data_1XTQ
# 
_entry.id   1XTQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XTQ         
RCSB  RCSB030758   
WWPDB D_1000030758 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1XTR 'the same protein in complex with GppNHp' unspecified 
PDB 1XTS 'the same protein in complex with GTP'    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XTQ 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yu, Y.'   1 
'Ding, J.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis for the Unique Biological Function of Small GTPase RHEB' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                17093 
_citation.page_last                 17100 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15728574 
_citation.pdbx_database_id_DOI      10.1074/jbc.M501253200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yu, Y.'     1 
primary 'Li, S.'     2 
primary 'Xu, X.'     3 
primary 'Li, Y.'     4 
primary 'Guan, K.'   5 
primary 'Arnold, E.' 6 
primary 'Ding, J.'   7 
# 
_cell.entry_id           1XTQ 
_cell.length_a           44.480 
_cell.length_b           52.260 
_cell.length_c           70.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XTQ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GTP-binding protein Rheb' 20148.965 1   ? ? 'GTPase domain' ? 
2 non-polymer syn 'MAGNESIUM ION'            24.305    1   ? ? ?               ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201   1   ? ? ?               ? 
4 water       nat water                      18.015    164 ? ? ?               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ras homolog enriched in brain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEKLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   GLN n 
1 4   SER n 
1 5   LYS n 
1 6   SER n 
1 7   ARG n 
1 8   LYS n 
1 9   ILE n 
1 10  ALA n 
1 11  ILE n 
1 12  LEU n 
1 13  GLY n 
1 14  TYR n 
1 15  ARG n 
1 16  SER n 
1 17  VAL n 
1 18  GLY n 
1 19  LYS n 
1 20  SER n 
1 21  SER n 
1 22  LEU n 
1 23  THR n 
1 24  ILE n 
1 25  GLN n 
1 26  PHE n 
1 27  VAL n 
1 28  GLU n 
1 29  GLY n 
1 30  GLN n 
1 31  PHE n 
1 32  VAL n 
1 33  ASP n 
1 34  SER n 
1 35  TYR n 
1 36  ASP n 
1 37  PRO n 
1 38  THR n 
1 39  ILE n 
1 40  GLU n 
1 41  ASN n 
1 42  THR n 
1 43  PHE n 
1 44  THR n 
1 45  LYS n 
1 46  LEU n 
1 47  ILE n 
1 48  THR n 
1 49  VAL n 
1 50  ASN n 
1 51  GLY n 
1 52  GLN n 
1 53  GLU n 
1 54  TYR n 
1 55  HIS n 
1 56  LEU n 
1 57  GLN n 
1 58  LEU n 
1 59  VAL n 
1 60  ASP n 
1 61  THR n 
1 62  ALA n 
1 63  GLY n 
1 64  GLN n 
1 65  ASP n 
1 66  GLU n 
1 67  TYR n 
1 68  SER n 
1 69  ILE n 
1 70  PHE n 
1 71  PRO n 
1 72  GLN n 
1 73  THR n 
1 74  TYR n 
1 75  SER n 
1 76  ILE n 
1 77  ASP n 
1 78  ILE n 
1 79  ASN n 
1 80  GLY n 
1 81  TYR n 
1 82  ILE n 
1 83  LEU n 
1 84  VAL n 
1 85  TYR n 
1 86  SER n 
1 87  VAL n 
1 88  THR n 
1 89  SER n 
1 90  ILE n 
1 91  LYS n 
1 92  SER n 
1 93  PHE n 
1 94  GLU n 
1 95  VAL n 
1 96  ILE n 
1 97  LYS n 
1 98  VAL n 
1 99  ILE n 
1 100 HIS n 
1 101 GLY n 
1 102 LYS n 
1 103 LEU n 
1 104 LEU n 
1 105 ASP n 
1 106 MET n 
1 107 VAL n 
1 108 GLY n 
1 109 LYS n 
1 110 VAL n 
1 111 GLN n 
1 112 ILE n 
1 113 PRO n 
1 114 ILE n 
1 115 MET n 
1 116 LEU n 
1 117 VAL n 
1 118 GLY n 
1 119 ASN n 
1 120 LYS n 
1 121 LYS n 
1 122 ASP n 
1 123 LEU n 
1 124 HIS n 
1 125 MET n 
1 126 GLU n 
1 127 ARG n 
1 128 VAL n 
1 129 ILE n 
1 130 SER n 
1 131 TYR n 
1 132 GLU n 
1 133 GLU n 
1 134 GLY n 
1 135 LYS n 
1 136 ALA n 
1 137 LEU n 
1 138 ALA n 
1 139 GLU n 
1 140 SER n 
1 141 TRP n 
1 142 ASN n 
1 143 ALA n 
1 144 ALA n 
1 145 PHE n 
1 146 LEU n 
1 147 GLU n 
1 148 SER n 
1 149 SER n 
1 150 ALA n 
1 151 LYS n 
1 152 GLU n 
1 153 ASN n 
1 154 GLN n 
1 155 THR n 
1 156 ALA n 
1 157 VAL n 
1 158 ASP n 
1 159 VAL n 
1 160 PHE n 
1 161 ARG n 
1 162 ARG n 
1 163 ILE n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 ALA n 
1 168 GLU n 
1 169 LYS n 
1 170 LEU n 
1 171 GLU n 
1 172 HIS n 
1 173 HIS n 
1 174 HIS n 
1 175 HIS n 
1 176 HIS n 
1 177 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 Rheb 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET22b(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RHEB_HUMAN 
_struct_ref.pdbx_db_accession          Q15382 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDING
YILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF
RRIILEAEK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1XTQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 169 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15382 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  169 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       169 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XTQ LEU A 170 ? UNP Q15382 ? ? 'EXPRESSION TAG' 170 1 
1 1XTQ GLU A 171 ? UNP Q15382 ? ? 'EXPRESSION TAG' 171 2 
1 1XTQ HIS A 172 ? UNP Q15382 ? ? 'EXPRESSION TAG' 172 3 
1 1XTQ HIS A 173 ? UNP Q15382 ? ? 'EXPRESSION TAG' 173 4 
1 1XTQ HIS A 174 ? UNP Q15382 ? ? 'EXPRESSION TAG' 174 5 
1 1XTQ HIS A 175 ? UNP Q15382 ? ? 'EXPRESSION TAG' 175 6 
1 1XTQ HIS A 176 ? UNP Q15382 ? ? 'EXPRESSION TAG' 176 7 
1 1XTQ HIS A 177 ? UNP Q15382 ? ? 'EXPRESSION TAG' 177 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1XTQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   40.1 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'potassium dihydrogenphosphate, PEG 8000, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2004-01-30 
_diffrn_detector.details                'osmic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Ni filter' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1XTQ 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.0 
_reflns.d_resolution_low             14.8 
_reflns.number_all                   11457 
_reflns.number_obs                   11457 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            0.029 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.6 
_reflns.B_iso_Wilson_estimate        20.1 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.122 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.9 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1126 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XTQ 
_refine.ls_d_res_high                            2.00 
_refine.ls_d_res_low                             14.8 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_number_reflns_all                     11436 
_refine.ls_number_reflns_obs                     11436 
_refine.ls_number_reflns_R_free                  575 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entries 1KAO, 1GUA' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               30.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  'Used weighted full matrix least squares procedure.' 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1XTQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           6.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1344 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             164 
_refine_hist.number_atoms_total               1537 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        14.8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_improper_angle_d 0.75  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.6  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
6 2.00 2.12  . 0.2945 . 0.3842 . . 85  1864 . . 'X-RAY DIFFRACTION' . 
6 2.12 2.29  . 0.2472 . 0.3032 . . 102 1896 . . 'X-RAY DIFFRACTION' . 
6 2.29 2.52  . 0.2374 . 0.3144 . . 84  1903 . . 'X-RAY DIFFRACTION' . 
6 2.52 2.88  . 0.2344 . 0.3043 . . 105 1901 . . 'X-RAY DIFFRACTION' . 
6 2.88 3.62  . 0.2157 . 0.2337 . . 105 1939 . . 'X-RAY DIFFRACTION' . 
6 3.62 14.80 . 0.1806 . 0.1937 . . 94  1932 . . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  1XTQ 
_struct.title                     'Structure of small GTPase human Rheb in complex with GDP' 
_struct.pdbx_descriptor           'GTP-binding protein Rheb' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XTQ 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'beta saddle, P-loop, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 18  ? GLY A 29  ? GLY A 18  GLY A 29  1 ? 12 
HELX_P HELX_P2 2 PRO A 71  ? SER A 75  ? PRO A 71  SER A 75  5 ? 5  
HELX_P HELX_P3 3 SER A 89  ? GLY A 108 ? SER A 89  GLY A 108 1 ? 20 
HELX_P HELX_P4 4 LEU A 123 ? ARG A 127 ? LEU A 123 ARG A 127 5 ? 5  
HELX_P HELX_P5 5 SER A 130 ? ASN A 142 ? SER A 130 ASN A 142 1 ? 13 
HELX_P HELX_P6 6 GLU A 152 ? GLU A 171 ? GLU A 152 GLU A 171 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 202 A HOH 203 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C GDP .  O3B ? ? A MG 202 A GDP 201 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 202 A HOH 204 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 202 A HOH 205 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 202 A HOH 206 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 A SER 20 OG  ? ? A MG 202 A SER 20  1_555 ? ? ? ? ? ? ? 2.347 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 41  ? VAL A 49  ? ASN A 41  VAL A 49  
A 2 GLN A 52  ? ASP A 60  ? GLN A 52  ASP A 60  
A 3 LYS A 5   ? GLY A 13  ? LYS A 5   GLY A 13  
A 4 GLY A 80  ? SER A 86  ? GLY A 80  SER A 86  
A 5 ILE A 114 ? ASN A 119 ? ILE A 114 ASN A 119 
A 6 ALA A 144 ? GLU A 147 ? ALA A 144 GLU A 147 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 45  ? N LYS A 45  O LEU A 56  ? O LEU A 56  
A 2 3 O VAL A 59  ? O VAL A 59  N ILE A 9   ? N ILE A 9   
A 3 4 N LEU A 12  ? N LEU A 12  O ILE A 82  ? O ILE A 82  
A 4 5 N LEU A 83  ? N LEU A 83  O VAL A 117 ? O VAL A 117 
A 5 6 N LEU A 116 ? N LEU A 116 O ALA A 144 ? O ALA A 144 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 202'  
AC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE GDP A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  SER A 20  ? SER A 20  . ? 1_555 ? 
2  AC1 6  GDP C .   ? GDP A 201 . ? 1_555 ? 
3  AC1 6  HOH D .   ? HOH A 203 . ? 1_555 ? 
4  AC1 6  HOH D .   ? HOH A 204 . ? 1_555 ? 
5  AC1 6  HOH D .   ? HOH A 205 . ? 1_555 ? 
6  AC1 6  HOH D .   ? HOH A 206 . ? 1_555 ? 
7  AC2 23 SER A 16  ? SER A 16  . ? 1_555 ? 
8  AC2 23 VAL A 17  ? VAL A 17  . ? 1_555 ? 
9  AC2 23 GLY A 18  ? GLY A 18  . ? 1_555 ? 
10 AC2 23 LYS A 19  ? LYS A 19  . ? 1_555 ? 
11 AC2 23 SER A 20  ? SER A 20  . ? 1_555 ? 
12 AC2 23 SER A 21  ? SER A 21  . ? 1_555 ? 
13 AC2 23 PHE A 31  ? PHE A 31  . ? 1_555 ? 
14 AC2 23 ASN A 119 ? ASN A 119 . ? 1_555 ? 
15 AC2 23 LYS A 120 ? LYS A 120 . ? 1_555 ? 
16 AC2 23 ASP A 122 ? ASP A 122 . ? 1_555 ? 
17 AC2 23 LEU A 123 ? LEU A 123 . ? 1_555 ? 
18 AC2 23 SER A 149 ? SER A 149 . ? 1_555 ? 
19 AC2 23 ALA A 150 ? ALA A 150 . ? 1_555 ? 
20 AC2 23 LYS A 151 ? LYS A 151 . ? 1_555 ? 
21 AC2 23 MG  B .   ? MG  A 202 . ? 1_555 ? 
22 AC2 23 HOH D .   ? HOH A 203 . ? 1_555 ? 
23 AC2 23 HOH D .   ? HOH A 204 . ? 1_555 ? 
24 AC2 23 HOH D .   ? HOH A 208 . ? 1_555 ? 
25 AC2 23 HOH D .   ? HOH A 268 . ? 1_555 ? 
26 AC2 23 HOH D .   ? HOH A 325 . ? 1_555 ? 
27 AC2 23 HOH D .   ? HOH A 331 . ? 1_555 ? 
28 AC2 23 HOH D .   ? HOH A 343 . ? 1_555 ? 
29 AC2 23 HOH D .   ? HOH A 355 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XTQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XTQ 
_atom_sites.fract_transf_matrix[1][1]   0.022482 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019135 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014170 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLN A 1 3   ? 2.638   20.722 72.774 1.00 50.35 ? 3   GLN A N     1 
ATOM   2    C  CA    . GLN A 1 3   ? 3.187   19.601 71.959 1.00 49.24 ? 3   GLN A CA    1 
ATOM   3    C  C     . GLN A 1 3   ? 2.235   19.199 70.833 1.00 48.34 ? 3   GLN A C     1 
ATOM   4    O  O     . GLN A 1 3   ? 2.343   18.104 70.280 1.00 49.00 ? 3   GLN A O     1 
ATOM   5    C  CB    . GLN A 1 3   ? 3.466   18.391 72.854 1.00 51.26 ? 3   GLN A CB    1 
ATOM   6    C  CG    . GLN A 1 3   ? 2.238   17.834 73.564 1.00 54.19 ? 3   GLN A CG    1 
ATOM   7    C  CD    . GLN A 1 3   ? 2.560   16.625 74.430 1.00 55.97 ? 3   GLN A CD    1 
ATOM   8    O  OE1   . GLN A 1 3   ? 3.080   15.617 73.945 1.00 56.46 ? 3   GLN A OE1   1 
ATOM   9    N  NE2   . GLN A 1 3   ? 2.250   16.721 75.719 1.00 57.42 ? 3   GLN A NE2   1 
ATOM   10   N  N     . SER A 1 4   ? 1.301   20.086 70.500 1.00 46.02 ? 4   SER A N     1 
ATOM   11   C  CA    . SER A 1 4   ? 0.342   19.821 69.432 1.00 43.51 ? 4   SER A CA    1 
ATOM   12   C  C     . SER A 1 4   ? 0.861   20.450 68.148 1.00 41.80 ? 4   SER A C     1 
ATOM   13   O  O     . SER A 1 4   ? 1.832   21.207 68.169 1.00 42.32 ? 4   SER A O     1 
ATOM   14   C  CB    . SER A 1 4   ? -1.022  20.420 69.772 1.00 43.61 ? 4   SER A CB    1 
ATOM   15   O  OG    . SER A 1 4   ? -0.961  21.834 69.773 1.00 44.73 ? 4   SER A OG    1 
ATOM   16   N  N     . LYS A 1 5   ? 0.211   20.149 67.032 1.00 39.40 ? 5   LYS A N     1 
ATOM   17   C  CA    . LYS A 1 5   ? 0.636   20.694 65.751 1.00 37.20 ? 5   LYS A CA    1 
ATOM   18   C  C     . LYS A 1 5   ? -0.575  21.147 64.936 1.00 35.69 ? 5   LYS A C     1 
ATOM   19   O  O     . LYS A 1 5   ? -1.472  20.355 64.644 1.00 33.30 ? 5   LYS A O     1 
ATOM   20   C  CB    . LYS A 1 5   ? 1.429   19.632 64.988 1.00 38.66 ? 5   LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 5   ? 2.518   20.184 64.086 1.00 40.78 ? 5   LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 5   ? 3.440   19.073 63.604 1.00 42.91 ? 5   LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 5   ? 4.088   18.340 64.774 1.00 42.33 ? 5   LYS A CE    1 
ATOM   24   N  NZ    . LYS A 1 5   ? 5.029   17.282 64.317 1.00 43.26 ? 5   LYS A NZ    1 
ATOM   25   N  N     . SER A 1 6   ? -0.601  22.428 64.583 1.00 33.56 ? 6   SER A N     1 
ATOM   26   C  CA    . SER A 1 6   ? -1.705  22.974 63.807 1.00 32.34 ? 6   SER A CA    1 
ATOM   27   C  C     . SER A 1 6   ? -1.353  22.983 62.326 1.00 30.01 ? 6   SER A C     1 
ATOM   28   O  O     . SER A 1 6   ? -0.243  23.344 61.938 1.00 29.18 ? 6   SER A O     1 
ATOM   29   C  CB    . SER A 1 6   ? -2.036  24.398 64.266 1.00 33.58 ? 6   SER A CB    1 
ATOM   30   O  OG    . SER A 1 6   ? -1.000  25.296 63.920 1.00 37.77 ? 6   SER A OG    1 
ATOM   31   N  N     . ARG A 1 7   ? -2.309  22.571 61.507 1.00 28.44 ? 7   ARG A N     1 
ATOM   32   C  CA    . ARG A 1 7   ? -2.124  22.521 60.068 1.00 27.27 ? 7   ARG A CA    1 
ATOM   33   C  C     . ARG A 1 7   ? -3.398  23.020 59.403 1.00 25.68 ? 7   ARG A C     1 
ATOM   34   O  O     . ARG A 1 7   ? -4.493  22.805 59.914 1.00 26.12 ? 7   ARG A O     1 
ATOM   35   C  CB    . ARG A 1 7   ? -1.823  21.084 59.632 1.00 28.70 ? 7   ARG A CB    1 
ATOM   36   C  CG    . ARG A 1 7   ? -0.467  20.553 60.115 1.00 30.80 ? 7   ARG A CG    1 
ATOM   37   C  CD    . ARG A 1 7   ? 0.684   21.249 59.395 1.00 33.96 ? 7   ARG A CD    1 
ATOM   38   N  NE    . ARG A 1 7   ? 2.002   20.726 59.759 1.00 37.29 ? 7   ARG A NE    1 
ATOM   39   C  CZ    . ARG A 1 7   ? 2.694   21.089 60.839 1.00 38.73 ? 7   ARG A CZ    1 
ATOM   40   N  NH1   . ARG A 1 7   ? 2.203   21.986 61.687 1.00 38.13 ? 7   ARG A NH1   1 
ATOM   41   N  NH2   . ARG A 1 7   ? 3.892   20.564 61.062 1.00 39.59 ? 7   ARG A NH2   1 
ATOM   42   N  N     . LYS A 1 8   ? -3.250  23.703 58.275 1.00 24.67 ? 8   LYS A N     1 
ATOM   43   C  CA    . LYS A 1 8   ? -4.401  24.222 57.544 1.00 24.38 ? 8   LYS A CA    1 
ATOM   44   C  C     . LYS A 1 8   ? -4.469  23.485 56.205 1.00 22.69 ? 8   LYS A C     1 
ATOM   45   O  O     . LYS A 1 8   ? -3.504  23.475 55.444 1.00 21.42 ? 8   LYS A O     1 
ATOM   46   C  CB    . LYS A 1 8   ? -4.249  25.730 57.323 1.00 23.87 ? 8   LYS A CB    1 
ATOM   47   C  CG    . LYS A 1 8   ? -5.496  26.422 56.802 1.00 27.20 ? 8   LYS A CG    1 
ATOM   48   C  CD    . LYS A 1 8   ? -5.308  27.936 56.770 1.00 29.87 ? 8   LYS A CD    1 
ATOM   49   C  CE    . LYS A 1 8   ? -6.642  28.660 56.619 1.00 32.47 ? 8   LYS A CE    1 
ATOM   50   N  NZ    . LYS A 1 8   ? -6.479  30.148 56.534 1.00 34.27 ? 8   LYS A NZ    1 
ATOM   51   N  N     . ILE A 1 9   ? -5.613  22.867 55.934 1.00 21.64 ? 9   ILE A N     1 
ATOM   52   C  CA    . ILE A 1 9   ? -5.811  22.098 54.707 1.00 21.01 ? 9   ILE A CA    1 
ATOM   53   C  C     . ILE A 1 9   ? -6.945  22.684 53.875 1.00 20.89 ? 9   ILE A C     1 
ATOM   54   O  O     . ILE A 1 9   ? -8.041  22.906 54.392 1.00 22.30 ? 9   ILE A O     1 
ATOM   55   C  CB    . ILE A 1 9   ? -6.177  20.642 55.045 1.00 21.25 ? 9   ILE A CB    1 
ATOM   56   C  CG1   . ILE A 1 9   ? -5.051  19.998 55.856 1.00 19.23 ? 9   ILE A CG1   1 
ATOM   57   C  CG2   . ILE A 1 9   ? -6.459  19.860 53.763 1.00 21.48 ? 9   ILE A CG2   1 
ATOM   58   C  CD1   . ILE A 1 9   ? -5.516  18.836 56.709 1.00 22.82 ? 9   ILE A CD1   1 
ATOM   59   N  N     . ALA A 1 10  ? -6.684  22.933 52.593 1.00 16.95 ? 10  ALA A N     1 
ATOM   60   C  CA    . ALA A 1 10  ? -7.710  23.475 51.710 1.00 17.37 ? 10  ALA A CA    1 
ATOM   61   C  C     . ALA A 1 10  ? -8.282  22.359 50.837 1.00 18.37 ? 10  ALA A C     1 
ATOM   62   O  O     . ALA A 1 10  ? -7.534  21.570 50.251 1.00 17.83 ? 10  ALA A O     1 
ATOM   63   C  CB    . ALA A 1 10  ? -7.122  24.582 50.832 1.00 14.93 ? 10  ALA A CB    1 
ATOM   64   N  N     . ILE A 1 11  ? -9.608  22.293 50.755 1.00 18.42 ? 11  ILE A N     1 
ATOM   65   C  CA    . ILE A 1 11  ? -10.278 21.280 49.945 1.00 16.93 ? 11  ILE A CA    1 
ATOM   66   C  C     . ILE A 1 11  ? -10.777 21.970 48.683 1.00 18.49 ? 11  ILE A C     1 
ATOM   67   O  O     . ILE A 1 11  ? -11.605 22.887 48.750 1.00 15.43 ? 11  ILE A O     1 
ATOM   68   C  CB    . ILE A 1 11  ? -11.478 20.650 50.687 1.00 17.13 ? 11  ILE A CB    1 
ATOM   69   C  CG1   . ILE A 1 11  ? -11.018 19.987 51.989 1.00 18.93 ? 11  ILE A CG1   1 
ATOM   70   C  CG2   . ILE A 1 11  ? -12.147 19.615 49.809 1.00 16.91 ? 11  ILE A CG2   1 
ATOM   71   C  CD1   . ILE A 1 11  ? -10.873 20.931 53.159 1.00 19.10 ? 11  ILE A CD1   1 
ATOM   72   N  N     . LEU A 1 12  ? -10.268 21.516 47.537 1.00 16.98 ? 12  LEU A N     1 
ATOM   73   C  CA    . LEU A 1 12  ? -10.613 22.082 46.239 1.00 14.78 ? 12  LEU A CA    1 
ATOM   74   C  C     . LEU A 1 12  ? -11.366 21.085 45.369 1.00 14.39 ? 12  LEU A C     1 
ATOM   75   O  O     . LEU A 1 12  ? -11.385 19.889 45.659 1.00 12.23 ? 12  LEU A O     1 
ATOM   76   C  CB    . LEU A 1 12  ? -9.340  22.502 45.504 1.00 16.82 ? 12  LEU A CB    1 
ATOM   77   C  CG    . LEU A 1 12  ? -8.389  23.455 46.229 1.00 21.00 ? 12  LEU A CG    1 
ATOM   78   C  CD1   . LEU A 1 12  ? -7.176  23.721 45.345 1.00 22.85 ? 12  LEU A CD1   1 
ATOM   79   C  CD2   . LEU A 1 12  ? -9.112  24.752 46.564 1.00 20.83 ? 12  LEU A CD2   1 
ATOM   80   N  N     . GLY A 1 13  ? -11.975 21.583 44.295 1.00 13.97 ? 13  GLY A N     1 
ATOM   81   C  CA    . GLY A 1 13  ? -12.699 20.703 43.396 1.00 14.21 ? 13  GLY A CA    1 
ATOM   82   C  C     . GLY A 1 13  ? -13.879 21.350 42.696 1.00 15.99 ? 13  GLY A C     1 
ATOM   83   O  O     . GLY A 1 13  ? -14.352 22.423 43.095 1.00 13.71 ? 13  GLY A O     1 
ATOM   84   N  N     . TYR A 1 14  ? -14.344 20.687 41.641 1.00 13.57 ? 14  TYR A N     1 
ATOM   85   C  CA    . TYR A 1 14  ? -15.482 21.146 40.851 1.00 15.78 ? 14  TYR A CA    1 
ATOM   86   C  C     . TYR A 1 14  ? -16.716 21.129 41.746 1.00 16.34 ? 14  TYR A C     1 
ATOM   87   O  O     . TYR A 1 14  ? -16.747 20.428 42.758 1.00 14.40 ? 14  TYR A O     1 
ATOM   88   C  CB    . TYR A 1 14  ? -15.692 20.201 39.664 1.00 15.77 ? 14  TYR A CB    1 
ATOM   89   C  CG    . TYR A 1 14  ? -16.673 20.679 38.611 1.00 18.94 ? 14  TYR A CG    1 
ATOM   90   C  CD1   . TYR A 1 14  ? -16.491 21.903 37.956 1.00 17.45 ? 14  TYR A CD1   1 
ATOM   91   C  CD2   . TYR A 1 14  ? -17.748 19.876 38.224 1.00 18.39 ? 14  TYR A CD2   1 
ATOM   92   C  CE1   . TYR A 1 14  ? -17.356 22.310 36.932 1.00 19.11 ? 14  TYR A CE1   1 
ATOM   93   C  CE2   . TYR A 1 14  ? -18.617 20.267 37.212 1.00 18.00 ? 14  TYR A CE2   1 
ATOM   94   C  CZ    . TYR A 1 14  ? -18.415 21.483 36.567 1.00 19.56 ? 14  TYR A CZ    1 
