 14  ? -6.830  4.167   -21.287 1.00 0.00  ? 14  ILE A CA     4  
ATOM   7660  C C      . ILE A 1 14  ? -7.657  5.378   -21.680 1.00 0.00  ? 14  ILE A C      4  
ATOM   7661  O O      . ILE A 1 14  ? -7.706  6.380   -20.967 1.00 0.00  ? 14  ILE A O      4  
ATOM   7662  C CB     . ILE A 1 14  ? -6.891  3.949   -19.759 1.00 0.00  ? 14  ILE A CB     4  
ATOM   7663  C CG1    . ILE A 1 14  ? -6.225  2.621   -19.400 1.00 0.00  ? 14  ILE A CG1    4  
ATOM   7664  C CG2    . ILE A 1 14  ? -8.335  3.969   -19.269 1.00 0.00  ? 14  ILE A CG2    4  
ATOM   7665  C CD1    . ILE A 1 14  ? -6.154  2.360   -17.911 1.00 0.00  ? 14  ILE A CD1    4  
ATOM   7666  H H      . ILE A 1 14  ? -4.809  4.778   -21.177 1.00 0.00  ? 14  ILE A H      4  
ATOM   7667  H HA     . ILE A 1 14  ? -7.233  3.292   -21.777 1.00 0.00  ? 14  ILE A HA     4  
ATOM   7668  H HB     . ILE A 1 14  ? -6.359  4.755   -19.279 1.00 0.00  ? 14  ILE A HB     4  
ATOM   7669  H HG12   . ILE A 1 14  ? -6.783  1.814   -19.849 1.00 0.00  ? 14  ILE A HG12   4  
ATOM   7670  H HG13   . ILE A 1 14  ? -5.217  2.616   -19.787 1.00 0.00  ? 14  ILE A HG13   4  
ATOM   7671  H HG21   . ILE A 1 14  ? -8.518  3.104   -18.648 1.00 0.00  ? 14  ILE A HG21   4  
ATOM   7672  H HG22   . ILE A 1 14  ? -9.005  3.952   -20.115 1.00 0.00  ? 14  ILE A HG22   4  
ATOM   7673  H HG23   . ILE A 1 14  ? -8.508  4.868   -18.693 1.00 0.00  ? 14  ILE A HG23   4  
ATOM   7674  H HD11   . ILE A 1 14  ? -5.869  3.268   -17.399 1.00 0.00  ? 14  ILE A HD11   4  
ATOM   7675  H HD12   . ILE A 1 14  ? -5.423  1.591   -17.716 1.00 0.00  ? 14  ILE A HD12   4  
ATOM   7676  H HD13   . ILE A 1 14  ? -7.122  2.036   -17.556 1.00 0.00  ? 14  ILE A HD13   4  
ATOM   7677  N N      . ILE A 1 15  ? -8.278  5.281   -22.841 1.00 0.00  ? 15  ILE A N      4  
ATOM   7678  C CA     . ILE A 1 15  ? -9.079  6.361   -23.380 1.00 0.00  ? 15  ILE A CA     4  
ATOM   7679  C C      . ILE A 1 15  ? -10.457 6.404   -22.748 1.00 0.00  ? 15  ILE A C      4  
ATOM   7680  O O      . ILE A 1 15  ? -11.016 5.371   -22.387 1.00 0.00  ? 15  ILE A O      4  
ATOM   7681  C CB     . ILE A 1 15  ? -9.206  6.218   -24.898 1.00 0.00  ? 15  ILE A CB     4  
ATOM   7682  C CG1    . ILE A 1 15  ? -7.817  6.240   -25.523 1.00 0.00  ? 15  ILE A CG1    4  
ATOM   7683  C CG2    . ILE A 1 15  ? -10.078 7.316   -25.484 1.00 0.00  ? 15  ILE A CG2    4  
ATOM   7684  C CD1    . ILE A 1 15  ? -7.781  5.655   -26.909 1.00 0.00  ? 15  ILE A CD1    4  
ATOM   7685  H H      . ILE A 1 15  ? -8.173  4.461   -23.367 1.00 0.00  ? 15  ILE A H      4  
ATOM   7686  H HA     . ILE A 1 15  ? -8.569  7.287   -23.170 1.00 0.00  ? 15  ILE A HA     4  
ATOM   7687  H HB     . ILE A 1 15  ? -9.671  5.272   -25.110 1.00 0.00  ? 15  ILE A HB     4  
ATOM   7688  H HG12   . ILE A 1 15  ? -7.467  7.259   -25.580 1.00 0.00  ? 15  ILE A HG12   4  
ATOM   7689  H HG13   . ILE A 1 15  ? -7.142  5.666   -24.904 1.00 0.00  ? 15  ILE A HG13   4  
ATOM   7690  H HG21   . ILE A 1 15  ? -10.289 7.088   -26.519 1.00 0.00  ? 15  ILE A HG21   4  
ATOM   7691  H HG22   . ILE A 1 15  ? -9.562  8.260   -25.418 1.00 0.00  ? 15  ILE A HG22   4  
ATOM   7692  H HG23   . ILE A 1 15  ? -11.007 7.371   -24.934 1.00 0.00  ? 15  ILE A HG23   4  
ATOM   7693  H HD11   . ILE A 1 15  ? -8.772  5.315   -27.179 1.00 0.00  ? 15  ILE A HD11   4  
ATOM   7694  H HD12   . ILE A 1 15  ? -7.092  4.822   -26.926 1.00 0.00  ? 15  ILE A HD12   4  
ATOM   7695  H HD13   . ILE A 1 15  ? -7.452  6.411   -27.606 1.00 0.00  ? 15  ILE A HD13   4  
ATOM   7696  N N      . PHE A 1 16  ? -10.987 7.610   -22.597 1.00 0.00  ? 16  PHE A N      4  
ATOM   7697  C CA     . PHE A 1 16  ? -12.290 7.797   -21.991 1.00 0.00  ? 16  PHE A CA     4  
ATOM   7698  C C      . PHE A 1 16  ? -12.980 9.051   -22.526 1.00 0.00  ? 16  PHE A C      4  
ATOM   7699  O O      . PHE A 1 16  ? -12.451 10.154  -22.409 1.00 0.00  ? 16  PHE A O      4  
ATOM   7700  C CB     . PHE A 1 16  ? -12.127 7.903   -20.477 1.00 0.00  ? 16  PHE A CB     4  
ATOM   7701  C CG     . PHE A 1 16  ? -11.389 9.137   -20.039 1.00 0.00  ? 16  PHE A CG     4  
ATOM   7702  C CD1    . PHE A 1 16  ? -10.006 9.135   -19.942 1.00 0.00  ? 16  PHE A CD1    4  
ATOM   7703  C CD2    . PHE A 1 16  ? -12.077 10.299  -19.730 1.00 0.00  ? 16  PHE A CD2    4  
ATOM   7704  C CE1    . PHE A 1 16  ? -9.323  10.270  -19.545 1.00 0.00  ? 16  PHE A CE1    4  
ATOM   7705  C CE2    . PHE A 1 16  ? -11.401 11.437  -19.333 1.00 0.00  ? 16  PHE A CE2    4  
ATOM   7706  C CZ     . PHE A 1 16  ? -10.023 11.422  -19.239 1.00 0.00  ? 16  PHE A CZ     4  
ATOM   7707  H H      . PHE A 1 16  ? -10.481 8.395   -22.892 1.00 0.00  ? 16  PHE A H      4  
ATOM   7708  H HA     . PHE A 1 16  ? -12.892 6.934   -22.221 1.00 0.00  ? 16  PHE A HA     4  
ATOM   7709  H HB2    . PHE A 1 16  ? -13.098 7.915   -20.019 1.00 0.00  ? 16  PHE A HB2    4  
ATOM   7710  H HB3    . PHE A 1 16  ? -11.576 7.047   -20.123 1.00 0.00  ? 16  PHE A HB3    4  
ATOM   7711  H HD1    . PHE A 1 16  ? -9.459  8.236   -20.180 1.00 0.00  ? 16  PHE A HD1    4  
ATOM   7712  H HD2    . PHE A 1 16  ? -13.154 10.313  -19.803 1.00 0.00  ? 16  PHE A HD2    4  
ATOM   7713  H HE1    . PHE A 1 16  ? -8.245  10.255  -19.470 1.00 0.00  ? 16  PHE A HE1    4  
ATOM   7714  H HE2    . PHE A 1 16  ? -11.949 12.336  -19.095 1.00 0.00  ? 16  PHE A HE2    4  
ATOM   7715  H HZ     . PHE A 1 16  ? -9.493  12.309  -18.929 1.00 0.00  ? 16  PHE A HZ     4  
ATOM   7716  N N      . ARG A 1 17  ? -14.170 8.882   -23.097 1.00 0.00  ? 17  ARG A N      4  
ATOM   7717  C CA     . ARG A 1 17  ? -14.922 10.016  -23.625 1.00 0.00  ? 17  ARG A CA     4  
ATOM   7718  C C      . ARG A 1 17  ? -15.676 10.713  -22.497 1.00 0.00  ? 17  ARG A C      4  
ATOM   7719  O O      . ARG A 1 17  ? -16.607 10.149  -21.921 1.00 0.00  ? 17  ARG A O      4  
ATOM   7720  C CB     . ARG A 1 17  ? -15.908 9.553   -24.702 1.00 0.00  ? 17  ARG A CB     4  
ATOM   7721  C CG     . ARG A 1 17  ? -15.943 10.453  -25.927 1.00 0.00  ? 17  ARG A CG     4  
ATOM   7722  C CD     . ARG A 1 17  ? -16.036 11.920  -25.540 1.00 0.00  ? 17  ARG A CD     4  
ATOM   7723  N NE     . ARG A 1 17  ? -16.550 12.742  -26.632 1.00 0.00  ? 17  ARG A NE     4  
ATOM   7724  C CZ     . ARG A 1 17  ? -16.854 14.031  -26.507 1.00 0.00  ? 17  ARG A CZ     4  
ATOM   7725  N NH1    . ARG A 1 17  ? -16.718 14.643  -25.337 1.00 0.00  ? 17  ARG A NH1    4  
ATOM   7726  N NH2    . ARG A 1 17  ? -17.300 14.712  -27.554 1.00 0.00  ? 17  ARG A NH2    4  
ATOM   7727  H H      . ARG A 1 17  ? -14.553 7.983   -23.155 1.00 0.00  ? 17  ARG A H      4  
ATOM   7728  H HA     . ARG A 1 17  ? -14.220 10.711  -24.060 1.00 0.00  ? 17  ARG A HA     4  
ATOM   7729  H HB2    . ARG A 1 17  ? -15.632 8.559   -25.022 1.00 0.00  ? 17  ARG A HB2    4  
ATOM   7730  H HB3    . ARG A 1 17  ? -16.900 9.522   -24.277 1.00 0.00  ? 17  ARG A HB3    4  
ATOM   7731  H HG2    . ARG A 1 17  ? -15.042 10.299  -26.502 1.00 0.00  ? 17  ARG A HG2    4  
ATOM   7732  H HG3    . ARG A 1 17  ? -16.802 10.193  -26.527 1.00 0.00  ? 17  ARG A HG3    4  
ATOM   7733  H HD2    . ARG A 1 17  ? -16.694 12.015  -24.690 1.00 0.00  ? 17  ARG A HD2    4  
ATOM   7734  H HD3    . ARG A 1 17  ? -15.049 12.271  -25.272 1.00 0.00  ? 17  ARG A HD3    4  
ATOM   7735  H HE     . ARG A 1 17  ? -16.669 12.312  -27.503 1.00 0.00  ? 17  ARG A HE     4  
ATOM   7736  H HH11   . ARG A 1 17  ? -16.384 14.135  -24.542 1.00 0.00  ? 17  ARG A HH11   4  
ATOM   7737  H HH12   . ARG A 1 17  ? -16.947 15.612  -25.249 1.00 0.00  ? 17  ARG A HH12   4  
ATOM   7738  H HH21   . ARG A 1 17  ? -17.409 14.256  -28.438 1.00 0.00  ? 17  ARG A HH21   4  
ATOM   7739  H HH22   . ARG A 1 17  ? -17.529 15.682  -27.460 1.00 0.00  ? 17  ARG A HH22   4  
ATOM   7740  N N      . ARG A 1 18  ? -15.265 11.935  -22.183 1.00 0.00  ? 18  ARG A N      4  
ATOM   7741  C CA     . ARG A 1 18  ? -15.899 12.703  -21.119 1.00 0.00  ? 18  ARG A CA     4  
ATOM   7742  C C      . ARG A 1 18  ? -16.889 13.717  -21.675 1.00 0.00  ? 18  ARG A C      4  
ATOM   7743  O O      . ARG A 1 18  ? -16.554 14.509  -22.558 1.00 0.00  ? 18  ARG A O      4  
ATOM   7744  C CB     . ARG A 1 18  ? -14.844 13.419  -20.277 1.00 0.00  ? 18  ARG A CB     4  
ATOM   7745  C CG     . ARG A 1 18  ? -15.420 14.130  -19.061 1.00 0.00  ? 18  ARG A CG     4  
ATOM   7746  C CD     . ARG A 1 18  ? -15.169 13.345  -17.782 1.00 0.00  ? 18  ARG A CD     4  
ATOM   7747  N NE     . ARG A 1 18  ? -14.466 14.143  -16.780 1.00 0.00  ? 18  ARG A NE     4  
ATOM   7748  C CZ     . ARG A 1 18  ? -15.041 15.102  -16.061 1.00 0.00  ? 18  ARG A CZ     4  
ATOM   7749  N NH1    . ARG A 1 18  ? -16.325 15.390  -16.234 1.00 0.00  ? 18  ARG A NH1    4  
ATOM   7750  N NH2    . ARG A 1 18  ? -14.331 15.777  -15.166 1.00 0.00  ? 18  ARG A NH2    4  
ATOM   7751  H H      . ARG A 1 18  ? -14.515 12.329  -22.675 1.00 0.00  ? 18  ARG A H      4  
ATOM   7752  H HA     . ARG A 1 18  ? -16.436 12.010  -20.487 1.00 0.00  ? 18  ARG A HA     4  
ATOM   7753  H HB2    . ARG A 1 18  ? -14.119 12.696  -19.936 1.00 0.00  ? 18  ARG A HB2    4  
ATOM   7754  H HB3    . ARG A 1 18  ? -14.346 14.152  -20.892 1.00 0.00  ? 18  ARG A HB3    4  
ATOM   7755  H HG2    . ARG A 1 18  ? -14.955 15.101  -18.972 1.00 0.00  ? 18  ARG A HG2    4  
ATOM   7756  H HG3    . ARG A 1 18  ? -16.484 14.249  -19.198 1.00 0.00  ? 18  ARG A HG3    4  
ATOM   7757  H HD2    . ARG A 1 18  ? -16.119 13.033  -17.376 1.00 0.00  ? 18  ARG A HD2    4  
ATOM   7758  H HD3    . ARG A 1 18  ? -14.575 12.474  -18.018 1.00 0.00  ? 18  ARG A HD3    4  
ATOM   7759  H HE     . ARG A 1 18  ? -13.515 13.952  -16.637 1.00 0.00  ? 18  ARG A HE     4  
ATOM   7760  H HH11   . ARG A 1 18  ? -16.865 14.886  -16.908 1.00 0.00  ? 18  ARG A HH11   4  
ATOM   7761  H HH12   . ARG A 1 18  ? -16.753 16.110  -15.689 1.00 0.00  ? 18  ARG A HH12   4  
ATOM   7762  H HH21   . ARG A 1 18  ? -13.364 15.565  -15.034 1.00 0.00  ? 18  ARG A HH21   4  
ATOM   7763  H HH22   . ARG A 1 18  ? -14.765 16.499  -14.626 1.00 0.00  ? 18  ARG A HH22   4  
ATOM   7764  N N      . CYS A 1 19  ? -18.105 13.696  -21.146 1.00 0.00  ? 19  CYS A N      4  
ATOM   7765  C CA     . CYS A 1 19  ? -19.142 14.624  -21.577 1.00 0.00  ? 19  CYS A CA     4  
ATOM   7766  C C      . CYS A 1 19  ? -18.754 16.055  -21.221 1.00 0.00  ? 19  CYS A C      4  
ATOM   7767  O O      . CYS A 1 19  ? -17.903 16.276  -20.360 1.00 0.00  ? 19  CYS A O      4  
ATOM   7768  C CB     . CYS A 1 19  ? -20.478 14.262  -20.926 1.00 0.00  ? 19  CYS A CB     4  
ATOM   7769  S SG     . CYS A 1 19  ? -21.640 13.434  -22.036 1.00 0.00  ? 19  CYS A SG     4  
ATOM   7770  H H      . CYS A 1 19  ? -18.308 13.048  -20.442 1.00 0.00  ? 19  CYS A H      4  
ATOM   7771  H HA     . CYS A 1 19  ? -19.239 14.542  -22.650 1.00 0.00  ? 19  CYS A HA     4  
ATOM   7772  H HB2    . CYS A 1 19  ? -20.294 13.602  -20.092 1.00 0.00  ? 19  CYS A HB2    4  
ATOM   7773  H HB3    . CYS A 1 19  ? -20.952 15.163  -20.564 1.00 0.00  ? 19  CYS A HB3    4  
ATOM   7774  H HG     . CYS A 1 19  ? -21.560 13.839  -22.902 1.00 0.00  ? 19  CYS A HG     4  
ATOM   7775  N N      . LEU A 1 20  ? -19.373 17.024  -21.888 1.00 0.00  ? 20  LEU A N      4  
ATOM   7776  C CA     . LEU A 1 20  ? -19.080 18.431  -21.637 1.00 0.00  ? 20  LEU A CA     4  
ATOM   7777  C C      . LEU A 1 20  ? -19.139 18.749  -20.143 1.00 0.00  ? 20  LEU A C      4  
ATOM   7778  O O      . LEU A 1 20  ? -18.414 19.614  -19.655 1.00 0.00  ? 20  LEU A O      4  
ATOM   7779  C CB     . LEU A 1 20  ? -20.053 19.332  -22.407 1.00 0.00  ? 20  LEU A CB     4  
ATOM   7780  C CG     . LEU A 1 20  ? -21.523 18.899  -22.374 1.00 0.00  ? 20  LEU A CG     4  
ATOM   7781  C CD1    . LEU A 1 20  ? -22.426 20.089  -22.080 1.00 0.00  ? 20  LEU A CD1    4  
ATOM   7782  C CD2    . LEU A 1 20  ? -21.919 18.247  -23.694 1.00 0.00  ? 20  LEU A CD2    4  
ATOM   7783  H H      . LEU A 1 20  ? -20.041 16.787  -22.565 1.00 0.00  ? 20  LEU A H      4  
ATOM   7784  H HA     . LEU A 1 20  ? -18.077 18.622  -21.988 1.00 0.00  ? 20  LEU A HA     4  
ATOM   7785  H HB2    . LEU A 1 20  ? -19.985 20.330  -21.999 1.00 0.00  ? 20  LEU A HB2    4  
ATOM   7786  H HB3    . LEU A 1 20  ? -19.733 19.365  -23.439 1.00 0.00  ? 20  LEU A HB3    4  
ATOM   7787  H HG     . LEU A 1 20  ? -21.661 18.173  -21.586 1.00 0.00  ? 20  LEU A HG     4  
ATOM   7788  H HD11   . LEU A 1 20  ? -22.785 20.027  -21.065 1.00 0.00  ? 20  LEU A HD11   4  
ATOM   7789  H HD12   . LEU A 1 20  ? -23.267 20.080  -22.757 1.00 0.00  ? 20  LEU A HD12   4  
ATOM   7790  H HD13   . LEU A 1 20  ? -21.870 21.005  -22.211 1.00 0.00  ? 20  LEU A HD13   4  
ATOM   7791  H HD21   . LEU A 1 20  ? -21.650 18.899  -24.512 1.00 0.00  ? 20  LEU A HD21   4  
ATOM   7792  H HD22   . LEU A 1 20  ? -22.986 18.078  -23.705 1.00 0.00  ? 20  LEU A HD22   4  
ATOM   7793  H HD23   . LEU A 1 20  ? -21.405 17.304  -23.801 1.00 0.00  ? 20  LEU A HD23   4  
ATOM   7794  N N      . ILE A 1 21  ? -19.995 18.029  -19.421 1.00 0.00  ? 21  ILE A N      4  
ATOM   7795  C CA     . ILE A 1 21  ? -20.143 18.219  -17.979 1.00 0.00  ? 21  ILE A CA     4  
ATOM   7796  C C      . ILE A 1 21  ? -20.907 17.052  -17.357 1.00 0.00  ? 21  ILE A C      4  
ATOM   7797  O O      . ILE A 1 21  ? -21.726 16.413  -18.017 1.00 0.00  ? 21  ILE A O      4  
ATOM   7798  C CB     . ILE A 1 21  ? -20.888 19.530  -17.629 1.00 0.00  ? 21  ILE A CB     4  
ATOM   7799  C CG1    . ILE A 1 21  ? -21.904 19.895  -18.715 1.00 0.00  ? 21  ILE A CG1    4  
ATOM   7800  C CG2    . ILE A 1 21  ? -19.904 20.673  -17.412 1.00 0.00  ? 21  ILE A CG2    4  
ATOM   7801  C CD1    . ILE A 1 21  ? -23.190 19.103  -18.631 1.00 0.00  ? 21  ILE A CD1    4  
ATOM   7802  H H      . ILE A 1 21  ? -20.536 17.344  -19.867 1.00 0.00  ? 21  ILE A H      4  
ATOM   7803  H HA     . ILE A 1 21  ? -19.157 18.263  -17.546 1.00 0.00  ? 21  ILE A HA     4  
ATOM   7804  H HB     . ILE A 1 21  ? -21.415 19.372  -16.699 1.00 0.00  ? 21  ILE A HB     4  
ATOM   7805  H HG12   . ILE A 1 21  ? -22.154 20.942  -18.628 1.00 0.00  ? 21  ILE A HG12   4  
ATOM   7806  H HG13   . ILE A 1 21  ? -21.465 19.716  -19.684 1.00 0.00  ? 21  ILE A HG13   4  
ATOM   7807  H HG21   . ILE A 1 21  ? -20.443 21.556  -17.098 1.00 0.00  ? 21  ILE A HG21   4  
ATOM   7808  H HG22   . ILE A 1 21  ? -19.384 20.880  -18.333 1.00 0.00  ? 21  ILE A HG22   4  
ATOM   7809  H HG23   . ILE A 1 21  ? -19.193 20.396  -16.649 1.00 0.00  ? 21  ILE A HG23   4  
ATOM   7810  H HD11   . ILE A 1 21  ? -23.083 18.320  -17.894 1.00 0.00  ? 21  ILE A HD11   4  
ATOM   7811  H HD12   . ILE A 1 21  ? -23.406 18.664  -19.594 1.00 0.00  ? 21  ILE A HD12   4  
ATOM   7812  H HD13   . ILE A 1 21  ? -23.998 19.760  -18.345 1.00 0.00  ? 21  ILE A HD13   4  
ATOM   7813  N N      . PRO A 1 22  ? -20.649 16.755  -16.069 1.00 0.00  ? 22  PRO A N      4  
ATOM   7814  C CA     . PRO A 1 22  ? -21.313 15.661  -15.358 1.00 0.00  ? 22  PRO A CA     4  
ATOM   7815  C C      . PRO A 1 22  ? -22.753 16.004  -14.993 1.00 0.00  ? 22  PRO A C      4  
ATOM   7816  O O      . PRO A 1 22  ? -23.125 17.176  -14.935 1.00 0.00  ? 22  PRO A O      4  
ATOM   7817  C CB     . PRO A 1 22  ? -20.466 15.475  -14.086 1.00 0.00  ? 22  PRO A CB     4  
ATOM   7818  C CG     . PRO A 1 22  ? -19.283 16.379  -14.243 1.00 0.00  ? 22  PRO A CG     4  
ATOM   7819  C CD     . PRO A 1 22  ? -19.701 17.456  -15.201 1.00 0.00  ? 22  PRO A CD     4  
ATOM   7820  H HA     . PRO A 1 22  ? -21.300 14.748  -15.938 1.00 0.00  ? 22  PRO A HA     4  
ATOM   7821  H HB2    . PRO A 1 22  ? -21.054 15.743  -13.220 1.00 0.00  ? 22  PRO A HB2    4  
ATOM   7822  H HB3    . PRO A 1 22  ? -20.161 14.441  -14.007 1.00 0.00  ? 22  PRO A HB3    4  
ATOM   7823  H HG2    . PRO A 1 22  ? -19.024 16.809  -13.288 1.00 0.00  ? 22  PRO A HG2    4  
ATOM   7824  H HG3    . PRO A 1 22  ? -18.449 15.823  -14.644 1.00 0.00  ? 22  PRO A HG3    4  
ATOM   7825  H HD2    . PRO A 1 22  ? -20.184 18.266  -14.674 1.00 0.00  ? 22  PRO A HD2    4  
ATOM   7826  H HD3    . PRO A 1 22  ? -18.855 17.816  -15.762 1.00 0.00  ? 22  PRO A HD3    4  
ATOM   7827  N N      . LYS A 1 23  ? -23.561 14.978  -14.746 1.00 0.00  ? 23  LYS A N      4  
ATOM   7828  C CA     . LYS A 1 23  ? -24.958 15.175  -14.383 1.00 0.00  ? 23  LYS A CA     4  
ATOM   7829  C C      . LYS A 1 23  ? -25.376 14.216  -13.273 1.00 0.00  ? 23  LYS A C      4  
ATOM   7830  O O      . LYS A 1 23  ? -25.427 14.593  -12.101 1.00 0.00  ? 23  LYS A O      4  
ATOM   7831  C CB     . LYS A 1 23  ? -25.854 14.991  -15.611 1.00 0.00  ? 23  LYS A CB     4  
ATOM   7832  C CG     . LYS A 1 23  ? -25.735 16.121  -16.622 1.00 0.00  ? 23  LYS A CG     4  
ATOM   7833  C CD     . LYS A 1 23  ? -26.895 17.100  -16.504 1.00 0.00  ? 23  LYS A CD     4  
ATOM   7834  C CE     . LYS A 1 23  ? -26.650 18.133  -15.414 1.00 0.00  ? 23  LYS A CE     4  
ATOM   7835  N NZ     . LYS A 1 23  ? -27.774 18.191  -14.437 1.00 0.00  ? 23  LYS A NZ     4  
ATOM   7836  H H      . LYS A 1 23  ? -23.206 14.064  -14.806 1.00 0.00  ? 23  LYS A H      4  
ATOM   7837  H HA     . LYS A 1 23  ? -25.064 16.185  -14.024 1.00 0.00  ? 23  LYS A HA     4  
ATOM   7838  H HB2    . LYS A 1 23  ? -25.587 14.068  -16.102 1.00 0.00  ? 23  LYS A HB2    4  
ATOM   7839  H HB3    . LYS A 1 23  ? -26.883 14.932  -15.286 1.00 0.00  ? 23  LYS A HB3    4  
ATOM   7840  H HG2    . LYS A 1 23  ? -24.812 16.652  -16.446 1.00 0.00  ? 23  LYS A HG2    4  
ATOM   7841  H HG3    . LYS A 1 23  ? -25.729 15.703  -17.618 1.00 0.00  ? 23  LYS A HG3    4  
ATOM   7842  H HD2    . LYS A 1 23  ? -27.020 17.611  -17.447 1.00 0.00  ? 23  LYS A HD2    4  
ATOM   7843  H HD3    . LYS A 1 23  ? -27.794 16.549  -16.270 1.00 0.00  ? 23  LYS A HD3    4  
ATOM   7844  H HE2    . LYS A 1 23  ? -25.743 17.875  -14.888 1.00 0.00  ? 23  LYS A HE2    4  
ATOM   7845  H HE3    . LYS A 1 23  ? -26.534 19.103  -15.875 1.00 0.00  ? 23  LYS A HE3    4  
ATOM   7846  H HZ1    . LYS A 1 23  ? -27.402 18.180  -13.465 1.00 0.00  ? 23  LYS A HZ1    4  
ATOM   7847  H HZ2    . LYS A 1 23  ? -28.403 17.374  -14.563 1.00 0.00  ? 23  LYS A HZ2    4  
ATOM   7848  H HZ3    . LYS A 1 23  ? -28.324 19.065  -14.576 1.00 0.00  ? 23  LYS A HZ3    4  
ATOM   7849  N N      . VAL A 1 24  ? -25.669 12.975  -13.645 1.00 0.00  ? 24  VAL A N      4  
ATOM   7850  C CA     . VAL A 1 24  ? -26.076 11.962  -12.678 1.00 0.00  ? 24  VAL A CA     4  
ATOM   7851  C C      . VAL A 1 24  ? -24.892 11.105  -12.239 1.00 0.00  ? 24  VAL A C      4  
ATOM   7852  O O      . VAL A 1 24  ? -25.002 10.314  -11.304 1.00 0.00  ? 24  VAL A O      4  
ATOM   7853  C CB     . VAL A 1 24  ? -27.172 11.046  -13.251 1.00 0.00  ? 24  VAL A CB     4  
ATOM   7854  C CG1    . VAL A 1 24  ? -27.722 10.126  -12.171 1.00 0.00  ? 24  VAL A CG1    4  
ATOM   7855  C CG2    . VAL A 1 24  ? -28.287 11.871  -13.877 1.00 0.00  ? 24  VAL A CG2    4  
ATOM   7856  H H      . VAL A 1 24  ? -25.607 12.730  -14.592 1.00 0.00  ? 24  VAL A H      4  
ATOM   7857  H HA     . VAL A 1 24  ? -26.477 12.472  -11.814 1.00 0.00  ? 24  VAL A HA     4  
ATOM   7858  H HB     . VAL A 1 24  ? -26.732 10.432  -14.025 1.00 0.00  ? 24  VAL A HB     4  
ATOM   7859  H HG11   . VAL A 1 24  ? -27.001 9.352   -11.957 1.00 0.00  ? 24  VAL A HG11   4  
ATOM   7860  H HG12   . VAL A 1 24  ? -28.641 9.677   -12.515 1.00 0.00  ? 24  VAL A HG12   4  
ATOM   7861  H HG13   . VAL A 1 24  ? -27.913 10.698  -11.275 1.00 0.00  ? 24  VAL A HG13   4  
ATOM   7862  H HG21   . VAL A 1 24  ? -29.223 11.340  -13.781 1.00 0.00  ? 24  VAL A HG21   4  
ATOM   7863  H HG22   . VAL A 1 24  ? -28.070 12.033  -14.921 1.00 0.00  ? 24  VAL A HG22   4  
ATOM   7864  H HG23   . VAL A 1 24  ? -28.356 12.823  -13.372 1.00 0.00  ? 24  VAL A HG23   4  
ATOM   7865  N N      . ASP A 1 25  ? -23.757 11.257  -12.925 1.00 0.00  ? 25  ASP A N      4  
ATOM   7866  C CA     . ASP A 1 25  ? -22.564 10.483  -12.603 1.00 0.00  ? 25  ASP A CA     4  
ATOM   7867  C C      . ASP A 1 25  ? -22.789 9.010   -12.923 1.00 0.00  ? 25  ASP A C      4  
ATOM   7868  O O      . ASP A 1 25  ? -22.283 8.127   -12.228 1.00 0.00  ? 25  ASP A O      4  
ATOM   7869  C CB     . ASP A 1 25  ? -22.192 10.652  -11.127 1.00 0.00  ? 25  ASP A CB     4  
ATOM   7870  C CG     . ASP A 1 25  ? -20.718 10.412  -10.870 1.00 0.00  ? 25  ASP A CG     4  
ATOM   7871  O OD1    . ASP A 1 25  ? -20.307 9.234   -10.824 1.00 0.00  ? 25  ASP A OD1    4  
ATOM   7872  O OD2    . ASP A 1 25  ? -19.973 11.403  -10.714 1.00 0.00  ? 25  ASP A OD2    4  
ATOM   7873  H H      . ASP A 1 25  ? -23.726 11.896  -13.668 1.00 0.00  ? 25  ASP A H      4  
ATOM   7874  H HA     . ASP A 1 25  ? -21.754 10.852  -13.216 1.00 0.00  ? 25  ASP A HA     4  
ATOM   7875  H HB2    . ASP A 1 25  ? -22.433 11.658  -10.813 1.00 0.00  ? 25  ASP A HB2    4  
ATOM   7876  H HB3    . ASP A 1 25  ? -22.761 9.949   -10.537 1.00 0.00  ? 25  ASP A HB3    4  
ATOM   7877  H HD2    . ASP A 1 25  ? -19.053 11.178  -10.555 1.00 0.00  ? 25  ASP A HD2    4  
ATOM   7878  N N      . ASN A 1 26  ? -23.561 8.757   -13.973 1.00 0.00  ? 26  ASN A N      4  
ATOM   7879  C CA     . ASN A 1 26  ? -23.873 7.394   -14.389 1.00 0.00  ? 26  ASN A CA     4  
ATOM   7880  C C      . ASN A 1 26  ? -22.867 6.879   -15.417 1.00 0.00  ? 26  ASN A C      4  
ATOM   7881  O O      . ASN A 1 26  ? -22.044 6.014   -15.116 1.00 0.00  ? 26  ASN A O      4  
ATOM   7882  C CB     . ASN A 1 26  ? -25.298 7.322   -14.951 1.00 0.00  ? 26  ASN A CB     4  
ATOM   7883  C CG     . ASN A 1 26  ? -25.617 8.460   -15.905 1.00 0.00  ? 26  ASN A CG     4  
ATOM   7884  O OD1    . ASN A 1 26  ? -25.365 9.626   -15.603 1.00 0.00  ? 26  ASN A OD1    4  
ATOM   7885  N ND2    . ASN A 1 26  ? -26.173 8.123   -17.063 1.00 0.00  ? 26  ASN A ND2    4  
ATOM   7886  H H      . ASN A 1 26  ? -23.939 9.507   -14.478 1.00 0.00  ? 26  ASN A H      4  
ATOM   7887  H HA     . ASN A 1 26  ? -23.815 6.766   -13.515 1.00 0.00  ? 26  ASN A HA     4  
ATOM   7888  H HB2    . ASN A 1 26  ? -25.423 6.390   -15.481 1.00 0.00  ? 26  ASN A HB2    4  
ATOM   7889  H HB3    . ASN A 1 26  ? -26.000 7.361   -14.131 1.00 0.00  ? 26  ASN A HB3    4  
ATOM   7890  H HD21   . ASN A 1 26  ? -26.344 7.174   -17.235 1.00 0.00  ? 26  ASN A HD21   4  
ATOM   7891  H HD22   . ASN A 1 26  ? -26.389 8.839   -17.698 1.00 0.00  ? 26  ASN A HD22   4  
ATOM   7892  N N      . ASN A 1 27  ? -22.937 7.418   -16.626 1.00 0.00  ? 27  ASN A N      4  
ATOM   7893  C CA     . ASN A 1 27  ? -22.035 7.019   -17.700 1.00 0.00  ? 27  ASN A CA     4  
ATOM   7894  C C      . ASN A 1 27  ? -21.356 8.243   -18.301 1.00 0.00  ? 27  ASN A C      4  
ATOM   7895  O O      . ASN A 1 27  ? -21.080 8.289   -19.500 1.00 0.00  ? 27  ASN A O      4  
ATOM   7896  C CB     . ASN A 1 27  ? -22.805 6.259   -18.784 1.00 0.00  ? 27  ASN A CB     4  
ATOM   7897  C CG     . ASN A 1 27  ? -22.486 4.776   -18.789 1.00 0.00  ? 27  ASN A CG     4  
ATOM   7898  O OD1    . ASN A 1 27  ? -21.859 4.260   -17.863 1.00 0.00  ? 27  ASN A OD1    4  
ATOM   7899  N ND2    . ASN A 1 27  ? -22.919 4.081   -19.835 1.00 0.00  ? 27  ASN A ND2    4  
ATOM   7900  H H      . ASN A 1 27  ? -23.608 8.102   -16.803 1.00 0.00  ? 27  ASN A H      4  
ATOM   7901  H HA     . ASN A 1 27  ? -21.283 6.371   -17.279 1.00 0.00  ? 27  ASN A HA     4  
ATOM   7902  H HB2    . ASN A 1 27  ? -23.863 6.378   -18.618 1.00 0.00  ? 27  ASN A HB2    4  
ATOM   7903  H HB3    . ASN A 1 27  ? -22.549 6.664   -19.753 1.00 0.00  ? 27  ASN A HB3    4  
ATOM   7904  H HD21   . ASN A 1 27  ? -23.411 4.558   -20.535 1.00 0.00  ? 27  ASN A HD21   4  
ATOM   7905  H HD22   . ASN A 1 27  ? -22.727 3.122   -19.862 1.00 0.00  ? 27  ASN A HD22   4  
ATOM   7906  N N      . ALA A 1 28  ? -21.093 9.233   -17.460 1.00 0.00  ? 28  ALA A N      4  
ATOM   7907  C CA     . ALA A 1 28  ? -20.448 10.464  -17.900 1.00 0.00  ? 28  ALA A CA     4  
ATOM   7908  C C      . ALA A 1 28  ? -19.157 10.172  -18.658 1.00 0.00  ? 28  ALA A C      4  
ATOM   7909  O O      . ALA A 1 28  ? -18.701 10.987  -19.460 1.00 0.00  ? 28  ALA A O      4  
ATOM   7910  C CB     . ALA A 1 28  ? -20.160 11.362  -16.705 1.00 0.00  ? 28  ALA A CB     4  
ATOM   7911  H H      . ALA A 1 28  ? -21.339 9.136   -16.517 1.00 0.00  ? 28  ALA A H      4  
ATOM   7912  H HA     . ALA A 1 28  ? -21.129 10.984  -18.556 1.00 0.00  ? 28  ALA A HA     4  
ATOM   7913  H HB1    . ALA A 1 28  ? -20.558 10.907  -15.810 1.00 0.00  ? 28  ALA A HB1    4  
ATOM   7914  H HB2    . ALA A 1 28  ? -20.624 12.324  -16.857 1.00 0.00  ? 28  ALA A HB2    4  
ATOM   7915  H HB3    . ALA A 1 28  ? -19.092 11.489  -16.599 1.00 0.00  ? 28  ALA A HB3    4  
ATOM   7916  N N      . ILE A 1 29  ? -18.566 9.013   -18.390 1.00 0.00  ? 29  ILE A N      4  
ATOM   7917  C CA     . ILE A 1 29  ? -17.322 8.629   -19.040 1.00 0.00  ? 29  ILE A CA     4  
ATOM   7918  C C      . ILE A 1 29  ? -17.404 7.232   -19.652 1.00 0.00  ? 29  ILE A C      4  
ATOM   7919  O O      . ILE A 1 29  ? -17.974 6.313   -19.063 1.00 0.00  ? 29  ILE A O      4  
ATOM   7920  C CB     . ILE A 1 29  ? -16.147 8.683   -18.043 1.00 0.00  ? 29  ILE A CB     4  
ATOM   7921  C CG1    . ILE A 1 29  ? -16.024 10.088  -17.448 1.00 0.00  ? 29  ILE A CG1    4  
ATOM   7922  C CG2    . ILE A 1 29  ? -14.853 8.279   -18.722 1.00 0.00  ? 29  ILE A CG2    4  
ATOM   7923  C CD1    . ILE A 1 29  ? -15.943 10.104  -15.938 1.00 0.00  ? 29  ILE A CD1    4  
ATOM   7924  H H      . ILE A 1 29  ? -18.968 8.407   -17.733 1.00 0.00  ? 29  ILE A H      4  
ATOM   7925  H HA     . ILE A 1 29  ? -17.125 9.341   -19.828 1.00 0.00  ? 29  ILE A HA     4  
ATOM   7926  H HB     . ILE A 1 29  ? -16.341 7.979   -17.250 1.00 0.00  ? 29  ILE A HB     4  
ATOM   7927  H HG12   . ILE A 1 29  ? -15.130 10.559  -17.831 1.00 0.00  ? 29  ILE A HG12   4  
ATOM   7928  H HG13   . ILE A 1 29  ? -16.884 10.674  -17.741 1.00 0.00  ? 29  ILE A HG13   4  
ATOM   7929  H HG21   . ILE A 1 29  ? -14.963 8.382   -19.793 1.00 0.00  ? 29  ILE A HG21   4  
ATOM   7930  H HG22   . ILE A 1 29  ? -14.625 7.252   -18.482 1.00 0.00  ? 29  ILE A HG22   4  
ATOM   7931  H HG23   . ILE A 1 29  ? -14.051 8.916   -18.381 1.00 0.00  ? 29  ILE A HG23   4  
ATOM   7932  H HD11   . ILE A 1 29  ? -16.515 9.279   -15.539 1.00 0.00  ? 29  ILE A HD11   4  
ATOM   7933  H HD12   . ILE A 1 29  ? -16.342 11.036  -15.566 1.00 0.00  ? 29  ILE A HD12   4  
ATOM   7934  H HD13   . ILE A 1 29  ? -14.911 10.008  -15.632 1.00 0.00  ? 29  ILE A HD13   4  
ATOM   7935  N N      . GLU A 1 30  ? -16.812 7.085   -20.835 1.00 0.00  ? 30  GLU A N      4  
ATOM   7936  C CA     . GLU A 1 30  ? -16.790 5.806   -21.540 1.00 0.00  ? 30  GLU A CA     4  
ATOM   7937  C C      . GLU A 1 30  ? -15.393 5.537   -22.089 1.00 0.00  ? 30  GLU A C      4  
ATOM   7938  O O      . GLU A 1 30  ? -14.820 6.376   -22.778 1.00 0.00  ? 30  GLU A O      4  
ATOM   7939  C CB     . GLU A 1 30  ? -17.806 5.801   -22.685 1.00 0.00  ? 30  GLU A CB     4  
ATOM   7940  C CG     . GLU A 1 30  ? -19.247 5.651   -22.222 1.00 0.00  ? 30  GLU A CG     4  
ATOM   7941  C CD     . GLU A 1 30  ? -20.069 6.903   -22.466 1.00 0.00  ? 30  GLU A CD     4  
ATOM   7942  O OE1    . GLU A 1 30  ? -19.963 7.849   -21.658 1.00 0.00  ? 30  GLU A OE1    4  
ATOM   7943  O OE2    . GLU A 1 30  ? -20.815 6.937   -23.467 1.00 0.00  ? 30  GLU A OE2    4  
ATOM   7944  H H      . GLU A 1 30  ? -16.367 7.858   -21.240 1.00 0.00  ? 30  GLU A H      4  
ATOM   7945  H HA     . GLU A 1 30  ? -17.046 5.030   -20.835 1.00 0.00  ? 30  GLU A HA     4  
ATOM   7946  H HB2    . GLU A 1 30  ? -17.720 6.728   -23.232 1.00 0.00  ? 30  GLU A HB2    4  
ATOM   7947  H HB3    . GLU A 1 30  ? -17.579 4.978   -23.349 1.00 0.00  ? 30  GLU A HB3    4  
ATOM   7948  H HG2    . GLU A 1 30  ? -19.701 4.833   -22.761 1.00 0.00  ? 30  GLU A HG2    4  
ATOM   7949  H HG3    . GLU A 1 30  ? -19.253 5.435   -21.166 1.00 0.00  ? 30  GLU A HG3    4  
ATOM   7950  H HE2    . GLU A 1 30  ? -21.304 7.758   -23.560 1.00 0.00  ? 30  GLU A HE2    4  
ATOM   7951  N N      . PHE A 1 31  ? -14.845 4.370   -21.766 1.00 0.00  ? 31  PHE A N      4  
ATOM   7952  C CA     . PHE A 1 31  ? -13.507 4.009   -22.211 1.00 0.00  ? 31  PHE A CA     4  
ATOM   7953  C C      . PHE A 1 31  ? -13.518 3.293   -23.559 1.00 0.00  ? 31  PHE A C      4  
ATOM   7954  O O      . PHE A 1 31  ? -14.473 2.592   -23.896 1.00 0.00  ? 31  PHE A O      4  
ATOM   7955  C CB     . PHE A 1 31  ? -12.826 3.120   -21.166 1.00 0.00  ? 31  PHE A CB     4  
ATOM   7956  C CG     . PHE A 1 31  ? -12.857 3.690   -19.775 1.00 0.00  ? 31  PHE A CG     4  
ATOM   7957  C CD1    . PHE A 1 31  ? -12.046 4.759   -19.439 1.00 0.00  ? 31  PHE A CD1    4  
ATOM   7958  C CD2    . PHE A 1 31  ? -13.699 3.163   -18.807 1.00 0.00  ? 31  PHE A CD2    4  
ATOM   7959  C CE1    . PHE A 1 31  ? -12.072 5.296   -18.166 1.00 0.00  ? 31  PHE A CE1    4  
ATOM   7960  C CE2    . PHE A 1 31  ? -13.728 3.693   -17.530 1.00 0.00  ? 31  PHE A CE2    4  
ATOM   7961  C CZ     . PHE A 1 31  ? -12.912 4.762   -17.210 1.00 0.00  ? 31  PHE A CZ     4  
ATOM   7962  H H      . PHE A 1 31  ? -15.350 3.744   -21.202 1.00 0.00  ? 31  PHE A H      4  
ATOM   7963  H HA     . PHE A 1 31  ? -12.942 4.920   -22.310 1.00 0.00  ? 31  PHE A HA     4  
ATOM   7964  H HB2    . PHE A 1 31  ? -13.320 2.161   -21.143 1.00 0.00  ? 31  PHE A HB2    4  
ATOM   7965  H HB3    . PHE A 1 31  ? -11.792 2.980   -21.444 1.00 0.00  ? 31  PHE A HB3    4  
ATOM   7966  H HD1    . PHE A 1 31  ? -11.386 5.176   -20.185 1.00 0.00  ? 31  PHE A HD1    4  
ATOM   7967  H HD2    . PHE A 1 31  ? -14.336 2.327   -19.057 1.00 0.00  ? 31  PHE A HD2    4  
ATOM   7968  H HE1    . PHE A 1 31  ? -11.434 6.132   -17.918 1.00 0.00  ? 31  PHE A HE1    4  
ATOM   7969  H HE2    . PHE A 1 31  ? -14.384 3.272   -16.782 1.00 0.00  ? 31  PHE A HE2    4  
ATOM   7970  H HZ     . PHE A 1 31  ? -12.934 5.181   -16.217 1.00 0.00  ? 31  PHE A HZ     4  
ATOM   7971  N N      . LEU A 1 32  ? -12.432 3.462   -24.317 1.00 0.00  ? 32  LEU A N      4  
ATOM   7972  C CA     . LEU A 1 32  ? -12.293 2.819   -25.620 1.00 0.00  ? 32  LEU A CA     4  
ATOM   7973  C C      . LEU A 1 32  ? -11.725 1.416   -25.447 1.00 0.00  ? 32  LEU A C      4  
ATOM   7974  O O      . LEU A 1 32  ? -10.816 1.200   -24.647 1.00 0.00  ? 32  LEU A O      4  
ATOM   7975  C CB     . LEU A 1 32  ? -11.374 3.633   -26.548 1.00 0.00  ? 32  LEU A CB     4  
ATOM   7976  C CG     . LEU A 1 32  ? -11.000 2.937   -27.864 1.00 0.00  ? 32  LEU A CG     4  
ATOM   7977  C CD1    . LEU A 1 32  ? -12.223 2.770   -28.755 1.00 0.00  ? 32  LEU A CD1    4  
ATOM   7978  C CD2    . LEU A 1 32  ? -9.917  3.713   -28.593 1.00 0.00  ? 32  LEU A CD2    4  
ATOM   7979  H H      . LEU A 1 32  ? -11.700 4.019   -23.980 1.00 0.00  ? 32  LEU A H      4  
ATOM   7980  H HA     . LEU A 1 32  ? -13.275 2.748   -26.065 1.00 0.00  ? 32  LEU A HA     4  
ATOM   7981  H HB2    . LEU A 1 32  ? -11.858 4.569   -26.782 1.00 0.00  ? 32  LEU A HB2    4  
ATOM   7982  H HB3    . LEU A 1 32  ? -10.464 3.849   -26.015 1.00 0.00  ? 32  LEU A HB3    4  
ATOM   7983  H HG     . LEU A 1 32  ? -10.614 1.951   -27.644 1.00 0.00  ? 32  LEU A HG     4  
ATOM   7984  H HD11   . LEU A 1 32  ? -11.961 2.172   -29.617 1.00 0.00  ? 32  LEU A HD11   4  
ATOM   7985  H HD12   . LEU A 1 32  ? -12.567 3.740   -29.081 1.00 0.00  ? 32  LEU A HD12   4  
ATOM   7986  H HD13   . LEU A 1 32  ? -13.008 2.277   -28.203 1.00 0.00  ? 32  LEU A HD13   4  
ATOM   7987  H HD21   . LEU A 1 32  ? -9.843  3.364   -29.612 1.00 0.00  ? 32  LEU A HD21   4  
ATOM   7988  H HD22   . LEU A 1 32  ? -8.969  3.565   -28.093 1.00 0.00  ? 32  LEU A HD22   4  
ATOM   7989  H HD23   . LEU A 1 32  ? -10.163 4.766   -28.590 1.00 0.00  ? 32  LEU A HD23   4  
ATOM   7990  N N      . LEU A 1 33  ? -12.263 0.465   -26.196 1.00 0.00  ? 33  LEU A N      4  
ATOM   7991  C CA     . LEU A 1 33  ? -11.799 -0.912  -26.115 1.00 0.00  ? 33  LEU A CA     4  
ATOM   7992  C C      . LEU A 1 33  ? -11.720 -1.537  -27.501 1.00 0.00  ? 33  LEU A C      4  
ATOM   7993  O O      . LEU A 1 33  ? -12.650 -1.420  -28.300 1.00 0.00  ? 33  LEU A O      4  
ATOM   7994  C CB     . LEU A 1 33  ? -12.729 -1.725  -25.215 1.00 0.00  ? 33  LEU A CB     4  
ATOM   7995  C CG     . LEU A 1 33  ? -12.340 -1.742  -23.737 1.00 0.00  ? 33  LEU A CG     4  
ATOM   7996  C CD1    . LEU A 1 33  ? -13.514 -2.189  -22.885 1.00 0.00  ? 33  LEU A CD1    4  
ATOM   7997  C CD2    . LEU A 1 33  ? -11.137 -2.648  -23.512 1.00 0.00  ? 33  LEU A CD2    4  
ATOM   7998  H H      . LEU A 1 33  ? -12.986 0.693   -26.819 1.00 0.00  ? 33  LEU A H      4  
ATOM   7999  H HA     . LEU A 1 33  ? -10.811 -0.903  -25.680 1.00 0.00  ? 33  LEU A HA     4  
ATOM   8000  H HB2    . LEU A 1 33  ? -13.725 -1.315  -25.298 1.00 0.00  ? 33  LEU A HB2    4  
ATOM   8001  H HB3    . LEU A 1 33  ? -12.749 -2.743  -25.574 1.00 0.00  ? 33  LEU A HB3    4  
ATOM   8002  H HG     . LEU A 1 33  ? -12.070 -0.742  -23.432 1.00 0.00  ? 33  LEU A HG     4  
ATOM   8003  H HD11   . LEU A 1 33  ? -14.173 -2.807  -23.475 1.00 0.00  ? 33  LEU A HD11   4  
ATOM   8004  H HD12   . LEU A 1 33  ? -14.053 -1.321  -22.533 1.00 0.00  ? 33  LEU A HD12   4  
ATOM   8005  H HD13   . LEU A 1 33  ? -13.151 -2.754  -22.039 1.00 0.00  ? 33  LEU A HD13   4  
ATOM   8006  H HD21   . LEU A 1 33  ? -10.795 -2.542  -22.493 1.00 0.00  ? 33  LEU A HD21   4  
ATOM   8007  H HD22   . LEU A 1 33  ? -10.344 -2.366  -24.190 1.00 0.00  ? 33  LEU A HD22   4  
ATOM   8008  H HD23   . LEU A 1 33  ? -11.419 -3.673  -23.693 1.00 0.00  ? 33  LEU A HD23   4  
ATOM   8009  N N      . LEU A 1 34  ? -10.603 -2.196  -27.784 1.00 0.00  ? 34  LEU A N      4  
ATOM   8010  C CA     . LEU A 1 34  ? -10.399 -2.833  -29.076 1.00 0.00  ? 34  LEU A CA     4  
ATOM   8011  C C      . LEU A 1 34  ? -10.456 -4.348  -28.950 1.00 0.00  ? 34  LEU A C      4  
ATOM   8012  O O      . LEU A 1 34  ? -9.487  -4.986  -28.540 1.00 0.00  ? 34  LEU A O      4  
ATOM   8013  C CB     . LEU A 1 34  ? -9.058  -2.401  -29.667 1.00 0.00  ? 34  LEU A CB     4  
ATOM   8014  C CG     . LEU A 1 34  ? -8.767  -0.904  -29.561 1.00 0.00  ? 34  LEU A CG     4  
ATOM   8015  C CD1    . LEU A 1 34  ? -7.336  -0.598  -29.978 1.00 0.00  ? 34  LEU A CD1    4  
ATOM   8016  C CD2    . LEU A 1 34  ? -9.757  -0.111  -30.403 1.00 0.00  ? 34  LEU A CD2    4  
ATOM   8017  H H      . LEU A 1 34  ? -9.897  -2.251  -27.107 1.00 0.00  ? 34  LEU A H      4  
ATOM   8018  H HA     . LEU A 1 34  ? -11.192 -2.510  -29.734 1.00 0.00  ? 34  LEU A HA     4  
ATOM   8019  H HB2    . LEU A 1 34  ? -8.273  -2.941  -29.157 1.00 0.00  ? 34  LEU A HB2    4  
ATOM   8020  H HB3    . LEU A 1 34  ? -9.042  -2.676  -30.710 1.00 0.00  ? 34  LEU A HB3    4  
ATOM   8021  H HG     . LEU A 1 34  ? -8.885  -0.595  -28.531 1.00 0.00  ? 34  LEU A HG     4  
ATOM   8022  H HD11   . LEU A 1 34  ? -6.815  -1.521  -30.186 1.00 0.00  ? 34  LEU A HD11   4  
ATOM   8023  H HD12   . LEU A 1 34  ? -6.833  -0.075  -29.180 1.00 0.00  ? 34  LEU A HD12   4  
ATOM   8024  H HD13   . LEU A 1 34  ? -7.344  0.019   -30.865 1.00 0.00  ? 34  LEU A HD13   4  
ATOM   8025  H HD21   . LEU A 1 34  ? -9.225  0.623   -30.990 1.00 0.00  ? 34  LEU A HD21   4  
ATOM   8026  H HD22   . LEU A 1 34  ? -10.462 0.389   -29.754 1.00 0.00  ? 34  LEU A HD22   4  
ATOM   8027  H HD23   . LEU A 1 34  ? -10.288 -0.783  -31.060 1.00 0.00  ? 34  LEU A HD23   4  
ATOM   8028  N N      . GLN A 1 35  ? -11.603 -4.914  -29.307 1.00 0.00  ? 35  GLN A N      4  
ATOM   8029  C CA     . GLN A 1 35  ? -11.805 -6.356  -29.236 1.00 0.00  ? 35  GLN A CA     4  
ATOM   8030  C C      . GLN A 1 35  ? -10.731 -7.101  -30.018 1.00 0.00  ? 35  GLN A C      4  
ATOM   8031  O O      . GLN A 1 35  ? -10.423 -6.754  -31.157 1.00 0.00  ? 35  GLN A O      4  
ATOM   8032  C CB     . GLN A 1 35  ? -13.180 -6.727  -29.789 1.00 0.00  ? 35  GLN A CB     4  
ATOM   8033  C CG     . GLN A 1 35  ? -13.528 -8.193  -29.597 1.00 0.00  ? 35  GLN A CG     4  
ATOM   8034  C CD     . GLN A 1 35  ? -14.701 -8.632  -30.452 1.00 0.00  ? 35  GLN A CD     4  
ATOM   8035  O OE1    . GLN A 1 35  ? -15.116 -7.922  -31.368 1.00 0.00  ? 35  GLN A OE1    4  
