data_1XUQ
# 
_entry.id   1XUQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XUQ         
RCSB  RCSB030784   
WWPDB D_1000030784 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1XRE 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XUQ 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Boucher, I.W.'   1 
'Levdikov, V.M.'  2 
'Blagova, E.V.'   3 
'Fogg, M.J.'      4 
'Brannigan, J.A.' 5 
'Wilkinson, A.J.' 6 
'Wilson, K.S.'    7 
# 
_citation.id                        primary 
_citation.title                     'Structures of two superoxide dismutases from Bacillus anthracis reveal a novel active centre.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            61 
_citation.page_first                621 
_citation.page_last                 624 
_citation.year                      2005 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16511113 
_citation.pdbx_database_id_DOI      10.1107/S1744309105017380 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Boucher, I.W.'   1 
primary 'Kalliomaa, A.K.' 2 
primary 'Levdikov, V.M.'  3 
primary 'Blagova, E.V.'   4 
primary 'Fogg, M.J.'      5 
primary 'Brannigan, J.A.' 6 
primary 'Wilson, K.S.'    7 
primary 'Wilkinson, A.J.' 8 
# 
_cell.entry_id           1XUQ 
_cell.length_a           60.881 
_cell.length_b           60.439 
_cell.length_c           61.981 
_cell.angle_alpha        90.00 
_cell.angle_beta         106.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XUQ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Superoxide dismutase' 23750.092 2   1.15.1.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'   54.938    2   ?        ? ? ? 
3 water       nat water                  18.015    474 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        SODA-2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHMAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNEVPEAIRT
AVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQD
SPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHMAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNEVPEAIRT
AVRNNGGGHANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQD
SPLTEGKTPVIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEAK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  MET n 
1 11  ALA n 
1 12  LYS n 
1 13  HIS n 
1 14  GLU n 
1 15  LEU n 
1 16  PRO n 
1 17  ASN n 
1 18  LEU n 
1 19  PRO n 
1 20  TYR n 
1 21  ALA n 
1 22  TYR n 
1 23  ASP n 
1 24  ALA n 
1 25  LEU n 
1 26  GLU n 
1 27  PRO n 
1 28  HIS n 
1 29  PHE n 
1 30  ASP n 
1 31  LYS n 
1 32  GLU n 
1 33  THR n 
1 34  MET n 
1 35  ASN n 
1 36  ILE n 
1 37  HIS n 
1 38  HIS n 
1 39  THR n 
1 40  LYS n 
1 41  HIS n 
1 42  HIS n 
1 43  ASN n 
1 44  THR n 
1 45  TYR n 
1 46  ILE n 
1 47  THR n 
1 48  ASN n 
1 49  LEU n 
1 50  ASN n 
1 51  ALA n 
1 52  ALA n 
1 53  LEU n 
1 54  GLU n 
1 55  GLY n 
1 56  HIS n 
1 57  ALA n 
1 58  GLU n 
1 59  LEU n 
1 60  ALA n 
1 61  ASP n 
1 62  LYS n 
1 63  SER n 
1 64  VAL n 
1 65  GLU n 
1 66  GLU n 
1 67  LEU n 
1 68  VAL n 
1 69  ALA n 
1 70  ASN n 
1 71  LEU n 
1 72  ASN n 
1 73  GLU n 
1 74  VAL n 
1 75  PRO n 
1 76  GLU n 
1 77  ALA n 
1 78  ILE n 
1 79  ARG n 
1 80  THR n 
1 81  ALA n 
1 82  VAL n 
1 83  ARG n 
1 84  ASN n 
1 85  ASN n 
1 86  GLY n 
1 87  GLY n 
1 88  GLY n 
1 89  HIS n 
1 90  ALA n 
1 91  ASN n 
1 92  HIS n 
1 93  THR n 
1 94  PHE n 
1 95  PHE n 
1 96  TRP n 
1 97  THR n 
1 98  ILE n 
1 99  LEU n 
1 100 SER n 
1 101 PRO n 
1 102 ASN n 
1 103 GLY n 
1 104 GLY n 
1 105 GLY n 
1 106 GLN n 
1 107 PRO n 
1 108 VAL n 
1 109 GLY n 
1 110 GLU n 
1 111 LEU n 
1 112 ALA n 
1 113 THR n 
1 114 ALA n 
1 115 ILE n 
1 116 GLU n 
1 117 ALA n 
1 118 LYS n 
1 119 PHE n 
1 120 GLY n 
1 121 SER n 
1 122 PHE n 
1 123 ASP n 
1 124 ALA n 
1 125 PHE n 
1 126 LYS n 
1 127 GLU n 
1 128 GLU n 
1 129 PHE n 
1 130 ALA n 
1 131 LYS n 
1 132 ALA n 
1 133 GLY n 
1 134 ALA n 
1 135 THR n 
1 136 ARG n 
1 137 PHE n 
1 138 GLY n 
1 139 SER n 
1 140 GLY n 
1 141 TRP n 
1 142 ALA n 
1 143 TRP n 
1 144 LEU n 
1 145 VAL n 
1 146 VAL n 
1 147 ASN n 
1 148 ASN n 
1 149 GLY n 
1 150 GLU n 
1 151 LEU n 
1 152 GLU n 
1 153 VAL n 
1 154 THR n 
1 155 SER n 
1 156 THR n 
1 157 PRO n 
1 158 ASN n 
1 159 GLN n 
1 160 ASP n 
1 161 SER n 
1 162 PRO n 
1 163 LEU n 
1 164 THR n 
1 165 GLU n 
1 166 GLY n 
1 167 LYS n 
1 168 THR n 
1 169 PRO n 
1 170 VAL n 
1 171 ILE n 
1 172 GLY n 
1 173 LEU n 
1 174 ASP n 
1 175 VAL n 
1 176 TRP n 
1 177 GLU n 
1 178 HIS n 
1 179 ALA n 
1 180 TYR n 
1 181 TYR n 
1 182 LEU n 
1 183 ASN n 
1 184 TYR n 
1 185 GLN n 
1 186 ASN n 
1 187 ARG n 
1 188 ARG n 
1 189 PRO n 
1 190 ASP n 
1 191 TYR n 
1 192 ILE n 
1 193 GLY n 
1 194 ALA n 
1 195 PHE n 
1 196 TRP n 
1 197 ASN n 
1 198 VAL n 
1 199 VAL n 
1 200 ASP n 
1 201 TRP n 
1 202 ASN n 
1 203 ALA n 
1 204 ALA n 
1 205 GLU n 
1 206 LYS n 
1 207 ARG n 
1 208 TYR n 
1 209 GLN n 
1 210 GLU n 
1 211 ALA n 
1 212 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 'sodA1, sodA-1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus anthracis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1392 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-YSBLIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SODM1_BACAN 
_struct_ref.pdbx_db_accession          Q81LW0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAKHELPNLPYAYDALEPHFDKETMNIHHTKHHNTYITNLNAALEGHAELADKSVEELVANLNEVPEAIRTAVRNNGGGH
ANHTFFWTILSPNGGGQPVGELATAIEAKFGSFDAFKEEFAKAGATRFGSGWAWLVVNNGELEVTSTPNQDSPLTEGKTP
VIGLDVWEHAYYLNYQNRRPDYIGAFWNVVDWNAAEKRYQEAK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XUQ A 10 ? 212 ? Q81LW0 1 ? 203 ? 1 203 
2 1 1XUQ B 10 ? 212 ? Q81LW0 1 ? 203 ? 1 203 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XUQ GLY A 1 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -8 1  
1 1XUQ SER A 2 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -7 2  
1 1XUQ SER A 3 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -6 3  
1 1XUQ HIS A 4 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -5 4  
1 1XUQ HIS A 5 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -4 5  
1 1XUQ HIS A 6 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -3 6  
1 1XUQ HIS A 7 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -2 7  
1 1XUQ HIS A 8 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -1 8  
1 1XUQ HIS A 9 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' 0  9  
2 1XUQ GLY B 1 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -8 10 
2 1XUQ SER B 2 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -7 11 
2 1XUQ SER B 3 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -6 12 
2 1XUQ HIS B 4 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -5 13 
2 1XUQ HIS B 5 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -4 14 
2 1XUQ HIS B 6 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -3 15 
2 1XUQ HIS B 7 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -2 16 
2 1XUQ HIS B 8 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' -1 17 
2 1XUQ HIS B 9 ? UNP Q81LW0 ? ? 'EXPRESSION TAG' 0  18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XUQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   48.7 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'PEG4000, Sodium Acetate trihydrate, TRIS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-07-23 
_diffrn_detector.details                'Rh coated Si mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.87000 
# 
_reflns.entry_id                     1XUQ 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             50.00 
_reflns.number_all                   39919 
_reflns.number_obs                   39919 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   89.7 
_reflns_shell.Rmerge_I_obs           0.748 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.5 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3607 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XUQ 
_refine.ls_number_reflns_obs                     37842 
_refine.ls_number_reflns_all                     37842 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.45 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.17203 
_refine.ls_R_factor_all                          0.17203 
_refine.ls_R_factor_R_work                       0.16912 
_refine.ls_R_factor_R_free                       0.22822 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2001 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.968 
_refine.correlation_coeff_Fo_to_Fc_free          0.948 
_refine.B_iso_mean                               24.884 
_refine.aniso_B[1][1]                            1.29 
_refine.aniso_B[2][2]                            -0.98 
_refine.aniso_B[3][3]                            0.20 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.91 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JR9' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.123 
_refine.pdbx_overall_ESU_R_Free                  0.130 
_refine.overall_SU_ML                            0.094 
_refine.overall_SU_B                             3.028 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3195 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             474 
_refine_hist.number_atoms_total               3671 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        31.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.017  0.021  ? 3303 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 2768 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.449  1.910  ? 4501 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.980  3.000  ? 6463 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.530  5.000  ? 406  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.421 24.944 ? 178  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   14.716 15.000 ? 484  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   16.886 15.000 ? 12   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.155  0.200  ? 466  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008  0.020  ? 3791 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 685  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.210  0.200  ? 702  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.174  0.200  ? 2701 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.182  0.200  ? 1567 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.084  0.200  ? 1603 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.165  0.200  ? 308  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.135  0.200  ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.237  0.200  ? 22   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.179  0.200  ? 15   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.657  2.000  ? 2574 'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.299  2.000  ? 824  'X-RAY DIFFRACTION' ? 
r_mcangle_it             2.378  4.000  ? 3207 'X-RAY DIFFRACTION' ? 
r_scbond_it              6.466  66.000 ? 1558 'X-RAY DIFFRACTION' ? 
r_scangle_it             6.747  10.000 ? 1291 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_R_work             2577 
_refine_ls_shell.R_factor_R_work                  0.253 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.299 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             162 
_refine_ls_shell.number_reflns_obs                2577 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1XUQ 
_struct.title                     'Crystal Structure of SodA-1 (BA4499) from Bacillus anthracis at 1.8A Resolution.' 
_struct.pdbx_descriptor           'Superoxide dismutase (E.C.1.15.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XUQ 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'SodA-1; Superoxide dismutase; Bacillus anthracis; BA4499; SPINE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 30  ? LYS A 40  ? ASP A 21  LYS A 31  1 ? 11 
HELX_P HELX_P2  2  LYS A 40  ? GLU A 54  ? LYS A 31  GLU A 45  1 ? 15 
HELX_P HELX_P3  3  HIS A 56  ? ASP A 61  ? HIS A 47  ASP A 52  1 ? 6  
HELX_P HELX_P4  4  SER A 63  ? ASN A 70  ? SER A 54  ASN A 61  1 ? 8  
HELX_P HELX_P5  5  LEU A 71  ? VAL A 74  ? LEU A 62  VAL A 65  5 ? 4  
HELX_P HELX_P6  6  PRO A 75  ? ILE A 98  ? PRO A 66  ILE A 89  1 ? 24 
HELX_P HELX_P7  7  VAL A 108 ? GLY A 120 ? VAL A 99  GLY A 111 1 ? 13 
HELX_P HELX_P8  8  SER A 121 ? ARG A 136 ? SER A 112 ARG A 127 1 ? 16 
HELX_P HELX_P9  9  SER A 161 ? GLY A 166 ? SER A 152 GLY A 157 5 ? 6  
HELX_P HELX_P10 10 TRP A 176 ? ALA A 179 ? TRP A 167 ALA A 170 5 ? 4  
HELX_P HELX_P11 11 TYR A 180 ? GLN A 185 ? TYR A 171 GLN A 176 1 ? 6  
HELX_P HELX_P12 12 ARG A 187 ? TRP A 196 ? ARG A 178 TRP A 187 1 ? 10 
HELX_P HELX_P13 13 ASP A 200 ? ALA A 211 ? ASP A 191 ALA A 202 1 ? 12 
HELX_P HELX_P14 14 ASP B 30  ? LYS B 40  ? ASP B 21  LYS B 31  1 ? 11 
HELX_P HELX_P15 15 LYS B 40  ? LEU B 53  ? LYS B 31  LEU B 44  1 ? 14 
HELX_P HELX_P16 16 GLU B 58  ? LYS B 62  ? GLU B 49  LYS B 53  5 ? 5  
HELX_P HELX_P17 17 SER B 63  ? ASN B 70  ? SER B 54  ASN B 61  1 ? 8  
HELX_P HELX_P18 18 LEU B 71  ? VAL B 74  ? LEU B 62  VAL B 65  5 ? 4  
HELX_P HELX_P19 19 PRO B 75  ? THR B 97  ? PRO B 66  THR B 88  1 ? 23 
HELX_P HELX_P20 20 VAL B 108 ? GLY B 120 ? VAL B 99  GLY B 111 1 ? 13 
HELX_P HELX_P21 21 SER B 121 ? ARG B 136 ? SER B 112 ARG B 127 1 ? 16 
HELX_P HELX_P22 22 SER B 161 ? GLY B 166 ? SER B 152 GLY B 157 5 ? 6  
HELX_P HELX_P23 23 TRP B 176 ? ALA B 179 ? TRP B 167 ALA B 170 5 ? 4  
HELX_P HELX_P24 24 TYR B 180 ? GLN B 185 ? TYR B 171 GLN B 176 1 ? 6  
HELX_P HELX_P25 25 ARG B 187 ? TRP B 196 ? ARG B 178 TRP B 187 1 ? 10 
HELX_P HELX_P26 26 ASP B 200 ? GLU B 210 ? ASP B 191 GLU B 201 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 174 OD2 ? ? ? 1_555 C MN  .   MN  ? ? A ASP 165 A MN  204 1_555 ? ? ? ? ? ? ? 1.911 ? 
metalc2  metalc ? ? B ASP 174 OD2 ? ? ? 1_555 D MN  .   MN  ? ? B ASP 165 B MN  204 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc3  metalc ? ? D MN  .   MN  ? ? ? 1_555 F HOH .   O   ? ? B MN  204 B HOH 206 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc4  metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH .   O   ? ? A MN  204 A HOH 365 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc5  metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH .   O   ? ? A MN  204 A HOH 206 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc6  metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 37  NE2 ? ? A MN  204 A HIS 28  1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc7  metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 92  NE2 ? ? A MN  204 A HIS 83  1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc8  metalc ? ? C MN  .   MN  ? ? ? 1_555 A HIS 178 NE2 ? ? A MN  204 A HIS 169 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc9  metalc ? ? D MN  .   MN  ? ? ? 1_555 B HIS 37  NE2 ? ? B MN  204 B HIS 28  1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc10 metalc ? ? D MN  .   MN  ? ? ? 1_555 B HIS 92  NE2 ? ? B MN  204 B HIS 83  1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc11 metalc ? ? D MN  .   MN  ? ? ? 1_555 B HIS 178 NE2 ? ? B MN  204 B HIS 169 1_555 ? ? ? ? ? ? ? 2.066 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26 A . ? GLU 17 A PRO 27 A ? PRO 18 A 1 0.14 
2 GLU 26 B . ? GLU 17 B PRO 27 B ? PRO 18 B 1 2.55 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 150 ? PRO A 157 ? GLU A 141 PRO A 148 
A 2 GLY A 140 ? ASN A 147 ? GLY A 131 ASN A 138 
A 3 THR A 168 ? ASP A 174 ? THR A 159 ASP A 165 
B 1 LEU B 151 ? PRO B 157 ? LEU B 142 PRO B 148 
B 2 GLY B 140 ? VAL B 146 ? GLY B 131 VAL B 137 
B 3 THR B 168 ? ASP B 174 ? THR B 159 ASP B 165 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 150 ? O GLU A 141 N ASN A 147 ? N ASN A 138 
A 2 3 N LEU A 144 ? N LEU A 135 O VAL A 170 ? O VAL A 161 
B 1 2 O GLU B 152 ? O GLU B 143 N VAL B 145 ? N VAL B 136 
B 2 3 N LEU B 144 ? N LEU B 135 O VAL B 170 ? O VAL B 161 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN B 204' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 204' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS B 37  ? HIS B 28  . ? 1_555 ? 
