data_1XU2
# 
_entry.id   1XU2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XU2         
RCSB  RCSB030770   
WWPDB D_1000030770 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1XU1 'Crystal structure of APRIL bound to TACI' unspecified 
PDB 1U5X APRIL                                      unspecified 
PDB 1U5Y APRIL                                      unspecified 
PDB 1U5Z APRIL                                      unspecified 
PDB 1XUT .                                          unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XU2 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hymowitz, S.G.'    1  
'Patel, D.R.'       2  
'Wallweber, H.J.A.' 3  
'Runyon, S.'        4  
'Yan, M.'           5  
'Yin, J.'           6  
'Shriver, S.K.'     7  
'Gordon, N.C.'      8  
'Pan, B.'           9  
'Skelton, N.J.'     10 
'Kelley, R.F.'      11 
'Starovasnik, M.A.' 12 
# 
_citation.id                        primary 
_citation.title                     
'Structures of APRIL-receptor complexes: Like BCMA, TACI employs only a single cysteine-rich domain for high-affinity ligand binding' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            280 
_citation.page_first                7218 
_citation.page_last                 7227 
_citation.year                      2005 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15542592 
_citation.pdbx_database_id_DOI      10.1074/jbc.M411714200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hymowitz, S.G.'    1  
primary 'Patel, D.R.'       2  
primary 'Wallweber, H.J.A.' 3  
primary 'Runyon, S.'        4  
primary 'Yan, M.'           5  
primary 'Yin, J.'           6  
primary 'Shriver, S.K.'     7  
primary 'Gordon, N.C.'      8  
primary 'Pan, B.'           9  
primary 'Skelton, N.J.'     10 
primary 'Kelley, R.F.'      11 
primary 'Starovasnik, M.A.' 12 
# 
_cell.entry_id           1XU2 
_cell.length_a           114.294 
_cell.length_b           114.294 
_cell.length_c           91.180 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XU2 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor necrosis factor ligand superfamily member 13'   15560.912 3  ? ? 'TNF domain of APRIL' ? 
2 polymer     man 'Tumor necrosis factor receptor superfamily member 17' 5113.745  3  ? ? 'BCMA ECD'            ? 
3 non-polymer syn 'NICKEL (II) ION'                                      58.693    1  ? ? ?                     ? 
4 water       nat water                                                  18.015    36 ? ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'A proliferation-inducing ligand, APRIL, TNFSF13B or Tall-2' 
2 'B-cell maturation protein, TNFFSF17'                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRET
LFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
;
;KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRET
LFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
;
A,B,D ? 
2 'polypeptide(L)' no no AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKG AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKG R,S,T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   LYS n 
1 3   HIS n 
1 4   SER n 
1 5   VAL n 
1 6   LEU n 
1 7   HIS n 
1 8   LEU n 
1 9   VAL n 
1 10  PRO n 
1 11  VAL n 
1 12  ASN n 
1 13  ILE n 
1 14  THR n 
1 15  SER n 
1 16  LYS n 
1 17  ALA n 
1 18  ASP n 
1 19  SER n 
1 20  ASP n 
1 21  VAL n 
1 22  THR n 
1 23  GLU n 
1 24  VAL n 
1 25  MET n 
1 26  TRP n 
1 27  GLN n 
1 28  PRO n 
1 29  VAL n 
1 30  LEU n 
1 31  ARG n 
1 32  ARG n 
1 33  GLY n 
1 34  ARG n 
1 35  GLY n 
1 36  LEU n 
1 37  GLU n 
1 38  ALA n 
1 39  GLN n 
1 40  GLY n 
1 41  ASP n 
1 42  ILE n 
1 43  VAL n 
1 44  ARG n 
1 45  VAL n 
1 46  TRP n 
1 47  ASP n 
1 48  THR n 
1 49  GLY n 
1 50  ILE n 
1 51  TYR n 
1 52  LEU n 
1 53  LEU n 
1 54  TYR n 
1 55  SER n 
1 56  GLN n 
1 57  VAL n 
1 58  LEU n 
1 59  PHE n 
1 60  HIS n 
1 61  ASP n 
1 62  VAL n 
1 63  THR n 
1 64  PHE n 
1 65  THR n 
1 66  MET n 
1 67  GLY n 
1 68  GLN n 
1 69  VAL n 
1 70  VAL n 
1 71  SER n 
1 72  ARG n 
1 73  GLU n 
1 74  GLY n 
1 75  GLN n 
1 76  GLY n 
1 77  ARG n 
1 78  ARG n 
1 79  GLU n 
1 80  THR n 
1 81  LEU n 
1 82  PHE n 
1 83  ARG n 
1 84  CYS n 
1 85  ILE n 
1 86  ARG n 
1 87  SER n 
1 88  MET n 
1 89  PRO n 
1 90  SER n 
1 91  ASP n 
1 92  PRO n 
1 93  ASP n 
1 94  ARG n 
1 95  ALA n 
1 96  TYR n 
1 97  ASN n 
1 98  SER n 
1 99  CYS n 
1 100 TYR n 
1 101 SER n 
1 102 ALA n 
1 103 GLY n 
1 104 VAL n 
1 105 PHE n 
1 106 HIS n 
1 107 LEU n 
1 108 HIS n 
1 109 GLN n 
1 110 GLY n 
1 111 ASP n 
1 112 ILE n 
1 113 ILE n 
1 114 THR n 
1 115 VAL n 
1 116 LYS n 
1 117 ILE n 
1 118 PRO n 
1 119 ARG n 
1 120 ALA n 
1 121 ASN n 
1 122 ALA n 
1 123 LYS n 
1 124 LEU n 
1 125 SER n 
1 126 LEU n 
1 127 SER n 
1 128 PRO n 
1 129 HIS n 
1 130 GLY n 
1 131 THR n 
1 132 PHE n 
1 133 LEU n 
1 134 GLY n 
1 135 PHE n 
1 136 VAL n 
1 137 LYS n 
1 138 LEU n 
2 1   ALA n 
2 2   GLY n 
2 3   GLN n 
2 4   CYS n 
2 5   SER n 
2 6   GLN n 
2 7   ASN n 
2 8   GLU n 
2 9   TYR n 
2 10  PHE n 
2 11  ASP n 
2 12  SER n 
2 13  LEU n 
2 14  LEU n 
2 15  HIS n 
2 16  ALA n 
2 17  CYS n 
2 18  ILE n 
2 19  PRO n 
2 20  CYS n 
2 21  GLN n 
2 22  LEU n 
2 23  ARG n 
2 24  CYS n 
2 25  SER n 
2 26  SER n 
2 27  ASN n 
2 28  THR n 
2 29  PRO n 
2 30  PRO n 
2 31  LEU n 
2 32  THR n 
2 33  CYS n 
2 34  GLN n 
2 35  ARG n 
2 36  TYR n 
2 37  CYS n 
2 38  ASN n 
2 39  ALA n 
2 40  SER n 
2 41  VAL n 
2 42  THR n 
2 43  ASN n 
2 44  SER n 
2 45  VAL n 
2 46  LYS n 
2 47  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus  'Tnfsf13, APRIL'      ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? 'Origami(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? 'pET32a (modified)' ? ? 
2 1 sample ? ? ? human         Homo 'TNFRSF17, BCM, BCMA' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ?              ? ? ? ? ? ? ? plasmid ? ? ? pZCT                ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TNF13_MOUSE Q9D777 1 
;KKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRET
LFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
;
104 ? 
2 UNP TNR17_HUMAN Q02223 2 AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKG 5   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XU2 A 1 ? 138 ? Q9D777 104 ? 241 ? 104 241 
2 1 1XU2 B 1 ? 138 ? Q9D777 104 ? 241 ? 104 241 
3 1 1XU2 D 1 ? 138 ? Q9D777 104 ? 241 ? 104 241 
4 2 1XU2 R 1 ? 47  ? Q02223 5   ? 51  ? 5   51  
5 2 1XU2 S 1 ? 47  ? Q02223 5   ? 51  ? 5   51  
6 2 1XU2 T 1 ? 47  ? Q02223 5   ? 51  ? 5   51  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
NI  non-polymer         . 'NICKEL (II) ION' ? 'Ni 2'           58.693  
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XU2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.7 
_exptl_crystal.density_percent_sol   55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pdbx_details    
'well solution: 0.1M MES, 5% Peg 8000, 10% Peg 1000, pH 5.0, VAPOR DIFFUSION, SITTING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   SBC-3 
_diffrn_detector.pdbx_collection_date   2004-06-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98040 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98040 
# 
_reflns.entry_id                     1XU2 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            2.35 
_reflns.d_resolution_low             50 
_reflns.number_all                   28292 
_reflns.number_obs                   28292 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.067 
_reflns.pdbx_netI_over_sigmaI        11.7 
_reflns.B_iso_Wilson_estimate        52 
_reflns.pdbx_redundancy              9.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.43 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.425 
_reflns_shell.meanI_over_sigI_obs    3.2 
_reflns_shell.pdbx_redundancy        7.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2831 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1XU2 
_refine.ls_number_reflns_obs                     25409 
_refine.ls_number_reflns_all                     28265 
_refine.pdbx_ls_sigma_I                          -3 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    99.96 
_refine.ls_R_factor_obs                          0.18151 
_refine.ls_R_factor_all                          0.1815 
_refine.ls_R_factor_R_work                       0.17773 
_refine.ls_R_factor_R_free                       0.21313 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  2856 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.947 
_refine.B_iso_mean                               29.888 
_refine.aniso_B[1][1]                            -0.11 
_refine.aniso_B[2][2]                            -0.11 
_refine.aniso_B[3][3]                            0.16 
_refine.aniso_B[1][2]                            -0.05 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'APRIL alone (1U5Z)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'THIN SHELLS' 
_refine.pdbx_overall_ESU_R                       0.294 
_refine.pdbx_overall_ESU_R_Free                  0.209 
_refine.overall_SU_ML                            0.143 
_refine.overall_SU_B                             5.871 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4082 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             36 
_refine_hist.number_atoms_total               4119 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010 0.021 ? 4187 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002 0.020 ? 3760 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.220 1.946 ? 5686 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.762 3.000 ? 8723 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.064 5.000 ? 513  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.077 0.200 ? 635  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004 0.020 ? 4636 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.003 0.020 ? 883  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.180 0.200 ? 589  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.229 0.200 ? 4165 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.083 0.200 ? 2776 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.133 0.200 ? 69   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.142 0.200 ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.201 0.200 ? 47   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.232 0.200 ? 5    'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.575 2.500 ? 2585 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4.084 5.000 ? 4189 'X-RAY DIFFRACTION' ? 
r_scbond_it              3.077 2.500 ? 1602 'X-RAY DIFFRACTION' ? 
r_scangle_it             4.711 5.000 ? 1497 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   25 
_refine_ls_shell.d_res_high                       2.350 
_refine_ls_shell.d_res_low                        2.398 
_refine_ls_shell.number_reflns_R_work             1680 
_refine_ls_shell.R_factor_R_work                  0.195 
_refine_ls_shell.percent_reflns_obs               100 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             0 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1XU2 
_struct.title                     'The crystal structure of APRIL bound to BCMA' 
_struct.pdbx_descriptor           
'Tumor necrosis factor ligand superfamily member 13, Tumor necrosis factor receptor superfamily member 17' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XU2 
_struct_keywords.pdbx_keywords   'CYTOKINE, HORMONE/GROWTH FACTOR receptor' 
_struct_keywords.text            
'TNFSF, cytokine, CRD, receptor, jelly-roll, cysteine-rich, HORMONE-GROWTH FACTOR receptor COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The assymmetric unit contains the biologically relevant assembly of a trimer of APRIL bound to 3 copies of BCMA' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 91 ? ARG A 94 ? ASP A 194 ARG A 197 5 ? 4 
HELX_P HELX_P2 2 GLN D 21 ? ARG D 23 ? GLN R 25  ARG R 27  5 ? 3 
HELX_P HELX_P3 3 PRO D 30 ? THR D 32 ? PRO R 34  THR R 36  5 ? 3 
HELX_P HELX_P4 4 CYS D 33 ? ALA D 39 ? CYS R 37  ALA R 43  1 ? 7 
HELX_P HELX_P5 5 GLN E 21 ? CYS E 24 ? GLN S 25  CYS S 28  5 ? 4 
HELX_P HELX_P6 6 CYS E 33 ? ASN E 38 ? CYS S 37  ASN S 42  1 ? 6 
HELX_P HELX_P7 7 GLN F 21 ? CYS F 24 ? GLN T 25  CYS T 28  5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 84 SG ? ? ? 1_555 A CYS 99 SG  ? ? A CYS 187 A CYS 202 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2  disulf ? ? B CYS 84 SG ? ? ? 1_555 B CYS 99 SG  ? ? B CYS 187 B CYS 202 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf3  disulf ? ? C CYS 84 SG ? ? ? 1_555 C CYS 99 SG  ? ? D CYS 187 D CYS 202 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf4  disulf ? ? D CYS 4  SG ? ? ? 1_555 D CYS 17 SG  ? ? R CYS 8   R CYS 21  1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf5  disulf ? ? D CYS 20 SG ? ? ? 1_555 D CYS 33 SG  ? ? R CYS 24  R CYS 37  1_555 ? ? ? ? ? ? ? 2.098 ? 
disulf6  disulf ? ? D CYS 24 SG ? ? ? 1_555 D CYS 37 SG  ? ? R CYS 28  R CYS 41  1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf7  disulf ? ? E CYS 4  SG ? ? ? 1_555 E CYS 17 SG  ? ? S CYS 8   S CYS 21  1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf8  disulf ? ? E CYS 20 SG ? ? ? 1_555 E CYS 33 SG  ? ? S CYS 24  S CYS 37  1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf9  disulf ? ? E CYS 24 SG ? ? ? 1_555 E CYS 37 SG  ? ? S CYS 28  S CYS 41  1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf10 disulf ? ? F CYS 4  SG ? ? ? 1_555 F CYS 17 SG  ? ? T CYS 8   T CYS 21  1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf11 disulf ? ? F CYS 20 SG ? ? ? 1_555 F CYS 33 SG  ? ? T CYS 24  T CYS 37  1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf12 disulf ? ? F CYS 24 SG ? ? ? 1_555 F CYS 37 SG  ? ? T CYS 28  T CYS 41  1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc1  metalc ? ? G NI  .  NI ? ? ? 1_555 A HIS 3  NE2 ? ? B NI  301 A HIS 106 1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc2  metalc ? ? G NI  .  NI ? ? ? 1_555 B HIS 3  NE2 ? ? B NI  301 B HIS 106 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc3  metalc ? ? G NI  .  NI ? ? ? 1_555 C HIS 3  NE2 ? ? B NI  301 D HIS 106 1_555 ? ? ? ? ? ? ? 2.341 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
C ? 5 ? 
D ? 8 ? 
E ? 5 ? 
F ? 8 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
F 7 8 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 36  ? GLN A 39  ? LEU A 139 GLN A 142 
A 2 ILE A 42  ? VAL A 45  ? ILE A 145 VAL A 148 
A 3 ILE A 112 ? ILE A 117 ? ILE A 215 ILE A 220 
A 4 THR A 65  ? GLU A 73  ? THR A 168 GLU A 176 
A 5 ARG A 78  ? SER A 87  ? ARG A 181 SER A 190 
B 1 LEU A 36  ? GLN A 39  ? LEU A 139 GLN A 142 
B 2 ILE A 42  ? VAL A 45  ? ILE A 145 VAL A 148 
B 3 ILE A 112 ? ILE A 117 ? ILE A 215 ILE A 220 
B 4 THR A 22  ? ARG A 32  ? THR A 125 ARG A 135 
B 5 VAL A 5   ? THR A 14  ? VAL A 108 THR A 117 
B 6 PHE A 132 ? LYS A 137 ? PHE A 235 LYS A 240 
B 7 GLY A 49  ? HIS A 60  ? GLY A 152 HIS A 163 
B 8 TYR A 96  ? LEU A 107 ? TYR A 199 LEU A 210 
C 1 LEU B 36  ? GLN B 39  ? LEU B 139 GLN B 142 
C 2 ILE B 42  ? VAL B 45  ? ILE B 145 VAL B 148 
C 3 ILE B 112 ? ILE B 117 ? ILE B 215 ILE B 220 
C 4 THR B 65  ? GLU B 73  ? THR B 168 GLU B 176 
C 5 ARG B 78  ? SER B 87  ? ARG B 181 SER B 190 
D 1 LEU B 36  ? GLN B 39  ? LEU B 139 GLN B 142 
D 2 ILE B 42  ? VAL B 45  ? ILE B 145 VAL B 148 
D 3 ILE B 112 ? ILE B 117 ? ILE B 215 ILE B 220 
D 4 THR B 22  ? ARG B 32  ? THR B 125 ARG B 135 
D 5 VAL B 5   ? THR B 14  ? VAL B 108 THR B 117 
D 6 PHE B 132 ? LYS B 137 ? PHE B 235 LYS B 240 
D 7 GLY B 49  ? PHE B 59  ? GLY B 152 PHE B 162 
D 8 ASN B 97  ? LEU B 107 ? ASN B 200 LEU B 210 
E 1 LEU C 36  ? GLN C 39  ? LEU D 139 GLN D 142 
E 2 ILE C 42  ? VAL C 45  ? ILE D 145 VAL D 148 
E 3 ILE C 112 ? ILE C 117 ? ILE D 215 ILE D 220 
E 4 THR C 65  ? GLU C 73  ? THR D 168 GLU D 176 
E 5 ARG C 78  ? SER C 87  ? ARG D 181 SER D 190 
F 1 LEU C 36  ? GLN C 39  ? LEU D 139 GLN D 142 
F 2 ILE C 42  ? VAL C 45  ? ILE D 145 VAL D 148 
F 3 ILE C 112 ? ILE C 117 ? ILE D 215 ILE D 220 
F 4 THR C 22  ? ARG C 32  ? THR D 125 ARG D 135 
F 5 VAL C 5   ? THR C 14  ? VAL D 108 THR D 117 
F 6 PHE C 132 ? LYS C 137 ? PHE D 235 LYS D 240 
F 7 GLY C 49  ? HIS C 60  ? GLY D 152 HIS D 163 
F 8 TYR C 96  ? LEU C 107 ? TYR D 199 LEU D 210 
G 1 GLU D 8   ? ASP D 11  ? GLU R 12  ASP R 15  
G 2 ALA D 16  ? PRO D 19  ? ALA R 20  PRO R 23  
H 1 GLU E 8   ? ASP E 11  ? GLU S 12  ASP S 15  
H 2 ALA E 16  ? PRO E 19  ? ALA S 20  PRO S 23  
I 1 GLU F 8   ? ASP F 11  ? GLU T 12  ASP T 15  
I 2 ALA F 16  ? PRO F 19  ? ALA T 20  PRO T 23  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 37  ? N GLU A 140 O ARG A 44  ? O ARG A 147 
A 2 3 N VAL A 43  ? N VAL A 146 O ILE A 113 ? O ILE A 216 
A 3 4 O ILE A 112 ? O ILE A 215 N GLU A 73  ? N GLU A 176 
A 4 5 N VAL A 70  ? N VAL A 173 O PHE A 82  ? O PHE A 185 
B 1 2 N GLU A 37  ? N GLU A 140 O ARG A 44  ? O ARG A 147 
B 2 3 N VAL A 43  ? N VAL A 146 O ILE A 113 ? O ILE A 216 
B 3 4 O ILE A 117 ? O ILE A 220 N THR A 22  ? N THR A 125 
B 4 5 O GLU A 23  ? O GLU A 126 N THR A 14  ? N THR A 117 
B 5 6 N LEU A 8   ? N LEU A 111 O LEU A 133 ? O LEU A 236 
B 6 7 O VAL A 136 ? O VAL A 239 N LEU A 52  ? N LEU A 155 
B 7 8 N LEU A 53  ? N LEU A 156 O GLY A 103 ? O GLY A 206 
C 1 2 N GLU B 37  ? N GLU B 140 O ARG B 44  ? O ARG B 147 
C 2 3 N VAL B 43  ? N VAL B 146 O ILE B 113 ? O ILE B 216 
C 3 4 O ILE B 112 ? O ILE B 215 N GLU B 73  ? N GLU B 176 
C 4 5 N MET B 66  ? N MET B 169 O ARG B 86  ? O ARG B 189 
D 1 2 N GLU B 37  ? N GLU B 140 O ARG B 44  ? O ARG B 147 
D 2 3 N VAL B 43  ? N VAL B 146 O ILE B 113 ? O ILE B 216 
D 3 4 O ILE B 117 ? O ILE B 220 N THR B 22  ? N THR B 125 
D 4 5 O MET B 25  ? O MET B 128 N ASN B 12  ? N ASN B 115 
D 5 6 N LEU B 8   ? N LEU B 111 O LEU B 133 ? O LEU B 236 
D 6 7 O VAL B 136 ? O VAL B 239 N LEU B 52  ? N LEU B 155 
D 7 8 N LEU B 53  ? N LEU B 156 O GLY B 103 ? O GLY B 206 
E 1 2 N GLU C 37  ? N GLU D 140 O ARG C 44  ? O ARG D 147 
E 2 3 N VAL C 43  ? N VAL D 146 O ILE C 113 ? O ILE D 216 
E 3 4 O LYS C 116 ? O LYS D 219 N VAL C 69  ? N VAL D 172 
E 4 5 N VAL C 70  ? N VAL D 173 O LEU C 81  ? O LEU D 184 
F 1 2 N GLU C 37  ? N GLU D 140 O ARG C 44  ? O ARG D 147 
F 2 3 N VAL C 43  ? N VAL D 146 O ILE C 113 ? O ILE D 216 
F 3 4 O ILE C 117 ? O ILE D 220 N THR C 22  ? N THR D 125 
F 4 5 O VAL C 29  ? O VAL D 132 N HIS C 7   ? N HIS D 110 
F 5 6 N LEU C 8   ? N LEU D 111 O LEU C 133 ? O LEU D 236 
F 6 7 O VAL C 136 ? O VAL D 239 N LEU C 52  ? N LEU D 155 
F 7 8 N LEU C 53  ? N LEU D 156 O GLY C 103 ? O GLY D 206 
G 1 2 N ASP D 11  ? N ASP R 15  O ALA D 16  ? O ALA R 20  
H 1 2 N ASP E 11  ? N ASP S 15  O ALA E 16  ? O ALA S 20  
I 1 2 N TYR F 9   ? N TYR T 13  O ILE F 18  ? O ILE T 22  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'BINDING SITE FOR RESIDUE NI B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 HIS A 3 ? HIS A 106 . ? 1_555 ? 
2 AC1 3 HIS B 3 ? HIS B 106 . ? 1_555 ? 
3 AC1 3 HIS C 3 ? HIS D 106 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XU2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XU2 
_atom_sites.fract_transf_matrix[1][1]   0.008749 
_atom_sites.fract_transf_matrix[1][2]   0.005051 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010103 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010967 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NI 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 2   ? 27.826  91.299  21.885  1.00 49.61 ? 105 LYS A N   1 
ATOM   2    C  CA  . LYS A 1 2   ? 27.727  90.344  20.741  1.00 51.06 ? 105 LYS A CA  1 
ATOM   3    C  C   . LYS A 1 2   ? 26.317  89.729  20.642  1.00 48.14 ? 105 LYS A C   1 
ATOM   4    O  O   . LYS A 1 2   ? 25.981  88.815  21.399  1.00 48.21 ? 105 LYS A O   1 
ATOM   5    C  CB  . LYS A 1 2   ? 28.789  89.236  20.883  1.00 53.52 ? 105 LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 2   ? 30.040  89.408  19.996  1.00 55.20 ? 105 LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 2   ? 31.261  89.916  20.773  1.00 57.03 ? 105 LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 2   ? 31.239  91.450  20.937  1.00 58.97 ? 105 LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 2   ? 31.780  91.920  22.256  1.00 56.53 ? 105 LYS A NZ  1 
ATOM   10   N  N   . HIS A 1 3   ? 25.505  90.240  19.713  1.00 44.00 ? 106 HIS A N   1 
ATOM   11   C  CA  . HIS A 1 3   ? 24.147  89.725  19.471  1.00 41.42 ? 106 HIS A CA  1 
ATOM   12   C  C   . HIS A 1 3   ? 24.181  88.433  18.690  1.00 34.84 ? 106 HIS A C   1 
ATOM   13   O  O   . HIS A 1 3   ? 25.058  88.239  17.855  1.00 32.96 ? 106 HIS A O   1 
ATOM   14   C  CB  . HIS A 1 3   ? 23.282  90.725  18.678  1.00 42.24 ? 106 HIS A CB  1 
ATOM   15   C  CG  . HIS A 1 3   ? 22.994  91.989  19.418  1.00 45.91 ? 106 HIS A CG  1 
ATOM   16   N  ND1 . HIS A 1 3   ? 22.870  92.026  20.787  1.00 54.48 ? 106 HIS A ND1 1 
ATOM   17   C  CD2 . HIS A 1 3   ? 22.833  93.262  18.991  1.00 50.98 ? 106 HIS A CD2 1 
ATOM   18   C  CE1 . HIS A 1 3   ? 22.639  93.264  21.175  1.00 54.23 ? 106 HIS A CE1 1 
ATOM   19   N  NE2 . HIS A 1 3   ? 22.612  94.036  20.103  1.00 53.42 ? 106 HIS A NE2 1 
ATOM   20   N  N   . SER A 1 4   ? 23.207  87.566  18.962  1.00 29.76 ? 107 SER A N   1 
ATOM   21   C  CA  . SER A 1 4   ? 23.004  86.351  18.194  1.00 29.02 ? 107 SER A CA  1 
ATOM   22   C  C   . SER A 1 4   ? 22.446  86.719  16.832  1.00 27.09 ? 107 SER A C   1 
ATOM   23   O  O   . SER A 1 4   ? 21.589  87.586  16.732  1.00 27.05 ? 107 SER A O   1 
ATOM   24   C  CB  . SER A 1 4   ? 22.014  85.418  18.889  1.00 28.49 ? 107 SER A CB  1 
ATOM   25   O  OG  . SER A 1 4   ? 22.421  85.183  20.214  1.00 34.01 ? 107 SER A OG  1 
ATOM   26   N  N   . VAL A 1 5   ? 22.950  86.067  15.792  1.00 24.49 ? 108 VAL A N   1 
ATOM   27   C  CA  . VAL A 1 5   ? 22.461  86.274  14.441  1.00 25.74 ? 108 VAL A CA  1 
ATOM   28   C  C   . VAL A 1 5   ? 22.349  84.959  13.685  1.00 21.15 ? 108 VAL A C   1 
ATOM   29   O  O   . VAL A 1 5   ? 22.967  83.968  14.037  1.00 21.83 ? 108 VAL A O   1 
ATOM   30   C  CB  . VAL A 1 5   ? 23.364  87.268  13.631  1.00 24.83 ? 108 VAL A CB  1 
ATOM   31   C  CG1 . VAL A 1 5   ? 23.577  88.549  14.401  1.00 26.70 ? 108 VAL A CG1 1 
ATOM   32   C  CG2 . VAL A 1 5   ? 24.705  86.643  13.283  1.00 27.59 ? 108 VAL A CG2 1 
ATOM   33   N  N   . LEU A 1 6   ? 21.550  84.990  12.628  1.00 23.08 ? 109 LEU A N   1 
ATOM   34   C  CA  . LEU A 1 6   ? 21.451  83.905  11.681  1.00 24.01 ? 109 LEU A CA  1 
ATOM   35   C  C   . LEU A 1 6   ? 21.138  84.508  10.315  1.00 27.03 ? 109 LEU A C   1 
ATOM   36   O  O   . LEU A 1 6   ? 20.190  85.269  10.173  1.00 26.27 ? 109 LEU A O   1 
ATOM   37   C  CB  . LEU A 1 6   ? 20.359  82.940  12.112  1.00 25.65 ? 109 LEU A CB  1 
ATOM   38   C  CG  . LEU A 1 6   ? 20.131  81.689  11.269  1.00 25.92 ? 109 LEU A CG  1 
ATOM   39   C  CD1 . LEU A 1 6   ? 21.321  80.775  11.299  1.00 24.22 ? 109 LEU A CD1 1 
ATOM   40   C  CD2 . LEU A 1 6   ? 18.903  80.967  11.807  1.00 29.62 ? 109 LEU A CD2 1 
ATOM   41   N  N   . HIS A 1 7   ? 21.958  84.190  9.317   1.00 24.50 ? 110 HIS A N   1 
ATOM   42   C  CA  . HIS A 1 7   ? 21.685  84.585  7.951   1.00 22.54 ? 110 HIS A CA  1 
ATOM   43   C  C   . HIS A 1 7   ? 21.581  83.315  7.111   1.00 23.48 ? 110 HIS A C   1 
ATOM   44   O  O   . HIS A 1 7   ? 22.496  82.504  7.108   1.00 25.67 ? 110 HIS A O   1 
ATOM   45   C  CB  . HIS A 1 7   ? 22.783  85.523  7.432   1.00 23.24 ? 110 HIS A CB  1 
ATOM   46   C  CG  . HIS A 1 7   ? 22.479  86.140  6.103   1.00 24.84 ? 110 HIS A CG  1 
ATOM   47   N  ND1 . HIS A 1 7   ? 21.566  87.161  5.946   1.00 29.54 ? 110 HIS A ND1 1 
ATOM   48   C  CD2 . HIS A 1 7   ? 22.976  85.883  4.867   1.00 24.96 ? 110 HIS A CD2 1 
ATOM   49   C  CE1 . HIS A 1 7   ? 21.517  87.507  4.668   1.00 29.73 ? 110 HIS A CE1 1 
ATOM   50   N  NE2 . HIS A 1 7   ? 22.357  86.739  3.993   1.00 24.51 ? 110 HIS A NE2 1 
ATOM   51   N  N   . LEU A 1 8   ? 20.452  83.162  6.414   1.00 27.10 ? 111 LEU A N   1 
ATOM   52   C  CA  . LEU A 1 8   ? 20.099  81.958  5.647   1.00 24.85 ? 111 LEU A CA  1 
ATOM   53   C  C   . LEU A 1 8   ? 19.937  82.229  4.148   1.00 27.10 ? 111 LEU A C   1 
ATOM   54   O  O   . LEU A 1 8   ? 19.376  83.256  3.758   1.00 23.49 ? 111 LEU A O   1 
ATOM   55   C  CB  . LEU A 1 8   ? 18.784  81.390  6.146   1.00 24.95 ? 111 LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 8   ? 18.720  81.117  7.652   1.00 27.98 ? 111 LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 8   ? 17.284  81.081  8.121   1.00 28.89 ? 111 LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 8   ? 19.419  79.826  7.983   1.00 26.77 ? 111 LEU A CD2 1 
ATOM   59   N  N   . VAL A 1 9   ? 20.383  81.272  3.330   1.00 25.63 ? 112 VAL A N   1 
ATOM   60   C  CA  . VAL A 1 9   ? 20.201  81.296  1.880   1.00 23.23 ? 112 VAL A CA  1 
ATOM   61   C  C   . VAL A 1 9   ? 19.556  79.988  1.375   1.00 28.56 ? 112 VAL A C   1 
ATOM   62   O  O   . VAL A 1 9   ? 19.563  78.976  2.084   1.00 27.01 ? 112 VAL A O   1 
ATOM   63   C  CB  . VAL A 1 9   ? 21.536  81.540  1.154   1.00 23.39 ? 112 VAL A CB  1 
ATOM   64   C  CG1 . VAL A 1 9   ? 22.171  82.845  1.633   1.00 28.92 ? 112 VAL A CG1 1 
ATOM   65   C  CG2 . VAL A 1 9   ? 22.502  80.359  1.327   1.00 24.41 ? 112 VAL A CG2 1 
ATOM   66   N  N   . PRO A 1 10  ? 18.995  80.000  0.161   1.00 29.39 ? 113 PRO A N   1 
ATOM   67   C  CA  . PRO A 1 10  ? 18.333  78.814  -0.386  1.00 30.25 ? 113 PRO A CA  1 
ATOM   68   C  C   . PRO A 1 10  ? 19.264  77.654  -0.683  1.00 31.67 ? 113 PRO A C   1 
ATOM   69   O  O   . PRO A 1 10  ? 20.422  77.845  -1.094  1.00 31.48 ? 113 PRO A O   1 
ATOM   70   C  CB  . PRO A 1 10  ? 17.746  79.318  -1.714  1.00 30.28 ? 113 PRO A CB  1 
ATOM   71   C  CG  . PRO A 1 10  ? 17.738  80.770  -1.616  1.00 30.57 ? 113 PRO A CG  1 
ATOM   72   C  CD  . PRO A 1 10  ? 18.909  81.131  -0.777  1.00 29.98 ? 113 PRO A CD  1 
ATOM   73   N  N   . VAL A 1 11  ? 18.748  76.450  -0.472  1.00 33.10 ? 114 VAL A N   1 
ATOM   74   C  CA  . VAL A 1 11  ? 19.309  75.268  -1.105  1.00 36.96 ? 114 VAL A CA  1 
ATOM   75   C  C   . VAL A 1 11  ? 18.383  74.843  -2.254  1.00 37.06 ? 114 VAL A C   1 
ATOM   76   O  O   . VAL A 1 11  ? 18.868  74.441  -3.313  1.00 38.33 ? 114 VAL A O   1 
ATOM   77   C  CB  . VAL A 1 11  ? 19.660  74.102  -0.085  1.00 40.20 ? 114 VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 11  ? 18.791  74.129  1.159   1.00 41.65 ? 114 VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 11  ? 19.613  72.713  -0.760  1.00 38.88 ? 114 VAL A CG2 1 
ATOM   80   N  N   . ASN A 1 12  ? 17.070  74.998  -2.066  1.00 39.08 ? 115 ASN A N   1 
ATOM   81   C  CA  . ASN A 1 12  ? 16.066  74.433  -2.973  1.00 38.94 ? 115 ASN A CA  1 
ATOM   82   C  C   . ASN A 1 12  ? 14.701  75.102  -2.846  1.00 34.13 ? 115 ASN A C   1 
ATOM   83   O  O   . ASN A 1 12  ? 14.443  75.784  -1.873  1.00 34.91 ? 115 ASN A O   1 
ATOM   84   C  CB  . ASN A 1 12  ? 15.895  72.934  -2.673  1.00 42.58 ? 115 ASN A CB  1 
ATOM   85   C  CG  . ASN A 1 12  ? 16.526  72.056  -3.716  1.00 49.08 ? 115 ASN A CG  1 
ATOM   86   O  OD1 . ASN A 1 12  ? 16.463  72.352  -4.911  1.00 53.07 ? 115 ASN A OD1 1 
ATOM   87   N  ND2 . ASN A 1 12  ? 17.138  70.952  -3.275  1.00 51.81 ? 115 ASN A ND2 1 
ATOM   88   N  N   . ILE A 1 13  ? 13.847  74.891  -3.848  1.00 34.21 ? 116 ILE A N   1 
ATOM   89   C  CA  . ILE A 1 13  ? 12.437  75.291  -3.828  1.00 38.46 ? 116 ILE A CA  1 
ATOM   90   C  C   . ILE A 1 13  ? 11.560  74.069  -3.572  1.00 34.34 ? 116 ILE A C   1 
ATOM   91   O  O   . ILE A 1 13  ? 11.922  72.958  -3.933  1.00 33.55 ? 116 ILE A O   1 
ATOM   92   C  CB  . ILE A 1 13  ? 12.023  75.924  -5.202  1.00 45.25 ? 116 ILE A CB  1 
ATOM   93   C  CG1 . ILE A 1 13  ? 12.784  77.214  -5.471  1.00 49.47 ? 116 ILE A CG1 1 
ATOM   94   C  CG2 . ILE A 1 13  ? 10.538  76.224  -5.262  1.00 47.02 ? 116 ILE A CG2 1 
ATOM   95   C  CD1 . ILE A 1 13  ? 12.571  78.271  -4.428  1.00 51.54 ? 116 ILE A CD1 1 
ATOM   96   N  N   . THR A 1 14  ? 10.406  74.295  -2.950  1.00 35.01 ? 117 THR A N   1 
ATOM   97   C  CA  . THR A 1 14  ? 9.342   73.292  -2.867  1.00 33.19 ? 117 THR A CA  1 
ATOM   98   C  C   . THR A 1 14  ? 7.968   73.918  -3.111  1.00 31.03 ? 117 THR A C   1 
ATOM   99   O  O   . THR A 1 14  ? 7.668   75.010  -2.624  1.00 26.76 ? 117 THR A O   1 
ATOM   100  C  CB  . THR A 1 14  ? 9.341   72.543  -1.505  1.00 33.57 ? 117 THR A CB  1 
ATOM   101  O  OG1 . THR A 1 14  ? 8.157   71.734  -1.396  1.00 39.00 ? 117 THR A OG1 1 
ATOM   102  C  CG2 . THR A 1 14  ? 9.235   73.492  -0.324  1.00 34.34 ? 117 THR A CG2 1 
ATOM   103  N  N   . SER A 1 15  ? 7.146   73.199  -3.866  1.00 30.27 ? 118 SER A N   1 
ATOM   104  C  CA  . SER A 1 15  ? 5.764   73.575  -4.101  1.00 34.25 ? 118 SER A CA  1 
ATOM   105  C  C   . SER A 1 15  ? 4.947   72.314  -4.401  1.00 38.53 ? 118 SER A C   1 
ATOM   106  O  O   . SER A 1 15  ? 5.189   71.636  -5.404  1.00 38.55 ? 118 SER A O   1 
ATOM   107  C  CB  . SER A 1 15  ? 5.674   74.561  -5.266  1.00 33.14 ? 118 SER A CB  1 
ATOM   108  O  OG  . SER A 1 15  ? 4.343   75.009  -5.437  1.00 34.50 ? 118 SER A OG  1 
ATOM   109  N  N   . LYS A 1 16  ? 3.995   71.989  -3.530  1.00 42.71 ? 119 LYS A N   1 
ATOM   110  C  CA  . LYS A 1 16  ? 3.148   70.812  -3.748  1.00 47.46 ? 119 LYS A CA  1 
ATOM   111  C  C   . LYS A 1 16  ? 1.959   71.150  -4.657  1.00 47.72 ? 119 LYS A C   1 
ATOM   112  O  O   . LYS A 1 16  ? 1.523   72.307  -4.730  1.00 44.65 ? 119 LYS A O   1 
ATOM   113  C  CB  . LYS A 1 16  ? 2.692   70.218  -2.414  1.00 49.88 ? 119 LYS A CB  1 
ATOM   114  C  CG  . LYS A 1 16  ? 3.861   69.707  -1.577  1.00 55.11 ? 119 LYS A CG  1 
ATOM   115  C  CD  . LYS A 1 16  ? 3.396   68.818  -0.431  1.00 59.10 ? 119 LYS A CD  1 
ATOM   116  C  CE  . LYS A 1 16  ? 4.451   68.722  0.671   1.00 59.67 ? 119 LYS A CE  1 
ATOM   117  N  NZ  . LYS A 1 16  ? 4.299   67.453  1.435   1.00 60.28 ? 119 LYS A NZ  1 
ATOM   118  N  N   . ALA A 1 17  ? 1.453   70.125  -5.345  1.00 49.21 ? 120 ALA A N   1 
ATOM   119  C  CA  . ALA A 1 17  ? 0.432   70.275  -6.393  1.00 50.55 ? 120 ALA A CA  1 
ATOM   120  C  C   . ALA A 1 17  ? -0.773  71.163  -6.024  1.00 50.98 ? 120 ALA A C   1 
ATOM   121  O  O   . ALA A 1 17  ? -1.042  72.166  -6.684  1.00 48.23 ? 120 ALA A O   1 
ATOM   122  C  CB  . ALA A 1 17  ? -0.054  68.891  -6.835  1.00 49.86 ? 120 ALA A CB  1 
ATOM   123  N  N   . ASP A 1 18  ? -1.481  70.790  -4.962  1.00 53.22 ? 121 ASP A N   1 
ATOM   124  C  CA  . ASP A 1 18  ? -2.783  71.398  -4.627  1.00 53.82 ? 121 ASP A CA  1 
ATOM   125  C  C   . ASP A 1 18  ? -2.733  72.773  -3.937  1.00 50.41 ? 121 ASP A C   1 
ATOM   126  O  O   . ASP A 1 18  ? -3.756  73.454  -3.831  1.00 50.61 ? 121 ASP A O   1 
ATOM   127  C  CB  . ASP A 1 18  ? -3.594  70.430  -3.741  1.00 53.98 ? 121 ASP A CB  1 
ATOM   128  C  CG  . ASP A 1 18  ? -2.795  69.902  -2.538  1.00 54.64 ? 121 ASP A CG  1 
ATOM   129  O  OD1 . ASP A 1 18  ? -2.029  70.675  -1.912  1.00 49.11 ? 121 ASP A OD1 1 
ATOM   130  O  OD2 . ASP A 1 18  ? -2.877  68.713  -2.152  1.00 57.34 ? 121 ASP A OD2 1 
ATOM   131  N  N   . SER A 1 19  ? -1.544  73.183  -3.506  1.00 45.86 ? 122 SER A N   1 
ATOM   132  C  CA  . SER A 1 19  ? -1.386  74.159  -2.418  1.00 44.19 ? 122 SER A CA  1 
ATOM   133  C  C   . SER A 1 19  ? -1.492  75.655  -2.767  1.00 39.29 ? 122 SER A C   1 
ATOM   134  O  O   . SER A 1 19  ? -1.962  76.446  -1.943  1.00 38.34 ? 122 SER A O   1 
ATOM   135  C  CB  . SER A 1 19  ? -0.040  73.903  -1.721  1.00 46.42 ? 122 SER A CB  1 
ATOM   136  O  OG  . SER A 1 19  ? 1.029   73.826  -2.658  1.00 46.56 ? 122 SER A OG  1 
ATOM   137  N  N   . ASP A 1 20  ? -1.039  76.036  -3.959  1.00 35.24 ? 123 ASP A N   1 
ATOM   138  C  CA  . ASP A 1 20  ? -0.874  77.453  -4.348  1.00 34.34 ? 123 ASP A CA  1 
ATOM   139  C  C   . ASP A 1 20  ? 0.123   78.167  -3.433  1.00 27.88 ? 123 ASP A C   1 
ATOM   140  O  O   . ASP A 1 20  ? -0.089  79.299  -2.981  1.00 25.92 ? 123 ASP A O   1 
ATOM   141  C  CB  . ASP A 1 20  ? -2.224  78.178  -4.418  1.00 36.98 ? 123 ASP A CB  1 
ATOM   142  C  CG  . ASP A 1 20  ? -3.225  77.454  -5.323  1.00 42.06 ? 123 ASP A CG  1 
ATOM   143  O  OD1 . ASP A 1 20  ? -2.830  77.041  -6.444  1.00 44.41 ? 123 ASP A OD1 1 
ATOM   144  O  OD2 . ASP A 1 20  ? -4.416  77.238  -4.996  1.00 42.47 ? 123 ASP A OD2 1 
ATOM   145  N  N   . VAL A 1 21  ? 1.223   77.469  -3.185  1.00 26.40 ? 124 VAL A N   1 
ATOM   146  C  CA  . VAL A 1 21  ? 2.254   77.898  -2.259  1.00 26.01 ? 124 VAL A CA  1 
ATOM   147  C  C   . VAL A 1 21  ? 3.600   77.376  -2.737  1.00 22.74 ? 124 VAL A C   1 
ATOM   148  O  O   . VAL A 1 21  ? 3.731   76.221  -3.168  1.00 20.16 ? 124 VAL A O   1 
ATOM   149  C  CB  . VAL A 1 21  ? 1.993   77.374  -0.811  1.00 32.56 ? 124 VAL A CB  1 
ATOM   150  C  CG1 . VAL A 1 21  ? 3.247   77.490  0.061   1.00 36.46 ? 124 VAL A CG1 1 
ATOM   151  C  CG2 . VAL A 1 21  ? 0.843   78.120  -0.152  1.00 35.82 ? 124 VAL A CG2 1 
ATOM   152  N  N   . THR A 1 22  ? 4.599   78.239  -2.634  1.00 19.26 ? 125 THR A N   1 
ATOM   153  C  CA  . THR A 1 22  ? 5.985   77.888  -2.858  1.00 20.74 ? 125 THR A CA  1 
ATOM   154  C  C   . THR A 1 22  ? 6.792   78.303  -1.625  1.00 22.39 ? 125 THR A C   1 
ATOM   155  O  O   . THR A 1 22  ? 6.596   79.386  -1.086  1.00 23.10 ? 125 THR A O   1 
ATOM   156  C  CB  . THR A 1 22  ? 6.487   78.611  -4.122  1.00 16.79 ? 125 THR A CB  1 
ATOM   157  O  OG1 . THR A 1 22  ? 5.747   78.138  -5.253  1.00 20.12 ? 125 THR A OG1 1 
ATOM   158  C  CG2 . THR A 1 22  ? 7.939   78.256  -4.445  1.00 17.85 ? 125 THR A CG2 1 
ATOM   159  N  N   . GLU A 1 23  ? 7.677   77.429  -1.168  1.00 26.39 ? 126 GLU A N   1 
ATOM   160  C  CA  . GLU A 1 23  ? 8.585   77.747  -0.067  1.00 28.08 ? 126 GLU A CA  1 
ATOM   161  C  C   . GLU A 1 23  ? 10.032  77.437  -0.448  1.00 28.59 ? 126 GLU A C   1 
ATOM   162  O  O   . GLU A 1 23  ? 10.307  76.764  -1.442  1.00 27.67 ? 126 GLU A O   1 
ATOM   163  C  CB  . GLU A 1 23  ? 8.193   76.975  1.190   1.00 28.33 ? 126 GLU A CB  1 
ATOM   164  C  CG  . GLU A 1 23  ? 6.834   77.345  1.745   1.00 32.36 ? 126 GLU A CG  1 
ATOM   165  C  CD  . GLU A 1 23  ? 6.243   76.262  2.628   1.00 36.01 ? 126 GLU A CD  1 
ATOM   166  O  OE1 . GLU A 1 23  ? 5.620   75.321  2.080   1.00 35.03 ? 126 GLU A OE1 1 
ATOM   167  O  OE2 . GLU A 1 23  ? 6.395   76.362  3.868   1.00 36.52 ? 126 GLU A OE2 1 
ATOM   168  N  N   . VAL A 1 24  ? 10.948  77.941  0.365   1.00 31.52 ? 127 VAL A N   1 
ATOM   169  C  CA  . VAL A 1 24  ? 12.377  77.765  0.160   1.00 32.13 ? 127 VAL A CA  1 
ATOM   170  C  C   . VAL A 1 24  ? 12.967  76.885  1.286   1.00 28.86 ? 127 VAL A C   1 
ATOM   171  O  O   . VAL A 1 24  ? 12.668  77.093  2.454   1.00 27.92 ? 127 VAL A O   1 
ATOM   172  C  CB  . VAL A 1 24  ? 13.052  79.151  0.126   1.00 31.46 ? 127 VAL A CB  1 
ATOM   173  C  CG1 . VAL A 1 24  ? 14.520  79.045  -0.200  1.00 33.89 ? 127 VAL A CG1 1 
ATOM   174  C  CG2 . VAL A 1 24  ? 12.362  80.041  -0.899  1.00 33.12 ? 127 VAL A CG2 1 
ATOM   175  N  N   . MET A 1 25  ? 13.781  75.898  0.925   1.00 28.83 ? 128 MET A N   1 
ATOM   176  C  CA  . MET A 1 25  ? 14.600  75.148  1.897   1.00 31.50 ? 128 MET A CA  1 
ATOM   177  C  C   . MET A 1 25  ? 15.813  76.011  2.220   1.00 27.29 ? 128 MET A C   1 
ATOM   178  O  O   . MET A 1 25  ? 16.518  76.446  1.306   1.00 26.94 ? 128 MET A O   1 
ATOM   179  C  CB  . MET A 1 25  ? 15.084  73.812  1.321   1.00 37.70 ? 128 MET A CB  1 
ATOM   180  C  CG  . MET A 1 25  ? 14.021  72.981  0.623   1.00 46.93 ? 128 MET A CG  1 
ATOM   181  S  SD  . MET A 1 25  ? 12.948  72.105  1.769   1.00 56.70 ? 128 MET A SD  1 
ATOM   182  C  CE  . MET A 1 25  ? 12.979  70.445  1.033   1.00 54.00 ? 128 MET A CE  1 
ATOM   183  N  N   . TRP A 1 26  ? 16.053  76.267  3.497   1.00 23.62 ? 129 TRP A N   1 
ATOM   184  C  CA  . TRP A 1 26  ? 17.093  77.220  3.927   1.00 28.28 ? 129 TRP A CA  1 
ATOM   185  C  C   . TRP A 1 26  ? 18.339  76.529  4.468   1.00 26.83 ? 129 TRP A C   1 
ATOM   186  O  O   . TRP A 1 26  ? 18.254  75.451  5.058   1.00 25.89 ? 129 TRP A O   1 
ATOM   187  C  CB  . TRP A 1 26  ? 16.550  78.154  5.023   1.00 28.89 ? 129 TRP A CB  1 
ATOM   188  C  CG  . TRP A 1 26  ? 15.401  78.986  4.593   1.00 26.91 ? 129 TRP A CG  1 
ATOM   189  C  CD1 . TRP A 1 26  ? 14.093  78.824  4.948   1.00 28.95 ? 129 TRP A CD1 1 
ATOM   190  C  CD2 . TRP A 1 26  ? 15.442  80.106  3.702   1.00 25.18 ? 129 TRP A CD2 1 
ATOM   191  N  NE1 . TRP A 1 26  ? 13.316  79.778  4.338   1.00 28.74 ? 129 TRP A NE1 1 
ATOM   192  C  CE2 . TRP A 1 26  ? 14.118  80.578  3.564   1.00 26.95 ? 129 TRP A CE2 1 
ATOM   193  C  CE3 . TRP A 1 26  ? 16.465  80.759  3.005   1.00 23.11 ? 129 TRP A CE3 1 
ATOM   194  C  CZ2 . TRP A 1 26  ? 13.789  81.669  2.757   1.00 26.80 ? 129 TRP A CZ2 1 
ATOM   195  C  CZ3 . TRP A 1 26  ? 16.149  81.837  2.209   1.00 26.81 ? 129 TRP A CZ3 1 
ATOM   196  C  CH2 . TRP A 1 26  ? 14.813  82.289  2.086   1.00 26.20 ? 129 TRP A CH2 1 
ATOM   197  N  N   . GLN A 1 27  ? 19.491  77.178  4.283   1.00 28.33 ? 130 GLN A N   1 
ATOM   198  C  CA  . GLN A 1 27  ? 20.757  76.749  4.898   1.00 29.86 ? 130 GLN A CA  1 
ATOM   199  C  C   . GLN A 1 27  ? 21.512  77.976  5.422   1.00 28.67 ? 130 GLN A C   1 
ATOM   200  O  O   . GLN A 1 27  ? 21.482  79.051  4.805   1.00 26.12 ? 130 GLN A O   1 
ATOM   201  C  CB  . GLN A 1 27  ? 21.635  75.945  3.917   1.00 31.12 ? 130 GLN A CB  1 
ATOM   202  C  CG  . GLN A 1 27  ? 22.382  76.810  2.883   1.00 34.33 ? 130 GLN A CG  1 
ATOM   203  C  CD  . GLN A 1 27  ? 23.034  76.007  1.764   1.00 35.12 ? 130 GLN A CD  1 
ATOM   204  O  OE1 . GLN A 1 27  ? 23.645  74.967  2.013   1.00 37.12 ? 130 GLN A OE1 1 
ATOM   205  N  NE2 . GLN A 1 27  ? 22.913  76.498  0.529   1.00 34.30 ? 130 GLN A NE2 1 
ATOM   206  N  N   . PRO A 1 28  ? 22.174  77.828  6.567   1.00 27.24 ? 131 PRO A N   1 
ATOM   207  C  CA  . PRO A 1 28  ? 22.911  78.947  7.157   1.00 19.94 ? 131 PRO A CA  1 
ATOM   208  C  C   . PRO A 1 28  ? 24.210  79.232  6.416   1.00 21.94 ? 131 PRO A C   1 
ATOM   209  O  O   . PRO A 1 28  ? 24.893  78.295  6.019   1.00 21.16 ? 131 PRO A O   1 
ATOM   210  C  CB  . PRO A 1 28  ? 23.184  78.471  8.582   1.00 24.12 ? 131 PRO A CB  1 
ATOM   211  C  CG  . PRO A 1 28  ? 23.231  76.955  8.497   1.00 26.46 ? 131 PRO A CG  1 
ATOM   212  C  CD  . PRO A 1 28  ? 22.260  76.596  7.389   1.00 27.61 ? 131 PRO A CD  1 
ATOM   213  N  N   . VAL A 1 29  ? 24.518  80.507  6.178   1.00 19.26 ? 132 VAL A N   1 
ATOM   214  C  CA  . VAL A 1 29  ? 25.884  80.887  5.820   1.00 21.13 ? 132 VAL A CA  1 
ATOM   215  C  C   . VAL A 1 29  ? 26.558  81.691  6.937   1.00 17.40 ? 132 VAL A C   1 
ATOM   216  O  O   . VAL A 1 29  ? 27.770  81.822  6.952   1.00 20.16 ? 132 VAL A O   1 
ATOM   217  C  CB  . VAL A 1 29  ? 25.960  81.629  4.461   1.00 25.38 ? 132 VAL A CB  1 
ATOM   218  C  CG1 . VAL A 1 29  ? 25.475  80.706  3.347   1.00 30.32 ? 132 VAL A CG1 1 
ATOM   219  C  CG2 . VAL A 1 29  ? 25.155  82.907  4.475   1.00 20.95 ? 132 VAL A CG2 1 
ATOM   220  N  N   . LEU A 1 30  ? 25.774  82.202  7.879   1.00 19.36 ? 133 LEU A N   1 
ATOM   221  C  CA  . LEU A 1 30  ? 26.309  82.932  9.029   1.00 21.92 ? 133 LEU A CA  1 
ATOM   222  C  C   . LEU A 1 30  ? 25.442  82.643  10.260  1.00 20.27 ? 133 LEU A C   1 
ATOM   223  O  O   . LEU A 1 30  ? 24.213  82.712  10.198  1.00 21.83 ? 133 LEU A O   1 
ATOM   224  C  CB  . LEU A 1 30  ? 26.353  84.443  8.761   1.00 20.69 ? 133 LEU A CB  1 
ATOM   225  C  CG  . LEU A 1 30  ? 26.935  85.364  9.851   1.00 26.06 ? 133 LEU A CG  1 
ATOM   226  C  CD1 . LEU A 1 30  ? 28.423  85.269  9.928   1.00 23.59 ? 133 LEU A CD1 1 
ATOM   227  C  CD2 . LEU A 1 30  ? 26.548  86.834  9.590   1.00 30.16 ? 133 LEU A CD2 1 
ATOM   228  N  N   . ARG A 1 31  ? 26.090  82.326  11.373  1.00 17.26 ? 134 ARG A N   1 
ATOM   229  C  CA  . ARG A 1 31  ? 25.403  82.224  12.656  1.00 23.52 ? 134 ARG A CA  1 
ATOM   230  C  C   . ARG A 1 31  ? 26.301  82.593  13.828  1.00 21.81 ? 134 ARG A C   1 
ATOM   231  O  O   . ARG A 1 31  ? 27.498  82.367  13.805  1.00 22.91 ? 134 ARG A O   1 
ATOM   232  C  CB  . ARG A 1 31  ? 24.831  80.818  12.864  1.00 26.60 ? 134 ARG A CB  1 
ATOM   233  C  CG  . ARG A 1 31  ? 25.789  79.700  12.590  1.00 28.23 ? 134 ARG A CG  1 
ATOM   234  C  CD  . ARG A 1 31  ? 25.511  78.450  13.404  1.00 36.30 ? 134 ARG A CD  1 
ATOM   235  N  NE  . ARG A 1 31  ? 24.083  78.160  13.465  1.00 37.34 ? 134 ARG A NE  1 
ATOM   236  C  CZ  . ARG A 1 31  ? 23.354  78.007  14.574  1.00 42.02 ? 134 ARG A CZ  1 
ATOM   237  N  NH1 . ARG A 1 31  ? 23.888  78.088  15.796  1.00 40.87 ? 134 ARG A NH1 1 
ATOM   238  N  NH2 . ARG A 1 31  ? 22.049  77.769  14.446  1.00 45.43 ? 134 ARG A NH2 1 
ATOM   239  N  N   . ARG A 1 32  ? 25.700  83.199  14.840  1.00 26.86 ? 135 ARG A N   1 
ATOM   240  C  CA  . ARG A 1 32  ? 26.351  83.444  16.121  1.00 27.92 ? 135 ARG A CA  1 
ATOM   241  C  C   . ARG A 1 32  ? 25.291  83.353  17.220  1.00 29.57 ? 135 ARG A C   1 
ATOM   242  O  O   . ARG A 1 32  ? 24.160  83.768  17.013  1.00 27.21 ? 135 ARG A O   1 
ATOM   243  C  CB  . ARG A 1 32  ? 27.029  84.814  16.131  1.00 28.76 ? 135 ARG A CB  1 
ATOM   244  C  CG  . ARG A 1 32  ? 28.072  84.952  17.259  1.00 34.81 ? 135 ARG A CG  1 
ATOM   245  C  CD  . ARG A 1 32  ? 28.884  86.239  17.223  1.00 35.28 ? 135 ARG A CD  1 
ATOM   246  N  NE  . ARG A 1 32  ? 28.020  87.416  17.285  1.00 37.66 ? 135 ARG A NE  1 
ATOM   247  C  CZ  . ARG A 1 32  ? 28.378  88.649  16.912  1.00 36.58 ? 135 ARG A CZ  1 
ATOM   248  N  NH1 . ARG A 1 32  ? 29.607  88.900  16.456  1.00 34.45 ? 135 ARG A NH1 1 
ATOM   249  N  NH2 . ARG A 1 32  ? 27.504  89.648  17.015  1.00 30.53 ? 135 ARG A NH2 1 
ATOM   250  N  N   . GLY A 1 33  ? 25.642  82.819  18.390  1.00 32.90 ? 136 GLY A N   1 
ATOM   251  C  CA  . GLY A 1 33  ? 24.640  82.554  19.417  1.00 35.36 ? 136 GLY A CA  1 
ATOM   252  C  C   . GLY A 1 33  ? 23.811  81.342  19.026  1.00 39.00 ? 136 GLY A C   1 
ATOM   253  O  O   . GLY A 1 33  ? 24.143  80.673  18.047  1.00 43.38 ? 136 GLY A O   1 
ATOM   254  N  N   . ARG A 1 34  ? 22.720  81.075  19.738  1.00 42.88 ? 137 ARG A N   1 
ATOM   255  C  CA  . ARG A 1 34  ? 22.144  79.718  19.742  1.00 48.08 ? 137 ARG A CA  1 
ATOM   256  C  C   . ARG A 1 34  ? 20.613  79.550  19.598  1.00 47.75 ? 137 ARG A C   1 
ATOM   257  O  O   . ARG A 1 34  ? 20.128  78.406  19.500  1.00 47.82 ? 137 ARG A O   1 
ATOM   258  C  CB  . ARG A 1 34  ? 22.588  79.011  21.029  1.00 51.96 ? 137 ARG A CB  1 
ATOM   259  C  CG  . ARG A 1 34  ? 22.184  79.747  22.306  1.00 55.36 ? 137 ARG A CG  1 
ATOM   260  C  CD  . ARG A 1 34  ? 21.569  78.851  23.387  1.00 60.87 ? 137 ARG A CD  1 
ATOM   261  N  NE  . ARG A 1 34  ? 20.761  79.630  24.329  1.00 65.37 ? 137 ARG A NE  1 
ATOM   262  C  CZ  . ARG A 1 34  ? 21.253  80.432  25.278  1.00 68.29 ? 137 ARG A CZ  1 
ATOM   263  N  NH1 . ARG A 1 34  ? 22.567  80.568  25.454  1.00 68.74 ? 137 ARG A NH1 1 
ATOM   264  N  NH2 . ARG A 1 34  ? 20.417  81.099  26.069  1.00 68.79 ? 137 ARG A NH2 1 
ATOM   265  N  N   . GLY A 1 35  ? 19.854  80.647  19.565  1.00 39.47 ? 138 GLY A N   1 
ATOM   266  C  CA  . GLY A 1 35  ? 18.404  80.550  19.684  1.00 38.42 ? 138 GLY A CA  1 
ATOM   267  C  C   . GLY A 1 35  ? 17.566  80.118  18.477  1.00 35.94 ? 138 GLY A C   1 
ATOM   268  O  O   . GLY A 1 35  ? 16.339  80.089  18.579  1.00 29.49 ? 138 GLY A O   1 
ATOM   269  N  N   . LEU A 1 36  ? 18.197  79.793  17.348  1.00 34.45 ? 139 LEU A N   1 
ATOM   270  C  CA  . LEU A 1 36  ? 17.465  79.540  16.100  1.00 30.89 ? 139 LEU A CA  1 
ATOM   271  C  C   . LEU A 1 36  ? 18.056  78.414  15.270  1.00 29.54 ? 139 LEU A C   1 
ATOM   272  O  O   . LEU A 1 36  ? 19.250  78.162  15.312  1.00 32.80 ? 139 LEU A O   1 
ATOM   273  C  CB  . LEU A 1 36  ? 17.447  80.799  15.248  1.00 31.30 ? 139 LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 36  ? 16.706  82.008  15.812  1.00 33.95 ? 139 LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 36  ? 17.263  83.279  15.181  1.00 36.64 ? 139 LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 36  ? 15.210  81.881  15.579  1.00 33.94 ? 139 LEU A CD2 1 
ATOM   277  N  N   . GLU A 1 37  ? 17.212  77.769  14.475  1.00 29.98 ? 140 GLU A N   1 
ATOM   278  C  CA  . GLU A 1 37  ? 17.636  76.649  13.662  1.00 27.14 ? 140 GLU A CA  1 
ATOM   279  C  C   . GLU A 1 37  ? 16.729  76.467  12.456  1.00 24.77 ? 140 GLU A C   1 
ATOM   280  O  O   . GLU A 1 37  ? 15.539  76.222  12.598  1.00 24.91 ? 140 GLU A O   1 
ATOM   281  C  CB  . GLU A 1 37  ? 17.637  75.372  14.500  1.00 33.21 ? 140 GLU A CB  1 
ATOM   282  C  CG  . GLU A 1 37  ? 18.294  74.183  13.813  1.00 37.05 ? 140 GLU A CG  1 
ATOM   283  C  CD  . GLU A 1 37  ? 18.094  72.882  14.565  1.00 41.79 ? 140 GLU A CD  1 
ATOM   284  O  OE1 . GLU A 1 37  ? 18.896  72.608  15.490  1.00 48.70 ? 140 GLU A OE1 1 
ATOM   285  O  OE2 . GLU A 1 37  ? 17.149  72.127  14.229  1.00 42.41 ? 140 GLU A OE2 1 
ATOM   286  N  N   . ALA A 1 38  ? 17.305  76.589  11.267  1.00 26.49 ? 141 ALA A N   1 
ATOM   287  C  CA  . ALA A 1 38  ? 16.623  76.243  10.029  1.00 26.42 ? 141 ALA A CA  1 
ATOM   288  C  C   . ALA A 1 38  ? 16.439  74.736  10.006  1.00 28.88 ? 141 ALA A C   1 
ATOM   289  O  O   . ALA A 1 38  ? 17.352  73.992  10.365  1.00 28.49 ? 141 ALA A O   1 
ATOM   290  C  CB  . ALA A 1 38  ? 17.441  76.687  8.841   1.00 28.71 ? 141 ALA A CB  1 
ATOM   291  N  N   . GLN A 1 39  ? 15.227  74.302  9.671   1.00 26.55 ? 142 GLN A N   1 
ATOM   292  C  CA  . GLN A 1 39  ? 14.945  72.909  9.367   1.00 25.46 ? 142 GLN A CA  1 
ATOM   293  C  C   . GLN A 1 39  ? 14.147  72.890  8.069   1.00 24.22 ? 142 GLN A C   1 
ATOM   294  O  O   . GLN A 1 39  ? 12.950  73.114  8.082   1.00 22.51 ? 142 GLN A O   1 
ATOM   295  C  CB  . GLN A 1 39  ? 14.111  72.254  10.469  1.00 22.39 ? 142 GLN A CB  1 
ATOM   296  C  CG  . GLN A 1 39  ? 14.694  72.296  11.848  1.00 23.78 ? 142 GLN A CG  1 
ATOM   297  C  CD  . GLN A 1 39  ? 13.911  71.435  12.841  1.00 27.36 ? 142 GLN A CD  1 
ATOM   298  O  OE1 . GLN A 1 39  ? 12.741  71.085  12.604  1.00 25.80 ? 142 GLN A OE1 1 
ATOM   299  N  NE2 . GLN A 1 39  ? 14.553  71.094  13.952  1.00 22.49 ? 142 GLN A NE2 1 
ATOM   300  N  N   . GLY A 1 40  ? 14.807  72.609  6.955   1.00 22.73 ? 143 GLY A N   1 
ATOM   301  C  CA  . GLY A 1 40  ? 14.133  72.562  5.678   1.00 21.62 ? 143 GLY A CA  1 
ATOM   302  C  C   . GLY A 1 40  ? 13.565  73.922  5.338   1.00 22.17 ? 143 GLY A C   1 
ATOM   303  O  O   . GLY A 1 40  ? 14.292  74.914  5.319   1.00 22.88 ? 143 GLY A O   1 
ATOM   304  N  N   . ASP A 1 41  ? 12.258  73.994  5.117   1.00 24.13 ? 144 ASP A N   1 
ATOM   305  C  CA  . ASP A 1 41  ? 11.667  75.261  4.708   1.00 26.76 ? 144 ASP A CA  1 
ATOM   306  C  C   . ASP A 1 41  ? 11.099  76.100  5.850   1.00 25.83 ? 144 ASP A C   1 
ATOM   307  O  O   . ASP A 1 41  ? 10.449  77.099  5.600   1.00 24.14 ? 144 ASP A O   1 
ATOM   308  C  CB  . ASP A 1 41  ? 10.646  75.070  3.571   1.00 31.72 ? 144 ASP A CB  1 
ATOM   309  C  CG  . ASP A 1 41  ? 9.466   74.216  3.954   1.00 33.04 ? 144 ASP A CG  1 
ATOM   310  O  OD1 . ASP A 1 41  ? 9.177   74.056  5.156   1.00 35.65 ? 144 ASP A OD1 1 
ATOM   311  O  OD2 . ASP A 1 41  ? 8.759   73.657  3.092   1.00 41.78 ? 144 ASP A OD2 1 
ATOM   312  N  N   . ILE A 1 42  ? 11.369  75.720  7.097   1.00 27.12 ? 145 ILE A N   1 
ATOM   313  C  CA  . ILE A 1 42  ? 11.019  76.569  8.245   1.00 28.15 ? 145 ILE A CA  1 
ATOM   314  C  C   . ILE A 1 42  ? 12.237  76.896  9.119   1.00 26.54 ? 145 ILE A C   1 
ATOM   315  O  O   . ILE A 1 42  ? 13.305  76.337  8.942   1.00 22.98 ? 145 ILE A O   1 
ATOM   316  C  CB  . ILE A 1 42  ? 9.860   75.942  9.078   1.00 30.76 ? 145 ILE A CB  1 
ATOM   317  C  CG1 . ILE A 1 42  ? 10.213  74.565  9.633   1.00 32.12 ? 145 ILE A CG1 1 
ATOM   318  C  CG2 . ILE A 1 42  ? 8.612   75.791  8.215   1.00 31.80 ? 145 ILE A CG2 1 
ATOM   319  C  CD1 . ILE A 1 42  ? 11.080  74.588  10.848  1.00 35.61 ? 145 ILE A CD1 1 
ATOM   320  N  N   . VAL A 1 43  ? 12.068  77.848  10.029  1.00 27.57 ? 146 VAL A N   1 
ATOM   321  C  CA  . VAL A 1 43  ? 13.061  78.152  11.047  1.00 25.40 ? 146 VAL A CA  1 
ATOM   322  C  C   . VAL A 1 43  ? 12.401  77.859  12.387  1.00 25.57 ? 146 VAL A C   1 
ATOM   323  O  O   . VAL A 1 43  ? 11.297  78.310  12.632  1.00 21.83 ? 146 VAL A O   1 
ATOM   324  C  CB  . VAL A 1 43  ? 13.502  79.624  10.990  1.00 23.31 ? 146 VAL A CB  1 
ATOM   325  C  CG1 . VAL A 1 43  ? 14.583  79.905  12.011  1.00 25.52 ? 146 VAL A CG1 1 
ATOM   326  C  CG2 . VAL A 1 43  ? 13.979  79.990  9.601   1.00 25.62 ? 146 VAL A CG2 1 
ATOM   327  N  N   . ARG A 1 44  ? 13.056  77.081  13.239  1.00 27.85 ? 147 ARG A N   1 
ATOM   328  C  CA  . ARG A 1 44  ? 12.543  76.826  14.584  1.00 30.24 ? 147 ARG A CA  1 
ATOM   329  C  C   . ARG A 1 44  ? 13.119  77.854  15.551  1.00 29.21 ? 147 ARG A C   1 
ATOM   330  O  O   . ARG A 1 44  ? 14.305  78.202  15.468  1.00 32.84 ? 147 ARG A O   1 
ATOM   331  C  CB  . ARG A 1 44  ? 12.869  75.399  15.047  1.00 33.62 ? 147 ARG A CB  1 
ATOM   332  C  CG  . ARG A 1 44  ? 11.633  74.635  15.546  1.00 42.49 ? 147 ARG A CG  1 
ATOM   333  C  CD  . ARG A 1 44  ? 11.563  73.176  15.117  1.00 47.02 ? 147 ARG A CD  1 
ATOM   334  N  NE  . ARG A 1 44  ? 10.196  72.663  15.059  1.00 50.49 ? 147 ARG A NE  1 
ATOM   335  C  CZ  . ARG A 1 44  ? 9.372   72.509  16.097  1.00 54.80 ? 147 ARG A CZ  1 
ATOM   336  N  NH1 . ARG A 1 44  ? 9.742   72.825  17.334  1.00 56.28 ? 147 ARG A NH1 1 
ATOM   337  N  NH2 . ARG A 1 44  ? 8.149   72.026  15.893  1.00 57.94 ? 147 ARG A NH2 1 
ATOM   338  N  N   . VAL A 1 45  ? 12.274  78.349  16.448  1.00 26.29 ? 148 VAL A N   1 
ATOM   339  C  CA  . VAL A 1 45  ? 12.688  79.284  17.490  1.00 26.68 ? 148 VAL A CA  1 
ATOM   340  C  C   . VAL A 1 45  ? 12.854  78.511  18.788  1.00 23.29 ? 148 VAL A C   1 
ATOM   341  O  O   . VAL A 1 45  ? 11.937  77.838  19.230  1.00 26.31 ? 148 VAL A O   1 
ATOM   342  C  CB  . VAL A 1 45  ? 11.663  80.417  17.678  1.00 26.94 ? 148 VAL A CB  1 
ATOM   343  C  CG1 . VAL A 1 45  ? 12.056  81.341  18.842  1.00 26.93 ? 148 VAL A CG1 1 
ATOM   344  C  CG2 . VAL A 1 45  ? 11.537  81.207  16.407  1.00 27.57 ? 148 VAL A CG2 1 
ATOM   345  N  N   . TRP A 1 46  ? 14.046  78.599  19.370  1.00 25.09 ? 149 TRP A N   1 
ATOM   346  C  CA  . TRP A 1 46  ? 14.399  77.867  20.576  1.00 29.39 ? 149 TRP A CA  1 
ATOM   347  C  C   . TRP A 1 46  ? 14.497  78.762  21.814  1.00 29.49 ? 149 TRP A C   1 
ATOM   348  O  O   . TRP A 1 46  ? 14.231  78.304  22.923  1.00 31.46 ? 149 TRP A O   1 
ATOM   349  C  CB  . TRP A 1 46  ? 15.701  77.102  20.329  1.00 31.77 ? 149 TRP A CB  1 
ATOM   350  C  CG  . TRP A 1 46  ? 15.594  76.098  19.181  1.00 36.43 ? 149 TRP A CG  1 
ATOM   351  C  CD1 . TRP A 1 46  ? 16.445  75.958  18.092  1.00 38.03 ? 149 TRP A CD1 1 
ATOM   352  C  CD2 . TRP A 1 46  ? 14.582  75.083  19.032  1.00 39.50 ? 149 TRP A CD2 1 
ATOM   353  N  NE1 . TRP A 1 46  ? 16.027  74.926  17.281  1.00 39.89 ? 149 TRP A NE1 1 
ATOM   354  C  CE2 . TRP A 1 46  ? 14.887  74.373  17.828  1.00 39.38 ? 149 TRP A CE2 1 
ATOM   355  C  CE3 . TRP A 1 46  ? 13.453  74.690  19.809  1.00 39.86 ? 149 TRP A CE3 1 
ATOM   356  C  CZ2 . TRP A 1 46  ? 14.107  73.301  17.387  1.00 40.49 ? 149 TRP A CZ2 1 
ATOM   357  C  CZ3 . TRP A 1 46  ? 12.673  73.631  19.356  1.00 42.63 ? 149 TRP A CZ3 1 
ATOM   358  C  CH2 . TRP A 1 46  ? 13.006  72.950  18.155  1.00 42.34 ? 149 TRP A CH2 1 
ATOM   359  N  N   . ASP A 1 47  ? 14.856  80.032  21.617  1.00 29.78 ? 150 ASP A N   1 
ATOM   360  C  CA  . ASP A 1 47  ? 14.960  81.011  22.702  1.00 29.92 ? 150 ASP A CA  1 
ATOM   361  C  C   . ASP A 1 47  ? 13.933  82.124  22.508  1.00 27.81 ? 150 ASP A C   1 
ATOM   362  O  O   . ASP A 1 47  ? 13.882  82.763  21.454  1.00 27.79 ? 150 ASP A O   1 
ATOM   363  C  CB  . ASP A 1 47  ? 16.355  81.664  22.752  1.00 34.56 ? 150 ASP A CB  1 