ATOM   8036  N NE2    . GLN A 1 35  ? -15.241 -9.808  -30.154 1.00 0.00  ? 35  GLN A NE2    4  
ATOM   8037  H H      . GLN A 1 35  ? -12.336 -4.347  -29.624 1.00 0.00  ? 35  GLN A H      4  
ATOM   8038  H HA     . GLN A 1 35  ? -11.752 -6.649  -28.199 1.00 0.00  ? 35  GLN A HA     4  
ATOM   8039  H HB2    . GLN A 1 35  ? -13.930 -6.129  -29.294 1.00 0.00  ? 35  GLN A HB2    4  
ATOM   8040  H HB3    . GLN A 1 35  ? -13.202 -6.512  -30.846 1.00 0.00  ? 35  GLN A HB3    4  
ATOM   8041  H HG2    . GLN A 1 35  ? -12.670 -8.790  -29.861 1.00 0.00  ? 35  GLN A HG2    4  
ATOM   8042  H HG3    . GLN A 1 35  ? -13.777 -8.359  -28.558 1.00 0.00  ? 35  GLN A HG3    4  
ATOM   8043  H HE21   . GLN A 1 35  ? -14.857 -10.320 -29.412 1.00 0.00  ? 35  GLN A HE21   4  
ATOM   8044  H HE22   . GLN A 1 35  ? -16.001 -10.117 -30.691 1.00 0.00  ? 35  GLN A HE22   4  
ATOM   8045  N N      . ALA A 1 36  ? -10.178 -8.142  -29.406 1.00 0.00  ? 36  ALA A N      4  
ATOM   8046  C CA     . ALA A 1 36  ? -9.157  -8.943  -30.061 1.00 0.00  ? 36  ALA A CA     4  
ATOM   8047  C C      . ALA A 1 36  ? -9.733  -9.597  -31.312 1.00 0.00  ? 36  ALA A C      4  
ATOM   8048  O O      . ALA A 1 36  ? -10.853 -10.103 -31.295 1.00 0.00  ? 36  ALA A O      4  
ATOM   8049  C CB     . ALA A 1 36  ? -8.615  -9.996  -29.105 1.00 0.00  ? 36  ALA A CB     4  
ATOM   8050  H H      . ALA A 1 36  ? -10.472 -8.382  -28.504 1.00 0.00  ? 36  ALA A H      4  
ATOM   8051  H HA     . ALA A 1 36  ? -8.345  -8.288  -30.345 1.00 0.00  ? 36  ALA A HA     4  
ATOM   8052  H HB1    . ALA A 1 36  ? -9.319  -10.813 -29.033 1.00 0.00  ? 36  ALA A HB1    4  
ATOM   8053  H HB2    . ALA A 1 36  ? -8.473  -9.557  -28.129 1.00 0.00  ? 36  ALA A HB2    4  
ATOM   8054  H HB3    . ALA A 1 36  ? -7.670  -10.367 -29.475 1.00 0.00  ? 36  ALA A HB3    4  
ATOM   8055  N N      . SER A 1 37  ? -8.968  -9.582  -32.397 1.00 0.00  ? 37  SER A N      4  
ATOM   8056  C CA     . SER A 1 37  ? -9.418  -10.172 -33.654 1.00 0.00  ? 37  SER A CA     4  
ATOM   8057  C C      . SER A 1 37  ? -9.463  -11.698 -33.576 1.00 0.00  ? 37  SER A C      4  
ATOM   8058  O O      . SER A 1 37  ? -9.817  -12.363 -34.549 1.00 0.00  ? 37  SER A O      4  
ATOM   8059  C CB     . SER A 1 37  ? -8.497  -9.739  -34.799 1.00 0.00  ? 37  SER A CB     4  
ATOM   8060  O OG     . SER A 1 37  ? -7.131  -9.968  -34.480 1.00 0.00  ? 37  SER A OG     4  
ATOM   8061  H H      . SER A 1 37  ? -8.083  -9.160  -32.354 1.00 0.00  ? 37  SER A H      4  
ATOM   8062  H HA     . SER A 1 37  ? -10.416 -9.806  -33.851 1.00 0.00  ? 37  SER A HA     4  
ATOM   8063  H HB2    . SER A 1 37  ? -8.742  -10.302 -35.688 1.00 0.00  ? 37  SER A HB2    4  
ATOM   8064  H HB3    . SER A 1 37  ? -8.638  -8.686  -34.990 1.00 0.00  ? 37  SER A HB3    4  
ATOM   8065  H HG     . SER A 1 37  ? -7.056  -10.305 -33.585 1.00 0.00  ? 37  SER A HG     4  
ATOM   8066  N N      . ASP A 1 38  ? -9.113  -12.249 -32.416 1.00 0.00  ? 38  ASP A N      4  
ATOM   8067  C CA     . ASP A 1 38  ? -9.125  -13.693 -32.225 1.00 0.00  ? 38  ASP A CA     4  
ATOM   8068  C C      . ASP A 1 38  ? -8.845  -14.046 -30.767 1.00 0.00  ? 38  ASP A C      4  
ATOM   8069  O O      . ASP A 1 38  ? -8.915  -13.189 -29.887 1.00 0.00  ? 38  ASP A O      4  
ATOM   8070  C CB     . ASP A 1 38  ? -8.090  -14.353 -33.138 1.00 0.00  ? 38  ASP A CB     4  
ATOM   8071  C CG     . ASP A 1 38  ? -8.714  -15.354 -34.091 1.00 0.00  ? 38  ASP A CG     4  
ATOM   8072  O OD1    . ASP A 1 38  ? -9.196  -16.405 -33.618 1.00 0.00  ? 38  ASP A OD1    4  
ATOM   8073  O OD2    . ASP A 1 38  ? -8.720  -15.088 -35.310 1.00 0.00  ? 38  ASP A OD2    4  
ATOM   8074  H H      . ASP A 1 38  ? -8.841  -11.676 -31.673 1.00 0.00  ? 38  ASP A H      4  
ATOM   8075  H HA     . ASP A 1 38  ? -10.107 -14.053 -32.488 1.00 0.00  ? 38  ASP A HA     4  
ATOM   8076  H HB2    . ASP A 1 38  ? -7.595  -13.592 -33.721 1.00 0.00  ? 38  ASP A HB2    4  
ATOM   8077  H HB3    . ASP A 1 38  ? -7.359  -14.868 -32.533 1.00 0.00  ? 38  ASP A HB3    4  
ATOM   8078  H HD2    . ASP A 1 38  ? -9.130  -15.764 -35.856 1.00 0.00  ? 38  ASP A HD2    4  
ATOM   8079  N N      . GLY A 1 39  ? -8.528  -15.311 -30.517 1.00 0.00  ? 39  GLY A N      4  
ATOM   8080  C CA     . GLY A 1 39  ? -8.244  -15.751 -29.164 1.00 0.00  ? 39  GLY A CA     4  
ATOM   8081  C C      . GLY A 1 39  ? -9.500  -15.935 -28.337 1.00 0.00  ? 39  GLY A C      4  
ATOM   8082  O O      . GLY A 1 39  ? -10.416 -16.655 -28.736 1.00 0.00  ? 39  GLY A O      4  
ATOM   8083  H H      . GLY A 1 39  ? -8.486  -15.953 -31.258 1.00 0.00  ? 39  GLY A H      4  
ATOM   8084  H HA2    . GLY A 1 39  ? -7.712  -16.690 -29.204 1.00 0.00  ? 39  GLY A HA2    4  
ATOM   8085  H HA3    . GLY A 1 39  ? -7.618  -15.014 -28.684 1.00 0.00  ? 39  GLY A HA3    4  
ATOM   8086  N N      . ILE A 1 40  ? -9.544  -15.284 -27.177 1.00 0.00  ? 40  ILE A N      4  
ATOM   8087  C CA     . ILE A 1 40  ? -10.697 -15.382 -26.288 1.00 0.00  ? 40  ILE A CA     4  
ATOM   8088  C C      . ILE A 1 40  ? -11.684 -14.238 -26.526 1.00 0.00  ? 40  ILE A C      4  
ATOM   8089  O O      . ILE A 1 40  ? -12.628 -14.056 -25.758 1.00 0.00  ? 40  ILE A O      4  
ATOM   8090  C CB     . ILE A 1 40  ? -10.261 -15.392 -24.795 1.00 0.00  ? 40  ILE A CB     4  
ATOM   8091  C CG1    . ILE A 1 40  ? -10.083 -13.972 -24.240 1.00 0.00  ? 40  ILE A CG1    4  
ATOM   8092  C CG2    . ILE A 1 40  ? -8.966  -16.173 -24.628 1.00 0.00  ? 40  ILE A CG2    4  
ATOM   8093  C CD1    . ILE A 1 40  ? -10.658 -13.795 -22.852 1.00 0.00  ? 40  ILE A CD1    4  
ATOM   8094  H H      . ILE A 1 40  ? -8.783  -14.727 -26.914 1.00 0.00  ? 40  ILE A H      4  
ATOM   8095  H HA     . ILE A 1 40  ? -11.197 -16.317 -26.498 1.00 0.00  ? 40  ILE A HA     4  
ATOM   8096  H HB     . ILE A 1 40  ? -11.030 -15.897 -24.228 1.00 0.00  ? 40  ILE A HB     4  
ATOM   8097  H HG12   . ILE A 1 40  ? -9.029  -13.742 -24.190 1.00 0.00  ? 40  ILE A HG12   4  
ATOM   8098  H HG13   . ILE A 1 40  ? -10.568 -13.263 -24.892 1.00 0.00  ? 40  ILE A HG13   4  
ATOM   8099  H HG21   . ILE A 1 40  ? -8.830  -16.833 -25.470 1.00 0.00  ? 40  ILE A HG21   4  
ATOM   8100  H HG22   . ILE A 1 40  ? -9.011  -16.752 -23.717 1.00 0.00  ? 40  ILE A HG22   4  
ATOM   8101  H HG23   . ILE A 1 40  ? -8.135  -15.480 -24.573 1.00 0.00  ? 40  ILE A HG23   4  
ATOM   8102  H HD11   . ILE A 1 40  ? -10.055 -13.091 -22.299 1.00 0.00  ? 40  ILE A HD11   4  
ATOM   8103  H HD12   . ILE A 1 40  ? -10.664 -14.745 -22.339 1.00 0.00  ? 40  ILE A HD12   4  
ATOM   8104  H HD13   . ILE A 1 40  ? -11.670 -13.421 -22.926 1.00 0.00  ? 40  ILE A HD13   4  
ATOM   8105  N N      . HIS A 1 41  ? -11.447 -13.457 -27.576 1.00 0.00  ? 41  HIS A N      4  
ATOM   8106  C CA     . HIS A 1 41  ? -12.306 -12.321 -27.879 1.00 0.00  ? 41  HIS A CA     4  
ATOM   8107  C C      . HIS A 1 41  ? -12.260 -11.327 -26.727 1.00 0.00  ? 41  HIS A C      4  
ATOM   8108  O O      . HIS A 1 41  ? -13.283 -10.788 -26.305 1.00 0.00  ? 41  HIS A O      4  
ATOM   8109  C CB     . HIS A 1 41  ? -13.743 -12.782 -28.135 1.00 0.00  ? 41  HIS A CB     4  
ATOM   8110  C CG     . HIS A 1 41  ? -14.023 -13.046 -29.581 1.00 0.00  ? 41  HIS A CG     4  
ATOM   8111  N ND1    . HIS A 1 41  ? -13.025 -13.216 -30.517 1.00 0.00  ? 41  HIS A ND1    4  
ATOM   8112  C CD2    . HIS A 1 41  ? -15.192 -13.167 -30.253 1.00 0.00  ? 41  HIS A CD2    4  
ATOM   8113  C CE1    . HIS A 1 41  ? -13.568 -13.429 -31.702 1.00 0.00  ? 41  HIS A CE1    4  
ATOM   8114  N NE2    . HIS A 1 41  ? -14.881 -13.404 -31.570 1.00 0.00  ? 41  HIS A NE2    4  
ATOM   8115  H H      . HIS A 1 41  ? -10.672 -13.633 -28.147 1.00 0.00  ? 41  HIS A H      4  
ATOM   8116  H HA     . HIS A 1 41  ? -11.923 -11.844 -28.769 1.00 0.00  ? 41  HIS A HA     4  
ATOM   8117  H HB2    . HIS A 1 41  ? -13.924 -13.697 -27.587 1.00 0.00  ? 41  HIS A HB2    4  
ATOM   8118  H HB3    . HIS A 1 41  ? -14.427 -12.019 -27.794 1.00 0.00  ? 41  HIS A HB3    4  
ATOM   8119  H HD1    . HIS A 1 41  ? -12.063 -13.183 -30.339 1.00 0.00  ? 41  HIS A HD1    4  
ATOM   8120  H HD2    . HIS A 1 41  ? -16.186 -13.090 -29.832 1.00 0.00  ? 41  HIS A HD2    4  
ATOM   8121  H HE1    . HIS A 1 41  ? -13.027 -13.597 -32.624 1.00 0.00  ? 41  HIS A HE1    4  
ATOM   8122  H HE2    . HIS A 1 41  ? -15.525 -13.440 -32.309 1.00 0.00  ? 41  HIS A HE2    4  
ATOM   8123  N N      . HIS A 1 42  ? -11.051 -11.102 -26.220 1.00 0.00  ? 42  HIS A N      4  
ATOM   8124  C CA     . HIS A 1 42  ? -10.838 -10.185 -25.109 1.00 0.00  ? 42  HIS A CA     4  
ATOM   8125  C C      . HIS A 1 42  ? -10.544 -8.779  -25.617 1.00 0.00  ? 42  HIS A C      4  
ATOM   8126  O O      . HIS A 1 42  ? -9.880  -8.601  -26.637 1.00 0.00  ? 42  HIS A O      4  
ATOM   8127  C CB     . HIS A 1 42  ? -9.694  -10.681 -24.212 1.00 0.00  ? 42  HIS A CB     4  
ATOM   8128  C CG     . HIS A 1 42  ? -8.426  -11.011 -24.945 1.00 0.00  ? 42  HIS A CG     4  
ATOM   8129  N ND1    . HIS A 1 42  ? -8.295  -12.094 -25.793 1.00 0.00  ? 42  HIS A ND1    4  
ATOM   8130  C CD2    . HIS A 1 42  ? -7.219  -10.397 -24.937 1.00 0.00  ? 42  HIS A CD2    4  
ATOM   8131  C CE1    . HIS A 1 42  ? -7.064  -12.130 -26.271 1.00 0.00  ? 42  HIS A CE1    4  
ATOM   8132  N NE2    . HIS A 1 42  ? -6.393  -11.111 -25.769 1.00 0.00  ? 42  HIS A NE2    4  
ATOM   8133  H H      . HIS A 1 42  ? -10.285 -11.567 -26.606 1.00 0.00  ? 42  HIS A H      4  
ATOM   8134  H HA     . HIS A 1 42  ? -11.747 -10.157 -24.529 1.00 0.00  ? 42  HIS A HA     4  
ATOM   8135  H HB2    . HIS A 1 42  ? -9.464  -9.917  -23.484 1.00 0.00  ? 42  HIS A HB2    4  
ATOM   8136  H HB3    . HIS A 1 42  ? -10.020 -11.570 -23.695 1.00 0.00  ? 42  HIS A HB3    4  
ATOM   8137  H HD1    . HIS A 1 42  ? -8.995  -12.740 -26.009 1.00 0.00  ? 42  HIS A HD1    4  
ATOM   8138  H HD2    . HIS A 1 42  ? -6.952  -9.520  -24.372 1.00 0.00  ? 42  HIS A HD2    4  
ATOM   8139  H HE1    . HIS A 1 42  ? -6.675  -12.870 -26.955 1.00 0.00  ? 42  HIS A HE1    4  
ATOM   8140  H HE2    . HIS A 1 42  ? -5.436  -10.946 -25.902 1.00 0.00  ? 42  HIS A HE2    4  
ATOM   8141  N N      . TRP A 1 43  ? -11.062 -7.785  -24.906 1.00 0.00  ? 43  TRP A N      4  
ATOM   8142  C CA     . TRP A 1 43  ? -10.877 -6.394  -25.291 1.00 0.00  ? 43  TRP A CA     4  
ATOM   8143  C C      . TRP A 1 43  ? -9.798  -5.718  -24.446 1.00 0.00  ? 43  TRP A C      4  
ATOM   8144  O O      . TRP A 1 43  ? -9.833  -5.766  -23.217 1.00 0.00  ? 43  TRP A O      4  
ATOM   8145  C CB     . TRP A 1 43  ? -12.197 -5.634  -25.158 1.00 0.00  ? 43  TRP A CB     4  
ATOM   8146  C CG     . TRP A 1 43  ? -13.341 -6.302  -25.864 1.00 0.00  ? 43  TRP A CG     4  
ATOM   8147  C CD1    . TRP A 1 43  ? -13.766 -7.590  -25.706 1.00 0.00  ? 43  TRP A CD1    4  
ATOM   8148  C CD2    . TRP A 1 43  ? -14.203 -5.714  -26.843 1.00 0.00  ? 43  TRP A CD2    4  
ATOM   8149  N NE1    . TRP A 1 43  ? -14.836 -7.839  -26.529 1.00 0.00  ? 43  TRP A NE1    4  
ATOM   8150  C CE2    . TRP A 1 43  ? -15.125 -6.704  -27.238 1.00 0.00  ? 43  TRP A CE2    4  
ATOM   8151  C CE3    . TRP A 1 43  ? -14.288 -4.448  -27.426 1.00 0.00  ? 43  TRP A CE3    4  
ATOM   8152  C CZ2    . TRP A 1 43  ? -16.115 -6.464  -28.186 1.00 0.00  ? 43  TRP A CZ2    4  
ATOM   8153  C CZ3    . TRP A 1 43  ? -15.271 -4.212  -28.365 1.00 0.00  ? 43  TRP A CZ3    4  
ATOM   8154  C CH2    . TRP A 1 43  ? -16.175 -5.214  -28.737 1.00 0.00  ? 43  TRP A CH2    4  
ATOM   8155  H H      . TRP A 1 43  ? -11.592 -7.992  -24.109 1.00 0.00  ? 43  TRP A H      4  
ATOM   8156  H HA     . TRP A 1 43  ? -10.565 -6.375  -26.325 1.00 0.00  ? 43  TRP A HA     4  
ATOM   8157  H HB2    . TRP A 1 43  ? -12.455 -5.555  -24.113 1.00 0.00  ? 43  TRP A HB2    4  
ATOM   8158  H HB3    . TRP A 1 43  ? -12.078 -4.644  -25.573 1.00 0.00  ? 43  TRP A HB3    4  
ATOM   8159  H HD1    . TRP A 1 43  ? -13.317 -8.299  -25.028 1.00 0.00  ? 43  TRP A HD1    4  
ATOM   8160  H HE1    . TRP A 1 43  ? -15.315 -8.692  -26.597 1.00 0.00  ? 43  TRP A HE1    4  
ATOM   8161  H HE3    . TRP A 1 43  ? -13.601 -3.661  -27.151 1.00 0.00  ? 43  TRP A HE3    4  
ATOM   8162  H HZ2    . TRP A 1 43  ? -16.820 -7.227  -28.484 1.00 0.00  ? 43  TRP A HZ2    4  
ATOM   8163  H HZ3    . TRP A 1 43  ? -15.352 -3.240  -28.821 1.00 0.00  ? 43  TRP A HZ3    4  
ATOM   8164  H HH2    . TRP A 1 43  ? -16.927 -4.983  -29.478 1.00 0.00  ? 43  TRP A HH2    4  
ATOM   8165  N N      . THR A 1 44  ? -8.846  -5.086  -25.125 1.00 0.00  ? 44  THR A N      4  
ATOM   8166  C CA     . THR A 1 44  ? -7.753  -4.389  -24.456 1.00 0.00  ? 44  THR A CA     4  
ATOM   8167  C C      . THR A 1 44  ? -7.486  -3.048  -25.136 1.00 0.00  ? 44  THR A C      4  
ATOM   8168  O O      . THR A 1 44  ? -7.513  -2.955  -26.364 1.00 0.00  ? 44  THR A O      4  
ATOM   8169  C CB     . THR A 1 44  ? -6.482  -5.243  -24.471 1.00 0.00  ? 44  THR A CB     4  
ATOM   8170  O OG1    . THR A 1 44  ? -6.537  -6.208  -25.507 1.00 0.00  ? 44  THR A OG1    4  
ATOM   8171  C CG2    . THR A 1 44  ? -6.236  -5.978  -23.169 1.00 0.00  ? 44  THR A CG2    4  
ATOM   8172  H H      . THR A 1 44  ? -8.883  -5.083  -26.103 1.00 0.00  ? 44  THR A H      4  
ATOM   8173  H HA     . THR A 1 44  ? -8.049  -4.212  -23.433 1.00 0.00  ? 44  THR A HA     4  
ATOM   8174  H HB     . THR A 1 44  ? -5.632  -4.601  -24.652 1.00 0.00  ? 44  THR A HB     4  
ATOM   8175  H HG1    . THR A 1 44  ? -7.282  -6.796  -25.359 1.00 0.00  ? 44  THR A HG1    4  
ATOM   8176  H HG21   . THR A 1 44  ? -7.169  -6.364  -22.789 1.00 0.00  ? 44  THR A HG21   4  
ATOM   8177  H HG22   . THR A 1 44  ? -5.806  -5.297  -22.447 1.00 0.00  ? 44  THR A HG22   4  
ATOM   8178  H HG23   . THR A 1 44  ? -5.551  -6.796  -23.343 1.00 0.00  ? 44  THR A HG23   4  
ATOM   8179  N N      . PRO A 1 45  ? -7.221  -1.987  -24.356 1.00 0.00  ? 45  PRO A N      4  
ATOM   8180  C CA     . PRO A 1 45  ? -6.950  -0.660  -24.909 1.00 0.00  ? 45  PRO A CA     4  
ATOM   8181  C C      . PRO A 1 45  ? -5.778  -0.677  -25.886 1.00 0.00  ? 45  PRO A C      4  
ATOM   8182  O O      . PRO A 1 45  ? -5.003  -1.632  -25.924 1.00 0.00  ? 45  PRO A O      4  
ATOM   8183  C CB     . PRO A 1 45  ? -6.611  0.187   -23.680 1.00 0.00  ? 45  PRO A CB     4  
ATOM   8184  C CG     . PRO A 1 45  ? -7.232  -0.534  -22.535 1.00 0.00  ? 45  PRO A CG     4  
ATOM   8185  C CD     . PRO A 1 45  ? -7.160  -1.992  -22.882 1.00 0.00  ? 45  PRO A CD     4  
ATOM   8186  H HA     . PRO A 1 45  ? -7.822  -0.254  -25.403 1.00 0.00  ? 45  PRO A HA     4  
ATOM   8187  H HB2    . PRO A 1 45  ? -5.539  0.252   -23.571 1.00 0.00  ? 45  PRO A HB2    4  
ATOM   8188  H HB3    . PRO A 1 45  ? -7.027  1.176   -23.795 1.00 0.00  ? 45  PRO A HB3    4  
ATOM   8189  H HG2    . PRO A 1 45  ? -6.677  -0.335  -21.630 1.00 0.00  ? 45  PRO A HG2    4  
ATOM   8190  H HG3    . PRO A 1 45  ? -8.262  -0.226  -22.420 1.00 0.00  ? 45  PRO A HG3    4  
ATOM   8191  H HD2    . PRO A 1 45  ? -6.229  -2.417  -22.538 1.00 0.00  ? 45  PRO A HD2    4  
ATOM   8192  H HD3    . PRO A 1 45  ? -8.001  -2.525  -22.463 1.00 0.00  ? 45  PRO A HD3    4  
ATOM   8193  N N      . PRO A 1 46  ? -5.636  0.385   -26.693 1.00 0.00  ? 46  PRO A N      4  
ATOM   8194  C CA     . PRO A 1 46  ? -4.555  0.492   -27.677 1.00 0.00  ? 46  PRO A CA     4  
ATOM   8195  C C      . PRO A 1 46  ? -3.173  0.453   -27.027 1.00 0.00  ? 46  PRO A C      4  
ATOM   8196  O O      . PRO A 1 46  ? -2.567  1.494   -26.772 1.00 0.00  ? 46  PRO A O      4  
ATOM   8197  C CB     . PRO A 1 46  ? -4.793  1.852   -28.341 1.00 0.00  ? 46  PRO A CB     4  
ATOM   8198  C CG     . PRO A 1 46  ? -6.210  2.204   -28.032 1.00 0.00  ? 46  PRO A CG     4  
ATOM   8199  C CD     . PRO A 1 46  ? -6.520  1.564   -26.712 1.00 0.00  ? 46  PRO A CD     4  
ATOM   8200  H HA     . PRO A 1 46  ? -4.621  -0.289  -28.420 1.00 0.00  ? 46  PRO A HA     4  
ATOM   8201  H HB2    . PRO A 1 46  ? -4.110  2.581   -27.929 1.00 0.00  ? 46  PRO A HB2    4  
ATOM   8202  H HB3    . PRO A 1 46  ? -4.634  1.767   -29.405 1.00 0.00  ? 46  PRO A HB3    4  
ATOM   8203  H HG2    . PRO A 1 46  ? -6.312  3.278   -27.960 1.00 0.00  ? 46  PRO A HG2    4  
ATOM   8204  H HG3    . PRO A 1 46  ? -6.860  1.818   -28.801 1.00 0.00  ? 46  PRO A HG3    4  
ATOM   8205  H HD2    . PRO A 1 46  ? -6.285  2.235   -25.899 1.00 0.00  ? 46  PRO A HD2    4  
ATOM   8206  H HD3    . PRO A 1 46  ? -7.558  1.266   -26.671 1.00 0.00  ? 46  PRO A HD3    4  
ATOM   8207  N N      . LYS A 1 47  ? -2.678  -0.753  -26.763 1.00 0.00  ? 47  LYS A N      4  
ATOM   8208  C CA     . LYS A 1 47  ? -1.365  -0.919  -26.146 1.00 0.00  ? 47  LYS A CA     4  
ATOM   8209  C C      . LYS A 1 47  ? -0.311  -1.273  -27.189 1.00 0.00  ? 47  LYS A C      4  
ATOM   8210  O O      . LYS A 1 47  ? -0.626  -1.847  -28.233 1.00 0.00  ? 47  LYS A O      4  
ATOM   8211  C CB     . LYS A 1 47  ? -1.413  -1.991  -25.055 1.00 0.00  ? 47  LYS A CB     4  
ATOM   8212  C CG     . LYS A 1 47  ? -1.779  -3.374  -25.572 1.00 0.00  ? 47  LYS A CG     4  
ATOM   8213  C CD     . LYS A 1 47  ? -2.176  -4.303  -24.438 1.00 0.00  ? 47  LYS A CD     4  
ATOM   8214  C CE     . LYS A 1 47  ? -1.656  -5.715  -24.661 1.00 0.00  ? 47  LYS A CE     4  
ATOM   8215  N NZ     . LYS A 1 47  ? -0.611  -6.088  -23.668 1.00 0.00  ? 47  LYS A NZ     4  
ATOM   8216  H H      . LYS A 1 47  ? -3.205  -1.547  -26.992 1.00 0.00  ? 47  LYS A H      4  
ATOM   8217  H HA     . LYS A 1 47  ? -1.095  0.022   -25.697 1.00 0.00  ? 47  LYS A HA     4  
ATOM   8218  H HB2    . LYS A 1 47  ? -0.443  -2.051  -24.584 1.00 0.00  ? 47  LYS A HB2    4  
ATOM   8219  H HB3    . LYS A 1 47  ? -2.144  -1.700  -24.317 1.00 0.00  ? 47  LYS A HB3    4  
ATOM   8220  H HG2    . LYS A 1 47  ? -2.609  -3.285  -26.256 1.00 0.00  ? 47  LYS A HG2    4  
ATOM   8221  H HG3    . LYS A 1 47  ? -0.929  -3.792  -26.088 1.00 0.00  ? 47  LYS A HG3    4  
ATOM   8222  H HD2    . LYS A 1 47  ? -1.769  -3.924  -23.513 1.00 0.00  ? 47  LYS A HD2    4  
ATOM   8223  H HD3    . LYS A 1 47  ? -3.254  -4.335  -24.373 1.00 0.00  ? 47  LYS A HD3    4  
ATOM   8224  H HE2    . LYS A 1 47  ? -2.480  -6.405  -24.577 1.00 0.00  ? 47  LYS A HE2    4  
ATOM   8225  H HE3    . LYS A 1 47  ? -1.234  -5.778  -25.655 1.00 0.00  ? 47  LYS A HE3    4  
ATOM   8226  H HZ1    . LYS A 1 47  ? -0.202  -5.232  -23.240 1.00 0.00  ? 47  LYS A HZ1    4  
ATOM   8227  H HZ2    . LYS A 1 47  ? 0.147   -6.627  -24.131 1.00 0.00  ? 47  LYS A HZ2    4  
ATOM   8228  H HZ3    . LYS A 1 47  ? -1.028  -6.673  -22.916 1.00 0.00  ? 47  LYS A HZ3    4  
ATOM   8229  N N      . GLY A 1 48  ? 0.940   -0.920  -26.907 1.00 0.00  ? 48  GLY A N      4  
ATOM   8230  C CA     . GLY A 1 48  ? 2.018   -1.204  -27.839 1.00 0.00  ? 48  GLY A CA     4  
ATOM   8231  C C      . GLY A 1 48  ? 3.289   -1.674  -27.154 1.00 0.00  ? 48  GLY A C      4  
ATOM   8232  O O      . GLY A 1 48  ? 3.246   -2.226  -26.056 1.00 0.00  ? 48  GLY A O      4  
ATOM   8233  H H      . GLY A 1 48  ? 1.130   -0.458  -26.064 1.00 0.00  ? 48  GLY A H      4  
ATOM   8234  H HA2    . GLY A 1 48  ? 1.689   -1.969  -28.527 1.00 0.00  ? 48  GLY A HA2    4  
ATOM   8235  H HA3    . GLY A 1 48  ? 2.237   -0.306  -28.398 1.00 0.00  ? 48  GLY A HA3    4  
ATOM   8236  N N      . HIS A 1 49  ? 4.424   -1.460  -27.817 1.00 0.00  ? 49  HIS A N      4  
ATOM   8237  C CA     . HIS A 1 49  ? 5.720   -1.867  -27.282 1.00 0.00  ? 49  HIS A CA     4  
ATOM   8238  C C      . HIS A 1 49  ? 6.687   -0.683  -27.234 1.00 0.00  ? 49  HIS A C      4  
ATOM   8239  O O      . HIS A 1 49  ? 7.147   -0.208  -28.273 1.00 0.00  ? 49  HIS A O      4  
ATOM   8240  C CB     . HIS A 1 49  ? 6.313   -2.984  -28.146 1.00 0.00  ? 49  HIS A CB     4  
ATOM   8241  C CG     . HIS A 1 49  ? 6.997   -4.059  -27.362 1.00 0.00  ? 49  HIS A CG     4  
ATOM   8242  N ND1    . HIS A 1 49  ? 8.169   -3.857  -26.668 1.00 0.00  ? 49  HIS A ND1    4  
ATOM   8243  C CD2    . HIS A 1 49  ? 6.669   -5.360  -27.174 1.00 0.00  ? 49  HIS A CD2    4  
ATOM   8244  C CE1    . HIS A 1 49  ? 8.535   -4.987  -26.088 1.00 0.00  ? 49  HIS A CE1    4  
ATOM   8245  N NE2    . HIS A 1 49  ? 7.641   -5.914  -26.378 1.00 0.00  ? 49  HIS A NE2    4  
ATOM   8246  H H      . HIS A 1 49  ? 4.385   -1.019  -28.692 1.00 0.00  ? 49  HIS A H      4  
ATOM   8247  H HA     . HIS A 1 49  ? 5.569   -2.237  -26.281 1.00 0.00  ? 49  HIS A HA     4  
ATOM   8248  H HB2    . HIS A 1 49  ? 5.520   -3.443  -28.718 1.00 0.00  ? 49  HIS A HB2    4  
ATOM   8249  H HB3    . HIS A 1 49  ? 7.035   -2.557  -28.827 1.00 0.00  ? 49  HIS A HB3    4  
ATOM   8250  H HD1    . HIS A 1 49  ? 8.661   -3.011  -26.611 1.00 0.00  ? 49  HIS A HD1    4  
ATOM   8251  H HD2    . HIS A 1 49  ? 5.804   -5.867  -27.577 1.00 0.00  ? 49  HIS A HD2    4  
ATOM   8252  H HE1    . HIS A 1 49  ? 9.418   -5.127  -25.481 1.00 0.00  ? 49  HIS A HE1    4  
ATOM   8253  H HE2    . HIS A 1 49  ? 7.748   -6.871  -26.200 1.00 0.00  ? 49  HIS A HE2    4  
ATOM   8254  N N      . VAL A 1 50  ? 6.992   -0.210  -26.028 1.00 0.00  ? 50  VAL A N      4  
ATOM   8255  C CA     . VAL A 1 50  ? 7.908   0.920   -25.867 1.00 0.00  ? 50  VAL A CA     4  
ATOM   8256  C C      . VAL A 1 50  ? 9.362   0.454   -25.899 1.00 0.00  ? 50  VAL A C      4  
ATOM   8257  O O      . VAL A 1 50  ? 9.736   -0.510  -25.233 1.00 0.00  ? 50  VAL A O      4  
ATOM   8258  C CB     . VAL A 1 50  ? 7.641   1.708   -24.558 1.00 0.00  ? 50  VAL A CB     4  
ATOM   8259  C CG1    . VAL A 1 50  ? 7.346   0.773   -23.395 1.00 0.00  ? 50  VAL A CG1    4  
ATOM   8260  C CG2    . VAL A 1 50  ? 8.813   2.628   -24.228 1.00 0.00  ? 50  VAL A CG2    4  
ATOM   8261  H H      . VAL A 1 50  ? 6.598   -0.627  -25.234 1.00 0.00  ? 50  VAL A H      4  
ATOM   8262  H HA     . VAL A 1 50  ? 7.745   1.589   -26.699 1.00 0.00  ? 50  VAL A HA     4  
ATOM   8263  H HB     . VAL A 1 50  ? 6.770   2.322   -24.709 1.00 0.00  ? 50  VAL A HB     4  
ATOM   8264  H HG11   . VAL A 1 50  ? 6.319   0.908   -23.084 1.00 0.00  ? 50  VAL A HG11   4  
ATOM   8265  H HG12   . VAL A 1 50  ? 8.004   1.000   -22.571 1.00 0.00  ? 50  VAL A HG12   4  
ATOM   8266  H HG13   . VAL A 1 50  ? 7.496   -0.247  -23.705 1.00 0.00  ? 50  VAL A HG13   4  
ATOM   8267  H HG21   . VAL A 1 50  ? 9.162   3.105   -25.133 1.00 0.00  ? 50  VAL A HG21   4  
ATOM   8268  H HG22   . VAL A 1 50  ? 9.615   2.047   -23.796 1.00 0.00  ? 50  VAL A HG22   4  
ATOM   8269  H HG23   . VAL A 1 50  ? 8.493   3.381   -23.522 1.00 0.00  ? 50  VAL A HG23   4  
ATOM   8270  N N      . GLU A 1 51  ? 10.175  1.155   -26.684 1.00 0.00  ? 51  GLU A N      4  
ATOM   8271  C CA     . GLU A 1 51  ? 11.592  0.834   -26.818 1.00 0.00  ? 51  GLU A CA     4  
ATOM   8272  C C      . GLU A 1 51  ? 12.425  1.685   -25.858 1.00 0.00  ? 51  GLU A C      4  
ATOM   8273  O O      . GLU A 1 51  ? 12.031  2.790   -25.489 1.00 0.00  ? 51  GLU A O      4  
ATOM   8274  C CB     . GLU A 1 51  ? 12.024  1.033   -28.279 1.00 0.00  ? 51  GLU A CB     4  
ATOM   8275  C CG     . GLU A 1 51  ? 13.520  1.200   -28.507 1.00 0.00  ? 51  GLU A CG     4  
ATOM   8276  C CD     . GLU A 1 51  ? 13.834  2.225   -29.580 1.00 0.00  ? 51  GLU A CD     4  
ATOM   8277  O OE1    . GLU A 1 51  ? 13.016  3.148   -29.774 1.00 0.00  ? 51  GLU A OE1    4  
ATOM   8278  O OE2    . GLU A 1 51  ? 14.899  2.106   -30.222 1.00 0.00  ? 51  GLU A OE2    4  
ATOM   8279  H H      . GLU A 1 51  ? 9.813   1.914   -27.188 1.00 0.00  ? 51  GLU A H      4  
ATOM   8280  H HA     . GLU A 1 51  ? 11.718  -0.205  -26.554 1.00 0.00  ? 51  GLU A HA     4  
ATOM   8281  H HB2    . GLU A 1 51  ? 11.706  0.169   -28.842 1.00 0.00  ? 51  GLU A HB2    4  
ATOM   8282  H HB3    . GLU A 1 51  ? 11.523  1.907   -28.673 1.00 0.00  ? 51  GLU A HB3    4  
ATOM   8283  H HG2    . GLU A 1 51  ? 13.985  1.512   -27.591 1.00 0.00  ? 51  GLU A HG2    4  
ATOM   8284  H HG3    . GLU A 1 51  ? 13.932  0.248   -28.810 1.00 0.00  ? 51  GLU A HG3    4  
ATOM   8285  H HE2    . GLU A 1 51  ? 15.033  2.789   -30.882 1.00 0.00  ? 51  GLU A HE2    4  
ATOM   8286  N N      . PRO A 1 52  ? 13.587  1.166   -25.431 1.00 0.00  ? 52  PRO A N      4  
ATOM   8287  C CA     . PRO A 1 52  ? 14.477  1.864   -24.500 1.00 0.00  ? 52  PRO A CA     4  
ATOM   8288  C C      . PRO A 1 52  ? 14.756  3.307   -24.916 1.00 0.00  ? 52  PRO A C      4  
ATOM   8289  O O      . PRO A 1 52  ? 14.955  4.177   -24.068 1.00 0.00  ? 52  PRO A O      4  
ATOM   8290  C CB     . PRO A 1 52  ? 15.770  1.031   -24.517 1.00 0.00  ? 52  PRO A CB     4  
ATOM   8291  C CG     . PRO A 1 52  ? 15.597  0.013   -25.599 1.00 0.00  ? 52  PRO A CG     4  
ATOM   8292  C CD     . PRO A 1 52  ? 14.118  -0.146  -25.813 1.00 0.00  ? 52  PRO A CD     4  
ATOM   8293  H HA     . PRO A 1 52  ? 14.067  1.863   -23.502 1.00 0.00  ? 52  PRO A HA     4  
ATOM   8294  H HB2    . PRO A 1 52  ? 16.612  1.678   -24.720 1.00 0.00  ? 52  PRO A HB2    4  
ATOM   8295  H HB3    . PRO A 1 52  ? 15.904  0.559   -23.555 1.00 0.00  ? 52  PRO A HB3    4  
ATOM   8296  H HG2    . PRO A 1 52  ? 16.068  0.362   -26.507 1.00 0.00  ? 52  PRO A HG2    4  
ATOM   8297  H HG3    . PRO A 1 52  ? 16.033  -0.925  -25.290 1.00 0.00  ? 52  PRO A HG3    4  
ATOM   8298  H HD2    . PRO A 1 52  ? 13.908  -0.364  -26.847 1.00 0.00  ? 52  PRO A HD2    4  
ATOM   8299  H HD3    . PRO A 1 52  ? 13.721  -0.920  -25.182 1.00 0.00  ? 52  PRO A HD3    4  
ATOM   8300  N N      . GLY A 1 53  ? 14.762  3.558   -26.219 1.00 0.00  ? 53  GLY A N      4  
ATOM   8301  C CA     . GLY A 1 53  ? 15.007  4.899   -26.715 1.00 0.00  ? 53  GLY A CA     4  
ATOM   8302  C C      . GLY A 1 53  ? 13.720  5.659   -26.981 1.00 0.00  ? 53  GLY A C      4  
ATOM   8303  O O      . GLY A 1 53  ? 13.742  6.868   -27.216 1.00 0.00  ? 53  GLY A O      4  
ATOM   8304  H H      . GLY A 1 53  ? 14.593  2.832   -26.849 1.00 0.00  ? 53  GLY A H      4  
ATOM   8305  H HA2    . GLY A 1 53  ? 15.587  5.442   -25.984 1.00 0.00  ? 53  GLY A HA2    4  
ATOM   8306  H HA3    . GLY A 1 53  ? 15.572  4.835   -27.634 1.00 0.00  ? 53  GLY A HA3    4  
ATOM   8307  N N      . GLU A 1 54  ? 12.594  4.949   -26.943 1.00 0.00  ? 54  GLU A N      4  
ATOM   8308  C CA     . GLU A 1 54  ? 11.293  5.559   -27.177 1.00 0.00  ? 54  GLU A CA     4  
ATOM   8309  C C      . GLU A 1 54  ? 10.706  6.085   -25.874 1.00 0.00  ? 54  GLU A C      4  
ATOM   8310  O O      . GLU A 1 54  ? 11.087  5.639   -24.792 1.00 0.00  ? 54  GLU A O      4  
ATOM   8311  C CB     . GLU A 1 54  ? 10.332  4.541   -27.797 1.00 0.00  ? 54  GLU A CB     4  
ATOM   8312  C CG     . GLU A 1 54  ? 9.138   5.174   -28.492 1.00 0.00  ? 54  GLU A CG     4  
ATOM   8313  C CD     . GLU A 1 54  ? 8.312   4.168   -29.270 1.00 0.00  ? 54  GLU A CD     4  
ATOM   8314  O OE1    . GLU A 1 54  ? 7.294   3.690   -28.728 1.00 0.00  ? 54  GLU A OE1    4  
ATOM   8315  O OE2    . GLU A 1 54  ? 8.683   3.861   -30.422 1.00 0.00  ? 54  GLU A OE2    4  
ATOM   8316  H H      . GLU A 1 54  ? 12.643  3.989   -26.749 1.00 0.00  ? 54  GLU A H      4  
ATOM   8317  H HA     . GLU A 1 54  ? 11.426  6.383   -27.862 1.00 0.00  ? 54  GLU A HA     4  
ATOM   8318  H HB2    . GLU A 1 54  ? 10.869  3.947   -28.520 1.00 0.00  ? 54  GLU A HB2    4  
ATOM   8319  H HB3    . GLU A 1 54  ? 9.963   3.892   -27.018 1.00 0.00  ? 54  GLU A HB3    4  
ATOM   8320  H HG2    . GLU A 1 54  ? 8.506   5.634   -27.746 1.00 0.00  ? 54  GLU A HG2    4  
ATOM   8321  H HG3    . GLU A 1 54  ? 9.495   5.931   -29.175 1.00 0.00  ? 54  GLU A HG3    4  
ATOM   8322  H HE2    . GLU A 1 54  ? 8.114   3.221   -30.857 1.00 0.00  ? 54  GLU A HE2    4  
ATOM   8323  N N      . ASP A 1 55  ? 9.771   7.023   -25.974 1.00 0.00  ? 55  ASP A N      4  
ATOM   8324  C CA     . ASP A 1 55  ? 9.142   7.575   -24.785 1.00 0.00  ? 55  ASP A CA     4  
ATOM   8325  C C      . ASP A 1 55  ? 8.118   6.592   -24.233 1.00 0.00  ? 55  ASP A C      4  
ATOM   8326  O O      . ASP A 1 55  ? 7.662   5.693   -24.942 1.00 0.00  ? 55  ASP A O      4  
ATOM   8327  C CB     . ASP A 1 55  ? 8.471   8.912   -25.102 1.00 0.00  ? 55  ASP A CB     4  
ATOM   8328  C CG     . ASP A 1 55  ? 7.697   9.475   -23.927 1.00 0.00  ? 55  ASP A CG     4  
ATOM   8329  O OD1    . ASP A 1 55  ? 6.564   9.954   -24.138 1.00 0.00  ? 55  ASP A OD1    4  
ATOM   8330  O OD2    . ASP A 1 55  ? 8.224   9.437   -22.794 1.00 0.00  ? 55  ASP A OD2    4  
ATOM   8331  H H      . ASP A 1 55  ? 9.491   7.341   -26.861 1.00 0.00  ? 55  ASP A H      4  
ATOM   8332  H HA     . ASP A 1 55  ? 9.912   7.732   -24.043 1.00 0.00  ? 55  ASP A HA     4  
ATOM   8333  H HB2    . ASP A 1 55  ? 9.221   9.625   -25.388 1.00 0.00  ? 55  ASP A HB2    4  
ATOM   8334  H HB3    . ASP A 1 55  ? 7.794   8.769   -25.920 1.00 0.00  ? 55  ASP A HB3    4  
ATOM   8335  H HD2    . ASP A 1 55  ? 7.679   9.810   -22.098 1.00 0.00  ? 55  ASP A HD2    4  
ATOM   8336  N N      . ASP A 1 56  ? 7.766   6.761   -22.969 1.00 0.00  ? 56  ASP A N      4  
ATOM   8337  C CA     . ASP A 1 56  ? 6.800   5.880   -22.328 1.00 0.00  ? 56  ASP A CA     4  
ATOM   8338  C C      . ASP A 1 56  ? 5.380   6.169   -22.814 1.00 0.00  ? 56  ASP A C      4  
ATOM   8339  O O      . ASP A 1 56  ? 4.727   5.304   -23.401 1.00 0.00  ? 56  ASP A O      4  
ATOM   8340  C CB     . ASP A 1 56  ? 6.883   6.021   -20.808 1.00 0.00  ? 56  ASP A CB     4  
ATOM   8341  C CG     . ASP A 1 56  ? 8.237   5.607   -20.263 1.00 0.00  ? 56  ASP A CG     4  
ATOM   8342  O OD1    . ASP A 1 56  ? 8.350   4.474   -19.751 1.00 0.00  ? 56  ASP A OD1    4  
ATOM   8343  O OD2    . ASP A 1 56  ? 9.186   6.415   -20.347 1.00 0.00  ? 56  ASP A OD2    4  
ATOM   8344  H H      . ASP A 1 56  ? 8.165   7.495   -22.455 1.00 0.00  ? 56  ASP A H      4  
ATOM   8345  H HA     . ASP A 1 56  ? 7.054   4.865   -22.597 1.00 0.00  ? 56  ASP A HA     4  
ATOM   8346  H HB2    . ASP A 1 56  ? 6.707   7.049   -20.536 1.00 0.00  ? 56  ASP A HB2    4  
ATOM   8347  H HB3    . ASP A 1 56  ? 6.129   5.397   -20.354 1.00 0.00  ? 56  ASP A HB3    4  
ATOM   8348  H HD2    . ASP A 1 56  ? 10.011  6.087   -19.983 1.00 0.00  ? 56  ASP A HD2    4  
ATOM   8349  N N      . LEU A 1 57  ? 4.902   7.387   -22.571 1.00 0.00  ? 57  LEU A N      4  
ATOM   8350  C CA     . LEU A 1 57  ? 3.557   7.773   -22.990 1.00 0.00  ? 57  LEU A CA     4  
ATOM   8351  C C      . LEU A 1 57  ? 3.411   7.694   -24.506 1.00 0.00  ? 57  LEU A C      4  
ATOM   8352  O O      . LEU A 1 57  ? 2.396   7.224   -25.016 1.00 0.00  ? 57  LEU A O      4  
ATOM   8353  C CB     . LEU A 1 57  ? 3.221   9.186   -22.511 1.00 0.00  ? 57  LEU A CB     4  
ATOM   8354  C CG     . LEU A 1 57  ? 1.857   9.717   -22.970 1.00 0.00  ? 57  LEU A CG     4  
ATOM   8355  C CD1    . LEU A 1 57  ? 0.766   8.684   -22.730 1.00 0.00  ? 57  LEU A CD1    4  
ATOM   8356  C CD2    . LEU A 1 57  ? 1.521   11.020  -22.262 1.00 0.00  ? 57  LEU A CD2    4  
ATOM   8357  H H      . LEU A 1 57  ? 5.464   8.038   -22.101 1.00 0.00  ? 57  LEU A H      4  
ATOM   8358  H HA     . LEU A 1 57  ? 2.862   7.079   -22.542 1.00 0.00  ? 57  LEU A HA     4  
ATOM   8359  H HB2    . LEU A 1 57  ? 3.246   9.194   -21.433 1.00 0.00  ? 57  LEU A HB2    4  
ATOM   8360  H HB3    . LEU A 1 57  ? 3.984   9.857   -22.876 1.00 0.00  ? 57  LEU A HB3    4  
ATOM   8361  H HG     . LEU A 1 57  ? 1.896   9.914   -24.031 1.00 0.00  ? 57  LEU A HG     4  
ATOM   8362  H HD11   . LEU A 1 57  ? 0.607   8.571   -21.667 1.00 0.00  ? 57  LEU A HD11   4  
ATOM   8363  H HD12   . LEU A 1 57  ? 1.069   7.736   -23.151 1.00 0.00  ? 57  LEU A HD12   4  
ATOM   8364  H HD13   . LEU A 1 57  ? -0.150  9.011   -23.199 1.00 0.00  ? 57  LEU A HD13   4  
ATOM   8365  H HD21   . LEU A 1 57  ? 1.950   11.014  -21.273 1.00 0.00  ? 57  LEU A HD21   4  
ATOM   8366  H HD22   . LEU A 1 57  ? 0.447   11.120  -22.187 1.00 0.00  ? 57  LEU A HD22   4  
ATOM   8367  H HD23   . LEU A 1 57  ? 1.920   11.850  -22.825 1.00 0.00  ? 57  LEU A HD23   4  
ATOM   8368  N N      . GLU A 1 58  ? 4.433   8.157   -25.220 1.00 0.00  ? 58  GLU A N      4  
ATOM   8369  C CA     . GLU A 1 58  ? 4.414   8.141   -26.681 1.00 0.00  ? 58  GLU A CA     4  
ATOM   8370  C C      . GLU A 1 58  ? 4.033   6.758   -27.191 1.00 0.00  ? 58  GLU A C      4  
ATOM   8371  O O      . GLU A 1 58  ? 3.182   6.626   -28.065 1.00 0.00  ? 58  GLU A O      4  
ATOM   8372  C CB     . GLU A 1 58  ? 5.783   8.538   -27.236 1.00 0.00  ? 58  GLU A CB     4  
ATOM   8373  C CG     . GLU A 1 58  ? 5.888   10.002  -27.633 1.00 0.00  ? 58  GLU A CG     4  
ATOM   8374  C CD     . GLU A 1 58  ? 7.178   10.650  -27.171 1.00 0.00  ? 58  GLU A CD     4  
ATOM   8375  O OE1    . GLU A 1 58  ? 7.108   11.590  -26.352 1.00 0.00  ? 58  GLU A OE1    4  
ATOM   8376  O OE2    . GLU A 1 58  ? 8.257   10.217  -27.628 1.00 0.00  ? 58  GLU A OE2    4  
ATOM   8377  H H      . GLU A 1 58  ? 5.217   8.519   -24.754 1.00 0.00  ? 58  GLU A H      4  
ATOM   8378  H HA     . GLU A 1 58  ? 3.672   8.854   -27.015 1.00 0.00  ? 58  GLU A HA     4  
ATOM   8379  H HB2    . GLU A 1 58  ? 6.526   8.336   -26.487 1.00 0.00  ? 58  GLU A HB2    4  
ATOM   8380  H HB3    . GLU A 1 58  ? 5.996   7.935   -28.106 1.00 0.00  ? 58  GLU A HB3    4  
ATOM   8381  H HG2    . GLU A 1 58  ? 5.843   10.066  -28.707 1.00 0.00  ? 58  GLU A HG2    4  
ATOM   8382  H HG3    . GLU A 1 58  ? 5.057   10.538  -27.203 1.00 0.00  ? 58  GLU A HG3    4  
ATOM   8383  H HE2    . GLU A 1 58  ? 9.033   10.674  -27.293 1.00 0.00  ? 58  GLU A HE2    4  
ATOM   8384  N N      . THR A 1 59  ? 4.654   5.727   -26.631 1.00 0.00  ? 59  THR A N      4  
ATOM   8385  C CA     . THR A 1 59  ? 4.351   4.360   -27.030 1.00 0.00  ? 59  THR A CA     4  
ATOM   8386  C C      . THR A 1 59  ? 2.859   4.095   -26.873 1.00 0.00  ? 59  THR A C      4  
ATOM   8387  O O      . THR A 1 59  ? 2.228   3.494   -27.742 1.00 0.00  ? 59  THR A O      4  
ATOM   8388  C CB     . THR A 1 59  ? 5.165   3.368   -26.202 1.00 0.00  ? 59  THR A CB     4  
ATOM   8389  O OG1    . THR A 1 59  ? 6.550   3.605   -26.370 1.00 0.00  ? 59  THR A OG1    4  
ATOM   8390  C CG2    . THR A 1 59  ? 4.896   1.926   -26.565 1.00 0.00  ? 59  THR A CG2    4  
ATOM   8391  H H      . THR A 1 59  ? 5.318   5.889   -25.925 1.00 0.00  ? 59  THR A H      4  
ATOM   8392  H HA     . THR A 1 59  ? 4.615   4.253   -28.072 1.00 0.00  ? 59  THR A HA     4  
ATOM   8393  H HB     . THR A 1 59  ? 4.921   3.497   -25.156 1.00 0.00  ? 59  THR A HB     4  
ATOM   8394  H HG1    . THR A 1 59  ? 6.828   4.305   -25.774 1.00 0.00  ? 59  THR A HG1    4  
ATOM   8395  H HG21   . THR A 1 59  ? 4.870   1.327   -25.667 1.00 0.00  ? 59  THR A HG21   4  
ATOM   8396  H HG22   . THR A 1 59  ? 5.681   1.569   -27.216 1.00 0.00  ? 59  THR A HG22   4  
ATOM   8397  H HG23   . THR A 1 59  ? 3.946   1.854   -27.075 1.00 0.00  ? 59  THR A HG23   4  
ATOM   8398  N N      . ALA A 1 60  ? 2.294   4.572   -25.767 1.00 0.00  ? 60  ALA A N      4  
ATOM   8399  C CA     . ALA A 1 60  ? 0.870   4.411   -25.509 1.00 0.00  ? 60  ALA A CA     4  
ATOM   8400  C C      . ALA A 1 60  ? 0.065   5.303   -26.446 1.00 0.00  ? 60  ALA A C      4  
ATOM   8401  O O      . ALA A 1 60  ? -1.039  4.951   -26.859 1.00 0.00  ? 60  ALA A O      4  
ATOM   8402  C CB     . ALA A 1 60  ? 0.546   4.739   -24.056 1.00 0.00  ? 60  ALA A CB     4  
ATOM   8403  H H      . ALA A 1 60  ? 2.847   5.060   -25.119 1.00 0.00  ? 60  ALA A H      4  
ATOM   8404  H HA     . ALA A 1 60  ? 0.609   3.379   -25.690 1.00 0.00  ? 60  ALA A HA     4  
ATOM   8405  H HB1    . ALA A 1 60  ? -0.394  5.272   -24.004 1.00 0.00  ? 60  ALA A HB1    4  
ATOM   8406  H HB2    . ALA A 1 60  ? 1.332   5.352   -23.641 1.00 0.00  ? 60  ALA A HB2    4  
ATOM   8407  H HB3    . ALA A 1 60  ? 0.470   3.822   -23.490 1.00 0.00  ? 60  ALA A HB3    4  
ATOM   8408  N N      . LEU A 1 61  ? 0.637   6.455   -26.785 1.00 0.00  ? 61  LEU A N      4  
ATOM   8409  C CA     . LEU A 1 61  ? -0.012  7.403   -27.681 1.00 0.00  ? 61  LEU A CA     4  
ATOM   8410  C C      . LEU A 1 61  ? -0.028  6.868   -29.107 1.00 0.00  ? 61  LEU A C      4  
ATOM   8411  O O      . LEU A 1 61  ? -1.074  6.803   -29.755 1.00 0.00  ? 61  LEU A O      4  
ATOM   8412  C CB     . LEU A 1 61  ? 0.745   8.725   -27.665 1.00 0.00  ? 61  LEU A CB     4  