2  AC1 5 HIS B 92  ? HIS B 83  . ? 1_555 ? 
3  AC1 5 ASP B 174 ? ASP B 165 . ? 1_555 ? 
4  AC1 5 HIS B 178 ? HIS B 169 . ? 1_555 ? 
5  AC1 5 HOH F .   ? HOH B 206 . ? 1_555 ? 
6  AC2 6 HIS A 37  ? HIS A 28  . ? 1_555 ? 
7  AC2 6 HIS A 92  ? HIS A 83  . ? 1_555 ? 
8  AC2 6 ASP A 174 ? ASP A 165 . ? 1_555 ? 
9  AC2 6 HIS A 178 ? HIS A 169 . ? 1_555 ? 
10 AC2 6 HOH E .   ? HOH A 206 . ? 1_555 ? 
11 AC2 6 HOH E .   ? HOH A 365 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XUQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XUQ 
_atom_sites.fract_transf_matrix[1][1]   0.016425 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004803 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016546 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016810 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 12  ? 15.881  17.396  -5.741  1.00 40.26 ? 3   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 12  ? 16.570  16.192  -6.264  1.00 38.88 ? 3   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 12  ? 15.817  14.899  -5.911  1.00 37.19 ? 3   LYS A C   1 
ATOM   4    O  O   . LYS A 1 12  ? 15.332  14.196  -6.800  1.00 39.10 ? 3   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 12  ? 18.014  16.113  -5.736  1.00 42.73 ? 3   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 12  ? 19.000  17.051  -6.422  1.00 47.30 ? 3   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 12  ? 19.661  16.423  -7.647  1.00 56.67 ? 3   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 12  ? 18.690  16.273  -8.806  1.00 54.97 ? 3   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 12  ? 19.389  16.289  -10.113 1.00 58.28 ? 3   LYS A NZ  1 
ATOM   10   N  N   . HIS A 1 13  ? 15.720  14.562  -4.628  1.00 34.61 ? 4   HIS A N   1 
ATOM   11   C  CA  . HIS A 1 13  ? 15.043  13.290  -4.262  1.00 31.76 ? 4   HIS A CA  1 
ATOM   12   C  C   . HIS A 1 13  ? 13.532  13.435  -4.440  1.00 28.79 ? 4   HIS A C   1 
ATOM   13   O  O   . HIS A 1 13  ? 12.992  14.485  -4.160  1.00 26.87 ? 4   HIS A O   1 
ATOM   14   C  CB  . HIS A 1 13  ? 15.416  12.884  -2.849  1.00 31.36 ? 4   HIS A CB  1 
ATOM   15   C  CG  . HIS A 1 13  ? 16.874  12.559  -2.679  1.00 31.99 ? 4   HIS A CG  1 
ATOM   16   N  ND1 . HIS A 1 13  ? 17.395  11.307  -2.939  1.00 31.71 ? 4   HIS A ND1 1 
ATOM   17   C  CD2 . HIS A 1 13  ? 17.915  13.320  -2.265  1.00 30.10 ? 4   HIS A CD2 1 
ATOM   18   C  CE1 . HIS A 1 13  ? 18.687  11.307  -2.669  1.00 32.54 ? 4   HIS A CE1 1 
ATOM   19   N  NE2 . HIS A 1 13  ? 19.031  12.521  -2.271  1.00 34.09 ? 4   HIS A NE2 1 
ATOM   20   N  N   . GLU A 1 14  ? 12.881  12.390  -4.960  1.00 27.52 ? 5   GLU A N   1 
ATOM   21   C  CA  . GLU A 1 14  ? 11.473  12.454  -5.358  1.00 28.69 ? 5   GLU A CA  1 
ATOM   22   C  C   . GLU A 1 14  ? 10.733  11.297  -4.678  1.00 26.47 ? 5   GLU A C   1 
ATOM   23   O  O   . GLU A 1 14  ? 11.328  10.237  -4.388  1.00 24.96 ? 5   GLU A O   1 
ATOM   24   C  CB  . GLU A 1 14  ? 11.342  12.300  -6.870  1.00 28.17 ? 5   GLU A CB  1 
ATOM   25   C  CG  . GLU A 1 14  ? 11.694  13.546  -7.672  1.00 38.76 ? 5   GLU A CG  1 
ATOM   26   C  CD  . GLU A 1 14  ? 12.128  13.225  -9.115  1.00 34.44 ? 5   GLU A CD  1 
ATOM   27   O  OE1 . GLU A 1 14  ? 11.712  12.172  -9.655  1.00 59.76 ? 5   GLU A OE1 1 
ATOM   28   O  OE2 . GLU A 1 14  ? 12.915  14.016  -9.692  1.00 60.82 ? 5   GLU A OE2 1 
ATOM   29   N  N   . LEU A 1 15  ? 9.456   11.518  -4.394  1.00 25.42 ? 6   LEU A N   1 
ATOM   30   C  CA  . LEU A 1 15  ? 8.620   10.448  -3.835  1.00 26.01 ? 6   LEU A CA  1 
ATOM   31   C  C   . LEU A 1 15  ? 8.286   9.407   -4.902  1.00 24.62 ? 6   LEU A C   1 
ATOM   32   O  O   . LEU A 1 15  ? 7.686   9.721   -5.920  1.00 24.68 ? 6   LEU A O   1 
ATOM   33   C  CB  . LEU A 1 15  ? 7.333   11.050  -3.231  1.00 22.95 ? 6   LEU A CB  1 
ATOM   34   C  CG  . LEU A 1 15  ? 6.364   10.067  -2.574  1.00 27.68 ? 6   LEU A CG  1 
ATOM   35   C  CD1 . LEU A 1 15  ? 6.865   9.638   -1.255  1.00 21.75 ? 6   LEU A CD1 1 
ATOM   36   C  CD2 . LEU A 1 15  ? 4.992   10.728  -2.442  1.00 26.09 ? 6   LEU A CD2 1 
ATOM   37   N  N   . PRO A 1 16  ? 8.670   8.157   -4.675  1.00 26.68 ? 7   PRO A N   1 
ATOM   38   C  CA  . PRO A 1 16  ? 8.296   7.092   -5.640  1.00 25.89 ? 7   PRO A CA  1 
ATOM   39   C  C   . PRO A 1 16  ? 6.791   6.767   -5.590  1.00 25.94 ? 7   PRO A C   1 
ATOM   40   O  O   . PRO A 1 16  ? 6.177   6.823   -4.522  1.00 24.60 ? 7   PRO A O   1 
ATOM   41   C  CB  . PRO A 1 16  ? 9.158   5.918   -5.188  1.00 27.65 ? 7   PRO A CB  1 
ATOM   42   C  CG  . PRO A 1 16  ? 9.428   6.145   -3.725  1.00 23.56 ? 7   PRO A CG  1 
ATOM   43   C  CD  . PRO A 1 16  ? 9.427   7.633   -3.522  1.00 24.78 ? 7   PRO A CD  1 
ATOM   44   N  N   . ASN A 1 17  ? 6.166   6.512   -6.736  1.00 24.46 ? 8   ASN A N   1 
ATOM   45   C  CA  . ASN A 1 17  ? 4.815   6.023   -6.720  1.00 25.97 ? 8   ASN A CA  1 
ATOM   46   C  C   . ASN A 1 17  ? 4.823   4.634   -6.076  1.00 24.59 ? 8   ASN A C   1 
ATOM   47   O  O   . ASN A 1 17  ? 5.847   3.882   -6.117  1.00 23.56 ? 8   ASN A O   1 
ATOM   48   C  CB  . ASN A 1 17  ? 4.218   5.945   -8.126  1.00 27.53 ? 8   ASN A CB  1 
ATOM   49   C  CG  . ASN A 1 17  ? 3.841   7.323   -8.724  1.00 32.27 ? 8   ASN A CG  1 
ATOM   50   O  OD1 . ASN A 1 17  ? 3.621   8.327   -8.023  1.00 31.85 ? 8   ASN A OD1 1 
ATOM   51   N  ND2 . ASN A 1 17  ? 3.748   7.354   -10.031 1.00 34.76 ? 8   ASN A ND2 1 
ATOM   52   N  N   . LEU A 1 18  ? 3.710   4.301   -5.438  1.00 26.30 ? 9   LEU A N   1 
ATOM   53   C  CA  . LEU A 1 18  ? 3.483   2.932   -4.966  1.00 24.45 ? 9   LEU A CA  1 
ATOM   54   C  C   . LEU A 1 18  ? 3.424   1.971   -6.152  1.00 24.09 ? 9   LEU A C   1 
ATOM   55   O  O   . LEU A 1 18  ? 2.981   2.373   -7.256  1.00 24.41 ? 9   LEU A O   1 
ATOM   56   C  CB  . LEU A 1 18  ? 2.179   2.823   -4.172  1.00 26.03 ? 9   LEU A CB  1 
ATOM   57   C  CG  . LEU A 1 18  ? 2.154   3.504   -2.802  1.00 20.00 ? 9   LEU A CG  1 
ATOM   58   C  CD1 . LEU A 1 18  ? 0.827   3.233   -2.104  1.00 19.56 ? 9   LEU A CD1 1 
ATOM   59   C  CD2 . LEU A 1 18  ? 3.326   3.144   -1.894  1.00 23.09 ? 9   LEU A CD2 1 
ATOM   60   N  N   . PRO A 1 19  ? 3.855   0.721   -5.957  1.00 24.40 ? 10  PRO A N   1 
ATOM   61   C  CA  . PRO A 1 19  ? 3.671   -0.291  -7.031  1.00 25.43 ? 10  PRO A CA  1 
ATOM   62   C  C   . PRO A 1 19  ? 2.247   -0.825  -7.198  1.00 26.25 ? 10  PRO A C   1 
ATOM   63   O  O   . PRO A 1 19  ? 2.020   -1.668  -8.044  1.00 27.70 ? 10  PRO A O   1 
ATOM   64   C  CB  . PRO A 1 19  ? 4.618   -1.438  -6.620  1.00 27.64 ? 10  PRO A CB  1 
ATOM   65   C  CG  . PRO A 1 19  ? 5.367   -0.984  -5.437  1.00 26.54 ? 10  PRO A CG  1 
ATOM   66   C  CD  . PRO A 1 19  ? 4.630   0.172   -4.831  1.00 21.38 ? 10  PRO A CD  1 
ATOM   67   N  N   . TYR A 1 20  ? 1.286   -0.360  -6.414  1.00 23.27 ? 11  TYR A N   1 
ATOM   68   C  CA  . TYR A 1 20  ? -0.051  -0.954  -6.383  1.00 22.36 ? 11  TYR A CA  1 
ATOM   69   C  C   . TYR A 1 20  ? -0.960  0.180   -5.903  1.00 21.73 ? 11  TYR A C   1 
ATOM   70   O  O   . TYR A 1 20  ? -0.497  1.213   -5.415  1.00 21.46 ? 11  TYR A O   1 
ATOM   71   C  CB  . TYR A 1 20  ? -0.148  -2.187  -5.411  1.00 21.43 ? 11  TYR A CB  1 
ATOM   72   C  CG  . TYR A 1 20  ? 0.766   -1.999  -4.223  1.00 19.38 ? 11  TYR A CG  1 
ATOM   73   C  CD1 . TYR A 1 20  ? 0.452   -1.079  -3.228  1.00 19.39 ? 11  TYR A CD1 1 
ATOM   74   C  CD2 . TYR A 1 20  ? 1.997   -2.650  -4.150  1.00 20.65 ? 11  TYR A CD2 1 
ATOM   75   C  CE1 . TYR A 1 20  ? 1.333   -0.850  -2.197  1.00 21.39 ? 11  TYR A CE1 1 
ATOM   76   C  CE2 . TYR A 1 20  ? 2.849   -2.420  -3.109  1.00 22.16 ? 11  TYR A CE2 1 
ATOM   77   C  CZ  . TYR A 1 20  ? 2.539   -1.482  -2.184  1.00 18.86 ? 11  TYR A CZ  1 
ATOM   78   O  OH  . TYR A 1 20  ? 3.461   -1.262  -1.155  1.00 16.56 ? 11  TYR A OH  1 
ATOM   79   N  N   . ALA A 1 21  ? -2.261  -0.022  -6.038  1.00 19.40 ? 12  ALA A N   1 
ATOM   80   C  CA  . ALA A 1 21  ? -3.258  0.925   -5.568  1.00 19.44 ? 12  ALA A CA  1 
ATOM   81   C  C   . ALA A 1 21  ? -3.236  1.112   -4.055  1.00 18.11 ? 12  ALA A C   1 
ATOM   82   O  O   . ALA A 1 21  ? -2.769  0.229   -3.302  1.00 18.08 ? 12  ALA A O   1 
ATOM   83   C  CB  . ALA A 1 21  ? -4.640  0.459   -6.006  1.00 20.82 ? 12  ALA A CB  1 
ATOM   84   N  N   . TYR A 1 22  ? -3.772  2.243   -3.577  1.00 19.26 ? 13  TYR A N   1 
ATOM   85   C  CA  . TYR A 1 22  ? -3.755  2.521   -2.129  1.00 18.36 ? 13  TYR A CA  1 
ATOM   86   C  C   . TYR A 1 22  ? -4.562  1.546   -1.273  1.00 19.03 ? 13  TYR A C   1 
ATOM   87   O  O   . TYR A 1 22  ? -4.234  1.316   -0.045  1.00 18.90 ? 13  TYR A O   1 
ATOM   88   C  CB  . TYR A 1 22  ? -4.146  3.985   -1.816  1.00 18.23 ? 13  TYR A CB  1 
ATOM   89   C  CG  . TYR A 1 22  ? -3.050  4.982   -2.183  1.00 19.34 ? 13  TYR A CG  1 
ATOM   90   C  CD1 . TYR A 1 22  ? -2.995  5.569   -3.457  1.00 18.65 ? 13  TYR A CD1 1 
ATOM   91   C  CD2 . TYR A 1 22  ? -2.055  5.326   -1.262  1.00 19.58 ? 13  TYR A CD2 1 
ATOM   92   C  CE1 . TYR A 1 22  ? -1.975  6.479   -3.771  1.00 20.37 ? 13  TYR A CE1 1 
ATOM   93   C  CE2 . TYR A 1 22  ? -1.021  6.205   -1.584  1.00 17.39 ? 13  TYR A CE2 1 
ATOM   94   C  CZ  . TYR A 1 22  ? -0.996  6.780   -2.837  1.00 26.33 ? 13  TYR A CZ  1 
ATOM   95   O  OH  . TYR A 1 22  ? 0.030   7.663   -3.119  1.00 19.94 ? 13  TYR A OH  1 
ATOM   96   N  N   . ASP A 1 23  ? -5.597  0.967   -1.886  1.00 20.39 ? 14  ASP A N   1 
ATOM   97   C  CA  . ASP A 1 23  ? -6.397  -0.087  -1.219  1.00 20.27 ? 14  ASP A CA  1 
ATOM   98   C  C   . ASP A 1 23  ? -6.009  -1.548  -1.526  1.00 20.44 ? 14  ASP A C   1 
ATOM   99   O  O   . ASP A 1 23  ? -6.701  -2.511  -1.112  1.00 21.27 ? 14  ASP A O   1 
ATOM   100  C  CB  . ASP A 1 23  ? -7.893  0.169   -1.479  1.00 21.37 ? 14  ASP A CB  1 
ATOM   101  C  CG  . ASP A 1 23  ? -8.312  -0.049  -2.940  1.00 27.97 ? 14  ASP A CG  1 
ATOM   102  O  OD1 . ASP A 1 23  ? -7.459  -0.332  -3.768  1.00 27.89 ? 14  ASP A OD1 1 
ATOM   103  O  OD2 . ASP A 1 23  ? -9.539  0.060   -3.250  1.00 32.60 ? 14  ASP A OD2 1 
ATOM   104  N  N   . ALA A 1 24  ? -4.872  -1.740  -2.180  1.00 19.95 ? 15  ALA A N   1 
ATOM   105  C  CA  . ALA A 1 24  ? -4.476  -3.059  -2.661  1.00 20.28 ? 15  ALA A CA  1 
ATOM   106  C  C   . ALA A 1 24  ? -4.061  -4.009  -1.535  1.00 20.73 ? 15  ALA A C   1 
ATOM   107  O  O   . ALA A 1 24  ? -4.097  -5.220  -1.731  1.00 21.46 ? 15  ALA A O   1 
ATOM   108  C  CB  . ALA A 1 24  ? -3.406  -2.953  -3.641  1.00 20.51 ? 15  ALA A CB  1 
ATOM   109  N  N   . LEU A 1 25  ? -3.655  -3.482  -0.371  1.00 20.51 ? 16  LEU A N   1 
ATOM   110  C  CA  . LEU A 1 25  ? -3.305  -4.310  0.771   1.00 20.17 ? 16  LEU A CA  1 
ATOM   111  C  C   . LEU A 1 25  ? -4.403  -4.530  1.811   1.00 19.12 ? 16  LEU A C   1 
ATOM   112  O  O   . LEU A 1 25  ? -4.119  -5.006  2.903   1.00 20.31 ? 16  LEU A O   1 
ATOM   113  C  CB  . LEU A 1 25  ? -2.028  -3.765  1.434   1.00 19.02 ? 16  LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 25  ? -0.917  -3.399  0.393   1.00 18.20 ? 16  LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 25  ? 0.336   -2.918  1.149   1.00 17.12 ? 16  LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 25  ? -0.526  -4.542  -0.565  1.00 15.14 ? 16  LEU A CD2 1 
ATOM   117  N  N   . GLU A 1 26  ? -5.626  -4.150  1.508   1.00 21.17 ? 17  GLU A N   1 
ATOM   118  C  CA  . GLU A 1 26  ? -6.740  -4.387  2.413   1.00 21.03 ? 17  GLU A CA  1 
ATOM   119  C  C   . GLU A 1 26  ? -7.062  -5.909  2.470   1.00 21.75 ? 17  GLU A C   1 
ATOM   120  O  O   . GLU A 1 26  ? -6.914  -6.597  1.470   1.00 21.26 ? 17  GLU A O   1 
ATOM   121  C  CB  . GLU A 1 26  ? -7.977  -3.638  1.943   1.00 20.67 ? 17  GLU A CB  1 
ATOM   122  C  CG  . GLU A 1 26  ? -7.845  -2.113  2.037   1.00 21.75 ? 17  GLU A CG  1 
ATOM   123  C  CD  . GLU A 1 26  ? -8.371  -1.543  3.328   1.00 33.86 ? 17  GLU A CD  1 
ATOM   124  O  OE1 . GLU A 1 26  ? -8.612  -2.346  4.271   1.00 37.36 ? 17  GLU A OE1 1 
ATOM   125  O  OE2 . GLU A 1 26  ? -8.549  -0.293  3.423   1.00 28.82 ? 17  GLU A OE2 1 
ATOM   126  N  N   . PRO A 1 27  ? -7.548  -6.417  3.629   1.00 20.49 ? 18  PRO A N   1 
ATOM   127  C  CA  . PRO A 1 27  ? -7.834  -5.741  4.887   1.00 19.25 ? 18  PRO A CA  1 
ATOM   128  C  C   . PRO A 1 27  ? -6.609  -5.634  5.786   1.00 18.18 ? 18  PRO A C   1 
ATOM   129  O  O   . PRO A 1 27  ? -6.703  -5.178  6.909   1.00 23.87 ? 18  PRO A O   1 
ATOM   130  C  CB  . PRO A 1 27  ? -8.917  -6.643  5.516   1.00 21.00 ? 18  PRO A CB  1 
ATOM   131  C  CG  . PRO A 1 27  ? -8.535  -8.022  5.043   1.00 21.67 ? 18  PRO A CG  1 
ATOM   132  C  CD  . PRO A 1 27  ? -7.943  -7.832  3.669   1.00 21.93 ? 18  PRO A CD  1 
ATOM   133  N  N   . HIS A 1 28  ? -5.445  -6.021  5.299   1.00 17.83 ? 19  HIS A N   1 
ATOM   134  C  CA  . HIS A 1 28  ? -4.279  -6.144  6.215   1.00 18.16 ? 19  HIS A CA  1 