ATOM   364  C  CG  . ASP A 1 47  ? 17.483  80.680  23.077  1.00 37.63 ? 150 ASP A CG  1 
ATOM   365  O  OD1 . ASP A 1 47  ? 17.222  79.559  23.573  1.00 37.01 ? 150 ASP A OD1 1 
ATOM   366  O  OD2 . ASP A 1 47  ? 18.684  80.967  22.866  1.00 38.07 ? 150 ASP A OD2 1 
ATOM   367  N  N   . THR A 1 48  ? 13.137  82.366  23.540  1.00 24.41 ? 151 THR A N   1 
ATOM   368  C  CA  . THR A 1 48  ? 12.220  83.490  23.562  1.00 25.22 ? 151 THR A CA  1 
ATOM   369  C  C   . THR A 1 48  ? 12.985  84.802  23.528  1.00 26.53 ? 151 THR A C   1 
ATOM   370  O  O   . THR A 1 48  ? 13.994  84.947  24.212  1.00 27.12 ? 151 THR A O   1 
ATOM   371  C  CB  . THR A 1 48  ? 11.373  83.429  24.830  1.00 23.54 ? 151 THR A CB  1 
ATOM   372  O  OG1 . THR A 1 48  ? 10.475  82.331  24.729  1.00 22.64 ? 151 THR A OG1 1 
ATOM   373  C  CG2 . THR A 1 48  ? 10.449  84.646  24.963  1.00 26.45 ? 151 THR A CG2 1 
ATOM   374  N  N   . GLY A 1 49  ? 12.500  85.754  22.738  1.00 26.63 ? 152 GLY A N   1 
ATOM   375  C  CA  . GLY A 1 49  ? 13.070  87.089  22.719  1.00 27.21 ? 152 GLY A CA  1 
ATOM   376  C  C   . GLY A 1 49  ? 12.523  88.006  21.637  1.00 26.83 ? 152 GLY A C   1 
ATOM   377  O  O   . GLY A 1 49  ? 11.601  87.656  20.907  1.00 25.77 ? 152 GLY A O   1 
ATOM   378  N  N   . ILE A 1 50  ? 13.104  89.196  21.547  1.00 24.70 ? 153 ILE A N   1 
ATOM   379  C  CA  . ILE A 1 50  ? 12.742  90.152  20.517  1.00 23.84 ? 153 ILE A CA  1 
ATOM   380  C  C   . ILE A 1 50  ? 13.788  90.050  19.422  1.00 23.10 ? 153 ILE A C   1 
ATOM   381  O  O   . ILE A 1 50  ? 14.980  90.121  19.693  1.00 23.01 ? 153 ILE A O   1 
ATOM   382  C  CB  . ILE A 1 50  ? 12.651  91.569  21.116  1.00 22.50 ? 153 ILE A CB  1 
ATOM   383  C  CG1 . ILE A 1 50  ? 11.381  91.674  21.971  1.00 22.63 ? 153 ILE A CG1 1 
ATOM   384  C  CG2 . ILE A 1 50  ? 12.610  92.611  20.019  1.00 24.34 ? 153 ILE A CG2 1 
ATOM   385  C  CD1 . ILE A 1 50  ? 11.314  92.883  22.839  1.00 22.29 ? 153 ILE A CD1 1 
ATOM   386  N  N   . TYR A 1 51  ? 13.330  89.852  18.191  1.00 22.04 ? 154 TYR A N   1 
ATOM   387  C  CA  . TYR A 1 51  ? 14.208  89.617  17.046  1.00 24.46 ? 154 TYR A CA  1 
ATOM   388  C  C   . TYR A 1 51  ? 13.880  90.565  15.910  1.00 25.09 ? 154 TYR A C   1 
ATOM   389  O  O   . TYR A 1 51  ? 12.707  90.797  15.630  1.00 24.08 ? 154 TYR A O   1 
ATOM   390  C  CB  . TYR A 1 51  ? 14.001  88.204  16.494  1.00 23.82 ? 154 TYR A CB  1 
ATOM   391  C  CG  . TYR A 1 51  ? 14.451  87.069  17.388  1.00 21.25 ? 154 TYR A CG  1 
ATOM   392  C  CD1 . TYR A 1 51  ? 13.672  86.654  18.448  1.00 18.66 ? 154 TYR A CD1 1 
ATOM   393  C  CD2 . TYR A 1 51  ? 15.646  86.390  17.143  1.00 21.92 ? 154 TYR A CD2 1 
ATOM   394  C  CE1 . TYR A 1 51  ? 14.074  85.604  19.267  1.00 21.64 ? 154 TYR A CE1 1 
ATOM   395  C  CE2 . TYR A 1 51  ? 16.060  85.340  17.967  1.00 20.73 ? 154 TYR A CE2 1 
ATOM   396  C  CZ  . TYR A 1 51  ? 15.266  84.951  19.019  1.00 20.48 ? 154 TYR A CZ  1 
ATOM   397  O  OH  . TYR A 1 51  ? 15.646  83.908  19.833  1.00 27.50 ? 154 TYR A OH  1 
ATOM   398  N  N   . LEU A 1 52  ? 14.912  91.085  15.247  1.00 21.61 ? 155 LEU A N   1 
ATOM   399  C  CA  . LEU A 1 52  ? 14.760  91.683  13.926  1.00 20.44 ? 155 LEU A CA  1 
ATOM   400  C  C   . LEU A 1 52  ? 14.719  90.538  12.918  1.00 23.03 ? 155 LEU A C   1 
ATOM   401  O  O   . LEU A 1 52  ? 15.639  89.737  12.875  1.00 23.08 ? 155 LEU A O   1 
ATOM   402  C  CB  . LEU A 1 52  ? 15.944  92.625  13.616  1.00 25.22 ? 155 LEU A CB  1 
ATOM   403  C  CG  . LEU A 1 52  ? 16.113  93.139  12.179  1.00 27.96 ? 155 LEU A CG  1 
ATOM   404  C  CD1 . LEU A 1 52  ? 14.955  94.035  11.797  1.00 30.56 ? 155 LEU A CD1 1 
ATOM   405  C  CD2 . LEU A 1 52  ? 17.422  93.901  12.023  1.00 32.96 ? 155 LEU A CD2 1 
ATOM   406  N  N   . LEU A 1 53  ? 13.646  90.456  12.136  1.00 25.19 ? 156 LEU A N   1 
ATOM   407  C  CA  . LEU A 1 53  ? 13.495  89.481  11.061  1.00 28.15 ? 156 LEU A CA  1 
ATOM   408  C  C   . LEU A 1 53  ? 13.512  90.178  9.722   1.00 25.19 ? 156 LEU A C   1 
ATOM   409  O  O   . LEU A 1 53  ? 12.756  91.105  9.519   1.00 24.90 ? 156 LEU A O   1 
ATOM   410  C  CB  . LEU A 1 53  ? 12.133  88.814  11.142  1.00 35.02 ? 156 LEU A CB  1 
ATOM   411  C  CG  . LEU A 1 53  ? 12.098  87.437  11.742  1.00 42.85 ? 156 LEU A CG  1 
ATOM   412  C  CD1 . LEU A 1 53  ? 12.153  87.585  13.260  1.00 47.88 ? 156 LEU A CD1 1 
ATOM   413  C  CD2 . LEU A 1 53  ? 10.846  86.717  11.302  1.00 44.83 ? 156 LEU A CD2 1 
ATOM   414  N  N   . TYR A 1 54  ? 14.315  89.695  8.786   1.00 25.96 ? 157 TYR A N   1 
ATOM   415  C  CA  . TYR A 1 54  ? 14.316  90.256  7.442   1.00 26.20 ? 157 TYR A CA  1 
ATOM   416  C  C   . TYR A 1 54  ? 14.285  89.168  6.384   1.00 26.05 ? 157 TYR A C   1 
ATOM   417  O  O   . TYR A 1 54  ? 14.830  88.086  6.574   1.00 26.34 ? 157 TYR A O   1 
ATOM   418  C  CB  . TYR A 1 54  ? 15.511  91.199  7.236   1.00 26.24 ? 157 TYR A CB  1 
ATOM   419  C  CG  . TYR A 1 54  ? 16.862  90.560  7.389   1.00 26.31 ? 157 TYR A CG  1 
ATOM   420  C  CD1 . TYR A 1 54  ? 17.491  89.955  6.307   1.00 27.28 ? 157 TYR A CD1 1 
ATOM   421  C  CD2 . TYR A 1 54  ? 17.524  90.571  8.610   1.00 24.74 ? 157 TYR A CD2 1 
ATOM   422  C  CE1 . TYR A 1 54  ? 18.747  89.370  6.436   1.00 27.61 ? 157 TYR A CE1 1 
ATOM   423  C  CE2 . TYR A 1 54  ? 18.773  89.985  8.746   1.00 24.30 ? 157 TYR A CE2 1 
ATOM   424  C  CZ  . TYR A 1 54  ? 19.383  89.386  7.655   1.00 25.78 ? 157 TYR A CZ  1 
ATOM   425  O  OH  . TYR A 1 54  ? 20.631  88.797  7.780   1.00 26.38 ? 157 TYR A OH  1 
ATOM   426  N  N   . SER A 1 55  ? 13.638  89.491  5.266   1.00 25.59 ? 158 SER A N   1 
ATOM   427  C  CA  . SER A 1 55  ? 13.365  88.550  4.183   1.00 28.37 ? 158 SER A CA  1 
ATOM   428  C  C   . SER A 1 55  ? 13.442  89.272  2.848   1.00 27.10 ? 158 SER A C   1 
ATOM   429  O  O   . SER A 1 55  ? 12.853  90.332  2.672   1.00 28.98 ? 158 SER A O   1 
ATOM   430  C  CB  . SER A 1 55  ? 11.972  87.932  4.334   1.00 27.36 ? 158 SER A CB  1 
ATOM   431  O  OG  . SER A 1 55  ? 11.585  87.187  3.178   1.00 30.31 ? 158 SER A OG  1 
ATOM   432  N  N   . GLN A 1 56  ? 14.225  88.710  1.942   1.00 22.89 ? 159 GLN A N   1 
ATOM   433  C  CA  . GLN A 1 56  ? 14.225  89.115  0.563   1.00 27.98 ? 159 GLN A CA  1 
ATOM   434  C  C   . GLN A 1 56  ? 13.992  87.919  -0.331  1.00 26.82 ? 159 GLN A C   1 
ATOM   435  O  O   . GLN A 1 56  ? 14.587  86.864  -0.128  1.00 24.75 ? 159 GLN A O   1 
ATOM   436  C  CB  . GLN A 1 56  ? 15.556  89.756  0.156   1.00 27.94 ? 159 GLN A CB  1 
ATOM   437  C  CG  . GLN A 1 56  ? 15.525  90.213  -1.307  1.00 27.86 ? 159 GLN A CG  1 
ATOM   438  C  CD  . GLN A 1 56  ? 16.632  91.167  -1.648  1.00 28.22 ? 159 GLN A CD  1 
ATOM   439  O  OE1 . GLN A 1 56  ? 16.691  92.274  -1.103  1.00 24.53 ? 159 GLN A OE1 1 
ATOM   440  N  NE2 . GLN A 1 56  ? 17.510  90.756  -2.563  1.00 23.76 ? 159 GLN A NE2 1 
ATOM   441  N  N   . VAL A 1 57  ? 13.159  88.107  -1.347  1.00 27.15 ? 160 VAL A N   1 
ATOM   442  C  CA  . VAL A 1 57  ? 13.048  87.142  -2.431  1.00 25.92 ? 160 VAL A CA  1 
ATOM   443  C  C   . VAL A 1 57  ? 13.205  87.847  -3.764  1.00 26.35 ? 160 VAL A C   1 
ATOM   444  O  O   . VAL A 1 57  ? 12.632  88.923  -3.992  1.00 27.35 ? 160 VAL A O   1 
ATOM   445  C  CB  . VAL A 1 57  ? 11.703  86.407  -2.395  1.00 30.57 ? 160 VAL A CB  1 
ATOM   446  C  CG1 . VAL A 1 57  ? 11.681  85.288  -3.431  1.00 30.29 ? 160 VAL A CG1 1 
ATOM   447  C  CG2 . VAL A 1 57  ? 11.426  85.851  -0.985  1.00 29.53 ? 160 VAL A CG2 1 
ATOM   448  N  N   . LEU A 1 58  ? 13.984  87.229  -4.642  1.00 25.91 ? 161 LEU A N   1 
ATOM   449  C  CA  . LEU A 1 58  ? 14.193  87.729  -5.987  1.00 27.64 ? 161 LEU A CA  1 
ATOM   450  C  C   . LEU A 1 58  ? 13.322  86.939  -6.959  1.00 26.61 ? 161 LEU A C   1 
ATOM   451  O  O   . LEU A 1 58  ? 13.512  85.736  -7.132  1.00 22.88 ? 161 LEU A O   1 
ATOM   452  C  CB  . LEU A 1 58  ? 15.671  87.616  -6.373  1.00 25.83 ? 161 LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 58  ? 16.021  87.905  -7.829  1.00 26.80 ? 161 LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 58  ? 15.472  89.257  -8.269  1.00 25.46 ? 161 LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 58  ? 17.540  87.829  -8.066  1.00 26.79 ? 161 LEU A CD2 1 
ATOM   456  N  N   . PHE A 1 59  ? 12.377  87.625  -7.604  1.00 24.62 ? 162 PHE A N   1 
ATOM   457  C  CA  . PHE A 1 59  ? 11.442  86.987  -8.534  1.00 24.72 ? 162 PHE A CA  1 
ATOM   458  C  C   . PHE A 1 59  ? 11.823  87.206  -9.988  1.00 25.43 ? 162 PHE A C   1 
ATOM   459  O  O   . PHE A 1 59  ? 12.391  88.229  -10.332 1.00 27.57 ? 162 PHE A O   1 
ATOM   460  C  CB  . PHE A 1 59  ? 10.023  87.502  -8.305  1.00 24.83 ? 162 PHE A CB  1 
ATOM   461  C  CG  . PHE A 1 59  ? 9.492   87.216  -6.926  1.00 23.27 ? 162 PHE A CG  1 
ATOM   462  C  CD1 . PHE A 1 59  ? 8.976   85.967  -6.613  1.00 27.61 ? 162 PHE A CD1 1 
ATOM   463  C  CD2 . PHE A 1 59  ? 9.504   88.197  -5.947  1.00 25.17 ? 162 PHE A CD2 1 
ATOM   464  C  CE1 . PHE A 1 59  ? 8.473   85.702  -5.347  1.00 23.98 ? 162 PHE A CE1 1 
ATOM   465  C  CE2 . PHE A 1 59  ? 9.013   87.940  -4.682  1.00 27.58 ? 162 PHE A CE2 1 
ATOM   466  C  CZ  . PHE A 1 59  ? 8.493   86.689  -4.382  1.00 27.38 ? 162 PHE A CZ  1 
ATOM   467  N  N   . HIS A 1 60  ? 11.524  86.216  -10.826 1.00 24.49 ? 163 HIS A N   1 
ATOM   468  C  CA  . HIS A 1 60  ? 11.621  86.334  -12.276 1.00 26.46 ? 163 HIS A CA  1 
ATOM   469  C  C   . HIS A 1 60  ? 10.387  85.616  -12.830 1.00 26.50 ? 163 HIS A C   1 
ATOM   470  O  O   . HIS A 1 60  ? 10.450  84.460  -13.236 1.00 32.27 ? 163 HIS A O   1 
ATOM   471  C  CB  . HIS A 1 60  ? 12.947  85.741  -12.795 1.00 27.53 ? 163 HIS A CB  1 
ATOM   472  C  CG  . HIS A 1 60  ? 13.072  85.717  -14.291 1.00 27.56 ? 163 HIS A CG  1 
ATOM   473  N  ND1 . HIS A 1 60  ? 12.426  86.617  -15.115 1.00 31.56 ? 163 HIS A ND1 1 
ATOM   474  C  CD2 . HIS A 1 60  ? 13.781  84.904  -15.109 1.00 28.23 ? 163 HIS A CD2 1 
ATOM   475  C  CE1 . HIS A 1 60  ? 12.723  86.350  -16.375 1.00 28.41 ? 163 HIS A CE1 1 
ATOM   476  N  NE2 . HIS A 1 60  ? 13.545  85.318  -16.398 1.00 29.45 ? 163 HIS A NE2 1 
ATOM   477  N  N   . ASP A 1 61  ? 9.265   86.335  -12.818 1.00 28.28 ? 164 ASP A N   1 
ATOM   478  C  CA  . ASP A 1 61  ? 7.920   85.751  -12.866 1.00 28.70 ? 164 ASP A CA  1 
ATOM   479  C  C   . ASP A 1 61  ? 6.912   86.836  -13.300 1.00 28.82 ? 164 ASP A C   1 
ATOM   480  O  O   . ASP A 1 61  ? 6.879   87.922  -12.709 1.00 28.13 ? 164 ASP A O   1 
ATOM   481  C  CB  . ASP A 1 61  ? 7.577   85.223  -11.457 1.00 33.82 ? 164 ASP A CB  1 
ATOM   482  C  CG  . ASP A 1 61  ? 6.427   84.223  -11.444 1.00 36.47 ? 164 ASP A CG  1 
ATOM   483  O  OD1 . ASP A 1 61  ? 5.363   84.504  -12.044 1.00 39.08 ? 164 ASP A OD1 1 
ATOM   484  O  OD2 . ASP A 1 61  ? 6.491   83.137  -10.827 1.00 34.63 ? 164 ASP A OD2 1 
ATOM   485  N  N   . VAL A 1 62  ? 6.093   86.551  -14.318 1.00 26.57 ? 165 VAL A N   1 
ATOM   486  C  CA  . VAL A 1 62  ? 5.166   87.561  -14.872 1.00 26.24 ? 165 VAL A CA  1 
ATOM   487  C  C   . VAL A 1 62  ? 3.813   87.675  -14.153 1.00 24.05 ? 165 VAL A C   1 
ATOM   488  O  O   . VAL A 1 62  ? 2.970   88.479  -14.546 1.00 20.15 ? 165 VAL A O   1 
ATOM   489  C  CB  . VAL A 1 62  ? 4.906   87.370  -16.395 1.00 27.60 ? 165 VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 62  ? 6.212   87.437  -17.166 1.00 30.01 ? 165 VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 62  ? 4.144   86.061  -16.696 1.00 26.20 ? 165 VAL A CG2 1 
ATOM   492  N  N   . THR A 1 63  ? 3.614   86.891  -13.097 1.00 26.00 ? 166 THR A N   1 
ATOM   493  C  CA  . THR A 1 63  ? 2.366   86.935  -12.347 1.00 22.32 ? 166 THR A CA  1 
ATOM   494  C  C   . THR A 1 63  ? 2.171   88.347  -11.814 1.00 19.82 ? 166 THR A C   1 
ATOM   495  O  O   . THR A 1 63  ? 3.084   88.950  -11.252 1.00 20.78 ? 166 THR A O   1 
ATOM   496  C  CB  . THR A 1 63  ? 2.391   85.926  -11.214 1.00 25.09 ? 166 THR A CB  1 
ATOM   497  O  OG1 . THR A 1 63  ? 2.608   84.612  -11.748 1.00 26.03 ? 166 THR A OG1 1 
ATOM   498  C  CG2 . THR A 1 63  ? 1.022   85.842  -10.518 1.00 25.82 ? 166 THR A CG2 1 
ATOM   499  N  N   . PHE A 1 64  ? 0.986   88.886  -12.028 1.00 20.05 ? 167 PHE A N   1 
ATOM   500  C  CA  . PHE A 1 64  ? 0.779   90.315  -11.865 1.00 22.68 ? 167 PHE A CA  1 
ATOM   501  C  C   . PHE A 1 64  ? 1.352   90.807  -10.534 1.00 18.89 ? 167 PHE A C   1 
ATOM   502  O  O   . PHE A 1 64  ? 1.930   91.861  -10.492 1.00 20.13 ? 167 PHE A O   1 
ATOM   503  C  CB  . PHE A 1 64  ? -0.692  90.685  -12.024 1.00 20.90 ? 167 PHE A CB  1 
ATOM   504  C  CG  . PHE A 1 64  ? -1.535  90.351  -10.824 1.00 24.39 ? 167 PHE A CG  1 
ATOM   505  C  CD1 . PHE A 1 64  ? -1.961  89.055  -10.601 1.00 25.47 ? 167 PHE A CD1 1 
ATOM   506  C  CD2 . PHE A 1 64  ? -1.910  91.344  -9.927  1.00 28.50 ? 167 PHE A CD2 1 
ATOM   507  C  CE1 . PHE A 1 64  ? -2.747  88.751  -9.512  1.00 32.13 ? 167 PHE A CE1 1 
ATOM   508  C  CE2 . PHE A 1 64  ? -2.691  91.047  -8.827  1.00 32.93 ? 167 PHE A CE2 1 
ATOM   509  C  CZ  . PHE A 1 64  ? -3.116  89.748  -8.620  1.00 33.99 ? 167 PHE A CZ  1 
ATOM   510  N  N   . THR A 1 65  ? 1.200   90.031  -9.466  1.00 20.44 ? 168 THR A N   1 
ATOM   511  C  CA  . THR A 1 65  ? 1.867   90.337  -8.201  1.00 19.97 ? 168 THR A CA  1 
ATOM   512  C  C   . THR A 1 65  ? 2.586   89.124  -7.670  1.00 20.49 ? 168 THR A C   1 
ATOM   513  O  O   . THR A 1 65  ? 2.127   87.997  -7.838  1.00 21.96 ? 168 THR A O   1 
ATOM   514  C  CB  . THR A 1 65  ? 0.884   90.850  -7.117  1.00 15.69 ? 168 THR A CB  1 
ATOM   515  O  OG1 . THR A 1 65  ? -0.311  90.062  -7.115  1.00 16.05 ? 168 THR A OG1 1 
ATOM   516  C  CG2 . THR A 1 65  ? 0.434   92.262  -7.445  1.00 15.09 ? 168 THR A CG2 1 
ATOM   517  N  N   . MET A 1 66  ? 3.725   89.386  -7.047  1.00 22.81 ? 169 MET A N   1 
ATOM   518  C  CA  . MET A 1 66  ? 4.507   88.395  -6.350  1.00 24.80 ? 169 MET A CA  1 
ATOM   519  C  C   . MET A 1 66  ? 4.948   88.963  -5.007  1.00 27.42 ? 169 MET A C   1 
ATOM   520  O  O   . MET A 1 66  ? 4.889   90.163  -4.764  1.00 26.16 ? 169 MET A O   1 
ATOM   521  C  CB  . MET A 1 66  ? 5.734   88.012  -7.177  1.00 26.16 ? 169 MET A CB  1 
ATOM   522  C  CG  . MET A 1 66  ? 5.438   87.212  -8.451  1.00 27.52 ? 169 MET A CG  1 
ATOM   523  S  SD  . MET A 1 66  ? 4.564   85.641  -8.198  1.00 29.01 ? 169 MET A SD  1 
ATOM   524  C  CE  . MET A 1 66  ? 5.805   84.614  -7.642  1.00 27.71 ? 169 MET A CE  1 
ATOM   525  N  N   . GLY A 1 67  ? 5.414   88.082  -4.139  1.00 31.06 ? 170 GLY A N   1 
ATOM   526  C  CA  . GLY A 1 67  ? 5.921   88.495  -2.848  1.00 32.83 ? 170 GLY A CA  1 
ATOM   527  C  C   . GLY A 1 67  ? 5.876   87.368  -1.850  1.00 31.55 ? 170 GLY A C   1 
ATOM   528  O  O   . GLY A 1 67  ? 5.638   86.221  -2.215  1.00 28.06 ? 170 GLY A O   1 
ATOM   529  N  N   . GLN A 1 68  ? 6.114   87.690  -0.587  1.00 29.44 ? 171 GLN A N   1 
ATOM   530  C  CA  . GLN A 1 68  ? 6.192   86.655  0.427   1.00 27.04 ? 171 GLN A CA  1 
ATOM   531  C  C   . GLN A 1 68  ? 5.479   87.050  1.710   1.00 28.71 ? 171 GLN A C   1 
ATOM   532  O  O   . GLN A 1 68  ? 5.278   88.236  1.990   1.00 27.70 ? 171 GLN A O   1 
ATOM   533  C  CB  . GLN A 1 68  ? 7.654   86.238  0.667   1.00 28.42 ? 171 GLN A CB  1 
ATOM   534  C  CG  . GLN A 1 68  ? 8.565   87.265  1.365   1.00 32.15 ? 171 GLN A CG  1 
ATOM   535  C  CD  . GLN A 1 68  ? 9.265   88.227  0.418   1.00 35.89 ? 171 GLN A CD  1 
ATOM   536  O  OE1 . GLN A 1 68  ? 8.866   88.366  -0.741  1.00 37.71 ? 171 GLN A OE1 1 
ATOM   537  N  NE2 . GLN A 1 68  ? 10.304  88.920  0.922   1.00 30.80 ? 171 GLN A NE2 1 
ATOM   538  N  N   . VAL A 1 69  ? 5.089   86.029  2.466   1.00 26.93 ? 172 VAL A N   1 
ATOM   539  C  CA  . VAL A 1 69  ? 4.355   86.166  3.716   1.00 26.44 ? 172 VAL A CA  1 
ATOM   540  C  C   . VAL A 1 69  ? 5.195   85.487  4.792   1.00 25.11 ? 172 VAL A C   1 
ATOM   541  O  O   . VAL A 1 69  ? 5.487   84.301  4.686   1.00 25.42 ? 172 VAL A O   1 
ATOM   542  C  CB  . VAL A 1 69  ? 2.962   85.457  3.633   1.00 26.04 ? 172 VAL A CB  1 
ATOM   543  C  CG1 . VAL A 1 69  ? 2.168   85.581  4.959   1.00 22.57 ? 172 VAL A CG1 1 
ATOM   544  C  CG2 . VAL A 1 69  ? 2.155   86.001  2.472   1.00 25.55 ? 172 VAL A CG2 1 
ATOM   545  N  N   . VAL A 1 70  ? 5.596   86.240  5.812   1.00 27.50 ? 173 VAL A N   1 
ATOM   546  C  CA  . VAL A 1 70  ? 6.399   85.709  6.916   1.00 25.54 ? 173 VAL A CA  1 
ATOM   547  C  C   . VAL A 1 70  ? 5.520   85.605  8.159   1.00 24.26 ? 173 VAL A C   1 
ATOM   548  O  O   . VAL A 1 70  ? 4.934   86.593  8.588   1.00 22.47 ? 173 VAL A O   1 
ATOM   549  C  CB  . VAL A 1 70  ? 7.609   86.592  7.181   1.00 26.56 ? 173 VAL A CB  1 
ATOM   550  C  CG1 . VAL A 1 70  ? 8.485   86.031  8.357   1.00 26.02 ? 173 VAL A CG1 1 
ATOM   551  C  CG2 . VAL A 1 70  ? 8.426   86.739  5.894   1.00 25.71 ? 173 VAL A CG2 1 
ATOM   552  N  N   . SER A 1 71  ? 5.412   84.399  8.712   1.00 24.48 ? 174 SER A N   1 
ATOM   553  C  CA  . SER A 1 71  ? 4.509   84.132  9.828   1.00 24.34 ? 174 SER A CA  1 
ATOM   554  C  C   . SER A 1 71  ? 5.203   83.378  10.934  1.00 26.02 ? 174 SER A C   1 
ATOM   555  O  O   . SER A 1 71  ? 6.287   82.826  10.749  1.00 23.21 ? 174 SER A O   1 
ATOM   556  C  CB  . SER A 1 71  ? 3.297   83.299  9.380   1.00 25.91 ? 174 SER A CB  1 
ATOM   557  O  OG  . SER A 1 71  ? 2.756   83.761  8.162   1.00 28.37 ? 174 SER A OG  1 
ATOM   558  N  N   . ARG A 1 72  ? 4.555   83.369  12.093  1.00 27.44 ? 175 ARG A N   1 
ATOM   559  C  CA  . ARG A 1 72  ? 4.966   82.529  13.187  1.00 32.11 ? 175 ARG A CA  1 
ATOM   560  C  C   . ARG A 1 72  ? 3.772   81.703  13.644  1.00 29.13 ? 175 ARG A C   1 
ATOM   561  O  O   . ARG A 1 72  ? 2.668   82.210  13.759  1.00 30.92 ? 175 ARG A O   1 
ATOM   562  C  CB  . ARG A 1 72  ? 5.606   83.356  14.314  1.00 35.22 ? 175 ARG A CB  1 
ATOM   563  C  CG  . ARG A 1 72  ? 4.688   84.302  15.047  1.00 38.62 ? 175 ARG A CG  1 
ATOM   564  C  CD  . ARG A 1 72  ? 4.230   83.778  16.390  1.00 44.38 ? 175 ARG A CD  1 
ATOM   565  N  NE  . ARG A 1 72  ? 4.513   84.720  17.467  1.00 47.81 ? 175 ARG A NE  1 
ATOM   566  C  CZ  . ARG A 1 72  ? 3.662   85.036  18.436  1.00 54.11 ? 175 ARG A CZ  1 
ATOM   567  N  NH1 . ARG A 1 72  ? 2.445   84.496  18.490  1.00 53.89 ? 175 ARG A NH1 1 
ATOM   568  N  NH2 . ARG A 1 72  ? 4.030   85.906  19.369  1.00 58.58 ? 175 ARG A NH2 1 
ATOM   569  N  N   . GLU A 1 73  ? 3.995   80.408  13.828  1.00 32.78 ? 176 GLU A N   1 
ATOM   570  C  CA  . GLU A 1 73  ? 2.979   79.491  14.348  1.00 36.63 ? 176 GLU A CA  1 
ATOM   571  C  C   . GLU A 1 73  ? 3.453   79.005  15.700  1.00 35.51 ? 176 GLU A C   1 
ATOM   572  O  O   . GLU A 1 73  ? 4.648   78.794  15.902  1.00 32.25 ? 176 GLU A O   1 
ATOM   573  C  CB  . GLU A 1 73  ? 2.768   78.303  13.406  1.00 40.88 ? 176 GLU A CB  1 
ATOM   574  C  CG  . GLU A 1 73  ? 2.796   78.682  11.930  1.00 46.34 ? 176 GLU A CG  1 
ATOM   575  C  CD  . GLU A 1 73  ? 2.200   77.624  11.011  1.00 51.79 ? 176 GLU A CD  1 
ATOM   576  O  OE1 . GLU A 1 73  ? 1.501   76.696  11.499  1.00 52.77 ? 176 GLU A OE1 1 
ATOM   577  O  OE2 . GLU A 1 73  ? 2.427   77.740  9.782   1.00 55.23 ? 176 GLU A OE2 1 
ATOM   578  N  N   . GLY A 1 74  ? 2.520   78.829  16.625  1.00 35.74 ? 177 GLY A N   1 
ATOM   579  C  CA  . GLY A 1 74  ? 2.864   78.461  17.985  1.00 39.04 ? 177 GLY A CA  1 
ATOM   580  C  C   . GLY A 1 74  ? 1.659   78.492  18.899  1.00 44.53 ? 177 GLY A C   1 
ATOM   581  O  O   . GLY A 1 74  ? 0.812   79.382  18.784  1.00 45.83 ? 177 GLY A O   1 
ATOM   582  N  N   . GLN A 1 75  ? 1.582   77.514  19.801  1.00 49.95 ? 178 GLN A N   1 
ATOM   583  C  CA  . GLN A 1 75  ? 0.496   77.418  20.786  1.00 52.30 ? 178 GLN A CA  1 
ATOM   584  C  C   . GLN A 1 75  ? -0.888  77.425  20.110  1.00 53.19 ? 178 GLN A C   1 
ATOM   585  O  O   . GLN A 1 75  ? -1.810  78.106  20.567  1.00 53.23 ? 178 GLN A O   1 
ATOM   586  C  CB  . GLN A 1 75  ? 0.611   78.550  21.833  1.00 53.42 ? 178 GLN A CB  1 
ATOM   587  C  CG  . GLN A 1 75  ? 1.981   78.630  22.561  1.00 54.50 ? 178 GLN A CG  1 
ATOM   588  C  CD  . GLN A 1 75  ? 2.777   79.911  22.251  1.00 55.85 ? 178 GLN A CD  1 
ATOM   589  O  OE1 . GLN A 1 75  ? 2.950   80.280  21.083  1.00 57.04 ? 178 GLN A OE1 1 
ATOM   590  N  NE2 . GLN A 1 75  ? 3.270   80.576  23.296  1.00 53.82 ? 178 GLN A NE2 1 
ATOM   591  N  N   . GLY A 1 76  ? -1.014  76.666  19.019  1.00 54.05 ? 179 GLY A N   1 
ATOM   592  C  CA  . GLY A 1 76  ? -2.255  76.578  18.259  1.00 53.71 ? 179 GLY A CA  1 
ATOM   593  C  C   . GLY A 1 76  ? -2.752  77.915  17.722  1.00 53.93 ? 179 GLY A C   1 
ATOM   594  O  O   . GLY A 1 76  ? -3.920  78.265  17.908  1.00 54.10 ? 179 GLY A O   1 
ATOM   595  N  N   . ARG A 1 77  ? -1.870  78.654  17.048  1.00 52.50 ? 180 ARG A N   1 
ATOM   596  C  CA  . ARG A 1 77  ? -2.166  80.025  16.612  1.00 49.53 ? 180 ARG A CA  1 
ATOM   597  C  C   . ARG A 1 77  ? -1.176  80.501  15.541  1.00 45.90 ? 180 ARG A C   1 
ATOM   598  O  O   . ARG A 1 77  ? 0.031   80.550  15.787  1.00 41.60 ? 180 ARG A O   1 
ATOM   599  C  CB  . ARG A 1 77  ? -2.113  80.990  17.814  1.00 49.79 ? 180 ARG A CB  1 
ATOM   600  C  CG  . ARG A 1 77  ? -3.462  81.572  18.238  1.00 50.15 ? 180 ARG A CG  1 
ATOM   601  C  CD  . ARG A 1 77  ? -3.453  82.246  19.611  1.00 49.10 ? 180 ARG A CD  1 
ATOM   602  N  NE  . ARG A 1 77  ? -3.810  81.326  20.696  1.00 49.31 ? 180 ARG A NE  1 
ATOM   603  C  CZ  . ARG A 1 77  ? -5.049  80.899  20.977  1.00 48.85 ? 180 ARG A CZ  1 
ATOM   604  N  NH1 . ARG A 1 77  ? -6.093  81.290  20.251  1.00 49.00 ? 180 ARG A NH1 1 
ATOM   605  N  NH2 . ARG A 1 77  ? -5.246  80.064  21.993  1.00 46.98 ? 180 ARG A NH2 1 
ATOM   606  N  N   . ARG A 1 78  ? -1.698  80.854  14.367  1.00 42.33 ? 181 ARG A N   1 
ATOM   607  C  CA  . ARG A 1 78  ? -0.895  81.419  13.292  1.00 40.15 ? 181 ARG A CA  1 
ATOM   608  C  C   . ARG A 1 78  ? -1.058  82.943  13.247  1.00 36.61 ? 181 ARG A C   1 
ATOM   609  O  O   . ARG A 1 78  ? -2.172  83.463  13.348  1.00 32.38 ? 181 ARG A O   1 
ATOM   610  C  CB  . ARG A 1 78  ? -1.291  80.796  11.951  1.00 44.79 ? 181 ARG A CB  1 
ATOM   611  C  CG  . ARG A 1 78  ? -0.258  81.007  10.834  1.00 51.28 ? 181 ARG A CG  1 
ATOM   612  C  CD  . ARG A 1 78  ? -0.848  81.334  9.455   1.00 56.19 ? 181 ARG A CD  1 
ATOM   613  N  NE  . ARG A 1 78  ? -1.470  82.665  9.407   1.00 61.06 ? 181 ARG A NE  1 
ATOM   614  C  CZ  . ARG A 1 78  ? -2.784  82.922  9.516   1.00 62.21 ? 181 ARG A CZ  1 
ATOM   615  N  NH1 . ARG A 1 78  ? -3.677  81.944  9.686   1.00 62.99 ? 181 ARG A NH1 1 
ATOM   616  N  NH2 . ARG A 1 78  ? -3.211  84.181  9.460   1.00 61.28 ? 181 ARG A NH2 1 
ATOM   617  N  N   . GLU A 1 79  ? 0.061   83.652  13.092  1.00 33.09 ? 182 GLU A N   1 
ATOM   618  C  CA  . GLU A 1 79  ? 0.066   85.110  13.000  1.00 31.68 ? 182 GLU A CA  1 
ATOM   619  C  C   . GLU A 1 79  ? 1.001   85.571  11.868  1.00 28.48 ? 182 GLU A C   1 
ATOM   620  O  O   . GLU A 1 79  ? 2.178   85.215  11.839  1.00 23.50 ? 182 GLU A O   1 
ATOM   621  C  CB  . GLU A 1 79  ? 0.485   85.728  14.345  1.00 34.50 ? 182 GLU A CB  1 
ATOM   622  C  CG  . GLU A 1 79  ? 1.089   87.124  14.244  1.00 42.69 ? 182 GLU A CG  1 
ATOM   623  C  CD  . GLU A 1 79  ? 1.396   87.755  15.592  1.00 47.02 ? 182 GLU A CD  1 
ATOM   624  O  OE1 . GLU A 1 79  ? 2.386   87.349  16.241  1.00 47.02 ? 182 GLU A OE1 1 
ATOM   625  O  OE2 . GLU A 1 79  ? 0.648   88.671  15.996  1.00 52.85 ? 182 GLU A OE2 1 
ATOM   626  N  N   . THR A 1 80  ? 0.476   86.371  10.944  1.00 26.23 ? 183 THR A N   1 
ATOM   627  C  CA  . THR A 1 80  ? 1.308   86.989  9.921   1.00 22.60 ? 183 THR A CA  1 
ATOM   628  C  C   . THR A 1 80  ? 2.066   88.154  10.520  1.00 25.47 ? 183 THR A C   1 
ATOM   629  O  O   . THR A 1 80  ? 1.468   89.052  11.111  1.00 28.22 ? 183 THR A O   1 
ATOM   630  C  CB  . THR A 1 80  ? 0.477   87.478  8.730   1.00 23.08 ? 183 THR A CB  1 
ATOM   631  O  OG1 . THR A 1 80  ? -0.204  86.377  8.124   1.00 26.17 ? 183 THR A OG1 1 
ATOM   632  C  CG2 . THR A 1 80  ? 1.393   87.977  7.621   1.00 25.39 ? 183 THR A CG2 1 
ATOM   633  N  N   . LEU A 1 81  ? 3.386   88.132  10.352  1.00 25.50 ? 184 LEU A N   1 
ATOM   634  C  CA  . LEU A 1 81  ? 4.254   89.180  10.869  1.00 25.79 ? 184 LEU A CA  1 
ATOM   635  C  C   . LEU A 1 81  ? 4.446   90.299  9.845   1.00 24.79 ? 184 LEU A C   1 
ATOM   636  O  O   . LEU A 1 81  ? 4.262   91.473  10.175  1.00 24.39 ? 184 LEU A O   1 
ATOM   637  C  CB  . LEU A 1 81  ? 5.595   88.588  11.299  1.00 25.38 ? 184 LEU A CB  1 
ATOM   638  C  CG  . LEU A 1 81  ? 5.545   87.453  12.324  1.00 25.10 ? 184 LEU A CG  1 
ATOM   639  C  CD1 . LEU A 1 81  ? 6.954   86.958  12.601  1.00 23.24 ? 184 LEU A CD1 1 
ATOM   640  C  CD2 . LEU A 1 81  ? 4.855   87.909  13.620  1.00 22.24 ? 184 LEU A CD2 1 
ATOM   641  N  N   . PHE A 1 82  ? 4.809   89.936  8.614   1.00 21.73 ? 185 PHE A N   1 
ATOM   642  C  CA  . PHE A 1 82  ? 4.839   90.900  7.517   1.00 19.70 ? 185 PHE A CA  1 
ATOM   643  C  C   . PHE A 1 82  ? 4.743   90.260  6.143   1.00 21.63 ? 185 PHE A C   1 
ATOM   644  O  O   . PHE A 1 82  ? 5.008   89.080  5.975   1.00 24.71 ? 185 PHE A O   1 
ATOM   645  C  CB  . PHE A 1 82  ? 6.075   91.806  7.581   1.00 22.50 ? 185 PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 82  ? 7.389   91.084  7.521   1.00 22.54 ? 185 PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 82  ? 7.958   90.748  6.308   1.00 27.97 ? 185 PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 82  ? 8.075   90.777  8.673   1.00 28.81 ? 185 PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 82  ? 9.183   90.118  6.249   1.00 30.21 ? 185 PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 82  ? 9.310   90.124  8.619   1.00 28.12 ? 185 PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 82  ? 9.860   89.808  7.417   1.00 29.80 ? 185 PHE A CZ  1 
ATOM   652  N  N   . ARG A 1 83  ? 4.333   91.074  5.178   1.00 24.65 ? 186 ARG A N   1 
ATOM   653  C  CA  . ARG A 1 83  ? 4.227   90.704  3.777   1.00 27.32 ? 186 ARG A CA  1 
ATOM   654  C  C   . ARG A 1 83  ? 4.999   91.709  2.931   1.00 26.96 ? 186 ARG A C   1 
ATOM   655  O  O   . ARG A 1 83  ? 5.015   92.919  3.212   1.00 28.81 ? 186 ARG A O   1 
ATOM   656  C  CB  . ARG A 1 83  ? 2.775   90.765  3.306   1.00 26.02 ? 186 ARG A CB  1 
ATOM   657  C  CG  . ARG A 1 83  ? 1.872   89.722  3.833   1.00 29.44 ? 186 ARG A CG  1 
ATOM   658  C  CD  . ARG A 1 83  ? 0.420   89.908  3.340   1.00 28.12 ? 186 ARG A CD  1 
ATOM   659  N  NE  . ARG A 1 83  ? -0.223  91.057  3.966   1.00 24.58 ? 186 ARG A NE  1 
ATOM   660  C  CZ  . ARG A 1 83  ? -1.128  91.853  3.394   1.00 22.06 ? 186 ARG A CZ  1 
ATOM   661  N  NH1 . ARG A 1 83  ? -1.525  91.687  2.143   1.00 24.93 ? 186 ARG A NH1 1 
ATOM   662  N  NH2 . ARG A 1 83  ? -1.633  92.843  4.097   1.00 19.83 ? 186 ARG A NH2 1 
ATOM   663  N  N   . CYS A 1 84  ? 5.608   91.198  1.874   1.00 29.47 ? 187 CYS A N   1 
ATOM   664  C  CA  . CYS A 1 84  ? 6.207   92.019  0.840   1.00 27.40 ? 187 CYS A CA  1 
ATOM   665  C  C   . CYS A 1 84  ? 5.412   91.754  -0.419  1.00 24.91 ? 187 CYS A C   1 
ATOM   666  O  O   . CYS A 1 84  ? 5.088   90.606  -0.711  1.00 25.84 ? 187 CYS A O   1 
ATOM   667  C  CB  . CYS A 1 84  ? 7.671   91.645  0.648   1.00 29.08 ? 187 CYS A CB  1 
ATOM   668  S  SG  . CYS A 1 84  ? 8.494   92.826  -0.421  1.00 43.18 ? 187 CYS A SG  1 
ATOM   669  N  N   . ILE A 1 85  ? 5.061   92.816  -1.143  1.00 25.67 ? 188 ILE A N   1 
ATOM   670  C  CA  . ILE A 1 85  ? 4.246   92.704  -2.354  1.00 24.91 ? 188 ILE A CA  1 
ATOM   671  C  C   . ILE A 1 85  ? 4.818   93.575  -3.464  1.00 26.48 ? 188 ILE A C   1 
ATOM   672  O  O   . ILE A 1 85  ? 5.106   94.758  -3.263  1.00 23.46 ? 188 ILE A O   1 
ATOM   673  C  CB  . ILE A 1 85  ? 2.800   93.129  -2.085  1.00 25.02 ? 188 ILE A CB  1 
ATOM   674  C  CG1 . ILE A 1 85  ? 2.088   92.129  -1.175  1.00 27.95 ? 188 ILE A CG1 1 
ATOM   675  C  CG2 . ILE A 1 85  ? 2.023   93.252  -3.384  1.00 29.59 ? 188 ILE A CG2 1 
ATOM   676  C  CD1 . ILE A 1 85  ? 0.981   92.755  -0.380  1.00 31.08 ? 188 ILE A CD1 1 
ATOM   677  N  N   . ARG A 1 86  ? 4.907   92.995  -4.651  1.00 26.80 ? 189 ARG A N   1 
ATOM   678  C  CA  . ARG A 1 86  ? 5.555   93.631  -5.779  1.00 32.15 ? 189 ARG A CA  1 
ATOM   679  C  C   . ARG A 1 86  ? 4.791   93.346  -7.078  1.00 27.58 ? 189 ARG A C   1 
ATOM   680  O  O   . ARG A 1 86  ? 4.590   92.197  -7.454  1.00 26.82 ? 189 ARG A O   1 
ATOM   681  C  CB  . ARG A 1 86  ? 7.010   93.138  -5.857  1.00 34.75 ? 189 ARG A CB  1 
ATOM   682  C  CG  . ARG A 1 86  ? 7.964   93.995  -6.684  1.00 41.59 ? 189 ARG A CG  1 
ATOM   683  C  CD  . ARG A 1 86  ? 8.135   95.469  -6.256  1.00 47.82 ? 189 ARG A CD  1 
ATOM   684  N  NE  . ARG A 1 86  ? 7.674   95.767  -4.889  1.00 51.05 ? 189 ARG A NE  1 
ATOM   685  C  CZ  . ARG A 1 86  ? 8.419   95.708  -3.782  1.00 47.17 ? 189 ARG A CZ  1 
ATOM   686  N  NH1 . ARG A 1 86  ? 9.696   95.370  -3.817  1.00 48.80 ? 189 ARG A NH1 1 
ATOM   687  N  NH2 . ARG A 1 86  ? 7.869   96.005  -2.620  1.00 47.83 ? 189 ARG A NH2 1 
ATOM   688  N  N   . SER A 1 87  ? 4.342   94.405  -7.740  1.00 26.84 ? 190 SER A N   1 
ATOM   689  C  CA  . SER A 1 87  ? 3.785   94.298  -9.096  1.00 28.71 ? 190 SER A CA  1 
ATOM   690  C  C   . SER A 1 87  ? 4.885   93.941  -10.090 1.00 27.79 ? 190 SER A C   1 
ATOM   691  O  O   . SER A 1 87  ? 6.019   94.422  -9.981  1.00 26.10 ? 190 SER A O   1 
ATOM   692  C  CB  . SER A 1 87  ? 3.136   95.608  -9.507  1.00 27.23 ? 190 SER A CB  1 
ATOM   693  O  OG  . SER A 1 87  ? 1.852   95.690  -8.929  1.00 34.01 ? 190 SER A OG  1 
ATOM   694  N  N   . MET A 1 88  ? 4.550   93.083  -11.045 1.00 24.18 ? 191 MET A N   1 
ATOM   695  C  CA  . MET A 1 88  ? 5.532   92.569  -11.980 1.00 25.38 ? 191 MET A CA  1 
ATOM   696  C  C   . MET A 1 88  ? 5.150   92.976  -13.398 1.00 22.35 ? 191 MET A C   1 
ATOM   697  O  O   . MET A 1 88  ? 3.977   93.066  -13.720 1.00 20.96 ? 191 MET A O   1 
ATOM   698  C  CB  . MET A 1 88  ? 5.627   91.041  -11.887 1.00 24.31 ? 191 MET A CB  1 
ATOM   699  C  CG  . MET A 1 88  ? 5.904   90.481  -10.495 1.00 24.34 ? 191 MET A CG  1 
ATOM   700  S  SD  . MET A 1 88  ? 7.517   90.885  -9.798  1.00 26.68 ? 191 MET A SD  1 
ATOM   701  C  CE  . MET A 1 88  ? 8.638   90.062  -10.977 1.00 26.12 ? 191 MET A CE  1 
ATOM   702  N  N   . PRO A 1 89  ? 6.146   93.232  -14.241 1.00 26.60 ? 192 PRO A N   1 
ATOM   703  C  CA  . PRO A 1 89  ? 5.900   93.411  -15.683 1.00 23.55 ? 192 PRO A CA  1 
ATOM   704  C  C   . PRO A 1 89  ? 5.332   92.123  -16.277 1.00 23.08 ? 192 PRO A C   1 
ATOM   705  O  O   . PRO A 1 89  ? 5.608   91.038  -15.769 1.00 20.57 ? 192 PRO A O   1 
ATOM   706  C  CB  . PRO A 1 89  ? 7.291   93.709  -16.263 1.00 23.98 ? 192 PRO A CB  1 
ATOM   707  C  CG  . PRO A 1 89  ? 8.186   94.028  -15.063 1.00 27.17 ? 192 PRO A CG  1 
ATOM   708  C  CD  . PRO A 1 89  ? 7.576   93.346  -13.882 1.00 26.02 ? 192 PRO A CD  1 
ATOM   709  N  N   . SER A 1 90  ? 4.531   92.247  -17.324 1.00 24.86 ? 193 SER A N   1 
ATOM   710  C  CA  . SER A 1 90  ? 3.852   91.089  -17.920 1.00 27.27 ? 193 SER A CA  1 
ATOM   711  C  C   . SER A 1 90  ? 4.674   90.427  -19.036 1.00 29.16 ? 193 SER A C   1 
ATOM   712  O  O   . SER A 1 90  ? 4.303   89.366  -19.541 1.00 29.72 ? 193 SER A O   1 
ATOM   713  C  CB  . SER A 1 90  ? 2.479   91.501  -18.453 1.00 23.10 ? 193 SER A CB  1 
ATOM   714  O  OG  . SER A 1 90  ? 2.567   92.736  -19.145 1.00 29.28 ? 193 SER A OG  1 
ATOM   715  N  N   . ASP A 1 91  ? 5.791   91.053  -19.400 1.00 29.59 ? 194 ASP A N   1 
ATOM   716  C  CA  . ASP A 1 91  ? 6.714   90.526  -20.396 1.00 30.46 ? 194 ASP A CA  1 
ATOM   717  C  C   . ASP A 1 91  ? 7.763   89.655  -19.678 1.00 27.41 ? 194 ASP A C   1 
ATOM   718  O  O   . ASP A 1 91  ? 8.472   90.158  -18.805 1.00 26.26 ? 194 ASP A O   1 
ATOM   719  C  CB  . ASP A 1 91  ? 7.376   91.704  -21.113 1.00 36.47 ? 194 ASP A CB  1 
ATOM   720  C  CG  . ASP A 1 91  ? 7.925   91.337  -22.463 1.00 42.11 ? 194 ASP A CG  1 
ATOM   721  O  OD1 . ASP A 1 91  ? 9.049   90.790  -22.503 1.00 44.48 ? 194 ASP A OD1 1 
ATOM   722  O  OD2 . ASP A 1 91  ? 7.310   91.572  -23.533 1.00 44.13 ? 194 ASP A OD2 1 
ATOM   723  N  N   . PRO A 1 92  ? 7.865   88.367  -20.021 1.00 24.28 ? 195 PRO A N   1 
ATOM   724  C  CA  . PRO A 1 92  ? 8.779   87.448  -19.322 1.00 26.97 ? 195 PRO A CA  1 
ATOM   725  C  C   . PRO A 1 92  ? 10.230  87.923  -19.247 1.00 30.03 ? 195 PRO A C   1 
ATOM   726  O  O   . PRO A 1 92  ? 10.851  87.794  -18.211 1.00 31.26 ? 195 PRO A O   1 
ATOM   727  C  CB  . PRO A 1 92  ? 8.694   86.157  -20.157 1.00 26.40 ? 195 PRO A CB  1 
ATOM   728  C  CG  . PRO A 1 92  ? 7.402   86.224  -20.862 1.00 25.27 ? 195 PRO A CG  1 
ATOM   729  C  CD  . PRO A 1 92  ? 7.123   87.680  -21.097 1.00 25.98 ? 195 PRO A CD  1 
ATOM   730  N  N   . ASP A 1 93  ? 10.751  88.472  -20.336 1.00 35.00 ? 196 ASP A N   1 
ATOM   731  C  CA  . ASP A 1 93  ? 12.150  88.895  -20.398 1.00 37.03 ? 196 ASP A CA  1 
ATOM   732  C  C   . ASP A 1 93  ? 12.457  90.111  -19.526 1.00 33.43 ? 196 ASP A C   1 
ATOM   733  O  O   . ASP A 1 93  ? 13.607  90.343  -19.175 1.00 34.00 ? 196 ASP A O   1 
ATOM   734  C  CB  . ASP A 1 93  ? 12.537  89.200  -21.845 1.00 39.57 ? 196 ASP A CB  1 
ATOM   735  C  CG  . ASP A 1 93  ? 12.521  87.968  -22.713 1.00 45.94 ? 196 ASP A CG  1 
ATOM   736  O  OD1 . ASP A 1 93  ? 13.462  87.155  -22.580 1.00 51.45 ? 196 ASP A OD1 1 
ATOM   737  O  OD2 . ASP A 1 93  ? 11.613  87.720  -23.541 1.00 46.22 ? 196 ASP A OD2 1 
ATOM   738  N  N   . ARG A 1 94  ? 11.432  90.890  -19.199 1.00 31.61 ? 197 ARG A N   1 
ATOM   739  C  CA  . ARG A 1 94  ? 11.582  92.099  -18.388 1.00 28.53 ? 197 ARG A CA  1 
ATOM   740  C  C   . ARG A 1 94  ? 11.213  91.912  -16.906 1.00 29.72 ? 197 ARG A C   1 
ATOM   741  O  O   . ARG A 1 94  ? 11.436  92.823  -16.101 1.00 31.19 ? 197 ARG A O   1 
ATOM   742  C  CB  . ARG A 1 94  ? 10.700  93.200  -18.980 1.00 32.07 ? 197 ARG A CB  1 
ATOM   743  C  CG  . ARG A 1 94  ? 10.995  93.517  -20.442 1.00 34.74 ? 197 ARG A CG  1 
ATOM   744  C  CD  . ARG A 1 94  ? 10.143  94.641  -21.034 1.00 38.73 ? 197 ARG A CD  1 
ATOM   745  N  NE  . ARG A 1 94  ? 10.303  95.898  -20.299 1.00 41.49 ? 197 ARG A NE  1 
ATOM   746  C  CZ  . ARG A 1 94  ? 10.343  97.114  -20.846 1.00 43.99 ? 197 ARG A CZ  1 
ATOM   747  N  NH1 . ARG A 1 94  ? 10.208  97.286  -22.162 1.00 47.94 ? 197 ARG A NH1 1 
ATOM   748  N  NH2 . ARG A 1 94  ? 10.495  98.176  -20.062 1.00 41.16 ? 197 ARG A NH2 1 
ATOM   749  N  N   . ALA A 1 95  ? 10.682  90.734  -16.552 1.00 25.57 ? 198 ALA A N   1 
ATOM   750  C  CA  . ALA A 1 95  ? 9.991   90.516  -15.282 1.00 24.14 ? 198 ALA A CA  1 
ATOM   751  C  C   . ALA A 1 95  ? 10.907  90.118  -14.124 1.00 27.67 ? 198 ALA A C   1 
ATOM   752  O  O   . ALA A 1 95  ? 10.887  88.973  -13.673 1.00 28.84 ? 198 ALA A O   1 
ATOM   753  C  CB  . ALA A 1 95  ? 8.892   89.466  -15.466 1.00 24.61 ? 198 ALA A CB  1 
ATOM   754  N  N   . TYR A 1 96  ? 11.684  91.080  -13.633 1.00 23.65 ? 199 TYR A N   1 
ATOM   755  C  CA  . TYR A 1 96  ? 12.553  90.883  -12.489 1.00 19.88 ? 199 TYR A CA  1 
ATOM   756  C  C   . TYR A 1 96  ? 12.241  91.912  -11.417 1.00 22.60 ? 199 TYR A C   1 
ATOM   757  O  O   . TYR A 1 96  ? 12.113  93.096  -11.715 1.00 24.84 ? 199 TYR A O   1 
ATOM   758  C  CB  . TYR A 1 96  ? 14.010  91.075  -12.896 1.00 25.31 ? 199 TYR A CB  1 
ATOM   759  C  CG  . TYR A 1 96  ? 14.567  90.100  -13.911 1.00 23.59 ? 199 TYR A CG  1 
ATOM   760  C  CD1 . TYR A 1 96  ? 14.394  90.316  -15.267 1.00 28.95 ? 199 TYR A CD1 1 
ATOM   761  C  CD2 . TYR A 1 96  ? 15.318  88.991  -13.510 1.00 26.27 ? 199 TYR A CD2 1 
ATOM   762  C  CE1 . TYR A 1 96  ? 14.920  89.440  -16.212 1.00 30.67 ? 199 TYR A CE1 1 
ATOM   763  C  CE2 . TYR A 1 96  ? 15.855  88.107  -14.445 1.00 27.23 ? 199 TYR A CE2 1 
ATOM   764  C  CZ  . TYR A 1 96  ? 15.649  88.343  -15.798 1.00 29.48 ? 199 TYR A CZ  1 
ATOM   765  O  OH  . TYR A 1 96  ? 16.163  87.497  -16.749 1.00 31.42 ? 199 TYR A OH  1 
ATOM   766  N  N   . ASN A 1 97  ? 12.130  91.457  -10.169 1.00 22.69 ? 200 ASN A N   1 
ATOM   767  C  CA  . ASN A 1 97  ? 12.011  92.340  -9.013  1.00 21.73 ? 200 ASN A CA  1 
ATOM   768  C  C   . ASN A 1 97  ? 12.429  91.608  -7.732  1.00 24.55 ? 200 ASN A C   1 
ATOM   769  O  O   . ASN A 1 97  ? 12.060  90.449  -7.515  1.00 21.62 ? 200 ASN A O   1 
ATOM   770  C  CB  . ASN A 1 97  ? 10.562  92.808  -8.833  1.00 24.60 ? 200 ASN A CB  1 
ATOM   771  C  CG  . ASN A 1 97  ? 10.221  94.042  -9.643  1.00 20.21 ? 200 ASN A CG  1 
ATOM   772  O  OD1 . ASN A 1 97  ? 10.913  95.042  -9.579  1.00 21.93 ? 200 ASN A OD1 1 
ATOM   773  N  ND2 . ASN A 1 97  ? 9.141   93.973  -10.395 1.00 21.69 ? 200 ASN A ND2 1 
ATOM   774  N  N   . SER A 1 98  ? 13.156  92.294  -6.861  1.00 22.75 ? 201 SER A N   1 
ATOM   775  C  CA  . SER A 1 98  ? 13.418  91.764  -5.542  1.00 26.58 ? 201 SER A CA  1 
ATOM   776  C  C   . SER A 1 98  ? 12.382  92.366  -4.627  1.00 29.50 ? 201 SER A C   1 
ATOM   777  O  O   . SER A 1 98  ? 11.927  93.488  -4.856  1.00 27.10 ? 201 SER A O   1 
ATOM   778  C  CB  . SER A 1 98  ? 14.843  92.087  -5.063  1.00 27.20 ? 201 SER A CB  1 
ATOM   779  O  OG  . SER A 1 98  ? 15.072  93.490  -4.989  1.00 27.42 ? 201 SER A OG  1 
ATOM   780  N  N   . CYS A 1 99  ? 12.028  91.627  -3.578  1.00 29.39 ? 202 CYS A N   1 
ATOM   781  C  CA  . CYS A 1 99  ? 11.035  92.071  -2.595  1.00 24.52 ? 202 CYS A CA  1 
ATOM   782  C  C   . CYS A 1 99  ? 11.661  91.912  -1.222  1.00 22.77 ? 202 CYS A C   1 
ATOM   783  O  O   . CYS A 1 99  ? 11.960  90.801  -0.798  1.00 25.88 ? 202 CYS A O   1 
ATOM   784  C  CB  . CYS A 1 99  ? 9.765   91.227  -2.717  1.00 32.60 ? 202 CYS A CB  1 
ATOM   785  S  SG  . CYS A 1 99  ? 8.292   92.151  -2.319  1.00 42.70 ? 202 CYS A SG  1 
ATOM   786  N  N   . TYR A 1 100 ? 11.894  93.030  -0.550  1.00 22.78 ? 203 TYR A N   1 
ATOM   787  C  CA  . TYR A 1 100 ? 12.534  93.062  0.751   1.00 25.10 ? 203 TYR A CA  1 
ATOM   788  C  C   . TYR A 1 100 ? 11.569  93.629  1.771   1.00 26.16 ? 203 TYR A C   1 
ATOM   789  O  O   . TYR A 1 100 ? 10.953  94.683  1.555   1.00 26.80 ? 203 TYR A O   1 
ATOM   790  C  CB  . TYR A 1 100 ? 13.817  93.919  0.730   1.00 24.12 ? 203 TYR A CB  1 
ATOM   791  C  CG  . TYR A 1 100 ? 14.508  93.967  2.084   1.00 26.12 ? 203 TYR A CG  1 
ATOM   792  C  CD1 . TYR A 1 100 ? 14.054  94.817  3.089   1.00 26.78 ? 203 TYR A CD1 1 
ATOM   793  C  CD2 . TYR A 1 100 ? 15.584  93.124  2.377   1.00 25.29 ? 203 TYR A CD2 1 
ATOM   794  C  CE1 . TYR A 1 100 ? 14.663  94.834  4.344   1.00 25.89 ? 203 TYR A CE1 1 
ATOM   795  C  CE2 . TYR A 1 100 ? 16.198  93.142  3.633   1.00 25.79 ? 203 TYR A CE2 1 
ATOM   796  C  CZ  . TYR A 1 100 ? 15.722  93.992  4.607   1.00 26.87 ? 203 TYR A CZ  1 
ATOM   797  O  OH  . TYR A 1 100 ? 16.311  94.044  5.845   1.00 28.57 ? 203 TYR A OH  1 
ATOM   798  N  N   . SER A 1 101 ? 11.446  92.933  2.895   1.00 27.40 ? 204 SER A N   1 
ATOM   799  C  CA  . SER A 1 101 ? 10.743  93.479  4.046   1.00 27.84 ? 204 SER A CA  1 
ATOM   800  C  C   . SER A 1 101 ? 11.386  93.013  5.342   1.00 27.20 ? 204 SER A C   1 
ATOM   801  O  O   . SER A 1 101 ? 12.120  92.038  5.358   1.00 28.29 ? 204 SER A O   1 
ATOM   802  C  CB  . SER A 1 101 ? 9.264   93.110  4.006   1.00 27.22 ? 204 SER A CB  1 
ATOM   803  O  OG  . SER A 1 101 ? 8.529   93.889  4.940   1.00 24.99 ? 204 SER A OG  1 
ATOM   804  N  N   . ALA A 1 102 ? 11.118  93.738  6.421   1.00 25.65 ? 205 ALA A N   1 
ATOM   805  C  CA  . ALA A 1 102 ? 11.644  93.390  7.739   1.00 25.05 ? 205 ALA A CA  1 
ATOM   806  C  C   . ALA A 1 102 ? 10.837  94.022  8.858   1.00 27.60 ? 205 ALA A C   1 
ATOM   807  O  O   . ALA A 1 102 ? 10.042  94.936  8.645   1.00 30.91 ? 205 ALA A O   1 
ATOM   808  C  CB  . ALA A 1 102 ? 13.115  93.804  7.865   1.00 22.79 ? 205 ALA A CB  1 
ATOM   809  N  N   . GLY A 1 103 ? 11.059  93.524  10.065  1.00 27.91 ? 206 GLY A N   1 
ATOM   810  C  CA  . GLY A 1 103 ? 10.446  94.088  11.247  1.00 25.71 ? 206 GLY A CA  1 
ATOM   811  C  C   . GLY A 1 103 ? 10.997  93.439  12.490  1.00 26.52 ? 206 GLY A C   1 
ATOM   812  O  O   . GLY A 1 103 ? 11.783  92.490  12.416  1.00 22.39 ? 206 GLY A O   1 
ATOM   813  N  N   . VAL A 1 104 ? 10.576  93.970  13.634  1.00 21.20 ? 207 VAL A N   1 
ATOM   814  C  CA  . VAL A 1 104 ? 11.009  93.485  14.930  1.00 22.41 ? 207 VAL A CA  1 
ATOM   815  C  C   . VAL A 1 104 ? 9.816   92.859  15.672  1.00 20.39 ? 207 VAL A C   1 
ATOM   816  O  O   . VAL A 1 104 ? 8.762   93.489  15.808  1.00 20.22 ? 207 VAL A O   1 
ATOM   817  C  CB  . VAL A 1 104 ? 11.630  94.642  15.727  1.00 23.17 ? 207 VAL A CB  1 
ATOM   818  C  CG1 . VAL A 1 104 ? 11.878  94.255  17.159  1.00 22.46 ? 207 VAL A CG1 1 
ATOM   819  C  CG2 . VAL A 1 104 ? 12.927  95.067  15.047  1.00 23.51 ? 207 VAL A CG2 1 
ATOM   820  N  N   . PHE A 1 105 ? 9.988   91.626  16.145  1.00 18.08 ? 208 PHE A N   1 
ATOM   821  C  CA  . PHE A 1 105 ? 8.875   90.841  16.687  1.00 21.30 ? 208 PHE A CA  1 
ATOM   822  C  C   . PHE A 1 105 ? 9.283   90.019  17.878  1.00 24.14 ? 208 PHE A C   1 
ATOM   823  O  O   . PHE A 1 105 ? 10.412  89.537  17.952  1.00 25.44 ? 208 PHE A O   1 
ATOM   824  C  CB  . PHE A 1 105 ? 8.317   89.906  15.618  1.00 21.54 ? 208 PHE A CB  1 
ATOM   825  C  CG  . PHE A 1 105 ? 7.922   90.612  14.385  1.00 21.06 ? 208 PHE A CG  1 
ATOM   826  C  CD1 . PHE A 1 105 ? 6.698   91.250  14.311  1.00 23.63 ? 208 PHE A CD1 1 
ATOM   827  C  CD2 . PHE A 1 105 ? 8.806   90.718  13.321  1.00 23.22 ? 208 PHE A CD2 1 
ATOM   828  C  CE1 . PHE A 1 105 ? 6.340   91.962  13.165  1.00 22.09 ? 208 PHE A CE1 1 
ATOM   829  C  CE2 . PHE A 1 105 ? 8.456   91.407  12.178  1.00 22.98 ? 208 PHE A CE2 1 
ATOM   830  C  CZ  . PHE A 1 105 ? 7.219   92.034  12.103  1.00 20.94 ? 208 PHE A CZ  1 
ATOM   831  N  N   . HIS A 1 106 ? 8.350   89.868  18.808  1.00 27.54 ? 209 HIS A N   1 
ATOM   832  C  CA  . HIS A 1 106 ? 8.519   88.971  19.943  1.00 29.41 ? 209 HIS A CA  1 
ATOM   833  C  C   . HIS A 1 106 ? 8.208   87.553  19.493  1.00 24.88 ? 209 HIS A C   1 
ATOM   834  O  O   . HIS A 1 106 ? 7.069   87.237  19.168  1.00 21.10 ? 209 HIS A O   1 
ATOM   835  C  CB  . HIS A 1 106 ? 7.603   89.372  21.104  1.00 32.99 ? 209 HIS A CB  1 
ATOM   836  C  CG  . HIS A 1 106 ? 8.087   88.888  22.433  1.00 42.60 ? 209 HIS A CG  1 
ATOM   837  N  ND1 . HIS A 1 106 ? 7.862   87.607  22.886  1.00 46.64 ? 209 HIS A ND1 1 
ATOM   838  C  CD2 . HIS A 1 106 ? 8.809   89.506  23.399  1.00 48.34 ? 209 HIS A CD2 1 
ATOM   839  C  CE1 . HIS A 1 106 ? 8.408   87.460  24.080  1.00 48.67 ? 209 HIS A CE1 1 
ATOM   840  N  NE2 . HIS A 1 106 ? 8.990   88.598  24.415  1.00 49.57 ? 209 HIS A NE2 1 
ATOM   841  N  N   . LEU A 1 107 ? 9.243   86.722  19.433  1.00 26.14 ? 210 LEU A N   1 
ATOM   842  C  CA  . LEU A 1 107 ? 9.108   85.300  19.126  1.00 28.19 ? 210 LEU A CA  1 
ATOM   843  C  C   . LEU A 1 107 ? 9.265   84.480  20.404  1.00 28.70 ? 210 LEU A C   1 
ATOM   844  O  O   . LEU A 1 107 ? 10.080  84.817  21.257  1.00 28.16 ? 210 LEU A O   1 
ATOM   845  C  CB  . LEU A 1 107 ? 10.173  84.892  18.102  1.00 28.44 ? 210 LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 107 ? 10.270  85.746  16.839  1.00 26.05 ? 210 LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 107 ? 11.374  85.223  15.922  1.00 25.88 ? 210 LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 107 ? 8.921   85.793  16.121  1.00 28.33 ? 210 LEU A CD2 1 
ATOM   849  N  N   . HIS A 1 108 ? 8.474   83.418  20.547  1.00 32.94 ? 211 HIS A N   1 
ATOM   850  C  CA  . HIS A 1 108 ? 8.520   82.567  21.743  1.00 34.87 ? 211 HIS A CA  1 
ATOM   851  C  C   . HIS A 1 108 ? 9.180   81.221  21.415  1.00 28.84 ? 211 HIS A C   1 
ATOM   852  O  O   . HIS A 1 108 ? 9.031   80.714  20.304  1.00 23.31 ? 211 HIS A O   1 
ATOM   853  C  CB  . HIS A 1 108 ? 7.108   82.324  22.317  1.00 43.85 ? 211 HIS A CB  1 
ATOM   854  C  CG  . HIS A 1 108 ? 6.228   83.545  22.354  1.00 55.17 ? 211 HIS A CG  1 
ATOM   855  N  ND1 . HIS A 1 108 ? 6.591   84.718  22.984  1.00 59.54 ? 211 HIS A ND1 1 
ATOM   856  C  CD2 . HIS A 1 108 ? 4.984   83.759  21.858  1.00 60.35 ? 211 HIS A CD2 1 
ATOM   857  C  CE1 . HIS A 1 108 ? 5.619   85.606  22.857  1.00 60.51 ? 211 HIS A CE1 1 
ATOM   858  N  NE2 . HIS A 1 108 ? 4.632   85.048  22.180  1.00 61.68 ? 211 HIS A NE2 1 
ATOM   859  N  N   . GLN A 1 109 ? 9.902   80.654  22.384  1.00 28.20 ? 212 GLN A N   1 
ATOM   860  C  CA  . GLN A 1 109 ? 10.412  79.279  22.307  1.00 27.25 ? 212 GLN A CA  1 
ATOM   861  C  C   . GLN A 1 109 ? 9.319   78.358  21.762  1.00 24.61 ? 212 GLN A C   1 
ATOM   862  O  O   . GLN A 1 109 ? 8.183   78.400  22.221  1.00 22.13 ? 212 GLN A O   1 
ATOM   863  C  CB  . GLN A 1 109 ? 10.874  78.799  23.702  1.00 26.61 ? 212 GLN A CB  1 
ATOM   864  C  CG  . GLN A 1 109 ? 11.218  77.291  23.800  1.00 30.13 ? 212 GLN A CG  1 
ATOM   865  C  CD  . GLN A 1 109 ? 11.595  76.843  25.210  1.00 30.95 ? 212 GLN A CD  1 
ATOM   866  O  OE1 . GLN A 1 109 ? 12.643  77.223  25.727  1.00 32.86 ? 212 GLN A OE1 1 
ATOM   867  N  NE2 . GLN A 1 109 ? 10.741  76.034  25.826  1.00 30.33 ? 212 GLN A NE2 1 
ATOM   868  N  N   . GLY A 1 110 ? 9.674   77.528  20.786  1.00 24.34 ? 213 GLY A N   1 
ATOM   869  C  CA  . GLY A 1 110 ? 8.734   76.602  20.176  1.00 25.18 ? 213 GLY A CA  1 
ATOM   870  C  C   . GLY A 1 110 ? 7.974   77.117  18.970  1.00 23.75 ? 213 GLY A C   1 
ATOM   871  O  O   . GLY A 1 110 ? 7.266   76.350  18.329  1.00 26.43 ? 213 GLY A O   1 
ATOM   872  N  N   . ASP A 1 111 ? 8.098   78.405  18.665  1.00 21.15 ? 214 ASP A N   1 
ATOM   873  C  CA  . ASP A 1 111 ? 7.517   78.968  17.449  1.00 27.34 ? 214 ASP A CA  1 
ATOM   874  C  C   . ASP A 1 111 ? 8.218   78.421  16.203  1.00 25.45 ? 214 ASP A C   1 
ATOM   875  O  O   . ASP A 1 111 ? 9.388   78.040  16.236  1.00 23.41 ? 214 ASP A O   1 
ATOM   876  C  CB  . ASP A 1 111 ? 7.663   80.499  17.394  1.00 30.99 ? 214 ASP A CB  1 
ATOM   877  C  CG  . ASP A 1 111 ? 6.604   81.237  18.190  1.00 33.70 ? 214 ASP A CG  1 
ATOM   878  O  OD1 . ASP A 1 111 ? 5.641   80.621  18.692  1.00 34.07 ? 214 ASP A OD1 1 
ATOM   879  O  OD2 . ASP A 1 111 ? 6.659   82.476  18.340  1.00 38.40 ? 214 ASP A OD2 1 
ATOM   880  N  N   . ILE A 1 112 ? 7.473   78.415  15.111  1.00 23.43 ? 215 ILE A N   1 
ATOM   881  C  CA  . ILE A 1 112 ? 7.949   78.024  13.795  1.00 24.75 ? 215 ILE A CA  1 
ATOM   882  C  C   . ILE A 1 112 ? 7.752   79.262  12.921  1.00 24.90 ? 215 ILE A C   1 
ATOM   883  O  O   . ILE A 1 112 ? 6.676   79.851  12.926  1.00 25.68 ? 215 ILE A O   1 
ATOM   884  C  CB  . ILE A 1 112 ? 7.095   76.833  13.286  1.00 28.23 ? 215 ILE A CB  1 
ATOM   885  C  CG1 . ILE A 1 112 ? 7.380   75.575  14.124  1.00 30.26 ? 215 ILE A CG1 1 
ATOM   886  C  CG2 . ILE A 1 112 ? 7.308   76.578  11.789  1.00 26.58 ? 215 ILE A CG2 1 
ATOM   887  C  CD1 . ILE A 1 112 ? 6.120   74.801  14.512  1.00 32.32 ? 215 ILE A CD1 1 
ATOM   888  N  N   . ILE A 1 113 ? 8.792   79.682  12.218  1.00 20.07 ? 216 ILE A N   1 
ATOM   889  C  CA  . ILE A 1 113 ? 8.694   80.782  11.283  1.00 20.57 ? 216 ILE A CA  1 
ATOM   890  C  C   . ILE A 1 113 ? 8.580   80.186  9.892   1.00 24.07 ? 216 ILE A C   1 
ATOM   891  O  O   . ILE A 1 113 ? 9.348   79.300  9.534   1.00 22.25 ? 216 ILE A O   1 
ATOM   892  C  CB  . ILE A 1 113 ? 9.943   81.711  11.379  1.00 18.20 ? 216 ILE A CB  1 
ATOM   893  C  CG1 . ILE A 1 113 ? 10.136  82.243  12.802  1.00 23.22 ? 216 ILE A CG1 1 
ATOM   894  C  CG2 . ILE A 1 113 ? 9.841   82.860  10.419  1.00 21.39 ? 216 ILE A CG2 1 
ATOM   895  C  CD1 . ILE A 1 113 ? 8.919   82.910  13.414  1.00 28.77 ? 216 ILE A CD1 1 
ATOM   896  N  N   . THR A 1 114 ? 7.613   80.674  9.113   1.00 23.49 ? 217 THR A N   1 
ATOM   897  C  CA  . THR A 1 114 ? 7.437   80.247  7.740   1.00 24.33 ? 217 THR A CA  1 
ATOM   898  C  C   . THR A 1 114 ? 7.618   81.436  6.807   1.00 24.12 ? 217 THR A C   1 
ATOM   899  O  O   . THR A 1 114 ? 7.313   82.566  7.165   1.00 26.56 ? 217 THR A O   1 
ATOM   900  C  CB  . THR A 1 114 ? 6.040   79.675  7.543   1.00 26.97 ? 217 THR A CB  1 
ATOM   901  O  OG1 . THR A 1 114 ? 5.072   80.612  8.022   1.00 28.18 ? 217 THR A OG1 1 
ATOM   902  C  CG2 . THR A 1 114 ? 5.823   78.432  8.399   1.00 28.96 ? 217 THR A CG2 1 
ATOM   903  N  N   . VAL A 1 115 ? 8.152   81.167  5.625   1.00 24.94 ? 218 VAL A N   1 
ATOM   904  C  CA  . VAL A 1 115 ? 8.227   82.143  4.545   1.00 27.82 ? 218 VAL A CA  1 
ATOM   905  C  C   . VAL A 1 115 ? 7.556   81.488  3.346   1.00 24.71 ? 218 VAL A C   1 
ATOM   906  O  O   . VAL A 1 115 ? 8.013   80.460  2.858   1.00 24.32 ? 218 VAL A O   1 
ATOM   907  C  CB  . VAL A 1 115 ? 9.677   82.548  4.225   1.00 32.62 ? 218 VAL A CB  1 
ATOM   908  C  CG1 . VAL A 1 115 ? 9.723   83.524  3.031   1.00 36.12 ? 218 VAL A CG1 1 
ATOM   909  C  CG2 . VAL A 1 115 ? 10.326  83.184  5.440   1.00 32.01 ? 218 VAL A CG2 1 
ATOM   910  N  N   . LYS A 1 116 ? 6.438   82.055  2.914   1.00 22.14 ? 219 LYS A N   1 
ATOM   911  C  CA  . LYS A 1 116 ? 5.623   81.438  1.879   1.00 26.05 ? 219 LYS A CA  1 
ATOM   912  C  C   . LYS A 1 116 ? 5.390   82.429  0.755   1.00 29.06 ? 219 LYS A C   1 
ATOM   913  O  O   . LYS A 1 116 ? 5.043   83.583  1.008   1.00 28.58 ? 219 LYS A O   1 
ATOM   914  C  CB  . LYS A 1 116 ? 4.286   80.971  2.462   1.00 25.69 ? 219 LYS A CB  1 
ATOM   915  C  CG  . LYS A 1 116 ? 4.449   79.873  3.516   1.00 31.26 ? 219 LYS A CG  1 
ATOM   916  C  CD  . LYS A 1 116 ? 3.131   79.282  3.996   1.00 31.09 ? 219 LYS A CD  1 
ATOM   917  C  CE  . LYS A 1 116 ? 3.405   78.145  4.982   1.00 33.93 ? 219 LYS A CE  1 
ATOM   918  N  NZ  . LYS A 1 116 ? 2.155   77.505  5.481   1.00 34.59 ? 219 LYS A NZ  1 
ATOM   919  N  N   . ILE A 1 117 ? 5.620   81.987  -0.480  1.00 27.25 ? 220 ILE A N   1 
ATOM   920  C  CA  . ILE A 1 117 ? 5.182   82.724  -1.649  1.00 25.45 ? 220 ILE A CA  1 
ATOM   921  C  C   . ILE A 1 117 ? 3.845   82.102  -2.005  1.00 27.45 ? 220 ILE A C   1 
ATOM   922  O  O   . ILE A 1 117 ? 3.825   80.968  -2.460  1.00 28.38 ? 220 ILE A O   1 
ATOM   923  C  CB  . ILE A 1 117 ? 6.165   82.572  -2.818  1.00 25.16 ? 220 ILE A CB  1 
ATOM   924  C  CG1 . ILE A 1 117 ? 7.516   83.208  -2.495  1.00 25.55 ? 220 ILE A CG1 1 
ATOM   925  C  CG2 . ILE A 1 117 ? 5.596   83.252  -4.054  1.00 24.03 ? 220 ILE A CG2 1 
ATOM   926  C  CD1 . ILE A 1 117 ? 8.414   82.392  -1.601  1.00 30.06 ? 220 ILE A CD1 1 
ATOM   927  N  N   . PRO A 1 118 ? 2.730   82.805  -1.794  1.00 25.17 ? 221 PRO A N   1 
ATOM   928  C  CA  . PRO A 1 118 ? 1.406   82.238  -2.076  1.00 23.08 ? 221 PRO A CA  1 
ATOM   929  C  C   . PRO A 1 118 ? 1.048   82.087  -3.568  1.00 23.97 ? 221 PRO A C   1 
ATOM   930  O  O   . PRO A 1 118 ? -0.042  82.463  -3.984  1.00 17.48 ? 221 PRO A O   1 
ATOM   931  C  CB  . PRO A 1 118 ? 0.447   83.220  -1.369  1.00 22.80 ? 221 PRO A CB  1 
ATOM   932  C  CG  . PRO A 1 118 ? 1.356   84.046  -0.462  1.00 25.27 ? 221 PRO A CG  1 
ATOM   933  C  CD  . PRO A 1 118 ? 2.618   84.165  -1.236  1.00 26.34 ? 221 PRO A CD  1 
ATOM   934  N  N   . ARG A 1 119 ? 1.966   81.543  -4.360  1.00 26.21 ? 222 ARG A N   1 
ATOM   935  C  CA  . ARG A 1 119 ? 1.656   81.011  -5.691  1.00 25.39 ? 222 ARG A CA  1 
ATOM   936  C  C   . ARG A 1 119 ? 2.377   79.688  -5.829  1.00 20.80 ? 222 ARG A C   1 
ATOM   937  O  O   . ARG A 1 119 ? 3.491   79.522  -5.320  1.00 25.00 ? 222 ARG A O   1 
ATOM   938  C  CB  . ARG A 1 119 ? 2.152   81.960  -6.805  1.00 26.24 ? 222 ARG A CB  1 
ATOM   939  C  CG  . ARG A 1 119 ? 1.439   83.308  -6.870  1.00 26.25 ? 222 ARG A CG  1 
ATOM   940  C  CD  . ARG A 1 119 ? 2.031   84.377  -5.955  1.00 26.41 ? 222 ARG A CD  1 
ATOM   941  N  NE  . ARG A 1 119 ? 1.413   85.677  -6.186  1.00 23.85 ? 222 ARG A NE  1 
ATOM   942  C  CZ  . ARG A 1 119 ? 0.180   86.016  -5.804  1.00 24.61 ? 222 ARG A CZ  1 
ATOM   943  N  NH1 . ARG A 1 119 ? -0.584  85.173  -5.124  1.00 23.84 ? 222 ARG A NH1 1 