ATOM   8413  C CG     . LEU A 1 61  ? 0.726   9.476   -26.340 1.00 0.00  ? 61  LEU A CG     4  
ATOM   8414  C CD1    . LEU A 1 61  ? 1.641   10.686  -26.422 1.00 0.00  ? 61  LEU A CD1    4  
ATOM   8415  C CD2    . LEU A 1 61  ? -0.697  9.884   -25.973 1.00 0.00  ? 61  LEU A CD2    4  
ATOM   8416  H H      . LEU A 1 61  ? 1.522   6.672   -26.425 1.00 0.00  ? 61  LEU A H      4  
ATOM   8417  H HA     . LEU A 1 61  ? -1.023  7.564   -27.343 1.00 0.00  ? 61  LEU A HA     4  
ATOM   8418  H HB2    . LEU A 1 61  ? 1.776   8.523   -27.920 1.00 0.00  ? 61  LEU A HB2    4  
ATOM   8419  H HB3    . LEU A 1 61  ? 0.329   9.367   -28.423 1.00 0.00  ? 61  LEU A HB3    4  
ATOM   8420  H HG     . LEU A 1 61  ? 1.100   8.829   -25.560 1.00 0.00  ? 61  LEU A HG     4  
ATOM   8421  H HD11   . LEU A 1 61  ? 1.120   11.561  -26.066 1.00 0.00  ? 61  LEU A HD11   4  
ATOM   8422  H HD12   . LEU A 1 61  ? 1.940   10.836  -27.451 1.00 0.00  ? 61  LEU A HD12   4  
ATOM   8423  H HD13   . LEU A 1 61  ? 2.517   10.514  -25.817 1.00 0.00  ? 61  LEU A HD13   4  
ATOM   8424  H HD21   . LEU A 1 61  ? -0.941  9.493   -24.998 1.00 0.00  ? 61  LEU A HD21   4  
ATOM   8425  H HD22   . LEU A 1 61  ? -1.387  9.484   -26.703 1.00 0.00  ? 61  LEU A HD22   4  
ATOM   8426  H HD23   . LEU A 1 61  ? -0.772  10.960  -25.959 1.00 0.00  ? 61  LEU A HD23   4  
ATOM   8427  N N      . ARG A 1 62  ? 1.151   6.492   -29.583 1.00 0.00  ? 62  ARG A N      4  
ATOM   8428  C CA     . ARG A 1 62  ? 1.310   5.961   -30.927 1.00 0.00  ? 62  ARG A CA     4  
ATOM   8429  C C      . ARG A 1 62  ? 0.442   4.724   -31.125 1.00 0.00  ? 62  ARG A C      4  
ATOM   8430  O O      . ARG A 1 62  ? -0.158  4.538   -32.183 1.00 0.00  ? 62  ARG A O      4  
ATOM   8431  C CB     . ARG A 1 62  ? 2.781   5.628   -31.178 1.00 0.00  ? 62  ARG A CB     4  
ATOM   8432  C CG     . ARG A 1 62  ? 3.508   6.671   -32.008 1.00 0.00  ? 62  ARG A CG     4  
ATOM   8433  C CD     . ARG A 1 62  ? 4.615   6.047   -32.840 1.00 0.00  ? 62  ARG A CD     4  
ATOM   8434  N NE     . ARG A 1 62  ? 4.554   6.472   -34.236 1.00 0.00  ? 62  ARG A NE     4  
ATOM   8435  C CZ     . ARG A 1 62  ? 4.729   5.656   -35.274 1.00 0.00  ? 62  ARG A CZ     4  
ATOM   8436  N NH1    . ARG A 1 62  ? 4.997   4.368   -35.088 1.00 0.00  ? 62  ARG A NH1    4  
ATOM   8437  N NH2    . ARG A 1 62  ? 4.638   6.132   -36.508 1.00 0.00  ? 62  ARG A NH2    4  
ATOM   8438  H H      . ARG A 1 62  ? 1.941   6.580   -29.009 1.00 0.00  ? 62  ARG A H      4  
ATOM   8439  H HA     . ARG A 1 62  ? 0.997   6.725   -31.627 1.00 0.00  ? 62  ARG A HA     4  
ATOM   8440  H HB2    . ARG A 1 62  ? 3.284   5.551   -30.222 1.00 0.00  ? 62  ARG A HB2    4  
ATOM   8441  H HB3    . ARG A 1 62  ? 2.846   4.679   -31.690 1.00 0.00  ? 62  ARG A HB3    4  
ATOM   8442  H HG2    . ARG A 1 62  ? 2.800   7.148   -32.669 1.00 0.00  ? 62  ARG A HG2    4  
ATOM   8443  H HG3    . ARG A 1 62  ? 3.940   7.408   -31.346 1.00 0.00  ? 62  ARG A HG3    4  
ATOM   8444  H HD2    . ARG A 1 62  ? 5.569   6.343   -32.427 1.00 0.00  ? 62  ARG A HD2    4  
ATOM   8445  H HD3    . ARG A 1 62  ? 4.521   4.974   -32.793 1.00 0.00  ? 62  ARG A HD3    4  
ATOM   8446  H HE     . ARG A 1 62  ? 4.365   7.417   -34.411 1.00 0.00  ? 62  ARG A HE     4  
ATOM   8447  H HH11   . ARG A 1 62  ? 5.071   4.000   -34.164 1.00 0.00  ? 62  ARG A HH11   4  
ATOM   8448  H HH12   . ARG A 1 62  ? 5.123   3.766   -35.876 1.00 0.00  ? 62  ARG A HH12   4  
ATOM   8449  H HH21   . ARG A 1 62  ? 4.440   7.101   -36.657 1.00 0.00  ? 62  ARG A HH21   4  
ATOM   8450  H HH22   . ARG A 1 62  ? 4.769   5.523   -37.290 1.00 0.00  ? 62  ARG A HH22   4  
ATOM   8451  N N      . ALA A 1 63  ? 0.366   3.887   -30.098 1.00 0.00  ? 63  ALA A N      4  
ATOM   8452  C CA     . ALA A 1 63  ? -0.448  2.685   -30.170 1.00 0.00  ? 63  ALA A CA     4  
ATOM   8453  C C      . ALA A 1 63  ? -1.919  3.060   -30.282 1.00 0.00  ? 63  ALA A C      4  
ATOM   8454  O O      . ALA A 1 63  ? -2.712  2.346   -30.893 1.00 0.00  ? 63  ALA A O      4  
ATOM   8455  C CB     . ALA A 1 63  ? -0.211  1.805   -28.953 1.00 0.00  ? 63  ALA A CB     4  
ATOM   8456  H H      . ALA A 1 63  ? 0.856   4.090   -29.273 1.00 0.00  ? 63  ALA A H      4  
ATOM   8457  H HA     . ALA A 1 63  ? -0.157  2.134   -31.052 1.00 0.00  ? 63  ALA A HA     4  
ATOM   8458  H HB1    . ALA A 1 63  ? 0.807   1.925   -28.614 1.00 0.00  ? 63  ALA A HB1    4  
ATOM   8459  H HB2    . ALA A 1 63  ? -0.382  0.771   -29.218 1.00 0.00  ? 63  ALA A HB2    4  
ATOM   8460  H HB3    . ALA A 1 63  ? -0.890  2.090   -28.163 1.00 0.00  ? 63  ALA A HB3    4  
ATOM   8461  N N      . THR A 1 64  ? -2.269  4.201   -29.692 1.00 0.00  ? 64  THR A N      4  
ATOM   8462  C CA     . THR A 1 64  ? -3.639  4.691   -29.731 1.00 0.00  ? 64  THR A CA     4  
ATOM   8463  C C      . THR A 1 64  ? -4.045  5.034   -31.155 1.00 0.00  ? 64  THR A C      4  
ATOM   8464  O O      . THR A 1 64  ? -5.085  4.592   -31.639 1.00 0.00  ? 64  THR A O      4  
ATOM   8465  C CB     . THR A 1 64  ? -3.790  5.920   -28.835 1.00 0.00  ? 64  THR A CB     4  
ATOM   8466  O OG1    . THR A 1 64  ? -3.235  5.681   -27.555 1.00 0.00  ? 64  THR A OG1    4  
ATOM   8467  C CG2    . THR A 1 64  ? -5.230  6.332   -28.639 1.00 0.00  ? 64  THR A CG2    4  
ATOM   8468  H H      . THR A 1 64  ? -1.588  4.729   -29.230 1.00 0.00  ? 64  THR A H      4  
ATOM   8469  H HA     . THR A 1 64  ? -4.284  3.909   -29.368 1.00 0.00  ? 64  THR A HA     4  
ATOM   8470  H HB     . THR A 1 64  ? -3.267  6.750   -29.286 1.00 0.00  ? 64  THR A HB     4  
ATOM   8471  H HG1    . THR A 1 64  ? -2.283  5.806   -27.590 1.00 0.00  ? 64  THR A HG1    4  
ATOM   8472  H HG21   . THR A 1 64  ? -5.651  6.629   -29.587 1.00 0.00  ? 64  THR A HG21   4  
ATOM   8473  H HG22   . THR A 1 64  ? -5.277  7.161   -27.949 1.00 0.00  ? 64  THR A HG22   4  
ATOM   8474  H HG23   . THR A 1 64  ? -5.788  5.499   -28.244 1.00 0.00  ? 64  THR A HG23   4  
ATOM   8475  N N      . GLN A 1 65  ? -3.214  5.825   -31.824 1.00 0.00  ? 65  GLN A N      4  
ATOM   8476  C CA     . GLN A 1 65  ? -3.488  6.223   -33.196 1.00 0.00  ? 65  GLN A CA     4  
ATOM   8477  C C      . GLN A 1 65  ? -3.195  5.079   -34.165 1.00 0.00  ? 65  GLN A C      4  
ATOM   8478  O O      . GLN A 1 65  ? -3.761  5.017   -35.256 1.00 0.00  ? 65  GLN A O      4  
ATOM   8479  C CB     . GLN A 1 65  ? -2.675  7.467   -33.571 1.00 0.00  ? 65  GLN A CB     4  
ATOM   8480  C CG     . GLN A 1 65  ? -1.184  7.326   -33.313 1.00 0.00  ? 65  GLN A CG     4  
ATOM   8481  C CD     . GLN A 1 65  ? -0.377  7.232   -34.593 1.00 0.00  ? 65  GLN A CD     4  
ATOM   8482  O OE1    . GLN A 1 65  ? -0.872  6.771   -35.621 1.00 0.00  ? 65  GLN A OE1    4  
ATOM   8483  N NE2    . GLN A 1 65  ? 0.875   7.672   -34.536 1.00 0.00  ? 65  GLN A NE2    4  
ATOM   8484  H H      . GLN A 1 65  ? -2.399  6.145   -31.385 1.00 0.00  ? 65  GLN A H      4  
ATOM   8485  H HA     . GLN A 1 65  ? -4.535  6.464   -33.258 1.00 0.00  ? 65  GLN A HA     4  
ATOM   8486  H HB2    . GLN A 1 65  ? -2.819  7.674   -34.620 1.00 0.00  ? 65  GLN A HB2    4  
ATOM   8487  H HB3    . GLN A 1 65  ? -3.041  8.306   -32.996 1.00 0.00  ? 65  GLN A HB3    4  
ATOM   8488  H HG2    . GLN A 1 65  ? -0.845  8.186   -32.754 1.00 0.00  ? 65  GLN A HG2    4  
ATOM   8489  H HG3    . GLN A 1 65  ? -1.014  6.434   -32.734 1.00 0.00  ? 65  GLN A HG3    4  
ATOM   8490  H HE21   . GLN A 1 65  ? 1.203   8.028   -33.685 1.00 0.00  ? 65  GLN A HE21   4  
ATOM   8491  H HE22   . GLN A 1 65  ? 1.420   7.624   -35.350 1.00 0.00  ? 65  GLN A HE22   4  
ATOM   8492  N N      . GLU A 1 66  ? -2.314  4.172   -33.759 1.00 0.00  ? 66  GLU A N      4  
ATOM   8493  C CA     . GLU A 1 66  ? -1.958  3.030   -34.594 1.00 0.00  ? 66  GLU A CA     4  
ATOM   8494  C C      . GLU A 1 66  ? -3.030  1.945   -34.519 1.00 0.00  ? 66  GLU A C      4  
ATOM   8495  O O      . GLU A 1 66  ? -3.327  1.286   -35.515 1.00 0.00  ? 66  GLU A O      4  
ATOM   8496  C CB     . GLU A 1 66  ? -0.608  2.453   -34.163 1.00 0.00  ? 66  GLU A CB     4  
ATOM   8497  C CG     . GLU A 1 66  ? 0.585   3.190   -34.747 1.00 0.00  ? 66  GLU A CG     4  
ATOM   8498  C CD     . GLU A 1 66  ? 1.810   2.306   -34.876 1.00 0.00  ? 66  GLU A CD     4  
ATOM   8499  O OE1    . GLU A 1 66  ? 2.116   1.873   -36.009 1.00 0.00  ? 66  GLU A OE1    4  
ATOM   8500  O OE2    . GLU A 1 66  ? 2.465   2.043   -33.846 1.00 0.00  ? 66  GLU A OE2    4  
ATOM   8501  H H      . GLU A 1 66  ? -1.896  4.268   -32.878 1.00 0.00  ? 66  GLU A H      4  
ATOM   8502  H HA     . GLU A 1 66  ? -1.884  3.376   -35.614 1.00 0.00  ? 66  GLU A HA     4  
ATOM   8503  H HB2    . GLU A 1 66  ? -0.539  2.494   -33.087 1.00 0.00  ? 66  GLU A HB2    4  
ATOM   8504  H HB3    . GLU A 1 66  ? -0.555  1.421   -34.477 1.00 0.00  ? 66  GLU A HB3    4  
ATOM   8505  H HG2    . GLU A 1 66  ? 0.322   3.557   -35.727 1.00 0.00  ? 66  GLU A HG2    4  
ATOM   8506  H HG3    . GLU A 1 66  ? 0.828   4.022   -34.105 1.00 0.00  ? 66  GLU A HG3    4  
ATOM   8507  H HE2    . GLU A 1 66  ? 3.227   1.479   -34.000 1.00 0.00  ? 66  GLU A HE2    4  
ATOM   8508  N N      . GLU A 1 67  ? -3.599  1.757   -33.331 1.00 0.00  ? 67  GLU A N      4  
ATOM   8509  C CA     . GLU A 1 67  ? -4.628  0.740   -33.132 1.00 0.00  ? 67  GLU A CA     4  
ATOM   8510  C C      . GLU A 1 67  ? -6.025  1.353   -33.037 1.00 0.00  ? 67  GLU A C      4  
ATOM   8511  O O      . GLU A 1 67  ? -7.019  0.630   -33.022 1.00 0.00  ? 67  GLU A O      4  
ATOM   8512  C CB     . GLU A 1 67  ? -4.341  -0.069  -31.864 1.00 0.00  ? 67  GLU A CB     4  
ATOM   8513  C CG     . GLU A 1 67  ? -3.259  -1.123  -32.041 1.00 0.00  ? 67  GLU A CG     4  
ATOM   8514  C CD     . GLU A 1 67  ? -2.345  -1.227  -30.834 1.00 0.00  ? 67  GLU A CD     4  
ATOM   8515  O OE1    . GLU A 1 67  ? -1.242  -1.794  -30.973 1.00 0.00  ? 67  GLU A OE1    4  
ATOM   8516  O OE2    . GLU A 1 67  ? -2.736  -0.739  -29.753 1.00 0.00  ? 67  GLU A OE2    4  
ATOM   8517  H H      . GLU A 1 67  ? -3.315  2.308   -32.570 1.00 0.00  ? 67  GLU A H      4  
ATOM   8518  H HA     . GLU A 1 67  ? -4.600  0.075   -33.980 1.00 0.00  ? 67  GLU A HA     4  
ATOM   8519  H HB2    . GLU A 1 67  ? -4.031  0.605   -31.081 1.00 0.00  ? 67  GLU A HB2    4  
ATOM   8520  H HB3    . GLU A 1 67  ? -5.250  -0.567  -31.557 1.00 0.00  ? 67  GLU A HB3    4  
ATOM   8521  H HG2    . GLU A 1 67  ? -3.731  -2.081  -32.198 1.00 0.00  ? 67  GLU A HG2    4  
ATOM   8522  H HG3    . GLU A 1 67  ? -2.663  -0.868  -32.905 1.00 0.00  ? 67  GLU A HG3    4  
ATOM   8523  H HE2    . GLU A 1 67  ? -2.109  -0.840  -29.032 1.00 0.00  ? 67  GLU A HE2    4  
ATOM   8524  N N      . ALA A 1 68  ? -6.106  2.680   -32.962 1.00 0.00  ? 68  ALA A N      4  
ATOM   8525  C CA     . ALA A 1 68  ? -7.401  3.346   -32.859 1.00 0.00  ? 68  ALA A CA     4  
ATOM   8526  C C      . ALA A 1 68  ? -7.488  4.597   -33.723 1.00 0.00  ? 68  ALA A C      4  
ATOM   8527  O O      . ALA A 1 68  ? -8.536  5.235   -33.785 1.00 0.00  ? 68  ALA A O      4  
ATOM   8528  C CB     . ALA A 1 68  ? -7.698  3.713   -31.417 1.00 0.00  ? 68  ALA A CB     4  
ATOM   8529  H H      . ALA A 1 68  ? -5.287  3.214   -32.966 1.00 0.00  ? 68  ALA A H      4  
ATOM   8530  H HA     . ALA A 1 68  ? -8.158  2.650   -33.183 1.00 0.00  ? 68  ALA A HA     4  
ATOM   8531  H HB1    . ALA A 1 68  ? -7.272  4.681   -31.199 1.00 0.00  ? 68  ALA A HB1    4  
ATOM   8532  H HB2    . ALA A 1 68  ? -7.264  2.972   -30.761 1.00 0.00  ? 68  ALA A HB2    4  
ATOM   8533  H HB3    . ALA A 1 68  ? -8.765  3.748   -31.270 1.00 0.00  ? 68  ALA A HB3    4  
ATOM   8534  N N      . GLY A 1 69  ? -6.398  4.959   -34.388 1.00 0.00  ? 69  GLY A N      4  
ATOM   8535  C CA     . GLY A 1 69  ? -6.417  6.145   -35.222 1.00 0.00  ? 69  GLY A CA     4  
ATOM   8536  C C      . GLY A 1 69  ? -6.479  7.429   -34.411 1.00 0.00  ? 69  GLY A C      4  
ATOM   8537  O O      . GLY A 1 69  ? -6.499  8.522   -34.978 1.00 0.00  ? 69  GLY A O      4  
ATOM   8538  H H      . GLY A 1 69  ? -5.582  4.428   -34.310 1.00 0.00  ? 69  GLY A H      4  
ATOM   8539  H HA2    . GLY A 1 69  ? -5.527  6.159   -35.830 1.00 0.00  ? 69  GLY A HA2    4  
ATOM   8540  H HA3    . GLY A 1 69  ? -7.280  6.099   -35.869 1.00 0.00  ? 69  GLY A HA3    4  
ATOM   8541  N N      . ILE A 1 70  ? -6.502  7.304   -33.083 1.00 0.00  ? 70  ILE A N      4  
ATOM   8542  C CA     . ILE A 1 70  ? -6.550  8.469   -32.209 1.00 0.00  ? 70  ILE A CA     4  
ATOM   8543  C C      . ILE A 1 70  ? -5.183  8.730   -31.583 1.00 0.00  ? 70  ILE A C      4  
ATOM   8544  O O      . ILE A 1 70  ? -4.603  7.856   -30.944 1.00 0.00  ? 70  ILE A O      4  
ATOM   8545  C CB     . ILE A 1 70  ? -7.605  8.317   -31.090 1.00 0.00  ? 70  ILE A CB     4  
ATOM   8546  C CG1    . ILE A 1 70  ? -8.849  7.581   -31.597 1.00 0.00  ? 70  ILE A CG1    4  
ATOM   8547  C CG2    . ILE A 1 70  ? -7.995  9.685   -30.559 1.00 0.00  ? 70  ILE A CG2    4  
ATOM   8548  C CD1    . ILE A 1 70  ? -9.629  6.878   -30.508 1.00 0.00  ? 70  ILE A CD1    4  
ATOM   8549  H H      . ILE A 1 70  ? -6.476  6.414   -32.682 1.00 0.00  ? 70  ILE A H      4  
ATOM   8550  H HA     . ILE A 1 70  ? -6.820  9.319   -32.811 1.00 0.00  ? 70  ILE A HA     4  
ATOM   8551  H HB     . ILE A 1 70  ? -7.163  7.753   -30.281 1.00 0.00  ? 70  ILE A HB     4  
ATOM   8552  H HG12   . ILE A 1 70  ? -9.511  8.293   -32.065 1.00 0.00  ? 70  ILE A HG12   4  
ATOM   8553  H HG13   . ILE A 1 70  ? -8.553  6.841   -32.324 1.00 0.00  ? 70  ILE A HG13   4  
ATOM   8554  H HG21   . ILE A 1 70  ? -8.773  9.576   -29.818 1.00 0.00  ? 70  ILE A HG21   4  
ATOM   8555  H HG22   . ILE A 1 70  ? -8.353  10.295  -31.372 1.00 0.00  ? 70  ILE A HG22   4  
ATOM   8556  H HG23   . ILE A 1 70  ? -7.134  10.157  -30.110 1.00 0.00  ? 70  ILE A HG23   4  
ATOM   8557  H HD11   . ILE A 1 70  ? -10.670 7.164   -30.569 1.00 0.00  ? 70  ILE A HD11   4  
ATOM   8558  H HD12   . ILE A 1 70  ? -9.234  7.158   -29.542 1.00 0.00  ? 70  ILE A HD12   4  
ATOM   8559  H HD13   . ILE A 1 70  ? -9.543  5.809   -30.635 1.00 0.00  ? 70  ILE A HD13   4  
ATOM   8560  N N      . GLU A 1 71  ? -4.670  9.939   -31.782 1.00 0.00  ? 71  GLU A N      4  
ATOM   8561  C CA     . GLU A 1 71  ? -3.369  10.316  -31.242 1.00 0.00  ? 71  GLU A CA     4  
ATOM   8562  C C      . GLU A 1 71  ? -3.523  11.312  -30.099 1.00 0.00  ? 71  GLU A C      4  
ATOM   8563  O O      . GLU A 1 71  ? -4.597  11.878  -29.899 1.00 0.00  ? 71  GLU A O      4  
ATOM   8564  C CB     . GLU A 1 71  ? -2.490  10.911  -32.344 1.00 0.00  ? 71  GLU A CB     4  
ATOM   8565  C CG     . GLU A 1 71  ? -2.954  12.280  -32.816 1.00 0.00  ? 71  GLU A CG     4  
ATOM   8566  C CD     . GLU A 1 71  ? -3.240  12.320  -34.305 1.00 0.00  ? 71  GLU A CD     4  
ATOM   8567  O OE1    . GLU A 1 71  ? -4.080  13.140  -34.727 1.00 0.00  ? 71  GLU A OE1    4  
ATOM   8568  O OE2    . GLU A 1 71  ? -2.621  11.530  -35.049 1.00 0.00  ? 71  GLU A OE2    4  
ATOM   8569  H H      . GLU A 1 71  ? -5.179  10.595  -32.302 1.00 0.00  ? 71  GLU A H      4  
ATOM   8570  H HA     . GLU A 1 71  ? -2.896  9.422   -30.861 1.00 0.00  ? 71  GLU A HA     4  
ATOM   8571  H HB2    . GLU A 1 71  ? -1.480  11.004  -31.974 1.00 0.00  ? 71  GLU A HB2    4  
ATOM   8572  H HB3    . GLU A 1 71  ? -2.494  10.243  -33.192 1.00 0.00  ? 71  GLU A HB3    4  
ATOM   8573  H HG2    . GLU A 1 71  ? -3.856  12.541  -32.283 1.00 0.00  ? 71  GLU A HG2    4  
ATOM   8574  H HG3    . GLU A 1 71  ? -2.183  13.004  -32.592 1.00 0.00  ? 71  GLU A HG3    4  
ATOM   8575  H HE2    . GLU A 1 71  ? -2.851  11.609  -35.978 1.00 0.00  ? 71  GLU A HE2    4  
ATOM   8576  N N      . ALA A 1 72  ? -2.442  11.527  -29.357 1.00 0.00  ? 72  ALA A N      4  
ATOM   8577  C CA     . ALA A 1 72  ? -2.454  12.464  -28.237 1.00 0.00  ? 72  ALA A CA     4  
ATOM   8578  C C      . ALA A 1 72  ? -3.070  13.799  -28.640 1.00 0.00  ? 72  ALA A C      4  
ATOM   8579  O O      . ALA A 1 72  ? -3.637  14.508  -27.808 1.00 0.00  ? 72  ALA A O      4  
ATOM   8580  C CB     . ALA A 1 72  ? -1.047  12.666  -27.710 1.00 0.00  ? 72  ALA A CB     4  
ATOM   8581  H H      . ALA A 1 72  ? -1.613  11.049  -29.570 1.00 0.00  ? 72  ALA A H      4  
ATOM   8582  H HA     . ALA A 1 72  ? -3.046  12.032  -27.447 1.00 0.00  ? 72  ALA A HA     4  
ATOM   8583  H HB1    . ALA A 1 72  ? -0.517  11.724  -27.739 1.00 0.00  ? 72  ALA A HB1    4  
ATOM   8584  H HB2    . ALA A 1 72  ? -1.093  13.020  -26.692 1.00 0.00  ? 72  ALA A HB2    4  
ATOM   8585  H HB3    . ALA A 1 72  ? -0.532  13.388  -28.323 1.00 0.00  ? 72  ALA A HB3    4  
ATOM   8586  N N      . GLY A 1 73  ? -2.965  14.130  -29.921 1.00 0.00  ? 73  GLY A N      4  
ATOM   8587  C CA     . GLY A 1 73  ? -3.526  15.372  -30.415 1.00 0.00  ? 73  GLY A CA     4  
ATOM   8588  C C      . GLY A 1 73  ? -5.033  15.301  -30.565 1.00 0.00  ? 73  GLY A C      4  
ATOM   8589  O O      . GLY A 1 73  ? -5.709  16.329  -30.590 1.00 0.00  ? 73  GLY A O      4  
ATOM   8590  H H      . GLY A 1 73  ? -2.509  13.522  -30.540 1.00 0.00  ? 73  GLY A H      4  
ATOM   8591  H HA2    . GLY A 1 73  ? -3.279  16.165  -29.724 1.00 0.00  ? 73  GLY A HA2    4  
ATOM   8592  H HA3    . GLY A 1 73  ? -3.089  15.597  -31.376 1.00 0.00  ? 73  GLY A HA3    4  
ATOM   8593  N N      . GLN A 1 74  ? -5.562  14.082  -30.661 1.00 0.00  ? 74  GLN A N      4  
ATOM   8594  C CA     . GLN A 1 74  ? -7.000  13.883  -30.808 1.00 0.00  ? 74  GLN A CA     4  
ATOM   8595  C C      . GLN A 1 74  ? -7.660  13.558  -29.469 1.00 0.00  ? 74  GLN A C      4  
ATOM   8596  O O      . GLN A 1 74  ? -8.886  13.550  -29.364 1.00 0.00  ? 74  GLN A O      4  
ATOM   8597  C CB     . GLN A 1 74  ? -7.288  12.770  -31.817 1.00 0.00  ? 74  GLN A CB     4  
ATOM   8598  C CG     . GLN A 1 74  ? -8.732  12.745  -32.297 1.00 0.00  ? 74  GLN A CG     4  
ATOM   8599  C CD     . GLN A 1 74  ? -8.863  13.066  -33.774 1.00 0.00  ? 74  GLN A CD     4  
ATOM   8600  O OE1    . GLN A 1 74  ? -7.967  12.777  -34.565 1.00 0.00  ? 74  GLN A OE1    4  
ATOM   8601  N NE2    . GLN A 1 74  ? -9.989  13.665  -34.148 1.00 0.00  ? 74  GLN A NE2    4  
ATOM   8602  H H      . GLN A 1 74  ? -4.972  13.300  -30.634 1.00 0.00  ? 74  GLN A H      4  
ATOM   8603  H HA     . GLN A 1 74  ? -7.420  14.806  -31.181 1.00 0.00  ? 74  GLN A HA     4  
ATOM   8604  H HB2    . GLN A 1 74  ? -6.646  12.903  -32.676 1.00 0.00  ? 74  GLN A HB2    4  
ATOM   8605  H HB3    . GLN A 1 74  ? -7.066  11.817  -31.358 1.00 0.00  ? 74  GLN A HB3    4  
ATOM   8606  H HG2    . GLN A 1 74  ? -9.138  11.760  -32.124 1.00 0.00  ? 74  GLN A HG2    4  
ATOM   8607  H HG3    . GLN A 1 74  ? -9.297  13.472  -31.734 1.00 0.00  ? 74  GLN A HG3    4  
ATOM   8608  H HE21   . GLN A 1 74  ? -10.657 13.862  -33.461 1.00 0.00  ? 74  GLN A HE21   4  
ATOM   8609  H HE22   . GLN A 1 74  ? -10.103 13.882  -35.097 1.00 0.00  ? 74  GLN A HE22   4  
ATOM   8610  N N      . LEU A 1 75  ? -6.850  13.314  -28.439 1.00 0.00  ? 75  LEU A N      4  
ATOM   8611  C CA     . LEU A 1 75  ? -7.380  13.020  -27.111 1.00 0.00  ? 75  LEU A CA     4  
ATOM   8612  C C      . LEU A 1 75  ? -6.777  13.961  -26.075 1.00 0.00  ? 75  LEU A C      4  
ATOM   8613  O O      . LEU A 1 75  ? -6.084  14.919  -26.414 1.00 0.00  ? 75  LEU A O      4  
ATOM   8614  C CB     . LEU A 1 75  ? -7.126  11.557  -26.694 1.00 0.00  ? 75  LEU A CB     4  
ATOM   8615  C CG     . LEU A 1 75  ? -6.269  10.709  -27.641 1.00 0.00  ? 75  LEU A CG     4  
ATOM   8616  C CD1    . LEU A 1 75  ? -4.858  10.554  -27.092 1.00 0.00  ? 75  LEU A CD1    4  
ATOM   8617  C CD2    . LEU A 1 75  ? -6.907  9.345   -27.848 1.00 0.00  ? 75  LEU A CD2    4  
ATOM   8618  H H      . LEU A 1 75  ? -5.879  13.349  -28.571 1.00 0.00  ? 75  LEU A H      4  
ATOM   8619  H HA     . LEU A 1 75  ? -8.445  13.191  -27.144 1.00 0.00  ? 75  LEU A HA     4  
ATOM   8620  H HB2    . LEU A 1 75  ? -6.644  11.563  -25.728 1.00 0.00  ? 75  LEU A HB2    4  
ATOM   8621  H HB3    . LEU A 1 75  ? -8.085  11.071  -26.586 1.00 0.00  ? 75  LEU A HB3    4  
ATOM   8622  H HG     . LEU A 1 75  ? -6.206  11.198  -28.600 1.00 0.00  ? 75  LEU A HG     4  
ATOM   8623  H HD11   . LEU A 1 75  ? -4.625  11.395  -26.455 1.00 0.00  ? 75  LEU A HD11   4  
ATOM   8624  H HD12   . LEU A 1 75  ? -4.156  10.519  -27.912 1.00 0.00  ? 75  LEU A HD12   4  
ATOM   8625  H HD13   . LEU A 1 75  ? -4.791  9.638   -26.521 1.00 0.00  ? 75  LEU A HD13   4  
ATOM   8626  H HD21   . LEU A 1 75  ? -6.763  8.742   -26.964 1.00 0.00  ? 75  LEU A HD21   4  
ATOM   8627  H HD22   . LEU A 1 75  ? -6.447  8.857   -28.696 1.00 0.00  ? 75  LEU A HD22   4  
ATOM   8628  H HD23   . LEU A 1 75  ? -7.962  9.468   -28.034 1.00 0.00  ? 75  LEU A HD23   4  
ATOM   8629  N N      . THR A 1 76  ? -7.047  13.670  -24.811 1.00 0.00  ? 76  THR A N      4  
ATOM   8630  C CA     . THR A 1 76  ? -6.539  14.474  -23.707 1.00 0.00  ? 76  THR A CA     4  
ATOM   8631  C C      . THR A 1 76  ? -5.966  13.577  -22.617 1.00 0.00  ? 76  THR A C      4  
ATOM   8632  O O      . THR A 1 76  ? -6.708  13.004  -21.821 1.00 0.00  ? 76  THR A O      4  
ATOM   8633  C CB     . THR A 1 76  ? -7.649  15.350  -23.128 1.00 0.00  ? 76  THR A CB     4  
ATOM   8634  O OG1    . THR A 1 76  ? -8.207  16.180  -24.131 1.00 0.00  ? 76  THR A OG1    4  
ATOM   8635  C CG2    . THR A 1 76  ? -7.177  16.239  -22.000 1.00 0.00  ? 76  THR A CG2    4  
ATOM   8636  H H      . THR A 1 76  ? -7.603  12.890  -24.615 1.00 0.00  ? 76  THR A H      4  
ATOM   8637  H HA     . THR A 1 76  ? -5.753  15.107  -24.090 1.00 0.00  ? 76  THR A HA     4  
ATOM   8638  H HB     . THR A 1 76  ? -8.432  14.713  -22.743 1.00 0.00  ? 76  THR A HB     4  
ATOM   8639  H HG1    . THR A 1 76  ? -8.852  15.681  -24.637 1.00 0.00  ? 76  THR A HG1    4  
ATOM   8640  H HG21   . THR A 1 76  ? -7.683  15.962  -21.087 1.00 0.00  ? 76  THR A HG21   4  
ATOM   8641  H HG22   . THR A 1 76  ? -7.398  17.270  -22.234 1.00 0.00  ? 76  THR A HG22   4  
ATOM   8642  H HG23   . THR A 1 76  ? -6.111  16.118  -21.870 1.00 0.00  ? 76  THR A HG23   4  
ATOM   8643  N N      . ILE A 1 77  ? -4.643  13.453  -22.592 1.00 0.00  ? 77  ILE A N      4  
ATOM   8644  C CA     . ILE A 1 77  ? -3.975  12.616  -21.605 1.00 0.00  ? 77  ILE A CA     4  
ATOM   8645  C C      . ILE A 1 77  ? -3.986  13.279  -20.232 1.00 0.00  ? 77  ILE A C      4  
ATOM   8646  O O      . ILE A 1 77  ? -3.438  14.365  -20.052 1.00 0.00  ? 77  ILE A O      4  
ATOM   8647  C CB     . ILE A 1 77  ? -2.519  12.300  -22.009 1.00 0.00  ? 77  ILE A CB     4  
ATOM   8648  C CG1    . ILE A 1 77  ? -2.438  11.966  -23.501 1.00 0.00  ? 77  ILE A CG1    4  
ATOM   8649  C CG2    . ILE A 1 77  ? -1.976  11.146  -21.173 1.00 0.00  ? 77  ILE A CG2    4  
ATOM   8650  C CD1    . ILE A 1 77  ? -3.081  10.642  -23.865 1.00 0.00  ? 77  ILE A CD1    4  
ATOM   8651  H H      . ILE A 1 77  ? -4.109  13.936  -23.254 1.00 0.00  ? 77  ILE A H      4  
ATOM   8652  H HA     . ILE A 1 77  ? -4.517  11.684  -21.546 1.00 0.00  ? 77  ILE A HA     4  
ATOM   8653  H HB     . ILE A 1 77  ? -1.916  13.171  -21.807 1.00 0.00  ? 77  ILE A HB     4  
ATOM   8654  H HG12   . ILE A 1 77  ? -2.938  12.739  -24.064 1.00 0.00  ? 77  ILE A HG12   4  
ATOM   8655  H HG13   . ILE A 1 77  ? -1.401  11.925  -23.799 1.00 0.00  ? 77  ILE A HG13   4  
ATOM   8656  H HG21   . ILE A 1 77  ? -1.833  10.278  -21.804 1.00 0.00  ? 77  ILE A HG21   4  
ATOM   8657  H HG22   . ILE A 1 77  ? -2.677  10.905  -20.387 1.00 0.00  ? 77  ILE A HG22   4  
ATOM   8658  H HG23   . ILE A 1 77  ? -1.031  11.431  -20.735 1.00 0.00  ? 77  ILE A HG23   4  
ATOM   8659  H HD11   . ILE A 1 77  ? -2.361  9.845   -23.732 1.00 0.00  ? 77  ILE A HD11   4  
ATOM   8660  H HD12   . ILE A 1 77  ? -3.403  10.668  -24.894 1.00 0.00  ? 77  ILE A HD12   4  
ATOM   8661  H HD13   . ILE A 1 77  ? -3.932  10.468  -23.224 1.00 0.00  ? 77  ILE A HD13   4  
ATOM   8662  N N      . ILE A 1 78  ? -4.623  12.620  -19.270 1.00 0.00  ? 78  ILE A N      4  
ATOM   8663  C CA     . ILE A 1 78  ? -4.717  13.147  -17.915 1.00 0.00  ? 78  ILE A CA     4  
ATOM   8664  C C      . ILE A 1 78  ? -3.441  12.873  -17.127 1.00 0.00  ? 78  ILE A C      4  
ATOM   8665  O O      . ILE A 1 78  ? -2.918  11.757  -17.129 1.00 0.00  ? 78  ILE A O      4  
ATOM   8666  C CB     . ILE A 1 78  ? -5.949  12.572  -17.175 1.00 0.00  ? 78  ILE A CB     4  
ATOM   8667  C CG1    . ILE A 1 78  ? -7.005  13.662  -16.997 1.00 0.00  ? 78  ILE A CG1    4  
ATOM   8668  C CG2    . ILE A 1 78  ? -5.569  11.977  -15.822 1.00 0.00  ? 78  ILE A CG2    4  
ATOM   8669  C CD1    . ILE A 1 78  ? -7.600  14.148  -18.301 1.00 0.00  ? 78  ILE A CD1    4  
ATOM   8670  H H      . ILE A 1 78  ? -5.046  11.762  -19.479 1.00 0.00  ? 78  ILE A H      4  
ATOM   8671  H HA     . ILE A 1 78  ? -4.842  14.217  -17.994 1.00 0.00  ? 78  ILE A HA     4  
ATOM   8672  H HB     . ILE A 1 78  ? -6.365  11.784  -17.779 1.00 0.00  ? 78  ILE A HB     4  
ATOM   8673  H HG12   . ILE A 1 78  ? -7.803  13.283  -16.385 1.00 0.00  ? 78  ILE A HG12   4  
ATOM   8674  H HG13   . ILE A 1 78  ? -6.555  14.507  -16.505 1.00 0.00  ? 78  ILE A HG13   4  
ATOM   8675  H HG21   . ILE A 1 78  ? -6.446  11.551  -15.357 1.00 0.00  ? 78  ILE A HG21   4  
ATOM   8676  H HG22   . ILE A 1 78  ? -5.169  12.754  -15.187 1.00 0.00  ? 78  ILE A HG22   4  
ATOM   8677  H HG23   . ILE A 1 78  ? -4.825  11.206  -15.963 1.00 0.00  ? 78  ILE A HG23   4  
ATOM   8678  H HD11   . ILE A 1 78  ? -7.667  13.321  -18.997 1.00 0.00  ? 78  ILE A HD11   4  
ATOM   8679  H HD12   . ILE A 1 78  ? -6.970  14.919  -18.719 1.00 0.00  ? 78  ILE A HD12   4  
ATOM   8680  H HD13   . ILE A 1 78  ? -8.587  14.546  -18.119 1.00 0.00  ? 78  ILE A HD13   4  
ATOM   8681  N N      . GLU A 1 79  ? -2.953  13.905  -16.460 1.00 0.00  ? 79  GLU A N      4  
ATOM   8682  C CA     . GLU A 1 79  ? -1.735  13.805  -15.662 1.00 0.00  ? 79  GLU A CA     4  
ATOM   8683  C C      . GLU A 1 79  ? -2.053  13.424  -14.218 1.00 0.00  ? 79  GLU A C      4  
ATOM   8684  O O      . GLU A 1 79  ? -3.104  13.783  -13.690 1.00 0.00  ? 79  GLU A O      4  
ATOM   8685  C CB     . GLU A 1 79  ? -0.980  15.135  -15.699 1.00 0.00  ? 79  GLU A CB     4  
ATOM   8686  C CG     . GLU A 1 79  ? -0.766  15.674  -17.107 1.00 0.00  ? 79  GLU A CG     4  
ATOM   8687  C CD     . GLU A 1 79  ? -0.444  17.156  -17.127 1.00 0.00  ? 79  GLU A CD     4  
ATOM   8688  O OE1    . GLU A 1 79  ? 0.614   17.542  -16.584 1.00 0.00  ? 79  GLU A OE1    4  
ATOM   8689  O OE2    . GLU A 1 79  ? -1.248  17.931  -17.686 1.00 0.00  ? 79  GLU A OE2    4  
ATOM   8690  H H      . GLU A 1 79  ? -3.426  14.763  -16.504 1.00 0.00  ? 79  GLU A H      4  
ATOM   8691  H HA     . GLU A 1 79  ? -1.114  13.037  -16.097 1.00 0.00  ? 79  GLU A HA     4  
ATOM   8692  H HB2    . GLU A 1 79  ? -1.543  15.867  -15.138 1.00 0.00  ? 79  GLU A HB2    4  
ATOM   8693  H HB3    . GLU A 1 79  ? -0.015  15.004  -15.234 1.00 0.00  ? 79  GLU A HB3    4  
ATOM   8694  H HG2    . GLU A 1 79  ? 0.052   15.138  -17.561 1.00 0.00  ? 79  GLU A HG2    4  
ATOM   8695  H HG3    . GLU A 1 79  ? -1.667  15.509  -17.682 1.00 0.00  ? 79  GLU A HG3    4  
ATOM   8696  H HE2    . GLU A 1 79  ? -0.982  18.854  -17.661 1.00 0.00  ? 79  GLU A HE2    4  
ATOM   8697  N N      . GLY A 1 80  ? -1.135  12.698  -13.585 1.00 0.00  ? 80  GLY A N      4  
ATOM   8698  C CA     . GLY A 1 80  ? -1.336  12.285  -12.208 1.00 0.00  ? 80  GLY A CA     4  
ATOM   8699  C C      . GLY A 1 80  ? -1.671  10.812  -12.085 1.00 0.00  ? 80  GLY A C      4  
ATOM   8700  O O      . GLY A 1 80  ? -1.400  10.191  -11.058 1.00 0.00  ? 80  GLY A O      4  
ATOM   8701  H H      . GLY A 1 80  ? -0.315  12.443  -14.056 1.00 0.00  ? 80  GLY A H      4  
ATOM   8702  H HA2    . GLY A 1 80  ? -0.433  12.484  -11.650 1.00 0.00  ? 80  GLY A HA2    4  
ATOM   8703  H HA3    . GLY A 1 80  ? -2.143  12.862  -11.782 1.00 0.00  ? 80  GLY A HA3    4  
ATOM   8704  N N      . PHE A 1 81  ? -2.262  10.252  -13.134 1.00 0.00  ? 81  PHE A N      4  
ATOM   8705  C CA     . PHE A 1 81  ? -2.630  8.843   -13.134 1.00 0.00  ? 81  PHE A CA     4  
ATOM   8706  C C      . PHE A 1 81  ? -1.653  8.023   -13.965 1.00 0.00  ? 81  PHE A C      4  
ATOM   8707  O O      . PHE A 1 81  ? -1.439  8.302   -15.145 1.00 0.00  ? 81  PHE A O      4  
ATOM   8708  C CB     . PHE A 1 81  ? -4.044  8.665   -13.679 1.00 0.00  ? 81  PHE A CB     4  
ATOM   8709  C CG     . PHE A 1 81  ? -4.541  7.252   -13.601 1.00 0.00  ? 81  PHE A CG     4  
ATOM   8710  C CD1    . PHE A 1 81  ? -4.022  6.271   -14.432 1.00 0.00  ? 81  PHE A CD1    4  
ATOM   8711  C CD2    . PHE A 1 81  ? -5.526  6.903   -12.694 1.00 0.00  ? 81  PHE A CD2    4  
ATOM   8712  C CE1    . PHE A 1 81  ? -4.477  4.970   -14.359 1.00 0.00  ? 81  PHE A CE1    4  
ATOM   8713  C CE2    . PHE A 1 81  ? -5.987  5.603   -12.616 1.00 0.00  ? 81  PHE A CE2    4  
ATOM   8714  C CZ     . PHE A 1 81  ? -5.463  4.635   -13.450 1.00 0.00  ? 81  PHE A CZ     4  
ATOM   8715  H H      . PHE A 1 81  ? -2.454  10.796  -13.928 1.00 0.00  ? 81  PHE A H      4  
ATOM   8716  H HA     . PHE A 1 81  ? -2.601  8.492   -12.114 1.00 0.00  ? 81  PHE A HA     4  
ATOM   8717  H HB2    . PHE A 1 81  ? -4.722  9.288   -13.111 1.00 0.00  ? 81  PHE A HB2    4  
ATOM   8718  H HB3    . PHE A 1 81  ? -4.066  8.972   -14.714 1.00 0.00  ? 81  PHE A HB3    4  
ATOM   8719  H HD1    . PHE A 1 81  ? -3.253  6.533   -15.144 1.00 0.00  ? 81  PHE A HD1    4  
ATOM   8720  H HD2    . PHE A 1 81  ? -5.937  7.658   -12.041 1.00 0.00  ? 81  PHE A HD2    4  
ATOM   8721  H HE1    . PHE A 1 81  ? -4.065  4.215   -15.013 1.00 0.00  ? 81  PHE A HE1    4  
ATOM   8722  H HE2    . PHE A 1 81  ? -6.754  5.345   -11.905 1.00 0.00  ? 81  PHE A HE2    4  
ATOM   8723  H HZ     . PHE A 1 81  ? -5.821  3.618   -13.391 1.00 0.00  ? 81  PHE A HZ     4  
ATOM   8724  N N      . LYS A 1 82  ? -1.067  7.005   -13.344 1.00 0.00  ? 82  LYS A N      4  
ATOM   8725  C CA     . LYS A 1 82  ? -0.119  6.140   -14.033 1.00 0.00  ? 82  LYS A CA     4  
ATOM   8726  C C      . LYS A 1 82  ? -0.007  4.787   -13.344 1.00 0.00  ? 82  LYS A C      4  
ATOM   8727  O O      . LYS A 1 82  ? 0.226   4.705   -12.137 1.00 0.00  ? 82  LYS A O      4  
ATOM   8728  C CB     . LYS A 1 82  ? 1.259   6.794   -14.111 1.00 0.00  ? 82  LYS A CB     4  
ATOM   8729  C CG     . LYS A 1 82  ? 1.940   6.601   -15.455 1.00 0.00  ? 82  LYS A CG     4  
ATOM   8730  C CD     . LYS A 1 82  ? 3.414   6.963   -15.390 1.00 0.00  ? 82  LYS A CD     4  
ATOM   8731  C CE     . LYS A 1 82  ? 4.183   6.024   -14.475 1.00 0.00  ? 82  LYS A CE     4  
ATOM   8732  N NZ     . LYS A 1 82  ? 4.917   6.762   -13.413 1.00 0.00  ? 82  LYS A NZ     4  
ATOM   8733  H H      . LYS A 1 82  ? -1.282  6.828   -12.404 1.00 0.00  ? 82  LYS A H      4  
ATOM   8734  H HA     . LYS A 1 82  ? -0.487  5.986   -15.036 1.00 0.00  ? 82  LYS A HA     4  
ATOM   8735  H HB2    . LYS A 1 82  ? 1.156   7.854   -13.928 1.00 0.00  ? 82  LYS A HB2    4  
ATOM   8736  H HB3    . LYS A 1 82  ? 1.890   6.362   -13.348 1.00 0.00  ? 82  LYS A HB3    4  
ATOM   8737  H HG2    . LYS A 1 82  ? 1.848   5.566   -15.747 1.00 0.00  ? 82  LYS A HG2    4  
ATOM   8738  H HG3    . LYS A 1 82  ? 1.454   7.230   -16.186 1.00 0.00  ? 82  LYS A HG3    4  
ATOM   8739  H HD2    . LYS A 1 82  ? 3.833   6.899   -16.383 1.00 0.00  ? 82  LYS A HD2    4  
ATOM   8740  H HD3    . LYS A 1 82  ? 3.511   7.972   -15.019 1.00 0.00  ? 82  LYS A HD3    4  
ATOM   8741  H HE2    . LYS A 1 82  ? 3.485   5.341   -14.012 1.00 0.00  ? 82  LYS A HE2    4  
ATOM   8742  H HE3    . LYS A 1 82  ? 4.890   5.466   -15.070 1.00 0.00  ? 82  LYS A HE3    4  
ATOM   8743  H HZ1    . LYS A 1 82  ? 5.799   6.265   -13.179 1.00 0.00  ? 82  LYS A HZ1    4  
ATOM   8744  H HZ2    . LYS A 1 82  ? 4.332   6.832   -12.555 1.00 0.00  ? 82  LYS A HZ2    4  
ATOM   8745  H HZ3    . LYS A 1 82  ? 5.149   7.721   -13.739 1.00 0.00  ? 82  LYS A HZ3    4  
ATOM   8746  N N      . ARG A 1 83  ? -0.170  3.732   -14.128 1.00 0.00  ? 83  ARG A N      4  
ATOM   8747  C CA     . ARG A 1 83  ? -0.083  2.369   -13.620 1.00 0.00  ? 83  ARG A CA     4  
ATOM   8748  C C      . ARG A 1 83  ? 0.259   1.407   -14.752 1.00 0.00  ? 83  ARG A C      4  
ATOM   8749  O O      . ARG A 1 83  ? -0.213  1.570   -15.877 1.00 0.00  ? 83  ARG A O      4  
ATOM   8750  C CB     . ARG A 1 83  ? -1.403  1.958   -12.963 1.00 0.00  ? 83  ARG A CB     4  
ATOM   8751  C CG     . ARG A 1 83  ? -1.258  0.810   -11.976 1.00 0.00  ? 83  ARG A CG     4  
ATOM   8752  C CD     . ARG A 1 83  ? -1.120  1.317   -10.551 1.00 0.00  ? 83  ARG A CD     4  
ATOM   8753  N NE     . ARG A 1 83  ? -0.336  0.407   -9.717  1.00 0.00  ? 83  ARG A NE     4  
ATOM   8754  C CZ     . ARG A 1 83  ? 0.995   0.396   -9.678  1.00 0.00  ? 83  ARG A CZ     4  
ATOM   8755  N NH1    . ARG A 1 83  ? 1.698   1.240   -10.426 1.00 0.00  ? 83  ARG A NH1    4  
ATOM   8756  N NH2    . ARG A 1 83  ? 1.629   -0.461  -8.887  1.00 0.00  ? 83  ARG A NH2    4  
ATOM   8757  H H      . ARG A 1 83  ? -0.346  3.876   -15.079 1.00 0.00  ? 83  ARG A H      4  
ATOM   8758  H HA     . ARG A 1 83  ? 0.704   2.337   -12.883 1.00 0.00  ? 83  ARG A HA     4  
ATOM   8759  H HB2    . ARG A 1 83  ? -1.809  2.807   -12.434 1.00 0.00  ? 83  ARG A HB2    4  
ATOM   8760  H HB3    . ARG A 1 83  ? -2.098  1.657   -13.733 1.00 0.00  ? 83  ARG A HB3    4  
ATOM   8761  H HG2    . ARG A 1 83  ? -2.135  0.181   -12.040 1.00 0.00  ? 83  ARG A HG2    4  
ATOM   8762  H HG3    . ARG A 1 83  ? -0.381  0.235   -12.233 1.00 0.00  ? 83  ARG A HG3    4  
ATOM   8763  H HD2    . ARG A 1 83  ? -0.632  2.282   -10.572 1.00 0.00  ? 83  ARG A HD2    4  
ATOM   8764  H HD3    . ARG A 1 83  ? -2.105  1.423   -10.123 1.00 0.00  ? 83  ARG A HD3    4  
ATOM   8765  H HE     . ARG A 1 83  ? -0.828  -0.227  -9.157  1.00 0.00  ? 83  ARG A HE     4  
ATOM   8766  H HH11   . ARG A 1 83  ? 1.228   1.889   -11.023 1.00 0.00  ? 83  ARG A HH11   4  
ATOM   8767  H HH12   . ARG A 1 83  ? 2.698   1.223   -10.393 1.00 0.00  ? 83  ARG A HH12   4  
ATOM   8768  H HH21   . ARG A 1 83  ? 1.108   -1.098  -8.321  1.00 0.00  ? 83  ARG A HH21   4  
ATOM   8769  H HH22   . ARG A 1 83  ? 2.629   -0.470  -8.861  1.00 0.00  ? 83  ARG A HH22   4  
ATOM   8770  N N      . GLU A 1 84  ? 1.077   0.402   -14.454 1.00 0.00  ? 84  GLU A N      4  
ATOM   8771  C CA     . GLU A 1 84  ? 1.465   -0.575  -15.465 1.00 0.00  ? 84  GLU A CA     4  
ATOM   8772  C C      . GLU A 1 84  ? 1.067   -1.987  -15.068 1.00 0.00  ? 84  GLU A C      4  
ATOM   8773  O O      . GLU A 1 84  ? 1.164   -2.371  -13.903 1.00 0.00  ? 84  GLU A O      4  
ATOM   8774  C CB     . GLU A 1 84  ? 2.970   -0.523  -15.746 1.00 0.00  ? 84  GLU A CB     4  
ATOM   8775  C CG     . GLU A 1 84  ? 3.839   -0.890  -14.556 1.00 0.00  ? 84  GLU A CG     4  
ATOM   8776  C CD     . GLU A 1 84  ? 3.836   0.174   -13.478 1.00 0.00  ? 84  GLU A CD     4  
ATOM   8777  O OE1    . GLU A 1 84  ? 4.013   -0.182  -12.293 1.00 0.00  ? 84  GLU A OE1    4  
ATOM   8778  O OE2    . GLU A 1 84  ? 3.660   1.363   -13.817 1.00 0.00  ? 84  GLU A OE2    4  
ATOM   8779  H H      . GLU A 1 84  ? 1.421   0.316   -13.541 1.00 0.00  ? 84  GLU A H      4  
ATOM   8780  H HA     . GLU A 1 84  ? 0.943   -0.318  -16.370 1.00 0.00  ? 84  GLU A HA     4  
ATOM   8781  H HB2    . GLU A 1 84  ? 3.194   -1.209  -16.549 1.00 0.00  ? 84  GLU A HB2    4  
ATOM   8782  H HB3    . GLU A 1 84  ? 3.228   0.472   -16.057 1.00 0.00  ? 84  GLU A HB3    4  
ATOM   8783  H HG2    . GLU A 1 84  ? 3.476   -1.811  -14.134 1.00 0.00  ? 84  GLU A HG2    4  
ATOM   8784  H HG3    . GLU A 1 84  ? 4.853   -1.031  -14.900 1.00 0.00  ? 84  GLU A HG3    4  
ATOM   8785  H HE2    . GLU A 1 84  ? 3.671   1.983   -13.084 1.00 0.00  ? 84  GLU A HE2    4  
ATOM   8786  N N      . LEU A 1 85  ? 0.624   -2.758  -16.053 1.00 0.00  ? 85  LEU A N      4  
ATOM   8787  C CA     . LEU A 1 85  ? 0.220   -4.135  -15.824 1.00 0.00  ? 85  LEU A CA     4  
ATOM   8788  C C      . LEU A 1 85  ? 1.325   -5.086  -16.271 1.00 0.00  ? 85  LEU A C      4  