ATOM   135  C  C   . HIS A 1 28  ? -3.695  -4.792  6.619   1.00 19.87 ? 19  HIS A C   1 
ATOM   136  O  O   . HIS A 1 28  ? -3.470  -4.533  7.837   1.00 18.57 ? 19  HIS A O   1 
ATOM   137  C  CB  . HIS A 1 28  ? -3.232  -7.039  5.558   1.00 17.82 ? 19  HIS A CB  1 
ATOM   138  C  CG  . HIS A 1 28  ? -3.829  -8.264  4.933   1.00 22.89 ? 19  HIS A CG  1 
ATOM   139  N  ND1 . HIS A 1 28  ? -4.414  -9.267  5.689   1.00 19.11 ? 19  HIS A ND1 1 
ATOM   140  C  CD2 . HIS A 1 28  ? -4.027  -8.596  3.637   1.00 19.75 ? 19  HIS A CD2 1 
ATOM   141  C  CE1 . HIS A 1 28  ? -4.906  -10.186 4.873   1.00 27.71 ? 19  HIS A CE1 1 
ATOM   142  N  NE2 . HIS A 1 28  ? -4.693  -9.797  3.624   1.00 26.92 ? 19  HIS A NE2 1 
ATOM   143  N  N   . PHE A 1 29  ? -3.386  -3.961  5.606   1.00 19.96 ? 20  PHE A N   1 
ATOM   144  C  CA  . PHE A 1 29  ? -2.999  -2.566  5.774   1.00 18.44 ? 20  PHE A CA  1 
ATOM   145  C  C   . PHE A 1 29  ? -4.112  -1.698  5.146   1.00 16.72 ? 20  PHE A C   1 
ATOM   146  O  O   . PHE A 1 29  ? -4.398  -1.852  3.949   1.00 17.79 ? 20  PHE A O   1 
ATOM   147  C  CB  . PHE A 1 29  ? -1.659  -2.244  5.076   1.00 19.40 ? 20  PHE A CB  1 
ATOM   148  C  CG  . PHE A 1 29  ? -0.426  -2.947  5.666   1.00 15.91 ? 20  PHE A CG  1 
ATOM   149  C  CD1 . PHE A 1 29  ? -0.483  -3.802  6.787   1.00 16.59 ? 20  PHE A CD1 1 
ATOM   150  C  CD2 . PHE A 1 29  ? 0.818   -2.775  5.048   1.00 20.43 ? 20  PHE A CD2 1 
ATOM   151  C  CE1 . PHE A 1 29  ? 0.645   -4.416  7.278   1.00 20.25 ? 20  PHE A CE1 1 
ATOM   152  C  CE2 . PHE A 1 29  ? 1.969   -3.416  5.545   1.00 15.13 ? 20  PHE A CE2 1 
ATOM   153  C  CZ  . PHE A 1 29  ? 1.874   -4.233  6.668   1.00 17.77 ? 20  PHE A CZ  1 
ATOM   154  N  N   . ASP A 1 30  ? -4.725  -0.823  5.951   1.00 18.16 ? 21  ASP A N   1 
ATOM   155  C  CA  . ASP A 1 30  ? -5.900  -0.007  5.533   1.00 17.82 ? 21  ASP A CA  1 
ATOM   156  C  C   . ASP A 1 30  ? -5.440  1.066   4.523   1.00 18.22 ? 21  ASP A C   1 
ATOM   157  O  O   . ASP A 1 30  ? -4.314  1.625   4.608   1.00 14.93 ? 21  ASP A O   1 
ATOM   158  C  CB  . ASP A 1 30  ? -6.593  0.640   6.773   1.00 17.24 ? 21  ASP A CB  1 
ATOM   159  C  CG  . ASP A 1 30  ? -5.613  1.419   7.662   1.00 16.04 ? 21  ASP A CG  1 
ATOM   160  O  OD1 . ASP A 1 30  ? -4.689  0.758   8.224   1.00 18.38 ? 21  ASP A OD1 1 
ATOM   161  O  OD2 . ASP A 1 30  ? -5.722  2.687   7.770   1.00 19.15 ? 21  ASP A OD2 1 
ATOM   162  N  N   . LYS A 1 31  ? -6.342  1.446   3.639   1.00 18.09 ? 22  LYS A N   1 
ATOM   163  C  CA  . LYS A 1 31  ? -6.056  2.438   2.589   1.00 18.73 ? 22  LYS A CA  1 
ATOM   164  C  C   . LYS A 1 31  ? -5.857  3.837   3.156   1.00 20.53 ? 22  LYS A C   1 
ATOM   165  O  O   . LYS A 1 31  ? -5.141  4.640   2.581   1.00 18.63 ? 22  LYS A O   1 
ATOM   166  C  CB  . LYS A 1 31  ? -7.195  2.446   1.526   1.00 17.98 ? 22  LYS A CB  1 
ATOM   167  C  CG  . LYS A 1 31  ? -8.491  2.984   1.997   1.00 23.21 ? 22  LYS A CG  1 
ATOM   168  C  CD  . LYS A 1 31  ? -9.557  2.679   0.924   1.00 21.71 ? 22  LYS A CD  1 
ATOM   169  C  CE  . LYS A 1 31  ? -10.946 3.333   1.183   1.00 29.40 ? 22  LYS A CE  1 
ATOM   170  N  NZ  . LYS A 1 31  ? -11.548 2.980   2.534   1.00 28.58 ? 22  LYS A NZ  1 
ATOM   171  N  N   . GLU A 1 32  ? -6.454  4.146   4.291   1.00 19.34 ? 23  GLU A N   1 
ATOM   172  C  CA  . GLU A 1 32  ? -6.285  5.479   4.878   1.00 19.72 ? 23  GLU A CA  1 
ATOM   173  C  C   . GLU A 1 32  ? -4.823  5.653   5.352   1.00 18.88 ? 23  GLU A C   1 
ATOM   174  O  O   . GLU A 1 32  ? -4.189  6.671   5.095   1.00 17.60 ? 23  GLU A O   1 
ATOM   175  C  CB  . GLU A 1 32  ? -7.249  5.676   6.060   1.00 22.67 ? 23  GLU A CB  1 
ATOM   176  C  CG  . GLU A 1 32  ? -8.734  5.800   5.707   1.00 26.22 ? 23  GLU A CG  1 
ATOM   177  C  CD  . GLU A 1 32  ? -9.405  4.482   5.348   1.00 27.57 ? 23  GLU A CD  1 
ATOM   178  O  OE1 . GLU A 1 32  ? -8.915  3.369   5.745   1.00 24.81 ? 23  GLU A OE1 1 
ATOM   179  O  OE2 . GLU A 1 32  ? -10.428 4.560   4.608   1.00 34.15 ? 23  GLU A OE2 1 
ATOM   180  N  N   . THR A 1 33  ? -4.299  4.619   5.981   1.00 17.10 ? 24  THR A N   1 
ATOM   181  C  CA  . THR A 1 33  ? -2.901  4.574   6.438   1.00 18.43 ? 24  THR A CA  1 
ATOM   182  C  C   . THR A 1 33  ? -1.968  4.603   5.208   1.00 18.85 ? 24  THR A C   1 
ATOM   183  O  O   . THR A 1 33  ? -0.997  5.359   5.177   1.00 18.39 ? 24  THR A O   1 
ATOM   184  C  CB  . THR A 1 33  ? -2.669  3.372   7.382   1.00 20.57 ? 24  THR A CB  1 
ATOM   185  O  OG1 . THR A 1 33  ? -3.328  3.629   8.632   1.00 19.42 ? 24  THR A OG1 1 
ATOM   186  C  CG2 . THR A 1 33  ? -1.188  3.131   7.664   1.00 19.44 ? 24  THR A CG2 1 
ATOM   187  N  N   . MET A 1 34  ? -2.233  3.772   4.213   1.00 16.80 ? 25  MET A N   1 
ATOM   188  C  CA  . MET A 1 34  ? -1.359  3.795   3.006   1.00 16.62 ? 25  MET A CA  1 
ATOM   189  C  C   . MET A 1 34  ? -1.246  5.204   2.439   1.00 16.92 ? 25  MET A C   1 
ATOM   190  O  O   . MET A 1 34  ? -0.135  5.625   2.110   1.00 17.24 ? 25  MET A O   1 
ATOM   191  C  CB  . MET A 1 34  ? -1.779  2.798   1.926   1.00 16.38 ? 25  MET A CB  1 
ATOM   192  C  CG  . MET A 1 34  ? -1.767  1.346   2.358   1.00 13.27 ? 25  MET A CG  1 
ATOM   193  S  SD  . MET A 1 34  ? -0.187  0.730   2.837   1.00 17.12 ? 25  MET A SD  1 
ATOM   194  C  CE  . MET A 1 34  ? 0.772   0.877   1.359   1.00 19.13 ? 25  MET A CE  1 
ATOM   195  N  N   . ASN A 1 35  ? -2.364  5.913   2.323   1.00 15.11 ? 26  ASN A N   1 
ATOM   196  C  CA  . ASN A 1 35  ? -2.397  7.350   1.920   1.00 15.96 ? 26  ASN A CA  1 
ATOM   197  C  C   . ASN A 1 35  ? -1.531  8.256   2.786   1.00 15.89 ? 26  ASN A C   1 
ATOM   198  O  O   . ASN A 1 35  ? -0.609  8.959   2.277   1.00 16.13 ? 26  ASN A O   1 
ATOM   199  C  CB  . ASN A 1 35  ? -3.839  7.884   1.823   1.00 14.85 ? 26  ASN A CB  1 
ATOM   200  C  CG  . ASN A 1 35  ? -3.905  9.338   1.407   1.00 16.08 ? 26  ASN A CG  1 
ATOM   201  O  OD1 . ASN A 1 35  ? -4.555  10.162  2.089   1.00 21.11 ? 26  ASN A OD1 1 
ATOM   202  N  ND2 . ASN A 1 35  ? -3.167  9.687   0.355   1.00 14.44 ? 26  ASN A ND2 1 
ATOM   203  N  N   . ILE A 1 36  ? -1.881  8.333   4.066   1.00 17.74 ? 27  ILE A N   1 
ATOM   204  C  CA  . ILE A 1 36  ? -1.177  9.244   4.953   1.00 17.27 ? 27  ILE A CA  1 
ATOM   205  C  C   . ILE A 1 36  ? 0.349   8.851   5.119   1.00 15.91 ? 27  ILE A C   1 
ATOM   206  O  O   . ILE A 1 36  ? 1.224   9.726   5.098   1.00 16.15 ? 27  ILE A O   1 
ATOM   207  C  CB  . ILE A 1 36  ? -1.847  9.319   6.306   1.00 15.27 ? 27  ILE A CB  1 
ATOM   208  C  CG1 . ILE A 1 36  ? -3.276  9.878   6.199   1.00 18.11 ? 27  ILE A CG1 1 
ATOM   209  C  CG2 . ILE A 1 36  ? -1.016  10.224  7.295   1.00 15.52 ? 27  ILE A CG2 1 
ATOM   210  C  CD1 . ILE A 1 36  ? -4.072  9.526   7.401   1.00 22.58 ? 27  ILE A CD1 1 
ATOM   211  N  N   . HIS A 1 37  ? 0.622   7.547   5.245   1.00 18.23 ? 28  HIS A N   1 
ATOM   212  C  CA  . HIS A 1 37  ? 1.988   7.060   5.418   1.00 16.74 ? 28  HIS A CA  1 
ATOM   213  C  C   . HIS A 1 37  ? 2.892   7.441   4.191   1.00 17.83 ? 28  HIS A C   1 
ATOM   214  O  O   . HIS A 1 37  ? 4.039   7.840   4.333   1.00 18.12 ? 28  HIS A O   1 
ATOM   215  C  CB  . HIS A 1 37  ? 1.949   5.561   5.719   1.00 15.81 ? 28  HIS A CB  1 
ATOM   216  C  CG  . HIS A 1 37  ? 3.202   5.024   6.338   1.00 13.76 ? 28  HIS A CG  1 
ATOM   217  N  ND1 . HIS A 1 37  ? 3.373   3.680   6.564   1.00 16.94 ? 28  HIS A ND1 1 
ATOM   218  C  CD2 . HIS A 1 37  ? 4.306   5.635   6.829   1.00 17.56 ? 28  HIS A CD2 1 
ATOM   219  C  CE1 . HIS A 1 37  ? 4.554   3.478   7.132   1.00 16.92 ? 28  HIS A CE1 1 
ATOM   220  N  NE2 . HIS A 1 37  ? 5.133   4.658   7.335   1.00 10.88 ? 28  HIS A NE2 1 
ATOM   221  N  N   . HIS A 1 38  ? 2.338   7.274   3.015   1.00 18.67 ? 29  HIS A N   1 
ATOM   222  C  CA  . HIS A 1 38  ? 3.095   7.521   1.732   1.00 17.42 ? 29  HIS A CA  1 
ATOM   223  C  C   . HIS A 1 38  ? 3.113   9.025   1.457   1.00 18.17 ? 29  HIS A C   1 
ATOM   224  O  O   . HIS A 1 38  ? 4.171   9.625   1.288   1.00 17.42 ? 29  HIS A O   1 
ATOM   225  C  CB  . HIS A 1 38  ? 2.424   6.750   0.596   1.00 16.02 ? 29  HIS A CB  1 
ATOM   226  C  CG  . HIS A 1 38  ? 3.062   6.952   -0.755  1.00 20.35 ? 29  HIS A CG  1 
ATOM   227  N  ND1 . HIS A 1 38  ? 2.362   7.405   -1.849  1.00 19.08 ? 29  HIS A ND1 1 
ATOM   228  C  CD2 . HIS A 1 38  ? 4.321   6.689   -1.192  1.00 23.58 ? 29  HIS A CD2 1 
ATOM   229  C  CE1 . HIS A 1 38  ? 3.171   7.444   -2.894  1.00 22.66 ? 29  HIS A CE1 1 
ATOM   230  N  NE2 . HIS A 1 38  ? 4.364   7.017   -2.523  1.00 20.80 ? 29  HIS A NE2 1 
ATOM   231  N  N   . THR A 1 39  ? 1.940   9.647   1.424   1.00 17.60 ? 30  THR A N   1 
ATOM   232  C  CA  . THR A 1 39  ? 1.876   11.039  0.882   1.00 17.02 ? 30  THR A CA  1 
ATOM   233  C  C   . THR A 1 39  ? 2.136   12.129  1.902   1.00 17.93 ? 30  THR A C   1 
ATOM   234  O  O   . THR A 1 39  ? 2.312   13.309  1.490   1.00 18.25 ? 30  THR A O   1 
ATOM   235  C  CB  . THR A 1 39  ? 0.551   11.324  0.132   1.00 17.44 ? 30  THR A CB  1 
ATOM   236  O  OG1 . THR A 1 39  ? -0.509  11.581  1.059   1.00 16.79 ? 30  THR A OG1 1 
ATOM   237  C  CG2 . THR A 1 39  ? 0.231   10.215  -0.855  1.00 18.72 ? 30  THR A CG2 1 
ATOM   238  N  N   . LYS A 1 40  ? 2.149   11.789  3.204   1.00 18.79 ? 31  LYS A N   1 
ATOM   239  C  CA  A LYS A 1 40  ? 2.464   12.752  4.239   0.50 18.30 ? 31  LYS A CA  1 
ATOM   240  C  CA  B LYS A 1 40  ? 2.468   12.750  4.239   0.50 18.35 ? 31  LYS A CA  1 
ATOM   241  C  C   . LYS A 1 40  ? 3.787   12.394  4.903   1.00 19.79 ? 31  LYS A C   1 
ATOM   242  O  O   . LYS A 1 40  ? 4.738   13.175  4.828   1.00 21.01 ? 31  LYS A O   1 
ATOM   243  C  CB  A LYS A 1 40  ? 1.349   12.894  5.261   0.50 19.13 ? 31  LYS A CB  1 
ATOM   244  C  CB  B LYS A 1 40  ? 1.356   12.894  5.264   0.50 18.86 ? 31  LYS A CB  1 
ATOM   245  C  CG  A LYS A 1 40  ? -0.043  13.159  4.666   0.50 16.46 ? 31  LYS A CG  1 
ATOM   246  C  CG  B LYS A 1 40  ? -0.051  13.055  4.677   0.50 18.45 ? 31  LYS A CG  1 
ATOM   247  C  CD  A LYS A 1 40  ? -0.280  14.593  4.320   0.50 18.54 ? 31  LYS A CD  1 
ATOM   248  C  CD  B LYS A 1 40  ? -0.130  14.117  3.632   0.50 12.05 ? 31  LYS A CD  1 
ATOM   249  C  CE  A LYS A 1 40  ? -1.661  14.780  3.644   0.50 22.81 ? 31  LYS A CE  1 
ATOM   250  C  CE  B LYS A 1 40  ? -1.568  14.371  3.180   0.50 21.30 ? 31  LYS A CE  1 
ATOM   251  N  NZ  A LYS A 1 40  ? -2.753  15.202  4.549   0.50 12.28 ? 31  LYS A NZ  1 
ATOM   252  N  NZ  B LYS A 1 40  ? -1.865  13.879  1.810   0.50 23.37 ? 31  LYS A NZ  1 
ATOM   253  N  N   . HIS A 1 41  ? 3.864   11.214  5.524   1.00 18.15 ? 32  HIS A N   1 
ATOM   254  C  CA  . HIS A 1 41  ? 5.066   10.850  6.241   1.00 18.51 ? 32  HIS A CA  1 
ATOM   255  C  C   . HIS A 1 41  ? 6.291   10.743  5.320   1.00 16.62 ? 32  HIS A C   1 
ATOM   256  O  O   . HIS A 1 41  ? 7.293   11.412  5.559   1.00 16.42 ? 32  HIS A O   1 
ATOM   257  C  CB  . HIS A 1 41  ? 4.888   9.553   7.074   1.00 18.40 ? 32  HIS A CB  1 
ATOM   258  C  CG  . HIS A 1 41  ? 3.999   9.708   8.278   1.00 16.29 ? 32  HIS A CG  1 
ATOM   259  N  ND1 . HIS A 1 41  ? 4.462   10.169  9.498   1.00 20.99 ? 32  HIS A ND1 1 
ATOM   260  C  CD2 . HIS A 1 41  ? 2.674   9.460   8.448   1.00 21.66 ? 32  HIS A CD2 1 
ATOM   261  C  CE1 . HIS A 1 41  ? 3.447   10.229  10.351  1.00 18.47 ? 32  HIS A CE1 1 
ATOM   262  N  NE2 . HIS A 1 41  ? 2.354   9.784   9.753   1.00 16.54 ? 32  HIS A NE2 1 
ATOM   263  N  N   . HIS A 1 42  ? 6.239   9.887   4.318   1.00 17.50 ? 33  HIS A N   1 
ATOM   264  C  CA  . HIS A 1 42  ? 7.377   9.639   3.434   1.00 17.74 ? 33  HIS A CA  1 
ATOM   265  C  C   . HIS A 1 42  ? 7.770   10.941  2.674   1.00 19.88 ? 33  HIS A C   1 
ATOM   266  O  O   . HIS A 1 42  ? 8.965   11.314  2.650   1.00 19.65 ? 33  HIS A O   1 
ATOM   267  C  CB  . HIS A 1 42  ? 7.087   8.458   2.500   1.00 16.95 ? 33  HIS A CB  1 
ATOM   268  C  CG  . HIS A 1 42  ? 8.273   8.014   1.675   1.00 16.94 ? 33  HIS A CG  1 
ATOM   269  N  ND1 . HIS A 1 42  ? 8.233   6.911   0.848   1.00 18.44 ? 33  HIS A ND1 1 
ATOM   270  C  CD2 . HIS A 1 42  ? 9.534   8.492   1.597   1.00 18.52 ? 33  HIS A CD2 1 
ATOM   271  C  CE1 . HIS A 1 42  ? 9.403   6.772   0.240   1.00 16.74 ? 33  HIS A CE1 1 
ATOM   272  N  NE2 . HIS A 1 42  ? 10.207  7.720   0.672   1.00 18.99 ? 33  HIS A NE2 1 
ATOM   273  N  N   . ASN A 1 43  ? 6.786   11.591  2.064   1.00 19.54 ? 34  ASN A N   1 
ATOM   274  C  CA  . ASN A 1 43  ? 6.978   12.923  1.460   1.00 19.31 ? 34  ASN A CA  1 
ATOM   275  C  C   . ASN A 1 43  ? 7.680   13.928  2.356   1.00 19.65 ? 34  ASN A C   1 
ATOM   276  O  O   . ASN A 1 43  ? 8.497   14.692  1.887   1.00 21.14 ? 34  ASN A O   1 
ATOM   277  C  CB  . ASN A 1 43  ? 5.668   13.539  1.092   1.00 19.70 ? 34  ASN A CB  1 
ATOM   278  C  CG  . ASN A 1 43  ? 5.822   14.625  0.073   1.00 27.89 ? 34  ASN A CG  1 
ATOM   279  O  OD1 . ASN A 1 43  ? 5.350   15.758  0.252   1.00 31.37 ? 34  ASN A OD1 1 