ATOM   944  N  NH2 . ARG A 1 119 ? -0.295  87.222  -6.104  1.00 23.58 ? 222 ARG A NH2 1 
ATOM   945  N  N   . ALA A 1 120 ? 1.764   78.762  -6.544  1.00 20.29 ? 223 ALA A N   1 
ATOM   946  C  CA  . ALA A 1 120 ? 2.392   77.480  -6.851  1.00 22.82 ? 223 ALA A CA  1 
ATOM   947  C  C   . ALA A 1 120 ? 3.497   77.675  -7.888  1.00 25.86 ? 223 ALA A C   1 
ATOM   948  O  O   . ALA A 1 120 ? 3.352   78.490  -8.796  1.00 27.71 ? 223 ALA A O   1 
ATOM   949  C  CB  . ALA A 1 120 ? 1.340   76.484  -7.371  1.00 17.92 ? 223 ALA A CB  1 
ATOM   950  N  N   . ASN A 1 121 ? 4.597   76.931  -7.749  1.00 26.99 ? 224 ASN A N   1 
ATOM   951  C  CA  . ASN A 1 121 ? 5.686   76.935  -8.735  1.00 28.46 ? 224 ASN A CA  1 
ATOM   952  C  C   . ASN A 1 121 ? 6.205   78.346  -9.047  1.00 29.40 ? 224 ASN A C   1 
ATOM   953  O  O   . ASN A 1 121 ? 6.488   78.677  -10.200 1.00 26.98 ? 224 ASN A O   1 
ATOM   954  C  CB  . ASN A 1 121 ? 5.238   76.227  -10.022 1.00 28.48 ? 224 ASN A CB  1 
ATOM   955  C  CG  . ASN A 1 121 ? 4.732   74.820  -9.762  1.00 29.90 ? 224 ASN A CG  1 
ATOM   956  O  OD1 . ASN A 1 121 ? 5.404   74.023  -9.115  1.00 34.11 ? 224 ASN A OD1 1 
ATOM   957  N  ND2 . ASN A 1 121 ? 3.542   74.513  -10.254 1.00 29.91 ? 224 ASN A ND2 1 
ATOM   958  N  N   . ALA A 1 122 ? 6.310   79.171  -8.010  1.00 27.43 ? 225 ALA A N   1 
ATOM   959  C  CA  . ALA A 1 122 ? 6.867   80.509  -8.139  1.00 28.20 ? 225 ALA A CA  1 
ATOM   960  C  C   . ALA A 1 122 ? 8.276   80.429  -8.709  1.00 27.46 ? 225 ALA A C   1 
ATOM   961  O  O   . ALA A 1 122 ? 9.072   79.610  -8.264  1.00 24.10 ? 225 ALA A O   1 
ATOM   962  C  CB  . ALA A 1 122 ? 6.891   81.203  -6.787  1.00 27.35 ? 225 ALA A CB  1 
ATOM   963  N  N   . LYS A 1 123 ? 8.577   81.278  -9.688  1.00 27.94 ? 226 LYS A N   1 
ATOM   964  C  CA  . LYS A 1 123 ? 9.896   81.299  -10.305 1.00 30.99 ? 226 LYS A CA  1 
ATOM   965  C  C   . LYS A 1 123 ? 10.717  82.305  -9.537  1.00 30.91 ? 226 LYS A C   1 
ATOM   966  O  O   . LYS A 1 123 ? 10.520  83.506  -9.654  1.00 35.27 ? 226 LYS A O   1 
ATOM   967  C  CB  . LYS A 1 123 ? 9.824   81.688  -11.778 1.00 34.51 ? 226 LYS A CB  1 
ATOM   968  C  CG  . LYS A 1 123 ? 9.275   80.597  -12.671 1.00 39.10 ? 226 LYS A CG  1 
ATOM   969  C  CD  . LYS A 1 123 ? 9.640   80.850  -14.135 1.00 44.91 ? 226 LYS A CD  1 
ATOM   970  C  CE  . LYS A 1 123 ? 8.508   80.474  -15.083 1.00 46.00 ? 226 LYS A CE  1 
ATOM   971  N  NZ  . LYS A 1 123 ? 8.999   80.162  -16.458 1.00 47.91 ? 226 LYS A NZ  1 
ATOM   972  N  N   . LEU A 1 124 ? 11.624  81.805  -8.718  1.00 35.05 ? 227 LEU A N   1 
ATOM   973  C  CA  . LEU A 1 124 ? 12.412  82.674  -7.868  1.00 36.35 ? 227 LEU A CA  1 
ATOM   974  C  C   . LEU A 1 124 ? 13.845  82.199  -7.799  1.00 31.21 ? 227 LEU A C   1 
ATOM   975  O  O   . LEU A 1 124 ? 14.121  81.014  -7.919  1.00 28.41 ? 227 LEU A O   1 
ATOM   976  C  CB  . LEU A 1 124 ? 11.775  82.764  -6.481  1.00 38.41 ? 227 LEU A CB  1 
ATOM   977  C  CG  . LEU A 1 124 ? 11.788  81.493  -5.634  1.00 39.42 ? 227 LEU A CG  1 
ATOM   978  C  CD1 . LEU A 1 124 ? 12.927  81.539  -4.619  1.00 40.91 ? 227 LEU A CD1 1 
ATOM   979  C  CD2 . LEU A 1 124 ? 10.451  81.322  -4.950  1.00 39.80 ? 227 LEU A CD2 1 
ATOM   980  N  N   . SER A 1 125 ? 14.751  83.148  -7.621  1.00 28.08 ? 228 SER A N   1 
ATOM   981  C  CA  . SER A 1 125 ? 16.169  82.874  -7.642  1.00 28.94 ? 228 SER A CA  1 
ATOM   982  C  C   . SER A 1 125 ? 16.641  82.151  -6.368  1.00 32.44 ? 228 SER A C   1 
ATOM   983  O  O   . SER A 1 125 ? 16.249  82.507  -5.253  1.00 29.83 ? 228 SER A O   1 
ATOM   984  C  CB  . SER A 1 125 ? 16.936  84.186  -7.810  1.00 28.41 ? 228 SER A CB  1 
ATOM   985  O  OG  . SER A 1 125 ? 18.329  83.986  -7.724  1.00 27.97 ? 228 SER A OG  1 
ATOM   986  N  N   . LEU A 1 126 ? 17.490  81.142  -6.574  1.00 32.56 ? 229 LEU A N   1 
ATOM   987  C  CA  . LEU A 1 126 ? 18.228  80.460  -5.514  1.00 32.37 ? 229 LEU A CA  1 
ATOM   988  C  C   . LEU A 1 126 ? 19.568  81.145  -5.171  1.00 27.21 ? 229 LEU A C   1 
ATOM   989  O  O   . LEU A 1 126 ? 20.327  80.659  -4.344  1.00 25.93 ? 229 LEU A O   1 
ATOM   990  C  CB  . LEU A 1 126 ? 18.489  79.004  -5.931  1.00 31.84 ? 229 LEU A CB  1 
ATOM   991  C  CG  . LEU A 1 126 ? 17.235  78.179  -6.260  1.00 33.30 ? 229 LEU A CG  1 
ATOM   992  C  CD1 . LEU A 1 126 ? 17.606  76.752  -6.668  1.00 31.68 ? 229 LEU A CD1 1 
ATOM   993  C  CD2 . LEU A 1 126 ? 16.255  78.164  -5.087  1.00 32.58 ? 229 LEU A CD2 1 
ATOM   994  N  N   . SER A 1 127 ? 19.864  82.262  -5.819  1.00 28.55 ? 230 SER A N   1 
ATOM   995  C  CA  . SER A 1 127 ? 21.102  82.985  -5.570  1.00 26.64 ? 230 SER A CA  1 
ATOM   996  C  C   . SER A 1 127 ? 21.139  83.443  -4.117  1.00 29.92 ? 230 SER A C   1 
ATOM   997  O  O   . SER A 1 127 ? 20.151  83.962  -3.616  1.00 26.50 ? 230 SER A O   1 
ATOM   998  C  CB  . SER A 1 127 ? 21.204  84.198  -6.483  1.00 27.26 ? 230 SER A CB  1 
ATOM   999  O  OG  . SER A 1 127 ? 22.334  84.974  -6.150  1.00 27.48 ? 230 SER A OG  1 
ATOM   1000 N  N   . PRO A 1 128 ? 22.261  83.230  -3.433  1.00 28.65 ? 231 PRO A N   1 
ATOM   1001 C  CA  . PRO A 1 128 ? 22.359  83.594  -2.019  1.00 29.65 ? 231 PRO A CA  1 
ATOM   1002 C  C   . PRO A 1 128 ? 22.302  85.105  -1.791  1.00 29.65 ? 231 PRO A C   1 
ATOM   1003 O  O   . PRO A 1 128 ? 21.907  85.539  -0.699  1.00 28.00 ? 231 PRO A O   1 
ATOM   1004 C  CB  . PRO A 1 128 ? 23.707  82.997  -1.587  1.00 28.18 ? 231 PRO A CB  1 
ATOM   1005 C  CG  . PRO A 1 128 ? 24.489  82.804  -2.845  1.00 26.82 ? 231 PRO A CG  1 
ATOM   1006 C  CD  . PRO A 1 128 ? 23.503  82.615  -3.941  1.00 28.49 ? 231 PRO A CD  1 
ATOM   1007 N  N   . HIS A 1 129 ? 22.646  85.884  -2.816  1.00 27.09 ? 232 HIS A N   1 
ATOM   1008 C  CA  . HIS A 1 129 ? 22.593  87.337  -2.727  1.00 27.40 ? 232 HIS A CA  1 
ATOM   1009 C  C   . HIS A 1 129 ? 21.299  87.943  -3.316  1.00 29.61 ? 232 HIS A C   1 
ATOM   1010 O  O   . HIS A 1 129 ? 21.097  89.149  -3.215  1.00 30.08 ? 232 HIS A O   1 
ATOM   1011 C  CB  . HIS A 1 129 ? 23.868  88.026  -3.296  1.00 29.40 ? 232 HIS A CB  1 
ATOM   1012 C  CG  . HIS A 1 129 ? 24.488  87.344  -4.478  1.00 28.24 ? 232 HIS A CG  1 
ATOM   1013 N  ND1 . HIS A 1 129 ? 23.868  87.265  -5.706  1.00 31.82 ? 232 HIS A ND1 1 
ATOM   1014 C  CD2 . HIS A 1 129 ? 25.703  86.764  -4.635  1.00 29.80 ? 232 HIS A CD2 1 
ATOM   1015 C  CE1 . HIS A 1 129 ? 24.662  86.641  -6.560  1.00 31.81 ? 232 HIS A CE1 1 
ATOM   1016 N  NE2 . HIS A 1 129 ? 25.783  86.332  -5.936  1.00 30.27 ? 232 HIS A NE2 1 
ATOM   1017 N  N   . GLY A 1 130 ? 20.414  87.119  -3.880  1.00 24.68 ? 233 GLY A N   1 
ATOM   1018 C  CA  . GLY A 1 130 ? 19.115  87.584  -4.357  1.00 24.80 ? 233 GLY A CA  1 
ATOM   1019 C  C   . GLY A 1 130 ? 17.945  87.241  -3.442  1.00 28.74 ? 233 GLY A C   1 
ATOM   1020 O  O   . GLY A 1 130 ? 16.985  88.020  -3.301  1.00 26.44 ? 233 GLY A O   1 
ATOM   1021 N  N   . THR A 1 131 ? 18.035  86.063  -2.830  1.00 26.14 ? 234 THR A N   1 
ATOM   1022 C  CA  . THR A 1 131 ? 17.022  85.534  -1.942  1.00 25.46 ? 234 THR A CA  1 
ATOM   1023 C  C   . THR A 1 131 ? 17.695  85.082  -0.652  1.00 25.82 ? 234 THR A C   1 
ATOM   1024 O  O   . THR A 1 131 ? 18.656  84.312  -0.685  1.00 27.68 ? 234 THR A O   1 
ATOM   1025 C  CB  . THR A 1 131 ? 16.318  84.343  -2.613  1.00 27.77 ? 234 THR A CB  1 
ATOM   1026 O  OG1 . THR A 1 131 ? 15.623  84.771  -3.800  1.00 27.56 ? 234 THR A OG1 1 
ATOM   1027 C  CG2 . THR A 1 131 ? 15.228  83.769  -1.705  1.00 27.75 ? 234 THR A CG2 1 
ATOM   1028 N  N   . PHE A 1 132 ? 17.194  85.562  0.486   1.00 26.45 ? 235 PHE A N   1 
ATOM   1029 C  CA  . PHE A 1 132 ? 17.783  85.240  1.780   1.00 25.42 ? 235 PHE A CA  1 
ATOM   1030 C  C   . PHE A 1 132 ? 16.817  85.600  2.916   1.00 25.70 ? 235 PHE A C   1 
ATOM   1031 O  O   . PHE A 1 132 ? 15.775  86.213  2.696   1.00 26.77 ? 235 PHE A O   1 
ATOM   1032 C  CB  . PHE A 1 132 ? 19.153  85.929  1.964   1.00 23.03 ? 235 PHE A CB  1 
ATOM   1033 C  CG  . PHE A 1 132 ? 19.133  87.409  1.671   1.00 25.32 ? 235 PHE A CG  1 
ATOM   1034 C  CD1 . PHE A 1 132 ? 18.604  88.310  2.599   1.00 26.27 ? 235 PHE A CD1 1 
ATOM   1035 C  CD2 . PHE A 1 132 ? 19.601  87.894  0.458   1.00 27.35 ? 235 PHE A CD2 1 
ATOM   1036 C  CE1 . PHE A 1 132 ? 18.571  89.660  2.332   1.00 29.01 ? 235 PHE A CE1 1 
ATOM   1037 C  CE2 . PHE A 1 132 ? 19.569  89.258  0.173   1.00 32.22 ? 235 PHE A CE2 1 
ATOM   1038 C  CZ  . PHE A 1 132 ? 19.059  90.147  1.104   1.00 30.26 ? 235 PHE A CZ  1 
ATOM   1039 N  N   . LEU A 1 133 ? 17.180  85.194  4.124   1.00 26.41 ? 236 LEU A N   1 
ATOM   1040 C  CA  . LEU A 1 133 ? 16.329  85.320  5.294   1.00 25.97 ? 236 LEU A CA  1 
ATOM   1041 C  C   . LEU A 1 133 ? 17.219  85.381  6.541   1.00 25.24 ? 236 LEU A C   1 
ATOM   1042 O  O   . LEU A 1 133 ? 18.153  84.598  6.682   1.00 24.42 ? 236 LEU A O   1 
ATOM   1043 C  CB  . LEU A 1 133 ? 15.387  84.129  5.344   1.00 27.32 ? 236 LEU A CB  1 
ATOM   1044 C  CG  . LEU A 1 133 ? 14.642  83.858  6.656   1.00 29.87 ? 236 LEU A CG  1 
ATOM   1045 C  CD1 . LEU A 1 133 ? 13.551  84.884  6.867   1.00 31.54 ? 236 LEU A CD1 1 
ATOM   1046 C  CD2 . LEU A 1 133 ? 14.065  82.453  6.649   1.00 28.77 ? 236 LEU A CD2 1 
ATOM   1047 N  N   . GLY A 1 134 ? 16.947  86.315  7.443   1.00 25.01 ? 237 GLY A N   1 
ATOM   1048 C  CA  . GLY A 1 134 ? 17.811  86.502  8.592   1.00 23.35 ? 237 GLY A CA  1 
ATOM   1049 C  C   . GLY A 1 134 ? 17.165  87.028  9.854   1.00 26.50 ? 237 GLY A C   1 
ATOM   1050 O  O   . GLY A 1 134 ? 16.023  87.519  9.835   1.00 24.16 ? 237 GLY A O   1 
ATOM   1051 N  N   . PHE A 1 135 ? 17.931  86.926  10.947  1.00 21.03 ? 238 PHE A N   1 
ATOM   1052 C  CA  . PHE A 1 135 ? 17.471  87.204  12.305  1.00 23.20 ? 238 PHE A CA  1 
ATOM   1053 C  C   . PHE A 1 135 ? 18.584  87.848  13.130  1.00 23.99 ? 238 PHE A C   1 
ATOM   1054 O  O   . PHE A 1 135 ? 19.745  87.455  13.038  1.00 24.48 ? 238 PHE A O   1 
ATOM   1055 C  CB  . PHE A 1 135 ? 17.079  85.906  13.037  1.00 24.31 ? 238 PHE A CB  1 
ATOM   1056 C  CG  . PHE A 1 135 ? 16.062  85.086  12.334  1.00 24.33 ? 238 PHE A CG  1 
ATOM   1057 C  CD1 . PHE A 1 135 ? 16.425  84.260  11.285  1.00 28.10 ? 238 PHE A CD1 1 
ATOM   1058 C  CD2 . PHE A 1 135 ? 14.728  85.112  12.739  1.00 30.88 ? 238 PHE A CD2 1 
ATOM   1059 C  CE1 . PHE A 1 135 ? 15.476  83.487  10.630  1.00 27.50 ? 238 PHE A CE1 1 
ATOM   1060 C  CE2 . PHE A 1 135 ? 13.769  84.335  12.095  1.00 30.73 ? 238 PHE A CE2 1 
ATOM   1061 C  CZ  . PHE A 1 135 ? 14.143  83.526  11.039  1.00 31.76 ? 238 PHE A CZ  1 
ATOM   1062 N  N   . VAL A 1 136 ? 18.223  88.806  13.967  1.00 25.55 ? 239 VAL A N   1 
ATOM   1063 C  CA  . VAL A 1 136 ? 19.146  89.381  14.936  1.00 22.09 ? 239 VAL A CA  1 
ATOM   1064 C  C   . VAL A 1 136 ? 18.390  89.465  16.246  1.00 19.80 ? 239 VAL A C   1 
ATOM   1065 O  O   . VAL A 1 136 ? 17.318  90.062  16.304  1.00 20.18 ? 239 VAL A O   1 
ATOM   1066 C  CB  . VAL A 1 136 ? 19.636  90.785  14.520  1.00 22.79 ? 239 VAL A CB  1 
ATOM   1067 C  CG1 . VAL A 1 136 ? 20.675  91.322  15.528  1.00 24.50 ? 239 VAL A CG1 1 
ATOM   1068 C  CG2 . VAL A 1 136 ? 20.218  90.760  13.134  1.00 24.69 ? 239 VAL A CG2 1 
ATOM   1069 N  N   . LYS A 1 137 ? 18.919  88.834  17.285  1.00 20.85 ? 240 LYS A N   1 
ATOM   1070 C  CA  . LYS A 1 137 ? 18.286  88.871  18.588  1.00 23.60 ? 240 LYS A CA  1 
ATOM   1071 C  C   . LYS A 1 137 ? 18.699  90.172  19.232  1.00 25.29 ? 240 LYS A C   1 
ATOM   1072 O  O   . LYS A 1 137 ? 19.888  90.424  19.400  1.00 27.59 ? 240 LYS A O   1 
ATOM   1073 C  CB  . LYS A 1 137 ? 18.700  87.688  19.463  1.00 21.04 ? 240 LYS A CB  1 
ATOM   1074 C  CG  . LYS A 1 137 ? 17.917  87.616  20.772  1.00 22.72 ? 240 LYS A CG  1 
ATOM   1075 C  CD  . LYS A 1 137 ? 18.158  86.307  21.527  1.00 29.26 ? 240 LYS A CD  1 
ATOM   1076 C  CE  . LYS A 1 137 ? 17.929  86.472  23.024  1.00 34.33 ? 240 LYS A CE  1 
ATOM   1077 N  NZ  . LYS A 1 137 ? 18.323  85.246  23.812  1.00 41.17 ? 240 LYS A NZ  1 
ATOM   1078 N  N   . LEU A 1 138 ? 17.712  90.982  19.597  1.00 24.76 ? 241 LEU A N   1 
ATOM   1079 C  CA  . LEU A 1 138 ? 17.953  92.320  20.116  1.00 29.84 ? 241 LEU A CA  1 
ATOM   1080 C  C   . LEU A 1 138 ? 17.910  92.319  21.630  1.00 32.94 ? 241 LEU A C   1 
ATOM   1081 O  O   . LEU A 1 138 ? 18.420  93.263  22.234  1.00 33.07 ? 241 LEU A O   1 
ATOM   1082 C  CB  . LEU A 1 138 ? 16.922  93.306  19.561  1.00 31.02 ? 241 LEU A CB  1 
ATOM   1083 C  CG  . LEU A 1 138 ? 16.825  93.347  18.037  1.00 30.52 ? 241 LEU A CG  1 
ATOM   1084 C  CD1 . LEU A 1 138 ? 15.653  94.209  17.617  1.00 31.08 ? 241 LEU A CD1 1 
ATOM   1085 C  CD2 . LEU A 1 138 ? 18.124  93.844  17.426  1.00 32.99 ? 241 LEU A CD2 1 
ATOM   1086 O  OXT . LEU A 1 138 ? 17.378  91.379  22.231  1.00 39.24 ? 241 LEU A OXT 1 
ATOM   1087 N  N   . LYS B 1 2   ? 18.863  94.211  25.696  1.00 56.12 ? 105 LYS B N   1 
ATOM   1088 C  CA  . LYS B 1 2   ? 18.397  95.295  26.621  1.00 59.33 ? 105 LYS B CA  1 
ATOM   1089 C  C   . LYS B 1 2   ? 17.912  96.545  25.858  1.00 58.15 ? 105 LYS B C   1 
ATOM   1090 O  O   . LYS B 1 2   ? 17.557  97.562  26.461  1.00 59.98 ? 105 LYS B O   1 
ATOM   1091 C  CB  . LYS B 1 2   ? 19.513  95.660  27.626  1.00 61.38 ? 105 LYS B CB  1 
ATOM   1092 C  CG  . LYS B 1 2   ? 20.935  95.756  27.022  1.00 61.78 ? 105 LYS B CG  1 
ATOM   1093 C  CD  . LYS B 1 2   ? 21.756  96.924  27.608  1.00 60.66 ? 105 LYS B CD  1 
ATOM   1094 C  CE  . LYS B 1 2   ? 21.374  98.274  26.973  1.00 59.30 ? 105 LYS B CE  1 
ATOM   1095 N  NZ  . LYS B 1 2   ? 21.859  98.436  25.565  1.00 55.93 ? 105 LYS B NZ  1 
ATOM   1096 N  N   . HIS B 1 3   ? 17.868  96.450  24.532  1.00 55.34 ? 106 HIS B N   1 
ATOM   1097 C  CA  . HIS B 1 3   ? 17.549  97.593  23.678  1.00 51.00 ? 106 HIS B CA  1 
ATOM   1098 C  C   . HIS B 1 3   ? 16.080  97.998  23.758  1.00 43.74 ? 106 HIS B C   1 
ATOM   1099 O  O   . HIS B 1 3   ? 15.204  97.138  23.770  1.00 41.56 ? 106 HIS B O   1 
ATOM   1100 C  CB  . HIS B 1 3   ? 17.901  97.262  22.221  1.00 52.05 ? 106 HIS B CB  1 
ATOM   1101 C  CG  . HIS B 1 3   ? 19.368  97.099  21.982  1.00 54.19 ? 106 HIS B CG  1 
ATOM   1102 N  ND1 . HIS B 1 3   ? 20.160  98.123  21.514  1.00 55.60 ? 106 HIS B ND1 1 
ATOM   1103 C  CD2 . HIS B 1 3   ? 20.192  96.040  22.168  1.00 55.25 ? 106 HIS B CD2 1 
ATOM   1104 C  CE1 . HIS B 1 3   ? 21.406  97.703  21.415  1.00 56.56 ? 106 HIS B CE1 1 
ATOM   1105 N  NE2 . HIS B 1 3   ? 21.454  96.443  21.809  1.00 56.50 ? 106 HIS B NE2 1 
ATOM   1106 N  N   . SER B 1 4   ? 15.823  99.306  23.803  1.00 38.47 ? 107 SER B N   1 
ATOM   1107 C  CA  . SER B 1 4   ? 14.472  99.846  23.623  1.00 34.18 ? 107 SER B CA  1 
ATOM   1108 C  C   . SER B 1 4   ? 13.939  99.577  22.213  1.00 29.73 ? 107 SER B C   1 
ATOM   1109 O  O   . SER B 1 4   ? 14.644  99.779  21.225  1.00 26.89 ? 107 SER B O   1 
ATOM   1110 C  CB  . SER B 1 4   ? 14.458  101.353 23.865  1.00 36.20 ? 107 SER B CB  1 
ATOM   1111 O  OG  . SER B 1 4   ? 14.867  101.637 25.185  1.00 41.05 ? 107 SER B OG  1 
ATOM   1112 N  N   . VAL B 1 5   ? 12.699  99.106  22.132  1.00 25.66 ? 108 VAL B N   1 
ATOM   1113 C  CA  . VAL B 1 5   ? 12.041  98.861  20.857  1.00 28.70 ? 108 VAL B CA  1 
ATOM   1114 C  C   . VAL B 1 5   ? 10.604  99.373  20.871  1.00 23.88 ? 108 VAL B C   1 
ATOM   1115 O  O   . VAL B 1 5   ? 10.006  99.535  21.928  1.00 21.06 ? 108 VAL B O   1 
ATOM   1116 C  CB  . VAL B 1 5   ? 12.063  97.352  20.457  1.00 31.23 ? 108 VAL B CB  1 
ATOM   1117 C  CG1 . VAL B 1 5   ? 13.488  96.783  20.564  1.00 35.32 ? 108 VAL B CG1 1 
ATOM   1118 C  CG2 . VAL B 1 5   ? 11.113  96.540  21.312  1.00 35.88 ? 108 VAL B CG2 1 
ATOM   1119 N  N   . LEU B 1 6   ? 10.085  99.631  19.674  1.00 22.83 ? 109 LEU B N   1 
ATOM   1120 C  CA  . LEU B 1 6   ? 8.701   100.020 19.462  1.00 24.72 ? 109 LEU B CA  1 
ATOM   1121 C  C   . LEU B 1 6   ? 8.287   99.600  18.049  1.00 24.23 ? 109 LEU B C   1 
ATOM   1122 O  O   . LEU B 1 6   ? 8.852   100.062 17.072  1.00 25.97 ? 109 LEU B O   1 
ATOM   1123 C  CB  . LEU B 1 6   ? 8.514   101.533 19.656  1.00 22.65 ? 109 LEU B CB  1 
ATOM   1124 C  CG  . LEU B 1 6   ? 7.049   101.988 19.786  1.00 26.14 ? 109 LEU B CG  1 
ATOM   1125 C  CD1 . LEU B 1 6   ? 6.397   101.414 21.018  1.00 24.38 ? 109 LEU B CD1 1 
ATOM   1126 C  CD2 . LEU B 1 6   ? 6.925   103.514 19.784  1.00 27.90 ? 109 LEU B CD2 1 
ATOM   1127 N  N   . HIS B 1 7   ? 7.337   98.682  17.957  1.00 23.01 ? 110 HIS B N   1 
ATOM   1128 C  CA  . HIS B 1 7   ? 6.736   98.298  16.690  1.00 22.58 ? 110 HIS B CA  1 
ATOM   1129 C  C   . HIS B 1 7   ? 5.281   98.784  16.703  1.00 24.51 ? 110 HIS B C   1 
ATOM   1130 O  O   . HIS B 1 7   ? 4.575   98.629  17.695  1.00 22.07 ? 110 HIS B O   1 
ATOM   1131 C  CB  . HIS B 1 7   ? 6.827   96.785  16.493  1.00 19.87 ? 110 HIS B CB  1 
ATOM   1132 C  CG  . HIS B 1 7   ? 6.404   96.326  15.132  1.00 24.39 ? 110 HIS B CG  1 
ATOM   1133 N  ND1 . HIS B 1 7   ? 7.052   96.711  13.980  1.00 27.31 ? 110 HIS B ND1 1 
ATOM   1134 C  CD2 . HIS B 1 7   ? 5.401   95.503  14.741  1.00 29.12 ? 110 HIS B CD2 1 
ATOM   1135 C  CE1 . HIS B 1 7   ? 6.454   96.161  12.937  1.00 28.40 ? 110 HIS B CE1 1 
ATOM   1136 N  NE2 . HIS B 1 7   ? 5.443   95.428  13.371  1.00 27.62 ? 110 HIS B NE2 1 
ATOM   1137 N  N   . LEU B 1 8   ? 4.853   99.390  15.595  1.00 27.42 ? 111 LEU B N   1 
ATOM   1138 C  CA  . LEU B 1 8   ? 3.575   100.093 15.514  1.00 26.43 ? 111 LEU B CA  1 
ATOM   1139 C  C   . LEU B 1 8   ? 2.801   99.687  14.272  1.00 24.54 ? 111 LEU B C   1 
ATOM   1140 O  O   . LEU B 1 8   ? 3.393   99.441  13.221  1.00 24.87 ? 111 LEU B O   1 
ATOM   1141 C  CB  . LEU B 1 8   ? 3.805   101.601 15.478  1.00 30.41 ? 111 LEU B CB  1 
ATOM   1142 C  CG  . LEU B 1 8   ? 4.583   102.185 16.663  1.00 31.41 ? 111 LEU B CG  1 
ATOM   1143 C  CD1 . LEU B 1 8   ? 5.552   103.226 16.196  1.00 36.73 ? 111 LEU B CD1 1 
ATOM   1144 C  CD2 . LEU B 1 8   ? 3.656   102.775 17.670  1.00 30.33 ? 111 LEU B CD2 1 
ATOM   1145 N  N   . VAL B 1 9   ? 1.478   99.621  14.402  1.00 23.03 ? 112 VAL B N   1 
ATOM   1146 C  CA  . VAL B 1 9   ? 0.599   99.279  13.290  1.00 25.18 ? 112 VAL B CA  1 
ATOM   1147 C  C   . VAL B 1 9   ? -0.584  100.259 13.221  1.00 27.92 ? 112 VAL B C   1 
ATOM   1148 O  O   . VAL B 1 9   ? -0.898  100.953 14.191  1.00 28.20 ? 112 VAL B O   1 
ATOM   1149 C  CB  . VAL B 1 9   ? 0.109   97.800  13.373  1.00 26.71 ? 112 VAL B CB  1 
ATOM   1150 C  CG1 . VAL B 1 9   ? 1.312   96.830  13.519  1.00 25.49 ? 112 VAL B CG1 1 
ATOM   1151 C  CG2 . VAL B 1 9   ? -0.887  97.602  14.514  1.00 23.81 ? 112 VAL B CG2 1 
ATOM   1152 N  N   . PRO B 1 10  ? -1.225  100.346 12.064  1.00 29.04 ? 113 PRO B N   1 
ATOM   1153 C  CA  . PRO B 1 10  ? -2.279  101.339 11.864  1.00 27.56 ? 113 PRO B CA  1 
ATOM   1154 C  C   . PRO B 1 10  ? -3.538  101.056 12.654  1.00 27.66 ? 113 PRO B C   1 
ATOM   1155 O  O   . PRO B 1 10  ? -3.864  99.896  12.921  1.00 30.85 ? 113 PRO B O   1 
ATOM   1156 C  CB  . PRO B 1 10  ? -2.563  101.236 10.360  1.00 27.86 ? 113 PRO B CB  1 
ATOM   1157 C  CG  . PRO B 1 10  ? -1.377  100.519 9.803   1.00 27.91 ? 113 PRO B CG  1 
ATOM   1158 C  CD  . PRO B 1 10  ? -0.999  99.548  10.846  1.00 28.20 ? 113 PRO B CD  1 
ATOM   1159 N  N   . VAL B 1 11  ? -4.226  102.124 13.039  1.00 27.94 ? 114 VAL B N   1 
ATOM   1160 C  CA  . VAL B 1 11  ? -5.620  102.033 13.472  1.00 26.39 ? 114 VAL B CA  1 
ATOM   1161 C  C   . VAL B 1 11  ? -6.502  102.692 12.399  1.00 26.92 ? 114 VAL B C   1 
ATOM   1162 O  O   . VAL B 1 11  ? -7.531  102.136 12.018  1.00 33.87 ? 114 VAL B O   1 
ATOM   1163 C  CB  . VAL B 1 11  ? -5.868  102.583 14.939  1.00 29.06 ? 114 VAL B CB  1 
ATOM   1164 C  CG1 . VAL B 1 11  ? -4.647  103.296 15.515  1.00 28.29 ? 114 VAL B CG1 1 
ATOM   1165 C  CG2 . VAL B 1 11  ? -7.133  103.456 15.048  1.00 27.27 ? 114 VAL B CG2 1 
ATOM   1166 N  N   . ASN B 1 12  ? -6.099  103.855 11.899  1.00 27.19 ? 115 ASN B N   1 
ATOM   1167 C  CA  . ASN B 1 12  ? -6.818  104.511 10.799  1.00 29.60 ? 115 ASN B CA  1 
ATOM   1168 C  C   . ASN B 1 12  ? -5.918  105.494 10.040  1.00 27.42 ? 115 ASN B C   1 
ATOM   1169 O  O   . ASN B 1 12  ? -4.824  105.755 10.482  1.00 26.21 ? 115 ASN B O   1 
ATOM   1170 C  CB  . ASN B 1 12  ? -8.070  105.236 11.325  1.00 29.65 ? 115 ASN B CB  1 
ATOM   1171 C  CG  . ASN B 1 12  ? -9.243  105.111 10.380  1.00 39.29 ? 115 ASN B CG  1 
ATOM   1172 O  OD1 . ASN B 1 12  ? -9.064  104.935 9.163   1.00 45.36 ? 115 ASN B OD1 1 
ATOM   1173 N  ND2 . ASN B 1 12  ? -10.454 105.187 10.924  1.00 42.12 ? 115 ASN B ND2 1 
ATOM   1174 N  N   . ILE B 1 13  ? -6.381  106.014 8.899   1.00 30.59 ? 116 ILE B N   1 
ATOM   1175 C  CA  . ILE B 1 13  ? -5.678  107.070 8.156   1.00 33.47 ? 116 ILE B CA  1 
ATOM   1176 C  C   . ILE B 1 13  ? -6.393  108.397 8.342   1.00 31.91 ? 116 ILE B C   1 
ATOM   1177 O  O   . ILE B 1 13  ? -7.572  108.415 8.665   1.00 30.77 ? 116 ILE B O   1 
ATOM   1178 C  CB  . ILE B 1 13  ? -5.603  106.741 6.633   1.00 38.98 ? 116 ILE B CB  1 
ATOM   1179 C  CG1 . ILE B 1 13  ? -6.953  107.017 5.941   1.00 42.81 ? 116 ILE B CG1 1 
ATOM   1180 C  CG2 . ILE B 1 13  ? -5.167  105.302 6.419   1.00 42.07 ? 116 ILE B CG2 1 
ATOM   1181 C  CD1 . ILE B 1 13  ? -7.071  106.454 4.530   1.00 45.74 ? 116 ILE B CD1 1 
ATOM   1182 N  N   . THR B 1 14  ? -5.674  109.500 8.128   1.00 32.36 ? 117 THR B N   1 
ATOM   1183 C  CA  . THR B 1 14  ? -6.262  110.843 8.106   1.00 31.40 ? 117 THR B CA  1 
ATOM   1184 C  C   . THR B 1 14  ? -5.718  111.659 6.933   1.00 31.40 ? 117 THR B C   1 
ATOM   1185 O  O   . THR B 1 14  ? -4.565  111.509 6.529   1.00 32.29 ? 117 THR B O   1 
ATOM   1186 C  CB  . THR B 1 14  ? -5.995  111.598 9.431   1.00 34.04 ? 117 THR B CB  1 
ATOM   1187 O  OG1 . THR B 1 14  ? -4.607  111.534 9.763   1.00 41.14 ? 117 THR B OG1 1 
ATOM   1188 C  CG2 . THR B 1 14  ? -6.669  110.913 10.609  1.00 36.42 ? 117 THR B CG2 1 
ATOM   1189 N  N   . SER B 1 15  ? -6.557  112.531 6.392   1.00 29.63 ? 118 SER B N   1 
ATOM   1190 C  CA  . SER B 1 15  ? -6.162  113.402 5.298   1.00 28.64 ? 118 SER B CA  1 
ATOM   1191 C  C   . SER B 1 15  ? -6.962  114.699 5.358   1.00 30.19 ? 118 SER B C   1 
ATOM   1192 O  O   . SER B 1 15  ? -8.146  114.710 5.034   1.00 34.90 ? 118 SER B O   1 
ATOM   1193 C  CB  . SER B 1 15  ? -6.370  112.681 3.962   1.00 25.59 ? 118 SER B CB  1 
ATOM   1194 O  OG  . SER B 1 15  ? -5.491  113.187 2.980   1.00 24.19 ? 118 SER B OG  1 
ATOM   1195 N  N   . LYS B 1 16  ? -6.326  115.782 5.803   1.00 35.72 ? 119 LYS B N   1 
ATOM   1196 C  CA  . LYS B 1 16  ? -6.983  117.099 5.858   1.00 38.43 ? 119 LYS B CA  1 
ATOM   1197 C  C   . LYS B 1 16  ? -7.343  117.570 4.451   1.00 36.47 ? 119 LYS B C   1 
ATOM   1198 O  O   . LYS B 1 16  ? -6.603  117.319 3.493   1.00 32.04 ? 119 LYS B O   1 
ATOM   1199 C  CB  . LYS B 1 16  ? -6.089  118.146 6.531   1.00 44.04 ? 119 LYS B CB  1 
ATOM   1200 C  CG  . LYS B 1 16  ? -5.717  117.838 7.988   1.00 49.22 ? 119 LYS B CG  1 
ATOM   1201 C  CD  . LYS B 1 16  ? -5.305  119.110 8.758   1.00 51.38 ? 119 LYS B CD  1 
ATOM   1202 C  CE  . LYS B 1 16  ? -6.499  119.847 9.367   1.00 51.34 ? 119 LYS B CE  1 
ATOM   1203 N  NZ  . LYS B 1 16  ? -6.469  121.309 9.070   1.00 52.38 ? 119 LYS B NZ  1 
ATOM   1204 N  N   . ALA B 1 17  ? -8.464  118.280 4.352   1.00 38.46 ? 120 ALA B N   1 
ATOM   1205 C  CA  . ALA B 1 17  ? -9.116  118.596 3.074   1.00 40.24 ? 120 ALA B CA  1 
ATOM   1206 C  C   . ALA B 1 17  ? -8.186  119.074 1.953   1.00 40.95 ? 120 ALA B C   1 
ATOM   1207 O  O   . ALA B 1 17  ? -7.977  118.352 0.979   1.00 47.47 ? 120 ALA B O   1 
ATOM   1208 C  CB  . ALA B 1 17  ? -10.252 119.599 3.289   1.00 38.09 ? 120 ALA B CB  1 
ATOM   1209 N  N   . ASP B 1 18  ? -7.626  120.272 2.082   1.00 39.71 ? 121 ASP B N   1 
ATOM   1210 C  CA  . ASP B 1 18  ? -6.872  120.871 0.970   1.00 44.16 ? 121 ASP B CA  1 
ATOM   1211 C  C   . ASP B 1 18  ? -5.354  120.588 1.005   1.00 44.22 ? 121 ASP B C   1 
ATOM   1212 O  O   . ASP B 1 18  ? -4.610  121.044 0.130   1.00 45.40 ? 121 ASP B O   1 
ATOM   1213 C  CB  . ASP B 1 18  ? -7.164  122.384 0.870   1.00 46.16 ? 121 ASP B CB  1 
ATOM   1214 C  CG  . ASP B 1 18  ? -8.500  122.690 0.159   1.00 48.65 ? 121 ASP B CG  1 
ATOM   1215 O  OD1 . ASP B 1 18  ? -8.981  121.833 -0.622  1.00 48.86 ? 121 ASP B OD1 1 
ATOM   1216 O  OD2 . ASP B 1 18  ? -9.138  123.764 0.314   1.00 47.76 ? 121 ASP B OD2 1 
ATOM   1217 N  N   . SER B 1 19  ? -4.899  119.833 2.001   1.00 42.93 ? 122 SER B N   1 
ATOM   1218 C  CA  . SER B 1 19  ? -3.522  119.342 2.016   1.00 43.67 ? 122 SER B CA  1 
ATOM   1219 C  C   . SER B 1 19  ? -3.408  118.211 0.997   1.00 41.15 ? 122 SER B C   1 
ATOM   1220 O  O   . SER B 1 19  ? -4.418  117.636 0.581   1.00 48.31 ? 122 SER B O   1 
ATOM   1221 C  CB  . SER B 1 19  ? -3.124  118.851 3.413   1.00 42.96 ? 122 SER B CB  1 
ATOM   1222 O  OG  . SER B 1 19  ? -4.004  117.836 3.868   1.00 44.86 ? 122 SER B OG  1 
ATOM   1223 N  N   . ASP B 1 20  ? -2.192  117.913 0.571   1.00 33.34 ? 123 ASP B N   1 
ATOM   1224 C  CA  . ASP B 1 20  ? -1.971  116.783 -0.319  1.00 32.20 ? 123 ASP B CA  1 
ATOM   1225 C  C   . ASP B 1 20  ? -1.136  115.771 0.434   1.00 26.38 ? 123 ASP B C   1 
ATOM   1226 O  O   . ASP B 1 20  ? -0.080  115.371 -0.008  1.00 28.73 ? 123 ASP B O   1 
ATOM   1227 C  CB  . ASP B 1 20  ? -1.292  117.234 -1.606  1.00 34.33 ? 123 ASP B CB  1 
ATOM   1228 C  CG  . ASP B 1 20  ? -2.171  118.153 -2.411  1.00 40.43 ? 123 ASP B CG  1 
ATOM   1229 O  OD1 . ASP B 1 20  ? -3.242  117.678 -2.859  1.00 41.17 ? 123 ASP B OD1 1 
ATOM   1230 O  OD2 . ASP B 1 20  ? -1.900  119.366 -2.613  1.00 43.30 ? 123 ASP B OD2 1 
ATOM   1231 N  N   . VAL B 1 21  ? -1.642  115.375 1.592   1.00 25.42 ? 124 VAL B N   1 
ATOM   1232 C  CA  . VAL B 1 21  ? -0.959  114.444 2.451   1.00 26.83 ? 124 VAL B CA  1 
ATOM   1233 C  C   . VAL B 1 21  ? -1.921  113.539 3.221   1.00 21.83 ? 124 VAL B C   1 
ATOM   1234 O  O   . VAL B 1 21  ? -3.018  113.932 3.630   1.00 22.58 ? 124 VAL B O   1 
ATOM   1235 C  CB  . VAL B 1 21  ? 0.019   115.176 3.412   1.00 29.25 ? 124 VAL B CB  1 
ATOM   1236 C  CG1 . VAL B 1 21  ? -0.729  115.945 4.474   1.00 34.79 ? 124 VAL B CG1 1 
ATOM   1237 C  CG2 . VAL B 1 21  ? 0.960   114.186 4.049   1.00 34.46 ? 124 VAL B CG2 1 
ATOM   1238 N  N   . THR B 1 22  ? -1.469  112.309 3.401   1.00 23.89 ? 125 THR B N   1 
ATOM   1239 C  CA  . THR B 1 22  ? -2.184  111.281 4.121   1.00 26.33 ? 125 THR B CA  1 
ATOM   1240 C  C   . THR B 1 22  ? -1.254  110.780 5.220   1.00 28.56 ? 125 THR B C   1 
ATOM   1241 O  O   . THR B 1 22  ? -0.079  110.519 4.972   1.00 28.33 ? 125 THR B O   1 
ATOM   1242 C  CB  . THR B 1 22  ? -2.566  110.145 3.150   1.00 23.78 ? 125 THR B CB  1 
ATOM   1243 O  OG1 . THR B 1 22  ? -3.574  110.612 2.252   1.00 23.21 ? 125 THR B OG1 1 
ATOM   1244 C  CG2 . THR B 1 22  ? -3.231  108.980 3.872   1.00 23.32 ? 125 THR B CG2 1 
ATOM   1245 N  N   . GLU B 1 23  ? -1.778  110.663 6.431   1.00 29.64 ? 126 GLU B N   1 
ATOM   1246 C  CA  . GLU B 1 23  ? -1.016  110.150 7.564   1.00 31.45 ? 126 GLU B CA  1 
ATOM   1247 C  C   . GLU B 1 23  ? -1.724  108.969 8.223   1.00 31.57 ? 126 GLU B C   1 
ATOM   1248 O  O   . GLU B 1 23  ? -2.879  108.681 7.930   1.00 34.80 ? 126 GLU B O   1 
ATOM   1249 C  CB  . GLU B 1 23  ? -0.774  111.264 8.579   1.00 32.34 ? 126 GLU B CB  1 
ATOM   1250 C  CG  . GLU B 1 23  ? 0.340   112.207 8.168   1.00 35.89 ? 126 GLU B CG  1 
ATOM   1251 C  CD  . GLU B 1 23  ? 0.425   113.427 9.060   1.00 39.78 ? 126 GLU B CD  1 
ATOM   1252 O  OE1 . GLU B 1 23  ? -0.494  114.281 8.974   1.00 41.69 ? 126 GLU B OE1 1 
ATOM   1253 O  OE2 . GLU B 1 23  ? 1.404   113.529 9.844   1.00 39.78 ? 126 GLU B OE2 1 
ATOM   1254 N  N   . VAL B 1 24  ? -1.010  108.291 9.115   1.00 29.54 ? 127 VAL B N   1 
ATOM   1255 C  CA  . VAL B 1 24  ? -1.517  107.109 9.776   1.00 30.69 ? 127 VAL B CA  1 
ATOM   1256 C  C   . VAL B 1 24  ? -1.522  107.322 11.280  1.00 29.11 ? 127 VAL B C   1 
ATOM   1257 O  O   . VAL B 1 24  ? -0.528  107.757 11.849  1.00 28.24 ? 127 VAL B O   1 
ATOM   1258 C  CB  . VAL B 1 24  ? -0.649  105.894 9.427   1.00 31.93 ? 127 VAL B CB  1 
ATOM   1259 C  CG1 . VAL B 1 24  ? -1.116  104.657 10.184  1.00 33.72 ? 127 VAL B CG1 1 
ATOM   1260 C  CG2 . VAL B 1 24  ? -0.669  105.655 7.917   1.00 31.68 ? 127 VAL B CG2 1 
ATOM   1261 N  N   . MET B 1 25  ? -2.649  107.020 11.916  1.00 26.71 ? 128 MET B N   1 
ATOM   1262 C  CA  . MET B 1 25  ? -2.723  106.967 13.369  1.00 30.07 ? 128 MET B CA  1 
ATOM   1263 C  C   . MET B 1 25  ? -2.195  105.604 13.814  1.00 30.55 ? 128 MET B C   1 
ATOM   1264 O  O   . MET B 1 25  ? -2.699  104.572 13.383  1.00 28.42 ? 128 MET B O   1 
ATOM   1265 C  CB  . MET B 1 25  ? -4.155  107.189 13.842  1.00 32.15 ? 128 MET B CB  1 
ATOM   1266 C  CG  . MET B 1 25  ? -4.697  108.568 13.477  1.00 37.61 ? 128 MET B CG  1 
ATOM   1267 S  SD  . MET B 1 25  ? -4.910  109.651 14.907  1.00 47.70 ? 128 MET B SD  1 
ATOM   1268 C  CE  . MET B 1 25  ? -6.283  108.805 15.786  1.00 42.44 ? 128 MET B CE  1 
ATOM   1269 N  N   . TRP B 1 26  ? -1.165  105.614 14.655  1.00 28.21 ? 129 TRP B N   1 
ATOM   1270 C  CA  . TRP B 1 26  ? -0.437  104.402 15.001  1.00 28.32 ? 129 TRP B CA  1 
ATOM   1271 C  C   . TRP B 1 26  ? -0.856  103.865 16.354  1.00 29.83 ? 129 TRP B C   1 
ATOM   1272 O  O   . TRP B 1 26  ? -1.253  104.629 17.243  1.00 25.89 ? 129 TRP B O   1 
ATOM   1273 C  CB  . TRP B 1 26  ? 1.061   104.683 15.025  1.00 28.07 ? 129 TRP B CB  1 
ATOM   1274 C  CG  . TRP B 1 26  ? 1.598   105.093 13.703  1.00 28.22 ? 129 TRP B CG  1 
ATOM   1275 C  CD1 . TRP B 1 26  ? 1.927   106.361 13.302  1.00 29.42 ? 129 TRP B CD1 1 
ATOM   1276 C  CD2 . TRP B 1 26  ? 1.861   104.239 12.589  1.00 24.61 ? 129 TRP B CD2 1 
ATOM   1277 N  NE1 . TRP B 1 26  ? 2.373   106.340 12.003  1.00 30.78 ? 129 TRP B NE1 1 
ATOM   1278 C  CE2 . TRP B 1 26  ? 2.348   105.051 11.540  1.00 28.73 ? 129 TRP B CE2 1 
ATOM   1279 C  CE3 . TRP B 1 26  ? 1.740   102.867 12.369  1.00 18.45 ? 129 TRP B CE3 1 
ATOM   1280 C  CZ2 . TRP B 1 26  ? 2.711   104.530 10.283  1.00 27.13 ? 129 TRP B CZ2 1 
ATOM   1281 C  CZ3 . TRP B 1 26  ? 2.103   102.350 11.121  1.00 24.91 ? 129 TRP B CZ3 1 
ATOM   1282 C  CH2 . TRP B 1 26  ? 2.586   103.181 10.099  1.00 20.91 ? 129 TRP B CH2 1 
ATOM   1283 N  N   . GLN B 1 27  ? -0.761  102.545 16.501  1.00 27.49 ? 130 GLN B N   1 
ATOM   1284 C  CA  . GLN B 1 27  ? -0.932  101.888 17.791  1.00 24.39 ? 130 GLN B CA  1 
ATOM   1285 C  C   . GLN B 1 27  ? 0.258   100.953 18.051  1.00 23.05 ? 130 GLN B C   1 
ATOM   1286 O  O   . GLN B 1 27  ? 0.685   100.219 17.147  1.00 24.14 ? 130 GLN B O   1 
ATOM   1287 C  CB  . GLN B 1 27  ? -2.273  101.140 17.849  1.00 29.40 ? 130 GLN B CB  1 
ATOM   1288 C  CG  . GLN B 1 27  ? -2.330  99.774  17.178  1.00 31.63 ? 130 GLN B CG  1 
ATOM   1289 C  CD  . GLN B 1 27  ? -3.701  99.128  17.300  1.00 34.80 ? 130 GLN B CD  1 
ATOM   1290 O  OE1 . GLN B 1 27  ? -4.102  98.715  18.393  1.00 38.26 ? 130 GLN B OE1 1 
ATOM   1291 N  NE2 . GLN B 1 27  ? -4.420  99.037  16.184  1.00 33.14 ? 130 GLN B NE2 1 
ATOM   1292 N  N   . PRO B 1 28  ? 0.820   100.988 19.255  1.00 20.88 ? 131 PRO B N   1 
ATOM   1293 C  CA  . PRO B 1 28  ? 1.940   100.107 19.582  1.00 22.76 ? 131 PRO B CA  1 
ATOM   1294 C  C   . PRO B 1 28  ? 1.470   98.681  19.839  1.00 21.79 ? 131 PRO B C   1 
ATOM   1295 O  O   . PRO B 1 28  ? 0.499   98.487  20.550  1.00 24.03 ? 131 PRO B O   1 
ATOM   1296 C  CB  . PRO B 1 28  ? 2.525   100.745 20.839  1.00 26.08 ? 131 PRO B CB  1 
ATOM   1297 C  CG  . PRO B 1 28  ? 1.347   101.381 21.515  1.00 27.87 ? 131 PRO B CG  1 
ATOM   1298 C  CD  . PRO B 1 28  ? 0.444   101.843 20.398  1.00 26.45 ? 131 PRO B CD  1 
ATOM   1299 N  N   . VAL B 1 29  ? 2.131   97.700  19.235  1.00 23.86 ? 132 VAL B N   1 
ATOM   1300 C  CA  . VAL B 1 29  ? 1.864   96.289  19.532  1.00 25.19 ? 132 VAL B CA  1 
ATOM   1301 C  C   . VAL B 1 29  ? 3.057   95.579  20.163  1.00 23.93 ? 132 VAL B C   1 
ATOM   1302 O  O   . VAL B 1 29  ? 2.916   94.496  20.689  1.00 29.88 ? 132 VAL B O   1 
ATOM   1303 C  CB  . VAL B 1 29  ? 1.370   95.507  18.289  1.00 28.06 ? 132 VAL B CB  1 
ATOM   1304 C  CG1 . VAL B 1 29  ? 0.079   96.112  17.786  1.00 32.25 ? 132 VAL B CG1 1 
ATOM   1305 C  CG2 . VAL B 1 29  ? 2.403   95.463  17.186  1.00 28.87 ? 132 VAL B CG2 1 
ATOM   1306 N  N   . LEU B 1 30  ? 4.232   96.190  20.105  1.00 27.74 ? 133 LEU B N   1 
ATOM   1307 C  CA  . LEU B 1 30  ? 5.396   95.705  20.840  1.00 24.46 ? 133 LEU B CA  1 
ATOM   1308 C  C   . LEU B 1 30  ? 6.147   96.903  21.401  1.00 24.75 ? 133 LEU B C   1 
ATOM   1309 O  O   . LEU B 1 30  ? 6.416   97.873  20.689  1.00 25.44 ? 133 LEU B O   1 
ATOM   1310 C  CB  . LEU B 1 30  ? 6.312   94.884  19.930  1.00 21.17 ? 133 LEU B CB  1 
ATOM   1311 C  CG  . LEU B 1 30  ? 7.579   94.318  20.571  1.00 20.82 ? 133 LEU B CG  1 
ATOM   1312 C  CD1 . LEU B 1 30  ? 7.246   93.224  21.568  1.00 24.61 ? 133 LEU B CD1 1 
ATOM   1313 C  CD2 . LEU B 1 30  ? 8.521   93.802  19.505  1.00 24.01 ? 133 LEU B CD2 1 
ATOM   1314 N  N   . ARG B 1 31  ? 6.491   96.816  22.676  1.00 24.93 ? 134 ARG B N   1 
ATOM   1315 C  CA  . ARG B 1 31  ? 7.141   97.905  23.380  1.00 31.90 ? 134 ARG B CA  1 
ATOM   1316 C  C   . ARG B 1 31  ? 8.080   97.328  24.435  1.00 29.81 ? 134 ARG B C   1 
ATOM   1317 O  O   . ARG B 1 31  ? 7.716   96.424  25.166  1.00 28.98 ? 134 ARG B O   1 
ATOM   1318 C  CB  . ARG B 1 31  ? 6.091   98.802  24.039  1.00 36.61 ? 134 ARG B CB  1 
ATOM   1319 C  CG  . ARG B 1 31  ? 6.636   100.104 24.633  1.00 42.62 ? 134 ARG B CG  1 
ATOM   1320 C  CD  . ARG B 1 31  ? 5.585   101.218 24.755  1.00 48.14 ? 134 ARG B CD  1 
ATOM   1321 N  NE  . ARG B 1 31  ? 4.288   100.714 25.223  1.00 52.55 ? 134 ARG B NE  1 
ATOM   1322 C  CZ  . ARG B 1 31  ? 3.143   101.406 25.203  1.00 58.17 ? 134 ARG B CZ  1 
ATOM   1323 N  NH1 . ARG B 1 31  ? 3.112   102.652 24.735  1.00 58.98 ? 134 ARG B NH1 1 
ATOM   1324 N  NH2 . ARG B 1 31  ? 2.016   100.853 25.666  1.00 58.92 ? 134 ARG B NH2 1 
ATOM   1325 N  N   . ARG B 1 32  ? 9.303   97.836  24.468  1.00 31.60 ? 135 ARG B N   1 
ATOM   1326 C  CA  . ARG B 1 32  ? 10.251  97.521  25.522  1.00 29.67 ? 135 ARG B CA  1 
ATOM   1327 C  C   . ARG B 1 32  ? 11.055  98.772  25.816  1.00 23.62 ? 135 ARG B C   1 
ATOM   1328 O  O   . ARG B 1 32  ? 11.535  99.430  24.904  1.00 18.19 ? 135 ARG B O   1 
ATOM   1329 C  CB  . ARG B 1 32  ? 11.190  96.384  25.114  1.00 34.07 ? 135 ARG B CB  1 
ATOM   1330 C  CG  . ARG B 1 32  ? 12.088  95.911  26.274  1.00 39.64 ? 135 ARG B CG  1 
ATOM   1331 C  CD  . ARG B 1 32  ? 12.887  94.645  26.002  1.00 42.59 ? 135 ARG B CD  1 
ATOM   1332 N  NE  . ARG B 1 32  ? 13.832  94.810  24.892  1.00 44.54 ? 135 ARG B NE  1 
ATOM   1333 C  CZ  . ARG B 1 32  ? 14.703  93.879  24.508  1.00 43.73 ? 135 ARG B CZ  1 
ATOM   1334 N  NH1 . ARG B 1 32  ? 14.758  92.706  25.133  1.00 45.44 ? 135 ARG B NH1 1 
ATOM   1335 N  NH2 . ARG B 1 32  ? 15.520  94.114  23.492  1.00 40.96 ? 135 ARG B NH2 1 
ATOM   1336 N  N   . GLY B 1 33  ? 11.181  99.096  27.097  1.00 24.69 ? 136 GLY B N   1 
ATOM   1337 C  CA  . GLY B 1 33  ? 11.879  100.287 27.535  1.00 25.82 ? 136 GLY B CA  1 
ATOM   1338 C  C   . GLY B 1 33  ? 11.068  101.535 27.269  1.00 28.66 ? 136 GLY B C   1 
ATOM   1339 O  O   . GLY B 1 33  ? 9.973   101.483 26.714  1.00 30.88 ? 136 GLY B O   1 
ATOM   1340 N  N   . ARG B 1 34  ? 11.621  102.666 27.672  1.00 33.56 ? 137 ARG B N   1 
ATOM   1341 C  CA  . ARG B 1 34  ? 11.001  103.961 27.439  1.00 35.09 ? 137 ARG B CA  1 
ATOM   1342 C  C   . ARG B 1 34  ? 11.817  104.733 26.387  1.00 35.74 ? 137 ARG B C   1 
ATOM   1343 O  O   . ARG B 1 34  ? 12.698  104.160 25.732  1.00 31.60 ? 137 ARG B O   1 
ATOM   1344 C  CB  . ARG B 1 34  ? 10.861  104.721 28.765  1.00 38.35 ? 137 ARG B CB  1 
ATOM   1345 C  CG  . ARG B 1 34  ? 12.121  104.815 29.614  1.00 40.06 ? 137 ARG B CG  1 
ATOM   1346 C  CD  . ARG B 1 34  ? 11.963  105.732 30.815  1.00 40.80 ? 137 ARG B CD  1 
ATOM   1347 N  NE  . ARG B 1 34  ? 13.079  105.628 31.759  1.00 41.84 ? 137 ARG B NE  1 
ATOM   1348 C  CZ  . ARG B 1 34  ? 13.145  104.789 32.792  1.00 42.77 ? 137 ARG B CZ  1 
ATOM   1349 N  NH1 . ARG B 1 34  ? 12.158  103.942 33.058  1.00 41.95 ? 137 ARG B NH1 1 
ATOM   1350 N  NH2 . ARG B 1 34  ? 14.217  104.804 33.576  1.00 45.40 ? 137 ARG B NH2 1 
ATOM   1351 N  N   . GLY B 1 35  ? 11.487  106.005 26.187  1.00 34.15 ? 138 GLY B N   1 
ATOM   1352 C  CA  . GLY B 1 35  ? 12.205  106.848 25.248  1.00 32.50 ? 138 GLY B CA  1 
ATOM   1353 C  C   . GLY B 1 35  ? 11.423  107.139 23.985  1.00 30.63 ? 138 GLY B C   1 
ATOM   1354 O  O   . GLY B 1 35  ? 11.784  108.030 23.240  1.00 30.68 ? 138 GLY B O   1 
ATOM   1355 N  N   . LEU B 1 36  ? 10.364  106.379 23.734  1.00 31.81 ? 139 LEU B N   1 
ATOM   1356 C  CA  . LEU B 1 36  ? 9.521   106.576 22.555  1.00 31.49 ? 139 LEU B CA  1 
ATOM   1357 C  C   . LEU B 1 36  ? 8.049   106.436 22.947  1.00 31.07 ? 139 LEU B C   1 
ATOM   1358 O  O   . LEU B 1 36  ? 7.682   105.547 23.711  1.00 31.32 ? 139 LEU B O   1 
ATOM   1359 C  CB  . LEU B 1 36  ? 9.867   105.554 21.475  1.00 32.85 ? 139 LEU B CB  1 
ATOM   1360 C  CG  . LEU B 1 36  ? 11.223  105.669 20.754  1.00 36.19 ? 139 LEU B CG  1 
ATOM   1361 C  CD1 . LEU B 1 36  ? 11.376  104.540 19.754  1.00 35.94 ? 139 LEU B CD1 1 
ATOM   1362 C  CD2 . LEU B 1 36  ? 11.420  107.000 20.039  1.00 32.51 ? 139 LEU B CD2 1 
ATOM   1363 N  N   . GLU B 1 37  ? 7.216   107.322 22.416  1.00 29.89 ? 140 GLU B N   1 
ATOM   1364 C  CA  . GLU B 1 37  ? 5.797   107.343 22.726  1.00 31.01 ? 140 GLU B CA  1 
ATOM   1365 C  C   . GLU B 1 37  ? 5.014   107.694 21.463  1.00 29.59 ? 140 GLU B C   1 
ATOM   1366 O  O   . GLU B 1 37  ? 5.146   108.789 20.933  1.00 27.66 ? 140 GLU B O   1 
ATOM   1367 C  CB  . GLU B 1 37  ? 5.517   108.363 23.835  1.00 31.39 ? 140 GLU B CB  1 
ATOM   1368 C  CG  . GLU B 1 37  ? 4.047   108.489 24.245  1.00 33.97 ? 140 GLU B CG  1 
ATOM   1369 C  CD  . GLU B 1 37  ? 3.767   109.677 25.166  1.00 34.72 ? 140 GLU B CD  1 
ATOM   1370 O  OE1 . GLU B 1 37  ? 4.443   110.723 25.041  1.00 34.12 ? 140 GLU B OE1 1 
ATOM   1371 O  OE2 . GLU B 1 37  ? 2.846   109.578 26.008  1.00 36.62 ? 140 GLU B OE2 1 
ATOM   1372 N  N   . ALA B 1 38  ? 4.199   106.763 20.983  1.00 28.35 ? 141 ALA B N   1 
ATOM   1373 C  CA  . ALA B 1 38  ? 3.238   107.084 19.936  1.00 28.29 ? 141 ALA B CA  1 
ATOM   1374 C  C   . ALA B 1 38  ? 2.121   107.935 20.522  1.00 29.02 ? 141 ALA B C   1 
ATOM   1375 O  O   . ALA B 1 38  ? 1.688   107.718 21.652  1.00 30.70 ? 141 ALA B O   1 
ATOM   1376 C  CB  . ALA B 1 38  ? 2.664   105.824 19.336  1.00 29.89 ? 141 ALA B CB  1 
ATOM   1377 N  N   . GLN B 1 39  ? 1.694   108.930 19.763  1.00 28.82 ? 142 GLN B N   1 
ATOM   1378 C  CA  . GLN B 1 39  ? 0.452   109.625 20.032  1.00 32.62 ? 142 GLN B CA  1 
ATOM   1379 C  C   . GLN B 1 39  ? -0.116  110.105 18.703  1.00 34.17 ? 142 GLN B C   1 
ATOM   1380 O  O   . GLN B 1 39  ? 0.451   110.981 18.050  1.00 33.40 ? 142 GLN B O   1 
ATOM   1381 C  CB  . GLN B 1 39  ? 0.640   110.790 21.015  1.00 35.43 ? 142 GLN B CB  1 
ATOM   1382 C  CG  . GLN B 1 39  ? 1.928   111.613 20.856  1.00 38.16 ? 142 GLN B CG  1 
ATOM   1383 C  CD  . GLN B 1 39  ? 2.013   112.789 21.848  1.00 41.30 ? 142 GLN B CD  1 
ATOM   1384 O  OE1 . GLN B 1 39  ? 3.025   113.510 21.892  1.00 38.72 ? 142 GLN B OE1 1 
ATOM   1385 N  NE2 . GLN B 1 39  ? 0.949   112.982 22.637  1.00 37.55 ? 142 GLN B NE2 1 
ATOM   1386 N  N   . GLY B 1 40  ? -1.228  109.500 18.297  1.00 35.00 ? 143 GLY B N   1 
ATOM   1387 C  CA  . GLY B 1 40  ? -1.876  109.850 17.053  1.00 34.40 ? 143 GLY B CA  1 
ATOM   1388 C  C   . GLY B 1 40  ? -0.990  109.471 15.894  1.00 31.10 ? 143 GLY B C   1 
ATOM   1389 O  O   . GLY B 1 40  ? -0.441  108.367 15.868  1.00 35.28 ? 143 GLY B O   1 
ATOM   1390 N  N   . ASP B 1 41  ? -0.817  110.399 14.958  1.00 30.67 ? 144 ASP B N   1 
ATOM   1391 C  CA  . ASP B 1 41  ? -0.080  110.116 13.716  1.00 34.33 ? 144 ASP B CA  1 
ATOM   1392 C  C   . ASP B 1 41  ? 1.431   110.413 13.764  1.00 28.87 ? 144 ASP B C   1 
ATOM   1393 O  O   . ASP B 1 41  ? 2.106   110.366 12.751  1.00 23.20 ? 144 ASP B O   1 
ATOM   1394 C  CB  . ASP B 1 41  ? -0.745  110.785 12.489  1.00 40.03 ? 144 ASP B CB  1 
ATOM   1395 C  CG  . ASP B 1 41  ? -1.051  112.268 12.685  1.00 41.30 ? 144 ASP B CG  1 
ATOM   1396 O  OD1 . ASP B 1 41  ? -0.383  112.949 13.498  1.00 43.98 ? 144 ASP B OD1 1 
ATOM   1397 O  OD2 . ASP B 1 41  ? -1.951  112.840 12.034  1.00 41.64 ? 144 ASP B OD2 1 
ATOM   1398 N  N   . ILE B 1 42  ? 1.950   110.679 14.957  1.00 31.47 ? 145 ILE B N   1 
ATOM   1399 C  CA  . ILE B 1 42  ? 3.376   110.923 15.154  1.00 30.38 ? 145 ILE B CA  1 
ATOM   1400 C  C   . ILE B 1 42  ? 3.919   110.107 16.332  1.00 30.39 ? 145 ILE B C   1 
ATOM   1401 O  O   . ILE B 1 42  ? 3.156   109.574 17.140  1.00 27.12 ? 145 ILE B O   1 
ATOM   1402 C  CB  . ILE B 1 42  ? 3.645   112.440 15.366  1.00 31.52 ? 145 ILE B CB  1 
ATOM   1403 C  CG1 . ILE B 1 42  ? 2.922   112.976 16.605  1.00 31.53 ? 145 ILE B CG1 1 
ATOM   1404 C  CG2 . ILE B 1 42  ? 3.191   113.242 14.141  1.00 32.89 ? 145 ILE B CG2 1 
ATOM   1405 C  CD1 . ILE B 1 42  ? 3.706   112.849 17.898  1.00 34.12 ? 145 ILE B CD1 1 
ATOM   1406 N  N   . VAL B 1 43  ? 5.246   110.010 16.406  1.00 30.11 ? 146 VAL B N   1 
ATOM   1407 C  CA  . VAL B 1 43  ? 5.936   109.385 17.527  1.00 26.88 ? 146 VAL B CA  1 
ATOM   1408 C  C   . VAL B 1 43  ? 6.851   110.432 18.155  1.00 25.74 ? 146 VAL B C   1 
ATOM   1409 O  O   . VAL B 1 43  ? 7.619   111.091 17.455  1.00 23.07 ? 146 VAL B O   1 
ATOM   1410 C  CB  . VAL B 1 43  ? 6.762   108.170 17.057  1.00 27.14 ? 146 VAL B CB  1 
ATOM   1411 C  CG1 . VAL B 1 43  ? 7.496   107.505 18.233  1.00 26.43 ? 146 VAL B CG1 1 
ATOM   1412 C  CG2 . VAL B 1 43  ? 5.856   107.182 16.330  1.00 28.92 ? 146 VAL B CG2 1 
ATOM   1413 N  N   . ARG B 1 44  ? 6.754   110.594 19.469  1.00 25.02 ? 147 ARG B N   1 
ATOM   1414 C  CA  . ARG B 1 44  ? 7.607   111.526 20.194  1.00 28.28 ? 147 ARG B CA  1 
ATOM   1415 C  C   . ARG B 1 44  ? 8.843   110.797 20.679  1.00 24.80 ? 147 ARG B C   1 
ATOM   1416 O  O   . ARG B 1 44  ? 8.751   109.684 21.189  1.00 24.01 ? 147 ARG B O   1 
ATOM   1417 C  CB  . ARG B 1 44  ? 6.865   112.161 21.389  1.00 33.10 ? 147 ARG B CB  1 
ATOM   1418 C  CG  . ARG B 1 44  ? 6.071   113.406 21.022  1.00 39.77 ? 147 ARG B CG  1 
ATOM   1419 C  CD  . ARG B 1 44  ? 5.959   114.473 22.117  1.00 46.56 ? 147 ARG B CD  1 
ATOM   1420 N  NE  . ARG B 1 44  ? 6.969   115.533 21.977  1.00 50.14 ? 147 ARG B NE  1 
ATOM   1421 C  CZ  . ARG B 1 44  ? 6.843   116.783 22.432  1.00 53.75 ? 147 ARG B CZ  1 
ATOM   1422 N  NH1 . ARG B 1 44  ? 5.742   117.172 23.071  1.00 56.32 ? 147 ARG B NH1 1 
ATOM   1423 N  NH2 . ARG B 1 44  ? 7.829   117.660 22.248  1.00 55.26 ? 147 ARG B NH2 1 
ATOM   1424 N  N   . VAL B 1 45  ? 9.996   111.438 20.521  1.00 21.22 ? 148 VAL B N   1 
ATOM   1425 C  CA  . VAL B 1 45  ? 11.249  110.915 21.040  1.00 22.27 ? 148 VAL B CA  1 
ATOM   1426 C  C   . VAL B 1 45  ? 11.527  111.632 22.347  1.00 20.28 ? 148 VAL B C   1 
ATOM   1427 O  O   . VAL B 1 45  ? 11.440  112.847 22.389  1.00 18.00 ? 148 VAL B O   1 
ATOM   1428 C  CB  . VAL B 1 45  ? 12.422  111.171 20.061  1.00 23.31 ? 148 VAL B CB  1 
ATOM   1429 C  CG1 . VAL B 1 45  ? 13.718  110.640 20.638  1.00 22.95 ? 148 VAL B CG1 1 
ATOM   1430 C  CG2 . VAL B 1 45  ? 12.136  110.549 18.695  1.00 20.18 ? 148 VAL B CG2 1 
ATOM   1431 N  N   . TRP B 1 46  ? 11.848  110.867 23.394  1.00 18.33 ? 149 TRP B N   1 
ATOM   1432 C  CA  . TRP B 1 46  ? 12.191  111.386 24.719  1.00 20.40 ? 149 TRP B CA  1 
ATOM   1433 C  C   . TRP B 1 46  ? 13.651  111.138 25.088  1.00 20.62 ? 149 TRP B C   1 
ATOM   1434 O  O   . TRP B 1 46  ? 14.266  111.979 25.728  1.00 19.90 ? 149 TRP B O   1 
ATOM   1435 C  CB  . TRP B 1 46  ? 11.289  110.766 25.804  1.00 21.38 ? 149 TRP B CB  1 
ATOM   1436 C  CG  . TRP B 1 46  ? 9.895   111.206 25.662  1.00 24.49 ? 149 TRP B CG  1 
ATOM   1437 C  CD1 . TRP B 1 46  ? 8.820   110.437 25.341  1.00 26.48 ? 149 TRP B CD1 1 
ATOM   1438 C  CD2 . TRP B 1 46  ? 9.417   112.545 25.766  1.00 28.94 ? 149 TRP B CD2 1 
ATOM   1439 N  NE1 . TRP B 1 46  ? 7.691   111.217 25.259  1.00 27.73 ? 149 TRP B NE1 1 
ATOM   1440 C  CE2 . TRP B 1 46  ? 8.032   112.517 25.513  1.00 27.97 ? 149 TRP B CE2 1 
ATOM   1441 C  CE3 . TRP B 1 46  ? 10.022  113.777 26.059  1.00 32.74 ? 149 TRP B CE3 1 
ATOM   1442 C  CZ2 . TRP B 1 46  ? 7.244   113.662 25.545  1.00 29.78 ? 149 TRP B CZ2 1 
ATOM   1443 C  CZ3 . TRP B 1 46  ? 9.240   114.912 26.093  1.00 32.60 ? 149 TRP B CZ3 1 
ATOM   1444 C  CH2 . TRP B 1 46  ? 7.864   114.847 25.835  1.00 32.68 ? 149 TRP B CH2 1 
ATOM   1445 N  N   . ASP B 1 47  ? 14.190  109.977 24.720  1.00 22.06 ? 150 ASP B N   1 
ATOM   1446 C  CA  . ASP B 1 47  ? 15.584  109.654 25.020  1.00 21.79 ? 150 ASP B CA  1 
ATOM   1447 C  C   . ASP B 1 47  ? 16.400  109.900 23.769  1.00 21.42 ? 150 ASP B C   1 
ATOM   1448 O  O   . ASP B 1 47  ? 16.151  109.296 22.722  1.00 21.87 ? 150 ASP B O   1 
ATOM   1449 C  CB  . ASP B 1 47  ? 15.742  108.204 25.492  1.00 23.60 ? 150 ASP B CB  1 
ATOM   1450 C  CG  . ASP B 1 47  ? 15.005  107.919 26.810  1.00 28.97 ? 150 ASP B CG  1 
ATOM   1451 O  OD1 . ASP B 1 47  ? 14.515  108.863 27.480  1.00 26.55 ? 150 ASP B OD1 1 
ATOM   1452 O  OD2 . ASP B 1 47  ? 14.857  106.758 27.249  1.00 33.50 ? 150 ASP B OD2 1 
ATOM   1453 N  N   . THR B 1 48  ? 17.347  110.826 23.876  1.00 21.14 ? 151 THR B N   1 
ATOM   1454 C  CA  . THR B 1 48  ? 18.302  111.096 22.812  1.00 20.55 ? 151 THR B CA  1 
ATOM   1455 C  C   . THR B 1 48  ? 19.174  109.860 22.549  1.00 20.95 ? 151 THR B C   1 
ATOM   1456 O  O   . THR B 1 48  ? 19.583  109.170 23.477  1.00 20.05 ? 151 THR B O   1 
ATOM   1457 C  CB  . THR B 1 48  ? 19.183  112.295 23.203  1.00 21.08 ? 151 THR B CB  1 
ATOM   1458 O  OG1 . THR B 1 48  ? 18.371  113.470 23.344  1.00 19.75 ? 151 THR B OG1 1 
ATOM   1459 C  CG2 . THR B 1 48  ? 20.178  112.645 22.089  1.00 18.47 ? 151 THR B CG2 1 
ATOM   1460 N  N   . GLY B 1 49  ? 19.446  109.580 21.283  1.00 19.12 ? 152 GLY B N   1 
ATOM   1461 C  CA  . GLY B 1 49  ? 20.305  108.469 20.926  1.00 19.68 ? 152 GLY B CA  1 
ATOM   1462 C  C   . GLY B 1 49  ? 20.203  108.086 19.470  1.00 20.86 ? 152 GLY B C   1 
ATOM   1463 O  O   . GLY B 1 49  ? 19.581  108.777 18.673  1.00 23.55 ? 152 GLY B O   1 
ATOM   1464 N  N   . ILE B 1 50  ? 20.820  106.964 19.133  1.00 20.15 ? 153 ILE B N   1 
ATOM   1465 C  CA  . ILE B 1 50  ? 20.846  106.457 17.775  1.00 20.87 ? 153 ILE B CA  1 
ATOM   1466 C  C   . ILE B 1 50  ? 19.829  105.331 17.654  1.00 21.14 ? 153 ILE B C   1 
ATOM   1467 O  O   . ILE B 1 50  ? 19.828  104.409 18.462  1.00 18.16 ? 153 ILE B O   1 
ATOM   1468 C  CB  . ILE B 1 50  ? 22.271  105.965 17.464  1.00 23.43 ? 153 ILE B CB  1 
ATOM   1469 C  CG1 . ILE B 1 50  ? 23.233  107.156 17.578  1.00 25.09 ? 153 ILE B CG1 1 
ATOM   1470 C  CG2 . ILE B 1 50  ? 22.319  105.270 16.094  1.00 21.53 ? 153 ILE B CG2 1 
ATOM   1471 C  CD1 . ILE B 1 50  ? 24.666  106.866 17.212  1.00 28.36 ? 153 ILE B CD1 1 
ATOM   1472 N  N   . TYR B 1 51  ? 18.956  105.417 16.655  1.00 20.64 ? 154 TYR B N   1 
ATOM   1473 C  CA  . TYR B 1 51  ? 17.891  104.448 16.479  1.00 19.35 ? 154 TYR B CA  1 
ATOM   1474 C  C   . TYR B 1 51  ? 17.850  103.891 15.070  1.00 23.85 ? 154 TYR B C   1 
ATOM   1475 O  O   . TYR B 1 51  ? 17.968  104.643 14.098  1.00 24.53 ? 154 TYR B O   1 
ATOM   1476 C  CB  . TYR B 1 51  ? 16.534  105.108 16.711  1.00 22.14 ? 154 TYR B CB  1 
ATOM   1477 C  CG  . TYR B 1 51  ? 16.241  105.553 18.113  1.00 22.63 ? 154 TYR B CG  1 
ATOM   1478 C  CD1 . TYR B 1 51  ? 16.760  106.752 18.598  1.00 26.54 ? 154 TYR B CD1 1 
ATOM   1479 C  CD2 . TYR B 1 51  ? 15.408  104.810 18.942  1.00 22.97 ? 154 TYR B CD2 1 
ATOM   1480 C  CE1 . TYR B 1 51  ? 16.476  107.189 19.879  1.00 26.07 ? 154 TYR B CE1 1 
ATOM   1481 C  CE2 . TYR B 1 51  ? 15.113  105.236 20.231  1.00 23.60 ? 154 TYR B CE2 1 
ATOM   1482 C  CZ  . TYR B 1 51  ? 15.653  106.427 20.697  1.00 25.16 ? 154 TYR B CZ  1 
ATOM   1483 O  OH  . TYR B 1 51  ? 15.374  106.875 21.963  1.00 24.00 ? 154 TYR B OH  1 
ATOM   1484 N  N   . LEU B 1 52  ? 17.632  102.585 14.959  1.00 25.31 ? 155 LEU B N   1 
ATOM   1485 C  CA  . LEU B 1 52  ? 17.121  101.986 13.724  1.00 24.57 ? 155 LEU B CA  1 
ATOM   1486 C  C   . LEU B 1 52  ? 15.674  102.415 13.555  1.00 24.01 ? 155 LEU B C   1 
ATOM   1487 O  O   . LEU B 1 52  ? 14.858  102.210 14.448  1.00 22.31 ? 155 LEU B O   1 
ATOM   1488 C  CB  . LEU B 1 52  ? 17.176  100.456 13.805  1.00 28.18 ? 155 LEU B CB  1 
ATOM   1489 C  CG  . LEU B 1 52  ? 17.345  99.569  12.556  1.00 34.18 ? 155 LEU B CG  1 
ATOM   1490 C  CD1 . LEU B 1 52  ? 16.507  98.298  12.673  1.00 34.93 ? 155 LEU B CD1 1 
ATOM   1491 C  CD2 . LEU B 1 52  ? 17.068  100.268 11.257  1.00 30.96 ? 155 LEU B CD2 1 
ATOM   1492 N  N   . LEU B 1 53  ? 15.357  103.008 12.411  1.00 24.40 ? 156 LEU B N   1 
ATOM   1493 C  CA  . LEU B 1 53  ? 13.995  103.375 12.053  1.00 27.11 ? 156 LEU B CA  1 
ATOM   1494 C  C   . LEU B 1 53  ? 13.610  102.649 10.780  1.00 28.06 ? 156 LEU B C   1 
ATOM   1495 O  O   . LEU B 1 53  ? 14.329  102.734 9.796   1.00 29.79 ? 156 LEU B O   1 
ATOM   1496 C  CB  . LEU B 1 53  ? 13.916  104.866 11.747  1.00 34.04 ? 156 LEU B CB  1 
ATOM   1497 C  CG  . LEU B 1 53  ? 13.128  105.722 12.706  1.00 39.65 ? 156 LEU B CG  1 
ATOM   1498 C  CD1 . LEU B 1 53  ? 14.030  106.024 13.892  1.00 44.64 ? 156 LEU B CD1 1 
ATOM   1499 C  CD2 . LEU B 1 53  ? 12.687  106.985 12.035  1.00 40.56 ? 156 LEU B CD2 1 
ATOM   1500 N  N   . TYR B 1 54  ? 12.481  101.953 10.786  1.00 28.04 ? 157 TYR B N   1 
ATOM   1501 C  CA  . TYR B 1 54  ? 11.981  101.300 9.571   1.00 27.15 ? 157 TYR B CA  1 
ATOM   1502 C  C   . TYR B 1 54  ? 10.490  101.594 9.392   1.00 24.81 ? 157 TYR B C   1 
ATOM   1503 O  O   . TYR B 1 54  ? 9.771   101.826 10.359  1.00 25.70 ? 157 TYR B O   1 
ATOM   1504 C  CB  . TYR B 1 54  ? 12.266  99.789  9.589   1.00 23.40 ? 157 TYR B CB  1 
ATOM   1505 C  CG  . TYR B 1 54  ? 11.601  99.033  10.727  1.00 21.87 ? 157 TYR B CG  1 
ATOM   1506 C  CD1 . TYR B 1 54  ? 10.312  98.517  10.595  1.00 23.90 ? 157 TYR B CD1 1 
ATOM   1507 C  CD2 . TYR B 1 54  ? 12.257  98.837  11.930  1.00 25.59 ? 157 TYR B CD2 1 
ATOM   1508 C  CE1 . TYR B 1 54  ? 9.702   97.828  11.636  1.00 24.97 ? 157 TYR B CE1 1 
ATOM   1509 C  CE2 . TYR B 1 54  ? 11.662  98.143  12.972  1.00 27.97 ? 157 TYR B CE2 1 
ATOM   1510 C  CZ  . TYR B 1 54  ? 10.388  97.636  12.824  1.00 28.59 ? 157 TYR B CZ  1 
ATOM   1511 O  OH  . TYR B 1 54  ? 9.798   96.957  13.879  1.00 30.79 ? 157 TYR B OH  1 
ATOM   1512 N  N   . SER B 1 55  ? 10.052  101.604 8.140   1.00 26.35 ? 158 SER B N   1 
ATOM   1513 C  CA  . SER B 1 55  ? 8.684   101.981 7.764   1.00 25.32 ? 158 SER B CA  1 
ATOM   1514 C  C   . SER B 1 55  ? 8.306   101.234 6.510   1.00 22.21 ? 158 SER B C   1 
ATOM   1515 O  O   . SER B 1 55  ? 9.078   101.199 5.565   1.00 26.57 ? 158 SER B O   1 
ATOM   1516 C  CB  . SER B 1 55  ? 8.596   103.471 7.472   1.00 27.69 ? 158 SER B CB  1 
ATOM   1517 O  OG  . SER B 1 55  ? 7.486   103.789 6.636   1.00 32.45 ? 158 SER B OG  1 
ATOM   1518 N  N   . GLN B 1 56  ? 7.152   100.586 6.535   1.00 21.84 ? 159 GLN B N   1 
ATOM   1519 C  CA  . GLN B 1 56  ? 6.563   100.010 5.352   1.00 24.71 ? 159 GLN B CA  1 
ATOM   1520 C  C   . GLN B 1 56  ? 5.133   100.479 5.219   1.00 23.11 ? 159 GLN B C   1 
ATOM   1521 O  O   . GLN B 1 56  ? 4.437   100.625 6.207   1.00 28.25 ? 159 GLN B O   1 
ATOM   1522 C  CB  . GLN B 1 56  ? 6.587   98.486  5.389   1.00 23.79 ? 159 GLN B CB  1 
ATOM   1523 C  CG  . GLN B 1 56  ? 5.813   97.877  4.216   1.00 26.46 ? 159 GLN B CG  1 
ATOM   1524 C  CD  . GLN B 1 56  ? 6.067   96.419  4.038   1.00 24.30 ? 159 GLN B CD  1 
ATOM   1525 O  OE1 . GLN B 1 56  ? 7.199   96.019  3.779   1.00 24.24 ? 159 GLN B OE1 1 
ATOM   1526 N  NE2 . GLN B 1 56  ? 5.010   95.603  4.167   1.00 24.96 ? 159 GLN B NE2 1 