ATOM   8789  O O      . LEU A 1 85  ? 1.704   -5.104  -17.442 1.00 0.00  ? 85  LEU A O      4  
ATOM   8790  C CB     . LEU A 1 85  ? -1.085  -4.442  -16.566 1.00 0.00  ? 85  LEU A CB     4  
ATOM   8791  C CG     . LEU A 1 85  ? -2.183  -3.376  -16.433 1.00 0.00  ? 85  LEU A CG     4  
ATOM   8792  C CD1    . LEU A 1 85  ? -3.544  -3.957  -16.794 1.00 0.00  ? 85  LEU A CD1    4  
ATOM   8793  C CD2    . LEU A 1 85  ? -2.208  -2.799  -15.023 1.00 0.00  ? 85  LEU A CD2    4  
ATOM   8794  H H      . LEU A 1 85  ? 0.580   -2.394  -16.962 1.00 0.00  ? 85  LEU A H      4  
ATOM   8795  H HA     . LEU A 1 85  ? 0.061   -4.261  -14.767 1.00 0.00  ? 85  LEU A HA     4  
ATOM   8796  H HB2    . LEU A 1 85  ? -0.856  -4.562  -17.615 1.00 0.00  ? 85  LEU A HB2    4  
ATOM   8797  H HB3    . LEU A 1 85  ? -1.475  -5.376  -16.192 1.00 0.00  ? 85  LEU A HB3    4  
ATOM   8798  H HG     . LEU A 1 85  ? -1.975  -2.569  -17.121 1.00 0.00  ? 85  LEU A HG     4  
ATOM   8799  H HD11   . LEU A 1 85  ? -3.454  -5.025  -16.940 1.00 0.00  ? 85  LEU A HD11   4  
ATOM   8800  H HD12   . LEU A 1 85  ? -3.902  -3.499  -17.704 1.00 0.00  ? 85  LEU A HD12   4  
ATOM   8801  H HD13   . LEU A 1 85  ? -4.244  -3.763  -15.993 1.00 0.00  ? 85  LEU A HD13   4  
ATOM   8802  H HD21   . LEU A 1 85  ? -1.672  -1.863  -15.007 1.00 0.00  ? 85  LEU A HD21   4  
ATOM   8803  H HD22   . LEU A 1 85  ? -1.740  -3.494  -14.342 1.00 0.00  ? 85  LEU A HD22   4  
ATOM   8804  H HD23   . LEU A 1 85  ? -3.231  -2.633  -14.720 1.00 0.00  ? 85  LEU A HD23   4  
ATOM   8805  N N      . ASN A 1 86  ? 1.850   -5.865  -15.330 1.00 0.00  ? 86  ASN A N      4  
ATOM   8806  C CA     . ASN A 1 86  ? 2.925   -6.804  -15.635 1.00 0.00  ? 86  ASN A CA     4  
ATOM   8807  C C      . ASN A 1 86  ? 2.440   -8.244  -15.528 1.00 0.00  ? 86  ASN A C      4  
ATOM   8808  O O      . ASN A 1 86  ? 1.920   -8.666  -14.494 1.00 0.00  ? 86  ASN A O      4  
ATOM   8809  C CB     . ASN A 1 86  ? 4.115   -6.589  -14.693 1.00 0.00  ? 86  ASN A CB     4  
ATOM   8810  C CG     . ASN A 1 86  ? 4.304   -5.132  -14.308 1.00 0.00  ? 86  ASN A CG     4  
ATOM   8811  O OD1    . ASN A 1 86  ? 3.668   -4.636  -13.378 1.00 0.00  ? 86  ASN A OD1    4  
ATOM   8812  N ND2    . ASN A 1 86  ? 5.183   -4.437  -15.023 1.00 0.00  ? 86  ASN A ND2    4  
ATOM   8813  H H      . ASN A 1 86  ? 1.516   -5.797  -14.410 1.00 0.00  ? 86  ASN A H      4  
ATOM   8814  H HA     . ASN A 1 86  ? 3.245   -6.621  -16.649 1.00 0.00  ? 86  ASN A HA     4  
ATOM   8815  H HB2    . ASN A 1 86  ? 3.960   -7.159  -13.791 1.00 0.00  ? 86  ASN A HB2    4  
ATOM   8816  H HB3    . ASN A 1 86  ? 5.015   -6.932  -15.180 1.00 0.00  ? 86  ASN A HB3    4  
ATOM   8817  H HD21   . ASN A 1 86  ? 5.654   -4.897  -15.750 1.00 0.00  ? 86  ASN A HD21   4  
ATOM   8818  H HD22   . ASN A 1 86  ? 5.325   -3.496  -14.794 1.00 0.00  ? 86  ASN A HD22   4  
ATOM   8819  N N      . TYR A 1 87  ? 2.616   -8.995  -16.609 1.00 0.00  ? 87  TYR A N      4  
ATOM   8820  C CA     . TYR A 1 87  ? 2.203   -10.391 -16.656 1.00 0.00  ? 87  TYR A CA     4  
ATOM   8821  C C      . TYR A 1 87  ? 2.797   -11.089 -17.866 1.00 0.00  ? 87  TYR A C      4  
ATOM   8822  O O      . TYR A 1 87  ? 2.953   -10.486 -18.928 1.00 0.00  ? 87  TYR A O      4  
ATOM   8823  C CB     . TYR A 1 87  ? 0.684   -10.498 -16.704 1.00 0.00  ? 87  TYR A CB     4  
ATOM   8824  C CG     . TYR A 1 87  ? 0.064   -9.715  -17.840 1.00 0.00  ? 87  TYR A CG     4  
ATOM   8825  C CD1    . TYR A 1 87  ? 0.085   -10.213 -19.137 1.00 0.00  ? 87  TYR A CD1    4  
ATOM   8826  C CD2    . TYR A 1 87  ? -0.535  -8.482  -17.618 1.00 0.00  ? 87  TYR A CD2    4  
ATOM   8827  C CE1    . TYR A 1 87  ? -0.475  -9.505  -20.182 1.00 0.00  ? 87  TYR A CE1    4  
ATOM   8828  C CE2    . TYR A 1 87  ? -1.097  -7.766  -18.659 1.00 0.00  ? 87  TYR A CE2    4  
ATOM   8829  C CZ     . TYR A 1 87  ? -1.065  -8.282  -19.938 1.00 0.00  ? 87  TYR A CZ     4  
ATOM   8830  O OH     . TYR A 1 87  ? -1.623  -7.570  -20.977 1.00 0.00  ? 87  TYR A OH     4  
ATOM   8831  H H      . TYR A 1 87  ? 3.038   -8.598  -17.401 1.00 0.00  ? 87  TYR A H      4  
ATOM   8832  H HA     . TYR A 1 87  ? 2.562   -10.875 -15.760 1.00 0.00  ? 87  TYR A HA     4  
ATOM   8833  H HB2    . TYR A 1 87  ? 0.408   -11.534 -16.828 1.00 0.00  ? 87  TYR A HB2    4  
ATOM   8834  H HB3    . TYR A 1 87  ? 0.275   -10.130 -15.779 1.00 0.00  ? 87  TYR A HB3    4  
ATOM   8835  H HD1    . TYR A 1 87  ? 0.545   -11.172 -19.322 1.00 0.00  ? 87  TYR A HD1    4  
ATOM   8836  H HD2    . TYR A 1 87  ? -0.557  -8.081  -16.616 1.00 0.00  ? 87  TYR A HD2    4  
ATOM   8837  H HE1    . TYR A 1 87  ? -0.450  -9.911  -21.183 1.00 0.00  ? 87  TYR A HE1    4  
ATOM   8838  H HE2    . TYR A 1 87  ? -1.559  -6.809  -18.467 1.00 0.00  ? 87  TYR A HE2    4  
ATOM   8839  H HH     . TYR A 1 87  ? -1.883  -8.172  -21.679 1.00 0.00  ? 87  TYR A HH     4  
ATOM   8840  N N      . VAL A 1 88  ? 3.114   -12.363 -17.704 1.00 0.00  ? 88  VAL A N      4  
ATOM   8841  C CA     . VAL A 1 88  ? 3.684   -13.146 -18.791 1.00 0.00  ? 88  VAL A CA     4  
ATOM   8842  C C      . VAL A 1 88  ? 2.583   -13.728 -19.674 1.00 0.00  ? 88  VAL A C      4  
ATOM   8843  O O      . VAL A 1 88  ? 1.812   -14.589 -19.246 1.00 0.00  ? 88  VAL A O      4  
ATOM   8844  C CB     . VAL A 1 88  ? 4.599   -14.272 -18.264 1.00 0.00  ? 88  VAL A CB     4  
ATOM   8845  C CG1    . VAL A 1 88  ? 3.806   -15.319 -17.504 1.00 0.00  ? 88  VAL A CG1    4  
ATOM   8846  C CG2    . VAL A 1 88  ? 5.377   -14.905 -19.403 1.00 0.00  ? 88  VAL A CG2    4  
ATOM   8847  H H      . VAL A 1 88  ? 2.954   -12.786 -16.833 1.00 0.00  ? 88  VAL A H      4  
ATOM   8848  H HA     . VAL A 1 88  ? 4.286   -12.481 -19.394 1.00 0.00  ? 88  VAL A HA     4  
ATOM   8849  H HB     . VAL A 1 88  ? 5.309   -13.832 -17.579 1.00 0.00  ? 88  VAL A HB     4  
ATOM   8850  H HG11   . VAL A 1 88  ? 4.032   -15.245 -16.452 1.00 0.00  ? 88  VAL A HG11   4  
ATOM   8851  H HG12   . VAL A 1 88  ? 4.075   -16.302 -17.863 1.00 0.00  ? 88  VAL A HG12   4  
ATOM   8852  H HG13   . VAL A 1 88  ? 2.751   -15.157 -17.657 1.00 0.00  ? 88  VAL A HG13   4  
ATOM   8853  H HG21   . VAL A 1 88  ? 6.241   -14.299 -19.628 1.00 0.00  ? 88  VAL A HG21   4  
ATOM   8854  H HG22   . VAL A 1 88  ? 4.747   -14.972 -20.277 1.00 0.00  ? 88  VAL A HG22   4  
ATOM   8855  H HG23   . VAL A 1 88  ? 5.696   -15.895 -19.115 1.00 0.00  ? 88  VAL A HG23   4  
ATOM   8856  N N      . ALA A 1 89  ? 2.498   -13.240 -20.902 1.00 0.00  ? 89  ALA A N      4  
ATOM   8857  C CA     . ALA A 1 89  ? 1.479   -13.701 -21.834 1.00 0.00  ? 89  ALA A CA     4  
ATOM   8858  C C      . ALA A 1 89  ? 1.821   -15.087 -22.391 1.00 0.00  ? 89  ALA A C      4  
ATOM   8859  O O      . ALA A 1 89  ? 1.703   -16.088 -21.686 1.00 0.00  ? 89  ALA A O      4  
ATOM   8860  C CB     . ALA A 1 89  ? 1.297   -12.683 -22.951 1.00 0.00  ? 89  ALA A CB     4  
ATOM   8861  H H      . ALA A 1 89  ? 3.128   -12.545 -21.185 1.00 0.00  ? 89  ALA A H      4  
ATOM   8862  H HA     . ALA A 1 89  ? 0.547   -13.769 -21.288 1.00 0.00  ? 89  ALA A HA     4  
ATOM   8863  H HB1    . ALA A 1 89  ? 0.793   -11.809 -22.564 1.00 0.00  ? 89  ALA A HB1    4  
ATOM   8864  H HB2    . ALA A 1 89  ? 0.706   -13.118 -23.742 1.00 0.00  ? 89  ALA A HB2    4  
ATOM   8865  H HB3    . ALA A 1 89  ? 2.263   -12.396 -23.339 1.00 0.00  ? 89  ALA A HB3    4  
ATOM   8866  N N      . ARG A 1 90  ? 2.244   -15.147 -23.655 1.00 0.00  ? 90  ARG A N      4  
ATOM   8867  C CA     . ARG A 1 90  ? 2.594   -16.418 -24.279 1.00 0.00  ? 90  ARG A CA     4  
ATOM   8868  C C      . ARG A 1 90  ? 3.766   -17.067 -23.551 1.00 0.00  ? 90  ARG A C      4  
ATOM   8869  O O      . ARG A 1 90  ? 3.794   -18.283 -23.357 1.00 0.00  ? 90  ARG A O      4  
ATOM   8870  C CB     . ARG A 1 90  ? 2.940   -16.208 -25.756 1.00 0.00  ? 90  ARG A CB     4  
ATOM   8871  C CG     . ARG A 1 90  ? 3.993   -15.133 -25.992 1.00 0.00  ? 90  ARG A CG     4  
ATOM   8872  C CD     . ARG A 1 90  ? 5.273   -15.723 -26.563 1.00 0.00  ? 90  ARG A CD     4  
ATOM   8873  N NE     . ARG A 1 90  ? 6.455   -14.954 -26.178 1.00 0.00  ? 90  ARG A NE     4  
ATOM   8874  C CZ     . ARG A 1 90  ? 7.704   -15.384 -26.345 1.00 0.00  ? 90  ARG A CZ     4  
ATOM   8875  N NH1    . ARG A 1 90  ? 7.937   -16.576 -26.880 1.00 0.00  ? 90  ARG A NH1    4  
ATOM   8876  N NH2    . ARG A 1 90  ? 8.724   -14.619 -25.976 1.00 0.00  ? 90  ARG A NH2    4  
ATOM   8877  H H      . ARG A 1 90  ? 2.323   -14.324 -24.179 1.00 0.00  ? 90  ARG A H      4  
ATOM   8878  H HA     . ARG A 1 90  ? 1.735   -17.068 -24.206 1.00 0.00  ? 90  ARG A HA     4  
ATOM   8879  H HB2    . ARG A 1 90  ? 3.308   -17.139 -26.162 1.00 0.00  ? 90  ARG A HB2    4  
ATOM   8880  H HB3    . ARG A 1 90  ? 2.044   -15.924 -26.286 1.00 0.00  ? 90  ARG A HB3    4  
ATOM   8881  H HG2    . ARG A 1 90  ? 3.601   -14.408 -26.689 1.00 0.00  ? 90  ARG A HG2    4  
ATOM   8882  H HG3    . ARG A 1 90  ? 4.217   -14.649 -25.054 1.00 0.00  ? 90  ARG A HG3    4  
ATOM   8883  H HD2    . ARG A 1 90  ? 5.382   -16.734 -26.201 1.00 0.00  ? 90  ARG A HD2    4  
ATOM   8884  H HD3    . ARG A 1 90  ? 5.199   -15.735 -27.641 1.00 0.00  ? 90  ARG A HD3    4  
ATOM   8885  H HE     . ARG A 1 90  ? 6.310   -14.070 -25.777 1.00 0.00  ? 90  ARG A HE     4  
ATOM   8886  H HH11   . ARG A 1 90  ? 7.174   -17.158 -27.159 1.00 0.00  ? 90  ARG A HH11   4  
ATOM   8887  H HH12   . ARG A 1 90  ? 8.878   -16.894 -27.004 1.00 0.00  ? 90  ARG A HH12   4  
ATOM   8888  H HH21   . ARG A 1 90  ? 8.555   -13.720 -25.574 1.00 0.00  ? 90  ARG A HH21   4  
ATOM   8889  H HH22   . ARG A 1 90  ? 9.661   -14.944 -26.101 1.00 0.00  ? 90  ARG A HH22   4  
ATOM   8890  N N      . ASN A 1 91  ? 4.730   -16.246 -23.149 1.00 0.00  ? 91  ASN A N      4  
ATOM   8891  C CA     . ASN A 1 91  ? 5.908   -16.732 -22.441 1.00 0.00  ? 91  ASN A CA     4  
ATOM   8892  C C      . ASN A 1 91  ? 6.871   -15.590 -22.136 1.00 0.00  ? 91  ASN A C      4  
ATOM   8893  O O      . ASN A 1 91  ? 8.083   -15.790 -22.064 1.00 0.00  ? 91  ASN A O      4  
ATOM   8894  C CB     . ASN A 1 91  ? 6.623   -17.807 -23.266 1.00 0.00  ? 91  ASN A CB     4  
ATOM   8895  C CG     . ASN A 1 91  ? 7.146   -18.941 -22.406 1.00 0.00  ? 91  ASN A CG     4  
ATOM   8896  O OD1    . ASN A 1 91  ? 6.587   -19.245 -21.354 1.00 0.00  ? 91  ASN A OD1    4  
ATOM   8897  N ND2    . ASN A 1 91  ? 8.225   -19.570 -22.853 1.00 0.00  ? 91  ASN A ND2    4  
ATOM   8898  H H      . ASN A 1 91  ? 4.646   -15.290 -23.335 1.00 0.00  ? 91  ASN A H      4  
ATOM   8899  H HA     . ASN A 1 91  ? 5.576   -17.167 -21.509 1.00 0.00  ? 91  ASN A HA     4  
ATOM   8900  H HB2    . ASN A 1 91  ? 5.935   -18.218 -23.989 1.00 0.00  ? 91  ASN A HB2    4  
ATOM   8901  H HB3    . ASN A 1 91  ? 7.458   -17.358 -23.783 1.00 0.00  ? 91  ASN A HB3    4  
ATOM   8902  H HD21   . ASN A 1 91  ? 8.619   -19.269 -23.699 1.00 0.00  ? 91  ASN A HD21   4  
ATOM   8903  H HD22   . ASN A 1 91  ? 8.587   -20.306 -22.318 1.00 0.00  ? 91  ASN A HD22   4  
ATOM   8904  N N      . LYS A 1 92  ? 6.325   -14.391 -21.953 1.00 0.00  ? 92  LYS A N      4  
ATOM   8905  C CA     . LYS A 1 92  ? 7.138   -13.221 -21.653 1.00 0.00  ? 92  LYS A CA     4  
ATOM   8906  C C      . LYS A 1 92  ? 6.312   -12.150 -20.936 1.00 0.00  ? 92  LYS A C      4  
ATOM   8907  O O      . LYS A 1 92  ? 5.259   -11.736 -21.423 1.00 0.00  ? 92  LYS A O      4  
ATOM   8908  C CB     . LYS A 1 92  ? 7.747   -12.662 -22.937 1.00 0.00  ? 92  LYS A CB     4  
ATOM   8909  C CG     . LYS A 1 92  ? 9.217   -12.304 -22.802 1.00 0.00  ? 92  LYS A CG     4  
ATOM   8910  C CD     . LYS A 1 92  ? 10.101  -13.519 -23.026 1.00 0.00  ? 92  LYS A CD     4  
ATOM   8911  C CE     . LYS A 1 92  ? 11.577  -13.162 -22.952 1.00 0.00  ? 92  LYS A CE     4  
ATOM   8912  N NZ     . LYS A 1 92  ? 12.173  -13.533 -21.639 1.00 0.00  ? 92  LYS A NZ     4  
ATOM   8913  H H      . LYS A 1 92  ? 5.352   -14.289 -22.020 1.00 0.00  ? 92  LYS A H      4  
ATOM   8914  H HA     . LYS A 1 92  ? 7.937   -13.538 -20.997 1.00 0.00  ? 92  LYS A HA     4  
ATOM   8915  H HB2    . LYS A 1 92  ? 7.653   -13.402 -23.715 1.00 0.00  ? 92  LYS A HB2    4  
ATOM   8916  H HB3    . LYS A 1 92  ? 7.207   -11.778 -23.227 1.00 0.00  ? 92  LYS A HB3    4  
ATOM   8917  H HG2    . LYS A 1 92  ? 9.464   -11.549 -23.534 1.00 0.00  ? 92  LYS A HG2    4  
ATOM   8918  H HG3    . LYS A 1 92  ? 9.394   -11.917 -21.809 1.00 0.00  ? 92  LYS A HG3    4  
ATOM   8919  H HD2    . LYS A 1 92  ? 9.882   -14.254 -22.265 1.00 0.00  ? 92  LYS A HD2    4  
ATOM   8920  H HD3    . LYS A 1 92  ? 9.887   -13.933 -24.000 1.00 0.00  ? 92  LYS A HD3    4  
ATOM   8921  H HE2    . LYS A 1 92  ? 12.100  -13.687 -23.737 1.00 0.00  ? 92  LYS A HE2    4  
ATOM   8922  H HE3    . LYS A 1 92  ? 11.684  -12.097 -23.099 1.00 0.00  ? 92  LYS A HE3    4  
ATOM   8923  H HZ1    . LYS A 1 92  ? 12.786  -12.767 -21.296 1.00 0.00  ? 92  LYS A HZ1    4  
ATOM   8924  H HZ2    . LYS A 1 92  ? 12.741  -14.398 -21.737 1.00 0.00  ? 92  LYS A HZ2    4  
ATOM   8925  H HZ3    . LYS A 1 92  ? 11.421  -13.704 -20.940 1.00 0.00  ? 92  LYS A HZ3    4  
ATOM   8926  N N      . PRO A 1 93  ? 6.780   -11.697 -19.757 1.00 0.00  ? 93  PRO A N      4  
ATOM   8927  C CA     . PRO A 1 93  ? 6.089   -10.680 -18.955 1.00 0.00  ? 93  PRO A CA     4  
ATOM   8928  C C      . PRO A 1 93  ? 6.136   -9.305  -19.584 1.00 0.00  ? 93  PRO A C      4  
ATOM   8929  O O      . PRO A 1 93  ? 7.203   -8.714  -19.743 1.00 0.00  ? 93  PRO A O      4  
ATOM   8930  C CB     . PRO A 1 93  ? 6.856   -10.668 -17.646 1.00 0.00  ? 93  PRO A CB     4  
ATOM   8931  C CG     . PRO A 1 93  ? 8.217   -11.149 -18.013 1.00 0.00  ? 93  PRO A CG     4  
ATOM   8932  C CD     . PRO A 1 93  ? 8.018   -12.149 -19.111 1.00 0.00  ? 93  PRO A CD     4  
ATOM   8933  H HA     . PRO A 1 93  ? 5.065   -10.954 -18.767 1.00 0.00  ? 93  PRO A HA     4  
ATOM   8934  H HB2    . PRO A 1 93  ? 6.879   -9.661  -17.255 1.00 0.00  ? 93  PRO A HB2    4  
ATOM   8935  H HB3    . PRO A 1 93  ? 6.375   -11.324 -16.945 1.00 0.00  ? 93  PRO A HB3    4  
ATOM   8936  H HG2    . PRO A 1 93  ? 8.811   -10.325 -18.364 1.00 0.00  ? 93  PRO A HG2    4  
ATOM   8937  H HG3    . PRO A 1 93  ? 8.689   -11.612 -17.171 1.00 0.00  ? 93  PRO A HG3    4  
ATOM   8938  H HD2    . PRO A 1 93  ? 8.843   -12.124 -19.802 1.00 0.00  ? 93  PRO A HD2    4  
ATOM   8939  H HD3    . PRO A 1 93  ? 7.897   -13.138 -18.706 1.00 0.00  ? 93  PRO A HD3    4  
ATOM   8940  N N      . LYS A 1 94  ? 4.968   -8.806  -19.929 1.00 0.00  ? 94  LYS A N      4  
ATOM   8941  C CA     . LYS A 1 94  ? 4.842   -7.495  -20.554 1.00 0.00  ? 94  LYS A CA     4  
ATOM   8942  C C      . LYS A 1 94  ? 4.430   -6.428  -19.547 1.00 0.00  ? 94  LYS A C      4  
ATOM   8943  O O      . LYS A 1 94  ? 3.432   -6.577  -18.844 1.00 0.00  ? 94  LYS A O      4  
ATOM   8944  C CB     . LYS A 1 94  ? 3.807   -7.542  -21.684 1.00 0.00  ? 94  LYS A CB     4  
ATOM   8945  C CG     . LYS A 1 94  ? 4.295   -8.213  -22.959 1.00 0.00  ? 94  LYS A CG     4  
ATOM   8946  C CD     . LYS A 1 94  ? 4.687   -7.191  -24.017 1.00 0.00  ? 94  LYS A CD     4  
ATOM   8947  C CE     . LYS A 1 94  ? 3.464   -6.588  -24.685 1.00 0.00  ? 94  LYS A CE     4  
ATOM   8948  N NZ     . LYS A 1 94  ? 3.638   -6.460  -26.159 1.00 0.00  ? 94  LYS A NZ     4  
ATOM   8949  H H      . LYS A 1 94  ? 4.165   -9.337  -19.757 1.00 0.00  ? 94  LYS A H      4  
ATOM   8950  H HA     . LYS A 1 94  ? 5.801   -7.233  -20.970 1.00 0.00  ? 94  LYS A HA     4  
ATOM   8951  H HB2    . LYS A 1 94  ? 2.940   -8.079  -21.335 1.00 0.00  ? 94  LYS A HB2    4  
ATOM   8952  H HB3    . LYS A 1 94  ? 3.517   -6.530  -21.926 1.00 0.00  ? 94  LYS A HB3    4  
ATOM   8953  H HG2    . LYS A 1 94  ? 5.151   -8.824  -22.728 1.00 0.00  ? 94  LYS A HG2    4  
ATOM   8954  H HG3    . LYS A 1 94  ? 3.503   -8.835  -23.351 1.00 0.00  ? 94  LYS A HG3    4  
ATOM   8955  H HD2    . LYS A 1 94  ? 5.256   -6.401  -23.550 1.00 0.00  ? 94  LYS A HD2    4  
ATOM   8956  H HD3    . LYS A 1 94  ? 5.292   -7.678  -24.767 1.00 0.00  ? 94  LYS A HD3    4  
ATOM   8957  H HE2    . LYS A 1 94  ? 2.612   -7.223  -24.487 1.00 0.00  ? 94  LYS A HE2    4  
ATOM   8958  H HE3    . LYS A 1 94  ? 3.286   -5.608  -24.265 1.00 0.00  ? 94  LYS A HE3    4  
ATOM   8959  H HZ1    . LYS A 1 94  ? 2.742   -6.676  -26.643 1.00 0.00  ? 94  LYS A HZ1    4  
ATOM   8960  H HZ2    . LYS A 1 94  ? 4.366   -7.123  -26.492 1.00 0.00  ? 94  LYS A HZ2    4  
ATOM   8961  H HZ3    . LYS A 1 94  ? 3.928   -5.491  -26.403 1.00 0.00  ? 94  LYS A HZ3    4  
ATOM   8962  N N      . THR A 1 95  ? 5.182   -5.331  -19.511 1.00 0.00  ? 95  THR A N      4  
ATOM   8963  C CA     . THR A 1 95  ? 4.860   -4.225  -18.621 1.00 0.00  ? 95  THR A CA     4  
ATOM   8964  C C      . THR A 1 95  ? 4.054   -3.196  -19.396 1.00 0.00  ? 95  THR A C      4  
ATOM   8965  O O      . THR A 1 95  ? 4.592   -2.474  -20.237 1.00 0.00  ? 95  THR A O      4  
ATOM   8966  C CB     . THR A 1 95  ? 6.128   -3.583  -18.053 1.00 0.00  ? 95  THR A CB     4  
ATOM   8967  O OG1    . THR A 1 95  ? 6.827   -4.497  -17.227 1.00 0.00  ? 95  THR A OG1    4  
ATOM   8968  C CG2    . THR A 1 95  ? 5.857   -2.335  -17.233 1.00 0.00  ? 95  THR A CG2    4  
ATOM   8969  H H      . THR A 1 95  ? 5.950   -5.255  -20.117 1.00 0.00  ? 95  THR A H      4  
ATOM   8970  H HA     . THR A 1 95  ? 4.257   -4.609  -17.811 1.00 0.00  ? 95  THR A HA     4  
ATOM   8971  H HB     . THR A 1 95  ? 6.775   -3.304  -18.873 1.00 0.00  ? 95  THR A HB     4  
ATOM   8972  H HG1    . THR A 1 95  ? 7.047   -5.281  -17.733 1.00 0.00  ? 95  THR A HG1    4  
ATOM   8973  H HG21   . THR A 1 95  ? 6.252   -1.473  -17.749 1.00 0.00  ? 95  THR A HG21   4  
ATOM   8974  H HG22   . THR A 1 95  ? 6.334   -2.427  -16.269 1.00 0.00  ? 95  THR A HG22   4  
ATOM   8975  H HG23   . THR A 1 95  ? 4.790   -2.215  -17.094 1.00 0.00  ? 95  THR A HG23   4  
ATOM   8976  N N      . VAL A 1 96  ? 2.757   -3.156  -19.135 1.00 0.00  ? 96  VAL A N      4  
ATOM   8977  C CA     . VAL A 1 96  ? 1.875   -2.243  -19.840 1.00 0.00  ? 96  VAL A CA     4  
ATOM   8978  C C      . VAL A 1 96  ? 1.485   -1.051  -18.980 1.00 0.00  ? 96  VAL A C      4  
ATOM   8979  O O      . VAL A 1 96  ? 0.683   -1.176  -18.062 1.00 0.00  ? 96  VAL A O      4  
ATOM   8980  C CB     . VAL A 1 96  ? 0.590   -2.970  -20.285 1.00 0.00  ? 96  VAL A CB     4  
ATOM   8981  C CG1    . VAL A 1 96  ? -0.274  -2.056  -21.144 1.00 0.00  ? 96  VAL A CG1    4  
ATOM   8982  C CG2    . VAL A 1 96  ? 0.930   -4.253  -21.032 1.00 0.00  ? 96  VAL A CG2    4  
ATOM   8983  H H      . VAL A 1 96  ? 2.381   -3.773  -18.474 1.00 0.00  ? 96  VAL A H      4  
ATOM   8984  H HA     . VAL A 1 96  ? 2.388   -1.891  -20.722 1.00 0.00  ? 96  VAL A HA     4  
ATOM   8985  H HB     . VAL A 1 96  ? 0.029   -3.234  -19.396 1.00 0.00  ? 96  VAL A HB     4  
ATOM   8986  H HG11   . VAL A 1 96  ? -1.116  -2.614  -21.527 1.00 0.00  ? 96  VAL A HG11   4  
ATOM   8987  H HG12   . VAL A 1 96  ? 0.311   -1.677  -21.969 1.00 0.00  ? 96  VAL A HG12   4  
ATOM   8988  H HG13   . VAL A 1 96  ? -0.631  -1.231  -20.546 1.00 0.00  ? 96  VAL A HG13   4  
ATOM   8989  H HG21   . VAL A 1 96  ? 1.042   -4.038  -22.085 1.00 0.00  ? 96  VAL A HG21   4  
ATOM   8990  H HG22   . VAL A 1 96  ? 0.135   -4.971  -20.895 1.00 0.00  ? 96  VAL A HG22   4  
ATOM   8991  H HG23   . VAL A 1 96  ? 1.853   -4.660  -20.651 1.00 0.00  ? 96  VAL A HG23   4  
ATOM   8992  N N      . ILE A 1 97  ? 2.027   0.118   -19.318 1.00 0.00  ? 97  ILE A N      4  
ATOM   8993  C CA     . ILE A 1 97  ? 1.704   1.344   -18.604 1.00 0.00  ? 97  ILE A CA     4  
ATOM   8994  C C      . ILE A 1 97  ? 0.452   1.950   -19.218 1.00 0.00  ? 97  ILE A C      4  
ATOM   8995  O O      . ILE A 1 97  ? 0.304   1.961   -20.440 1.00 0.00  ? 97  ILE A O      4  
ATOM   8996  C CB     . ILE A 1 97  ? 2.857   2.369   -18.666 1.00 0.00  ? 97  ILE A CB     4  
ATOM   8997  C CG1    . ILE A 1 97  ? 4.182   1.713   -18.229 1.00 0.00  ? 97  ILE A CG1    4  
ATOM   8998  C CG2    . ILE A 1 97  ? 2.521   3.602   -17.827 1.00 0.00  ? 97  ILE A CG2    4  
ATOM   8999  C CD1    . ILE A 1 97  ? 4.627   2.040   -16.815 1.00 0.00  ? 97  ILE A CD1    4  
ATOM   9000  H H      . ILE A 1 97  ? 2.637   0.156   -20.083 1.00 0.00  ? 97  ILE A H      4  
ATOM   9001  H HA     . ILE A 1 97  ? 1.510   1.096   -17.570 1.00 0.00  ? 97  ILE A HA     4  
ATOM   9002  H HB     . ILE A 1 97  ? 2.951   2.693   -19.692 1.00 0.00  ? 97  ILE A HB     4  
ATOM   9003  H HG12   . ILE A 1 97  ? 4.078   0.640   -18.292 1.00 0.00  ? 97  ILE A HG12   4  
ATOM   9004  H HG13   . ILE A 1 97  ? 4.968   2.029   -18.903 1.00 0.00  ? 97  ILE A HG13   4  
ATOM   9005  H HG21   . ILE A 1 97  ? 2.185   4.396   -18.474 1.00 0.00  ? 97  ILE A HG21   4  
ATOM   9006  H HG22   . ILE A 1 97  ? 3.398   3.925   -17.287 1.00 0.00  ? 97  ILE A HG22   4  
ATOM   9007  H HG23   . ILE A 1 97  ? 1.738   3.356   -17.125 1.00 0.00  ? 97  ILE A HG23   4  
ATOM   9008  H HD11   . ILE A 1 97  ? 5.086   1.169   -16.371 1.00 0.00  ? 97  ILE A HD11   4  
ATOM   9009  H HD12   . ILE A 1 97  ? 3.770   2.331   -16.225 1.00 0.00  ? 97  ILE A HD12   4  
ATOM   9010  H HD13   . ILE A 1 97  ? 5.341   2.850   -16.839 1.00 0.00  ? 97  ILE A HD13   4  
ATOM   9011  N N      . TYR A 1 98  ? -0.467  2.416   -18.384 1.00 0.00  ? 98  TYR A N      4  
ATOM   9012  C CA     . TYR A 1 98  ? -1.715  2.973   -18.890 1.00 0.00  ? 98  TYR A CA     4  
ATOM   9013  C C      . TYR A 1 98  ? -1.959  4.402   -18.418 1.00 0.00  ? 98  TYR A C      4  
ATOM   9014  O O      . TYR A 1 98  ? -1.890  4.702   -17.226 1.00 0.00  ? 98  TYR A O      4  
ATOM   9015  C CB     . TYR A 1 98  ? -2.881  2.083   -18.468 1.00 0.00  ? 98  TYR A CB     4  
ATOM   9016  C CG     . TYR A 1 98  ? -3.016  0.839   -19.312 1.00 0.00  ? 98  TYR A CG     4  
ATOM   9017  C CD1    . TYR A 1 98  ? -3.328  0.925   -20.663 1.00 0.00  ? 98  TYR A CD1    4  
ATOM   9018  C CD2    . TYR A 1 98  ? -2.833  -0.423  -18.761 1.00 0.00  ? 98  TYR A CD2    4  
ATOM   9019  C CE1    . TYR A 1 98  ? -3.453  -0.211  -21.440 1.00 0.00  ? 98  TYR A CE1    4  
ATOM   9020  C CE2    . TYR A 1 98  ? -2.956  -1.563  -19.531 1.00 0.00  ? 98  TYR A CE2    4  
ATOM   9021  C CZ     . TYR A 1 98  ? -3.267  -1.451  -20.870 1.00 0.00  ? 98  TYR A CZ     4  
ATOM   9022  O OH     . TYR A 1 98  ? -3.393  -2.585  -21.639 1.00 0.00  ? 98  TYR A OH     4  
ATOM   9023  H H      . TYR A 1 98  ? -0.318  2.358   -17.417 1.00 0.00  ? 98  TYR A H      4  
ATOM   9024  H HA     . TYR A 1 98  ? -1.659  2.973   -19.966 1.00 0.00  ? 98  TYR A HA     4  
ATOM   9025  H HB2    . TYR A 1 98  ? -2.739  1.775   -17.443 1.00 0.00  ? 98  TYR A HB2    4  
ATOM   9026  H HB3    . TYR A 1 98  ? -3.799  2.643   -18.548 1.00 0.00  ? 98  TYR A HB3    4  
ATOM   9027  H HD1    . TYR A 1 98  ? -3.470  1.899   -21.108 1.00 0.00  ? 98  TYR A HD1    4  
ATOM   9028  H HD2    . TYR A 1 98  ? -2.590  -0.507  -17.711 1.00 0.00  ? 98  TYR A HD2    4  
ATOM   9029  H HE1    . TYR A 1 98  ? -3.694  -0.123  -22.490 1.00 0.00  ? 98  TYR A HE1    4  
ATOM   9030  H HE2    . TYR A 1 98  ? -2.811  -2.536  -19.084 1.00 0.00  ? 98  TYR A HE2    4  
ATOM   9031  H HH     . TYR A 1 98  ? -4.318  -2.836  -21.690 1.00 0.00  ? 98  TYR A HH     4  
ATOM   9032  N N      . TRP A 1 99  ? -2.269  5.267   -19.377 1.00 0.00  ? 99  TRP A N      4  
ATOM   9033  C CA     . TRP A 1 99  ? -2.557  6.668   -19.100 1.00 0.00  ? 99  TRP A CA     4  
ATOM   9034  C C      . TRP A 1 99  ? -4.006  6.980   -19.444 1.00 0.00  ? 99  TRP A C      4  
ATOM   9035  O O      . TRP A 1 99  ? -4.570  6.391   -20.367 1.00 0.00  ? 99  TRP A O      4  
ATOM   9036  C CB     . TRP A 1 99  ? -1.641  7.579   -19.919 1.00 0.00  ? 99  TRP A CB     4  
ATOM   9037  C CG     . TRP A 1 99  ? -0.327  7.853   -19.261 1.00 0.00  ? 99  TRP A CG     4  
ATOM   9038  C CD1    . TRP A 1 99  ? -0.074  8.764   -18.276 1.00 0.00  ? 99  TRP A CD1    4  
ATOM   9039  C CD2    . TRP A 1 99  ? 0.915   7.212   -19.549 1.00 0.00  ? 99  TRP A CD2    4  
ATOM   9040  N NE1    . TRP A 1 99  ? 1.256   8.725   -17.931 1.00 0.00  ? 99  TRP A NE1    4  
ATOM   9041  C CE2    . TRP A 1 99  ? 1.884   7.779   -18.698 1.00 0.00  ? 99  TRP A CE2    4  
ATOM   9042  C CE3    . TRP A 1 99  ? 1.304   6.211   -20.442 1.00 0.00  ? 99  TRP A CE3    4  
ATOM   9043  C CZ2    . TRP A 1 99  ? 3.217   7.375   -18.715 1.00 0.00  ? 99  TRP A CZ2    4  
ATOM   9044  C CZ3    . TRP A 1 99  ? 2.627   5.812   -20.458 1.00 0.00  ? 99  TRP A CZ3    4  
ATOM   9045  C CH2    . TRP A 1 99  ? 3.567   6.392   -19.598 1.00 0.00  ? 99  TRP A CH2    4  
ATOM   9046  H H      . TRP A 1 99  ? -2.320  4.948   -20.302 1.00 0.00  ? 99  TRP A H      4  
ATOM   9047  H HA     . TRP A 1 99  ? -2.393  6.847   -18.048 1.00 0.00  ? 99  TRP A HA     4  
ATOM   9048  H HB2    . TRP A 1 99  ? -1.445  7.113   -20.873 1.00 0.00  ? 99  TRP A HB2    4  
ATOM   9049  H HB3    . TRP A 1 99  ? -2.140  8.523   -20.082 1.00 0.00  ? 99  TRP A HB3    4  
ATOM   9050  H HD1    . TRP A 1 99  ? -0.820  9.412   -17.842 1.00 0.00  ? 99  TRP A HD1    4  
ATOM   9051  H HE1    . TRP A 1 99  ? 1.683   9.281   -17.247 1.00 0.00  ? 99  TRP A HE1    4  
ATOM   9052  H HE3    . TRP A 1 99  ? 0.591   5.756   -21.113 1.00 0.00  ? 99  TRP A HE3    4  
ATOM   9053  H HZ2    . TRP A 1 99  ? 3.954   7.810   -18.059 1.00 0.00  ? 99  TRP A HZ2    4  
ATOM   9054  H HZ3    . TRP A 1 99  ? 2.947   5.037   -21.141 1.00 0.00  ? 99  TRP A HZ3    4  
ATOM   9055  H HH2    . TRP A 1 99  ? 4.587   6.050   -19.645 1.00 0.00  ? 99  TRP A HH2    4  
ATOM   9056  N N      . LEU A 1 100 ? -4.604  7.916   -18.722 1.00 0.00  ? 100 LEU A N      4  
ATOM   9057  C CA     . LEU A 1 100 ? -5.983  8.299   -18.995 1.00 0.00  ? 100 LEU A CA     4  
ATOM   9058  C C      . LEU A 1 100 ? -6.017  9.314   -20.124 1.00 0.00  ? 100 LEU A C      4  
ATOM   9059  O O      . LEU A 1 100 ? -5.326  10.325  -20.075 1.00 0.00  ? 100 LEU A O      4  
ATOM   9060  C CB     . LEU A 1 100 ? -6.644  8.890   -17.747 1.00 0.00  ? 100 LEU A CB     4  
ATOM   9061  C CG     . LEU A 1 100 ? -6.267  8.218   -16.429 1.00 0.00  ? 100 LEU A CG     4  
ATOM   9062  C CD1    . LEU A 1 100 ? -7.101  8.777   -15.286 1.00 0.00  ? 100 LEU A CD1    4  
ATOM   9063  C CD2    . LEU A 1 100 ? -6.443  6.714   -16.530 1.00 0.00  ? 100 LEU A CD2    4  
ATOM   9064  H H      . LEU A 1 100 ? -4.110  8.367   -18.008 1.00 0.00  ? 100 LEU A H      4  
ATOM   9065  H HA     . LEU A 1 100 ? -6.522  7.414   -19.298 1.00 0.00  ? 100 LEU A HA     4  
ATOM   9066  H HB2    . LEU A 1 100 ? -6.371  9.931   -17.685 1.00 0.00  ? 100 LEU A HB2    4  
ATOM   9067  H HB3    . LEU A 1 100 ? -7.714  8.821   -17.867 1.00 0.00  ? 100 LEU A HB3    4  
ATOM   9068  H HG     . LEU A 1 100 ? -5.228  8.423   -16.217 1.00 0.00  ? 100 LEU A HG     4  
ATOM   9069  H HD11   . LEU A 1 100 ? -6.565  8.657   -14.356 1.00 0.00  ? 100 LEU A HD11   4  
ATOM   9070  H HD12   . LEU A 1 100 ? -8.039  8.247   -15.232 1.00 0.00  ? 100 LEU A HD12   4  
ATOM   9071  H HD13   . LEU A 1 100 ? -7.291  9.827   -15.458 1.00 0.00  ? 100 LEU A HD13   4  
ATOM   9072  H HD21   . LEU A 1 100 ? -7.474  6.487   -16.760 1.00 0.00  ? 100 LEU A HD21   4  
ATOM   9073  H HD22   . LEU A 1 100 ? -6.177  6.257   -15.590 1.00 0.00  ? 100 LEU A HD22   4  
ATOM   9074  H HD23   . LEU A 1 100 ? -5.806  6.329   -17.312 1.00 0.00  ? 100 LEU A HD23   4  
ATOM   9075  N N      . ALA A 1 101 ? -6.818  9.042   -21.142 1.00 0.00  ? 101 ALA A N      4  
ATOM   9076  C CA     . ALA A 1 101 ? -6.927  9.945   -22.277 1.00 0.00  ? 101 ALA A CA     4  
ATOM   9077  C C      . ALA A 1 101 ? -8.384  10.165  -22.648 1.00 0.00  ? 101 ALA A C      4  
ATOM   9078  O O      . ALA A 1 101 ? -9.199  9.259   -22.536 1.00 0.00  ? 101 ALA A O      4  
ATOM   9079  C CB     . ALA A 1 101 ? -6.153  9.399   -23.468 1.00 0.00  ? 101 ALA A CB     4  
ATOM   9080  H H      . ALA A 1 101 ? -7.345  8.217   -21.132 1.00 0.00  ? 101 ALA A H      4  
ATOM   9081  H HA     . ALA A 1 101 ? -6.488  10.889  -21.994 1.00 0.00  ? 101 ALA A HA     4  
ATOM   9082  H HB1    . ALA A 1 101 ? -6.755  8.669   -23.985 1.00 0.00  ? 101 ALA A HB1    4  
ATOM   9083  H HB2    . ALA A 1 101 ? -5.241  8.934   -23.121 1.00 0.00  ? 101 ALA A HB2    4  
ATOM   9084  H HB3    . ALA A 1 101 ? -5.911  10.208  -24.141 1.00 0.00  ? 101 ALA A HB3    4  
ATOM   9085  N N      . GLU A 1 102 ? -8.710  11.375  -23.081 1.00 0.00  ? 102 GLU A N      4  
ATOM   9086  C CA     . GLU A 1 102 ? -10.081 11.696  -23.456 1.00 0.00  ? 102 GLU A CA     4  
ATOM   9087  C C      . GLU A 1 102 ? -10.160 12.207  -24.888 1.00 0.00  ? 102 GLU A C      4  
ATOM   9088  O O      . GLU A 1 102 ? -9.602  13.254  -25.215 1.00 0.00  ? 102 GLU A O      4  
ATOM   9089  C CB     . GLU A 1 102 ? -10.662 12.739  -22.501 1.00 0.00  ? 102 GLU A CB     4  
ATOM   9090  C CG     . GLU A 1 102 ? -12.124 13.064  -22.774 1.00 0.00  ? 102 GLU A CG     4  
ATOM   9091  C CD     . GLU A 1 102 ? -12.324 14.485  -23.265 1.00 0.00  ? 102 GLU A CD     4  
ATOM   9092  O OE1    . GLU A 1 102 ? -13.105 15.227  -22.634 1.00 0.00  ? 102 GLU A OE1    4  
ATOM   9093  O OE2    . GLU A 1 102 ? -11.696 14.857  -24.278 1.00 0.00  ? 102 GLU A OE2    4  
ATOM   9094  H H      . GLU A 1 102 ? -8.019  12.063  -23.142 1.00 0.00  ? 102 GLU A H      4  
ATOM   9095  H HA     . GLU A 1 102 ? -10.661 10.790  -23.381 1.00 0.00  ? 102 GLU A HA     4  
ATOM   9096  H HB2    . GLU A 1 102 ? -10.582 12.369  -21.489 1.00 0.00  ? 102 GLU A HB2    4  
ATOM   9097  H HB3    . GLU A 1 102 ? -10.091 13.650  -22.590 1.00 0.00  ? 102 GLU A HB3    4  
ATOM   9098  H HG2    . GLU A 1 102 ? -12.496 12.387  -23.526 1.00 0.00  ? 102 GLU A HG2    4  
ATOM   9099  H HG3    . GLU A 1 102 ? -12.686 12.931  -21.861 1.00 0.00  ? 102 GLU A HG3    4  
ATOM   9100  H HE2    . GLU A 1 102 ? -11.869 15.766  -24.532 1.00 0.00  ? 102 GLU A HE2    4  
ATOM   9101  N N      . VAL A 1 103 ? -10.861 11.462  -25.739 1.00 0.00  ? 103 VAL A N      4  
ATOM   9102  C CA     . VAL A 1 103 ? -11.012 11.848  -27.133 1.00 0.00  ? 103 VAL A CA     4  
ATOM   9103  C C      . VAL A 1 103 ? -12.039 12.969  -27.278 1.00 0.00  ? 103 VAL A C      4  
ATOM   9104  O O      . VAL A 1 103 ? -13.196 12.834  -26.884 1.00 0.00  ? 103 VAL A O      4  
ATOM   9105  C CB     . VAL A 1 103 ? -11.381 10.639  -28.027 1.00 0.00  ? 103 VAL A CB     4  
ATOM   9106  C CG1    . VAL A 1 103 ? -10.447 9.482   -27.737 1.00 0.00  ? 103 VAL A CG1    4  
ATOM   9107  C CG2    . VAL A 1 103 ? -12.825 10.190  -27.840 1.00 0.00  ? 103 VAL A CG2    4  
ATOM   9108  H H      . VAL A 1 103 ? -11.285 10.638  -25.420 1.00 0.00  ? 103 VAL A H      4  
ATOM   9109  H HA     . VAL A 1 103 ? -10.055 12.224  -27.464 1.00 0.00  ? 103 VAL A HA     4  
ATOM   9110  H HB     . VAL A 1 103 ? -11.246 10.927  -29.059 1.00 0.00  ? 103 VAL A HB     4  
ATOM   9111  H HG11   . VAL A 1 103 ? -10.204 8.971   -28.659 1.00 0.00  ? 103 VAL A HG11   4  
ATOM   9112  H HG12   . VAL A 1 103 ? -10.935 8.798   -27.064 1.00 0.00  ? 103 VAL A HG12   4  
ATOM   9113  H HG13   . VAL A 1 103 ? -9.545  9.854   -27.278 1.00 0.00  ? 103 VAL A HG13   4  
ATOM   9114  H HG21   . VAL A 1 103 ? -12.854 9.347   -27.163 1.00 0.00  ? 103 VAL A HG21   4  
ATOM   9115  H HG22   . VAL A 1 103 ? -13.233 9.898   -28.795 1.00 0.00  ? 103 VAL A HG22   4  
ATOM   9116  H HG23   . VAL A 1 103 ? -13.412 10.995  -27.434 1.00 0.00  ? 103 VAL A HG23   4  
ATOM   9117  N N      . LYS A 1 104 ? -11.589 14.088  -27.831 1.00 0.00  ? 104 LYS A N      4  
ATOM   9118  C CA     . LYS A 1 104 ? -12.451 15.251  -28.020 1.00 0.00  ? 104 LYS A CA     4  
ATOM   9119  C C      . LYS A 1 104 ? -13.605 14.944  -28.970 1.00 0.00  ? 104 LYS A C      4  
ATOM   9120  O O      . LYS A 1 104 ? -14.629 15.628  -28.955 1.00 0.00  ? 104 LYS A O      4  
ATOM   9121  C CB     . LYS A 1 104 ? -11.635 16.417  -28.573 1.00 0.00  ? 104 LYS A CB     4  
ATOM   9122  C CG     . LYS A 1 104 ? -10.826 16.043  -29.807 1.00 0.00  ? 104 LYS A CG     4  
ATOM   9123  C CD     . LYS A 1 104 ? -9.400  16.578  -29.759 1.00 0.00  ? 104 LYS A CD     4  
ATOM   9124  C CE     . LYS A 1 104 ? -8.714  16.291  -28.427 1.00 0.00  ? 104 LYS A CE     4  
ATOM   9125  N NZ     . LYS A 1 104 ? -8.428  17.542  -27.669 1.00 0.00  ? 104 LYS A NZ     4  
ATOM   9126  H H      . LYS A 1 104 ? -10.651 14.137  -28.109 1.00 0.00  ? 104 LYS A H      4  
ATOM   9127  H HA     . LYS A 1 104 ? -12.852 15.529  -27.057 1.00 0.00  ? 104 LYS A HA     4  
ATOM   9128  H HB2    . LYS A 1 104 ? -12.309 17.220  -28.839 1.00 0.00  ? 104 LYS A HB2    4  
ATOM   9129  H HB3    . LYS A 1 104 ? -10.957 16.765  -27.809 1.00 0.00  ? 104 LYS A HB3    4  
ATOM   9130  H HG2    . LYS A 1 104 ? -10.789 14.967  -29.885 1.00 0.00  ? 104 LYS A HG2    4  
ATOM   9131  H HG3    . LYS A 1 104 ? -11.321 16.447  -30.678 1.00 0.00  ? 104 LYS A HG3    4  
ATOM   9132  H HD2    . LYS A 1 104 ? -8.835  16.105  -30.545 1.00 0.00  ? 104 LYS A HD2    4  
ATOM   9133  H HD3    . LYS A 1 104 ? -9.422  17.646  -29.921 1.00 0.00  ? 104 LYS A HD3    4  
ATOM   9134  H HE2    . LYS A 1 104 ? -9.356  15.659  -27.831 1.00 0.00  ? 104 LYS A HE2    4  
ATOM   9135  H HE3    . LYS A 1 104 ? -7.785  15.779  -28.618 1.00 0.00  ? 104 LYS A HE3    4  
ATOM   9136  H HZ1    . LYS A 1 104 ? -7.449  17.529  -27.317 1.00 0.00  ? 104 LYS A HZ1    4  
ATOM   9137  H HZ2    . LYS A 1 104 ? -9.073  17.625  -26.858 1.00 0.00  ? 104 LYS A HZ2    4  
ATOM   9138  H HZ3    . LYS A 1 104 ? -8.552  18.371  -28.285 1.00 0.00  ? 104 LYS A HZ3    4  
ATOM   9139  N N      . ASP A 1 105 ? -13.433 13.925  -29.807 1.00 0.00  ? 105 ASP A N      4  
ATOM   9140  C CA     . ASP A 1 105 ? -14.466 13.557  -30.769 1.00 0.00  ? 105 ASP A CA     4  
ATOM   9141  C C      . ASP A 1 105 ? -15.209 12.293  -30.344 1.00 0.00  ? 105 ASP A C      4  
ATOM   9142  O O      . ASP A 1 105 ? -14.614 11.226  -30.203 1.00 0.00  ? 105 ASP A O      4  
ATOM   9143  C CB     . ASP A 1 105 ? -13.837 13.367  -32.149 1.00 0.00  ? 105 ASP A CB     4  
ATOM   9144  C CG     . ASP A 1 105 ? -13.242 14.648  -32.693 1.00 0.00  ? 105 ASP A CG     4  
ATOM   9145  O OD1    . ASP A 1 105 ? -13.886 15.282  -33.555 1.00 0.00  ? 105 ASP A OD1    4  
ATOM   9146  O OD2    . ASP A 1 105 ? -12.130 15.017  -32.257 1.00 0.00  ? 105 ASP A OD2    4  
ATOM   9147  H H      . ASP A 1 105 ? -12.591 13.419  -29.787 1.00 0.00  ? 105 ASP A H      4  
ATOM   9148  H HA     . ASP A 1 105 ? -15.172 14.368  -30.819 1.00 0.00  ? 105 ASP A HA     4  
ATOM   9149  H HB2    . ASP A 1 105 ? -13.052 12.637  -32.076 1.00 0.00  ? 105 ASP A HB2    4  
ATOM   9150  H HB3    . ASP A 1 105 ? -14.589 13.014  -32.839 1.00 0.00  ? 105 ASP A HB3    4  
ATOM   9151  H HD2    . ASP A 1 105 ? -11.813 15.836  -32.645 1.00 0.00  ? 105 ASP A HD2    4  
ATOM   9152  N N      . TYR A 1 106 ? -16.519 12.427  -30.153 1.00 0.00  ? 106 TYR A N      4  
ATOM   9153  C CA     . TYR A 1 106 ? -17.361 11.301  -29.758 1.00 0.00  ? 106 TYR A CA     4  
ATOM   9154  C C      . TYR A 1 106 ? -17.364 10.239  -30.850 1.00 0.00  ? 106 TYR A C      4  
ATOM   9155  O O      . TYR A 1 106 ? -17.235 9.046   -30.575 1.00 0.00  ? 106 TYR A O      4  
ATOM   9156  C CB     . TYR A 1 106 ? -18.792 11.771  -29.482 1.00 0.00  ? 106 TYR A CB     4  
ATOM   9157  C CG     . TYR A 1 106 ? -19.304 11.396  -28.108 1.00 0.00  ? 106 TYR A CG     4  
ATOM   9158  C CD1    . TYR A 1 106 ? -19.192 10.095  -27.633 1.00 0.00  ? 106 TYR A CD1    4  
ATOM   9159  C CD2    . TYR A 1 106 ? -19.896 12.345  -27.285 1.00 0.00  ? 106 TYR A CD2    4  
ATOM   9160  C CE1    . TYR A 1 106 ? -19.657 9.751   -26.379 1.00 0.00  ? 106 TYR A CE1    4  
ATOM   9161  C CE2    . TYR A 1 106 ? -20.363 12.009  -26.029 1.00 0.00  ? 106 TYR A CE2    4  
ATOM   9162  C CZ     . TYR A 1 106 ? -20.241 10.710  -25.581 1.00 0.00  ? 106 TYR A CZ     4  
ATOM   9163  O OH     . TYR A 1 106 ? -20.704 10.372  -24.331 1.00 0.00  ? 106 TYR A OH     4  
ATOM   9164  H H      . TYR A 1 106 ? -16.931 13.304  -30.291 1.00 0.00  ? 106 TYR A H      4  
ATOM   9165  H HA     . TYR A 1 106 ? -16.948 10.873  -28.856 1.00 0.00  ? 106 TYR A HA     4  