ATOM   280  N  ND2 . ASN A 1 43  ? 6.521   14.300  -1.002  1.00 21.92 ? 34  ASN A ND2 1 
ATOM   281  N  N   . THR A 1 44  ? 7.338   13.954  3.640   1.00 16.88 ? 35  THR A N   1 
ATOM   282  C  CA  . THR A 1 44  ? 7.957   14.888  4.551   1.00 19.78 ? 35  THR A CA  1 
ATOM   283  C  C   . THR A 1 44  ? 9.434   14.577  4.817   1.00 21.15 ? 35  THR A C   1 
ATOM   284  O  O   . THR A 1 44  ? 10.256  15.508  4.927   1.00 18.40 ? 35  THR A O   1 
ATOM   285  C  CB  . THR A 1 44  ? 7.195   14.974  5.885   1.00 21.17 ? 35  THR A CB  1 
ATOM   286  O  OG1 . THR A 1 44  ? 5.949   15.615  5.661   1.00 19.27 ? 35  THR A OG1 1 
ATOM   287  C  CG2 . THR A 1 44  ? 7.929   15.814  6.875   1.00 19.54 ? 35  THR A CG2 1 
ATOM   288  N  N   . TYR A 1 45  ? 9.786   13.293  4.926   1.00 20.90 ? 36  TYR A N   1 
ATOM   289  C  CA  . TYR A 1 45  ? 11.223  12.901  5.005   1.00 20.38 ? 36  TYR A CA  1 
ATOM   290  C  C   . TYR A 1 45  ? 12.006  13.422  3.762   1.00 21.00 ? 36  TYR A C   1 
ATOM   291  O  O   . TYR A 1 45  ? 13.135  13.931  3.894   1.00 19.64 ? 36  TYR A O   1 
ATOM   292  C  CB  . TYR A 1 45  ? 11.407  11.378  5.125   1.00 20.02 ? 36  TYR A CB  1 
ATOM   293  C  CG  . TYR A 1 45  ? 10.859  10.765  6.400   1.00 16.53 ? 36  TYR A CG  1 
ATOM   294  C  CD1 . TYR A 1 45  ? 11.241  11.240  7.651   1.00 20.56 ? 36  TYR A CD1 1 
ATOM   295  C  CD2 . TYR A 1 45  ? 9.955   9.683   6.358   1.00 27.70 ? 36  TYR A CD2 1 
ATOM   296  C  CE1 . TYR A 1 45  ? 10.723  10.690  8.823   1.00 23.24 ? 36  TYR A CE1 1 
ATOM   297  C  CE2 . TYR A 1 45  ? 9.426   9.122   7.548   1.00 20.33 ? 36  TYR A CE2 1 
ATOM   298  C  CZ  . TYR A 1 45  ? 9.797   9.645   8.760   1.00 22.19 ? 36  TYR A CZ  1 
ATOM   299  O  OH  . TYR A 1 45  ? 9.341   9.121   9.950   1.00 29.12 ? 36  TYR A OH  1 
ATOM   300  N  N   . ILE A 1 46  ? 11.386  13.320  2.598   1.00 19.66 ? 37  ILE A N   1 
ATOM   301  C  CA  . ILE A 1 46  ? 12.005  13.766  1.347   1.00 21.61 ? 37  ILE A CA  1 
ATOM   302  C  C   . ILE A 1 46  ? 12.191  15.294  1.323   1.00 23.33 ? 37  ILE A C   1 
ATOM   303  O  O   . ILE A 1 46  ? 13.248  15.792  0.885   1.00 23.73 ? 37  ILE A O   1 
ATOM   304  C  CB  . ILE A 1 46  ? 11.194  13.284  0.134   1.00 19.82 ? 37  ILE A CB  1 
ATOM   305  C  CG1 . ILE A 1 46  ? 11.285  11.768  0.031   1.00 24.01 ? 37  ILE A CG1 1 
ATOM   306  C  CG2 . ILE A 1 46  ? 11.724  13.902  -1.159  1.00 22.20 ? 37  ILE A CG2 1 
ATOM   307  C  CD1 . ILE A 1 46  ? 10.314  11.166  -0.990  1.00 20.64 ? 37  ILE A CD1 1 
ATOM   308  N  N   . THR A 1 47  ? 11.162  16.050  1.747   1.00 23.05 ? 38  THR A N   1 
ATOM   309  C  CA  . THR A 1 47  ? 11.258  17.515  1.853   1.00 22.11 ? 38  THR A CA  1 
ATOM   310  C  C   . THR A 1 47  ? 12.408  17.910  2.777   1.00 24.01 ? 38  THR A C   1 
ATOM   311  O  O   . THR A 1 47  ? 13.298  18.664  2.412   1.00 22.44 ? 38  THR A O   1 
ATOM   312  C  CB  . THR A 1 47  ? 9.912   18.085  2.356   1.00 24.41 ? 38  THR A CB  1 
ATOM   313  O  OG1 . THR A 1 47  ? 8.931   17.791  1.363   1.00 21.45 ? 38  THR A OG1 1 
ATOM   314  C  CG2 . THR A 1 47  ? 9.980   19.605  2.535   1.00 26.99 ? 38  THR A CG2 1 
ATOM   315  N  N   . ASN A 1 48  ? 12.425  17.312  3.944   1.00 19.95 ? 39  ASN A N   1 
ATOM   316  C  CA  . ASN A 1 48  ? 13.433  17.605  4.912   1.00 21.38 ? 39  ASN A CA  1 
ATOM   317  C  C   . ASN A 1 48  ? 14.842  17.224  4.466   1.00 23.44 ? 39  ASN A C   1 
ATOM   318  O  O   . ASN A 1 48  ? 15.797  17.931  4.789   1.00 26.87 ? 39  ASN A O   1 
ATOM   319  C  CB  . ASN A 1 48  ? 13.028  17.000  6.252   1.00 22.09 ? 39  ASN A CB  1 
ATOM   320  C  CG  . ASN A 1 48  ? 11.825  17.697  6.851   1.00 22.95 ? 39  ASN A CG  1 
ATOM   321  O  OD1 . ASN A 1 48  ? 11.478  18.776  6.441   1.00 27.82 ? 39  ASN A OD1 1 
ATOM   322  N  ND2 . ASN A 1 48  ? 11.209  17.092  7.835   1.00 23.75 ? 39  ASN A ND2 1 
ATOM   323  N  N   . LEU A 1 49  ? 14.967  16.114  3.736   1.00 23.33 ? 40  LEU A N   1 
ATOM   324  C  CA  . LEU A 1 49  ? 16.237  15.662  3.164   1.00 23.96 ? 40  LEU A CA  1 
ATOM   325  C  C   . LEU A 1 49  ? 16.750  16.654  2.117   1.00 25.22 ? 40  LEU A C   1 
ATOM   326  O  O   . LEU A 1 49  ? 17.922  17.068  2.158   1.00 29.60 ? 40  LEU A O   1 
ATOM   327  C  CB  . LEU A 1 49  ? 16.087  14.284  2.534   1.00 24.38 ? 40  LEU A CB  1 
ATOM   328  C  CG  . LEU A 1 49  ? 17.388  13.707  1.949   1.00 23.24 ? 40  LEU A CG  1 
ATOM   329  C  CD1 . LEU A 1 49  ? 18.380  13.479  3.070   1.00 24.51 ? 40  LEU A CD1 1 
ATOM   330  C  CD2 . LEU A 1 49  ? 17.135  12.469  1.146   1.00 24.98 ? 40  LEU A CD2 1 
ATOM   331  N  N   . ASN A 1 50  ? 15.893  17.023  1.179   1.00 26.18 ? 41  ASN A N   1 
ATOM   332  C  CA  . ASN A 1 50  ? 16.251  18.005  0.175   1.00 26.57 ? 41  ASN A CA  1 
ATOM   333  C  C   . ASN A 1 50  ? 16.671  19.361  0.808   1.00 27.56 ? 41  ASN A C   1 
ATOM   334  O  O   . ASN A 1 50  ? 17.696  19.936  0.414   1.00 28.82 ? 41  ASN A O   1 
ATOM   335  C  CB  . ASN A 1 50  ? 15.170  18.142  -0.878  1.00 25.12 ? 41  ASN A CB  1 
ATOM   336  C  CG  . ASN A 1 50  ? 15.052  16.909  -1.815  1.00 23.31 ? 41  ASN A CG  1 
ATOM   337  O  OD1 . ASN A 1 50  ? 16.027  16.226  -2.146  1.00 28.66 ? 41  ASN A OD1 1 
ATOM   338  N  ND2 . ASN A 1 50  ? 13.840  16.669  -2.286  1.00 23.28 ? 41  ASN A ND2 1 
ATOM   339  N  N   . ALA A 1 51  ? 15.942  19.842  1.810   1.00 27.40 ? 42  ALA A N   1 
ATOM   340  C  CA  . ALA A 1 51  ? 16.316  21.073  2.504   1.00 29.64 ? 42  ALA A CA  1 
ATOM   341  C  C   . ALA A 1 51  ? 17.729  20.961  3.082   1.00 33.27 ? 42  ALA A C   1 
ATOM   342  O  O   . ALA A 1 51  ? 18.555  21.889  2.935   1.00 34.19 ? 42  ALA A O   1 
ATOM   343  C  CB  . ALA A 1 51  ? 15.298  21.412  3.600   1.00 29.80 ? 42  ALA A CB  1 
ATOM   344  N  N   . ALA A 1 52  ? 18.022  19.816  3.705   1.00 33.93 ? 43  ALA A N   1 
ATOM   345  C  CA  . ALA A 1 52  ? 19.313  19.572  4.353   1.00 33.82 ? 43  ALA A CA  1 
ATOM   346  C  C   . ALA A 1 52  ? 20.484  19.534  3.351   1.00 35.25 ? 43  ALA A C   1 
ATOM   347  O  O   . ALA A 1 52  ? 21.609  19.944  3.686   1.00 35.76 ? 43  ALA A O   1 
ATOM   348  C  CB  . ALA A 1 52  ? 19.261  18.273  5.149   1.00 33.98 ? 43  ALA A CB  1 
ATOM   349  N  N   . LEU A 1 53  ? 20.231  19.052  2.140   1.00 34.49 ? 44  LEU A N   1 
ATOM   350  C  CA  . LEU A 1 53  ? 21.304  18.889  1.152   1.00 36.49 ? 44  LEU A CA  1 
ATOM   351  C  C   . LEU A 1 53  ? 21.522  20.140  0.303   1.00 37.95 ? 44  LEU A C   1 
ATOM   352  O  O   . LEU A 1 53  ? 22.390  20.128  -0.561  1.00 38.91 ? 44  LEU A O   1 
ATOM   353  C  CB  . LEU A 1 53  ? 21.023  17.709  0.237   1.00 36.78 ? 44  LEU A CB  1 
ATOM   354  C  CG  . LEU A 1 53  ? 20.934  16.344  0.927   1.00 31.17 ? 44  LEU A CG  1 
ATOM   355  C  CD1 . LEU A 1 53  ? 20.501  15.282  -0.055  1.00 32.40 ? 44  LEU A CD1 1 
ATOM   356  C  CD2 . LEU A 1 53  ? 22.274  15.994  1.562   1.00 39.99 ? 44  LEU A CD2 1 
ATOM   357  N  N   . GLU A 1 54  ? 20.702  21.172  0.509   1.00 38.23 ? 45  GLU A N   1 
ATOM   358  C  CA  . GLU A 1 54  ? 20.933  22.484  -0.130  1.00 42.46 ? 45  GLU A CA  1 
ATOM   359  C  C   . GLU A 1 54  ? 22.316  22.942  0.255   1.00 41.81 ? 45  GLU A C   1 
ATOM   360  O  O   . GLU A 1 54  ? 22.606  23.088  1.427   1.00 40.42 ? 45  GLU A O   1 
ATOM   361  C  CB  . GLU A 1 54  ? 19.928  23.548  0.327   1.00 40.85 ? 45  GLU A CB  1 
ATOM   362  C  CG  . GLU A 1 54  ? 18.554  23.420  -0.303  1.00 45.98 ? 45  GLU A CG  1 
ATOM   363  C  CD  . GLU A 1 54  ? 17.528  24.336  0.340   1.00 45.81 ? 45  GLU A CD  1 
ATOM   364  O  OE1 . GLU A 1 54  ? 17.926  25.325  0.998   1.00 56.00 ? 45  GLU A OE1 1 
ATOM   365  O  OE2 . GLU A 1 54  ? 16.317  24.073  0.183   1.00 59.17 ? 45  GLU A OE2 1 
ATOM   366  N  N   . GLY A 1 55  ? 23.165  23.115  -0.740  1.00 45.59 ? 46  GLY A N   1 
ATOM   367  C  CA  . GLY A 1 55  ? 24.520  23.595  -0.506  1.00 47.74 ? 46  GLY A CA  1 
ATOM   368  C  C   . GLY A 1 55  ? 25.568  22.500  -0.463  1.00 49.91 ? 46  GLY A C   1 
ATOM   369  O  O   . GLY A 1 55  ? 26.729  22.791  -0.179  1.00 51.66 ? 46  GLY A O   1 
ATOM   370  N  N   . HIS A 1 56  ? 25.173  21.256  -0.758  1.00 50.31 ? 47  HIS A N   1 
ATOM   371  C  CA  . HIS A 1 56  ? 26.097  20.107  -0.782  1.00 51.24 ? 47  HIS A CA  1 
ATOM   372  C  C   . HIS A 1 56  ? 25.945  19.286  -2.069  1.00 52.37 ? 47  HIS A C   1 
ATOM   373  O  O   . HIS A 1 56  ? 25.239  18.281  -2.099  1.00 52.46 ? 47  HIS A O   1 
ATOM   374  C  CB  . HIS A 1 56  ? 25.864  19.214  0.440   1.00 49.91 ? 47  HIS A CB  1 
ATOM   375  C  CG  . HIS A 1 56  ? 25.903  19.947  1.740   1.00 49.68 ? 47  HIS A CG  1 
ATOM   376  N  ND1 . HIS A 1 56  ? 26.926  19.791  2.651   1.00 51.85 ? 47  HIS A ND1 1 
ATOM   377  C  CD2 . HIS A 1 56  ? 25.043  20.837  2.290   1.00 51.01 ? 47  HIS A CD2 1 
ATOM   378  C  CE1 . HIS A 1 56  ? 26.696  20.555  3.705   1.00 51.69 ? 47  HIS A CE1 1 
ATOM   379  N  NE2 . HIS A 1 56  ? 25.556  21.196  3.514   1.00 52.90 ? 47  HIS A NE2 1 
ATOM   380  N  N   . ALA A 1 57  ? 26.620  19.722  -3.131  1.00 54.56 ? 48  ALA A N   1 
ATOM   381  C  CA  . ALA A 1 57  ? 26.527  19.066  -4.454  1.00 55.81 ? 48  ALA A CA  1 
ATOM   382  C  C   . ALA A 1 57  ? 27.056  17.614  -4.441  1.00 57.74 ? 48  ALA A C   1 
ATOM   383  O  O   . ALA A 1 57  ? 26.408  16.682  -4.949  1.00 58.69 ? 48  ALA A O   1 
ATOM   384  C  CB  . ALA A 1 57  ? 27.263  19.896  -5.496  1.00 54.87 ? 48  ALA A CB  1 
ATOM   385  N  N   . GLU A 1 58  ? 28.252  17.449  -3.880  1.00 58.88 ? 49  GLU A N   1 
ATOM   386  C  CA  . GLU A 1 58  ? 28.806  16.139  -3.509  1.00 57.66 ? 49  GLU A CA  1 
ATOM   387  C  C   . GLU A 1 58  ? 27.700  15.125  -3.204  1.00 58.90 ? 49  GLU A C   1 
ATOM   388  O  O   . GLU A 1 58  ? 27.580  14.074  -3.865  1.00 59.97 ? 49  GLU A O   1 
ATOM   389  C  CB  . GLU A 1 58  ? 29.701  16.260  -2.260  1.00 58.87 ? 49  GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 58  ? 30.484  17.565  -2.085  1.00 55.68 ? 49  GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 58  ? 29.629  18.709  -1.558  1.00 67.70 ? 49  GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 58  ? 29.413  18.807  -0.319  1.00 63.59 ? 49  GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 58  ? 29.182  19.514  -2.402  1.00 62.52 ? 49  GLU A OE2 1 
ATOM   394  N  N   . LEU A 1 59  ? 26.874  15.470  -2.219  1.00 57.30 ? 50  LEU A N   1 
ATOM   395  C  CA  . LEU A 1 59  ? 25.898  14.536  -1.657  1.00 56.41 ? 50  LEU A CA  1 
ATOM   396  C  C   . LEU A 1 59  ? 24.693  14.350  -2.576  1.00 56.44 ? 50  LEU A C   1 
ATOM   397  O  O   . LEU A 1 59  ? 24.282  13.220  -2.838  1.00 56.89 ? 50  LEU A O   1 
ATOM   398  C  CB  . LEU A 1 59  ? 25.450  15.014  -0.278  1.00 55.15 ? 50  LEU A CB  1 
ATOM   399  C  CG  . LEU A 1 59  ? 26.614  15.358  0.658   1.00 52.69 ? 50  LEU A CG  1 
ATOM   400  C  CD1 . LEU A 1 59  ? 26.127  15.933  1.979   1.00 45.41 ? 50  LEU A CD1 1 
ATOM   401  C  CD2 . LEU A 1 59  ? 27.481  14.134  0.905   1.00 46.06 ? 50  LEU A CD2 1 
ATOM   402  N  N   . ALA A 1 60  ? 24.148  15.453  -3.083  1.00 55.91 ? 51  ALA A N   1 
ATOM   403  C  CA  . ALA A 1 60  ? 22.914  15.423  -3.881  1.00 55.25 ? 51  ALA A CA  1 
ATOM   404  C  C   . ALA A 1 60  ? 23.096  14.761  -5.264  1.00 55.23 ? 51  ALA A C   1 
ATOM   405  O  O   . ALA A 1 60  ? 22.182  14.789  -6.107  1.00 56.82 ? 51  ALA A O   1 
ATOM   406  C  CB  . ALA A 1 60  ? 22.346  16.836  -4.026  1.00 55.78 ? 51  ALA A CB  1 
ATOM   407  N  N   . ASP A 1 61  ? 24.279  14.194  -5.499  1.00 52.79 ? 52  ASP A N   1 
ATOM   408  C  CA  . ASP A 1 61  ? 24.479  13.279  -6.606  1.00 49.94 ? 52  ASP A CA  1 
ATOM   409  C  C   . ASP A 1 61  ? 24.357  11.805  -6.141  1.00 46.91 ? 52  ASP A C   1 
ATOM   410  O  O   . ASP A 1 61  ? 24.172  10.905  -6.960  1.00 46.25 ? 52  ASP A O   1 
ATOM   411  C  CB  . ASP A 1 61  ? 25.845  13.542  -7.242  1.00 51.22 ? 52  ASP A CB  1 
ATOM   412  C  CG  . ASP A 1 61  ? 25.913  13.089  -8.686  1.00 54.88 ? 52  ASP A CG  1 
ATOM   413  O  OD1 . ASP A 1 61  ? 26.836  12.303  -9.022  1.00 70.62 ? 52  ASP A OD1 1 
ATOM   414  O  OD2 . ASP A 1 61  ? 25.040  13.520  -9.482  1.00 71.31 ? 52  ASP A OD2 1 
ATOM   415  N  N   . LYS A 1 62  ? 24.451  11.562  -4.835  1.00 43.88 ? 53  LYS A N   1 
ATOM   416  C  CA  . LYS A 1 62  ? 24.373  10.203  -4.297  1.00 42.22 ? 53  LYS A CA  1 
ATOM   417  C  C   . LYS A 1 62  ? 22.928  9.667   -4.210  1.00 39.38 ? 53  LYS A C   1 
ATOM   418  O  O   . LYS A 1 62  ? 21.975  10.421  -3.977  1.00 38.08 ? 53  LYS A O   1 
ATOM   419  C  CB  . LYS A 1 62  ? 24.969  10.131  -2.890  1.00 41.60 ? 53  LYS A CB  1 
ATOM   420  C  CG  . LYS A 1 62  ? 26.388  10.708  -2.677  1.00 45.07 ? 53  LYS A CG  1 
ATOM   421  C  CD  . LYS A 1 62  ? 27.064  9.914   -1.548  1.00 44.09 ? 53  LYS A CD  1 
ATOM   422  C  CE  . LYS A 1 62  ? 28.246  10.606  -0.864  1.00 61.62 ? 53  LYS A CE  1 
ATOM   423  N  NZ  . LYS A 1 62  ? 28.826  9.707   0.239   1.00 48.12 ? 53  LYS A NZ  1 