ATOM   1527 N  N   . VAL B 1 57  ? 4.726   100.749 3.987   1.00 25.84 ? 160 VAL B N   1 
ATOM   1528 C  CA  . VAL B 1 57  ? 3.338   101.042 3.655   1.00 25.22 ? 160 VAL B CA  1 
ATOM   1529 C  C   . VAL B 1 57  ? 2.971   100.180 2.465   1.00 27.20 ? 160 VAL B C   1 
ATOM   1530 O  O   . VAL B 1 57  ? 3.764   100.037 1.522   1.00 30.04 ? 160 VAL B O   1 
ATOM   1531 C  CB  . VAL B 1 57  ? 3.140   102.523 3.277   1.00 30.48 ? 160 VAL B CB  1 
ATOM   1532 C  CG1 . VAL B 1 57  ? 1.644   102.824 2.980   1.00 30.30 ? 160 VAL B CG1 1 
ATOM   1533 C  CG2 . VAL B 1 57  ? 3.682   103.436 4.374   1.00 28.68 ? 160 VAL B CG2 1 
ATOM   1534 N  N   . LEU B 1 58  ? 1.771   99.621  2.508   1.00 26.35 ? 161 LEU B N   1 
ATOM   1535 C  CA  . LEU B 1 58  ? 1.210   98.837  1.404   1.00 29.79 ? 161 LEU B CA  1 
ATOM   1536 C  C   . LEU B 1 58  ? 0.164   99.660  0.662   1.00 28.58 ? 161 LEU B C   1 
ATOM   1537 O  O   . LEU B 1 58  ? -0.817  100.108 1.253   1.00 26.94 ? 161 LEU B O   1 
ATOM   1538 C  CB  . LEU B 1 58  ? 0.580   97.551  1.947   1.00 28.77 ? 161 LEU B CB  1 
ATOM   1539 C  CG  . LEU B 1 58  ? -0.218  96.658  0.998   1.00 29.26 ? 161 LEU B CG  1 
ATOM   1540 C  CD1 . LEU B 1 58  ? 0.605   96.293  -0.223  1.00 31.81 ? 161 LEU B CD1 1 
ATOM   1541 C  CD2 . LEU B 1 58  ? -0.678  95.399  1.739   1.00 25.30 ? 161 LEU B CD2 1 
ATOM   1542 N  N   . PHE B 1 59  ? 0.370   99.828  -0.638  1.00 28.65 ? 162 PHE B N   1 
ATOM   1543 C  CA  . PHE B 1 59  ? -0.478  100.665 -1.476  1.00 27.84 ? 162 PHE B CA  1 
ATOM   1544 C  C   . PHE B 1 59  ? -1.311  99.844  -2.444  1.00 28.68 ? 162 PHE B C   1 
ATOM   1545 O  O   . PHE B 1 59  ? -0.835  98.842  -2.976  1.00 23.39 ? 162 PHE B O   1 
ATOM   1546 C  CB  . PHE B 1 59  ? 0.392   101.620 -2.287  1.00 30.60 ? 162 PHE B CB  1 
ATOM   1547 C  CG  . PHE B 1 59  ? 1.149   102.609 -1.451  1.00 28.77 ? 162 PHE B CG  1 
ATOM   1548 C  CD1 . PHE B 1 59  ? 0.492   103.673 -0.861  1.00 30.54 ? 162 PHE B CD1 1 
ATOM   1549 C  CD2 . PHE B 1 59  ? 2.510   102.474 -1.255  1.00 30.15 ? 162 PHE B CD2 1 
ATOM   1550 C  CE1 . PHE B 1 59  ? 1.183   104.601 -0.099  1.00 30.84 ? 162 PHE B CE1 1 
ATOM   1551 C  CE2 . PHE B 1 59  ? 3.202   103.389 -0.493  1.00 31.21 ? 162 PHE B CE2 1 
ATOM   1552 C  CZ  . PHE B 1 59  ? 2.527   104.459 0.093   1.00 29.77 ? 162 PHE B CZ  1 
ATOM   1553 N  N   . HIS B 1 60  ? -2.558  100.287 -2.635  1.00 29.56 ? 163 HIS B N   1 
ATOM   1554 C  CA  . HIS B 1 60  ? -3.487  99.779  -3.644  1.00 33.65 ? 163 HIS B CA  1 
ATOM   1555 C  C   . HIS B 1 60  ? -4.073  100.996 -4.379  1.00 32.77 ? 163 HIS B C   1 
ATOM   1556 O  O   . HIS B 1 60  ? -5.222  101.381 -4.165  1.00 41.62 ? 163 HIS B O   1 
ATOM   1557 C  CB  . HIS B 1 60  ? -4.607  98.958  -2.995  1.00 32.59 ? 163 HIS B CB  1 
ATOM   1558 C  CG  . HIS B 1 60  ? -5.611  98.412  -3.965  1.00 32.29 ? 163 HIS B CG  1 
ATOM   1559 N  ND1 . HIS B 1 60  ? -5.263  97.915  -5.204  1.00 33.36 ? 163 HIS B ND1 1 
ATOM   1560 C  CD2 . HIS B 1 60  ? -6.957  98.284  -3.876  1.00 32.93 ? 163 HIS B CD2 1 
ATOM   1561 C  CE1 . HIS B 1 60  ? -6.349  97.492  -5.829  1.00 28.52 ? 163 HIS B CE1 1 
ATOM   1562 N  NE2 . HIS B 1 60  ? -7.390  97.709  -5.047  1.00 27.48 ? 163 HIS B NE2 1 
ATOM   1563 N  N   . ASP B 1 61  ? -3.264  101.570 -5.258  1.00 31.46 ? 164 ASP B N   1 
ATOM   1564 C  CA  . ASP B 1 61  ? -3.466  102.916 -5.791  1.00 30.06 ? 164 ASP B CA  1 
ATOM   1565 C  C   . ASP B 1 61  ? -2.832  102.991 -7.189  1.00 25.64 ? 164 ASP B C   1 
ATOM   1566 O  O   . ASP B 1 61  ? -1.723  102.497 -7.378  1.00 23.63 ? 164 ASP B O   1 
ATOM   1567 C  CB  . ASP B 1 61  ? -2.769  103.897 -4.835  1.00 33.81 ? 164 ASP B CB  1 
ATOM   1568 C  CG  . ASP B 1 61  ? -3.339  105.299 -4.890  1.00 37.00 ? 164 ASP B CG  1 
ATOM   1569 O  OD1 . ASP B 1 61  ? -3.248  105.934 -5.962  1.00 41.27 ? 164 ASP B OD1 1 
ATOM   1570 O  OD2 . ASP B 1 61  ? -3.868  105.864 -3.903  1.00 35.21 ? 164 ASP B OD2 1 
ATOM   1571 N  N   . VAL B 1 62  ? -3.525  103.590 -8.161  1.00 24.40 ? 165 VAL B N   1 
ATOM   1572 C  CA  . VAL B 1 62  ? -3.007  103.714 -9.536  1.00 24.39 ? 165 VAL B CA  1 
ATOM   1573 C  C   . VAL B 1 62  ? -2.185  104.990 -9.792  1.00 26.17 ? 165 VAL B C   1 
ATOM   1574 O  O   . VAL B 1 62  ? -1.607  105.153 -10.882 1.00 24.45 ? 165 VAL B O   1 
ATOM   1575 C  CB  . VAL B 1 62  ? -4.132  103.619 -10.623 1.00 26.46 ? 165 VAL B CB  1 
ATOM   1576 C  CG1 . VAL B 1 62  ? -4.681  102.190 -10.709 1.00 29.03 ? 165 VAL B CG1 1 
ATOM   1577 C  CG2 . VAL B 1 62  ? -5.253  104.624 -10.376 1.00 26.04 ? 165 VAL B CG2 1 
ATOM   1578 N  N   . THR B 1 63  ? -2.124  105.882 -8.802  1.00 25.92 ? 166 THR B N   1 
ATOM   1579 C  CA  . THR B 1 63  ? -1.301  107.089 -8.907  1.00 25.28 ? 166 THR B CA  1 
ATOM   1580 C  C   . THR B 1 63  ? 0.104   106.679 -9.312  1.00 21.71 ? 166 THR B C   1 
ATOM   1581 O  O   . THR B 1 63  ? 0.675   105.769 -8.730  1.00 23.67 ? 166 THR B O   1 
ATOM   1582 C  CB  . THR B 1 63  ? -1.237  107.872 -7.586  1.00 25.96 ? 166 THR B CB  1 
ATOM   1583 O  OG1 . THR B 1 63  ? -2.556  108.203 -7.142  1.00 24.27 ? 166 THR B OG1 1 
ATOM   1584 C  CG2 . THR B 1 63  ? -0.560  109.230 -7.802  1.00 25.33 ? 166 THR B CG2 1 
ATOM   1585 N  N   . PHE B 1 64  ? 0.648   107.370 -10.304 1.00 21.93 ? 167 PHE B N   1 
ATOM   1586 C  CA  . PHE B 1 64  ? 1.813   106.896 -11.039 1.00 25.32 ? 167 PHE B CA  1 
ATOM   1587 C  C   . PHE B 1 64  ? 2.981   106.515 -10.136 1.00 27.10 ? 167 PHE B C   1 
ATOM   1588 O  O   . PHE B 1 64  ? 3.698   105.579 -10.451 1.00 27.85 ? 167 PHE B O   1 
ATOM   1589 C  CB  . PHE B 1 64  ? 2.240   107.911 -12.106 1.00 23.11 ? 167 PHE B CB  1 
ATOM   1590 C  CG  . PHE B 1 64  ? 3.019   109.075 -11.574 1.00 21.69 ? 167 PHE B CG  1 
ATOM   1591 C  CD1 . PHE B 1 64  ? 2.384   110.096 -10.882 1.00 19.93 ? 167 PHE B CD1 1 
ATOM   1592 C  CD2 . PHE B 1 64  ? 4.400   109.159 -11.790 1.00 24.88 ? 167 PHE B CD2 1 
ATOM   1593 C  CE1 . PHE B 1 64  ? 3.106   111.186 -10.405 1.00 24.95 ? 167 PHE B CE1 1 
ATOM   1594 C  CE2 . PHE B 1 64  ? 5.133   110.243 -11.316 1.00 25.27 ? 167 PHE B CE2 1 
ATOM   1595 C  CZ  . PHE B 1 64  ? 4.491   111.258 -10.620 1.00 25.06 ? 167 PHE B CZ  1 
ATOM   1596 N  N   . THR B 1 65  ? 3.173   107.266 -9.044  1.00 26.49 ? 168 THR B N   1 
ATOM   1597 C  CA  . THR B 1 65  ? 4.080   106.881 -7.971  1.00 24.45 ? 168 THR B CA  1 
ATOM   1598 C  C   . THR B 1 65  ? 3.399   107.069 -6.645  1.00 24.36 ? 168 THR B C   1 
ATOM   1599 O  O   . THR B 1 65  ? 2.613   108.004 -6.472  1.00 23.75 ? 168 THR B O   1 
ATOM   1600 C  CB  . THR B 1 65  ? 5.369   107.708 -7.948  1.00 25.11 ? 168 THR B CB  1 
ATOM   1601 O  OG1 . THR B 1 65  ? 5.060   109.106 -8.047  1.00 21.08 ? 168 THR B OG1 1 
ATOM   1602 C  CG2 . THR B 1 65  ? 6.256   107.389 -9.142  1.00 23.25 ? 168 THR B CG2 1 
ATOM   1603 N  N   . MET B 1 66  ? 3.710   106.159 -5.727  1.00 22.65 ? 169 MET B N   1 
ATOM   1604 C  CA  . MET B 1 66  ? 3.323   106.255 -4.328  1.00 27.24 ? 169 MET B CA  1 
ATOM   1605 C  C   . MET B 1 66  ? 4.547   106.019 -3.454  1.00 26.53 ? 169 MET B C   1 
ATOM   1606 O  O   . MET B 1 66  ? 5.595   105.575 -3.930  1.00 25.15 ? 169 MET B O   1 
ATOM   1607 C  CB  . MET B 1 66  ? 2.243   105.210 -3.996  1.00 30.10 ? 169 MET B CB  1 
ATOM   1608 C  CG  . MET B 1 66  ? 0.896   105.473 -4.661  1.00 26.95 ? 169 MET B CG  1 
ATOM   1609 S  SD  . MET B 1 66  ? 0.176   107.093 -4.220  1.00 28.51 ? 169 MET B SD  1 
ATOM   1610 C  CE  . MET B 1 66  ? -0.470  106.777 -2.548  1.00 26.57 ? 169 MET B CE  1 
ATOM   1611 N  N   . GLY B 1 67  ? 4.408   106.313 -2.171  1.00 25.33 ? 170 GLY B N   1 
ATOM   1612 C  CA  . GLY B 1 67  ? 5.482   106.108 -1.211  1.00 25.22 ? 170 GLY B CA  1 
ATOM   1613 C  C   . GLY B 1 67  ? 5.325   106.967 0.032   1.00 25.87 ? 170 GLY B C   1 
ATOM   1614 O  O   . GLY B 1 67  ? 4.308   107.621 0.216   1.00 30.13 ? 170 GLY B O   1 
ATOM   1615 N  N   . GLN B 1 68  ? 6.341   106.984 0.888   1.00 26.96 ? 171 GLN B N   1 
ATOM   1616 C  CA  . GLN B 1 68  ? 6.240   107.713 2.147   1.00 27.15 ? 171 GLN B CA  1 
ATOM   1617 C  C   . GLN B 1 68  ? 7.520   108.450 2.467   1.00 24.36 ? 171 GLN B C   1 
ATOM   1618 O  O   . GLN B 1 68  ? 8.595   108.091 2.005   1.00 30.40 ? 171 GLN B O   1 
ATOM   1619 C  CB  . GLN B 1 68  ? 5.798   106.793 3.308   1.00 29.51 ? 171 GLN B CB  1 
ATOM   1620 C  CG  . GLN B 1 68  ? 6.889   105.850 3.865   1.00 36.19 ? 171 GLN B CG  1 
ATOM   1621 C  CD  . GLN B 1 68  ? 6.936   104.507 3.166   1.00 38.01 ? 171 GLN B CD  1 
ATOM   1622 O  OE1 . GLN B 1 68  ? 6.369   104.349 2.072   1.00 40.47 ? 171 GLN B OE1 1 
ATOM   1623 N  NE2 . GLN B 1 68  ? 7.603   103.530 3.791   1.00 30.35 ? 171 GLN B NE2 1 
ATOM   1624 N  N   . VAL B 1 69  ? 7.366   109.528 3.221   1.00 25.99 ? 172 VAL B N   1 
ATOM   1625 C  CA  . VAL B 1 69  ? 8.453   110.388 3.639   1.00 25.60 ? 172 VAL B CA  1 
ATOM   1626 C  C   . VAL B 1 69  ? 8.463   110.315 5.150   1.00 27.90 ? 172 VAL B C   1 
ATOM   1627 O  O   . VAL B 1 69  ? 7.471   110.655 5.799   1.00 29.77 ? 172 VAL B O   1 
ATOM   1628 C  CB  . VAL B 1 69  ? 8.211   111.843 3.203   1.00 25.36 ? 172 VAL B CB  1 
ATOM   1629 C  CG1 . VAL B 1 69  ? 9.306   112.769 3.711   1.00 23.33 ? 172 VAL B CG1 1 
ATOM   1630 C  CG2 . VAL B 1 69  ? 8.091   111.941 1.672   1.00 25.43 ? 172 VAL B CG2 1 
ATOM   1631 N  N   . VAL B 1 70  ? 9.577   109.853 5.700   1.00 24.85 ? 173 VAL B N   1 
ATOM   1632 C  CA  . VAL B 1 70  ? 9.766   109.774 7.137   1.00 24.12 ? 173 VAL B CA  1 
ATOM   1633 C  C   . VAL B 1 70  ? 10.708  110.890 7.582   1.00 22.24 ? 173 VAL B C   1 
ATOM   1634 O  O   . VAL B 1 70  ? 11.801  111.019 7.042   1.00 26.56 ? 173 VAL B O   1 
ATOM   1635 C  CB  . VAL B 1 70  ? 10.356  108.414 7.509   1.00 24.07 ? 173 VAL B CB  1 
ATOM   1636 C  CG1 . VAL B 1 70  ? 10.477  108.259 9.036   1.00 24.91 ? 173 VAL B CG1 1 
ATOM   1637 C  CG2 . VAL B 1 70  ? 9.502   107.318 6.923   1.00 26.96 ? 173 VAL B CG2 1 
ATOM   1638 N  N   . SER B 1 71  ? 10.287  111.678 8.568   1.00 22.42 ? 174 SER B N   1 
ATOM   1639 C  CA  . SER B 1 71  ? 11.026  112.859 9.009   1.00 20.62 ? 174 SER B CA  1 
ATOM   1640 C  C   . SER B 1 71  ? 11.072  113.004 10.511  1.00 24.30 ? 174 SER B C   1 
ATOM   1641 O  O   . SER B 1 71  ? 10.311  112.371 11.227  1.00 29.90 ? 174 SER B O   1 
ATOM   1642 C  CB  . SER B 1 71  ? 10.368  114.119 8.460   1.00 24.23 ? 174 SER B CB  1 
ATOM   1643 O  OG  . SER B 1 71  ? 10.174  114.031 7.068   1.00 29.94 ? 174 SER B OG  1 
ATOM   1644 N  N   . ARG B 1 72  ? 11.975  113.853 10.980  1.00 25.63 ? 175 ARG B N   1 
ATOM   1645 C  CA  . ARG B 1 72  ? 11.951  114.314 12.350  1.00 29.73 ? 175 ARG B CA  1 
ATOM   1646 C  C   . ARG B 1 72  ? 11.800  115.827 12.375  1.00 24.99 ? 175 ARG B C   1 
ATOM   1647 O  O   . ARG B 1 72  ? 12.340  116.524 11.526  1.00 21.01 ? 175 ARG B O   1 
ATOM   1648 C  CB  . ARG B 1 72  ? 13.202  113.870 13.120  1.00 32.06 ? 175 ARG B CB  1 
ATOM   1649 C  CG  . ARG B 1 72  ? 14.524  114.331 12.560  1.00 36.37 ? 175 ARG B CG  1 
ATOM   1650 C  CD  . ARG B 1 72  ? 15.710  113.934 13.433  1.00 40.32 ? 175 ARG B CD  1 
ATOM   1651 N  NE  . ARG B 1 72  ? 16.704  114.990 13.577  1.00 45.79 ? 175 ARG B NE  1 
ATOM   1652 C  CZ  . ARG B 1 72  ? 16.507  116.153 14.195  1.00 51.00 ? 175 ARG B CZ  1 
ATOM   1653 N  NH1 . ARG B 1 72  ? 15.338  116.452 14.748  1.00 55.87 ? 175 ARG B NH1 1 
ATOM   1654 N  NH2 . ARG B 1 72  ? 17.492  117.033 14.262  1.00 53.28 ? 175 ARG B NH2 1 
ATOM   1655 N  N   . GLU B 1 73  ? 11.046  116.320 13.352  1.00 27.47 ? 176 GLU B N   1 
ATOM   1656 C  CA  . GLU B 1 73  ? 10.889  117.749 13.591  1.00 34.59 ? 176 GLU B CA  1 
ATOM   1657 C  C   . GLU B 1 73  ? 11.279  118.056 15.026  1.00 35.74 ? 176 GLU B C   1 
ATOM   1658 O  O   . GLU B 1 73  ? 10.999  117.286 15.930  1.00 34.04 ? 176 GLU B O   1 
ATOM   1659 C  CB  . GLU B 1 73  ? 9.448   118.180 13.361  1.00 40.66 ? 176 GLU B CB  1 
ATOM   1660 C  CG  . GLU B 1 73  ? 8.884   117.774 12.008  1.00 46.08 ? 176 GLU B CG  1 
ATOM   1661 C  CD  . GLU B 1 73  ? 7.425   118.167 11.851  1.00 50.40 ? 176 GLU B CD  1 
ATOM   1662 O  OE1 . GLU B 1 73  ? 6.994   119.153 12.503  1.00 54.09 ? 176 GLU B OE1 1 
ATOM   1663 O  OE2 . GLU B 1 73  ? 6.714   117.489 11.078  1.00 50.73 ? 176 GLU B OE2 1 
ATOM   1664 N  N   . GLY B 1 74  ? 11.921  119.191 15.236  1.00 43.47 ? 177 GLY B N   1 
ATOM   1665 C  CA  . GLY B 1 74  ? 12.389  119.560 16.559  1.00 45.91 ? 177 GLY B CA  1 
ATOM   1666 C  C   . GLY B 1 74  ? 13.214  120.823 16.475  1.00 49.39 ? 177 GLY B C   1 
ATOM   1667 O  O   . GLY B 1 74  ? 13.883  121.055 15.460  1.00 47.41 ? 177 GLY B O   1 
ATOM   1668 N  N   . GLN B 1 75  ? 13.163  121.633 17.536  1.00 52.35 ? 178 GLN B N   1 
ATOM   1669 C  CA  . GLN B 1 75  ? 13.881  122.911 17.587  1.00 55.67 ? 178 GLN B CA  1 
ATOM   1670 C  C   . GLN B 1 75  ? 13.541  123.787 16.366  1.00 58.14 ? 178 GLN B C   1 
ATOM   1671 O  O   . GLN B 1 75  ? 14.404  124.499 15.845  1.00 60.32 ? 178 GLN B O   1 
ATOM   1672 C  CB  . GLN B 1 75  ? 15.405  122.678 17.690  1.00 55.74 ? 178 GLN B CB  1 
ATOM   1673 C  CG  . GLN B 1 75  ? 15.864  121.903 18.950  1.00 56.20 ? 178 GLN B CG  1 
ATOM   1674 C  CD  . GLN B 1 75  ? 16.677  120.629 18.652  1.00 56.50 ? 178 GLN B CD  1 
ATOM   1675 O  OE1 . GLN B 1 75  ? 17.045  120.363 17.507  1.00 56.14 ? 178 GLN B OE1 1 
ATOM   1676 N  NE2 . GLN B 1 75  ? 16.952  119.848 19.693  1.00 55.35 ? 178 GLN B NE2 1 
ATOM   1677 N  N   . GLY B 1 76  ? 12.282  123.723 15.920  1.00 58.54 ? 179 GLY B N   1 
ATOM   1678 C  CA  . GLY B 1 76  ? 11.826  124.424 14.727  1.00 58.24 ? 179 GLY B CA  1 
ATOM   1679 C  C   . GLY B 1 76  ? 12.649  124.106 13.485  1.00 57.30 ? 179 GLY B C   1 
ATOM   1680 O  O   . GLY B 1 76  ? 13.308  124.991 12.926  1.00 60.62 ? 179 GLY B O   1 
ATOM   1681 N  N   . ARG B 1 77  ? 12.611  122.847 13.057  1.00 51.85 ? 180 ARG B N   1 
ATOM   1682 C  CA  . ARG B 1 77  ? 13.467  122.369 11.970  1.00 49.42 ? 180 ARG B CA  1 
ATOM   1683 C  C   . ARG B 1 77  ? 13.048  120.965 11.523  1.00 46.17 ? 180 ARG B C   1 
ATOM   1684 O  O   . ARG B 1 77  ? 13.293  119.993 12.238  1.00 48.25 ? 180 ARG B O   1 
ATOM   1685 C  CB  . ARG B 1 77  ? 14.938  122.333 12.431  1.00 51.03 ? 180 ARG B CB  1 
ATOM   1686 C  CG  . ARG B 1 77  ? 15.844  123.435 11.869  1.00 51.32 ? 180 ARG B CG  1 
ATOM   1687 C  CD  . ARG B 1 77  ? 17.060  122.899 11.108  1.00 53.11 ? 180 ARG B CD  1 
ATOM   1688 N  NE  . ARG B 1 77  ? 18.034  123.941 10.774  1.00 54.13 ? 180 ARG B NE  1 
ATOM   1689 C  CZ  . ARG B 1 77  ? 18.889  124.500 11.638  1.00 57.13 ? 180 ARG B CZ  1 
ATOM   1690 N  NH1 . ARG B 1 77  ? 18.915  124.135 12.923  1.00 56.84 ? 180 ARG B NH1 1 
ATOM   1691 N  NH2 . ARG B 1 77  ? 19.732  125.438 11.214  1.00 57.99 ? 180 ARG B NH2 1 
ATOM   1692 N  N   . ARG B 1 78  ? 12.419  120.863 10.352  1.00 40.28 ? 181 ARG B N   1 
ATOM   1693 C  CA  . ARG B 1 78  ? 12.104  119.565 9.755   1.00 40.37 ? 181 ARG B CA  1 
ATOM   1694 C  C   . ARG B 1 78  ? 13.302  119.007 8.976   1.00 35.63 ? 181 ARG B C   1 
ATOM   1695 O  O   . ARG B 1 78  ? 13.905  119.706 8.177   1.00 37.44 ? 181 ARG B O   1 
ATOM   1696 C  CB  . ARG B 1 78  ? 10.881  119.673 8.830   1.00 43.96 ? 181 ARG B CB  1 
ATOM   1697 C  CG  . ARG B 1 78  ? 10.279  118.325 8.435   1.00 49.19 ? 181 ARG B CG  1 
ATOM   1698 C  CD  . ARG B 1 78  ? 8.787   118.361 8.022   1.00 54.46 ? 181 ARG B CD  1 
ATOM   1699 N  NE  . ARG B 1 78  ? 8.409   117.151 7.276   1.00 59.39 ? 181 ARG B NE  1 
ATOM   1700 C  CZ  . ARG B 1 78  ? 7.445   117.069 6.344   1.00 63.69 ? 181 ARG B CZ  1 
ATOM   1701 N  NH1 . ARG B 1 78  ? 6.702   118.128 6.014   1.00 63.92 ? 181 ARG B NH1 1 
ATOM   1702 N  NH2 . ARG B 1 78  ? 7.221   115.902 5.732   1.00 63.19 ? 181 ARG B NH2 1 
ATOM   1703 N  N   . GLU B 1 79  ? 13.629  117.740 9.207   1.00 33.78 ? 182 GLU B N   1 
ATOM   1704 C  CA  . GLU B 1 79  ? 14.686  117.049 8.480   1.00 31.51 ? 182 GLU B CA  1 
ATOM   1705 C  C   . GLU B 1 79  ? 14.138  115.741 7.922   1.00 28.65 ? 182 GLU B C   1 
ATOM   1706 O  O   . GLU B 1 79  ? 13.620  114.912 8.671   1.00 27.11 ? 182 GLU B O   1 
ATOM   1707 C  CB  . GLU B 1 79  ? 15.875  116.765 9.404   1.00 35.69 ? 182 GLU B CB  1 
ATOM   1708 C  CG  . GLU B 1 79  ? 17.007  115.985 8.735   1.00 40.44 ? 182 GLU B CG  1 
ATOM   1709 C  CD  . GLU B 1 79  ? 18.192  115.698 9.650   1.00 42.78 ? 182 GLU B CD  1 
ATOM   1710 O  OE1 . GLU B 1 79  ? 18.019  115.516 10.875  1.00 41.55 ? 182 GLU B OE1 1 
ATOM   1711 O  OE2 . GLU B 1 79  ? 19.319  115.642 9.125   1.00 49.77 ? 182 GLU B OE2 1 
ATOM   1712 N  N   . THR B 1 80  ? 14.245  115.544 6.612   1.00 24.23 ? 183 THR B N   1 
ATOM   1713 C  CA  . THR B 1 80  ? 13.801  114.289 6.011   1.00 26.07 ? 183 THR B CA  1 
ATOM   1714 C  C   . THR B 1 80  ? 14.844  113.196 6.274   1.00 24.81 ? 183 THR B C   1 
ATOM   1715 O  O   . THR B 1 80  ? 16.003  113.387 5.997   1.00 23.03 ? 183 THR B O   1 
ATOM   1716 C  CB  . THR B 1 80  ? 13.599  114.460 4.519   1.00 27.25 ? 183 THR B CB  1 
ATOM   1717 O  OG1 . THR B 1 80  ? 12.740  115.570 4.277   1.00 31.73 ? 183 THR B OG1 1 
ATOM   1718 C  CG2 . THR B 1 80  ? 12.860  113.269 3.919   1.00 28.22 ? 183 THR B CG2 1 
ATOM   1719 N  N   . LEU B 1 81  ? 14.424  112.071 6.838   1.00 23.07 ? 184 LEU B N   1 
ATOM   1720 C  CA  . LEU B 1 81  ? 15.343  110.981 7.153   1.00 25.31 ? 184 LEU B CA  1 
ATOM   1721 C  C   . LEU B 1 81  ? 15.494  110.012 5.976   1.00 23.52 ? 184 LEU B C   1 
ATOM   1722 O  O   . LEU B 1 81  ? 16.607  109.724 5.523   1.00 24.22 ? 184 LEU B O   1 
ATOM   1723 C  CB  . LEU B 1 81  ? 14.864  110.245 8.410   1.00 25.27 ? 184 LEU B CB  1 
ATOM   1724 C  CG  . LEU B 1 81  ? 14.828  111.108 9.684   1.00 24.37 ? 184 LEU B CG  1 
ATOM   1725 C  CD1 . LEU B 1 81  ? 14.407  110.282 10.865  1.00 25.45 ? 184 LEU B CD1 1 
ATOM   1726 C  CD2 . LEU B 1 81  ? 16.186  111.768 9.980   1.00 22.63 ? 184 LEU B CD2 1 
ATOM   1727 N  N   . PHE B 1 82  ? 14.373  109.498 5.492   1.00 22.62 ? 185 PHE B N   1 
ATOM   1728 C  CA  . PHE B 1 82  ? 14.385  108.707 4.261   1.00 25.11 ? 185 PHE B CA  1 
ATOM   1729 C  C   . PHE B 1 82  ? 13.050  108.740 3.581   1.00 22.76 ? 185 PHE B C   1 
ATOM   1730 O  O   . PHE B 1 82  ? 12.052  109.181 4.139   1.00 26.25 ? 185 PHE B O   1 
ATOM   1731 C  CB  . PHE B 1 82  ? 14.831  107.249 4.496   1.00 25.94 ? 185 PHE B CB  1 
ATOM   1732 C  CG  . PHE B 1 82  ? 14.007  106.507 5.510   1.00 27.78 ? 185 PHE B CG  1 
ATOM   1733 C  CD1 . PHE B 1 82  ? 14.345  106.539 6.850   1.00 25.55 ? 185 PHE B CD1 1 
ATOM   1734 C  CD2 . PHE B 1 82  ? 12.895  105.776 5.118   1.00 29.53 ? 185 PHE B CD2 1 
ATOM   1735 C  CE1 . PHE B 1 82  ? 13.575  105.857 7.795   1.00 31.71 ? 185 PHE B CE1 1 
ATOM   1736 C  CE2 . PHE B 1 82  ? 12.128  105.089 6.050   1.00 31.01 ? 185 PHE B CE2 1 
ATOM   1737 C  CZ  . PHE B 1 82  ? 12.467  105.132 7.394   1.00 29.82 ? 185 PHE B CZ  1 
ATOM   1738 N  N   . ARG B 1 83  ? 13.040  108.284 2.347   1.00 27.46 ? 186 ARG B N   1 
ATOM   1739 C  CA  . ARG B 1 83  ? 11.790  108.048 1.683   1.00 29.38 ? 186 ARG B CA  1 
ATOM   1740 C  C   . ARG B 1 83  ? 11.838  106.803 0.829   1.00 29.22 ? 186 ARG B C   1 
ATOM   1741 O  O   . ARG B 1 83  ? 12.910  106.286 0.475   1.00 28.96 ? 186 ARG B O   1 
ATOM   1742 C  CB  . ARG B 1 83  ? 11.302  109.288 0.919   1.00 31.12 ? 186 ARG B CB  1 
ATOM   1743 C  CG  . ARG B 1 83  ? 12.153  109.775 -0.163  1.00 30.30 ? 186 ARG B CG  1 
ATOM   1744 C  CD  . ARG B 1 83  ? 11.935  111.255 -0.506  1.00 29.71 ? 186 ARG B CD  1 
ATOM   1745 N  NE  . ARG B 1 83  ? 13.191  111.815 -0.997  1.00 27.86 ? 186 ARG B NE  1 
ATOM   1746 C  CZ  . ARG B 1 83  ? 13.503  112.023 -2.268  1.00 23.99 ? 186 ARG B CZ  1 
ATOM   1747 N  NH1 . ARG B 1 83  ? 12.660  111.776 -3.255  1.00 23.20 ? 186 ARG B NH1 1 
ATOM   1748 N  NH2 . ARG B 1 83  ? 14.700  112.494 -2.552  1.00 24.46 ? 186 ARG B NH2 1 
ATOM   1749 N  N   . CYS B 1 84  ? 10.643  106.301 0.567   1.00 25.25 ? 187 CYS B N   1 
ATOM   1750 C  CA  . CYS B 1 84  ? 10.446  105.126 -0.245  1.00 30.27 ? 187 CYS B CA  1 
ATOM   1751 C  C   . CYS B 1 84  ? 9.554   105.533 -1.425  1.00 25.84 ? 187 CYS B C   1 
ATOM   1752 O  O   . CYS B 1 84  ? 8.600   106.269 -1.256  1.00 27.17 ? 187 CYS B O   1 
ATOM   1753 C  CB  . CYS B 1 84  ? 9.794   104.025 0.608   1.00 31.42 ? 187 CYS B CB  1 
ATOM   1754 S  SG  . CYS B 1 84  ? 9.734   102.453 -0.253  1.00 43.35 ? 187 CYS B SG  1 
ATOM   1755 N  N   . ILE B 1 85  ? 9.884   105.066 -2.620  1.00 27.81 ? 188 ILE B N   1 
ATOM   1756 C  CA  . ILE B 1 85  ? 9.158   105.433 -3.831  1.00 25.80 ? 188 ILE B CA  1 
ATOM   1757 C  C   . ILE B 1 85  ? 8.919   104.212 -4.717  1.00 28.40 ? 188 ILE B C   1 
ATOM   1758 O  O   . ILE B 1 85  ? 9.867   103.509 -5.094  1.00 23.61 ? 188 ILE B O   1 
ATOM   1759 C  CB  . ILE B 1 85  ? 9.960   106.485 -4.635  1.00 29.60 ? 188 ILE B CB  1 
ATOM   1760 C  CG1 . ILE B 1 85  ? 10.095  107.778 -3.828  1.00 31.07 ? 188 ILE B CG1 1 
ATOM   1761 C  CG2 . ILE B 1 85  ? 9.306   106.754 -6.008  1.00 29.39 ? 188 ILE B CG2 1 
ATOM   1762 C  CD1 . ILE B 1 85  ? 11.251  108.594 -4.218  1.00 32.64 ? 188 ILE B CD1 1 
ATOM   1763 N  N   . ARG B 1 86  ? 7.659   104.021 -5.106  1.00 25.89 ? 189 ARG B N   1 
ATOM   1764 C  CA  . ARG B 1 86  ? 7.268   102.925 -5.965  1.00 28.26 ? 189 ARG B CA  1 
ATOM   1765 C  C   . ARG B 1 86  ? 6.405   103.395 -7.129  1.00 25.26 ? 189 ARG B C   1 
ATOM   1766 O  O   . ARG B 1 86  ? 5.381   104.061 -6.936  1.00 24.95 ? 189 ARG B O   1 
ATOM   1767 C  CB  . ARG B 1 86  ? 6.513   101.882 -5.136  1.00 34.78 ? 189 ARG B CB  1 
ATOM   1768 C  CG  . ARG B 1 86  ? 6.740   100.429 -5.550  1.00 40.01 ? 189 ARG B CG  1 
ATOM   1769 C  CD  . ARG B 1 86  ? 8.180   99.946  -5.476  1.00 45.44 ? 189 ARG B CD  1 
ATOM   1770 N  NE  . ARG B 1 86  ? 8.521   99.400  -4.162  1.00 47.79 ? 189 ARG B NE  1 
ATOM   1771 C  CZ  . ARG B 1 86  ? 9.600   99.725  -3.451  1.00 48.98 ? 189 ARG B CZ  1 
ATOM   1772 N  NH1 . ARG B 1 86  ? 10.457  100.631 -3.896  1.00 44.13 ? 189 ARG B NH1 1 
ATOM   1773 N  NH2 . ARG B 1 86  ? 9.816   99.146  -2.262  1.00 55.59 ? 189 ARG B NH2 1 
ATOM   1774 N  N   . SER B 1 87  ? 6.813   103.036 -8.338  1.00 26.41 ? 190 SER B N   1 
ATOM   1775 C  CA  . SER B 1 87  ? 5.957   103.211 -9.514  1.00 29.80 ? 190 SER B CA  1 
ATOM   1776 C  C   . SER B 1 87  ? 4.813   102.210 -9.424  1.00 27.03 ? 190 SER B C   1 
ATOM   1777 O  O   . SER B 1 87  ? 5.031   101.084 -8.991  1.00 23.16 ? 190 SER B O   1 
ATOM   1778 C  CB  . SER B 1 87  ? 6.751   103.003 -10.802 1.00 32.58 ? 190 SER B CB  1 
ATOM   1779 O  OG  . SER B 1 87  ? 7.512   104.157 -11.113 1.00 36.93 ? 190 SER B OG  1 
ATOM   1780 N  N   . MET B 1 88  ? 3.601   102.640 -9.782  1.00 24.53 ? 191 MET B N   1 
ATOM   1781 C  CA  . MET B 1 88  ? 2.410   101.796 -9.709  1.00 26.81 ? 191 MET B CA  1 
ATOM   1782 C  C   . MET B 1 88  ? 1.861   101.505 -11.115 1.00 25.83 ? 191 MET B C   1 
ATOM   1783 O  O   . MET B 1 88  ? 1.881   102.376 -11.995 1.00 26.30 ? 191 MET B O   1 
ATOM   1784 C  CB  . MET B 1 88  ? 1.297   102.454 -8.864  1.00 25.04 ? 191 MET B CB  1 
ATOM   1785 C  CG  . MET B 1 88  ? 1.694   102.887 -7.453  1.00 24.13 ? 191 MET B CG  1 
ATOM   1786 S  SD  . MET B 1 88  ? 2.120   101.532 -6.295  1.00 23.84 ? 191 MET B SD  1 
ATOM   1787 C  CE  . MET B 1 88  ? 0.569   100.655 -6.068  1.00 24.63 ? 191 MET B CE  1 
ATOM   1788 N  N   . PRO B 1 89  ? 1.406   100.273 -11.335 1.00 24.20 ? 192 PRO B N   1 
ATOM   1789 C  CA  . PRO B 1 89  ? 0.588   99.938  -12.510 1.00 23.51 ? 192 PRO B CA  1 
ATOM   1790 C  C   . PRO B 1 89  ? -0.612  100.881 -12.647 1.00 23.48 ? 192 PRO B C   1 
ATOM   1791 O  O   . PRO B 1 89  ? -1.120  101.328 -11.616 1.00 20.37 ? 192 PRO B O   1 
ATOM   1792 C  CB  . PRO B 1 89  ? 0.108   98.512  -12.204 1.00 23.31 ? 192 PRO B CB  1 
ATOM   1793 C  CG  . PRO B 1 89  ? 1.137   97.936  -11.290 1.00 24.73 ? 192 PRO B CG  1 
ATOM   1794 C  CD  . PRO B 1 89  ? 1.676   99.092  -10.492 1.00 24.17 ? 192 PRO B CD  1 
ATOM   1795 N  N   . SER B 1 90  ? -1.036  101.192 -13.873 1.00 24.58 ? 193 SER B N   1 
ATOM   1796 C  CA  . SER B 1 90  ? -2.208  102.069 -14.094 1.00 28.48 ? 193 SER B CA  1 
ATOM   1797 C  C   . SER B 1 90  ? -3.554  101.323 -14.074 1.00 27.56 ? 193 SER B C   1 
ATOM   1798 O  O   . SER B 1 90  ? -4.615  101.947 -14.059 1.00 26.65 ? 193 SER B O   1 
ATOM   1799 C  CB  . SER B 1 90  ? -2.075  102.871 -15.404 1.00 28.14 ? 193 SER B CB  1 
ATOM   1800 O  OG  . SER B 1 90  ? -1.683  102.057 -16.490 1.00 29.28 ? 193 SER B OG  1 
ATOM   1801 N  N   . ASP B 1 91  ? -3.495  99.996  -14.083 1.00 27.24 ? 194 ASP B N   1 
ATOM   1802 C  CA  . ASP B 1 91  ? -4.674  99.144  -14.029 1.00 26.67 ? 194 ASP B CA  1 
ATOM   1803 C  C   . ASP B 1 91  ? -5.030  98.899  -12.560 1.00 26.59 ? 194 ASP B C   1 
ATOM   1804 O  O   . ASP B 1 91  ? -4.249  98.278  -11.849 1.00 25.85 ? 194 ASP B O   1 
ATOM   1805 C  CB  . ASP B 1 91  ? -4.341  97.819  -14.726 1.00 31.13 ? 194 ASP B CB  1 
ATOM   1806 C  CG  . ASP B 1 91  ? -5.511  96.848  -14.768 1.00 34.76 ? 194 ASP B CG  1 
ATOM   1807 O  OD1 . ASP B 1 91  ? -6.567  97.103  -14.144 1.00 35.22 ? 194 ASP B OD1 1 
ATOM   1808 O  OD2 . ASP B 1 91  ? -5.445  95.781  -15.411 1.00 35.87 ? 194 ASP B OD2 1 
ATOM   1809 N  N   . PRO B 1 92  ? -6.192  99.365  -12.101 1.00 28.76 ? 195 PRO B N   1 
ATOM   1810 C  CA  . PRO B 1 92  ? -6.580  99.211  -10.687 1.00 31.14 ? 195 PRO B CA  1 
ATOM   1811 C  C   . PRO B 1 92  ? -6.648  97.766  -10.174 1.00 31.69 ? 195 PRO B C   1 
ATOM   1812 O  O   . PRO B 1 92  ? -6.383  97.559  -8.992  1.00 34.11 ? 195 PRO B O   1 
ATOM   1813 C  CB  . PRO B 1 92  ? -7.969  99.888  -10.603 1.00 28.22 ? 195 PRO B CB  1 
ATOM   1814 C  CG  . PRO B 1 92  ? -8.435  100.047 -11.998 1.00 29.38 ? 195 PRO B CG  1 
ATOM   1815 C  CD  . PRO B 1 92  ? -7.226  100.074 -12.882 1.00 30.45 ? 195 PRO B CD  1 
ATOM   1816 N  N   . ASP B 1 93  ? -6.992  96.802  -11.028 1.00 32.26 ? 196 ASP B N   1 
ATOM   1817 C  CA  . ASP B 1 93  ? -6.964  95.373  -10.654 1.00 32.54 ? 196 ASP B CA  1 
ATOM   1818 C  C   . ASP B 1 93  ? -5.571  94.859  -10.266 1.00 31.60 ? 196 ASP B C   1 
ATOM   1819 O  O   . ASP B 1 93  ? -5.450  93.918  -9.474  1.00 30.83 ? 196 ASP B O   1 
ATOM   1820 C  CB  . ASP B 1 93  ? -7.459  94.500  -11.808 1.00 34.55 ? 196 ASP B CB  1 
ATOM   1821 C  CG  . ASP B 1 93  ? -8.839  94.867  -12.273 1.00 36.57 ? 196 ASP B CG  1 
ATOM   1822 O  OD1 . ASP B 1 93  ? -9.696  95.134  -11.406 1.00 37.89 ? 196 ASP B OD1 1 
ATOM   1823 O  OD2 . ASP B 1 93  ? -9.152  94.917  -13.484 1.00 37.44 ? 196 ASP B OD2 1 
ATOM   1824 N  N   . ARG B 1 94  ? -4.536  95.463  -10.849 1.00 26.72 ? 197 ARG B N   1 
ATOM   1825 C  CA  . ARG B 1 94  ? -3.153  95.007  -10.683 1.00 28.35 ? 197 ARG B CA  1 
ATOM   1826 C  C   . ARG B 1 94  ? -2.295  95.866  -9.745  1.00 26.57 ? 197 ARG B C   1 
ATOM   1827 O  O   . ARG B 1 94  ? -1.158  95.505  -9.453  1.00 32.25 ? 197 ARG B O   1 
ATOM   1828 C  CB  . ARG B 1 94  ? -2.470  94.966  -12.056 1.00 29.12 ? 197 ARG B CB  1 
ATOM   1829 C  CG  . ARG B 1 94  ? -3.011  93.890  -12.997 1.00 30.12 ? 197 ARG B CG  1 
ATOM   1830 C  CD  . ARG B 1 94  ? -2.309  93.837  -14.351 1.00 31.53 ? 197 ARG B CD  1 
ATOM   1831 N  NE  . ARG B 1 94  ? -3.268  93.507  -15.395 1.00 37.15 ? 197 ARG B NE  1 
ATOM   1832 C  CZ  . ARG B 1 94  ? -3.528  92.281  -15.844 1.00 39.96 ? 197 ARG B CZ  1 
ATOM   1833 N  NH1 . ARG B 1 94  ? -2.872  91.221  -15.378 1.00 43.74 ? 197 ARG B NH1 1 
ATOM   1834 N  NH2 . ARG B 1 94  ? -4.452  92.113  -16.781 1.00 38.06 ? 197 ARG B NH2 1 
ATOM   1835 N  N   . ALA B 1 95  ? -2.836  96.986  -9.270  1.00 23.57 ? 198 ALA B N   1 
ATOM   1836 C  CA  . ALA B 1 95  ? -2.026  98.037  -8.666  1.00 23.52 ? 198 ALA B CA  1 
ATOM   1837 C  C   . ALA B 1 95  ? -1.787  97.849  -7.173  1.00 24.85 ? 198 ALA B C   1 
ATOM   1838 O  O   . ALA B 1 95  ? -2.436  98.481  -6.348  1.00 30.35 ? 198 ALA B O   1 
ATOM   1839 C  CB  . ALA B 1 95  ? -2.645  99.391  -8.940  1.00 22.23 ? 198 ALA B CB  1 
ATOM   1840 N  N   . TYR B 1 96  ? -0.828  96.988  -6.852  1.00 23.67 ? 199 TYR B N   1 
ATOM   1841 C  CA  . TYR B 1 96  ? -0.447  96.659  -5.485  1.00 23.57 ? 199 TYR B CA  1 
ATOM   1842 C  C   . TYR B 1 96  ? 1.080   96.702  -5.360  1.00 25.54 ? 199 TYR B C   1 
ATOM   1843 O  O   . TYR B 1 96  ? 1.778   96.053  -6.133  1.00 25.16 ? 199 TYR B O   1 
ATOM   1844 C  CB  . TYR B 1 96  ? -0.892  95.236  -5.121  1.00 26.05 ? 199 TYR B CB  1 
ATOM   1845 C  CG  . TYR B 1 96  ? -2.385  94.981  -5.065  1.00 24.80 ? 199 TYR B CG  1 
ATOM   1846 C  CD1 . TYR B 1 96  ? -3.077  94.525  -6.190  1.00 26.81 ? 199 TYR B CD1 1 
ATOM   1847 C  CD2 . TYR B 1 96  ? -3.094  95.125  -3.876  1.00 26.35 ? 199 TYR B CD2 1 
ATOM   1848 C  CE1 . TYR B 1 96  ? -4.456  94.253  -6.142  1.00 22.95 ? 199 TYR B CE1 1 
ATOM   1849 C  CE2 . TYR B 1 96  ? -4.474  94.861  -3.821  1.00 28.03 ? 199 TYR B CE2 1 
ATOM   1850 C  CZ  . TYR B 1 96  ? -5.141  94.428  -4.959  1.00 25.18 ? 199 TYR B CZ  1 
ATOM   1851 O  OH  . TYR B 1 96  ? -6.490  94.175  -4.913  1.00 29.47 ? 199 TYR B OH  1 
ATOM   1852 N  N   . ASN B 1 97  ? 1.591   97.440  -4.378  1.00 25.38 ? 200 ASN B N   1 
ATOM   1853 C  CA  . ASN B 1 97  ? 3.021   97.452  -4.074  1.00 26.38 ? 200 ASN B CA  1 
ATOM   1854 C  C   . ASN B 1 97  ? 3.241   97.834  -2.612  1.00 28.10 ? 200 ASN B C   1 
ATOM   1855 O  O   . ASN B 1 97  ? 2.655   98.804  -2.135  1.00 24.38 ? 200 ASN B O   1 
ATOM   1856 C  CB  . ASN B 1 97  ? 3.768   98.480  -4.940  1.00 23.72 ? 200 ASN B CB  1 
ATOM   1857 C  CG  . ASN B 1 97  ? 4.191   97.934  -6.281  1.00 21.16 ? 200 ASN B CG  1 
ATOM   1858 O  OD1 . ASN B 1 97  ? 4.885   96.938  -6.362  1.00 23.79 ? 200 ASN B OD1 1 
ATOM   1859 N  ND2 . ASN B 1 97  ? 3.757   98.585  -7.346  1.00 25.63 ? 200 ASN B ND2 1 
ATOM   1860 N  N   . SER B 1 98  ? 4.091   97.091  -1.910  1.00 26.29 ? 201 SER B N   1 
ATOM   1861 C  CA  . SER B 1 98  ? 4.592   97.550  -0.619  1.00 25.01 ? 201 SER B CA  1 
ATOM   1862 C  C   . SER B 1 98  ? 5.861   98.377  -0.846  1.00 27.29 ? 201 SER B C   1 
ATOM   1863 O  O   . SER B 1 98  ? 6.596   98.180  -1.813  1.00 26.39 ? 201 SER B O   1 
ATOM   1864 C  CB  . SER B 1 98  ? 4.841   96.381  0.331   1.00 23.50 ? 201 SER B CB  1 
ATOM   1865 O  OG  . SER B 1 98  ? 5.832   95.518  -0.173  1.00 24.60 ? 201 SER B OG  1 
ATOM   1866 N  N   . CYS B 1 99  ? 6.096   99.311  0.062   1.00 25.73 ? 202 CYS B N   1 
ATOM   1867 C  CA  . CYS B 1 99  ? 7.228   100.202 0.011   1.00 24.88 ? 202 CYS B CA  1 
ATOM   1868 C  C   . CYS B 1 99  ? 7.890   100.175 1.374   1.00 28.76 ? 202 CYS B C   1 
ATOM   1869 O  O   . CYS B 1 99  ? 7.324   100.689 2.349   1.00 31.14 ? 202 CYS B O   1 
ATOM   1870 C  CB  . CYS B 1 99  ? 6.753   101.616 -0.304  1.00 31.99 ? 202 CYS B CB  1 
ATOM   1871 S  SG  . CYS B 1 99  ? 7.960   102.505 -1.263  1.00 42.68 ? 202 CYS B SG  1 
ATOM   1872 N  N   . TYR B 1 100 ? 9.082   99.581  1.441   1.00 27.81 ? 203 TYR B N   1 
ATOM   1873 C  CA  . TYR B 1 100 ? 9.839   99.471  2.691   1.00 28.00 ? 203 TYR B CA  1 
ATOM   1874 C  C   . TYR B 1 100 ? 11.118  100.275 2.586   1.00 29.59 ? 203 TYR B C   1 
ATOM   1875 O  O   . TYR B 1 100 ? 11.833  100.166 1.597   1.00 27.02 ? 203 TYR B O   1 
ATOM   1876 C  CB  . TYR B 1 100 ? 10.200  98.012  3.001   1.00 24.06 ? 203 TYR B CB  1 
ATOM   1877 C  CG  . TYR B 1 100 ? 11.059  97.837  4.261   1.00 25.65 ? 203 TYR B CG  1 
ATOM   1878 C  CD1 . TYR B 1 100 ? 12.429  98.009  4.215   1.00 24.82 ? 203 TYR B CD1 1 
ATOM   1879 C  CD2 . TYR B 1 100 ? 10.490  97.475  5.489   1.00 25.86 ? 203 TYR B CD2 1 
ATOM   1880 C  CE1 . TYR B 1 100 ? 13.213  97.850  5.346   1.00 27.43 ? 203 TYR B CE1 1 
ATOM   1881 C  CE2 . TYR B 1 100 ? 11.277  97.322  6.635   1.00 24.78 ? 203 TYR B CE2 1 
ATOM   1882 C  CZ  . TYR B 1 100 ? 12.639  97.504  6.551   1.00 24.18 ? 203 TYR B CZ  1 
ATOM   1883 O  OH  . TYR B 1 100 ? 13.465  97.355  7.650   1.00 25.13 ? 203 TYR B OH  1 
ATOM   1884 N  N   . SER B 1 101 ? 11.410  101.073 3.611   1.00 27.35 ? 204 SER B N   1 
ATOM   1885 C  CA  . SER B 1 101 ? 12.746  101.639 3.758   1.00 24.70 ? 204 SER B CA  1 
ATOM   1886 C  C   . SER B 1 101 ? 13.124  101.739 5.223   1.00 26.67 ? 204 SER B C   1 
ATOM   1887 O  O   . SER B 1 101 ? 12.280  101.684 6.105   1.00 27.97 ? 204 SER B O   1 
ATOM   1888 C  CB  . SER B 1 101 ? 12.838  103.004 3.084   1.00 21.98 ? 204 SER B CB  1 
ATOM   1889 O  OG  . SER B 1 101 ? 14.174  103.507 3.122   1.00 24.33 ? 204 SER B OG  1 
ATOM   1890 N  N   . ALA B 1 102 ? 14.413  101.878 5.471   1.00 24.14 ? 205 ALA B N   1 
ATOM   1891 C  CA  . ALA B 1 102 ? 14.920  101.955 6.829   1.00 23.03 ? 205 ALA B CA  1 
ATOM   1892 C  C   . ALA B 1 102 ? 16.282  102.621 6.862   1.00 25.16 ? 205 ALA B C   1 
ATOM   1893 O  O   . ALA B 1 102 ? 17.027  102.595 5.877   1.00 29.35 ? 205 ALA B O   1 
ATOM   1894 C  CB  . ALA B 1 102 ? 15.018  100.566 7.426   1.00 23.21 ? 205 ALA B CB  1 
ATOM   1895 N  N   . GLY B 1 103 ? 16.610  103.212 7.999   1.00 24.60 ? 206 GLY B N   1 
ATOM   1896 C  CA  . GLY B 1 103 ? 17.968  103.676 8.257   1.00 25.66 ? 206 GLY B CA  1 
ATOM   1897 C  C   . GLY B 1 103 ? 18.215  103.857 9.745   1.00 25.46 ? 206 GLY B C   1 
ATOM   1898 O  O   . GLY B 1 103 ? 17.301  103.678 10.559  1.00 22.18 ? 206 GLY B O   1 
ATOM   1899 N  N   . VAL B 1 104 ? 19.449  104.211 10.083  1.00 20.27 ? 207 VAL B N   1 
ATOM   1900 C  CA  . VAL B 1 104 ? 19.877  104.447 11.458  1.00 24.84 ? 207 VAL B CA  1 
ATOM   1901 C  C   . VAL B 1 104 ? 20.150  105.951 11.613  1.00 24.46 ? 207 VAL B C   1 
ATOM   1902 O  O   . VAL B 1 104 ? 20.906  106.523 10.826  1.00 22.42 ? 207 VAL B O   1 
ATOM   1903 C  CB  . VAL B 1 104 ? 21.158  103.635 11.777  1.00 26.80 ? 207 VAL B CB  1 
ATOM   1904 C  CG1 . VAL B 1 104 ? 21.853  104.152 13.013  1.00 27.69 ? 207 VAL B CG1 1 
ATOM   1905 C  CG2 . VAL B 1 104 ? 20.815  102.156 11.955  1.00 27.13 ? 207 VAL B CG2 1 
ATOM   1906 N  N   . PHE B 1 105 ? 19.530  106.582 12.613  1.00 24.99 ? 208 PHE B N   1 
ATOM   1907 C  CA  . PHE B 1 105 ? 19.584  108.041 12.779  1.00 22.71 ? 208 PHE B CA  1 
ATOM   1908 C  C   . PHE B 1 105 ? 19.755  108.492 14.217  1.00 19.85 ? 208 PHE B C   1 
ATOM   1909 O  O   . PHE B 1 105 ? 19.314  107.826 15.118  1.00 21.56 ? 208 PHE B O   1 
ATOM   1910 C  CB  . PHE B 1 105 ? 18.310  108.660 12.215  1.00 24.53 ? 208 PHE B CB  1 
ATOM   1911 C  CG  . PHE B 1 105 ? 18.066  108.301 10.786  1.00 21.49 ? 208 PHE B CG  1 
ATOM   1912 C  CD1 . PHE B 1 105 ? 18.730  108.968 9.778   1.00 17.67 ? 208 PHE B CD1 1 
ATOM   1913 C  CD2 . PHE B 1 105 ? 17.183  107.294 10.456  1.00 23.73 ? 208 PHE B CD2 1 
ATOM   1914 C  CE1 . PHE B 1 105 ? 18.540  108.620 8.462   1.00 21.96 ? 208 PHE B CE1 1 
ATOM   1915 C  CE2 . PHE B 1 105 ? 16.983  106.938 9.137   1.00 24.79 ? 208 PHE B CE2 1 
ATOM   1916 C  CZ  . PHE B 1 105 ? 17.655  107.591 8.142   1.00 21.96 ? 208 PHE B CZ  1 
ATOM   1917 N  N   . HIS B 1 106 ? 20.385  109.648 14.403  1.00 19.95 ? 209 HIS B N   1 
ATOM   1918 C  CA  . HIS B 1 106 ? 20.509  110.295 15.700  1.00 25.54 ? 209 HIS B CA  1 
ATOM   1919 C  C   . HIS B 1 106 ? 19.223  111.080 15.960  1.00 24.09 ? 209 HIS B C   1 
ATOM   1920 O  O   . HIS B 1 106 ? 18.937  112.063 15.280  1.00 21.89 ? 209 HIS B O   1 
ATOM   1921 C  CB  . HIS B 1 106 ? 21.732  111.223 15.718  1.00 28.19 ? 209 HIS B CB  1 
ATOM   1922 C  CG  . HIS B 1 106 ? 22.202  111.590 17.092  1.00 35.44 ? 209 HIS B CG  1 
ATOM   1923 N  ND1 . HIS B 1 106 ? 21.866  112.777 17.704  1.00 40.76 ? 209 HIS B ND1 1 
ATOM   1924 C  CD2 . HIS B 1 106 ? 23.001  110.934 17.966  1.00 41.34 ? 209 HIS B CD2 1 
ATOM   1925 C  CE1 . HIS B 1 106 ? 22.423  112.830 18.901  1.00 39.26 ? 209 HIS B CE1 1 
ATOM   1926 N  NE2 . HIS B 1 106 ? 23.121  111.725 19.083  1.00 40.04 ? 209 HIS B NE2 1 
ATOM   1927 N  N   . LEU B 1 107 ? 18.422  110.598 16.905  1.00 21.77 ? 210 LEU B N   1 
ATOM   1928 C  CA  . LEU B 1 107 ? 17.182  111.269 17.293  1.00 22.49 ? 210 LEU B CA  1 
ATOM   1929 C  C   . LEU B 1 107 ? 17.357  111.994 18.623  1.00 24.09 ? 210 LEU B C   1 
ATOM   1930 O  O   . LEU B 1 107 ? 17.935  111.459 19.551  1.00 24.99 ? 210 LEU B O   1 
ATOM   1931 C  CB  . LEU B 1 107 ? 16.049  110.253 17.393  1.00 21.29 ? 210 LEU B CB  1 
ATOM   1932 C  CG  . LEU B 1 107 ? 15.827  109.437 16.114  1.00 21.21 ? 210 LEU B CG  1 
ATOM   1933 C  CD1 . LEU B 1 107 ? 14.633  108.503 16.253  1.00 22.57 ? 210 LEU B CD1 1 
ATOM   1934 C  CD2 . LEU B 1 107 ? 15.645  110.363 14.926  1.00 23.73 ? 210 LEU B CD2 1 
ATOM   1935 N  N   . HIS B 1 108 ? 16.875  113.224 18.699  1.00 24.70 ? 211 HIS B N   1 
ATOM   1936 C  CA  . HIS B 1 108 ? 17.033  114.038 19.901  1.00 28.39 ? 211 HIS B CA  1 
ATOM   1937 C  C   . HIS B 1 108 ? 15.752  114.062 20.718  1.00 23.54 ? 211 HIS B C   1 
ATOM   1938 O  O   . HIS B 1 108 ? 14.659  113.970 20.174  1.00 20.91 ? 211 HIS B O   1 
ATOM   1939 C  CB  . HIS B 1 108 ? 17.392  115.477 19.526  1.00 31.86 ? 211 HIS B CB  1 
ATOM   1940 C  CG  . HIS B 1 108 ? 18.679  115.611 18.776  1.00 40.38 ? 211 HIS B CG  1 
ATOM   1941 N  ND1 . HIS B 1 108 ? 19.910  115.550 19.393  1.00 43.34 ? 211 HIS B ND1 1 
ATOM   1942 C  CD2 . HIS B 1 108 ? 18.926  115.830 17.461  1.00 46.00 ? 211 HIS B CD2 1 
ATOM   1943 C  CE1 . HIS B 1 108 ? 20.860  115.725 18.491  1.00 46.41 ? 211 HIS B CE1 1 
ATOM   1944 N  NE2 . HIS B 1 108 ? 20.290  115.890 17.310  1.00 47.67 ? 211 HIS B NE2 1 
ATOM   1945 N  N   . GLN B 1 109 ? 15.914  114.203 22.028  1.00 24.07 ? 212 GLN B N   1 
ATOM   1946 C  CA  . GLN B 1 109 ? 14.818  114.418 22.970  1.00 22.62 ? 212 GLN B CA  1 
ATOM   1947 C  C   . GLN B 1 109 ? 13.995  115.606 22.506  1.00 21.25 ? 212 GLN B C   1 
ATOM   1948 O  O   . GLN B 1 109 ? 14.544  116.672 22.266  1.00 23.80 ? 212 GLN B O   1 
ATOM   1949 C  CB  . GLN B 1 109 ? 15.416  114.684 24.350  1.00 25.35 ? 212 GLN B CB  1 
ATOM   1950 C  CG  . GLN B 1 109 ? 14.492  115.252 25.408  1.00 29.02 ? 212 GLN B CG  1 
ATOM   1951 C  CD  . GLN B 1 109 ? 15.281  115.839 26.558  1.00 31.64 ? 212 GLN B CD  1 
ATOM   1952 O  OE1 . GLN B 1 109 ? 15.123  117.015 26.888  1.00 33.71 ? 212 GLN B OE1 1 
ATOM   1953 N  NE2 . GLN B 1 109 ? 16.157  115.030 27.153  1.00 29.80 ? 212 GLN B NE2 1 
ATOM   1954 N  N   . GLY B 1 110 ? 12.686  115.417 22.364  1.00 20.23 ? 213 GLY B N   1 
ATOM   1955 C  CA  . GLY B 1 110 ? 11.802  116.461 21.862  1.00 22.51 ? 213 GLY B CA  1 
ATOM   1956 C  C   . GLY B 1 110 ? 11.469  116.372 20.381  1.00 23.89 ? 213 GLY B C   1 
ATOM   1957 O  O   . GLY B 1 110 ? 10.623  117.118 19.893  1.00 25.28 ? 213 GLY B O   1 
ATOM   1958 N  N   . ASP B 1 111 ? 12.120  115.466 19.660  1.00 25.75 ? 214 ASP B N   1 
ATOM   1959 C  CA  . ASP B 1 111 ? 11.821  115.259 18.245  1.00 28.50 ? 214 ASP B CA  1 
ATOM   1960 C  C   . ASP B 1 111 ? 10.420  114.673 18.061  1.00 26.43 ? 214 ASP B C   1 
ATOM   1961 O  O   . ASP B 1 111 ? 9.951   113.898 18.877  1.00 23.87 ? 214 ASP B O   1 
ATOM   1962 C  CB  . ASP B 1 111 ? 12.824  114.296 17.595  1.00 28.12 ? 214 ASP B CB  1 
ATOM   1963 C  CG  . ASP B 1 111 ? 14.169  114.938 17.292  1.00 27.70 ? 214 ASP B CG  1 
ATOM   1964 O  OD1 . ASP B 1 111 ? 14.398  116.123 17.629  1.00 25.17 ? 214 ASP B OD1 1 
ATOM   1965 O  OD2 . ASP B 1 111 ? 15.078  114.301 16.711  1.00 26.59 ? 214 ASP B OD2 1 
ATOM   1966 N  N   . ILE B 1 112 ? 9.778   115.056 16.966  1.00 26.24 ? 215 ILE B N   1 
ATOM   1967 C  CA  . ILE B 1 112 ? 8.541   114.447 16.502  1.00 26.61 ? 215 ILE B CA  1 
ATOM   1968 C  C   . ILE B 1 112 ? 8.907   113.694 15.236  1.00 25.19 ? 215 ILE B C   1 
ATOM   1969 O  O   . ILE B 1 112 ? 9.468   114.296 14.323  1.00 21.78 ? 215 ILE B O   1 
ATOM   1970 C  CB  . ILE B 1 112 ? 7.503   115.541 16.153  1.00 30.69 ? 215 ILE B CB  1 
ATOM   1971 C  CG1 . ILE B 1 112 ? 7.224   116.460 17.354  1.00 33.10 ? 215 ILE B CG1 1 
ATOM   1972 C  CG2 . ILE B 1 112 ? 6.219   114.917 15.626  1.00 31.44 ? 215 ILE B CG2 1 
ATOM   1973 C  CD1 . ILE B 1 112 ? 6.448   115.814 18.454  1.00 35.82 ? 215 ILE B CD1 1 
ATOM   1974 N  N   . ILE B 1 113 ? 8.601   112.396 15.177  1.00 22.38 ? 216 ILE B N   1 
ATOM   1975 C  CA  . ILE B 1 113 ? 8.788   111.602 13.967  1.00 21.00 ? 216 ILE B CA  1 
ATOM   1976 C  C   . ILE B 1 113 ? 7.468   111.500 13.218  1.00 24.85 ? 216 ILE B C   1 
ATOM   1977 O  O   . ILE B 1 113 ? 6.477   111.045 13.778  1.00 30.82 ? 216 ILE B O   1 
ATOM   1978 C  CB  . ILE B 1 113 ? 9.277   110.172 14.301  1.00 24.29 ? 216 ILE B CB  1 
ATOM   1979 C  CG1 . ILE B 1 113 ? 10.532  110.195 15.194  1.00 28.88 ? 216 ILE B CG1 1 
ATOM   1980 C  CG2 . ILE B 1 113 ? 9.537   109.387 13.020  1.00 24.95 ? 216 ILE B CG2 1 
ATOM   1981 C  CD1 . ILE B 1 113 ? 11.690  110.994 14.650  1.00 30.82 ? 216 ILE B CD1 1 
ATOM   1982 N  N   . THR B 1 114 ? 7.463   111.916 11.954  1.00 25.77 ? 217 THR B N   1 
ATOM   1983 C  CA  . THR B 1 114 ? 6.290   111.833 11.081  1.00 26.78 ? 217 THR B CA  1 
ATOM   1984 C  C   . THR B 1 114 ? 6.492   110.827 9.940   1.00 28.56 ? 217 THR B C   1 
ATOM   1985 O  O   . THR B 1 114 ? 7.601   110.653 9.436   1.00 27.66 ? 217 THR B O   1 
ATOM   1986 C  CB  . THR B 1 114 ? 5.984   113.212 10.451  1.00 29.43 ? 217 THR B CB  1 
ATOM   1987 O  OG1 . THR B 1 114 ? 7.064   113.612 9.585   1.00 31.47 ? 217 THR B OG1 1 
ATOM   1988 C  CG2 . THR B 1 114 ? 5.910   114.317 11.510  1.00 27.78 ? 217 THR B CG2 1 
ATOM   1989 N  N   . VAL B 1 115 ? 5.401   110.176 9.547   1.00 26.06 ? 218 VAL B N   1 
ATOM   1990 C  CA  . VAL B 1 115 ? 5.350   109.360 8.356   1.00 24.44 ? 218 VAL B CA  1 
ATOM   1991 C  C   . VAL B 1 115 ? 4.216   109.895 7.492   1.00 26.07 ? 218 VAL B C   1 
ATOM   1992 O  O   . VAL B 1 115 ? 3.055   109.792 7.852   1.00 27.89 ? 218 VAL B O   1 
ATOM   1993 C  CB  . VAL B 1 115 ? 5.111   107.889 8.704   1.00 29.20 ? 218 VAL B CB  1 
ATOM   1994 C  CG1 . VAL B 1 115 ? 5.138   107.014 7.454   1.00 29.24 ? 218 VAL B CG1 1 
ATOM   1995 C  CG2 . VAL B 1 115 ? 6.160   107.415 9.712   1.00 33.91 ? 218 VAL B CG2 1 
ATOM   1996 N  N   . LYS B 1 116 ? 4.565   110.465 6.343   1.00 27.56 ? 219 LYS B N   1 
ATOM   1997 C  CA  . LYS B 1 116 ? 3.605   111.136 5.480   1.00 24.04 ? 219 LYS B CA  1 
ATOM   1998 C  C   . LYS B 1 116 ? 3.591   110.504 4.098   1.00 24.39 ? 219 LYS B C   1 
ATOM   1999 O  O   . LYS B 1 116 ? 4.642   110.304 3.488   1.00 22.93 ? 219 LYS B O   1 
ATOM   2000 C  CB  . LYS B 1 116 ? 3.967   112.617 5.371   1.00 26.20 ? 219 LYS B CB  1 
ATOM   2001 C  CG  . LYS B 1 116 ? 3.882   113.356 6.704   1.00 30.97 ? 219 LYS B CG  1 
ATOM   2002 C  CD  . LYS B 1 116 ? 3.989   114.872 6.559   1.00 30.50 ? 219 LYS B CD  1 
ATOM   2003 C  CE  . LYS B 1 116 ? 3.673   115.563 7.885   1.00 32.31 ? 219 LYS B CE  1 
ATOM   2004 N  NZ  . LYS B 1 116 ? 3.706   117.063 7.783   1.00 34.15 ? 219 LYS B NZ  1 
ATOM   2005 N  N   . ILE B 1 117 ? 2.401   110.188 3.603   1.00 22.61 ? 220 ILE B N   1 
ATOM   2006 C  CA  . ILE B 1 117 ? 2.235   109.802 2.207   1.00 24.40 ? 220 ILE B CA  1 
ATOM   2007 C  C   . ILE B 1 117 ? 1.825   111.086 1.483   1.00 26.24 ? 220 ILE B C   1 
ATOM   2008 O  O   . ILE B 1 117 ? 0.730   111.579 1.731   1.00 29.80 ? 220 ILE B O   1 
ATOM   2009 C  CB  . ILE B 1 117 ? 1.163   108.697 2.049   1.00 24.61 ? 220 ILE B CB  1 
ATOM   2010 C  CG1 . ILE B 1 117 ? 1.610   107.391 2.702   1.00 27.86 ? 220 ILE B CG1 1 
ATOM   2011 C  CG2 . ILE B 1 117 ? 0.865   108.441 0.570   1.00 27.23 ? 220 ILE B CG2 1 
ATOM   2012 C  CD1 . ILE B 1 117 ? 1.560   107.384 4.214   1.00 31.35 ? 220 ILE B CD1 1 
ATOM   2013 N  N   . PRO B 1 118 ? 2.684   111.665 0.635   1.00 26.38 ? 221 PRO B N   1 
ATOM   2014 C  CA  . PRO B 1 118 ? 2.373   112.954 -0.021  1.00 24.25 ? 221 PRO B CA  1 
ATOM   2015 C  C   . PRO B 1 118 ? 1.330   112.921 -1.164  1.00 26.08 ? 221 PRO B C   1 
ATOM   2016 O  O   . PRO B 1 118 ? 1.526   113.570 -2.202  1.00 15.97 ? 221 PRO B O   1 
ATOM   2017 C  CB  . PRO B 1 118 ? 3.743   113.418 -0.536  1.00 27.11 ? 221 PRO B CB  1 
ATOM   2018 C  CG  . PRO B 1 118 ? 4.729   112.537 0.160   1.00 29.26 ? 221 PRO B CG  1 
ATOM   2019 C  CD  . PRO B 1 118 ? 4.039   111.210 0.285   1.00 29.40 ? 221 PRO B CD  1 
ATOM   2020 N  N   . ARG B 1 119 ? 0.240   112.175 -0.962  1.00 26.97 ? 222 ARG B N   1 
ATOM   2021 C  CA  . ARG B 1 119 ? -0.963  112.237 -1.796  1.00 25.90 ? 222 ARG B CA  1 
ATOM   2022 C  C   . ARG B 1 119 ? -2.165  112.324 -0.860  1.00 24.51 ? 222 ARG B C   1 
ATOM   2023 O  O   . ARG B 1 119 ? -2.150  111.740 0.230   1.00 25.22 ? 222 ARG B O   1 
ATOM   2024 C  CB  . ARG B 1 119 ? -1.100  110.966 -2.664  1.00 29.06 ? 222 ARG B CB  1 
ATOM   2025 C  CG  . ARG B 1 119 ? -0.111  110.822 -3.830  1.00 27.34 ? 222 ARG B CG  1 
ATOM   2026 C  CD  . ARG B 1 119 ? 1.279   110.350 -3.428  1.00 26.79 ? 222 ARG B CD  1 
ATOM   2027 N  NE  . ARG B 1 119 ? 2.164   110.245 -4.584  1.00 26.77 ? 222 ARG B NE  1 
ATOM   2028 C  CZ  . ARG B 1 119 ? 2.941   111.226 -5.061  1.00 27.97 ? 222 ARG B CZ  1 
ATOM   2029 N  NH1 . ARG B 1 119 ? 3.015   112.407 -4.466  1.00 26.50 ? 222 ARG B NH1 1 
ATOM   2030 N  NH2 . ARG B 1 119 ? 3.676   111.007 -6.145  1.00 28.03 ? 222 ARG B NH2 1 
ATOM   2031 N  N   . ALA B 1 120 ? -3.200  113.060 -1.263  1.00 24.32 ? 223 ALA B N   1 
ATOM   2032 C  CA  . ALA B 1 120 ? -4.425  113.154 -0.468  1.00 27.38 ? 223 ALA B CA  1 
ATOM   2033 C  C   . ALA B 1 120 ? -5.233  111.869 -0.658  1.00 28.38 ? 223 ALA B C   1 
ATOM   2034 O  O   . ALA B 1 120 ? -5.249  111.307 -1.750  1.00 30.57 ? 223 ALA B O   1 
ATOM   2035 C  CB  . ALA B 1 120 ? -5.257  114.365 -0.886  1.00 25.78 ? 223 ALA B CB  1 
ATOM   2036 N  N   . ASN B 1 121 ? -5.898  111.414 0.399   1.00 28.53 ? 224 ASN B N   1 
ATOM   2037 C  CA  . ASN B 1 121 ? -6.791  110.260 0.309   1.00 29.16 ? 224 ASN B CA  1 
ATOM   2038 C  C   . ASN B 1 121 ? -6.108  109.038 -0.316  1.00 28.79 ? 224 ASN B C   1 
ATOM   2039 O  O   . ASN B 1 121 ? -6.684  108.349 -1.146  1.00 31.33 ? 224 ASN B O   1 
ATOM   2040 C  CB  . ASN B 1 121 ? -8.052  110.640 -0.478  1.00 26.12 ? 224 ASN B CB  1 
ATOM   2041 C  CG  . ASN B 1 121 ? -8.763  111.848 0.112   1.00 30.17 ? 224 ASN B CG  1 
ATOM   2042 O  OD1 . ASN B 1 121 ? -9.191  112.755 -0.609  1.00 30.80 ? 224 ASN B OD1 1 
ATOM   2043 N  ND2 . ASN B 1 121 ? -8.894  111.866 1.428   1.00 31.55 ? 224 ASN B ND2 1 
ATOM   2044 N  N   . ALA B 1 122 ? -4.871  108.784 0.090   1.00 31.52 ? 225 ALA B N   1 
ATOM   2045 C  CA  . ALA B 1 122 ? -4.100  107.661 -0.433  1.00 32.41 ? 225 ALA B CA  1 
ATOM   2046 C  C   . ALA B 1 122 ? -4.732  106.347 -0.002  1.00 32.41 ? 225 ALA B C   1 
ATOM   2047 O  O   . ALA B 1 122 ? -5.192  106.212 1.133   1.00 32.78 ? 225 ALA B O   1 
ATOM   2048 C  CB  . ALA B 1 122 ? -2.657  107.732 0.042   1.00 30.27 ? 225 ALA B CB  1 
ATOM   2049 N  N   . LYS B 1 123 ? -4.747  105.388 -0.920  1.00 31.71 ? 226 LYS B N   1 
ATOM   2050 C  CA  . LYS B 1 123 ? -5.361  104.092 -0.685  1.00 32.50 ? 226 LYS B CA  1 
ATOM   2051 C  C   . LYS B 1 123 ? -4.298  103.133 -0.182  1.00 33.37 ? 226 LYS B C   1 
ATOM   2052 O  O   . LYS B 1 123 ? -3.608  102.468 -0.952  1.00 30.90 ? 226 LYS B O   1 
ATOM   2053 C  CB  . LYS B 1 123 ? -6.029  103.582 -1.958  1.00 33.94 ? 226 LYS B CB  1 
ATOM   2054 C  CG  . LYS B 1 123 ? -7.333  104.334 -2.260  1.00 38.84 ? 226 LYS B CG  1 
ATOM   2055 C  CD  . LYS B 1 123 ? -7.678  104.329 -3.734  1.00 42.50 ? 226 LYS B CD  1 
ATOM   2056 C  CE  . LYS B 1 123 ? -9.036  104.972 -3.975  1.00 45.55 ? 226 LYS B CE  1 
ATOM   2057 N  NZ  . LYS B 1 123 ? -9.031  106.427 -3.609  1.00 47.52 ? 226 LYS B NZ  1 
ATOM   2058 N  N   . LEU B 1 124 ? -4.156  103.093 1.131   1.00 34.60 ? 227 LEU B N   1 
ATOM   2059 C  CA  . LEU B 1 124 ? -3.135  102.276 1.752   1.00 36.43 ? 227 LEU B CA  1 
ATOM   2060 C  C   . LEU B 1 124 ? -3.765  101.335 2.759   1.00 34.65 ? 227 LEU B C   1 
ATOM   2061 O  O   . LEU B 1 124 ? -4.796  101.644 3.351   1.00 36.94 ? 227 LEU B O   1 
ATOM   2062 C  CB  . LEU B 1 124 ? -2.057  103.167 2.385   1.00 39.02 ? 227 LEU B CB  1 
ATOM   2063 C  CG  . LEU B 1 124 ? -2.421  103.997 3.615   1.00 40.61 ? 227 LEU B CG  1 
ATOM   2064 C  CD1 . LEU B 1 124 ? -2.033  103.280 4.900   1.00 42.79 ? 227 LEU B CD1 1 
ATOM   2065 C  CD2 . LEU B 1 124 ? -1.729  105.349 3.560   1.00 42.01 ? 227 LEU B CD2 1 
ATOM   2066 N  N   . SER B 1 125 ? -3.145  100.175 2.936   1.00 33.10 ? 228 SER B N   1 
ATOM   2067 C  CA  . SER B 1 125 ? -3.676  99.137  3.812   1.00 32.80 ? 228 SER B CA  1 
ATOM   2068 C  C   . SER B 1 125 ? -3.519  99.508  5.291   1.00 28.72 ? 228 SER B C   1 
ATOM   2069 O  O   . SER B 1 125 ? -2.479  100.030 5.715   1.00 29.77 ? 228 SER B O   1 
ATOM   2070 C  CB  . SER B 1 125 ? -2.965  97.804  3.536   1.00 33.35 ? 228 SER B CB  1 
ATOM   2071 O  OG  . SER B 1 125 ? -3.693  96.709  4.053   1.00 33.28 ? 228 SER B OG  1 
ATOM   2072 N  N   . LEU B 1 126 ? -4.569  99.232  6.054   1.00 26.25 ? 229 LEU B N   1 
ATOM   2073 C  CA  . LEU B 1 126 ? -4.550  99.299  7.513   1.00 28.85 ? 229 LEU B CA  1 
ATOM   2074 C  C   . LEU B 1 126 ? -4.120  97.957  8.125   1.00 28.85 ? 229 LEU B C   1 
ATOM   2075 O  O   . LEU B 1 126 ? -4.102  97.799  9.358   1.00 29.91 ? 229 LEU B O   1 
ATOM   2076 C  CB  . LEU B 1 126 ? -5.941  99.670  8.050   1.00 25.72 ? 229 LEU B CB  1 
ATOM   2077 C  CG  . LEU B 1 126 ? -6.591  100.975 7.567   1.00 29.47 ? 229 LEU B CG  1 
ATOM   2078 C  CD1 . LEU B 1 126 ? -7.983  101.141 8.210   1.00 27.38 ? 229 LEU B CD1 1 
ATOM   2079 C  CD2 . LEU B 1 126 ? -5.718  102.204 7.854   1.00 29.53 ? 229 LEU B CD2 1 
ATOM   2080 N  N   . SER B 1 127 ? -3.793  96.990  7.269   1.00 27.70 ? 230 SER B N   1 
ATOM   2081 C  CA  . SER B 1 127 ? -3.365  95.669  7.724   1.00 26.97 ? 230 SER B CA  1 
ATOM   2082 C  C   . SER B 1 127 ? -2.070  95.812  8.531   1.00 24.08 ? 230 SER B C   1 
ATOM   2083 O  O   . SER B 1 127 ? -1.155  96.471  8.073   1.00 21.27 ? 230 SER B O   1 
ATOM   2084 C  CB  . SER B 1 127 ? -3.138  94.745  6.520   1.00 26.80 ? 230 SER B CB  1 
ATOM   2085 O  OG  . SER B 1 127 ? -2.470  93.559  6.912   1.00 30.73 ? 230 SER B OG  1 
ATOM   2086 N  N   . PRO B 1 128 ? -1.982  95.215  9.720   1.00 22.89 ? 231 PRO B N   1 
ATOM   2087 C  CA  . PRO B 1 128 ? -0.755  95.336  10.535  1.00 23.49 ? 231 PRO B CA  1 
ATOM   2088 C  C   . PRO B 1 128 ? 0.511   94.677  9.941   1.00 26.68 ? 231 PRO B C   1 
ATOM   2089 O  O   . PRO B 1 128 ? 1.641   95.036  10.332  1.00 25.07 ? 231 PRO B O   1 
ATOM   2090 C  CB  . PRO B 1 128 ? -1.140  94.669  11.868  1.00 19.47 ? 231 PRO B CB  1 
ATOM   2091 C  CG  . PRO B 1 128 ? -2.314  93.761  11.537  1.00 20.25 ? 231 PRO B CG  1 
ATOM   2092 C  CD  . PRO B 1 128 ? -3.029  94.424  10.393  1.00 18.80 ? 231 PRO B CD  1 
ATOM   2093 N  N   . HIS B 1 129 ? 0.332   93.726  9.027   1.00 24.42 ? 232 HIS B N   1 
ATOM   2094 C  CA  . HIS B 1 129 ? 1.461   93.078  8.385   1.00 25.76 ? 232 HIS B CA  1 
ATOM   2095 C  C   . HIS B 1 129 ? 1.726   93.664  6.983   1.00 27.89 ? 232 HIS B C   1 
ATOM   2096 O  O   . HIS B 1 129 ? 2.633   93.229  6.263   1.00 30.25 ? 232 HIS B O   1 
ATOM   2097 C  CB  . HIS B 1 129 ? 1.321   91.542  8.375   1.00 27.26 ? 232 HIS B CB  1 
ATOM   2098 C  CG  . HIS B 1 129 ? -0.062  91.029  8.113   1.00 30.53 ? 232 HIS B CG  1 
ATOM   2099 N  ND1 . HIS B 1 129 ? -1.031  90.947  9.095   1.00 33.35 ? 232 HIS B ND1 1 
ATOM   2100 C  CD2 . HIS B 1 129 ? -0.616  90.496  6.997   1.00 31.93 ? 232 HIS B CD2 1 
ATOM   2101 C  CE1 . HIS B 1 129 ? -2.131  90.419  8.586   1.00 30.38 ? 232 HIS B CE1 1 
ATOM   2102 N  NE2 . HIS B 1 129 ? -1.905  90.133  7.315   1.00 32.32 ? 232 HIS B NE2 1 
ATOM   2103 N  N   . GLY B 1 130 ? 0.938   94.660  6.605   1.00 27.20 ? 233 GLY B N   1 
ATOM   2104 C  CA  . GLY B 1 130 ? 1.134   95.362  5.350   1.00 28.65 ? 233 GLY B CA  1 
ATOM   2105 C  C   . GLY B 1 130 ? 1.785   96.715  5.534   1.00 26.18 ? 233 GLY B C   1 
ATOM   2106 O  O   . GLY B 1 130 ? 2.694   97.074  4.786   1.00 27.56 ? 233 GLY B O   1 
ATOM   2107 N  N   . THR B 1 131 ? 1.319   97.458  6.533   1.00 24.74 ? 234 THR B N   1 
ATOM   2108 C  CA  . THR B 1 131 ? 1.791   98.825  6.807   1.00 24.20 ? 234 THR B CA  1 