ATOM   95   O  OH    . TYR A 1 14  ? -19.268 21.854 35.556 1.00 18.48 ? 14  TYR A OH    1 
ATOM   96   N  N     . ARG A 1 15  ? -17.734 21.898 41.383 1.00 19.14 ? 15  ARG A N     1 
ATOM   97   C  CA    . ARG A 1 15  ? -18.951 21.916 42.188 1.00 21.29 ? 15  ARG A CA    1 
ATOM   98   C  C     . ARG A 1 15  ? -19.608 20.534 42.217 1.00 19.47 ? 15  ARG A C     1 
ATOM   99   O  O     . ARG A 1 15  ? -19.533 19.790 41.242 1.00 18.26 ? 15  ARG A O     1 
ATOM   100  C  CB    . ARG A 1 15  ? -19.945 22.937 41.628 1.00 25.54 ? 15  ARG A CB    1 
ATOM   101  C  CG    . ARG A 1 15  ? -20.385 22.663 40.202 1.00 29.13 ? 15  ARG A CG    1 
ATOM   102  C  CD    . ARG A 1 15  ? -21.568 23.548 39.831 1.00 36.51 ? 15  ARG A CD    1 
ATOM   103  N  NE    . ARG A 1 15  ? -21.929 23.429 38.421 1.00 39.69 ? 15  ARG A NE    1 
ATOM   104  C  CZ    . ARG A 1 15  ? -21.179 23.873 37.417 1.00 42.90 ? 15  ARG A CZ    1 
ATOM   105  N  NH1   . ARG A 1 15  ? -20.017 24.469 37.664 1.00 43.40 ? 15  ARG A NH1   1 
ATOM   106  N  NH2   . ARG A 1 15  ? -21.594 23.728 36.164 1.00 43.37 ? 15  ARG A NH2   1 
ATOM   107  N  N     . SER A 1 16  ? -20.224 20.202 43.350 1.00 17.76 ? 16  SER A N     1 
ATOM   108  C  CA    . SER A 1 16  ? -20.939 18.940 43.551 1.00 18.14 ? 16  SER A CA    1 
ATOM   109  C  C     . SER A 1 16  ? -20.147 17.634 43.600 1.00 17.11 ? 16  SER A C     1 
ATOM   110  O  O     . SER A 1 16  ? -20.743 16.557 43.586 1.00 14.49 ? 16  SER A O     1 
ATOM   111  C  CB    . SER A 1 16  ? -22.040 18.803 42.497 1.00 19.79 ? 16  SER A CB    1 
ATOM   112  O  OG    . SER A 1 16  ? -22.867 19.952 42.506 1.00 25.84 ? 16  SER A OG    1 
ATOM   113  N  N     . VAL A 1 17  ? -18.820 17.703 43.654 1.00 16.09 ? 17  VAL A N     1 
ATOM   114  C  CA    . VAL A 1 17  ? -18.045 16.473 43.716 1.00 13.04 ? 17  VAL A CA    1 
ATOM   115  C  C     . VAL A 1 17  ? -18.085 15.904 45.129 1.00 12.81 ? 17  VAL A C     1 
ATOM   116  O  O     . VAL A 1 17  ? -17.732 14.755 45.344 1.00 14.46 ? 17  VAL A O     1 
ATOM   117  C  CB    . VAL A 1 17  ? -16.566 16.693 43.300 1.00 14.34 ? 17  VAL A CB    1 
ATOM   118  C  CG1   . VAL A 1 17  ? -16.505 17.185 41.867 1.00 11.42 ? 17  VAL A CG1   1 
ATOM   119  C  CG2   . VAL A 1 17  ? -15.892 17.680 44.244 1.00 13.96 ? 17  VAL A CG2   1 
ATOM   120  N  N     . GLY A 1 18  ? -18.514 16.717 46.089 1.00 13.98 ? 18  GLY A N     1 
ATOM   121  C  CA    . GLY A 1 18  ? -18.600 16.252 47.465 1.00 13.56 ? 18  GLY A CA    1 
ATOM   122  C  C     . GLY A 1 18  ? -17.602 16.835 48.454 1.00 15.77 ? 18  GLY A C     1 
ATOM   123  O  O     . GLY A 1 18  ? -17.333 16.223 49.485 1.00 16.59 ? 18  GLY A O     1 
ATOM   124  N  N     . LYS A 1 19  ? -17.051 18.008 48.156 1.00 15.96 ? 19  LYS A N     1 
ATOM   125  C  CA    . LYS A 1 19  ? -16.087 18.647 49.056 1.00 17.79 ? 19  LYS A CA    1 
ATOM   126  C  C     . LYS A 1 19  ? -16.644 18.847 50.468 1.00 19.75 ? 19  LYS A C     1 
ATOM   127  O  O     . LYS A 1 19  ? -16.014 18.462 51.451 1.00 18.50 ? 19  LYS A O     1 
ATOM   128  C  CB    . LYS A 1 19  ? -15.654 20.004 48.493 1.00 17.13 ? 19  LYS A CB    1 
ATOM   129  C  CG    . LYS A 1 19  ? -15.005 19.932 47.118 1.00 19.53 ? 19  LYS A CG    1 
ATOM   130  C  CD    . LYS A 1 19  ? -14.601 21.312 46.625 1.00 17.97 ? 19  LYS A CD    1 
ATOM   131  C  CE    . LYS A 1 19  ? -15.811 22.224 46.455 1.00 18.85 ? 19  LYS A CE    1 
ATOM   132  N  NZ    . LYS A 1 19  ? -16.748 21.705 45.422 1.00 18.26 ? 19  LYS A NZ    1 
ATOM   133  N  N     . SER A 1 20  ? -17.823 19.455 50.565 1.00 19.14 ? 20  SER A N     1 
ATOM   134  C  CA    . SER A 1 20  ? -18.443 19.703 51.864 1.00 20.67 ? 20  SER A CA    1 
ATOM   135  C  C     . SER A 1 20  ? -18.833 18.428 52.590 1.00 20.99 ? 20  SER A C     1 
ATOM   136  O  O     . SER A 1 20  ? -18.567 18.282 53.781 1.00 22.30 ? 20  SER A O     1 
ATOM   137  C  CB    . SER A 1 20  ? -19.685 20.579 51.701 1.00 19.69 ? 20  SER A CB    1 
ATOM   138  O  OG    . SER A 1 20  ? -19.327 21.858 51.233 1.00 21.60 ? 20  SER A OG    1 
ATOM   139  N  N     . SER A 1 21  ? -19.465 17.510 51.866 1.00 21.21 ? 21  SER A N     1 
ATOM   140  C  CA    . SER A 1 21  ? -19.919 16.245 52.431 1.00 23.13 ? 21  SER A CA    1 
ATOM   141  C  C     . SER A 1 21  ? -18.781 15.379 52.954 1.00 25.06 ? 21  SER A C     1 
ATOM   142  O  O     . SER A 1 21  ? -18.933 14.674 53.959 1.00 22.84 ? 21  SER A O     1 
ATOM   143  C  CB    . SER A 1 21  ? -20.715 15.466 51.379 1.00 25.50 ? 21  SER A CB    1 
ATOM   144  O  OG    . SER A 1 21  ? -21.795 16.250 50.894 1.00 25.31 ? 21  SER A OG    1 
ATOM   145  N  N     . LEU A 1 22  ? -17.645 15.424 52.263 1.00 23.85 ? 22  LEU A N     1 
ATOM   146  C  CA    . LEU A 1 22  ? -16.482 14.639 52.668 1.00 24.36 ? 22  LEU A CA    1 
ATOM   147  C  C     . LEU A 1 22  ? -15.893 15.259 53.934 1.00 23.31 ? 22  LEU A C     1 
ATOM   148  O  O     . LEU A 1 22  ? -15.609 14.570 54.913 1.00 23.93 ? 22  LEU A O     1 
ATOM   149  C  CB    . LEU A 1 22  ? -15.422 14.650 51.562 1.00 25.82 ? 22  LEU A CB    1 
ATOM   150  C  CG    . LEU A 1 22  ? -14.748 13.330 51.176 1.00 28.10 ? 22  LEU A CG    1 
ATOM   151  C  CD1   . LEU A 1 22  ? -13.425 13.646 50.489 1.00 28.88 ? 22  LEU A CD1   1 
ATOM   152  C  CD2   . LEU A 1 22  ? -14.508 12.470 52.395 1.00 28.08 ? 22  LEU A CD2   1 
ATOM   153  N  N     . THR A 1 23  ? -15.711 16.572 53.894 1.00 22.84 ? 23  THR A N     1 
ATOM   154  C  CA    . THR A 1 23  ? -15.160 17.305 55.020 1.00 24.86 ? 23  THR A CA    1 
ATOM   155  C  C     . THR A 1 23  ? -16.045 17.127 56.254 1.00 26.49 ? 23  THR A C     1 
ATOM   156  O  O     . THR A 1 23  ? -15.563 16.768 57.328 1.00 26.80 ? 23  THR A O     1 
ATOM   157  C  CB    . THR A 1 23  ? -15.046 18.803 54.681 1.00 24.95 ? 23  THR A CB    1 
ATOM   158  O  OG1   . THR A 1 23  ? -14.211 18.967 53.526 1.00 24.23 ? 23  THR A OG1   1 
ATOM   159  C  CG2   . THR A 1 23  ? -14.443 19.578 55.846 1.00 24.98 ? 23  THR A CG2   1 
ATOM   160  N  N     . ILE A 1 24  ? -17.344 17.362 56.089 1.00 26.62 ? 24  ILE A N     1 
ATOM   161  C  CA    . ILE A 1 24  ? -18.288 17.239 57.193 1.00 28.29 ? 24  ILE A CA    1 
ATOM   162  C  C     . ILE A 1 24  ? -18.377 15.816 57.735 1.00 29.23 ? 24  ILE A C     1 
ATOM   163  O  O     . ILE A 1 24  ? -18.571 15.624 58.935 1.00 31.25 ? 24  ILE A O     1 
ATOM   164  C  CB    . ILE A 1 24  ? -19.682 17.761 56.779 1.00 28.00 ? 24  ILE A CB    1 
ATOM   165  C  CG1   . ILE A 1 24  ? -19.607 19.282 56.604 1.00 26.61 ? 24  ILE A CG1   1 
ATOM   166  C  CG2   . ILE A 1 24  ? -20.728 17.391 57.831 1.00 29.70 ? 24  ILE A CG2   1 
ATOM   167  C  CD1   . ILE A 1 24  ? -20.873 19.923 56.063 1.00 30.28 ? 24  ILE A CD1   1 
ATOM   168  N  N     . GLN A 1 25  ? -18.221 14.823 56.863 1.00 29.21 ? 25  GLN A N     1 
ATOM   169  C  CA    . GLN A 1 25  ? -18.248 13.427 57.289 1.00 29.07 ? 25  GLN A CA    1 
ATOM   170  C  C     . GLN A 1 25  ? -17.057 13.194 58.214 1.00 30.75 ? 25  GLN A C     1 
ATOM   171  O  O     . GLN A 1 25  ? -17.154 12.468 59.203 1.00 29.30 ? 25  GLN A O     1 
ATOM   172  C  CB    . GLN A 1 25  ? -18.148 12.498 56.078 1.00 29.00 ? 25  GLN A CB    1 
ATOM   173  C  CG    . GLN A 1 25  ? -17.856 11.024 56.399 1.00 30.28 ? 25  GLN A CG    1 
ATOM   174  C  CD    . GLN A 1 25  ? -18.945 10.356 57.223 1.00 32.42 ? 25  GLN A CD    1 
ATOM   175  O  OE1   . GLN A 1 25  ? -18.956 10.447 58.449 1.00 34.20 ? 25  GLN A OE1   1 
ATOM   176  N  NE2   . GLN A 1 25  ? -19.871 9.687  56.548 1.00 29.14 ? 25  GLN A NE2   1 
ATOM   177  N  N     . PHE A 1 26  ? -15.930 13.815 57.879 1.00 30.13 ? 26  PHE A N     1 
ATOM   178  C  CA    . PHE A 1 26  ? -14.722 13.687 58.686 1.00 29.75 ? 26  PHE A CA    1 
ATOM   179  C  C     . PHE A 1 26  ? -14.868 14.460 59.991 1.00 30.74 ? 26  PHE A C     1 
ATOM   180  O  O     . PHE A 1 26  ? -14.704 13.904 61.073 1.00 31.81 ? 26  PHE A O     1 
ATOM   181  C  CB    . PHE A 1 26  ? -13.512 14.223 57.917 1.00 25.96 ? 26  PHE A CB    1 
ATOM   182  C  CG    . PHE A 1 26  ? -12.259 14.330 58.746 1.00 22.72 ? 26  PHE A CG    1 
ATOM   183  C  CD1   . PHE A 1 26  ? -11.765 13.228 59.426 1.00 19.65 ? 26  PHE A CD1   1 
ATOM   184  C  CD2   . PHE A 1 26  ? -11.552 15.529 58.810 1.00 22.54 ? 26  PHE A CD2   1 
ATOM   185  C  CE1   . PHE A 1 26  ? -10.576 13.310 60.161 1.00 21.87 ? 26  PHE A CE1   1 
ATOM   186  C  CE2   . PHE A 1 26  ? -10.361 15.627 59.540 1.00 22.98 ? 26  PHE A CE2   1 
ATOM   187  C  CZ    . PHE A 1 26  ? -9.872  14.513 60.217 1.00 21.58 ? 26  PHE A CZ    1 
ATOM   188  N  N     . VAL A 1 27  ? -15.184 15.746 59.874 1.00 32.25 ? 27  VAL A N     1 
ATOM   189  C  CA    . VAL A 1 27  ? -15.328 16.619 61.031 1.00 32.84 ? 27  VAL A CA    1 
ATOM   190  C  C     . VAL A 1 27  ? -16.392 16.216 62.051 1.00 33.87 ? 27  VAL A C     1 
ATOM   191  O  O     . VAL A 1 27  ? -16.093 16.087 63.238 1.00 32.83 ? 27  VAL A O     1 
ATOM   192  C  CB    . VAL A 1 27  ? -15.612 18.071 60.593 1.00 32.60 ? 27  VAL A CB    1 
ATOM   193  C  CG1   . VAL A 1 27  ? -15.852 18.947 61.814 1.00 33.42 ? 27  VAL A CG1   1 
ATOM   194  C  CG2   . VAL A 1 27  ? -14.437 18.609 59.789 1.00 33.69 ? 27  VAL A CG2   1 
ATOM   195  N  N     . GLU A 1 28  ? -17.624 16.018 61.594 1.00 34.63 ? 28  GLU A N     1 
ATOM   196  C  CA    . GLU A 1 28  ? -18.719 15.673 62.497 1.00 36.00 ? 28  GLU A CA    1 
ATOM   197  C  C     . GLU A 1 28  ? -19.114 14.203 62.469 1.00 36.39 ? 28  GLU A C     1 
ATOM   198  O  O     . GLU A 1 28  ? -20.011 13.788 63.198 1.00 37.01 ? 28  GLU A O     1 
ATOM   199  C  CB    . GLU A 1 28  ? -19.940 16.537 62.178 1.00 35.91 ? 28  GLU A CB    1 
ATOM   200  C  CG    . GLU A 1 28  ? -19.583 17.975 61.836 1.00 37.66 ? 28  GLU A CG    1 
ATOM   201  C  CD    . GLU A 1 28  ? -20.796 18.840 61.562 1.00 39.92 ? 28  GLU A CD    1 
ATOM   202  O  OE1   . GLU A 1 28  ? -21.836 18.290 61.143 1.00 38.72 ? 28  GLU A OE1   1 
ATOM   203  O  OE2   . GLU A 1 28  ? -20.702 20.074 61.752 1.00 41.47 ? 28  GLU A OE2   1 
ATOM   204  N  N     . GLY A 1 29  ? -18.446 13.417 61.632 1.00 37.05 ? 29  GLY A N     1 
ATOM   205  C  CA    . GLY A 1 29  ? -18.750 12.000 61.547 1.00 38.00 ? 29  GLY A CA    1 
ATOM   206  C  C     . GLY A 1 29  ? -20.159 11.695 61.077 1.00 40.26 ? 29  GLY A C     1 
ATOM   207  O  O     . GLY A 1 29  ? -20.703 10.633 61.382 1.00 39.61 ? 29  GLY A O     1 
ATOM   208  N  N     . GLN A 1 30  ? -20.755 12.613 60.324 1.00 42.79 ? 30  GLN A N     1 
ATOM   209  C  CA    . GLN A 1 30  ? -22.111 12.406 59.834 1.00 45.57 ? 30  GLN A CA    1 
ATOM   210  C  C     . GLN A 1 30  ? -22.249 12.758 58.357 1.00 46.58 ? 30  GLN A C     1 
ATOM   211  O  O     . GLN A 1 30  ? -21.598 13.682 57.867 1.00 47.28 ? 30  GLN A O     1 
ATOM   212  C  CB    . GLN A 1 30  ? -23.092 13.257 60.639 1.00 47.48 ? 30  GLN A CB    1 
ATOM   213  C  CG    . GLN A 1 30  ? -24.451 12.612 60.822 1.00 51.67 ? 30  GLN A CG    1 
ATOM   214  C  CD    . GLN A 1 30  ? -24.428 11.504 61.859 1.00 53.50 ? 30  GLN A CD    1 
ATOM   215  O  OE1   . GLN A 1 30  ? -23.604 10.590 61.794 1.00 54.42 ? 30  GLN A OE1   1 
ATOM   216  N  NE2   . GLN A 1 30  ? -25.336 11.582 62.826 1.00 55.73 ? 30  GLN A NE2   1 
ATOM   217  N  N     . PHE A 1 31  ? -23.096 12.017 57.650 1.00 47.13 ? 31  PHE A N     1 
ATOM   218  C  CA    . PHE A 1 31  ? -23.329 12.282 56.235 1.00 48.99 ? 31  PHE A CA    1 
ATOM   219  C  C     . PHE A 1 31  ? -24.522 13.221 56.113 1.00 50.71 ? 31  PHE A C     1 
ATOM   220  O  O     . PHE A 1 31  ? -25.671 12.780 56.108 1.00 50.98 ? 31  PHE A O     1 
ATOM   221  C  CB    . PHE A 1 31  ? -23.621 10.986 55.475 1.00 48.56 ? 31  PHE A CB    1 
ATOM   222  C  CG    . PHE A 1 31  ? -23.960 11.200 54.025 1.00 48.70 ? 31  PHE A CG    1 
ATOM   223  C  CD1   . PHE A 1 31  ? -25.161 10.733 53.501 1.00 48.74 ? 31  PHE A CD1   1 
ATOM   224  C  CD2   . PHE A 1 31  ? -23.085 11.887 53.185 1.00 48.39 ? 31  PHE A CD2   1 
ATOM   225  C  CE1   . PHE A 1 31  ? -25.489 10.947 52.165 1.00 47.90 ? 31  PHE A CE1   1 
ATOM   226  C  CE2   . PHE A 1 31  ? -23.404 12.106 51.846 1.00 48.68 ? 31  PHE A CE2   1 
ATOM   227  C  CZ    . PHE A 1 31  ? -24.608 11.635 51.335 1.00 48.37 ? 31  PHE A CZ    1 
ATOM   228  N  N     . VAL A 1 32  ? -24.246 14.517 56.026 1.00 52.37 ? 32  VAL A N     1 
ATOM   229  C  CA    . VAL A 1 32  ? -25.304 15.509 55.911 1.00 54.81 ? 32  VAL A CA    1 
ATOM   230  C  C     . VAL A 1 32  ? -26.026 15.332 54.580 1.00 56.41 ? 32  VAL A C     1 
ATOM   231  O  O     . VAL A 1 32  ? -25.410 14.987 53.574 1.00 56.07 ? 32  VAL A O     1 
ATOM   232  C  CB    . VAL A 1 32  ? -24.737 16.945 56.001 1.00 54.73 ? 32  VAL A CB    1 
ATOM   233  C  CG1   . VAL A 1 32  ? -23.858 17.241 54.797 1.00 55.14 ? 32  VAL A CG1   1 
ATOM   234  C  CG2   . VAL A 1 32  ? -25.871 17.947 56.097 1.00 55.88 ? 32  VAL A CG2   1 
ATOM   235  N  N     . ASP A 1 33  ? -27.335 15.561 54.582 1.00 59.16 ? 33  ASP A N     1 
ATOM   236  C  CA    . ASP A 1 33  ? -28.132 15.420 53.370 1.00 61.35 ? 33  ASP A CA    1 
ATOM   237  C  C     . ASP A 1 33  ? -28.246 16.738 52.611 1.00 61.41 ? 33  ASP A C     1 
ATOM   238  O  O     . ASP A 1 33  ? -28.191 16.761 51.382 1.00 62.25 ? 33  ASP A O     1 
ATOM   239  C  CB    . ASP A 1 33  ? -29.529 14.900 53.718 1.00 63.88 ? 33  ASP A CB    1 
ATOM   240  C  CG    . ASP A 1 33  ? -30.422 14.767 52.498 1.00 66.16 ? 33  ASP A CG    1 
ATOM   241  O  OD1   . ASP A 1 33  ? -30.764 15.807 51.894 1.00 67.67 ? 33  ASP A OD1   1 
ATOM   242  O  OD2   . ASP A 1 33  ? -30.779 13.624 52.141 1.00 67.26 ? 33  ASP A OD2   1 
ATOM   243  N  N     . SER A 1 34  ? -28.404 17.834 53.345 1.00 61.03 ? 34  SER A N     1 
ATOM   244  C  CA    . SER A 1 34  ? -28.523 19.149 52.729 1.00 60.62 ? 34  SER A CA    1 
ATOM   245  C  C     . SER A 1 34  ? -27.437 20.093 53.229 1.00 60.39 ? 34  SER A C     1 
ATOM   246  O  O     . SER A 1 34  ? -27.078 20.068 54.407 1.00 61.42 ? 34  SER A O     1 
ATOM   247  C  CB    . SER A 1 34  ? -29.896 19.750 53.032 1.00 61.08 ? 34  SER A CB    1 
ATOM   248  O  OG    . SER A 1 34  ? -29.993 21.067 52.521 1.00 61.84 ? 34  SER A OG    1 
ATOM   249  N  N     . TYR A 1 35  ? -26.917 20.928 52.335 1.00 58.53 ? 35  TYR A N     1 
ATOM   250  C  CA    . TYR A 1 35  ? -25.876 21.874 52.711 1.00 56.95 ? 35  TYR A CA    1 
ATOM   251  C  C     . TYR A 1 35  ? -25.698 22.968 51.663 1.00 57.10 ? 35  TYR A C     1 
ATOM   252  O  O     . TYR A 1 35  ? -25.621 22.690 50.465 1.00 56.51 ? 35  TYR A O     1 
ATOM   253  C  CB    . TYR A 1 35  ? -24.547 21.140 52.920 1.00 55.21 ? 35  TYR A CB    1 
ATOM   254  C  CG    . TYR A 1 35  ? -23.467 21.991 53.554 1.00 52.29 ? 35  TYR A CG    1 
ATOM   255  C  CD1   . TYR A 1 35  ? -23.575 22.414 54.879 1.00 51.26 ? 35  TYR A CD1   1 
ATOM   256  C  CD2   . TYR A 1 35  ? -22.346 22.384 52.828 1.00 50.50 ? 35  TYR A CD2   1 
ATOM   257  C  CE1   . TYR A 1 35  ? -22.593 23.208 55.464 1.00 49.10 ? 35  TYR A CE1   1 
ATOM   258  C  CE2   . TYR A 1 35  ? -21.357 23.179 53.403 1.00 49.23 ? 35  TYR A CE2   1 
ATOM   259  C  CZ    . TYR A 1 35  ? -21.488 23.587 54.721 1.00 49.37 ? 35  TYR A CZ    1 
ATOM   260  O  OH    . TYR A 1 35  ? -20.518 24.377 55.294 1.00 48.36 ? 35  TYR A OH    1 
ATOM   261  N  N     . ASP A 1 36  ? -25.639 24.212 52.133 1.00 57.19 ? 36  ASP A N     1 
ATOM   262  C  CA    . ASP A 1 36  ? -25.458 25.385 51.280 1.00 57.33 ? 36  ASP A CA    1 
ATOM   263  C  C     . ASP A 1 36  ? -24.435 25.146 50.164 1.00 57.07 ? 36  ASP A C     1 
ATOM   264  O  O     . ASP A 1 36  ? -23.246 24.945 50.422 1.00 55.70 ? 36  ASP A O     1 
ATOM   265  C  CB    . ASP A 1 36  ? -25.030 26.563 52.147 1.00 59.74 ? 36  ASP A CB    1 
ATOM   266  C  CG    . ASP A 1 36  ? -24.131 26.137 53.287 1.00 61.46 ? 36  ASP A CG    1 
ATOM   267  O  OD1   . ASP A 1 36  ? -23.025 25.630 53.010 1.00 63.87 ? 36  ASP A OD1   1 
ATOM   268  O  OD2   . ASP A 1 36  ? -24.533 26.296 54.460 1.00 62.95 ? 36  ASP A OD2   1 
ATOM   269  N  N     . PRO A 1 37  ? -24.894 25.181 48.904 1.00 56.33 ? 37  PRO A N     1 
ATOM   270  C  CA    . PRO A 1 37  ? -24.106 24.974 47.682 1.00 55.73 ? 37  PRO A CA    1 
ATOM   271  C  C     . PRO A 1 37  ? -22.957 25.938 47.366 1.00 54.74 ? 37  PRO A C     1 
ATOM   272  O  O     . PRO A 1 37  ? -22.115 25.623 46.522 1.00 54.72 ? 37  PRO A O     1 
ATOM   273  C  CB    . PRO A 1 37  ? -25.167 25.009 46.578 1.00 55.95 ? 37  PRO A CB    1 
ATOM   274  C  CG    . PRO A 1 37  ? -26.422 24.580 47.279 1.00 56.65 ? 37  PRO A CG    1 
ATOM   275  C  CD    . PRO A 1 37  ? -26.324 25.328 48.575 1.00 56.68 ? 37  PRO A CD    1 
ATOM   276  N  N     . THR A 1 38  ? -22.896 27.091 48.030 1.00 52.94 ? 38  THR A N     1 
ATOM   277  C  CA    . THR A 1 38  ? -21.851 28.061 47.701 1.00 50.99 ? 38  THR A CA    1 
ATOM   278  C  C     . THR A 1 38  ? -20.888 28.585 48.769 1.00 49.23 ? 38  THR A C     1 
ATOM   279  O  O     . THR A 1 38  ? -19.714 28.804 48.478 1.00 49.18 ? 38  THR A O     1 
ATOM   280  C  CB    . THR A 1 38  ? -22.472 29.299 47.025 1.00 51.74 ? 38  THR A CB    1 
ATOM   281  O  OG1   . THR A 1 38  ? -23.443 29.883 47.903 1.00 51.29 ? 38  THR A OG1   1 
ATOM   282  C  CG2   . THR A 1 38  ? -23.142 28.913 45.713 1.00 52.06 ? 38  THR A CG2   1 
ATOM   283  N  N     . ILE A 1 39  ? -21.370 28.795 49.988 1.00 47.55 ? 39  ILE A N     1 
ATOM   284  C  CA    . ILE A 1 39  ? -20.528 29.346 51.050 1.00 45.56 ? 39  ILE A CA    1 
ATOM   285  C  C     . ILE A 1 39  ? -19.226 28.613 51.357 1.00 44.66 ? 39  ILE A C     1 
ATOM   286  O  O     . ILE A 1 39  ? -19.195 27.389 51.475 1.00 43.85 ? 39  ILE A O     1 
ATOM   287  C  CB    . ILE A 1 39  ? -21.312 29.473 52.377 1.00 46.18 ? 39  ILE A CB    1 
ATOM   288  C  CG1   . ILE A 1 39  ? -20.453 30.184 53.425 1.00 46.37 ? 39  ILE A CG1   1 
ATOM   289  C  CG2   . ILE A 1 39  ? -21.696 28.099 52.883 1.00 45.29 ? 39  ILE A CG2   1 
ATOM   290  C  CD1   . ILE A 1 39  ? -21.131 30.340 54.771 1.00 48.28 ? 39  ILE A CD1   1 
ATOM   291  N  N     . GLU A 1 40  ? -18.152 29.385 51.491 1.00 43.67 ? 40  GLU A N     1 
ATOM   292  C  CA    . GLU A 1 40  ? -16.842 28.841 51.828 1.00 43.88 ? 40  GLU A CA    1 
ATOM   293  C  C     . GLU A 1 40  ? -16.746 28.886 53.350 1.00 42.72 ? 40  GLU A C     1 
ATOM   294  O  O     . GLU A 1 40  ? -16.933 29.940 53.960 1.00 42.54 ? 40  GLU A O     1 
ATOM   295  C  CB    . GLU A 1 40  ? -15.733 29.692 51.204 1.00 45.57 ? 40  GLU A CB    1 
ATOM   296  C  CG    . GLU A 1 40  ? -14.327 29.173 51.474 1.00 50.11 ? 40  GLU A CG    1 
ATOM   297  C  CD    . GLU A 1 40  ? -13.259 29.935 50.704 1.00 52.76 ? 40  GLU A CD    1 
ATOM   298  O  OE1   . GLU A 1 40  ? -13.307 29.933 49.452 1.00 53.83 ? 40  GLU A OE1   1 
ATOM   299  O  OE2   . GLU A 1 40  ? -12.369 30.531 51.350 1.00 54.50 ? 40  GLU A OE2   1 
ATOM   300  N  N     . ASN A 1 41  ? -16.465 27.743 53.963 1.00 40.14 ? 41  ASN A N     1 
ATOM   301  C  CA    . ASN A 1 41  ? -16.378 27.670 55.414 1.00 38.78 ? 41  ASN A CA    1 
ATOM   302  C  C     . ASN A 1 41  ? -15.125 26.933 55.872 1.00 36.92 ? 41  ASN A C     1 
ATOM   303  O  O     . ASN A 1 41  ? -14.630 26.045 55.183 1.00 34.68 ? 41  ASN A O     1 
ATOM   304  C  CB    . ASN A 1 41  ? -17.631 26.975 55.961 1.00 41.47 ? 41  ASN A CB    1 
ATOM   305  C  CG    . ASN A 1 41  ? -17.632 26.866 57.473 1.00 46.05 ? 41  ASN A CG    1 
ATOM   306  O  OD1   . ASN A 1 41  ? -17.490 27.866 58.185 1.00 47.72 ? 41  ASN A OD1   1 
ATOM   307  N  ND2   . ASN A 1 41  ? -17.801 25.646 57.976 1.00 47.31 ? 41  ASN A ND2   1 
ATOM   308  N  N     . THR A 1 42  ? -14.611 27.320 57.035 1.00 35.61 ? 42  THR A N     1 
ATOM   309  C  CA    . THR A 1 42  ? -13.421 26.693 57.596 1.00 34.77 ? 42  THR A CA    1 
ATOM   310  C  C     . THR A 1 42  ? -13.789 25.910 58.849 1.00 34.48 ? 42  THR A C     1 
ATOM   311  O  O     . THR A 1 42  ? -14.143 26.496 59.871 1.00 35.90 ? 42  THR A O     1 
ATOM   312  C  CB    . THR A 1 42  ? -12.359 27.743 57.971 1.00 34.66 ? 42  THR A CB    1 
ATOM   313  O  OG1   . THR A 1 42  ? -11.960 28.459 56.797 1.00 34.42 ? 42  THR A OG1   1 
ATOM   314  C  CG2   . THR A 1 42  ? -11.138 27.074 58.590 1.00 33.57 ? 42  THR A CG2   1 