ATOM   424  N  N   . SER A 1 63  ? 22.786  8.358   -4.367  1.00 36.28 ? 54  SER A N   1 
ATOM   425  C  CA  . SER A 1 63  ? 21.510  7.684   -4.078  1.00 35.66 ? 54  SER A CA  1 
ATOM   426  C  C   . SER A 1 63  ? 21.254  7.845   -2.607  1.00 31.66 ? 54  SER A C   1 
ATOM   427  O  O   . SER A 1 63  ? 22.186  8.108   -1.819  1.00 29.83 ? 54  SER A O   1 
ATOM   428  C  CB  . SER A 1 63  ? 21.582  6.191   -4.396  1.00 33.30 ? 54  SER A CB  1 
ATOM   429  O  OG  . SER A 1 63  ? 22.363  5.516   -3.418  1.00 30.99 ? 54  SER A OG  1 
ATOM   430  N  N   . VAL A 1 64  ? 20.006  7.663   -2.183  1.00 29.62 ? 55  VAL A N   1 
ATOM   431  C  CA  . VAL A 1 64  ? 19.764  7.827   -0.752  1.00 27.39 ? 55  VAL A CA  1 
ATOM   432  C  C   . VAL A 1 64  ? 20.391  6.658   -0.002  1.00 28.10 ? 55  VAL A C   1 
ATOM   433  O  O   . VAL A 1 64  ? 20.824  6.801   1.139   1.00 28.05 ? 55  VAL A O   1 
ATOM   434  C  CB  . VAL A 1 64  ? 18.241  8.040   -0.407  1.00 28.59 ? 55  VAL A CB  1 
ATOM   435  C  CG1 . VAL A 1 64  ? 17.437  6.782   -0.765  1.00 24.79 ? 55  VAL A CG1 1 
ATOM   436  C  CG2 . VAL A 1 64  ? 18.084  8.430   1.069   1.00 26.50 ? 55  VAL A CG2 1 
ATOM   437  N  N   . GLU A 1 65  ? 20.455  5.497   -0.643  1.00 27.04 ? 56  GLU A N   1 
ATOM   438  C  CA  . GLU A 1 65  ? 21.053  4.330   -0.034  1.00 29.42 ? 56  GLU A CA  1 
ATOM   439  C  C   . GLU A 1 65  ? 22.581  4.500   0.157   1.00 30.82 ? 56  GLU A C   1 
ATOM   440  O  O   . GLU A 1 65  ? 23.143  4.117   1.181   1.00 30.43 ? 56  GLU A O   1 
ATOM   441  C  CB  . GLU A 1 65  ? 20.732  3.099   -0.876  1.00 30.59 ? 56  GLU A CB  1 
ATOM   442  C  CG  . GLU A 1 65  ? 19.199  2.757   -0.971  1.00 29.31 ? 56  GLU A CG  1 
ATOM   443  C  CD  . GLU A 1 65  ? 18.425  3.514   -2.054  1.00 50.13 ? 56  GLU A CD  1 
ATOM   444  O  OE1 . GLU A 1 65  ? 17.170  3.370   -2.031  1.00 30.22 ? 56  GLU A OE1 1 
ATOM   445  O  OE2 . GLU A 1 65  ? 19.031  4.254   -2.910  1.00 29.07 ? 56  GLU A OE2 1 
ATOM   446  N  N   . GLU A 1 66  ? 23.248  5.087   -0.838  1.00 31.66 ? 57  GLU A N   1 
ATOM   447  C  CA  . GLU A 1 66  ? 24.642  5.498   -0.677  1.00 33.67 ? 57  GLU A CA  1 
ATOM   448  C  C   . GLU A 1 66  ? 24.837  6.522   0.474   1.00 33.02 ? 57  GLU A C   1 
ATOM   449  O  O   . GLU A 1 66  ? 25.739  6.414   1.313   1.00 31.76 ? 57  GLU A O   1 
ATOM   450  C  CB  . GLU A 1 66  ? 25.079  6.064   -2.024  1.00 35.58 ? 57  GLU A CB  1 
ATOM   451  C  CG  . GLU A 1 66  ? 26.527  6.125   -2.349  1.00 42.83 ? 57  GLU A CG  1 
ATOM   452  C  CD  . GLU A 1 66  ? 26.684  6.380   -3.850  1.00 38.83 ? 57  GLU A CD  1 
ATOM   453  O  OE1 . GLU A 1 66  ? 25.890  7.197   -4.401  1.00 49.91 ? 57  GLU A OE1 1 
ATOM   454  O  OE2 . GLU A 1 66  ? 27.538  5.712   -4.477  1.00 61.01 ? 57  GLU A OE2 1 
ATOM   455  N  N   . LEU A 1 67  ? 23.952  7.500   0.564   1.00 30.75 ? 58  LEU A N   1 
ATOM   456  C  CA  . LEU A 1 67  ? 24.064  8.484   1.618   1.00 31.13 ? 58  LEU A CA  1 
ATOM   457  C  C   . LEU A 1 67  ? 24.001  7.877   3.036   1.00 29.87 ? 58  LEU A C   1 
ATOM   458  O  O   . LEU A 1 67  ? 24.794  8.181   3.922   1.00 31.43 ? 58  LEU A O   1 
ATOM   459  C  CB  . LEU A 1 67  ? 22.918  9.469   1.448   1.00 29.69 ? 58  LEU A CB  1 
ATOM   460  C  CG  . LEU A 1 67  ? 23.054  10.823  2.047   1.00 37.21 ? 58  LEU A CG  1 
ATOM   461  C  CD1 . LEU A 1 67  ? 24.238  11.618  1.390   1.00 34.24 ? 58  LEU A CD1 1 
ATOM   462  C  CD2 . LEU A 1 67  ? 21.710  11.508  1.858   1.00 31.13 ? 58  LEU A CD2 1 
ATOM   463  N  N   . VAL A 1 68  ? 23.022  7.015   3.228   1.00 29.82 ? 59  VAL A N   1 
ATOM   464  C  CA  . VAL A 1 68  ? 22.761  6.395   4.513   1.00 29.26 ? 59  VAL A CA  1 
ATOM   465  C  C   . VAL A 1 68  ? 23.803  5.290   4.836   1.00 29.78 ? 59  VAL A C   1 
ATOM   466  O  O   . VAL A 1 68  ? 24.120  5.048   6.007   1.00 29.90 ? 59  VAL A O   1 
ATOM   467  C  CB  . VAL A 1 68  ? 21.259  5.880   4.529   1.00 27.77 ? 59  VAL A CB  1 
ATOM   468  C  CG1 . VAL A 1 68  ? 20.992  4.877   5.600   1.00 34.47 ? 59  VAL A CG1 1 
ATOM   469  C  CG2 . VAL A 1 68  ? 20.300  7.088   4.610   1.00 32.27 ? 59  VAL A CG2 1 
ATOM   470  N  N   . ALA A 1 69  ? 24.350  4.625   3.818   1.00 30.93 ? 60  ALA A N   1 
ATOM   471  C  CA  . ALA A 1 69  ? 25.423  3.634   4.081   1.00 31.69 ? 60  ALA A CA  1 
ATOM   472  C  C   . ALA A 1 69  ? 26.687  4.284   4.660   1.00 31.49 ? 60  ALA A C   1 
ATOM   473  O  O   . ALA A 1 69  ? 27.351  3.707   5.499   1.00 35.04 ? 60  ALA A O   1 
ATOM   474  C  CB  . ALA A 1 69  ? 25.777  2.879   2.805   1.00 31.16 ? 60  ALA A CB  1 
ATOM   475  N  N   . ASN A 1 70  ? 26.985  5.489   4.195   1.00 33.07 ? 61  ASN A N   1 
ATOM   476  C  CA  . ASN A 1 70  ? 28.229  6.217   4.497   1.00 34.82 ? 61  ASN A CA  1 
ATOM   477  C  C   . ASN A 1 70  ? 27.899  7.483   5.236   1.00 35.59 ? 61  ASN A C   1 
ATOM   478  O  O   . ASN A 1 70  ? 28.328  8.579   4.870   1.00 34.16 ? 61  ASN A O   1 
ATOM   479  C  CB  . ASN A 1 70  ? 28.934  6.551   3.190   1.00 33.89 ? 61  ASN A CB  1 
ATOM   480  C  CG  . ASN A 1 70  ? 29.289  5.329   2.419   1.00 41.05 ? 61  ASN A CG  1 
ATOM   481  O  OD1 . ASN A 1 70  ? 30.070  4.497   2.898   1.00 52.11 ? 61  ASN A OD1 1 
ATOM   482  N  ND2 . ASN A 1 70  ? 28.698  5.174   1.241   1.00 47.10 ? 61  ASN A ND2 1 
ATOM   483  N  N   . LEU A 1 71  ? 27.100  7.321   6.283   1.00 39.39 ? 62  LEU A N   1 
ATOM   484  C  CA  . LEU A 1 71  ? 26.584  8.445   7.037   1.00 40.32 ? 62  LEU A CA  1 
ATOM   485  C  C   . LEU A 1 71  ? 27.727  9.227   7.692   1.00 41.75 ? 62  LEU A C   1 
ATOM   486  O  O   . LEU A 1 71  ? 27.656  10.452  7.883   1.00 40.53 ? 62  LEU A O   1 
ATOM   487  C  CB  . LEU A 1 71  ? 25.627  7.896   8.092   1.00 41.11 ? 62  LEU A CB  1 
ATOM   488  C  CG  . LEU A 1 71  ? 24.641  8.830   8.712   1.00 41.92 ? 62  LEU A CG  1 
ATOM   489  C  CD1 . LEU A 1 71  ? 23.735  9.430   7.617   1.00 37.33 ? 62  LEU A CD1 1 
ATOM   490  C  CD2 . LEU A 1 71  ? 23.838  8.051   9.756   1.00 38.71 ? 62  LEU A CD2 1 
ATOM   491  N  N   . ASN A 1 72  ? 28.789  8.503   8.046   1.00 42.76 ? 63  ASN A N   1 
ATOM   492  C  CA  . ASN A 1 72  ? 29.986  9.109   8.638   1.00 42.50 ? 63  ASN A CA  1 
ATOM   493  C  C   . ASN A 1 72  ? 30.658  10.175  7.767   1.00 42.25 ? 63  ASN A C   1 
ATOM   494  O  O   . ASN A 1 72  ? 31.298  11.077  8.305   1.00 43.35 ? 63  ASN A O   1 
ATOM   495  C  CB  . ASN A 1 72  ? 31.007  8.015   8.966   1.00 44.57 ? 63  ASN A CB  1 
ATOM   496  C  CG  . ASN A 1 72  ? 31.575  7.364   7.721   1.00 46.69 ? 63  ASN A CG  1 
ATOM   497  O  OD1 . ASN A 1 72  ? 30.838  6.774   6.909   1.00 60.54 ? 63  ASN A OD1 1 
ATOM   498  N  ND2 . ASN A 1 72  ? 32.890  7.473   7.548   1.00 62.59 ? 63  ASN A ND2 1 
ATOM   499  N  N   . GLU A 1 73  ? 30.507  10.071  6.442   1.00 42.10 ? 64  GLU A N   1 
ATOM   500  C  CA  . GLU A 1 73  ? 31.040  11.072  5.482   1.00 41.61 ? 64  GLU A CA  1 
ATOM   501  C  C   . GLU A 1 73  ? 30.127  12.291  5.301   1.00 41.44 ? 64  GLU A C   1 
ATOM   502  O  O   . GLU A 1 73  ? 30.428  13.214  4.520   1.00 40.67 ? 64  GLU A O   1 
ATOM   503  C  CB  . GLU A 1 73  ? 31.236  10.449  4.099   1.00 41.37 ? 64  GLU A CB  1 
ATOM   504  C  CG  . GLU A 1 73  ? 32.112  9.231   4.018   1.00 47.16 ? 64  GLU A CG  1 
ATOM   505  C  CD  . GLU A 1 73  ? 32.157  8.665   2.588   1.00 41.77 ? 64  GLU A CD  1 
ATOM   506  O  OE1 . GLU A 1 73  ? 31.813  9.399   1.623   1.00 64.16 ? 64  GLU A OE1 1 
ATOM   507  O  OE2 . GLU A 1 73  ? 32.516  7.476   2.431   1.00 67.40 ? 64  GLU A OE2 1 
ATOM   508  N  N   . VAL A 1 74  ? 28.998  12.308  6.008   1.00 40.40 ? 65  VAL A N   1 
ATOM   509  C  CA  . VAL A 1 74  ? 28.129  13.464  5.950   1.00 39.89 ? 65  VAL A CA  1 
ATOM   510  C  C   . VAL A 1 74  ? 28.689  14.503  6.926   1.00 38.95 ? 65  VAL A C   1 
ATOM   511  O  O   . VAL A 1 74  ? 28.988  14.176  8.069   1.00 38.66 ? 65  VAL A O   1 
ATOM   512  C  CB  . VAL A 1 74  ? 26.641  13.091  6.248   1.00 38.86 ? 65  VAL A CB  1 
ATOM   513  C  CG1 . VAL A 1 74  ? 25.744  14.284  6.108   1.00 40.30 ? 65  VAL A CG1 1 
ATOM   514  C  CG2 . VAL A 1 74  ? 26.207  12.026  5.301   1.00 33.52 ? 65  VAL A CG2 1 
ATOM   515  N  N   . PRO A 1 75  ? 28.837  15.761  6.461   1.00 39.32 ? 66  PRO A N   1 
ATOM   516  C  CA  . PRO A 1 75  ? 29.292  16.834  7.338   1.00 39.53 ? 66  PRO A CA  1 
ATOM   517  C  C   . PRO A 1 75  ? 28.455  16.890  8.604   1.00 39.69 ? 66  PRO A C   1 
ATOM   518  O  O   . PRO A 1 75  ? 27.226  16.696  8.564   1.00 37.17 ? 66  PRO A O   1 
ATOM   519  C  CB  . PRO A 1 75  ? 29.080  18.096  6.495   1.00 40.50 ? 66  PRO A CB  1 
ATOM   520  C  CG  . PRO A 1 75  ? 29.192  17.638  5.115   1.00 41.88 ? 66  PRO A CG  1 
ATOM   521  C  CD  . PRO A 1 75  ? 28.600  16.243  5.093   1.00 37.59 ? 66  PRO A CD  1 
ATOM   522  N  N   . GLU A 1 76  ? 29.123  17.143  9.718   1.00 36.85 ? 67  GLU A N   1 
ATOM   523  C  CA  . GLU A 1 76  ? 28.476  17.079  10.997  1.00 37.91 ? 67  GLU A CA  1 
ATOM   524  C  C   . GLU A 1 76  ? 27.242  17.979  11.057  1.00 36.49 ? 67  GLU A C   1 
ATOM   525  O  O   . GLU A 1 76  ? 26.244  17.609  11.647  1.00 37.44 ? 67  GLU A O   1 
ATOM   526  C  CB  . GLU A 1 76  ? 29.467  17.442  12.116  1.00 38.33 ? 67  GLU A CB  1 
ATOM   527  C  CG  . GLU A 1 76  ? 29.600  16.381  13.233  1.00 45.31 ? 67  GLU A CG  1 
ATOM   528  C  CD  . GLU A 1 76  ? 28.314  16.181  14.048  1.00 59.59 ? 67  GLU A CD  1 
ATOM   529  O  OE1 . GLU A 1 76  ? 28.345  16.448  15.270  1.00 60.73 ? 67  GLU A OE1 1 
ATOM   530  O  OE2 . GLU A 1 76  ? 27.281  15.746  13.475  1.00 63.23 ? 67  GLU A OE2 1 
ATOM   531  N  N   . ALA A 1 77  ? 27.306  19.160  10.450  1.00 35.59 ? 68  ALA A N   1 
ATOM   532  C  CA  . ALA A 1 77  ? 26.231  20.131  10.599  1.00 35.75 ? 68  ALA A CA  1 
ATOM   533  C  C   . ALA A 1 77  ? 24.884  19.601  10.068  1.00 35.11 ? 68  ALA A C   1 
ATOM   534  O  O   . ALA A 1 77  ? 23.828  20.031  10.541  1.00 35.03 ? 68  ALA A O   1 
ATOM   535  C  CB  . ALA A 1 77  ? 26.589  21.441  9.894   1.00 35.02 ? 68  ALA A CB  1 
ATOM   536  N  N   . ILE A 1 78  ? 24.926  18.704  9.078   1.00 34.83 ? 69  ILE A N   1 
ATOM   537  C  CA  . ILE A 1 78  ? 23.689  18.107  8.511   1.00 33.39 ? 69  ILE A CA  1 
ATOM   538  C  C   . ILE A 1 78  ? 23.527  16.589  8.781   1.00 31.70 ? 69  ILE A C   1 
ATOM   539  O  O   . ILE A 1 78  ? 22.547  15.971  8.338   1.00 29.51 ? 69  ILE A O   1 
ATOM   540  C  CB  . ILE A 1 78  ? 23.529  18.410  6.974   1.00 32.86 ? 69  ILE A CB  1 
ATOM   541  C  CG1 . ILE A 1 78  ? 24.670  17.819  6.138   1.00 24.83 ? 69  ILE A CG1 1 
ATOM   542  C  CG2 . ILE A 1 78  ? 23.408  19.911  6.713   1.00 40.16 ? 69  ILE A CG2 1 
ATOM   543  C  CD1 . ILE A 1 78  ? 24.357  17.785  4.651   1.00 34.61 ? 69  ILE A CD1 1 
ATOM   544  N  N   . ARG A 1 79  ? 24.441  15.981  9.542   1.00 30.78 ? 70  ARG A N   1 
ATOM   545  C  CA  . ARG A 1 79  ? 24.416  14.537  9.690   1.00 30.01 ? 70  ARG A CA  1 
ATOM   546  C  C   . ARG A 1 79  ? 23.135  13.979  10.355  1.00 29.99 ? 70  ARG A C   1 
ATOM   547  O  O   . ARG A 1 79  ? 22.594  12.980  9.869   1.00 27.23 ? 70  ARG A O   1 
ATOM   548  C  CB  . ARG A 1 79  ? 25.648  14.038  10.437  1.00 30.54 ? 70  ARG A CB  1 
ATOM   549  C  CG  . ARG A 1 79  ? 25.893  12.559  10.285  1.00 29.97 ? 70  ARG A CG  1 
ATOM   550  C  CD  . ARG A 1 79  ? 27.209  12.208  11.029  1.00 32.41 ? 70  ARG A CD  1 
ATOM   551  N  NE  . ARG A 1 79  ? 28.397  12.782  10.387  1.00 40.04 ? 70  ARG A NE  1 
ATOM   552  C  CZ  . ARG A 1 79  ? 29.541  13.031  11.025  1.00 42.35 ? 70  ARG A CZ  1 
ATOM   553  N  NH1 . ARG A 1 79  ? 29.664  12.764  12.323  1.00 35.27 ? 70  ARG A NH1 1 
ATOM   554  N  NH2 . ARG A 1 79  ? 30.572  13.563  10.373  1.00 42.02 ? 70  ARG A NH2 1 
ATOM   555  N  N   . THR A 1 80  ? 22.673  14.611  11.442  1.00 30.19 ? 71  THR A N   1 
ATOM   556  C  CA  . THR A 1 80  ? 21.455  14.168  12.130  1.00 29.57 ? 71  THR A CA  1 
ATOM   557  C  C   . THR A 1 80  ? 20.252  14.257  11.186  1.00 27.85 ? 71  THR A C   1 
ATOM   558  O  O   . THR A 1 80  ? 19.452  13.318  11.105  1.00 28.84 ? 71  THR A O   1 
ATOM   559  C  CB  . THR A 1 80  ? 21.219  14.935  13.428  1.00 28.81 ? 71  THR A CB  1 
ATOM   560  O  OG1 . THR A 1 80  ? 22.198  14.528  14.390  1.00 33.03 ? 71  THR A OG1 1 
ATOM   561  C  CG2 . THR A 1 80  ? 19.852  14.623  14.005  1.00 31.79 ? 71  THR A CG2 1 
ATOM   562  N  N   . ALA A 1 81  ? 20.165  15.346  10.426  1.00 27.24 ? 72  ALA A N   1 
ATOM   563  C  CA  . ALA A 1 81  ? 19.092  15.526  9.460   1.00 27.12 ? 72  ALA A CA  1 
ATOM   564  C  C   . ALA A 1 81  ? 19.115  14.463  8.368   1.00 27.44 ? 72  ALA A C   1 
ATOM   565  O  O   . ALA A 1 81  ? 18.062  13.987  7.928   1.00 24.09 ? 72  ALA A O   1 
ATOM   566  C  CB  . ALA A 1 81  ? 19.121  16.919  8.828   1.00 28.93 ? 72  ALA A CB  1 
ATOM   567  N  N   . VAL A 1 82  ? 20.304  14.090  7.923   1.00 24.40 ? 73  VAL A N   1 