ATOM   2109 C  C   . THR B 1 131 ? 2.233   98.869  8.259   1.00 25.97 ? 234 THR B C   1 
ATOM   2110 O  O   . THR B 1 131 ? 1.478   98.447  9.147   1.00 23.93 ? 234 THR B O   1 
ATOM   2111 C  CB  . THR B 1 131 ? 0.625   99.819  6.599   1.00 28.96 ? 234 THR B CB  1 
ATOM   2112 O  OG1 . THR B 1 131 ? 0.296   99.913  5.208   1.00 27.32 ? 234 THR B OG1 1 
ATOM   2113 C  CG2 . THR B 1 131 ? 0.999   101.249 7.000   1.00 28.34 ? 234 THR B CG2 1 
ATOM   2114 N  N   . PHE B 1 132 ? 3.441   99.359  8.517   1.00 24.92 ? 235 PHE B N   1 
ATOM   2115 C  CA  . PHE B 1 132 ? 3.969   99.401  9.889   1.00 21.56 ? 235 PHE B CA  1 
ATOM   2116 C  C   . PHE B 1 132 ? 5.185   100.292 10.024  1.00 22.27 ? 235 PHE B C   1 
ATOM   2117 O  O   . PHE B 1 132 ? 5.764   100.739 9.041   1.00 25.27 ? 235 PHE B O   1 
ATOM   2118 C  CB  . PHE B 1 132 ? 4.282   97.990  10.412  1.00 20.74 ? 235 PHE B CB  1 
ATOM   2119 C  CG  . PHE B 1 132 ? 5.211   97.202  9.529   1.00 25.27 ? 235 PHE B CG  1 
ATOM   2120 C  CD1 . PHE B 1 132 ? 6.577   97.441  9.544   1.00 25.15 ? 235 PHE B CD1 1 
ATOM   2121 C  CD2 . PHE B 1 132 ? 4.720   96.230  8.673   1.00 25.91 ? 235 PHE B CD2 1 
ATOM   2122 C  CE1 . PHE B 1 132 ? 7.431   96.715  8.725   1.00 26.99 ? 235 PHE B CE1 1 
ATOM   2123 C  CE2 . PHE B 1 132 ? 5.574   95.502  7.849   1.00 27.12 ? 235 PHE B CE2 1 
ATOM   2124 C  CZ  . PHE B 1 132 ? 6.922   95.740  7.874   1.00 23.91 ? 235 PHE B CZ  1 
ATOM   2125 N  N   . LEU B 1 133 ? 5.560   100.538 11.268  1.00 25.78 ? 236 LEU B N   1 
ATOM   2126 C  CA  . LEU B 1 133 ? 6.623   101.463 11.614  1.00 25.37 ? 236 LEU B CA  1 
ATOM   2127 C  C   . LEU B 1 133 ? 7.286   100.982 12.898  1.00 28.56 ? 236 LEU B C   1 
ATOM   2128 O  O   . LEU B 1 133 ? 6.603   100.630 13.858  1.00 28.48 ? 236 LEU B O   1 
ATOM   2129 C  CB  . LEU B 1 133 ? 6.016   102.844 11.834  1.00 28.93 ? 236 LEU B CB  1 
ATOM   2130 C  CG  . LEU B 1 133 ? 6.827   103.950 12.509  1.00 26.84 ? 236 LEU B CG  1 
ATOM   2131 C  CD1 . LEU B 1 133 ? 7.964   104.390 11.641  1.00 29.85 ? 236 LEU B CD1 1 
ATOM   2132 C  CD2 . LEU B 1 133 ? 5.906   105.125 12.805  1.00 29.75 ? 236 LEU B CD2 1 
ATOM   2133 N  N   . GLY B 1 134 ? 8.614   100.969 12.923  1.00 25.85 ? 237 GLY B N   1 
ATOM   2134 C  CA  . GLY B 1 134 ? 9.323   100.601 14.123  1.00 26.23 ? 237 GLY B CA  1 
ATOM   2135 C  C   . GLY B 1 134 ? 10.641  101.303 14.385  1.00 26.88 ? 237 GLY B C   1 
ATOM   2136 O  O   . GLY B 1 134 ? 11.194  101.994 13.528  1.00 24.19 ? 237 GLY B O   1 
ATOM   2137 N  N   . PHE B 1 135 ? 11.121  101.093 15.611  1.00 24.59 ? 238 PHE B N   1 
ATOM   2138 C  CA  . PHE B 1 135 ? 12.296  101.743 16.170  1.00 22.56 ? 238 PHE B CA  1 
ATOM   2139 C  C   . PHE B 1 135 ? 13.045  100.747 17.022  1.00 21.62 ? 238 PHE B C   1 
ATOM   2140 O  O   . PHE B 1 135 ? 12.427  99.997  17.782  1.00 25.01 ? 238 PHE B O   1 
ATOM   2141 C  CB  . PHE B 1 135 ? 11.902  102.892 17.095  1.00 26.61 ? 238 PHE B CB  1 
ATOM   2142 C  CG  . PHE B 1 135 ? 11.094  103.966 16.440  1.00 30.94 ? 238 PHE B CG  1 
ATOM   2143 C  CD1 . PHE B 1 135 ? 9.736   103.794 16.220  1.00 30.18 ? 238 PHE B CD1 1 
ATOM   2144 C  CD2 . PHE B 1 135 ? 11.682  105.177 16.095  1.00 33.57 ? 238 PHE B CD2 1 
ATOM   2145 C  CE1 . PHE B 1 135 ? 8.970   104.799 15.636  1.00 32.74 ? 238 PHE B CE1 1 
ATOM   2146 C  CE2 . PHE B 1 135 ? 10.925  106.192 15.509  1.00 36.10 ? 238 PHE B CE2 1 
ATOM   2147 C  CZ  . PHE B 1 135 ? 9.569   106.001 15.275  1.00 34.46 ? 238 PHE B CZ  1 
ATOM   2148 N  N   . VAL B 1 136 ? 14.370  100.752 16.907  1.00 21.32 ? 239 VAL B N   1 
ATOM   2149 C  CA  . VAL B 1 136 ? 15.243  100.052 17.833  1.00 23.15 ? 239 VAL B CA  1 
ATOM   2150 C  C   . VAL B 1 136 ? 16.346  101.027 18.255  1.00 25.19 ? 239 VAL B C   1 
ATOM   2151 O  O   . VAL B 1 136 ? 17.081  101.553 17.417  1.00 21.97 ? 239 VAL B O   1 
ATOM   2152 C  CB  . VAL B 1 136 ? 15.900  98.786  17.211  1.00 24.64 ? 239 VAL B CB  1 
ATOM   2153 C  CG1 . VAL B 1 136 ? 16.738  98.047  18.261  1.00 22.75 ? 239 VAL B CG1 1 
ATOM   2154 C  CG2 . VAL B 1 136 ? 14.860  97.850  16.625  1.00 24.71 ? 239 VAL B CG2 1 
ATOM   2155 N  N   . LYS B 1 137 ? 16.454  101.268 19.554  1.00 23.69 ? 240 LYS B N   1 
ATOM   2156 C  CA  . LYS B 1 137 ? 17.547  102.062 20.082  1.00 26.31 ? 240 LYS B CA  1 
ATOM   2157 C  C   . LYS B 1 137 ? 18.815  101.207 20.080  1.00 25.47 ? 240 LYS B C   1 
ATOM   2158 O  O   . LYS B 1 137 ? 18.848  100.134 20.669  1.00 23.30 ? 240 LYS B O   1 
ATOM   2159 C  CB  . LYS B 1 137 ? 17.214  102.556 21.491  1.00 24.91 ? 240 LYS B CB  1 
ATOM   2160 C  CG  . LYS B 1 137 ? 18.170  103.615 22.007  1.00 28.23 ? 240 LYS B CG  1 
ATOM   2161 C  CD  . LYS B 1 137 ? 17.681  104.178 23.333  1.00 34.06 ? 240 LYS B CD  1 
ATOM   2162 C  CE  . LYS B 1 137 ? 18.752  105.008 24.015  1.00 38.95 ? 240 LYS B CE  1 
ATOM   2163 N  NZ  . LYS B 1 137 ? 19.090  106.201 23.188  1.00 41.32 ? 240 LYS B NZ  1 
ATOM   2164 N  N   . LEU B 1 138 ? 19.845  101.676 19.392  1.00 27.24 ? 241 LEU B N   1 
ATOM   2165 C  CA  . LEU B 1 138 ? 21.098  100.945 19.275  1.00 31.94 ? 241 LEU B CA  1 
ATOM   2166 C  C   . LEU B 1 138 ? 22.152  101.500 20.227  1.00 39.12 ? 241 LEU B C   1 
ATOM   2167 O  O   . LEU B 1 138 ? 23.264  100.959 20.279  1.00 41.72 ? 241 LEU B O   1 
ATOM   2168 C  CB  . LEU B 1 138 ? 21.613  101.038 17.845  1.00 35.88 ? 241 LEU B CB  1 
ATOM   2169 C  CG  . LEU B 1 138 ? 20.636  100.599 16.752  1.00 34.07 ? 241 LEU B CG  1 
ATOM   2170 C  CD1 . LEU B 1 138 ? 21.242  100.948 15.416  1.00 35.40 ? 241 LEU B CD1 1 
ATOM   2171 C  CD2 . LEU B 1 138 ? 20.338  99.109  16.861  1.00 30.11 ? 241 LEU B CD2 1 
ATOM   2172 O  OXT . LEU B 1 138 ? 21.909  102.483 20.945  1.00 41.41 ? 241 LEU B OXT 1 
ATOM   2173 N  N   . LYS C 1 2   ? 28.577  100.912 23.627  1.00 65.51 ? 105 LYS D N   1 
ATOM   2174 C  CA  . LYS C 1 2   ? 27.523  101.230 22.615  1.00 64.72 ? 105 LYS D CA  1 
ATOM   2175 C  C   . LYS C 1 2   ? 27.912  100.695 21.235  1.00 64.67 ? 105 LYS D C   1 
ATOM   2176 O  O   . LYS C 1 2   ? 29.100  100.575 20.918  1.00 65.63 ? 105 LYS D O   1 
ATOM   2177 C  CB  . LYS C 1 2   ? 27.299  102.747 22.549  1.00 63.72 ? 105 LYS D CB  1 
ATOM   2178 C  CG  . LYS C 1 2   ? 26.000  103.229 23.202  1.00 63.76 ? 105 LYS D CG  1 
ATOM   2179 C  CD  . LYS C 1 2   ? 26.157  104.630 23.811  1.00 62.75 ? 105 LYS D CD  1 
ATOM   2180 C  CE  . LYS C 1 2   ? 24.815  105.209 24.265  1.00 61.63 ? 105 LYS D CE  1 
ATOM   2181 N  NZ  . LYS C 1 2   ? 24.970  106.295 25.280  1.00 60.82 ? 105 LYS D NZ  1 
ATOM   2182 N  N   . HIS C 1 3   ? 26.905  100.386 20.416  1.00 63.46 ? 106 HIS D N   1 
ATOM   2183 C  CA  . HIS C 1 3   ? 27.136  99.861  19.060  1.00 59.41 ? 106 HIS D CA  1 
ATOM   2184 C  C   . HIS C 1 3   ? 27.756  100.900 18.120  1.00 51.93 ? 106 HIS D C   1 
ATOM   2185 O  O   . HIS C 1 3   ? 27.298  102.033 18.059  1.00 51.26 ? 106 HIS D O   1 
ATOM   2186 C  CB  . HIS C 1 3   ? 25.835  99.300  18.455  1.00 58.76 ? 106 HIS D CB  1 
ATOM   2187 C  CG  . HIS C 1 3   ? 25.462  97.953  18.994  1.00 60.14 ? 106 HIS D CG  1 
ATOM   2188 N  ND1 . HIS C 1 3   ? 25.998  96.780  18.508  1.00 60.38 ? 106 HIS D ND1 1 
ATOM   2189 C  CD2 . HIS C 1 3   ? 24.638  97.598  20.006  1.00 60.86 ? 106 HIS D CD2 1 
ATOM   2190 C  CE1 . HIS C 1 3   ? 25.511  95.759  19.190  1.00 61.98 ? 106 HIS D CE1 1 
ATOM   2191 N  NE2 . HIS C 1 3   ? 24.683  96.228  20.104  1.00 62.23 ? 106 HIS D NE2 1 
ATOM   2192 N  N   . SER C 1 4   ? 28.801  100.483 17.408  1.00 44.18 ? 107 SER D N   1 
ATOM   2193 C  CA  . SER C 1 4   ? 29.488  101.296 16.409  1.00 37.26 ? 107 SER D CA  1 
ATOM   2194 C  C   . SER C 1 4   ? 28.661  101.389 15.099  1.00 33.05 ? 107 SER D C   1 
ATOM   2195 O  O   . SER C 1 4   ? 28.154  100.389 14.615  1.00 27.97 ? 107 SER D O   1 
ATOM   2196 C  CB  . SER C 1 4   ? 30.869  100.683 16.148  1.00 38.45 ? 107 SER D CB  1 
ATOM   2197 O  OG  . SER C 1 4   ? 31.399  101.056 14.882  1.00 44.08 ? 107 SER D OG  1 
ATOM   2198 N  N   . VAL C 1 5   ? 28.512  102.592 14.543  1.00 26.62 ? 108 VAL D N   1 
ATOM   2199 C  CA  . VAL C 1 5   ? 27.642  102.806 13.381  1.00 27.28 ? 108 VAL D CA  1 
ATOM   2200 C  C   . VAL C 1 5   ? 28.191  103.808 12.372  1.00 23.84 ? 108 VAL D C   1 
ATOM   2201 O  O   . VAL C 1 5   ? 28.998  104.678 12.701  1.00 22.62 ? 108 VAL D O   1 
ATOM   2202 C  CB  . VAL C 1 5   ? 26.177  103.226 13.798  1.00 30.73 ? 108 VAL D CB  1 
ATOM   2203 C  CG1 . VAL C 1 5   ? 25.813  102.713 15.204  1.00 33.12 ? 108 VAL D CG1 1 
ATOM   2204 C  CG2 . VAL C 1 5   ? 25.966  104.714 13.731  1.00 32.47 ? 108 VAL D CG2 1 
ATOM   2205 N  N   . LEU C 1 6   ? 27.732  103.681 11.137  1.00 21.74 ? 109 LEU D N   1 
ATOM   2206 C  CA  . LEU C 1 6   ? 28.077  104.631 10.084  1.00 27.00 ? 109 LEU D CA  1 
ATOM   2207 C  C   . LEU C 1 6   ? 26.909  104.763 9.114   1.00 26.53 ? 109 LEU D C   1 
ATOM   2208 O  O   . LEU C 1 6   ? 26.452  103.775 8.572   1.00 27.11 ? 109 LEU D O   1 
ATOM   2209 C  CB  . LEU C 1 6   ? 29.332  104.171 9.341   1.00 27.20 ? 109 LEU D CB  1 
ATOM   2210 C  CG  . LEU C 1 6   ? 29.988  105.131 8.350   1.00 26.96 ? 109 LEU D CG  1 
ATOM   2211 C  CD1 . LEU C 1 6   ? 30.606  106.300 9.075   1.00 28.90 ? 109 LEU D CD1 1 
ATOM   2212 C  CD2 . LEU C 1 6   ? 31.049  104.411 7.531   1.00 25.68 ? 109 LEU D CD2 1 
ATOM   2213 N  N   . HIS C 1 7   ? 26.421  105.983 8.915   1.00 23.45 ? 110 HIS D N   1 
ATOM   2214 C  CA  . HIS C 1 7   ? 25.426  106.249 7.889   1.00 22.29 ? 110 HIS D CA  1 
ATOM   2215 C  C   . HIS C 1 7   ? 26.018  107.201 6.852   1.00 21.09 ? 110 HIS D C   1 
ATOM   2216 O  O   . HIS C 1 7   ? 26.524  108.263 7.205   1.00 19.22 ? 110 HIS D O   1 
ATOM   2217 C  CB  . HIS C 1 7   ? 24.182  106.849 8.531   1.00 22.01 ? 110 HIS D CB  1 
ATOM   2218 C  CG  . HIS C 1 7   ? 23.041  107.040 7.589   1.00 22.79 ? 110 HIS D CG  1 
ATOM   2219 N  ND1 . HIS C 1 7   ? 22.321  105.986 7.065   1.00 28.61 ? 110 HIS D ND1 1 
ATOM   2220 C  CD2 . HIS C 1 7   ? 22.479  108.169 7.088   1.00 21.34 ? 110 HIS D CD2 1 
ATOM   2221 C  CE1 . HIS C 1 7   ? 21.355  106.458 6.294   1.00 28.35 ? 110 HIS D CE1 1 
ATOM   2222 N  NE2 . HIS C 1 7   ? 21.424  107.779 6.298   1.00 23.64 ? 110 HIS D NE2 1 
ATOM   2223 N  N   . LEU C 1 8   ? 25.930  106.824 5.575   1.00 24.85 ? 111 LEU D N   1 
ATOM   2224 C  CA  . LEU C 1 8   ? 26.557  107.561 4.478   1.00 22.81 ? 111 LEU D CA  1 
ATOM   2225 C  C   . LEU C 1 8   ? 25.544  107.998 3.438   1.00 24.75 ? 111 LEU D C   1 
ATOM   2226 O  O   . LEU C 1 8   ? 24.588  107.272 3.131   1.00 22.98 ? 111 LEU D O   1 
ATOM   2227 C  CB  . LEU C 1 8   ? 27.595  106.693 3.778   1.00 29.48 ? 111 LEU D CB  1 
ATOM   2228 C  CG  . LEU C 1 8   ? 28.679  106.016 4.631   1.00 33.49 ? 111 LEU D CG  1 
ATOM   2229 C  CD1 . LEU C 1 8   ? 29.125  104.702 4.022   1.00 35.39 ? 111 LEU D CD1 1 
ATOM   2230 C  CD2 . LEU C 1 8   ? 29.859  106.907 4.777   1.00 32.03 ? 111 LEU D CD2 1 
ATOM   2231 N  N   . VAL C 1 9   ? 25.782  109.172 2.865   1.00 20.39 ? 112 VAL D N   1 
ATOM   2232 C  CA  . VAL C 1 9   ? 24.964  109.675 1.777   1.00 19.51 ? 112 VAL D CA  1 
ATOM   2233 C  C   . VAL C 1 9   ? 25.871  110.100 0.611   1.00 19.99 ? 112 VAL D C   1 
ATOM   2234 O  O   . VAL C 1 9   ? 27.061  110.287 0.799   1.00 19.77 ? 112 VAL D O   1 
ATOM   2235 C  CB  . VAL C 1 9   ? 24.022  110.794 2.264   1.00 20.84 ? 112 VAL D CB  1 
ATOM   2236 C  CG1 . VAL C 1 9   ? 23.182  110.292 3.441   1.00 21.73 ? 112 VAL D CG1 1 
ATOM   2237 C  CG2 . VAL C 1 9   ? 24.790  112.055 2.666   1.00 20.63 ? 112 VAL D CG2 1 
ATOM   2238 N  N   . PRO C 1 10  ? 25.340  110.198 -0.603  1.00 23.79 ? 113 PRO D N   1 
ATOM   2239 C  CA  . PRO C 1 10  ? 26.173  110.568 -1.769  1.00 24.08 ? 113 PRO D CA  1 
ATOM   2240 C  C   . PRO C 1 10  ? 26.778  111.962 -1.706  1.00 22.85 ? 113 PRO D C   1 
ATOM   2241 O  O   . PRO C 1 10  ? 26.147  112.857 -1.144  1.00 22.32 ? 113 PRO D O   1 
ATOM   2242 C  CB  . PRO C 1 10  ? 25.189  110.500 -2.949  1.00 25.17 ? 113 PRO D CB  1 
ATOM   2243 C  CG  . PRO C 1 10  ? 24.046  109.636 -2.468  1.00 25.82 ? 113 PRO D CG  1 
ATOM   2244 C  CD  . PRO C 1 10  ? 23.945  109.913 -0.985  1.00 25.94 ? 113 PRO D CD  1 
ATOM   2245 N  N   . VAL C 1 11  ? 27.980  112.131 -2.262  1.00 22.99 ? 114 VAL D N   1 
ATOM   2246 C  CA  . VAL C 1 11  ? 28.491  113.453 -2.618  1.00 24.60 ? 114 VAL D CA  1 
ATOM   2247 C  C   . VAL C 1 11  ? 28.436  113.701 -4.136  1.00 22.54 ? 114 VAL D C   1 
ATOM   2248 O  O   . VAL C 1 11  ? 28.179  114.824 -4.567  1.00 19.56 ? 114 VAL D O   1 
ATOM   2249 C  CB  . VAL C 1 11  ? 29.914  113.787 -1.995  1.00 28.81 ? 114 VAL D CB  1 
ATOM   2250 C  CG1 . VAL C 1 11  ? 30.290  112.823 -0.889  1.00 28.19 ? 114 VAL D CG1 1 
ATOM   2251 C  CG2 . VAL C 1 11  ? 30.998  113.879 -3.024  1.00 31.94 ? 114 VAL D CG2 1 
ATOM   2252 N  N   . ASN C 1 12  ? 28.711  112.662 -4.924  1.00 22.96 ? 115 ASN D N   1 
ATOM   2253 C  CA  . ASN C 1 12  ? 28.480  112.664 -6.380  1.00 23.12 ? 115 ASN D CA  1 
ATOM   2254 C  C   . ASN C 1 12  ? 28.522  111.248 -6.951  1.00 26.41 ? 115 ASN D C   1 
ATOM   2255 O  O   . ASN C 1 12  ? 28.748  110.282 -6.220  1.00 31.61 ? 115 ASN D O   1 
ATOM   2256 C  CB  . ASN C 1 12  ? 29.459  113.573 -7.131  1.00 20.51 ? 115 ASN D CB  1 
ATOM   2257 C  CG  . ASN C 1 12  ? 30.900  113.096 -7.060  1.00 25.82 ? 115 ASN D CG  1 
ATOM   2258 O  OD1 . ASN C 1 12  ? 31.561  112.927 -8.080  1.00 30.50 ? 115 ASN D OD1 1 
ATOM   2259 N  ND2 . ASN C 1 12  ? 31.405  112.933 -5.863  1.00 21.12 ? 115 ASN D ND2 1 
ATOM   2260 N  N   . ILE C 1 13  ? 28.257  111.110 -8.240  1.00 28.32 ? 116 ILE D N   1 
ATOM   2261 C  CA  . ILE C 1 13  ? 28.362  109.807 -8.883  1.00 34.21 ? 116 ILE D CA  1 
ATOM   2262 C  C   . ILE C 1 13  ? 29.377  109.852 -9.994  1.00 32.47 ? 116 ILE D C   1 
ATOM   2263 O  O   . ILE C 1 13  ? 29.676  110.907 -10.541 1.00 34.47 ? 116 ILE D O   1 
ATOM   2264 C  CB  . ILE C 1 13  ? 26.993  109.282 -9.383  1.00 37.35 ? 116 ILE D CB  1 
ATOM   2265 C  CG1 . ILE C 1 13  ? 26.456  110.106 -10.555 1.00 43.36 ? 116 ILE D CG1 1 
ATOM   2266 C  CG2 . ILE C 1 13  ? 26.005  109.264 -8.246  1.00 39.05 ? 116 ILE D CG2 1 
ATOM   2267 C  CD1 . ILE C 1 13  ? 24.979  109.832 -10.860 1.00 46.00 ? 116 ILE D CD1 1 
ATOM   2268 N  N   . THR C 1 14  ? 29.927  108.686 -10.297 1.00 35.66 ? 117 THR D N   1 
ATOM   2269 C  CA  . THR C 1 14  ? 30.922  108.552 -11.346 1.00 35.83 ? 117 THR D CA  1 
ATOM   2270 C  C   . THR C 1 14  ? 30.679  107.272 -12.134 1.00 33.46 ? 117 THR D C   1 
ATOM   2271 O  O   . THR C 1 14  ? 30.287  106.245 -11.579 1.00 28.08 ? 117 THR D O   1 
ATOM   2272 C  CB  . THR C 1 14  ? 32.346  108.597 -10.737 1.00 38.40 ? 117 THR D CB  1 
ATOM   2273 O  OG1 . THR C 1 14  ? 33.320  108.360 -11.757 1.00 48.65 ? 117 THR D OG1 1 
ATOM   2274 C  CG2 . THR C 1 14  ? 32.585  107.482 -9.729  1.00 37.23 ? 117 THR D CG2 1 
ATOM   2275 N  N   . SER C 1 15  ? 30.874  107.354 -13.442 1.00 34.06 ? 118 SER D N   1 
ATOM   2276 C  CA  . SER C 1 15  ? 30.755  106.192 -14.300 1.00 35.43 ? 118 SER D CA  1 
ATOM   2277 C  C   . SER C 1 15  ? 31.945  106.152 -15.227 1.00 35.59 ? 118 SER D C   1 
ATOM   2278 O  O   . SER C 1 15  ? 32.173  107.093 -15.974 1.00 38.00 ? 118 SER D O   1 
ATOM   2279 C  CB  . SER C 1 15  ? 29.465  106.255 -15.104 1.00 35.19 ? 118 SER D CB  1 
ATOM   2280 O  OG  . SER C 1 15  ? 29.271  105.039 -15.807 1.00 34.56 ? 118 SER D OG  1 
ATOM   2281 N  N   . LYS C 1 16  ? 32.709  105.066 -15.166 1.00 40.22 ? 119 LYS D N   1 
ATOM   2282 C  CA  . LYS C 1 16  ? 33.896  104.916 -16.016 1.00 45.83 ? 119 LYS D CA  1 
ATOM   2283 C  C   . LYS C 1 16  ? 33.487  104.678 -17.473 1.00 44.19 ? 119 LYS D C   1 
ATOM   2284 O  O   . LYS C 1 16  ? 32.384  104.188 -17.749 1.00 39.01 ? 119 LYS D O   1 
ATOM   2285 C  CB  . LYS C 1 16  ? 34.790  103.769 -15.515 1.00 49.94 ? 119 LYS D CB  1 
ATOM   2286 C  CG  . LYS C 1 16  ? 36.199  104.194 -15.089 1.00 53.62 ? 119 LYS D CG  1 
ATOM   2287 C  CD  . LYS C 1 16  ? 37.301  103.375 -15.792 1.00 55.65 ? 119 LYS D CD  1 
ATOM   2288 C  CE  . LYS C 1 16  ? 38.351  102.869 -14.800 1.00 56.37 ? 119 LYS D CE  1 
ATOM   2289 N  NZ  . LYS C 1 16  ? 39.640  102.552 -15.466 1.00 55.45 ? 119 LYS D NZ  1 
ATOM   2290 N  N   . ALA C 1 17  ? 34.380  105.036 -18.395 1.00 46.72 ? 120 ALA D N   1 
ATOM   2291 C  CA  . ALA C 1 17  ? 34.103  104.940 -19.831 1.00 46.49 ? 120 ALA D CA  1 
ATOM   2292 C  C   . ALA C 1 17  ? 33.653  103.529 -20.245 1.00 45.90 ? 120 ALA D C   1 
ATOM   2293 O  O   . ALA C 1 17  ? 32.447  103.239 -20.295 1.00 44.09 ? 120 ALA D O   1 
ATOM   2294 C  CB  . ALA C 1 17  ? 35.330  105.388 -20.651 1.00 45.41 ? 120 ALA D CB  1 
ATOM   2295 N  N   . ASP C 1 18  ? 34.621  102.646 -20.482 1.00 45.06 ? 121 ASP D N   1 
ATOM   2296 C  CA  . ASP C 1 18  ? 34.353  101.341 -21.107 1.00 44.60 ? 121 ASP D CA  1 
ATOM   2297 C  C   . ASP C 1 18  ? 33.632  100.335 -20.198 1.00 45.15 ? 121 ASP D C   1 
ATOM   2298 O  O   . ASP C 1 18  ? 33.215  99.271  -20.661 1.00 48.15 ? 121 ASP D O   1 
ATOM   2299 C  CB  . ASP C 1 18  ? 35.657  100.723 -21.627 1.00 41.42 ? 121 ASP D CB  1 
ATOM   2300 C  CG  . ASP C 1 18  ? 36.371  101.619 -22.629 1.00 41.92 ? 121 ASP D CG  1 
ATOM   2301 O  OD1 . ASP C 1 18  ? 35.837  102.714 -22.923 1.00 43.84 ? 121 ASP D OD1 1 
ATOM   2302 O  OD2 . ASP C 1 18  ? 37.460  101.314 -23.171 1.00 37.96 ? 121 ASP D OD2 1 
ATOM   2303 N  N   . SER C 1 19  ? 33.493  100.667 -18.917 1.00 43.04 ? 122 SER D N   1 
ATOM   2304 C  CA  . SER C 1 19  ? 32.796  99.809  -17.970 1.00 42.79 ? 122 SER D CA  1 
ATOM   2305 C  C   . SER C 1 19  ? 31.300  100.047 -18.127 1.00 42.65 ? 122 SER D C   1 
ATOM   2306 O  O   . SER C 1 19  ? 30.884  101.025 -18.760 1.00 48.14 ? 122 SER D O   1 
ATOM   2307 C  CB  . SER C 1 19  ? 33.255  100.108 -16.536 1.00 44.46 ? 122 SER D CB  1 
ATOM   2308 O  OG  . SER C 1 19  ? 32.778  101.370 -16.080 1.00 46.68 ? 122 SER D OG  1 
ATOM   2309 N  N   . ASP C 1 20  ? 30.490  99.150  -17.581 1.00 35.79 ? 123 ASP D N   1 
ATOM   2310 C  CA  . ASP C 1 20  ? 29.046  99.371  -17.559 1.00 33.92 ? 123 ASP D CA  1 
ATOM   2311 C  C   . ASP C 1 20  ? 28.639  99.435  -16.101 1.00 29.83 ? 123 ASP D C   1 
ATOM   2312 O  O   . ASP C 1 20  ? 27.870  98.612  -15.607 1.00 30.34 ? 123 ASP D O   1 
ATOM   2313 C  CB  . ASP C 1 20  ? 28.300  98.290  -18.352 1.00 34.94 ? 123 ASP D CB  1 
ATOM   2314 C  CG  . ASP C 1 20  ? 28.508  98.426  -19.859 1.00 39.32 ? 123 ASP D CG  1 
ATOM   2315 O  OD1 . ASP C 1 20  ? 28.415  99.558  -20.389 1.00 40.79 ? 123 ASP D OD1 1 
ATOM   2316 O  OD2 . ASP C 1 20  ? 28.790  97.459  -20.601 1.00 46.18 ? 123 ASP D OD2 1 
ATOM   2317 N  N   . VAL C 1 21  ? 29.219  100.423 -15.422 1.00 27.22 ? 124 VAL D N   1 
ATOM   2318 C  CA  . VAL C 1 21  ? 29.082  100.598 -13.985 1.00 26.01 ? 124 VAL D CA  1 
ATOM   2319 C  C   . VAL C 1 21  ? 28.976  102.069 -13.601 1.00 23.08 ? 124 VAL D C   1 
ATOM   2320 O  O   . VAL C 1 21  ? 29.611  102.924 -14.186 1.00 20.94 ? 124 VAL D O   1 
ATOM   2321 C  CB  . VAL C 1 21  ? 30.285  100.012 -13.213 1.00 30.25 ? 124 VAL D CB  1 
ATOM   2322 C  CG1 . VAL C 1 21  ? 30.063  100.135 -11.695 1.00 30.81 ? 124 VAL D CG1 1 
ATOM   2323 C  CG2 . VAL C 1 21  ? 30.520  98.552  -13.595 1.00 33.58 ? 124 VAL D CG2 1 
ATOM   2324 N  N   . THR C 1 22  ? 28.166  102.335 -12.590 1.00 25.03 ? 125 THR D N   1 
ATOM   2325 C  CA  . THR C 1 22  ? 28.096  103.633 -11.955 1.00 23.06 ? 125 THR D CA  1 
ATOM   2326 C  C   . THR C 1 22  ? 28.304  103.400 -10.468 1.00 23.87 ? 125 THR D C   1 
ATOM   2327 O  O   . THR C 1 22  ? 27.707  102.501 -9.892  1.00 26.58 ? 125 THR D O   1 
ATOM   2328 C  CB  . THR C 1 22  ? 26.735  104.276 -12.252 1.00 23.45 ? 125 THR D CB  1 
ATOM   2329 O  OG1 . THR C 1 22  ? 26.649  104.533 -13.658 1.00 24.19 ? 125 THR D OG1 1 
ATOM   2330 C  CG2 . THR C 1 22  ? 26.596  105.675 -11.598 1.00 20.63 ? 125 THR D CG2 1 
ATOM   2331 N  N   . GLU C 1 23  ? 29.205  104.168 -9.868  1.00 28.06 ? 126 GLU D N   1 
ATOM   2332 C  CA  . GLU C 1 23  ? 29.425  104.134 -8.426  1.00 29.70 ? 126 GLU D CA  1 
ATOM   2333 C  C   . GLU C 1 23  ? 29.118  105.484 -7.792  1.00 27.30 ? 126 GLU D C   1 
ATOM   2334 O  O   . GLU C 1 23  ? 28.929  106.491 -8.478  1.00 30.47 ? 126 GLU D O   1 
ATOM   2335 C  CB  . GLU C 1 23  ? 30.871  103.732 -8.138  1.00 38.09 ? 126 GLU D CB  1 
ATOM   2336 C  CG  . GLU C 1 23  ? 31.131  102.245 -8.347  1.00 41.13 ? 126 GLU D CG  1 
ATOM   2337 C  CD  . GLU C 1 23  ? 32.609  101.893 -8.339  1.00 43.48 ? 126 GLU D CD  1 
ATOM   2338 O  OE1 . GLU C 1 23  ? 33.266  102.084 -9.392  1.00 45.91 ? 126 GLU D OE1 1 
ATOM   2339 O  OE2 . GLU C 1 23  ? 33.111  101.417 -7.284  1.00 40.98 ? 126 GLU D OE2 1 
ATOM   2340 N  N   . VAL C 1 24  ? 29.060  105.486 -6.470  1.00 29.11 ? 127 VAL D N   1 
ATOM   2341 C  CA  . VAL C 1 24  ? 28.778  106.672 -5.685  1.00 26.86 ? 127 VAL D CA  1 
ATOM   2342 C  C   . VAL C 1 24  ? 29.967  107.007 -4.800  1.00 25.20 ? 127 VAL D C   1 
ATOM   2343 O  O   . VAL C 1 24  ? 30.608  106.122 -4.263  1.00 27.97 ? 127 VAL D O   1 
ATOM   2344 C  CB  . VAL C 1 24  ? 27.553  106.445 -4.810  1.00 29.28 ? 127 VAL D CB  1 
ATOM   2345 C  CG1 . VAL C 1 24  ? 27.141  107.725 -4.117  1.00 31.84 ? 127 VAL D CG1 1 
ATOM   2346 C  CG2 . VAL C 1 24  ? 26.399  105.902 -5.638  1.00 34.18 ? 127 VAL D CG2 1 
ATOM   2347 N  N   . MET C 1 25  ? 30.288  108.288 -4.681  1.00 27.69 ? 128 MET D N   1 
ATOM   2348 C  CA  . MET C 1 25  ? 31.243  108.759 -3.685  1.00 23.92 ? 128 MET D CA  1 
ATOM   2349 C  C   . MET C 1 25  ? 30.400  109.067 -2.450  1.00 26.18 ? 128 MET D C   1 
ATOM   2350 O  O   . MET C 1 25  ? 29.348  109.689 -2.572  1.00 22.39 ? 128 MET D O   1 
ATOM   2351 C  CB  . MET C 1 25  ? 31.951  109.993 -4.193  1.00 29.49 ? 128 MET D CB  1 
ATOM   2352 C  CG  . MET C 1 25  ? 32.692  109.793 -5.525  1.00 34.65 ? 128 MET D CG  1 
ATOM   2353 S  SD  . MET C 1 25  ? 34.172  108.762 -5.339  1.00 37.55 ? 128 MET D SD  1 
ATOM   2354 C  CE  . MET C 1 25  ? 35.300  109.969 -4.721  1.00 35.81 ? 128 MET D CE  1 
ATOM   2355 N  N   . TRP C 1 26  ? 30.842  108.592 -1.284  1.00 24.62 ? 129 TRP D N   1 
ATOM   2356 C  CA  . TRP C 1 26  ? 30.076  108.671 -0.041  1.00 27.58 ? 129 TRP D CA  1 
ATOM   2357 C  C   . TRP C 1 26  ? 30.692  109.665 0.952   1.00 25.41 ? 129 TRP D C   1 
ATOM   2358 O  O   . TRP C 1 26  ? 31.907  109.833 0.983   1.00 26.77 ? 129 TRP D O   1 
ATOM   2359 C  CB  . TRP C 1 26  ? 29.985  107.277 0.618   1.00 27.15 ? 129 TRP D CB  1 
ATOM   2360 C  CG  . TRP C 1 26  ? 29.318  106.217 -0.220  1.00 22.04 ? 129 TRP D CG  1 
ATOM   2361 C  CD1 . TRP C 1 26  ? 29.935  105.222 -0.907  1.00 25.62 ? 129 TRP D CD1 1 
ATOM   2362 C  CD2 . TRP C 1 26  ? 27.916  106.049 -0.460  1.00 23.58 ? 129 TRP D CD2 1 
ATOM   2363 N  NE1 . TRP C 1 26  ? 29.011  104.445 -1.560  1.00 24.27 ? 129 TRP D NE1 1 
ATOM   2364 C  CE2 . TRP C 1 26  ? 27.764  104.941 -1.318  1.00 22.54 ? 129 TRP D CE2 1 
ATOM   2365 C  CE3 . TRP C 1 26  ? 26.773  106.735 -0.060  1.00 23.15 ? 129 TRP D CE3 1 
ATOM   2366 C  CZ2 . TRP C 1 26  ? 26.524  104.496 -1.762  1.00 26.22 ? 129 TRP D CZ2 1 
ATOM   2367 C  CZ3 . TRP C 1 26  ? 25.542  106.290 -0.503  1.00 27.37 ? 129 TRP D CZ3 1 
ATOM   2368 C  CH2 . TRP C 1 26  ? 25.424  105.182 -1.341  1.00 25.16 ? 129 TRP D CH2 1 
ATOM   2369 N  N   . GLN C 1 27  ? 29.834  110.298 1.759   1.00 25.40 ? 130 GLN D N   1 
ATOM   2370 C  CA  . GLN C 1 27  ? 30.215  111.173 2.898   1.00 22.55 ? 130 GLN D CA  1 
ATOM   2371 C  C   . GLN C 1 27  ? 29.485  110.620 4.130   1.00 23.05 ? 130 GLN D C   1 
ATOM   2372 O  O   . GLN C 1 27  ? 28.310  110.270 4.047   1.00 17.52 ? 130 GLN D O   1 
ATOM   2373 C  CB  . GLN C 1 27  ? 29.804  112.653 2.693   1.00 24.91 ? 130 GLN D CB  1 
ATOM   2374 C  CG  . GLN C 1 27  ? 28.281  112.843 2.451   1.00 30.39 ? 130 GLN D CG  1 
ATOM   2375 C  CD  . GLN C 1 27  ? 27.803  114.297 2.200   1.00 38.77 ? 130 GLN D CD  1 
ATOM   2376 O  OE1 . GLN C 1 27  ? 27.845  115.138 3.104   1.00 36.94 ? 130 GLN D OE1 1 
ATOM   2377 N  NE2 . GLN C 1 27  ? 27.295  114.562 0.978   1.00 37.16 ? 130 GLN D NE2 1 
ATOM   2378 N  N   . PRO C 1 28  ? 30.153  110.558 5.273   1.00 27.52 ? 131 PRO D N   1 
ATOM   2379 C  CA  . PRO C 1 28  ? 29.484  110.135 6.509   1.00 26.87 ? 131 PRO D CA  1 
ATOM   2380 C  C   . PRO C 1 28  ? 28.635  111.267 7.080   1.00 25.82 ? 131 PRO D C   1 
ATOM   2381 O  O   . PRO C 1 28  ? 29.123  112.381 7.147   1.00 26.71 ? 131 PRO D O   1 
ATOM   2382 C  CB  . PRO C 1 28  ? 30.659  109.813 7.449   1.00 28.06 ? 131 PRO D CB  1 
ATOM   2383 C  CG  . PRO C 1 28  ? 31.804  110.736 6.978   1.00 29.18 ? 131 PRO D CG  1 
ATOM   2384 C  CD  . PRO C 1 28  ? 31.581  110.902 5.487   1.00 28.14 ? 131 PRO D CD  1 
ATOM   2385 N  N   . VAL C 1 29  ? 27.389  110.995 7.458   1.00 24.80 ? 132 VAL D N   1 
ATOM   2386 C  CA  . VAL C 1 29  ? 26.598  111.970 8.213   1.00 26.57 ? 132 VAL D CA  1 
ATOM   2387 C  C   . VAL C 1 29  ? 26.380  111.554 9.670   1.00 24.62 ? 132 VAL D C   1 
ATOM   2388 O  O   . VAL C 1 29  ? 26.042  112.380 10.496  1.00 21.41 ? 132 VAL D O   1 
ATOM   2389 C  CB  . VAL C 1 29  ? 25.235  112.285 7.535   1.00 29.36 ? 132 VAL D CB  1 
ATOM   2390 C  CG1 . VAL C 1 29  ? 25.459  113.121 6.272   1.00 30.35 ? 132 VAL D CG1 1 
ATOM   2391 C  CG2 . VAL C 1 29  ? 24.464  111.030 7.220   1.00 27.65 ? 132 VAL D CG2 1 
ATOM   2392 N  N   . LEU C 1 30  ? 26.590  110.276 9.972   1.00 24.31 ? 133 LEU D N   1 
ATOM   2393 C  CA  . LEU C 1 30  ? 26.494  109.766 11.331  1.00 22.55 ? 133 LEU D CA  1 
ATOM   2394 C  C   . LEU C 1 30  ? 27.600  108.747 11.548  1.00 20.99 ? 133 LEU D C   1 
ATOM   2395 O  O   . LEU C 1 30  ? 27.793  107.846 10.725  1.00 20.27 ? 133 LEU D O   1 
ATOM   2396 C  CB  . LEU C 1 30  ? 25.131  109.106 11.573  1.00 22.10 ? 133 LEU D CB  1 
ATOM   2397 C  CG  . LEU C 1 30  ? 24.894  108.458 12.947  1.00 24.28 ? 133 LEU D CG  1 
ATOM   2398 C  CD1 . LEU C 1 30  ? 25.124  109.448 14.087  1.00 23.34 ? 133 LEU D CD1 1 
ATOM   2399 C  CD2 . LEU C 1 30  ? 23.479  107.879 13.030  1.00 26.95 ? 133 LEU D CD2 1 
ATOM   2400 N  N   . ARG C 1 31  ? 28.319  108.903 12.658  1.00 20.69 ? 134 ARG D N   1 
ATOM   2401 C  CA  . ARG C 1 31  ? 29.438  108.039 13.002  1.00 25.84 ? 134 ARG D CA  1 
ATOM   2402 C  C   . ARG C 1 31  ? 29.484  107.848 14.502  1.00 24.07 ? 134 ARG D C   1 
ATOM   2403 O  O   . ARG C 1 31  ? 29.532  108.810 15.242  1.00 23.25 ? 134 ARG D O   1 
ATOM   2404 C  CB  . ARG C 1 31  ? 30.775  108.639 12.539  1.00 30.15 ? 134 ARG D CB  1 
ATOM   2405 C  CG  . ARG C 1 31  ? 31.975  107.692 12.755  1.00 38.12 ? 134 ARG D CG  1 
ATOM   2406 C  CD  . ARG C 1 31  ? 33.362  108.366 12.748  1.00 44.82 ? 134 ARG D CD  1 
ATOM   2407 N  NE  . ARG C 1 31  ? 33.597  109.078 11.497  1.00 53.35 ? 134 ARG D NE  1 
ATOM   2408 C  CZ  . ARG C 1 31  ? 33.878  108.501 10.328  1.00 58.81 ? 134 ARG D CZ  1 
ATOM   2409 N  NH1 . ARG C 1 31  ? 33.996  107.171 10.227  1.00 58.90 ? 134 ARG D NH1 1 
ATOM   2410 N  NH2 . ARG C 1 31  ? 34.049  109.264 9.248   1.00 58.83 ? 134 ARG D NH2 1 
ATOM   2411 N  N   . ARG C 1 32  ? 29.451  106.604 14.950  1.00 27.68 ? 135 ARG D N   1 
ATOM   2412 C  CA  . ARG C 1 32  ? 29.831  106.292 16.318  1.00 29.53 ? 135 ARG D CA  1 
ATOM   2413 C  C   . ARG C 1 32  ? 30.918  105.238 16.278  1.00 26.71 ? 135 ARG D C   1 
ATOM   2414 O  O   . ARG C 1 32  ? 30.836  104.280 15.514  1.00 25.65 ? 135 ARG D O   1 
ATOM   2415 C  CB  . ARG C 1 32  ? 28.643  105.803 17.141  1.00 33.05 ? 135 ARG D CB  1 
ATOM   2416 C  CG  . ARG C 1 32  ? 29.050  105.307 18.536  1.00 38.10 ? 135 ARG D CG  1 
ATOM   2417 C  CD  . ARG C 1 32  ? 27.953  105.400 19.573  1.00 42.34 ? 135 ARG D CD  1 
ATOM   2418 N  NE  . ARG C 1 32  ? 26.878  104.447 19.306  1.00 44.70 ? 135 ARG D NE  1 
ATOM   2419 C  CZ  . ARG C 1 32  ? 25.675  104.484 19.882  1.00 46.45 ? 135 ARG D CZ  1 
ATOM   2420 N  NH1 . ARG C 1 32  ? 25.352  105.445 20.758  1.00 45.53 ? 135 ARG D NH1 1 
ATOM   2421 N  NH2 . ARG C 1 32  ? 24.783  103.548 19.568  1.00 46.39 ? 135 ARG D NH2 1 
ATOM   2422 N  N   . GLY C 1 33  ? 31.937  105.420 17.112  1.00 28.77 ? 136 GLY D N   1 
ATOM   2423 C  CA  . GLY C 1 33  ? 33.091  104.549 17.105  1.00 30.86 ? 136 GLY D CA  1 
ATOM   2424 C  C   . GLY C 1 33  ? 33.857  104.645 15.798  1.00 36.27 ? 136 GLY D C   1 
ATOM   2425 O  O   . GLY C 1 33  ? 33.637  105.548 14.970  1.00 33.06 ? 136 GLY D O   1 
ATOM   2426 N  N   . ARG C 1 34  ? 34.790  103.716 15.633  1.00 41.22 ? 137 ARG D N   1 
ATOM   2427 C  CA  . ARG C 1 34  ? 35.521  103.554 14.385  1.00 46.33 ? 137 ARG D CA  1 
ATOM   2428 C  C   . ARG C 1 34  ? 35.210  102.138 13.904  1.00 48.52 ? 137 ARG D C   1 
ATOM   2429 O  O   . ARG C 1 34  ? 34.114  101.615 14.168  1.00 53.80 ? 137 ARG D O   1 
ATOM   2430 C  CB  . ARG C 1 34  ? 37.026  103.775 14.586  1.00 48.95 ? 137 ARG D CB  1 
ATOM   2431 C  CG  . ARG C 1 34  ? 37.408  104.956 15.506  1.00 52.76 ? 137 ARG D CG  1 
ATOM   2432 C  CD  . ARG C 1 34  ? 37.734  106.268 14.773  1.00 55.48 ? 137 ARG D CD  1 
ATOM   2433 N  NE  . ARG C 1 34  ? 38.589  107.154 15.571  1.00 55.96 ? 137 ARG D NE  1 
ATOM   2434 C  CZ  . ARG C 1 34  ? 38.782  108.453 15.331  1.00 56.33 ? 137 ARG D CZ  1 
ATOM   2435 N  NH1 . ARG C 1 34  ? 38.190  109.064 14.303  1.00 55.83 ? 137 ARG D NH1 1 
ATOM   2436 N  NH2 . ARG C 1 34  ? 39.575  109.152 16.134  1.00 57.02 ? 137 ARG D NH2 1 
ATOM   2437 N  N   . GLY C 1 35  ? 36.150  101.509 13.208  1.00 44.71 ? 138 GLY D N   1 
ATOM   2438 C  CA  . GLY C 1 35  ? 35.900  100.202 12.632  1.00 40.39 ? 138 GLY D CA  1 
ATOM   2439 C  C   . GLY C 1 35  ? 35.557  100.299 11.165  1.00 36.61 ? 138 GLY D C   1 
ATOM   2440 O  O   . GLY C 1 35  ? 35.804  99.354  10.431  1.00 37.13 ? 138 GLY D O   1 
ATOM   2441 N  N   . LEU C 1 36  ? 35.001  101.436 10.743  1.00 32.81 ? 139 LEU D N   1 
ATOM   2442 C  CA  . LEU C 1 36  ? 34.661  101.680 9.344   1.00 29.96 ? 139 LEU D CA  1 
ATOM   2443 C  C   . LEU C 1 36  ? 35.039  103.097 8.920   1.00 33.49 ? 139 LEU D C   1 
ATOM   2444 O  O   . LEU C 1 36  ? 34.971  104.042 9.714   1.00 32.45 ? 139 LEU D O   1 
ATOM   2445 C  CB  . LEU C 1 36  ? 33.169  101.505 9.128   1.00 28.46 ? 139 LEU D CB  1 
ATOM   2446 C  CG  . LEU C 1 36  ? 32.609  100.115 9.386   1.00 29.92 ? 139 LEU D CG  1 
ATOM   2447 C  CD1 . LEU C 1 36  ? 31.137  100.213 9.679   1.00 29.05 ? 139 LEU D CD1 1 
ATOM   2448 C  CD2 . LEU C 1 36  ? 32.866  99.204  8.195   1.00 31.29 ? 139 LEU D CD2 1 
ATOM   2449 N  N   . GLU C 1 37  ? 35.381  103.246 7.645   1.00 33.30 ? 140 GLU D N   1 
ATOM   2450 C  CA  . GLU C 1 37  ? 35.809  104.528 7.110   1.00 33.43 ? 140 GLU D CA  1 
ATOM   2451 C  C   . GLU C 1 37  ? 35.519  104.591 5.626   1.00 30.44 ? 140 GLU D C   1 
ATOM   2452 O  O   . GLU C 1 37  ? 35.993  103.755 4.866   1.00 26.33 ? 140 GLU D O   1 
ATOM   2453 C  CB  . GLU C 1 37  ? 37.299  104.735 7.339   1.00 39.36 ? 140 GLU D CB  1 
ATOM   2454 C  CG  . GLU C 1 37  ? 37.739  106.171 7.103   1.00 47.44 ? 140 GLU D CG  1 
ATOM   2455 C  CD  . GLU C 1 37  ? 39.232  106.361 7.286   1.00 50.53 ? 140 GLU D CD  1 
ATOM   2456 O  OE1 . GLU C 1 37  ? 39.643  106.884 8.349   1.00 54.24 ? 140 GLU D OE1 1 
ATOM   2457 O  OE2 . GLU C 1 37  ? 39.985  105.981 6.364   1.00 52.21 ? 140 GLU D OE2 1 
ATOM   2458 N  N   . ALA C 1 38  ? 34.728  105.581 5.222   1.00 25.00 ? 141 ALA D N   1 
ATOM   2459 C  CA  . ALA C 1 38  ? 34.478  105.825 3.818   1.00 27.93 ? 141 ALA D CA  1 
ATOM   2460 C  C   . ALA C 1 38  ? 35.730  106.419 3.183   1.00 28.14 ? 141 ALA D C   1 
ATOM   2461 O  O   . ALA C 1 38  ? 36.335  107.329 3.738   1.00 30.29 ? 141 ALA D O   1 
ATOM   2462 C  CB  . ALA C 1 38  ? 33.299  106.773 3.649   1.00 26.90 ? 141 ALA D CB  1 
ATOM   2463 N  N   . GLN C 1 39  ? 36.119  105.884 2.029   1.00 31.57 ? 142 GLN D N   1 
ATOM   2464 C  CA  . GLN C 1 39  ? 37.205  106.440 1.221   1.00 34.64 ? 142 GLN D CA  1 
ATOM   2465 C  C   . GLN C 1 39  ? 36.706  106.596 -0.214  1.00 32.94 ? 142 GLN D C   1 
ATOM   2466 O  O   . GLN C 1 39  ? 36.957  105.757 -1.075  1.00 32.97 ? 142 GLN D O   1 
ATOM   2467 C  CB  . GLN C 1 39  ? 38.453  105.540 1.285   1.00 37.51 ? 142 GLN D CB  1 
ATOM   2468 C  CG  . GLN C 1 39  ? 38.969  105.257 2.708   1.00 40.59 ? 142 GLN D CG  1 
ATOM   2469 C  CD  . GLN C 1 39  ? 40.419  104.751 2.733   1.00 43.82 ? 142 GLN D CD  1 
ATOM   2470 O  OE1 . GLN C 1 39  ? 40.671  103.546 2.645   1.00 40.13 ? 142 GLN D OE1 1 
ATOM   2471 N  NE2 . GLN C 1 39  ? 41.368  105.676 2.854   1.00 46.25 ? 142 GLN D NE2 1 
ATOM   2472 N  N   . GLY C 1 40  ? 35.973  107.675 -0.456  1.00 36.50 ? 143 GLY D N   1 
ATOM   2473 C  CA  . GLY C 1 40  ? 35.385  107.924 -1.758  1.00 33.76 ? 143 GLY D CA  1 
ATOM   2474 C  C   . GLY C 1 40  ? 34.288  106.930 -2.081  1.00 32.49 ? 143 GLY D C   1 
ATOM   2475 O  O   . GLY C 1 40  ? 33.266  106.883 -1.391  1.00 29.37 ? 143 GLY D O   1 
ATOM   2476 N  N   . ASP C 1 41  ? 34.512  106.113 -3.110  1.00 31.89 ? 144 ASP D N   1 
ATOM   2477 C  CA  . ASP C 1 41  ? 33.474  105.195 -3.611  1.00 34.87 ? 144 ASP D CA  1 
ATOM   2478 C  C   . ASP C 1 41  ? 33.396  103.843 -2.881  1.00 32.08 ? 144 ASP D C   1 
ATOM   2479 O  O   . ASP C 1 41  ? 32.527  103.037 -3.176  1.00 28.68 ? 144 ASP D O   1 
ATOM   2480 C  CB  . ASP C 1 41  ? 33.627  104.962 -5.127  1.00 40.86 ? 144 ASP D CB  1 
ATOM   2481 C  CG  . ASP C 1 41  ? 34.986  104.375 -5.508  1.00 47.40 ? 144 ASP D CG  1 
ATOM   2482 O  OD1 . ASP C 1 41  ? 35.949  104.491 -4.718  1.00 52.35 ? 144 ASP D OD1 1 
ATOM   2483 O  OD2 . ASP C 1 41  ? 35.193  103.786 -6.590  1.00 53.10 ? 144 ASP D OD2 1 
ATOM   2484 N  N   . ILE C 1 42  ? 34.300  103.599 -1.938  1.00 31.13 ? 145 ILE D N   1 
ATOM   2485 C  CA  . ILE C 1 42  ? 34.328  102.333 -1.206  1.00 29.45 ? 145 ILE D CA  1 
ATOM   2486 C  C   . ILE C 1 42  ? 34.312  102.593 0.287   1.00 28.28 ? 145 ILE D C   1 
ATOM   2487 O  O   . ILE C 1 42  ? 34.692  103.664 0.740   1.00 28.98 ? 145 ILE D O   1 
ATOM   2488 C  CB  . ILE C 1 42  ? 35.599  101.514 -1.571  1.00 33.85 ? 145 ILE D CB  1 
ATOM   2489 C  CG1 . ILE C 1 42  ? 36.882  102.237 -1.131  1.00 35.65 ? 145 ILE D CG1 1 
ATOM   2490 C  CG2 . ILE C 1 42  ? 35.646  101.230 -3.081  1.00 34.61 ? 145 ILE D CG2 1 
ATOM   2491 C  CD1 . ILE C 1 42  ? 37.476  101.741 0.157   1.00 38.90 ? 145 ILE D CD1 1 
ATOM   2492 N  N   . VAL C 1 43  ? 33.898  101.602 1.057   1.00 24.22 ? 146 VAL D N   1 
ATOM   2493 C  CA  . VAL C 1 43  ? 34.047  101.682 2.495   1.00 27.48 ? 146 VAL D CA  1 
ATOM   2494 C  C   . VAL C 1 43  ? 35.078  100.671 2.983   1.00 26.09 ? 146 VAL D C   1 
ATOM   2495 O  O   . VAL C 1 43  ? 35.022  99.493  2.655   1.00 25.00 ? 146 VAL D O   1 
ATOM   2496 C  CB  . VAL C 1 43  ? 32.720  101.470 3.198   1.00 27.67 ? 146 VAL D CB  1 
ATOM   2497 C  CG1 . VAL C 1 43  ? 32.898  101.566 4.705   1.00 30.14 ? 146 VAL D CG1 1 
ATOM   2498 C  CG2 . VAL C 1 43  ? 31.725  102.509 2.714   1.00 32.71 ? 146 VAL D CG2 1 
ATOM   2499 N  N   . ARG C 1 44  ? 36.014  101.150 3.783   1.00 28.09 ? 147 ARG D N   1 
ATOM   2500 C  CA  . ARG C 1 44  ? 37.062  100.312 4.342   1.00 29.75 ? 147 ARG D CA  1 
ATOM   2501 C  C   . ARG C 1 44  ? 36.684  99.801  5.710   1.00 28.16 ? 147 ARG D C   1 
ATOM   2502 O  O   . ARG C 1 44  ? 36.192  100.555 6.548   1.00 25.52 ? 147 ARG D O   1 
ATOM   2503 C  CB  . ARG C 1 44  ? 38.365  101.101 4.469   1.00 35.39 ? 147 ARG D CB  1 
ATOM   2504 C  CG  . ARG C 1 44  ? 39.394  100.718 3.432   1.00 43.07 ? 147 ARG D CG  1 
ATOM   2505 C  CD  . ARG C 1 44  ? 40.647  100.091 3.991   1.00 43.17 ? 147 ARG D CD  1 
ATOM   2506 N  NE  . ARG C 1 44  ? 41.769  100.310 3.081   1.00 47.21 ? 147 ARG D NE  1 
ATOM   2507 C  CZ  . ARG C 1 44  ? 42.183  99.461  2.137   1.00 49.59 ? 147 ARG D CZ  1 
ATOM   2508 N  NH1 . ARG C 1 44  ? 41.590  98.289  1.939   1.00 48.22 ? 147 ARG D NH1 1 
ATOM   2509 N  NH2 . ARG C 1 44  ? 43.223  99.790  1.381   1.00 53.14 ? 147 ARG D NH2 1 
ATOM   2510 N  N   . VAL C 1 45  ? 36.964  98.524  5.947   1.00 27.12 ? 148 VAL D N   1 
ATOM   2511 C  CA  . VAL C 1 45  ? 36.716  97.913  7.239   1.00 24.06 ? 148 VAL D CA  1 
ATOM   2512 C  C   . VAL C 1 45  ? 38.015  97.891  8.019   1.00 20.37 ? 148 VAL D C   1 
ATOM   2513 O  O   . VAL C 1 45  ? 38.994  97.314  7.577   1.00 18.35 ? 148 VAL D O   1 
ATOM   2514 C  CB  . VAL C 1 45  ? 36.180  96.481  7.089   1.00 23.39 ? 148 VAL D CB  1 
ATOM   2515 C  CG1 . VAL C 1 45  ? 35.955  95.842  8.459   1.00 21.40 ? 148 VAL D CG1 1 
ATOM   2516 C  CG2 . VAL C 1 45  ? 34.913  96.487  6.259   1.00 20.58 ? 148 VAL D CG2 1 
ATOM   2517 N  N   . TRP C 1 46  ? 38.024  98.545  9.174   1.00 22.61 ? 149 TRP D N   1 
ATOM   2518 C  CA  . TRP C 1 46  ? 39.171  98.508  10.078  1.00 27.34 ? 149 TRP D CA  1 
ATOM   2519 C  C   . TRP C 1 46  ? 39.000  97.469  11.207  1.00 26.79 ? 149 TRP D C   1 
ATOM   2520 O  O   . TRP C 1 46  ? 39.980  96.885  11.639  1.00 29.19 ? 149 TRP D O   1 
ATOM   2521 C  CB  . TRP C 1 46  ? 39.430  99.907  10.646  1.00 27.24 ? 149 TRP D CB  1 
ATOM   2522 C  CG  . TRP C 1 46  ? 39.985  100.869 9.633   1.00 27.77 ? 149 TRP D CG  1 
ATOM   2523 C  CD1 . TRP C 1 46  ? 39.286  101.770 8.888   1.00 26.86 ? 149 TRP D CD1 1 
ATOM   2524 C  CD2 . TRP C 1 46  ? 41.361  101.034 9.268   1.00 33.01 ? 149 TRP D CD2 1 
ATOM   2525 N  NE1 . TRP C 1 46  ? 40.133  102.479 8.071   1.00 28.44 ? 149 TRP D NE1 1 
ATOM   2526 C  CE2 . TRP C 1 46  ? 41.417  102.054 8.286   1.00 34.83 ? 149 TRP D CE2 1 
ATOM   2527 C  CE3 . TRP C 1 46  ? 42.563  100.426 9.674   1.00 35.67 ? 149 TRP D CE3 1 
ATOM   2528 C  CZ2 . TRP C 1 46  ? 42.628  102.483 7.703   1.00 36.16 ? 149 TRP D CZ2 1 
ATOM   2529 C  CZ3 . TRP C 1 46  ? 43.773  100.850 9.087   1.00 37.38 ? 149 TRP D CZ3 1 
ATOM   2530 C  CH2 . TRP C 1 46  ? 43.788  101.868 8.112   1.00 36.85 ? 149 TRP D CH2 1 
ATOM   2531 N  N   . ASP C 1 47  ? 37.764  97.230  11.656  1.00 28.13 ? 150 ASP D N   1 
ATOM   2532 C  CA  . ASP C 1 47  ? 37.487  96.328  12.788  1.00 31.45 ? 150 ASP D CA  1 
ATOM   2533 C  C   . ASP C 1 47  ? 36.667  95.131  12.328  1.00 26.78 ? 150 ASP D C   1 
ATOM   2534 O  O   . ASP C 1 47  ? 35.520  95.272  11.911  1.00 27.75 ? 150 ASP D O   1 
ATOM   2535 C  CB  . ASP C 1 47  ? 36.693  97.036  13.900  1.00 37.33 ? 150 ASP D CB  1 
ATOM   2536 C  CG  . ASP C 1 47  ? 37.525  98.037  14.689  1.00 44.30 ? 150 ASP D CG  1 
ATOM   2537 O  OD1 . ASP C 1 47  ? 38.765  98.072  14.533  1.00 48.98 ? 150 ASP D OD1 1 
ATOM   2538 O  OD2 . ASP C 1 47  ? 37.012  98.840  15.500  1.00 49.11 ? 150 ASP D OD2 1 
ATOM   2539 N  N   . THR C 1 48  ? 37.257  93.954  12.419  1.00 24.26 ? 151 THR D N   1 
ATOM   2540 C  CA  . THR C 1 48  ? 36.551  92.728  12.113  1.00 24.37 ? 151 THR D CA  1 
ATOM   2541 C  C   . THR C 1 48  ? 35.321  92.594  13.013  1.00 23.01 ? 151 THR D C   1 
ATOM   2542 O  O   . THR C 1 48  ? 35.359  92.938  14.191  1.00 23.75 ? 151 THR D O   1 
ATOM   2543 C  CB  . THR C 1 48  ? 37.496  91.533  12.296  1.00 21.32 ? 151 THR D CB  1 
ATOM   2544 O  OG1 . THR C 1 48  ? 38.551  91.632  11.337  1.00 21.68 ? 151 THR D OG1 1 
ATOM   2545 C  CG2 . THR C 1 48  ? 36.810  90.211  11.967  1.00 19.93 ? 151 THR D CG2 1 
ATOM   2546 N  N   . GLY C 1 49  ? 34.234  92.100  12.442  1.00 20.00 ? 152 GLY D N   1 
ATOM   2547 C  CA  . GLY C 1 49  ? 32.999  91.925  13.177  1.00 20.41 ? 152 GLY D CA  1 
ATOM   2548 C  C   . GLY C 1 49  ? 31.843  91.564  12.276  1.00 21.65 ? 152 GLY D C   1 
ATOM   2549 O  O   . GLY C 1 49  ? 31.984  91.509  11.053  1.00 22.20 ? 152 GLY D O   1 
ATOM   2550 N  N   . ILE C 1 50  ? 30.692  91.324  12.894  1.00 22.46 ? 153 ILE D N   1 
ATOM   2551 C  CA  . ILE C 1 50  ? 29.454  91.069  12.180  1.00 20.93 ? 153 ILE D CA  1 
ATOM   2552 C  C   . ILE C 1 50  ? 28.667  92.366  12.128  1.00 20.12 ? 153 ILE D C   1 
ATOM   2553 O  O   . ILE C 1 50  ? 28.436  92.974  13.162  1.00 18.49 ? 153 ILE D O   1 
ATOM   2554 C  CB  . ILE C 1 50  ? 28.659  89.970  12.886  1.00 20.34 ? 153 ILE D CB  1 
ATOM   2555 C  CG1 . ILE C 1 50  ? 29.410  88.631  12.736  1.00 22.45 ? 153 ILE D CG1 1 
ATOM   2556 C  CG2 . ILE C 1 50  ? 27.227  89.917  12.335  1.00 22.23 ? 153 ILE D CG2 1 
ATOM   2557 C  CD1 . ILE C 1 50  ? 28.796  87.473  13.482  1.00 21.96 ? 153 ILE D CD1 1 
ATOM   2558 N  N   . TYR C 1 51  ? 28.262  92.775  10.928  1.00 17.28 ? 154 TYR D N   1 
ATOM   2559 C  CA  . TYR C 1 51  ? 27.595  94.059  10.711  1.00 21.45 ? 154 TYR D CA  1 
ATOM   2560 C  C   . TYR C 1 51  ? 26.258  93.892  10.012  1.00 21.43 ? 154 TYR D C   1 
ATOM   2561 O  O   . TYR C 1 51  ? 26.129  93.087  9.104   1.00 21.98 ? 154 TYR D O   1 
ATOM   2562 C  CB  . TYR C 1 51  ? 28.453  94.992  9.835   1.00 21.61 ? 154 TYR D CB  1 
ATOM   2563 C  CG  . TYR C 1 51  ? 29.745  95.479  10.453  1.00 20.81 ? 154 TYR D CG  1 
ATOM   2564 C  CD1 . TYR C 1 51  ? 30.880  94.677  10.448  1.00 21.49 ? 154 TYR D CD1 1 
ATOM   2565 C  CD2 . TYR C 1 51  ? 29.849  96.758  11.011  1.00 22.14 ? 154 TYR D CD2 1 
ATOM   2566 C  CE1 . TYR C 1 51  ? 32.080  95.117  10.991  1.00 19.84 ? 154 TYR D CE1 1 
ATOM   2567 C  CE2 . TYR C 1 51  ? 31.053  97.205  11.577  1.00 19.57 ? 154 TYR D CE2 1 
ATOM   2568 C  CZ  . TYR C 1 51  ? 32.164  96.377  11.555  1.00 19.63 ? 154 TYR D CZ  1 
ATOM   2569 O  OH  . TYR C 1 51  ? 33.371  96.778  12.091  1.00 22.18 ? 154 TYR D OH  1 
ATOM   2570 N  N   . LEU C 1 52  ? 25.264  94.657  10.448  1.00 26.72 ? 155 LEU D N   1 
ATOM   2571 C  CA  . LEU C 1 52  ? 24.080  94.919  9.643   1.00 24.87 ? 155 LEU D CA  1 
ATOM   2572 C  C   . LEU C 1 52  ? 24.502  95.946  8.612   1.00 23.65 ? 155 LEU D C   1 
ATOM   2573 O  O   . LEU C 1 52  ? 25.008  96.999  8.958   1.00 22.11 ? 155 LEU D O   1 
ATOM   2574 C  CB  . LEU C 1 52  ? 22.950  95.503  10.498  1.00 28.12 ? 155 LEU D CB  1 
ATOM   2575 C  CG  . LEU C 1 52  ? 21.728  96.022  9.712   1.00 31.55 ? 155 LEU D CG  1 
ATOM   2576 C  CD1 . LEU C 1 52  ? 21.000  94.869  9.068   1.00 30.47 ? 155 LEU D CD1 1 
ATOM   2577 C  CD2 . LEU C 1 52  ? 20.799  96.810  10.613  1.00 34.00 ? 155 LEU D CD2 1 
ATOM   2578 N  N   . LEU C 1 53  ? 24.265  95.641  7.348   1.00 24.88 ? 156 LEU D N   1 
ATOM   2579 C  CA  . LEU C 1 53  ? 24.609  96.512  6.228   1.00 27.19 ? 156 LEU D CA  1 
ATOM   2580 C  C   . LEU C 1 53  ? 23.317  96.784  5.450   1.00 30.76 ? 156 LEU D C   1 
ATOM   2581 O  O   . LEU C 1 53  ? 22.620  95.850  5.068   1.00 26.15 ? 156 LEU D O   1 
ATOM   2582 C  CB  . LEU C 1 53  ? 25.592  95.763  5.341   1.00 30.26 ? 156 LEU D CB  1 
ATOM   2583 C  CG  . LEU C 1 53  ? 26.611  96.513  4.506   1.00 35.46 ? 156 LEU D CG  1 
ATOM   2584 C  CD1 . LEU C 1 53  ? 27.562  95.512  3.885   1.00 36.08 ? 156 LEU D CD1 1 
ATOM   2585 C  CD2 . LEU C 1 53  ? 25.929  97.337  3.436   1.00 39.88 ? 156 LEU D CD2 1 
ATOM   2586 N  N   . TYR C 1 54  ? 22.982  98.051  5.236   1.00 27.73 ? 157 TYR D N   1 
ATOM   2587 C  CA  . TYR C 1 54  ? 21.804  98.403  4.453   1.00 27.45 ? 157 TYR D CA  1 
ATOM   2588 C  C   . TYR C 1 54  ? 22.158  99.406  3.340   1.00 26.67 ? 157 TYR D C   1 
ATOM   2589 O  O   . TYR C 1 54  ? 23.079  100.198 3.468   1.00 23.23 ? 157 TYR D O   1 
ATOM   2590 C  CB  . TYR C 1 54  ? 20.673  98.919  5.363   1.00 27.29 ? 157 TYR D CB  1 
ATOM   2591 C  CG  . TYR C 1 54  ? 20.994  100.173 6.128   1.00 29.16 ? 157 TYR D CG  1 
ATOM   2592 C  CD1 . TYR C 1 54  ? 20.787  101.433 5.560   1.00 27.79 ? 157 TYR D CD1 1 
ATOM   2593 C  CD2 . TYR C 1 54  ? 21.497  100.108 7.422   1.00 27.23 ? 157 TYR D CD2 1 
ATOM   2594 C  CE1 . TYR C 1 54  ? 21.082  102.597 6.265   1.00 27.28 ? 157 TYR D CE1 1 
ATOM   2595 C  CE2 . TYR C 1 54  ? 21.793  101.256 8.131   1.00 27.65 ? 157 TYR D CE2 1 
ATOM   2596 C  CZ  . TYR C 1 54  ? 21.588  102.502 7.545   1.00 27.72 ? 157 TYR D CZ  1 
ATOM   2597 O  OH  . TYR C 1 54  ? 21.883  103.645 8.256   1.00 29.46 ? 157 TYR D OH  1 
ATOM   2598 N  N   . SER C 1 55  ? 21.396  99.358  2.256   1.00 25.14 ? 158 SER D N   1 
ATOM   2599 C  CA  . SER C 1 55  ? 21.682  100.116 1.052   1.00 24.65 ? 158 SER D CA  1 
ATOM   2600 C  C   . SER C 1 55  ? 20.393  100.467 0.355   1.00 24.24 ? 158 SER D C   1 
ATOM   2601 O  O   . SER C 1 55  ? 19.605  99.587  0.062   1.00 23.26 ? 158 SER D O   1 
ATOM   2602 C  CB  . SER C 1 55  ? 22.537  99.289  0.095   1.00 30.37 ? 158 SER D CB  1 
ATOM   2603 O  OG  . SER C 1 55  ? 22.722  99.933  -1.160  1.00 32.96 ? 158 SER D OG  1 
ATOM   2604 N  N   . GLN C 1 56  ? 20.176  101.755 0.098   1.00 25.44 ? 159 GLN D N   1 
ATOM   2605 C  CA  . GLN C 1 56  ? 19.089  102.178 -0.774  1.00 26.50 ? 159 GLN D CA  1 
ATOM   2606 C  C   . GLN C 1 56  ? 19.629  103.054 -1.899  1.00 26.72 ? 159 GLN D C   1 
ATOM   2607 O  O   . GLN C 1 56  ? 20.530  103.871 -1.695  1.00 26.88 ? 159 GLN D O   1 
ATOM   2608 C  CB  . GLN C 1 56  ? 18.001  102.932 -0.002  1.00 26.32 ? 159 GLN D CB  1 
ATOM   2609 C  CG  . GLN C 1 56  ? 16.882  103.498 -0.913  1.00 28.96 ? 159 GLN D CG  1 
ATOM   2610 C  CD  . GLN C 1 56  ? 15.671  103.961 -0.143  1.00 27.51 ? 159 GLN D CD  1 
ATOM   2611 O  OE1 . GLN C 1 56  ? 15.062  103.176 0.568   1.00 30.21 ? 159 GLN D OE1 1 
ATOM   2612 N  NE2 . GLN C 1 56  ? 15.318  105.238 -0.283  1.00 30.81 ? 159 GLN D NE2 1 
ATOM   2613 N  N   . VAL C 1 57  ? 19.075  102.869 -3.090  1.00 27.37 ? 160 VAL D N   1 
ATOM   2614 C  CA  . VAL C 1 57  ? 19.328  103.769 -4.211  1.00 27.64 ? 160 VAL D CA  1 
ATOM   2615 C  C   . VAL C 1 57  ? 18.006  104.174 -4.837  1.00 26.44 ? 160 VAL D C   1 
ATOM   2616 O  O   . VAL C 1 57  ? 17.119  103.350 -4.994  1.00 26.12 ? 160 VAL D O   1 
ATOM   2617 C  CB  . VAL C 1 57  ? 20.215  103.133 -5.287  1.00 29.25 ? 160 VAL D CB  1 
ATOM   2618 C  CG1 . VAL C 1 57  ? 20.499  104.156 -6.394  1.00 31.61 ? 160 VAL D CG1 1 
ATOM   2619 C  CG2 . VAL C 1 57  ? 21.513  102.609 -4.673  1.00 29.31 ? 160 VAL D CG2 1 
ATOM   2620 N  N   . LEU C 1 58  ? 17.889  105.452 -5.176  1.00 28.38 ? 161 LEU D N   1 
ATOM   2621 C  CA  . LEU C 1 58  ? 16.702  105.992 -5.819  1.00 27.40 ? 161 LEU D CA  1 
ATOM   2622 C  C   . LEU C 1 58  ? 17.031  106.263 -7.283  1.00 26.17 ? 161 LEU D C   1 
ATOM   2623 O  O   . LEU C 1 58  ? 17.903  107.071 -7.589  1.00 24.48 ? 161 LEU D O   1 
ATOM   2624 C  CB  . LEU C 1 58  ? 16.237  107.264 -5.123  1.00 24.88 ? 161 LEU D CB  1 
ATOM   2625 C  CG  . LEU C 1 58  ? 15.138  108.112 -5.785  1.00 27.10 ? 161 LEU D CG  1 
ATOM   2626 C  CD1 . LEU C 1 58  ? 13.892  107.260 -6.034  1.00 27.99 ? 161 LEU D CD1 1 
ATOM   2627 C  CD2 . LEU C 1 58  ? 14.797  109.321 -4.916  1.00 22.11 ? 161 LEU D CD2 1 
ATOM   2628 N  N   . PHE C 1 59  ? 16.319  105.570 -8.164  1.00 23.50 ? 162 PHE D N   1 
ATOM   2629 C  CA  . PHE C 1 59  ? 16.526  105.630 -9.610  1.00 24.65 ? 162 PHE D CA  1 
ATOM   2630 C  C   . PHE C 1 59  ? 15.469  106.475 -10.298 1.00 25.59 ? 162 PHE D C   1 
ATOM   2631 O  O   . PHE C 1 59  ? 14.311  106.472 -9.888  1.00 22.48 ? 162 PHE D O   1 
ATOM   2632 C  CB  . PHE C 1 59  ? 16.461  104.224 -10.194 1.00 23.75 ? 162 PHE D CB  1 
ATOM   2633 C  CG  . PHE C 1 59  ? 17.551  103.325 -9.704  1.00 23.37 ? 162 PHE D CG  1 
ATOM   2634 C  CD1 . PHE C 1 59  ? 18.840  103.462 -10.177 1.00 25.09 ? 162 PHE D CD1 1 
ATOM   2635 C  CD2 . PHE C 1 59  ? 17.287  102.344 -8.770  1.00 27.01 ? 162 PHE D CD2 1 
ATOM   2636 C  CE1 . PHE C 1 59  ? 19.841  102.636 -9.716  1.00 27.27 ? 162 PHE D CE1 1 
ATOM   2637 C  CE2 . PHE C 1 59  ? 18.289  101.524 -8.299  1.00 27.63 ? 162 PHE D CE2 1 
ATOM   2638 C  CZ  . PHE C 1 59  ? 19.560  101.667 -8.766  1.00 25.34 ? 162 PHE D CZ  1 
ATOM   2639 N  N   . HIS C 1 60  ? 15.898  107.204 -11.332 1.00 26.70 ? 163 HIS D N   1 
ATOM   2640 C  CA  . HIS C 1 60  ? 15.028  107.920 -12.261 1.00 27.91 ? 163 HIS D CA  1 
ATOM   2641 C  C   . HIS C 1 60  ? 15.493  107.587 -13.683 1.00 29.99 ? 163 HIS D C   1 
ATOM   2642 O  O   . HIS C 1 60  ? 16.196  108.358 -14.320 1.00 36.76 ? 163 HIS D O   1 
ATOM   2643 C  CB  . HIS C 1 60  ? 15.081  109.431 -12.012 1.00 28.08 ? 163 HIS D CB  1 
ATOM   2644 C  CG  . HIS C 1 60  ? 14.198  110.227 -12.925 1.00 27.57 ? 163 HIS D CG  1 
ATOM   2645 N  ND1 . HIS C 1 60  ? 12.957  109.786 -13.331 1.00 28.74 ? 163 HIS D ND1 1 
ATOM   2646 C  CD2 . HIS C 1 60  ? 14.379  111.432 -13.518 1.00 29.61 ? 163 HIS D CD2 1 
ATOM   2647 C  CE1 . HIS C 1 60  ? 12.409  110.686 -14.133 1.00 28.16 ? 163 HIS D CE1 1 
ATOM   2648 N  NE2 . HIS C 1 60  ? 13.250  111.694 -14.264 1.00 25.78 ? 163 HIS D NE2 1 
ATOM   2649 N  N   . ASP C 1 61  ? 15.078  106.426 -14.171 1.00 32.71 ? 164 ASP D N   1 
ATOM   2650 C  CA  . ASP C 1 61  ? 15.743  105.760 -15.286 1.00 30.03 ? 164 ASP D CA  1 
ATOM   2651 C  C   . ASP C 1 61  ? 14.784  104.771 -15.962 1.00 29.46 ? 164 ASP D C   1 
ATOM   2652 O  O   . ASP C 1 61  ? 14.139  103.970 -15.279 1.00 29.83 ? 164 ASP D O   1 
ATOM   2653 C  CB  . ASP C 1 61  ? 16.946  104.998 -14.717 1.00 33.92 ? 164 ASP D CB  1 
ATOM   2654 C  CG  . ASP C 1 61  ? 18.068  104.843 -15.710 1.00 38.51 ? 164 ASP D CG  1 
ATOM   2655 O  OD1 . ASP C 1 61  ? 17.867  104.174 -16.746 1.00 37.93 ? 164 ASP D OD1 1 
ATOM   2656 O  OD2 . ASP C 1 61  ? 19.193  105.349 -15.528 1.00 39.95 ? 164 ASP D OD2 1 
ATOM   2657 N  N   . VAL C 1 62  ? 14.694  104.815 -17.289 1.00 25.67 ? 165 VAL D N   1 
ATOM   2658 C  CA  . VAL C 1 62  ? 13.755  103.962 -18.030 1.00 23.66 ? 165 VAL D CA  1 
ATOM   2659 C  C   . VAL C 1 62  ? 14.326  102.599 -18.399 1.00 23.35 ? 165 VAL D C   1 
ATOM   2660 O  O   . VAL C 1 62  ? 13.608  101.746 -18.919 1.00 25.77 ? 165 VAL D O   1 
ATOM   2661 C  CB  . VAL C 1 62  ? 13.186  104.665 -19.300 1.00 25.21 ? 165 VAL D CB  1 
ATOM   2662 C  CG1 . VAL C 1 62  ? 12.541  105.981 -18.910 1.00 28.53 ? 165 VAL D CG1 1 
ATOM   2663 C  CG2 . VAL C 1 62  ? 14.263  104.886 -20.392 1.00 21.52 ? 165 VAL D CG2 1 
ATOM   2664 N  N   . THR C 1 63  ? 15.607  102.383 -18.115 1.00 24.33 ? 166 THR D N   1 
ATOM   2665 C  CA  . THR C 1 63  ? 16.226  101.076 -18.333 1.00 25.35 ? 166 THR D CA  1 
ATOM   2666 C  C   . THR C 1 63  ? 15.383  99.993  -17.657 1.00 21.78 ? 166 THR D C   1 
ATOM   2667 O  O   . THR C 1 63  ? 14.971  100.146 -16.505 1.00 24.11 ? 166 THR D O   1 
ATOM   2668 C  CB  . THR C 1 63  ? 17.679  101.053 -17.805 1.00 27.34 ? 166 THR D CB  1 
ATOM   2669 O  OG1 . THR C 1 63  ? 18.463  102.045 -18.486 1.00 29.22 ? 166 THR D OG1 1 
ATOM   2670 C  CG2 . THR C 1 63  ? 18.372  99.729  -18.143 1.00 24.68 ? 166 THR D CG2 1 
ATOM   2671 N  N   . PHE C 1 64  ? 15.143  98.909  -18.388 1.00 21.48 ? 167 PHE D N   1 
ATOM   2672 C  CA  . PHE C 1 64  ? 14.103  97.937  -18.051 1.00 20.66 ? 167 PHE D CA  1 
ATOM   2673 C  C   . PHE C 1 64  ? 14.213  97.436  -16.616 1.00 22.06 ? 167 PHE D C   1 
ATOM   2674 O  O   . PHE C 1 64  ? 13.199  97.308  -15.941 1.00 21.50 ? 167 PHE D O   1 
ATOM   2675 C  CB  . PHE C 1 64  ? 14.046  96.788  -19.086 1.00 20.04 ? 167 PHE D CB  1 
ATOM   2676 C  CG  . PHE C 1 64  ? 15.117  95.742  -18.918 1.00 24.76 ? 167 PHE D CG  1 
ATOM   2677 C  CD1 . PHE C 1 64  ? 16.432  95.993  -19.308 1.00 26.89 ? 167 PHE D CD1 1 
ATOM   2678 C  CD2 . PHE C 1 64  ? 14.808  94.494  -18.377 1.00 24.96 ? 167 PHE D CD2 1 
ATOM   2679 C  CE1 . PHE C 1 64  ? 17.422  95.021  -19.146 1.00 24.12 ? 167 PHE D CE1 1 
ATOM   2680 C  CE2 . PHE C 1 64  ? 15.790  93.523  -18.224 1.00 26.30 ? 167 PHE D CE2 1 
ATOM   2681 C  CZ  . PHE C 1 64  ? 17.096  93.789  -18.608 1.00 24.73 ? 167 PHE D CZ  1 
ATOM   2682 N  N   . THR C 1 65  ? 15.437  97.171  -16.159 1.00 19.95 ? 168 THR D N   1 
ATOM   2683 C  CA  . THR C 1 65  ? 15.706  96.975  -14.738 1.00 20.73 ? 168 THR D CA  1 
ATOM   2684 C  C   . THR C 1 65  ? 16.871  97.843  -14.284 1.00 23.64 ? 168 THR D C   1 
ATOM   2685 O  O   . THR C 1 65  ? 17.802  98.121  -15.045 1.00 21.68 ? 168 THR D O   1 
ATOM   2686 C  CB  . THR C 1 65  ? 16.036  95.497  -14.412 1.00 22.79 ? 168 THR D CB  1 
ATOM   2687 O  OG1 . THR C 1 65  ? 16.992  94.982  -15.351 1.00 25.09 ? 168 THR D OG1 1 
ATOM   2688 C  CG2 . THR C 1 65  ? 14.808  94.610  -14.584 1.00 20.64 ? 168 THR D CG2 1 
ATOM   2689 N  N   . MET C 1 66  ? 16.792  98.270  -13.031 1.00 22.11 ? 169 MET D N   1 
ATOM   2690 C  CA  . MET C 1 66  ? 17.866  98.957  -12.352 1.00 23.83 ? 169 MET D CA  1 
ATOM   2691 C  C   . MET C 1 66  ? 18.070  98.313  -10.971 1.00 26.34 ? 169 MET D C   1 