ATOM   9166  H HB2    . TYR A 1 106 ? -18.831 12.847  -29.566 1.00 0.00  ? 106 TYR A HB2    4  
ATOM   9167  H HB3    . TYR A 1 106 ? -19.455 11.335  -30.214 1.00 0.00  ? 106 TYR A HB3    4  
ATOM   9168  H HD1    . TYR A 1 106 ? -18.735 9.344   -28.261 1.00 0.00  ? 106 TYR A HD1    4  
ATOM   9169  H HD2    . TYR A 1 106 ? -19.991 13.361  -27.638 1.00 0.00  ? 106 TYR A HD2    4  
ATOM   9170  H HE1    . TYR A 1 106 ? -19.562 8.733   -26.027 1.00 0.00  ? 106 TYR A HE1    4  
ATOM   9171  H HE2    . TYR A 1 106 ? -20.821 12.760  -25.404 1.00 0.00  ? 106 TYR A HE2    4  
ATOM   9172  H HH     . TYR A 1 106 ? -21.453 9.777   -24.416 1.00 0.00  ? 106 TYR A HH     4  
ATOM   9173  N N      . ASP A 1 107 ? -17.491 10.690  -32.093 1.00 0.00  ? 107 ASP A N      4  
ATOM   9174  C CA     . ASP A 1 107 ? -17.487 9.794   -33.241 1.00 0.00  ? 107 ASP A CA     4  
ATOM   9175  C C      . ASP A 1 107 ? -16.088 9.724   -33.846 1.00 0.00  ? 107 ASP A C      4  
ATOM   9176  O O      . ASP A 1 107 ? -15.919 9.366   -35.012 1.00 0.00  ? 107 ASP A O      4  
ATOM   9177  C CB     . ASP A 1 107 ? -18.486 10.271  -34.294 1.00 0.00  ? 107 ASP A CB     4  
ATOM   9178  C CG     . ASP A 1 107 ? -19.904 9.837   -33.985 1.00 0.00  ? 107 ASP A CG     4  
ATOM   9179  O OD1    . ASP A 1 107 ? -20.775 10.719  -33.830 1.00 0.00  ? 107 ASP A OD1    4  
ATOM   9180  O OD2    . ASP A 1 107 ? -20.145 8.614   -33.897 1.00 0.00  ? 107 ASP A OD2    4  
ATOM   9181  H H      . ASP A 1 107 ? -17.573 11.655  -32.243 1.00 0.00  ? 107 ASP A H      4  
ATOM   9182  H HA     . ASP A 1 107 ? -17.773 8.810   -32.900 1.00 0.00  ? 107 ASP A HA     4  
ATOM   9183  H HB2    . ASP A 1 107 ? -18.463 11.349  -34.339 1.00 0.00  ? 107 ASP A HB2    4  
ATOM   9184  H HB3    . ASP A 1 107 ? -18.206 9.869   -35.257 1.00 0.00  ? 107 ASP A HB3    4  
ATOM   9185  H HD2    . ASP A 1 107 ? -21.062 8.411   -33.700 1.00 0.00  ? 107 ASP A HD2    4  
ATOM   9186  N N      . VAL A 1 108 ? -15.091 10.078  -33.034 1.00 0.00  ? 108 VAL A N      4  
ATOM   9187  C CA     . VAL A 1 108 ? -13.698 10.073  -33.452 1.00 0.00  ? 108 VAL A CA     4  
ATOM   9188  C C      . VAL A 1 108 ? -13.369 8.831   -34.275 1.00 0.00  ? 108 VAL A C      4  
ATOM   9189  O O      . VAL A 1 108 ? -13.924 7.756   -34.048 1.00 0.00  ? 108 VAL A O      4  
ATOM   9190  C CB     . VAL A 1 108 ? -12.770 10.151  -32.221 1.00 0.00  ? 108 VAL A CB     4  
ATOM   9191  C CG1    . VAL A 1 108 ? -13.105 9.059   -31.230 1.00 0.00  ? 108 VAL A CG1    4  
ATOM   9192  C CG2    . VAL A 1 108 ? -11.306 10.093  -32.623 1.00 0.00  ? 108 VAL A CG2    4  
ATOM   9193  H H      . VAL A 1 108 ? -15.304 10.353  -32.120 1.00 0.00  ? 108 VAL A H      4  
ATOM   9194  H HA     . VAL A 1 108 ? -13.528 10.948  -34.060 1.00 0.00  ? 108 VAL A HA     4  
ATOM   9195  H HB     . VAL A 1 108 ? -12.943 11.095  -31.733 1.00 0.00  ? 108 VAL A HB     4  
ATOM   9196  H HG11   . VAL A 1 108 ? -14.119 9.192   -30.883 1.00 0.00  ? 108 VAL A HG11   4  
ATOM   9197  H HG12   . VAL A 1 108 ? -12.426 9.115   -30.391 1.00 0.00  ? 108 VAL A HG12   4  
ATOM   9198  H HG13   . VAL A 1 108 ? -13.011 8.095   -31.709 1.00 0.00  ? 108 VAL A HG13   4  
ATOM   9199  H HG21   . VAL A 1 108 ? -10.695 10.011  -31.735 1.00 0.00  ? 108 VAL A HG21   4  
ATOM   9200  H HG22   . VAL A 1 108 ? -11.044 10.995  -33.157 1.00 0.00  ? 108 VAL A HG22   4  
ATOM   9201  H HG23   . VAL A 1 108 ? -11.140 9.237   -33.258 1.00 0.00  ? 108 VAL A HG23   4  
ATOM   9202  N N      . GLU A 1 109 ? -12.476 8.995   -35.245 1.00 0.00  ? 109 GLU A N      4  
ATOM   9203  C CA     . GLU A 1 109 ? -12.088 7.899   -36.117 1.00 0.00  ? 109 GLU A CA     4  
ATOM   9204  C C      . GLU A 1 109 ? -11.437 6.770   -35.330 1.00 0.00  ? 109 GLU A C      4  
ATOM   9205  O O      . GLU A 1 109 ? -10.668 7.001   -34.397 1.00 0.00  ? 109 GLU A O      4  
ATOM   9206  C CB     . GLU A 1 109 ? -11.152 8.398   -37.233 1.00 0.00  ? 109 GLU A CB     4  
ATOM   9207  C CG     . GLU A 1 109 ? -9.678  8.475   -36.849 1.00 0.00  ? 109 GLU A CG     4  
ATOM   9208  C CD     . GLU A 1 109 ? -9.235  9.888   -36.526 1.00 0.00  ? 109 GLU A CD     4  
ATOM   9209  O OE1    . GLU A 1 109 ? -9.168  10.231  -35.327 1.00 0.00  ? 109 GLU A OE1    4  
ATOM   9210  O OE2    . GLU A 1 109 ? -8.951  10.654  -37.473 1.00 0.00  ? 109 GLU A OE2    4  
ATOM   9211  H H      . GLU A 1 109 ? -12.082 9.874   -35.383 1.00 0.00  ? 109 GLU A H      4  
ATOM   9212  H HA     . GLU A 1 109 ? -12.989 7.517   -36.571 1.00 0.00  ? 109 GLU A HA     4  
ATOM   9213  H HB2    . GLU A 1 109 ? -11.243 7.733   -38.078 1.00 0.00  ? 109 GLU A HB2    4  
ATOM   9214  H HB3    . GLU A 1 109 ? -11.473 9.387   -37.533 1.00 0.00  ? 109 GLU A HB3    4  
ATOM   9215  H HG2    . GLU A 1 109 ? -9.508  7.856   -35.983 1.00 0.00  ? 109 GLU A HG2    4  
ATOM   9216  H HG3    . GLU A 1 109 ? -9.084  8.105   -37.674 1.00 0.00  ? 109 GLU A HG3    4  
ATOM   9217  H HE2    . GLU A 1 109 ? -8.678  11.531  -37.197 1.00 0.00  ? 109 GLU A HE2    4  
ATOM   9218  N N      . ILE A 1 110 ? -11.756 5.553   -35.727 1.00 0.00  ? 110 ILE A N      4  
ATOM   9219  C CA     . ILE A 1 110 ? -11.213 4.367   -35.086 1.00 0.00  ? 110 ILE A CA     4  
ATOM   9220  C C      . ILE A 1 110 ? -10.517 3.478   -36.108 1.00 0.00  ? 110 ILE A C      4  
ATOM   9221  O O      . ILE A 1 110 ? -11.159 2.750   -36.864 1.00 0.00  ? 110 ILE A O      4  
ATOM   9222  C CB     . ILE A 1 110 ? -12.299 3.577   -34.337 1.00 0.00  ? 110 ILE A CB     4  
ATOM   9223  C CG1    . ILE A 1 110 ? -12.860 4.425   -33.198 1.00 0.00  ? 110 ILE A CG1    4  
ATOM   9224  C CG2    . ILE A 1 110 ? -11.723 2.282   -33.795 1.00 0.00  ? 110 ILE A CG2    4  
ATOM   9225  C CD1    . ILE A 1 110 ? -11.846 4.709   -32.111 1.00 0.00  ? 110 ILE A CD1    4  
ATOM   9226  H H      . ILE A 1 110 ? -12.370 5.451   -36.480 1.00 0.00  ? 110 ILE A H      4  
ATOM   9227  H HA     . ILE A 1 110 ? -10.480 4.691   -34.363 1.00 0.00  ? 110 ILE A HA     4  
ATOM   9228  H HB     . ILE A 1 110 ? -13.090 3.336   -35.030 1.00 0.00  ? 110 ILE A HB     4  
ATOM   9229  H HG12   . ILE A 1 110 ? -13.199 5.372   -33.591 1.00 0.00  ? 110 ILE A HG12   4  
ATOM   9230  H HG13   . ILE A 1 110 ? -13.693 3.909   -32.748 1.00 0.00  ? 110 ILE A HG13   4  
ATOM   9231  H HG21   . ILE A 1 110 ? -11.870 1.489   -34.513 1.00 0.00  ? 110 ILE A HG21   4  
ATOM   9232  H HG22   . ILE A 1 110 ? -12.217 2.028   -32.871 1.00 0.00  ? 110 ILE A HG22   4  
ATOM   9233  H HG23   . ILE A 1 110 ? -10.666 2.411   -33.614 1.00 0.00  ? 110 ILE A HG23   4  
ATOM   9234  H HD11   . ILE A 1 110 ? -11.503 5.729   -32.195 1.00 0.00  ? 110 ILE A HD11   4  
ATOM   9235  H HD12   . ILE A 1 110 ? -11.004 4.037   -32.221 1.00 0.00  ? 110 ILE A HD12   4  
ATOM   9236  H HD13   . ILE A 1 110 ? -12.301 4.560   -31.144 1.00 0.00  ? 110 ILE A HD13   4  
ATOM   9237  N N      . ARG A 1 111 ? -9.194  3.575   -36.135 1.00 0.00  ? 111 ARG A N      4  
ATOM   9238  C CA     . ARG A 1 111 ? -8.376  2.815   -37.070 1.00 0.00  ? 111 ARG A CA     4  
ATOM   9239  C C      . ARG A 1 111 ? -7.770  1.580   -36.405 1.00 0.00  ? 111 ARG A C      4  
ATOM   9240  O O      . ARG A 1 111 ? -6.779  1.677   -35.679 1.00 0.00  ? 111 ARG A O      4  
ATOM   9241  C CB     . ARG A 1 111 ? -7.257  3.707   -37.619 1.00 0.00  ? 111 ARG A CB     4  
ATOM   9242  C CG     . ARG A 1 111 ? -7.724  4.730   -38.650 1.00 0.00  ? 111 ARG A CG     4  
ATOM   9243  C CD     . ARG A 1 111 ? -8.724  5.712   -38.073 1.00 0.00  ? 111 ARG A CD     4  
ATOM   9244  N NE     . ARG A 1 111 ? -9.995  5.679   -38.791 1.00 0.00  ? 111 ARG A NE     4  
ATOM   9245  C CZ     . ARG A 1 111 ? -10.162 6.163   -40.020 1.00 0.00  ? 111 ARG A CZ     4  
ATOM   9246  N NH1    . ARG A 1 111 ? -9.140  6.710   -40.670 1.00 0.00  ? 111 ARG A NH1    4  
ATOM   9247  N NH2    . ARG A 1 111 ? -11.350 6.097   -40.604 1.00 0.00  ? 111 ARG A NH2    4  
ATOM   9248  H H      . ARG A 1 111 ? -8.757  4.188   -35.513 1.00 0.00  ? 111 ARG A H      4  
ATOM   9249  H HA     . ARG A 1 111 ? -9.007  2.499   -37.887 1.00 0.00  ? 111 ARG A HA     4  
ATOM   9250  H HB2    . ARG A 1 111 ? -6.807  4.243   -36.795 1.00 0.00  ? 111 ARG A HB2    4  
ATOM   9251  H HB3    . ARG A 1 111 ? -6.508  3.082   -38.080 1.00 0.00  ? 111 ARG A HB3    4  
ATOM   9252  H HG2    . ARG A 1 111 ? -6.869  5.289   -39.001 1.00 0.00  ? 111 ARG A HG2    4  
ATOM   9253  H HG3    . ARG A 1 111 ? -8.180  4.211   -39.478 1.00 0.00  ? 111 ARG A HG3    4  
ATOM   9254  H HD2    . ARG A 1 111 ? -8.896  5.474   -37.037 1.00 0.00  ? 111 ARG A HD2    4  
ATOM   9255  H HD3    . ARG A 1 111 ? -8.305  6.702   -38.150 1.00 0.00  ? 111 ARG A HD3    4  
ATOM   9256  H HE     . ARG A 1 111 ? -10.763 5.277   -38.335 1.00 0.00  ? 111 ARG A HE     4  
ATOM   9257  H HH11   . ARG A 1 111 ? -8.241  6.762   -40.238 1.00 0.00  ? 111 ARG A HH11   4  
ATOM   9258  H HH12   . ARG A 1 111 ? -9.272  7.072   -41.593 1.00 0.00  ? 111 ARG A HH12   4  
ATOM   9259  H HH21   . ARG A 1 111 ? -12.121 5.683   -40.120 1.00 0.00  ? 111 ARG A HH21   4  
ATOM   9260  H HH22   . ARG A 1 111 ? -11.475 6.461   -41.526 1.00 0.00  ? 111 ARG A HH22   4  
ATOM   9261  N N      . LEU A 1 112 ? -8.365  0.419   -36.665 1.00 0.00  ? 112 LEU A N      4  
ATOM   9262  C CA     . LEU A 1 112 ? -7.883  -0.834  -36.097 1.00 0.00  ? 112 LEU A CA     4  
ATOM   9263  C C      . LEU A 1 112 ? -6.902  -1.516  -37.048 1.00 0.00  ? 112 LEU A C      4  
ATOM   9264  O O      . LEU A 1 112 ? -6.833  -1.177  -38.228 1.00 0.00  ? 112 LEU A O      4  
ATOM   9265  C CB     . LEU A 1 112 ? -9.057  -1.769  -35.799 1.00 0.00  ? 112 LEU A CB     4  
ATOM   9266  C CG     . LEU A 1 112 ? -10.259 -1.102  -35.130 1.00 0.00  ? 112 LEU A CG     4  
ATOM   9267  C CD1    . LEU A 1 112 ? -11.343 -2.125  -34.831 1.00 0.00  ? 112 LEU A CD1    4  
ATOM   9268  C CD2    . LEU A 1 112 ? -9.826  -0.385  -33.858 1.00 0.00  ? 112 LEU A CD2    4  
ATOM   9269  H H      . LEU A 1 112 ? -9.148  0.407   -37.255 1.00 0.00  ? 112 LEU A H      4  
ATOM   9270  H HA     . LEU A 1 112 ? -7.371  -0.606  -35.174 1.00 0.00  ? 112 LEU A HA     4  
ATOM   9271  H HB2    . LEU A 1 112 ? -9.386  -2.210  -36.729 1.00 0.00  ? 112 LEU A HB2    4  
ATOM   9272  H HB3    . LEU A 1 112 ? -8.706  -2.558  -35.151 1.00 0.00  ? 112 LEU A HB3    4  
ATOM   9273  H HG     . LEU A 1 112 ? -10.672 -0.366  -35.804 1.00 0.00  ? 112 LEU A HG     4  
ATOM   9274  H HD11   . LEU A 1 112 ? -12.207 -1.926  -35.450 1.00 0.00  ? 112 LEU A HD11   4  
ATOM   9275  H HD12   . LEU A 1 112 ? -11.628 -2.059  -33.790 1.00 0.00  ? 112 LEU A HD12   4  
ATOM   9276  H HD13   . LEU A 1 112 ? -10.973 -3.117  -35.039 1.00 0.00  ? 112 LEU A HD13   4  
ATOM   9277  H HD21   . LEU A 1 112 ? -10.185 0.632   -33.877 1.00 0.00  ? 112 LEU A HD21   4  
ATOM   9278  H HD22   . LEU A 1 112 ? -8.749  -0.382  -33.795 1.00 0.00  ? 112 LEU A HD22   4  
ATOM   9279  H HD23   . LEU A 1 112 ? -10.235 -0.894  -32.999 1.00 0.00  ? 112 LEU A HD23   4  
ATOM   9280  N N      . SER A 1 113 ? -6.145  -2.477  -36.526 1.00 0.00  ? 113 SER A N      4  
ATOM   9281  C CA     . SER A 1 113 ? -5.169  -3.203  -37.333 1.00 0.00  ? 113 SER A CA     4  
ATOM   9282  C C      . SER A 1 113 ? -5.511  -4.687  -37.411 1.00 0.00  ? 113 SER A C      4  
ATOM   9283  O O      . SER A 1 113 ? -6.600  -5.105  -37.016 1.00 0.00  ? 113 SER A O      4  
ATOM   9284  C CB     . SER A 1 113 ? -3.762  -3.018  -36.755 1.00 0.00  ? 113 SER A CB     4  
ATOM   9285  O OG     . SER A 1 113 ? -2.853  -2.583  -37.751 1.00 0.00  ? 113 SER A OG     4  
ATOM   9286  H H      . SER A 1 113 ? -6.245  -2.705  -35.577 1.00 0.00  ? 113 SER A H      4  
ATOM   9287  H HA     . SER A 1 113 ? -5.193  -2.789  -38.331 1.00 0.00  ? 113 SER A HA     4  
ATOM   9288  H HB2    . SER A 1 113 ? -3.792  -2.279  -35.968 1.00 0.00  ? 113 SER A HB2    4  
ATOM   9289  H HB3    . SER A 1 113 ? -3.414  -3.958  -36.351 1.00 0.00  ? 113 SER A HB3    4  
ATOM   9290  H HG     . SER A 1 113 ? -2.990  -3.091  -38.555 1.00 0.00  ? 113 SER A HG     4  
ATOM   9291  N N      . HIS A 1 114 ? -4.573  -5.480  -37.925 1.00 0.00  ? 114 HIS A N      4  
ATOM   9292  C CA     . HIS A 1 114 ? -4.773  -6.921  -38.056 1.00 0.00  ? 114 HIS A CA     4  
ATOM   9293  C C      . HIS A 1 114 ? -4.915  -7.589  -36.690 1.00 0.00  ? 114 HIS A C      4  
ATOM   9294  O O      . HIS A 1 114 ? -5.417  -8.709  -36.589 1.00 0.00  ? 114 HIS A O      4  
ATOM   9295  C CB     . HIS A 1 114 ? -3.610  -7.552  -38.825 1.00 0.00  ? 114 HIS A CB     4  
ATOM   9296  C CG     . HIS A 1 114 ? -3.856  -7.658  -40.296 1.00 0.00  ? 114 HIS A CG     4  
ATOM   9297  N ND1    . HIS A 1 114 ? -2.853  -7.559  -41.235 1.00 0.00  ? 114 HIS A ND1    4  
ATOM   9298  C CD2    . HIS A 1 114 ? -5.002  -7.855  -40.989 1.00 0.00  ? 114 HIS A CD2    4  
ATOM   9299  C CE1    . HIS A 1 114 ? -3.371  -7.687  -42.444 1.00 0.00  ? 114 HIS A CE1    4  
ATOM   9300  N NE2    . HIS A 1 114 ? -4.672  -7.869  -42.321 1.00 0.00  ? 114 HIS A NE2    4  
ATOM   9301  H H      . HIS A 1 114 ? -3.728  -5.087  -38.223 1.00 0.00  ? 114 HIS A H      4  
ATOM   9302  H HA     . HIS A 1 114 ? -5.685  -7.077  -38.614 1.00 0.00  ? 114 HIS A HA     4  
ATOM   9303  H HB2    . HIS A 1 114 ? -2.722  -6.952  -38.678 1.00 0.00  ? 114 HIS A HB2    4  
ATOM   9304  H HB3    . HIS A 1 114 ? -3.433  -8.546  -38.443 1.00 0.00  ? 114 HIS A HB3    4  
ATOM   9305  H HD1    . HIS A 1 114 ? -1.904  -7.414  -41.046 1.00 0.00  ? 114 HIS A HD1    4  
ATOM   9306  H HD2    . HIS A 1 114 ? -5.990  -7.977  -40.571 1.00 0.00  ? 114 HIS A HD2    4  
ATOM   9307  H HE1    . HIS A 1 114 ? -2.823  -7.652  -43.373 1.00 0.00  ? 114 HIS A HE1    4  
ATOM   9308  H HE2    . HIS A 1 114 ? -5.288  -8.070  -43.057 1.00 0.00  ? 114 HIS A HE2    4  
ATOM   9309  N N      . GLU A 1 115 ? -4.472  -6.902  -35.642 1.00 0.00  ? 115 GLU A N      4  
ATOM   9310  C CA     . GLU A 1 115 ? -4.556  -7.438  -34.287 1.00 0.00  ? 115 GLU A CA     4  
ATOM   9311  C C      . GLU A 1 115 ? -5.921  -7.155  -33.666 1.00 0.00  ? 115 GLU A C      4  
ATOM   9312  O O      . GLU A 1 115 ? -6.312  -7.795  -32.689 1.00 0.00  ? 115 GLU A O      4  
ATOM   9313  C CB     . GLU A 1 115 ? -3.450  -6.841  -33.413 1.00 0.00  ? 115 GLU A CB     4  
ATOM   9314  C CG     . GLU A 1 115 ? -2.662  -7.882  -32.636 1.00 0.00  ? 115 GLU A CG     4  
ATOM   9315  C CD     . GLU A 1 115 ? -1.325  -8.199  -33.279 1.00 0.00  ? 115 GLU A CD     4  
ATOM   9316  O OE1    . GLU A 1 115 ? -0.283  -7.897  -32.660 1.00 0.00  ? 115 GLU A OE1    4  
ATOM   9317  O OE2    . GLU A 1 115 ? -1.323  -8.751  -34.398 1.00 0.00  ? 115 GLU A OE2    4  
ATOM   9318  H H      . GLU A 1 115 ? -4.080  -6.013  -35.779 1.00 0.00  ? 115 GLU A H      4  
ATOM   9319  H HA     . GLU A 1 115 ? -4.417  -8.506  -34.346 1.00 0.00  ? 115 GLU A HA     4  
ATOM   9320  H HB2    . GLU A 1 115 ? -2.762  -6.299  -34.046 1.00 0.00  ? 115 GLU A HB2    4  
ATOM   9321  H HB3    . GLU A 1 115 ? -3.892  -6.156  -32.708 1.00 0.00  ? 115 GLU A HB3    4  
ATOM   9322  H HG2    . GLU A 1 115 ? -2.486  -7.509  -31.638 1.00 0.00  ? 115 GLU A HG2    4  
ATOM   9323  H HG3    . GLU A 1 115 ? -3.244  -8.789  -32.583 1.00 0.00  ? 115 GLU A HG3    4  
ATOM   9324  H HE2    . GLU A 1 115 ? -0.444  -8.922  -34.745 1.00 0.00  ? 115 GLU A HE2    4  
ATOM   9325  N N      . HIS A 1 116 ? -6.641  -6.195  -34.240 1.00 0.00  ? 116 HIS A N      4  
ATOM   9326  C CA     . HIS A 1 116 ? -7.961  -5.829  -33.746 1.00 0.00  ? 116 HIS A CA     4  
ATOM   9327  C C      . HIS A 1 116 ? -9.014  -6.035  -34.830 1.00 0.00  ? 116 HIS A C      4  
ATOM   9328  O O      . HIS A 1 116 ? -8.795  -5.699  -35.994 1.00 0.00  ? 116 HIS A O      4  
ATOM   9329  C CB     . HIS A 1 116 ? -7.960  -4.377  -33.274 1.00 0.00  ? 116 HIS A CB     4  
ATOM   9330  C CG     . HIS A 1 116 ? -7.093  -4.147  -32.079 1.00 0.00  ? 116 HIS A CG     4  
ATOM   9331  N ND1    . HIS A 1 116 ? -7.207  -4.879  -30.914 1.00 0.00  ? 116 HIS A ND1    4  
ATOM   9332  C CD2    . HIS A 1 116 ? -6.083  -3.269  -31.872 1.00 0.00  ? 116 HIS A CD2    4  
ATOM   9333  C CE1    . HIS A 1 116 ? -6.305  -4.461  -30.044 1.00 0.00  ? 116 HIS A CE1    4  
ATOM   9334  N NE2    . HIS A 1 116 ? -5.611  -3.486  -30.600 1.00 0.00  ? 116 HIS A NE2    4  
ATOM   9335  H H      . HIS A 1 116 ? -6.277  -5.722  -35.014 1.00 0.00  ? 116 HIS A H      4  
ATOM   9336  H HA     . HIS A 1 116 ? -8.194  -6.472  -32.910 1.00 0.00  ? 116 HIS A HA     4  
ATOM   9337  H HB2    . HIS A 1 116 ? -7.598  -3.748  -34.073 1.00 0.00  ? 116 HIS A HB2    4  
ATOM   9338  H HB3    . HIS A 1 116 ? -8.969  -4.086  -33.019 1.00 0.00  ? 116 HIS A HB3    4  
ATOM   9339  H HD1    . HIS A 1 116 ? -7.853  -5.597  -30.751 1.00 0.00  ? 116 HIS A HD1    4  
ATOM   9340  H HD2    . HIS A 1 116 ? -5.717  -2.534  -32.575 1.00 0.00  ? 116 HIS A HD2    4  
ATOM   9341  H HE1    . HIS A 1 116 ? -6.158  -4.854  -29.049 1.00 0.00  ? 116 HIS A HE1    4  
ATOM   9342  H HE2    . HIS A 1 116 ? -4.909  -2.967  -30.157 1.00 0.00  ? 116 HIS A HE2    4  
ATOM   9343  N N      . GLN A 1 117 ? -10.151 -6.603  -34.443 1.00 0.00  ? 117 GLN A N      4  
ATOM   9344  C CA     . GLN A 1 117 ? -11.231 -6.868  -35.386 1.00 0.00  ? 117 GLN A CA     4  
ATOM   9345  C C      . GLN A 1 117 ? -12.428 -5.949  -35.141 1.00 0.00  ? 117 GLN A C      4  
ATOM   9346  O O      . GLN A 1 117 ? -13.270 -5.767  -36.021 1.00 0.00  ? 117 GLN A O      4  
ATOM   9347  C CB     . GLN A 1 117 ? -11.655 -8.335  -35.279 1.00 0.00  ? 117 GLN A CB     4  
ATOM   9348  C CG     . GLN A 1 117 ? -12.763 -8.729  -36.235 1.00 0.00  ? 117 GLN A CG     4  
ATOM   9349  C CD     . GLN A 1 117 ? -12.255 -9.011  -37.637 1.00 0.00  ? 117 GLN A CD     4  
ATOM   9350  O OE1    . GLN A 1 117 ? -12.082 -10.165 -38.027 1.00 0.00  ? 117 GLN A OE1    4  
ATOM   9351  N NE2    . GLN A 1 117 ? -12.017 -7.952  -38.403 1.00 0.00  ? 117 GLN A NE2    4  
ATOM   9352  H H      . GLN A 1 117 ? -10.262 -6.859  -33.504 1.00 0.00  ? 117 GLN A H      4  
ATOM   9353  H HA     . GLN A 1 117 ? -10.853 -6.687  -36.380 1.00 0.00  ? 117 GLN A HA     4  
ATOM   9354  H HB2    . GLN A 1 117 ? -10.797 -8.957  -35.485 1.00 0.00  ? 117 GLN A HB2    4  
ATOM   9355  H HB3    . GLN A 1 117 ? -11.992 -8.526  -34.271 1.00 0.00  ? 117 GLN A HB3    4  
ATOM   9356  H HG2    . GLN A 1 117 ? -13.246 -9.620  -35.858 1.00 0.00  ? 117 GLN A HG2    4  
ATOM   9357  H HG3    . GLN A 1 117 ? -13.478 -7.928  -36.280 1.00 0.00  ? 117 GLN A HG3    4  
ATOM   9358  H HE21   . GLN A 1 117 ? -12.178 -7.061  -38.026 1.00 0.00  ? 117 GLN A HE21   4  
ATOM   9359  H HE22   . GLN A 1 117 ? -11.688 -8.104  -39.313 1.00 0.00  ? 117 GLN A HE22   4  
ATOM   9360  N N      . ALA A 1 118 ? -12.498 -5.367  -33.946 1.00 0.00  ? 118 ALA A N      4  
ATOM   9361  C CA     . ALA A 1 118 ? -13.594 -4.469  -33.603 1.00 0.00  ? 118 ALA A CA     4  
ATOM   9362  C C      . ALA A 1 118 ? -13.286 -3.683  -32.333 1.00 0.00  ? 118 ALA A C      4  
ATOM   9363  O O      . ALA A 1 118 ? -12.352 -4.008  -31.600 1.00 0.00  ? 118 ALA A O      4  
ATOM   9364  C CB     . ALA A 1 118 ? -14.885 -5.254  -33.436 1.00 0.00  ? 118 ALA A CB     4  
ATOM   9365  H H      . ALA A 1 118 ? -11.798 -5.545  -33.284 1.00 0.00  ? 118 ALA A H      4  
ATOM   9366  H HA     . ALA A 1 118 ? -13.725 -3.775  -34.420 1.00 0.00  ? 118 ALA A HA     4  
ATOM   9367  H HB1    . ALA A 1 118 ? -15.726 -4.580  -33.503 1.00 0.00  ? 118 ALA A HB1    4  
ATOM   9368  H HB2    . ALA A 1 118 ? -14.889 -5.739  -32.470 1.00 0.00  ? 118 ALA A HB2    4  
ATOM   9369  H HB3    . ALA A 1 118 ? -14.957 -5.999  -34.214 1.00 0.00  ? 118 ALA A HB3    4  
ATOM   9370  N N      . TYR A 1 119 ? -14.074 -2.643  -32.084 1.00 0.00  ? 119 TYR A N      4  
ATOM   9371  C CA     . TYR A 1 119 ? -13.887 -1.804  -30.906 1.00 0.00  ? 119 TYR A CA     4  
ATOM   9372  C C      . TYR A 1 119 ? -15.232 -1.422  -30.292 1.00 0.00  ? 119 TYR A C      4  
ATOM   9373  O O      . TYR A 1 119 ? -16.286 -1.715  -30.855 1.00 0.00  ? 119 TYR A O      4  
ATOM   9374  C CB     . TYR A 1 119 ? -13.113 -0.542  -31.282 1.00 0.00  ? 119 TYR A CB     4  
ATOM   9375  C CG     . TYR A 1 119 ? -13.908 0.415   -32.141 1.00 0.00  ? 119 TYR A CG     4  
ATOM   9376  C CD1    . TYR A 1 119 ? -14.688 1.405   -31.563 1.00 0.00  ? 119 TYR A CD1    4  
ATOM   9377  C CD2    . TYR A 1 119 ? -13.872 0.328   -33.526 1.00 0.00  ? 119 TYR A CD2    4  
ATOM   9378  C CE1    . TYR A 1 119 ? -15.415 2.283   -32.341 1.00 0.00  ? 119 TYR A CE1    4  
ATOM   9379  C CE2    . TYR A 1 119 ? -14.594 1.204   -34.313 1.00 0.00  ? 119 TYR A CE2    4  
ATOM   9380  C CZ     . TYR A 1 119 ? -15.364 2.181   -33.716 1.00 0.00  ? 119 TYR A CZ     4  
ATOM   9381  O OH     . TYR A 1 119 ? -16.084 3.059   -34.495 1.00 0.00  ? 119 TYR A OH     4  
ATOM   9382  H H      . TYR A 1 119 ? -14.799 -2.431  -32.708 1.00 0.00  ? 119 TYR A H      4  
ATOM   9383  H HA     . TYR A 1 119 ? -13.318 -2.365  -30.184 1.00 0.00  ? 119 TYR A HA     4  
ATOM   9384  H HB2    . TYR A 1 119 ? -12.826 -0.021  -30.382 1.00 0.00  ? 119 TYR A HB2    4  
ATOM   9385  H HB3    . TYR A 1 119 ? -12.225 -0.822  -31.829 1.00 0.00  ? 119 TYR A HB3    4  
ATOM   9386  H HD1    . TYR A 1 119 ? -14.727 1.484   -30.486 1.00 0.00  ? 119 TYR A HD1    4  
ATOM   9387  H HD2    . TYR A 1 119 ? -13.267 -0.437  -33.989 1.00 0.00  ? 119 TYR A HD2    4  
ATOM   9388  H HE1    . TYR A 1 119 ? -16.015 3.048   -31.872 1.00 0.00  ? 119 TYR A HE1    4  
ATOM   9389  H HE2    . TYR A 1 119 ? -14.552 1.121   -35.387 1.00 0.00  ? 119 TYR A HE2    4  
ATOM   9390  H HH     . TYR A 1 119 ? -16.426 2.599   -35.263 1.00 0.00  ? 119 TYR A HH     4  
ATOM   9391  N N      . ARG A 1 120 ? -15.187 -0.767  -29.136 1.00 0.00  ? 120 ARG A N      4  
ATOM   9392  C CA     . ARG A 1 120 ? -16.406 -0.349  -28.451 1.00 0.00  ? 120 ARG A CA     4  
ATOM   9393  C C      . ARG A 1 120 ? -16.127 0.758   -27.440 1.00 0.00  ? 120 ARG A C      4  
ATOM   9394  O O      . ARG A 1 120 ? -15.005 0.914   -26.960 1.00 0.00  ? 120 ARG A O      4  
ATOM   9395  C CB     . ARG A 1 120 ? -17.046 -1.535  -27.728 1.00 0.00  ? 120 ARG A CB     4  
ATOM   9396  C CG     . ARG A 1 120 ? -17.975 -2.368  -28.595 1.00 0.00  ? 120 ARG A CG     4  
ATOM   9397  C CD     . ARG A 1 120 ? -18.751 -3.374  -27.762 1.00 0.00  ? 120 ARG A CD     4  
ATOM   9398  N NE     . ARG A 1 120 ? -20.012 -3.757  -28.395 1.00 0.00  ? 120 ARG A NE     4  
ATOM   9399  C CZ     . ARG A 1 120 ? -21.174 -3.143  -28.175 1.00 0.00  ? 120 ARG A CZ     4  
ATOM   9400  N NH1    . ARG A 1 120 ? -21.246 -2.109  -27.345 1.00 0.00  ? 120 ARG A NH1    4  
ATOM   9401  N NH2    . ARG A 1 120 ? -22.270 -3.568  -28.789 1.00 0.00  ? 120 ARG A NH2    4  
ATOM   9402  H H      . ARG A 1 120 ? -14.318 -0.561  -28.734 1.00 0.00  ? 120 ARG A H      4  
ATOM   9403  H HA     . ARG A 1 120 ? -17.095 0.021   -29.193 1.00 0.00  ? 120 ARG A HA     4  
ATOM   9404  H HB2    . ARG A 1 120 ? -16.265 -2.177  -27.356 1.00 0.00  ? 120 ARG A HB2    4  
ATOM   9405  H HB3    . ARG A 1 120 ? -17.617 -1.162  -26.890 1.00 0.00  ? 120 ARG A HB3    4  
ATOM   9406  H HG2    . ARG A 1 120 ? -18.673 -1.711  -29.093 1.00 0.00  ? 120 ARG A HG2    4  
ATOM   9407  H HG3    . ARG A 1 120 ? -17.386 -2.897  -29.328 1.00 0.00  ? 120 ARG A HG3    4  
ATOM   9408  H HD2    . ARG A 1 120 ? -18.143 -4.257  -27.632 1.00 0.00  ? 120 ARG A HD2    4  
ATOM   9409  H HD3    . ARG A 1 120 ? -18.961 -2.938  -26.796 1.00 0.00  ? 120 ARG A HD3    4  
ATOM   9410  H HE     . ARG A 1 120 ? -19.993 -4.513  -29.018 1.00 0.00  ? 120 ARG A HE     4  
ATOM   9411  H HH11   . ARG A 1 120 ? -20.426 -1.780  -26.879 1.00 0.00  ? 120 ARG A HH11   4  
ATOM   9412  H HH12   . ARG A 1 120 ? -22.124 -1.657  -27.186 1.00 0.00  ? 120 ARG A HH12   4  
ATOM   9413  H HH21   . ARG A 1 120 ? -22.222 -4.345  -29.415 1.00 0.00  ? 120 ARG A HH21   4  
ATOM   9414  H HH22   . ARG A 1 120 ? -23.144 -3.109  -28.627 1.00 0.00  ? 120 ARG A HH22   4  
ATOM   9415  N N      . TRP A 1 121 ? -17.175 1.501   -27.104 1.00 0.00  ? 121 TRP A N      4  
ATOM   9416  C CA     . TRP A 1 121 ? -17.082 2.578   -26.128 1.00 0.00  ? 121 TRP A CA     4  
ATOM   9417  C C      . TRP A 1 121 ? -18.062 2.315   -24.995 1.00 0.00  ? 121 TRP A C      4  
ATOM   9418  O O      . TRP A 1 121 ? -19.275 2.421   -25.177 1.00 0.00  ? 121 TRP A O      4  
ATOM   9419  C CB     . TRP A 1 121 ? -17.381 3.926   -26.786 1.00 0.00  ? 121 TRP A CB     4  
ATOM   9420  C CG     . TRP A 1 121 ? -16.300 4.374   -27.719 1.00 0.00  ? 121 TRP A CG     4  
ATOM   9421  C CD1    . TRP A 1 121 ? -16.173 4.054   -29.041 1.00 0.00  ? 121 TRP A CD1    4  
ATOM   9422  C CD2    . TRP A 1 121 ? -15.189 5.217   -27.400 1.00 0.00  ? 121 TRP A CD2    4  
ATOM   9423  N NE1    . TRP A 1 121 ? -15.048 4.649   -29.563 1.00 0.00  ? 121 TRP A NE1    4  
ATOM   9424  C CE2    . TRP A 1 121 ? -14.430 5.368   -28.575 1.00 0.00  ? 121 TRP A CE2    4  
ATOM   9425  C CE3    . TRP A 1 121 ? -14.766 5.861   -26.236 1.00 0.00  ? 121 TRP A CE3    4  
ATOM   9426  C CZ2    . TRP A 1 121 ? -13.271 6.136   -28.617 1.00 0.00  ? 121 TRP A CZ2    4  
ATOM   9427  C CZ3    . TRP A 1 121 ? -13.616 6.624   -26.279 1.00 0.00  ? 121 TRP A CZ3    4  
ATOM   9428  C CH2    . TRP A 1 121 ? -12.880 6.754   -27.462 1.00 0.00  ? 121 TRP A CH2    4  
ATOM   9429  H H      . TRP A 1 121 ? -18.043 1.303   -27.512 1.00 0.00  ? 121 TRP A H      4  
ATOM   9430  H HA     . TRP A 1 121 ? -16.076 2.588   -25.732 1.00 0.00  ? 121 TRP A HA     4  
ATOM   9431  H HB2    . TRP A 1 121 ? -18.300 3.852   -27.346 1.00 0.00  ? 121 TRP A HB2    4  
ATOM   9432  H HB3    . TRP A 1 121 ? -17.492 4.678   -26.017 1.00 0.00  ? 121 TRP A HB3    4  
ATOM   9433  H HD1    . TRP A 1 121 ? -16.860 3.422   -29.585 1.00 0.00  ? 121 TRP A HD1    4  
ATOM   9434  H HE1    . TRP A 1 121 ? -14.742 4.572   -30.490 1.00 0.00  ? 121 TRP A HE1    4  
ATOM   9435  H HE3    . TRP A 1 121 ? -15.322 5.772   -25.314 1.00 0.00  ? 121 TRP A HE3    4  
ATOM   9436  H HZ2    . TRP A 1 121 ? -12.691 6.248   -29.520 1.00 0.00  ? 121 TRP A HZ2    4  
ATOM   9437  H HZ3    . TRP A 1 121 ? -13.271 7.129   -25.389 1.00 0.00  ? 121 TRP A HZ3    4  
ATOM   9438  H HH2    . TRP A 1 121 ? -11.987 7.357   -27.451 1.00 0.00  ? 121 TRP A HH2    4  
ATOM   9439  N N      . LEU A 1 122 ? -17.540 1.937   -23.836 1.00 0.00  ? 122 LEU A N      4  
ATOM   9440  C CA     . LEU A 1 122 ? -18.389 1.621   -22.694 1.00 0.00  ? 122 LEU A CA     4  
ATOM   9441  C C      . LEU A 1 122 ? -17.859 2.237   -21.407 1.00 0.00  ? 122 LEU A C      4  
ATOM   9442  O O      . LEU A 1 122 ? -16.763 2.792   -21.374 1.00 0.00  ? 122 LEU A O      4  
ATOM   9443  C CB     . LEU A 1 122 ? -18.492 0.101   -22.535 1.00 0.00  ? 122 LEU A CB     4  
ATOM   9444  C CG     . LEU A 1 122 ? -18.323 -0.694  -23.833 1.00 0.00  ? 122 LEU A CG     4  
ATOM   9445  C CD1    . LEU A 1 122 ? -16.866 -1.091  -24.032 1.00 0.00  ? 122 LEU A CD1    4  
ATOM   9446  C CD2    . LEU A 1 122 ? -19.222 -1.922  -23.834 1.00 0.00  ? 122 LEU A CD2    4  
ATOM   9447  H H      . LEU A 1 122 ? -16.567 1.843   -23.753 1.00 0.00  ? 122 LEU A H      4  
ATOM   9448  H HA     . LEU A 1 122 ? -19.373 2.017   -22.891 1.00 0.00  ? 122 LEU A HA     4  
ATOM   9449  H HB2    . LEU A 1 122 ? -17.727 -0.218  -21.836 1.00 0.00  ? 122 LEU A HB2    4  
ATOM   9450  H HB3    . LEU A 1 122 ? -19.460 -0.134  -22.117 1.00 0.00  ? 122 LEU A HB3    4  
ATOM   9451  H HG     . LEU A 1 122 ? -18.612 -0.070  -24.666 1.00 0.00  ? 122 LEU A HG     4  
ATOM   9452  H HD11   . LEU A 1 122 ? -16.261 -0.640  -23.261 1.00 0.00  ? 122 LEU A HD11   4  
ATOM   9453  H HD12   . LEU A 1 122 ? -16.528 -0.751  -25.000 1.00 0.00  ? 122 LEU A HD12   4  
ATOM   9454  H HD13   . LEU A 1 122 ? -16.774 -2.165  -23.979 1.00 0.00  ? 122 LEU A HD13   4  
ATOM   9455  H HD21   . LEU A 1 122 ? -18.654 -2.783  -23.521 1.00 0.00  ? 122 LEU A HD21   4  
ATOM   9456  H HD22   . LEU A 1 122 ? -19.605 -2.087  -24.831 1.00 0.00  ? 122 LEU A HD22   4  
ATOM   9457  H HD23   . LEU A 1 122 ? -20.045 -1.765  -23.154 1.00 0.00  ? 122 LEU A HD23   4  
ATOM   9458  N N      . GLY A 1 123 ? -18.650 2.126   -20.347 1.00 0.00  ? 123 GLY A N      4  
ATOM   9459  C CA     . GLY A 1 123 ? -18.252 2.667   -19.063 1.00 0.00  ? 123 GLY A CA     4  
ATOM   9460  C C      . GLY A 1 123 ? -17.287 1.757   -18.332 1.00 0.00  ? 123 GLY A C      4  
ATOM   9461  O O      . GLY A 1 123 ? -16.529 1.019   -18.956 1.00 0.00  ? 123 GLY A O      4  
ATOM   9462  H H      . GLY A 1 123 ? -19.511 1.666   -20.435 1.00 0.00  ? 123 GLY A H      4  
ATOM   9463  H HA2    . GLY A 1 123 ? -17.780 3.626   -19.219 1.00 0.00  ? 123 GLY A HA2    4  
ATOM   9464  H HA3    . GLY A 1 123 ? -19.133 2.804   -18.453 1.00 0.00  ? 123 GLY A HA3    4  
ATOM   9465  N N      . LEU A 1 124 ? -17.310 1.815   -17.007 1.00 0.00  ? 124 LEU A N      4  
ATOM   9466  C CA     . LEU A 1 124 ? -16.426 0.992   -16.192 1.00 0.00  ? 124 LEU A CA     4  
ATOM   9467  C C      . LEU A 1 124 ? -16.920 -0.449  -16.110 1.00 0.00  ? 124 LEU A C      4  
ATOM   9468  O O      . LEU A 1 124 ? -16.138 -1.389  -16.260 1.00 0.00  ? 124 LEU A O      4  
ATOM   9469  C CB     . LEU A 1 124 ? -16.306 1.585   -14.787 1.00 0.00  ? 124 LEU A CB     4  
ATOM   9470  C CG     . LEU A 1 124 ? -15.312 0.878   -13.858 1.00 0.00  ? 124 LEU A CG     4  
ATOM   9471  C CD1    . LEU A 1 124 ? -14.057 0.468   -14.612 1.00 0.00  ? 124 LEU A CD1    4  
ATOM   9472  C CD2    . LEU A 1 124 ? -14.954 1.778   -12.689 1.00 0.00  ? 124 LEU A CD2    4  
ATOM   9473  H H      . LEU A 1 124 ? -17.935 2.427   -16.566 1.00 0.00  ? 124 LEU A H      4  
ATOM   9474  H HA     . LEU A 1 124 ? -15.451 0.998   -16.658 1.00 0.00  ? 124 LEU A HA     4  
ATOM   9475  H HB2    . LEU A 1 124 ? -16.004 2.618   -14.882 1.00 0.00  ? 124 LEU A HB2    4  
ATOM   9476  H HB3    . LEU A 1 124 ? -17.279 1.553   -14.323 1.00 0.00  ? 124 LEU A HB3    4  
ATOM   9477  H HG     . LEU A 1 124 ? -15.772 -0.016  -13.463 1.00 0.00  ? 124 LEU A HG     4  
ATOM   9478  H HD11   . LEU A 1 124 ? -13.396 -0.067  -13.947 1.00 0.00  ? 124 LEU A HD11   4  
ATOM   9479  H HD12   . LEU A 1 124 ? -13.557 1.350   -14.987 1.00 0.00  ? 124 LEU A HD12   4  
ATOM   9480  H HD13   . LEU A 1 124 ? -14.328 -0.171  -15.440 1.00 0.00  ? 124 LEU A HD13   4  
ATOM   9481  H HD21   . LEU A 1 124 ? -15.857 2.165   -12.239 1.00 0.00  ? 124 LEU A HD21   4  
ATOM   9482  H HD22   . LEU A 1 124 ? -14.348 2.601   -13.041 1.00 0.00  ? 124 LEU A HD22   4  
ATOM   9483  H HD23   . LEU A 1 124 ? -14.402 1.211   -11.956 1.00 0.00  ? 124 LEU A HD23   4  
ATOM   9484  N N      . GLU A 1 125 ? -18.215 -0.618  -15.861 1.00 0.00  ? 125 GLU A N      4  
ATOM   9485  C CA     . GLU A 1 125 ? -18.805 -1.948  -15.746 1.00 0.00  ? 125 GLU A CA     4  
ATOM   9486  C C      . GLU A 1 125 ? -18.589 -2.766  -17.013 1.00 0.00  ? 125 GLU A C      4  
ATOM   9487  O O      . GLU A 1 125 ? -18.114 -3.900  -16.956 1.00 0.00  ? 125 GLU A O      4  
ATOM   9488  C CB     . GLU A 1 125 ? -20.303 -1.852  -15.439 1.00 0.00  ? 125 GLU A CB     4  
ATOM   9489  C CG     . GLU A 1 125 ? -21.098 -1.061  -16.470 1.00 0.00  ? 125 GLU A CG     4  
ATOM   9490  C CD     . GLU A 1 125 ? -22.552 -0.896  -16.075 1.00 0.00  ? 125 GLU A CD     4  
ATOM   9491  O OE1    . GLU A 1 125 ? -22.953 0.241   -15.745 1.00 0.00  ? 125 GLU A OE1    4  
ATOM   9492  O OE2    . GLU A 1 125 ? -23.289 -1.903  -16.094 1.00 0.00  ? 125 GLU A OE2    4  
ATOM   9493  H H      . GLU A 1 125 ? -18.784 0.170   -15.742 1.00 0.00  ? 125 GLU A H      4  
ATOM   9494  H HA     . GLU A 1 125 ? -18.312 -2.455  -14.927 1.00 0.00  ? 125 GLU A HA     4  
ATOM   9495  H HB2    . GLU A 1 125 ? -20.714 -2.849  -15.392 1.00 0.00  ? 125 GLU A HB2    4  
ATOM   9496  H HB3    . GLU A 1 125 ? -20.430 -1.376  -14.478 1.00 0.00  ? 125 GLU A HB3    4  
ATOM   9497  H HG2    . GLU A 1 125 ? -20.657 -0.081  -16.575 1.00 0.00  ? 125 GLU A HG2    4  
ATOM   9498  H HG3    . GLU A 1 125 ? -21.058 -1.577  -17.422 1.00 0.00  ? 125 GLU A HG3    4  
ATOM   9499  H HE2    . GLU A 1 125 ? -24.197 -1.728  -15.832 1.00 0.00  ? 125 GLU A HE2    4  
ATOM   9500  N N      . GLU A 1 126 ? -18.941 -2.190  -18.156 1.00 0.00  ? 126 GLU A N      4  
ATOM   9501  C CA     . GLU A 1 126 ? -18.783 -2.875  -19.428 1.00 0.00  ? 126 GLU A CA     4  
ATOM   9502  C C      . GLU A 1 126 ? -17.311 -3.053  -19.749 1.00 0.00  ? 126 GLU A C      4  
ATOM   9503  O O      . GLU A 1 126 ? -16.844 -4.164  -19.988 1.00 0.00  ? 126 GLU A O      4  
ATOM   9504  C CB     . GLU A 1 126 ? -19.473 -2.090  -20.538 1.00 0.00  ? 126 GLU A CB     4  
ATOM   9505  C CG     . GLU A 1 126 ? -20.903 -2.535  -20.803 1.00 0.00  ? 126 GLU A CG     4  
ATOM   9506  C CD     . GLU A 1 126 ? -21.670 -2.857  -19.533 1.00 0.00  ? 126 GLU A CD     4  
ATOM   9507  O OE1    . GLU A 1 126 ? -22.492 -2.017  -19.109 1.00 0.00  ? 126 GLU A OE1    4  
ATOM   9508  O OE2    . GLU A 1 126 ? -21.448 -3.946  -18.965 1.00 0.00  ? 126 GLU A OE2    4  
ATOM   9509  H H      . GLU A 1 126 ? -19.314 -1.285  -18.143 1.00 0.00  ? 126 GLU A H      4  
ATOM   9510  H HA     . GLU A 1 126 ? -19.243 -3.851  -19.341 1.00 0.00  ? 126 GLU A HA     4  
ATOM   9511  H HB2    . GLU A 1 126 ? -19.488 -1.044  -20.267 1.00 0.00  ? 126 GLU A HB2    4  
ATOM   9512  H HB3    . GLU A 1 126 ? -18.907 -2.208  -21.448 1.00 0.00  ? 126 GLU A HB3    4  
ATOM   9513  H HG2    . GLU A 1 126 ? -21.417 -1.740  -21.318 1.00 0.00  ? 126 GLU A HG2    4  
ATOM   9514  H HG3    . GLU A 1 126 ? -20.882 -3.417  -21.429 1.00 0.00  ? 126 GLU A HG3    4  
ATOM   9515  H HE2    . GLU A 1 126 ? -21.968 -4.084  -18.169 1.00 0.00  ? 126 GLU A HE2    4  
ATOM   9516  N N      . ALA A 1 127 ? -16.572 -1.953  -19.733 1.00 0.00  ? 127 ALA A N      4  
ATOM   9517  C CA     . ALA A 1 127 ? -15.147 -2.003  -20.009 1.00 0.00  ? 127 ALA A CA     4  
ATOM   9518  C C      . ALA A 1 127 ? -14.486 -3.084  -19.163 1.00 0.00  ? 127 ALA A C      4  
ATOM   9519  O O      . ALA A 1 127 ? -13.510 -3.709  -19.577 1.00 0.00  ? 127 ALA A O      4  
ATOM   9520  C CB     . ALA A 1 127 ? -14.517 -0.650  -19.735 1.00 0.00  ? 127 ALA A CB     4  
ATOM   9521  H H      . ALA A 1 127 ? -16.993 -1.093  -19.522 1.00 0.00  ? 127 ALA A H      4  
ATOM   9522  H HA     . ALA A 1 127 ? -15.016 -2.238  -21.053 1.00 0.00  ? 127 ALA A HA     4  
ATOM   9523  H HB1    . ALA A 1 127 ? -13.482 -0.665  -20.044 1.00 0.00  ? 127 ALA A HB1    4  
ATOM   9524  H HB2    . ALA A 1 127 ? -14.574 -0.437  -18.678 1.00 0.00  ? 127 ALA A HB2    4  
ATOM   9525  H HB3    . ALA A 1 127 ? -15.049 0.111   -20.289 1.00 0.00  ? 127 ALA A HB3    4  
ATOM   9526  N N      . CYS A 1 128 ? -15.047 -3.305  -17.978 1.00 0.00  ? 128 CYS A N      4  
ATOM   9527  C CA     . CYS A 1 128 ? -14.548 -4.319  -17.060 1.00 0.00  ? 128 CYS A CA     4  
ATOM   9528  C C      . CYS A 1 128 ? -15.119 -5.691  -17.408 1.00 0.00  ? 128 CYS A C      4  
ATOM   9529  O O      . CYS A 1 128 ? -14.477 -6.717  -17.186 1.00 0.00  ? 128 CYS A O      4  
ATOM   9530  C CB     . CYS A 1 128 ? -14.912 -3.947  -15.623 1.00 0.00  ? 128 CYS A CB     4  
ATOM   9531  S SG     . CYS A 1 128 ? -13.728 -2.839  -14.824 1.00 0.00  ? 128 CYS A SG     4  
ATOM   9532  H H      . CYS A 1 128 ? -15.832 -2.779  -17.717 1.00 0.00  ? 128 CYS A H      4  
ATOM   9533  H HA     . CYS A 1 128 ? -13.470 -4.355  -17.152 1.00 0.00  ? 128 CYS A HA     4  
ATOM   9534  H HB2    . CYS A 1 128 ? -15.873 -3.457  -15.620 1.00 0.00  ? 128 CYS A HB2    4  
ATOM   9535  H HB3    . CYS A 1 128 ? -14.976 -4.843  -15.032 1.00 0.00  ? 128 CYS A HB3    4  
ATOM   9536  H HG     . CYS A 1 128 ? -14.172 -2.005  -14.655 1.00 0.00  ? 128 CYS A HG     4  
ATOM   9537  N N      . GLN A 1 129 ? -16.336 -5.697  -17.951 1.00 0.00  ? 129 GLN A N      4  
ATOM   9538  C CA     . GLN A 1 129 ? -16.999 -6.941  -18.328 1.00 0.00  ? 129 GLN A CA     4  
ATOM   9539  C C      . GLN A 1 129 ? -16.227 -7.652  -19.434 1.00 0.00  ? 129 GLN A C      4  
ATOM   9540  O O      . GLN A 1 129 ? -16.027 -8.866  -19.386 1.00 0.00  ? 129 GLN A O      4  
ATOM   9541  C CB     . GLN A 1 129 ? -18.449 -6.664  -18.759 1.00 0.00  ? 129 GLN A CB     4  
ATOM   9542  C CG     . GLN A 1 129 ? -18.631 -6.317  -20.231 1.00 0.00  ? 129 GLN A CG     4  