ATOM   568  C  CA  . VAL A 1 82  ? 20.465  13.049  6.873   1.00 24.17 ? 73  VAL A CA  1 
ATOM   569  C  C   . VAL A 1 82  ? 20.220  11.670  7.427   1.00 24.01 ? 73  VAL A C   1 
ATOM   570  O  O   . VAL A 1 82  ? 19.564  10.829  6.750   1.00 23.90 ? 73  VAL A O   1 
ATOM   571  C  CB  . VAL A 1 82  ? 21.847  13.112  6.160   1.00 21.64 ? 73  VAL A CB  1 
ATOM   572  C  CG1 . VAL A 1 82  ? 22.015  11.920  5.163   1.00 25.19 ? 73  VAL A CG1 1 
ATOM   573  C  CG2 . VAL A 1 82  ? 21.993  14.395  5.407   1.00 29.89 ? 73  VAL A CG2 1 
ATOM   574  N  N   . ARG A 1 83  ? 20.697  11.409  8.646   1.00 24.23 ? 74  ARG A N   1 
ATOM   575  C  CA  . ARG A 1 83  ? 20.358  10.175  9.328   1.00 24.03 ? 74  ARG A CA  1 
ATOM   576  C  C   . ARG A 1 83  ? 18.817  9.961   9.430   1.00 23.22 ? 74  ARG A C   1 
ATOM   577  O  O   . ARG A 1 83  ? 18.318  8.869   9.164   1.00 21.88 ? 74  ARG A O   1 
ATOM   578  C  CB  . ARG A 1 83  ? 20.977  10.172  10.711  1.00 24.36 ? 74  ARG A CB  1 
ATOM   579  C  CG  . ARG A 1 83  ? 20.694  8.954   11.563  1.00 23.91 ? 74  ARG A CG  1 
ATOM   580  C  CD  . ARG A 1 83  ? 21.301  9.154   12.909  1.00 25.24 ? 74  ARG A CD  1 
ATOM   581  N  NE  . ARG A 1 83  ? 21.199  7.975   13.790  1.00 25.88 ? 74  ARG A NE  1 
ATOM   582  C  CZ  . ARG A 1 83  ? 21.831  7.871   14.967  1.00 48.28 ? 74  ARG A CZ  1 
ATOM   583  N  NH1 . ARG A 1 83  ? 22.614  8.860   15.400  1.00 43.25 ? 74  ARG A NH1 1 
ATOM   584  N  NH2 . ARG A 1 83  ? 21.689  6.779   15.725  1.00 25.23 ? 74  ARG A NH2 1 
ATOM   585  N  N   . ASN A 1 84  ? 18.080  10.990  9.839   1.00 20.76 ? 75  ASN A N   1 
ATOM   586  C  CA  . ASN A 1 84  ? 16.698  10.788  10.227  1.00 21.99 ? 75  ASN A CA  1 
ATOM   587  C  C   . ASN A 1 84  ? 15.813  10.795  8.945   1.00 20.69 ? 75  ASN A C   1 
ATOM   588  O  O   . ASN A 1 84  ? 14.978  9.937   8.749   1.00 21.77 ? 75  ASN A O   1 
ATOM   589  C  CB  . ASN A 1 84  ? 16.256  11.871  11.231  1.00 25.12 ? 75  ASN A CB  1 
ATOM   590  C  CG  . ASN A 1 84  ? 16.825  11.688  12.670  1.00 22.53 ? 75  ASN A CG  1 
ATOM   591  O  OD1 . ASN A 1 84  ? 17.331  10.638  13.048  1.00 23.23 ? 75  ASN A OD1 1 
ATOM   592  N  ND2 . ASN A 1 84  ? 16.695  12.750  13.489  1.00 24.81 ? 75  ASN A ND2 1 
ATOM   593  N  N   . ASN A 1 85  ? 16.038  11.765  8.077   1.00 18.50 ? 76  ASN A N   1 
ATOM   594  C  CA  . ASN A 1 85  ? 15.250  11.961  6.863   1.00 21.56 ? 76  ASN A CA  1 
ATOM   595  C  C   . ASN A 1 85  ? 15.734  11.127  5.678   1.00 20.84 ? 76  ASN A C   1 
ATOM   596  O  O   . ASN A 1 85  ? 14.914  10.669  4.846   1.00 19.34 ? 76  ASN A O   1 
ATOM   597  C  CB  . ASN A 1 85  ? 15.215  13.454  6.517   1.00 22.73 ? 76  ASN A CB  1 
ATOM   598  C  CG  . ASN A 1 85  ? 14.541  14.242  7.569   1.00 23.74 ? 76  ASN A CG  1 
ATOM   599  O  OD1 . ASN A 1 85  ? 13.333  14.105  7.761   1.00 24.30 ? 76  ASN A OD1 1 
ATOM   600  N  ND2 . ASN A 1 85  ? 15.317  15.078  8.300   1.00 23.22 ? 76  ASN A ND2 1 
ATOM   601  N  N   . GLY A 1 86  ? 17.062  11.004  5.554   1.00 19.49 ? 77  GLY A N   1 
ATOM   602  C  CA  . GLY A 1 86  ? 17.679  10.059  4.633   1.00 20.00 ? 77  GLY A CA  1 
ATOM   603  C  C   . GLY A 1 86  ? 17.280  8.634   4.998   1.00 20.43 ? 77  GLY A C   1 
ATOM   604  O  O   . GLY A 1 86  ? 16.854  7.865   4.153   1.00 20.04 ? 77  GLY A O   1 
ATOM   605  N  N   . GLY A 1 87  ? 17.336  8.319   6.277   1.00 19.01 ? 78  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 87  ? 16.901  7.035   6.798   1.00 19.11 ? 78  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 87  ? 15.441  6.805   6.472   1.00 19.76 ? 78  GLY A C   1 
ATOM   608  O  O   . GLY A 1 87  ? 15.109  5.757   5.953   1.00 17.97 ? 78  GLY A O   1 
ATOM   609  N  N   . GLY A 1 88  ? 14.588  7.796   6.747   1.00 19.24 ? 79  GLY A N   1 
ATOM   610  C  CA  . GLY A 1 88  ? 13.173  7.670   6.475   1.00 19.27 ? 79  GLY A CA  1 
ATOM   611  C  C   . GLY A 1 88  ? 12.902  7.436   5.003   1.00 20.63 ? 79  GLY A C   1 
ATOM   612  O  O   . GLY A 1 88  ? 12.096  6.600   4.630   1.00 19.10 ? 79  GLY A O   1 
ATOM   613  N  N   . HIS A 1 89  ? 13.610  8.156   4.131   1.00 20.35 ? 80  HIS A N   1 
ATOM   614  C  CA  . HIS A 1 89  ? 13.357  8.001   2.691   1.00 19.98 ? 80  HIS A CA  1 
ATOM   615  C  C   . HIS A 1 89  ? 13.814  6.613   2.158   1.00 19.13 ? 80  HIS A C   1 
ATOM   616  O  O   . HIS A 1 89  ? 13.095  5.937   1.468   1.00 20.02 ? 80  HIS A O   1 
ATOM   617  C  CB  . HIS A 1 89  ? 14.038  9.143   1.915   1.00 19.16 ? 80  HIS A CB  1 
ATOM   618  C  CG  . HIS A 1 89  ? 13.923  9.045   0.406   1.00 19.47 ? 80  HIS A CG  1 
ATOM   619  N  ND1 . HIS A 1 89  ? 12.806  8.556   -0.263  1.00 19.22 ? 80  HIS A ND1 1 
ATOM   620  C  CD2 . HIS A 1 89  ? 14.771  9.481   -0.562  1.00 22.89 ? 80  HIS A CD2 1 
ATOM   621  C  CE1 . HIS A 1 89  ? 13.007  8.651   -1.572  1.00 23.92 ? 80  HIS A CE1 1 
ATOM   622  N  NE2 . HIS A 1 89  ? 14.172  9.255   -1.778  1.00 21.64 ? 80  HIS A NE2 1 
ATOM   623  N  N   . ALA A 1 90  ? 15.024  6.187   2.539   1.00 21.03 ? 81  ALA A N   1 
ATOM   624  C  CA  . ALA A 1 90  ? 15.553  4.886   2.163   1.00 20.83 ? 81  ALA A CA  1 
ATOM   625  C  C   . ALA A 1 90  ? 14.686  3.751   2.724   1.00 21.03 ? 81  ALA A C   1 
ATOM   626  O  O   . ALA A 1 90  ? 14.285  2.865   1.983   1.00 19.97 ? 81  ALA A O   1 
ATOM   627  C  CB  . ALA A 1 90  ? 16.995  4.724   2.677   1.00 23.86 ? 81  ALA A CB  1 
ATOM   628  N  N   . ASN A 1 91  ? 14.352  3.828   4.017   1.00 19.84 ? 82  ASN A N   1 
ATOM   629  C  CA  . ASN A 1 91  ? 13.540  2.790   4.663   1.00 20.29 ? 82  ASN A CA  1 
ATOM   630  C  C   . ASN A 1 91  ? 12.137  2.623   4.024   1.00 19.71 ? 82  ASN A C   1 
ATOM   631  O  O   . ASN A 1 91  ? 11.707  1.481   3.721   1.00 18.95 ? 82  ASN A O   1 
ATOM   632  C  CB  . ASN A 1 91  ? 13.416  3.055   6.168   1.00 21.97 ? 82  ASN A CB  1 
ATOM   633  C  CG  . ASN A 1 91  ? 14.721  2.826   6.913   1.00 20.74 ? 82  ASN A CG  1 
ATOM   634  O  OD1 . ASN A 1 91  ? 15.670  2.221   6.374   1.00 21.29 ? 82  ASN A OD1 1 
ATOM   635  N  ND2 . ASN A 1 91  ? 14.798  3.326   8.139   1.00 19.60 ? 82  ASN A ND2 1 
ATOM   636  N  N   . HIS A 1 92  ? 11.433  3.736   3.810   1.00 19.51 ? 83  HIS A N   1 
ATOM   637  C  CA  . HIS A 1 92  ? 10.101  3.692   3.187   1.00 18.59 ? 83  HIS A CA  1 
ATOM   638  C  C   . HIS A 1 92  ? 10.111  3.314   1.708   1.00 20.76 ? 83  HIS A C   1 
ATOM   639  O  O   . HIS A 1 92  ? 9.288   2.521   1.276   1.00 18.54 ? 83  HIS A O   1 
ATOM   640  C  CB  . HIS A 1 92  ? 9.282   4.954   3.475   1.00 14.54 ? 83  HIS A CB  1 
ATOM   641  C  CG  . HIS A 1 92  ? 8.914   5.129   4.931   1.00 19.95 ? 83  HIS A CG  1 
ATOM   642  N  ND1 . HIS A 1 92  ? 9.785   5.679   5.847   1.00 18.52 ? 83  HIS A ND1 1 
ATOM   643  C  CD2 . HIS A 1 92  ? 7.798   4.769   5.635   1.00 17.46 ? 83  HIS A CD2 1 
ATOM   644  C  CE1 . HIS A 1 92  ? 9.195   5.711   7.046   1.00 18.73 ? 83  HIS A CE1 1 
ATOM   645  N  NE2 . HIS A 1 92  ? 7.988   5.145   6.960   1.00 19.33 ? 83  HIS A NE2 1 
ATOM   646  N  N   . THR A 1 93  ? 11.037  3.861   0.926   1.00 21.92 ? 84  THR A N   1 
ATOM   647  C  CA  . THR A 1 93  ? 11.255  3.390   -0.459  1.00 20.87 ? 84  THR A CA  1 
ATOM   648  C  C   . THR A 1 93  ? 11.371  1.840   -0.524  1.00 19.40 ? 84  THR A C   1 
ATOM   649  O  O   . THR A 1 93  ? 10.684  1.176   -1.287  1.00 22.29 ? 84  THR A O   1 
ATOM   650  C  CB  . THR A 1 93  ? 12.522  4.031   -1.048  1.00 20.34 ? 84  THR A CB  1 
ATOM   651  O  OG1 . THR A 1 93  ? 12.358  5.456   -1.163  1.00 19.16 ? 84  THR A OG1 1 
ATOM   652  C  CG2 . THR A 1 93  ? 12.854  3.443   -2.409  1.00 24.39 ? 84  THR A CG2 1 
ATOM   653  N  N   . PHE A 1 94  ? 12.222  1.280   0.323   1.00 18.45 ? 85  PHE A N   1 
ATOM   654  C  CA  . PHE A 1 94  ? 12.381  -0.157  0.435   1.00 18.37 ? 85  PHE A CA  1 
ATOM   655  C  C   . PHE A 1 94  ? 11.067  -0.880  0.795   1.00 19.04 ? 85  PHE A C   1 
ATOM   656  O  O   . PHE A 1 94  ? 10.666  -1.850  0.125   1.00 21.21 ? 85  PHE A O   1 
ATOM   657  C  CB  . PHE A 1 94  ? 13.465  -0.472  1.465   1.00 15.21 ? 85  PHE A CB  1 
ATOM   658  C  CG  . PHE A 1 94  ? 13.589  -1.931  1.794   1.00 19.61 ? 85  PHE A CG  1 
ATOM   659  C  CD1 . PHE A 1 94  ? 14.441  -2.732  1.050   1.00 21.50 ? 85  PHE A CD1 1 
ATOM   660  C  CD2 . PHE A 1 94  ? 12.866  -2.501  2.872   1.00 22.00 ? 85  PHE A CD2 1 
ATOM   661  C  CE1 . PHE A 1 94  ? 14.553  -4.117  1.343   1.00 25.13 ? 85  PHE A CE1 1 
ATOM   662  C  CE2 . PHE A 1 94  ? 12.983  -3.837  3.167   1.00 28.46 ? 85  PHE A CE2 1 
ATOM   663  C  CZ  . PHE A 1 94  ? 13.826  -4.658  2.411   1.00 30.43 ? 85  PHE A CZ  1 
ATOM   664  N  N   . PHE A 1 95  ? 10.383  -0.359  1.807   1.00 19.15 ? 86  PHE A N   1 
ATOM   665  C  CA  . PHE A 1 95  ? 9.160   -0.958  2.375   1.00 19.53 ? 86  PHE A CA  1 
ATOM   666  C  C   . PHE A 1 95  ? 8.063   -1.147  1.300   1.00 18.29 ? 86  PHE A C   1 
ATOM   667  O  O   . PHE A 1 95  ? 7.482   -2.223  1.184   1.00 20.32 ? 86  PHE A O   1 
ATOM   668  C  CB  . PHE A 1 95  ? 8.644   -0.064  3.525   1.00 19.11 ? 86  PHE A CB  1 
ATOM   669  C  CG  . PHE A 1 95  ? 7.478   -0.651  4.341   1.00 17.73 ? 86  PHE A CG  1 
ATOM   670  C  CD1 . PHE A 1 95  ? 7.566   -1.910  4.924   1.00 19.66 ? 86  PHE A CD1 1 
ATOM   671  C  CD2 . PHE A 1 95  ? 6.331   0.114   4.596   1.00 14.91 ? 86  PHE A CD2 1 
ATOM   672  C  CE1 . PHE A 1 95  ? 6.526   -2.447  5.677   1.00 17.55 ? 86  PHE A CE1 1 
ATOM   673  C  CE2 . PHE A 1 95  ? 5.291   -0.383  5.400   1.00 16.81 ? 86  PHE A CE2 1 
ATOM   674  C  CZ  . PHE A 1 95  ? 5.376   -1.667  5.941   1.00 19.04 ? 86  PHE A CZ  1 
ATOM   675  N  N   . TRP A 1 96  ? 7.808   -0.120  0.514   1.00 17.22 ? 87  TRP A N   1 
ATOM   676  C  CA  . TRP A 1 96  ? 6.743   -0.207  -0.467  1.00 17.71 ? 87  TRP A CA  1 
ATOM   677  C  C   . TRP A 1 96  ? 6.993   -1.360  -1.462  1.00 17.93 ? 87  TRP A C   1 
ATOM   678  O  O   . TRP A 1 96  ? 6.049   -1.967  -1.925  1.00 19.61 ? 87  TRP A O   1 
ATOM   679  C  CB  . TRP A 1 96  ? 6.569   1.083   -1.235  1.00 18.39 ? 87  TRP A CB  1 
ATOM   680  C  CG  . TRP A 1 96  ? 6.474   2.339   -0.415  1.00 18.45 ? 87  TRP A CG  1 
ATOM   681  C  CD1 . TRP A 1 96  ? 7.156   3.477   -0.636  1.00 25.63 ? 87  TRP A CD1 1 
ATOM   682  C  CD2 . TRP A 1 96  ? 5.690   2.552   0.757   1.00 18.86 ? 87  TRP A CD2 1 
ATOM   683  N  NE1 . TRP A 1 96  ? 6.832   4.413   0.301   1.00 21.79 ? 87  TRP A NE1 1 
ATOM   684  C  CE2 . TRP A 1 96  ? 5.959   3.869   1.198   1.00 16.81 ? 87  TRP A CE2 1 
ATOM   685  C  CE3 . TRP A 1 96  ? 4.763   1.769   1.478   1.00 25.14 ? 87  TRP A CE3 1 
ATOM   686  C  CZ2 . TRP A 1 96  ? 5.331   4.430   2.307   1.00 14.41 ? 87  TRP A CZ2 1 
ATOM   687  C  CZ3 . TRP A 1 96  ? 4.162   2.334   2.616   1.00 20.66 ? 87  TRP A CZ3 1 
ATOM   688  C  CH2 . TRP A 1 96  ? 4.438   3.650   2.999   1.00 20.59 ? 87  TRP A CH2 1 
ATOM   689  N  N   . THR A 1 97  ? 8.271   -1.607  -1.771  1.00 17.20 ? 88  THR A N   1 
ATOM   690  C  CA  . THR A 1 97  ? 8.730   -2.619  -2.739  1.00 19.10 ? 88  THR A CA  1 
ATOM   691  C  C   . THR A 1 97  ? 8.715   -4.092  -2.259  1.00 20.97 ? 88  THR A C   1 
ATOM   692  O  O   . THR A 1 97  ? 8.863   -5.019  -3.099  1.00 22.52 ? 88  THR A O   1 
ATOM   693  C  CB  . THR A 1 97  ? 10.167  -2.287  -3.335  1.00 16.45 ? 88  THR A CB  1 
ATOM   694  O  OG1 . THR A 1 97  ? 11.222  -2.486  -2.371  1.00 22.59 ? 88  THR A OG1 1 
ATOM   695  C  CG2 . THR A 1 97  ? 10.208  -0.902  -3.877  1.00 30.19 ? 88  THR A CG2 1 
ATOM   696  N  N   . ILE A 1 98  ? 8.540   -4.305  -0.947  1.00 21.50 ? 89  ILE A N   1 
ATOM   697  C  CA  . ILE A 1 98  ? 8.494   -5.663  -0.388  1.00 19.14 ? 89  ILE A CA  1 
ATOM   698  C  C   . ILE A 1 98  ? 7.102   -6.095  0.086   1.00 19.14 ? 89  ILE A C   1 
ATOM   699  O  O   . ILE A 1 98  ? 6.966   -7.114  0.773   1.00 19.05 ? 89  ILE A O   1 
ATOM   700  C  CB  . ILE A 1 98  ? 9.604   -5.956  0.680   1.00 21.02 ? 89  ILE A CB  1 
ATOM   701  C  CG1 . ILE A 1 98  ? 9.592   -4.960  1.846   1.00 20.16 ? 89  ILE A CG1 1 
ATOM   702  C  CG2 . ILE A 1 98  ? 10.973  -6.008  -0.032  1.00 27.14 ? 89  ILE A CG2 1 
ATOM   703  C  CD1 . ILE A 1 98  ? 8.737   -5.355  2.943   1.00 22.93 ? 89  ILE A CD1 1 
ATOM   704  N  N   . LEU A 1 99  ? 6.094   -5.375  -0.398  1.00 17.58 ? 90  LEU A N   1 
ATOM   705  C  CA  . LEU A 1 99  ? 4.691   -5.610  -0.129  1.00 19.49 ? 90  LEU A CA  1 
ATOM   706  C  C   . LEU A 1 99  ? 4.009   -5.806  -1.458  1.00 18.53 ? 90  LEU A C   1 
ATOM   707  O  O   . LEU A 1 99  ? 4.437   -5.226  -2.453  1.00 17.60 ? 90  LEU A O   1 
ATOM   708  C  CB  . LEU A 1 99  ? 3.990   -4.407  0.605   1.00 18.31 ? 90  LEU A CB  1 
ATOM   709  C  CG  . LEU A 1 99  ? 4.644   -3.849  1.861   1.00 15.23 ? 90  LEU A CG  1 
ATOM   710  C  CD1 . LEU A 1 99  ? 3.929   -2.648  2.398   1.00 18.06 ? 90  LEU A CD1 1 
ATOM   711  C  CD2 . LEU A 1 99  ? 4.733   -4.877  2.904   1.00 15.61 ? 90  LEU A CD2 1 
ATOM   712  N  N   . SER A 1 100 ? 2.900   -6.531  -1.473  1.00 20.37 ? 91  SER A N   1 