ATOM   315  N  N     . PHE A 1 43  ? -13.717 24.585 58.760 1.00 32.97 ? 43  PHE A N     1 
ATOM   316  C  CA    . PHE A 1 43  ? -14.032 23.721 59.892 1.00 31.38 ? 43  PHE A CA    1 
ATOM   317  C  C     . PHE A 1 43  ? -12.782 23.515 60.744 1.00 31.49 ? 43  PHE A C     1 
ATOM   318  O  O     . PHE A 1 43  ? -11.657 23.663 60.259 1.00 31.34 ? 43  PHE A O     1 
ATOM   319  C  CB    . PHE A 1 43  ? -14.529 22.349 59.414 1.00 31.81 ? 43  PHE A CB    1 
ATOM   320  C  CG    . PHE A 1 43  ? -15.794 22.397 58.598 1.00 32.75 ? 43  PHE A CG    1 
ATOM   321  C  CD1   . PHE A 1 43  ? -15.800 22.949 57.320 1.00 32.56 ? 43  PHE A CD1   1 
ATOM   322  C  CD2   . PHE A 1 43  ? -16.981 21.872 59.105 1.00 33.06 ? 43  PHE A CD2   1 
ATOM   323  C  CE1   . PHE A 1 43  ? -16.971 22.975 56.557 1.00 32.79 ? 43  PHE A CE1   1 
ATOM   324  C  CE2   . PHE A 1 43  ? -18.156 21.894 58.351 1.00 32.45 ? 43  PHE A CE2   1 
ATOM   325  C  CZ    . PHE A 1 43  ? -18.150 22.447 57.074 1.00 32.10 ? 43  PHE A CZ    1 
ATOM   326  N  N     . THR A 1 44  ? -12.984 23.171 62.012 1.00 31.56 ? 44  THR A N     1 
ATOM   327  C  CA    . THR A 1 44  ? -11.879 22.920 62.932 1.00 31.96 ? 44  THR A CA    1 
ATOM   328  C  C     . THR A 1 44  ? -11.992 21.472 63.392 1.00 31.95 ? 44  THR A C     1 
ATOM   329  O  O     . THR A 1 44  ? -13.084 20.995 63.699 1.00 32.44 ? 44  THR A O     1 
ATOM   330  C  CB    . THR A 1 44  ? -11.945 23.844 64.163 1.00 33.97 ? 44  THR A CB    1 
ATOM   331  O  OG1   . THR A 1 44  ? -13.128 23.555 64.916 1.00 35.98 ? 44  THR A OG1   1 
ATOM   332  C  CG2   . THR A 1 44  ? -11.974 25.298 63.733 1.00 32.90 ? 44  THR A CG2   1 
ATOM   333  N  N     . LYS A 1 45  ? -10.869 20.764 63.435 1.00 30.79 ? 45  LYS A N     1 
ATOM   334  C  CA    . LYS A 1 45  ? -10.903 19.366 63.840 1.00 29.72 ? 45  LYS A CA    1 
ATOM   335  C  C     . LYS A 1 45  ? -9.663  18.934 64.605 1.00 30.18 ? 45  LYS A C     1 
ATOM   336  O  O     . LYS A 1 45  ? -8.543  19.302 64.254 1.00 29.67 ? 45  LYS A O     1 
ATOM   337  C  CB    . LYS A 1 45  ? -11.071 18.478 62.605 1.00 28.06 ? 45  LYS A CB    1 
ATOM   338  C  CG    . LYS A 1 45  ? -11.105 16.991 62.901 1.00 27.51 ? 45  LYS A CG    1 
ATOM   339  C  CD    . LYS A 1 45  ? -12.368 16.587 63.643 1.00 26.14 ? 45  LYS A CD    1 
ATOM   340  C  CE    . LYS A 1 45  ? -12.445 15.075 63.773 1.00 25.71 ? 45  LYS A CE    1 
ATOM   341  N  NZ    . LYS A 1 45  ? -13.696 14.630 64.454 1.00 27.21 ? 45  LYS A NZ    1 
ATOM   342  N  N     . LEU A 1 46  ? -9.877  18.142 65.650 1.00 30.54 ? 46  LEU A N     1 
ATOM   343  C  CA    . LEU A 1 46  ? -8.790  17.631 66.471 1.00 33.05 ? 46  LEU A CA    1 
ATOM   344  C  C     . LEU A 1 46  ? -8.634  16.140 66.199 1.00 33.63 ? 46  LEU A C     1 
ATOM   345  O  O     . LEU A 1 46  ? -9.584  15.373 66.346 1.00 32.83 ? 46  LEU A O     1 
ATOM   346  C  CB    . LEU A 1 46  ? -9.095  17.861 67.958 1.00 33.27 ? 46  LEU A CB    1 
ATOM   347  C  CG    . LEU A 1 46  ? -8.139  17.324 69.036 1.00 35.84 ? 46  LEU A CG    1 
ATOM   348  C  CD1   . LEU A 1 46  ? -8.271  15.813 69.170 1.00 37.66 ? 46  LEU A CD1   1 
ATOM   349  C  CD2   . LEU A 1 46  ? -6.711  17.718 68.695 1.00 35.52 ? 46  LEU A CD2   1 
ATOM   350  N  N     . ILE A 1 47  ? -7.439  15.731 65.791 1.00 33.62 ? 47  ILE A N     1 
ATOM   351  C  CA    . ILE A 1 47  ? -7.187  14.327 65.525 1.00 34.76 ? 47  ILE A CA    1 
ATOM   352  C  C     . ILE A 1 47  ? -5.771  13.957 65.920 1.00 36.25 ? 47  ILE A C     1 
ATOM   353  O  O     . ILE A 1 47  ? -4.842  14.742 65.747 1.00 36.05 ? 47  ILE A O     1 
ATOM   354  C  CB    . ILE A 1 47  ? -7.385  13.980 64.036 1.00 33.48 ? 47  ILE A CB    1 
ATOM   355  C  CG1   . ILE A 1 47  ? -6.354  14.718 63.184 1.00 32.12 ? 47  ILE A CG1   1 
ATOM   356  C  CG2   . ILE A 1 47  ? -8.797  14.343 63.601 1.00 34.82 ? 47  ILE A CG2   1 
ATOM   357  C  CD1   . ILE A 1 47  ? -6.303  14.234 61.760 1.00 35.04 ? 47  ILE A CD1   1 
ATOM   358  N  N     . THR A 1 48  ? -5.615  12.757 66.461 1.00 38.54 ? 48  THR A N     1 
ATOM   359  C  CA    . THR A 1 48  ? -4.305  12.276 66.871 1.00 41.56 ? 48  THR A CA    1 
ATOM   360  C  C     . THR A 1 48  ? -3.831  11.210 65.885 1.00 42.68 ? 48  THR A C     1 
ATOM   361  O  O     . THR A 1 48  ? -4.439  10.145 65.765 1.00 44.92 ? 48  THR A O     1 
ATOM   362  C  CB    . THR A 1 48  ? -4.354  11.695 68.302 1.00 41.45 ? 48  THR A CB    1 
ATOM   363  O  OG1   . THR A 1 48  ? -3.107  11.059 68.605 1.00 42.58 ? 48  THR A OG1   1 
ATOM   364  C  CG2   . THR A 1 48  ? -5.487  10.693 68.438 1.00 44.27 ? 48  THR A CG2   1 
ATOM   365  N  N     . VAL A 1 49  ? -2.751  11.512 65.169 1.00 42.65 ? 49  VAL A N     1 
ATOM   366  C  CA    . VAL A 1 49  ? -2.193  10.592 64.183 1.00 43.47 ? 49  VAL A CA    1 
ATOM   367  C  C     . VAL A 1 49  ? -0.756  10.201 64.534 1.00 44.42 ? 49  VAL A C     1 
ATOM   368  O  O     . VAL A 1 49  ? 0.121   11.059 64.651 1.00 44.10 ? 49  VAL A O     1 
ATOM   369  C  CB    . VAL A 1 49  ? -2.202  11.221 62.777 1.00 43.38 ? 49  VAL A CB    1 
ATOM   370  C  CG1   . VAL A 1 49  ? -1.766  10.194 61.749 1.00 43.60 ? 49  VAL A CG1   1 
ATOM   371  C  CG2   . VAL A 1 49  ? -3.592  11.754 62.453 1.00 42.69 ? 49  VAL A CG2   1 
ATOM   372  N  N     . ASN A 1 50  ? -0.524  8.901  64.691 1.00 45.25 ? 50  ASN A N     1 
ATOM   373  C  CA    . ASN A 1 50  ? 0.797   8.380  65.038 1.00 46.18 ? 50  ASN A CA    1 
ATOM   374  C  C     . ASN A 1 50  ? 1.232   8.878  66.412 1.00 45.47 ? 50  ASN A C     1 
ATOM   375  O  O     . ASN A 1 50  ? 2.409   9.165  66.629 1.00 45.83 ? 50  ASN A O     1 
ATOM   376  C  CB    . ASN A 1 50  ? 1.851   8.800  64.003 1.00 47.83 ? 50  ASN A CB    1 
ATOM   377  C  CG    . ASN A 1 50  ? 1.483   8.398  62.585 1.00 49.79 ? 50  ASN A CG    1 
ATOM   378  O  OD1   . ASN A 1 50  ? 0.944   7.314  62.349 1.00 51.35 ? 50  ASN A OD1   1 
ATOM   379  N  ND2   . ASN A 1 50  ? 1.793   9.266  61.628 1.00 49.54 ? 50  ASN A ND2   1 
ATOM   380  N  N     . GLY A 1 51  ? 0.282   8.980  67.336 1.00 45.40 ? 51  GLY A N     1 
ATOM   381  C  CA    . GLY A 1 51  ? 0.599   9.452  68.672 1.00 44.43 ? 51  GLY A CA    1 
ATOM   382  C  C     . GLY A 1 51  ? 0.820   10.954 68.714 1.00 44.11 ? 51  GLY A C     1 
ATOM   383  O  O     . GLY A 1 51  ? 1.048   11.526 69.782 1.00 45.41 ? 51  GLY A O     1 
ATOM   384  N  N     . GLN A 1 52  ? 0.754   11.591 67.547 1.00 42.55 ? 52  GLN A N     1 
ATOM   385  C  CA    . GLN A 1 52  ? 0.940   13.036 67.424 1.00 39.51 ? 52  GLN A CA    1 
ATOM   386  C  C     . GLN A 1 52  ? -0.416  13.725 67.290 1.00 38.19 ? 52  GLN A C     1 
ATOM   387  O  O     . GLN A 1 52  ? -1.215  13.370 66.419 1.00 37.59 ? 52  GLN A O     1 
ATOM   388  C  CB    . GLN A 1 52  ? 1.802   13.346 66.196 1.00 40.04 ? 52  GLN A CB    1 
ATOM   389  C  CG    . GLN A 1 52  ? 1.951   14.827 65.870 1.00 42.07 ? 52  GLN A CG    1 
ATOM   390  C  CD    . GLN A 1 52  ? 2.663   15.614 66.960 1.00 42.48 ? 52  GLN A CD    1 
ATOM   391  O  OE1   . GLN A 1 52  ? 3.815   15.336 67.291 1.00 43.58 ? 52  GLN A OE1   1 
ATOM   392  N  NE2   . GLN A 1 52  ? 1.978   16.604 67.518 1.00 42.31 ? 52  GLN A NE2   1 
ATOM   393  N  N     . GLU A 1 53  ? -0.673  14.710 68.147 1.00 33.92 ? 53  GLU A N     1 
ATOM   394  C  CA    . GLU A 1 53  ? -1.943  15.430 68.111 1.00 31.58 ? 53  GLU A CA    1 
ATOM   395  C  C     . GLU A 1 53  ? -1.916  16.575 67.100 1.00 29.05 ? 53  GLU A C     1 
ATOM   396  O  O     . GLU A 1 53  ? -0.933  17.310 67.005 1.00 26.57 ? 53  GLU A O     1 
ATOM   397  C  CB    . GLU A 1 53  ? -2.279  15.965 69.502 1.00 33.91 ? 53  GLU A CB    1 
ATOM   398  C  CG    . GLU A 1 53  ? -3.644  16.622 69.596 1.00 37.97 ? 53  GLU A CG    1 
ATOM   399  C  CD    . GLU A 1 53  ? -4.047  16.917 71.027 1.00 39.77 ? 53  GLU A CD    1 
ATOM   400  O  OE1   . GLU A 1 53  ? -4.082  15.967 71.838 1.00 42.15 ? 53  GLU A OE1   1 
ATOM   401  O  OE2   . GLU A 1 53  ? -4.333  18.092 71.342 1.00 40.92 ? 53  GLU A OE2   1 
ATOM   402  N  N     . TYR A 1 54  ? -3.002  16.719 66.347 1.00 25.75 ? 54  TYR A N     1 
ATOM   403  C  CA    . TYR A 1 54  ? -3.100  17.764 65.333 1.00 24.89 ? 54  TYR A CA    1 
ATOM   404  C  C     . TYR A 1 54  ? -4.323  18.656 65.503 1.00 25.10 ? 54  TYR A C     1 
ATOM   405  O  O     . TYR A 1 54  ? -5.407  18.172 65.834 1.00 23.65 ? 54  TYR A O     1 
ATOM   406  C  CB    . TYR A 1 54  ? -3.155  17.136 63.937 1.00 25.24 ? 54  TYR A CB    1 
ATOM   407  C  CG    . TYR A 1 54  ? -1.856  16.534 63.459 1.00 24.88 ? 54  TYR A CG    1 
ATOM   408  C  CD1   . TYR A 1 54  ? -0.887  17.319 62.840 1.00 23.90 ? 54  TYR A CD1   1 
ATOM   409  C  CD2   . TYR A 1 54  ? -1.603  15.172 63.616 1.00 25.90 ? 54  TYR A CD2   1 
ATOM   410  C  CE1   . TYR A 1 54  ? 0.305   16.762 62.382 1.00 26.64 ? 54  TYR A CE1   1 
ATOM   411  C  CE2   . TYR A 1 54  ? -0.415  14.602 63.167 1.00 25.70 ? 54  TYR A CE2   1 
ATOM   412  C  CZ    . TYR A 1 54  ? 0.532   15.400 62.550 1.00 27.97 ? 54  TYR A CZ    1 
ATOM   413  O  OH    . TYR A 1 54  ? 1.700   14.834 62.097 1.00 29.48 ? 54  TYR A OH    1 
ATOM   414  N  N     . HIS A 1 55  ? -4.126  19.957 65.277 1.00 25.60 ? 55  HIS A N     1 
ATOM   415  C  CA    . HIS A 1 55  ? -5.195  20.956 65.331 1.00 27.12 ? 55  HIS A CA    1 
ATOM   416  C  C     . HIS A 1 55  ? -5.395  21.372 63.871 1.00 26.61 ? 55  HIS A C     1 
ATOM   417  O  O     . HIS A 1 55  ? -4.603  22.150 63.325 1.00 25.20 ? 55  HIS A O     1 
ATOM   418  C  CB    . HIS A 1 55  ? -4.784  22.192 66.147 1.00 30.63 ? 55  HIS A CB    1 
ATOM   419  C  CG    . HIS A 1 55  ? -4.633  21.938 67.616 1.00 32.90 ? 55  HIS A CG    1 
ATOM   420  N  ND1   . HIS A 1 55  ? -5.524  21.172 68.336 1.00 34.29 ? 55  HIS A ND1   1 
ATOM   421  C  CD2   . HIS A 1 55  ? -3.715  22.382 68.507 1.00 34.61 ? 55  HIS A CD2   1 
ATOM   422  C  CE1   . HIS A 1 55  ? -5.161  21.152 69.606 1.00 34.37 ? 55  HIS A CE1   1 
ATOM   423  N  NE2   . HIS A 1 55  ? -4.067  21.880 69.736 1.00 35.63 ? 55  HIS A NE2   1 
ATOM   424  N  N     . LEU A 1 56  ? -6.450  20.859 63.245 1.00 25.30 ? 56  LEU A N     1 
ATOM   425  C  CA    . LEU A 1 56  ? -6.708  21.142 61.838 1.00 25.12 ? 56  LEU A CA    1 
ATOM   426  C  C     . LEU A 1 56  ? -7.741  22.214 61.514 1.00 25.48 ? 56  LEU A C     1 
ATOM   427  O  O     . LEU A 1 56  ? -8.797  22.307 62.141 1.00 26.89 ? 56  LEU A O     1 
ATOM   428  C  CB    . LEU A 1 56  ? -7.136  19.859 61.120 1.00 24.05 ? 56  LEU A CB    1 
ATOM   429  C  CG    . LEU A 1 56  ? -6.295  18.595 61.325 1.00 23.46 ? 56  LEU A CG    1 
ATOM   430  C  CD1   . LEU A 1 56  ? -6.947  17.434 60.593 1.00 25.60 ? 56  LEU A CD1   1 
ATOM   431  C  CD2   . LEU A 1 56  ? -4.886  18.821 60.825 1.00 23.20 ? 56  LEU A CD2   1 
ATOM   432  N  N     . GLN A 1 57  ? -7.410  23.019 60.513 1.00 25.28 ? 57  GLN A N     1 
ATOM   433  C  CA    . GLN A 1 57  ? -8.306  24.046 60.003 1.00 25.51 ? 57  GLN A CA    1 
ATOM   434  C  C     . GLN A 1 57  ? -8.552  23.572 58.570 1.00 24.39 ? 57  GLN A C     1 
ATOM   435  O  O     . GLN A 1 57  ? -7.642  23.578 57.737 1.00 24.02 ? 57  GLN A O     1 
ATOM   436  C  CB    . GLN A 1 57  ? -7.633  25.419 60.012 1.00 27.87 ? 57  GLN A CB    1 
ATOM   437  C  CG    . GLN A 1 57  ? -7.527  26.038 61.400 1.00 33.20 ? 57  GLN A CG    1 
ATOM   438  C  CD    . GLN A 1 57  ? -8.889  26.323 62.019 1.00 37.32 ? 57  GLN A CD    1 
ATOM   439  O  OE1   . GLN A 1 57  ? -9.640  27.178 61.541 1.00 38.83 ? 57  GLN A OE1   1 
ATOM   440  N  NE2   . GLN A 1 57  ? -9.215  25.602 63.086 1.00 38.56 ? 57  GLN A NE2   1 
ATOM   441  N  N     . LEU A 1 58  ? -9.776  23.134 58.303 1.00 22.74 ? 58  LEU A N     1 
ATOM   442  C  CA    . LEU A 1 58  ? -10.152 22.622 56.991 1.00 21.40 ? 58  LEU A CA    1 
ATOM   443  C  C     . LEU A 1 58  ? -10.941 23.662 56.195 1.00 21.25 ? 58  LEU A C     1 
ATOM   444  O  O     . LEU A 1 58  ? -12.094 23.958 56.511 1.00 21.70 ? 58  LEU A O     1 
ATOM   445  C  CB    . LEU A 1 58  ? -10.984 21.351 57.180 1.00 20.25 ? 58  LEU A CB    1 
ATOM   446  C  CG    . LEU A 1 58  ? -10.385 20.349 58.178 1.00 21.46 ? 58  LEU A CG    1 
ATOM   447  C  CD1   . LEU A 1 58  ? -11.355 19.203 58.399 1.00 20.33 ? 58  LEU A CD1   1 
ATOM   448  C  CD2   . LEU A 1 58  ? -9.045  19.828 57.662 1.00 20.23 ? 58  LEU A CD2   1 
ATOM   449  N  N     . VAL A 1 59  ? -10.313 24.217 55.163 1.00 21.95 ? 59  VAL A N     1 
ATOM   450  C  CA    . VAL A 1 59  ? -10.960 25.225 54.341 1.00 21.48 ? 59  VAL A CA    1 
ATOM   451  C  C     . VAL A 1 59  ? -11.767 24.586 53.208 1.00 22.54 ? 59  VAL A C     1 
ATOM   452  O  O     . VAL A 1 59  ? -11.220 24.194 52.176 1.00 22.51 ? 59  VAL A O     1 
ATOM   453  C  CB    . VAL A 1 59  ? -9.915  26.191 53.759 1.00 22.33 ? 59  VAL A CB    1 
ATOM   454  C  CG1   . VAL A 1 59  ? -10.601 27.370 53.087 1.00 21.35 ? 59  VAL A CG1   1 
ATOM   455  C  CG2   . VAL A 1 59  ? -8.994  26.672 54.872 1.00 24.16 ? 59  VAL A CG2   1 
ATOM   456  N  N     . ASP A 1 60  ? -13.072 24.466 53.421 1.00 22.56 ? 60  ASP A N     1 
ATOM   457  C  CA    . ASP A 1 60  ? -13.971 23.889 52.432 1.00 23.57 ? 60  ASP A CA    1 
ATOM   458  C  C     . ASP A 1 60  ? -14.378 25.011 51.477 1.00 26.21 ? 60  ASP A C     1 
ATOM   459  O  O     . ASP A 1 60  ? -15.335 25.744 51.730 1.00 27.31 ? 60  ASP A O     1 
ATOM   460  C  CB    . ASP A 1 60  ? -15.191 23.296 53.140 1.00 23.43 ? 60  ASP A CB    1 
ATOM   461  C  CG    . ASP A 1 60  ? -16.285 22.888 52.181 1.00 25.09 ? 60  ASP A CG    1 
ATOM   462  O  OD1   . ASP A 1 60  ? -15.966 22.309 51.122 1.00 24.82 ? 60  ASP A OD1   1 
ATOM   463  O  OD2   . ASP A 1 60  ? -17.469 23.138 52.495 1.00 25.14 ? 60  ASP A OD2   1 
ATOM   464  N  N     . THR A 1 61  ? -13.636 25.137 50.379 1.00 25.76 ? 61  THR A N     1 
ATOM   465  C  CA    . THR A 1 61  ? -13.875 26.182 49.393 1.00 26.34 ? 61  THR A CA    1 
ATOM   466  C  C     . THR A 1 61  ? -15.199 26.068 48.653 1.00 27.82 ? 61  THR A C     1 
ATOM   467  O  O     . THR A 1 61  ? -15.850 25.024 48.660 1.00 26.54 ? 61  THR A O     1 
ATOM   468  C  CB    . THR A 1 61  ? -12.737 26.236 48.350 1.00 27.40 ? 61  THR A CB    1 
ATOM   469  O  OG1   . THR A 1 61  ? -12.710 25.013 47.602 1.00 26.08 ? 61  THR A OG1   1 
ATOM   470  C  CG2   . THR A 1 61  ? -11.395 26.439 49.041 1.00 27.77 ? 61  THR A CG2   1 
ATOM   471  N  N     . ALA A 1 62  ? -15.576 27.166 48.006 1.00 29.20 ? 62  ALA A N     1 
ATOM   472  C  CA    . ALA A 1 62  ? -16.819 27.253 47.254 1.00 30.37 ? 62  ALA A CA    1 
ATOM   473  C  C     . ALA A 1 62  ? -16.721 26.473 45.955 1.00 31.34 ? 62  ALA A C     1 
ATOM   474  O  O     . ALA A 1 62  ? -17.701 26.347 45.221 1.00 32.16 ? 62  ALA A O     1 
ATOM   475  C  CB    . ALA A 1 62  ? -17.138 28.710 46.958 1.00 31.23 ? 62  ALA A CB    1 
ATOM   476  N  N     . GLY A 1 63  ? -15.533 25.951 45.675 1.00 31.86 ? 63  GLY A N     1 
ATOM   477  C  CA    . GLY A 1 63  ? -15.336 25.187 44.459 1.00 31.34 ? 63  GLY A CA    1 
ATOM   478  C  C     . GLY A 1 63  ? -14.891 26.088 43.329 1.00 31.08 ? 63  GLY A C     1 
ATOM   479  O  O     . GLY A 1 63  ? -15.054 27.306 43.395 1.00 31.71 ? 63  GLY A O     1 
ATOM   480  N  N     . GLN A 1 64  ? -14.317 25.499 42.288 1.00 29.07 ? 64  GLN A N     1 
ATOM   481  C  CA    . GLN A 1 64  ? -13.861 26.294 41.163 1.00 27.17 ? 64  GLN A CA    1 
ATOM   482  C  C     . GLN A 1 64  ? -13.906 25.537 39.838 1.00 26.65 ? 64  GLN A C     1 
ATOM   483  O  O     . GLN A 1 64  ? -14.257 24.359 39.800 1.00 24.56 ? 64  GLN A O     1 
ATOM   484  C  CB    . GLN A 1 64  ? -12.450 26.834 41.447 1.00 29.13 ? 64  GLN A CB    1 
ATOM   485  C  CG    . GLN A 1 64  ? -11.438 25.853 42.042 1.00 26.72 ? 64  GLN A CG    1 
ATOM   486  C  CD    . GLN A 1 64  ? -11.735 25.429 43.480 1.00 28.93 ? 64  GLN A CD    1 
ATOM   487  O  OE1   . GLN A 1 64  ? -11.980 26.261 44.361 1.00 30.31 ? 64  GLN A OE1   1 
ATOM   488  N  NE2   . GLN A 1 64  ? -11.694 24.124 43.725 1.00 24.51 ? 64  GLN A NE2   1 
ATOM   489  N  N     . ASP A 1 65  ? -13.579 26.228 38.749 1.00 26.03 ? 65  ASP A N     1 
ATOM   490  C  CA    . ASP A 1 65  ? -13.580 25.617 37.422 1.00 26.88 ? 65  ASP A CA    1 
ATOM   491  C  C     . ASP A 1 65  ? -12.461 26.177 36.547 1.00 27.14 ? 65  ASP A C     1 
ATOM   492  O  O     . ASP A 1 65  ? -11.572 26.881 37.034 1.00 26.22 ? 65  ASP A O     1 
ATOM   493  C  CB    . ASP A 1 65  ? -14.936 25.824 36.730 1.00 26.03 ? 65  ASP A CB    1 
ATOM   494  C  CG    . ASP A 1 65  ? -15.341 27.290 36.646 1.00 27.72 ? 65  ASP A CG    1 
ATOM   495  O  OD1   . ASP A 1 65  ? -14.463 28.145 36.396 1.00 23.26 ? 65  ASP A OD1   1 
ATOM   496  O  OD2   . ASP A 1 65  ? -16.545 27.585 36.814 1.00 29.09 ? 65  ASP A OD2   1 
ATOM   497  N  N     . GLU A 1 66  ? -12.516 25.869 35.255 1.00 27.56 ? 66  GLU A N     1 
ATOM   498  C  CA    . GLU A 1 66  ? -11.505 26.327 34.309 1.00 30.64 ? 66  GLU A CA    1 
ATOM   499  C  C     . GLU A 1 66  ? -11.378 27.846 34.252 1.00 31.93 ? 66  GLU A C     1 
ATOM   500  O  O     . GLU A 1 66  ? -10.348 28.366 33.836 1.00 33.57 ? 66  GLU A O     1 
ATOM   501  C  CB    . GLU A 1 66  ? -11.820 25.837 32.889 1.00 31.41 ? 66  GLU A CB    1 
ATOM   502  C  CG    . GLU A 1 66  ? -12.124 24.355 32.730 1.00 31.54 ? 66  GLU A CG    1 
ATOM   503  C  CD    . GLU A 1 66  ? -13.596 24.025 32.909 1.00 32.62 ? 66  GLU A CD    1 
ATOM   504  O  OE1   . GLU A 1 66  ? -14.065 23.059 32.272 1.00 35.36 ? 66  GLU A OE1   1 
ATOM   505  O  OE2   . GLU A 1 66  ? -14.288 24.715 33.686 1.00 32.71 ? 66  GLU A OE2   1 
ATOM   506  N  N     . TYR A 1 67  ? -12.420 28.560 34.661 1.00 33.73 ? 67  TYR A N     1 
ATOM   507  C  CA    . TYR A 1 67  ? -12.396 30.019 34.590 1.00 37.02 ? 67  TYR A CA    1 
ATOM   508  C  C     . TYR A 1 67  ? -12.250 30.736 35.926 1.00 39.13 ? 67  TYR A C     1 
ATOM   509  O  O     . TYR A 1 67  ? -12.247 31.966 35.977 1.00 40.75 ? 67  TYR A O     1 
ATOM   510  C  CB    . TYR A 1 67  ? -13.657 30.510 33.882 1.00 35.77 ? 67  TYR A CB    1 
ATOM   511  C  CG    . TYR A 1 67  ? -14.007 29.690 32.662 1.00 36.27 ? 67  TYR A CG    1 
ATOM   512  C  CD1   . TYR A 1 67  ? -14.575 28.422 32.793 1.00 36.51 ? 67  TYR A CD1   1 
ATOM   513  C  CD2   . TYR A 1 67  ? -13.753 30.167 31.379 1.00 35.97 ? 67  TYR A CD2   1 
ATOM   514  C  CE1   . TYR A 1 67  ? -14.880 27.651 31.680 1.00 36.49 ? 67  TYR A CE1   1 
ATOM   515  C  CE2   . TYR A 1 67  ? -14.054 29.399 30.254 1.00 35.92 ? 67  TYR A CE2   1 
ATOM   516  C  CZ    . TYR A 1 67  ? -14.618 28.144 30.414 1.00 36.25 ? 67  TYR A CZ    1 
ATOM   517  O  OH    . TYR A 1 67  ? -14.929 27.375 29.317 1.00 35.79 ? 67  TYR A OH    1 
ATOM   518  N  N     . SER A 1 68  ? -12.118 29.971 37.001 1.00 40.52 ? 68  SER A N     1 
ATOM   519  C  CA    . SER A 1 68  ? -11.973 30.549 38.330 1.00 42.50 ? 68  SER A CA    1 
ATOM   520  C  C     . SER A 1 68  ? -10.647 31.277 38.511 1.00 44.17 ? 68  SER A C     1 
ATOM   521  O  O     . SER A 1 68  ? -9.631  30.900 37.927 1.00 44.21 ? 68  SER A O     1 
ATOM   522  C  CB    . SER A 1 68  ? -12.093 29.456 39.393 1.00 41.44 ? 68  SER A CB    1 
ATOM   523  O  OG    . SER A 1 68  ? -13.347 28.806 39.311 1.00 41.33 ? 68  SER A OG    1 
ATOM   524  N  N     . ILE A 1 69  ? -10.672 32.327 39.322 1.00 46.55 ? 69  ILE A N     1 
ATOM   525  C  CA    . ILE A 1 69  ? -9.476  33.104 39.621 1.00 48.76 ? 69  ILE A CA    1 
ATOM   526  C  C     . ILE A 1 69  ? -9.191  32.877 41.102 1.00 49.85 ? 69  ILE A C     1 
ATOM   527  O  O     . ILE A 1 69  ? -9.777  33.534 41.962 1.00 51.14 ? 69  ILE A O     1 
ATOM   528  C  CB    . ILE A 1 69  ? -9.701  34.613 39.378 1.00 49.04 ? 69  ILE A CB    1 
ATOM   529  C  CG1   . ILE A 1 69  ? -10.273 34.839 37.977 1.00 48.44 ? 69  ILE A CG1   1 
ATOM   530  C  CG2   . ILE A 1 69  ? -8.385  35.360 39.532 1.00 47.87 ? 69  ILE A CG2   1 
ATOM   531  C  CD1   . ILE A 1 69  ? -10.557 36.291 37.657 1.00 48.28 ? 69  ILE A CD1   1 
ATOM   532  N  N     . PHE A 1 70  ? -8.295  31.939 41.391 1.00 51.03 ? 70  PHE A N     1 
ATOM   533  C  CA    . PHE A 1 70  ? -7.951  31.590 42.766 1.00 52.03 ? 70  PHE A CA    1 