ATOM   2692 O  O   . MET C 1 66  ? 17.231  97.555  -10.477 1.00 23.41 ? 169 MET D O   1 
ATOM   2693 C  CB  . MET C 1 66  ? 17.539  100.446 -12.195 1.00 25.36 ? 169 MET D CB  1 
ATOM   2694 C  CG  . MET C 1 66  ? 17.482  101.268 -13.492 1.00 24.31 ? 169 MET D CG  1 
ATOM   2695 S  SD  . MET C 1 66  ? 19.034  101.282 -14.472 1.00 26.39 ? 169 MET D SD  1 
ATOM   2696 C  CE  . MET C 1 66  ? 20.114  102.216 -13.430 1.00 27.70 ? 169 MET D CE  1 
ATOM   2697 N  N   . GLY C 1 67  ? 19.192  98.621  -10.345 1.00 25.80 ? 170 GLY D N   1 
ATOM   2698 C  CA  . GLY C 1 67  ? 19.458  98.110  -9.019  1.00 24.98 ? 170 GLY D CA  1 
ATOM   2699 C  C   . GLY C 1 67  ? 20.905  98.262  -8.630  1.00 26.39 ? 170 GLY D C   1 
ATOM   2700 O  O   . GLY C 1 67  ? 21.679  98.876  -9.358  1.00 27.62 ? 170 GLY D O   1 
ATOM   2701 N  N   . GLN C 1 68  ? 21.272  97.686  -7.489  1.00 26.72 ? 171 GLN D N   1 
ATOM   2702 C  CA  . GLN C 1 68  ? 22.629  97.807  -6.985  1.00 28.02 ? 171 GLN D CA  1 
ATOM   2703 C  C   . GLN C 1 68  ? 23.165  96.489  -6.436  1.00 26.86 ? 171 GLN D C   1 
ATOM   2704 O  O   . GLN C 1 68  ? 22.428  95.659  -5.953  1.00 28.30 ? 171 GLN D O   1 
ATOM   2705 C  CB  . GLN C 1 68  ? 22.729  98.936  -5.935  1.00 30.10 ? 171 GLN D CB  1 
ATOM   2706 C  CG  . GLN C 1 68  ? 22.136  98.626  -4.546  1.00 34.12 ? 171 GLN D CG  1 
ATOM   2707 C  CD  . GLN C 1 68  ? 20.697  99.102  -4.390  1.00 38.03 ? 171 GLN D CD  1 
ATOM   2708 O  OE1 . GLN C 1 68  ? 19.990  99.311  -5.387  1.00 37.91 ? 171 GLN D OE1 1 
ATOM   2709 N  NE2 . GLN C 1 68  ? 20.253  99.262  -3.138  1.00 35.96 ? 171 GLN D NE2 1 
ATOM   2710 N  N   . VAL C 1 69  ? 24.478  96.330  -6.529  1.00 27.64 ? 172 VAL D N   1 
ATOM   2711 C  CA  . VAL C 1 69  ? 25.185  95.151  -6.098  1.00 25.26 ? 172 VAL D CA  1 
ATOM   2712 C  C   . VAL C 1 69  ? 26.138  95.637  -5.012  1.00 27.54 ? 172 VAL D C   1 
ATOM   2713 O  O   . VAL C 1 69  ? 26.984  96.498  -5.259  1.00 28.06 ? 172 VAL D O   1 
ATOM   2714 C  CB  . VAL C 1 69  ? 26.005  94.546  -7.270  1.00 30.82 ? 172 VAL D CB  1 
ATOM   2715 C  CG1 . VAL C 1 69  ? 26.794  93.305  -6.826  1.00 31.53 ? 172 VAL D CG1 1 
ATOM   2716 C  CG2 . VAL C 1 69  ? 25.113  94.200  -8.450  1.00 28.80 ? 172 VAL D CG2 1 
ATOM   2717 N  N   . VAL C 1 70  ? 25.985  95.098  -3.811  1.00 26.99 ? 173 VAL D N   1 
ATOM   2718 C  CA  . VAL C 1 70  ? 26.860  95.413  -2.686  1.00 26.40 ? 173 VAL D CA  1 
ATOM   2719 C  C   . VAL C 1 70  ? 27.795  94.234  -2.484  1.00 23.49 ? 173 VAL D C   1 
ATOM   2720 O  O   . VAL C 1 70  ? 27.349  93.099  -2.381  1.00 26.95 ? 173 VAL D O   1 
ATOM   2721 C  CB  . VAL C 1 70  ? 26.036  95.681  -1.415  1.00 24.70 ? 173 VAL D CB  1 
ATOM   2722 C  CG1 . VAL C 1 70  ? 26.935  96.038  -0.226  1.00 27.46 ? 173 VAL D CG1 1 
ATOM   2723 C  CG2 . VAL C 1 70  ? 25.051  96.792  -1.685  1.00 25.68 ? 173 VAL D CG2 1 
ATOM   2724 N  N   . SER C 1 71  ? 29.090  94.504  -2.448  1.00 21.93 ? 174 SER D N   1 
ATOM   2725 C  CA  . SER C 1 71  ? 30.101  93.455  -2.421  1.00 22.57 ? 174 SER D CA  1 
ATOM   2726 C  C   . SER C 1 71  ? 31.223  93.753  -1.445  1.00 23.23 ? 174 SER D C   1 
ATOM   2727 O  O   . SER C 1 71  ? 31.423  94.889  -1.025  1.00 19.58 ? 174 SER D O   1 
ATOM   2728 C  CB  . SER C 1 71  ? 30.712  93.257  -3.814  1.00 28.46 ? 174 SER D CB  1 
ATOM   2729 O  OG  . SER C 1 71  ? 29.705  93.081  -4.795  1.00 35.27 ? 174 SER D OG  1 
ATOM   2730 N  N   . ARG C 1 72  ? 31.958  92.695  -1.122  1.00 25.41 ? 175 ARG D N   1 
ATOM   2731 C  CA  . ARG C 1 72  ? 33.087  92.730  -0.233  1.00 27.40 ? 175 ARG D CA  1 
ATOM   2732 C  C   . ARG C 1 72  ? 34.311  92.213  -1.003  1.00 26.61 ? 175 ARG D C   1 
ATOM   2733 O  O   . ARG C 1 72  ? 34.248  91.185  -1.675  1.00 24.36 ? 175 ARG D O   1 
ATOM   2734 C  CB  . ARG C 1 72  ? 32.775  91.876  1.003   1.00 31.09 ? 175 ARG D CB  1 
ATOM   2735 C  CG  . ARG C 1 72  ? 33.975  91.277  1.680   1.00 40.47 ? 175 ARG D CG  1 
ATOM   2736 C  CD  . ARG C 1 72  ? 33.692  90.716  3.067   1.00 46.60 ? 175 ARG D CD  1 
ATOM   2737 N  NE  . ARG C 1 72  ? 32.969  89.452  3.074   1.00 50.09 ? 175 ARG D NE  1 
ATOM   2738 C  CZ  . ARG C 1 72  ? 33.484  88.285  2.726   1.00 54.52 ? 175 ARG D CZ  1 
ATOM   2739 N  NH1 . ARG C 1 72  ? 34.743  88.193  2.300   1.00 56.05 ? 175 ARG D NH1 1 
ATOM   2740 N  NH2 . ARG C 1 72  ? 32.728  87.195  2.793   1.00 56.66 ? 175 ARG D NH2 1 
ATOM   2741 N  N   . GLU C 1 73  ? 35.420  92.942  -0.910  1.00 28.54 ? 176 GLU D N   1 
ATOM   2742 C  CA  . GLU C 1 73  ? 36.664  92.566  -1.572  1.00 31.31 ? 176 GLU D CA  1 
ATOM   2743 C  C   . GLU C 1 73  ? 37.742  92.512  -0.510  1.00 28.46 ? 176 GLU D C   1 
ATOM   2744 O  O   . GLU C 1 73  ? 37.927  93.477  0.219   1.00 26.03 ? 176 GLU D O   1 
ATOM   2745 C  CB  . GLU C 1 73  ? 37.031  93.585  -2.652  1.00 37.71 ? 176 GLU D CB  1 
ATOM   2746 C  CG  . GLU C 1 73  ? 36.578  93.183  -4.048  1.00 45.36 ? 176 GLU D CG  1 
ATOM   2747 C  CD  . GLU C 1 73  ? 36.594  94.338  -5.037  1.00 50.43 ? 176 GLU D CD  1 
ATOM   2748 O  OE1 . GLU C 1 73  ? 35.657  95.177  -5.008  1.00 49.70 ? 176 GLU D OE1 1 
ATOM   2749 O  OE2 . GLU C 1 73  ? 37.550  94.399  -5.847  1.00 54.20 ? 176 GLU D OE2 1 
ATOM   2750 N  N   . GLY C 1 74  ? 38.433  91.385  -0.406  1.00 29.69 ? 177 GLY D N   1 
ATOM   2751 C  CA  . GLY C 1 74  ? 39.453  91.211  0.611   1.00 34.39 ? 177 GLY D CA  1 
ATOM   2752 C  C   . GLY C 1 74  ? 40.027  89.807  0.632   1.00 40.72 ? 177 GLY D C   1 
ATOM   2753 O  O   . GLY C 1 74  ? 39.305  88.829  0.440   1.00 44.18 ? 177 GLY D O   1 
ATOM   2754 N  N   . GLN C 1 75  ? 41.330  89.704  0.877   1.00 48.52 ? 178 GLN D N   1 
ATOM   2755 C  CA  . GLN C 1 75  ? 42.023  88.414  0.836   1.00 53.06 ? 178 GLN D CA  1 
ATOM   2756 C  C   . GLN C 1 75  ? 41.858  87.783  -0.556  1.00 53.36 ? 178 GLN D C   1 
ATOM   2757 O  O   . GLN C 1 75  ? 41.368  86.659  -0.695  1.00 52.68 ? 178 GLN D O   1 
ATOM   2758 C  CB  . GLN C 1 75  ? 41.514  87.481  1.955   1.00 56.05 ? 178 GLN D CB  1 
ATOM   2759 C  CG  . GLN C 1 75  ? 41.113  88.219  3.253   1.00 57.72 ? 178 GLN D CG  1 
ATOM   2760 C  CD  . GLN C 1 75  ? 41.469  87.469  4.532   1.00 59.01 ? 178 GLN D CD  1 
ATOM   2761 O  OE1 . GLN C 1 75  ? 40.682  87.461  5.480   1.00 60.39 ? 178 GLN D OE1 1 
ATOM   2762 N  NE2 . GLN C 1 75  ? 42.655  86.859  4.569   1.00 57.67 ? 178 GLN D NE2 1 
ATOM   2763 N  N   . GLY C 1 76  ? 42.240  88.552  -1.579  1.00 54.71 ? 179 GLY D N   1 
ATOM   2764 C  CA  . GLY C 1 76  ? 42.261  88.103  -2.967  1.00 54.71 ? 179 GLY D CA  1 
ATOM   2765 C  C   . GLY C 1 76  ? 40.958  87.593  -3.568  1.00 54.35 ? 179 GLY D C   1 
ATOM   2766 O  O   . GLY C 1 76  ? 40.991  86.813  -4.527  1.00 55.29 ? 179 GLY D O   1 
ATOM   2767 N  N   . ARG C 1 77  ? 39.818  88.029  -3.031  1.00 52.85 ? 180 ARG D N   1 
ATOM   2768 C  CA  . ARG C 1 77  ? 38.524  87.492  -3.454  1.00 51.26 ? 180 ARG D CA  1 
ATOM   2769 C  C   . ARG C 1 77  ? 37.401  88.525  -3.505  1.00 49.30 ? 180 ARG D C   1 
ATOM   2770 O  O   . ARG C 1 77  ? 37.345  89.453  -2.707  1.00 47.11 ? 180 ARG D O   1 
ATOM   2771 C  CB  . ARG C 1 77  ? 38.105  86.332  -2.544  1.00 53.02 ? 180 ARG D CB  1 
ATOM   2772 C  CG  . ARG C 1 77  ? 37.242  85.291  -3.255  1.00 54.54 ? 180 ARG D CG  1 
ATOM   2773 C  CD  . ARG C 1 77  ? 36.730  84.165  -2.359  1.00 54.73 ? 180 ARG D CD  1 
ATOM   2774 N  NE  . ARG C 1 77  ? 36.610  82.890  -3.075  1.00 54.45 ? 180 ARG D NE  1 
ATOM   2775 C  CZ  . ARG C 1 77  ? 35.669  82.605  -3.979  1.00 55.37 ? 180 ARG D CZ  1 
ATOM   2776 N  NH1 . ARG C 1 77  ? 34.740  83.499  -4.323  1.00 54.71 ? 180 ARG D NH1 1 
ATOM   2777 N  NH2 . ARG C 1 77  ? 35.660  81.408  -4.556  1.00 56.93 ? 180 ARG D NH2 1 
ATOM   2778 N  N   . ARG C 1 78  ? 36.513  88.338  -4.471  1.00 47.93 ? 181 ARG D N   1 
ATOM   2779 C  CA  . ARG C 1 78  ? 35.321  89.147  -4.626  1.00 46.69 ? 181 ARG D CA  1 
ATOM   2780 C  C   . ARG C 1 78  ? 34.124  88.312  -4.169  1.00 44.37 ? 181 ARG D C   1 
ATOM   2781 O  O   . ARG C 1 78  ? 34.061  87.109  -4.427  1.00 44.74 ? 181 ARG D O   1 
ATOM   2782 C  CB  . ARG C 1 78  ? 35.172  89.539  -6.094  1.00 50.46 ? 181 ARG D CB  1 
ATOM   2783 C  CG  . ARG C 1 78  ? 34.340  90.782  -6.358  1.00 54.98 ? 181 ARG D CG  1 
ATOM   2784 C  CD  . ARG C 1 78  ? 34.205  91.078  -7.848  1.00 59.52 ? 181 ARG D CD  1 
ATOM   2785 N  NE  . ARG C 1 78  ? 33.321  92.209  -8.142  1.00 63.85 ? 181 ARG D NE  1 
ATOM   2786 C  CZ  . ARG C 1 78  ? 33.204  92.790  -9.344  1.00 64.57 ? 181 ARG D CZ  1 
ATOM   2787 N  NH1 . ARG C 1 78  ? 33.912  92.350  -10.389 1.00 63.57 ? 181 ARG D NH1 1 
ATOM   2788 N  NH2 . ARG C 1 78  ? 32.374  93.820  -9.502  1.00 61.77 ? 181 ARG D NH2 1 
ATOM   2789 N  N   . GLU C 1 79  ? 33.180  88.934  -3.475  1.00 40.80 ? 182 GLU D N   1 
ATOM   2790 C  CA  . GLU C 1 79  ? 31.955  88.240  -3.098  1.00 38.12 ? 182 GLU D CA  1 
ATOM   2791 C  C   . GLU C 1 79  ? 30.780  89.203  -3.016  1.00 34.14 ? 182 GLU D C   1 
ATOM   2792 O  O   . GLU C 1 79  ? 30.807  90.164  -2.255  1.00 31.28 ? 182 GLU D O   1 
ATOM   2793 C  CB  . GLU C 1 79  ? 32.118  87.507  -1.770  1.00 42.50 ? 182 GLU D CB  1 
ATOM   2794 C  CG  . GLU C 1 79  ? 30.920  86.626  -1.433  1.00 48.27 ? 182 GLU D CG  1 
ATOM   2795 C  CD  . GLU C 1 79  ? 30.874  86.194  0.022   1.00 53.60 ? 182 GLU D CD  1 
ATOM   2796 O  OE1 . GLU C 1 79  ? 30.866  87.073  0.911   1.00 53.93 ? 182 GLU D OE1 1 
ATOM   2797 O  OE2 . GLU C 1 79  ? 30.830  84.966  0.272   1.00 58.82 ? 182 GLU D OE2 1 
ATOM   2798 N  N   . THR C 1 80  ? 29.743  88.937  -3.798  1.00 28.03 ? 183 THR D N   1 
ATOM   2799 C  CA  . THR C 1 80  ? 28.512  89.706  -3.683  1.00 30.19 ? 183 THR D CA  1 
ATOM   2800 C  C   . THR C 1 80  ? 27.795  89.366  -2.383  1.00 25.33 ? 183 THR D C   1 
ATOM   2801 O  O   . THR C 1 80  ? 27.618  88.205  -2.055  1.00 27.83 ? 183 THR D O   1 
ATOM   2802 C  CB  . THR C 1 80  ? 27.599  89.437  -4.863  1.00 28.16 ? 183 THR D CB  1 
ATOM   2803 O  OG1 . THR C 1 80  ? 28.319  89.648  -6.079  1.00 35.46 ? 183 THR D OG1 1 
ATOM   2804 C  CG2 . THR C 1 80  ? 26.469  90.454  -4.907  1.00 29.01 ? 183 THR D CG2 1 
ATOM   2805 N  N   . LEU C 1 81  ? 27.403  90.398  -1.646  1.00 25.78 ? 184 LEU D N   1 
ATOM   2806 C  CA  . LEU C 1 81  ? 26.717  90.236  -0.374  1.00 23.20 ? 184 LEU D CA  1 
ATOM   2807 C  C   . LEU C 1 81  ? 25.214  90.228  -0.610  1.00 23.83 ? 184 LEU D C   1 
ATOM   2808 O  O   . LEU C 1 81  ? 24.511  89.305  -0.192  1.00 24.38 ? 184 LEU D O   1 
ATOM   2809 C  CB  . LEU C 1 81  ? 27.103  91.360  0.591   1.00 26.44 ? 184 LEU D CB  1 
ATOM   2810 C  CG  . LEU C 1 81  ? 28.578  91.434  1.021   1.00 28.94 ? 184 LEU D CG  1 
ATOM   2811 C  CD1 . LEU C 1 81  ? 28.760  92.565  2.019   1.00 32.68 ? 184 LEU D CD1 1 
ATOM   2812 C  CD2 . LEU C 1 81  ? 29.099  90.116  1.611   1.00 25.90 ? 184 LEU D CD2 1 
ATOM   2813 N  N   . PHE C 1 82  ? 24.723  91.258  -1.283  1.00 21.23 ? 185 PHE D N   1 
ATOM   2814 C  CA  . PHE C 1 82  ? 23.323  91.297  -1.705  1.00 23.14 ? 185 PHE D CA  1 
ATOM   2815 C  C   . PHE C 1 82  ? 23.082  92.197  -2.913  1.00 22.55 ? 185 PHE D C   1 
ATOM   2816 O  O   . PHE C 1 82  ? 23.856  93.107  -3.199  1.00 27.20 ? 185 PHE D O   1 
ATOM   2817 C  CB  . PHE C 1 82  ? 22.372  91.666  -0.546  1.00 21.05 ? 185 PHE D CB  1 
ATOM   2818 C  CG  . PHE C 1 82  ? 22.638  93.003  0.084   1.00 22.76 ? 185 PHE D CG  1 
ATOM   2819 C  CD1 . PHE C 1 82  ? 22.040  94.147  -0.405  1.00 25.85 ? 185 PHE D CD1 1 
ATOM   2820 C  CD2 . PHE C 1 82  ? 23.447  93.107  1.196   1.00 24.42 ? 185 PHE D CD2 1 
ATOM   2821 C  CE1 . PHE C 1 82  ? 22.273  95.366  0.181   1.00 26.94 ? 185 PHE D CE1 1 
ATOM   2822 C  CE2 . PHE C 1 82  ? 23.682  94.323  1.786   1.00 24.56 ? 185 PHE D CE2 1 
ATOM   2823 C  CZ  . PHE C 1 82  ? 23.090  95.453  1.286   1.00 24.90 ? 185 PHE D CZ  1 
ATOM   2824 N  N   . ARG C 1 83  ? 22.015  91.880  -3.632  1.00 23.02 ? 186 ARG D N   1 
ATOM   2825 C  CA  . ARG C 1 83  ? 21.538  92.638  -4.773  1.00 27.42 ? 186 ARG D CA  1 
ATOM   2826 C  C   . ARG C 1 83  ? 20.108  93.123  -4.517  1.00 25.99 ? 186 ARG D C   1 
ATOM   2827 O  O   . ARG C 1 83  ? 19.314  92.445  -3.857  1.00 31.47 ? 186 ARG D O   1 
ATOM   2828 C  CB  . ARG C 1 83  ? 21.495  91.751  -6.008  1.00 26.81 ? 186 ARG D CB  1 
ATOM   2829 C  CG  . ARG C 1 83  ? 22.821  91.425  -6.616  1.00 27.82 ? 186 ARG D CG  1 
ATOM   2830 C  CD  . ARG C 1 83  ? 22.884  89.985  -7.137  1.00 27.57 ? 186 ARG D CD  1 
ATOM   2831 N  NE  . ARG C 1 83  ? 21.963  89.786  -8.236  1.00 25.66 ? 186 ARG D NE  1 
ATOM   2832 C  CZ  . ARG C 1 83  ? 21.358  88.644  -8.552  1.00 25.33 ? 186 ARG D CZ  1 
ATOM   2833 N  NH1 . ARG C 1 83  ? 21.524  87.524  -7.851  1.00 26.04 ? 186 ARG D NH1 1 
ATOM   2834 N  NH2 . ARG C 1 83  ? 20.567  88.631  -9.607  1.00 29.26 ? 186 ARG D NH2 1 
ATOM   2835 N  N   . CYS C 1 84  ? 19.790  94.287  -5.057  1.00 25.52 ? 187 CYS D N   1 
ATOM   2836 C  CA  . CYS C 1 84  ? 18.419  94.788  -5.119  1.00 31.98 ? 187 CYS D CA  1 
ATOM   2837 C  C   . CYS C 1 84  ? 18.093  94.994  -6.612  1.00 28.57 ? 187 CYS D C   1 
ATOM   2838 O  O   . CYS C 1 84  ? 18.949  95.450  -7.370  1.00 28.71 ? 187 CYS D O   1 
ATOM   2839 C  CB  . CYS C 1 84  ? 18.291  96.088  -4.309  1.00 34.21 ? 187 CYS D CB  1 
ATOM   2840 S  SG  . CYS C 1 84  ? 16.606  96.737  -4.182  1.00 46.59 ? 187 CYS D SG  1 
ATOM   2841 N  N   . ILE C 1 85  ? 16.894  94.605  -7.042  1.00 25.63 ? 188 ILE D N   1 
ATOM   2842 C  CA  . ILE C 1 85  ? 16.489  94.714  -8.452  1.00 22.18 ? 188 ILE D CA  1 
ATOM   2843 C  C   . ILE C 1 85  ? 15.063  95.242  -8.565  1.00 23.98 ? 188 ILE D C   1 
ATOM   2844 O  O   . ILE C 1 85  ? 14.157  94.770  -7.883  1.00 22.94 ? 188 ILE D O   1 
ATOM   2845 C  CB  . ILE C 1 85  ? 16.602  93.341  -9.186  1.00 25.37 ? 188 ILE D CB  1 
ATOM   2846 C  CG1 . ILE C 1 85  ? 18.056  92.854  -9.220  1.00 29.13 ? 188 ILE D CG1 1 
ATOM   2847 C  CG2 . ILE C 1 85  ? 16.082  93.447  -10.621 1.00 26.20 ? 188 ILE D CG2 1 
ATOM   2848 C  CD1 . ILE C 1 85  ? 18.208  91.390  -9.477  1.00 31.22 ? 188 ILE D CD1 1 
ATOM   2849 N  N   . ARG C 1 86  ? 14.866  96.201  -9.460  1.00 22.81 ? 189 ARG D N   1 
ATOM   2850 C  CA  . ARG C 1 86  ? 13.575  96.827  -9.646  1.00 26.39 ? 189 ARG D CA  1 
ATOM   2851 C  C   . ARG C 1 86  ? 13.333  97.048  -11.144 1.00 23.88 ? 189 ARG D C   1 
ATOM   2852 O  O   . ARG C 1 86  ? 14.139  97.660  -11.819 1.00 19.99 ? 189 ARG D O   1 
ATOM   2853 C  CB  . ARG C 1 86  ? 13.559  98.140  -8.858  1.00 31.17 ? 189 ARG D CB  1 
ATOM   2854 C  CG  . ARG C 1 86  ? 12.183  98.690  -8.472  1.00 41.40 ? 189 ARG D CG  1 
ATOM   2855 C  CD  . ARG C 1 86  ? 11.192  97.732  -7.793  1.00 46.37 ? 189 ARG D CD  1 
ATOM   2856 N  NE  . ARG C 1 86  ? 11.821  96.705  -6.955  1.00 50.20 ? 189 ARG D NE  1 
ATOM   2857 C  CZ  . ARG C 1 86  ? 12.335  96.915  -5.750  1.00 49.19 ? 189 ARG D CZ  1 
ATOM   2858 N  NH1 . ARG C 1 86  ? 12.326  98.120  -5.207  1.00 51.57 ? 189 ARG D NH1 1 
ATOM   2859 N  NH2 . ARG C 1 86  ? 12.874  95.907  -5.087  1.00 51.93 ? 189 ARG D NH2 1 
ATOM   2860 N  N   . SER C 1 87  ? 12.249  96.499  -11.670 1.00 19.50 ? 190 SER D N   1 
ATOM   2861 C  CA  . SER C 1 87  ? 11.778  96.868  -12.996 1.00 22.55 ? 190 SER D CA  1 
ATOM   2862 C  C   . SER C 1 87  ? 11.316  98.330  -13.023 1.00 21.32 ? 190 SER D C   1 
ATOM   2863 O  O   . SER C 1 87  ? 10.727  98.817  -12.057 1.00 19.61 ? 190 SER D O   1 
ATOM   2864 C  CB  . SER C 1 87  ? 10.635  95.958  -13.402 1.00 23.42 ? 190 SER D CB  1 
ATOM   2865 O  OG  . SER C 1 87  ? 11.112  94.623  -13.482 1.00 29.74 ? 190 SER D OG  1 
ATOM   2866 N  N   . MET C 1 88  ? 11.596  99.023  -14.122 1.00 21.94 ? 191 MET D N   1 
ATOM   2867 C  CA  . MET C 1 88  ? 11.257  100.438 -14.247 1.00 24.50 ? 191 MET D CA  1 
ATOM   2868 C  C   . MET C 1 88  ? 10.217  100.634 -15.344 1.00 23.92 ? 191 MET D C   1 
ATOM   2869 O  O   . MET C 1 88  ? 10.212  99.895  -16.309 1.00 18.96 ? 191 MET D O   1 
ATOM   2870 C  CB  . MET C 1 88  ? 12.503  101.260 -14.575 1.00 23.78 ? 191 MET D CB  1 
ATOM   2871 C  CG  . MET C 1 88  ? 13.677  101.057 -13.614 1.00 23.35 ? 191 MET D CG  1 
ATOM   2872 S  SD  . MET C 1 88  ? 13.402  101.648 -11.922 1.00 25.72 ? 191 MET D SD  1 
ATOM   2873 C  CE  . MET C 1 88  ? 13.037  103.417 -12.182 1.00 25.47 ? 191 MET D CE  1 
ATOM   2874 N  N   . PRO C 1 89  ? 9.310   101.599 -15.174 1.00 26.71 ? 192 PRO D N   1 
ATOM   2875 C  CA  . PRO C 1 89  ? 8.449   102.057 -16.273 1.00 23.41 ? 192 PRO D CA  1 
ATOM   2876 C  C   . PRO C 1 89  ? 9.254   102.549 -17.482 1.00 21.63 ? 192 PRO D C   1 
ATOM   2877 O  O   . PRO C 1 89  ? 10.390  103.012 -17.352 1.00 24.52 ? 192 PRO D O   1 
ATOM   2878 C  CB  . PRO C 1 89  ? 7.665   103.226 -15.653 1.00 22.31 ? 192 PRO D CB  1 
ATOM   2879 C  CG  . PRO C 1 89  ? 7.708   102.997 -14.189 1.00 25.64 ? 192 PRO D CG  1 
ATOM   2880 C  CD  . PRO C 1 89  ? 9.002   102.285 -13.908 1.00 25.77 ? 192 PRO D CD  1 
ATOM   2881 N  N   . SER C 1 90  ? 8.668   102.440 -18.657 1.00 23.44 ? 193 SER D N   1 
ATOM   2882 C  CA  . SER C 1 90  ? 9.368   102.821 -19.884 1.00 26.18 ? 193 SER D CA  1 
ATOM   2883 C  C   . SER C 1 90  ? 9.203   104.311 -20.245 1.00 26.56 ? 193 SER D C   1 
ATOM   2884 O  O   . SER C 1 90  ? 9.925   104.817 -21.098 1.00 29.77 ? 193 SER D O   1 
ATOM   2885 C  CB  . SER C 1 90  ? 8.914   101.925 -21.026 1.00 25.04 ? 193 SER D CB  1 
ATOM   2886 O  OG  . SER C 1 90  ? 7.529   102.089 -21.265 1.00 28.10 ? 193 SER D OG  1 
ATOM   2887 N  N   . ASP C 1 91  ? 8.278   105.009 -19.588 1.00 28.46 ? 194 ASP D N   1 
ATOM   2888 C  CA  . ASP C 1 91  ? 8.076   106.443 -19.810 1.00 30.23 ? 194 ASP D CA  1 
ATOM   2889 C  C   . ASP C 1 91  ? 8.941   107.257 -18.841 1.00 29.12 ? 194 ASP D C   1 
ATOM   2890 O  O   . ASP C 1 91  ? 8.827   107.075 -17.641 1.00 30.92 ? 194 ASP D O   1 
ATOM   2891 C  CB  . ASP C 1 91  ? 6.601   106.803 -19.623 1.00 34.71 ? 194 ASP D CB  1 
ATOM   2892 C  CG  . ASP C 1 91  ? 6.311   108.253 -19.945 1.00 42.19 ? 194 ASP D CG  1 
ATOM   2893 O  OD1 . ASP C 1 91  ? 5.916   108.540 -21.094 1.00 49.32 ? 194 ASP D OD1 1 
ATOM   2894 O  OD2 . ASP C 1 91  ? 6.454   109.182 -19.123 1.00 45.02 ? 194 ASP D OD2 1 
ATOM   2895 N  N   . PRO C 1 92  ? 9.787   108.163 -19.344 1.00 31.93 ? 195 PRO D N   1 
ATOM   2896 C  CA  . PRO C 1 92  ? 10.721  108.920 -18.485 1.00 30.82 ? 195 PRO D CA  1 
ATOM   2897 C  C   . PRO C 1 92  ? 10.075  109.754 -17.369 1.00 32.61 ? 195 PRO D C   1 
ATOM   2898 O  O   . PRO C 1 92  ? 10.614  109.820 -16.268 1.00 34.10 ? 195 PRO D O   1 
ATOM   2899 C  CB  . PRO C 1 92  ? 11.458  109.841 -19.468 1.00 32.20 ? 195 PRO D CB  1 
ATOM   2900 C  CG  . PRO C 1 92  ? 11.199  109.294 -20.824 1.00 31.55 ? 195 PRO D CG  1 
ATOM   2901 C  CD  . PRO C 1 92  ? 9.911   108.541 -20.765 1.00 30.38 ? 195 PRO D CD  1 
ATOM   2902 N  N   . ASP C 1 93  ? 8.935   110.372 -17.647 1.00 35.72 ? 196 ASP D N   1 
ATOM   2903 C  CA  . ASP C 1 93  ? 8.221   111.160 -16.638 1.00 36.79 ? 196 ASP D CA  1 
ATOM   2904 C  C   . ASP C 1 93  ? 7.696   110.336 -15.467 1.00 33.66 ? 196 ASP D C   1 
ATOM   2905 O  O   . ASP C 1 93  ? 7.409   110.897 -14.415 1.00 33.97 ? 196 ASP D O   1 
ATOM   2906 C  CB  . ASP C 1 93  ? 7.027   111.882 -17.272 1.00 38.25 ? 196 ASP D CB  1 
ATOM   2907 C  CG  . ASP C 1 93  ? 7.439   112.955 -18.255 1.00 40.15 ? 196 ASP D CG  1 
ATOM   2908 O  OD1 . ASP C 1 93  ? 8.588   113.443 -18.148 1.00 42.85 ? 196 ASP D OD1 1 
ATOM   2909 O  OD2 . ASP C 1 93  ? 6.665   113.381 -19.151 1.00 36.87 ? 196 ASP D OD2 1 
ATOM   2910 N  N   . ARG C 1 94  ? 7.542   109.025 -15.669 1.00 33.06 ? 197 ARG D N   1 
ATOM   2911 C  CA  . ARG C 1 94  ? 6.921   108.114 -14.695 1.00 31.46 ? 197 ARG D CA  1 
ATOM   2912 C  C   . ARG C 1 94  ? 7.917   107.183 -13.982 1.00 30.33 ? 197 ARG D C   1 
ATOM   2913 O  O   . ARG C 1 94  ? 7.578   106.521 -12.997 1.00 36.26 ? 197 ARG D O   1 
ATOM   2914 C  CB  . ARG C 1 94  ? 5.874   107.257 -15.417 1.00 32.86 ? 197 ARG D CB  1 
ATOM   2915 C  CG  . ARG C 1 94  ? 4.595   108.002 -15.763 1.00 37.30 ? 197 ARG D CG  1 
ATOM   2916 C  CD  . ARG C 1 94  ? 3.656   107.239 -16.692 1.00 39.68 ? 197 ARG D CD  1 
ATOM   2917 N  NE  . ARG C 1 94  ? 3.042   106.091 -16.024 1.00 44.37 ? 197 ARG D NE  1 
ATOM   2918 C  CZ  . ARG C 1 94  ? 1.782   106.029 -15.577 1.00 45.51 ? 197 ARG D CZ  1 
ATOM   2919 N  NH1 . ARG C 1 94  ? 0.946   107.056 -15.703 1.00 45.20 ? 197 ARG D NH1 1 
ATOM   2920 N  NH2 . ARG C 1 94  ? 1.352   104.919 -14.990 1.00 44.98 ? 197 ARG D NH2 1 
ATOM   2921 N  N   . ALA C 1 95  ? 9.143   107.137 -14.476 1.00 27.48 ? 198 ALA D N   1 
ATOM   2922 C  CA  . ALA C 1 95  ? 10.093  106.098 -14.107 1.00 28.09 ? 198 ALA D CA  1 
ATOM   2923 C  C   . ALA C 1 95  ? 10.892  106.442 -12.836 1.00 29.27 ? 198 ALA D C   1 
ATOM   2924 O  O   . ALA C 1 95  ? 12.040  106.879 -12.904 1.00 31.38 ? 198 ALA D O   1 
ATOM   2925 C  CB  . ALA C 1 95  ? 11.036  105.823 -15.296 1.00 26.37 ? 198 ALA D CB  1 
ATOM   2926 N  N   . TYR C 1 96  ? 10.276  106.221 -11.681 1.00 24.24 ? 199 TYR D N   1 
ATOM   2927 C  CA  . TYR C 1 96  ? 10.916  106.460 -10.391 1.00 20.40 ? 199 TYR D CA  1 
ATOM   2928 C  C   . TYR C 1 96  ? 10.740  105.223 -9.523  1.00 22.16 ? 199 TYR D C   1 
ATOM   2929 O  O   . TYR C 1 96  ? 9.633   104.699 -9.434  1.00 22.61 ? 199 TYR D O   1 
ATOM   2930 C  CB  . TYR C 1 96  ? 10.256  107.638 -9.675  1.00 24.24 ? 199 TYR D CB  1 
ATOM   2931 C  CG  . TYR C 1 96  ? 10.461  109.004 -10.287 1.00 23.39 ? 199 TYR D CG  1 
ATOM   2932 C  CD1 . TYR C 1 96  ? 9.582   109.503 -11.239 1.00 26.75 ? 199 TYR D CD1 1 
ATOM   2933 C  CD2 . TYR C 1 96  ? 11.519  109.808 -9.881  1.00 28.69 ? 199 TYR D CD2 1 
ATOM   2934 C  CE1 . TYR C 1 96  ? 9.763   110.768 -11.787 1.00 30.37 ? 199 TYR D CE1 1 
ATOM   2935 C  CE2 . TYR C 1 96  ? 11.710  111.069 -10.411 1.00 28.96 ? 199 TYR D CE2 1 
ATOM   2936 C  CZ  . TYR C 1 96  ? 10.831  111.544 -11.363 1.00 29.14 ? 199 TYR D CZ  1 
ATOM   2937 O  OH  . TYR C 1 96  ? 11.026  112.792 -11.884 1.00 29.71 ? 199 TYR D OH  1 
ATOM   2938 N  N   . ASN C 1 97  ? 11.817  104.761 -8.884  1.00 25.16 ? 200 ASN D N   1 
ATOM   2939 C  CA  . ASN C 1 97  ? 11.739  103.644 -7.938  1.00 23.97 ? 200 ASN D CA  1 
ATOM   2940 C  C   . ASN C 1 97  ? 12.919  103.715 -6.992  1.00 24.07 ? 200 ASN D C   1 
ATOM   2941 O  O   . ASN C 1 97  ? 14.047  103.908 -7.431  1.00 26.60 ? 200 ASN D O   1 
ATOM   2942 C  CB  . ASN C 1 97  ? 11.792  102.281 -8.644  1.00 23.96 ? 200 ASN D CB  1 
ATOM   2943 C  CG  . ASN C 1 97  ? 10.429  101.770 -9.108  1.00 24.10 ? 200 ASN D CG  1 
ATOM   2944 O  OD1 . ASN C 1 97  ? 9.497   101.653 -8.320  1.00 23.04 ? 200 ASN D OD1 1 
ATOM   2945 N  ND2 . ASN C 1 97  ? 10.322  101.446 -10.410 1.00 21.58 ? 200 ASN D ND2 1 
ATOM   2946 N  N   . SER C 1 98  ? 12.676  103.540 -5.695  1.00 24.22 ? 201 SER D N   1 
ATOM   2947 C  CA  . SER C 1 98  ? 13.769  103.312 -4.767  1.00 26.29 ? 201 SER D CA  1 
ATOM   2948 C  C   . SER C 1 98  ? 13.949  101.796 -4.674  1.00 28.51 ? 201 SER D C   1 
ATOM   2949 O  O   . SER C 1 98  ? 13.009  101.025 -4.916  1.00 25.28 ? 201 SER D O   1 
ATOM   2950 C  CB  . SER C 1 98  ? 13.504  103.937 -3.395  1.00 26.70 ? 201 SER D CB  1 
ATOM   2951 O  OG  . SER C 1 98  ? 12.396  103.331 -2.756  1.00 27.94 ? 201 SER D OG  1 
ATOM   2952 N  N   . CYS C 1 99  ? 15.175  101.386 -4.380  1.00 25.75 ? 202 CYS D N   1 
ATOM   2953 C  CA  . CYS C 1 99  ? 15.543  99.987  -4.260  1.00 29.46 ? 202 CYS D CA  1 
ATOM   2954 C  C   . CYS C 1 99  ? 16.335  99.840  -2.948  1.00 27.58 ? 202 CYS D C   1 
ATOM   2955 O  O   . CYS C 1 99  ? 17.433  100.374 -2.815  1.00 28.15 ? 202 CYS D O   1 
ATOM   2956 C  CB  . CYS C 1 99  ? 16.378  99.571  -5.472  1.00 34.58 ? 202 CYS D CB  1 
ATOM   2957 S  SG  . CYS C 1 99  ? 16.236  97.829  -5.876  1.00 44.80 ? 202 CYS D SG  1 
ATOM   2958 N  N   . TYR C 1 100 ? 15.750  99.146  -1.985  1.00 22.42 ? 203 TYR D N   1 
ATOM   2959 C  CA  . TYR C 1 100 ? 16.337  98.968  -0.661  1.00 27.36 ? 203 TYR D CA  1 
ATOM   2960 C  C   . TYR C 1 100 ? 16.597  97.494  -0.429  1.00 28.84 ? 203 TYR D C   1 
ATOM   2961 O  O   . TYR C 1 100 ? 15.764  96.641  -0.768  1.00 28.90 ? 203 TYR D O   1 
ATOM   2962 C  CB  . TYR C 1 100 ? 15.407  99.501  0.449   1.00 24.28 ? 203 TYR D CB  1 
ATOM   2963 C  CG  . TYR C 1 100 ? 15.949  99.299  1.862   1.00 24.45 ? 203 TYR D CG  1 
ATOM   2964 C  CD1 . TYR C 1 100 ? 15.863  98.060  2.499   1.00 23.88 ? 203 TYR D CD1 1 
ATOM   2965 C  CD2 . TYR C 1 100 ? 16.548  100.350 2.567   1.00 23.31 ? 203 TYR D CD2 1 
ATOM   2966 C  CE1 . TYR C 1 100 ? 16.373  97.871  3.783   1.00 25.96 ? 203 TYR D CE1 1 
ATOM   2967 C  CE2 . TYR C 1 100 ? 17.056  100.162 3.862   1.00 21.05 ? 203 TYR D CE2 1 
ATOM   2968 C  CZ  . TYR C 1 100 ? 16.967  98.926  4.456   1.00 24.95 ? 203 TYR D CZ  1 
ATOM   2969 O  OH  . TYR C 1 100 ? 17.446  98.722  5.727   1.00 29.09 ? 203 TYR D OH  1 
ATOM   2970 N  N   . SER C 1 101 ? 17.760  97.200  0.146   1.00 27.29 ? 204 SER D N   1 
ATOM   2971 C  CA  . SER C 1 101 ? 18.057  95.870  0.642   1.00 25.14 ? 204 SER D CA  1 
ATOM   2972 C  C   . SER C 1 101 ? 19.068  95.940  1.768   1.00 27.95 ? 204 SER D C   1 
ATOM   2973 O  O   . SER C 1 101 ? 19.747  96.955  1.951   1.00 25.69 ? 204 SER D O   1 
ATOM   2974 C  CB  . SER C 1 101 ? 18.587  94.972  -0.474  1.00 27.95 ? 204 SER D CB  1 
ATOM   2975 O  OG  . SER C 1 101 ? 18.701  93.635  -0.011  1.00 27.74 ? 204 SER D OG  1 
ATOM   2976 N  N   . ALA C 1 102 ? 19.154  94.850  2.527   1.00 23.75 ? 205 ALA D N   1 
ATOM   2977 C  CA  . ALA C 1 102 ? 20.014  94.791  3.701   1.00 23.35 ? 205 ALA D CA  1 
ATOM   2978 C  C   . ALA C 1 102 ? 20.242  93.362  4.163   1.00 24.37 ? 205 ALA D C   1 
ATOM   2979 O  O   . ALA C 1 102 ? 19.459  92.453  3.872   1.00 29.89 ? 205 ALA D O   1 
ATOM   2980 C  CB  . ALA C 1 102 ? 19.406  95.595  4.833   1.00 19.15 ? 205 ALA D CB  1 
ATOM   2981 N  N   . GLY C 1 103 ? 21.320  93.169  4.903   1.00 25.66 ? 206 GLY D N   1 
ATOM   2982 C  CA  . GLY C 1 103 ? 21.580  91.889  5.537   1.00 24.58 ? 206 GLY D CA  1 
ATOM   2983 C  C   . GLY C 1 103 ? 22.675  92.000  6.567   1.00 22.18 ? 206 GLY D C   1 
ATOM   2984 O  O   . GLY C 1 103 ? 23.239  93.063  6.759   1.00 23.87 ? 206 GLY D O   1 
ATOM   2985 N  N   . VAL C 1 104 ? 22.976  90.877  7.201   1.00 22.07 ? 207 VAL D N   1 
ATOM   2986 C  CA  . VAL C 1 104 ? 24.011  90.777  8.203   1.00 21.67 ? 207 VAL D CA  1 
ATOM   2987 C  C   . VAL C 1 104 ? 25.176  89.941  7.663   1.00 19.46 ? 207 VAL D C   1 
ATOM   2988 O  O   . VAL C 1 104 ? 24.989  88.825  7.180   1.00 17.81 ? 207 VAL D O   1 
ATOM   2989 C  CB  . VAL C 1 104 ? 23.439  90.125  9.470   1.00 22.97 ? 207 VAL D CB  1 
ATOM   2990 C  CG1 . VAL C 1 104 ? 24.507  89.982  10.520  1.00 24.13 ? 207 VAL D CG1 1 
ATOM   2991 C  CG2 . VAL C 1 104 ? 22.265  90.952  9.991   1.00 21.14 ? 207 VAL D CG2 1 
ATOM   2992 N  N   . PHE C 1 105 ? 26.385  90.480  7.769   1.00 21.21 ? 208 PHE D N   1 
ATOM   2993 C  CA  . PHE C 1 105 ? 27.559  89.859  7.173   1.00 21.43 ? 208 PHE D CA  1 
ATOM   2994 C  C   . PHE C 1 105 ? 28.772  89.961  8.082   1.00 18.88 ? 208 PHE D C   1 
ATOM   2995 O  O   . PHE C 1 105 ? 28.934  90.927  8.808   1.00 22.04 ? 208 PHE D O   1 
ATOM   2996 C  CB  . PHE C 1 105 ? 27.844  90.502  5.812   1.00 23.14 ? 208 PHE D CB  1 
ATOM   2997 C  CG  . PHE C 1 105 ? 26.683  90.413  4.877   1.00 20.44 ? 208 PHE D CG  1 
ATOM   2998 C  CD1 . PHE C 1 105 ? 26.461  89.256  4.154   1.00 19.71 ? 208 PHE D CD1 1 
ATOM   2999 C  CD2 . PHE C 1 105 ? 25.775  91.446  4.783   1.00 21.64 ? 208 PHE D CD2 1 
ATOM   3000 C  CE1 . PHE C 1 105 ? 25.364  89.136  3.331   1.00 17.90 ? 208 PHE D CE1 1 
ATOM   3001 C  CE2 . PHE C 1 105 ? 24.666  91.338  3.967   1.00 20.62 ? 208 PHE D CE2 1 
ATOM   3002 C  CZ  . PHE C 1 105 ? 24.466  90.188  3.233   1.00 20.58 ? 208 PHE D CZ  1 
ATOM   3003 N  N   . HIS C 1 106 ? 29.601  88.933  8.044   1.00 16.29 ? 209 HIS D N   1 
ATOM   3004 C  CA  . HIS C 1 106 ? 30.899  88.963  8.677   1.00 24.04 ? 209 HIS D CA  1 
ATOM   3005 C  C   . HIS C 1 106 ? 31.881  89.736  7.791   1.00 25.12 ? 209 HIS D C   1 
ATOM   3006 O  O   . HIS C 1 106 ? 32.231  89.289  6.698   1.00 26.29 ? 209 HIS D O   1 
ATOM   3007 C  CB  . HIS C 1 106 ? 31.405  87.541  8.899   1.00 22.63 ? 209 HIS D CB  1 
ATOM   3008 C  CG  . HIS C 1 106 ? 32.378  87.410  10.026  1.00 22.99 ? 209 HIS D CG  1 
ATOM   3009 N  ND1 . HIS C 1 106 ? 32.935  86.204  10.383  1.00 29.11 ? 209 HIS D ND1 1 
ATOM   3010 C  CD2 . HIS C 1 106 ? 32.887  88.323  10.884  1.00 26.80 ? 209 HIS D CD2 1 
ATOM   3011 C  CE1 . HIS C 1 106 ? 33.742  86.377  11.414  1.00 30.91 ? 209 HIS D CE1 1 
ATOM   3012 N  NE2 . HIS C 1 106 ? 33.731  87.656  11.738  1.00 28.80 ? 209 HIS D NE2 1 
ATOM   3013 N  N   . LEU C 1 107 ? 32.300  90.903  8.264   1.00 25.80 ? 210 LEU D N   1 
ATOM   3014 C  CA  . LEU C 1 107 ? 33.321  91.692  7.594   1.00 25.68 ? 210 LEU D CA  1 
ATOM   3015 C  C   . LEU C 1 107 ? 34.673  91.569  8.306   1.00 28.58 ? 210 LEU D C   1 
ATOM   3016 O  O   . LEU C 1 107 ? 34.748  91.545  9.528   1.00 30.70 ? 210 LEU D O   1 
ATOM   3017 C  CB  . LEU C 1 107 ? 32.865  93.139  7.498   1.00 22.35 ? 210 LEU D CB  1 
ATOM   3018 C  CG  . LEU C 1 107 ? 31.483  93.299  6.851   1.00 24.89 ? 210 LEU D CG  1 
ATOM   3019 C  CD1 . LEU C 1 107 ? 31.095  94.763  6.723   1.00 23.79 ? 210 LEU D CD1 1 
ATOM   3020 C  CD2 . LEU C 1 107 ? 31.429  92.589  5.490   1.00 27.31 ? 210 LEU D CD2 1 
ATOM   3021 N  N   . HIS C 1 108 ? 35.740  91.465  7.527   1.00 32.10 ? 211 HIS D N   1 
ATOM   3022 C  CA  . HIS C 1 108 ? 37.084  91.280  8.067   1.00 33.12 ? 211 HIS D CA  1 
ATOM   3023 C  C   . HIS C 1 108 ? 37.919  92.546  7.828   1.00 27.11 ? 211 HIS D C   1 
ATOM   3024 O  O   . HIS C 1 108 ? 37.764  93.222  6.811   1.00 19.36 ? 211 HIS D O   1 
ATOM   3025 C  CB  . HIS C 1 108 ? 37.746  90.045  7.437   1.00 38.52 ? 211 HIS D CB  1 
ATOM   3026 C  CG  . HIS C 1 108 ? 38.695  89.337  8.356   1.00 48.62 ? 211 HIS D CG  1 
ATOM   3027 N  ND1 . HIS C 1 108 ? 38.282  88.397  9.276   1.00 53.45 ? 211 HIS D ND1 1 
ATOM   3028 C  CD2 . HIS C 1 108 ? 40.039  89.446  8.508   1.00 52.22 ? 211 HIS D CD2 1 
ATOM   3029 C  CE1 . HIS C 1 108 ? 39.330  87.955  9.952   1.00 54.66 ? 211 HIS D CE1 1 
ATOM   3030 N  NE2 . HIS C 1 108 ? 40.407  88.573  9.503   1.00 53.78 ? 211 HIS D NE2 1 
ATOM   3031 N  N   . GLN C 1 109 ? 38.779  92.873  8.785   1.00 24.52 ? 212 GLN D N   1 
ATOM   3032 C  CA  . GLN C 1 109 ? 39.728  93.976  8.651   1.00 27.43 ? 212 GLN D CA  1 
ATOM   3033 C  C   . GLN C 1 109 ? 40.444  93.892  7.301   1.00 25.00 ? 212 GLN D C   1 
ATOM   3034 O  O   . GLN C 1 109 ? 40.844  92.804  6.864   1.00 22.06 ? 212 GLN D O   1 
ATOM   3035 C  CB  . GLN C 1 109 ? 40.753  93.929  9.794   1.00 32.05 ? 212 GLN D CB  1 
ATOM   3036 C  CG  . GLN C 1 109 ? 41.889  94.957  9.691   1.00 36.23 ? 212 GLN D CG  1 
ATOM   3037 C  CD  . GLN C 1 109 ? 42.955  94.757  10.753  1.00 39.19 ? 212 GLN D CD  1 
ATOM   3038 O  OE1 . GLN C 1 109 ? 43.973  94.106  10.502  1.00 40.77 ? 212 GLN D OE1 1 
ATOM   3039 N  NE2 . GLN C 1 109 ? 42.728  95.320  11.938  1.00 38.90 ? 212 GLN D NE2 1 
ATOM   3040 N  N   . GLY C 1 110 ? 40.603  95.047  6.656   1.00 22.69 ? 213 GLY D N   1 
ATOM   3041 C  CA  . GLY C 1 110 ? 41.153  95.132  5.315   1.00 23.02 ? 213 GLY D CA  1 
ATOM   3042 C  C   . GLY C 1 110 ? 40.137  95.065  4.186   1.00 25.06 ? 213 GLY D C   1 
ATOM   3043 O  O   . GLY C 1 110 ? 40.466  95.396  3.050   1.00 32.00 ? 213 GLY D O   1 
ATOM   3044 N  N   . ASP C 1 111 ? 38.906  94.657  4.473   1.00 24.88 ? 214 ASP D N   1 
ATOM   3045 C  CA  . ASP C 1 111 ? 37.912  94.466  3.412   1.00 23.89 ? 214 ASP D CA  1 
ATOM   3046 C  C   . ASP C 1 111 ? 37.520  95.798  2.811   1.00 24.21 ? 214 ASP D C   1 
ATOM   3047 O  O   . ASP C 1 111 ? 37.617  96.838  3.453   1.00 23.46 ? 214 ASP D O   1 
ATOM   3048 C  CB  . ASP C 1 111 ? 36.639  93.792  3.927   1.00 24.27 ? 214 ASP D CB  1 
ATOM   3049 C  CG  . ASP C 1 111 ? 36.775  92.276  4.079   1.00 29.55 ? 214 ASP D CG  1 
ATOM   3050 O  OD1 . ASP C 1 111 ? 37.834  91.693  3.753   1.00 31.57 ? 214 ASP D OD1 1 
ATOM   3051 O  OD2 . ASP C 1 111 ? 35.835  91.583  4.528   1.00 29.94 ? 214 ASP D OD2 1 
ATOM   3052 N  N   . ILE C 1 112 ? 37.051  95.741  1.575   1.00 25.64 ? 215 ILE D N   1 
ATOM   3053 C  CA  . ILE C 1 112 ? 36.543  96.900  0.867   1.00 24.74 ? 215 ILE D CA  1 
ATOM   3054 C  C   . ILE C 1 112 ? 35.103  96.581  0.495   1.00 26.02 ? 215 ILE D C   1 
ATOM   3055 O  O   . ILE C 1 112 ? 34.839  95.562  -0.134  1.00 26.86 ? 215 ILE D O   1 
ATOM   3056 C  CB  . ILE C 1 112 ? 37.434  97.154  -0.366  1.00 27.07 ? 215 ILE D CB  1 
ATOM   3057 C  CG1 . ILE C 1 112 ? 38.755  97.803  0.069   1.00 31.03 ? 215 ILE D CG1 1 
ATOM   3058 C  CG2 . ILE C 1 112 ? 36.751  98.027  -1.395  1.00 29.01 ? 215 ILE D CG2 1 
ATOM   3059 C  CD1 . ILE C 1 112 ? 39.959  97.369  -0.779  1.00 34.69 ? 215 ILE D CD1 1 
ATOM   3060 N  N   . ILE C 1 113 ? 34.171  97.429  0.919   1.00 28.29 ? 216 ILE D N   1 
ATOM   3061 C  CA  . ILE C 1 113 ? 32.769  97.290  0.558   1.00 28.75 ? 216 ILE D CA  1 
ATOM   3062 C  C   . ILE C 1 113 ? 32.463  98.247  -0.590  1.00 31.40 ? 216 ILE D C   1 
ATOM   3063 O  O   . ILE C 1 113 ? 32.771  99.434  -0.505  1.00 30.80 ? 216 ILE D O   1 
ATOM   3064 C  CB  . ILE C 1 113 ? 31.851  97.620  1.755   1.00 29.35 ? 216 ILE D CB  1 
ATOM   3065 C  CG1 . ILE C 1 113 ? 32.255  96.838  3.009   1.00 29.46 ? 216 ILE D CG1 1 
ATOM   3066 C  CG2 . ILE C 1 113 ? 30.382  97.390  1.381   1.00 31.05 ? 216 ILE D CG2 1 
ATOM   3067 C  CD1 . ILE C 1 113 ? 32.390  95.350  2.808   1.00 31.64 ? 216 ILE D CD1 1 
ATOM   3068 N  N   . THR C 1 114 ? 31.854  97.720  -1.649  1.00 31.19 ? 217 THR D N   1 
ATOM   3069 C  CA  . THR C 1 114 ? 31.494  98.489  -2.845  1.00 31.11 ? 217 THR D CA  1 
ATOM   3070 C  C   . THR C 1 114 ? 29.981  98.458  -3.063  1.00 30.81 ? 217 THR D C   1 
ATOM   3071 O  O   . THR C 1 114 ? 29.325  97.453  -2.772  1.00 28.60 ? 217 THR D O   1 
ATOM   3072 C  CB  . THR C 1 114 ? 32.182  97.899  -4.110  1.00 32.01 ? 217 THR D CB  1 
ATOM   3073 O  OG1 . THR C 1 114 ? 32.034  96.471  -4.134  1.00 36.30 ? 217 THR D OG1 1 
ATOM   3074 C  CG2 . THR C 1 114 ? 33.684  98.116  -4.098  1.00 32.70 ? 217 THR D CG2 1 
ATOM   3075 N  N   . VAL C 1 115 ? 29.433  99.567  -3.553  1.00 29.86 ? 218 VAL D N   1 
ATOM   3076 C  CA  . VAL C 1 115 ? 28.065  99.604  -4.084  1.00 30.15 ? 218 VAL D CA  1 
ATOM   3077 C  C   . VAL C 1 115 ? 28.116  100.033 -5.556  1.00 29.95 ? 218 VAL D C   1 
ATOM   3078 O  O   . VAL C 1 115 ? 28.509  101.148 -5.865  1.00 31.18 ? 218 VAL D O   1 
ATOM   3079 C  CB  . VAL C 1 115 ? 27.175  100.569 -3.301  1.00 32.25 ? 218 VAL D CB  1 
ATOM   3080 C  CG1 . VAL C 1 115 ? 25.731  100.590 -3.883  1.00 31.37 ? 218 VAL D CG1 1 
ATOM   3081 C  CG2 . VAL C 1 115 ? 27.179  100.192 -1.814  1.00 34.60 ? 218 VAL D CG2 1 
ATOM   3082 N  N   . LYS C 1 116 ? 27.709  99.134  -6.445  1.00 29.41 ? 219 LYS D N   1 
ATOM   3083 C  CA  . LYS C 1 116 ? 27.841  99.318  -7.882  1.00 30.38 ? 219 LYS D CA  1 
ATOM   3084 C  C   . LYS C 1 116 ? 26.496  99.137  -8.566  1.00 30.65 ? 219 LYS D C   1 
ATOM   3085 O  O   . LYS C 1 116 ? 25.783  98.160  -8.308  1.00 26.48 ? 219 LYS D O   1 
ATOM   3086 C  CB  . LYS C 1 116 ? 28.819  98.299  -8.445  1.00 28.20 ? 219 LYS D CB  1 
ATOM   3087 C  CG  . LYS C 1 116 ? 30.245  98.522  -8.003  1.00 32.06 ? 219 LYS D CG  1 
ATOM   3088 C  CD  . LYS C 1 116 ? 31.205  97.650  -8.781  1.00 35.10 ? 219 LYS D CD  1 
ATOM   3089 C  CE  . LYS C 1 116 ? 32.640  97.923  -8.363  1.00 38.32 ? 219 LYS D CE  1 
ATOM   3090 N  NZ  . LYS C 1 116 ? 33.606  97.033  -9.058  1.00 37.42 ? 219 LYS D NZ  1 
ATOM   3091 N  N   . ILE C 1 117 ? 26.154  100.091 -9.424  1.00 24.88 ? 220 ILE D N   1 
ATOM   3092 C  CA  . ILE C 1 117 ? 24.952  100.008 -10.237 1.00 25.10 ? 220 ILE D CA  1 
ATOM   3093 C  C   . ILE C 1 117 ? 25.472  99.537  -11.581 1.00 23.96 ? 220 ILE D C   1 
ATOM   3094 O  O   . ILE C 1 117 ? 26.166  100.288 -12.266 1.00 26.94 ? 220 ILE D O   1 
ATOM   3095 C  CB  . ILE C 1 117 ? 24.260  101.375 -10.360 1.00 28.03 ? 220 ILE D CB  1 
ATOM   3096 C  CG1 . ILE C 1 117 ? 23.652  101.809 -9.022  1.00 33.05 ? 220 ILE D CG1 1 
ATOM   3097 C  CG2 . ILE C 1 117 ? 23.141  101.312 -11.407 1.00 29.18 ? 220 ILE D CG2 1 
ATOM   3098 C  CD1 . ILE C 1 117 ? 24.630  102.061 -7.931  1.00 35.48 ? 220 ILE D CD1 1 
ATOM   3099 N  N   . PRO C 1 118 ? 25.207  98.292  -11.956 1.00 20.75 ? 221 PRO D N   1 
ATOM   3100 C  CA  . PRO C 1 118 ? 25.781  97.742  -13.193 1.00 22.99 ? 221 PRO D CA  1 
ATOM   3101 C  C   . PRO C 1 118 ? 25.179  98.285  -14.512 1.00 21.18 ? 221 PRO D C   1 
ATOM   3102 O  O   . PRO C 1 118 ? 24.935  97.501  -15.418 1.00 16.91 ? 221 PRO D O   1 
ATOM   3103 C  CB  . PRO C 1 118 ? 25.536  96.226  -13.048 1.00 22.04 ? 221 PRO D CB  1 
ATOM   3104 C  CG  . PRO C 1 118 ? 25.133  96.034  -11.635 1.00 22.72 ? 221 PRO D CG  1 
ATOM   3105 C  CD  . PRO C 1 118 ? 24.394  97.288  -11.257 1.00 22.95 ? 221 PRO D CD  1 
ATOM   3106 N  N   . ARG C 1 119 ? 24.944  99.593  -14.598 1.00 23.59 ? 222 ARG D N   1 
ATOM   3107 C  CA  . ARG C 1 119 ? 24.706  100.289 -15.866 1.00 25.03 ? 222 ARG D CA  1 
ATOM   3108 C  C   . ARG C 1 119 ? 25.572  101.536 -15.915 1.00 23.80 ? 222 ARG D C   1 
ATOM   3109 O  O   . ARG C 1 119 ? 25.855  102.151 -14.887 1.00 27.83 ? 222 ARG D O   1 
ATOM   3110 C  CB  . ARG C 1 119 ? 23.237  100.718 -16.010 1.00 24.47 ? 222 ARG D CB  1 
ATOM   3111 C  CG  . ARG C 1 119 ? 22.270  99.570  -16.188 1.00 25.25 ? 222 ARG D CG  1 
ATOM   3112 C  CD  . ARG C 1 119 ? 21.776  98.966  -14.868 1.00 26.53 ? 222 ARG D CD  1 
ATOM   3113 N  NE  . ARG C 1 119 ? 20.750  97.951  -15.087 1.00 22.51 ? 222 ARG D NE  1 
ATOM   3114 C  CZ  . ARG C 1 119 ? 20.985  96.718  -15.513 1.00 20.93 ? 222 ARG D CZ  1 
ATOM   3115 N  NH1 . ARG C 1 119 ? 22.225  96.305  -15.730 1.00 20.29 ? 222 ARG D NH1 1 
ATOM   3116 N  NH2 . ARG C 1 119 ? 19.966  95.882  -15.705 1.00 20.50 ? 222 ARG D NH2 1 
ATOM   3117 N  N   . ALA C 1 120 ? 25.971  101.913 -17.118 1.00 23.72 ? 223 ALA D N   1 
ATOM   3118 C  CA  . ALA C 1 120 ? 26.748  103.117 -17.327 1.00 29.02 ? 223 ALA D CA  1 
ATOM   3119 C  C   . ALA C 1 120 ? 25.846  104.339 -17.250 1.00 29.10 ? 223 ALA D C   1 
ATOM   3120 O  O   . ALA C 1 120 ? 24.701  104.312 -17.715 1.00 26.50 ? 223 ALA D O   1 
ATOM   3121 C  CB  . ALA C 1 120 ? 27.456  103.067 -18.674 1.00 29.30 ? 223 ALA D CB  1 
ATOM   3122 N  N   . ASN C 1 121 ? 26.375  105.395 -16.633 1.00 28.69 ? 224 ASN D N   1 
ATOM   3123 C  CA  . ASN C 1 121 ? 25.715  106.694 -16.550 1.00 31.19 ? 224 ASN D CA  1 
ATOM   3124 C  C   . ASN C 1 121 ? 24.313  106.591 -15.986 1.00 28.00 ? 224 ASN D C   1 
ATOM   3125 O  O   . ASN C 1 121 ? 23.406  107.266 -16.443 1.00 29.29 ? 224 ASN D O   1 
ATOM   3126 C  CB  . ASN C 1 121 ? 25.716  107.400 -17.924 1.00 30.34 ? 224 ASN D CB  1 
ATOM   3127 C  CG  . ASN C 1 121 ? 27.124  107.585 -18.484 1.00 32.29 ? 224 ASN D CG  1 
ATOM   3128 O  OD1 . ASN C 1 121 ? 27.358  107.415 -19.687 1.00 34.90 ? 224 ASN D OD1 1 
ATOM   3129 N  ND2 . ASN C 1 121 ? 28.070  107.930 -17.612 1.00 30.69 ? 224 ASN D ND2 1 
ATOM   3130 N  N   . ALA C 1 122 ? 24.158  105.731 -14.983 1.00 30.99 ? 225 ALA D N   1 
ATOM   3131 C  CA  . ALA C 1 122 ? 22.885  105.527 -14.311 1.00 30.03 ? 225 ALA D CA  1 
ATOM   3132 C  C   . ALA C 1 122 ? 22.373  106.824 -13.706 1.00 31.13 ? 225 ALA D C   1 
ATOM   3133 O  O   . ALA C 1 122 ? 23.154  107.632 -13.200 1.00 30.77 ? 225 ALA D O   1 
ATOM   3134 C  CB  . ALA C 1 122 ? 23.021  104.469 -13.224 1.00 29.68 ? 225 ALA D CB  1 
ATOM   3135 N  N   . LYS C 1 123 ? 21.054  107.003 -13.748 1.00 31.24 ? 226 LYS D N   1 
ATOM   3136 C  CA  . LYS C 1 123 ? 20.417  108.216 -13.246 1.00 33.94 ? 226 LYS D CA  1 
ATOM   3137 C  C   . LYS C 1 123 ? 19.891  107.925 -11.862 1.00 32.76 ? 226 LYS D C   1 
ATOM   3138 O  O   . LYS C 1 123 ? 18.834  107.320 -11.659 1.00 30.82 ? 226 LYS D O   1 
ATOM   3139 C  CB  . LYS C 1 123 ? 19.299  108.688 -14.182 1.00 38.14 ? 226 LYS D CB  1 
ATOM   3140 C  CG  . LYS C 1 123 ? 19.753  109.023 -15.627 1.00 42.54 ? 226 LYS D CG  1 
ATOM   3141 C  CD  . LYS C 1 123 ? 20.930  110.007 -15.677 1.00 47.24 ? 226 LYS D CD  1 
ATOM   3142 C  CE  . LYS C 1 123 ? 21.393  110.282 -17.118 1.00 50.99 ? 226 LYS D CE  1 
ATOM   3143 N  NZ  . LYS C 1 123 ? 22.481  111.308 -17.189 1.00 50.96 ? 226 LYS D NZ  1 
ATOM   3144 N  N   . LEU C 1 124 ? 20.663  108.325 -10.881 1.00 33.64 ? 227 LEU D N   1 
ATOM   3145 C  CA  . LEU C 1 124 ? 20.244  108.079 -9.534  1.00 36.05 ? 227 LEU D CA  1 
ATOM   3146 C  C   . LEU C 1 124 ? 20.350  109.336 -8.711  1.00 33.52 ? 227 LEU D C   1 
ATOM   3147 O  O   . LEU C 1 124 ? 21.140  110.220 -9.012  1.00 29.36 ? 227 LEU D O   1 
ATOM   3148 C  CB  . LEU C 1 124 ? 21.036  106.923 -8.959  1.00 40.19 ? 227 LEU D CB  1 
ATOM   3149 C  CG  . LEU C 1 124 ? 22.527  107.117 -8.827  1.00 40.68 ? 227 LEU D CG  1 
ATOM   3150 C  CD1 . LEU C 1 124 ? 22.863  107.490 -7.392  1.00 44.71 ? 227 LEU D CD1 1 
ATOM   3151 C  CD2 . LEU C 1 124 ? 23.225  105.829 -9.229  1.00 44.49 ? 227 LEU D CD2 1 
ATOM   3152 N  N   . SER C 1 125 ? 19.503  109.424 -7.692  1.00 29.68 ? 228 SER D N   1 
ATOM   3153 C  CA  . SER C 1 125 ? 19.415  110.622 -6.888  1.00 30.08 ? 228 SER D CA  1 
ATOM   3154 C  C   . SER C 1 125 ? 20.641  110.743 -5.993  1.00 27.53 ? 228 SER D C   1 
ATOM   3155 O  O   . SER C 1 125 ? 21.115  109.746 -5.455  1.00 26.00 ? 228 SER D O   1 
ATOM   3156 C  CB  . SER C 1 125 ? 18.161  110.586 -6.028  1.00 31.48 ? 228 SER D CB  1 
ATOM   3157 O  OG  . SER C 1 125 ? 18.089  111.752 -5.245  1.00 30.33 ? 228 SER D OG  1 
ATOM   3158 N  N   . LEU C 1 126 ? 21.154  111.964 -5.881  1.00 25.18 ? 229 LEU D N   1 
ATOM   3159 C  CA  . LEU C 1 126 ? 22.134  112.335 -4.864  1.00 25.92 ? 229 LEU D CA  1 
ATOM   3160 C  C   . LEU C 1 126 ? 21.519  112.720 -3.510  1.00 27.87 ? 229 LEU D C   1 
ATOM   3161 O  O   . LEU C 1 126 ? 22.248  112.976 -2.545  1.00 28.92 ? 229 LEU D O   1 
ATOM   3162 C  CB  . LEU C 1 126 ? 22.947  113.533 -5.347  1.00 25.14 ? 229 LEU D CB  1 
ATOM   3163 C  CG  . LEU C 1 126 ? 23.765  113.308 -6.608  1.00 28.90 ? 229 LEU D CG  1 
ATOM   3164 C  CD1 . LEU C 1 126 ? 24.568  114.554 -6.891  1.00 28.60 ? 229 LEU D CD1 1 
ATOM   3165 C  CD2 . LEU C 1 126 ? 24.672  112.075 -6.438  1.00 29.46 ? 229 LEU D CD2 1 
ATOM   3166 N  N   . SER C 1 127 ? 20.196  112.820 -3.454  1.00 24.45 ? 230 SER D N   1 
ATOM   3167 C  CA  . SER C 1 127 ? 19.502  113.226 -2.242  1.00 20.15 ? 230 SER D CA  1 
ATOM   3168 C  C   . SER C 1 127 ? 19.883  112.283 -1.101  1.00 21.62 ? 230 SER D C   1 
ATOM   3169 O  O   . SER C 1 127 ? 19.834  111.077 -1.273  1.00 21.54 ? 230 SER D O   1 
ATOM   3170 C  CB  . SER C 1 127 ? 17.990  113.157 -2.474  1.00 24.18 ? 230 SER D CB  1 
ATOM   3171 O  OG  . SER C 1 127 ? 17.284  113.376 -1.269  1.00 32.09 ? 230 SER D OG  1 
ATOM   3172 N  N   . PRO C 1 128 ? 20.253  112.817 0.063   1.00 19.77 ? 231 PRO D N   1 
ATOM   3173 C  CA  . PRO C 1 128 ? 20.665  111.964 1.182   1.00 23.16 ? 231 PRO D CA  1 
ATOM   3174 C  C   . PRO C 1 128 ? 19.555  111.068 1.716   1.00 23.62 ? 231 PRO D C   1 
ATOM   3175 O  O   . PRO C 1 128 ? 19.889  110.077 2.372   1.00 21.75 ? 231 PRO D O   1 
ATOM   3176 C  CB  . PRO C 1 128 ? 21.120  112.965 2.268   1.00 21.50 ? 231 PRO D CB  1 
ATOM   3177 C  CG  . PRO C 1 128 ? 20.524  114.290 1.911   1.00 19.85 ? 231 PRO D CG  1 
ATOM   3178 C  CD  . PRO C 1 128 ? 20.277  114.245 0.423   1.00 23.47 ? 231 PRO D CD  1 
ATOM   3179 N  N   . HIS C 1 129 ? 18.288  111.397 1.425   1.00 25.07 ? 232 HIS D N   1 
ATOM   3180 C  CA  . HIS C 1 129 ? 17.144  110.609 1.880   1.00 23.21 ? 232 HIS D CA  1 
ATOM   3181 C  C   . HIS C 1 129 ? 16.561  109.692 0.814   1.00 26.91 ? 232 HIS D C   1 
ATOM   3182 O  O   . HIS C 1 129 ? 15.625  108.938 1.096   1.00 25.86 ? 232 HIS D O   1 
ATOM   3183 C  CB  . HIS C 1 129 ? 16.024  111.478 2.465   1.00 25.76 ? 232 HIS D CB  1 
ATOM   3184 C  CG  . HIS C 1 129 ? 15.851  112.815 1.821   1.00 24.26 ? 232 HIS D CG  1 
ATOM   3185 N  ND1 . HIS C 1 129 ? 14.711  113.161 1.136   1.00 31.44 ? 232 HIS D ND1 1 
ATOM   3186 C  CD2 . HIS C 1 129 ? 16.632  113.920 1.820   1.00 29.31 ? 232 HIS D CD2 1 
ATOM   3187 C  CE1 . HIS C 1 129 ? 14.811  114.407 0.704   1.00 25.36 ? 232 HIS D CE1 1 
ATOM   3188 N  NE2 . HIS C 1 129 ? 15.963  114.894 1.117   1.00 25.56 ? 232 HIS D NE2 1 
ATOM   3189 N  N   . GLY C 1 130 ? 17.103  109.755 -0.395  1.00 23.03 ? 233 GLY D N   1 
ATOM   3190 C  CA  . GLY C 1 130 ? 16.727  108.832 -1.455  1.00 24.93 ? 233 GLY D CA  1 
ATOM   3191 C  C   . GLY C 1 130 ? 17.756  107.742 -1.669  1.00 26.25 ? 233 GLY D C   1 
ATOM   3192 O  O   . GLY C 1 130 ? 17.390  106.604 -1.938  1.00 28.44 ? 233 GLY D O   1 
ATOM   3193 N  N   . THR C 1 131 ? 19.036  108.103 -1.562  1.00 24.62 ? 234 THR D N   1 
ATOM   3194 C  CA  . THR C 1 131 ? 20.155  107.190 -1.752  1.00 23.51 ? 234 THR D CA  1 
ATOM   3195 C  C   . THR C 1 131 ? 21.032  107.227 -0.506  1.00 25.00 ? 234 THR D C   1 
ATOM   3196 O  O   . THR C 1 131 ? 21.449  108.308 -0.074  1.00 24.16 ? 234 THR D O   1 
ATOM   3197 C  CB  . THR C 1 131 ? 20.981  107.620 -3.007  1.00 26.39 ? 234 THR D CB  1 
ATOM   3198 O  OG1 . THR C 1 131 ? 20.184  107.492 -4.199  1.00 25.72 ? 234 THR D OG1 1 
ATOM   3199 C  CG2 . THR C 1 131 ? 22.171  106.695 -3.254  1.00 23.36 ? 234 THR D CG2 1 
ATOM   3200 N  N   . PHE C 1 132 ? 21.311  106.061 0.082   1.00 25.32 ? 235 PHE D N   1 
ATOM   3201 C  CA  . PHE C 1 132 ? 22.160  105.999 1.269   1.00 22.94 ? 235 PHE D CA  1 
ATOM   3202 C  C   . PHE C 1 132 ? 22.711  104.610 1.534   1.00 25.41 ? 235 PHE D C   1 
ATOM   3203 O  O   . PHE C 1 132 ? 22.289  103.634 0.917   1.00 29.25 ? 235 PHE D O   1 
ATOM   3204 C  CB  . PHE C 1 132 ? 21.409  106.525 2.507   1.00 21.55 ? 235 PHE D CB  1 
ATOM   3205 C  CG  . PHE C 1 132 ? 20.062  105.910 2.708   1.00 23.59 ? 235 PHE D CG  1 
ATOM   3206 C  CD1 . PHE C 1 132 ? 19.930  104.664 3.315   1.00 23.36 ? 235 PHE D CD1 1 
ATOM   3207 C  CD2 . PHE C 1 132 ? 18.913  106.575 2.287   1.00 28.68 ? 235 PHE D CD2 1 
ATOM   3208 C  CE1 . PHE C 1 132 ? 18.680  104.090 3.488   1.00 27.12 ? 235 PHE D CE1 1 
ATOM   3209 C  CE2 . PHE C 1 132 ? 17.649  106.008 2.479   1.00 27.85 ? 235 PHE D CE2 1 
ATOM   3210 C  CZ  . PHE C 1 132 ? 17.536  104.766 3.076   1.00 26.38 ? 235 PHE D CZ  1 
ATOM   3211 N  N   . LEU C 1 133 ? 23.660  104.543 2.466   1.00 27.86 ? 236 LEU D N   1 
ATOM   3212 C  CA  . LEU C 1 133 ? 24.402  103.317 2.805   1.00 26.51 ? 236 LEU D CA  1 
ATOM   3213 C  C   . LEU C 1 133 ? 24.720  103.316 4.301   1.00 24.63 ? 236 LEU D C   1 
ATOM   3214 O  O   . LEU C 1 133 ? 25.175  104.323 4.826   1.00 28.79 ? 236 LEU D O   1 
ATOM   3215 C  CB  . LEU C 1 133 ? 25.706  103.276 2.004   1.00 26.83 ? 236 LEU D CB  1 
ATOM   3216 C  CG  . LEU C 1 133 ? 26.679  102.103 2.227   1.00 29.01 ? 236 LEU D CG  1 
ATOM   3217 C  CD1 . LEU C 1 133 ? 26.064  100.802 1.826   1.00 29.16 ? 236 LEU D CD1 1 
ATOM   3218 C  CD2 . LEU C 1 133 ? 27.971  102.310 1.454   1.00 28.28 ? 236 LEU D CD2 1 
ATOM   3219 N  N   . GLY C 1 134 ? 24.510  102.209 5.007   1.00 23.25 ? 237 GLY D N   1 
ATOM   3220 C  CA  . GLY C 1 134 ? 24.814  102.210 6.428   1.00 23.99 ? 237 GLY D CA  1 
ATOM   3221 C  C   . GLY C 1 134 ? 25.254  100.898 7.034   1.00 23.83 ? 237 GLY D C   1 
ATOM   3222 O  O   . GLY C 1 134 ? 25.054  99.845  6.442   1.00 26.41 ? 237 GLY D O   1 
ATOM   3223 N  N   . PHE C 1 135 ? 25.856  100.983 8.224   1.00 20.67 ? 238 PHE D N   1 
ATOM   3224 C  CA  . PHE C 1 135 ? 26.484  99.850  8.904   1.00 21.44 ? 238 PHE D CA  1 
ATOM   3225 C  C   . PHE C 1 135 ? 26.212  99.962  10.386  1.00 20.47 ? 238 PHE D C   1 
ATOM   3226 O  O   . PHE C 1 135 ? 26.279  101.052 10.955  1.00 23.61 ? 238 PHE D O   1 
ATOM   3227 C  CB  . PHE C 1 135 ? 28.000  99.878  8.746   1.00 21.10 ? 238 PHE D CB  1 
ATOM   3228 C  CG  . PHE C 1 135 ? 28.478  99.822  7.330   1.00 25.76 ? 238 PHE D CG  1 
ATOM   3229 C  CD1 . PHE C 1 135 ? 28.479  100.960 6.536   1.00 24.90 ? 238 PHE D CD1 1 
ATOM   3230 C  CD2 . PHE C 1 135 ? 28.980  98.642  6.798   1.00 29.23 ? 238 PHE D CD2 1 
ATOM   3231 C  CE1 . PHE C 1 135 ? 28.957  100.915 5.219   1.00 25.58 ? 238 PHE D CE1 1 
ATOM   3232 C  CE2 . PHE C 1 135 ? 29.450  98.592  5.486   1.00 32.09 ? 238 PHE D CE2 1 
ATOM   3233 C  CZ  . PHE C 1 135 ? 29.433  99.724  4.694   1.00 27.44 ? 238 PHE D CZ  1 
ATOM   3234 N  N   . VAL C 1 136 ? 25.918  98.836  11.016  1.00 21.61 ? 239 VAL D N   1 
ATOM   3235 C  CA  . VAL C 1 136 ? 25.808  98.756  12.458  1.00 20.84 ? 239 VAL D CA  1 
ATOM   3236 C  C   . VAL C 1 136 ? 26.547  97.516  12.880  1.00 22.10 ? 239 VAL D C   1 
ATOM   3237 O  O   . VAL C 1 136 ? 26.172  96.418  12.484  1.00 22.94 ? 239 VAL D O   1 
ATOM   3238 C  CB  . VAL C 1 136 ? 24.336  98.668  12.912  1.00 23.03 ? 239 VAL D CB  1 
ATOM   3239 C  CG1 . VAL C 1 136 ? 24.240  98.610  14.443  1.00 24.01 ? 239 VAL D CG1 1 
ATOM   3240 C  CG2 . VAL C 1 136 ? 23.582  99.862  12.410  1.00 26.36 ? 239 VAL D CG2 1 
ATOM   3241 N  N   . LYS C 1 137 ? 27.614  97.689  13.655  1.00 20.42 ? 240 LYS D N   1 
ATOM   3242 C  CA  . LYS C 1 137 ? 28.305  96.552  14.242  1.00 21.65 ? 240 LYS D CA  1 
ATOM   3243 C  C   . LYS C 1 137 ? 27.421  95.939  15.312  1.00 24.53 ? 240 LYS D C   1 
ATOM   3244 O  O   . LYS C 1 137 ? 26.987  96.622  16.233  1.00 25.51 ? 240 LYS D O   1 
ATOM   3245 C  CB  . LYS C 1 137 ? 29.643  96.948  14.851  1.00 20.41 ? 240 LYS D CB  1 
ATOM   3246 C  CG  . LYS C 1 137 ? 30.495  95.722  15.217  1.00 26.40 ? 240 LYS D CG  1 
ATOM   3247 C  CD  . LYS C 1 137 ? 31.963  96.052  15.368  1.00 30.46 ? 240 LYS D CD  1 
ATOM   3248 C  CE  . LYS C 1 137 ? 32.743  94.858  15.866  1.00 33.87 ? 240 LYS D CE  1 
ATOM   3249 N  NZ  . LYS C 1 137 ? 32.933  94.913  17.335  1.00 37.68 ? 240 LYS D NZ  1 
ATOM   3250 N  N   . LEU C 1 138 ? 27.149  94.651  15.166  1.00 25.93 ? 241 LEU D N   1 
ATOM   3251 C  CA  . LEU C 1 138 ? 26.299  93.924  16.081  1.00 27.73 ? 241 LEU D CA  1 
ATOM   3252 C  C   . LEU C 1 138 ? 27.140  93.075  17.025  1.00 33.52 ? 241 LEU D C   1 
ATOM   3253 O  O   . LEU C 1 138 ? 26.674  92.780  18.120  1.00 33.76 ? 241 LEU D O   1 
ATOM   3254 C  CB  . LEU C 1 138 ? 25.339  93.039  15.300  1.00 28.87 ? 241 LEU D CB  1 
ATOM   3255 C  CG  . LEU C 1 138 ? 24.512  93.739  14.225  1.00 29.32 ? 241 LEU D CG  1 
ATOM   3256 C  CD1 . LEU C 1 138 ? 23.731  92.693  13.466  1.00 29.12 ? 241 LEU D CD1 1 
ATOM   3257 C  CD2 . LEU C 1 138 ? 23.588  94.799  14.814  1.00 28.50 ? 241 LEU D CD2 1 
ATOM   3258 O  OXT . LEU C 1 138 ? 28.279  92.678  16.726  1.00 37.18 ? 241 LEU D OXT 1 
ATOM   3259 N  N   . CYS D 2 4   ? -15.760 84.928  -1.614  1.00 33.24 ? 8   CYS R N   1 
ATOM   3260 C  CA  . CYS D 2 4   ? -15.561 85.536  -2.963  1.00 39.84 ? 8   CYS R CA  1 
ATOM   3261 C  C   . CYS D 2 4   ? -16.664 85.102  -3.913  1.00 40.13 ? 8   CYS R C   1 
ATOM   3262 O  O   . CYS D 2 4   ? -17.281 84.060  -3.712  1.00 43.99 ? 8   CYS R O   1 
ATOM   3263 C  CB  . CYS D 2 4   ? -14.215 85.116  -3.557  1.00 42.04 ? 8   CYS R CB  1 
ATOM   3264 S  SG  . CYS D 2 4   ? -12.755 85.878  -2.800  1.00 47.16 ? 8   CYS R SG  1 
ATOM   3265 N  N   . SER D 2 5   ? -16.895 85.894  -4.957  1.00 37.92 ? 9   SER R N   1 
ATOM   3266 C  CA  . SER D 2 5   ? -17.949 85.598  -5.931  1.00 33.90 ? 9   SER R CA  1 
ATOM   3267 C  C   . SER D 2 5   ? -17.429 84.691  -7.058  1.00 31.36 ? 9   SER R C   1 
ATOM   3268 O  O   . SER D 2 5   ? -16.281 84.247  -7.024  1.00 28.38 ? 9   SER R O   1 
ATOM   3269 C  CB  . SER D 2 5   ? -18.544 86.898  -6.484  1.00 32.34 ? 9   SER R CB  1 
ATOM   3270 O  OG  . SER D 2 5   ? -17.740 87.446  -7.504  1.00 31.52 ? 9   SER R OG  1 
ATOM   3271 N  N   . GLN D 2 6   ? -18.283 84.412  -8.042  1.00 29.75 ? 10  GLN R N   1 
ATOM   3272 C  CA  . GLN D 2 6   ? -17.944 83.495  -9.134  1.00 30.57 ? 10  GLN R CA  1 
ATOM   3273 C  C   . GLN D 2 6   ? -16.784 84.027  -9.986  1.00 32.46 ? 10  GLN R C   1 