ATOM   9543  C CD     . GLN A 1 129 ? -18.919 -7.537  -21.081 1.00 0.00  ? 129 GLN A CD     4  
ATOM   9544  O OE1    . GLN A 1 129 ? -18.860 -8.669  -20.603 1.00 0.00  ? 129 GLN A OE1    4  
ATOM   9545  N NE2    . GLN A 1 129 ? -19.237 -7.314  -22.351 1.00 0.00  ? 129 GLN A NE2    4  
ATOM   9546  H H      . GLN A 1 129 ? -16.796 -4.847  -18.099 1.00 0.00  ? 129 GLN A H      4  
ATOM   9547  H HA     . GLN A 1 129 ? -17.013 -7.579  -17.455 1.00 0.00  ? 129 GLN A HA     4  
ATOM   9548  H HB2    . GLN A 1 129 ? -19.035 -7.538  -18.557 1.00 0.00  ? 129 GLN A HB2    4  
ATOM   9549  H HB3    . GLN A 1 129 ? -18.834 -5.843  -18.170 1.00 0.00  ? 129 GLN A HB3    4  
ATOM   9550  H HG2    . GLN A 1 129 ? -19.459 -5.631  -20.327 1.00 0.00  ? 129 GLN A HG2    4  
ATOM   9551  H HG3    . GLN A 1 129 ? -17.738 -5.847  -20.594 1.00 0.00  ? 129 GLN A HG3    4  
ATOM   9552  H HE21   . GLN A 1 129 ? -19.266 -6.387  -22.665 1.00 0.00  ? 129 GLN A HE21   4  
ATOM   9553  H HE22   . GLN A 1 129 ? -19.426 -8.086  -22.923 1.00 0.00  ? 129 GLN A HE22   4  
ATOM   9554  N N      . LEU A 1 130 ? -15.783 -6.884  -20.416 1.00 0.00  ? 130 LEU A N      4  
ATOM   9555  C CA     . LEU A 1 130 ? -15.019 -7.429  -21.531 1.00 0.00  ? 130 LEU A CA     4  
ATOM   9556  C C      . LEU A 1 130 ? -13.582 -7.687  -21.106 1.00 0.00  ? 130 LEU A C      4  
ATOM   9557  O O      . LEU A 1 130 ? -13.007 -8.726  -21.428 1.00 0.00  ? 130 LEU A O      4  
ATOM   9558  C CB     . LEU A 1 130 ? -15.047 -6.472  -22.722 1.00 0.00  ? 130 LEU A CB     4  
ATOM   9559  C CG     . LEU A 1 130 ? -16.432 -5.931  -23.089 1.00 0.00  ? 130 LEU A CG     4  
ATOM   9560  C CD1    . LEU A 1 130 ? -16.428 -4.412  -23.082 1.00 0.00  ? 130 LEU A CD1    4  
ATOM   9561  C CD2    . LEU A 1 130 ? -16.872 -6.455  -24.449 1.00 0.00  ? 130 LEU A CD2    4  
ATOM   9562  H H      . LEU A 1 130 ? -15.971 -5.924  -20.387 1.00 0.00  ? 130 LEU A H      4  
ATOM   9563  H HA     . LEU A 1 130 ? -15.467 -8.370  -21.818 1.00 0.00  ? 130 LEU A HA     4  
ATOM   9564  H HB2    . LEU A 1 130 ? -14.401 -5.637  -22.496 1.00 0.00  ? 130 LEU A HB2    4  
ATOM   9565  H HB3    . LEU A 1 130 ? -14.649 -6.990  -23.578 1.00 0.00  ? 130 LEU A HB3    4  
ATOM   9566  H HG     . LEU A 1 130 ? -17.149 -6.263  -22.353 1.00 0.00  ? 130 LEU A HG     4  
ATOM   9567  H HD11   . LEU A 1 130 ? -15.691 -4.058  -22.375 1.00 0.00  ? 130 LEU A HD11   4  
ATOM   9568  H HD12   . LEU A 1 130 ? -17.403 -4.048  -22.796 1.00 0.00  ? 130 LEU A HD12   4  
ATOM   9569  H HD13   . LEU A 1 130 ? -16.182 -4.049  -24.068 1.00 0.00  ? 130 LEU A HD13   4  
ATOM   9570  H HD21   . LEU A 1 130 ? -16.481 -7.451  -24.594 1.00 0.00  ? 130 LEU A HD21   4  
ATOM   9571  H HD22   . LEU A 1 130 ? -16.495 -5.803  -25.224 1.00 0.00  ? 130 LEU A HD22   4  
ATOM   9572  H HD23   . LEU A 1 130 ? -17.952 -6.482  -24.493 1.00 0.00  ? 130 LEU A HD23   4  
ATOM   9573  N N      . ALA A 1 131 ? -13.008 -6.747  -20.363 1.00 0.00  ? 131 ALA A N      4  
ATOM   9574  C CA     . ALA A 1 131 ? -11.645 -6.896  -19.880 1.00 0.00  ? 131 ALA A CA     4  
ATOM   9575  C C      . ALA A 1 131 ? -11.608 -7.860  -18.702 1.00 0.00  ? 131 ALA A C      4  
ATOM   9576  O O      . ALA A 1 131 ? -11.115 -7.527  -17.627 1.00 0.00  ? 131 ALA A O      4  
ATOM   9577  C CB     . ALA A 1 131 ? -11.061 -5.549  -19.485 1.00 0.00  ? 131 ALA A CB     4  
ATOM   9578  H H      . ALA A 1 131 ? -13.519 -5.944  -20.124 1.00 0.00  ? 131 ALA A H      4  
ATOM   9579  H HA     . ALA A 1 131 ? -11.048 -7.301  -20.687 1.00 0.00  ? 131 ALA A HA     4  
ATOM   9580  H HB1    . ALA A 1 131 ? -11.587 -5.170  -18.622 1.00 0.00  ? 131 ALA A HB1    4  
ATOM   9581  H HB2    . ALA A 1 131 ? -11.163 -4.854  -20.305 1.00 0.00  ? 131 ALA A HB2    4  
ATOM   9582  H HB3    . ALA A 1 131 ? -10.014 -5.671  -19.244 1.00 0.00  ? 131 ALA A HB3    4  
ATOM   9583  N N      . GLN A 1 132 ? -12.152 -9.059  -18.924 1.00 0.00  ? 132 GLN A N      4  
ATOM   9584  C CA     . GLN A 1 132 ? -12.212 -10.103 -17.895 1.00 0.00  ? 132 GLN A CA     4  
ATOM   9585  C C      . GLN A 1 132 ? -10.948 -10.112 -17.040 1.00 0.00  ? 132 GLN A C      4  
ATOM   9586  O O      . GLN A 1 132 ? -10.996 -10.398 -15.844 1.00 0.00  ? 132 GLN A O      4  
ATOM   9587  C CB     . GLN A 1 132 ? -12.415 -11.503 -18.516 1.00 0.00  ? 132 GLN A CB     4  
ATOM   9588  C CG     . GLN A 1 132 ? -12.406 -11.554 -20.044 1.00 0.00  ? 132 GLN A CG     4  
ATOM   9589  C CD     . GLN A 1 132 ? -13.794 -11.696 -20.637 1.00 0.00  ? 132 GLN A CD     4  
ATOM   9590  O OE1    . GLN A 1 132 ? -13.989 -12.405 -21.623 1.00 0.00  ? 132 GLN A OE1    4  
ATOM   9591  N NE2    . GLN A 1 132 ? -14.770 -11.021 -20.038 1.00 0.00  ? 132 GLN A NE2    4  
ATOM   9592  H H      . GLN A 1 132 ? -12.532 -9.239  -19.799 1.00 0.00  ? 132 GLN A H      4  
ATOM   9593  H HA     . GLN A 1 132 ? -13.055 -9.882  -17.256 1.00 0.00  ? 132 GLN A HA     4  
ATOM   9594  H HB2    . GLN A 1 132 ? -11.625 -12.150 -18.164 1.00 0.00  ? 132 GLN A HB2    4  
ATOM   9595  H HB3    . GLN A 1 132 ? -13.360 -11.895 -18.173 1.00 0.00  ? 132 GLN A HB3    4  
ATOM   9596  H HG2    . GLN A 1 132 ? -11.956 -10.654 -20.427 1.00 0.00  ? 132 GLN A HG2    4  
ATOM   9597  H HG3    . GLN A 1 132 ? -11.818 -12.401 -20.353 1.00 0.00  ? 132 GLN A HG3    4  
ATOM   9598  H HE21   . GLN A 1 132 ? -14.546 -10.476 -19.257 1.00 0.00  ? 132 GLN A HE21   4  
ATOM   9599  H HE22   . GLN A 1 132 ? -15.676 -11.099 -20.404 1.00 0.00  ? 132 GLN A HE22   4  
ATOM   9600  N N      . PHE A 1 133 ? -9.825  -9.793  -17.665 1.00 0.00  ? 133 PHE A N      4  
ATOM   9601  C CA     . PHE A 1 133 ? -8.549  -9.757  -16.969 1.00 0.00  ? 133 PHE A CA     4  
ATOM   9602  C C      . PHE A 1 133 ? -8.589  -8.752  -15.823 1.00 0.00  ? 133 PHE A C      4  
ATOM   9603  O O      . PHE A 1 133 ? -8.832  -7.563  -16.031 1.00 0.00  ? 133 PHE A O      4  
ATOM   9604  C CB     . PHE A 1 133 ? -7.429  -9.414  -17.951 1.00 0.00  ? 133 PHE A CB     4  
ATOM   9605  C CG     . PHE A 1 133 ? -7.248  -10.458 -19.018 1.00 0.00  ? 133 PHE A CG     4  
ATOM   9606  C CD1    . PHE A 1 133 ? -8.133  -10.542 -20.082 1.00 0.00  ? 133 PHE A CD1    4  
ATOM   9607  C CD2    . PHE A 1 133 ? -6.202  -11.362 -18.952 1.00 0.00  ? 133 PHE A CD2    4  
ATOM   9608  C CE1    . PHE A 1 133 ? -7.979  -11.507 -21.057 1.00 0.00  ? 133 PHE A CE1    4  
ATOM   9609  C CE2    . PHE A 1 133 ? -6.042  -12.331 -19.925 1.00 0.00  ? 133 PHE A CE2    4  
ATOM   9610  C CZ     . PHE A 1 133 ? -6.932  -12.403 -20.979 1.00 0.00  ? 133 PHE A CZ     4  
ATOM   9611  H H      . PHE A 1 133 ? -9.856  -9.572  -18.616 1.00 0.00  ? 133 PHE A H      4  
ATOM   9612  H HA     . PHE A 1 133 ? -8.369  -10.741 -16.559 1.00 0.00  ? 133 PHE A HA     4  
ATOM   9613  H HB2    . PHE A 1 133 ? -7.657  -8.478  -18.436 1.00 0.00  ? 133 PHE A HB2    4  
ATOM   9614  H HB3    . PHE A 1 133 ? -6.499  -9.321  -17.413 1.00 0.00  ? 133 PHE A HB3    4  
ATOM   9615  H HD1    . PHE A 1 133 ? -8.951  -9.841  -20.149 1.00 0.00  ? 133 PHE A HD1    4  
ATOM   9616  H HD2    . PHE A 1 133 ? -5.506  -11.307 -18.127 1.00 0.00  ? 133 PHE A HD2    4  
ATOM   9617  H HE1    . PHE A 1 133 ? -8.677  -11.561 -21.879 1.00 0.00  ? 133 PHE A HE1    4  
ATOM   9618  H HE2    . PHE A 1 133 ? -5.222  -13.031 -19.861 1.00 0.00  ? 133 PHE A HE2    4  
ATOM   9619  H HZ     . PHE A 1 133 ? -6.810  -13.159 -21.741 1.00 0.00  ? 133 PHE A HZ     4  
ATOM   9620  N N      . LYS A 1 134 ? -8.355  -9.245  -14.611 1.00 0.00  ? 134 LYS A N      4  
ATOM   9621  C CA     . LYS A 1 134 ? -8.365  -8.411  -13.412 1.00 0.00  ? 134 LYS A CA     4  
ATOM   9622  C C      . LYS A 1 134 ? -7.572  -7.126  -13.626 1.00 0.00  ? 134 LYS A C      4  
ATOM   9623  O O      . LYS A 1 134 ? -8.077  -6.023  -13.416 1.00 0.00  ? 134 LYS A O      4  
ATOM   9624  C CB     . LYS A 1 134 ? -7.763  -9.194  -12.244 1.00 0.00  ? 134 LYS A CB     4  
ATOM   9625  C CG     . LYS A 1 134 ? -7.672  -8.403  -10.948 1.00 0.00  ? 134 LYS A CG     4  
ATOM   9626  C CD     . LYS A 1 134 ? -6.255  -8.407  -10.392 1.00 0.00  ? 134 LYS A CD     4  
ATOM   9627  C CE     . LYS A 1 134 ? -6.030  -9.566  -9.433  1.00 0.00  ? 134 LYS A CE     4  
ATOM   9628  N NZ     . LYS A 1 134 ? -4.827  -10.365 -9.798  1.00 0.00  ? 134 LYS A NZ     4  
ATOM   9629  H H      . LYS A 1 134 ? -8.174  -10.204 -14.520 1.00 0.00  ? 134 LYS A H      4  
ATOM   9630  H HA     . LYS A 1 134 ? -9.389  -8.162  -13.182 1.00 0.00  ? 134 LYS A HA     4  
ATOM   9631  H HB2    . LYS A 1 134 ? -8.367  -10.071 -12.065 1.00 0.00  ? 134 LYS A HB2    4  
ATOM   9632  H HB3    . LYS A 1 134 ? -6.763  -9.506  -12.522 1.00 0.00  ? 134 LYS A HB3    4  
ATOM   9633  H HG2    . LYS A 1 134 ? -7.972  -7.384  -11.139 1.00 0.00  ? 134 LYS A HG2    4  
ATOM   9634  H HG3    . LYS A 1 134 ? -8.337  -8.847  -10.220 1.00 0.00  ? 134 LYS A HG3    4  
ATOM   9635  H HD2    . LYS A 1 134 ? -5.558  -8.493  -11.213 1.00 0.00  ? 134 LYS A HD2    4  
ATOM   9636  H HD3    . LYS A 1 134 ? -6.082  -7.477  -9.868  1.00 0.00  ? 134 LYS A HD3    4  
ATOM   9637  H HE2    . LYS A 1 134 ? -5.900  -9.171  -8.436  1.00 0.00  ? 134 LYS A HE2    4  
ATOM   9638  H HE3    . LYS A 1 134 ? -6.898  -10.209 -9.453  1.00 0.00  ? 134 LYS A HE3    4  
ATOM   9639  H HZ1    . LYS A 1 134 ? -4.024  -9.734  -9.995  1.00 0.00  ? 134 LYS A HZ1    4  
ATOM   9640  H HZ2    . LYS A 1 134 ? -5.020  -10.937 -10.644 1.00 0.00  ? 134 LYS A HZ2    4  
ATOM   9641  H HZ3    . LYS A 1 134 ? -4.570  -11.001 -9.015  1.00 0.00  ? 134 LYS A HZ3    4  
ATOM   9642  N N      . GLU A 1 135 ? -6.324  -7.294  -14.035 1.00 0.00  ? 135 GLU A N      4  
ATOM   9643  C CA     . GLU A 1 135 ? -5.419  -6.174  -14.282 1.00 0.00  ? 135 GLU A CA     4  
ATOM   9644  C C      . GLU A 1 135 ? -6.113  -5.022  -14.999 1.00 0.00  ? 135 GLU A C      4  
ATOM   9645  O O      . GLU A 1 135 ? -6.081  -3.881  -14.536 1.00 0.00  ? 135 GLU A O      4  
ATOM   9646  C CB     . GLU A 1 135 ? -4.231  -6.649  -15.112 1.00 0.00  ? 135 GLU A CB     4  
ATOM   9647  C CG     . GLU A 1 135 ? -3.543  -7.877  -14.541 1.00 0.00  ? 135 GLU A CG     4  
ATOM   9648  C CD     . GLU A 1 135 ? -4.102  -9.180  -15.080 1.00 0.00  ? 135 GLU A CD     4  
ATOM   9649  O OE1    . GLU A 1 135 ? -5.285  -9.198  -15.482 1.00 0.00  ? 135 GLU A OE1    4  
ATOM   9650  O OE2    . GLU A 1 135 ? -3.356  -10.181 -15.103 1.00 0.00  ? 135 GLU A OE2    4  
ATOM   9651  H H      . GLU A 1 135 ? -5.995  -8.203  -14.172 1.00 0.00  ? 135 GLU A H      4  
ATOM   9652  H HA     . GLU A 1 135 ? -5.058  -5.825  -13.326 1.00 0.00  ? 135 GLU A HA     4  
ATOM   9653  H HB2    . GLU A 1 135 ? -4.573  -6.884  -16.108 1.00 0.00  ? 135 GLU A HB2    4  
ATOM   9654  H HB3    . GLU A 1 135 ? -3.504  -5.852  -15.169 1.00 0.00  ? 135 GLU A HB3    4  
ATOM   9655  H HG2    . GLU A 1 135 ? -2.500  -7.828  -14.790 1.00 0.00  ? 135 GLU A HG2    4  
ATOM   9656  H HG3    . GLU A 1 135 ? -3.658  -7.871  -13.467 1.00 0.00  ? 135 GLU A HG3    4  
ATOM   9657  H HE2    . GLU A 1 135 ? -3.774  -10.970 -15.456 1.00 0.00  ? 135 GLU A HE2    4  
ATOM   9658  N N      . MET A 1 136 ? -6.725  -5.318  -16.141 1.00 0.00  ? 136 MET A N      4  
ATOM   9659  C CA     . MET A 1 136 ? -7.405  -4.292  -16.918 1.00 0.00  ? 136 MET A CA     4  
ATOM   9660  C C      . MET A 1 136 ? -8.566  -3.693  -16.141 1.00 0.00  ? 136 MET A C      4  
ATOM   9661  O O      . MET A 1 136 ? -8.735  -2.474  -16.112 1.00 0.00  ? 136 MET A O      4  
ATOM   9662  C CB     . MET A 1 136 ? -7.897  -4.867  -18.243 1.00 0.00  ? 136 MET A CB     4  
ATOM   9663  C CG     . MET A 1 136 ? -6.772  -5.181  -19.213 1.00 0.00  ? 136 MET A CG     4  
ATOM   9664  S SD     . MET A 1 136 ? -6.382  -3.796  -20.304 1.00 0.00  ? 136 MET A SD     4  
ATOM   9665  C CE     . MET A 1 136 ? -6.421  -2.415  -19.162 1.00 0.00  ? 136 MET A CE     4  
ATOM   9666  H H      . MET A 1 136 ? -6.710  -6.241  -16.469 1.00 0.00  ? 136 MET A H      4  
ATOM   9667  H HA     . MET A 1 136 ? -6.690  -3.514  -17.119 1.00 0.00  ? 136 MET A HA     4  
ATOM   9668  H HB2    . MET A 1 136 ? -8.439  -5.779  -18.046 1.00 0.00  ? 136 MET A HB2    4  
ATOM   9669  H HB3    . MET A 1 136 ? -8.559  -4.154  -18.710 1.00 0.00  ? 136 MET A HB3    4  
ATOM   9670  H HG2    . MET A 1 136 ? -5.887  -5.438  -18.645 1.00 0.00  ? 136 MET A HG2    4  
ATOM   9671  H HG3    . MET A 1 136 ? -7.067  -6.024  -19.820 1.00 0.00  ? 136 MET A HG3    4  
ATOM   9672  H HE1    . MET A 1 136 ? -5.621  -2.518  -18.442 1.00 0.00  ? 136 MET A HE1    4  
ATOM   9673  H HE2    . MET A 1 136 ? -7.369  -2.402  -18.645 1.00 0.00  ? 136 MET A HE2    4  
ATOM   9674  H HE3    . MET A 1 136 ? -6.297  -1.490  -19.706 1.00 0.00  ? 136 MET A HE3    4  
ATOM   9675  N N      . LYS A 1 137 ? -9.359  -4.546  -15.502 1.00 0.00  ? 137 LYS A N      4  
ATOM   9676  C CA     . LYS A 1 137 ? -10.493 -4.078  -14.718 1.00 0.00  ? 137 LYS A CA     4  
ATOM   9677  C C      . LYS A 1 137 ? -10.049 -2.974  -13.768 1.00 0.00  ? 137 LYS A C      4  
ATOM   9678  O O      . LYS A 1 137 ? -10.730 -1.963  -13.613 1.00 0.00  ? 137 LYS A O      4  
ATOM   9679  C CB     . LYS A 1 137 ? -11.115 -5.227  -13.928 1.00 0.00  ? 137 LYS A CB     4  
ATOM   9680  C CG     . LYS A 1 137 ? -12.299 -5.871  -14.626 1.00 0.00  ? 137 LYS A CG     4  
ATOM   9681  C CD     . LYS A 1 137 ? -11.989 -7.299  -15.044 1.00 0.00  ? 137 LYS A CD     4  
ATOM   9682  C CE     . LYS A 1 137 ? -12.407 -8.294  -13.975 1.00 0.00  ? 137 LYS A CE     4  
ATOM   9683  N NZ     . LYS A 1 137 ? -12.133 -7.791  -12.599 1.00 0.00  ? 137 LYS A NZ     4  
ATOM   9684  H H      . LYS A 1 137 ? -9.173  -5.508  -15.553 1.00 0.00  ? 137 LYS A H      4  
ATOM   9685  H HA     . LYS A 1 137 ? -11.228 -3.677  -15.402 1.00 0.00  ? 137 LYS A HA     4  
ATOM   9686  H HB2    . LYS A 1 137 ? -10.362 -5.985  -13.764 1.00 0.00  ? 137 LYS A HB2    4  
ATOM   9687  H HB3    . LYS A 1 137 ? -11.449 -4.853  -12.971 1.00 0.00  ? 137 LYS A HB3    4  
ATOM   9688  H HG2    . LYS A 1 137 ? -13.142 -5.881  -13.950 1.00 0.00  ? 137 LYS A HG2    4  
ATOM   9689  H HG3    . LYS A 1 137 ? -12.547 -5.294  -15.505 1.00 0.00  ? 137 LYS A HG3    4  
ATOM   9690  H HD2    . LYS A 1 137 ? -12.521 -7.519  -15.956 1.00 0.00  ? 137 LYS A HD2    4  
ATOM   9691  H HD3    . LYS A 1 137 ? -10.924 -7.391  -15.213 1.00 0.00  ? 137 LYS A HD3    4  
ATOM   9692  H HE2    . LYS A 1 137 ? -13.467 -8.478  -14.075 1.00 0.00  ? 137 LYS A HE2    4  
ATOM   9693  H HE3    . LYS A 1 137 ? -11.864 -9.215  -14.128 1.00 0.00  ? 137 LYS A HE3    4  
ATOM   9694  H HZ1    . LYS A 1 137 ? -12.809 -7.040  -12.350 1.00 0.00  ? 137 LYS A HZ1    4  
ATOM   9695  H HZ2    . LYS A 1 137 ? -11.169 -7.404  -12.546 1.00 0.00  ? 137 LYS A HZ2    4  
ATOM   9696  H HZ3    . LYS A 1 137 ? -12.222 -8.566  -11.912 1.00 0.00  ? 137 LYS A HZ3    4  
ATOM   9697  N N      . ALA A 1 138 ? -8.892  -3.179  -13.145 1.00 0.00  ? 138 ALA A N      4  
ATOM   9698  C CA     . ALA A 1 138 ? -8.339  -2.204  -12.218 1.00 0.00  ? 138 ALA A CA     4  
ATOM   9699  C C      . ALA A 1 138 ? -7.904  -0.945  -12.955 1.00 0.00  ? 138 ALA A C      4  
ATOM   9700  O O      . ALA A 1 138 ? -8.188  0.170   -12.521 1.00 0.00  ? 138 ALA A O      4  
ATOM   9701  C CB     . ALA A 1 138 ? -7.171  -2.802  -11.455 1.00 0.00  ? 138 ALA A CB     4  
ATOM   9702  H H      . ALA A 1 138 ? -8.393  -4.005  -13.325 1.00 0.00  ? 138 ALA A H      4  
ATOM   9703  H HA     . ALA A 1 138 ? -9.109  -1.948  -11.506 1.00 0.00  ? 138 ALA A HA     4  
ATOM   9704  H HB1    . ALA A 1 138 ? -6.727  -2.042  -10.829 1.00 0.00  ? 138 ALA A HB1    4  
ATOM   9705  H HB2    . ALA A 1 138 ? -6.434  -3.170  -12.155 1.00 0.00  ? 138 ALA A HB2    4  
ATOM   9706  H HB3    . ALA A 1 138 ? -7.523  -3.616  -10.838 1.00 0.00  ? 138 ALA A HB3    4  
ATOM   9707  N N      . ALA A 1 139 ? -7.218  -1.133  -14.081 1.00 0.00  ? 139 ALA A N      4  
ATOM   9708  C CA     . ALA A 1 139 ? -6.753  -0.011  -14.887 1.00 0.00  ? 139 ALA A CA     4  
ATOM   9709  C C      . ALA A 1 139 ? -7.909  0.925   -15.215 1.00 0.00  ? 139 ALA A C      4  
ATOM   9710  O O      . ALA A 1 139 ? -7.777  2.145   -15.140 1.00 0.00  ? 139 ALA A O      4  
ATOM   9711  C CB     . ALA A 1 139 ? -6.099  -0.518  -16.166 1.00 0.00  ? 139 ALA A CB     4  
ATOM   9712  H H      . ALA A 1 139 ? -7.029  -2.048  -14.379 1.00 0.00  ? 139 ALA A H      4  
ATOM   9713  H HA     . ALA A 1 139 ? -6.012  0.529   -14.317 1.00 0.00  ? 139 ALA A HA     4  
ATOM   9714  H HB1    . ALA A 1 139 ? -6.364  -1.553  -16.321 1.00 0.00  ? 139 ALA A HB1    4  
ATOM   9715  H HB2    . ALA A 1 139 ? -5.025  -0.433  -16.079 1.00 0.00  ? 139 ALA A HB2    4  
ATOM   9716  H HB3    . ALA A 1 139 ? -6.439  0.071   -17.004 1.00 0.00  ? 139 ALA A HB3    4  
ATOM   9717  N N      . LEU A 1 140 ? -9.046  0.335   -15.565 1.00 0.00  ? 140 LEU A N      4  
ATOM   9718  C CA     . LEU A 1 140 ? -10.238 1.104   -15.892 1.00 0.00  ? 140 LEU A CA     4  
ATOM   9719  C C      . LEU A 1 140 ? -10.968 1.518   -14.617 1.00 0.00  ? 140 LEU A C      4  
ATOM   9720  O O      . LEU A 1 140 ? -11.636 2.552   -14.580 1.00 0.00  ? 140 LEU A O      4  
ATOM   9721  C CB     . LEU A 1 140 ? -11.170 0.282   -16.784 1.00 0.00  ? 140 LEU A CB     4  
ATOM   9722  C CG     . LEU A 1 140 ? -10.475 -0.474  -17.923 1.00 0.00  ? 140 LEU A CG     4  
ATOM   9723  C CD1    . LEU A 1 140 ? -10.827 -1.954  -17.880 1.00 0.00  ? 140 LEU A CD1    4  
ATOM   9724  C CD2    . LEU A 1 140 ? -10.847 0.123   -19.275 1.00 0.00  ? 140 LEU A CD2    4  
ATOM   9725  H H      . LEU A 1 140 ? -9.086  -0.644  -15.597 1.00 0.00  ? 140 LEU A H      4  
ATOM   9726  H HA     . LEU A 1 140 ? -9.926  1.990   -16.425 1.00 0.00  ? 140 LEU A HA     4  
ATOM   9727  H HB2    . LEU A 1 140 ? -11.688 -0.433  -16.164 1.00 0.00  ? 140 LEU A HB2    4  
ATOM   9728  H HB3    . LEU A 1 140 ? -11.899 0.952   -17.218 1.00 0.00  ? 140 LEU A HB3    4  
ATOM   9729  H HG     . LEU A 1 140 ? -9.405  -0.386  -17.803 1.00 0.00  ? 140 LEU A HG     4  
ATOM   9730  H HD11   . LEU A 1 140 ? -10.093 -2.515  -18.440 1.00 0.00  ? 140 LEU A HD11   4  
ATOM   9731  H HD12   . LEU A 1 140 ? -11.804 -2.106  -18.315 1.00 0.00  ? 140 LEU A HD12   4  
ATOM   9732  H HD13   . LEU A 1 140 ? -10.833 -2.293  -16.855 1.00 0.00  ? 140 LEU A HD13   4  
ATOM   9733  H HD21   . LEU A 1 140 ? -11.408 1.036   -19.125 1.00 0.00  ? 140 LEU A HD21   4  
ATOM   9734  H HD22   . LEU A 1 140 ? -11.451 -0.582  -19.828 1.00 0.00  ? 140 LEU A HD22   4  
ATOM   9735  H HD23   . LEU A 1 140 ? -9.947  0.340   -19.831 1.00 0.00  ? 140 LEU A HD23   4  
ATOM   9736  N N      . GLN A 1 141 ? -10.834 0.702   -13.575 1.00 0.00  ? 141 GLN A N      4  
ATOM   9737  C CA     . GLN A 1 141 ? -11.479 0.980   -12.296 1.00 0.00  ? 141 GLN A CA     4  
ATOM   9738  C C      . GLN A 1 141 ? -10.953 2.278   -11.692 1.00 0.00  ? 141 GLN A C      4  
ATOM   9739  O O      . GLN A 1 141 ? -11.730 3.162   -11.325 1.00 0.00  ? 141 GLN A O      4  
ATOM   9740  C CB     . GLN A 1 141 ? -11.246 -0.179  -11.324 1.00 0.00  ? 141 GLN A CB     4  
ATOM   9741  C CG     . GLN A 1 141 ? -12.531 -0.853  -10.865 1.00 0.00  ? 141 GLN A CG     4  
ATOM   9742  C CD     . GLN A 1 141 ? -13.453 0.069   -10.086 1.00 0.00  ? 141 GLN A CD     4  
ATOM   9743  O OE1    . GLN A 1 141 ? -14.671 -0.103  -10.103 1.00 0.00  ? 141 GLN A OE1    4  
ATOM   9744  N NE2    . GLN A 1 141 ? -12.885 1.053   -9.395  1.00 0.00  ? 141 GLN A NE2    4  
ATOM   9745  H H      . GLN A 1 141 ? -10.290 -0.108  -13.668 1.00 0.00  ? 141 GLN A H      4  
ATOM   9746  H HA     . GLN A 1 141 ? -12.538 1.080   -12.473 1.00 0.00  ? 141 GLN A HA     4  
ATOM   9747  H HB2    . GLN A 1 141 ? -10.629 -0.918  -11.809 1.00 0.00  ? 141 GLN A HB2    4  
ATOM   9748  H HB3    . GLN A 1 141 ? -10.725 0.190   -10.453 1.00 0.00  ? 141 GLN A HB3    4  
ATOM   9749  H HG2    . GLN A 1 141 ? -13.061 -1.209  -11.735 1.00 0.00  ? 141 GLN A HG2    4  
ATOM   9750  H HG3    . GLN A 1 141 ? -12.274 -1.691  -10.240 1.00 0.00  ? 141 GLN A HG3    4  
ATOM   9751  H HE21   . GLN A 1 141 ? -11.910 1.137   -9.421  1.00 0.00  ? 141 GLN A HE21   4  
ATOM   9752  H HE22   . GLN A 1 141 ? -13.467 1.658   -8.889  1.00 0.00  ? 141 GLN A HE22   4  
ATOM   9753  N N      . GLU A 1 142 ? -9.633  2.392   -11.599 1.00 0.00  ? 142 GLU A N      4  
ATOM   9754  C CA     . GLU A 1 142 ? -9.011  3.586   -11.047 1.00 0.00  ? 142 GLU A CA     4  
ATOM   9755  C C      . GLU A 1 142 ? -9.124  4.749   -12.028 1.00 0.00  ? 142 GLU A C      4  
ATOM   9756  O O      . GLU A 1 142 ? -9.178  5.911   -11.627 1.00 0.00  ? 142 GLU A O      4  
ATOM   9757  C CB     . GLU A 1 142 ? -7.540  3.319   -10.717 1.00 0.00  ? 142 GLU A CB     4  
ATOM   9758  C CG     . GLU A 1 142 ? -7.340  2.225   -9.680  1.00 0.00  ? 142 GLU A CG     4  
ATOM   9759  C CD     . GLU A 1 142 ? -7.885  2.607   -8.317  1.00 0.00  ? 142 GLU A CD     4  
ATOM   9760  O OE1    . GLU A 1 142 ? -7.073  2.884   -7.410  1.00 0.00  ? 142 GLU A OE1    4  
ATOM   9761  O OE2    . GLU A 1 142 ? -9.123  2.631   -8.160  1.00 0.00  ? 142 GLU A OE2    4  
ATOM   9762  H H      . GLU A 1 142 ? -9.064  1.657   -11.913 1.00 0.00  ? 142 GLU A H      4  
ATOM   9763  H HA     . GLU A 1 142 ? -9.535  3.846   -10.138 1.00 0.00  ? 142 GLU A HA     4  
ATOM   9764  H HB2    . GLU A 1 142 ? -7.029  3.025   -11.621 1.00 0.00  ? 142 GLU A HB2    4  
ATOM   9765  H HB3    . GLU A 1 142 ? -7.095  4.227   -10.340 1.00 0.00  ? 142 GLU A HB3    4  
ATOM   9766  H HG2    . GLU A 1 142 ? -7.844  1.333   -10.014 1.00 0.00  ? 142 GLU A HG2    4  
ATOM   9767  H HG3    . GLU A 1 142 ? -6.282  2.026   -9.586  1.00 0.00  ? 142 GLU A HG3    4  
ATOM   9768  H HE2    . GLU A 1 142 ? -9.397  2.881   -7.274  1.00 0.00  ? 142 GLU A HE2    4  
ATOM   9769  N N      . GLY A 1 143 ? -9.163  4.424   -13.319 1.00 0.00  ? 143 GLY A N      4  
ATOM   9770  C CA     . GLY A 1 143 ? -9.272  5.450   -14.338 1.00 0.00  ? 143 GLY A CA     4  
ATOM   9771  C C      . GLY A 1 143 ? -10.456 6.368   -14.103 1.00 0.00  ? 143 GLY A C      4  
ATOM   9772  O O      . GLY A 1 143 ? -10.336 7.590   -14.202 1.00 0.00  ? 143 GLY A O      4  
ATOM   9773  H H      . GLY A 1 143 ? -9.119  3.481   -13.579 1.00 0.00  ? 143 GLY A H      4  
ATOM   9774  H HA2    . GLY A 1 143 ? -8.368  6.039   -14.341 1.00 0.00  ? 143 GLY A HA2    4  
ATOM   9775  H HA3    . GLY A 1 143 ? -9.386  4.977   -15.302 1.00 0.00  ? 143 GLY A HA3    4  
ATOM   9776  N N      . HIS A 1 144 ? -11.602 5.778   -13.782 1.00 0.00  ? 144 HIS A N      4  
ATOM   9777  C CA     . HIS A 1 144 ? -12.811 6.546   -13.522 1.00 0.00  ? 144 HIS A CA     4  
ATOM   9778  C C      . HIS A 1 144 ? -12.796 7.108   -12.105 1.00 0.00  ? 144 HIS A C      4  
ATOM   9779  O O      . HIS A 1 144 ? -13.378 8.157   -11.836 1.00 0.00  ? 144 HIS A O      4  
ATOM   9780  C CB     . HIS A 1 144 ? -14.051 5.671   -13.718 1.00 0.00  ? 144 HIS A CB     4  
ATOM   9781  C CG     . HIS A 1 144 ? -15.341 6.418   -13.571 1.00 0.00  ? 144 HIS A CG     4  
ATOM   9782  N ND1    . HIS A 1 144 ? -15.988 6.570   -12.362 1.00 0.00  ? 144 HIS A ND1    4  
ATOM   9783  C CD2    . HIS A 1 144 ? -16.101 7.059   -14.486 1.00 0.00  ? 144 HIS A CD2    4  
ATOM   9784  C CE1    . HIS A 1 144 ? -17.092 7.272   -12.542 1.00 0.00  ? 144 HIS A CE1    4  
ATOM   9785  N NE2    . HIS A 1 144 ? -17.183 7.582   -13.821 1.00 0.00  ? 144 HIS A NE2    4  
ATOM   9786  H H      . HIS A 1 144 ? -11.632 4.801   -13.713 1.00 0.00  ? 144 HIS A H      4  
ATOM   9787  H HA     . HIS A 1 144 ? -12.842 7.366   -14.224 1.00 0.00  ? 144 HIS A HA     4  
ATOM   9788  H HB2    . HIS A 1 144 ? -14.031 5.243   -14.708 1.00 0.00  ? 144 HIS A HB2    4  
ATOM   9789  H HB3    . HIS A 1 144 ? -14.042 4.875   -12.988 1.00 0.00  ? 144 HIS A HB3    4  
ATOM   9790  H HD1    . HIS A 1 144 ? -15.684 6.215   -11.501 1.00 0.00  ? 144 HIS A HD1    4  
ATOM   9791  H HD2    . HIS A 1 144 ? -15.895 7.145   -15.544 1.00 0.00  ? 144 HIS A HD2    4  
ATOM   9792  H HE1    . HIS A 1 144 ? -17.799 7.549   -11.773 1.00 0.00  ? 144 HIS A HE1    4  
ATOM   9793  H HE2    . HIS A 1 144 ? -17.866 8.163   -14.215 1.00 0.00  ? 144 HIS A HE2    4  
ATOM   9794  N N      . GLN A 1 145 ? -12.130 6.396   -11.199 1.00 0.00  ? 145 GLN A N      4  
ATOM   9795  C CA     . GLN A 1 145 ? -12.040 6.814   -9.803  1.00 0.00  ? 145 GLN A CA     4  
ATOM   9796  C C      . GLN A 1 145 ? -11.223 8.094   -9.661  1.00 0.00  ? 145 GLN A C      4  
ATOM   9797  O O      . GLN A 1 145 ? -11.673 9.067   -9.056  1.00 0.00  ? 145 GLN A O      4  
ATOM   9798  C CB     . GLN A 1 145 ? -11.403 5.704   -8.966  1.00 0.00  ? 145 GLN A CB     4  
ATOM   9799  C CG     . GLN A 1 145 ? -11.295 6.041   -7.487  1.00 0.00  ? 145 GLN A CG     4  
ATOM   9800  C CD     . GLN A 1 145 ? -12.648 6.277   -6.848  1.00 0.00  ? 145 GLN A CD     4  
ATOM   9801  O OE1    . GLN A 1 145 ? -13.130 7.409   -6.785  1.00 0.00  ? 145 GLN A OE1    4  
ATOM   9802  N NE2    . GLN A 1 145 ? -13.269 5.207   -6.366  1.00 0.00  ? 145 GLN A NE2    4  
ATOM   9803  H H      . GLN A 1 145 ? -11.691 5.565   -11.475 1.00 0.00  ? 145 GLN A H      4  
ATOM   9804  H HA     . GLN A 1 145 ? -13.042 6.993   -9.443  1.00 0.00  ? 145 GLN A HA     4  
ATOM   9805  H HB2    . GLN A 1 145 ? -11.995 4.807   -9.066  1.00 0.00  ? 145 GLN A HB2    4  
ATOM   9806  H HB3    . GLN A 1 145 ? -10.409 5.512   -9.342  1.00 0.00  ? 145 GLN A HB3    4  
ATOM   9807  H HG2    . GLN A 1 145 ? -10.812 5.220   -6.980  1.00 0.00  ? 145 GLN A HG2    4  
ATOM   9808  H HG3    . GLN A 1 145 ? -10.698 6.933   -7.378  1.00 0.00  ? 145 GLN A HG3    4  
ATOM   9809  H HE21   . GLN A 1 145 ? -12.827 4.338   -6.450  1.00 0.00  ? 145 GLN A HE21   4  
ATOM   9810  H HE22   . GLN A 1 145 ? -14.147 5.331   -5.947  1.00 0.00  ? 145 GLN A HE22   4  
ATOM   9811  N N      . PHE A 1 146 ? -10.019 8.084   -10.219 1.00 0.00  ? 146 PHE A N      4  
ATOM   9812  C CA     . PHE A 1 146 ? -9.132  9.240   -10.156 1.00 0.00  ? 146 PHE A CA     4  
ATOM   9813  C C      . PHE A 1 146 ? -9.744  10.434  -10.884 1.00 0.00  ? 146 PHE A C      4  
ATOM   9814  O O      . PHE A 1 146 ? -9.788  11.544  -10.350 1.00 0.00  ? 146 PHE A O      4  
ATOM   9815  C CB     . PHE A 1 146 ? -7.774  8.887   -10.769 1.00 0.00  ? 146 PHE A CB     4  
ATOM   9816  C CG     . PHE A 1 146 ? -6.830  10.052  -10.867 1.00 0.00  ? 146 PHE A CG     4  
ATOM   9817  C CD1    . PHE A 1 146 ? -6.865  10.895  -11.966 1.00 0.00  ? 146 PHE A CD1    4  
ATOM   9818  C CD2    . PHE A 1 146 ? -5.911  10.304  -9.861  1.00 0.00  ? 146 PHE A CD2    4  
ATOM   9819  C CE1    . PHE A 1 146 ? -6.000  11.967  -12.061 1.00 0.00  ? 146 PHE A CE1    4  
ATOM   9820  C CE2    . PHE A 1 146 ? -5.043  11.375  -9.951  1.00 0.00  ? 146 PHE A CE2    4  
ATOM   9821  C CZ     . PHE A 1 146 ? -5.087  12.208  -11.052 1.00 0.00  ? 146 PHE A CZ     4  
ATOM   9822  H H      . PHE A 1 146 ? -9.717  7.276   -10.685 1.00 0.00  ? 146 PHE A H      4  
ATOM   9823  H HA     . PHE A 1 146 ? -8.995  9.496   -9.115  1.00 0.00  ? 146 PHE A HA     4  
ATOM   9824  H HB2    . PHE A 1 146 ? -7.302  8.129   -10.165 1.00 0.00  ? 146 PHE A HB2    4  
ATOM   9825  H HB3    . PHE A 1 146 ? -7.929  8.501   -11.766 1.00 0.00  ? 146 PHE A HB3    4  
ATOM   9826  H HD1    . PHE A 1 146 ? -7.578  10.708  -12.754 1.00 0.00  ? 146 PHE A HD1    4  
ATOM   9827  H HD2    . PHE A 1 146 ? -5.876  9.653   -9.000  1.00 0.00  ? 146 PHE A HD2    4  
ATOM   9828  H HE1    . PHE A 1 146 ? -6.036  12.614  -12.924 1.00 0.00  ? 146 PHE A HE1    4  
ATOM   9829  H HE2    . PHE A 1 146 ? -4.333  11.563  -9.159  1.00 0.00  ? 146 PHE A HE2    4  
ATOM   9830  H HZ     . PHE A 1 146 ? -4.410  13.046  -11.125 1.00 0.00  ? 146 PHE A HZ     4  
ATOM   9831  N N      . LEU A 1 147 ? -10.203 10.196  -12.105 1.00 0.00  ? 147 LEU A N      4  
ATOM   9832  C CA     . LEU A 1 147 ? -10.804 11.244  -12.920 1.00 0.00  ? 147 LEU A CA     4  
ATOM   9833  C C      . LEU A 1 147 ? -11.991 11.895  -12.221 1.00 0.00  ? 147 LEU A C      4  
ATOM   9834  O O      . LEU A 1 147 ? -12.239 13.089  -12.391 1.00 0.00  ? 147 LEU A O      4  
ATOM   9835  C CB     . LEU A 1 147 ? -11.233 10.670  -14.268 1.00 0.00  ? 147 LEU A CB     4  
ATOM   9836  C CG     . LEU A 1 147 ? -10.071 10.280  -15.176 1.00 0.00  ? 147 LEU A CG     4  
ATOM   9837  C CD1    . LEU A 1 147 ? -10.579 9.677   -16.470 1.00 0.00  ? 147 LEU A CD1    4  
ATOM   9838  C CD2    . LEU A 1 147 ? -9.194  11.487  -15.454 1.00 0.00  ? 147 LEU A CD2    4  
ATOM   9839  H H      . LEU A 1 147 ? -10.130 9.291   -12.472 1.00 0.00  ? 147 LEU A H      4  
ATOM   9840  H HA     . LEU A 1 147 ? -10.050 11.995  -13.090 1.00 0.00  ? 147 LEU A HA     4  
ATOM   9841  H HB2    . LEU A 1 147 ? -11.841 9.796   -14.090 1.00 0.00  ? 147 LEU A HB2    4  
ATOM   9842  H HB3    . LEU A 1 147 ? -11.830 11.409  -14.780 1.00 0.00  ? 147 LEU A HB3    4  
ATOM   9843  H HG     . LEU A 1 147 ? -9.467  9.538   -14.675 1.00 0.00  ? 147 LEU A HG     4  
ATOM   9844  H HD11   . LEU A 1 147 ? -9.958  10.013  -17.284 1.00 0.00  ? 147 LEU A HD11   4  
ATOM   9845  H HD12   . LEU A 1 147 ? -11.599 9.991   -16.641 1.00 0.00  ? 147 LEU A HD12   4  
ATOM   9846  H HD13   . LEU A 1 147 ? -10.539 8.599   -16.407 1.00 0.00  ? 147 LEU A HD13   4  
ATOM   9847  H HD21   . LEU A 1 147 ? -8.511  11.258  -16.259 1.00 0.00  ? 147 LEU A HD21   4  
ATOM   9848  H HD22   . LEU A 1 147 ? -8.635  11.739  -14.565 1.00 0.00  ? 147 LEU A HD22   4  
ATOM   9849  H HD23   . LEU A 1 147 ? -9.813  12.325  -15.738 1.00 0.00  ? 147 LEU A HD23   4  
ATOM   9850  N N      . CYS A 1 148 ? -12.722 11.117  -11.430 1.00 0.00  ? 148 CYS A N      4  
ATOM   9851  C CA     . CYS A 1 148 ? -13.877 11.642  -10.710 1.00 0.00  ? 148 CYS A CA     4  
ATOM   9852  C C      . CYS A 1 148 ? -13.440 12.587  -9.591  1.00 0.00  ? 148 CYS A C      4  
ATOM   9853  O O      . CYS A 1 148 ? -14.243 13.359  -9.069  1.00 0.00  ? 148 CYS A O      4  
ATOM   9854  C CB     . CYS A 1 148 ? -14.716 10.500  -10.134 1.00 0.00  ? 148 CYS A CB     4  
ATOM   9855  S SG     . CYS A 1 148 ? -16.461 10.562  -10.601 1.00 0.00  ? 148 CYS A SG     4  
ATOM   9856  H H      . CYS A 1 148 ? -12.477 10.173  -11.326 1.00 0.00  ? 148 CYS A H      4  
ATOM   9857  H HA     . CYS A 1 148 ? -14.479 12.197  -11.415 1.00 0.00  ? 148 CYS A HA     4  
ATOM   9858  H HB2    . CYS A 1 148 ? -14.318 9.558   -10.481 1.00 0.00  ? 148 CYS A HB2    4  
ATOM   9859  H HB3    . CYS A 1 148 ? -14.663 10.529  -9.055  1.00 0.00  ? 148 CYS A HB3    4  
ATOM   9860  H HG     . CYS A 1 148 ? -16.927 9.893   -10.095 1.00 0.00  ? 148 CYS A HG     4  
ATOM   9861  N N      . SER A 1 149 ? -12.161 12.517  -9.227  1.00 0.00  ? 149 SER A N      4  
ATOM   9862  C CA     . SER A 1 149 ? -11.617 13.362  -8.170  1.00 0.00  ? 149 SER A CA     4  
ATOM   9863  C C      . SER A 1 149 ? -11.055 14.671  -8.731  1.00 0.00  ? 149 SER A C      4  
ATOM   9864  O O      . SER A 1 149 ? -10.685 15.565  -7.973  1.00 0.00  ? 149 SER A O      4  
ATOM   9865  C CB     . SER A 1 149 ? -10.520 12.614  -7.408  1.00 0.00  ? 149 SER A CB     4  
ATOM   9866  O OG     . SER A 1 149 ? -10.839 12.503  -6.033  1.00 0.00  ? 149 SER A OG     4  
ATOM   9867  H H      . SER A 1 149 ? -11.570 11.880  -9.679  1.00 0.00  ? 149 SER A H      4  
ATOM   9868  H HA     . SER A 1 149 ? -12.418 13.594  -7.488  1.00 0.00  ? 149 SER A HA     4  
ATOM   9869  H HB2    . SER A 1 149 ? -10.412 11.621  -7.820  1.00 0.00  ? 149 SER A HB2    4  
ATOM   9870  H HB3    . SER A 1 149 ? -9.586  13.145  -7.506  1.00 0.00  ? 149 SER A HB3    4  
ATOM   9871  H HG     . SER A 1 149 ? -11.736 12.172  -5.937  1.00 0.00  ? 149 SER A HG     4  
ATOM   9872  N N      . ILE A 1 150 ? -10.989 14.776  -10.056 1.00 0.00  ? 150 ILE A N      4  
ATOM   9873  C CA     . ILE A 1 150 ? -10.468 15.970  -10.699 1.00 0.00  ? 150 ILE A CA     4  
ATOM   9874  C C      . ILE A 1 150 ? -11.601 16.964  -10.981 1.00 0.00  ? 150 ILE A C      4  
ATOM   9875  O O      . ILE A 1 150 ? -12.495 17.145  -10.153 1.00 0.00  ? 150 ILE A O      4  
ATOM   9876  C CB     . ILE A 1 150 ? -9.714  15.622  -12.010 1.00 0.00  ? 150 ILE A CB     4  
ATOM   9877  C CG1    . ILE A 1 150 ? -9.198  14.179  -11.991 1.00 0.00  ? 150 ILE A CG1    4  
ATOM   9878  C CG2    . ILE A 1 150 ? -8.557  16.589  -12.223 1.00 0.00  ? 150 ILE A CG2    4  
ATOM   9879  C CD1    . ILE A 1 150 ? -8.423  13.803  -13.234 1.00 0.00  ? 150 ILE A CD1    4  
ATOM   9880  H H      . ILE A 1 150 ? -11.297 14.037  -10.616 1.00 0.00  ? 150 ILE A H      4  
ATOM   9881  H HA     . ILE A 1 150 ? -9.767  16.431  -10.018 1.00 0.00  ? 150 ILE A HA     4  
ATOM   9882  H HB     . ILE A 1 150 ? -10.401 15.734  -12.834 1.00 0.00  ? 150 ILE A HB     4  
ATOM   9883  H HG12   . ILE A 1 150 ? -8.546  14.043  -11.145 1.00 0.00  ? 150 ILE A HG12   4  
ATOM   9884  H HG13   . ILE A 1 150 ? -10.036 13.504  -11.905 1.00 0.00  ? 150 ILE A HG13   4  
ATOM   9885  H HG21   . ILE A 1 150 ? -8.943  17.579  -12.408 1.00 0.00  ? 150 ILE A HG21   4  
ATOM   9886  H HG22   . ILE A 1 150 ? -7.973  16.267  -13.072 1.00 0.00  ? 150 ILE A HG22   4  
ATOM   9887  H HG23   . ILE A 1 150 ? -7.934  16.603  -11.343 1.00 0.00  ? 150 ILE A HG23   4  
ATOM   9888  H HD11   . ILE A 1 150 ? -7.617  14.506  -13.382 1.00 0.00  ? 150 ILE A HD11   4  
ATOM   9889  H HD12   . ILE A 1 150 ? -9.083  13.823  -14.088 1.00 0.00  ? 150 ILE A HD12   4  
ATOM   9890  H HD13   . ILE A 1 150 ? -8.021  12.810  -13.116 1.00 0.00  ? 150 ILE A HD13   4  
ATOM   9891  N N      . GLU A 1 151 ? -11.564 17.605  -12.145 1.00 0.00  ? 151 GLU A N      4  
ATOM   9892  C CA     . GLU A 1 151 ? -12.588 18.571  -12.523 1.00 0.00  ? 151 GLU A CA     4  
ATOM   9893  C C      . GLU A 1 151 ? -12.731 18.633  -14.040 1.00 0.00  ? 151 GLU A C      4  
ATOM   9894  O O      . GLU A 1 151 ? -13.829 18.485  -14.578 1.00 0.00  ? 151 GLU A O      4  
ATOM   9895  C CB     . GLU A 1 151 ? -12.240 19.958  -11.978 1.00 0.00  ? 151 GLU A CB     4  
ATOM   9896  C CG     . GLU A 1 151 ? -13.433 20.895  -11.887 1.00 0.00  ? 151 GLU A CG     4  
ATOM   9897  C CD     . GLU A 1 151 ? -13.882 21.133  -10.458 1.00 0.00  ? 151 GLU A CD     4  
ATOM   9898  O OE1    . GLU A 1 151 ? -13.740 20.207  -9.632  1.00 0.00  ? 151 GLU A OE1    4  
ATOM   9899  O OE2    . GLU A 1 151 ? -14.369 22.242  -10.164 1.00 0.00  ? 151 GLU A OE2    4  
ATOM   9900  H H      . GLU A 1 151 ? -10.837 17.422  -12.765 1.00 0.00  ? 151 GLU A H      4  
ATOM   9901  H HA     . GLU A 1 151 ? -13.526 18.248  -12.096 1.00 0.00  ? 151 GLU A HA     4  
ATOM   9902  H HB2    . GLU A 1 151 ? -11.819 19.848  -10.990 1.00 0.00  ? 151 GLU A HB2    4  
ATOM   9903  H HB3    . GLU A 1 151 ? -11.503 20.409  -12.625 1.00 0.00  ? 151 GLU A HB3    4  
ATOM   9904  H HG2    . GLU A 1 151 ? -13.163 21.844  -12.324 1.00 0.00  ? 151 GLU A HG2    4  
ATOM   9905  H HG3    . GLU A 1 151 ? -14.256 20.467  -12.441 1.00 0.00  ? 151 GLU A HG3    4  
ATOM   9906  H HE2    . GLU A 1 151 ? -14.630 22.323  -9.244  1.00 0.00  ? 151 GLU A HE2    4  
ATOM   9907  N N      . ALA A 1 152 ? -11.613 18.847  -14.725 1.00 0.00  ? 152 ALA A N      4  
ATOM   9908  C CA     . ALA A 1 152 ? -11.610 18.927  -16.181 1.00 0.00  ? 152 ALA A CA     4  
ATOM   9909  C C      . ALA A 1 152 ? -10.187 18.884  -16.730 1.00 0.00  ? 152 ALA A C      4  
ATOM   9910  O O      . ALA A 1 152 ? -9.228  18.701  -15.983 1.00 0.00  ? 152 ALA A O      4  
ATOM   9911  C CB     . ALA A 1 152 ? -12.317 20.189  -16.643 1.00 0.00  ? 152 ALA A CB     4  
ATOM   9912  H H      . ALA A 1 152 ? -10.767 18.954  -14.238 1.00 0.00  ? 152 ALA A H      4  
ATOM   9913  H HA     . ALA A 1 152 ? -12.157 18.076  -16.561 1.00 0.00  ? 152 ALA A HA     4  
ATOM   9914  H HB1    . ALA A 1 152 ? -12.828 19.994  -17.576 1.00 0.00  ? 152 ALA A HB1    4  
ATOM   9915  H HB2    . ALA A 1 152 ? -11.592 20.975  -16.789 1.00 0.00  ? 152 ALA A HB2    4  
ATOM   9916  H HB3    . ALA A 1 152 ? -13.036 20.493  -15.896 1.00 0.00  ? 152 ALA A HB3    4  
ATOM   9917  N N      . LEU A 1 153 ? -10.059 19.055  -18.041 1.00 0.00  ? 153 LEU A N      4  
ATOM   9918  C CA     . LEU A 1 153 ? -8.754  19.035  -18.691 1.00 0.00  ? 153 LEU A CA     4  