ATOM   534  C  C     . PHE A 1 70  ? -7.846  32.750 43.743 1.00 52.96 ? 70  PHE A C     1 
ATOM   535  O  O     . PHE A 1 70  ? -7.036  33.659 43.561 1.00 53.22 ? 70  PHE A O     1 
ATOM   536  C  CB    . PHE A 1 70  ? -6.640  30.798 42.809 1.00 52.11 ? 70  PHE A CB    1 
ATOM   537  C  CG    . PHE A 1 70  ? -6.762  29.384 42.317 1.00 51.97 ? 70  PHE A CG    1 
ATOM   538  C  CD1   . PHE A 1 70  ? -5.784  28.448 42.626 1.00 51.70 ? 70  PHE A CD1   1 
ATOM   539  C  CD2   . PHE A 1 70  ? -7.850  28.986 41.544 1.00 51.81 ? 70  PHE A CD2   1 
ATOM   540  C  CE1   . PHE A 1 70  ? -5.883  27.136 42.177 1.00 52.69 ? 70  PHE A CE1   1 
ATOM   541  C  CE2   . PHE A 1 70  ? -7.959  27.677 41.089 1.00 52.60 ? 70  PHE A CE2   1 
ATOM   542  C  CZ    . PHE A 1 70  ? -6.974  26.749 41.406 1.00 52.84 ? 70  PHE A CZ    1 
ATOM   543  N  N     . PRO A 1 71  ? -8.677  32.735 44.796 1.00 53.48 ? 71  PRO A N     1 
ATOM   544  C  CA    . PRO A 1 71  ? -8.649  33.798 45.802 1.00 53.70 ? 71  PRO A CA    1 
ATOM   545  C  C     . PRO A 1 71  ? -7.347  33.659 46.587 1.00 53.90 ? 71  PRO A C     1 
ATOM   546  O  O     . PRO A 1 71  ? -6.759  32.576 46.632 1.00 52.57 ? 71  PRO A O     1 
ATOM   547  C  CB    . PRO A 1 71  ? -9.870  33.490 46.668 1.00 53.78 ? 71  PRO A CB    1 
ATOM   548  C  CG    . PRO A 1 71  ? -10.794 32.793 45.725 1.00 53.53 ? 71  PRO A CG    1 
ATOM   549  C  CD    . PRO A 1 71  ? -9.855  31.875 44.989 1.00 53.55 ? 71  PRO A CD    1 
ATOM   550  N  N     . GLN A 1 72  ? -6.903  34.748 47.201 1.00 53.52 ? 72  GLN A N     1 
ATOM   551  C  CA    . GLN A 1 72  ? -5.672  34.724 47.976 1.00 54.08 ? 72  GLN A CA    1 
ATOM   552  C  C     . GLN A 1 72  ? -5.782  33.662 49.075 1.00 52.65 ? 72  GLN A C     1 
ATOM   553  O  O     . GLN A 1 72  ? -4.804  32.991 49.408 1.00 52.55 ? 72  GLN A O     1 
ATOM   554  C  CB    . GLN A 1 72  ? -5.424  36.099 48.604 1.00 56.92 ? 72  GLN A CB    1 
ATOM   555  C  CG    . GLN A 1 72  ? -5.746  37.274 47.686 1.00 60.86 ? 72  GLN A CG    1 
ATOM   556  C  CD    . GLN A 1 72  ? -4.892  37.304 46.427 1.00 63.32 ? 72  GLN A CD    1 
ATOM   557  O  OE1   . GLN A 1 72  ? -3.673  37.472 46.491 1.00 64.88 ? 72  GLN A OE1   1 
ATOM   558  N  NE2   . GLN A 1 72  ? -5.534  37.144 45.273 1.00 63.95 ? 72  GLN A NE2   1 
ATOM   559  N  N     . THR A 1 73  ? -6.984  33.511 49.623 1.00 50.43 ? 73  THR A N     1 
ATOM   560  C  CA    . THR A 1 73  ? -7.241  32.548 50.689 1.00 48.58 ? 73  THR A CA    1 
ATOM   561  C  C     . THR A 1 73  ? -6.900  31.105 50.323 1.00 47.54 ? 73  THR A C     1 
ATOM   562  O  O     . THR A 1 73  ? -6.869  30.231 51.191 1.00 47.68 ? 73  THR A O     1 
ATOM   563  C  CB    . THR A 1 73  ? -8.719  32.598 51.137 1.00 48.75 ? 73  THR A CB    1 
ATOM   564  O  OG1   . THR A 1 73  ? -9.573  32.432 49.998 1.00 48.38 ? 73  THR A OG1   1 
ATOM   565  C  CG2   . THR A 1 73  ? -9.026  33.927 51.807 1.00 48.24 ? 73  THR A CG2   1 
ATOM   566  N  N     . TYR A 1 74  ? -6.651  30.851 49.042 1.00 45.86 ? 74  TYR A N     1 
ATOM   567  C  CA    . TYR A 1 74  ? -6.313  29.505 48.590 1.00 43.74 ? 74  TYR A CA    1 
ATOM   568  C  C     . TYR A 1 74  ? -4.817  29.232 48.709 1.00 42.43 ? 74  TYR A C     1 
ATOM   569  O  O     . TYR A 1 74  ? -4.392  28.078 48.701 1.00 42.59 ? 74  TYR A O     1 
ATOM   570  C  CB    . TYR A 1 74  ? -6.732  29.302 47.128 1.00 42.72 ? 74  TYR A CB    1 
ATOM   571  C  CG    . TYR A 1 74  ? -8.220  29.152 46.880 1.00 41.63 ? 74  TYR A CG    1 
ATOM   572  C  CD1   . TYR A 1 74  ? -9.163  29.624 47.796 1.00 41.87 ? 74  TYR A CD1   1 
ATOM   573  C  CD2   . TYR A 1 74  ? -8.685  28.590 45.689 1.00 41.18 ? 74  TYR A CD2   1 
ATOM   574  C  CE1   . TYR A 1 74  ? -10.532 29.544 47.527 1.00 40.61 ? 74  TYR A CE1   1 
ATOM   575  C  CE2   . TYR A 1 74  ? -10.047 28.508 45.409 1.00 40.87 ? 74  TYR A CE2   1 
ATOM   576  C  CZ    . TYR A 1 74  ? -10.965 28.988 46.330 1.00 41.19 ? 74  TYR A CZ    1 
ATOM   577  O  OH    . TYR A 1 74  ? -12.312 28.924 46.044 1.00 41.19 ? 74  TYR A OH    1 
ATOM   578  N  N     . SER A 1 75  ? -4.013  30.284 48.824 1.00 40.86 ? 75  SER A N     1 
ATOM   579  C  CA    . SER A 1 75  ? -2.571  30.089 48.909 1.00 40.93 ? 75  SER A CA    1 
ATOM   580  C  C     . SER A 1 75  ? -1.875  30.669 50.135 1.00 39.33 ? 75  SER A C     1 
ATOM   581  O  O     . SER A 1 75  ? -0.647  30.634 50.215 1.00 41.16 ? 75  SER A O     1 
ATOM   582  C  CB    . SER A 1 75  ? -1.896  30.643 47.651 1.00 42.11 ? 75  SER A CB    1 
ATOM   583  O  OG    . SER A 1 75  ? -2.060  32.047 47.564 1.00 44.28 ? 75  SER A OG    1 
ATOM   584  N  N     . ILE A 1 76  ? -2.624  31.203 51.093 1.00 36.06 ? 76  ILE A N     1 
ATOM   585  C  CA    . ILE A 1 76  ? -1.952  31.752 52.260 1.00 33.10 ? 76  ILE A CA    1 
ATOM   586  C  C     . ILE A 1 76  ? -2.015  30.798 53.451 1.00 29.86 ? 76  ILE A C     1 
ATOM   587  O  O     . ILE A 1 76  ? -3.089  30.367 53.874 1.00 28.80 ? 76  ILE A O     1 
ATOM   588  C  CB    . ILE A 1 76  ? -2.511  33.159 52.645 1.00 34.27 ? 76  ILE A CB    1 
ATOM   589  C  CG1   . ILE A 1 76  ? -3.758  33.039 53.511 1.00 35.49 ? 76  ILE A CG1   1 
ATOM   590  C  CG2   . ILE A 1 76  ? -2.817  33.961 51.391 1.00 34.29 ? 76  ILE A CG2   1 
ATOM   591  C  CD1   . ILE A 1 76  ? -3.449  33.030 54.999 1.00 36.65 ? 76  ILE A CD1   1 
ATOM   592  N  N     . ASP A 1 77  ? -0.838  30.445 53.957 1.00 27.28 ? 77  ASP A N     1 
ATOM   593  C  CA    . ASP A 1 77  ? -0.703  29.559 55.108 1.00 26.72 ? 77  ASP A CA    1 
ATOM   594  C  C     . ASP A 1 77  ? -1.364  28.189 54.965 1.00 22.86 ? 77  ASP A C     1 
ATOM   595  O  O     . ASP A 1 77  ? -1.844  27.616 55.948 1.00 20.01 ? 77  ASP A O     1 
ATOM   596  C  CB    . ASP A 1 77  ? -1.235  30.258 56.362 1.00 29.44 ? 77  ASP A CB    1 
ATOM   597  C  CG    . ASP A 1 77  ? -0.495  31.552 56.662 1.00 35.12 ? 77  ASP A CG    1 
ATOM   598  O  OD1   . ASP A 1 77  ? 0.755   31.520 56.699 1.00 37.70 ? 77  ASP A OD1   1 
ATOM   599  O  OD2   . ASP A 1 77  ? -1.157  32.594 56.865 1.00 34.14 ? 77  ASP A OD2   1 
ATOM   600  N  N     . ILE A 1 78  ? -1.390  27.659 53.747 1.00 19.91 ? 78  ILE A N     1 
ATOM   601  C  CA    . ILE A 1 78  ? -1.981  26.347 53.529 1.00 18.65 ? 78  ILE A CA    1 
ATOM   602  C  C     . ILE A 1 78  ? -0.872  25.305 53.612 1.00 19.14 ? 78  ILE A C     1 
ATOM   603  O  O     . ILE A 1 78  ? 0.133   25.412 52.920 1.00 21.42 ? 78  ILE A O     1 
ATOM   604  C  CB    . ILE A 1 78  ? -2.651  26.238 52.147 1.00 18.02 ? 78  ILE A CB    1 
ATOM   605  C  CG1   . ILE A 1 78  ? -3.707  27.334 51.980 1.00 15.62 ? 78  ILE A CG1   1 
ATOM   606  C  CG2   . ILE A 1 78  ? -3.282  24.860 51.997 1.00 19.19 ? 78  ILE A CG2   1 
ATOM   607  C  CD1   . ILE A 1 78  ? -4.756  27.366 53.083 1.00 14.46 ? 78  ILE A CD1   1 
ATOM   608  N  N     . ASN A 1 79  ? -1.057  24.300 54.460 1.00 18.85 ? 79  ASN A N     1 
ATOM   609  C  CA    . ASN A 1 79  ? -0.057  23.249 54.627 1.00 20.19 ? 79  ASN A CA    1 
ATOM   610  C  C     . ASN A 1 79  ? -0.293  22.058 53.703 1.00 20.74 ? 79  ASN A C     1 
ATOM   611  O  O     . ASN A 1 79  ? 0.590   21.218 53.522 1.00 19.75 ? 79  ASN A O     1 
ATOM   612  C  CB    . ASN A 1 79  ? -0.044  22.782 56.080 1.00 22.25 ? 79  ASN A CB    1 
ATOM   613  C  CG    . ASN A 1 79  ? 0.301   23.905 57.037 1.00 24.14 ? 79  ASN A CG    1 
ATOM   614  O  OD1   . ASN A 1 79  ? 1.387   24.483 56.961 1.00 27.65 ? 79  ASN A OD1   1 
ATOM   615  N  ND2   . ASN A 1 79  ? -0.623  24.228 57.931 1.00 23.13 ? 79  ASN A ND2   1 
ATOM   616  N  N     . GLY A 1 80  ? -1.484  21.990 53.119 1.00 19.33 ? 80  GLY A N     1 
ATOM   617  C  CA    . GLY A 1 80  ? -1.796  20.889 52.225 1.00 19.50 ? 80  GLY A CA    1 
ATOM   618  C  C     . GLY A 1 80  ? -3.109  21.091 51.496 1.00 19.39 ? 80  GLY A C     1 
ATOM   619  O  O     . GLY A 1 80  ? -4.003  21.796 51.978 1.00 19.17 ? 80  GLY A O     1 
ATOM   620  N  N     . TYR A 1 81  ? -3.229  20.458 50.334 1.00 18.43 ? 81  TYR A N     1 
ATOM   621  C  CA    . TYR A 1 81  ? -4.432  20.572 49.529 1.00 17.57 ? 81  TYR A CA    1 
ATOM   622  C  C     . TYR A 1 81  ? -5.007  19.210 49.172 1.00 16.20 ? 81  TYR A C     1 
ATOM   623  O  O     . TYR A 1 81  ? -4.274  18.259 48.891 1.00 16.23 ? 81  TYR A O     1 
ATOM   624  C  CB    . TYR A 1 81  ? -4.143  21.321 48.229 1.00 19.24 ? 81  TYR A CB    1 
ATOM   625  C  CG    . TYR A 1 81  ? -3.619  22.732 48.384 1.00 20.72 ? 81  TYR A CG    1 
ATOM   626  C  CD1   . TYR A 1 81  ? -2.281  22.974 48.702 1.00 22.37 ? 81  TYR A CD1   1 
ATOM   627  C  CD2   . TYR A 1 81  ? -4.453  23.827 48.171 1.00 19.46 ? 81  TYR A CD2   1 
ATOM   628  C  CE1   . TYR A 1 81  ? -1.789  24.272 48.797 1.00 24.11 ? 81  TYR A CE1   1 
ATOM   629  C  CE2   . TYR A 1 81  ? -3.974  25.126 48.266 1.00 22.02 ? 81  TYR A CE2   1 
ATOM   630  C  CZ    . TYR A 1 81  ? -2.641  25.343 48.575 1.00 23.69 ? 81  TYR A CZ    1 
ATOM   631  O  OH    . TYR A 1 81  ? -2.159  26.632 48.628 1.00 25.00 ? 81  TYR A OH    1 
ATOM   632  N  N     . ILE A 1 82  ? -6.330  19.132 49.192 1.00 15.71 ? 82  ILE A N     1 
ATOM   633  C  CA    . ILE A 1 82  ? -7.050  17.925 48.829 1.00 14.83 ? 82  ILE A CA    1 
ATOM   634  C  C     . ILE A 1 82  ? -7.839  18.317 47.585 1.00 15.45 ? 82  ILE A C     1 
ATOM   635  O  O     . ILE A 1 82  ? -8.696  19.198 47.642 1.00 15.35 ? 82  ILE A O     1 
ATOM   636  C  CB    . ILE A 1 82  ? -8.030  17.497 49.929 1.00 15.37 ? 82  ILE A CB    1 
ATOM   637  C  CG1   . ILE A 1 82  ? -7.255  17.041 51.171 1.00 15.65 ? 82  ILE A CG1   1 
ATOM   638  C  CG2   . ILE A 1 82  ? -8.938  16.386 49.405 1.00 15.30 ? 82  ILE A CG2   1 
ATOM   639  C  CD1   . ILE A 1 82  ? -8.125  16.836 52.393 1.00 19.00 ? 82  ILE A CD1   1 
ATOM   640  N  N     . LEU A 1 83  ? -7.524  17.687 46.458 1.00 14.08 ? 83  LEU A N     1 
ATOM   641  C  CA    . LEU A 1 83  ? -8.202  17.979 45.205 1.00 13.53 ? 83  LEU A CA    1 
ATOM   642  C  C     . LEU A 1 83  ? -9.159  16.846 44.898 1.00 14.47 ? 83  LEU A C     1 
ATOM   643  O  O     . LEU A 1 83  ? -8.743  15.729 44.583 1.00 13.33 ? 83  LEU A O     1 
ATOM   644  C  CB    . LEU A 1 83  ? -7.186  18.143 44.069 1.00 13.80 ? 83  LEU A CB    1 
ATOM   645  C  CG    . LEU A 1 83  ? -6.602  19.544 43.824 1.00 14.72 ? 83  LEU A CG    1 
ATOM   646  C  CD1   . LEU A 1 83  ? -6.078  20.141 45.112 1.00 10.01 ? 83  LEU A CD1   1 
ATOM   647  C  CD2   . LEU A 1 83  ? -5.492  19.451 42.788 1.00 11.57 ? 83  LEU A CD2   1 
ATOM   648  N  N     . VAL A 1 84  ? -10.450 17.128 44.992 1.00 13.91 ? 84  VAL A N     1 
ATOM   649  C  CA    . VAL A 1 84  ? -11.414 16.079 44.740 1.00 14.00 ? 84  VAL A CA    1 
ATOM   650  C  C     . VAL A 1 84  ? -12.244 16.217 43.482 1.00 14.02 ? 84  VAL A C     1 
ATOM   651  O  O     . VAL A 1 84  ? -12.574 17.321 43.029 1.00 13.61 ? 84  VAL A O     1 
ATOM   652  C  CB    . VAL A 1 84  ? -12.333 15.855 45.992 1.00 17.64 ? 84  VAL A CB    1 
ATOM   653  C  CG1   . VAL A 1 84  ? -12.373 17.102 46.854 1.00 18.70 ? 84  VAL A CG1   1 
ATOM   654  C  CG2   . VAL A 1 84  ? -13.728 15.430 45.572 1.00 14.88 ? 84  VAL A CG2   1 
ATOM   655  N  N     . TYR A 1 85  ? -12.530 15.066 42.887 1.00 13.19 ? 85  TYR A N     1 
ATOM   656  C  CA    . TYR A 1 85  ? -13.372 15.012 41.703 1.00 12.88 ? 85  TYR A CA    1 
ATOM   657  C  C     . TYR A 1 85  ? -14.383 13.911 42.008 1.00 12.65 ? 85  TYR A C     1 
ATOM   658  O  O     . TYR A 1 85  ? -14.276 13.240 43.042 1.00 11.60 ? 85  TYR A O     1 
ATOM   659  C  CB    . TYR A 1 85  ? -12.538 14.686 40.457 1.00 11.96 ? 85  TYR A CB    1 
ATOM   660  C  CG    . TYR A 1 85  ? -11.888 13.321 40.462 1.00 12.95 ? 85  TYR A CG    1 
ATOM   661  C  CD1   . TYR A 1 85  ? -12.511 12.224 39.860 1.00 11.75 ? 85  TYR A CD1   1 
ATOM   662  C  CD2   . TYR A 1 85  ? -10.649 13.123 41.071 1.00 11.95 ? 85  TYR A CD2   1 
ATOM   663  C  CE1   . TYR A 1 85  ? -11.912 10.963 39.866 1.00 10.17 ? 85  TYR A CE1   1 
ATOM   664  C  CE2   . TYR A 1 85  ? -10.048 11.871 41.088 1.00 13.90 ? 85  TYR A CE2   1 
ATOM   665  C  CZ    . TYR A 1 85  ? -10.685 10.796 40.485 1.00 12.28 ? 85  TYR A CZ    1 
ATOM   666  O  OH    . TYR A 1 85  ? -10.103 9.555  40.528 1.00 11.17 ? 85  TYR A OH    1 
ATOM   667  N  N     . SER A 1 86  ? -15.379 13.746 41.147 1.00 12.81 ? 86  SER A N     1 
ATOM   668  C  CA    . SER A 1 86  ? -16.382 12.705 41.362 1.00 13.68 ? 86  SER A CA    1 
ATOM   669  C  C     . SER A 1 86  ? -16.127 11.596 40.358 1.00 12.54 ? 86  SER A C     1 
ATOM   670  O  O     . SER A 1 86  ? -15.913 11.887 39.183 1.00 12.16 ? 86  SER A O     1 
ATOM   671  C  CB    . SER A 1 86  ? -17.790 13.262 41.141 1.00 12.19 ? 86  SER A CB    1 
ATOM   672  O  OG    . SER A 1 86  ? -18.732 12.205 41.158 1.00 13.82 ? 86  SER A OG    1 
ATOM   673  N  N     . VAL A 1 87  ? -16.134 10.335 40.796 1.00 12.80 ? 87  VAL A N     1 
ATOM   674  C  CA    . VAL A 1 87  ? -15.904 9.257  39.838 1.00 14.26 ? 87  VAL A CA    1 
ATOM   675  C  C     . VAL A 1 87  ? -17.101 9.126  38.903 1.00 13.73 ? 87  VAL A C     1 
ATOM   676  O  O     . VAL A 1 87  ? -17.052 8.361  37.939 1.00 15.77 ? 87  VAL A O     1 
ATOM   677  C  CB    . VAL A 1 87  ? -15.633 7.879  40.518 1.00 15.44 ? 87  VAL A CB    1 
ATOM   678  C  CG1   . VAL A 1 87  ? -14.440 7.991  41.447 1.00 13.54 ? 87  VAL A CG1   1 
ATOM   679  C  CG2   . VAL A 1 87  ? -16.866 7.387  41.261 1.00 14.87 ? 87  VAL A CG2   1 
ATOM   680  N  N     . THR A 1 88  ? -18.167 9.882  39.179 1.00 14.49 ? 88  THR A N     1 
ATOM   681  C  CA    . THR A 1 88  ? -19.368 9.853  38.333 1.00 14.95 ? 88  THR A CA    1 
ATOM   682  C  C     . THR A 1 88  ? -19.387 11.023 37.352 1.00 15.12 ? 88  THR A C     1 
ATOM   683  O  O     . THR A 1 88  ? -20.383 11.240 36.658 1.00 13.31 ? 88  THR A O     1 
ATOM   684  C  CB    . THR A 1 88  ? -20.680 9.933  39.160 1.00 15.05 ? 88  THR A CB    1 
ATOM   685  O  OG1   . THR A 1 88  ? -20.846 11.262 39.675 1.00 14.09 ? 88  THR A OG1   1 
ATOM   686  C  CG2   . THR A 1 88  ? -20.643 8.949  40.326 1.00 15.18 ? 88  THR A CG2   1 
ATOM   687  N  N     . SER A 1 89  ? -18.283 11.766 37.271 1.00 15.50 ? 89  SER A N     1 
ATOM   688  C  CA    . SER A 1 89  ? -18.248 12.919 36.380 1.00 12.94 ? 89  SER A CA    1 
ATOM   689  C  C     . SER A 1 89  ? -16.921 13.145 35.668 1.00 13.52 ? 89  SER A C     1 
ATOM   690  O  O     . SER A 1 89  ? -15.938 13.541 36.294 1.00 14.07 ? 89  SER A O     1 
ATOM   691  C  CB    . SER A 1 89  ? -18.626 14.177 37.172 1.00 14.63 ? 89  SER A CB    1 
ATOM   692  O  OG    . SER A 1 89  ? -18.530 15.352 36.379 1.00 16.17 ? 89  SER A OG    1 
ATOM   693  N  N     . ILE A 1 90  ? -16.897 12.902 34.359 1.00 10.28 ? 90  ILE A N     1 
ATOM   694  C  CA    . ILE A 1 90  ? -15.683 13.120 33.577 1.00 11.08 ? 90  ILE A CA    1 
ATOM   695  C  C     . ILE A 1 90  ? -15.347 14.616 33.610 1.00 13.36 ? 90  ILE A C     1 
ATOM   696  O  O     . ILE A 1 90  ? -14.180 15.012 33.632 1.00 11.76 ? 90  ILE A O     1 
ATOM   697  C  CB    . ILE A 1 90  ? -15.877 12.643 32.117 1.00 12.22 ? 90  ILE A CB    1 
ATOM   698  C  CG1   . ILE A 1 90  ? -15.941 11.105 32.089 1.00 12.09 ? 90  ILE A CG1   1 
ATOM   699  C  CG2   . ILE A 1 90  ? -14.759 13.180 31.226 1.00 10.90 ? 90  ILE A CG2   1 
ATOM   700  C  CD1   . ILE A 1 90  ? -16.332 10.503 30.741 1.00 11.49 ? 90  ILE A CD1   1 
ATOM   701  N  N     . LYS A 1 91  ? -16.383 15.446 33.629 1.00 12.13 ? 91  LYS A N     1 
ATOM   702  C  CA    . LYS A 1 91  ? -16.190 16.886 33.678 1.00 13.73 ? 91  LYS A CA    1 
ATOM   703  C  C     . LYS A 1 91  ? -15.407 17.297 34.926 1.00 13.06 ? 91  LYS A C     1 
ATOM   704  O  O     . LYS A 1 91  ? -14.439 18.050 34.831 1.00 14.21 ? 91  LYS A O     1 
ATOM   705  C  CB    . LYS A 1 91  ? -17.547 17.601 33.652 1.00 16.48 ? 91  LYS A CB    1 
ATOM   706  C  CG    . LYS A 1 91  ? -17.453 19.124 33.619 1.00 21.88 ? 91  LYS A CG    1 
ATOM   707  C  CD    . LYS A 1 91  ? -16.556 19.584 32.483 1.00 25.23 ? 91  LYS A CD    1 
ATOM   708  C  CE    . LYS A 1 91  ? -16.766 21.056 32.174 1.00 29.94 ? 91  LYS A CE    1 
ATOM   709  N  NZ    . LYS A 1 91  ? -16.662 21.892 33.394 1.00 34.69 ? 91  LYS A NZ    1 
ATOM   710  N  N     . SER A 1 92  ? -15.814 16.806 36.098 1.00 11.72 ? 92  SER A N     1 
ATOM   711  C  CA    . SER A 1 92  ? -15.109 17.163 37.332 1.00 9.52  ? 92  SER A CA    1 
ATOM   712  C  C     . SER A 1 92  ? -13.663 16.683 37.295 1.00 11.60 ? 92  SER A C     1 
ATOM   713  O  O     . SER A 1 92  ? -12.797 17.271 37.939 1.00 11.09 ? 92  SER A O     1 
ATOM   714  C  CB    . SER A 1 92  ? -15.796 16.555 38.557 1.00 10.71 ? 92  SER A CB    1 
ATOM   715  O  OG    . SER A 1 92  ? -15.534 15.166 38.652 1.00 9.65  ? 92  SER A OG    1 
ATOM   716  N  N     . PHE A 1 93  ? -13.411 15.608 36.550 1.00 11.09 ? 93  PHE A N     1 
ATOM   717  C  CA    . PHE A 1 93  ? -12.067 15.040 36.436 1.00 12.94 ? 93  PHE A CA    1 
ATOM   718  C  C     . PHE A 1 93  ? -11.190 15.924 35.551 1.00 13.13 ? 93  PHE A C     1 
ATOM   719  O  O     . PHE A 1 93  ? -10.026 16.193 35.871 1.00 11.52 ? 93  PHE A O     1 
ATOM   720  C  CB    . PHE A 1 93  ? -12.155 13.624 35.846 1.00 13.00 ? 93  PHE A CB    1 
ATOM   721  C  CG    . PHE A 1 93  ? -10.857 12.858 35.879 1.00 14.68 ? 93  PHE A CG    1 
ATOM   722  C  CD1   . PHE A 1 93  ? -10.215 12.597 37.089 1.00 15.97 ? 93  PHE A CD1   1 
ATOM   723  C  CD2   . PHE A 1 93  ? -10.293 12.366 34.704 1.00 12.93 ? 93  PHE A CD2   1 
ATOM   724  C  CE1   . PHE A 1 93  ? -9.026  11.850 37.127 1.00 16.57 ? 93  PHE A CE1   1 
ATOM   725  C  CE2   . PHE A 1 93  ? -9.106  11.619 34.728 1.00 12.44 ? 93  PHE A CE2   1 
ATOM   726  C  CZ    . PHE A 1 93  ? -8.474  11.360 35.942 1.00 14.63 ? 93  PHE A CZ    1 
ATOM   727  N  N     . GLU A 1 94  ? -11.745 16.368 34.428 1.00 14.20 ? 94  GLU A N     1 
ATOM   728  C  CA    . GLU A 1 94  ? -10.994 17.232 33.530 1.00 14.68 ? 94  GLU A CA    1 
ATOM   729  C  C     . GLU A 1 94  ? -10.765 18.576 34.207 1.00 14.40 ? 94  GLU A C     1 
ATOM   730  O  O     . GLU A 1 94  ? -9.751  19.234 33.983 1.00 13.09 ? 94  GLU A O     1 
ATOM   731  C  CB    . GLU A 1 94  ? -11.745 17.415 32.205 1.00 18.90 ? 94  GLU A CB    1 
ATOM   732  C  CG    . GLU A 1 94  ? -11.570 16.235 31.260 1.00 21.43 ? 94  GLU A CG    1 
ATOM   733  C  CD    . GLU A 1 94  ? -10.100 15.905 31.023 1.00 23.11 ? 94  GLU A CD    1 
ATOM   734  O  OE1   . GLU A 1 94  ? -9.349  16.800 30.574 1.00 25.63 ? 94  GLU A OE1   1 
ATOM   735  O  OE2   . GLU A 1 94  ? -9.694  14.754 31.287 1.00 22.56 ? 94  GLU A OE2   1 
ATOM   736  N  N     . VAL A 1 95  ? -11.707 18.976 35.051 1.00 11.23 ? 95  VAL A N     1 
ATOM   737  C  CA    . VAL A 1 95  ? -11.574 20.243 35.754 1.00 13.66 ? 95  VAL A CA    1 
ATOM   738  C  C     . VAL A 1 95  ? -10.529 20.178 36.864 1.00 13.07 ? 95  VAL A C     1 
ATOM   739  O  O     . VAL A 1 95  ? -9.835  21.157 37.122 1.00 14.25 ? 95  VAL A O     1 
ATOM   740  C  CB    . VAL A 1 95  ? -12.922 20.694 36.355 1.00 14.44 ? 95  VAL A CB    1 
ATOM   741  C  CG1   . VAL A 1 95  ? -12.701 21.832 37.351 1.00 13.89 ? 95  VAL A CG1   1 
ATOM   742  C  CG2   . VAL A 1 95  ? -13.850 21.153 35.229 1.00 12.68 ? 95  VAL A CG2   1 
ATOM   743  N  N     . ILE A 1 96  ? -10.402 19.031 37.519 1.00 11.98 ? 96  ILE A N     1 
ATOM   744  C  CA    . ILE A 1 96  ? -9.426  18.933 38.592 1.00 12.07 ? 96  ILE A CA    1 
ATOM   745  C  C     . ILE A 1 96  ? -8.007  19.032 38.030 1.00 11.20 ? 96  ILE A C     1 
ATOM   746  O  O     . ILE A 1 96  ? -7.081  19.427 38.738 1.00 11.09 ? 96  ILE A O     1 
ATOM   747  C  CB    . ILE A 1 96  ? -9.591  17.626 39.401 1.00 11.17 ? 96  ILE A CB    1 
ATOM   748  C  CG1   . ILE A 1 96  ? -8.974  17.803 40.790 1.00 13.08 ? 96  ILE A CG1   1 
ATOM   749  C  CG2   . ILE A 1 96  ? -8.917  16.460 38.676 1.00 13.01 ? 96  ILE A CG2   1 
ATOM   750  C  CD1   . ILE A 1 96  ? -9.582  18.954 41.593 1.00 12.74 ? 96  ILE A CD1   1 
ATOM   751  N  N     . LYS A 1 97  ? -7.833  18.673 36.760 1.00 11.92 ? 97  LYS A N     1 
ATOM   752  C  CA    . LYS A 1 97  ? -6.513  18.766 36.137 1.00 11.92 ? 97  LYS A CA    1 
ATOM   753  C  C     . LYS A 1 97  ? -6.174  20.250 35.986 1.00 15.04 ? 97  LYS A C     1 