ATOM   3274 O  O   . GLN D 2 6   ? -16.712 85.226  -10.271 1.00 33.60 ? 10  GLN R O   1 
ATOM   3275 C  CB  . GLN D 2 6   ? -19.171 83.224  -10.022 1.00 31.21 ? 10  GLN R CB  1 
ATOM   3276 C  CG  . GLN D 2 6   ? -19.118 81.887  -10.764 1.00 30.35 ? 10  GLN R CG  1 
ATOM   3277 C  CD  . GLN D 2 6   ? -20.175 81.758  -11.850 1.00 31.55 ? 10  GLN R CD  1 
ATOM   3278 O  OE1 . GLN D 2 6   ? -20.566 82.750  -12.470 1.00 32.10 ? 10  GLN R OE1 1 
ATOM   3279 N  NE2 . GLN D 2 6   ? -20.635 80.530  -12.088 1.00 30.76 ? 10  GLN R NE2 1 
ATOM   3280 N  N   . ASN D 2 7   ? -15.885 83.122  -10.378 1.00 30.70 ? 11  ASN R N   1 
ATOM   3281 C  CA  . ASN D 2 7   ? -14.701 83.450  -11.175 1.00 29.27 ? 11  ASN R CA  1 
ATOM   3282 C  C   . ASN D 2 7   ? -13.783 84.462  -10.497 1.00 28.61 ? 11  ASN R C   1 
ATOM   3283 O  O   . ASN D 2 7   ? -13.196 85.326  -11.146 1.00 26.63 ? 11  ASN R O   1 
ATOM   3284 C  CB  . ASN D 2 7   ? -15.093 83.919  -12.578 1.00 29.46 ? 11  ASN R CB  1 
ATOM   3285 C  CG  . ASN D 2 7   ? -15.998 82.931  -13.290 1.00 30.35 ? 11  ASN R CG  1 
ATOM   3286 O  OD1 . ASN D 2 7   ? -15.964 81.731  -13.017 1.00 30.71 ? 11  ASN R OD1 1 
ATOM   3287 N  ND2 . ASN D 2 7   ? -16.808 83.430  -14.210 1.00 28.08 ? 11  ASN R ND2 1 
ATOM   3288 N  N   . GLU D 2 8   ? -13.685 84.344  -9.178  1.00 30.95 ? 12  GLU R N   1 
ATOM   3289 C  CA  . GLU D 2 8   ? -12.678 85.046  -8.391  1.00 31.44 ? 12  GLU R CA  1 
ATOM   3290 C  C   . GLU D 2 8   ? -11.978 84.031  -7.480  1.00 28.60 ? 12  GLU R C   1 
ATOM   3291 O  O   . GLU D 2 8   ? -12.487 82.931  -7.252  1.00 23.50 ? 12  GLU R O   1 
ATOM   3292 C  CB  . GLU D 2 8   ? -13.322 86.155  -7.547  1.00 34.82 ? 12  GLU R CB  1 
ATOM   3293 C  CG  . GLU D 2 8   ? -13.674 87.427  -8.312  1.00 37.91 ? 12  GLU R CG  1 
ATOM   3294 C  CD  . GLU D 2 8   ? -14.313 88.504  -7.437  1.00 41.17 ? 12  GLU R CD  1 
ATOM   3295 O  OE1 . GLU D 2 8   ? -14.575 88.254  -6.238  1.00 42.49 ? 12  GLU R OE1 1 
ATOM   3296 O  OE2 . GLU D 2 8   ? -14.566 89.611  -7.953  1.00 42.93 ? 12  GLU R OE2 1 
ATOM   3297 N  N   . TYR D 2 9   ? -10.804 84.400  -6.971  1.00 26.33 ? 13  TYR R N   1 
ATOM   3298 C  CA  . TYR D 2 9   ? -10.129 83.610  -5.945  1.00 25.87 ? 13  TYR R CA  1 
ATOM   3299 C  C   . TYR D 2 9   ? -9.660  84.526  -4.814  1.00 25.08 ? 13  TYR R C   1 
ATOM   3300 O  O   . TYR D 2 9   ? -9.402  85.720  -5.024  1.00 18.89 ? 13  TYR R O   1 
ATOM   3301 C  CB  . TYR D 2 9   ? -8.943  82.823  -6.539  1.00 26.19 ? 13  TYR R CB  1 
ATOM   3302 C  CG  . TYR D 2 9   ? -7.732  83.676  -6.845  1.00 26.90 ? 13  TYR R CG  1 
ATOM   3303 C  CD1 . TYR D 2 9   ? -7.677  84.435  -8.002  1.00 26.81 ? 13  TYR R CD1 1 
ATOM   3304 C  CD2 . TYR D 2 9   ? -6.643  83.729  -5.970  1.00 29.84 ? 13  TYR R CD2 1 
ATOM   3305 C  CE1 . TYR D 2 9   ? -6.569  85.236  -8.293  1.00 26.50 ? 13  TYR R CE1 1 
ATOM   3306 C  CE2 . TYR D 2 9   ? -5.514  84.530  -6.255  1.00 30.39 ? 13  TYR R CE2 1 
ATOM   3307 C  CZ  . TYR D 2 9   ? -5.496  85.284  -7.417  1.00 27.04 ? 13  TYR R CZ  1 
ATOM   3308 O  OH  . TYR D 2 9   ? -4.414  86.080  -7.721  1.00 27.29 ? 13  TYR R OH  1 
ATOM   3309 N  N   . PHE D 2 10  ? -9.560  83.963  -3.612  1.00 24.55 ? 14  PHE R N   1 
ATOM   3310 C  CA  . PHE D 2 10  ? -9.040  84.706  -2.488  1.00 24.78 ? 14  PHE R CA  1 
ATOM   3311 C  C   . PHE D 2 10  ? -7.533  84.603  -2.570  1.00 25.21 ? 14  PHE R C   1 
ATOM   3312 O  O   . PHE D 2 10  ? -6.978  83.515  -2.456  1.00 23.95 ? 14  PHE R O   1 
ATOM   3313 C  CB  . PHE D 2 10  ? -9.554  84.181  -1.145  1.00 26.67 ? 14  PHE R CB  1 
ATOM   3314 C  CG  . PHE D 2 10  ? -9.169  85.061  0.007   1.00 29.40 ? 14  PHE R CG  1 
ATOM   3315 C  CD1 . PHE D 2 10  ? -9.866  86.238  0.255   1.00 29.37 ? 14  PHE R CD1 1 
ATOM   3316 C  CD2 . PHE D 2 10  ? -8.071  84.750  0.801   1.00 31.58 ? 14  PHE R CD2 1 
ATOM   3317 C  CE1 . PHE D 2 10  ? -9.500  87.074  1.297   1.00 32.04 ? 14  PHE R CE1 1 
ATOM   3318 C  CE2 . PHE D 2 10  ? -7.696  85.584  1.848   1.00 33.22 ? 14  PHE R CE2 1 
ATOM   3319 C  CZ  . PHE D 2 10  ? -8.416  86.748  2.098   1.00 33.60 ? 14  PHE R CZ  1 
ATOM   3320 N  N   . ASP D 2 11  ? -6.883  85.736  -2.822  1.00 24.53 ? 15  ASP R N   1 
ATOM   3321 C  CA  . ASP D 2 11  ? -5.438  85.778  -2.956  1.00 23.75 ? 15  ASP R CA  1 
ATOM   3322 C  C   . ASP D 2 11  ? -4.829  85.964  -1.577  1.00 22.88 ? 15  ASP R C   1 
ATOM   3323 O  O   . ASP D 2 11  ? -5.033  86.996  -0.950  1.00 24.78 ? 15  ASP R O   1 
ATOM   3324 C  CB  . ASP D 2 11  ? -5.041  86.933  -3.871  1.00 22.58 ? 15  ASP R CB  1 
ATOM   3325 C  CG  . ASP D 2 11  ? -3.599  86.872  -4.296  1.00 24.06 ? 15  ASP R CG  1 
ATOM   3326 O  OD1 . ASP D 2 11  ? -2.719  86.584  -3.450  1.00 25.34 ? 15  ASP R OD1 1 
ATOM   3327 O  OD2 . ASP D 2 11  ? -3.249  87.106  -5.468  1.00 27.01 ? 15  ASP R OD2 1 
ATOM   3328 N  N   . SER D 2 12  ? -4.081  84.971  -1.111  1.00 24.12 ? 16  SER R N   1 
ATOM   3329 C  CA  . SER D 2 12  ? -3.557  84.991  0.256   1.00 27.55 ? 16  SER R CA  1 
ATOM   3330 C  C   . SER D 2 12  ? -2.377  85.952  0.437   1.00 28.05 ? 16  SER R C   1 
ATOM   3331 O  O   . SER D 2 12  ? -1.987  86.262  1.570   1.00 30.61 ? 16  SER R O   1 
ATOM   3332 C  CB  . SER D 2 12  ? -3.146  83.585  0.690   1.00 28.12 ? 16  SER R CB  1 
ATOM   3333 O  OG  . SER D 2 12  ? -4.266  82.901  1.211   1.00 32.55 ? 16  SER R OG  1 
ATOM   3334 N  N   . LEU D 2 13  ? -1.798  86.402  -0.670  1.00 22.85 ? 17  LEU R N   1 
ATOM   3335 C  CA  . LEU D 2 13  ? -0.751  87.410  -0.608  1.00 22.15 ? 17  LEU R CA  1 
ATOM   3336 C  C   . LEU D 2 13  ? -1.370  88.778  -0.415  1.00 25.14 ? 17  LEU R C   1 
ATOM   3337 O  O   . LEU D 2 13  ? -0.869  89.579  0.358   1.00 26.82 ? 17  LEU R O   1 
ATOM   3338 C  CB  . LEU D 2 13  ? 0.082   87.404  -1.885  1.00 21.69 ? 17  LEU R CB  1 
ATOM   3339 C  CG  . LEU D 2 13  ? 1.130   88.504  -1.998  1.00 19.23 ? 17  LEU R CG  1 
ATOM   3340 C  CD1 . LEU D 2 13  ? 2.147   88.361  -0.860  1.00 22.77 ? 17  LEU R CD1 1 
ATOM   3341 C  CD2 . LEU D 2 13  ? 1.800   88.436  -3.337  1.00 20.80 ? 17  LEU R CD2 1 
ATOM   3342 N  N   . LEU D 2 14  ? -2.457  89.046  -1.132  1.00 27.89 ? 18  LEU R N   1 
ATOM   3343 C  CA  . LEU D 2 14  ? -3.047  90.379  -1.155  1.00 27.81 ? 18  LEU R CA  1 
ATOM   3344 C  C   . LEU D 2 14  ? -4.204  90.514  -0.172  1.00 31.99 ? 18  LEU R C   1 
ATOM   3345 O  O   . LEU D 2 14  ? -4.699  91.621  0.040   1.00 34.87 ? 18  LEU R O   1 
ATOM   3346 C  CB  . LEU D 2 14  ? -3.532  90.707  -2.568  1.00 26.49 ? 18  LEU R CB  1 
ATOM   3347 C  CG  . LEU D 2 14  ? -2.503  90.494  -3.688  1.00 26.56 ? 18  LEU R CG  1 
ATOM   3348 C  CD1 . LEU D 2 14  ? -3.172  90.663  -5.054  1.00 26.71 ? 18  LEU R CD1 1 
ATOM   3349 C  CD2 . LEU D 2 14  ? -1.322  91.438  -3.547  1.00 21.97 ? 18  LEU R CD2 1 
ATOM   3350 N  N   . HIS D 2 15  ? -4.627  89.396  0.427   1.00 31.88 ? 19  HIS R N   1 
ATOM   3351 C  CA  . HIS D 2 15  ? -5.810  89.357  1.293   1.00 32.88 ? 19  HIS R CA  1 
ATOM   3352 C  C   . HIS D 2 15  ? -7.024  90.055  0.655   1.00 31.94 ? 19  HIS R C   1 
ATOM   3353 O  O   . HIS D 2 15  ? -7.736  90.827  1.302   1.00 28.27 ? 19  HIS R O   1 
ATOM   3354 C  CB  . HIS D 2 15  ? -5.483  89.949  2.676   1.00 36.92 ? 19  HIS R CB  1 
ATOM   3355 C  CG  . HIS D 2 15  ? -4.815  88.979  3.596   1.00 42.36 ? 19  HIS R CG  1 
ATOM   3356 N  ND1 . HIS D 2 15  ? -3.458  88.736  3.565   1.00 44.85 ? 19  HIS R ND1 1 
ATOM   3357 C  CD2 . HIS D 2 15  ? -5.321  88.169  4.556   1.00 45.92 ? 19  HIS R CD2 1 
ATOM   3358 C  CE1 . HIS D 2 15  ? -3.155  87.826  4.474   1.00 46.02 ? 19  HIS R CE1 1 
ATOM   3359 N  NE2 . HIS D 2 15  ? -4.267  87.468  5.091   1.00 47.24 ? 19  HIS R NE2 1 
ATOM   3360 N  N   . ALA D 2 16  ? -7.243  89.765  -0.623  1.00 31.77 ? 20  ALA R N   1 
ATOM   3361 C  CA  . ALA D 2 16  ? -8.353  90.332  -1.376  1.00 33.02 ? 20  ALA R CA  1 
ATOM   3362 C  C   . ALA D 2 16  ? -8.934  89.321  -2.374  1.00 34.38 ? 20  ALA R C   1 
ATOM   3363 O  O   . ALA D 2 16  ? -8.310  88.306  -2.689  1.00 36.70 ? 20  ALA R O   1 
ATOM   3364 C  CB  . ALA D 2 16  ? -7.894  91.594  -2.102  1.00 31.48 ? 20  ALA R CB  1 
ATOM   3365 N  N   . CYS D 2 17  ? -10.140 89.602  -2.853  1.00 33.97 ? 21  CYS R N   1 
ATOM   3366 C  CA  . CYS D 2 17  ? -10.751 88.811  -3.918  1.00 34.48 ? 21  CYS R CA  1 
ATOM   3367 C  C   . CYS D 2 17  ? -10.315 89.358  -5.263  1.00 31.38 ? 21  CYS R C   1 
ATOM   3368 O  O   . CYS D 2 17  ? -10.497 90.542  -5.532  1.00 35.84 ? 21  CYS R O   1 
ATOM   3369 C  CB  . CYS D 2 17  ? -12.272 88.861  -3.821  1.00 35.67 ? 21  CYS R CB  1 
ATOM   3370 S  SG  . CYS D 2 17  ? -12.917 87.892  -2.443  1.00 42.84 ? 21  CYS R SG  1 
ATOM   3371 N  N   . ILE D 2 18  ? -9.770  88.487  -6.108  1.00 27.60 ? 22  ILE R N   1 
ATOM   3372 C  CA  . ILE D 2 18  ? -9.193  88.880  -7.389  1.00 28.53 ? 22  ILE R CA  1 
ATOM   3373 C  C   . ILE D 2 18  ? -9.837  88.076  -8.516  1.00 26.52 ? 22  ILE R C   1 
ATOM   3374 O  O   . ILE D 2 18  ? -10.039 86.874  -8.377  1.00 22.40 ? 22  ILE R O   1 
ATOM   3375 C  CB  . ILE D 2 18  ? -7.643  88.655  -7.353  1.00 31.70 ? 22  ILE R CB  1 
ATOM   3376 C  CG1 . ILE D 2 18  ? -6.949  89.828  -6.647  1.00 35.29 ? 22  ILE R CG1 1 
ATOM   3377 C  CG2 . ILE D 2 18  ? -7.055  88.527  -8.749  1.00 31.36 ? 22  ILE R CG2 1 
ATOM   3378 C  CD1 . ILE D 2 18  ? -6.753  89.604  -5.211  1.00 38.59 ? 22  ILE R CD1 1 
ATOM   3379 N  N   . PRO D 2 19  ? -10.158 88.728  -9.634  1.00 30.65 ? 23  PRO R N   1 
ATOM   3380 C  CA  . PRO D 2 19  ? -10.669 88.010  -10.816 1.00 29.43 ? 23  PRO R CA  1 
ATOM   3381 C  C   . PRO D 2 19  ? -9.677  86.945  -11.302 1.00 28.23 ? 23  PRO R C   1 
ATOM   3382 O  O   . PRO D 2 19  ? -8.482  87.179  -11.235 1.00 26.51 ? 23  PRO R O   1 
ATOM   3383 C  CB  . PRO D 2 19  ? -10.823 89.122  -11.860 1.00 30.54 ? 23  PRO R CB  1 
ATOM   3384 C  CG  . PRO D 2 19  ? -10.918 90.389  -11.079 1.00 29.77 ? 23  PRO R CG  1 
ATOM   3385 C  CD  . PRO D 2 19  ? -10.086 90.185  -9.860  1.00 30.52 ? 23  PRO R CD  1 
ATOM   3386 N  N   . CYS D 2 20  ? -10.166 85.804  -11.773 1.00 26.59 ? 24  CYS R N   1 
ATOM   3387 C  CA  . CYS D 2 20  ? -9.301  84.697  -12.197 1.00 25.96 ? 24  CYS R CA  1 
ATOM   3388 C  C   . CYS D 2 20  ? -8.487  85.003  -13.450 1.00 22.47 ? 24  CYS R C   1 
ATOM   3389 O  O   . CYS D 2 20  ? -7.419  84.442  -13.646 1.00 25.53 ? 24  CYS R O   1 
ATOM   3390 C  CB  . CYS D 2 20  ? -10.135 83.441  -12.464 1.00 31.01 ? 24  CYS R CB  1 
ATOM   3391 S  SG  . CYS D 2 20  ? -10.441 82.431  -11.002 1.00 39.48 ? 24  CYS R SG  1 
ATOM   3392 N  N   . GLN D 2 21  ? -8.993  85.887  -14.302 1.00 25.36 ? 25  GLN R N   1 
ATOM   3393 C  CA  . GLN D 2 21  ? -8.335  86.198  -15.569 1.00 22.91 ? 25  GLN R CA  1 
ATOM   3394 C  C   . GLN D 2 21  ? -6.965  86.840  -15.391 1.00 23.87 ? 25  GLN R C   1 
ATOM   3395 O  O   . GLN D 2 21  ? -6.136  86.763  -16.292 1.00 21.71 ? 25  GLN R O   1 
ATOM   3396 C  CB  . GLN D 2 21  ? -9.223  87.087  -16.429 1.00 23.71 ? 25  GLN R CB  1 
ATOM   3397 C  CG  . GLN D 2 21  ? -9.450  88.498  -15.916 1.00 23.85 ? 25  GLN R CG  1 
ATOM   3398 C  CD  . GLN D 2 21  ? -10.567 89.173  -16.667 1.00 25.21 ? 25  GLN R CD  1 
ATOM   3399 O  OE1 . GLN D 2 21  ? -10.321 89.924  -17.612 1.00 26.19 ? 25  GLN R OE1 1 
ATOM   3400 N  NE2 . GLN D 2 21  ? -11.806 88.875  -16.284 1.00 25.57 ? 25  GLN R NE2 1 
ATOM   3401 N  N   . LEU D 2 22  ? -6.748  87.478  -14.236 1.00 27.34 ? 26  LEU R N   1 
ATOM   3402 C  CA  . LEU D 2 22  ? -5.435  88.020  -13.858 1.00 31.87 ? 26  LEU R CA  1 
ATOM   3403 C  C   . LEU D 2 22  ? -4.357  86.948  -13.686 1.00 32.64 ? 26  LEU R C   1 
ATOM   3404 O  O   . LEU D 2 22  ? -3.177  87.237  -13.839 1.00 37.75 ? 26  LEU R O   1 
ATOM   3405 C  CB  . LEU D 2 22  ? -5.533  88.816  -12.547 1.00 31.84 ? 26  LEU R CB  1 
ATOM   3406 C  CG  . LEU D 2 22  ? -6.152  90.219  -12.559 1.00 34.74 ? 26  LEU R CG  1 
ATOM   3407 C  CD1 . LEU D 2 22  ? -5.607  91.038  -11.401 1.00 36.79 ? 26  LEU R CD1 1 
ATOM   3408 C  CD2 . LEU D 2 22  ? -5.906  90.949  -13.856 1.00 35.61 ? 26  LEU R CD2 1 
ATOM   3409 N  N   . ARG D 2 23  ? -4.772  85.729  -13.348 1.00 33.83 ? 27  ARG R N   1 
ATOM   3410 C  CA  . ARG D 2 23  ? -3.855  84.613  -13.102 1.00 32.39 ? 27  ARG R CA  1 
ATOM   3411 C  C   . ARG D 2 23  ? -3.814  83.549  -14.205 1.00 34.56 ? 27  ARG R C   1 
ATOM   3412 O  O   . ARG D 2 23  ? -3.086  82.564  -14.073 1.00 35.26 ? 27  ARG R O   1 
ATOM   3413 C  CB  . ARG D 2 23  ? -4.248  83.921  -11.789 1.00 29.72 ? 27  ARG R CB  1 
ATOM   3414 C  CG  . ARG D 2 23  ? -4.005  84.766  -10.559 1.00 27.32 ? 27  ARG R CG  1 
ATOM   3415 C  CD  . ARG D 2 23  ? -2.541  85.036  -10.288 1.00 27.28 ? 27  ARG R CD  1 
ATOM   3416 N  NE  . ARG D 2 23  ? -1.814  83.791  -10.073 1.00 27.66 ? 27  ARG R NE  1 
ATOM   3417 C  CZ  . ARG D 2 23  ? -1.816  83.096  -8.940  1.00 23.54 ? 27  ARG R CZ  1 
ATOM   3418 N  NH1 . ARG D 2 23  ? -2.489  83.519  -7.882  1.00 26.46 ? 27  ARG R NH1 1 
ATOM   3419 N  NH2 . ARG D 2 23  ? -1.130  81.971  -8.861  1.00 22.20 ? 27  ARG R NH2 1 
ATOM   3420 N  N   . CYS D 2 24  ? -4.578  83.722  -15.283 1.00 33.09 ? 28  CYS R N   1 
ATOM   3421 C  CA  . CYS D 2 24  ? -4.729  82.635  -16.253 1.00 35.61 ? 28  CYS R CA  1 
ATOM   3422 C  C   . CYS D 2 24  ? -3.513  82.399  -17.152 1.00 36.50 ? 28  CYS R C   1 
ATOM   3423 O  O   . CYS D 2 24  ? -3.015  81.276  -17.243 1.00 34.24 ? 28  CYS R O   1 
ATOM   3424 C  CB  . CYS D 2 24  ? -5.992  82.836  -17.090 1.00 38.30 ? 28  CYS R CB  1 
ATOM   3425 S  SG  . CYS D 2 24  ? -7.483  82.387  -16.172 1.00 41.62 ? 28  CYS R SG  1 
ATOM   3426 N  N   . SER D 2 25  ? -3.040  83.457  -17.802 1.00 40.54 ? 29  SER R N   1 
ATOM   3427 C  CA  . SER D 2 25  ? -1.903  83.375  -18.717 1.00 44.61 ? 29  SER R CA  1 
ATOM   3428 C  C   . SER D 2 25  ? -0.577  83.597  -17.978 1.00 46.32 ? 29  SER R C   1 
ATOM   3429 O  O   . SER D 2 25  ? 0.256   84.411  -18.396 1.00 51.15 ? 29  SER R O   1 
ATOM   3430 C  CB  . SER D 2 25  ? -2.066  84.419  -19.826 1.00 46.08 ? 29  SER R CB  1 
ATOM   3431 O  OG  . SER D 2 25  ? -0.942  84.433  -20.683 1.00 48.11 ? 29  SER R OG  1 
ATOM   3432 N  N   . SER D 2 26  ? -0.382  82.866  -16.885 1.00 43.78 ? 30  SER R N   1 
ATOM   3433 C  CA  . SER D 2 26  ? 0.769   83.067  -16.017 1.00 43.30 ? 30  SER R CA  1 
ATOM   3434 C  C   . SER D 2 26  ? 1.043   81.816  -15.191 1.00 43.63 ? 30  SER R C   1 
ATOM   3435 O  O   . SER D 2 26  ? 0.390   81.580  -14.170 1.00 47.94 ? 30  SER R O   1 
ATOM   3436 C  CB  . SER D 2 26  ? 0.515   84.257  -15.092 1.00 43.91 ? 30  SER R CB  1 
ATOM   3437 O  OG  . SER D 2 26  ? 0.383   85.450  -15.841 1.00 44.67 ? 30  SER R OG  1 
ATOM   3438 N  N   . ASN D 2 27  ? 1.998   81.013  -15.655 1.00 41.53 ? 31  ASN R N   1 
ATOM   3439 C  CA  . ASN D 2 27  ? 2.457   79.826  -14.932 1.00 39.37 ? 31  ASN R CA  1 
ATOM   3440 C  C   . ASN D 2 27  ? 1.298   78.940  -14.452 1.00 35.44 ? 31  ASN R C   1 
ATOM   3441 O  O   . ASN D 2 27  ? 0.498   78.484  -15.264 1.00 35.52 ? 31  ASN R O   1 
ATOM   3442 C  CB  . ASN D 2 27  ? 3.383   80.242  -13.777 1.00 39.21 ? 31  ASN R CB  1 
ATOM   3443 C  CG  . ASN D 2 27  ? 4.618   80.979  -14.262 1.00 39.75 ? 31  ASN R CG  1 
ATOM   3444 O  OD1 . ASN D 2 27  ? 5.380   80.460  -15.087 1.00 37.21 ? 31  ASN R OD1 1 
ATOM   3445 N  ND2 . ASN D 2 27  ? 4.819   82.198  -13.761 1.00 38.37 ? 31  ASN R ND2 1 
ATOM   3446 N  N   . THR D 2 28  ? 1.209   78.710  -13.142 1.00 32.24 ? 32  THR R N   1 
ATOM   3447 C  CA  . THR D 2 28  ? 0.172   77.872  -12.558 1.00 27.96 ? 32  THR R CA  1 
ATOM   3448 C  C   . THR D 2 28  ? -0.863  78.755  -11.857 1.00 28.08 ? 32  THR R C   1 
ATOM   3449 O  O   . THR D 2 28  ? -0.558  79.364  -10.836 1.00 29.31 ? 32  THR R O   1 
ATOM   3450 C  CB  . THR D 2 28  ? 0.791   76.884  -11.550 1.00 24.85 ? 32  THR R CB  1 
ATOM   3451 O  OG1 . THR D 2 28  ? 2.034   76.379  -12.054 1.00 20.92 ? 32  THR R OG1 1 
ATOM   3452 C  CG2 . THR D 2 28  ? -0.079  75.650  -11.402 1.00 26.12 ? 32  THR R CG2 1 
ATOM   3453 N  N   . PRO D 2 29  ? -2.084  78.829  -12.387 1.00 27.69 ? 33  PRO R N   1 
ATOM   3454 C  CA  . PRO D 2 29  ? -3.140  79.597  -11.714 1.00 27.40 ? 33  PRO R CA  1 
ATOM   3455 C  C   . PRO D 2 29  ? -3.603  78.877  -10.448 1.00 25.31 ? 33  PRO R C   1 
ATOM   3456 O  O   . PRO D 2 29  ? -3.284  77.700  -10.310 1.00 25.38 ? 33  PRO R O   1 
ATOM   3457 C  CB  . PRO D 2 29  ? -4.275  79.665  -12.756 1.00 27.29 ? 33  PRO R CB  1 
ATOM   3458 C  CG  . PRO D 2 29  ? -3.783  78.944  -13.987 1.00 27.15 ? 33  PRO R CG  1 
ATOM   3459 C  CD  . PRO D 2 29  ? -2.559  78.188  -13.628 1.00 26.03 ? 33  PRO R CD  1 
ATOM   3460 N  N   . PRO D 2 30  ? -4.337  79.541  -9.552  1.00 25.59 ? 34  PRO R N   1 
ATOM   3461 C  CA  . PRO D 2 30  ? -4.858  78.861  -8.360  1.00 25.05 ? 34  PRO R CA  1 
ATOM   3462 C  C   . PRO D 2 30  ? -5.791  77.730  -8.773  1.00 24.89 ? 34  PRO R C   1 
ATOM   3463 O  O   . PRO D 2 30  ? -6.333  77.777  -9.880  1.00 24.60 ? 34  PRO R O   1 
ATOM   3464 C  CB  . PRO D 2 30  ? -5.620  79.965  -7.611  1.00 23.35 ? 34  PRO R CB  1 
ATOM   3465 C  CG  . PRO D 2 30  ? -5.111  81.234  -8.158  1.00 25.44 ? 34  PRO R CG  1 
ATOM   3466 C  CD  . PRO D 2 30  ? -4.743  80.956  -9.591  1.00 26.00 ? 34  PRO R CD  1 
ATOM   3467 N  N   . LEU D 2 31  ? -5.973  76.748  -7.897  1.00 25.92 ? 35  LEU R N   1 
ATOM   3468 C  CA  . LEU D 2 31  ? -6.744  75.537  -8.204  1.00 27.44 ? 35  LEU R CA  1 
ATOM   3469 C  C   . LEU D 2 31  ? -8.219  75.809  -8.547  1.00 27.55 ? 35  LEU R C   1 
ATOM   3470 O  O   . LEU D 2 31  ? -8.795  75.137  -9.412  1.00 26.26 ? 35  LEU R O   1 
ATOM   3471 C  CB  . LEU D 2 31  ? -6.634  74.535  -7.038  1.00 27.89 ? 35  LEU R CB  1 
ATOM   3472 C  CG  . LEU D 2 31  ? -7.138  73.096  -7.231  1.00 29.03 ? 35  LEU R CG  1 
ATOM   3473 C  CD1 . LEU D 2 31  ? -6.867  72.535  -8.626  1.00 29.29 ? 35  LEU R CD1 1 
ATOM   3474 C  CD2 . LEU D 2 31  ? -6.515  72.195  -6.176  1.00 29.42 ? 35  LEU R CD2 1 
ATOM   3475 N  N   . THR D 2 32  ? -8.822  76.793  -7.878  1.00 30.85 ? 36  THR R N   1 
ATOM   3476 C  CA  . THR D 2 32  ? -10.210 77.190  -8.153  1.00 34.99 ? 36  THR R CA  1 
ATOM   3477 C  C   . THR D 2 32  ? -10.373 77.704  -9.579  1.00 34.02 ? 36  THR R C   1 
ATOM   3478 O  O   . THR D 2 32  ? -11.397 77.471  -10.219 1.00 37.35 ? 36  THR R O   1 
ATOM   3479 C  CB  . THR D 2 32  ? -10.666 78.306  -7.184  1.00 39.79 ? 36  THR R CB  1 
ATOM   3480 O  OG1 . THR D 2 32  ? -10.312 77.972  -5.838  1.00 46.63 ? 36  THR R OG1 1 
ATOM   3481 C  CG2 . THR D 2 32  ? -12.193 78.414  -7.144  1.00 38.97 ? 36  THR R CG2 1 
ATOM   3482 N  N   . CYS D 2 33  ? -9.351  78.410  -10.052 1.00 32.28 ? 37  CYS R N   1 
ATOM   3483 C  CA  . CYS D 2 33  ? -9.369  79.089  -11.347 1.00 31.38 ? 37  CYS R CA  1 
ATOM   3484 C  C   . CYS D 2 33  ? -9.131  78.182  -12.549 1.00 30.18 ? 37  CYS R C   1 
ATOM   3485 O  O   . CYS D 2 33  ? -9.410  78.581  -13.676 1.00 32.72 ? 37  CYS R O   1 
ATOM   3486 C  CB  . CYS D 2 33  ? -8.298  80.192  -11.361 1.00 30.37 ? 37  CYS R CB  1 
ATOM   3487 S  SG  . CYS D 2 33  ? -8.668  81.581  -10.270 1.00 35.17 ? 37  CYS R SG  1 
ATOM   3488 N  N   . GLN D 2 34  ? -8.614  76.980  -12.318 1.00 30.54 ? 38  GLN R N   1 
ATOM   3489 C  CA  . GLN D 2 34  ? -8.084  76.145  -13.405 1.00 33.97 ? 38  GLN R CA  1 
ATOM   3490 C  C   . GLN D 2 34  ? -9.127  75.774  -14.440 1.00 31.25 ? 38  GLN R C   1 
ATOM   3491 O  O   . GLN D 2 34  ? -8.799  75.658  -15.618 1.00 29.74 ? 38  GLN R O   1 
ATOM   3492 C  CB  . GLN D 2 34  ? -7.410  74.871  -12.864 1.00 36.29 ? 38  GLN R CB  1 
ATOM   3493 C  CG  . GLN D 2 34  ? -6.322  75.158  -11.825 1.00 39.18 ? 38  GLN R CG  1 
ATOM   3494 C  CD  . GLN D 2 34  ? -5.101  74.252  -11.926 1.00 40.71 ? 38  GLN R CD  1 
ATOM   3495 O  OE1 . GLN D 2 34  ? -5.221  73.057  -12.218 1.00 40.88 ? 38  GLN R OE1 1 
ATOM   3496 N  NE2 . GLN D 2 34  ? -3.924  74.818  -11.669 1.00 38.11 ? 38  GLN R NE2 1 
ATOM   3497 N  N   . ARG D 2 35  ? -10.371 75.583  -14.004 1.00 32.79 ? 39  ARG R N   1 
ATOM   3498 C  CA  . ARG D 2 35  ? -11.456 75.235  -14.928 1.00 34.41 ? 39  ARG R CA  1 
ATOM   3499 C  C   . ARG D 2 35  ? -11.777 76.441  -15.824 1.00 33.66 ? 39  ARG R C   1 
ATOM   3500 O  O   . ARG D 2 35  ? -11.867 76.305  -17.043 1.00 33.15 ? 39  ARG R O   1 
ATOM   3501 C  CB  . ARG D 2 35  ? -12.708 74.736  -14.175 1.00 35.04 ? 39  ARG R CB  1 
ATOM   3502 C  CG  . ARG D 2 35  ? -13.007 73.247  -14.388 1.00 36.77 ? 39  ARG R CG  1 
ATOM   3503 C  CD  . ARG D 2 35  ? -14.117 72.681  -13.496 1.00 37.59 ? 39  ARG R CD  1 
ATOM   3504 N  NE  . ARG D 2 35  ? -14.755 71.486  -14.064 1.00 37.50 ? 39  ARG R NE  1 
ATOM   3505 C  CZ  . ARG D 2 35  ? -15.664 71.485  -15.051 1.00 37.73 ? 39  ARG R CZ  1 
ATOM   3506 N  NH1 . ARG D 2 35  ? -16.069 72.617  -15.618 1.00 38.77 ? 39  ARG R NH1 1 
ATOM   3507 N  NH2 . ARG D 2 35  ? -16.173 70.335  -15.483 1.00 36.72 ? 39  ARG R NH2 1 
ATOM   3508 N  N   . TYR D 2 36  ? -11.914 77.613  -15.204 1.00 33.03 ? 40  TYR R N   1 
ATOM   3509 C  CA  . TYR D 2 36  ? -12.151 78.882  -15.905 1.00 32.59 ? 40  TYR R CA  1 
ATOM   3510 C  C   . TYR D 2 36  ? -11.066 79.220  -16.940 1.00 35.73 ? 40  TYR R C   1 
ATOM   3511 O  O   . TYR D 2 36  ? -11.365 79.767  -18.005 1.00 36.90 ? 40  TYR R O   1 
ATOM   3512 C  CB  . TYR D 2 36  ? -12.271 80.011  -14.867 1.00 29.74 ? 40  TYR R CB  1 
ATOM   3513 C  CG  . TYR D 2 36  ? -12.331 81.421  -15.414 1.00 27.81 ? 40  TYR R CG  1 
ATOM   3514 C  CD1 . TYR D 2 36  ? -11.169 82.154  -15.645 1.00 22.50 ? 40  TYR R CD1 1 
ATOM   3515 C  CD2 . TYR D 2 36  ? -13.554 82.034  -15.677 1.00 29.75 ? 40  TYR R CD2 1 
ATOM   3516 C  CE1 . TYR D 2 36  ? -11.221 83.464  -16.140 1.00 22.41 ? 40  TYR R CE1 1 
ATOM   3517 C  CE2 . TYR D 2 36  ? -13.616 83.345  -16.165 1.00 28.90 ? 40  TYR R CE2 1 
ATOM   3518 C  CZ  . TYR D 2 36  ? -12.445 84.056  -16.391 1.00 24.49 ? 40  TYR R CZ  1 
ATOM   3519 O  OH  . TYR D 2 36  ? -12.511 85.342  -16.881 1.00 24.58 ? 40  TYR R OH  1 
ATOM   3520 N  N   . CYS D 2 37  ? -9.817  78.879  -16.632 1.00 38.67 ? 41  CYS R N   1 
ATOM   3521 C  CA  . CYS D 2 37  ? -8.675  79.260  -17.468 1.00 39.99 ? 41  CYS R CA  1 
ATOM   3522 C  C   . CYS D 2 37  ? -8.528  78.387  -18.713 1.00 41.62 ? 41  CYS R C   1 
ATOM   3523 O  O   . CYS D 2 37  ? -7.775  78.737  -19.621 1.00 41.10 ? 41  CYS R O   1 
ATOM   3524 C  CB  . CYS D 2 37  ? -7.368  79.222  -16.658 1.00 38.57 ? 41  CYS R CB  1 
ATOM   3525 S  SG  . CYS D 2 37  ? -7.240  80.500  -15.379 1.00 41.29 ? 41  CYS R SG  1 
ATOM   3526 N  N   . ASN D 2 38  ? -9.225  77.253  -18.749 1.00 45.92 ? 42  ASN R N   1 
ATOM   3527 C  CA  . ASN D 2 38  ? -9.186  76.364  -19.909 1.00 50.61 ? 42  ASN R CA  1 
ATOM   3528 C  C   . ASN D 2 38  ? -10.294 76.658  -20.921 1.00 53.23 ? 42  ASN R C   1 
ATOM   3529 O  O   . ASN D 2 38  ? -10.012 77.144  -22.022 1.00 52.70 ? 42  ASN R O   1 
ATOM   3530 C  CB  . ASN D 2 38  ? -9.224  74.905  -19.453 1.00 51.79 ? 42  ASN R CB  1 
ATOM   3531 C  CG  . ASN D 2 38  ? -8.057  74.554  -18.541 1.00 52.06 ? 42  ASN R CG  1 
ATOM   3532 O  OD1 . ASN D 2 38  ? -6.963  75.102  -18.674 1.00 51.47 ? 42  ASN R OD1 1 
ATOM   3533 N  ND2 . ASN D 2 38  ? -8.289  73.643  -17.605 1.00 53.29 ? 42  ASN R ND2 1 
ATOM   3534 N  N   . ALA D 2 39  ? -11.545 76.391  -20.543 1.00 58.46 ? 43  ALA R N   1 
ATOM   3535 C  CA  . ALA D 2 39  ? -12.681 76.504  -21.472 1.00 62.15 ? 43  ALA R CA  1 
ATOM   3536 C  C   . ALA D 2 39  ? -13.117 77.954  -21.701 1.00 62.29 ? 43  ALA R C   1 
ATOM   3537 O  O   . ALA D 2 39  ? -12.545 78.890  -21.139 1.00 60.72 ? 43  ALA R O   1 
ATOM   3538 C  CB  . ALA D 2 39  ? -13.868 75.667  -20.978 1.00 62.97 ? 43  ALA R CB  1 
ATOM   3539 N  N   . GLY E 2 2   ? 10.000  124.654 -4.677  1.00 43.24 ? 6   GLY S N   1 
ATOM   3540 C  CA  . GLY E 2 2   ? 8.557   124.383 -4.869  1.00 37.43 ? 6   GLY S CA  1 
ATOM   3541 C  C   . GLY E 2 2   ? 7.952   125.135 -6.038  1.00 39.27 ? 6   GLY S C   1 
ATOM   3542 O  O   . GLY E 2 2   ? 6.725   125.245 -6.087  1.00 42.02 ? 6   GLY S O   1 
ATOM   3543 N  N   . GLN E 2 3   ? 8.771   125.660 -6.967  1.00 38.10 ? 7   GLN S N   1 
ATOM   3544 C  CA  . GLN E 2 3   ? 8.219   126.362 -8.147  1.00 33.31 ? 7   GLN S CA  1 
ATOM   3545 C  C   . GLN E 2 3   ? 8.685   125.841 -9.520  1.00 27.38 ? 7   GLN S C   1 
ATOM   3546 O  O   . GLN E 2 3   ? 9.867   125.642 -9.783  1.00 21.77 ? 7   GLN S O   1 
ATOM   3547 C  CB  . GLN E 2 3   ? 8.402   127.874 -8.053  1.00 35.23 ? 7   GLN S CB  1 
ATOM   3548 C  CG  . GLN E 2 3   ? 7.266   128.662 -8.728  1.00 37.40 ? 7   GLN S CG  1 
ATOM   3549 C  CD  . GLN E 2 3   ? 5.867   128.291 -8.204  1.00 38.95 ? 7   GLN S CD  1 
ATOM   3550 O  OE1 . GLN E 2 3   ? 5.234   127.336 -8.685  1.00 35.78 ? 7   GLN S OE1 1 
ATOM   3551 N  NE2 . GLN E 2 3   ? 5.388   129.049 -7.225  1.00 39.28 ? 7   GLN S NE2 1 
ATOM   3552 N  N   . CYS E 2 4   ? 7.701   125.657 -10.392 1.00 28.19 ? 8   CYS S N   1 
ATOM   3553 C  CA  . CYS E 2 4   ? 7.835   124.871 -11.606 1.00 27.90 ? 8   CYS S CA  1 
ATOM   3554 C  C   . CYS E 2 4   ? 7.359   125.662 -12.825 1.00 25.78 ? 8   CYS S C   1 
ATOM   3555 O  O   . CYS E 2 4   ? 7.013   126.840 -12.709 1.00 22.37 ? 8   CYS S O   1 
ATOM   3556 C  CB  . CYS E 2 4   ? 7.001   123.604 -11.439 1.00 31.05 ? 8   CYS S CB  1 
ATOM   3557 S  SG  . CYS E 2 4   ? 7.563   122.572 -10.067 1.00 39.61 ? 8   CYS S SG  1 
ATOM   3558 N  N   . SER E 2 5   ? 7.372   125.030 -13.998 1.00 27.19 ? 9   SER S N   1 
ATOM   3559 C  CA  . SER E 2 5   ? 6.764   125.638 -15.190 1.00 30.06 ? 9   SER S CA  1 
ATOM   3560 C  C   . SER E 2 5   ? 5.242   125.465 -15.125 1.00 28.94 ? 9   SER S C   1 
ATOM   3561 O  O   . SER E 2 5   ? 4.736   124.657 -14.331 1.00 27.17 ? 9   SER S O   1 
ATOM   3562 C  CB  . SER E 2 5   ? 7.335   125.066 -16.506 1.00 29.50 ? 9   SER S CB  1 
ATOM   3563 O  OG  . SER E 2 5   ? 7.413   123.654 -16.498 1.00 29.99 ? 9   SER S OG  1 
ATOM   3564 N  N   . GLN E 2 6   ? 4.528   126.232 -15.949 1.00 27.48 ? 10  GLN S N   1 
ATOM   3565 C  CA  . GLN E 2 6   ? 3.059   126.212 -15.977 1.00 30.25 ? 10  GLN S CA  1 
ATOM   3566 C  C   . GLN E 2 6   ? 2.541   124.807 -16.288 1.00 30.67 ? 10  GLN S C   1 
ATOM   3567 O  O   . GLN E 2 6   ? 3.149   124.048 -17.077 1.00 36.25 ? 10  GLN S O   1 
ATOM   3568 C  CB  . GLN E 2 6   ? 2.491   127.218 -17.012 1.00 33.05 ? 10  GLN S CB  1 
ATOM   3569 C  CG  . GLN E 2 6   ? 1.285   128.006 -16.484 1.00 33.10 ? 10  GLN S CG  1 
ATOM   3570 C  CD  . GLN E 2 6   ? 0.656   128.887 -17.545 1.00 37.20 ? 10  GLN S CD  1 
ATOM   3571 O  OE1 . GLN E 2 6   ? -0.177  128.429 -18.331 1.00 39.53 ? 10  GLN S OE1 1 
ATOM   3572 N  NE2 . GLN E 2 6   ? 1.050   130.157 -17.574 1.00 37.06 ? 10  GLN S NE2 1 
ATOM   3573 N  N   . ASN E 2 7   ? 1.436   124.459 -15.630 1.00 28.36 ? 11  ASN S N   1 
ATOM   3574 C  CA  . ASN E 2 7   ? 0.873   123.107 -15.694 1.00 28.55 ? 11  ASN S CA  1 
ATOM   3575 C  C   . ASN E 2 7   ? 1.810   121.995 -15.157 1.00 24.63 ? 11  ASN S C   1 
ATOM   3576 O  O   . ASN E 2 7   ? 1.849   120.907 -15.718 1.00 23.65 ? 11  ASN S O   1 
ATOM   3577 C  CB  . ASN E 2 7   ? 0.393   122.812 -17.133 1.00 27.99 ? 11  ASN S CB  1 
ATOM   3578 C  CG  . ASN E 2 7   ? -0.333  124.006 -17.765 1.00 30.78 ? 11  ASN S CG  1 
ATOM   3579 O  OD1 . ASN E 2 7   ? -0.074  124.388 -18.918 1.00 29.35 ? 11  ASN S OD1 1 
ATOM   3580 N  ND2 . ASN E 2 7   ? -1.246  124.607 -17.003 1.00 28.86 ? 11  ASN S ND2 1 
ATOM   3581 N  N   . GLU E 2 8   ? 2.562   122.299 -14.088 1.00 25.21 ? 12  GLU S N   1 
ATOM   3582 C  CA  . GLU E 2 8   ? 3.290   121.295 -13.271 1.00 25.34 ? 12  GLU S CA  1 
ATOM   3583 C  C   . GLU E 2 8   ? 3.097   121.575 -11.775 1.00 21.52 ? 12  GLU S C   1 
ATOM   3584 O  O   . GLU E 2 8   ? 2.723   122.668 -11.388 1.00 19.72 ? 12  GLU S O   1 
ATOM   3585 C  CB  . GLU E 2 8   ? 4.802   121.296 -13.564 1.00 30.86 ? 12  GLU S CB  1 
ATOM   3586 C  CG  . GLU E 2 8   ? 5.208   121.024 -15.006 1.00 35.05 ? 12  GLU S CG  1 
ATOM   3587 C  CD  . GLU E 2 8   ? 6.723   120.908 -15.186 1.00 39.32 ? 12  GLU S CD  1 
ATOM   3588 O  OE1 . GLU E 2 8   ? 7.478   121.709 -14.590 1.00 38.76 ? 12  GLU S OE1 1 
ATOM   3589 O  OE2 . GLU E 2 8   ? 7.168   120.018 -15.941 1.00 44.02 ? 12  GLU S OE2 1 
ATOM   3590 N  N   . TYR E 2 9   ? 3.358   120.583 -10.929 1.00 25.30 ? 13  TYR S N   1 
ATOM   3591 C  CA  . TYR E 2 9   ? 3.353   120.787 -9.472  1.00 25.40 ? 13  TYR S CA  1 
ATOM   3592 C  C   . TYR E 2 9   ? 4.660   120.268 -8.884  1.00 24.53 ? 13  TYR S C   1 
ATOM   3593 O  O   . TYR E 2 9   ? 5.304   119.403 -9.473  1.00 25.48 ? 13  TYR S O   1 
ATOM   3594 C  CB  . TYR E 2 9   ? 2.153   120.082 -8.806  1.00 22.38 ? 13  TYR S CB  1 
ATOM   3595 C  CG  . TYR E 2 9   ? 2.261   118.571 -8.788  1.00 21.57 ? 13  TYR S CG  1 
ATOM   3596 C  CD1 . TYR E 2 9   ? 2.005   117.832 -9.939  1.00 19.09 ? 13  TYR S CD1 1 
ATOM   3597 C  CD2 . TYR E 2 9   ? 2.645   117.886 -7.631  1.00 24.86 ? 13  TYR S CD2 1 
ATOM   3598 C  CE1 . TYR E 2 9   ? 2.117   116.461 -9.954  1.00 20.83 ? 13  TYR S CE1 1 
ATOM   3599 C  CE2 . TYR E 2 9   ? 2.763   116.487 -7.626  1.00 23.50 ? 13  TYR S CE2 1 
ATOM   3600 C  CZ  . TYR E 2 9   ? 2.496   115.789 -8.800  1.00 24.13 ? 13  TYR S CZ  1 
ATOM   3601 O  OH  . TYR E 2 9   ? 2.598   114.425 -8.845  1.00 20.98 ? 13  TYR S OH  1 
ATOM   3602 N  N   . PHE E 2 10  ? 5.053   120.794 -7.727  1.00 25.24 ? 14  PHE S N   1 
ATOM   3603 C  CA  . PHE E 2 10  ? 6.210   120.255 -7.041  1.00 25.96 ? 14  PHE S CA  1 
ATOM   3604 C  C   . PHE E 2 10  ? 5.769   119.093 -6.176  1.00 27.63 ? 14  PHE S C   1 
ATOM   3605 O  O   . PHE E 2 10  ? 5.047   119.259 -5.178  1.00 31.40 ? 14  PHE S O   1 
ATOM   3606 C  CB  . PHE E 2 10  ? 6.971   121.286 -6.204  1.00 26.95 ? 14  PHE S CB  1 
ATOM   3607 C  CG  . PHE E 2 10  ? 8.297   120.770 -5.731  1.00 27.98 ? 14  PHE S CG  1 
ATOM   3608 C  CD1 . PHE E 2 10  ? 9.355   120.638 -6.627  1.00 26.38 ? 14  PHE S CD1 1 
ATOM   3609 C  CD2 . PHE E 2 10  ? 8.466   120.338 -4.420  1.00 26.10 ? 14  PHE S CD2 1 
ATOM   3610 C  CE1 . PHE E 2 10  ? 10.573  120.117 -6.218  1.00 27.66 ? 14  PHE S CE1 1 
ATOM   3611 C  CE2 . PHE E 2 10  ? 9.684   119.819 -4.002  1.00 27.18 ? 14  PHE S CE2 1 
ATOM   3612 C  CZ  . PHE E 2 10  ? 10.741  119.711 -4.902  1.00 26.28 ? 14  PHE S CZ  1 
ATOM   3613 N  N   . ASP E 2 11  ? 6.212   117.913 -6.586  1.00 25.35 ? 15  ASP S N   1 
ATOM   3614 C  CA  . ASP E 2 11  ? 5.885   116.672 -5.923  1.00 21.20 ? 15  ASP S CA  1 
ATOM   3615 C  C   . ASP E 2 11  ? 6.832   116.448 -4.749  1.00 21.48 ? 15  ASP S C   1 
ATOM   3616 O  O   . ASP E 2 11  ? 8.010   116.208 -4.938  1.00 27.51 ? 15  ASP S O   1 
ATOM   3617 C  CB  . ASP E 2 11  ? 6.006   115.541 -6.939  1.00 21.48 ? 15  ASP S CB  1 
ATOM   3618 C  CG  . ASP E 2 11  ? 5.368   114.274 -6.463  1.00 25.28 ? 15  ASP S CG  1 
ATOM   3619 O  OD1 . ASP E 2 11  ? 5.727   113.814 -5.359  1.00 25.59 ? 15  ASP S OD1 1 
ATOM   3620 O  OD2 . ASP E 2 11  ? 4.489   113.677 -7.121  1.00 25.04 ? 15  ASP S OD2 1 
ATOM   3621 N  N   . SER E 2 12  ? 6.294   116.530 -3.542  1.00 27.13 ? 16  SER S N   1 
ATOM   3622 C  CA  . SER E 2 12  ? 7.054   116.376 -2.301  1.00 28.14 ? 16  SER S CA  1 
ATOM   3623 C  C   . SER E 2 12  ? 7.500   114.947 -2.001  1.00 26.38 ? 16  SER S C   1 
ATOM   3624 O  O   . SER E 2 12  ? 8.316   114.736 -1.115  1.00 25.81 ? 16  SER S O   1 
ATOM   3625 C  CB  . SER E 2 12  ? 6.228   116.887 -1.115  1.00 27.29 ? 16  SER S CB  1 
ATOM   3626 O  OG  . SER E 2 12  ? 6.277   118.294 -1.080  1.00 32.50 ? 16  SER S OG  1 
ATOM   3627 N  N   . LEU E 2 13  ? 6.942   113.965 -2.698  1.00 26.94 ? 17  LEU S N   1 
ATOM   3628 C  CA  . LEU E 2 13  ? 7.451   112.600 -2.599  1.00 24.76 ? 17  LEU S CA  1 
ATOM   3629 C  C   . LEU E 2 13  ? 8.698   112.420 -3.462  1.00 27.57 ? 17  LEU S C   1 
ATOM   3630 O  O   . LEU E 2 13  ? 9.678   111.834 -3.009  1.00 28.07 ? 17  LEU S O   1 
ATOM   3631 C  CB  . LEU E 2 13  ? 6.407   111.586 -3.033  1.00 22.45 ? 17  LEU S CB  1 
ATOM   3632 C  CG  . LEU E 2 13  ? 6.938   110.159 -3.157  1.00 16.57 ? 17  LEU S CG  1 
ATOM   3633 C  CD1 . LEU E 2 13  ? 7.299   109.627 -1.792  1.00 16.51 ? 17  LEU S CD1 1 
ATOM   3634 C  CD2 . LEU E 2 13  ? 5.910   109.281 -3.847  1.00 16.66 ? 17  LEU S CD2 1 
ATOM   3635 N  N   . LEU E 2 14  ? 8.644   112.898 -4.706  1.00 25.61 ? 18  LEU S N   1 
ATOM   3636 C  CA  . LEU E 2 14  ? 9.752   112.737 -5.659  1.00 24.42 ? 18  LEU S CA  1 
ATOM   3637 C  C   . LEU E 2 14  ? 10.748  113.893 -5.642  1.00 21.83 ? 18  LEU S C   1 
ATOM   3638 O  O   . LEU E 2 14  ? 11.775  113.814 -6.280  1.00 28.72 ? 18  LEU S O   1 
ATOM   3639 C  CB  . LEU E 2 14  ? 9.204   112.582 -7.080  1.00 23.93 ? 18  LEU S CB  1 
ATOM   3640 C  CG  . LEU E 2 14  ? 8.113   111.535 -7.321  1.00 22.03 ? 18  LEU S CG  1 
ATOM   3641 C  CD1 . LEU E 2 14  ? 7.574   111.639 -8.758  1.00 21.74 ? 18  LEU S CD1 1 
ATOM   3642 C  CD2 . LEU E 2 14  ? 8.638   110.160 -7.062  1.00 20.30 ? 18  LEU S CD2 1 
ATOM   3643 N  N   . HIS E 2 15  ? 10.442  114.955 -4.905  1.00 26.35 ? 19  HIS S N   1 
ATOM   3644 C  CA  . HIS E 2 15  ? 11.234  116.187 -4.909  1.00 31.06 ? 19  HIS S CA  1 
ATOM   3645 C  C   . HIS E 2 15  ? 11.599  116.628 -6.327  1.00 29.69 ? 19  HIS S C   1 
ATOM   3646 O  O   . HIS E 2 15  ? 12.756  116.885 -6.641  1.00 28.08 ? 19  HIS S O   1 
ATOM   3647 C  CB  . HIS E 2 15  ? 12.470  116.031 -4.021  1.00 34.25 ? 19  HIS S CB  1 
ATOM   3648 C  CG  . HIS E 2 15  ? 12.131  115.956 -2.566  1.00 43.23 ? 19  HIS S CG  1 
ATOM   3649 N  ND1 . HIS E 2 15  ? 12.357  116.998 -1.694  1.00 47.02 ? 19  HIS S ND1 1 
ATOM   3650 C  CD2 . HIS E 2 15  ? 11.536  114.978 -1.839  1.00 45.89 ? 19  HIS S CD2 1 
ATOM   3651 C  CE1 . HIS E 2 15  ? 11.936  116.657 -0.488  1.00 47.32 ? 19  HIS S CE1 1 
ATOM   3652 N  NE2 . HIS E 2 15  ? 11.435  115.436 -0.549  1.00 45.57 ? 19  HIS S NE2 1 
ATOM   3653 N  N   . ALA E 2 16  ? 10.585  116.687 -7.178  1.00 29.76 ? 20  ALA S N   1 
ATOM   3654 C  CA  . ALA E 2 16  ? 10.766  117.072 -8.566  1.00 32.31 ? 20  ALA S CA  1 
ATOM   3655 C  C   . ALA E 2 16  ? 9.497   117.668 -9.137  1.00 29.68 ? 20  ALA S C   1 
ATOM   3656 O  O   . ALA E 2 16  ? 8.396   117.393 -8.658  1.00 30.28 ? 20  ALA S O   1 
ATOM   3657 C  CB  . ALA E 2 16  ? 11.203  115.863 -9.402  1.00 33.57 ? 20  ALA S CB  1 
ATOM   3658 N  N   . CYS E 2 17  ? 9.668   118.475 -10.178 1.00 28.88 ? 21  CYS S N   1 
ATOM   3659 C  CA  . CYS E 2 17  ? 8.549   119.039 -10.917 1.00 32.44 ? 21  CYS S CA  1 
ATOM   3660 C  C   . CYS E 2 17  ? 7.980   117.975 -11.849 1.00 32.22 ? 21  CYS S C   1 
ATOM   3661 O  O   . CYS E 2 17  ? 8.731   117.331 -12.581 1.00 33.05 ? 21  CYS S O   1 
ATOM   3662 C  CB  . CYS E 2 17  ? 9.002   120.276 -11.696 1.00 34.58 ? 21  CYS S CB  1 
ATOM   3663 S  SG  . CYS E 2 17  ? 9.363   121.664 -10.591 1.00 37.35 ? 21  CYS S SG  1 
ATOM   3664 N  N   . ILE E 2 18  ? 6.658   117.790 -11.798 1.00 30.86 ? 22  ILE S N   1 
ATOM   3665 C  CA  . ILE E 2 18  ? 5.965   116.735 -12.551 1.00 30.01 ? 22  ILE S CA  1 
ATOM   3666 C  C   . ILE E 2 18  ? 4.758   117.319 -13.271 1.00 27.56 ? 22  ILE S C   1 
ATOM   3667 O  O   . ILE E 2 18  ? 4.038   118.135 -12.688 1.00 27.98 ? 22  ILE S O   1 
ATOM   3668 C  CB  . ILE E 2 18  ? 5.542   115.586 -11.583 1.00 31.11 ? 22  ILE S CB  1 
ATOM   3669 C  CG1 . ILE E 2 18  ? 6.742   114.667 -11.306 1.00 33.91 ? 22  ILE S CG1 1 
ATOM   3670 C  CG2 . ILE E 2 18  ? 4.404   114.741 -12.153 1.00 29.03 ? 22  ILE S CG2 1 
ATOM   3671 C  CD1 . ILE E 2 18  ? 7.226   114.778 -9.958  1.00 38.04 ? 22  ILE S CD1 1 
ATOM   3672 N  N   . PRO E 2 19  ? 4.537   116.936 -14.531 1.00 28.01 ? 23  PRO S N   1 
ATOM   3673 C  CA  . PRO E 2 19  ? 3.336   117.393 -15.258 1.00 27.37 ? 23  PRO S CA  1 
ATOM   3674 C  C   . PRO E 2 19  ? 2.062   117.054 -14.498 1.00 25.91 ? 23  PRO S C   1 
ATOM   3675 O  O   . PRO E 2 19  ? 1.940   115.938 -13.980 1.00 25.62 ? 23  PRO S O   1 
ATOM   3676 C  CB  . PRO E 2 19  ? 3.387   116.618 -16.584 1.00 26.66 ? 23  PRO S CB  1 
ATOM   3677 C  CG  . PRO E 2 19  ? 4.811   116.217 -16.750 1.00 29.61 ? 23  PRO S CG  1 
ATOM   3678 C  CD  . PRO E 2 19  ? 5.405   116.092 -15.373 1.00 27.97 ? 23  PRO S CD  1 
ATOM   3679 N  N   . CYS E 2 20  ? 1.162   118.029 -14.400 1.00 20.63 ? 24  CYS S N   1 
ATOM   3680 C  CA  . CYS E 2 20  ? -0.166  117.834 -13.828 1.00 24.59 ? 24  CYS S CA  1 
ATOM   3681 C  C   . CYS E 2 20  ? -0.931  116.723 -14.545 1.00 24.70 ? 24  CYS S C   1 
ATOM   3682 O  O   . CYS E 2 20  ? -1.765  116.047 -13.940 1.00 21.69 ? 24  CYS S O   1 
ATOM   3683 C  CB  . CYS E 2 20  ? -0.975  119.144 -13.904 1.00 30.93 ? 24  CYS S CB  1 
ATOM   3684 S  SG  . CYS E 2 20  ? -0.672  120.272 -12.513 1.00 38.30 ? 24  CYS S SG  1 
ATOM   3685 N  N   . GLN E 2 21  ? -0.655  116.563 -15.840 1.00 26.36 ? 25  GLN S N   1 
ATOM   3686 C  CA  . GLN E 2 21  ? -1.293  115.546 -16.671 1.00 23.68 ? 25  GLN S CA  1 
ATOM   3687 C  C   . GLN E 2 21  ? -1.150  114.154 -16.038 1.00 19.87 ? 25  GLN S C   1 
ATOM   3688 O  O   . GLN E 2 21  ? -2.072  113.352 -16.101 1.00 15.42 ? 25  GLN S O   1 
ATOM   3689 C  CB  . GLN E 2 21  ? -0.700  115.588 -18.094 1.00 28.29 ? 25  GLN S CB  1 
ATOM   3690 C  CG  . GLN E 2 21  ? -1.055  114.407 -19.025 1.00 33.78 ? 25  GLN S CG  1 
ATOM   3691 C  CD  . GLN E 2 21  ? 0.104   113.415 -19.181 1.00 40.69 ? 25  GLN S CD  1 
ATOM   3692 O  OE1 . GLN E 2 21  ? 1.194   113.790 -19.628 1.00 43.36 ? 25  GLN S OE1 1 
ATOM   3693 N  NE2 . GLN E 2 21  ? -0.127  112.156 -18.805 1.00 41.74 ? 25  GLN S NE2 1 
ATOM   3694 N  N   . LEU E 2 22  ? -0.004  113.883 -15.413 1.00 18.02 ? 26  LEU S N   1 
ATOM   3695 C  CA  . LEU E 2 22  ? 0.248   112.579 -14.785 1.00 19.87 ? 26  LEU S CA  1 
ATOM   3696 C  C   . LEU E 2 22  ? -0.623  112.278 -13.572 1.00 19.56 ? 26  LEU S C   1 
ATOM   3697 O  O   . LEU E 2 22  ? -0.753  111.116 -13.194 1.00 22.92 ? 26  LEU S O   1 
ATOM   3698 C  CB  . LEU E 2 22  ? 1.713   112.445 -14.366 1.00 22.27 ? 26  LEU S CB  1 
ATOM   3699 C  CG  . LEU E 2 22  ? 2.800   112.281 -15.427 1.00 23.60 ? 26  LEU S CG  1 
ATOM   3700 C  CD1 . LEU E 2 22  ? 4.060   111.808 -14.738 1.00 23.95 ? 26  LEU S CD1 1 
ATOM   3701 C  CD2 . LEU E 2 22  ? 2.404   111.305 -16.528 1.00 26.10 ? 26  LEU S CD2 1 
ATOM   3702 N  N   . ARG E 2 23  ? -1.190  113.312 -12.954 1.00 22.86 ? 27  ARG S N   1 
ATOM   3703 C  CA  . ARG E 2 23  ? -2.056  113.149 -11.779 1.00 24.45 ? 27  ARG S CA  1 
ATOM   3704 C  C   . ARG E 2 23  ? -3.567  113.268 -12.050 1.00 28.15 ? 27  ARG S C   1 
ATOM   3705 O  O   . ARG E 2 23  ? -4.362  113.227 -11.111 1.00 31.48 ? 27  ARG S O   1 
ATOM   3706 C  CB  . ARG E 2 23  ? -1.644  114.149 -10.696 1.00 22.43 ? 27  ARG S CB  1 
ATOM   3707 C  CG  . ARG E 2 23  ? -0.269  113.877 -10.106 1.00 22.27 ? 27  ARG S CG  1 
ATOM   3708 C  CD  . ARG E 2 23  ? -0.200  112.614 -9.246  1.00 21.94 ? 27  ARG S CD  1 
ATOM   3709 N  NE  . ARG E 2 23  ? -1.071  112.714 -8.076  1.00 20.14 ? 27  ARG S NE  1 
ATOM   3710 C  CZ  . ARG E 2 23  ? -0.758  113.343 -6.949  1.00 18.68 ? 27  ARG S CZ  1 
ATOM   3711 N  NH1 . ARG E 2 23  ? 0.424   113.928 -6.809  1.00 21.71 ? 27  ARG S NH1 1 
ATOM   3712 N  NH2 . ARG E 2 23  ? -1.630  113.386 -5.951  1.00 17.51 ? 27  ARG S NH2 1 
ATOM   3713 N  N   . CYS E 2 24  ? -3.968  113.390 -13.313 1.00 29.74 ? 28  CYS S N   1 
ATOM   3714 C  CA  . CYS E 2 24  ? -5.393  113.494 -13.657 1.00 32.60 ? 28  CYS S CA  1 
ATOM   3715 C  C   . CYS E 2 24  ? -6.148  112.161 -13.591 1.00 34.70 ? 28  CYS S C   1 
ATOM   3716 O  O   . CYS E 2 24  ? -7.356  112.134 -13.359 1.00 35.17 ? 28  CYS S O   1 
ATOM   3717 C  CB  . CYS E 2 24  ? -5.564  114.142 -15.033 1.00 33.64 ? 28  CYS S CB  1 
ATOM   3718 S  SG  . CYS E 2 24  ? -5.102  115.902 -15.060 1.00 36.01 ? 28  CYS S SG  1 
ATOM   3719 N  N   . SER E 2 25  ? -5.440  111.057 -13.793 1.00 38.95 ? 29  SER S N   1 
ATOM   3720 C  CA  . SER E 2 25  ? -6.020  109.732 -13.578 1.00 40.64 ? 29  SER S CA  1 
ATOM   3721 C  C   . SER E 2 25  ? -6.179  109.408 -12.080 1.00 41.93 ? 29  SER S C   1 
ATOM   3722 O  O   . SER E 2 25  ? -7.006  108.579 -11.711 1.00 41.66 ? 29  SER S O   1 
ATOM   3723 C  CB  . SER E 2 25  ? -5.161  108.661 -14.259 1.00 40.79 ? 29  SER S CB  1 
ATOM   3724 O  OG  . SER E 2 25  ? -3.831  108.681 -13.763 1.00 38.89 ? 29  SER S OG  1 
ATOM   3725 N  N   . SER E 2 26  ? -5.386  110.058 -11.226 1.00 44.91 ? 30  SER S N   1 
ATOM   3726 C  CA  . SER E 2 26  ? -5.430  109.810 -9.778  1.00 44.96 ? 30  SER S CA  1 
ATOM   3727 C  C   . SER E 2 26  ? -6.733  110.326 -9.168  1.00 43.08 ? 30  SER S C   1 
ATOM   3728 O  O   . SER E 2 26  ? -7.400  111.186 -9.745  1.00 41.07 ? 30  SER S O   1 
ATOM   3729 C  CB  . SER E 2 26  ? -4.204  110.420 -9.063  1.00 45.03 ? 30  SER S CB  1 
ATOM   3730 O  OG  . SER E 2 26  ? -4.460  111.721 -8.551  1.00 45.84 ? 30  SER S OG  1 
ATOM   3731 N  N   . ASN E 2 27  ? -7.085  109.791 -8.001  1.00 42.56 ? 31  ASN S N   1 
ATOM   3732 C  CA  . ASN E 2 27  ? -8.370  110.097 -7.366  1.00 41.18 ? 31  ASN S CA  1 
ATOM   3733 C  C   . ASN E 2 27  ? -8.500  111.565 -6.965  1.00 39.43 ? 31  ASN S C   1 
ATOM   3734 O  O   . ASN E 2 27  ? -9.431  112.253 -7.400  1.00 40.26 ? 31  ASN S O   1 
ATOM   3735 C  CB  . ASN E 2 27  ? -8.612  109.197 -6.144  1.00 40.31 ? 31  ASN S CB  1 
ATOM   3736 C  CG  . ASN E 2 27  ? -9.487  108.000 -6.469  1.00 40.25 ? 31  ASN S CG  1 
ATOM   3737 O  OD1 . ASN E 2 27  ? -10.703 108.027 -6.264  1.00 39.99 ? 31  ASN S OD1 1 
ATOM   3738 N  ND2 . ASN E 2 27  ? -8.872  106.945 -6.988  1.00 39.49 ? 31  ASN S ND2 1 
ATOM   3739 N  N   . THR E 2 28  ? -7.572  112.028 -6.128  1.00 34.29 ? 32  THR S N   1 
ATOM   3740 C  CA  . THR E 2 28  ? -7.550  113.417 -5.679  1.00 30.50 ? 32  THR S CA  1 
ATOM   3741 C  C   . THR E 2 28  ? -6.238  114.066 -6.137  1.00 28.10 ? 32  THR S C   1 
ATOM   3742 O  O   . THR E 2 28  ? -5.195  113.865 -5.509  1.00 23.67 ? 32  THR S O   1 
ATOM   3743 C  CB  . THR E 2 28  ? -7.712  113.505 -4.139  1.00 29.11 ? 32  THR S CB  1 
ATOM   3744 O  OG1 . THR E 2 28  ? -8.818  112.698 -3.708  1.00 29.35 ? 32  THR S OG1 1 
ATOM   3745 C  CG2 . THR E 2 28  ? -8.106  114.919 -3.711  1.00 27.82 ? 32  THR S CG2 1 
ATOM   3746 N  N   . PRO E 2 29  ? -6.282  114.822 -7.240  1.00 26.18 ? 33  PRO S N   1 
ATOM   3747 C  CA  . PRO E 2 29  ? -5.088  115.514 -7.743  1.00 25.07 ? 33  PRO S CA  1 
ATOM   3748 C  C   . PRO E 2 29  ? -4.584  116.542 -6.737  1.00 20.42 ? 33  PRO S C   1 
ATOM   3749 O  O   . PRO E 2 29  ? -5.320  116.869 -5.803  1.00 17.71 ? 33  PRO S O   1 
ATOM   3750 C  CB  . PRO E 2 29  ? -5.588  116.224 -9.015  1.00 26.23 ? 33  PRO S CB  1 
ATOM   3751 C  CG  . PRO E 2 29  ? -6.865  115.588 -9.361  1.00 25.44 ? 33  PRO S CG  1 
ATOM   3752 C  CD  . PRO E 2 29  ? -7.456  115.070 -8.095  1.00 25.63 ? 33  PRO S CD  1 
ATOM   3753 N  N   . PRO E 2 30  ? -3.359  117.032 -6.900  1.00 19.78 ? 34  PRO S N   1 
ATOM   3754 C  CA  . PRO E 2 30  ? -2.861  118.109 -6.036  1.00 22.90 ? 34  PRO S CA  1 
ATOM   3755 C  C   . PRO E 2 30  ? -3.732  119.351 -6.161  1.00 22.79 ? 34  PRO S C   1 
ATOM   3756 O  O   . PRO E 2 30  ? -4.262  119.593 -7.238  1.00 22.77 ? 34  PRO S O   1 
ATOM   3757 C  CB  . PRO E 2 30  ? -1.449  118.383 -6.568  1.00 20.16 ? 34  PRO S CB  1 
ATOM   3758 C  CG  . PRO E 2 30  ? -1.074  117.163 -7.295  1.00 18.45 ? 34  PRO S CG  1 
ATOM   3759 C  CD  . PRO E 2 30  ? -2.347  116.603 -7.878  1.00 18.59 ? 34  PRO S CD  1 
ATOM   3760 N  N   . LEU E 2 31  ? -3.881  120.094 -5.069  1.00 24.49 ? 35  LEU S N   1 
ATOM   3761 C  CA  . LEU E 2 31  ? -4.651  121.335 -5.038  1.00 28.35 ? 35  LEU S CA  1 
ATOM   3762 C  C   . LEU E 2 31  ? -4.368  122.278 -6.224  1.00 30.67 ? 35  LEU S C   1 
ATOM   3763 O  O   . LEU E 2 31  ? -5.308  122.824 -6.817  1.00 28.30 ? 35  LEU S O   1 
ATOM   3764 C  CB  . LEU E 2 31  ? -4.390  122.064 -3.711  1.00 30.63 ? 35  LEU S CB  1 
ATOM   3765 C  CG  . LEU E 2 31  ? -5.449  123.050 -3.215  1.00 32.83 ? 35  LEU S CG  1 
ATOM   3766 C  CD1 . LEU E 2 31  ? -6.777  122.352 -2.909  1.00 32.95 ? 35  LEU S CD1 1 
ATOM   3767 C  CD2 . LEU E 2 31  ? -4.926  123.789 -1.986  1.00 33.34 ? 35  LEU S CD2 1 
ATOM   3768 N  N   . THR E 2 32  ? -3.090  122.461 -6.570  1.00 32.94 ? 36  THR S N   1 
ATOM   3769 C  CA  . THR E 2 32  ? -2.704  123.381 -7.660  1.00 37.52 ? 36  THR S CA  1 
ATOM   3770 C  C   . THR E 2 32  ? -3.006  122.832 -9.053  1.00 37.08 ? 36  THR S C   1 
ATOM   3771 O  O   . THR E 2 32  ? -3.191  123.603 -9.992  1.00 42.64 ? 36  THR S O   1 
ATOM   3772 C  CB  . THR E 2 32  ? -1.204  123.774 -7.594  1.00 39.26 ? 36  THR S CB  1 
ATOM   3773 O  OG1 . THR E 2 32  ? -0.400  122.625 -7.298  1.00 34.34 ? 36  THR S OG1 1 
ATOM   3774 C  CG2 . THR E 2 32  ? -0.937  124.754 -6.444  1.00 41.57 ? 36  THR S CG2 1 
ATOM   3775 N  N   . CYS E 2 33  ? -3.037  121.509 -9.181  1.00 32.86 ? 37  CYS S N   1 
ATOM   3776 C  CA  . CYS E 2 33  ? -3.437  120.853 -10.426 1.00 31.13 ? 37  CYS S CA  1 
ATOM   3777 C  C   . CYS E 2 33  ? -4.956  120.809 -10.673 1.00 29.57 ? 37  CYS S C   1 
ATOM   3778 O  O   . CYS E 2 33  ? -5.378  120.586 -11.803 1.00 25.23 ? 37  CYS S O   1 
ATOM   3779 C  CB  . CYS E 2 33  ? -2.890  119.424 -10.466 1.00 32.82 ? 37  CYS S CB  1 
ATOM   3780 S  SG  . CYS E 2 33  ? -1.099  119.332 -10.716 1.00 38.64 ? 37  CYS S SG  1 
ATOM   3781 N  N   . GLN E 2 34  ? -5.771  121.005 -9.635  1.00 30.04 ? 38  GLN S N   1 
ATOM   3782 C  CA  . GLN E 2 34  ? -7.224  120.809 -9.757  1.00 31.76 ? 38  GLN S CA  1 
ATOM   3783 C  C   . GLN E 2 34  ? -7.845  121.620 -10.906 1.00 29.38 ? 38  GLN S C   1 
ATOM   3784 O  O   . GLN E 2 34  ? -8.756  121.134 -11.573 1.00 24.95 ? 38  GLN S O   1 
ATOM   3785 C  CB  . GLN E 2 34  ? -7.954  121.103 -8.431  1.00 34.78 ? 38  GLN S CB  1 
ATOM   3786 C  CG  . GLN E 2 34  ? -8.280  119.852 -7.581  1.00 36.47 ? 38  GLN S CG  1 
ATOM   3787 C  CD  . GLN E 2 34  ? -9.694  119.312 -7.825  1.00 38.86 ? 38  GLN S CD  1 
ATOM   3788 O  OE1 . GLN E 2 34  ? -10.676 119.857 -7.311  1.00 40.28 ? 38  GLN S OE1 1 
ATOM   3789 N  NE2 . GLN E 2 34  ? -9.795  118.243 -8.609  1.00 38.95 ? 38  GLN S NE2 1 
ATOM   3790 N  N   . ARG E 2 35  ? -7.334  122.828 -11.151 1.00 30.07 ? 39  ARG S N   1 
ATOM   3791 C  CA  . ARG E 2 35  ? -7.846  123.679 -12.236 1.00 33.39 ? 39  ARG S CA  1 
ATOM   3792 C  C   . ARG E 2 35  ? -7.476  123.159 -13.628 1.00 34.31 ? 39  ARG S C   1 
ATOM   3793 O  O   . ARG E 2 35  ? -8.273  123.282 -14.563 1.00 33.96 ? 39  ARG S O   1 
ATOM   3794 C  CB  . ARG E 2 35  ? -7.366  125.126 -12.068 1.00 33.63 ? 39  ARG S CB  1 
ATOM   3795 N  N   . TYR E 2 36  ? -6.270  122.598 -13.760 1.00 34.71 ? 40  TYR S N   1 
ATOM   3796 C  CA  . TYR E 2 36  ? -5.807  122.016 -15.024 1.00 33.14 ? 40  TYR S CA  1 
ATOM   3797 C  C   . TYR E 2 36  ? -6.571  120.746 -15.400 1.00 31.04 ? 40  TYR S C   1 
ATOM   3798 O  O   . TYR E 2 36  ? -6.992  120.597 -16.546 1.00 31.86 ? 40  TYR S O   1 
ATOM   3799 C  CB  . TYR E 2 36  ? -4.303  121.720 -14.981 1.00 34.30 ? 40  TYR S CB  1 
ATOM   3800 C  CG  . TYR E 2 36  ? -3.787  121.055 -16.257 1.00 37.08 ? 40  TYR S CG  1 
ATOM   3801 C  CD1 . TYR E 2 36  ? -3.452  121.809 -17.396 1.00 37.66 ? 40  TYR S CD1 1 
ATOM   3802 C  CD2 . TYR E 2 36  ? -3.641  119.667 -16.333 1.00 39.06 ? 40  TYR S CD2 1 
ATOM   3803 C  CE1 . TYR E 2 36  ? -2.971  121.201 -18.576 1.00 38.16 ? 40  TYR S CE1 1 
ATOM   3804 C  CE2 . TYR E 2 36  ? -3.167  119.044 -17.516 1.00 39.92 ? 40  TYR S CE2 1 
ATOM   3805 C  CZ  . TYR E 2 36  ? -2.837  119.822 -18.637 1.00 39.04 ? 40  TYR S CZ  1 
ATOM   3806 O  OH  . TYR E 2 36  ? -2.360  119.231 -19.804 1.00 39.51 ? 40  TYR S OH  1 
ATOM   3807 N  N   . CYS E 2 37  ? -6.745  119.836 -14.442 1.00 29.56 ? 41  CYS S N   1 
ATOM   3808 C  CA  . CYS E 2 37  ? -7.476  118.590 -14.689 1.00 31.94 ? 41  CYS S CA  1 
ATOM   3809 C  C   . CYS E 2 37  ? -8.961  118.846 -14.971 1.00 32.77 ? 41  CYS S C   1 
ATOM   3810 O  O   . CYS E 2 37  ? -9.634  118.005 -15.568 1.00 34.55 ? 41  CYS S O   1 
ATOM   3811 C  CB  . CYS E 2 37  ? -7.318  117.619 -13.512 1.00 34.84 ? 41  CYS S CB  1 
ATOM   3812 S  SG  . CYS E 2 37  ? -5.649  116.902 -13.353 1.00 38.84 ? 41  CYS S SG  1 
ATOM   3813 N  N   . ASN E 2 38  ? -9.453  120.009 -14.542 1.00 31.05 ? 42  ASN S N   1 
ATOM   3814 C  CA  . ASN E 2 38  ? -10.815 120.446 -14.811 1.00 30.60 ? 42  ASN S CA  1 
ATOM   3815 C  C   . ASN E 2 38  ? -10.809 121.716 -15.657 1.00 30.90 ? 42  ASN S C   1 
ATOM   3816 O  O   . ASN E 2 38  ? -10.973 121.664 -16.876 1.00 30.44 ? 42  ASN S O   1 
ATOM   3817 C  CB  . ASN E 2 38  ? -11.557 120.696 -13.492 1.00 30.30 ? 42  ASN S CB  1 
ATOM   3818 C  CG  . ASN E 2 38  ? -12.252 119.451 -12.965 1.00 30.99 ? 42  ASN S CG  1 
ATOM   3819 O  OD1 . ASN E 2 38  ? -13.295 119.039 -13.488 1.00 31.78 ? 42  ASN S OD1 1 
ATOM   3820 N  ND2 . ASN E 2 38  ? -11.681 118.846 -11.926 1.00 29.02 ? 42  ASN S ND2 1 
ATOM   3821 N  N   . CYS F 2 4   ? 27.555  84.099  -24.016 1.00 28.45 ? 8   CYS T N   1 
ATOM   3822 C  CA  . CYS F 2 4   ? 26.213  84.537  -24.506 1.00 33.05 ? 8   CYS T CA  1 
ATOM   3823 C  C   . CYS F 2 4   ? 26.039  84.281  -26.000 1.00 32.27 ? 8   CYS T C   1 
ATOM   3824 O  O   . CYS F 2 4   ? 27.010  84.042  -26.714 1.00 34.09 ? 8   CYS T O   1 
ATOM   3825 C  CB  . CYS F 2 4   ? 26.012  86.032  -24.251 1.00 35.38 ? 8   CYS T CB  1 
ATOM   3826 S  SG  . CYS F 2 4   ? 25.372  86.486  -22.625 1.00 41.77 ? 8   CYS T SG  1 
ATOM   3827 N  N   . SER F 2 5   ? 24.789  84.350  -26.458 1.00 31.36 ? 9   SER T N   1 
ATOM   3828 C  CA  . SER F 2 5   ? 24.455  84.247  -27.877 1.00 29.50 ? 9   SER T CA  1 
ATOM   3829 C  C   . SER F 2 5   ? 24.668  85.581  -28.589 1.00 28.31 ? 9   SER T C   1 
ATOM   3830 O  O   . SER F 2 5   ? 24.943  86.598  -27.951 1.00 26.55 ? 9   SER T O   1 
ATOM   3831 C  CB  . SER F 2 5   ? 22.994  83.818  -28.038 1.00 28.70 ? 9   SER T CB  1 
ATOM   3832 O  OG  . SER F 2 5   ? 22.651  82.728  -27.092 1.00 29.83 ? 9   SER T OG  1 
ATOM   3833 N  N   . GLN F 2 6   ? 24.531  85.567  -29.915 1.00 27.40 ? 10  GLN T N   1 
ATOM   3834 C  CA  . GLN F 2 6   ? 24.663  86.778  -30.726 1.00 27.50 ? 10  GLN T CA  1 
ATOM   3835 C  C   . GLN F 2 6   ? 23.571  87.778  -30.361 1.00 29.27 ? 10  GLN T C   1 
ATOM   3836 O  O   . GLN F 2 6   ? 22.439  87.388  -30.068 1.00 31.81 ? 10  GLN T O   1 
ATOM   3837 C  CB  . GLN F 2 6   ? 24.584  86.446  -32.223 1.00 27.14 ? 10  GLN T CB  1 
ATOM   3838 C  CG  . GLN F 2 6   ? 24.997  87.593  -33.144 1.00 25.59 ? 10  GLN T CG  1 
ATOM   3839 C  CD  . GLN F 2 6   ? 24.809  87.259  -34.612 1.00 23.32 ? 10  GLN T CD  1 
ATOM   3840 O  OE1 . GLN F 2 6   ? 25.749  86.830  -35.275 1.00 23.31 ? 10  GLN T OE1 1 
ATOM   3841 N  NE2 . GLN F 2 6   ? 23.596  87.454  -35.121 1.00 21.82 ? 10  GLN T NE2 1 
ATOM   3842 N  N   . ASN F 2 7   ? 23.926  89.062  -30.373 1.00 28.66 ? 11  ASN T N   1 
ATOM   3843 C  CA  . ASN F 2 7   ? 23.008  90.139  -30.006 1.00 28.10 ? 11  ASN T CA  1 
ATOM   3844 C  C   . ASN F 2 7   ? 22.394  89.948  -28.610 1.00 29.03 ? 11  ASN T C   1 
ATOM   3845 O  O   . ASN F 2 7   ? 21.205  90.190  -28.407 1.00 26.95 ? 11  ASN T O   1 
ATOM   3846 C  CB  . ASN F 2 7   ? 21.903  90.301  -31.064 1.00 28.26 ? 11  ASN T CB  1 
ATOM   3847 C  CG  . ASN F 2 7   ? 22.454  90.457  -32.473 1.00 28.69 ? 11  ASN T CG  1 
ATOM   3848 O  OD1 . ASN F 2 7   ? 22.002  89.791  -33.408 1.00 27.42 ? 11  ASN T OD1 1 
ATOM   3849 N  ND2 . ASN F 2 7   ? 23.428  91.346  -32.633 1.00 28.84 ? 11  ASN T ND2 1 
ATOM   3850 N  N   . GLU F 2 8   ? 23.217  89.485  -27.668 1.00 29.86 ? 12  GLU T N   1 
ATOM   3851 C  CA  . GLU F 2 8   ? 22.875  89.449  -26.243 1.00 28.71 ? 12  GLU T CA  1 
ATOM   3852 C  C   . GLU F 2 8   ? 24.121  89.782  -25.417 1.00 27.82 ? 12  GLU T C   1 
ATOM   3853 O  O   . GLU F 2 8   ? 25.245  89.554  -25.863 1.00 26.58 ? 12  GLU T O   1 
ATOM   3854 C  CB  . GLU F 2 8   ? 22.332  88.070  -25.825 1.00 30.76 ? 12  GLU T CB  1 
ATOM   3855 C  CG  . GLU F 2 8   ? 21.250  87.484  -26.741 1.00 33.15 ? 12  GLU T CG  1 
ATOM   3856 C  CD  . GLU F 2 8   ? 20.612  86.190  -26.210 1.00 33.12 ? 12  GLU T CD  1 