ATOM   9919  C C      . LEU A 1 153 ? -8.081  17.677  -18.515 1.00 0.00  ? 153 LEU A C      4  
ATOM   9920  C CB     . LEU A 1 153 ? -7.863  20.146  -18.127 1.00 0.00  ? 153 LEU A CB     4  
ATOM   9921  C CG     . LEU A 1 153 ? -7.250  21.076  -19.173 1.00 0.00  ? 153 LEU A CG     4  
ATOM   9922  C CD1    . LEU A 1 153 ? -6.410  20.288  -20.164 1.00 0.00  ? 153 LEU A CD1    4  
ATOM   9923  C CD2    . LEU A 1 153 ? -8.339  21.857  -19.894 1.00 0.00  ? 153 LEU A CD2    4  
ATOM   9924  H H      . LEU A 1 153 ? -10.863 19.197  -18.585 1.00 0.00  ? 153 LEU A H      4  
ATOM   9925  H HA     . LEU A 1 153 ? -8.909  19.213  -19.744 1.00 0.00  ? 153 LEU A HA     4  
ATOM   9926  H HB2    . LEU A 1 153 ? -8.452  20.743  -17.446 1.00 0.00  ? 153 LEU A HB2    4  
ATOM   9927  H HB3    . LEU A 1 153 ? -7.057  19.687  -17.571 1.00 0.00  ? 153 LEU A HB3    4  
ATOM   9928  H HG     . LEU A 1 153 ? -6.601  21.786  -18.678 1.00 0.00  ? 153 LEU A HG     4  
ATOM   9929  H HD11   . LEU A 1 153 ? -5.414  20.157  -19.768 1.00 0.00  ? 153 LEU A HD11   4  
ATOM   9930  H HD12   . LEU A 1 153 ? -6.360  20.825  -21.100 1.00 0.00  ? 153 LEU A HD12   4  
ATOM   9931  H HD13   . LEU A 1 153 ? -6.860  19.322  -20.328 1.00 0.00  ? 153 LEU A HD13   4  
ATOM   9932  H HD21   . LEU A 1 153 ? -8.502  22.797  -19.388 1.00 0.00  ? 153 LEU A HD21   4  
ATOM   9933  H HD22   . LEU A 1 153 ? -9.254  21.284  -19.893 1.00 0.00  ? 153 LEU A HD22   4  
ATOM   9934  H HD23   . LEU A 1 153 ? -8.032  22.043  -20.913 1.00 0.00  ? 153 LEU A HD23   4  
HETATM 9935  P PG     . ATP B 2 .   ? 1.979   -11.019 -30.782 1.00 0.00  ? 154 ATP A PG     4  
HETATM 9936  O O1G    . ATP B 2 .   ? 2.028   -12.461 -31.137 1.00 0.00  ? 154 ATP A O1G    4  
HETATM 9937  O O2G    . ATP B 2 .   ? 3.377   -10.776 -30.348 1.00 0.00  ? 154 ATP A O2G    4  
HETATM 9938  O O3G    . ATP B 2 .   ? 1.604   -10.013 -31.808 1.00 0.00  ? 154 ATP A O3G    4  
HETATM 9939  P PB     . ATP B 2 .   ? -0.408  -11.031 -29.484 1.00 0.00  ? 154 ATP A PB     4  
HETATM 9940  O O1B    . ATP B 2 .   ? -0.757  -12.138 -30.412 1.00 0.00  ? 154 ATP A O1B    4  
HETATM 9941  O O2B    . ATP B 2 .   ? -1.088  -9.716  -29.604 1.00 0.00  ? 154 ATP A O2B    4  
HETATM 9942  O O3B    . ATP B 2 .   ? 1.052   -10.818 -29.639 1.00 0.00  ? 154 ATP A O3B    4  
HETATM 9943  P PA     . ATP B 2 .   ? -1.616  -12.735 -27.709 1.00 0.00  ? 154 ATP A PA     4  
HETATM 9944  O O1A    . ATP B 2 .   ? -3.018  -12.438 -27.324 1.00 0.00  ? 154 ATP A O1A    4  
HETATM 9945  O O2A    . ATP B 2 .   ? -1.348  -13.889 -28.605 1.00 0.00  ? 154 ATP A O2A    4  
HETATM 9946  O O3A    . ATP B 2 .   ? -0.775  -11.598 -28.160 1.00 0.00  ? 154 ATP A O3A    4  
HETATM 9947  O "O5'"  . ATP B 2 .   ? -0.888  -12.973 -26.313 1.00 0.00  ? 154 ATP A "O5'"  4  
HETATM 9948  C "C5'"  . ATP B 2 .   ? -1.368  -12.354 -25.124 1.00 0.00  ? 154 ATP A "C5'"  4  
HETATM 9949  C "C4'"  . ATP B 2 .   ? -1.759  -13.404 -24.114 1.00 0.00  ? 154 ATP A "C4'"  4  
HETATM 9950  O "O4'"  . ATP B 2 .   ? -1.792  -12.788 -22.796 1.00 0.00  ? 154 ATP A "O4'"  4  
HETATM 9951  C "C3'"  . ATP B 2 .   ? -3.143  -14.016 -24.323 1.00 0.00  ? 154 ATP A "C3'"  4  
HETATM 9952  O "O3'"  . ATP B 2 .   ? -3.148  -15.405 -24.017 1.00 0.00  ? 154 ATP A "O3'"  4  
HETATM 9953  C "C2'"  . ATP B 2 .   ? -4.026  -13.218 -23.370 1.00 0.00  ? 154 ATP A "C2'"  4  
HETATM 9954  O "O2'"  . ATP B 2 .   ? -5.113  -13.992 -22.901 1.00 0.00  ? 154 ATP A "O2'"  4  
HETATM 9955  C "C1'"  . ATP B 2 .   ? -3.062  -12.984 -22.213 1.00 0.00  ? 154 ATP A "C1'"  4  
HETATM 9956  N N9     . ATP B 2 .   ? -3.372  -11.821 -21.386 1.00 0.00  ? 154 ATP A N9     4  
HETATM 9957  C C8     . ATP B 2 .   ? -4.099  -10.705 -21.718 1.00 0.00  ? 154 ATP A C8     4  
HETATM 9958  N N7     . ATP B 2 .   ? -4.193  -9.829  -20.746 1.00 0.00  ? 154 ATP A N7     4  
HETATM 9959  C C5     . ATP B 2 .   ? -3.479  -10.408 -19.706 1.00 0.00  ? 154 ATP A C5     4  
HETATM 9960  C C6     . ATP B 2 .   ? -3.198  -9.982  -18.397 1.00 0.00  ? 154 ATP A C6     4  
HETATM 9961  N N6     . ATP B 2 .   ? -3.620  -8.820  -17.890 1.00 0.00  ? 154 ATP A N6     4  
HETATM 9962  N N1     . ATP B 2 .   ? -2.458  -10.800 -17.615 1.00 0.00  ? 154 ATP A N1     4  
HETATM 9963  C C2     . ATP B 2 .   ? -2.031  -11.962 -18.127 1.00 0.00  ? 154 ATP A C2     4  
HETATM 9964  N N3     . ATP B 2 .   ? -2.232  -12.471 -19.338 1.00 0.00  ? 154 ATP A N3     4  
HETATM 9965  C C4     . ATP B 2 .   ? -2.970  -11.636 -20.086 1.00 0.00  ? 154 ATP A C4     4  
HETATM 9966  H "H5'1" . ATP B 2 .   ? -2.236  -11.737 -25.355 1.00 0.00  ? 154 ATP A "H5'1" 4  
HETATM 9967  H "H5'2" . ATP B 2 .   ? -0.589  -11.723 -24.695 1.00 0.00  ? 154 ATP A "H5'2" 4  
HETATM 9968  H "H4'"  . ATP B 2 .   ? -1.039  -14.220 -24.192 1.00 0.00  ? 154 ATP A "H4'"  4  
HETATM 9969  H "H3'"  . ATP B 2 .   ? -3.466  -13.935 -25.360 1.00 0.00  ? 154 ATP A "H3'"  4  
HETATM 9970  H "H2'"  . ATP B 2 .   ? -4.341  -12.278 -23.829 1.00 0.00  ? 154 ATP A "H2'"  4  
HETATM 9971  H "HO2'" . ATP B 2 .   ? -5.139  -14.793 -23.425 1.00 0.00  ? 154 ATP A "HO2'" 4  
HETATM 9972  H "H1'"  . ATP B 2 .   ? -2.983  -13.856 -21.560 1.00 0.00  ? 154 ATP A "H1'"  4  
HETATM 9973  H H8     . ATP B 2 .   ? -4.551  -10.561 -22.689 1.00 0.00  ? 154 ATP A H8     4  
HETATM 9974  H HN61   . ATP B 2 .   ? -4.175  -8.194  -18.458 1.00 0.00  ? 154 ATP A HN61   4  
HETATM 9975  H HN62   . ATP B 2 .   ? -3.378  -8.557  -16.947 1.00 0.00  ? 154 ATP A HN62   4  
HETATM 9976  H H2     . ATP B 2 .   ? -1.431  -12.578 -17.458 1.00 0.00  ? 154 ATP A H2     4  
ATOM   9977  N N      . GLY A 1 1   ? 22.933  -8.620  -30.015 1.00 0.00  ? 1   GLY A N      5  
ATOM   9978  C CA     . GLY A 1 1   ? 21.533  -8.367  -29.738 1.00 0.00  ? 1   GLY A CA     5  
ATOM   9979  C C      . GLY A 1 1   ? 20.865  -9.628  -29.207 1.00 0.00  ? 1   GLY A C      5  
ATOM   9980  O O      . GLY A 1 1   ? 19.774  -9.988  -29.646 1.00 0.00  ? 1   GLY A O      5  
ATOM   9981  H H1     . GLY A 1 1   ? 23.497  -7.863  -30.374 1.00 0.00  ? 1   GLY A H1     5  
ATOM   9982  H HA2    . GLY A 1 1   ? 21.450  -7.575  -28.994 1.00 0.00  ? 1   GLY A HA2    5  
ATOM   9983  H HA3    . GLY A 1 1   ? 21.035  -8.055  -30.656 1.00 0.00  ? 1   GLY A HA3    5  
ATOM   9984  N N      . PRO A 1 2   ? 21.522  -10.299 -28.259 1.00 0.00  ? 2   PRO A N      5  
ATOM   9985  C CA     . PRO A 1 2   ? 21.042  -11.514 -27.637 1.00 0.00  ? 2   PRO A CA     5  
ATOM   9986  C C      . PRO A 1 2   ? 19.886  -11.187 -26.702 1.00 0.00  ? 2   PRO A C      5  
ATOM   9987  O O      . PRO A 1 2   ? 19.552  -10.020 -26.510 1.00 0.00  ? 2   PRO A O      5  
ATOM   9988  C CB     . PRO A 1 2   ? 22.239  -12.055 -26.858 1.00 0.00  ? 2   PRO A CB     5  
ATOM   9989  C CG     . PRO A 1 2   ? 23.004  -10.785 -26.489 1.00 0.00  ? 2   PRO A CG     5  
ATOM   9990  C CD     . PRO A 1 2   ? 22.806  -9.905  -27.720 1.00 0.00  ? 2   PRO A CD     5  
ATOM   9991  H HA     . PRO A 1 2   ? 20.718  -12.236 -28.387 1.00 0.00  ? 2   PRO A HA     5  
ATOM   9992  H HB2    . PRO A 1 2   ? 21.938  -12.629 -25.982 1.00 0.00  ? 2   PRO A HB2    5  
ATOM   9993  H HB3    . PRO A 1 2   ? 22.855  -12.661 -27.523 1.00 0.00  ? 2   PRO A HB3    5  
ATOM   9994  H HG2    . PRO A 1 2   ? 22.524  -10.316 -25.631 1.00 0.00  ? 2   PRO A HG2    5  
ATOM   9995  H HG3    . PRO A 1 2   ? 24.057  -10.980 -26.284 1.00 0.00  ? 2   PRO A HG3    5  
ATOM   9996  H HD2    . PRO A 1 2   ? 22.820  -8.849  -27.449 1.00 0.00  ? 2   PRO A HD2    5  
ATOM   9997  H HD3    . PRO A 1 2   ? 23.582  -10.118 -28.456 1.00 0.00  ? 2   PRO A HD3    5  
ATOM   9998  N N      . LEU A 1 3   ? 19.275  -12.216 -26.123 1.00 0.00  ? 3   LEU A N      5  
ATOM   9999  C CA     . LEU A 1 3   ? 18.157  -12.019 -25.208 1.00 0.00  ? 3   LEU A CA     5  
ATOM   10000 C C      . LEU A 1 3   ? 18.571  -11.154 -24.022 1.00 0.00  ? 3   LEU A C      5  
ATOM   10001 O O      . LEU A 1 3   ? 19.347  -11.586 -23.170 1.00 0.00  ? 3   LEU A O      5  
ATOM   10002 C CB     . LEU A 1 3   ? 17.625  -13.364 -24.708 1.00 0.00  ? 3   LEU A CB     5  
ATOM   10003 C CG     . LEU A 1 3   ? 16.267  -13.298 -24.000 1.00 0.00  ? 3   LEU A CG     5  
ATOM   10004 C CD1    . LEU A 1 3   ? 15.171  -13.878 -24.882 1.00 0.00  ? 3   LEU A CD1    5  
ATOM   10005 C CD2    . LEU A 1 3   ? 16.323  -14.030 -22.668 1.00 0.00  ? 3   LEU A CD2    5  
ATOM   10006 H H      . LEU A 1 3   ? 19.585  -13.129 -26.312 1.00 0.00  ? 3   LEU A H      5  
ATOM   10007 H HA     . LEU A 1 3   ? 17.371  -11.512 -25.751 1.00 0.00  ? 3   LEU A HA     5  
ATOM   10008 H HB2    . LEU A 1 3   ? 17.537  -14.029 -25.554 1.00 0.00  ? 3   LEU A HB2    5  
ATOM   10009 H HB3    . LEU A 1 3   ? 18.346  -13.777 -24.020 1.00 0.00  ? 3   LEU A HB3    5  
ATOM   10010 H HG     . LEU A 1 3   ? 16.024  -12.264 -23.803 1.00 0.00  ? 3   LEU A HG     5  
ATOM   10011 H HD11   . LEU A 1 3   ? 14.269  -14.000 -24.302 1.00 0.00  ? 3   LEU A HD11   5  
ATOM   10012 H HD12   . LEU A 1 3   ? 15.486  -14.837 -25.265 1.00 0.00  ? 3   LEU A HD12   5  
ATOM   10013 H HD13   . LEU A 1 3   ? 14.980  -13.207 -25.708 1.00 0.00  ? 3   LEU A HD13   5  
ATOM   10014 H HD21   . LEU A 1 3   ? 17.031  -13.541 -22.016 1.00 0.00  ? 3   LEU A HD21   5  
ATOM   10015 H HD22   . LEU A 1 3   ? 16.634  -15.052 -22.832 1.00 0.00  ? 3   LEU A HD22   5  
ATOM   10016 H HD23   . LEU A 1 3   ? 15.346  -14.022 -22.211 1.00 0.00  ? 3   LEU A HD23   5  
ATOM   10017 N N      . GLY A 1 4   ? 18.051  -9.933  -23.976 1.00 0.00  ? 4   GLY A N      5  
ATOM   10018 C CA     . GLY A 1 4   ? 18.380  -9.027  -22.891 1.00 0.00  ? 4   GLY A CA     5  
ATOM   10019 C C      . GLY A 1 4   ? 17.167  -8.279  -22.369 1.00 0.00  ? 4   GLY A C      5  
ATOM   10020 O O      . GLY A 1 4   ? 16.074  -8.399  -22.921 1.00 0.00  ? 4   GLY A O      5  
ATOM   10021 H H      . GLY A 1 4   ? 17.438  -9.644  -24.684 1.00 0.00  ? 4   GLY A H      5  
ATOM   10022 H HA2    . GLY A 1 4   ? 18.815  -9.595  -22.082 1.00 0.00  ? 4   GLY A HA2    5  
ATOM   10023 H HA3    . GLY A 1 4   ? 19.106  -8.310  -23.242 1.00 0.00  ? 4   GLY A HA3    5  
ATOM   10024 N N      . SER A 1 5   ? 17.362  -7.510  -21.305 1.00 0.00  ? 5   SER A N      5  
ATOM   10025 C CA     . SER A 1 5   ? 16.274  -6.740  -20.710 1.00 0.00  ? 5   SER A CA     5  
ATOM   10026 C C      . SER A 1 5   ? 15.152  -7.658  -20.239 1.00 0.00  ? 5   SER A C      5  
ATOM   10027 O O      . SER A 1 5   ? 14.394  -8.195  -21.047 1.00 0.00  ? 5   SER A O      5  
ATOM   10028 C CB     . SER A 1 5   ? 15.731  -5.726  -21.719 1.00 0.00  ? 5   SER A CB     5  
ATOM   10029 O OG     . SER A 1 5   ? 16.553  -4.574  -21.777 1.00 0.00  ? 5   SER A OG     5  
ATOM   10030 H H      . SER A 1 5   ? 18.257  -7.454  -20.909 1.00 0.00  ? 5   SER A H      5  
ATOM   10031 H HA     . SER A 1 5   ? 16.672  -6.209  -19.859 1.00 0.00  ? 5   SER A HA     5  
ATOM   10032 H HB2    . SER A 1 5   ? 15.697  -6.178  -22.698 1.00 0.00  ? 5   SER A HB2    5  
ATOM   10033 H HB3    . SER A 1 5   ? 14.734  -5.429  -21.426 1.00 0.00  ? 5   SER A HB3    5  
ATOM   10034 H HG     . SER A 1 5   ? 17.168  -4.655  -22.510 1.00 0.00  ? 5   SER A HG     5  
ATOM   10035 N N      . MET A 1 6   ? 15.052  -7.832  -18.925 1.00 0.00  ? 6   MET A N      5  
ATOM   10036 C CA     . MET A 1 6   ? 14.024  -8.684  -18.345 1.00 0.00  ? 6   MET A CA     5  
ATOM   10037 C C      . MET A 1 6   ? 12.637  -8.108  -18.599 1.00 0.00  ? 6   MET A C      5  
ATOM   10038 O O      . MET A 1 6   ? 12.386  -6.930  -18.346 1.00 0.00  ? 6   MET A O      5  
ATOM   10039 C CB     . MET A 1 6   ? 14.254  -8.841  -16.840 1.00 0.00  ? 6   MET A CB     5  
ATOM   10040 C CG     . MET A 1 6   ? 14.245  -7.520  -16.086 1.00 0.00  ? 6   MET A CG     5  
ATOM   10041 S SD     . MET A 1 6   ? 12.899  -7.405  -14.891 1.00 0.00  ? 6   MET A SD     5  
ATOM   10042 C CE     . MET A 1 6   ? 11.935  -6.067  -15.589 1.00 0.00  ? 6   MET A CE     5  
ATOM   10043 H H      . MET A 1 6   ? 15.684  -7.378  -18.334 1.00 0.00  ? 6   MET A H      5  
ATOM   10044 H HA     . MET A 1 6   ? 14.090  -9.654  -18.813 1.00 0.00  ? 6   MET A HA     5  
ATOM   10045 H HB2    . MET A 1 6   ? 13.478  -9.471  -16.433 1.00 0.00  ? 6   MET A HB2    5  
ATOM   10046 H HB3    . MET A 1 6   ? 15.211  -9.315  -16.683 1.00 0.00  ? 6   MET A HB3    5  
ATOM   10047 H HG2    . MET A 1 6   ? 15.182  -7.417  -15.560 1.00 0.00  ? 6   MET A HG2    5  
ATOM   10048 H HG3    . MET A 1 6   ? 14.146  -6.715  -16.799 1.00 0.00  ? 6   MET A HG3    5  
ATOM   10049 H HE1    . MET A 1 6   ? 11.008  -6.458  -15.987 1.00 0.00  ? 6   MET A HE1    5  
ATOM   10050 H HE2    . MET A 1 6   ? 12.495  -5.594  -16.381 1.00 0.00  ? 6   MET A HE2    5  
ATOM   10051 H HE3    . MET A 1 6   ? 11.717  -5.342  -14.819 1.00 0.00  ? 6   MET A HE3    5  
ATOM   10052 N N      . ALA A 1 7   ? 11.740  -8.948  -19.102 1.00 0.00  ? 7   ALA A N      5  
ATOM   10053 C CA     . ALA A 1 7   ? 10.373  -8.530  -19.392 1.00 0.00  ? 7   ALA A CA     5  
ATOM   10054 C C      . ALA A 1 7   ? 10.329  -7.580  -20.582 1.00 0.00  ? 7   ALA A C      5  
ATOM   10055 O O      . ALA A 1 7   ? 11.353  -7.038  -21.001 1.00 0.00  ? 7   ALA A O      5  
ATOM   10056 C CB     . ALA A 1 7   ? 9.745   -7.878  -18.166 1.00 0.00  ? 7   ALA A CB     5  
ATOM   10057 H H      . ALA A 1 7   ? 12.005  -9.874  -19.281 1.00 0.00  ? 7   ALA A H      5  
ATOM   10058 H HA     . ALA A 1 7   ? 9.799   -9.415  -19.635 1.00 0.00  ? 7   ALA A HA     5  
ATOM   10059 H HB1    . ALA A 1 7   ? 10.452  -7.890  -17.349 1.00 0.00  ? 7   ALA A HB1    5  
ATOM   10060 H HB2    . ALA A 1 7   ? 8.857   -8.422  -17.880 1.00 0.00  ? 7   ALA A HB2    5  
ATOM   10061 H HB3    . ALA A 1 7   ? 9.481   -6.856  -18.394 1.00 0.00  ? 7   ALA A HB3    5  
ATOM   10062 N N      . LEU A 1 8   ? 9.131   -7.383  -21.117 1.00 0.00  ? 8   LEU A N      5  
ATOM   10063 C CA     . LEU A 1 8   ? 8.936   -6.499  -22.261 1.00 0.00  ? 8   LEU A CA     5  
ATOM   10064 C C      . LEU A 1 8   ? 8.255   -5.201  -21.826 1.00 0.00  ? 8   LEU A C      5  
ATOM   10065 O O      . LEU A 1 8   ? 7.194   -5.225  -21.203 1.00 0.00  ? 8   LEU A O      5  
ATOM   10066 C CB     . LEU A 1 8   ? 8.100   -7.193  -23.344 1.00 0.00  ? 8   LEU A CB     5  
ATOM   10067 C CG     . LEU A 1 8   ? 8.191   -8.724  -23.373 1.00 0.00  ? 8   LEU A CG     5  
ATOM   10068 C CD1    . LEU A 1 8   ? 7.380   -9.337  -22.243 1.00 0.00  ? 8   LEU A CD1    5  
ATOM   10069 C CD2    . LEU A 1 8   ? 7.710   -9.253  -24.712 1.00 0.00  ? 8   LEU A CD2    5  
ATOM   10070 H H      . LEU A 1 8   ? 8.358   -7.846  -20.729 1.00 0.00  ? 8   LEU A H      5  
ATOM   10071 H HA     . LEU A 1 8   ? 9.908   -6.261  -22.666 1.00 0.00  ? 8   LEU A HA     5  
ATOM   10072 H HB2    . LEU A 1 8   ? 7.067   -6.916  -23.202 1.00 0.00  ? 8   LEU A HB2    5  
ATOM   10073 H HB3    . LEU A 1 8   ? 8.422   -6.821  -24.305 1.00 0.00  ? 8   LEU A HB3    5  
ATOM   10074 H HG     . LEU A 1 8   ? 9.221   -9.022  -23.245 1.00 0.00  ? 8   LEU A HG     5  
ATOM   10075 H HD11   . LEU A 1 8   ? 6.794   -8.566  -21.769 1.00 0.00  ? 8   LEU A HD11   5  
ATOM   10076 H HD12   . LEU A 1 8   ? 8.045   -9.783  -21.514 1.00 0.00  ? 8   LEU A HD12   5  
ATOM   10077 H HD13   . LEU A 1 8   ? 6.720   -10.095 -22.639 1.00 0.00  ? 8   LEU A HD13   5  
ATOM   10078 H HD21   . LEU A 1 8   ? 7.566   -10.321 -24.643 1.00 0.00  ? 8   LEU A HD21   5  
ATOM   10079 H HD22   . LEU A 1 8   ? 8.448   -9.038  -25.470 1.00 0.00  ? 8   LEU A HD22   5  
ATOM   10080 H HD23   . LEU A 1 8   ? 6.772   -8.779  -24.971 1.00 0.00  ? 8   LEU A HD23   5  
ATOM   10081 N N      . ARG A 1 9   ? 8.873   -4.073  -22.155 1.00 0.00  ? 9   ARG A N      5  
ATOM   10082 C CA     . ARG A 1 9   ? 8.327   -2.770  -21.794 1.00 0.00  ? 9   ARG A CA     5  
ATOM   10083 C C      . ARG A 1 9   ? 7.206   -2.364  -22.741 1.00 0.00  ? 9   ARG A C      5  
ATOM   10084 O O      . ARG A 1 9   ? 7.431   -2.156  -23.930 1.00 0.00  ? 9   ARG A O      5  
ATOM   10085 C CB     . ARG A 1 9   ? 9.427   -1.706  -21.804 1.00 0.00  ? 9   ARG A CB     5  
ATOM   10086 C CG     . ARG A 1 9   ? 9.396   -0.795  -20.589 1.00 0.00  ? 9   ARG A CG     5  
ATOM   10087 C CD     . ARG A 1 9   ? 10.433  0.312   -20.691 1.00 0.00  ? 9   ARG A CD     5  
ATOM   10088 N NE     . ARG A 1 9   ? 11.774  -0.209  -20.959 1.00 0.00  ? 9   ARG A NE     5  
ATOM   10089 C CZ     . ARG A 1 9   ? 12.896  0.357   -20.518 1.00 0.00  ? 9   ARG A CZ     5  
ATOM   10090 N NH1    . ARG A 1 9   ? 12.854  1.468   -19.794 1.00 0.00  ? 9   ARG A NH1    5  
ATOM   10091 N NH2    . ARG A 1 9   ? 14.070  -0.190  -20.806 1.00 0.00  ? 9   ARG A NH2    5  
ATOM   10092 H H      . ARG A 1 9   ? 9.714   -4.114  -22.651 1.00 0.00  ? 9   ARG A H      5  
ATOM   10093 H HA     . ARG A 1 9   ? 7.925   -2.845  -20.794 1.00 0.00  ? 9   ARG A HA     5  
ATOM   10094 H HB2    . ARG A 1 9   ? 10.387  -2.197  -21.837 1.00 0.00  ? 9   ARG A HB2    5  
ATOM   10095 H HB3    . ARG A 1 9   ? 9.316   -1.096  -22.686 1.00 0.00  ? 9   ARG A HB3    5  
ATOM   10096 H HG2    . ARG A 1 9   ? 8.416   -0.349  -20.514 1.00 0.00  ? 9   ARG A HG2    5  
ATOM   10097 H HG3    . ARG A 1 9   ? 9.595   -1.383  -19.705 1.00 0.00  ? 9   ARG A HG3    5  
ATOM   10098 H HD2    . ARG A 1 9   ? 10.150  0.980   -21.491 1.00 0.00  ? 9   ARG A HD2    5  
ATOM   10099 H HD3    . ARG A 1 9   ? 10.448  0.856   -19.759 1.00 0.00  ? 9   ARG A HD3    5  
ATOM   10100 H HE     . ARG A 1 9   ? 11.841  -1.024  -21.496 1.00 0.00  ? 9   ARG A HE     5  
ATOM   10101 H HH11   . ARG A 1 9   ? 11.977  1.891   -19.576 1.00 0.00  ? 9   ARG A HH11   5  
ATOM   10102 H HH12   . ARG A 1 9   ? 13.704  1.884   -19.467 1.00 0.00  ? 9   ARG A HH12   5  
ATOM   10103 H HH21   . ARG A 1 9   ? 14.112  -1.024  -21.355 1.00 0.00  ? 9   ARG A HH21   5  
ATOM   10104 H HH22   . ARG A 1 9   ? 14.914  0.232   -20.473 1.00 0.00  ? 9   ARG A HH22   5  
ATOM   10105 N N      . ALA A 1 10  ? 6.001   -2.247  -22.201 1.00 0.00  ? 10  ALA A N      5  
ATOM   10106 C CA     . ALA A 1 10  ? 4.845   -1.863  -22.997 1.00 0.00  ? 10  ALA A CA     5  
ATOM   10107 C C      . ALA A 1 10  ? 4.126   -0.672  -22.377 1.00 0.00  ? 10  ALA A C      5  
ATOM   10108 O O      . ALA A 1 10  ? 4.287   -0.380  -21.194 1.00 0.00  ? 10  ALA A O      5  
ATOM   10109 C CB     . ALA A 1 10  ? 3.890   -3.036  -23.144 1.00 0.00  ? 10  ALA A CB     5  
ATOM   10110 H H      . ALA A 1 10  ? 5.886   -2.421  -21.243 1.00 0.00  ? 10  ALA A H      5  
ATOM   10111 H HA     . ALA A 1 10  ? 5.193   -1.589  -23.980 1.00 0.00  ? 10  ALA A HA     5  
ATOM   10112 H HB1    . ALA A 1 10  ? 2.881   -2.710  -22.921 1.00 0.00  ? 10  ALA A HB1    5  
ATOM   10113 H HB2    . ALA A 1 10  ? 4.176   -3.821  -22.459 1.00 0.00  ? 10  ALA A HB2    5  
ATOM   10114 H HB3    . ALA A 1 10  ? 3.933   -3.410  -24.156 1.00 0.00  ? 10  ALA A HB3    5  
ATOM   10115 N N      . CYS A 1 11  ? 3.326   0.007   -23.186 1.00 0.00  ? 11  CYS A N      5  
ATOM   10116 C CA     . CYS A 1 11  ? 2.576   1.158   -22.715 1.00 0.00  ? 11  CYS A CA     5  
ATOM   10117 C C      . CYS A 1 11  ? 1.298   1.332   -23.519 1.00 0.00  ? 11  CYS A C      5  
ATOM   10118 O O      . CYS A 1 11  ? 1.331   1.459   -24.744 1.00 0.00  ? 11  CYS A O      5  
ATOM   10119 C CB     . CYS A 1 11  ? 3.430   2.425   -22.807 1.00 0.00  ? 11  CYS A CB     5  
ATOM   10120 S SG     . CYS A 1 11  ? 4.830   2.461   -21.662 1.00 0.00  ? 11  CYS A SG     5  
ATOM   10121 H H      . CYS A 1 11  ? 3.235   -0.276  -24.120 1.00 0.00  ? 11  CYS A H      5  
ATOM   10122 H HA     . CYS A 1 11  ? 2.316   0.984   -21.682 1.00 0.00  ? 11  CYS A HA     5  
ATOM   10123 H HB2    . CYS A 1 11  ? 3.823   2.510   -23.807 1.00 0.00  ? 11  CYS A HB2    5  
ATOM   10124 H HB3    . CYS A 1 11  ? 2.809   3.282   -22.595 1.00 0.00  ? 11  CYS A HB3    5  
ATOM   10125 H HG     . CYS A 1 11  ? 4.718   1.745   -21.030 1.00 0.00  ? 11  CYS A HG     5  
ATOM   10126 N N      . GLY A 1 12  ? 0.172   1.347   -22.820 1.00 0.00  ? 12  GLY A N      5  
ATOM   10127 C CA     . GLY A 1 12  ? -1.108  1.515   -23.475 1.00 0.00  ? 12  GLY A CA     5  
ATOM   10128 C C      . GLY A 1 12  ? -1.781  2.812   -23.081 1.00 0.00  ? 12  GLY A C      5  
ATOM   10129 O O      . GLY A 1 12  ? -1.258  3.562   -22.257 1.00 0.00  ? 12  GLY A O      5  
ATOM   10130 H H      . GLY A 1 12  ? 0.213   1.243   -21.845 1.00 0.00  ? 12  GLY A H      5  
ATOM   10131 H HA2    . GLY A 1 12  ? -0.953  1.516   -24.543 1.00 0.00  ? 12  GLY A HA2    5  
ATOM   10132 H HA3    . GLY A 1 12  ? -1.751  0.690   -23.212 1.00 0.00  ? 12  GLY A HA3    5  
ATOM   10133 N N      . LEU A 1 13  ? -2.942  3.082   -23.669 1.00 0.00  ? 13  LEU A N      5  
ATOM   10134 C CA     . LEU A 1 13  ? -3.669  4.307   -23.366 1.00 0.00  ? 13  LEU A CA     5  
ATOM   10135 C C      . LEU A 1 13  ? -5.110  4.016   -22.974 1.00 0.00  ? 13  LEU A C      5  
ATOM   10136 O O      . LEU A 1 13  ? -5.896  3.526   -23.786 1.00 0.00  ? 13  LEU A O      5  
ATOM   10137 C CB     . LEU A 1 13  ? -3.658  5.245   -24.582 1.00 0.00  ? 13  LEU A CB     5  
ATOM   10138 C CG     . LEU A 1 13  ? -3.027  6.620   -24.346 1.00 0.00  ? 13  LEU A CG     5  
ATOM   10139 C CD1    . LEU A 1 13  ? -3.347  7.560   -25.496 1.00 0.00  ? 13  LEU A CD1    5  
ATOM   10140 C CD2    . LEU A 1 13  ? -3.501  7.215   -23.030 1.00 0.00  ? 13  LEU A CD2    5  
ATOM   10141 H H      . LEU A 1 13  ? -3.310  2.451   -24.321 1.00 0.00  ? 13  LEU A H      5  
ATOM   10142 H HA     . LEU A 1 13  ? -3.173  4.795   -22.541 1.00 0.00  ? 13  LEU A HA     5  
ATOM   10143 H HB2    . LEU A 1 13  ? -3.116  4.759   -25.379 1.00 0.00  ? 13  LEU A HB2    5  
ATOM   10144 H HB3    . LEU A 1 13  ? -4.678  5.397   -24.905 1.00 0.00  ? 13  LEU A HB3    5  
ATOM   10145 H HG     . LEU A 1 13  ? -1.958  6.508   -24.298 1.00 0.00  ? 13  LEU A HG     5  
ATOM   10146 H HD11   . LEU A 1 13  ? -3.267  8.581   -25.155 1.00 0.00  ? 13  LEU A HD11   5  
ATOM   10147 H HD12   . LEU A 1 13  ? -4.351  7.374   -25.847 1.00 0.00  ? 13  LEU A HD12   5  
ATOM   10148 H HD13   . LEU A 1 13  ? -2.645  7.394   -26.301 1.00 0.00  ? 13  LEU A HD13   5  
ATOM   10149 H HD21   . LEU A 1 13  ? -2.982  6.740   -22.210 1.00 0.00  ? 13  LEU A HD21   5  
ATOM   10150 H HD22   . LEU A 1 13  ? -4.565  7.054   -22.923 1.00 0.00  ? 13  LEU A HD22   5  
ATOM   10151 H HD23   . LEU A 1 13  ? -3.296  8.275   -23.020 1.00 0.00  ? 13  LEU A HD23   5  
ATOM   10152 N N      . ILE A 1 14  ? -5.468  4.362   -21.742 1.00 0.00  ? 14  ILE A N      5  
ATOM   10153 C CA     . ILE A 1 14  ? -6.831  4.178   -21.285 1.00 0.00  ? 14  ILE A CA     5  
ATOM   10154 C C      . ILE A 1 14  ? -7.650  5.368   -21.733 1.00 0.00  ? 14  ILE A C      5  
ATOM   10155 O O      . ILE A 1 14  ? -7.721  6.390   -21.051 1.00 0.00  ? 14  ILE A O      5  
ATOM   10156 C CB     . ILE A 1 14  ? -6.922  4.031   -19.753 1.00 0.00  ? 14  ILE A CB     5  
ATOM   10157 C CG1    . ILE A 1 14  ? -6.157  2.794   -19.302 1.00 0.00  ? 14  ILE A CG1    5  
ATOM   10158 C CG2    . ILE A 1 14  ? -8.375  3.942   -19.307 1.00 0.00  ? 14  ILE A CG2    5  
ATOM   10159 C CD1    . ILE A 1 14  ? -6.160  2.595   -17.804 1.00 0.00  ? 14  ILE A CD1    5  
ATOM   10160 H H      . ILE A 1 14  ? -4.810  4.780   -21.147 1.00 0.00  ? 14  ILE A H      5  
ATOM   10161 H HA     . ILE A 1 14  ? -7.225  3.281   -21.746 1.00 0.00  ? 14  ILE A HA     5  
ATOM   10162 H HB     . ILE A 1 14  ? -6.482  4.906   -19.300 1.00 0.00  ? 14  ILE A HB     5  
ATOM   10163 H HG12   . ILE A 1 14  ? -6.599  1.920   -19.753 1.00 0.00  ? 14  ILE A HG12   5  
ATOM   10164 H HG13   . ILE A 1 14  ? -5.131  2.879   -19.627 1.00 0.00  ? 14  ILE A HG13   5  
ATOM   10165 H HG21   . ILE A 1 14  ? -8.726  4.923   -19.019 1.00 0.00  ? 14  ILE A HG21   5  
ATOM   10166 H HG22   . ILE A 1 14  ? -8.452  3.271   -18.465 1.00 0.00  ? 14  ILE A HG22   5  
ATOM   10167 H HG23   . ILE A 1 14  ? -8.978  3.569   -20.121 1.00 0.00  ? 14  ILE A HG23   5  
ATOM   10168 H HD11   . ILE A 1 14  ? -5.317  3.113   -17.368 1.00 0.00  ? 14  ILE A HD11   5  
ATOM   10169 H HD12   . ILE A 1 14  ? -6.088  1.541   -17.585 1.00 0.00  ? 14  ILE A HD12   5  
ATOM   10170 H HD13   . ILE A 1 14  ? -7.077  2.988   -17.391 1.00 0.00  ? 14  ILE A HD13   5  
ATOM   10171 N N      . ILE A 1 15  ? -8.241  5.233   -22.903 1.00 0.00  ? 15  ILE A N      5  
ATOM   10172 C CA     . ILE A 1 15  ? -9.031  6.293   -23.483 1.00 0.00  ? 15  ILE A CA     5  
ATOM   10173 C C      . ILE A 1 15  ? -10.414 6.349   -22.864 1.00 0.00  ? 15  ILE A C      5  
ATOM   10174 O O      . ILE A 1 15  ? -10.976 5.322   -22.494 1.00 0.00  ? 15  ILE A O      5  
ATOM   10175 C CB     . ILE A 1 15  ? -9.131  6.105   -24.998 1.00 0.00  ? 15  ILE A CB     5  
ATOM   10176 C CG1    . ILE A 1 15  ? -7.726  6.016   -25.587 1.00 0.00  ? 15  ILE A CG1    5  
ATOM   10177 C CG2    . ILE A 1 15  ? -9.920  7.230   -25.637 1.00 0.00  ? 15  ILE A CG2    5  
ATOM   10178 C CD1    . ILE A 1 15  ? -7.655  5.203   -26.855 1.00 0.00  ? 15  ILE A CD1    5  
ATOM   10179 H H      . ILE A 1 15  ? -8.123  4.399   -23.403 1.00 0.00  ? 15  ILE A H      5  
ATOM   10180 H HA     . ILE A 1 15  ? -8.522  7.226   -23.293 1.00 0.00  ? 15  ILE A HA     5  
ATOM   10181 H HB     . ILE A 1 15  ? -9.650  5.180   -25.189 1.00 0.00  ? 15  ILE A HB     5  
ATOM   10182 H HG12   . ILE A 1 15  ? -7.369  7.012   -25.803 1.00 0.00  ? 15  ILE A HG12   5  
ATOM   10183 H HG13   . ILE A 1 15  ? -7.069  5.558   -24.864 1.00 0.00  ? 15  ILE A HG13   5  
ATOM   10184 H HG21   . ILE A 1 15  ? -10.922 7.238   -25.237 1.00 0.00  ? 15  ILE A HG21   5  
ATOM   10185 H HG22   . ILE A 1 15  ? -9.958  7.077   -26.705 1.00 0.00  ? 15  ILE A HG22   5  
ATOM   10186 H HG23   . ILE A 1 15  ? -9.438  8.174   -25.423 1.00 0.00  ? 15  ILE A HG23   5  
ATOM   10187 H HD11   . ILE A 1 15  ? -7.784  5.853   -27.709 1.00 0.00  ? 15  ILE A HD11   5  
ATOM   10188 H HD12   . ILE A 1 15  ? -8.440  4.459   -26.846 1.00 0.00  ? 15  ILE A HD12   5  
ATOM   10189 H HD13   . ILE A 1 15  ? -6.690  4.716   -26.915 1.00 0.00  ? 15  ILE A HD13   5  
ATOM   10190 N N      . PHE A 1 16  ? -10.943 7.559   -22.730 1.00 0.00  ? 16  PHE A N      5  
ATOM   10191 C CA     . PHE A 1 16  ? -12.248 7.748   -22.129 1.00 0.00  ? 16  PHE A CA     5  
ATOM   10192 C C      . PHE A 1 16  ? -12.979 8.949   -22.724 1.00 0.00  ? 16  PHE A C      5  
ATOM   10193 O O      . PHE A 1 16  ? -12.493 10.076  -22.668 1.00 0.00  ? 16  PHE A O      5  
ATOM   10194 C CB     . PHE A 1 16  ? -12.088 7.920   -20.619 1.00 0.00  ? 16  PHE A CB     5  
ATOM   10195 C CG     . PHE A 1 16  ? -11.409 9.200   -20.213 1.00 0.00  ? 16  PHE A CG     5  
ATOM   10196 C CD1    . PHE A 1 16  ? -12.140 10.362  -20.030 1.00 0.00  ? 16  PHE A CD1    5  
ATOM   10197 C CD2    . PHE A 1 16  ? -10.038 9.235   -20.006 1.00 0.00  ? 16  PHE A CD2    5  
ATOM   10198 C CE1    . PHE A 1 16  ? -11.519 11.536  -19.648 1.00 0.00  ? 16  PHE A CE1    5  
ATOM   10199 C CE2    . PHE A 1 16  ? -9.411  10.407  -19.623 1.00 0.00  ? 16  PHE A CE2    5  
ATOM   10200 C CZ     . PHE A 1 16  ? -10.153 11.558  -19.443 1.00 0.00  ? 16  PHE A CZ     5  
ATOM   10201 H H      . PHE A 1 16  ? -10.436 8.340   -23.029 1.00 0.00  ? 16  PHE A H      5  
ATOM   10202 H HA     . PHE A 1 16  ? -12.827 6.860   -22.318 1.00 0.00  ? 16  PHE A HA     5  
ATOM   10203 H HB2    . PHE A 1 16  ? -13.057 7.900   -20.159 1.00 0.00  ? 16  PHE A HB2    5  
ATOM   10204 H HB3    . PHE A 1 16  ? -11.499 7.103   -20.236 1.00 0.00  ? 16  PHE A HB3    5  
ATOM   10205 H HD1    . PHE A 1 16  ? -13.205 10.347  -20.192 1.00 0.00  ? 16  PHE A HD1    5  
ATOM   10206 H HD2    . PHE A 1 16  ? -9.457  8.336   -20.145 1.00 0.00  ? 16  PHE A HD2    5  
ATOM   10207 H HE1    . PHE A 1 16  ? -12.103 12.434  -19.509 1.00 0.00  ? 16  PHE A HE1    5  
ATOM   10208 H HE2    . PHE A 1 16  ? -8.342  10.421  -19.463 1.00 0.00  ? 16  PHE A HE2    5  
ATOM   10209 H HZ     . PHE A 1 16  ? -9.667  12.474  -19.144 1.00 0.00  ? 16  PHE A HZ     5  
ATOM   10210 N N      . ARG A 1 17  ? -14.161 8.703   -23.276 1.00 0.00  ? 17  ARG A N      5  
ATOM   10211 C CA     . ARG A 1 17  ? -14.965 9.766   -23.862 1.00 0.00  ? 17  ARG A CA     5  
ATOM   10212 C C      . ARG A 1 17  ? -15.817 10.431  -22.784 1.00 0.00  ? 17  ARG A C      5  
ATOM   10213 O O      . ARG A 1 17  ? -16.721 9.808   -22.225 1.00 0.00  ? 17  ARG A O      5  
ATOM   10214 C CB     . ARG A 1 17  ? -15.857 9.205   -24.970 1.00 0.00  ? 17  ARG A CB     5  
ATOM   10215 C CG     . ARG A 1 17  ? -15.863 10.051  -26.235 1.00 0.00  ? 17  ARG A CG     5  
ATOM   10216 C CD     . ARG A 1 17  ? -15.859 9.182   -27.481 1.00 0.00  ? 17  ARG A CD     5  
ATOM   10217 N NE     . ARG A 1 17  ? -17.023 8.304   -27.537 1.00 0.00  ? 17  ARG A NE     5  
ATOM   10218 C CZ     . ARG A 1 17  ? -17.218 7.398   -28.489 1.00 0.00  ? 17  ARG A CZ     5  
ATOM   10219 N NH1    . ARG A 1 17  ? -16.329 7.250   -29.464 1.00 0.00  ? 17  ARG A NH1    5  
ATOM   10220 N NH2    . ARG A 1 17  ? -18.303 6.639   -28.467 1.00 0.00  ? 17  ARG A NH2    5  
ATOM   10221 H H      . ARG A 1 17  ? -14.504 7.787   -23.284 1.00 0.00  ? 17  ARG A H      5  
ATOM   10222 H HA     . ARG A 1 17  ? -14.293 10.501  -24.284 1.00 0.00  ? 17  ARG A HA     5  
ATOM   10223 H HB2    . ARG A 1 17  ? -15.510 8.215   -25.228 1.00 0.00  ? 17  ARG A HB2    5  
ATOM   10224 H HB3    . ARG A 1 17  ? -16.870 9.137   -24.604 1.00 0.00  ? 17  ARG A HB3    5  
ATOM   10225 H HG2    . ARG A 1 17  ? -16.751 10.664  -26.240 1.00 0.00  ? 17  ARG A HG2    5  
ATOM   10226 H HG3    . ARG A 1 17  ? -14.986 10.678  -26.239 1.00 0.00  ? 17  ARG A HG3    5  
ATOM   10227 H HD2    . ARG A 1 17  ? -15.858 9.822   -28.349 1.00 0.00  ? 17  ARG A HD2    5  
ATOM   10228 H HD3    . ARG A 1 17  ? -14.962 8.578   -27.478 1.00 0.00  ? 17  ARG A HD3    5  
ATOM   10229 H HE     . ARG A 1 17  ? -17.694 8.395   -26.827 1.00 0.00  ? 17  ARG A HE     5  
ATOM   10230 H HH11   . ARG A 1 17  ? -15.509 7.821   -29.485 1.00 0.00  ? 17  ARG A HH11   5  
ATOM   10231 H HH12   . ARG A 1 17  ? -16.481 6.567   -30.178 1.00 0.00  ? 17  ARG A HH12   5  
ATOM   10232 H HH21   . ARG A 1 17  ? -18.976 6.749   -27.734 1.00 0.00  ? 17  ARG A HH21   5  
ATOM   10233 H HH22   . ARG A 1 17  ? -18.454 5.957   -29.181 1.00 0.00  ? 17  ARG A HH22   5  
ATOM   10234 N N      . ARG A 1 18  ? -15.517 11.691  -22.487 1.00 0.00  ? 18  ARG A N      5  
ATOM   10235 C CA     . ARG A 1 18  ? -16.252 12.431  -21.466 1.00 0.00  ? 18  ARG A CA     5  
ATOM   10236 C C      . ARG A 1 18  ? -17.438 13.176  -22.064 1.00 0.00  ? 18  ARG A C      5  
ATOM   10237 O O      . ARG A 1 18  ? -17.277 14.036  -22.929 1.00 0.00  ? 18  ARG A O      5  
ATOM   10238 C CB     . ARG A 1 18  ? -15.320 13.416  -20.753 1.00 0.00  ? 18  ARG A CB     5  
ATOM   10239 C CG     . ARG A 1 18  ? -16.011 14.241  -19.678 1.00 0.00  ? 18  ARG A CG     5  
ATOM   10240 C CD     . ARG A 1 18  ? -15.090 14.514  -18.501 1.00 0.00  ? 18  ARG A CD     5  
ATOM   10241 N NE     . ARG A 1 18  ? -13.998 15.416  -18.858 1.00 0.00  ? 18  ARG A NE     5  
ATOM   10242 C CZ     . ARG A 1 18  ? -13.173 15.970  -17.971 1.00 0.00  ? 18  ARG A CZ     5  
ATOM   10243 N NH1    . ARG A 1 18  ? -13.311 15.716  -16.675 1.00 0.00  ? 18  ARG A NH1    5  
ATOM   10244 N NH2    . ARG A 1 18  ? -12.205 16.780  -18.381 1.00 0.00  ? 18  ARG A NH2    5  
ATOM   10245 H H      . ARG A 1 18  ? -14.783 12.132  -22.961 1.00 0.00  ? 18  ARG A H      5  
ATOM   10246 H HA     . ARG A 1 18  ? -16.619 11.717  -20.744 1.00 0.00  ? 18  ARG A HA     5  
ATOM   10247 H HB2    . ARG A 1 18  ? -14.518 12.862  -20.290 1.00 0.00  ? 18  ARG A HB2    5  
ATOM   10248 H HB3    . ARG A 1 18  ? -14.904 14.092  -21.484 1.00 0.00  ? 18  ARG A HB3    5  
ATOM   10249 H HG2    . ARG A 1 18  ? -16.322 15.183  -20.105 1.00 0.00  ? 18  ARG A HG2    5  
ATOM   10250 H HG3    . ARG A 1 18  ? -16.879 13.702  -19.327 1.00 0.00  ? 18  ARG A HG3    5  
ATOM   10251 H HD2    . ARG A 1 18  ? -15.666 14.959  -17.705 1.00 0.00  ? 18  ARG A HD2    5  
ATOM   10252 H HD3    . ARG A 1 18  ? -14.673 13.577  -18.162 1.00 0.00  ? 18  ARG A HD3    5  
ATOM   10253 H HE     . ARG A 1 18  ? -13.872 15.623  -19.808 1.00 0.00  ? 18  ARG A HE     5  
ATOM   10254 H HH11   . ARG A 1 18  ? -14.039 15.107  -16.358 1.00 0.00  ? 18  ARG A HH11   5  
ATOM   10255 H HH12   . ARG A 1 18  ? -12.687 16.136  -16.014 1.00 0.00  ? 18  ARG A HH12   5  
ATOM   10256 H HH21   . ARG A 1 18  ? -12.094 16.975  -19.356 1.00 0.00  ? 18  ARG A HH21   5  
ATOM   10257 H HH22   . ARG A 1 18  ? -11.585 17.195  -17.715 1.00 0.00  ? 18  ARG A HH22   5  
ATOM   10258 N N      . CYS A 1 19  ? -18.633 12.842  -21.588 1.00 0.00  ? 19  CYS A N      5  
ATOM   10259 C CA     . CYS A 1 19  ? -19.852 13.480  -22.067 1.00 0.00  ? 19  CYS A CA     5  
ATOM   10260 C C      . CYS A 1 19  ? -19.914 14.936  -21.614 1.00 0.00  ? 19  CYS A C      5  
ATOM   10261 O O      . CYS A 1 19  ? -19.222 15.334  -20.675 1.00 0.00  ? 19  CYS A O      5  
ATOM   10262 C CB     . CYS A 1 19  ? -21.079 12.721  -21.563 1.00 0.00  ? 19  CYS A CB     5  
ATOM   10263 S SG     . CYS A 1 19  ? -22.390 12.542  -22.794 1.00 0.00  ? 19  CYS A SG     5  
ATOM   10264 H H      . CYS A 1 19  ? -18.696 12.153  -20.894 1.00 0.00  ? 19  CYS A H      5  
ATOM   10265 H HA     . CYS A 1 19  ? -19.839 13.451  -23.146 1.00 0.00  ? 19  CYS A HA     5  
ATOM   10266 H HB2    . CYS A 1 19  ? -20.778 11.730  -21.258 1.00 0.00  ? 19  CYS A HB2    5  
ATOM   10267 H HB3    . CYS A 1 19  ? -21.493 13.242  -20.713 1.00 0.00  ? 19  CYS A HB3    5  
ATOM   10268 H HG     . CYS A 1 19  ? -22.014 12.104  -23.562 1.00 0.00  ? 19  CYS A HG     5  
ATOM   10269 N N      . LEU A 1 20  ? -20.738 15.732  -22.292 1.00 0.00  ? 20  LEU A N      5  
ATOM   10270 C CA     . LEU A 1 20  ? -20.878 17.144  -21.957 1.00 0.00  ? 20  LEU A CA     5  
ATOM   10271 C C      . LEU A 1 20  ? -21.310 17.330  -20.502 1.00 0.00  ? 20  LEU A C      5  
ATOM   10272 O O      . LEU A 1 20  ? -20.478 17.580  -19.631 1.00 0.00  ? 20  LEU A O      5  
ATOM   10273 C CB     . LEU A 1 20  ? -21.872 17.821  -22.905 1.00 0.00  ? 20  LEU A CB     5  
ATOM   10274 C CG     . LEU A 1 20  ? -21.705 19.339  -23.035 1.00 0.00  ? 20  LEU A CG     5  
ATOM   10275 C CD1    . LEU A 1 20  ? -21.563 19.741  -24.496 1.00 0.00  ? 20  LEU A CD1    5  
ATOM   10276 C CD2    . LEU A 1 20  ? -22.877 20.064  -22.390 1.00 0.00  ? 20  LEU A CD2    5  
ATOM   10277 H H      . LEU A 1 20  ? -21.259 15.360  -23.032 1.00 0.00  ? 20  LEU A H      5  
ATOM   10278 H HA     . LEU A 1 20  ? -19.909 17.605  -22.086 1.00 0.00  ? 20  LEU A HA     5  
ATOM   10279 H HB2    . LEU A 1 20  ? -21.758 17.381  -23.885 1.00 0.00  ? 20  LEU A HB2    5  
ATOM   10280 H HB3    . LEU A 1 20  ? -22.872 17.620  -22.556 1.00 0.00  ? 20  LEU A HB3    5  
ATOM   10281 H HG     . LEU A 1 20  ? -20.804 19.636  -22.519 1.00 0.00  ? 20  LEU A HG     5  
ATOM   10282 H HD11   . LEU A 1 20  ? -22.145 20.630  -24.684 1.00 0.00  ? 20  LEU A HD11   5  
ATOM   10283 H HD12   . LEU A 1 20  ? -21.916 18.938  -25.127 1.00 0.00  ? 20  LEU A HD12   5  
ATOM   10284 H HD13   . LEU A 1 20  ? -20.524 19.940  -24.715 1.00 0.00  ? 20  LEU A HD13   5  
ATOM   10285 H HD21   . LEU A 1 20  ? -22.558 21.042  -22.059 1.00 0.00  ? 20  LEU A HD21   5  
ATOM   10286 H HD22   . LEU A 1 20  ? -23.229 19.495  -21.541 1.00 0.00  ? 20  LEU A HD22   5  
ATOM   10287 H HD23   . LEU A 1 20  ? -23.675 20.168  -23.108 1.00 0.00  ? 20  LEU A HD23   5  
ATOM   10288 N N      . ILE A 1 21  ? -22.610 17.207  -20.238 1.00 0.00  ? 21  ILE A N      5  
ATOM   10289 C CA     . ILE A 1 21  ? -23.131 17.362  -18.884 1.00 0.00  ? 21  ILE A CA     5  
ATOM   10290 C C      . ILE A 1 21  ? -23.918 16.130  -18.440 1.00 0.00  ? 21  ILE A C      5  
ATOM   10291 O O      . ILE A 1 21  ? -24.529 15.444  -19.259 1.00 0.00  ? 21  ILE A O      5  
ATOM   10292 C CB     . ILE A 1 21  ? -24.031 18.608  -18.757 1.00 0.00  ? 21  ILE A CB     5  
ATOM   10293 C CG1    . ILE A 1 21  ? -25.084 18.630  -19.865 1.00 0.00  ? 21  ILE A CG1    5  
ATOM   10294 C CG2    . ILE A 1 21  ? -23.187 19.875  -18.797 1.00 0.00  ? 21  ILE A CG2    5  
ATOM   10295 C CD1    . ILE A 1 21  ? -26.291 17.766  -19.569 1.00 0.00  ? 21  ILE A CD1    5  