ATOM   754  O  O     . LYS A 1 97  ? -5.051  20.674 36.268 1.00 13.85 ? 97  LYS A O     1 
ATOM   755  C  CB    . LYS A 1 97  ? -6.508  18.101 34.762 1.00 11.11 ? 97  LYS A CB    1 
ATOM   756  C  CG    . LYS A 1 97  ? -6.665  16.582 34.777 1.00 7.85  ? 97  LYS A CG    1 
ATOM   757  C  CD    . LYS A 1 97  ? -6.766  16.028 33.362 1.00 10.41 ? 97  LYS A CD    1 
ATOM   758  C  CE    . LYS A 1 97  ? -6.964  14.507 33.352 1.00 10.04 ? 97  LYS A CE    1 
ATOM   759  N  NZ    . LYS A 1 97  ? -6.875  13.960 31.964 1.00 10.40 ? 97  LYS A NZ    1 
ATOM   760  N  N     . VAL A 1 98  ? -7.154  21.031 35.537 1.00 15.14 ? 98  VAL A N     1 
ATOM   761  C  CA    . VAL A 1 98  ? -6.972  22.467 35.353 1.00 15.90 ? 98  VAL A CA    1 
ATOM   762  C  C     . VAL A 1 98  ? -6.723  23.134 36.703 1.00 14.96 ? 98  VAL A C     1 
ATOM   763  O  O     . VAL A 1 98  ? -5.842  23.983 36.836 1.00 15.42 ? 98  VAL A O     1 
ATOM   764  C  CB    . VAL A 1 98  ? -8.217  23.104 34.685 1.00 17.50 ? 98  VAL A CB    1 
ATOM   765  C  CG1   . VAL A 1 98  ? -8.039  24.615 34.566 1.00 17.26 ? 98  VAL A CG1   1 
ATOM   766  C  CG2   . VAL A 1 98  ? -8.433  22.492 33.311 1.00 16.96 ? 98  VAL A CG2   1 
ATOM   767  N  N     . ILE A 1 99  ? -7.498  22.740 37.710 1.00 15.48 ? 99  ILE A N     1 
ATOM   768  C  CA    . ILE A 1 99  ? -7.344  23.294 39.051 1.00 14.23 ? 99  ILE A CA    1 
ATOM   769  C  C     . ILE A 1 99  ? -5.925  23.049 39.576 1.00 15.40 ? 99  ILE A C     1 
ATOM   770  O  O     . ILE A 1 99  ? -5.316  23.929 40.203 1.00 13.14 ? 99  ILE A O     1 
ATOM   771  C  CB    . ILE A 1 99  ? -8.373  22.665 40.026 1.00 15.96 ? 99  ILE A CB    1 
ATOM   772  C  CG1   . ILE A 1 99  ? -9.778  23.171 39.687 1.00 16.88 ? 99  ILE A CG1   1 
ATOM   773  C  CG2   . ILE A 1 99  ? -8.012  22.992 41.469 1.00 15.92 ? 99  ILE A CG2   1 
ATOM   774  C  CD1   . ILE A 1 99  ? -10.873 22.588 40.580 1.00 17.85 ? 99  ILE A CD1   1 
ATOM   775  N  N     . HIS A 1 100 ? -5.400  21.856 39.316 1.00 13.56 ? 100 HIS A N     1 
ATOM   776  C  CA    . HIS A 1 100 ? -4.054  21.520 39.766 1.00 14.15 ? 100 HIS A CA    1 
ATOM   777  C  C     . HIS A 1 100 ? -3.035  22.430 39.080 1.00 15.05 ? 100 HIS A C     1 
ATOM   778  O  O     . HIS A 1 100 ? -2.103  22.922 39.719 1.00 16.84 ? 100 HIS A O     1 
ATOM   779  C  CB    . HIS A 1 100 ? -3.740  20.054 39.462 1.00 15.97 ? 100 HIS A CB    1 
ATOM   780  C  CG    . HIS A 1 100 ? -2.363  19.632 39.880 1.00 17.55 ? 100 HIS A CG    1 
ATOM   781  N  ND1   . HIS A 1 100 ? -1.317  19.511 38.991 1.00 19.67 ? 100 HIS A ND1   1 
ATOM   782  C  CD2   . HIS A 1 100 ? -1.857  19.327 41.099 1.00 18.85 ? 100 HIS A CD2   1 
ATOM   783  C  CE1   . HIS A 1 100 ? -0.225  19.152 39.644 1.00 18.19 ? 100 HIS A CE1   1 
ATOM   784  N  NE2   . HIS A 1 100 ? -0.525  19.033 40.925 1.00 21.21 ? 100 HIS A NE2   1 
ATOM   785  N  N     . GLY A 1 101 ? -3.213  22.640 37.779 1.00 15.46 ? 101 GLY A N     1 
ATOM   786  C  CA    . GLY A 1 101 ? -2.309  23.506 37.034 1.00 18.01 ? 101 GLY A CA    1 
ATOM   787  C  C     . GLY A 1 101 ? -2.351  24.942 37.540 1.00 18.53 ? 101 GLY A C     1 
ATOM   788  O  O     . GLY A 1 101 ? -1.310  25.592 37.678 1.00 17.64 ? 101 GLY A O     1 
ATOM   789  N  N     . LYS A 1 102 ? -3.553  25.445 37.811 1.00 17.34 ? 102 LYS A N     1 
ATOM   790  C  CA    . LYS A 1 102 ? -3.703  26.810 38.322 1.00 21.07 ? 102 LYS A CA    1 
ATOM   791  C  C     . LYS A 1 102 ? -3.065  26.917 39.701 1.00 21.01 ? 102 LYS A C     1 
ATOM   792  O  O     . LYS A 1 102 ? -2.428  27.918 40.027 1.00 22.60 ? 102 LYS A O     1 
ATOM   793  C  CB    . LYS A 1 102 ? -5.182  27.198 38.437 1.00 21.13 ? 102 LYS A CB    1 
ATOM   794  C  CG    . LYS A 1 102 ? -5.913  27.437 37.126 1.00 26.05 ? 102 LYS A CG    1 
ATOM   795  C  CD    . LYS A 1 102 ? -7.386  27.729 37.417 1.00 29.08 ? 102 LYS A CD    1 
ATOM   796  C  CE    . LYS A 1 102 ? -8.096  28.345 36.229 1.00 31.62 ? 102 LYS A CE    1 
ATOM   797  N  NZ    . LYS A 1 102 ? -7.527  29.676 35.913 1.00 32.64 ? 102 LYS A NZ    1 
ATOM   798  N  N     . LEU A 1 103 ? -3.239  25.879 40.512 1.00 21.89 ? 103 LEU A N     1 
ATOM   799  C  CA    . LEU A 1 103 ? -2.684  25.866 41.858 1.00 21.92 ? 103 LEU A CA    1 
ATOM   800  C  C     . LEU A 1 103 ? -1.163  25.970 41.814 1.00 24.20 ? 103 LEU A C     1 
ATOM   801  O  O     . LEU A 1 103 ? -0.562  26.743 42.573 1.00 23.67 ? 103 LEU A O     1 
ATOM   802  C  CB    . LEU A 1 103 ? -3.104  24.587 42.590 1.00 22.61 ? 103 LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 103 ? -2.609  24.413 44.029 1.00 22.76 ? 103 LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 103 ? -3.119  25.568 44.891 1.00 25.75 ? 103 LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 103 ? -3.101  23.084 44.591 1.00 21.61 ? 103 LEU A CD2   1 
ATOM   806  N  N     . LEU A 1 104 ? -0.539  25.189 40.934 1.00 24.28 ? 104 LEU A N     1 
ATOM   807  C  CA    . LEU A 1 104 ? 0.917   25.219 40.791 1.00 25.80 ? 104 LEU A CA    1 
ATOM   808  C  C     . LEU A 1 104 ? 1.389   26.588 40.313 1.00 27.64 ? 104 LEU A C     1 
ATOM   809  O  O     . LEU A 1 104 ? 2.469   27.043 40.686 1.00 27.24 ? 104 LEU A O     1 
ATOM   810  C  CB    . LEU A 1 104 ? 1.393   24.148 39.801 1.00 24.85 ? 104 LEU A CB    1 
ATOM   811  C  CG    . LEU A 1 104 ? 1.382   22.691 40.271 1.00 25.28 ? 104 LEU A CG    1 
ATOM   812  C  CD1   . LEU A 1 104 ? 2.036   21.806 39.216 1.00 24.35 ? 104 LEU A CD1   1 
ATOM   813  C  CD2   . LEU A 1 104 ? 2.133   22.573 41.575 1.00 26.62 ? 104 LEU A CD2   1 
ATOM   814  N  N     . ASP A 1 105 ? 0.580   27.230 39.475 1.00 29.96 ? 105 ASP A N     1 
ATOM   815  C  CA    . ASP A 1 105 ? 0.905   28.554 38.949 1.00 34.16 ? 105 ASP A CA    1 
ATOM   816  C  C     . ASP A 1 105 ? 0.858   29.600 40.058 1.00 37.27 ? 105 ASP A C     1 
ATOM   817  O  O     . ASP A 1 105 ? 1.719   30.477 40.143 1.00 36.76 ? 105 ASP A O     1 
ATOM   818  C  CB    . ASP A 1 105 ? -0.091  28.955 37.855 1.00 35.35 ? 105 ASP A CB    1 
ATOM   819  C  CG    . ASP A 1 105 ? 0.226   28.330 36.512 1.00 37.20 ? 105 ASP A CG    1 
ATOM   820  O  OD1   . ASP A 1 105 ? -0.611  28.451 35.589 1.00 38.27 ? 105 ASP A OD1   1 
ATOM   821  O  OD2   . ASP A 1 105 ? 1.312   27.728 36.373 1.00 38.54 ? 105 ASP A OD2   1 
ATOM   822  N  N     . MET A 1 106 ? -0.159  29.499 40.906 1.00 40.83 ? 106 MET A N     1 
ATOM   823  C  CA    . MET A 1 106 ? -0.344  30.440 41.999 1.00 46.15 ? 106 MET A CA    1 
ATOM   824  C  C     . MET A 1 106 ? 0.671   30.321 43.139 1.00 47.75 ? 106 MET A C     1 
ATOM   825  O  O     . MET A 1 106 ? 1.090   31.332 43.701 1.00 48.21 ? 106 MET A O     1 
ATOM   826  C  CB    . MET A 1 106 ? -1.774  30.317 42.538 1.00 49.19 ? 106 MET A CB    1 
ATOM   827  C  CG    . MET A 1 106 ? -2.673  31.508 42.188 1.00 53.40 ? 106 MET A CG    1 
ATOM   828  S  SD    . MET A 1 106 ? -2.688  31.990 40.432 1.00 57.38 ? 106 MET A SD    1 
ATOM   829  C  CE    . MET A 1 106 ? -4.387  31.609 39.971 1.00 58.06 ? 106 MET A CE    1 
ATOM   830  N  N     . VAL A 1 107 ? 1.077   29.101 43.478 1.00 49.59 ? 107 VAL A N     1 
ATOM   831  C  CA    . VAL A 1 107 ? 2.041   28.912 44.559 1.00 51.90 ? 107 VAL A CA    1 
ATOM   832  C  C     . VAL A 1 107 ? 3.485   28.930 44.062 1.00 54.94 ? 107 VAL A C     1 
ATOM   833  O  O     . VAL A 1 107 ? 4.383   29.400 44.761 1.00 55.77 ? 107 VAL A O     1 
ATOM   834  C  CB    . VAL A 1 107 ? 1.800   27.585 45.308 1.00 50.37 ? 107 VAL A CB    1 
ATOM   835  C  CG1   . VAL A 1 107 ? 0.383   27.545 45.845 1.00 50.13 ? 107 VAL A CG1   1 
ATOM   836  C  CG2   . VAL A 1 107 ? 2.060   26.410 44.385 1.00 50.32 ? 107 VAL A CG2   1 
ATOM   837  N  N     . GLY A 1 108 ? 3.704   28.413 42.857 1.00 57.43 ? 108 GLY A N     1 
ATOM   838  C  CA    . GLY A 1 108 ? 5.044   28.385 42.300 1.00 60.11 ? 108 GLY A CA    1 
ATOM   839  C  C     . GLY A 1 108 ? 5.666   26.999 42.299 1.00 61.82 ? 108 GLY A C     1 
ATOM   840  O  O     . GLY A 1 108 ? 5.048   26.029 41.855 1.00 62.54 ? 108 GLY A O     1 
ATOM   841  N  N     . LYS A 1 109 ? 6.895   26.910 42.798 1.00 62.97 ? 109 LYS A N     1 
ATOM   842  C  CA    . LYS A 1 109 ? 7.622   25.645 42.858 1.00 63.86 ? 109 LYS A CA    1 
ATOM   843  C  C     . LYS A 1 109 ? 7.751   25.168 44.299 1.00 63.93 ? 109 LYS A C     1 
ATOM   844  O  O     . LYS A 1 109 ? 8.645   24.388 44.627 1.00 64.01 ? 109 LYS A O     1 
ATOM   845  C  CB    . LYS A 1 109 ? 9.019   25.819 42.257 1.00 64.73 ? 109 LYS A CB    1 
ATOM   846  C  CG    . LYS A 1 109 ? 9.026   26.247 40.797 1.00 65.23 ? 109 LYS A CG    1 
ATOM   847  C  CD    . LYS A 1 109 ? 10.401  26.739 40.362 1.00 65.28 ? 109 LYS A CD    1 
ATOM   848  C  CE    . LYS A 1 109 ? 11.464  25.664 40.514 1.00 65.74 ? 109 LYS A CE    1 
ATOM   849  N  NZ    . LYS A 1 109 ? 12.800  26.157 40.079 1.00 65.44 ? 109 LYS A NZ    1 
ATOM   850  N  N     . VAL A 1 110 ? 6.850   25.641 45.154 1.00 63.50 ? 110 VAL A N     1 
ATOM   851  C  CA    . VAL A 1 110 ? 6.861   25.284 46.569 1.00 62.37 ? 110 VAL A CA    1 
ATOM   852  C  C     . VAL A 1 110 ? 6.768   23.773 46.797 1.00 60.78 ? 110 VAL A C     1 
ATOM   853  O  O     . VAL A 1 110 ? 6.926   23.298 47.924 1.00 60.81 ? 110 VAL A O     1 
ATOM   854  C  CB    . VAL A 1 110 ? 5.693   25.971 47.315 1.00 63.53 ? 110 VAL A CB    1 
ATOM   855  C  CG1   . VAL A 1 110 ? 5.861   25.811 48.819 1.00 64.14 ? 110 VAL A CG1   1 
ATOM   856  C  CG2   . VAL A 1 110 ? 5.630   27.443 46.935 1.00 63.58 ? 110 VAL A CG2   1 
ATOM   857  N  N     . GLN A 1 111 ? 6.520   23.022 45.727 1.00 58.28 ? 111 GLN A N     1 
ATOM   858  C  CA    . GLN A 1 111 ? 6.401   21.570 45.822 1.00 54.89 ? 111 GLN A CA    1 
ATOM   859  C  C     . GLN A 1 111 ? 5.415   21.246 46.940 1.00 50.88 ? 111 GLN A C     1 
ATOM   860  O  O     . GLN A 1 111 ? 5.699   20.453 47.839 1.00 51.21 ? 111 GLN A O     1 
ATOM   861  C  CB    . GLN A 1 111 ? 7.762   20.948 46.130 1.00 57.57 ? 111 GLN A CB    1 
ATOM   862  C  CG    . GLN A 1 111 ? 7.799   19.440 45.976 1.00 60.79 ? 111 GLN A CG    1 
ATOM   863  C  CD    . GLN A 1 111 ? 9.116   18.846 46.427 1.00 62.78 ? 111 GLN A CD    1 
ATOM   864  O  OE1   . GLN A 1 111 ? 9.445   18.868 47.616 1.00 64.35 ? 111 GLN A OE1   1 
ATOM   865  N  NE2   . GLN A 1 111 ? 9.884   18.318 45.480 1.00 63.75 ? 111 GLN A NE2   1 
ATOM   866  N  N     . ILE A 1 112 ? 4.251   21.877 46.862 1.00 45.52 ? 112 ILE A N     1 
ATOM   867  C  CA    . ILE A 1 112 ? 3.191   21.721 47.848 1.00 39.56 ? 112 ILE A CA    1 
ATOM   868  C  C     . ILE A 1 112 ? 2.643   20.300 47.992 1.00 33.77 ? 112 ILE A C     1 
ATOM   869  O  O     . ILE A 1 112 ? 2.652   19.519 47.041 1.00 33.12 ? 112 ILE A O     1 
ATOM   870  C  CB    . ILE A 1 112 ? 2.019   22.662 47.513 1.00 40.53 ? 112 ILE A CB    1 
ATOM   871  C  CG1   . ILE A 1 112 ? 1.429   22.289 46.150 1.00 39.30 ? 112 ILE A CG1   1 
ATOM   872  C  CG2   . ILE A 1 112 ? 2.508   24.106 47.492 1.00 40.15 ? 112 ILE A CG2   1 
ATOM   873  C  CD1   . ILE A 1 112 ? 0.222   23.112 45.750 1.00 41.50 ? 112 ILE A CD1   1 
ATOM   874  N  N     . PRO A 1 113 ? 2.165   19.951 49.199 1.00 28.68 ? 113 PRO A N     1 
ATOM   875  C  CA    . PRO A 1 113 ? 1.600   18.629 49.496 1.00 26.54 ? 113 PRO A CA    1 
ATOM   876  C  C     . PRO A 1 113 ? 0.210   18.543 48.878 1.00 25.13 ? 113 PRO A C     1 
ATOM   877  O  O     . PRO A 1 113 ? -0.676  19.327 49.224 1.00 25.78 ? 113 PRO A O     1 
ATOM   878  C  CB    . PRO A 1 113 ? 1.540   18.604 51.026 1.00 26.85 ? 113 PRO A CB    1 
ATOM   879  C  CG    . PRO A 1 113 ? 2.551   19.647 51.448 1.00 26.67 ? 113 PRO A CG    1 
ATOM   880  C  CD    . PRO A 1 113 ? 2.331   20.730 50.436 1.00 27.76 ? 113 PRO A CD    1 
ATOM   881  N  N     . ILE A 1 114 ? 0.019   17.596 47.968 1.00 22.37 ? 114 ILE A N     1 
ATOM   882  C  CA    . ILE A 1 114 ? -1.265  17.438 47.302 1.00 22.08 ? 114 ILE A CA    1 
ATOM   883  C  C     . ILE A 1 114 ? -1.798  16.016 47.367 1.00 20.49 ? 114 ILE A C     1 
ATOM   884  O  O     . ILE A 1 114 ? -1.053  15.046 47.248 1.00 19.52 ? 114 ILE A O     1 
ATOM   885  C  CB    . ILE A 1 114 ? -1.176  17.861 45.813 1.00 24.52 ? 114 ILE A CB    1 
ATOM   886  C  CG1   . ILE A 1 114 ? -1.049  19.382 45.719 1.00 25.91 ? 114 ILE A CG1   1 
ATOM   887  C  CG2   . ILE A 1 114 ? -2.406  17.371 45.044 1.00 23.88 ? 114 ILE A CG2   1 
ATOM   888  C  CD1   . ILE A 1 114 ? -0.893  19.897 44.306 1.00 28.34 ? 114 ILE A CD1   1 
ATOM   889  N  N     . MET A 1 115 ? -3.104  15.909 47.561 1.00 18.96 ? 115 MET A N     1 
ATOM   890  C  CA    . MET A 1 115 ? -3.762  14.620 47.616 1.00 19.69 ? 115 MET A CA    1 
ATOM   891  C  C     . MET A 1 115 ? -4.970  14.637 46.687 1.00 19.18 ? 115 MET A C     1 
ATOM   892  O  O     . MET A 1 115 ? -5.883  15.452 46.856 1.00 19.27 ? 115 MET A O     1 
ATOM   893  C  CB    . MET A 1 115 ? -4.197  14.312 49.046 1.00 18.64 ? 115 MET A CB    1 
ATOM   894  C  CG    . MET A 1 115 ? -5.453  13.464 49.132 1.00 24.56 ? 115 MET A CG    1 
ATOM   895  S  SD    . MET A 1 115 ? -5.298  12.156 50.337 1.00 23.05 ? 115 MET A SD    1 
ATOM   896  C  CE    . MET A 1 115 ? -5.547  10.732 49.330 1.00 27.13 ? 115 MET A CE    1 
ATOM   897  N  N     . LEU A 1 116 ? -4.961  13.744 45.702 1.00 15.61 ? 116 LEU A N     1 
ATOM   898  C  CA    . LEU A 1 116 ? -6.053  13.645 44.747 1.00 12.51 ? 116 LEU A CA    1 
ATOM   899  C  C     . LEU A 1 116 ? -7.077  12.653 45.281 1.00 14.97 ? 116 LEU A C     1 
ATOM   900  O  O     . LEU A 1 116 ? -6.711  11.559 45.723 1.00 10.34 ? 116 LEU A O     1 
ATOM   901  C  CB    . LEU A 1 116 ? -5.522  13.168 43.400 1.00 14.09 ? 116 LEU A CB    1 
ATOM   902  C  CG    . LEU A 1 116 ? -6.574  12.911 42.323 1.00 14.31 ? 116 LEU A CG    1 
ATOM   903  C  CD1   . LEU A 1 116 ? -7.252  14.226 41.935 1.00 9.85  ? 116 LEU A CD1   1 
ATOM   904  C  CD2   . LEU A 1 116 ? -5.906  12.240 41.121 1.00 10.69 ? 116 LEU A CD2   1 
ATOM   905  N  N     . VAL A 1 117 ? -8.357  13.022 45.227 1.00 12.27 ? 117 VAL A N     1 
ATOM   906  C  CA    . VAL A 1 117 ? -9.407  12.146 45.743 1.00 14.24 ? 117 VAL A CA    1 
ATOM   907  C  C     . VAL A 1 117 ? -10.574 11.944 44.779 1.00 14.38 ? 117 VAL A C     1 
ATOM   908  O  O     . VAL A 1 117 ? -11.190 12.912 44.335 1.00 15.01 ? 117 VAL A O     1 
ATOM   909  C  CB    . VAL A 1 117 ? -9.979  12.699 47.075 1.00 14.58 ? 117 VAL A CB    1 
ATOM   910  C  CG1   . VAL A 1 117 ? -11.085 11.793 47.591 1.00 15.52 ? 117 VAL A CG1   1 
ATOM   911  C  CG2   . VAL A 1 117 ? -8.867  12.834 48.104 1.00 14.69 ? 117 VAL A CG2   1 
ATOM   912  N  N     . GLY A 1 118 ? -10.865 10.681 44.469 1.00 13.40 ? 118 GLY A N     1 
ATOM   913  C  CA    . GLY A 1 118 ? -11.979 10.347 43.594 1.00 13.24 ? 118 GLY A CA    1 
ATOM   914  C  C     . GLY A 1 118 ? -13.136 9.951  44.495 1.00 14.60 ? 118 GLY A C     1 
ATOM   915  O  O     . GLY A 1 118 ? -13.203 8.815  44.986 1.00 13.44 ? 118 GLY A O     1 
ATOM   916  N  N     . ASN A 1 119 ? -14.049 10.891 44.717 1.00 13.44 ? 119 ASN A N     1 
ATOM   917  C  CA    . ASN A 1 119 ? -15.183 10.671 45.602 1.00 15.59 ? 119 ASN A CA    1 
ATOM   918  C  C     . ASN A 1 119 ? -16.411 10.041 44.929 1.00 17.54 ? 119 ASN A C     1 
ATOM   919  O  O     . ASN A 1 119 ? -16.450 9.875  43.710 1.00 18.08 ? 119 ASN A O     1 
ATOM   920  C  CB    . ASN A 1 119 ? -15.531 12.005 46.264 1.00 12.87 ? 119 ASN A CB    1 
ATOM   921  C  CG    . ASN A 1 119 ? -16.506 11.861 47.403 1.00 16.43 ? 119 ASN A CG    1 
ATOM   922  O  OD1   . ASN A 1 119 ? -16.349 10.993 48.272 1.00 17.37 ? 119 ASN A OD1   1 
ATOM   923  N  ND2   . ASN A 1 119 ? -17.514 12.729 47.425 1.00 13.94 ? 119 ASN A ND2   1 
ATOM   924  N  N     . LYS A 1 120 ? -17.403 9.687  45.745 1.00 18.73 ? 120 LYS A N     1 
ATOM   925  C  CA    . LYS A 1 120 ? -18.642 9.054  45.281 1.00 18.56 ? 120 LYS A CA    1 
ATOM   926  C  C     . LYS A 1 120 ? -18.441 7.625  44.766 1.00 19.19 ? 120 LYS A C     1 
ATOM   927  O  O     . LYS A 1 120 ? -19.172 7.166  43.888 1.00 19.80 ? 120 LYS A O     1 
ATOM   928  C  CB    . LYS A 1 120 ? -19.315 9.905  44.192 1.00 19.21 ? 120 LYS A CB    1 
ATOM   929  C  CG    . LYS A 1 120 ? -19.767 11.285 44.669 1.00 18.51 ? 120 LYS A CG    1 
ATOM   930  C  CD    . LYS A 1 120 ? -20.595 12.038 43.614 1.00 18.35 ? 120 LYS A CD    1 
ATOM   931  C  CE    . LYS A 1 120 ? -21.074 13.374 44.172 1.00 16.25 ? 120 LYS A CE    1 
ATOM   932  N  NZ    . LYS A 1 120 ? -21.932 14.182 43.246 1.00 16.20 ? 120 LYS A NZ    1 
ATOM   933  N  N     . LYS A 1 121 ? -17.462 6.914  45.319 1.00 17.89 ? 121 LYS A N     1 
ATOM   934  C  CA    . LYS A 1 121 ? -17.191 5.544  44.885 1.00 19.94 ? 121 LYS A CA    1 
ATOM   935  C  C     . LYS A 1 121 ? -18.350 4.572  45.148 1.00 20.68 ? 121 LYS A C     1 
ATOM   936  O  O     . LYS A 1 121 ? -18.373 3.460  44.606 1.00 18.69 ? 121 LYS A O     1 
ATOM   937  C  CB    . LYS A 1 121 ? -15.922 5.014  45.559 1.00 22.04 ? 121 LYS A CB    1 
ATOM   938  C  CG    . LYS A 1 121 ? -15.980 4.975  47.081 1.00 24.91 ? 121 LYS A CG    1 
ATOM   939  C  CD    . LYS A 1 121 ? -14.622 4.599  47.666 1.00 29.88 ? 121 LYS A CD    1 
ATOM   940  C  CE    . LYS A 1 121 ? -14.316 3.116  47.498 1.00 32.50 ? 121 LYS A CE    1 
ATOM   941  N  NZ    . LYS A 1 121 ? -15.031 2.286  48.518 1.00 34.44 ? 121 LYS A NZ    1 
ATOM   942  N  N     . ASP A 1 122 ? -19.304 4.985  45.975 1.00 20.25 ? 122 ASP A N     1 
ATOM   943  C  CA    . ASP A 1 122 ? -20.452 4.137  46.283 1.00 22.60 ? 122 ASP A CA    1 
ATOM   944  C  C     . ASP A 1 122 ? -21.459 4.072  45.133 1.00 24.06 ? 122 ASP A C     1 
ATOM   945  O  O     . ASP A 1 122 ? -22.226 3.113  45.030 1.00 24.08 ? 122 ASP A O     1 
ATOM   946  C  CB    . ASP A 1 122 ? -21.153 4.638  47.544 1.00 20.45 ? 122 ASP A CB    1 
ATOM   947  C  CG    . ASP A 1 122 ? -21.584 6.081  47.432 1.00 22.93 ? 122 ASP A CG    1 
ATOM   948  O  OD1   . ASP A 1 122 ? -22.799 6.333  47.303 1.00 22.00 ? 122 ASP A OD1   1 
ATOM   949  O  OD2   . ASP A 1 122 ? -20.705 6.968  47.466 1.00 21.33 ? 122 ASP A OD2   1 
ATOM   950  N  N     . LEU A 1 123 ? -21.462 5.091  44.275 1.00 24.11 ? 123 LEU A N     1 
ATOM   951  C  CA    . LEU A 1 123 ? -22.388 5.123  43.148 1.00 24.43 ? 123 LEU A CA    1 
ATOM   952  C  C     . LEU A 1 123 ? -21.850 4.284  41.996 1.00 25.52 ? 123 LEU A C     1 
ATOM   953  O  O     . LEU A 1 123 ? -21.562 4.799  40.917 1.00 23.88 ? 123 LEU A O     1 
ATOM   954  C  CB    . LEU A 1 123 ? -22.622 6.568  42.698 1.00 23.82 ? 123 LEU A CB    1 
ATOM   955  C  CG    . LEU A 1 123 ? -23.278 7.464  43.759 1.00 23.24 ? 123 LEU A CG    1 
ATOM   956  C  CD1   . LEU A 1 123 ? -23.402 8.886  43.239 1.00 21.24 ? 123 LEU A CD1   1 
ATOM   957  C  CD2   . LEU A 1 123 ? -24.652 6.909  44.126 1.00 22.44 ? 123 LEU A CD2   1 
ATOM   958  N  N     . HIS A 1 124 ? -21.736 2.981  42.243 1.00 26.81 ? 124 HIS A N     1 
ATOM   959  C  CA    . HIS A 1 124 ? -21.213 2.027  41.266 1.00 29.57 ? 124 HIS A CA    1 
ATOM   960  C  C     . HIS A 1 124 ? -21.829 2.155  39.882 1.00 28.37 ? 124 HIS A C     1 
ATOM   961  O  O     . HIS A 1 124 ? -21.118 2.135  38.877 1.00 26.46 ? 124 HIS A O     1 
ATOM   962  C  CB    . HIS A 1 124 ? -21.418 0.593  41.765 1.00 32.67 ? 124 HIS A CB    1 
ATOM   963  C  CG    . HIS A 1 124 ? -20.773 0.314  43.087 1.00 37.37 ? 124 HIS A CG    1 
ATOM   964  N  ND1   . HIS A 1 124 ? -19.417 0.441  43.297 1.00 39.06 ? 124 HIS A ND1   1 
ATOM   965  C  CD2   . HIS A 1 124 ? -21.300 -0.089 44.268 1.00 38.57 ? 124 HIS A CD2   1 
ATOM   966  C  CE1   . HIS A 1 124 ? -19.135 0.129  44.549 1.00 39.48 ? 124 HIS A CE1   1 
ATOM   967  N  NE2   . HIS A 1 124 ? -20.260 -0.197 45.160 1.00 40.08 ? 124 HIS A NE2   1 
ATOM   968  N  N     . MET A 1 125 ? -23.152 2.286  39.838 1.00 28.31 ? 125 MET A N     1 
ATOM   969  C  CA    . MET A 1 125 ? -23.873 2.395  38.574 1.00 29.24 ? 125 MET A CA    1 
ATOM   970  C  C     . MET A 1 125 ? -23.462 3.602  37.734 1.00 26.58 ? 125 MET A C     1 
ATOM   971  O  O     . MET A 1 125 ? -23.319 3.493  36.514 1.00 26.90 ? 125 MET A O     1 
ATOM   972  C  CB    . MET A 1 125 ? -25.383 2.459  38.835 1.00 33.11 ? 125 MET A CB    1 
ATOM   973  C  CG    . MET A 1 125 ? -25.954 1.226  39.525 1.00 40.17 ? 125 MET A CG    1 