ATOM   713  C  CA  . SER A 1 100 ? 2.170   -6.797  -2.720  1.00 19.98 ? 91  SER A CA  1 
ATOM   714  C  C   . SER A 1 100 ? 0.782   -7.344  -2.445  1.00 18.29 ? 91  SER A C   1 
ATOM   715  O  O   . SER A 1 100 ? 0.592   -8.113  -1.470  1.00 18.06 ? 91  SER A O   1 
ATOM   716  C  CB  . SER A 1 100 ? 2.931   -7.791  -3.660  1.00 22.87 ? 91  SER A CB  1 
ATOM   717  O  OG  . SER A 1 100 ? 2.202   -8.010  -4.866  1.00 24.57 ? 91  SER A OG  1 
ATOM   718  N  N   . PRO A 1 101 ? -0.193  -6.982  -3.286  1.00 19.03 ? 92  PRO A N   1 
ATOM   719  C  CA  . PRO A 1 101 ? -1.461  -7.708  -3.143  1.00 20.24 ? 92  PRO A CA  1 
ATOM   720  C  C   . PRO A 1 101 ? -1.340  -9.217  -3.576  1.00 21.96 ? 92  PRO A C   1 
ATOM   721  O  O   . PRO A 1 101 ? -2.224  -10.030 -3.267  1.00 23.37 ? 92  PRO A O   1 
ATOM   722  C  CB  . PRO A 1 101 ? -2.423  -6.965  -4.081  1.00 19.37 ? 92  PRO A CB  1 
ATOM   723  C  CG  . PRO A 1 101 ? -1.491  -6.333  -5.112  1.00 24.96 ? 92  PRO A CG  1 
ATOM   724  C  CD  . PRO A 1 101 ? -0.208  -6.014  -4.396  1.00 20.22 ? 92  PRO A CD  1 
ATOM   725  N  N   . ASN A 1 102 ? -0.288  -9.542  -4.326  1.00 22.12 ? 93  ASN A N   1 
ATOM   726  C  CA  . ASN A 1 102 ? 0.067   -10.952 -4.681  1.00 22.31 ? 93  ASN A CA  1 
ATOM   727  C  C   . ASN A 1 102 ? 1.129   -11.519 -3.715  1.00 21.87 ? 93  ASN A C   1 
ATOM   728  O  O   . ASN A 1 102 ? 1.922   -12.411 -4.060  1.00 22.65 ? 93  ASN A O   1 
ATOM   729  C  CB  . ASN A 1 102 ? 0.630   -10.969 -6.093  1.00 23.59 ? 93  ASN A CB  1 
ATOM   730  C  CG  . ASN A 1 102 ? 0.916   -12.403 -6.598  1.00 24.91 ? 93  ASN A CG  1 
ATOM   731  O  OD1 . ASN A 1 102 ? 0.032   -13.239 -6.558  1.00 30.38 ? 93  ASN A OD1 1 
ATOM   732  N  ND2 . ASN A 1 102 ? 2.163   -12.669 -7.036  1.00 29.95 ? 93  ASN A ND2 1 
ATOM   733  N  N   . GLY A 1 103 ? 1.195   -10.945 -2.518  1.00 21.23 ? 94  GLY A N   1 
ATOM   734  C  CA  . GLY A 1 103 ? 2.161   -11.348 -1.531  1.00 21.10 ? 94  GLY A CA  1 
ATOM   735  C  C   . GLY A 1 103 ? 1.606   -12.437 -0.646  1.00 21.78 ? 94  GLY A C   1 
ATOM   736  O  O   . GLY A 1 103 ? 0.609   -13.113 -0.971  1.00 23.02 ? 94  GLY A O   1 
ATOM   737  N  N   . GLY A 1 104 ? 2.278   -12.635 0.475   1.00 18.91 ? 95  GLY A N   1 
ATOM   738  C  CA  . GLY A 1 104 ? 1.903   -13.649 1.438   1.00 20.53 ? 95  GLY A CA  1 
ATOM   739  C  C   . GLY A 1 104 ? 2.427   -15.031 1.081   1.00 19.88 ? 95  GLY A C   1 
ATOM   740  O  O   . GLY A 1 104 ? 3.243   -15.191 0.159   1.00 18.27 ? 95  GLY A O   1 
ATOM   741  N  N   . GLY A 1 105 ? 1.966   -16.009 1.842   1.00 19.15 ? 96  GLY A N   1 
ATOM   742  C  CA  . GLY A 1 105 ? 2.396   -17.394 1.667   1.00 18.63 ? 96  GLY A CA  1 
ATOM   743  C  C   . GLY A 1 105 ? 3.826   -17.706 2.119   1.00 18.66 ? 96  GLY A C   1 
ATOM   744  O  O   . GLY A 1 105 ? 4.407   -16.980 2.899   1.00 16.90 ? 96  GLY A O   1 
ATOM   745  N  N   . GLN A 1 106 ? 4.356   -18.827 1.637   1.00 18.58 ? 97  GLN A N   1 
ATOM   746  C  CA  . GLN A 1 106 ? 5.690   -19.338 2.000   1.00 19.33 ? 97  GLN A CA  1 
ATOM   747  C  C   . GLN A 1 106 ? 6.833   -18.643 1.237   1.00 18.19 ? 97  GLN A C   1 
ATOM   748  O  O   . GLN A 1 106 ? 6.661   -18.208 0.116   1.00 16.86 ? 97  GLN A O   1 
ATOM   749  C  CB  . GLN A 1 106 ? 5.787   -20.871 1.758   1.00 21.67 ? 97  GLN A CB  1 
ATOM   750  C  CG  . GLN A 1 106 ? 4.689   -21.701 2.400   1.00 18.19 ? 97  GLN A CG  1 
ATOM   751  C  CD  . GLN A 1 106 ? 4.759   -21.698 3.901   1.00 17.77 ? 97  GLN A CD  1 
ATOM   752  O  OE1 . GLN A 1 106 ? 5.644   -22.359 4.505   1.00 26.66 ? 97  GLN A OE1 1 
ATOM   753  N  NE2 . GLN A 1 106 ? 3.893   -20.935 4.529   1.00 23.64 ? 97  GLN A NE2 1 
ATOM   754  N  N   . PRO A 1 107 ? 8.018   -18.546 1.861   1.00 19.54 ? 98  PRO A N   1 
ATOM   755  C  CA  . PRO A 1 107 ? 9.156   -18.055 1.105   1.00 21.82 ? 98  PRO A CA  1 
ATOM   756  C  C   . PRO A 1 107 ? 9.427   -18.954 -0.101  1.00 23.21 ? 98  PRO A C   1 
ATOM   757  O  O   . PRO A 1 107 ? 9.004   -20.155 -0.086  1.00 21.17 ? 98  PRO A O   1 
ATOM   758  C  CB  . PRO A 1 107 ? 10.311  -18.119 2.111   1.00 21.68 ? 98  PRO A CB  1 
ATOM   759  C  CG  . PRO A 1 107 ? 9.694   -18.211 3.435   1.00 28.62 ? 98  PRO A CG  1 
ATOM   760  C  CD  . PRO A 1 107 ? 8.369   -18.888 3.254   1.00 18.36 ? 98  PRO A CD  1 
ATOM   761  N  N   . VAL A 1 108 ? 10.073  -18.368 -1.102  1.00 23.60 ? 99  VAL A N   1 
ATOM   762  C  CA  . VAL A 1 108 ? 10.444  -19.044 -2.348  1.00 23.94 ? 99  VAL A CA  1 
ATOM   763  C  C   . VAL A 1 108 ? 11.966  -18.960 -2.652  1.00 24.19 ? 99  VAL A C   1 
ATOM   764  O  O   . VAL A 1 108 ? 12.722  -18.236 -2.000  1.00 23.53 ? 99  VAL A O   1 
ATOM   765  C  CB  . VAL A 1 108 ? 9.650   -18.507 -3.568  1.00 25.03 ? 99  VAL A CB  1 
ATOM   766  C  CG1 . VAL A 1 108 ? 8.140   -18.594 -3.347  1.00 23.58 ? 99  VAL A CG1 1 
ATOM   767  C  CG2 . VAL A 1 108 ? 10.072  -17.098 -3.994  1.00 23.20 ? 99  VAL A CG2 1 
ATOM   768  N  N   . GLY A 1 109 ? 12.425  -19.747 -3.627  1.00 26.38 ? 100 GLY A N   1 
ATOM   769  C  CA  . GLY A 1 109 ? 13.784  -19.557 -4.168  1.00 24.74 ? 100 GLY A CA  1 
ATOM   770  C  C   . GLY A 1 109 ? 14.885  -19.973 -3.222  1.00 23.74 ? 100 GLY A C   1 
ATOM   771  O  O   . GLY A 1 109 ? 14.660  -20.757 -2.252  1.00 26.46 ? 100 GLY A O   1 
ATOM   772  N  N   . GLU A 1 110 ? 16.090  -19.444 -3.471  1.00 24.71 ? 101 GLU A N   1 
ATOM   773  C  CA  . GLU A 1 110 ? 17.232  -19.704 -2.602  1.00 25.68 ? 101 GLU A CA  1 
ATOM   774  C  C   . GLU A 1 110 ? 17.070  -19.130 -1.186  1.00 24.61 ? 101 GLU A C   1 
ATOM   775  O  O   . GLU A 1 110 ? 17.615  -19.664 -0.213  1.00 24.46 ? 101 GLU A O   1 
ATOM   776  C  CB  . GLU A 1 110 ? 18.519  -19.157 -3.232  1.00 26.26 ? 101 GLU A CB  1 
ATOM   777  C  CG  . GLU A 1 110 ? 18.912  -19.829 -4.566  1.00 36.99 ? 101 GLU A CG  1 
ATOM   778  C  CD  . GLU A 1 110 ? 20.312  -19.384 -5.065  1.00 29.42 ? 101 GLU A CD  1 
ATOM   779  O  OE1 . GLU A 1 110 ? 21.216  -19.157 -4.205  1.00 54.60 ? 101 GLU A OE1 1 
ATOM   780  O  OE2 . GLU A 1 110 ? 20.481  -19.231 -6.295  1.00 53.35 ? 101 GLU A OE2 1 
ATOM   781  N  N   . LEU A 1 111 ? 16.308  -18.043 -1.085  1.00 25.63 ? 102 LEU A N   1 
ATOM   782  C  CA  . LEU A 1 111 ? 16.010  -17.444 0.220   1.00 24.15 ? 102 LEU A CA  1 
ATOM   783  C  C   . LEU A 1 111 ? 15.249  -18.430 1.115   1.00 22.80 ? 102 LEU A C   1 
ATOM   784  O  O   . LEU A 1 111 ? 15.532  -18.541 2.305   1.00 24.79 ? 102 LEU A O   1 
ATOM   785  C  CB  . LEU A 1 111 ? 15.242  -16.118 0.074   1.00 24.15 ? 102 LEU A CB  1 
ATOM   786  C  CG  . LEU A 1 111 ? 14.842  -15.438 1.414   1.00 25.04 ? 102 LEU A CG  1 
ATOM   787  C  CD1 . LEU A 1 111 ? 16.011  -15.182 2.303   1.00 23.67 ? 102 LEU A CD1 1 
ATOM   788  C  CD2 . LEU A 1 111 ? 14.099  -14.115 1.179   1.00 24.17 ? 102 LEU A CD2 1 
ATOM   789  N  N   . ALA A 1 112 ? 14.256  -19.125 0.558   1.00 23.33 ? 103 ALA A N   1 
ATOM   790  C  CA  . ALA A 1 112 ? 13.498  -20.119 1.343   1.00 23.96 ? 103 ALA A CA  1 
ATOM   791  C  C   . ALA A 1 112 ? 14.412  -21.170 1.994   1.00 24.46 ? 103 ALA A C   1 
ATOM   792  O  O   . ALA A 1 112 ? 14.226  -21.561 3.174   1.00 20.10 ? 103 ALA A O   1 
ATOM   793  C  CB  . ALA A 1 112 ? 12.407  -20.797 0.473   1.00 24.32 ? 103 ALA A CB  1 
ATOM   794  N  N   . THR A 1 113 ? 15.374  -21.652 1.202   1.00 26.99 ? 104 THR A N   1 
ATOM   795  C  CA  . THR A 1 113 ? 16.320  -22.686 1.669   1.00 25.87 ? 104 THR A CA  1 
ATOM   796  C  C   . THR A 1 113 ? 17.230  -22.139 2.756   1.00 26.84 ? 104 THR A C   1 
ATOM   797  O  O   . THR A 1 113 ? 17.458  -22.797 3.787   1.00 28.96 ? 104 THR A O   1 
ATOM   798  C  CB  . THR A 1 113 ? 17.128  -23.225 0.457   1.00 26.25 ? 104 THR A CB  1 
ATOM   799  O  OG1 . THR A 1 113 ? 16.206  -23.671 -0.561  1.00 30.84 ? 104 THR A OG1 1 
ATOM   800  C  CG2 . THR A 1 113 ? 18.015  -24.346 0.863   1.00 30.31 ? 104 THR A CG2 1 
ATOM   801  N  N   . ALA A 1 114 ? 17.711  -20.919 2.542   1.00 26.91 ? 105 ALA A N   1 
ATOM   802  C  CA  . ALA A 1 114 ? 18.553  -20.256 3.516   1.00 26.46 ? 105 ALA A CA  1 
ATOM   803  C  C   . ALA A 1 114 ? 17.838  -19.985 4.854   1.00 27.07 ? 105 ALA A C   1 
ATOM   804  O  O   . ALA A 1 114 ? 18.432  -20.155 5.910   1.00 27.94 ? 105 ALA A O   1 
ATOM   805  C  CB  . ALA A 1 114 ? 19.102  -19.010 2.929   1.00 27.11 ? 105 ALA A CB  1 
ATOM   806  N  N   . ILE A 1 115 ? 16.583  -19.541 4.805   1.00 25.61 ? 106 ILE A N   1 
ATOM   807  C  CA  . ILE A 1 115 ? 15.748  -19.378 6.008   1.00 26.69 ? 106 ILE A CA  1 
ATOM   808  C  C   . ILE A 1 115 ? 15.570  -20.691 6.778   1.00 27.50 ? 106 ILE A C   1 
ATOM   809  O  O   . ILE A 1 115 ? 15.709  -20.727 7.986   1.00 29.34 ? 106 ILE A O   1 
ATOM   810  C  CB  . ILE A 1 115 ? 14.312  -18.784 5.661   1.00 24.40 ? 106 ILE A CB  1 
ATOM   811  C  CG1 . ILE A 1 115 ? 14.417  -17.283 5.362   1.00 21.49 ? 106 ILE A CG1 1 
ATOM   812  C  CG2 . ILE A 1 115 ? 13.328  -19.055 6.779   1.00 26.87 ? 106 ILE A CG2 1 
ATOM   813  C  CD1 . ILE A 1 115 ? 13.194  -16.713 4.696   1.00 23.05 ? 106 ILE A CD1 1 
ATOM   814  N  N   . GLU A 1 116 ? 15.227  -21.762 6.079   1.00 31.09 ? 107 GLU A N   1 
ATOM   815  C  CA  . GLU A 1 116 ? 15.150  -23.087 6.726   1.00 32.47 ? 107 GLU A CA  1 
ATOM   816  C  C   . GLU A 1 116 ? 16.441  -23.507 7.414   1.00 32.52 ? 107 GLU A C   1 
ATOM   817  O  O   . GLU A 1 116 ? 16.408  -23.946 8.545   1.00 33.02 ? 107 GLU A O   1 
ATOM   818  C  CB  . GLU A 1 116 ? 14.775  -24.147 5.710   1.00 30.92 ? 107 GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 116 ? 13.287  -24.417 5.653   1.00 40.68 ? 107 GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 116 ? 12.908  -25.314 4.475   1.00 39.05 ? 107 GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 116 ? 13.614  -26.321 4.244   1.00 58.56 ? 107 GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 116 ? 11.907  -25.009 3.788   1.00 55.13 ? 107 GLU A OE2 1 
ATOM   823  N  N   . ALA A 1 117 ? 17.570  -23.373 6.722   1.00 33.79 ? 108 ALA A N   1 
ATOM   824  C  CA  . ALA A 1 117 ? 18.887  -23.711 7.290   1.00 33.22 ? 108 ALA A CA  1 
ATOM   825  C  C   . ALA A 1 117 ? 19.248  -22.872 8.514   1.00 33.53 ? 108 ALA A C   1 
ATOM   826  O  O   . ALA A 1 117 ? 19.678  -23.407 9.542   1.00 32.31 ? 108 ALA A O   1 
ATOM   827  C  CB  . ALA A 1 117 ? 19.953  -23.559 6.229   1.00 34.46 ? 108 ALA A CB  1 
ATOM   828  N  N   . LYS A 1 118 ? 19.073  -21.549 8.407   1.00 32.52 ? 109 LYS A N   1 
ATOM   829  C  CA  . LYS A 1 118 ? 19.399  -20.625 9.502   1.00 32.06 ? 109 LYS A CA  1 
ATOM   830  C  C   . LYS A 1 118 ? 18.469  -20.697 10.710  1.00 31.96 ? 109 LYS A C   1 
ATOM   831  O  O   . LYS A 1 118 ? 18.931  -20.653 11.859  1.00 30.57 ? 109 LYS A O   1 
ATOM   832  C  CB  . LYS A 1 118 ? 19.431  -19.177 8.986   1.00 33.31 ? 109 LYS A CB  1 
ATOM   833  C  CG  . LYS A 1 118 ? 19.782  -18.111 10.048  1.00 31.55 ? 109 LYS A CG  1 
ATOM   834  C  CD  . LYS A 1 118 ? 21.194  -18.251 10.591  1.00 37.55 ? 109 LYS A CD  1 
ATOM   835  C  CE  . LYS A 1 118 ? 22.278  -18.034 9.525   1.00 47.74 ? 109 LYS A CE  1 
ATOM   836  N  NZ  . LYS A 1 118 ? 23.637  -17.934 10.182  1.00 49.01 ? 109 LYS A NZ  1 
ATOM   837  N  N   . PHE A 1 119 ? 17.169  -20.792 10.456  1.00 30.92 ? 110 PHE A N   1 
ATOM   838  C  CA  . PHE A 1 119 ? 16.174  -20.656 11.513  1.00 30.64 ? 110 PHE A CA  1 
ATOM   839  C  C   . PHE A 1 119 ? 15.491  -21.948 11.844  1.00 29.90 ? 110 PHE A C   1 
ATOM   840  O  O   . PHE A 1 119 ? 14.739  -22.001 12.834  1.00 30.03 ? 110 PHE A O   1 
ATOM   841  C  CB  . PHE A 1 119 ? 15.121  -19.581 11.154  1.00 29.82 ? 110 PHE A CB  1 
ATOM   842  C  CG  . PHE A 1 119 ? 15.727  -18.225 10.956  1.00 25.63 ? 110 PHE A CG  1 
ATOM   843  C  CD1 . PHE A 1 119 ? 16.087  -17.805 9.673   1.00 28.77 ? 110 PHE A CD1 1 
ATOM   844  C  CD2 . PHE A 1 119 ? 16.006  -17.397 12.041  1.00 31.12 ? 110 PHE A CD2 1 
ATOM   845  C  CE1 . PHE A 1 119 ? 16.695  -16.580 9.478   1.00 30.50 ? 110 PHE A CE1 1 
ATOM   846  C  CE2 . PHE A 1 119 ? 16.645  -16.142 11.835  1.00 26.01 ? 110 PHE A CE2 1 
ATOM   847  C  CZ  . PHE A 1 119 ? 16.959  -15.749 10.569  1.00 24.35 ? 110 PHE A CZ  1 
ATOM   848  N  N   . GLY A 1 120 ? 15.737  -22.983 11.037  1.00 30.10 ? 111 GLY A N   1 
ATOM   849  C  CA  . GLY A 1 120 ? 15.096  -24.277 11.254  1.00 29.59 ? 111 GLY A CA  1 
ATOM   850  C  C   . GLY A 1 120 ? 13.856  -24.497 10.416  1.00 30.55 ? 111 GLY A C   1 
ATOM   851  O  O   . GLY A 1 120 ? 13.696  -25.532 9.778   1.00 30.39 ? 111 GLY A O   1 
ATOM   852  N  N   . SER A 1 121 ? 12.963  -23.523 10.427  1.00 28.49 ? 112 SER A N   1 
ATOM   853  C  CA  . SER A 1 121 ? 11.744  -23.551 9.622   1.00 28.24 ? 112 SER A CA  1 
ATOM   854  C  C   . SER A 1 121 ? 11.300  -22.113 9.386   1.00 27.59 ? 112 SER A C   1 
ATOM   855  O  O   . SER A 1 121 ? 11.756  -21.196 10.066  1.00 27.85 ? 112 SER A O   1 
ATOM   856  C  CB  . SER A 1 121 ? 10.620  -24.294 10.345  1.00 29.07 ? 112 SER A CB  1 