ATOM   3857 O  OE1 . GLU F 2 8   ? 21.156  85.563  -25.271 1.00 34.83 ? 12  GLU T OE1 1 
ATOM   3858 O  OE2 . GLU F 2 8   ? 19.546  85.802  -26.730 1.00 31.81 ? 12  GLU T OE2 1 
ATOM   3859 N  N   . TYR F 2 9   ? 23.912  90.309  -24.211 1.00 29.22 ? 13  TYR T N   1 
ATOM   3860 C  CA  . TYR F 2 9   ? 25.000  90.684  -23.295 1.00 28.94 ? 13  TYR T CA  1 
ATOM   3861 C  C   . TYR F 2 9   ? 24.811  90.030  -21.936 1.00 30.76 ? 13  TYR T C   1 
ATOM   3862 O  O   . TYR F 2 9   ? 23.682  89.734  -21.530 1.00 30.96 ? 13  TYR T O   1 
ATOM   3863 C  CB  . TYR F 2 9   ? 25.064  92.215  -23.111 1.00 27.87 ? 13  TYR T CB  1 
ATOM   3864 C  CG  . TYR F 2 9   ? 23.957  92.813  -22.244 1.00 26.65 ? 13  TYR T CG  1 
ATOM   3865 C  CD1 . TYR F 2 9   ? 22.678  93.001  -22.750 1.00 26.00 ? 13  TYR T CD1 1 
ATOM   3866 C  CD2 . TYR F 2 9   ? 24.203  93.207  -20.924 1.00 26.45 ? 13  TYR T CD2 1 
ATOM   3867 C  CE1 . TYR F 2 9   ? 21.666  93.550  -21.973 1.00 23.97 ? 13  TYR T CE1 1 
ATOM   3868 C  CE2 . TYR F 2 9   ? 23.197  93.754  -20.133 1.00 25.94 ? 13  TYR T CE2 1 
ATOM   3869 C  CZ  . TYR F 2 9   ? 21.920  93.923  -20.661 1.00 27.95 ? 13  TYR T CZ  1 
ATOM   3870 O  OH  . TYR F 2 9   ? 20.893  94.475  -19.890 1.00 23.10 ? 13  TYR T OH  1 
ATOM   3871 N  N   . PHE F 2 10  ? 25.914  89.829  -21.221 1.00 30.74 ? 14  PHE T N   1 
ATOM   3872 C  CA  . PHE F 2 10  ? 25.823  89.392  -19.835 1.00 30.76 ? 14  PHE T CA  1 
ATOM   3873 C  C   . PHE F 2 10  ? 25.485  90.578  -18.941 1.00 29.67 ? 14  PHE T C   1 
ATOM   3874 O  O   . PHE F 2 10  ? 26.268  91.518  -18.821 1.00 29.25 ? 14  PHE T O   1 
ATOM   3875 C  CB  . PHE F 2 10  ? 27.107  88.721  -19.350 1.00 31.83 ? 14  PHE T CB  1 
ATOM   3876 C  CG  . PHE F 2 10  ? 26.925  87.966  -18.063 1.00 35.65 ? 14  PHE T CG  1 
ATOM   3877 C  CD1 . PHE F 2 10  ? 26.229  86.760  -18.046 1.00 37.02 ? 14  PHE T CD1 1 
ATOM   3878 C  CD2 . PHE F 2 10  ? 27.411  88.476  -16.863 1.00 37.29 ? 14  PHE T CD2 1 
ATOM   3879 C  CE1 . PHE F 2 10  ? 26.041  86.062  -16.865 1.00 37.56 ? 14  PHE T CE1 1 
ATOM   3880 C  CE2 . PHE F 2 10  ? 27.228  87.783  -15.672 1.00 38.43 ? 14  PHE T CE2 1 
ATOM   3881 C  CZ  . PHE F 2 10  ? 26.541  86.573  -15.674 1.00 38.91 ? 14  PHE T CZ  1 
ATOM   3882 N  N   . ASP F 2 11  ? 24.304  90.528  -18.334 1.00 29.05 ? 15  ASP T N   1 
ATOM   3883 C  CA  . ASP F 2 11  ? 23.865  91.540  -17.387 1.00 28.33 ? 15  ASP T CA  1 
ATOM   3884 C  C   . ASP F 2 11  ? 24.382  91.148  -16.004 1.00 27.01 ? 15  ASP T C   1 
ATOM   3885 O  O   . ASP F 2 11  ? 23.974  90.129  -15.454 1.00 24.78 ? 15  ASP T O   1 
ATOM   3886 C  CB  . ASP F 2 11  ? 22.339  91.622  -17.396 1.00 30.30 ? 15  ASP T CB  1 
ATOM   3887 C  CG  . ASP F 2 11  ? 21.816  92.903  -16.799 1.00 29.46 ? 15  ASP T CG  1 
ATOM   3888 O  OD1 . ASP F 2 11  ? 22.187  93.224  -15.662 1.00 28.44 ? 15  ASP T OD1 1 
ATOM   3889 O  OD2 . ASP F 2 11  ? 21.009  93.646  -17.390 1.00 32.00 ? 15  ASP T OD2 1 
ATOM   3890 N  N   . SER F 2 12  ? 25.291  91.958  -15.466 1.00 26.04 ? 16  SER T N   1 
ATOM   3891 C  CA  . SER F 2 12  ? 25.888  91.718  -14.157 1.00 28.24 ? 16  SER T CA  1 
ATOM   3892 C  C   . SER F 2 12  ? 24.943  91.995  -12.998 1.00 26.97 ? 16  SER T C   1 
ATOM   3893 O  O   . SER F 2 12  ? 25.233  91.614  -11.871 1.00 27.32 ? 16  SER T O   1 
ATOM   3894 C  CB  . SER F 2 12  ? 27.140  92.571  -13.973 1.00 30.06 ? 16  SER T CB  1 
ATOM   3895 O  OG  . SER F 2 12  ? 28.260  91.886  -14.480 1.00 35.93 ? 16  SER T OG  1 
ATOM   3896 N  N   . LEU F 2 13  ? 23.846  92.698  -13.256 1.00 28.93 ? 17  LEU T N   1 
ATOM   3897 C  CA  . LEU F 2 13  ? 22.825  92.899  -12.225 1.00 27.76 ? 17  LEU T CA  1 
ATOM   3898 C  C   . LEU F 2 13  ? 21.977  91.646  -12.074 1.00 27.78 ? 17  LEU T C   1 
ATOM   3899 O  O   . LEU F 2 13  ? 21.794  91.149  -10.968 1.00 27.74 ? 17  LEU T O   1 
ATOM   3900 C  CB  . LEU F 2 13  ? 21.936  94.097  -12.547 1.00 26.87 ? 17  LEU T CB  1 
ATOM   3901 C  CG  . LEU F 2 13  ? 20.894  94.434  -11.474 1.00 26.78 ? 17  LEU T CG  1 
ATOM   3902 C  CD1 . LEU F 2 13  ? 21.557  94.691  -10.084 1.00 22.32 ? 17  LEU T CD1 1 
ATOM   3903 C  CD2 . LEU F 2 13  ? 20.031  95.617  -11.917 1.00 26.41 ? 17  LEU T CD2 1 
ATOM   3904 N  N   . LEU F 2 14  ? 21.493  91.132  -13.202 1.00 25.92 ? 18  LEU T N   1 
ATOM   3905 C  CA  . LEU F 2 14  ? 20.563  90.012  -13.223 1.00 22.75 ? 18  LEU T CA  1 
ATOM   3906 C  C   . LEU F 2 14  ? 21.250  88.637  -13.252 1.00 24.05 ? 18  LEU T C   1 
ATOM   3907 O  O   . LEU F 2 14  ? 20.573  87.618  -13.106 1.00 27.52 ? 18  LEU T O   1 
ATOM   3908 C  CB  . LEU F 2 14  ? 19.614  90.158  -14.425 1.00 23.11 ? 18  LEU T CB  1 
ATOM   3909 C  CG  . LEU F 2 14  ? 18.967  91.544  -14.607 1.00 25.97 ? 18  LEU T CG  1 
ATOM   3910 C  CD1 . LEU F 2 14  ? 18.057  91.561  -15.816 1.00 28.27 ? 18  LEU T CD1 1 
ATOM   3911 C  CD2 . LEU F 2 14  ? 18.175  92.007  -13.370 1.00 26.15 ? 18  LEU T CD2 1 
ATOM   3912 N  N   . HIS F 2 15  ? 22.577  88.612  -13.412 1.00 26.47 ? 19  HIS T N   1 
ATOM   3913 C  CA  . HIS F 2 15  ? 23.357  87.368  -13.590 1.00 29.93 ? 19  HIS T CA  1 
ATOM   3914 C  C   . HIS F 2 15  ? 22.740  86.441  -14.639 1.00 29.63 ? 19  HIS T C   1 
ATOM   3915 O  O   . HIS F 2 15  ? 22.420  85.286  -14.348 1.00 31.24 ? 19  HIS T O   1 
ATOM   3916 C  CB  . HIS F 2 15  ? 23.535  86.620  -12.255 1.00 32.89 ? 19  HIS T CB  1 
ATOM   3917 C  CG  . HIS F 2 15  ? 24.532  87.254  -11.336 1.00 38.29 ? 19  HIS T CG  1 
ATOM   3918 N  ND1 . HIS F 2 15  ? 25.554  86.544  -10.742 1.00 41.13 ? 19  HIS T ND1 1 
ATOM   3919 C  CD2 . HIS F 2 15  ? 24.667  88.533  -10.908 1.00 41.28 ? 19  HIS T CD2 1 
ATOM   3920 C  CE1 . HIS F 2 15  ? 26.276  87.358  -9.990  1.00 42.74 ? 19  HIS T CE1 1 
ATOM   3921 N  NE2 . HIS F 2 15  ? 25.761  88.572  -10.077 1.00 43.58 ? 19  HIS T NE2 1 
ATOM   3922 N  N   . ALA F 2 16  ? 22.567  86.958  -15.852 1.00 28.03 ? 20  ALA T N   1 
ATOM   3923 C  CA  . ALA F 2 16  ? 21.932  86.196  -16.933 1.00 30.66 ? 20  ALA T CA  1 
ATOM   3924 C  C   . ALA F 2 16  ? 22.030  86.907  -18.288 1.00 31.13 ? 20  ALA T C   1 
ATOM   3925 O  O   . ALA F 2 16  ? 22.145  88.134  -18.346 1.00 30.04 ? 20  ALA T O   1 
ATOM   3926 C  CB  . ALA F 2 16  ? 20.468  85.918  -16.589 1.00 30.50 ? 20  ALA T CB  1 
ATOM   3927 N  N   . CYS F 2 17  ? 21.968  86.133  -19.371 1.00 31.02 ? 21  CYS T N   1 
ATOM   3928 C  CA  . CYS F 2 17  ? 22.014  86.697  -20.728 1.00 34.81 ? 21  CYS T CA  1 
ATOM   3929 C  C   . CYS F 2 17  ? 20.695  87.361  -21.119 1.00 33.54 ? 21  CYS T C   1 
ATOM   3930 O  O   . CYS F 2 17  ? 19.623  86.771  -20.945 1.00 30.58 ? 21  CYS T O   1 
ATOM   3931 C  CB  . CYS F 2 17  ? 22.353  85.624  -21.771 1.00 35.02 ? 21  CYS T CB  1 
ATOM   3932 S  SG  . CYS F 2 17  ? 24.088  85.127  -21.787 1.00 39.04 ? 21  CYS T SG  1 
ATOM   3933 N  N   . ILE F 2 18  ? 20.789  88.569  -21.681 1.00 31.18 ? 22  ILE T N   1 
ATOM   3934 C  CA  . ILE F 2 18  ? 19.617  89.372  -22.013 1.00 29.59 ? 22  ILE T CA  1 
ATOM   3935 C  C   . ILE F 2 18  ? 19.718  89.970  -23.423 1.00 29.15 ? 22  ILE T C   1 
ATOM   3936 O  O   . ILE F 2 18  ? 20.779  90.459  -23.804 1.00 30.35 ? 22  ILE T O   1 
ATOM   3937 C  CB  . ILE F 2 18  ? 19.440  90.461  -20.930 1.00 28.69 ? 22  ILE T CB  1 
ATOM   3938 C  CG1 . ILE F 2 18  ? 18.699  89.861  -19.730 1.00 32.50 ? 22  ILE T CG1 1 
ATOM   3939 C  CG2 . ILE F 2 18  ? 18.662  91.663  -21.445 1.00 29.38 ? 22  ILE T CG2 1 
ATOM   3940 C  CD1 . ILE F 2 18  ? 19.360  90.115  -18.455 1.00 36.77 ? 22  ILE T CD1 1 
ATOM   3941 N  N   . PRO F 2 19  ? 18.627  89.919  -24.199 1.00 28.49 ? 23  PRO T N   1 
ATOM   3942 C  CA  . PRO F 2 19  ? 18.616  90.500  -25.552 1.00 28.04 ? 23  PRO T CA  1 
ATOM   3943 C  C   . PRO F 2 19  ? 18.894  92.003  -25.576 1.00 28.10 ? 23  PRO T C   1 
ATOM   3944 O  O   . PRO F 2 19  ? 18.463  92.738  -24.682 1.00 28.83 ? 23  PRO T O   1 
ATOM   3945 C  CB  . PRO F 2 19  ? 17.192  90.216  -26.053 1.00 28.00 ? 23  PRO T CB  1 
ATOM   3946 C  CG  . PRO F 2 19  ? 16.692  89.102  -25.200 1.00 28.66 ? 23  PRO T CG  1 
ATOM   3947 C  CD  . PRO F 2 19  ? 17.336  89.285  -23.871 1.00 28.04 ? 23  PRO T CD  1 
ATOM   3948 N  N   . CYS F 2 20  ? 19.606  92.444  -26.607 1.00 27.54 ? 24  CYS T N   1 
ATOM   3949 C  CA  . CYS F 2 20  ? 20.000  93.843  -26.746 1.00 31.25 ? 24  CYS T CA  1 
ATOM   3950 C  C   . CYS F 2 20  ? 18.817  94.804  -26.973 1.00 32.66 ? 24  CYS T C   1 
ATOM   3951 O  O   . CYS F 2 20  ? 18.959  96.008  -26.726 1.00 32.17 ? 24  CYS T O   1 
ATOM   3952 C  CB  . CYS F 2 20  ? 21.030  93.998  -27.877 1.00 36.25 ? 24  CYS T CB  1 
ATOM   3953 S  SG  . CYS F 2 20  ? 22.734  93.574  -27.409 1.00 40.46 ? 24  CYS T SG  1 
ATOM   3954 N  N   . GLN F 2 21  ? 17.674  94.284  -27.446 1.00 31.20 ? 25  GLN T N   1 
ATOM   3955 C  CA  . GLN F 2 21  ? 16.437  95.072  -27.590 1.00 29.64 ? 25  GLN T CA  1 
ATOM   3956 C  C   . GLN F 2 21  ? 16.047  95.792  -26.301 1.00 25.42 ? 25  GLN T C   1 
ATOM   3957 O  O   . GLN F 2 21  ? 15.575  96.926  -26.329 1.00 19.07 ? 25  GLN T O   1 
ATOM   3958 C  CB  . GLN F 2 21  ? 15.256  94.180  -27.996 1.00 31.48 ? 25  GLN T CB  1 
ATOM   3959 C  CG  . GLN F 2 21  ? 15.262  93.752  -29.434 1.00 35.13 ? 25  GLN T CG  1 
ATOM   3960 C  CD  . GLN F 2 21  ? 14.697  94.802  -30.385 1.00 38.58 ? 25  GLN T CD  1 
ATOM   3961 O  OE1 . GLN F 2 21  ? 14.205  94.460  -31.463 1.00 38.75 ? 25  GLN T OE1 1 
ATOM   3962 N  NE2 . GLN F 2 21  ? 14.772  96.074  -29.996 1.00 39.43 ? 25  GLN T NE2 1 
ATOM   3963 N  N   . LEU F 2 22  ? 16.246  95.117  -25.175 1.00 27.02 ? 26  LEU T N   1 
ATOM   3964 C  CA  . LEU F 2 22  ? 15.864  95.642  -23.867 1.00 27.43 ? 26  LEU T CA  1 
ATOM   3965 C  C   . LEU F 2 22  ? 16.743  96.792  -23.367 1.00 27.04 ? 26  LEU T C   1 
ATOM   3966 O  O   . LEU F 2 22  ? 16.425  97.416  -22.343 1.00 33.19 ? 26  LEU T O   1 
ATOM   3967 C  CB  . LEU F 2 22  ? 15.875  94.503  -22.840 1.00 29.73 ? 26  LEU T CB  1 
ATOM   3968 C  CG  . LEU F 2 22  ? 14.899  93.354  -23.098 1.00 31.82 ? 26  LEU T CG  1 
ATOM   3969 C  CD1 . LEU F 2 22  ? 14.864  92.403  -21.907 1.00 33.03 ? 26  LEU T CD1 1 
ATOM   3970 C  CD2 . LEU F 2 22  ? 13.494  93.877  -23.400 1.00 33.46 ? 26  LEU T CD2 1 
ATOM   3971 N  N   . ARG F 2 23  ? 17.846  97.066  -24.062 1.00 25.11 ? 27  ARG T N   1 
ATOM   3972 C  CA  . ARG F 2 23  ? 18.748  98.155  -23.681 1.00 24.01 ? 27  ARG T CA  1 
ATOM   3973 C  C   . ARG F 2 23  ? 18.886  99.261  -24.734 1.00 26.35 ? 27  ARG T C   1 
ATOM   3974 O  O   . ARG F 2 23  ? 19.714  100.159 -24.583 1.00 24.08 ? 27  ARG T O   1 
ATOM   3975 C  CB  . ARG F 2 23  ? 20.120  97.579  -23.313 1.00 21.68 ? 27  ARG T CB  1 
ATOM   3976 C  CG  . ARG F 2 23  ? 20.123  96.753  -22.023 1.00 21.71 ? 27  ARG T CG  1 
ATOM   3977 C  CD  . ARG F 2 23  ? 19.851  97.546  -20.732 1.00 18.98 ? 27  ARG T CD  1 
ATOM   3978 N  NE  . ARG F 2 23  ? 20.889  98.541  -20.452 1.00 18.82 ? 27  ARG T NE  1 
ATOM   3979 C  CZ  . ARG F 2 23  ? 22.076  98.287  -19.901 1.00 20.14 ? 27  ARG T CZ  1 
ATOM   3980 N  NH1 . ARG F 2 23  ? 22.429  97.058  -19.546 1.00 24.42 ? 27  ARG T NH1 1 
ATOM   3981 N  NH2 . ARG F 2 23  ? 22.927  99.281  -19.703 1.00 19.72 ? 27  ARG T NH2 1 
ATOM   3982 N  N   . CYS F 2 24  ? 18.058  99.214  -25.780 1.00 32.11 ? 28  CYS T N   1 
ATOM   3983 C  CA  . CYS F 2 24  ? 18.038  100.257 -26.810 1.00 35.03 ? 28  CYS T CA  1 
ATOM   3984 C  C   . CYS F 2 24  ? 17.313  101.543 -26.371 1.00 36.43 ? 28  CYS T C   1 
ATOM   3985 O  O   . CYS F 2 24  ? 17.340  102.544 -27.084 1.00 38.55 ? 28  CYS T O   1 
ATOM   3986 C  CB  . CYS F 2 24  ? 17.411  99.717  -28.104 1.00 39.77 ? 28  CYS T CB  1 
ATOM   3987 S  SG  . CYS F 2 24  ? 18.401  98.450  -28.963 1.00 44.81 ? 28  CYS T SG  1 
ATOM   3988 N  N   . SER F 2 25  ? 16.660  101.509 -25.212 1.00 38.63 ? 29  SER T N   1 
ATOM   3989 C  CA  . SER F 2 25  ? 16.061  102.702 -24.615 1.00 37.93 ? 29  SER T CA  1 
ATOM   3990 C  C   . SER F 2 25  ? 17.063  103.434 -23.723 1.00 38.45 ? 29  SER T C   1 
ATOM   3991 O  O   . SER F 2 25  ? 16.930  104.633 -23.494 1.00 37.06 ? 29  SER T O   1 
ATOM   3992 C  CB  . SER F 2 25  ? 14.832  102.316 -23.785 1.00 38.17 ? 29  SER T CB  1 
ATOM   3993 O  OG  . SER F 2 25  ? 15.197  101.560 -22.636 1.00 36.61 ? 29  SER T OG  1 
ATOM   3994 N  N   . SER F 2 26  ? 18.056  102.699 -23.219 1.00 39.94 ? 30  SER T N   1 
ATOM   3995 C  CA  . SER F 2 26  ? 19.029  103.231 -22.263 1.00 40.32 ? 30  SER T CA  1 
ATOM   3996 C  C   . SER F 2 26  ? 19.847  104.367 -22.846 1.00 39.42 ? 30  SER T C   1 
ATOM   3997 O  O   . SER F 2 26  ? 20.146  104.378 -24.045 1.00 37.65 ? 30  SER T O   1 
ATOM   3998 C  CB  . SER F 2 26  ? 19.988  102.132 -21.785 1.00 39.18 ? 30  SER T CB  1 
ATOM   3999 O  OG  . SER F 2 26  ? 19.290  101.109 -21.108 1.00 35.24 ? 30  SER T OG  1 
ATOM   4000 N  N   . ASN F 2 27  ? 20.205  105.316 -21.980 1.00 39.63 ? 31  ASN T N   1 
ATOM   4001 C  CA  . ASN F 2 27  ? 21.082  106.424 -22.354 1.00 38.67 ? 31  ASN T CA  1 
ATOM   4002 C  C   . ASN F 2 27  ? 22.375  105.875 -22.929 1.00 36.73 ? 31  ASN T C   1 
ATOM   4003 O  O   . ASN F 2 27  ? 22.802  106.277 -24.011 1.00 32.50 ? 31  ASN T O   1 
ATOM   4004 C  CB  . ASN F 2 27  ? 21.399  107.305 -21.141 1.00 38.01 ? 31  ASN T CB  1 
ATOM   4005 C  CG  . ASN F 2 27  ? 20.218  108.154 -20.710 1.00 38.60 ? 31  ASN T CG  1 
ATOM   4006 O  OD1 . ASN F 2 27  ? 19.644  108.896 -21.513 1.00 37.01 ? 31  ASN T OD1 1 
ATOM   4007 N  ND2 . ASN F 2 27  ? 19.848  108.051 -19.433 1.00 38.87 ? 31  ASN T ND2 1 
ATOM   4008 N  N   . THR F 2 28  ? 22.979  104.946 -22.188 1.00 34.79 ? 32  THR T N   1 
ATOM   4009 C  CA  . THR F 2 28  ? 24.188  104.262 -22.621 1.00 33.40 ? 32  THR T CA  1 
ATOM   4010 C  C   . THR F 2 28  ? 23.964  102.749 -22.589 1.00 32.26 ? 32  THR T C   1 
ATOM   4011 O  O   . THR F 2 28  ? 24.028  102.136 -21.526 1.00 30.99 ? 32  THR T O   1 
ATOM   4012 C  CB  . THR F 2 28  ? 25.386  104.659 -21.729 1.00 32.88 ? 32  THR T CB  1 
ATOM   4013 O  OG1 . THR F 2 28  ? 25.320  106.058 -21.411 1.00 32.71 ? 32  THR T OG1 1 
ATOM   4014 C  CG2 . THR F 2 28  ? 26.708  104.516 -22.491 1.00 31.37 ? 32  THR T CG2 1 
ATOM   4015 N  N   . PRO F 2 29  ? 23.682  102.147 -23.747 1.00 33.70 ? 33  PRO T N   1 
ATOM   4016 C  CA  . PRO F 2 29  ? 23.613  100.682 -23.838 1.00 32.20 ? 33  PRO T CA  1 
ATOM   4017 C  C   . PRO F 2 29  ? 25.006  100.078 -23.629 1.00 30.83 ? 33  PRO T C   1 
ATOM   4018 O  O   . PRO F 2 29  ? 25.982  100.815 -23.765 1.00 31.14 ? 33  PRO T O   1 
ATOM   4019 C  CB  . PRO F 2 29  ? 23.106  100.424 -25.270 1.00 32.62 ? 33  PRO T CB  1 
ATOM   4020 C  CG  . PRO F 2 29  ? 22.666  101.761 -25.813 1.00 32.74 ? 33  PRO T CG  1 
ATOM   4021 C  CD  . PRO F 2 29  ? 23.411  102.801 -25.045 1.00 33.18 ? 33  PRO T CD  1 
ATOM   4022 N  N   . PRO F 2 30  ? 25.115  98.791  -23.294 1.00 30.96 ? 34  PRO T N   1 
ATOM   4023 C  CA  . PRO F 2 30  ? 26.436  98.161  -23.147 1.00 30.00 ? 34  PRO T CA  1 
ATOM   4024 C  C   . PRO F 2 30  ? 27.192  98.135  -24.480 1.00 29.79 ? 34  PRO T C   1 
ATOM   4025 O  O   . PRO F 2 30  ? 26.565  98.308  -25.526 1.00 29.19 ? 34  PRO T O   1 
ATOM   4026 C  CB  . PRO F 2 30  ? 26.101  96.745  -22.656 1.00 29.87 ? 34  PRO T CB  1 
ATOM   4027 C  CG  . PRO F 2 30  ? 24.713  96.837  -22.137 1.00 28.58 ? 34  PRO T CG  1 
ATOM   4028 C  CD  . PRO F 2 30  ? 24.025  97.838  -23.018 1.00 29.52 ? 34  PRO T CD  1 
ATOM   4029 N  N   . LEU F 2 31  ? 28.510  97.938  -24.429 1.00 31.26 ? 35  LEU T N   1 
ATOM   4030 C  CA  . LEU F 2 31  ? 29.384  98.105  -25.602 1.00 30.79 ? 35  LEU T CA  1 
ATOM   4031 C  C   . LEU F 2 31  ? 29.194  97.028  -26.676 1.00 31.24 ? 35  LEU T C   1 
ATOM   4032 O  O   . LEU F 2 31  ? 29.267  97.328  -27.872 1.00 30.94 ? 35  LEU T O   1 
ATOM   4033 C  CB  . LEU F 2 31  ? 30.866  98.161  -25.185 1.00 31.53 ? 35  LEU T CB  1 
ATOM   4034 C  CG  . LEU F 2 31  ? 31.511  99.553  -25.112 1.00 32.37 ? 35  LEU T CG  1 
ATOM   4035 C  CD1 . LEU F 2 31  ? 32.774  99.519  -24.250 1.00 31.62 ? 35  LEU T CD1 1 
ATOM   4036 C  CD2 . LEU F 2 31  ? 31.818  100.101 -26.514 1.00 30.83 ? 35  LEU T CD2 1 
ATOM   4037 N  N   . THR F 2 32  ? 28.972  95.782  -26.250 1.00 31.57 ? 36  THR T N   1 
ATOM   4038 C  CA  . THR F 2 32  ? 28.672  94.675  -27.179 1.00 33.45 ? 36  THR T CA  1 
ATOM   4039 C  C   . THR F 2 32  ? 27.300  94.824  -27.848 1.00 33.99 ? 36  THR T C   1 
ATOM   4040 O  O   . THR F 2 32  ? 27.001  94.127  -28.818 1.00 35.15 ? 36  THR T O   1 
ATOM   4041 C  CB  . THR F 2 32  ? 28.735  93.296  -26.461 1.00 33.17 ? 36  THR T CB  1 
ATOM   4042 O  OG1 . THR F 2 32  ? 28.204  93.399  -25.126 1.00 31.11 ? 36  THR T OG1 1 
ATOM   4043 C  CG2 . THR F 2 32  ? 30.185  92.824  -26.285 1.00 33.14 ? 36  THR T CG2 1 
ATOM   4044 N  N   . CYS F 2 33  ? 26.481  95.728  -27.310 1.00 34.19 ? 37  CYS T N   1 
ATOM   4045 C  CA  . CYS F 2 33  ? 25.115  95.973  -27.771 1.00 34.24 ? 37  CYS T CA  1 
ATOM   4046 C  C   . CYS F 2 33  ? 25.002  97.174  -28.711 1.00 32.29 ? 37  CYS T C   1 
ATOM   4047 O  O   . CYS F 2 33  ? 24.017  97.300  -29.436 1.00 29.24 ? 37  CYS T O   1 
ATOM   4048 C  CB  . CYS F 2 33  ? 24.205  96.224  -26.550 1.00 38.68 ? 37  CYS T CB  1 
ATOM   4049 S  SG  . CYS F 2 33  ? 23.407  94.755  -25.842 1.00 42.09 ? 37  CYS T SG  1 
ATOM   4050 N  N   . GLN F 2 34  ? 26.003  98.053  -28.690 1.00 32.11 ? 38  GLN T N   1 
ATOM   4051 C  CA  . GLN F 2 34  ? 25.885  99.378  -29.299 1.00 31.07 ? 38  GLN T CA  1 
ATOM   4052 C  C   . GLN F 2 34  ? 25.782  99.368  -30.828 1.00 30.13 ? 38  GLN T C   1 
ATOM   4053 O  O   . GLN F 2 34  ? 25.075  100.204 -31.390 1.00 28.79 ? 38  GLN T O   1 
ATOM   4054 C  CB  . GLN F 2 34  ? 27.037  100.279 -28.841 1.00 31.24 ? 38  GLN T CB  1 
ATOM   4055 N  N   . ARG F 2 35  ? 26.468  98.439  -31.497 1.00 29.24 ? 39  ARG T N   1 
ATOM   4056 C  CA  . ARG F 2 35  ? 26.406  98.355  -32.965 1.00 30.53 ? 39  ARG T CA  1 
ATOM   4057 C  C   . ARG F 2 35  ? 25.028  97.895  -33.449 1.00 30.16 ? 39  ARG T C   1 
ATOM   4058 O  O   . ARG F 2 35  ? 24.560  98.313  -34.510 1.00 28.87 ? 39  ARG T O   1 
ATOM   4059 C  CB  . ARG F 2 35  ? 27.495  97.425  -33.508 1.00 30.56 ? 39  ARG T CB  1 
ATOM   4060 N  N   . TYR F 2 36  ? 24.390  97.038  -32.656 1.00 30.45 ? 40  TYR T N   1 
ATOM   4061 C  CA  . TYR F 2 36  ? 23.067  96.495  -32.973 1.00 31.99 ? 40  TYR T CA  1 
ATOM   4062 C  C   . TYR F 2 36  ? 21.950  97.545  -32.878 1.00 33.05 ? 40  TYR T C   1 
ATOM   4063 O  O   . TYR F 2 36  ? 21.083  97.606  -33.760 1.00 31.29 ? 40  TYR T O   1 
ATOM   4064 C  CB  . TYR F 2 36  ? 22.772  95.296  -32.059 1.00 32.08 ? 40  TYR T CB  1 
ATOM   4065 C  CG  . TYR F 2 36  ? 21.333  94.837  -32.031 1.00 33.96 ? 40  TYR T CG  1 
ATOM   4066 C  CD1 . TYR F 2 36  ? 20.419  95.424  -31.166 1.00 36.78 ? 40  TYR T CD1 1 
ATOM   4067 C  CD2 . TYR F 2 36  ? 20.892  93.796  -32.840 1.00 36.19 ? 40  TYR T CD2 1 
ATOM   4068 C  CE1 . TYR F 2 36  ? 19.103  95.007  -31.115 1.00 36.79 ? 40  TYR T CE1 1 
ATOM   4069 C  CE2 . TYR F 2 36  ? 19.569  93.367  -32.797 1.00 37.65 ? 40  TYR T CE2 1 
ATOM   4070 C  CZ  . TYR F 2 36  ? 18.682  93.980  -31.926 1.00 37.70 ? 40  TYR T CZ  1 
ATOM   4071 O  OH  . TYR F 2 36  ? 17.367  93.585  -31.857 1.00 38.14 ? 40  TYR T OH  1 
ATOM   4072 N  N   . CYS F 2 37  ? 21.988  98.377  -31.832 1.00 33.12 ? 41  CYS T N   1 
ATOM   4073 C  CA  . CYS F 2 37  ? 20.945  99.386  -31.589 1.00 34.28 ? 41  CYS T CA  1 
ATOM   4074 C  C   . CYS F 2 37  ? 20.958  100.578 -32.578 1.00 32.78 ? 41  CYS T C   1 
ATOM   4075 O  O   . CYS F 2 37  ? 20.274  101.573 -32.346 1.00 30.91 ? 41  CYS T O   1 
ATOM   4076 C  CB  . CYS F 2 37  ? 21.022  99.908  -30.138 1.00 38.18 ? 41  CYS T CB  1 
ATOM   4077 S  SG  . CYS F 2 37  ? 20.428  98.770  -28.843 1.00 44.20 ? 41  CYS T SG  1 
ATOM   4078 N  N   . ASN F 2 38  ? 21.723  100.487 -33.668 1.00 33.33 ? 42  ASN T N   1 
ATOM   4079 C  CA  . ASN F 2 38  ? 21.693  101.503 -34.721 1.00 30.79 ? 42  ASN T CA  1 
ATOM   4080 C  C   . ASN F 2 38  ? 20.387  101.442 -35.512 1.00 30.03 ? 42  ASN T C   1 
ATOM   4081 O  O   . ASN F 2 38  ? 20.395  100.701 -36.780 1.00 30.49 ? 42  ASN T O   1 
ATOM   4082 C  CB  . ASN F 2 38  ? 22.867  101.321 -35.651 1.00 32.33 ? 42  ASN T CB  1 
HETATM 4083 NI NI  . NI  G 3 .   ? 23.441  95.574  21.978  1.00 58.60 ? 301 NI  B NI  1 
HETATM 4084 O  O   . HOH H 4 .   ? 6.537   94.320  -19.499 1.00 43.19 ? 2   HOH A O   1 
HETATM 4085 O  O   . HOH H 4 .   ? 20.540  77.070  10.944  1.00 31.95 ? 11  HOH A O   1 
HETATM 4086 O  O   . HOH H 4 .   ? 4.056   82.620  6.180   1.00 41.69 ? 12  HOH A O   1 
HETATM 4087 O  O   . HOH H 4 .   ? 6.093   93.353  16.879  1.00 43.32 ? 17  HOH A O   1 
HETATM 4088 O  O   . HOH H 4 .   ? 5.893   91.261  18.261  1.00 36.77 ? 19  HOH A O   1 
HETATM 4089 O  O   . HOH H 4 .   ? 24.284  83.248  -7.202  1.00 49.49 ? 31  HOH A O   1 
HETATM 4090 O  O   . HOH H 4 .   ? 21.772  79.889  -2.356  1.00 40.46 ? 33  HOH A O   1 
HETATM 4091 O  O   . HOH H 4 .   ? 15.099  94.164  -2.490  1.00 38.01 ? 35  HOH A O   1 
HETATM 4092 O  O   . HOH H 4 .   ? 5.023   95.327  -18.412 1.00 56.53 ? 38  HOH A O   1 
HETATM 4093 O  O   . HOH H 4 .   ? 18.617  80.426  -9.289  1.00 52.20 ? 39  HOH A O   1 
HETATM 4094 O  O   . HOH I 4 .   ? 15.995  96.636  7.149   1.00 37.75 ? 3   HOH B O   1 
HETATM 4095 O  O   . HOH I 4 .   ? 4.776   95.136  24.570  1.00 49.35 ? 10  HOH B O   1 
HETATM 4096 O  O   . HOH I 4 .   ? 21.516  111.015 12.017  1.00 38.32 ? 15  HOH B O   1 
HETATM 4097 O  O   . HOH I 4 .   ? 7.992   95.731  1.197   1.00 46.62 ? 16  HOH B O   1 
HETATM 4098 O  O   . HOH I 4 .   ? -0.021  99.228  -15.835 1.00 52.23 ? 18  HOH B O   1 
HETATM 4099 O  O   . HOH I 4 .   ? 3.555   93.956  11.673  1.00 40.14 ? 21  HOH B O   1 
HETATM 4100 O  O   . HOH I 4 .   ? 0.128   104.241 -12.643 1.00 45.08 ? 23  HOH B O   1 
HETATM 4101 O  O   . HOH I 4 .   ? 0.210   115.233 -3.930  1.00 41.31 ? 24  HOH B O   1 
HETATM 4102 O  O   . HOH I 4 .   ? 16.210  117.782 4.425   1.00 48.51 ? 28  HOH B O   1 
HETATM 4103 O  O   . HOH I 4 .   ? 7.412   112.996 7.112   1.00 45.34 ? 30  HOH B O   1 
HETATM 4104 O  O   . HOH J 4 .   ? 26.019  86.552  6.006   1.00 39.43 ? 4   HOH D O   1 
HETATM 4105 O  O   . HOH J 4 .   ? 5.250   105.616 -12.578 1.00 41.57 ? 5   HOH D O   1 
HETATM 4106 O  O   . HOH J 4 .   ? 13.068  101.862 -0.848  1.00 40.41 ? 6   HOH D O   1 
HETATM 4107 O  O   . HOH J 4 .   ? 23.629  113.520 -0.317  1.00 38.35 ? 7   HOH D O   1 
HETATM 4108 O  O   . HOH J 4 .   ? 19.802  114.134 -7.452  1.00 43.00 ? 8   HOH D O   1 
HETATM 4109 O  O   . HOH J 4 .   ? 15.644  112.807 -5.370  1.00 47.83 ? 13  HOH D O   1 
HETATM 4110 O  O   . HOH J 4 .   ? 23.225  102.565 -1.493  1.00 36.00 ? 14  HOH D O   1 
HETATM 4111 O  O   . HOH J 4 .   ? 28.142  111.928 13.720  1.00 43.84 ? 22  HOH D O   1 
HETATM 4112 O  O   . HOH J 4 .   ? 33.982  88.833  14.664  1.00 50.11 ? 25  HOH D O   1 
HETATM 4113 O  O   . HOH J 4 .   ? 11.725  95.415  -16.674 1.00 52.68 ? 26  HOH D O   1 
HETATM 4114 O  O   . HOH J 4 .   ? 27.180  113.652 -9.632  1.00 34.46 ? 27  HOH D O   1 
HETATM 4115 O  O   . HOH J 4 .   ? 19.335  109.514 4.990   1.00 37.66 ? 29  HOH D O   1 
HETATM 4116 O  O   . HOH J 4 .   ? 29.524  95.756  -5.648  1.00 45.23 ? 32  HOH D O   1 
HETATM 4117 O  O   . HOH J 4 .   ? 28.810  86.748  6.213   1.00 39.30 ? 34  HOH D O   1 
HETATM 4118 O  O   . HOH J 4 .   ? 17.858  111.488 -10.352 1.00 59.43 ? 40  HOH D O   1 
HETATM 4119 O  O   . HOH K 4 .   ? -12.230 86.494  -14.201 1.00 61.95 ? 52  HOH R O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   104 ?   ?   ?   A . n 
A 1 2   LYS 2   105 105 LYS LYS A . n 
A 1 3   HIS 3   106 106 HIS HIS A . n 
A 1 4   SER 4   107 107 SER SER A . n 
A 1 5   VAL 5   108 108 VAL VAL A . n 
A 1 6   LEU 6   109 109 LEU LEU A . n 
A 1 7   HIS 7   110 110 HIS HIS A . n 
A 1 8   LEU 8   111 111 LEU LEU A . n 
A 1 9   VAL 9   112 112 VAL VAL A . n 
A 1 10  PRO 10  113 113 PRO PRO A . n 
A 1 11  VAL 11  114 114 VAL VAL A . n 
A 1 12  ASN 12  115 115 ASN ASN A . n 
A 1 13  ILE 13  116 116 ILE ILE A . n 
A 1 14  THR 14  117 117 THR THR A . n 
A 1 15  SER 15  118 118 SER SER A . n 
A 1 16  LYS 16  119 119 LYS LYS A . n 
A 1 17  ALA 17  120 120 ALA ALA A . n 
A 1 18  ASP 18  121 121 ASP ASP A . n 
A 1 19  SER 19  122 122 SER SER A . n 
A 1 20  ASP 20  123 123 ASP ASP A . n 
A 1 21  VAL 21  124 124 VAL VAL A . n 
A 1 22  THR 22  125 125 THR THR A . n 
A 1 23  GLU 23  126 126 GLU GLU A . n 
A 1 24  VAL 24  127 127 VAL VAL A . n 
A 1 25  MET 25  128 128 MET MET A . n 
A 1 26  TRP 26  129 129 TRP TRP A . n 
A 1 27  GLN 27  130 130 GLN GLN A . n 
A 1 28  PRO 28  131 131 PRO PRO A . n 
A 1 29  VAL 29  132 132 VAL VAL A . n 
A 1 30  LEU 30  133 133 LEU LEU A . n 
A 1 31  ARG 31  134 134 ARG ARG A . n 
A 1 32  ARG 32  135 135 ARG ARG A . n 
A 1 33  GLY 33  136 136 GLY GLY A . n 
A 1 34  ARG 34  137 137 ARG ARG A . n 
A 1 35  GLY 35  138 138 GLY GLY A . n 
A 1 36  LEU 36  139 139 LEU LEU A . n 
A 1 37  GLU 37  140 140 GLU GLU A . n 
A 1 38  ALA 38  141 141 ALA ALA A . n 
A 1 39  GLN 39  142 142 GLN GLN A . n 
A 1 40  GLY 40  143 143 GLY GLY A . n 
A 1 41  ASP 41  144 144 ASP ASP A . n 
A 1 42  ILE 42  145 145 ILE ILE A . n 
A 1 43  VAL 43  146 146 VAL VAL A . n 
A 1 44  ARG 44  147 147 ARG ARG A . n 
A 1 45  VAL 45  148 148 VAL VAL A . n 
A 1 46  TRP 46  149 149 TRP TRP A . n 
A 1 47  ASP 47  150 150 ASP ASP A . n 
A 1 48  THR 48  151 151 THR THR A . n 
A 1 49  GLY 49  152 152 GLY GLY A . n 
A 1 50  ILE 50  153 153 ILE ILE A . n 
A 1 51  TYR 51  154 154 TYR TYR A . n 
A 1 52  LEU 52  155 155 LEU LEU A . n 
A 1 53  LEU 53  156 156 LEU LEU A . n 
A 1 54  TYR 54  157 157 TYR TYR A . n 
A 1 55  SER 55  158 158 SER SER A . n 
A 1 56  GLN 56  159 159 GLN GLN A . n 
A 1 57  VAL 57  160 160 VAL VAL A . n 
A 1 58  LEU 58  161 161 LEU LEU A . n 
A 1 59  PHE 59  162 162 PHE PHE A . n 
A 1 60  HIS 60  163 163 HIS HIS A . n 
A 1 61  ASP 61  164 164 ASP ASP A . n 
A 1 62  VAL 62  165 165 VAL VAL A . n 
A 1 63  THR 63  166 166 THR THR A . n 
A 1 64  PHE 64  167 167 PHE PHE A . n 
A 1 65  THR 65  168 168 THR THR A . n 
A 1 66  MET 66  169 169 MET MET A . n 
A 1 67  GLY 67  170 170 GLY GLY A . n 
A 1 68  GLN 68  171 171 GLN GLN A . n 
A 1 69  VAL 69  172 172 VAL VAL A . n 
A 1 70  VAL 70  173 173 VAL VAL A . n 
A 1 71  SER 71  174 174 SER SER A . n 
A 1 72  ARG 72  175 175 ARG ARG A . n 
A 1 73  GLU 73  176 176 GLU GLU A . n 
A 1 74  GLY 74  177 177 GLY GLY A . n 
A 1 75  GLN 75  178 178 GLN GLN A . n 
A 1 76  GLY 76  179 179 GLY GLY A . n 
A 1 77  ARG 77  180 180 ARG ARG A . n 
A 1 78  ARG 78  181 181 ARG ARG A . n 
A 1 79  GLU 79  182 182 GLU GLU A . n 
A 1 80  THR 80  183 183 THR THR A . n 
A 1 81  LEU 81  184 184 LEU LEU A . n 
A 1 82  PHE 82  185 185 PHE PHE A . n 
A 1 83  ARG 83  186 186 ARG ARG A . n 
A 1 84  CYS 84  187 187 CYS CYS A . n 
A 1 85  ILE 85  188 188 ILE ILE A . n 
A 1 86  ARG 86  189 189 ARG ARG A . n 
A 1 87  SER 87  190 190 SER SER A . n 
A 1 88  MET 88  191 191 MET MET A . n 
A 1 89  PRO 89  192 192 PRO PRO A . n 
A 1 90  SER 90  193 193 SER SER A . n 
A 1 91  ASP 91  194 194 ASP ASP A . n 
A 1 92  PRO 92  195 195 PRO PRO A . n 
A 1 93  ASP 93  196 196 ASP ASP A . n 
A 1 94  ARG 94  197 197 ARG ARG A . n 
A 1 95  ALA 95  198 198 ALA ALA A . n 
A 1 96  TYR 96  199 199 TYR TYR A . n 
A 1 97  ASN 97  200 200 ASN ASN A . n 
A 1 98  SER 98  201 201 SER SER A . n 
A 1 99  CYS 99  202 202 CYS CYS A . n 
A 1 100 TYR 100 203 203 TYR TYR A . n 
A 1 101 SER 101 204 204 SER SER A . n 
A 1 102 ALA 102 205 205 ALA ALA A . n 
A 1 103 GLY 103 206 206 GLY GLY A . n 
A 1 104 VAL 104 207 207 VAL VAL A . n 
A 1 105 PHE 105 208 208 PHE PHE A . n 
A 1 106 HIS 106 209 209 HIS HIS A . n 
A 1 107 LEU 107 210 210 LEU LEU A . n 
A 1 108 HIS 108 211 211 HIS HIS A . n 
A 1 109 GLN 109 212 212 GLN GLN A . n 
A 1 110 GLY 110 213 213 GLY GLY A . n 
A 1 111 ASP 111 214 214 ASP ASP A . n 
A 1 112 ILE 112 215 215 ILE ILE A . n 
A 1 113 ILE 113 216 216 ILE ILE A . n 
A 1 114 THR 114 217 217 THR THR A . n 
A 1 115 VAL 115 218 218 VAL VAL A . n 
A 1 116 LYS 116 219 219 LYS LYS A . n 
A 1 117 ILE 117 220 220 ILE ILE A . n 
A 1 118 PRO 118 221 221 PRO PRO A . n 
A 1 119 ARG 119 222 222 ARG ARG A . n 
A 1 120 ALA 120 223 223 ALA ALA A . n 
A 1 121 ASN 121 224 224 ASN ASN A . n 
A 1 122 ALA 122 225 225 ALA ALA A . n 
A 1 123 LYS 123 226 226 LYS LYS A . n 
A 1 124 LEU 124 227 227 LEU LEU A . n 
A 1 125 SER 125 228 228 SER SER A . n 
A 1 126 LEU 126 229 229 LEU LEU A . n 
A 1 127 SER 127 230 230 SER SER A . n 
A 1 128 PRO 128 231 231 PRO PRO A . n 
A 1 129 HIS 129 232 232 HIS HIS A . n 
A 1 130 GLY 130 233 233 GLY GLY A . n 
A 1 131 THR 131 234 234 THR THR A . n 
A 1 132 PHE 132 235 235 PHE PHE A . n 
A 1 133 LEU 133 236 236 LEU LEU A . n 
A 1 134 GLY 134 237 237 GLY GLY A . n 
A 1 135 PHE 135 238 238 PHE PHE A . n 
A 1 136 VAL 136 239 239 VAL VAL A . n 
A 1 137 LYS 137 240 240 LYS LYS A . n 
A 1 138 LEU 138 241 241 LEU LEU A . n 
B 1 1   LYS 1   104 ?   ?   ?   B . n 
B 1 2   LYS 2   105 105 LYS LYS B . n 
B 1 3   HIS 3   106 106 HIS HIS B . n 
B 1 4   SER 4   107 107 SER SER B . n 
B 1 5   VAL 5   108 108 VAL VAL B . n 
B 1 6   LEU 6   109 109 LEU LEU B . n 
B 1 7   HIS 7   110 110 HIS HIS B . n 
B 1 8   LEU 8   111 111 LEU LEU B . n 
B 1 9   VAL 9   112 112 VAL VAL B . n 
B 1 10  PRO 10  113 113 PRO PRO B . n 
B 1 11  VAL 11  114 114 VAL VAL B . n 
B 1 12  ASN 12  115 115 ASN ASN B . n 
B 1 13  ILE 13  116 116 ILE ILE B . n 
B 1 14  THR 14  117 117 THR THR B . n 
B 1 15  SER 15  118 118 SER SER B . n 
B 1 16  LYS 16  119 119 LYS LYS B . n 
B 1 17  ALA 17  120 120 ALA ALA B . n 
B 1 18  ASP 18  121 121 ASP ASP B . n 
B 1 19  SER 19  122 122 SER SER B . n 
B 1 20  ASP 20  123 123 ASP ASP B . n 
B 1 21  VAL 21  124 124 VAL VAL B . n 
B 1 22  THR 22  125 125 THR THR B . n 
B 1 23  GLU 23  126 126 GLU GLU B . n 
B 1 24  VAL 24  127 127 VAL VAL B . n 
B 1 25  MET 25  128 128 MET MET B . n 
B 1 26  TRP 26  129 129 TRP TRP B . n 
B 1 27  GLN 27  130 130 GLN GLN B . n 
B 1 28  PRO 28  131 131 PRO PRO B . n 
B 1 29  VAL 29  132 132 VAL VAL B . n 
B 1 30  LEU 30  133 133 LEU LEU B . n 
B 1 31  ARG 31  134 134 ARG ARG B . n 
B 1 32  ARG 32  135 135 ARG ARG B . n 
B 1 33  GLY 33  136 136 GLY GLY B . n 
B 1 34  ARG 34  137 137 ARG ARG B . n 
B 1 35  GLY 35  138 138 GLY GLY B . n 
B 1 36  LEU 36  139 139 LEU LEU B . n 
B 1 37  GLU 37  140 140 GLU GLU B . n 
B 1 38  ALA 38  141 141 ALA ALA B . n 
B 1 39  GLN 39  142 142 GLN GLN B . n 
B 1 40  GLY 40  143 143 GLY GLY B . n 
B 1 41  ASP 41  144 144 ASP ASP B . n 
B 1 42  ILE 42  145 145 ILE ILE B . n 
B 1 43  VAL 43  146 146 VAL VAL B . n 
B 1 44  ARG 44  147 147 ARG ARG B . n 
B 1 45  VAL 45  148 148 VAL VAL B . n 
B 1 46  TRP 46  149 149 TRP TRP B . n 
B 1 47  ASP 47  150 150 ASP ASP B . n 
B 1 48  THR 48  151 151 THR THR B . n 
B 1 49  GLY 49  152 152 GLY GLY B . n 
B 1 50  ILE 50  153 153 ILE ILE B . n 
B 1 51  TYR 51  154 154 TYR TYR B . n 
B 1 52  LEU 52  155 155 LEU LEU B . n 
B 1 53  LEU 53  156 156 LEU LEU B . n 
B 1 54  TYR 54  157 157 TYR TYR B . n 
B 1 55  SER 55  158 158 SER SER B . n 
B 1 56  GLN 56  159 159 GLN GLN B . n 
B 1 57  VAL 57  160 160 VAL VAL B . n 
B 1 58  LEU 58  161 161 LEU LEU B . n 
B 1 59  PHE 59  162 162 PHE PHE B . n 
B 1 60  HIS 60  163 163 HIS HIS B . n 
B 1 61  ASP 61  164 164 ASP ASP B . n 
B 1 62  VAL 62  165 165 VAL VAL B . n 
B 1 63  THR 63  166 166 THR THR B . n 
B 1 64  PHE 64  167 167 PHE PHE B . n 
B 1 65  THR 65  168 168 THR THR B . n 
B 1 66  MET 66  169 169 MET MET B . n 
B 1 67  GLY 67  170 170 GLY GLY B . n 
B 1 68  GLN 68  171 171 GLN GLN B . n 
B 1 69  VAL 69  172 172 VAL VAL B . n 
B 1 70  VAL 70  173 173 VAL VAL B . n 
B 1 71  SER 71  174 174 SER SER B . n 
B 1 72  ARG 72  175 175 ARG ARG B . n 
B 1 73  GLU 73  176 176 GLU GLU B . n 
B 1 74  GLY 74  177 177 GLY GLY B . n 
B 1 75  GLN 75  178 178 GLN GLN B . n 
B 1 76  GLY 76  179 179 GLY GLY B . n 
B 1 77  ARG 77  180 180 ARG ARG B . n 
B 1 78  ARG 78  181 181 ARG ARG B . n 
B 1 79  GLU 79  182 182 GLU GLU B . n 
B 1 80  THR 80  183 183 THR THR B . n 
B 1 81  LEU 81  184 184 LEU LEU B . n 
B 1 82  PHE 82  185 185 PHE PHE B . n 
B 1 83  ARG 83  186 186 ARG ARG B . n 
B 1 84  CYS 84  187 187 CYS CYS B . n 
B 1 85  ILE 85  188 188 ILE ILE B . n 
B 1 86  ARG 86  189 189 ARG ARG B . n 
B 1 87  SER 87  190 190 SER SER B . n 
B 1 88  MET 88  191 191 MET MET B . n 
B 1 89  PRO 89  192 192 PRO PRO B . n 
B 1 90  SER 90  193 193 SER SER B . n 
B 1 91  ASP 91  194 194 ASP ASP B . n 
B 1 92  PRO 92  195 195 PRO PRO B . n 
B 1 93  ASP 93  196 196 ASP ASP B . n 
B 1 94  ARG 94  197 197 ARG ARG B . n 
B 1 95  ALA 95  198 198 ALA ALA B . n 
B 1 96  TYR 96  199 199 TYR TYR B . n 
B 1 97  ASN 97  200 200 ASN ASN B . n 
B 1 98  SER 98  201 201 SER SER B . n 
B 1 99  CYS 99  202 202 CYS CYS B . n 
B 1 100 TYR 100 203 203 TYR TYR B . n 
B 1 101 SER 101 204 204 SER SER B . n 
B 1 102 ALA 102 205 205 ALA ALA B . n 
B 1 103 GLY 103 206 206 GLY GLY B . n 
B 1 104 VAL 104 207 207 VAL VAL B . n 
B 1 105 PHE 105 208 208 PHE PHE B . n 
B 1 106 HIS 106 209 209 HIS HIS B . n 
B 1 107 LEU 107 210 210 LEU LEU B . n 
B 1 108 HIS 108 211 211 HIS HIS B . n 
B 1 109 GLN 109 212 212 GLN GLN B . n 
B 1 110 GLY 110 213 213 GLY GLY B . n 
B 1 111 ASP 111 214 214 ASP ASP B . n 
B 1 112 ILE 112 215 215 ILE ILE B . n 
B 1 113 ILE 113 216 216 ILE ILE B . n 
B 1 114 THR 114 217 217 THR THR B . n 
B 1 115 VAL 115 218 218 VAL VAL B . n 
B 1 116 LYS 116 219 219 LYS LYS B . n 
B 1 117 ILE 117 220 220 ILE ILE B . n 
B 1 118 PRO 118 221 221 PRO PRO B . n 
B 1 119 ARG 119 222 222 ARG ARG B . n 
B 1 120 ALA 120 223 223 ALA ALA B . n 
B 1 121 ASN 121 224 224 ASN ASN B . n 
B 1 122 ALA 122 225 225 ALA ALA B . n 
B 1 123 LYS 123 226 226 LYS LYS B . n 
B 1 124 LEU 124 227 227 LEU LEU B . n 
B 1 125 SER 125 228 228 SER SER B . n 
B 1 126 LEU 126 229 229 LEU LEU B . n 
B 1 127 SER 127 230 230 SER SER B . n 
B 1 128 PRO 128 231 231 PRO PRO B . n 
B 1 129 HIS 129 232 232 HIS HIS B . n 
B 1 130 GLY 130 233 233 GLY GLY B . n 
B 1 131 THR 131 234 234 THR THR B . n 
B 1 132 PHE 132 235 235 PHE PHE B . n 
B 1 133 LEU 133 236 236 LEU LEU B . n 
B 1 134 GLY 134 237 237 GLY GLY B . n 
B 1 135 PHE 135 238 238 PHE PHE B . n 
B 1 136 VAL 136 239 239 VAL VAL B . n 
B 1 137 LYS 137 240 240 LYS LYS B . n 
B 1 138 LEU 138 241 241 LEU LEU B . n 
C 1 1   LYS 1   104 ?   ?   ?   D . n 
C 1 2   LYS 2   105 105 LYS LYS D . n 
C 1 3   HIS 3   106 106 HIS HIS D . n 
C 1 4   SER 4   107 107 SER SER D . n 
C 1 5   VAL 5   108 108 VAL VAL D . n 
C 1 6   LEU 6   109 109 LEU LEU D . n 
C 1 7   HIS 7   110 110 HIS HIS D . n 
C 1 8   LEU 8   111 111 LEU LEU D . n 
C 1 9   VAL 9   112 112 VAL VAL D . n 
C 1 10  PRO 10  113 113 PRO PRO D . n 
C 1 11  VAL 11  114 114 VAL VAL D . n 
C 1 12  ASN 12  115 115 ASN ASN D . n 
C 1 13  ILE 13  116 116 ILE ILE D . n 
C 1 14  THR 14  117 117 THR THR D . n 
C 1 15  SER 15  118 118 SER SER D . n 
C 1 16  LYS 16  119 119 LYS LYS D . n 
C 1 17  ALA 17  120 120 ALA ALA D . n 
C 1 18  ASP 18  121 121 ASP ASP D . n 
C 1 19  SER 19  122 122 SER SER D . n 
C 1 20  ASP 20  123 123 ASP ASP D . n 
C 1 21  VAL 21  124 124 VAL VAL D . n 
C 1 22  THR 22  125 125 THR THR D . n 
C 1 23  GLU 23  126 126 GLU GLU D . n 
C 1 24  VAL 24  127 127 VAL VAL D . n 
C 1 25  MET 25  128 128 MET MET D . n 
C 1 26  TRP 26  129 129 TRP TRP D . n 
C 1 27  GLN 27  130 130 GLN GLN D . n 
C 1 28  PRO 28  131 131 PRO PRO D . n 
C 1 29  VAL 29  132 132 VAL VAL D . n 
C 1 30  LEU 30  133 133 LEU LEU D . n 
C 1 31  ARG 31  134 134 ARG ARG D . n 
C 1 32  ARG 32  135 135 ARG ARG D . n 
C 1 33  GLY 33  136 136 GLY GLY D . n 
C 1 34  ARG 34  137 137 ARG ARG D . n 
C 1 35  GLY 35  138 138 GLY GLY D . n 
C 1 36  LEU 36  139 139 LEU LEU D . n 
C 1 37  GLU 37  140 140 GLU GLU D . n 
C 1 38  ALA 38  141 141 ALA ALA D . n 
C 1 39  GLN 39  142 142 GLN GLN D . n 
C 1 40  GLY 40  143 143 GLY GLY D . n 
C 1 41  ASP 41  144 144 ASP ASP D . n 
C 1 42  ILE 42  145 145 ILE ILE D . n 
C 1 43  VAL 43  146 146 VAL VAL D . n 
C 1 44  ARG 44  147 147 ARG ARG D . n 
C 1 45  VAL 45  148 148 VAL VAL D . n 
C 1 46  TRP 46  149 149 TRP TRP D . n 
C 1 47  ASP 47  150 150 ASP ASP D . n 
C 1 48  THR 48  151 151 THR THR D . n 
C 1 49  GLY 49  152 152 GLY GLY D . n 
C 1 50  ILE 50  153 153 ILE ILE D . n 
C 1 51  TYR 51  154 154 TYR TYR D . n 
C 1 52  LEU 52  155 155 LEU LEU D . n 
C 1 53  LEU 53  156 156 LEU LEU D . n 
C 1 54  TYR 54  157 157 TYR TYR D . n 
C 1 55  SER 55  158 158 SER SER D . n 
C 1 56  GLN 56  159 159 GLN GLN D . n 
C 1 57  VAL 57  160 160 VAL VAL D . n 
C 1 58  LEU 58  161 161 LEU LEU D . n 
C 1 59  PHE 59  162 162 PHE PHE D . n 
C 1 60  HIS 60  163 163 HIS HIS D . n 
C 1 61  ASP 61  164 164 ASP ASP D . n 
C 1 62  VAL 62  165 165 VAL VAL D . n 
C 1 63  THR 63  166 166 THR THR D . n 
C 1 64  PHE 64  167 167 PHE PHE D . n 
C 1 65  THR 65  168 168 THR THR D . n 
C 1 66  MET 66  169 169 MET MET D . n 
C 1 67  GLY 67  170 170 GLY GLY D . n 
C 1 68  GLN 68  171 171 GLN GLN D . n 
C 1 69  VAL 69  172 172 VAL VAL D . n 
C 1 70  VAL 70  173 173 VAL VAL D . n 
C 1 71  SER 71  174 174 SER SER D . n 
C 1 72  ARG 72  175 175 ARG ARG D . n 
C 1 73  GLU 73  176 176 GLU GLU D . n 
C 1 74  GLY 74  177 177 GLY GLY D . n 
C 1 75  GLN 75  178 178 GLN GLN D . n 
C 1 76  GLY 76  179 179 GLY GLY D . n 
C 1 77  ARG 77  180 180 ARG ARG D . n 
C 1 78  ARG 78  181 181 ARG ARG D . n 
C 1 79  GLU 79  182 182 GLU GLU D . n 
C 1 80  THR 80  183 183 THR THR D . n 
C 1 81  LEU 81  184 184 LEU LEU D . n 
C 1 82  PHE 82  185 185 PHE PHE D . n 
C 1 83  ARG 83  186 186 ARG ARG D . n 
C 1 84  CYS 84  187 187 CYS CYS D . n 
C 1 85  ILE 85  188 188 ILE ILE D . n 
C 1 86  ARG 86  189 189 ARG ARG D . n 
C 1 87  SER 87  190 190 SER SER D . n 
C 1 88  MET 88  191 191 MET MET D . n 
C 1 89  PRO 89  192 192 PRO PRO D . n 
C 1 90  SER 90  193 193 SER SER D . n 
C 1 91  ASP 91  194 194 ASP ASP D . n 
C 1 92  PRO 92  195 195 PRO PRO D . n 
C 1 93  ASP 93  196 196 ASP ASP D . n 
C 1 94  ARG 94  197 197 ARG ARG D . n 
C 1 95  ALA 95  198 198 ALA ALA D . n 
C 1 96  TYR 96  199 199 TYR TYR D . n 
C 1 97  ASN 97  200 200 ASN ASN D . n 
C 1 98  SER 98  201 201 SER SER D . n 
C 1 99  CYS 99  202 202 CYS CYS D . n 
C 1 100 TYR 100 203 203 TYR TYR D . n 
C 1 101 SER 101 204 204 SER SER D . n 
C 1 102 ALA 102 205 205 ALA ALA D . n 
C 1 103 GLY 103 206 206 GLY GLY D . n 
C 1 104 VAL 104 207 207 VAL VAL D . n 
C 1 105 PHE 105 208 208 PHE PHE D . n 
C 1 106 HIS 106 209 209 HIS HIS D . n 
C 1 107 LEU 107 210 210 LEU LEU D . n 
C 1 108 HIS 108 211 211 HIS HIS D . n 
C 1 109 GLN 109 212 212 GLN GLN D . n 
C 1 110 GLY 110 213 213 GLY GLY D . n 
C 1 111 ASP 111 214 214 ASP ASP D . n 
C 1 112 ILE 112 215 215 ILE ILE D . n 
C 1 113 ILE 113 216 216 ILE ILE D . n 
C 1 114 THR 114 217 217 THR THR D . n 
C 1 115 VAL 115 218 218 VAL VAL D . n 
C 1 116 LYS 116 219 219 LYS LYS D . n 
C 1 117 ILE 117 220 220 ILE ILE D . n 
C 1 118 PRO 118 221 221 PRO PRO D . n 
C 1 119 ARG 119 222 222 ARG ARG D . n 
C 1 120 ALA 120 223 223 ALA ALA D . n 
C 1 121 ASN 121 224 224 ASN ASN D . n 
C 1 122 ALA 122 225 225 ALA ALA D . n 
C 1 123 LYS 123 226 226 LYS LYS D . n 
C 1 124 LEU 124 227 227 LEU LEU D . n 
C 1 125 SER 125 228 228 SER SER D . n 
C 1 126 LEU 126 229 229 LEU LEU D . n 
C 1 127 SER 127 230 230 SER SER D . n 
C 1 128 PRO 128 231 231 PRO PRO D . n 
C 1 129 HIS 129 232 232 HIS HIS D . n 
C 1 130 GLY 130 233 233 GLY GLY D . n 
C 1 131 THR 131 234 234 THR THR D . n 
C 1 132 PHE 132 235 235 PHE PHE D . n 
C 1 133 LEU 133 236 236 LEU LEU D . n 
C 1 134 GLY 134 237 237 GLY GLY D . n 
C 1 135 PHE 135 238 238 PHE PHE D . n 
C 1 136 VAL 136 239 239 VAL VAL D . n 
C 1 137 LYS 137 240 240 LYS LYS D . n 
C 1 138 LEU 138 241 241 LEU LEU D . n 
D 2 1   ALA 1   5   ?   ?   ?   R . n 
D 2 2   GLY 2   6   ?   ?   ?   R . n 
D 2 3   GLN 3   7   ?   ?   ?   R . n 
D 2 4   CYS 4   8   8   CYS CYS R . n 
D 2 5   SER 5   9   9   SER SER R . n 
D 2 6   GLN 6   10  10  GLN GLN R . n 
D 2 7   ASN 7   11  11  ASN ASN R . n 
D 2 8   GLU 8   12  12  GLU GLU R . n 
D 2 9   TYR 9   13  13  TYR TYR R . n 
D 2 10  PHE 10  14  14  PHE PHE R . n 
D 2 11  ASP 11  15  15  ASP ASP R . n 
D 2 12  SER 12  16  16  SER SER R . n 
D 2 13  LEU 13  17  17  LEU LEU R . n 
D 2 14  LEU 14  18  18  LEU LEU R . n 
D 2 15  HIS 15  19  19  HIS HIS R . n 
D 2 16  ALA 16  20  20  ALA ALA R . n 
D 2 17  CYS 17  21  21  CYS CYS R . n 
D 2 18  ILE 18  22  22  ILE ILE R . n 
D 2 19  PRO 19  23  23  PRO PRO R . n 
D 2 20  CYS 20  24  24  CYS CYS R . n 
D 2 21  GLN 21  25  25  GLN GLN R . n 
D 2 22  LEU 22  26  26  LEU LEU R . n 
D 2 23  ARG 23  27  27  ARG ARG R . n 
D 2 24  CYS 24  28  28  CYS CYS R . n 
D 2 25  SER 25  29  29  SER SER R . n 
D 2 26  SER 26  30  30  SER SER R . n 
D 2 27  ASN 27  31  31  ASN ASN R . n 
D 2 28  THR 28  32  32  THR THR R . n 
D 2 29  PRO 29  33  33  PRO PRO R . n 
D 2 30  PRO 30  34  34  PRO PRO R . n 
D 2 31  LEU 31  35  35  LEU LEU R . n 
D 2 32  THR 32  36  36  THR THR R . n 
D 2 33  CYS 33  37  37  CYS CYS R . n 
D 2 34  GLN 34  38  38  GLN GLN R . n 
D 2 35  ARG 35  39  39  ARG ARG R . n 
D 2 36  TYR 36  40  40  TYR TYR R . n 
D 2 37  CYS 37  41  41  CYS CYS R . n 
D 2 38  ASN 38  42  42  ASN ASN R . n 
D 2 39  ALA 39  43  43  ALA ALA R . n 
D 2 40  SER 40  44  ?   ?   ?   R . n 
D 2 41  VAL 41  45  ?   ?   ?   R . n 
D 2 42  THR 42  46  ?   ?   ?   R . n 
D 2 43  ASN 43  47  ?   ?   ?   R . n 
D 2 44  SER 44  48  ?   ?   ?   R . n 
D 2 45  VAL 45  49  ?   ?   ?   R . n 
D 2 46  LYS 46  50  ?   ?   ?   R . n 
D 2 47  GLY 47  51  ?   ?   ?   R . n 
E 2 1   ALA 1   5   ?   ?   ?   S . n 
E 2 2   GLY 2   6   6   GLY GLY S . n 
E 2 3   GLN 3   7   7   GLN GLN S . n 
E 2 4   CYS 4   8   8   CYS CYS S . n 
E 2 5   SER 5   9   9   SER SER S . n 
E 2 6   GLN 6   10  10  GLN GLN S . n 
E 2 7   ASN 7   11  11  ASN ASN S . n 
E 2 8   GLU 8   12  12  GLU GLU S . n 
E 2 9   TYR 9   13  13  TYR TYR S . n 
E 2 10  PHE 10  14  14  PHE PHE S . n 
E 2 11  ASP 11  15  15  ASP ASP S . n 
E 2 12  SER 12  16  16  SER SER S . n 
E 2 13  LEU 13  17  17  LEU LEU S . n 
E 2 14  LEU 14  18  18  LEU LEU S . n 
E 2 15  HIS 15  19  19  HIS HIS S . n 
E 2 16  ALA 16  20  20  ALA ALA S . n 
E 2 17  CYS 17  21  21  CYS CYS S . n 
E 2 18  ILE 18  22  22  ILE ILE S . n 
E 2 19  PRO 19  23  23  PRO PRO S . n 
E 2 20  CYS 20  24  24  CYS CYS S . n 
E 2 21  GLN 21  25  25  GLN GLN S . n 
E 2 22  LEU 22  26  26  LEU LEU S . n 
E 2 23  ARG 23  27  27  ARG ARG S . n 
E 2 24  CYS 24  28  28  CYS CYS S . n 
E 2 25  SER 25  29  29  SER SER S . n 
E 2 26  SER 26  30  30  SER SER S . n 
E 2 27  ASN 27  31  31  ASN ASN S . n 
E 2 28  THR 28  32  32  THR THR S . n 
E 2 29  PRO 29  33  33  PRO PRO S . n 
E 2 30  PRO 30  34  34  PRO PRO S . n 
E 2 31  LEU 31  35  35  LEU LEU S . n 
E 2 32  THR 32  36  36  THR THR S . n 
E 2 33  CYS 33  37  37  CYS CYS S . n 
E 2 34  GLN 34  38  38  GLN GLN S . n 
E 2 35  ARG 35  39  39  ARG ALA S . n 
E 2 36  TYR 36  40  40  TYR TYR S . n 
E 2 37  CYS 37  41  41  CYS CYS S . n 
E 2 38  ASN 38  42  42  ASN ASN S . n 
E 2 39  ALA 39  43  ?   ?   ?   S . n 
E 2 40  SER 40  44  ?   ?   ?   S . n 
E 2 41  VAL 41  45  ?   ?   ?   S . n 
E 2 42  THR 42  46  ?   ?   ?   S . n 
E 2 43  ASN 43  47  ?   ?   ?   S . n 
E 2 44  SER 44  48  ?   ?   ?   S . n 
E 2 45  VAL 45  49  ?   ?   ?   S . n 
E 2 46  LYS 46  50  ?   ?   ?   S . n 
E 2 47  GLY 47  51  ?   ?   ?   S . n 
F 2 1   ALA 1   5   ?   ?   ?   T . n 
F 2 2   GLY 2   6   ?   ?   ?   T . n 
F 2 3   GLN 3   7   ?   ?   ?   T . n 
F 2 4   CYS 4   8   8   CYS CYS T . n 
F 2 5   SER 5   9   9   SER SER T . n 
F 2 6   GLN 6   10  10  GLN GLN T . n 
F 2 7   ASN 7   11  11  ASN ASN T . n 
F 2 8   GLU 8   12  12  GLU GLU T . n 
F 2 9   TYR 9   13  13  TYR TYR T . n 
F 2 10  PHE 10  14  14  PHE PHE T . n 
F 2 11  ASP 11  15  15  ASP ASP T . n 
F 2 12  SER 12  16  16  SER SER T . n 
F 2 13  LEU 13  17  17  LEU LEU T . n 
F 2 14  LEU 14  18  18  LEU LEU T . n 
F 2 15  HIS 15  19  19  HIS HIS T . n 
F 2 16  ALA 16  20  20  ALA ALA T . n 
F 2 17  CYS 17  21  21  CYS CYS T . n 
F 2 18  ILE 18  22  22  ILE ILE T . n 
F 2 19  PRO 19  23  23  PRO PRO T . n 
F 2 20  CYS 20  24  24  CYS CYS T . n 
F 2 21  GLN 21  25  25  GLN GLN T . n 
F 2 22  LEU 22  26  26  LEU LEU T . n 
F 2 23  ARG 23  27  27  ARG ARG T . n 
F 2 24  CYS 24  28  28  CYS CYS T . n 
F 2 25  SER 25  29  29  SER SER T . n 
F 2 26  SER 26  30  30  SER SER T . n 
F 2 27  ASN 27  31  31  ASN ASN T . n 
F 2 28  THR 28  32  32  THR THR T . n 
F 2 29  PRO 29  33  33  PRO PRO T . n 
F 2 30  PRO 30  34  34  PRO PRO T . n 
F 2 31  LEU 31  35  35  LEU LEU T . n 
F 2 32  THR 32  36  36  THR THR T . n 
F 2 33  CYS 33  37  37  CYS CYS T . n 
F 2 34  GLN 34  38  38  GLN ALA T . n 
F 2 35  ARG 35  39  39  ARG ALA T . n 
F 2 36  TYR 36  40  40  TYR TYR T . n 
F 2 37  CYS 37  41  41  CYS CYS T . n 
F 2 38  ASN 38  42  42  ASN ALA T . n 
F 2 39  ALA 39  43  ?   ?   ?   T . n 
F 2 40  SER 40  44  ?   ?   ?   T . n 
F 2 41  VAL 41  45  ?   ?   ?   T . n 
F 2 42  THR 42  46  ?   ?   ?   T . n 
F 2 43  ASN 43  47  ?   ?   ?   T . n 
F 2 44  SER 44  48  ?   ?   ?   T . n 
F 2 45  VAL 45  49  ?   ?   ?   T . n 
F 2 46  LYS 46  50  ?   ?   ?   T . n 
F 2 47  GLY 47  51  ?   ?   ?   T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 NI  1  301 301 NI  NI  B . 
H 4 HOH 1  2   2   HOH HOH A . 
H 4 HOH 2  11  11  HOH HOH A . 
H 4 HOH 3  12  12  HOH HOH A . 
H 4 HOH 4  17  17  HOH HOH A . 
H 4 HOH 5  19  19  HOH HOH A . 
H 4 HOH 6  31  31  HOH HOH A . 
H 4 HOH 7  33  33  HOH HOH A . 
H 4 HOH 8  35  35  HOH HOH A . 
H 4 HOH 9  38  38  HOH HOH A . 
H 4 HOH 10 39  39  HOH HOH A . 
I 4 HOH 1  3   3   HOH HOH B . 
I 4 HOH 2  10  10  HOH HOH B . 
I 4 HOH 3  15  15  HOH HOH B . 
I 4 HOH 4  16  16  HOH HOH B . 
I 4 HOH 5  18  18  HOH HOH B . 
I 4 HOH 6  21  21  HOH HOH B . 
I 4 HOH 7  23  23  HOH HOH B . 
I 4 HOH 8  24  24  HOH HOH B . 
I 4 HOH 9  28  28  HOH HOH B . 
I 4 HOH 10 30  30  HOH HOH B . 
J 4 HOH 1  4   4   HOH HOH D . 
J 4 HOH 2  5   5   HOH HOH D . 
J 4 HOH 3  6   6   HOH HOH D . 
J 4 HOH 4  7   7   HOH HOH D . 
J 4 HOH 5  8   8   HOH HOH D . 
J 4 HOH 6  13  13  HOH HOH D . 
J 4 HOH 7  14  14  HOH HOH D . 
J 4 HOH 8  22  22  HOH HOH D . 
J 4 HOH 9  25  25  HOH HOH D . 
J 4 HOH 10 26  26  HOH HOH D . 
J 4 HOH 11 27  27  HOH HOH D . 
J 4 HOH 12 29  29  HOH HOH D . 
J 4 HOH 13 32  32  HOH HOH D . 
J 4 HOH 14 34  34  HOH HOH D . 
J 4 HOH 15 40  40  HOH HOH D . 
K 4 HOH 1  52  36  HOH HOH R . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10580 ? 
1 MORE         -53   ? 
1 'SSA (A^2)'  20560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 3 ? A HIS 106 ? 1_555 NI ? G NI . ? B NI 301 ? 1_555 NE2 ? B HIS 3 ? B HIS 106 ? 1_555 83.5  ? 
2 NE2 ? A HIS 3 ? A HIS 106 ? 1_555 NI ? G NI . ? B NI 301 ? 1_555 NE2 ? C HIS 3 ? D HIS 106 ? 1_555 75.7  ? 
3 NE2 ? B HIS 3 ? B HIS 106 ? 1_555 NI ? G NI . ? B NI 301 ? 1_555 NE2 ? C HIS 3 ? D HIS 106 ? 1_555 108.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-11-09 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 11.4510 84.0327  4.6368   0.1011 0.1091 0.1583 -0.0141 -0.0341 0.1024  3.1461 2.7331  2.5638  -0.1252 0.9115  -0.2272 
0.1006  -0.2092 -0.3960 0.0627  0.0298  0.2027  0.2755  -0.2148 -0.1305 'X-RAY DIFFRACTION' 
2 ? refined 6.1167  105.9483 9.1820   0.0730 0.1615 0.1655 0.0442  0.0914  0.0533  2.6695 2.6706  3.8296  0.4075  0.9553  -0.1667 
0.0179  -0.3133 0.2335  0.3207  -0.0449 0.4227  -0.2728 -0.2242 0.0270  'X-RAY DIFFRACTION' 
3 ? refined 26.0421 100.8884 -1.3595  0.0501 0.1274 0.1136 0.0171  0.0550  0.0814  2.9861 3.6954  2.9577  0.1324  0.9974  -0.8393 
0.0827  0.1931  -0.0274 -0.0713 -0.0891 -0.4532 0.1006  0.2988  0.0064  'X-RAY DIFFRACTION' 
4 ? refined -7.6636 83.1563  -9.5482  0.2739 0.2909 0.3931 -0.1393 -0.1688 0.1414  4.8149 9.5216  14.3511 1.5843  5.9660  4.6937  
0.2382  -0.0941 -0.6291 -0.4535 0.1703  0.7924  0.8782  -0.5263 -0.4085 'X-RAY DIFFRACTION' 
5 ? refined 0.9554  117.8873 -10.0897 0.2506 0.3033 0.4320 0.0712  -0.1136 0.1626  9.2180 10.6111 11.1624 -3.9994 1.4052  -0.4374 
-0.0251 0.3173  0.2861  -0.6638 0.0771  1.4078  -0.5072 -1.1028 -0.0520 'X-RAY DIFFRACTION' 
6 ? refined 22.3902 94.1774  -23.5163 0.5681 0.5537 0.1712 -0.0691 0.1130  -0.0916 9.8575 6.2674  21.7778 4.1672  -1.6925 -4.1417 
-0.4791 1.7580  -0.3046 -1.6534 0.6037  -0.6857 0.4978  0.0757  -0.1245 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 2 105 A 138 241 ? A A 'X-RAY DIFFRACTION' ? 
2 2 B 2 105 B 138 241 ? B B 'X-RAY DIFFRACTION' ? 
3 3 C 2 105 C 138 241 ? D D 'X-RAY DIFFRACTION' ? 
4 4 D 4 8   D 39  43  ? R R 'X-RAY DIFFRACTION' ? 
5 5 E 2 6   E 38  42  ? S S 'X-RAY DIFFRACTION' ? 
6 6 F 4 8   F 38  42  ? T T 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.24 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    2 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    38 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.12 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            T 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ASN 
_pdbx_validate_rmsd_bond.auth_seq_id_1             42 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            O 
_pdbx_validate_rmsd_bond.auth_asym_id_2            T 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ASN 
_pdbx_validate_rmsd_bond.auth_seq_id_2             42 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.469 
_pdbx_validate_rmsd_bond.bond_target_value         1.229 
_pdbx_validate_rmsd_bond.bond_deviation            0.240 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 221 ? ? -72.17  46.87   
2  1 ASP B 123 ? ? -114.89 55.66   
3  1 ARG B 180 ? ? -170.12 106.71  
4  1 PRO B 221 ? ? -74.03  42.82   
5  1 ALA D 120 ? ? -54.12  -83.92  
6  1 ASP D 123 ? ? -117.90 60.86   
7  1 ARG D 137 ? ? -119.47 -149.05 
8  1 PRO D 221 ? ? -72.56  42.72   
9  1 ASN R 31  ? ? 48.75   -121.45 
10 1 ASN R 42  ? ? -92.13  -68.23  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 S ARG 39 ? CG  ? E ARG 35 CG  
2  1 Y 1 S ARG 39 ? CD  ? E ARG 35 CD  
3  1 Y 1 S ARG 39 ? NE  ? E ARG 35 NE  
4  1 Y 1 S ARG 39 ? CZ  ? E ARG 35 CZ  
5  1 Y 1 S ARG 39 ? NH1 ? E ARG 35 NH1 
6  1 Y 1 S ARG 39 ? NH2 ? E ARG 35 NH2 
7  1 Y 1 T GLN 38 ? CG  ? F GLN 34 CG  
8  1 Y 1 T GLN 38 ? CD  ? F GLN 34 CD  
9  1 Y 1 T GLN 38 ? OE1 ? F GLN 34 OE1 
10 1 Y 1 T GLN 38 ? NE2 ? F GLN 34 NE2 
11 1 Y 1 T ARG 39 ? CG  ? F ARG 35 CG  
12 1 Y 1 T ARG 39 ? CD  ? F ARG 35 CD  
13 1 Y 1 T ARG 39 ? NE  ? F ARG 35 NE  
14 1 Y 1 T ARG 39 ? CZ  ? F ARG 35 CZ  
15 1 Y 1 T ARG 39 ? NH1 ? F ARG 35 NH1 
16 1 Y 1 T ARG 39 ? NH2 ? F ARG 35 NH2 
17 1 Y 1 T ASN 42 ? CG  ? F ASN 38 CG  
18 1 Y 1 T ASN 42 ? OD1 ? F ASN 38 OD1 
19 1 Y 1 T ASN 42 ? ND2 ? F ASN 38 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 104 ? A LYS 1  
2  1 Y 1 B LYS 104 ? B LYS 1  
3  1 Y 1 D LYS 104 ? C LYS 1  
4  1 Y 1 R ALA 5   ? D ALA 1  
5  1 Y 1 R GLY 6   ? D GLY 2  
6  1 Y 1 R GLN 7   ? D GLN 3  
7  1 Y 1 R SER 44  ? D SER 40 
8  1 Y 1 R VAL 45  ? D VAL 41 
9  1 Y 1 R THR 46  ? D THR 42 
10 1 Y 1 R ASN 47  ? D ASN 43 
11 1 Y 1 R SER 48  ? D SER 44 
12 1 Y 1 R VAL 49  ? D VAL 45 
13 1 Y 1 R LYS 50  ? D LYS 46 
14 1 Y 1 R GLY 51  ? D GLY 47 
15 1 Y 1 S ALA 5   ? E ALA 1  
16 1 Y 1 S ALA 43  ? E ALA 39 
17 1 Y 1 S SER 44  ? E SER 40 
18 1 Y 1 S VAL 45  ? E VAL 41 
19 1 Y 1 S THR 46  ? E THR 42 
20 1 Y 1 S ASN 47  ? E ASN 43 
21 1 Y 1 S SER 48  ? E SER 44 
22 1 Y 1 S VAL 49  ? E VAL 45 
23 1 Y 1 S LYS 50  ? E LYS 46 
24 1 Y 1 S GLY 51  ? E GLY 47 
25 1 Y 1 T ALA 5   ? F ALA 1  
26 1 Y 1 T GLY 6   ? F GLY 2  
27 1 Y 1 T GLN 7   ? F GLN 3  
28 1 Y 1 T ALA 43  ? F ALA 39 
29 1 Y 1 T SER 44  ? F SER 40 
30 1 Y 1 T VAL 45  ? F VAL 41 
31 1 Y 1 T THR 46  ? F THR 42 
32 1 Y 1 T ASN 47  ? F ASN 43 
33 1 Y 1 T SER 48  ? F SER 44 
34 1 Y 1 T VAL 49  ? F VAL 45 
35 1 Y 1 T LYS 50  ? F LYS 46 
36 1 Y 1 T GLY 51  ? F GLY 47 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'NICKEL (II) ION' NI  
4 water             HOH 
#