ATOM   974  S  SD    . MET A 1 125 ? -27.652 1.484  40.119 1.00 49.48 ? 125 MET A SD    1 
ATOM   975  C  CE    . MET A 1 125 ? -28.596 0.940  38.716 1.00 45.69 ? 125 MET A CE    1 
ATOM   976  N  N     . GLU A 1 126 ? -23.259 4.741  38.393 1.00 23.93 ? 126 GLU A N     1 
ATOM   977  C  CA    . GLU A 1 126 ? -22.906 5.991  37.716 1.00 20.93 ? 126 GLU A CA    1 
ATOM   978  C  C     . GLU A 1 126 ? -21.408 6.270  37.518 1.00 20.64 ? 126 GLU A C     1 
ATOM   979  O  O     . GLU A 1 126 ? -21.032 7.345  37.048 1.00 16.14 ? 126 GLU A O     1 
ATOM   980  C  CB    . GLU A 1 126 ? -23.539 7.161  38.474 1.00 23.26 ? 126 GLU A CB    1 
ATOM   981  C  CG    . GLU A 1 126 ? -25.000 6.929  38.835 1.00 26.82 ? 126 GLU A CG    1 
ATOM   982  C  CD    . GLU A 1 126 ? -25.596 8.052  39.661 1.00 30.32 ? 126 GLU A CD    1 
ATOM   983  O  OE1   . GLU A 1 126 ? -26.524 7.777  40.451 1.00 31.51 ? 126 GLU A OE1   1 
ATOM   984  O  OE2   . GLU A 1 126 ? -25.150 9.210  39.517 1.00 31.36 ? 126 GLU A OE2   1 
ATOM   985  N  N     . ARG A 1 127 ? -20.550 5.321  37.870 1.00 18.70 ? 127 ARG A N     1 
ATOM   986  C  CA    . ARG A 1 127 ? -19.114 5.541  37.702 1.00 18.73 ? 127 ARG A CA    1 
ATOM   987  C  C     . ARG A 1 127 ? -18.700 5.644  36.238 1.00 17.04 ? 127 ARG A C     1 
ATOM   988  O  O     . ARG A 1 127 ? -19.113 4.828  35.402 1.00 15.45 ? 127 ARG A O     1 
ATOM   989  C  CB    . ARG A 1 127 ? -18.302 4.422  38.369 1.00 19.36 ? 127 ARG A CB    1 
ATOM   990  C  CG    . ARG A 1 127 ? -16.792 4.571  38.149 1.00 20.66 ? 127 ARG A CG    1 
ATOM   991  C  CD    . ARG A 1 127 ? -16.009 3.362  38.632 1.00 21.64 ? 127 ARG A CD    1 
ATOM   992  N  NE    . ARG A 1 127 ? -15.888 3.297  40.086 1.00 19.46 ? 127 ARG A NE    1 
ATOM   993  C  CZ    . ARG A 1 127 ? -14.916 3.871  40.793 1.00 21.72 ? 127 ARG A CZ    1 
ATOM   994  N  NH1   . ARG A 1 127 ? -13.957 4.570  40.191 1.00 16.06 ? 127 ARG A NH1   1 
ATOM   995  N  NH2   . ARG A 1 127 ? -14.886 3.723  42.112 1.00 16.45 ? 127 ARG A NH2   1 
ATOM   996  N  N     . VAL A 1 128 ? -17.884 6.654  35.937 1.00 14.19 ? 128 VAL A N     1 
ATOM   997  C  CA    . VAL A 1 128 ? -17.372 6.869  34.586 1.00 13.82 ? 128 VAL A CA    1 
ATOM   998  C  C     . VAL A 1 128 ? -15.856 7.074  34.569 1.00 14.08 ? 128 VAL A C     1 
ATOM   999  O  O     . VAL A 1 128 ? -15.242 7.100  33.506 1.00 15.48 ? 128 VAL A O     1 
ATOM   1000 C  CB    . VAL A 1 128 ? -18.069 8.067  33.888 1.00 14.19 ? 128 VAL A CB    1 
ATOM   1001 C  CG1   . VAL A 1 128 ? -19.489 7.662  33.474 1.00 15.16 ? 128 VAL A CG1   1 
ATOM   1002 C  CG2   . VAL A 1 128 ? -18.102 9.284  34.812 1.00 14.06 ? 128 VAL A CG2   1 
ATOM   1003 N  N     . ILE A 1 129 ? -15.257 7.211  35.750 1.00 15.02 ? 129 ILE A N     1 
ATOM   1004 C  CA    . ILE A 1 129 ? -13.805 7.368  35.874 1.00 14.46 ? 129 ILE A CA    1 
ATOM   1005 C  C     . ILE A 1 129 ? -13.330 6.134  36.631 1.00 15.00 ? 129 ILE A C     1 
ATOM   1006 O  O     . ILE A 1 129 ? -13.857 5.830  37.703 1.00 13.23 ? 129 ILE A O     1 
ATOM   1007 C  CB    . ILE A 1 129 ? -13.399 8.597  36.730 1.00 14.65 ? 129 ILE A CB    1 
ATOM   1008 C  CG1   . ILE A 1 129 ? -14.017 9.879  36.168 1.00 15.68 ? 129 ILE A CG1   1 
ATOM   1009 C  CG2   . ILE A 1 129 ? -11.864 8.732  36.742 1.00 12.85 ? 129 ILE A CG2   1 
ATOM   1010 C  CD1   . ILE A 1 129 ? -13.562 10.208 34.773 1.00 15.28 ? 129 ILE A CD1   1 
ATOM   1011 N  N     . SER A 1 130 ? -12.335 5.434  36.093 1.00 14.95 ? 130 SER A N     1 
ATOM   1012 C  CA    . SER A 1 130 ? -11.827 4.235  36.747 1.00 17.42 ? 130 SER A CA    1 
ATOM   1013 C  C     . SER A 1 130 ? -10.778 4.547  37.805 1.00 17.43 ? 130 SER A C     1 
ATOM   1014 O  O     . SER A 1 130 ? -10.179 5.627  37.817 1.00 14.93 ? 130 SER A O     1 
ATOM   1015 C  CB    . SER A 1 130 ? -11.202 3.290  35.725 1.00 18.73 ? 130 SER A CB    1 
ATOM   1016 O  OG    . SER A 1 130 ? -9.933  3.773  35.330 1.00 16.46 ? 130 SER A OG    1 
ATOM   1017 N  N     . TYR A 1 131 ? -10.563 3.580  38.690 1.00 16.35 ? 131 TYR A N     1 
ATOM   1018 C  CA    . TYR A 1 131 ? -9.567  3.709  39.739 1.00 16.08 ? 131 TYR A CA    1 
ATOM   1019 C  C     . TYR A 1 131 ? -8.214  3.954  39.070 1.00 16.17 ? 131 TYR A C     1 
ATOM   1020 O  O     . TYR A 1 131 ? -7.426  4.795  39.522 1.00 14.99 ? 131 TYR A O     1 
ATOM   1021 C  CB    . TYR A 1 131 ? -9.497  2.420  40.569 1.00 18.11 ? 131 TYR A CB    1 
ATOM   1022 C  CG    . TYR A 1 131 ? -8.418  2.450  41.629 1.00 21.44 ? 131 TYR A CG    1 
ATOM   1023 C  CD1   . TYR A 1 131 ? -8.663  3.004  42.884 1.00 22.05 ? 131 TYR A CD1   1 
ATOM   1024 C  CD2   . TYR A 1 131 ? -7.132  1.991  41.352 1.00 22.87 ? 131 TYR A CD2   1 
ATOM   1025 C  CE1   . TYR A 1 131 ? -7.646  3.107  43.837 1.00 25.17 ? 131 TYR A CE1   1 
ATOM   1026 C  CE2   . TYR A 1 131 ? -6.110  2.089  42.295 1.00 24.46 ? 131 TYR A CE2   1 
ATOM   1027 C  CZ    . TYR A 1 131 ? -6.374  2.650  43.531 1.00 25.26 ? 131 TYR A CZ    1 
ATOM   1028 O  OH    . TYR A 1 131 ? -5.361  2.785  44.450 1.00 26.64 ? 131 TYR A OH    1 
ATOM   1029 N  N     . GLU A 1 132 ? -7.958  3.226  37.984 1.00 12.40 ? 132 GLU A N     1 
ATOM   1030 C  CA    . GLU A 1 132 ? -6.694  3.344  37.261 1.00 15.37 ? 132 GLU A CA    1 
ATOM   1031 C  C     . GLU A 1 132 ? -6.447  4.744  36.704 1.00 14.17 ? 132 GLU A C     1 
ATOM   1032 O  O     . GLU A 1 132 ? -5.334  5.270  36.799 1.00 11.32 ? 132 GLU A O     1 
ATOM   1033 C  CB    . GLU A 1 132 ? -6.635  2.321  36.121 1.00 18.64 ? 132 GLU A CB    1 
ATOM   1034 C  CG    . GLU A 1 132 ? -6.558  0.875  36.597 1.00 26.66 ? 132 GLU A CG    1 
ATOM   1035 C  CD    . GLU A 1 132 ? -7.788  0.444  37.384 1.00 29.63 ? 132 GLU A CD    1 
ATOM   1036 O  OE1   . GLU A 1 132 ? -7.624  -0.280 38.389 1.00 34.61 ? 132 GLU A OE1   1 
ATOM   1037 O  OE2   . GLU A 1 132 ? -8.918  0.820  36.996 1.00 30.90 ? 132 GLU A OE2   1 
ATOM   1038 N  N     . GLU A 1 133 ? -7.477  5.344  36.114 1.00 11.84 ? 133 GLU A N     1 
ATOM   1039 C  CA    . GLU A 1 133 ? -7.327  6.691  35.557 1.00 13.48 ? 133 GLU A CA    1 
ATOM   1040 C  C     . GLU A 1 133 ? -6.966  7.670  36.668 1.00 11.59 ? 133 GLU A C     1 
ATOM   1041 O  O     . GLU A 1 133 ? -6.090  8.520  36.501 1.00 11.91 ? 133 GLU A O     1 
ATOM   1042 C  CB    . GLU A 1 133 ? -8.624  7.141  34.885 1.00 13.12 ? 133 GLU A CB    1 
ATOM   1043 C  CG    . GLU A 1 133 ? -9.053  6.278  33.710 1.00 17.51 ? 133 GLU A CG    1 
ATOM   1044 C  CD    . GLU A 1 133 ? -10.337 6.786  33.077 1.00 21.13 ? 133 GLU A CD    1 
ATOM   1045 O  OE1   . GLU A 1 133 ? -10.274 7.748  32.283 1.00 24.90 ? 133 GLU A OE1   1 
ATOM   1046 O  OE2   . GLU A 1 133 ? -11.412 6.234  33.390 1.00 19.69 ? 133 GLU A OE2   1 
ATOM   1047 N  N     . GLY A 1 134 ? -7.656  7.549  37.797 1.00 10.77 ? 134 GLY A N     1 
ATOM   1048 C  CA    . GLY A 1 134 ? -7.390  8.419  38.929 1.00 11.76 ? 134 GLY A CA    1 
ATOM   1049 C  C     . GLY A 1 134 ? -5.969  8.220  39.434 1.00 14.27 ? 134 GLY A C     1 
ATOM   1050 O  O     . GLY A 1 134 ? -5.236  9.184  39.674 1.00 13.46 ? 134 GLY A O     1 
ATOM   1051 N  N     . LYS A 1 135 ? -5.569  6.964  39.587 1.00 12.78 ? 135 LYS A N     1 
ATOM   1052 C  CA    . LYS A 1 135 ? -4.226  6.654  40.063 1.00 13.93 ? 135 LYS A CA    1 
ATOM   1053 C  C     . LYS A 1 135 ? -3.150  7.162  39.098 1.00 13.49 ? 135 LYS A C     1 
ATOM   1054 O  O     . LYS A 1 135 ? -2.103  7.641  39.533 1.00 13.54 ? 135 LYS A O     1 
ATOM   1055 C  CB    . LYS A 1 135 ? -4.074  5.141  40.276 1.00 14.92 ? 135 LYS A CB    1 
ATOM   1056 C  CG    . LYS A 1 135 ? -2.708  4.746  40.825 1.00 17.28 ? 135 LYS A CG    1 
ATOM   1057 C  CD    . LYS A 1 135 ? -2.609  3.254  41.075 1.00 25.68 ? 135 LYS A CD    1 
ATOM   1058 C  CE    . LYS A 1 135 ? -1.199  2.873  41.513 1.00 28.34 ? 135 LYS A CE    1 
ATOM   1059 N  NZ    . LYS A 1 135 ? -0.771  3.662  42.711 1.00 30.86 ? 135 LYS A NZ    1 
ATOM   1060 N  N     . ALA A 1 136 ? -3.400  7.055  37.792 1.00 12.69 ? 136 ALA A N     1 
ATOM   1061 C  CA    . ALA A 1 136 ? -2.436  7.524  36.786 1.00 11.56 ? 136 ALA A CA    1 
ATOM   1062 C  C     . ALA A 1 136 ? -2.217  9.040  36.895 1.00 10.49 ? 136 ALA A C     1 
ATOM   1063 O  O     . ALA A 1 136 ? -1.104  9.538  36.704 1.00 8.85  ? 136 ALA A O     1 
ATOM   1064 C  CB    . ALA A 1 136 ? -2.932  7.187  35.387 1.00 11.04 ? 136 ALA A CB    1 
ATOM   1065 N  N     . LEU A 1 137 ? -3.294  9.768  37.171 1.00 9.99  ? 137 LEU A N     1 
ATOM   1066 C  CA    . LEU A 1 137 ? -3.223  11.217 37.310 1.00 11.77 ? 137 LEU A CA    1 
ATOM   1067 C  C     . LEU A 1 137 ? -2.369  11.573 38.526 1.00 11.81 ? 137 LEU A C     1 
ATOM   1068 O  O     . LEU A 1 137 ? -1.457  12.398 38.443 1.00 12.67 ? 137 LEU A O     1 
ATOM   1069 C  CB    . LEU A 1 137 ? -4.628  11.807 37.484 1.00 8.84  ? 137 LEU A CB    1 
ATOM   1070 C  CG    . LEU A 1 137 ? -4.698  13.346 37.535 1.00 10.45 ? 137 LEU A CG    1 
ATOM   1071 C  CD1   . LEU A 1 137 ? -3.963  13.948 36.351 1.00 10.52 ? 137 LEU A CD1   1 
ATOM   1072 C  CD2   . LEU A 1 137 ? -6.165  13.795 37.544 1.00 9.06  ? 137 LEU A CD2   1 
ATOM   1073 N  N     . ALA A 1 138 ? -2.677  10.957 39.658 1.00 10.86 ? 138 ALA A N     1 
ATOM   1074 C  CA    . ALA A 1 138 ? -1.919  11.213 40.879 1.00 11.19 ? 138 ALA A CA    1 
ATOM   1075 C  C     . ALA A 1 138 ? -0.442  10.919 40.633 1.00 10.72 ? 138 ALA A C     1 
ATOM   1076 O  O     . ALA A 1 138 ? 0.432   11.660 41.090 1.00 11.78 ? 138 ALA A O     1 
ATOM   1077 C  CB    . ALA A 1 138 ? -2.439  10.353 42.004 1.00 11.10 ? 138 ALA A CB    1 
ATOM   1078 N  N     . GLU A 1 139 ? -0.156  9.845  39.901 1.00 11.12 ? 139 GLU A N     1 
ATOM   1079 C  CA    . GLU A 1 139 ? 1.237   9.502  39.631 1.00 12.59 ? 139 GLU A CA    1 
ATOM   1080 C  C     . GLU A 1 139 ? 1.879   10.554 38.729 1.00 11.68 ? 139 GLU A C     1 
ATOM   1081 O  O     . GLU A 1 139 ? 3.074   10.842 38.855 1.00 9.48  ? 139 GLU A O     1 
ATOM   1082 C  CB    . GLU A 1 139 ? 1.340   8.109  39.000 1.00 13.21 ? 139 GLU A CB    1 
ATOM   1083 C  CG    . GLU A 1 139 ? 1.002   6.977  39.969 1.00 19.55 ? 139 GLU A CG    1 
ATOM   1084 C  CD    . GLU A 1 139 ? 1.098   5.600  39.320 1.00 26.19 ? 139 GLU A CD    1 
ATOM   1085 O  OE1   . GLU A 1 139 ? 0.485   5.396  38.246 1.00 27.72 ? 139 GLU A OE1   1 
ATOM   1086 O  OE2   . GLU A 1 139 ? 1.782   4.720  39.884 1.00 29.94 ? 139 GLU A OE2   1 
ATOM   1087 N  N     . SER A 1 140 ? 1.088   11.129 37.826 1.00 9.12  ? 140 SER A N     1 
ATOM   1088 C  CA    . SER A 1 140 ? 1.598   12.173 36.939 1.00 11.20 ? 140 SER A CA    1 
ATOM   1089 C  C     . SER A 1 140 ? 2.063   13.354 37.784 1.00 11.58 ? 140 SER A C     1 
ATOM   1090 O  O     . SER A 1 140 ? 3.014   14.045 37.427 1.00 12.65 ? 140 SER A O     1 
ATOM   1091 C  CB    . SER A 1 140 ? 0.509   12.655 35.971 1.00 10.13 ? 140 SER A CB    1 
ATOM   1092 O  OG    . SER A 1 140 ? 0.236   11.671 34.990 1.00 15.02 ? 140 SER A OG    1 
ATOM   1093 N  N     . TRP A 1 141 ? 1.380   13.577 38.905 1.00 11.43 ? 141 TRP A N     1 
ATOM   1094 C  CA    . TRP A 1 141 ? 1.708   14.677 39.808 1.00 10.94 ? 141 TRP A CA    1 
ATOM   1095 C  C     . TRP A 1 141 ? 2.604   14.260 40.966 1.00 11.43 ? 141 TRP A C     1 
ATOM   1096 O  O     . TRP A 1 141 ? 3.099   15.114 41.689 1.00 13.15 ? 141 TRP A O     1 
ATOM   1097 C  CB    . TRP A 1 141 ? 0.440   15.264 40.443 1.00 11.18 ? 141 TRP A CB    1 
ATOM   1098 C  CG    . TRP A 1 141 ? -0.628  15.716 39.505 1.00 11.20 ? 141 TRP A CG    1 
ATOM   1099 C  CD1   . TRP A 1 141 ? -0.497  16.014 38.181 1.00 13.28 ? 141 TRP A CD1   1 
ATOM   1100 C  CD2   . TRP A 1 141 ? -1.989  15.994 39.850 1.00 13.36 ? 141 TRP A CD2   1 
ATOM   1101 N  NE1   . TRP A 1 141 ? -1.696  16.466 37.676 1.00 13.43 ? 141 TRP A NE1   1 
ATOM   1102 C  CE2   . TRP A 1 141 ? -2.629  16.462 38.680 1.00 12.20 ? 141 TRP A CE2   1 
ATOM   1103 C  CE3   . TRP A 1 141 ? -2.731  15.895 41.037 1.00 12.01 ? 141 TRP A CE3   1 
ATOM   1104 C  CZ2   . TRP A 1 141 ? -3.979  16.829 38.660 1.00 13.51 ? 141 TRP A CZ2   1 
ATOM   1105 C  CZ3   . TRP A 1 141 ? -4.083  16.264 41.017 1.00 14.63 ? 141 TRP A CZ3   1 
ATOM   1106 C  CH2   . TRP A 1 141 ? -4.687  16.723 39.833 1.00 12.29 ? 141 TRP A CH2   1 
ATOM   1107 N  N     . ASN A 1 142 ? 2.806   12.958 41.139 1.00 12.60 ? 142 ASN A N     1 
ATOM   1108 C  CA    . ASN A 1 142 ? 3.566   12.440 42.277 1.00 13.73 ? 142 ASN A CA    1 
ATOM   1109 C  C     . ASN A 1 142 ? 2.794   12.861 43.544 1.00 13.54 ? 142 ASN A C     1 
ATOM   1110 O  O     . ASN A 1 142 ? 3.382   13.316 44.534 1.00 10.80 ? 142 ASN A O     1 
ATOM   1111 C  CB    . ASN A 1 142 ? 4.982   13.018 42.344 1.00 17.05 ? 142 ASN A CB    1 
ATOM   1112 C  CG    . ASN A 1 142 ? 5.830   12.341 43.415 1.00 23.08 ? 142 ASN A CG    1 
ATOM   1113 O  OD1   . ASN A 1 142 ? 6.775   12.928 43.957 1.00 25.31 ? 142 ASN A OD1   1 
ATOM   1114 N  ND2   . ASN A 1 142 ? 5.498   11.095 43.719 1.00 23.15 ? 142 ASN A ND2   1 
ATOM   1115 N  N     . ALA A 1 143 ? 1.471   12.713 43.498 1.00 10.44 ? 143 ALA A N     1 
ATOM   1116 C  CA    . ALA A 1 143 ? 0.606   13.078 44.622 1.00 10.81 ? 143 ALA A CA    1 
ATOM   1117 C  C     . ALA A 1 143 ? -0.005  11.831 45.238 1.00 13.45 ? 143 ALA A C     1 
ATOM   1118 O  O     . ALA A 1 143 ? 0.020   10.762 44.635 1.00 14.21 ? 143 ALA A O     1 
ATOM   1119 C  CB    . ALA A 1 143 ? -0.515  14.003 44.140 1.00 11.15 ? 143 ALA A CB    1 
ATOM   1120 N  N     . ALA A 1 144 ? -0.564  11.968 46.435 1.00 11.53 ? 144 ALA A N     1 
ATOM   1121 C  CA    . ALA A 1 144 ? -1.199  10.829 47.077 1.00 12.09 ? 144 ALA A CA    1 
ATOM   1122 C  C     . ALA A 1 144 ? -2.530  10.649 46.370 1.00 11.37 ? 144 ALA A C     1 
ATOM   1123 O  O     . ALA A 1 144 ? -3.045  11.597 45.771 1.00 11.25 ? 144 ALA A O     1 
ATOM   1124 C  CB    . ALA A 1 144 ? -1.408  11.103 48.552 1.00 9.00  ? 144 ALA A CB    1 
ATOM   1125 N  N     . PHE A 1 145 ? -3.078  9.436  46.430 1.00 10.08 ? 145 PHE A N     1 
ATOM   1126 C  CA    . PHE A 1 145 ? -4.350  9.126  45.792 1.00 11.22 ? 145 PHE A CA    1 
ATOM   1127 C  C     . PHE A 1 145 ? -5.199  8.181  46.628 1.00 12.46 ? 145 PHE A C     1 
ATOM   1128 O  O     . PHE A 1 145 ? -4.695  7.246  47.241 1.00 12.42 ? 145 PHE A O     1 
ATOM   1129 C  CB    . PHE A 1 145 ? -4.139  8.480  44.426 1.00 11.56 ? 145 PHE A CB    1 
ATOM   1130 C  CG    . PHE A 1 145 ? -5.424  8.117  43.725 1.00 13.43 ? 145 PHE A CG    1 
ATOM   1131 C  CD1   . PHE A 1 145 ? -6.302  9.110  43.300 1.00 13.01 ? 145 PHE A CD1   1 
ATOM   1132 C  CD2   . PHE A 1 145 ? -5.763  6.782  43.505 1.00 12.60 ? 145 PHE A CD2   1 
ATOM   1133 C  CE1   . PHE A 1 145 ? -7.506  8.784  42.663 1.00 13.78 ? 145 PHE A CE1   1 
ATOM   1134 C  CE2   . PHE A 1 145 ? -6.973  6.445  42.865 1.00 14.35 ? 145 PHE A CE2   1 
ATOM   1135 C  CZ    . PHE A 1 145 ? -7.839  7.450  42.447 1.00 12.73 ? 145 PHE A CZ    1 
ATOM   1136 N  N     . LEU A 1 146 ? -6.500  8.428  46.621 1.00 12.36 ? 146 LEU A N     1 
ATOM   1137 C  CA    . LEU A 1 146 ? -7.445  7.607  47.353 1.00 14.56 ? 146 LEU A CA    1 
ATOM   1138 C  C     . LEU A 1 146 ? -8.816  7.874  46.735 1.00 15.37 ? 146 LEU A C     1 
ATOM   1139 O  O     . LEU A 1 146 ? -9.049  8.956  46.197 1.00 14.17 ? 146 LEU A O     1 
ATOM   1140 C  CB    . LEU A 1 146 ? -7.453  8.036  48.822 1.00 16.37 ? 146 LEU A CB    1 
ATOM   1141 C  CG    . LEU A 1 146 ? -7.232  7.033  49.953 1.00 21.88 ? 146 LEU A CG    1 
ATOM   1142 C  CD1   . LEU A 1 146 ? -6.113  6.068  49.619 1.00 22.59 ? 146 LEU A CD1   1 
ATOM   1143 C  CD2   . LEU A 1 146 ? -6.925  7.811  51.230 1.00 21.07 ? 146 LEU A CD2   1 
ATOM   1144 N  N     . GLU A 1 147 ? -9.699  6.881  46.769 1.00 14.46 ? 147 GLU A N     1 
ATOM   1145 C  CA    . GLU A 1 147 ? -11.054 7.085  46.286 1.00 16.36 ? 147 GLU A CA    1 
ATOM   1146 C  C     . GLU A 1 147 ? -11.829 7.120  47.592 1.00 16.18 ? 147 GLU A C     1 
ATOM   1147 O  O     . GLU A 1 147 ? -11.367 6.581  48.600 1.00 15.82 ? 147 GLU A O     1 
ATOM   1148 C  CB    . GLU A 1 147 ? -11.532 5.932  45.399 1.00 18.19 ? 147 GLU A CB    1 
ATOM   1149 C  CG    . GLU A 1 147 ? -10.817 5.843  44.057 1.00 20.33 ? 147 GLU A CG    1 
ATOM   1150 C  CD    . GLU A 1 147 ? -11.607 5.048  43.034 1.00 20.27 ? 147 GLU A CD    1 
ATOM   1151 O  OE1   . GLU A 1 147 ? -12.105 3.960  43.385 1.00 20.92 ? 147 GLU A OE1   1 
ATOM   1152 O  OE2   . GLU A 1 147 ? -11.726 5.503  41.876 1.00 18.40 ? 147 GLU A OE2   1 
ATOM   1153 N  N     . SER A 1 148 ? -12.987 7.762  47.601 1.00 15.33 ? 148 SER A N     1 
ATOM   1154 C  CA    . SER A 1 148 ? -13.747 7.854  48.835 1.00 17.91 ? 148 SER A CA    1 
ATOM   1155 C  C     . SER A 1 148 ? -15.243 7.938  48.612 1.00 18.33 ? 148 SER A C     1 
ATOM   1156 O  O     . SER A 1 148 ? -15.726 7.934  47.482 1.00 16.82 ? 148 SER A O     1 
ATOM   1157 C  CB    . SER A 1 148 ? -13.310 9.092  49.613 1.00 18.84 ? 148 SER A CB    1 
ATOM   1158 O  OG    . SER A 1 148 ? -13.643 10.266 48.886 1.00 18.74 ? 148 SER A OG    1 
ATOM   1159 N  N     . SER A 1 149 ? -15.964 8.013  49.723 1.00 18.26 ? 149 SER A N     1 
ATOM   1160 C  CA    . SER A 1 149 ? -17.410 8.139  49.709 1.00 19.16 ? 149 SER A CA    1 
ATOM   1161 C  C     . SER A 1 149 ? -17.808 8.922  50.957 1.00 20.89 ? 149 SER A C     1 
ATOM   1162 O  O     . SER A 1 149 ? -17.571 8.471  52.081 1.00 20.27 ? 149 SER A O     1 
ATOM   1163 C  CB    . SER A 1 149 ? -18.076 6.765  49.726 1.00 21.07 ? 149 SER A CB    1 
ATOM   1164 O  OG    . SER A 1 149 ? -19.473 6.906  49.915 1.00 22.65 ? 149 SER A OG    1 
ATOM   1165 N  N     . ALA A 1 150 ? -18.395 10.098 50.761 1.00 21.03 ? 150 ALA A N     1 
ATOM   1166 C  CA    . ALA A 1 150 ? -18.818 10.922 51.884 1.00 25.56 ? 150 ALA A CA    1 
ATOM   1167 C  C     . ALA A 1 150 ? -19.767 10.167 52.818 1.00 28.46 ? 150 ALA A C     1 
ATOM   1168 O  O     . ALA A 1 150 ? -20.032 10.617 53.935 1.00 30.45 ? 150 ALA A O     1 
ATOM   1169 C  CB    . ALA A 1 150 ? -19.483 12.193 51.380 1.00 25.98 ? 150 ALA A CB    1 
ATOM   1170 N  N     . LYS A 1 151 ? -20.269 9.021  52.367 1.00 29.08 ? 151 LYS A N     1 
ATOM   1171 C  CA    . LYS A 1 151 ? -21.187 8.219  53.175 1.00 32.63 ? 151 LYS A CA    1 
ATOM   1172 C  C     . LYS A 1 151 ? -20.457 7.194  54.046 1.00 33.29 ? 151 LYS A C     1 
ATOM   1173 O  O     . LYS A 1 151 ? -21.031 6.657  54.997 1.00 34.46 ? 151 LYS A O     1 
ATOM   1174 C  CB    . LYS A 1 151 ? -22.194 7.485  52.277 1.00 32.79 ? 151 LYS A CB    1 
ATOM   1175 C  CG    . LYS A 1 151 ? -23.084 8.400  51.440 1.00 34.59 ? 151 LYS A CG    1 
ATOM   1176 C  CD    . LYS A 1 151 ? -24.245 7.626  50.819 1.00 34.71 ? 151 LYS A CD    1 
ATOM   1177 C  CE    . LYS A 1 151 ? -25.143 8.543  50.009 1.00 34.84 ? 151 LYS A CE    1 
ATOM   1178 N  NZ    . LYS A 1 151 ? -26.451 7.920  49.665 1.00 34.91 ? 151 LYS A NZ    1 
ATOM   1179 N  N     . GLU A 1 152 ? -19.197 6.925  53.717 1.00 31.82 ? 152 GLU A N     1 
ATOM   1180 C  CA    . GLU A 1 152 ? -18.386 5.960  54.454 1.00 29.31 ? 152 GLU A CA    1 
ATOM   1181 C  C     . GLU A 1 152 ? -17.304 6.681  55.259 1.00 29.35 ? 152 GLU A C     1 
ATOM   1182 O  O     . GLU A 1 152 ? -16.220 6.979  54.748 1.00 26.51 ? 152 GLU A O     1 
ATOM   1183 C  CB    . GLU A 1 152 ? -17.769 4.963  53.468 1.00 32.02 ? 152 GLU A CB    1 
ATOM   1184 C  CG    . GLU A 1 152 ? -18.785 3.971  52.897 1.00 35.00 ? 152 GLU A CG    1 
ATOM   1185 C  CD    . GLU A 1 152 ? -18.312 3.270  51.631 1.00 37.06 ? 152 GLU A CD    1 
ATOM   1186 O  OE1   . GLU A 1 152 ? -17.162 2.781  51.594 1.00 40.03 ? 152 GLU A OE1   1 
ATOM   1187 O  OE2   . GLU A 1 152 ? -19.103 3.196  50.667 1.00 40.08 ? 152 GLU A OE2   1 
ATOM   1188 N  N     . ASN A 1 153 ? -17.612 6.951  56.527 1.00 27.88 ? 153 ASN A N     1 
ATOM   1189 C  CA    . ASN A 1 153 ? -16.715 7.671  57.429 1.00 26.87 ? 153 ASN A CA    1 
ATOM   1190 C  C     . ASN A 1 153 ? -15.246 7.262  57.406 1.00 26.51 ? 153 ASN A C     1 
ATOM   1191 O  O     . ASN A 1 153 ? -14.362 8.121  57.432 1.00 27.26 ? 153 ASN A O     1 
ATOM   1192 C  CB    . ASN A 1 153 ? -17.246 7.595  58.868 1.00 28.62 ? 153 ASN A CB    1 