ATOM   10296 H H      . ILE A 1 21  ? -23.229 17.003  -20.969 1.00 0.00  ? 21  ILE A H      5  
ATOM   10297 H HA     . ILE A 1 21  ? -22.287 17.490  -18.223 1.00 0.00  ? 21  ILE A HA     5  
ATOM   10298 H HB     . ILE A 1 21  ? -24.526 18.569  -17.799 1.00 0.00  ? 21  ILE A HB     5  
ATOM   10299 H HG12   . ILE A 1 21  ? -25.431 19.642  -20.004 1.00 0.00  ? 21  ILE A HG12   5  
ATOM   10300 H HG13   . ILE A 1 21  ? -24.642 18.277  -20.784 1.00 0.00  ? 21  ILE A HG13   5  
ATOM   10301 H HG21   . ILE A 1 21  ? -22.704 20.015  -17.842 1.00 0.00  ? 21  ILE A HG21   5  
ATOM   10302 H HG22   . ILE A 1 21  ? -23.822 20.723  -19.006 1.00 0.00  ? 21  ILE A HG22   5  
ATOM   10303 H HG23   . ILE A 1 21  ? -22.440 19.785  -19.570 1.00 0.00  ? 21  ILE A HG23   5  
ATOM   10304 H HD11   . ILE A 1 21  ? -27.180 18.246  -19.951 1.00 0.00  ? 21  ILE A HD11   5  
ATOM   10305 H HD12   . ILE A 1 21  ? -26.386 17.633  -18.501 1.00 0.00  ? 21  ILE A HD12   5  
ATOM   10306 H HD13   . ILE A 1 21  ? -26.170 16.804  -20.043 1.00 0.00  ? 21  ILE A HD13   5  
ATOM   10307 N N      . PRO A 1 22  ? -23.916 15.836  -17.125 1.00 0.00  ? 22  PRO A N      5  
ATOM   10308 C CA     . PRO A 1 22  ? -24.633 14.681  -16.568 1.00 0.00  ? 22  PRO A CA     5  
ATOM   10309 C C      . PRO A 1 22  ? -26.145 14.807  -16.725 1.00 0.00  ? 22  PRO A C      5  
ATOM   10310 O O      . PRO A 1 22  ? -26.658 15.878  -17.055 1.00 0.00  ? 22  PRO A O      5  
ATOM   10311 C CB     . PRO A 1 22  ? -24.251 14.692  -15.078 1.00 0.00  ? 22  PRO A CB     5  
ATOM   10312 C CG     . PRO A 1 22  ? -23.069 15.597  -14.978 1.00 0.00  ? 22  PRO A CG     5  
ATOM   10313 C CD     . PRO A 1 22  ? -23.220 16.602  -16.081 1.00 0.00  ? 22  PRO A CD     5  
ATOM   10314 H HA     . PRO A 1 22  ? -24.302 13.756  -17.018 1.00 0.00  ? 22  PRO A HA     5  
ATOM   10315 H HB2    . PRO A 1 22  ? -25.081 15.064  -14.496 1.00 0.00  ? 22  PRO A HB2    5  
ATOM   10316 H HB3    . PRO A 1 22  ? -24.006 13.690  -14.762 1.00 0.00  ? 22  PRO A HB3    5  
ATOM   10317 H HG2    . PRO A 1 22  ? -23.066 16.093  -14.018 1.00 0.00  ? 22  PRO A HG2    5  
ATOM   10318 H HG3    . PRO A 1 22  ? -22.159 15.029  -15.110 1.00 0.00  ? 22  PRO A HG3    5  
ATOM   10319 H HD2    . PRO A 1 22  ? -23.820 17.438  -15.751 1.00 0.00  ? 22  PRO A HD2    5  
ATOM   10320 H HD3    . PRO A 1 22  ? -22.254 16.935  -16.425 1.00 0.00  ? 22  PRO A HD3    5  
ATOM   10321 N N      . LYS A 1 23  ? -26.856 13.710  -16.487 1.00 0.00  ? 23  LYS A N      5  
ATOM   10322 C CA     . LYS A 1 23  ? -28.310 13.700  -16.602 1.00 0.00  ? 23  LYS A CA     5  
ATOM   10323 C C      . LYS A 1 23  ? -28.935 12.794  -15.548 1.00 0.00  ? 23  LYS A C      5  
ATOM   10324 O O      . LYS A 1 23  ? -29.485 13.266  -14.553 1.00 0.00  ? 23  LYS A O      5  
ATOM   10325 C CB     . LYS A 1 23  ? -28.731 13.245  -18.000 1.00 0.00  ? 23  LYS A CB     5  
ATOM   10326 C CG     . LYS A 1 23  ? -28.718 14.362  -19.033 1.00 0.00  ? 23  LYS A CG     5  
ATOM   10327 C CD     . LYS A 1 23  ? -28.283 13.852  -20.395 1.00 0.00  ? 23  LYS A CD     5  
ATOM   10328 C CE     . LYS A 1 23  ? -26.800 13.517  -20.420 1.00 0.00  ? 23  LYS A CE     5  
ATOM   10329 N NZ     . LYS A 1 23  ? -26.480 12.491  -21.451 1.00 0.00  ? 23  LYS A NZ     5  
ATOM   10330 H H      . LYS A 1 23  ? -26.393 12.886  -16.225 1.00 0.00  ? 23  LYS A H      5  
ATOM   10331 H HA     . LYS A 1 23  ? -28.660 14.707  -16.441 1.00 0.00  ? 23  LYS A HA     5  
ATOM   10332 H HB2    . LYS A 1 23  ? -28.056 12.471  -18.332 1.00 0.00  ? 23  LYS A HB2    5  
ATOM   10333 H HB3    . LYS A 1 23  ? -29.731 12.842  -17.949 1.00 0.00  ? 23  LYS A HB3    5  
ATOM   10334 H HG2    . LYS A 1 23  ? -29.713 14.774  -19.115 1.00 0.00  ? 23  LYS A HG2    5  
ATOM   10335 H HG3    . LYS A 1 23  ? -28.034 15.131  -18.708 1.00 0.00  ? 23  LYS A HG3    5  
ATOM   10336 H HD2    . LYS A 1 23  ? -28.845 12.962  -20.634 1.00 0.00  ? 23  LYS A HD2    5  
ATOM   10337 H HD3    . LYS A 1 23  ? -28.482 14.614  -21.135 1.00 0.00  ? 23  LYS A HD3    5  
ATOM   10338 H HE2    . LYS A 1 23  ? -26.242 14.417  -20.636 1.00 0.00  ? 23  LYS A HE2    5  
ATOM   10339 H HE3    . LYS A 1 23  ? -26.513 13.140  -19.450 1.00 0.00  ? 23  LYS A HE3    5  
ATOM   10340 H HZ1    . LYS A 1 23  ? -25.449 12.394  -21.551 1.00 0.00  ? 23  LYS A HZ1    5  
ATOM   10341 H HZ2    . LYS A 1 23  ? -26.880 12.770  -22.369 1.00 0.00  ? 23  LYS A HZ2    5  
ATOM   10342 H HZ3    . LYS A 1 23  ? -26.879 11.571  -21.175 1.00 0.00  ? 23  LYS A HZ3    5  
ATOM   10343 N N      . VAL A 1 24  ? -28.844 11.488  -15.772 1.00 0.00  ? 24  VAL A N      5  
ATOM   10344 C CA     . VAL A 1 24  ? -29.402 10.516  -14.836 1.00 0.00  ? 24  VAL A CA     5  
ATOM   10345 C C      . VAL A 1 24  ? -28.542 10.391  -13.581 1.00 0.00  ? 24  VAL A C      5  
ATOM   10346 O O      . VAL A 1 24  ? -28.953 9.774   -12.597 1.00 0.00  ? 24  VAL A O      5  
ATOM   10347 C CB     . VAL A 1 24  ? -29.546 9.122   -15.475 1.00 0.00  ? 24  VAL A CB     5  
ATOM   10348 C CG1    . VAL A 1 24  ? -30.830 9.031   -16.284 1.00 0.00  ? 24  VAL A CG1    5  
ATOM   10349 C CG2    . VAL A 1 24  ? -28.335 8.789   -16.335 1.00 0.00  ? 24  VAL A CG2    5  
ATOM   10350 H H      . VAL A 1 24  ? -28.394 11.174  -16.581 1.00 0.00  ? 24  VAL A H      5  
ATOM   10351 H HA     . VAL A 1 24  ? -30.387 10.858  -14.551 1.00 0.00  ? 24  VAL A HA     5  
ATOM   10352 H HB     . VAL A 1 24  ? -29.601 8.394   -14.679 1.00 0.00  ? 24  VAL A HB     5  
ATOM   10353 H HG11   . VAL A 1 24  ? -31.312 8.083   -16.094 1.00 0.00  ? 24  VAL A HG11   5  
ATOM   10354 H HG12   . VAL A 1 24  ? -30.598 9.112   -17.337 1.00 0.00  ? 24  VAL A HG12   5  
ATOM   10355 H HG13   . VAL A 1 24  ? -31.493 9.836   -16.000 1.00 0.00  ? 24  VAL A HG13   5  
ATOM   10356 H HG21   . VAL A 1 24  ? -27.508 9.422   -16.053 1.00 0.00  ? 24  VAL A HG21   5  
ATOM   10357 H HG22   . VAL A 1 24  ? -28.576 8.954   -17.375 1.00 0.00  ? 24  VAL A HG22   5  
ATOM   10358 H HG23   . VAL A 1 24  ? -28.063 7.754   -16.189 1.00 0.00  ? 24  VAL A HG23   5  
ATOM   10359 N N      . ASP A 1 25  ? -27.350 10.979  -13.617 1.00 0.00  ? 25  ASP A N      5  
ATOM   10360 C CA     . ASP A 1 25  ? -26.432 10.934  -12.483 1.00 0.00  ? 25  ASP A CA     5  
ATOM   10361 C C      . ASP A 1 25  ? -25.873 9.528   -12.281 1.00 0.00  ? 25  ASP A C      5  
ATOM   10362 O O      . ASP A 1 25  ? -25.482 9.162   -11.174 1.00 0.00  ? 25  ASP A O      5  
ATOM   10363 C CB     . ASP A 1 25  ? -27.133 11.404  -11.205 1.00 0.00  ? 25  ASP A CB     5  
ATOM   10364 C CG     . ASP A 1 25  ? -26.168 12.015  -10.206 1.00 0.00  ? 25  ASP A CG     5  
ATOM   10365 O OD1    . ASP A 1 25  ? -25.072 11.447  -10.014 1.00 0.00  ? 25  ASP A OD1    5  
ATOM   10366 O OD2    . ASP A 1 25  ? -26.509 13.061  -9.615  1.00 0.00  ? 25  ASP A OD2    5  
ATOM   10367 H H      . ASP A 1 25  ? -27.079 11.452  -14.429 1.00 0.00  ? 25  ASP A H      5  
ATOM   10368 H HA     . ASP A 1 25  ? -25.612 11.602  -12.696 1.00 0.00  ? 25  ASP A HA     5  
ATOM   10369 H HB2    . ASP A 1 25  ? -27.875 12.144  -11.457 1.00 0.00  ? 25  ASP A HB2    5  
ATOM   10370 H HB3    . ASP A 1 25  ? -27.619 10.559  -10.737 1.00 0.00  ? 25  ASP A HB3    5  
ATOM   10371 H HD2    . ASP A 1 25  ? -25.852 13.392  -8.998  1.00 0.00  ? 25  ASP A HD2    5  
ATOM   10372 N N      . ASN A 1 26  ? -25.838 8.745   -13.355 1.00 0.00  ? 26  ASN A N      5  
ATOM   10373 C CA     . ASN A 1 26  ? -25.321 7.383   -13.286 1.00 0.00  ? 26  ASN A CA     5  
ATOM   10374 C C      . ASN A 1 26  ? -23.988 7.274   -14.025 1.00 0.00  ? 26  ASN A C      5  
ATOM   10375 O O      . ASN A 1 26  ? -22.923 7.342   -13.413 1.00 0.00  ? 26  ASN A O      5  
ATOM   10376 C CB     . ASN A 1 26  ? -26.339 6.397   -13.863 1.00 0.00  ? 26  ASN A CB     5  
ATOM   10377 C CG     . ASN A 1 26  ? -25.921 4.952   -13.667 1.00 0.00  ? 26  ASN A CG     5  
ATOM   10378 O OD1    . ASN A 1 26  ? -24.759 4.597   -13.865 1.00 0.00  ? 26  ASN A OD1    5  
ATOM   10379 N ND2    . ASN A 1 26  ? -26.871 4.109   -13.275 1.00 0.00  ? 26  ASN A ND2    5  
ATOM   10380 H H      . ASN A 1 26  ? -26.160 9.091   -14.213 1.00 0.00  ? 26  ASN A H      5  
ATOM   10381 H HA     . ASN A 1 26  ? -25.156 7.147   -12.248 1.00 0.00  ? 26  ASN A HA     5  
ATOM   10382 H HB2    . ASN A 1 26  ? -27.289 6.544   -13.373 1.00 0.00  ? 26  ASN A HB2    5  
ATOM   10383 H HB3    . ASN A 1 26  ? -26.454 6.579   -14.919 1.00 0.00  ? 26  ASN A HB3    5  
ATOM   10384 H HD21   . ASN A 1 26  ? -27.774 4.462   -13.136 1.00 0.00  ? 26  ASN A HD21   5  
ATOM   10385 H HD22   . ASN A 1 26  ? -26.629 3.170   -13.141 1.00 0.00  ? 26  ASN A HD22   5  
ATOM   10386 N N      . ASN A 1 27  ? -24.057 7.118   -15.342 1.00 0.00  ? 27  ASN A N      5  
ATOM   10387 C CA     . ASN A 1 27  ? -22.855 7.015   -16.164 1.00 0.00  ? 27  ASN A CA     5  
ATOM   10388 C C      . ASN A 1 27  ? -22.379 8.403   -16.576 1.00 0.00  ? 27  ASN A C      5  
ATOM   10389 O O      . ASN A 1 27  ? -22.943 9.409   -16.150 1.00 0.00  ? 27  ASN A O      5  
ATOM   10390 C CB     . ASN A 1 27  ? -23.126 6.161   -17.403 1.00 0.00  ? 27  ASN A CB     5  
ATOM   10391 C CG     . ASN A 1 27  ? -23.734 4.818   -17.053 1.00 0.00  ? 27  ASN A CG     5  
ATOM   10392 O OD1    . ASN A 1 27  ? -24.833 4.485   -17.499 1.00 0.00  ? 27  ASN A OD1    5  
ATOM   10393 N ND2    . ASN A 1 27  ? -23.022 4.036   -16.250 1.00 0.00  ? 27  ASN A ND2    5  
ATOM   10394 H H      . ASN A 1 27  ? -24.934 7.081   -15.772 1.00 0.00  ? 27  ASN A H      5  
ATOM   10395 H HA     . ASN A 1 27  ? -22.085 6.543   -15.570 1.00 0.00  ? 27  ASN A HA     5  
ATOM   10396 H HB2    . ASN A 1 27  ? -23.807 6.686   -18.055 1.00 0.00  ? 27  ASN A HB2    5  
ATOM   10397 H HB3    . ASN A 1 27  ? -22.195 5.987   -17.924 1.00 0.00  ? 27  ASN A HB3    5  
ATOM   10398 H HD21   . ASN A 1 27  ? -22.158 4.368   -15.931 1.00 0.00  ? 27  ASN A HD21   5  
ATOM   10399 H HD22   . ASN A 1 27  ? -23.394 3.163   -16.004 1.00 0.00  ? 27  ASN A HD22   5  
ATOM   10400 N N      . ALA A 1 28  ? -21.340 8.457   -17.404 1.00 0.00  ? 28  ALA A N      5  
ATOM   10401 C CA     . ALA A 1 28  ? -20.803 9.735   -17.860 1.00 0.00  ? 28  ALA A CA     5  
ATOM   10402 C C      . ALA A 1 28  ? -19.602 9.540   -18.776 1.00 0.00  ? 28  ALA A C      5  
ATOM   10403 O O      . ALA A 1 28  ? -19.520 10.146  -19.845 1.00 0.00  ? 28  ALA A O      5  
ATOM   10404 C CB     . ALA A 1 28  ? -20.414 10.597  -16.666 1.00 0.00  ? 28  ALA A CB     5  
ATOM   10405 H H      . ALA A 1 28  ? -20.927 7.624   -17.713 1.00 0.00  ? 28  ALA A H      5  
ATOM   10406 H HA     . ALA A 1 28  ? -21.581 10.248  -18.405 1.00 0.00  ? 28  ALA A HA     5  
ATOM   10407 H HB1    . ALA A 1 28  ? -21.194 11.321  -16.477 1.00 0.00  ? 28  ALA A HB1    5  
ATOM   10408 H HB2    . ALA A 1 28  ? -19.489 11.112  -16.878 1.00 0.00  ? 28  ALA A HB2    5  
ATOM   10409 H HB3    . ALA A 1 28  ? -20.287 9.970   -15.795 1.00 0.00  ? 28  ALA A HB3    5  
ATOM   10410 N N      . ILE A 1 29  ? -18.660 8.708   -18.343 1.00 0.00  ? 29  ILE A N      5  
ATOM   10411 C CA     . ILE A 1 29  ? -17.455 8.457   -19.120 1.00 0.00  ? 29  ILE A CA     5  
ATOM   10412 C C      . ILE A 1 29  ? -17.405 7.027   -19.653 1.00 0.00  ? 29  ILE A C      5  
ATOM   10413 O O      . ILE A 1 29  ? -17.794 6.080   -18.969 1.00 0.00  ? 29  ILE A O      5  
ATOM   10414 C CB     . ILE A 1 29  ? -16.192 8.736   -18.283 1.00 0.00  ? 29  ILE A CB     5  
ATOM   10415 C CG1    . ILE A 1 29  ? -16.276 10.129  -17.655 1.00 0.00  ? 29  ILE A CG1    5  
ATOM   10416 C CG2    . ILE A 1 29  ? -14.944 8.621   -19.138 1.00 0.00  ? 29  ILE A CG2    5  
ATOM   10417 C CD1    . ILE A 1 29  ? -15.943 10.152  -16.180 1.00 0.00  ? 29  ILE A CD1    5  
ATOM   10418 H H      . ILE A 1 29  ? -18.775 8.267   -17.476 1.00 0.00  ? 29  ILE A H      5  
ATOM   10419 H HA     . ILE A 1 29  ? -17.456 9.137   -19.959 1.00 0.00  ? 29  ILE A HA     5  
ATOM   10420 H HB     . ILE A 1 29  ? -16.130 7.999   -17.498 1.00 0.00  ? 29  ILE A HB     5  
ATOM   10421 H HG12   . ILE A 1 29  ? -15.585 10.787  -18.161 1.00 0.00  ? 29  ILE A HG12   5  
ATOM   10422 H HG13   . ILE A 1 29  ? -17.280 10.509  -17.778 1.00 0.00  ? 29  ILE A HG13   5  
ATOM   10423 H HG21   . ILE A 1 29  ? -14.605 9.607   -19.407 1.00 0.00  ? 29  ILE A HG21   5  
ATOM   10424 H HG22   . ILE A 1 29  ? -15.171 8.062   -20.034 1.00 0.00  ? 29  ILE A HG22   5  
ATOM   10425 H HG23   . ILE A 1 29  ? -14.173 8.112   -18.582 1.00 0.00  ? 29  ILE A HG23   5  
ATOM   10426 H HD11   . ILE A 1 29  ? -15.573 9.183   -15.880 1.00 0.00  ? 29  ILE A HD11   5  
ATOM   10427 H HD12   . ILE A 1 29  ? -16.830 10.392  -15.614 1.00 0.00  ? 29  ILE A HD12   5  
ATOM   10428 H HD13   . ILE A 1 29  ? -15.184 10.899  -15.995 1.00 0.00  ? 29  ILE A HD13   5  
ATOM   10429 N N      . GLU A 1 30  ? -16.909 6.890   -20.878 1.00 0.00  ? 30  GLU A N      5  
ATOM   10430 C CA     . GLU A 1 30  ? -16.785 5.588   -21.528 1.00 0.00  ? 30  GLU A CA     5  
ATOM   10431 C C      . GLU A 1 30  ? -15.362 5.394   -22.047 1.00 0.00  ? 30  GLU A C      5  
ATOM   10432 O O      . GLU A 1 30  ? -14.776 6.307   -22.623 1.00 0.00  ? 30  GLU A O      5  
ATOM   10433 C CB     . GLU A 1 30  ? -17.784 5.468   -22.681 1.00 0.00  ? 30  GLU A CB     5  
ATOM   10434 C CG     . GLU A 1 30  ? -17.722 6.627   -23.667 1.00 0.00  ? 30  GLU A CG     5  
ATOM   10435 C CD     . GLU A 1 30  ? -19.032 7.384   -23.768 1.00 0.00  ? 30  GLU A CD     5  
ATOM   10436 O OE1    . GLU A 1 30  ? -20.098 6.748   -23.631 1.00 0.00  ? 30  GLU A OE1    5  
ATOM   10437 O OE2    . GLU A 1 30  ? -18.992 8.613   -23.988 1.00 0.00  ? 30  GLU A OE2    5  
ATOM   10438 H H      . GLU A 1 30  ? -16.613 7.693   -21.358 1.00 0.00  ? 30  GLU A H      5  
ATOM   10439 H HA     . GLU A 1 30  ? -16.996 4.827   -20.791 1.00 0.00  ? 30  GLU A HA     5  
ATOM   10440 H HB2    . GLU A 1 30  ? -17.583 4.555   -23.221 1.00 0.00  ? 30  GLU A HB2    5  
ATOM   10441 H HB3    . GLU A 1 30  ? -18.782 5.424   -22.274 1.00 0.00  ? 30  GLU A HB3    5  
ATOM   10442 H HG2    . GLU A 1 30  ? -16.953 7.313   -23.347 1.00 0.00  ? 30  GLU A HG2    5  
ATOM   10443 H HG3    . GLU A 1 30  ? -17.471 6.238   -24.642 1.00 0.00  ? 30  GLU A HG3    5  
ATOM   10444 H HE2    . GLU A 1 30  ? -19.856 9.028   -24.041 1.00 0.00  ? 30  GLU A HE2    5  
ATOM   10445 N N      . PHE A 1 31  ? -14.808 4.205   -21.827 1.00 0.00  ? 31  PHE A N      5  
ATOM   10446 C CA     . PHE A 1 31  ? -13.446 3.904   -22.258 1.00 0.00  ? 31  PHE A CA     5  
ATOM   10447 C C      . PHE A 1 31  ? -13.419 3.198   -23.613 1.00 0.00  ? 31  PHE A C      5  
ATOM   10448 O O      . PHE A 1 31  ? -14.377 2.527   -23.996 1.00 0.00  ? 31  PHE A O      5  
ATOM   10449 C CB     . PHE A 1 31  ? -12.748 3.035   -21.204 1.00 0.00  ? 31  PHE A CB     5  
ATOM   10450 C CG     . PHE A 1 31  ? -12.773 3.631   -19.823 1.00 0.00  ? 31  PHE A CG     5  
ATOM   10451 C CD1    . PHE A 1 31  ? -12.109 4.815   -19.561 1.00 0.00  ? 31  PHE A CD1    5  
ATOM   10452 C CD2    . PHE A 1 31  ? -13.461 3.008   -18.790 1.00 0.00  ? 31  PHE A CD2    5  
ATOM   10453 C CE1    . PHE A 1 31  ? -12.129 5.375   -18.299 1.00 0.00  ? 31  PHE A CE1    5  
ATOM   10454 C CE2    . PHE A 1 31  ? -13.482 3.563   -17.521 1.00 0.00  ? 31  PHE A CE2    5  
ATOM   10455 C CZ     . PHE A 1 31  ? -12.817 4.748   -17.276 1.00 0.00  ? 31  PHE A CZ     5  
ATOM   10456 H H      . PHE A 1 31  ? -15.320 3.518   -21.353 1.00 0.00  ? 31  PHE A H      5  
ATOM   10457 H HA     . PHE A 1 31  ? -12.917 4.839   -22.346 1.00 0.00  ? 31  PHE A HA     5  
ATOM   10458 H HB2    . PHE A 1 31  ? -13.239 2.074   -21.158 1.00 0.00  ? 31  PHE A HB2    5  
ATOM   10459 H HB3    . PHE A 1 31  ? -11.716 2.894   -21.489 1.00 0.00  ? 31  PHE A HB3    5  
ATOM   10460 H HD1    . PHE A 1 31  ? -11.572 5.304   -20.357 1.00 0.00  ? 31  PHE A HD1    5  
ATOM   10461 H HD2    . PHE A 1 31  ? -13.981 2.082   -18.981 1.00 0.00  ? 31  PHE A HD2    5  
ATOM   10462 H HE1    . PHE A 1 31  ? -11.605 6.300   -18.109 1.00 0.00  ? 31  PHE A HE1    5  
ATOM   10463 H HE2    . PHE A 1 31  ? -14.020 3.070   -16.723 1.00 0.00  ? 31  PHE A HE2    5  
ATOM   10464 H HZ     . PHE A 1 31  ? -12.833 5.185   -16.289 1.00 0.00  ? 31  PHE A HZ     5  
ATOM   10465 N N      . LEU A 1 32  ? -12.304 3.347   -24.330 1.00 0.00  ? 32  LEU A N      5  
ATOM   10466 C CA     . LEU A 1 32  ? -12.141 2.718   -25.637 1.00 0.00  ? 32  LEU A CA     5  
ATOM   10467 C C      . LEU A 1 32  ? -11.595 1.303   -25.484 1.00 0.00  ? 32  LEU A C      5  
ATOM   10468 O O      . LEU A 1 32  ? -10.648 1.071   -24.731 1.00 0.00  ? 32  LEU A O      5  
ATOM   10469 C CB     . LEU A 1 32  ? -11.196 3.537   -26.527 1.00 0.00  ? 32  LEU A CB     5  
ATOM   10470 C CG     . LEU A 1 32  ? -10.865 2.906   -27.883 1.00 0.00  ? 32  LEU A CG     5  
ATOM   10471 C CD1    . LEU A 1 32  ? -12.128 2.687   -28.703 1.00 0.00  ? 32  LEU A CD1    5  
ATOM   10472 C CD2    . LEU A 1 32  ? -9.881  3.778   -28.645 1.00 0.00  ? 32  LEU A CD2    5  
ATOM   10473 H H      . LEU A 1 32  ? -11.573 3.889   -23.966 1.00 0.00  ? 32  LEU A H      5  
ATOM   10474 H HA     . LEU A 1 32  ? -13.113 2.667   -26.106 1.00 0.00  ? 32  LEU A HA     5  
ATOM   10475 H HB2    . LEU A 1 32  ? -11.641 4.500   -26.702 1.00 0.00  ? 32  LEU A HB2    5  
ATOM   10476 H HB3    . LEU A 1 32  ? -10.275 3.686   -25.993 1.00 0.00  ? 32  LEU A HB3    5  
ATOM   10477 H HG     . LEU A 1 32  ? -10.401 1.943   -27.721 1.00 0.00  ? 32  LEU A HG     5  
ATOM   10478 H HD11   . LEU A 1 32  ? -12.261 3.514   -29.386 1.00 0.00  ? 32  LEU A HD11   5  
ATOM   10479 H HD12   . LEU A 1 32  ? -12.980 2.624   -28.043 1.00 0.00  ? 32  LEU A HD12   5  
ATOM   10480 H HD13   . LEU A 1 32  ? -12.036 1.768   -29.264 1.00 0.00  ? 32  LEU A HD13   5  
ATOM   10481 H HD21   . LEU A 1 32  ? -9.944  4.794   -28.283 1.00 0.00  ? 32  LEU A HD21   5  
ATOM   10482 H HD22   . LEU A 1 32  ? -10.120 3.759   -29.699 1.00 0.00  ? 32  LEU A HD22   5  
ATOM   10483 H HD23   . LEU A 1 32  ? -8.879  3.405   -28.498 1.00 0.00  ? 32  LEU A HD23   5  
ATOM   10484 N N      . LEU A 1 33  ? -12.190 0.363   -26.206 1.00 0.00  ? 33  LEU A N      5  
ATOM   10485 C CA     . LEU A 1 33  ? -11.757 -1.027  -26.152 1.00 0.00  ? 33  LEU A CA     5  
ATOM   10486 C C      . LEU A 1 33  ? -11.688 -1.625  -27.553 1.00 0.00  ? 33  LEU A C      5  
ATOM   10487 O O      . LEU A 1 33  ? -12.542 -1.353  -28.396 1.00 0.00  ? 33  LEU A O      5  
ATOM   10488 C CB     . LEU A 1 33  ? -12.706 -1.841  -25.274 1.00 0.00  ? 33  LEU A CB     5  
ATOM   10489 C CG     . LEU A 1 33  ? -12.367 -1.835  -23.782 1.00 0.00  ? 33  LEU A CG     5  
ATOM   10490 C CD1    . LEU A 1 33  ? -13.597 -2.173  -22.952 1.00 0.00  ? 33  LEU A CD1    5  
ATOM   10491 C CD2    . LEU A 1 33  ? -11.237 -2.812  -23.491 1.00 0.00  ? 33  LEU A CD2    5  
ATOM   10492 H H      . LEU A 1 33  ? -12.936 0.610   -26.790 1.00 0.00  ? 33  LEU A H      5  
ATOM   10493 H HA     . LEU A 1 33  ? -10.770 -1.048  -25.714 1.00 0.00  ? 33  LEU A HA     5  
ATOM   10494 H HB2    . LEU A 1 33  ? -13.705 -1.445  -25.395 1.00 0.00  ? 33  LEU A HB2    5  
ATOM   10495 H HB3    . LEU A 1 33  ? -12.699 -2.863  -25.617 1.00 0.00  ? 33  LEU A HB3    5  
ATOM   10496 H HG     . LEU A 1 33  ? -12.037 -0.847  -23.497 1.00 0.00  ? 33  LEU A HG     5  
ATOM   10497 H HD11   . LEU A 1 33  ? -14.383 -2.530  -23.602 1.00 0.00  ? 33  LEU A HD11   5  
ATOM   10498 H HD12   . LEU A 1 33  ? -13.935 -1.289  -22.432 1.00 0.00  ? 33  LEU A HD12   5  
ATOM   10499 H HD13   . LEU A 1 33  ? -13.349 -2.940  -22.233 1.00 0.00  ? 33  LEU A HD13   5  
ATOM   10500 H HD21   . LEU A 1 33  ? -10.344 -2.490  -24.005 1.00 0.00  ? 33  LEU A HD21   5  
ATOM   10501 H HD22   . LEU A 1 33  ? -11.515 -3.797  -23.834 1.00 0.00  ? 33  LEU A HD22   5  
ATOM   10502 H HD23   . LEU A 1 33  ? -11.050 -2.840  -22.427 1.00 0.00  ? 33  LEU A HD23   5  
ATOM   10503 N N      . LEU A 1 34  ? -10.659 -2.430  -27.797 1.00 0.00  ? 34  LEU A N      5  
ATOM   10504 C CA     . LEU A 1 34  ? -10.467 -3.057  -29.101 1.00 0.00  ? 34  LEU A CA     5  
ATOM   10505 C C      . LEU A 1 34  ? -10.580 -4.575  -29.012 1.00 0.00  ? 34  LEU A C      5  
ATOM   10506 O O      . LEU A 1 34  ? -9.902  -5.211  -28.203 1.00 0.00  ? 34  LEU A O      5  
ATOM   10507 C CB     . LEU A 1 34  ? -9.102  -2.672  -29.669 1.00 0.00  ? 34  LEU A CB     5  
ATOM   10508 C CG     . LEU A 1 34  ? -8.800  -1.174  -29.667 1.00 0.00  ? 34  LEU A CG     5  
ATOM   10509 C CD1    . LEU A 1 34  ? -7.431  -0.903  -30.266 1.00 0.00  ? 34  LEU A CD1    5  
ATOM   10510 C CD2    . LEU A 1 34  ? -9.876  -0.414  -30.428 1.00 0.00  ? 34  LEU A CD2    5  
ATOM   10511 H H      . LEU A 1 34  ? -10.006 -2.601  -27.086 1.00 0.00  ? 34  LEU A H      5  
ATOM   10512 H HA     . LEU A 1 34  ? -11.237 -2.690  -29.763 1.00 0.00  ? 34  LEU A HA     5  
ATOM   10513 H HB2    . LEU A 1 34  ? -8.340  -3.174  -29.089 1.00 0.00  ? 34  LEU A HB2    5  
ATOM   10514 H HB3    . LEU A 1 34  ? -9.045  -3.026  -30.689 1.00 0.00  ? 34  LEU A HB3    5  
ATOM   10515 H HG     . LEU A 1 34  ? -8.794  -0.816  -28.648 1.00 0.00  ? 34  LEU A HG     5  
ATOM   10516 H HD11   . LEU A 1 34  ? -7.337  -1.428  -31.204 1.00 0.00  ? 34  LEU A HD11   5  
ATOM   10517 H HD12   . LEU A 1 34  ? -6.666  -1.246  -29.586 1.00 0.00  ? 34  LEU A HD12   5  
ATOM   10518 H HD13   . LEU A 1 34  ? -7.314  0.158   -30.435 1.00 0.00  ? 34  LEU A HD13   5  
ATOM   10519 H HD21   . LEU A 1 34  ? -10.304 -1.057  -31.182 1.00 0.00  ? 34  LEU A HD21   5  
ATOM   10520 H HD22   . LEU A 1 34  ? -9.439  0.453   -30.901 1.00 0.00  ? 34  LEU A HD22   5  
ATOM   10521 H HD23   . LEU A 1 34  ? -10.649 -0.100  -29.742 1.00 0.00  ? 34  LEU A HD23   5  
ATOM   10522 N N      . GLN A 1 35  ? -11.430 -5.151  -29.855 1.00 0.00  ? 35  GLN A N      5  
ATOM   10523 C CA     . GLN A 1 35  ? -11.618 -6.596  -29.879 1.00 0.00  ? 35  GLN A CA     5  
ATOM   10524 C C      . GLN A 1 35  ? -10.340 -7.285  -30.346 1.00 0.00  ? 35  GLN A C      5  
ATOM   10525 O O      . GLN A 1 35  ? -9.502  -6.672  -31.008 1.00 0.00  ? 35  GLN A O      5  
ATOM   10526 C CB     . GLN A 1 35  ? -12.785 -6.968  -30.797 1.00 0.00  ? 35  GLN A CB     5  
ATOM   10527 C CG     . GLN A 1 35  ? -13.325 -8.369  -30.553 1.00 0.00  ? 35  GLN A CG     5  
ATOM   10528 C CD     . GLN A 1 35  ? -14.801 -8.496  -30.878 1.00 0.00  ? 35  GLN A CD     5  
ATOM   10529 O OE1    . GLN A 1 35  ? -15.301 -7.866  -31.809 1.00 0.00  ? 35  GLN A OE1    5  
ATOM   10530 N NE2    . GLN A 1 35  ? -15.506 -9.316  -30.106 1.00 0.00  ? 35  GLN A NE2    5  
ATOM   10531 H H      . GLN A 1 35  ? -11.935 -4.593  -30.483 1.00 0.00  ? 35  GLN A H      5  
ATOM   10532 H HA     . GLN A 1 35  ? -11.840 -6.918  -28.873 1.00 0.00  ? 35  GLN A HA     5  
ATOM   10533 H HB2    . GLN A 1 35  ? -13.590 -6.263  -30.641 1.00 0.00  ? 35  GLN A HB2    5  
ATOM   10534 H HB3    . GLN A 1 35  ? -12.456 -6.906  -31.822 1.00 0.00  ? 35  GLN A HB3    5  
ATOM   10535 H HG2    . GLN A 1 35  ? -12.778 -9.064  -31.169 1.00 0.00  ? 35  GLN A HG2    5  
ATOM   10536 H HG3    . GLN A 1 35  ? -13.179 -8.620  -29.513 1.00 0.00  ? 35  GLN A HG3    5  
ATOM   10537 H HE21   . GLN A 1 35  ? -15.039 -9.784  -29.382 1.00 0.00  ? 35  GLN A HE21   5  
ATOM   10538 H HE22   . GLN A 1 35  ? -16.462 -9.418  -30.292 1.00 0.00  ? 35  GLN A HE22   5  
ATOM   10539 N N      . ALA A 1 36  ? -10.189 -8.555  -29.992 1.00 0.00  ? 36  ALA A N      5  
ATOM   10540 C CA     . ALA A 1 36  ? -9.004  -9.314  -30.375 1.00 0.00  ? 36  ALA A CA     5  
ATOM   10541 C C      . ALA A 1 36  ? -9.130  -9.885  -31.787 1.00 0.00  ? 36  ALA A C      5  
ATOM   10542 O O      . ALA A 1 36  ? -8.138  -10.324 -32.369 1.00 0.00  ? 36  ALA A O      5  
ATOM   10543 C CB     . ALA A 1 36  ? -8.752  -10.429 -29.371 1.00 0.00  ? 36  ALA A CB     5  
ATOM   10544 H H      . ALA A 1 36  ? -10.886 -8.991  -29.459 1.00 0.00  ? 36  ALA A H      5  
ATOM   10545 H HA     . ALA A 1 36  ? -8.159  -8.641  -30.347 1.00 0.00  ? 36  ALA A HA     5  
ATOM   10546 H HB1    . ALA A 1 36  ? -9.692  -10.750 -28.947 1.00 0.00  ? 36  ALA A HB1    5  
ATOM   10547 H HB2    . ALA A 1 36  ? -8.108  -10.065 -28.584 1.00 0.00  ? 36  ALA A HB2    5  
ATOM   10548 H HB3    . ALA A 1 36  ? -8.278  -11.262 -29.869 1.00 0.00  ? 36  ALA A HB3    5  
ATOM   10549 N N      . SER A 1 37  ? -10.352 -9.884  -32.326 1.00 0.00  ? 37  SER A N      5  
ATOM   10550 C CA     . SER A 1 37  ? -10.630 -10.405 -33.670 1.00 0.00  ? 37  SER A CA     5  
ATOM   10551 C C      . SER A 1 37  ? -10.740 -11.930 -33.671 1.00 0.00  ? 37  SER A C      5  
ATOM   10552 O O      . SER A 1 37  ? -11.497 -12.501 -34.456 1.00 0.00  ? 37  SER A O      5  
ATOM   10553 C CB     . SER A 1 37  ? -9.562  -9.958  -34.676 1.00 0.00  ? 37  SER A CB     5  
ATOM   10554 O OG     . SER A 1 37  ? -8.401  -10.765 -34.593 1.00 0.00  ? 37  SER A OG     5  
ATOM   10555 H H      . SER A 1 37  ? -11.095 -9.525  -31.802 1.00 0.00  ? 37  SER A H      5  
ATOM   10556 H HA     . SER A 1 37  ? -11.583 -9.998  -33.980 1.00 0.00  ? 37  SER A HA     5  
ATOM   10557 H HB2    . SER A 1 37  ? -9.963  -10.037 -35.676 1.00 0.00  ? 37  SER A HB2    5  
ATOM   10558 H HB3    . SER A 1 37  ? -9.293  -8.930  -34.479 1.00 0.00  ? 37  SER A HB3    5  
ATOM   10559 H HG     . SER A 1 37  ? -7.878  -10.656 -35.390 1.00 0.00  ? 37  SER A HG     5  
ATOM   10560 N N      . ASP A 1 38  ? -9.986  -12.586 -32.793 1.00 0.00  ? 38  ASP A N      5  
ATOM   10561 C CA     . ASP A 1 38  ? -10.011 -14.041 -32.702 1.00 0.00  ? 38  ASP A CA     5  
ATOM   10562 C C      . ASP A 1 38  ? -9.691  -14.499 -31.281 1.00 0.00  ? 38  ASP A C      5  
ATOM   10563 O O      . ASP A 1 38  ? -9.698  -13.699 -30.347 1.00 0.00  ? 38  ASP A O      5  
ATOM   10564 C CB     . ASP A 1 38  ? -9.008  -14.648 -33.691 1.00 0.00  ? 38  ASP A CB     5  
ATOM   10565 C CG     . ASP A 1 38  ? -9.691  -15.384 -34.827 1.00 0.00  ? 38  ASP A CG     5  
ATOM   10566 O OD1    . ASP A 1 38  ? -10.611 -14.805 -35.441 1.00 0.00  ? 38  ASP A OD1    5  
ATOM   10567 O OD2    . ASP A 1 38  ? -9.307  -16.540 -35.102 1.00 0.00  ? 38  ASP A OD2    5  
ATOM   10568 H H      . ASP A 1 38  ? -9.402  -12.083 -32.191 1.00 0.00  ? 38  ASP A H      5  
ATOM   10569 H HA     . ASP A 1 38  ? -11.004 -14.374 -32.960 1.00 0.00  ? 38  ASP A HA     5  
ATOM   10570 H HB2    . ASP A 1 38  ? -8.404  -13.858 -34.112 1.00 0.00  ? 38  ASP A HB2    5  
ATOM   10571 H HB3    . ASP A 1 38  ? -8.369  -15.343 -33.168 1.00 0.00  ? 38  ASP A HB3    5  
ATOM   10572 H HD2    . ASP A 1 38  ? -9.781  -16.946 -35.830 1.00 0.00  ? 38  ASP A HD2    5  
ATOM   10573 N N      . GLY A 1 39  ? -9.409  -15.789 -31.125 1.00 0.00  ? 39  GLY A N      5  
ATOM   10574 C CA     . GLY A 1 39  ? -9.091  -16.324 -29.814 1.00 0.00  ? 39  GLY A CA     5  
ATOM   10575 C C      . GLY A 1 39  ? -10.240 -16.178 -28.835 1.00 0.00  ? 39  GLY A C      5  
ATOM   10576 O O      . GLY A 1 39  ? -11.363 -16.591 -29.120 1.00 0.00  ? 39  GLY A O      5  
ATOM   10577 H H      . GLY A 1 39  ? -9.417  -16.381 -31.904 1.00 0.00  ? 39  GLY A H      5  
ATOM   10578 H HA2    . GLY A 1 39  ? -8.848  -17.371 -29.915 1.00 0.00  ? 39  GLY A HA2    5  
ATOM   10579 H HA3    . GLY A 1 39  ? -8.230  -15.801 -29.425 1.00 0.00  ? 39  GLY A HA3    5  
ATOM   10580 N N      . ILE A 1 40  ? -9.954  -15.587 -27.676 1.00 0.00  ? 40  ILE A N      5  
ATOM   10581 C CA     . ILE A 1 40  ? -10.969 -15.385 -26.645 1.00 0.00  ? 40  ILE A CA     5  
ATOM   10582 C C      . ILE A 1 40  ? -11.735 -14.079 -26.866 1.00 0.00  ? 40  ILE A C      5  
ATOM   10583 O O      . ILE A 1 40  ? -12.691 -13.785 -26.150 1.00 0.00  ? 40  ILE A O      5  
ATOM   10584 C CB     . ILE A 1 40  ? -10.331 -15.368 -25.239 1.00 0.00  ? 40  ILE A CB     5  
ATOM   10585 C CG1    . ILE A 1 40  ? -11.398 -15.195 -24.152 1.00 0.00  ? 40  ILE A CG1    5  
ATOM   10586 C CG2    . ILE A 1 40  ? -9.289  -14.266 -25.143 1.00 0.00  ? 40  ILE A CG2    5  
ATOM   10587 C CD1    . ILE A 1 40  ? -10.834 -15.185 -22.748 1.00 0.00  ? 40  ILE A CD1    5  
ATOM   10588 H H      . ILE A 1 40  ? -9.039  -15.281 -27.511 1.00 0.00  ? 40  ILE A H      5  
ATOM   10589 H HA     . ILE A 1 40  ? -11.663 -16.212 -26.694 1.00 0.00  ? 40  ILE A HA     5  
ATOM   10590 H HB     . ILE A 1 40  ? -9.829  -16.313 -25.087 1.00 0.00  ? 40  ILE A HB     5  
ATOM   10591 H HG12   . ILE A 1 40  ? -11.909 -14.257 -24.305 1.00 0.00  ? 40  ILE A HG12   5  
ATOM   10592 H HG13   . ILE A 1 40  ? -12.110 -16.004 -24.222 1.00 0.00  ? 40  ILE A HG13   5  
ATOM   10593 H HG21   . ILE A 1 40  ? -8.301  -14.698 -25.195 1.00 0.00  ? 40  ILE A HG21   5  
ATOM   10594 H HG22   . ILE A 1 40  ? -9.404  -13.741 -24.205 1.00 0.00  ? 40  ILE A HG22   5  
ATOM   10595 H HG23   . ILE A 1 40  ? -9.421  -13.574 -25.961 1.00 0.00  ? 40  ILE A HG23   5  
ATOM   10596 H HD11   . ILE A 1 40  ? -11.646 -15.215 -22.034 1.00 0.00  ? 40  ILE A HD11   5  
ATOM   10597 H HD12   . ILE A 1 40  ? -10.257 -14.284 -22.597 1.00 0.00  ? 40  ILE A HD12   5  
ATOM   10598 H HD13   . ILE A 1 40  ? -10.200 -16.048 -22.608 1.00 0.00  ? 40  ILE A HD13   5  
ATOM   10599 N N      . HIS A 1 41  ? -11.315 -13.297 -27.858 1.00 0.00  ? 41  HIS A N      5  
ATOM   10600 C CA     . HIS A 1 41  ? -11.968 -12.027 -28.157 1.00 0.00  ? 41  HIS A CA     5  
ATOM   10601 C C      . HIS A 1 41  ? -11.796 -11.049 -27.001 1.00 0.00  ? 41  HIS A C      5  
ATOM   10602 O O      . HIS A 1 41  ? -12.677 -10.231 -26.729 1.00 0.00  ? 41  HIS A O      5  
ATOM   10603 C CB     . HIS A 1 41  ? -13.456 -12.241 -28.444 1.00 0.00  ? 41  HIS A CB     5  
ATOM   10604 C CG     . HIS A 1 41  ? -13.717 -13.239 -29.528 1.00 0.00  ? 41  HIS A CG     5  
ATOM   10605 N ND1    . HIS A 1 41  ? -12.771 -13.597 -30.464 1.00 0.00  ? 41  HIS A ND1    5  
ATOM   10606 C CD2    . HIS A 1 41  ? -14.828 -13.956 -29.825 1.00 0.00  ? 41  HIS A CD2    5  
ATOM   10607 C CE1    . HIS A 1 41  ? -13.287 -14.487 -31.291 1.00 0.00  ? 41  HIS A CE1    5  
ATOM   10608 N NE2    . HIS A 1 41  ? -14.533 -14.724 -30.924 1.00 0.00  ? 41  HIS A NE2    5  
ATOM   10609 H H      . HIS A 1 41  ? -10.549 -13.578 -28.400 1.00 0.00  ? 41  HIS A H      5  
ATOM   10610 H HA     . HIS A 1 41  ? -11.497 -11.612 -29.034 1.00 0.00  ? 41  HIS A HA     5  
ATOM   10611 H HB2    . HIS A 1 41  ? -13.944 -12.589 -27.547 1.00 0.00  ? 41  HIS A HB2    5  
ATOM   10612 H HB3    . HIS A 1 41  ? -13.894 -11.300 -28.744 1.00 0.00  ? 41  HIS A HB3    5  
ATOM   10613 H HD1    . HIS A 1 41  ? -11.856 -13.248 -30.514 1.00 0.00  ? 41  HIS A HD1    5  
ATOM   10614 H HD2    . HIS A 1 41  ? -15.769 -13.929 -29.293 1.00 0.00  ? 41  HIS A HD2    5  
ATOM   10615 H HE1    . HIS A 1 41  ? -12.776 -14.945 -32.125 1.00 0.00  ? 41  HIS A HE1    5  
ATOM   10616 H HE2    . HIS A 1 41  ? -15.115 -15.412 -31.310 1.00 0.00  ? 41  HIS A HE2    5  
ATOM   10617 N N      . HIS A 1 42  ? -10.658 -11.139 -26.323 1.00 0.00  ? 42  HIS A N      5  
ATOM   10618 C CA     . HIS A 1 42  ? -10.369 -10.263 -25.198 1.00 0.00  ? 42  HIS A CA     5  
ATOM   10619 C C      . HIS A 1 42  ? -10.303 -8.810  -25.653 1.00 0.00  ? 42  HIS A C      5  
ATOM   10620 O O      . HIS A 1 42  ? -9.684  -8.493  -26.668 1.00 0.00  ? 42  HIS A O      5  
ATOM   10621 C CB     . HIS A 1 42  ? -9.053  -10.668 -24.531 1.00 0.00  ? 42  HIS A CB     5  
ATOM   10622 C CG     . HIS A 1 42  ? -7.872  -10.617 -25.451 1.00 0.00  ? 42  HIS A CG     5  
ATOM   10623 N ND1    . HIS A 1 42  ? -7.174  -11.743 -25.839 1.00 0.00  ? 42  HIS A ND1    5  
ATOM   10624 C CD2    . HIS A 1 42  ? -7.263  -9.572  -26.058 1.00 0.00  ? 42  HIS A CD2    5  
ATOM   10625 C CE1    . HIS A 1 42  ? -6.187  -11.390 -26.644 1.00 0.00  ? 42  HIS A CE1    5  
ATOM   10626 N NE2    . HIS A 1 42  ? -6.220  -10.079 -26.793 1.00 0.00  ? 42  HIS A NE2    5  
ATOM   10627 H H      . HIS A 1 42  ? -9.996  -11.811 -26.589 1.00 0.00  ? 42  HIS A H      5  
ATOM   10628 H HA     . HIS A 1 42  ? -11.171 -10.367 -24.483 1.00 0.00  ? 42  HIS A HA     5  
ATOM   10629 H HB2    . HIS A 1 42  ? -8.857  -10.003 -23.704 1.00 0.00  ? 42  HIS A HB2    5  
ATOM   10630 H HB3    . HIS A 1 42  ? -9.143  -11.677 -24.161 1.00 0.00  ? 42  HIS A HB3    5  
ATOM   10631 H HD1    . HIS A 1 42  ? -7.372  -12.662 -25.566 1.00 0.00  ? 42  HIS A HD1    5  
ATOM   10632 H HD2    . HIS A 1 42  ? -7.547  -8.531  -25.980 1.00 0.00  ? 42  HIS A HD2    5  
ATOM   10633 H HE1    . HIS A 1 42  ? -5.475  -12.060 -27.101 1.00 0.00  ? 42  HIS A HE1    5  
ATOM   10634 H HE2    . HIS A 1 42  ? -5.557  -9.548  -27.283 1.00 0.00  ? 42  HIS A HE2    5  
ATOM   10635 N N      . TRP A 1 43  ? -10.947 -7.929  -24.895 1.00 0.00  ? 43  TRP A N      5  
ATOM   10636 C CA     . TRP A 1 43  ? -10.964 -6.509  -25.222 1.00 0.00  ? 43  TRP A CA     5  
ATOM   10637 C C      . TRP A 1 43  ? -9.977  -5.742  -24.348 1.00 0.00  ? 43  TRP A C      5  
ATOM   10638 O O      . TRP A 1 43  ? -9.974  -5.883  -23.126 1.00 0.00  ? 43  TRP A O      5  
ATOM   10639 C CB     . TRP A 1 43  ? -12.370 -5.930  -25.043 1.00 0.00  ? 43  TRP A CB     5  
ATOM   10640 C CG     . TRP A 1 43  ? -13.414 -6.613  -25.876 1.00 0.00  ? 43  TRP A CG     5  
ATOM   10641 C CD1    . TRP A 1 43  ? -13.921 -7.867  -25.694 1.00 0.00  ? 43  TRP A CD1    5  
ATOM   10642 C CD2    . TRP A 1 43  ? -14.082 -6.072  -27.022 1.00 0.00  ? 43  TRP A CD2    5  
ATOM   10643 N NE1    . TRP A 1 43  ? -14.863 -8.141  -26.657 1.00 0.00  ? 43  TRP A NE1    5  
ATOM   10644 C CE2    . TRP A 1 43  ? -14.979 -7.055  -27.484 1.00 0.00  ? 43  TRP A CE2    5  
ATOM   10645 C CE3    . TRP A 1 43  ? -14.010 -4.855  -27.703 1.00 0.00  ? 43  TRP A CE3    5  
ATOM   10646 C CZ2    . TRP A 1 43  ? -15.796 -6.855  -28.594 1.00 0.00  ? 43  TRP A CZ2    5  
ATOM   10647 C CZ3    . TRP A 1 43  ? -14.820 -4.658  -28.806 1.00 0.00  ? 43  TRP A CZ3    5  
ATOM   10648 C CH2    . TRP A 1 43  ? -15.703 -5.654  -29.241 1.00 0.00  ? 43  TRP A CH2    5  
ATOM   10649 H H      . TRP A 1 43  ? -11.426 -8.242  -24.098 1.00 0.00  ? 43  TRP A H      5  
ATOM   10650 H HA     . TRP A 1 43  ? -10.668 -6.403  -26.255 1.00 0.00  ? 43  TRP A HA     5  
ATOM   10651 H HB2    . TRP A 1 43  ? -12.661 -6.021  -24.008 1.00 0.00  ? 43  TRP A HB2    5  
ATOM   10652 H HB3    . TRP A 1 43  ? -12.358 -4.885  -25.316 1.00 0.00  ? 43  TRP A HB3    5  
ATOM   10653 H HD1    . TRP A 1 43  ? -13.618 -8.535  -24.903 1.00 0.00  ? 43  TRP A HD1    5  
ATOM   10654 H HE1    . TRP A 1 43  ? -15.367 -8.977  -26.737 1.00 0.00  ? 43  TRP A HE1    5  
ATOM   10655 H HE3    . TRP A 1 43  ? -13.335 -4.075  -27.382 1.00 0.00  ? 43  TRP A HE3    5  
ATOM   10656 H HZ2    . TRP A 1 43  ? -16.483 -7.611  -28.941 1.00 0.00  ? 43  TRP A HZ2    5  
ATOM   10657 H HZ3    . TRP A 1 43  ? -14.777 -3.724  -29.344 1.00 0.00  ? 43  TRP A HZ3    5  
ATOM   10658 H HH2    . TRP A 1 43  ? -16.317 -5.457  -30.108 1.00 0.00  ? 43  TRP A HH2    5  
ATOM   10659 N N      . THR A 1 44  ? -9.140  -4.931  -24.985 1.00 0.00  ? 44  THR A N      5  
ATOM   10660 C CA     . THR A 1 44  ? -8.149  -4.139  -24.267 1.00 0.00  ? 44  THR A CA     5  
ATOM   10661 C C      . THR A 1 44  ? -7.874  -2.831  -25.000 1.00 0.00  ? 44  THR A C      5  
ATOM   10662 O O      . THR A 1 44  ? -7.868  -2.789  -26.230 1.00 0.00  ? 44  THR A O      5  
ATOM   10663 C CB     . THR A 1 44  ? -6.851  -4.927  -24.114 1.00 0.00  ? 44  THR A CB     5  
ATOM   10664 O OG1    . THR A 1 44  ? -6.449  -5.478  -25.358 1.00 0.00  ? 44  THR A OG1    5  
ATOM   10665 C CG2    . THR A 1 44  ? -6.956  -6.064  -23.122 1.00 0.00  ? 44  THR A CG2    5  
ATOM   10666 H H      . THR A 1 44  ? -9.191  -4.861  -25.961 1.00 0.00  ? 44  THR A H      5  
ATOM   10667 H HA     . THR A 1 44  ? -8.546  -3.918  -23.288 1.00 0.00  ? 44  THR A HA     5  
ATOM   10668 H HB     . THR A 1 44  ? -6.074  -4.260  -23.772 1.00 0.00  ? 44  THR A HB     5  
ATOM   10669 H HG1    . THR A 1 44  ? -5.491  -5.479  -25.413 1.00 0.00  ? 44  THR A HG1    5  
ATOM   10670 H HG21   . THR A 1 44  ? -7.780  -6.705  -23.397 1.00 0.00  ? 44  THR A HG21   5  
ATOM   10671 H HG22   . THR A 1 44  ? -7.126  -5.663  -22.134 1.00 0.00  ? 44  THR A HG22   5  
ATOM   10672 H HG23   . THR A 1 44  ? -6.040  -6.635  -23.128