ATOM   1193 C  CG    . ASN A 1 153 ? -16.396 8.390  59.852 1.00 28.09 ? 153 ASN A CG    1 
ATOM   1194 O  OD1   . ASN A 1 153 ? -15.421 7.879  60.406 1.00 29.21 ? 153 ASN A OD1   1 
ATOM   1195 N  ND2   . ASN A 1 153 ? -16.757 9.650  60.059 1.00 26.60 ? 153 ASN A ND2   1 
ATOM   1196 N  N     . GLN A 1 154 ? -14.971 5.964  57.357 1.00 25.58 ? 154 GLN A N     1 
ATOM   1197 C  CA    . GLN A 1 154 ? -13.584 5.525  57.353 1.00 26.31 ? 154 GLN A CA    1 
ATOM   1198 C  C     . GLN A 1 154 ? -12.814 5.989  56.118 1.00 25.48 ? 154 GLN A C     1 
ATOM   1199 O  O     . GLN A 1 154 ? -11.598 6.182  56.186 1.00 23.81 ? 154 GLN A O     1 
ATOM   1200 C  CB    . GLN A 1 154 ? -13.492 4.003  57.484 1.00 27.96 ? 154 GLN A CB    1 
ATOM   1201 C  CG    . GLN A 1 154 ? -12.075 3.513  57.747 1.00 30.93 ? 154 GLN A CG    1 
ATOM   1202 C  CD    . GLN A 1 154 ? -11.470 4.127  59.001 1.00 33.01 ? 154 GLN A CD    1 
ATOM   1203 O  OE1   . GLN A 1 154 ? -12.011 3.983  60.099 1.00 35.06 ? 154 GLN A OE1   1 
ATOM   1204 N  NE2   . GLN A 1 154 ? -10.342 4.815  58.843 1.00 31.99 ? 154 GLN A NE2   1 
ATOM   1205 N  N     . THR A 1 155 ? -13.507 6.171  54.994 1.00 23.84 ? 155 THR A N     1 
ATOM   1206 C  CA    . THR A 1 155 ? -12.827 6.627  53.781 1.00 22.34 ? 155 THR A CA    1 
ATOM   1207 C  C     . THR A 1 155 ? -12.509 8.115  53.914 1.00 21.50 ? 155 THR A C     1 
ATOM   1208 O  O     . THR A 1 155 ? -11.479 8.588  53.426 1.00 20.62 ? 155 THR A O     1 
ATOM   1209 C  CB    . THR A 1 155 ? -13.684 6.402  52.503 1.00 20.70 ? 155 THR A CB    1 
ATOM   1210 O  OG1   . THR A 1 155 ? -14.846 7.236  52.543 1.00 19.80 ? 155 THR A OG1   1 
ATOM   1211 C  CG2   . THR A 1 155 ? -14.109 4.944  52.390 1.00 21.68 ? 155 THR A CG2   1 
ATOM   1212 N  N     . ALA A 1 156 ? -13.396 8.847  54.584 1.00 21.87 ? 156 ALA A N     1 
ATOM   1213 C  CA    . ALA A 1 156 ? -13.205 10.276 54.802 1.00 21.98 ? 156 ALA A CA    1 
ATOM   1214 C  C     . ALA A 1 156 ? -12.054 10.499 55.781 1.00 22.55 ? 156 ALA A C     1 
ATOM   1215 O  O     . ALA A 1 156 ? -11.271 11.442 55.634 1.00 20.18 ? 156 ALA A O     1 
ATOM   1216 C  CB    . ALA A 1 156 ? -14.484 10.898 55.350 1.00 24.39 ? 156 ALA A CB    1 
ATOM   1217 N  N     . VAL A 1 157 ? -11.959 9.632  56.785 1.00 21.68 ? 157 VAL A N     1 
ATOM   1218 C  CA    . VAL A 1 157 ? -10.894 9.742  57.775 1.00 23.14 ? 157 VAL A CA    1 
ATOM   1219 C  C     . VAL A 1 157 ? -9.556  9.418  57.128 1.00 21.49 ? 157 VAL A C     1 
ATOM   1220 O  O     . VAL A 1 157 ? -8.554  10.079 57.403 1.00 22.74 ? 157 VAL A O     1 
ATOM   1221 C  CB    . VAL A 1 157 ? -11.109 8.775  58.968 1.00 22.86 ? 157 VAL A CB    1 
ATOM   1222 C  CG1   . VAL A 1 157 ? -9.916  8.833  59.905 1.00 24.26 ? 157 VAL A CG1   1 
ATOM   1223 C  CG2   . VAL A 1 157 ? -12.372 9.151  59.724 1.00 24.33 ? 157 VAL A CG2   1 
ATOM   1224 N  N     . ASP A 1 158 ? -9.541  8.399  56.272 1.00 20.13 ? 158 ASP A N     1 
ATOM   1225 C  CA    . ASP A 1 158 ? -8.314  8.003  55.595 1.00 20.18 ? 158 ASP A CA    1 
ATOM   1226 C  C     . ASP A 1 158 ? -7.799  9.133  54.716 1.00 19.01 ? 158 ASP A C     1 
ATOM   1227 O  O     . ASP A 1 158 ? -6.592  9.360  54.622 1.00 18.09 ? 158 ASP A O     1 
ATOM   1228 C  CB    . ASP A 1 158 ? -8.538  6.754  54.737 1.00 22.88 ? 158 ASP A CB    1 
ATOM   1229 C  CG    . ASP A 1 158 ? -8.828  5.511  55.569 1.00 25.48 ? 158 ASP A CG    1 
ATOM   1230 O  OD1   . ASP A 1 158 ? -8.407  5.462  56.745 1.00 23.23 ? 158 ASP A OD1   1 
ATOM   1231 O  OD2   . ASP A 1 158 ? -9.463  4.578  55.036 1.00 26.29 ? 158 ASP A OD2   1 
ATOM   1232 N  N     . VAL A 1 159 ? -8.719  9.834  54.064 1.00 16.64 ? 159 VAL A N     1 
ATOM   1233 C  CA    . VAL A 1 159 ? -8.339  10.952 53.209 1.00 15.67 ? 159 VAL A CA    1 
ATOM   1234 C  C     . VAL A 1 159 ? -7.587  12.016 54.003 1.00 16.91 ? 159 VAL A C     1 
ATOM   1235 O  O     . VAL A 1 159 ? -6.457  12.367 53.665 1.00 16.96 ? 159 VAL A O     1 
ATOM   1236 C  CB    . VAL A 1 159 ? -9.585  11.586 52.542 1.00 14.67 ? 159 VAL A CB    1 
ATOM   1237 C  CG1   . VAL A 1 159 ? -9.263  12.991 52.029 1.00 14.80 ? 159 VAL A CG1   1 
ATOM   1238 C  CG2   . VAL A 1 159 ? -10.040 10.700 51.377 1.00 12.37 ? 159 VAL A CG2   1 
ATOM   1239 N  N     . PHE A 1 160 ? -8.203  12.522 55.068 1.00 17.64 ? 160 PHE A N     1 
ATOM   1240 C  CA    . PHE A 1 160 ? -7.562  13.563 55.864 1.00 17.12 ? 160 PHE A CA    1 
ATOM   1241 C  C     . PHE A 1 160 ? -6.292  13.103 56.580 1.00 17.65 ? 160 PHE A C     1 
ATOM   1242 O  O     . PHE A 1 160 ? -5.332  13.869 56.689 1.00 18.95 ? 160 PHE A O     1 
ATOM   1243 C  CB    . PHE A 1 160 ? -8.584  14.173 56.826 1.00 17.86 ? 160 PHE A CB    1 
ATOM   1244 C  CG    . PHE A 1 160 ? -9.547  15.115 56.145 1.00 19.19 ? 160 PHE A CG    1 
ATOM   1245 C  CD1   . PHE A 1 160 ? -9.207  16.448 55.940 1.00 17.71 ? 160 PHE A CD1   1 
ATOM   1246 C  CD2   . PHE A 1 160 ? -10.761 14.653 55.644 1.00 20.44 ? 160 PHE A CD2   1 
ATOM   1247 C  CE1   . PHE A 1 160 ? -10.057 17.307 55.243 1.00 17.82 ? 160 PHE A CE1   1 
ATOM   1248 C  CE2   . PHE A 1 160 ? -11.617 15.508 54.945 1.00 20.06 ? 160 PHE A CE2   1 
ATOM   1249 C  CZ    . PHE A 1 160 ? -11.264 16.833 54.745 1.00 18.59 ? 160 PHE A CZ    1 
ATOM   1250 N  N     . ARG A 1 161 ? -6.259  11.856 57.044 1.00 19.06 ? 161 ARG A N     1 
ATOM   1251 C  CA    . ARG A 1 161 ? -5.049  11.353 57.694 1.00 20.57 ? 161 ARG A CA    1 
ATOM   1252 C  C     . ARG A 1 161 ? -3.932  11.318 56.644 1.00 20.71 ? 161 ARG A C     1 
ATOM   1253 O  O     . ARG A 1 161 ? -2.772  11.652 56.917 1.00 18.98 ? 161 ARG A O     1 
ATOM   1254 C  CB    . ARG A 1 161 ? -5.266  9.933  58.233 1.00 23.38 ? 161 ARG A CB    1 
ATOM   1255 C  CG    . ARG A 1 161 ? -6.315  9.829  59.332 1.00 28.58 ? 161 ARG A CG    1 
ATOM   1256 C  CD    . ARG A 1 161 ? -6.314  8.449  59.966 1.00 34.00 ? 161 ARG A CD    1 
ATOM   1257 N  NE    . ARG A 1 161 ? -5.047  8.169  60.634 1.00 40.05 ? 161 ARG A NE    1 
ATOM   1258 C  CZ    . ARG A 1 161 ? -4.793  7.069  61.336 1.00 43.31 ? 161 ARG A CZ    1 
ATOM   1259 N  NH1   . ARG A 1 161 ? -5.721  6.129  61.467 1.00 46.84 ? 161 ARG A NH1   1 
ATOM   1260 N  NH2   . ARG A 1 161 ? -3.608  6.912  61.914 1.00 44.50 ? 161 ARG A NH2   1 
ATOM   1261 N  N     . ARG A 1 162 ? -4.301  10.912 55.434 1.00 19.59 ? 162 ARG A N     1 
ATOM   1262 C  CA    . ARG A 1 162 ? -3.356  10.805 54.334 1.00 18.92 ? 162 ARG A CA    1 
ATOM   1263 C  C     . ARG A 1 162 ? -2.703  12.130 53.938 1.00 19.57 ? 162 ARG A C     1 
ATOM   1264 O  O     . ARG A 1 162 ? -1.488  12.173 53.733 1.00 17.75 ? 162 ARG A O     1 
ATOM   1265 C  CB    . ARG A 1 162 ? -4.038  10.178 53.116 1.00 18.94 ? 162 ARG A CB    1 
ATOM   1266 C  CG    . ARG A 1 162 ? -3.071  9.790  52.023 1.00 20.11 ? 162 ARG A CG    1 
ATOM   1267 C  CD    . ARG A 1 162 ? -1.945  8.944  52.586 1.00 20.43 ? 162 ARG A CD    1 
ATOM   1268 N  NE    . ARG A 1 162 ? -0.723  9.148  51.825 1.00 25.84 ? 162 ARG A NE    1 
ATOM   1269 C  CZ    . ARG A 1 162 ? -0.425  8.523  50.696 1.00 28.53 ? 162 ARG A CZ    1 
ATOM   1270 N  NH1   . ARG A 1 162 ? -1.265  7.631  50.193 1.00 32.78 ? 162 ARG A NH1   1 
ATOM   1271 N  NH2   . ARG A 1 162 ? 0.700   8.818  50.052 1.00 31.16 ? 162 ARG A NH2   1 
ATOM   1272 N  N     . ILE A 1 163 ? -3.488  13.205 53.826 1.00 19.47 ? 163 ILE A N     1 
ATOM   1273 C  CA    . ILE A 1 163 ? -2.914  14.499 53.444 1.00 18.47 ? 163 ILE A CA    1 
ATOM   1274 C  C     . ILE A 1 163 ? -1.953  14.987 54.527 1.00 20.53 ? 163 ILE A C     1 
ATOM   1275 O  O     . ILE A 1 163 ? -0.955  15.654 54.233 1.00 17.85 ? 163 ILE A O     1 
ATOM   1276 C  CB    . ILE A 1 163 ? -3.996  15.585 53.193 1.00 18.31 ? 163 ILE A CB    1 
ATOM   1277 C  CG1   . ILE A 1 163 ? -3.325  16.882 52.720 1.00 16.66 ? 163 ILE A CG1   1 
ATOM   1278 C  CG2   . ILE A 1 163 ? -4.776  15.874 54.471 1.00 18.57 ? 163 ILE A CG2   1 
ATOM   1279 C  CD1   . ILE A 1 163 ? -2.398  16.697 51.526 1.00 17.23 ? 163 ILE A CD1   1 
ATOM   1280 N  N     . ILE A 1 164 ? -2.254  14.643 55.777 1.00 20.90 ? 164 ILE A N     1 
ATOM   1281 C  CA    . ILE A 1 164 ? -1.397  15.018 56.898 1.00 22.50 ? 164 ILE A CA    1 
ATOM   1282 C  C     . ILE A 1 164 ? -0.031  14.349 56.740 1.00 22.50 ? 164 ILE A C     1 
ATOM   1283 O  O     . ILE A 1 164 ? 1.005   14.974 56.963 1.00 22.55 ? 164 ILE A O     1 
ATOM   1284 C  CB    . ILE A 1 164 ? -2.023  14.588 58.242 1.00 23.37 ? 164 ILE A CB    1 
ATOM   1285 C  CG1   . ILE A 1 164 ? -3.225  15.483 58.551 1.00 23.54 ? 164 ILE A CG1   1 
ATOM   1286 C  CG2   . ILE A 1 164 ? -0.993  14.668 59.361 1.00 22.60 ? 164 ILE A CG2   1 
ATOM   1287 C  CD1   . ILE A 1 164 ? -3.951  15.107 59.814 1.00 25.85 ? 164 ILE A CD1   1 
ATOM   1288 N  N     . LEU A 1 165 ? -0.035  13.079 56.342 1.00 23.62 ? 165 LEU A N     1 
ATOM   1289 C  CA    . LEU A 1 165 ? 1.210   12.339 56.152 1.00 23.30 ? 165 LEU A CA    1 
ATOM   1290 C  C     . LEU A 1 165 ? 1.957   12.875 54.938 1.00 22.98 ? 165 LEU A C     1 
ATOM   1291 O  O     . LEU A 1 165 ? 3.184   12.974 54.944 1.00 22.24 ? 165 LEU A O     1 
ATOM   1292 C  CB    . LEU A 1 165 ? 0.917   10.850 55.978 1.00 26.17 ? 165 LEU A CB    1 
ATOM   1293 C  CG    . LEU A 1 165 ? 0.152   10.209 57.141 1.00 27.47 ? 165 LEU A CG    1 
ATOM   1294 C  CD1   . LEU A 1 165 ? -0.046  8.719  56.865 1.00 29.81 ? 165 LEU A CD1   1 
ATOM   1295 C  CD2   . LEU A 1 165 ? 0.917   10.412 58.437 1.00 28.61 ? 165 LEU A CD2   1 
ATOM   1296 N  N     . GLU A 1 166 ? 1.217   13.221 53.890 1.00 22.25 ? 166 GLU A N     1 
ATOM   1297 C  CA    . GLU A 1 166 ? 1.847   13.769 52.698 1.00 24.46 ? 166 GLU A CA    1 
ATOM   1298 C  C     . GLU A 1 166 ? 2.555   15.061 53.112 1.00 25.78 ? 166 GLU A C     1 
ATOM   1299 O  O     . GLU A 1 166 ? 3.698   15.306 52.734 1.00 26.43 ? 166 GLU A O     1 
ATOM   1300 C  CB    . GLU A 1 166 ? 0.798   14.069 51.627 1.00 23.08 ? 166 GLU A CB    1 
ATOM   1301 C  CG    . GLU A 1 166 ? 1.384   14.500 50.293 1.00 24.70 ? 166 GLU A CG    1 
ATOM   1302 C  CD    . GLU A 1 166 ? 2.087   13.364 49.569 1.00 25.80 ? 166 GLU A CD    1 
ATOM   1303 O  OE1   . GLU A 1 166 ? 2.135   12.238 50.115 1.00 22.86 ? 166 GLU A OE1   1 
ATOM   1304 O  OE2   . GLU A 1 166 ? 2.589   13.600 48.451 1.00 25.49 ? 166 GLU A OE2   1 
ATOM   1305 N  N     . ALA A 1 167 ? 1.872   15.880 53.903 1.00 27.48 ? 167 ALA A N     1 
ATOM   1306 C  CA    . ALA A 1 167 ? 2.452   17.135 54.370 1.00 31.07 ? 167 ALA A CA    1 
ATOM   1307 C  C     . ALA A 1 167 ? 3.742   16.853 55.138 1.00 33.14 ? 167 ALA A C     1 
ATOM   1308 O  O     . ALA A 1 167 ? 4.784   17.447 54.860 1.00 34.24 ? 167 ALA A O     1 
ATOM   1309 C  CB    . ALA A 1 167 ? 1.462   17.868 55.264 1.00 29.25 ? 167 ALA A CB    1 
ATOM   1310 N  N     . GLU A 1 168 ? 3.672   15.942 56.101 1.00 35.81 ? 168 GLU A N     1 
ATOM   1311 C  CA    . GLU A 1 168 ? 4.844   15.595 56.898 1.00 40.06 ? 168 GLU A CA    1 
ATOM   1312 C  C     . GLU A 1 168 ? 5.967   15.051 56.017 1.00 41.53 ? 168 GLU A C     1 
ATOM   1313 O  O     . GLU A 1 168 ? 7.142   15.324 56.255 1.00 41.98 ? 168 GLU A O     1 
ATOM   1314 C  CB    . GLU A 1 168 ? 4.469   14.563 57.964 1.00 41.23 ? 168 GLU A CB    1 
ATOM   1315 C  CG    . GLU A 1 168 ? 3.337   15.008 58.884 1.00 46.52 ? 168 GLU A CG    1 
ATOM   1316 C  CD    . GLU A 1 168 ? 3.712   16.189 59.772 1.00 49.54 ? 168 GLU A CD    1 
ATOM   1317 O  OE1   . GLU A 1 168 ? 4.186   17.219 59.244 1.00 50.96 ? 168 GLU A OE1   1 
ATOM   1318 O  OE2   . GLU A 1 168 ? 3.524   16.090 61.003 1.00 50.47 ? 168 GLU A OE2   1 
ATOM   1319 N  N     . LYS A 1 169 ? 5.601   14.285 54.995 1.00 43.30 ? 169 LYS A N     1 
ATOM   1320 C  CA    . LYS A 1 169 ? 6.586   13.711 54.086 1.00 46.16 ? 169 LYS A CA    1 
ATOM   1321 C  C     . LYS A 1 169 ? 7.340   14.799 53.323 1.00 47.82 ? 169 LYS A C     1 
ATOM   1322 O  O     . LYS A 1 169 ? 8.572   14.789 53.269 1.00 48.00 ? 169 LYS A O     1 
ATOM   1323 C  CB    . LYS A 1 169 ? 5.904   12.764 53.093 1.00 47.23 ? 169 LYS A CB    1 
ATOM   1324 C  CG    . LYS A 1 169 ? 6.875   12.008 52.198 1.00 48.54 ? 169 LYS A CG    1 
ATOM   1325 C  CD    . LYS A 1 169 ? 6.149   11.082 51.237 1.00 50.23 ? 169 LYS A CD    1 
ATOM   1326 C  CE    . LYS A 1 169 ? 5.334   11.870 50.228 1.00 51.58 ? 169 LYS A CE    1 
ATOM   1327 N  NZ    . LYS A 1 169 ? 6.206   12.788 49.441 1.00 52.82 ? 169 LYS A NZ    1 
ATOM   1328 N  N     . LEU A 1 170 ? 6.599   15.734 52.731 1.00 49.31 ? 170 LEU A N     1 
ATOM   1329 C  CA    . LEU A 1 170 ? 7.209   16.828 51.980 1.00 50.97 ? 170 LEU A CA    1 
ATOM   1330 C  C     . LEU A 1 170 ? 7.958   17.763 52.920 1.00 52.88 ? 170 LEU A C     1 
ATOM   1331 O  O     . LEU A 1 170 ? 8.828   18.522 52.497 1.00 54.09 ? 170 LEU A O     1 
ATOM   1332 C  CB    . LEU A 1 170 ? 6.143   17.616 51.210 1.00 49.96 ? 170 LEU A CB    1 
ATOM   1333 C  CG    . LEU A 1 170 ? 5.622   17.043 49.886 1.00 50.84 ? 170 LEU A CG    1 
ATOM   1334 C  CD1   . LEU A 1 170 ? 6.766   16.958 48.884 1.00 51.01 ? 170 LEU A CD1   1 
ATOM   1335 C  CD2   . LEU A 1 170 ? 5.004   15.676 50.109 1.00 50.75 ? 170 LEU A CD2   1 
ATOM   1336 N  N     . GLU A 1 171 ? 7.611   17.700 54.199 1.00 54.80 ? 171 GLU A N     1 
ATOM   1337 C  CA    . GLU A 1 171 ? 8.240   18.529 55.217 1.00 57.66 ? 171 GLU A CA    1 
ATOM   1338 C  C     . GLU A 1 171 ? 9.720   18.174 55.378 1.00 58.69 ? 171 GLU A C     1 
ATOM   1339 O  O     . GLU A 1 171 ? 10.168  17.215 54.716 1.00 59.90 ? 171 GLU A O     1 
ATOM   1340 C  CB    . GLU A 1 171 ? 7.501   18.335 56.540 1.00 58.87 ? 171 GLU A CB    1 
ATOM   1341 C  CG    . GLU A 1 171 ? 8.131   19.003 57.738 1.00 61.56 ? 171 GLU A CG    1 
ATOM   1342 C  CD    . GLU A 1 171 ? 7.394   18.673 59.017 1.00 63.48 ? 171 GLU A CD    1 
ATOM   1343 O  OE1   . GLU A 1 171 ? 6.228   19.101 59.159 1.00 63.93 ? 171 GLU A OE1   1 
ATOM   1344 O  OE2   . GLU A 1 171 ? 7.978   17.977 59.875 1.00 65.66 ? 171 GLU A OE2   1 
HETATM 1345 MG MG    . MG  B 2 .   ? -19.820 22.696 49.097 1.00 30.99 ? 202 MG  A MG    1 
HETATM 1346 P  PB    . GDP C 3 .   ? -19.432 20.240 46.919 1.00 25.85 ? 201 GDP A PB    1 
HETATM 1347 O  O1B   . GDP C 3 .   ? -20.078 21.369 46.225 1.00 24.82 ? 201 GDP A O1B   1 
HETATM 1348 O  O2B   . GDP C 3 .   ? -18.254 19.686 46.225 1.00 25.88 ? 201 GDP A O2B   1 
HETATM 1349 O  O3B   . GDP C 3 .   ? -19.032 20.550 48.311 1.00 26.30 ? 201 GDP A O3B   1 
HETATM 1350 O  O3A   . GDP C 3 .   ? -20.498 19.046 46.974 1.00 23.21 ? 201 GDP A O3A   1 
HETATM 1351 P  PA    . GDP C 3 .   ? -21.542 18.633 48.165 1.00 26.32 ? 201 GDP A PA    1 
HETATM 1352 O  O1A   . GDP C 3 .   ? -22.464 19.744 48.364 1.00 27.25 ? 201 GDP A O1A   1 
HETATM 1353 O  O2A   . GDP C 3 .   ? -20.724 18.197 49.308 1.00 25.54 ? 201 GDP A O2A   1 
HETATM 1354 O  "O5'" . GDP C 3 .   ? -22.246 17.375 47.491 1.00 24.62 ? 201 GDP A "O5'" 1 
HETATM 1355 C  "C5'" . GDP C 3 .   ? -23.111 17.532 46.348 1.00 24.44 ? 201 GDP A "C5'" 1 
HETATM 1356 C  "C4'" . GDP C 3 .   ? -24.177 16.449 46.282 1.00 25.23 ? 201 GDP A "C4'" 1 
HETATM 1357 O  "O4'" . GDP C 3 .   ? -23.507 15.174 46.117 1.00 24.01 ? 201 GDP A "O4'" 1 
HETATM 1358 C  "C3'" . GDP C 3 .   ? -25.039 16.321 47.538 1.00 25.95 ? 201 GDP A "C3'" 1 
HETATM 1359 O  "O3'" . GDP C 3 .   ? -26.348 16.025 47.026 1.00 24.41 ? 201 GDP A "O3'" 1 
HETATM 1360 C  "C2'" . GDP C 3 .   ? -24.380 15.125 48.287 1.00 26.49 ? 201 GDP A "C2'" 1 
HETATM 1361 O  "O2'" . GDP C 3 .   ? -25.325 14.396 49.120 1.00 27.83 ? 201 GDP A "O2'" 1 
HETATM 1362 C  "C1'" . GDP C 3 .   ? -23.852 14.246 47.162 1.00 24.77 ? 201 GDP A "C1'" 1 
HETATM 1363 N  N9    . GDP C 3 .   ? -22.613 13.510 47.549 1.00 21.80 ? 201 GDP A N9    1 
HETATM 1364 C  C8    . GDP C 3 .   ? -21.397 14.005 48.004 1.00 21.13 ? 201 GDP A C8    1 
HETATM 1365 N  N7    . GDP C 3 .   ? -20.487 13.095 48.258 1.00 20.10 ? 201 GDP A N7    1 
HETATM 1366 C  C5    . GDP C 3 .   ? -21.152 11.915 47.948 1.00 20.73 ? 201 GDP A C5    1 
HETATM 1367 C  C6    . GDP C 3 .   ? -20.731 10.572 48.000 1.00 19.88 ? 201 GDP A C6    1 
HETATM 1368 O  O6    . GDP C 3 .   ? -19.619 10.133 48.352 1.00 18.54 ? 201 GDP A O6    1 
HETATM 1369 N  N1    . GDP C 3 .   ? -21.708 9.669  47.601 1.00 20.81 ? 201 GDP A N1    1 
HETATM 1370 C  C2    . GDP C 3 .   ? -22.995 10.014 47.181 1.00 21.86 ? 201 GDP A C2    1 
HETATM 1371 N  N2    . GDP C 3 .   ? -23.821 9.046  46.829 1.00 23.25 ? 201 GDP A N2    1 
HETATM 1372 N  N3    . GDP C 3 .   ? -23.417 11.275 47.122 1.00 21.29 ? 201 GDP A N3    1 
HETATM 1373 C  C4    . GDP C 3 .   ? -22.465 12.171 47.512 1.00 21.44 ? 201 GDP A C4    1 
HETATM 1374 O  O     . HOH D 4 .   ? -22.008 21.893 49.586 1.00 27.18 ? 203 HOH A O     1 
HETATM 1375 O  O     . HOH D 4 .   ? -19.768 23.933 47.086 1.00 20.14 ? 204 HOH A O     1 
HETATM 1376 O  O     . HOH D 4 .   ? -17.516 23.216 49.074 1.00 16.53 ? 205 HOH A O     1 
HETATM 1377 O  O     . HOH D 4 .   ? -20.242 24.787 50.245 1.00 24.47 ? 206 HOH A O     1 
HETATM 1378 O  O     . HOH D 4 .   ? -20.774 14.299 40.685 1.00 17.02 ? 207 HOH A O     1 
HETATM 1379 O  O     . HOH D 4 .   ? -26.381 14.718 44.546 1.00 29.96 ? 208 HOH A O     1 
HETATM 1380 O  O     . HOH D 4 .   ? -18.463 23.618 44.820 1.00 29.65 ? 209 HOH A O     1 
HETATM 1381 O  O     . HOH D 4 .   ? -21.657 4.472  34.639 1.00 14.98 ? 210 HOH A O     1 
HETATM 1382 O  O     . HOH D 4 .   ? -11.058 7.175  39.972 1.00 10.96 ? 211 HOH A O     1 
HETATM 1383 O  O     . HOH D 4 .   ? -13.156 18.485 40.554 1.00 10.65 ? 212 HOH A O     1 
HETATM 1384 O  O     . HOH D 4 .   ? -2.218  9.738  29.970 1.00 71.36 ? 213 HOH A O     1 
HETATM 1385 O  O     . HOH D 4 .   ? -6.601  11.167 32.157 1.00 13.93 ? 214 HOH A O     1 
HETATM 1386 O  O     . HOH D 4 .   ? -16.775 6.377  31.048 1.00 28.48 ? 215 HOH A O     1 
HETATM 1387 O  O     . HOH D 4 .   ? -5.206  9.556  34.179 1.00 15.20 ? 216 HOH A O     1 
HETATM 1388 O  O     . HOH D 4 .   ? -19.530 16.830 40.079 1.00 16.57 ? 217 HOH A O     1 
HETATM 1389 O  O     . HOH D 4 .   ? -23.362 16.154 38.334 1.00 39.88 ? 218 HOH A O     1 
HETATM 1390 O  O     . HOH D 4 .   ? -2.742  13.399 32.820 1.00 26.78 ? 219 HOH A O     1 
HETATM 1391 O  O     . HOH D 4 .   ? -3.354  3.392  36.983 1.00 16.50 ? 220 HOH A O     1 
HETATM 1392 O  O     . HOH D 4 .   ? -2.979  27.819 66.274 1.00 51.02 ? 221 HOH A O     1 
HETATM 1393 O  O     . HOH D 4 .   ? -5.201  7.293  32.611 1.00 21.05 ? 222 HOH A O     1 
HETATM 1394 O  O     . HOH D 4 .   ? -13.293 7.972  31.679 1.00 22.25 ? 223 HOH A O     1 
HETATM 1395 O  O     . HOH D 4 .   ? -4.950  7.230  55.005 1.00 24.07 ? 224 HOH A O     1 
HETATM 1396 O  O     . HOH D 4 .   ? -13.522 15.873 28.367 1.00 38.17 ? 225 HOH A O     1 
HETATM 1397 O  O     . HOH D 4 .   ? -12.481 1.363  38.666 1.00 21.04 ? 226 HOH A O     1 
HETATM 1398 O  O     . HOH D 4 .   ? -8.433  19.076 31.592 1.00 12.45 ? 227 HOH A O     1 
HETATM 1399 O  O     . HOH D 4 .   ? -16.260 1.877  43.613 1.00 34.26 ? 228 HOH A O     1 
HETATM 1400 O  O     . HOH D 4 .   ? -24.942 10.236 36.985 1.00 16.04 ? 229 HOH A O     1 
HETATM 1401 O  O     . HOH D 4 .   ? -7.127  15.653 29.303 1.00 27.22 ? 230 HOH A O     1 
HETATM 1402 O  O     . HOH D 4 .   ? 4.983   9.693  40.438 1.00 16.29 ? 231 HOH A O     1 
HETATM 1403 O  O     . HOH D 4 .   ? -5.478  4.947  33.249 1.00 26.38 ? 232 HOH A O     1 
HETATM 1404 O  O     . HOH D 4 .   ? -3.258  6.598  49.240 1.00 46.65 ? 233 HOH A O     1 
HETATM 1405 O  O     . HOH D 4 .   ? 1.078   6.412  35.991 1.00 25.52 ? 234 HOH A O     1 
HETATM 1406 O  O     . HOH D 4 .   ? -4.591  14.531 30.569 1.00 24.60 ? 235 HOH A O     1 
HETATM 1407 O  O     . HOH D 4 .   ? -2.972  17.561 35.401 1.00 27.99 ? 236 HOH A O     1 
HETATM 1408 O  O     . HOH D 4 .   ? -1.230  7.230  46.763 1.00 16.65 ? 237 HOH A O     1 
HETATM 1409 O  O     . HOH D 4 .   ? -19.483 29.916 58.121 1.00 37.74 ? 238 HOH A O     1 
HETATM 1410 O  O     . HOH D 4 .   ? 3.628   8.407  42.718 1.00 38.96 ? 239 HOH A O     1 
HETATM 1411 O  O     . HOH D 4 .   ? -12.440 28.022 62.404 1.00 28.06 ? 240 HOH A O     1 
HETATM 1412 O  O     . HOH D 4 .   ? -22.174 9.447  35.748 1.00 18.07 ? 241 HOH A O     1 
HETATM 1413 O  O     . HOH D 4 .   ? 4.716   13.100 47.004 1.00 28.28 ? 242 HOH A O     1 
HETATM 1414 O  O     . HOH D 4 .   ? 2.055   15.755 47.177 1.00 24.33 ? 243 HOH A O     1 
HETATM 1415 O  O     . HOH D 4 .   ? -6.837  0.193  45.667 1.00 40.22 ? 244 HOH A O     1 
HETATM 1416 O  O     . HOH D 4 .   ? -14.952 21.163 65.771 1.00 41.17 ? 245 HOH A O     1 
HETATM 1417 O  O     . HOH D 4 .   ? 0.442   26.920 49.367 1.00 29.90 ? 246 HOH A O     1 
HETATM 1418 O  O     . HOH D 4 .   ? -8.642  4.901  60.935 1.00 36.53 ? 247 HOH A O     1 
HETATM 1419 O  O     . HOH D 4 .   ? -3.220  29.681 36.147 1.00 37.57 ? 248 HOH A O     1 
HETATM 1420 O  O     . HOH D 4 .   ? 0.527   28.466 51.594 1.00 36.77 ? 249 HOH A O     1 
HETATM 1421 O  O     . HOH D 4 .   ? -23.317 21.773 61.956 1.00 49.89 ? 250 HOH A O     1 
HETATM 1422 O  O     . HOH D 4 .   ? 10.447  15.260 49.961 1.00 34.94 ? 251 HOH A O     1 
HETATM 1423 O  O     . HOH D 4 .   ? -11.107 12.589 30.789 1.00 31.93 ? 252 HOH A O     1 
HETATM 1424 O  O     . HOH D 4 .   ? -14.239 7.902  62.927 1.00 37.19 ? 253 HOH A O     1 
HETATM 1425 O  O     . HOH D 4 .   ? -11.511 14.136 67.449 1.00 47.99 ? 254 HOH A O     1 
HETATM 1426 O  O     . HOH D 4 .   ? -14.953 3.828  34.778 1.00 29.95 ? 255 HOH A O     1 
HETATM 1427 O  O     . HOH D 4 .   ? -2.279  4.737  46.072 1.00 39.43 ? 256 HOH A O     1 
HETATM 1428 O  O     . HOH D 4 .   ? 6.385   10.645 47.785 1.00 43.75 ? 257 HOH A O     1 
HETATM 1429 O  O     . HOH D 4 .   ? -14.095 1.418  36.580 1.00 24.58 ? 258 HOH A O     1 
HETATM 1430 O  O     . HOH D 4 .   ? -16.818 32.613 54.130 1.00 34.27 ? 259 HOH A O     1 
HETATM 1431 O  O     . HOH D 4 .   ? -10.394 18.140 28.279 1.00 29.19 ? 260 HOH A O     1 
HETATM 1432 O  O     . HOH D 4 .   ? -2.511  7.283  31.490 1.00 32.75 ? 261 HOH A O     1 
HETATM 1433 O  O     . HOH D 4 .   ? -10.203 7.031  51.403 1.00 25.52 ? 262 HOH A O     1 
HETATM 1434 O  O     . HOH D 4 .   ? -8.929  4.311  47.583 1.00 16.20 ? 263 HOH A O     1 
HETATM 1435 O  O     . HOH D 4 .   ? -23.321 11.905 40.817 1.00 25.07 ? 264 HOH A O     1 
HETATM 1436 O  O     . HOH D 4 .   ? -18.036 2.853  41.938 1.00 39.68 ? 265 HOH A O     1 
HETATM 1437 O  O     . HOH D 4 .   ? -2.671  20.087 35.582 1.00 39.01 ? 266 HOH A O     1 
HETATM 1438 O  O     . HOH D 4 .   ? -8.968  9.816  31.454 1.00 35.29 ? 267 HOH A O     1 
HETATM 1439 O  O     . HOH D 4 .   ? -28.220 15.783 48.903 1.00 41.70 ? 268 HOH A O     1 
HETATM 1440 O  O     . HOH D 4 .   ? 0.797   8.669  35.223 1.00 32.04 ? 269 HOH A O     1 
HETATM 1441 O  O     . HOH D 4 .   ? -11.054 2.575  45.348 1.00 35.37 ? 270 HOH A O     1 
HETATM 1442 O  O     . HOH D 4 .   ? -11.905 10.170 30.973 1.00 40.72 ? 271 HOH A O     1 
HETATM 1443 O  O     . HOH D 4 .   ? -17.133 11.640 64.177 1.00 48.39 ? 272 HOH A O     1 
HETATM 1444 O  O     . HOH D 4 .   ? -17.207 24.938 33.443 1.00 35.35 ? 273 HOH A O     1 
HETATM 1445 O  O     . HOH D 4 .   ? -6.769  33.185 54.455 1.00 51.31 ? 274 HOH A O     1 
HETATM 1446 O  O     . HOH D 4 .   ? -5.254  16.980 28.274 1.00 36.62 ? 275 HOH A O     1 
HETATM 1447 O  O     . HOH D 4 .   ? -17.459 30.813 60.341 1.00 52.20 ? 276 HOH A O     1 
HETATM 1448 O  O     . HOH D 4 .   ? -5.506  27.681 33.194 1.00 53.62 ? 277 HOH A O     1 
HETATM 1449 O  O     . HOH D 4 .   ? 7.708   15.421 42.914 1.00 33.24 ? 278 HOH A O     1 
HETATM 1450 O  O     . HOH D 4 .   ? -27.682 10.249 56.119 1.00 41.74 ? 279 HOH A O     1 
HETATM 1451 O  O     . HOH D 4 .   ? -24.599 15.766 43.031 1.00 25.08 ? 280 HOH A O     1 
HETATM 1452 O  O     . HOH D 4 .   ? 4.237   6.424  48.055 1.00 45.78 ? 281 HOH A O     1 
HETATM 1453 O  O     . HOH D 4 .   ? -0.674  26.712 58.780 1.00 35.51 ? 282 HOH A O     1 
HETATM 1454 O  O     . HOH D 4 .   ? -27.814 29.042 48.293 1.00 42.70 ? 283 HOH A O     1 
HETATM 1455 O  O     . HOH D 4 .   ? -20.417 17.080 37.474 1.00 35.61 ? 284 HOH A O     1 
HETATM 1456 O  O     . HOH D 4 .   ? -25.153 28.680 42.993 1.00 35.95 ? 285 HOH A O     1 
HETATM 1457 O  O     . HOH D 4 .   ? 2.920   17.920 40.642 1.00 26.25 ? 286 HOH A O     1 
HETATM 1458 O  O     . HOH D 4 .   ? 5.458   5.765  41.328 1.00 41.05 ? 287 HOH A O     1 
HETATM 1459 O  O     . HOH D 4 .   ? -10.627 -0.688 38.049 1.00 48.22 ? 288 HOH A O     1 
HETATM 1460 O  O     . HOH D 4 .   ? -5.895  20.697 31.507 1.00 35.73 ? 289 HOH A O     1 
HETATM 1461 O  O     . HOH D 4 .   ? -21.337 14.462 55.336 1.00 27.59 ? 290 HOH A O     1 
HETATM 1462 O  O     . HOH D 4 .   ? -2.545  6.950  64.645 1.00 35.13 ? 291 HOH A O     1 
HETATM 1463 O  O     . HOH D 4 .   ? 1.150   25.195 36.380 1.00 30.34 ? 292 HOH A O     1 
HETATM 1464 O  O     . HOH D 4 .   ? 3.874   24.568 54.247 1.00 35.20 ? 293 HOH A O     1 
HETATM 1465 O  O     . HOH D 4 .   ? 11.294  15.382 53.098 1.00 43.16 ? 294 HOH A O     1 
HETATM 1466 O  O     . HOH D 4 .   ? -28.571 24.260 52.352 1.00 50.02 ? 295 HOH A O     1 
HETATM 1467 O  O     . HOH D 4 .   ? 4.470   23.937 63.076 1.00 39.95 ? 296 HOH A O     1 
HETATM 1468 O  O     . HOH D 4 .   ? -18.476 25.328 53.606 1.00 39.73 ? 297 HOH A O     1 
HETATM 1469 O  O     . HOH D 4 .   ? -8.130  27.470 32.566 1.00 44.99 ? 298 HOH A O     1 
HETATM 1470 O  O     . HOH D 4 .   ? -17.285 24.504 40.128 1.00 24.35 ? 299 HOH A O     1 
HETATM 1471 O  O     . HOH D 4 .   ? -3.826  30.359 44.789 1.00 36.70 ? 300 HOH A O     1 
HETATM 1472 O  O     . HOH D 4 .   ? -18.137 1.217  48.033 1.00 46.44 ? 301 HOH A O     1 
HETATM 1473 O  O     . HOH D 4 .   ? -0.023  12.651 32.369 1.00 32.63 ? 302 HOH A O     1 
HETATM 1474 O  O     . HOH D 4 .   ? -5.908  1.980  49.760 1.00 32.33 ? 303 HOH A O     1 
HETATM 1475 O  O     . HOH D 4 .   ? -5.726  31.015 53.673 1.00 33.28 ? 304 HOH A O     1 
HETATM 1476 O  O     . HOH D 4 .   ? -13.069 28.279 64.953 1.00 40.15 ? 305 HOH A O     1 
HETATM 1477 O  O     . HOH D 4 .   ? -15.879 30.403 37.303 1.00 36.14 ? 306 HOH A O     1 
HETATM 1478 O  O     . HOH D 4 .   ? 5.145   20.023 54.017 1.00 41.51 ? 307 HOH A O     1 
HETATM 1479 O  O     . HOH D 4 .   ? -16.643 20.000 68.133 1.00 37.08 ? 308 HOH A O     1 
HETATM 1480 O  O     . HOH D 4 .   ? -12.284 18.942 67.114 1.00 33.25 ? 309 HOH A O     1 
HETATM 1481 O  O     . HOH D 4 .   ? -3.218  3.567  33.599 1.00 33.36 ? 310 HOH A O     1 
HETATM 1482 O  O     . HOH D 4 .   ? -12.033 6.664  63.418 1.00 38.22 ? 311 HOH A O     1 
HETATM 1483 O  O     . HOH D 4 .   ? -15.040 11.461 61.580 1.00 32.90 ? 312 HOH A O     1 
HETATM 1484 O  O     . HOH D 4 .   ? 1.373   24.059 50.931 1.00 25.17 ? 313 HOH A O     1 
HETATM 1485 O  O     . HOH D 4 .   ? -17.351 24.758 64.829 1.00 51.53 ? 314 HOH A O     1 
HETATM 1486 O  O     . HOH D 4 .   ? -12.245 1.403  42.644 1.00 29.90 ? 315 HOH A O     1 
HETATM 1487 O  O     . HOH D 4 .   ? -22.540 1.509  47.274 1.00 35.52 ? 316 HOH A O     1 
HETATM 1488 O  O     . HOH D 4 .   ? -13.981 33.366 38.147 1.00 45.68 ? 317 HOH A O     1 
HETATM 1489 O  O     . HOH D 4 .   ? -25.866 5.007  41.057 1.00 45.33 ? 318 HOH A O     1 
HETATM 1490 O  O     . HOH D 4 .   ? -13.571 19.371 30.261 1.00 52.88 ? 319 HOH A O     1 
HETATM 1491 O  O     . HOH D 4 .   ? -3.877  25.229 67.937 1.00 33.25 ? 320 HOH A O     1 
HETATM 1492 O  O     . HOH D 4 .   ? -3.499  5.362  51.805 1.00 40.93 ? 321 HOH A O     1 
HETATM 1493 O  O     . HOH D 4 .   ? -15.962 23.155 62.847 1.00 35.84 ? 322 HOH A O     1 
HETATM 1494 O  O     . HOH D 4 .   ? -15.123 5.228  60.788 1.00 54.66 ? 323 HOH A O     1 
HETATM 1495 O  O     . HOH D 4 .   ? -3.648  1.164  38.183 1.00 36.46 ? 324 HOH A O     1 
HETATM 1496 O  O     . HOH D 4 .   ? -26.176 10.228 45.830 1.00 53.27 ? 325 HOH A O     1 
HETATM 1497 O  O     . HOH D 4 .   ? -15.421 29.795 58.648 1.00 32.61 ? 326 HOH A O     1 
HETATM 1498 O  O     . HOH D 4 .   ? -15.085 30.047 40.889 1.00 40.83 ? 327 HOH A O     1 
HETATM 1499 O  O     . HOH D 4 .   ? -5.185  11.058 30.061 1.00 31.34 ? 328 HOH A O     1 
HETATM 1500 O  O     . HOH D 4 .   ? -8.886  2.493  33.167 1.00 33.10 ? 329 HOH A O     1 
HETATM 1501 O  O     . HOH D 4 .   ? 1.611   18.575 42.663 1.00 29.67 ? 330 HOH A O     1 
HETATM 1502 O  O     . HOH D 4 .   ? -22.750 21.442 45.461 1.00 32.12 ? 331 HOH A O     1 
HETATM 1503 O  O     . HOH D 4 .   ? -13.500 30.467 55.633 1.00 38.19 ? 332 HOH A O     1 
HETATM 1504 O  O     . HOH D 4 .   ? 5.145   8.672  49.182 1.00 35.02 ? 333 HOH A O     1 
HETATM 1505 O  O     . HOH D 4 .   ? 3.553   13.126 70.910 1.00 39.24 ? 334 HOH A O     1 
HETATM 1506 O  O     . HOH D 4 .   ? 2.316   26.782 58.408 1.00 38.90 ? 335 HOH A O     1 
HETATM 1507 O  O     . HOH D 4 .   ? 3.086   10.329 47.546 1.00 48.91 ? 336 HOH A O     1 
HETATM 1508 O  O     . HOH D 4 .   ? 0.637   3.534  46.053 1.00 42.66 ? 337 HOH A O     1 
HETATM 1509 O  O     . HOH D 4 .   ? -5.149  -0.717 39.289 1.00 44.74 ? 338 HOH A O     1 
HETATM 1510 O  O     . HOH D 4 .   ? -1.453  4.972  53.344 1.00 34.21 ? 339 HOH A O     1 
HETATM 1511 O  O     . HOH D 4 .   ? -9.660  29.654 57.208 1.00 39.18 ? 340 HOH A O     1 
HETATM 1512 O  O     . HOH D 4 .   ? 1.688   30.815 48.800 1.00 35.95 ? 341 HOH A O     1 
HETATM 1513 O  O     . HOH D 4 .   ? -17.504 3.340  33.937 1.00 30.40 ? 342 HOH A O     1 
HETATM 1514 O  O     . HOH D 4 .   ? -25.016 19.629 49.264 1.00 49.05 ? 343 HOH A O     1 
HETATM 1515 O  O     . HOH D 4 .   ? -24.109 12.761 44.017 1.00 37.19 ? 344 HOH A O     1 
HETATM 1516 O  O     . HOH D 4 .   ? -9.785  4.127  51.909 1.00 50.52 ? 345 HOH A O     1 
HETATM 1517 O  O     . HOH D 4 .   ? -25.066 28.739 50.147 1.00 51.30 ? 346 HOH A O     1 
HETATM 1518 O  O     . HOH D 4 .   ? -15.657 18.247 65.701 1.00 37.20 ? 347 HOH A O     1 
HETATM 1519 O  O     . HOH D 4 .   ? -8.344  9.149  63.271 1.00 47.76 ? 348 HOH A O     1 
HETATM 1520 O  O     . HOH D 4 .   ? -25.078 10.224 58.673 1.00 44.61 ? 349 HOH A O     1 
HETATM 1521 O  O     . HOH D 4 .   ? 1.338   2.130  43.348 1.00 39.33 ? 350 HOH A O     1 
HETATM 1522 O  O     . HOH D 4 .   ? -17.346 27.081 27.233 1.00 38.05 ? 351 HOH A O     1 
HETATM 1523 O  O     . HOH D 4 .   ? -18.228 19.211 65.301 1.00 54.14 ? 352 HOH A O     1 
HETATM 1524 O  O     . HOH D 4 .   ? 1.847   16.399 44.247 1.00 21.89 ? 353 HOH A O     1 
HETATM 1525 O  O     . HOH D 4 .   ? -9.372  0.125  34.445 1.00 36.88 ? 354 HOH A O     1 
HETATM 1526 O  O     . HOH D 4 .   ? -24.677 15.886 51.318 1.00 28.11 ? 355 HOH A O     1 
HETATM 1527 O  O     . HOH D 4 .   ? -18.102 26.152 35.486 1.00 49.39 ? 356 HOH A O     1 
HETATM 1528 O  O     . HOH D 4 .   ? -19.366 24.171 34.370 1.00 33.37 ? 357 HOH A O     1 
HETATM 1529 O  O     . HOH D 4 .   ? -24.107 -0.694 37.643 1.00 55.15 ? 358 HOH A O     1 
HETATM 1530 O  O     . HOH D 4 .   ? 0.327   11.179 51.230 1.00 34.95 ? 359 HOH A O     1 
HETATM 1531 O  O     . HOH D 4 .   ? -24.316 21.237 40.645 1.00 52.24 ? 360 HOH A O     1 
HETATM 1532 O  O     . HOH D 4 .   ? -14.740 16.899 30.378 1.00 21.89 ? 361 HOH A O     1 
HETATM 1533 O  O     . HOH D 4 .   ? 1.069   8.405  43.202 1.00 34.65 ? 362 HOH A O     1 
HETATM 1534 O  O     . HOH D 4 .   ? -26.538 0.789  36.321 1.00 26.64 ? 363 HOH A O     1 
HETATM 1535 O  O     . HOH D 4 .   ? -2.894  10.916 34.028 1.00 16.73 ? 364 HOH A O     1 
HETATM 1536 O  O     . HOH D 4 .   ? -4.722  4.674  46.713 1.00 33.64 ? 365 HOH A O     1 
HETATM 1537 O  O     . HOH D 4 .   ? -3.390  2.937  50.260 1.00 45.68 ? 366 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   ARG 7   7   7   ARG ARG A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  TYR 35  35  35  TYR TYR A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 HIS 100 100 100 HIS HIS A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 MET 115 115 115 MET MET A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 HIS 124 124 124 HIS HIS A . n 
A 1 125 MET 125 125 125 MET MET A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 ARG 161 161 161 ARG ARG A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 HIS 172 172 ?   ?   ?   A . n 
A 1 173 HIS 173 173 ?   ?   ?   A . n 
A 1 174 HIS 174 174 ?   ?   ?   A . n 
A 1 175 HIS 175 175 ?   ?   ?   A . n 
A 1 176 HIS 176 176 ?   ?   ?   A . n 
A 1 177 HIS 177 177 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   202 2   MG  MG  A . 
C 3 GDP 1   201 1   GDP GDP A . 
D 4 HOH 1   203 1   HOH TIP A . 
D 4 HOH 2   204 2   HOH TIP A . 
D 4 HOH 3   205 3   HOH TIP A . 
D 4 HOH 4   206 4   HOH TIP A . 
D 4 HOH 5   207 5   HOH TIP A . 
D 4 HOH 6   208 6   HOH TIP A . 
D 4 HOH 7   209 7   HOH TIP A . 
D 4 HOH 8   210 8   HOH TIP A . 
D 4 HOH 9   211 9   HOH TIP A . 
D 4 HOH 10  212 10  HOH TIP A . 
D 4 HOH 11  213 11  HOH TIP A . 
D 4 HOH 12  214 12  HOH TIP A . 
D 4 HOH 13  215 13  HOH TIP A . 
D 4 HOH 14  216 14  HOH TIP A . 
D 4 HOH 15  217 15  HOH TIP A . 
D 4 HOH 16  218 16  HOH TIP A . 
D 4 HOH 17  219 17  HOH TIP A . 
D 4 HOH 18  220 18  HOH TIP A . 
D 4 HOH 19  221 19  HOH TIP A . 
D 4 HOH 20  222 20  HOH TIP A . 
D 4 HOH 21  223 21  HOH TIP A . 
D 4 HOH 22  224 22  HOH TIP A . 
D 4 HOH 23  225 23  HOH TIP A . 
D 4 HOH 24  226 24  HOH TIP A . 
D 4 HOH 25  227 25  HOH TIP A . 
D 4 HOH 26  228 26  HOH TIP A . 
D 4 HOH 27  229 27  HOH TIP A . 
D 4 HOH 28  230 28  HOH TIP A . 
D 4 HOH 29  231 29  HOH TIP A . 
D 4 HOH 30  232 30  HOH TIP A . 
D 4 HOH 31  233 31  HOH TIP A . 
D 4 HOH 32  234 32  HOH TIP A . 
D 4 HOH 33  235 33  HOH TIP A . 
D 4 HOH 34  236 34  HOH TIP A . 
D 4 HOH 35  237 35  HOH TIP A . 
D 4 HOH 36  238 36  HOH TIP A . 
D 4 HOH 37  239 37  HOH TIP A . 
D 4 HOH 38  240 38  HOH TIP A . 
D 4 HOH 39  241 39  HOH TIP A . 
D 4 HOH 40  242 40  HOH TIP A . 
D 4 HOH 41  243 41  HOH TIP A . 
D 4 HOH 42  244 42  HOH TIP A . 
D 4 HOH 43  245 43  HOH TIP A . 
D 4 HOH 44  246 44  HOH TIP A . 
D 4 HOH 45  247 45  HOH TIP A . 
D 4 HOH 46  248 46  HOH TIP A . 
D 4 HOH 47  249 47  HOH TIP A . 
D 4 HOH 48  250 48  HOH TIP A . 
D 4 HOH 49  251 49  HOH TIP A . 
D 4 HOH 50  252 50  HOH TIP A . 
D 4 HOH 51  253 51  HOH TIP A . 
D 4 HOH 52  254 52  HOH TIP A . 
D 4 HOH 53  255 53  HOH TIP A . 
D 4 HOH 54  256 54  HOH TIP A . 
D 4 HOH 55  257 55  HOH TIP A . 
D 4 HOH 56  258 56  HOH TIP A . 
D 4 HOH 57  259 57  HOH TIP A . 
D 4 HOH 58  260 58  HOH TIP A . 
D 4 HOH 59  261 59  HOH TIP A . 
D 4 HOH 60  262 60  HOH TIP A . 
D 4 HOH 61  263 61  HOH TIP A . 
D 4 HOH 62  264 62  HOH TIP A . 
D 4 HOH 63  265 63  HOH TIP A . 
D 4 HOH 64  266 64  HOH TIP A . 
D 4 HOH 65  267 65  HOH TIP A . 
D 4 HOH 66  268 66  HOH TIP A . 
D 4 HOH 67  269 67  HOH TIP A . 
D 4 HOH 68  270 68  HOH TIP A . 
D 4 HOH 69  271 69  HOH TIP A . 
D 4 HOH 70  272 70  HOH TIP A . 
D 4 HOH 71  273 71  HOH TIP A . 
D 4 HOH 72  274 72  HOH TIP A . 
D 4 HOH 73  275 73  HOH TIP A . 
D 4 HOH 74  276 74  HOH TIP A . 
D 4 HOH 75  277 75  HOH TIP A . 
D 4 HOH 76  278 76  HOH TIP A . 
D 4 HOH 77  279 77  HOH TIP A . 
D 4 HOH 78  280 78  HOH TIP A . 
D 4 HOH 79  281 79  HOH TIP A . 
D 4 HOH 80  282 80  HOH TIP A . 
D 4 HOH 81  283 81  HOH TIP A . 
D 4 HOH 82  284 82  HOH TIP A . 
D 4 HOH 83  285 83  HOH TIP A . 
D 4 HOH 84  286 84  HOH TIP A . 
D 4 HOH 85  287 85  HOH TIP A . 
D 4 HOH 86  288 86  HOH TIP A . 
D 4 HOH 87  289 87  HOH TIP A . 
D 4 HOH 88  290 88  HOH TIP A . 
D 4 HOH 89  291 89  HOH TIP A . 
D 4 HOH 90  292 90  HOH TIP A . 
D 4 HOH 91  293 91  HOH TIP A . 
D 4 HOH 92  294 92  HOH TIP A . 
D 4 HOH 93  295 93  HOH TIP A . 
D 4 HOH 94  296 94  HOH TIP A . 
D 4 HOH 95  297 95  HOH TIP A . 
D 4 HOH 96  298 96  HOH TIP A . 
D 4 HOH 97  299 97  HOH TIP A . 
D 4 HOH 98  300 98  HOH TIP A . 
D 4 HOH 99  301 99  HOH TIP A . 
D 4 HOH 100 302 100 HOH TIP A . 
D 4 HOH 101 303 101 HOH TIP A . 
D 4 HOH 102 304 102 HOH TIP A . 
D 4 HOH 103 305 103 HOH TIP A . 
D 4 HOH 104 306 104 HOH TIP A . 
D 4 HOH 105 307 105 HOH TIP A . 
D 4 HOH 106 308 106 HOH TIP A . 
D 4 HOH 107 309 107 HOH TIP A . 
D 4 HOH 108 310 108 HOH TIP A . 
D 4 HOH 109 311 109 HOH TIP A . 
D 4 HOH 110 312 110 HOH TIP A . 
D 4 HOH 111 313 111 HOH TIP A . 
D 4 HOH 112 314 112 HOH TIP A . 
D 4 HOH 113 315 113 HOH TIP A . 
D 4 HOH 114 316 114 HOH TIP A . 
D 4 HOH 115 317 115 HOH TIP A . 
D 4 HOH 116 318 116 HOH TIP A . 
D 4 HOH 117 319 117 HOH TIP A . 
D 4 HOH 118 320 118 HOH TIP A . 
D 4 HOH 119 321 119 HOH TIP A . 
D 4 HOH 120 322 120 HOH TIP A . 
D 4 HOH 121 323 121 HOH TIP A . 
D 4 HOH 122 324 122 HOH TIP A . 
D 4 HOH 123 325 123 HOH TIP A . 
D 4 HOH 124 326 124 HOH TIP A . 
D 4 HOH 125 327 125 HOH TIP A . 
D 4 HOH 126 328 126 HOH TIP A . 
D 4 HOH 127 329 127 HOH TIP A . 
D 4 HOH 128 330 128 HOH TIP A . 
D 4 HOH 129 331 129 HOH TIP A . 
D 4 HOH 130 332 130 HOH TIP A . 
D 4 HOH 131 333 131 HOH TIP A . 
D 4 HOH 132 334 132 HOH TIP A . 
D 4 HOH 133 335 133 HOH TIP A . 
D 4 HOH 134 336 134 HOH TIP A . 
D 4 HOH 135 337 135 HOH TIP A . 
D 4 HOH 136 338 136 HOH TIP A . 
D 4 HOH 137 339 137 HOH TIP A . 
D 4 HOH 138 340 138 HOH TIP A . 
D 4 HOH 139 341 139 HOH TIP A . 
D 4 HOH 140 342 140 HOH TIP A . 
D 4 HOH 141 343 141 HOH TIP A . 
D 4 HOH 142 344 142 HOH TIP A . 
D 4 HOH 143 345 143 HOH TIP A . 
D 4 HOH 144 346 144 HOH TIP A . 
D 4 HOH 145 347 145 HOH TIP A . 
D 4 HOH 146 348 146 HOH TIP A . 
D 4 HOH 147 349 147 HOH TIP A . 
D 4 HOH 148 350 148 HOH TIP A . 
D 4 HOH 149 351 149 HOH TIP A . 
D 4 HOH 150 352 150 HOH TIP A . 
D 4 HOH 151 353 151 HOH TIP A . 
D 4 HOH 152 354 152 HOH TIP A . 
D 4 HOH 153 355 153 HOH TIP A . 
D 4 HOH 154 356 154 HOH TIP A . 
D 4 HOH 155 357 155 HOH TIP A . 
D 4 HOH 156 358 156 HOH TIP A . 
D 4 HOH 157 359 157 HOH TIP A . 
D 4 HOH 158 360 158 HOH TIP A . 
D 4 HOH 159 361 159 HOH TIP A . 
D 4 HOH 160 362 160 HOH TIP A . 
D 4 HOH 161 363 161 HOH TIP A . 
D 4 HOH 162 364 162 HOH TIP A . 
D 4 HOH 163 365 163 HOH TIP A . 
D 4 HOH 164 366 164 HOH TIP A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? D HOH . ? A HOH 203 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O3B ? C GDP .  ? A GDP 201 ? 1_555 93.8  ? 
2  O   ? D HOH . ? A HOH 203 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 204 ? 1_555 111.8 ? 
3  O3B ? C GDP . ? A GDP 201 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 204 ? 1_555 100.4 ? 
4  O   ? D HOH . ? A HOH 203 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 166.5 ? 
5  O3B ? C GDP . ? A GDP 201 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 82.8  ? 
6  O   ? D HOH . ? A HOH 204 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 205 ? 1_555 81.7  ? 
7  O   ? D HOH . ? A HOH 203 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 206 ? 1_555 91.9  ? 
8  O3B ? C GDP . ? A GDP 201 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 206 ? 1_555 167.7 ? 
9  O   ? D HOH . ? A HOH 204 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 206 ? 1_555 87.4  ? 
10 O   ? D HOH . ? A HOH 205 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 O   ? D HOH .  ? A HOH 206 ? 1_555 89.1  ? 
11 O   ? D HOH . ? A HOH 203 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 83.4  ? 
12 O3B ? C GDP . ? A GDP 201 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 84.9  ? 
13 O   ? D HOH . ? A HOH 204 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 163.2 ? 
14 O   ? D HOH . ? A HOH 205 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 83.3  ? 
15 O   ? D HOH . ? A HOH 206 ? 1_555 MG ? B MG . ? A MG 202 ? 1_555 OG  ? A SER 20 ? A SER 20  ? 1_555 85.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-03-08 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TRUNCATE 'data reduction' .            ? 1 
CNS      refinement       .            ? 2 
CCP4     'data scaling'   '(TRUNCATE)' ? 3 
CNS      phasing          .            ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 70  ? ? -39.58 119.72 
2 1 VAL A 110 ? ? -57.57 -8.35  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A PRO 2   ? A PRO 2   
3 1 Y 1 A HIS 172 ? A HIS 172 
4 1 Y 1 A HIS 173 ? A HIS 173 
5 1 Y 1 A HIS 174 ? A HIS 174 
6 1 Y 1 A HIS 175 ? A HIS 175 
7 1 Y 1 A HIS 176 ? A HIS 176 
8 1 Y 1 A HIS 177 ? A HIS 177 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "GUANOSINE-5'-DIPHOSPHATE" GDP 
4 water                      HOH 
#