ATOM   857  O  OG  . SER A 1 121 ? 10.286  -23.652 11.568  1.00 27.34 ? 112 SER A OG  1 
ATOM   858  N  N   . PHE A 1 122 ? 10.375  -21.947 8.457   1.00 26.03 ? 113 PHE A N   1 
ATOM   859  C  CA  . PHE A 1 122 ? 9.763   -20.625 8.219   1.00 26.14 ? 113 PHE A CA  1 
ATOM   860  C  C   . PHE A 1 122 ? 9.005   -20.161 9.450   1.00 25.92 ? 113 PHE A C   1 
ATOM   861  O  O   . PHE A 1 122 ? 9.139   -19.004 9.876   1.00 24.88 ? 113 PHE A O   1 
ATOM   862  C  CB  . PHE A 1 122 ? 8.873   -20.697 6.990   1.00 25.33 ? 113 PHE A CB  1 
ATOM   863  C  CG  . PHE A 1 122 ? 8.073   -19.462 6.706   1.00 22.45 ? 113 PHE A CG  1 
ATOM   864  C  CD1 . PHE A 1 122 ? 8.666   -18.201 6.652   1.00 22.07 ? 113 PHE A CD1 1 
ATOM   865  C  CD2 . PHE A 1 122 ? 6.724   -19.571 6.383   1.00 25.61 ? 113 PHE A CD2 1 
ATOM   866  C  CE1 . PHE A 1 122 ? 7.898   -17.059 6.319   1.00 23.95 ? 113 PHE A CE1 1 
ATOM   867  C  CE2 . PHE A 1 122 ? 5.976   -18.448 6.022   1.00 23.02 ? 113 PHE A CE2 1 
ATOM   868  C  CZ  . PHE A 1 122 ? 6.558   -17.200 6.009   1.00 25.43 ? 113 PHE A CZ  1 
ATOM   869  N  N   . ASP A 1 123 ? 8.234   -21.054 10.059  1.00 26.42 ? 114 ASP A N   1 
ATOM   870  C  CA  . ASP A 1 123 ? 7.488   -20.681 11.272  1.00 27.12 ? 114 ASP A CA  1 
ATOM   871  C  C   . ASP A 1 123 ? 8.383   -20.194 12.390  1.00 27.50 ? 114 ASP A C   1 
ATOM   872  O  O   . ASP A 1 123 ? 8.049   -19.218 13.090  1.00 25.47 ? 114 ASP A O   1 
ATOM   873  C  CB  . ASP A 1 123 ? 6.640   -21.857 11.781  1.00 28.81 ? 114 ASP A CB  1 
ATOM   874  C  CG  . ASP A 1 123 ? 5.476   -22.161 10.864  1.00 33.59 ? 114 ASP A CG  1 
ATOM   875  O  OD1 . ASP A 1 123 ? 5.312   -21.458 9.853   1.00 37.75 ? 114 ASP A OD1 1 
ATOM   876  O  OD2 . ASP A 1 123 ? 4.747   -23.134 11.133  1.00 39.24 ? 114 ASP A OD2 1 
ATOM   877  N  N   . ALA A 1 124 ? 9.559   -20.810 12.530  1.00 28.07 ? 115 ALA A N   1 
ATOM   878  C  CA  . ALA A 1 124 ? 10.480  -20.399 13.602  1.00 26.51 ? 115 ALA A CA  1 
ATOM   879  C  C   . ALA A 1 124 ? 11.033  -18.979 13.299  1.00 25.71 ? 115 ALA A C   1 
ATOM   880  O  O   . ALA A 1 124 ? 11.148  -18.083 14.205  1.00 21.66 ? 115 ALA A O   1 
ATOM   881  C  CB  . ALA A 1 124 ? 11.573  -21.394 13.733  1.00 29.50 ? 115 ALA A CB  1 
ATOM   882  N  N   . PHE A 1 125 ? 11.319  -18.763 12.016  1.00 24.98 ? 116 PHE A N   1 
ATOM   883  C  CA  . PHE A 1 125 ? 11.760  -17.458 11.513  1.00 25.75 ? 116 PHE A CA  1 
ATOM   884  C  C   . PHE A 1 125 ? 10.701  -16.397 11.843  1.00 24.78 ? 116 PHE A C   1 
ATOM   885  O  O   . PHE A 1 125 ? 11.036  -15.386 12.441  1.00 24.24 ? 116 PHE A O   1 
ATOM   886  C  CB  . PHE A 1 125 ? 12.060  -17.442 9.992   1.00 25.02 ? 116 PHE A CB  1 
ATOM   887  C  CG  . PHE A 1 125 ? 12.036  -16.073 9.438   1.00 21.98 ? 116 PHE A CG  1 
ATOM   888  C  CD1 . PHE A 1 125 ? 13.037  -15.202 9.772   1.00 18.77 ? 116 PHE A CD1 1 
ATOM   889  C  CD2 . PHE A 1 125 ? 10.941  -15.599 8.688   1.00 23.38 ? 116 PHE A CD2 1 
ATOM   890  C  CE1 . PHE A 1 125 ? 12.992  -13.824 9.313   1.00 18.67 ? 116 PHE A CE1 1 
ATOM   891  C  CE2 . PHE A 1 125 ? 10.864  -14.250 8.266   1.00 21.92 ? 116 PHE A CE2 1 
ATOM   892  C  CZ  . PHE A 1 125 ? 11.885  -13.380 8.564   1.00 21.59 ? 116 PHE A CZ  1 
ATOM   893  N  N   . LYS A 1 126 ? 9.442   -16.653 11.509  1.00 24.08 ? 117 LYS A N   1 
ATOM   894  C  CA  . LYS A 1 126 ? 8.363   -15.682 11.781  1.00 24.23 ? 117 LYS A CA  1 
ATOM   895  C  C   . LYS A 1 126 ? 8.284   -15.349 13.266  1.00 23.72 ? 117 LYS A C   1 
ATOM   896  O  O   . LYS A 1 126 ? 8.157   -14.199 13.625  1.00 21.98 ? 117 LYS A O   1 
ATOM   897  C  CB  . LYS A 1 126 ? 7.027   -16.190 11.276  1.00 24.24 ? 117 LYS A CB  1 
ATOM   898  C  CG  . LYS A 1 126 ? 6.931   -16.226 9.800   1.00 24.87 ? 117 LYS A CG  1 
ATOM   899  C  CD  . LYS A 1 126 ? 5.508   -16.455 9.363   1.00 23.47 ? 117 LYS A CD  1 
ATOM   900  C  CE  . LYS A 1 126 ? 5.096   -17.889 9.552   1.00 25.17 ? 117 LYS A CE  1 
ATOM   901  N  NZ  . LYS A 1 126 ? 3.697   -18.031 8.975   1.00 21.32 ? 117 LYS A NZ  1 
ATOM   902  N  N   . GLU A 1 127 ? 8.387   -16.345 14.119  1.00 24.53 ? 118 GLU A N   1 
ATOM   903  C  CA  . GLU A 1 127 ? 8.400   -16.115 15.571  1.00 27.08 ? 118 GLU A CA  1 
ATOM   904  C  C   . GLU A 1 127 ? 9.545   -15.194 16.041  1.00 26.86 ? 118 GLU A C   1 
ATOM   905  O  O   . GLU A 1 127 ? 9.342   -14.255 16.821  1.00 24.11 ? 118 GLU A O   1 
ATOM   906  C  CB  . GLU A 1 127 ? 8.398   -17.463 16.299  1.00 27.27 ? 118 GLU A CB  1 
ATOM   907  C  CG  . GLU A 1 127 ? 7.095   -18.207 16.134  1.00 38.34 ? 118 GLU A CG  1 
ATOM   908  C  CD  . GLU A 1 127 ? 7.130   -19.671 16.594  1.00 33.89 ? 118 GLU A CD  1 
ATOM   909  O  OE1 . GLU A 1 127 ? 8.129   -20.096 17.239  1.00 54.50 ? 118 GLU A OE1 1 
ATOM   910  O  OE2 . GLU A 1 127 ? 6.144   -20.381 16.289  1.00 56.13 ? 118 GLU A OE2 1 
ATOM   911  N  N   . GLU A 1 128 ? 10.735  -15.419 15.519  1.00 26.99 ? 119 GLU A N   1 
ATOM   912  C  CA  . GLU A 1 128 ? 11.882  -14.596 15.887  1.00 26.13 ? 119 GLU A CA  1 
ATOM   913  C  C   . GLU A 1 128 ? 11.710  -13.156 15.384  1.00 23.50 ? 119 GLU A C   1 
ATOM   914  O  O   . GLU A 1 128 ? 12.008  -12.224 16.111  1.00 23.77 ? 119 GLU A O   1 
ATOM   915  C  CB  . GLU A 1 128 ? 13.173  -15.179 15.344  1.00 25.94 ? 119 GLU A CB  1 
ATOM   916  C  CG  . GLU A 1 128 ? 14.435  -14.388 15.775  1.00 27.20 ? 119 GLU A CG  1 
ATOM   917  C  CD  . GLU A 1 128 ? 15.766  -15.093 15.471  1.00 30.21 ? 119 GLU A CD  1 
ATOM   918  O  OE1 . GLU A 1 128 ? 15.740  -16.330 15.279  1.00 30.72 ? 119 GLU A OE1 1 
ATOM   919  O  OE2 . GLU A 1 128 ? 16.831  -14.407 15.440  1.00 35.08 ? 119 GLU A OE2 1 
ATOM   920  N  N   . PHE A 1 129 ? 11.237  -13.013 14.145  1.00 24.30 ? 120 PHE A N   1 
ATOM   921  C  CA  . PHE A 1 129 ? 10.955  -11.667 13.534  1.00 23.38 ? 120 PHE A CA  1 
ATOM   922  C  C   . PHE A 1 129 ? 9.867   -10.918 14.329  1.00 23.32 ? 120 PHE A C   1 
ATOM   923  O  O   . PHE A 1 129 ? 10.011  -9.748  14.639  1.00 22.84 ? 120 PHE A O   1 
ATOM   924  C  CB  . PHE A 1 129 ? 10.543  -11.825 12.073  1.00 24.91 ? 120 PHE A CB  1 
ATOM   925  C  CG  . PHE A 1 129 ? 10.401  -10.491 11.312  1.00 22.91 ? 120 PHE A CG  1 
ATOM   926  C  CD1 . PHE A 1 129 ? 11.412  -10.022 10.517  1.00 16.83 ? 120 PHE A CD1 1 
ATOM   927  C  CD2 . PHE A 1 129 ? 9.242   -9.752  11.375  1.00 22.05 ? 120 PHE A CD2 1 
ATOM   928  C  CE1 . PHE A 1 129 ? 11.289  -8.844  9.790   1.00 20.98 ? 120 PHE A CE1 1 
ATOM   929  C  CE2 . PHE A 1 129 ? 9.117   -8.539  10.674  1.00 18.62 ? 120 PHE A CE2 1 
ATOM   930  C  CZ  . PHE A 1 129 ? 10.135  -8.096  9.872   1.00 21.03 ? 120 PHE A CZ  1 
ATOM   931  N  N   . ALA A 1 130 ? 8.817   -11.642 14.693  1.00 21.92 ? 121 ALA A N   1 
ATOM   932  C  CA  . ALA A 1 130 ? 7.694   -11.118 15.470  1.00 25.06 ? 121 ALA A CA  1 
ATOM   933  C  C   . ALA A 1 130 ? 8.143   -10.623 16.838  1.00 25.79 ? 121 ALA A C   1 
ATOM   934  O  O   . ALA A 1 130 ? 7.714   -9.541  17.305  1.00 24.10 ? 121 ALA A O   1 
ATOM   935  C  CB  . ALA A 1 130 ? 6.631   -12.186 15.602  1.00 25.53 ? 121 ALA A CB  1 
ATOM   936  N  N   . LYS A 1 131 ? 9.030   -11.384 17.469  1.00 26.91 ? 122 LYS A N   1 
ATOM   937  C  CA  . LYS A 1 131 ? 9.644   -10.975 18.722  1.00 26.21 ? 122 LYS A CA  1 
ATOM   938  C  C   . LYS A 1 131 ? 10.524  -9.741  18.629  1.00 24.86 ? 122 LYS A C   1 
ATOM   939  O  O   . LYS A 1 131 ? 10.472  -8.890  19.519  1.00 26.89 ? 122 LYS A O   1 
ATOM   940  C  CB  . LYS A 1 131 ? 10.404  -12.139 19.362  1.00 28.18 ? 122 LYS A CB  1 
ATOM   941  C  CG  . LYS A 1 131 ? 10.921  -11.828 20.775  1.00 29.32 ? 122 LYS A CG  1 
ATOM   942  C  CD  . LYS A 1 131 ? 10.744  -13.014 21.748  1.00 33.45 ? 122 LYS A CD  1 
ATOM   943  C  CE  . LYS A 1 131 ? 11.959  -13.916 21.874  1.00 55.57 ? 122 LYS A CE  1 
ATOM   944  N  NZ  . LYS A 1 131 ? 11.717  -14.972 22.950  1.00 48.84 ? 122 LYS A NZ  1 
ATOM   945  N  N   . ALA A 1 132 ? 11.343  -9.641  17.580  1.00 23.39 ? 123 ALA A N   1 
ATOM   946  C  CA  . ALA A 1 132 ? 12.144  -8.446  17.328  1.00 23.16 ? 123 ALA A CA  1 
ATOM   947  C  C   . ALA A 1 132 ? 11.244  -7.221  17.166  1.00 23.09 ? 123 ALA A C   1 
ATOM   948  O  O   . ALA A 1 132 ? 11.518  -6.178  17.727  1.00 24.94 ? 123 ALA A O   1 
ATOM   949  C  CB  . ALA A 1 132 ? 13.074  -8.631  16.099  1.00 24.59 ? 123 ALA A CB  1 
ATOM   950  N  N   . GLY A 1 133 ? 10.157  -7.376  16.420  1.00 21.93 ? 124 GLY A N   1 
ATOM   951  C  CA  . GLY A 1 133 ? 9.235   -6.292  16.181  1.00 23.80 ? 124 GLY A CA  1 
ATOM   952  C  C   . GLY A 1 133 ? 8.520   -5.867  17.451  1.00 23.51 ? 124 GLY A C   1 
ATOM   953  O  O   . GLY A 1 133 ? 8.336   -4.655  17.710  1.00 22.77 ? 124 GLY A O   1 
ATOM   954  N  N   . ALA A 1 134 ? 8.035   -6.858  18.203  1.00 22.04 ? 125 ALA A N   1 
ATOM   955  C  CA  . ALA A 1 134 ? 7.259   -6.542  19.409  1.00 23.67 ? 125 ALA A CA  1 
ATOM   956  C  C   . ALA A 1 134 ? 8.114   -5.837  20.450  1.00 24.85 ? 125 ALA A C   1 
ATOM   957  O  O   . ALA A 1 134 ? 7.630   -4.895  21.156  1.00 25.42 ? 125 ALA A O   1 
ATOM   958  C  CB  . ALA A 1 134 ? 6.650   -7.785  19.968  1.00 25.70 ? 125 ALA A CB  1 
ATOM   959  N  N   . THR A 1 135 ? 9.382   -6.245  20.534  1.00 23.00 ? 126 THR A N   1 
ATOM   960  C  CA  . THR A 1 135 ? 10.292  -5.759  21.586  1.00 24.93 ? 126 THR A CA  1 
ATOM   961  C  C   . THR A 1 135 ? 11.061  -4.481  21.239  1.00 27.04 ? 126 THR A C   1 
ATOM   962  O  O   . THR A 1 135 ? 11.790  -3.962  22.082  1.00 25.64 ? 126 THR A O   1 
ATOM   963  C  CB  . THR A 1 135 ? 11.323  -6.833  22.018  1.00 24.68 ? 126 THR A CB  1 
ATOM   964  O  OG1 . THR A 1 135 ? 12.161  -7.151  20.921  1.00 30.50 ? 126 THR A OG1 1 
ATOM   965  C  CG2 . THR A 1 135 ? 10.620  -8.094  22.508  1.00 37.18 ? 126 THR A CG2 1 
ATOM   966  N  N   . ARG A 1 136 ? 10.880  -3.956  20.028  1.00 25.99 ? 127 ARG A N   1 
ATOM   967  C  CA  . ARG A 1 136 ? 11.525  -2.693  19.659  1.00 25.25 ? 127 ARG A CA  1 
ATOM   968  C  C   . ARG A 1 136 ? 10.756  -1.600  20.397  1.00 23.65 ? 127 ARG A C   1 
ATOM   969  O  O   . ARG A 1 136 ? 9.620   -1.249  20.000  1.00 24.75 ? 127 ARG A O   1 
ATOM   970  C  CB  . ARG A 1 136 ? 11.548  -2.505  18.132  1.00 25.73 ? 127 ARG A CB  1 
ATOM   971  C  CG  . ARG A 1 136 ? 11.919  -1.103  17.566  1.00 25.20 ? 127 ARG A CG  1 
ATOM   972  C  CD  . ARG A 1 136 ? 13.129  -0.449  18.145  1.00 23.36 ? 127 ARG A CD  1 
ATOM   973  N  NE  . ARG A 1 136 ? 14.360  -1.208  17.987  1.00 24.30 ? 127 ARG A NE  1 
ATOM   974  C  CZ  . ARG A 1 136 ? 15.531  -0.795  18.465  1.00 26.20 ? 127 ARG A CZ  1 
ATOM   975  N  NH1 . ARG A 1 136 ? 15.615  0.370   19.111  1.00 24.73 ? 127 ARG A NH1 1 
ATOM   976  N  NH2 . ARG A 1 136 ? 16.626  -1.510  18.270  1.00 26.41 ? 127 ARG A NH2 1 
ATOM   977  N  N   . PHE A 1 137 ? 11.338  -1.128  21.493  1.00 22.48 ? 128 PHE A N   1 
ATOM   978  C  CA  . PHE A 1 137 ? 10.624  -0.139  22.382  1.00 22.63 ? 128 PHE A CA  1 
ATOM   979  C  C   . PHE A 1 137 ? 10.715  1.280   21.801  1.00 21.79 ? 128 PHE A C   1 
ATOM   980  O  O   . PHE A 1 137 ? 11.807  1.787   21.562  1.00 23.04 ? 128 PHE A O   1 
ATOM   981  C  CB  . PHE A 1 137 ? 11.234  -0.168  23.796  1.00 22.83 ? 128 PHE A CB  1 
ATOM   982  C  CG  . PHE A 1 137 ? 10.406  0.550   24.811  1.00 22.47 ? 128 PHE A CG  1 
ATOM   983  C  CD1 . PHE A 1 137 ? 9.282   -0.065  25.336  1.00 20.84 ? 128 PHE A CD1 1 
ATOM   984  C  CD2 . PHE A 1 137 ? 10.740  1.813   25.238  1.00 25.66 ? 128 PHE A CD2 1 
ATOM   985  C  CE1 . PHE A 1 137 ? 8.487   0.581   26.266  1.00 30.41 ? 128 PHE A CE1 1 
ATOM   986  C  CE2 . PHE A 1 137 ? 9.965   2.461   26.188  1.00 31.00 ? 128 PHE A CE2 1 
ATOM   987  C  CZ  . PHE A 1 137 ? 8.826   1.848   26.695  1.00 25.47 ? 128 PHE A CZ  1 
ATOM   988  N  N   . GLY A 1 138 ? 9.553   1.899   21.584  1.00 19.11 ? 129 GLY A N   1 
ATOM   989  C  CA  . GLY A 1 138 ? 9.448   3.201   20.923  1.00 20.65 ? 129 GLY A CA  1 
ATOM   990  C  C   . GLY A 1 138 ? 9.309   2.979   19.423  1.00 19.76 ? 129 GLY A C   1 
ATOM   991  O  O   . GLY A 1 138 ? 8.653   2.044   18.990  1.00 19.22 ? 129 GLY A O   1 
ATOM   992  N  N   . SER A 1 139 ? 9.919   3.848   18.645  1.00 18.85 ? 130 SER A N   1 
ATOM   993  C  CA  . SER A 1 139 ? 9.772   3.853   17.213  1.00 20.38 ? 130 SER A CA  1 
ATOM   994  C  C   . SER A 1 139 ? 10.927  3.073   16.573  1.00 19.80 ? 130 SER A C   1 
ATOM   995  O  O   . SER A 1 139 ? 12.057  3.080   17.095  1.00 20.14 ? 130 SER A O   1 
ATOM   996  C  CB  . SER A 1 139 ? 9.784   5.307   16.695  1.00 22.66 ? 130 SER A CB  1 
ATOM   997  O  OG  . SER A 1 139 ? 8.736   6.088   17.270  1.00 20.07 ? 130 SER A OG  1 
ATOM   998  N  N   . GLY A 1 140 ? 10.617  2.358   15.493  1.00 19.02 ? 131 GLY A N   1 
ATOM   999  C  CA  . GLY A 1 140 ? 11.620  1.722   14.675  1.00 19.36 ? 131 GLY A CA  1 
ATOM   1000 C  C   . GLY A 1 140 ? 11.142  0.735   13.617  1.00 18.68 ? 131 GLY A C   1 
ATOM   1001 O  O   . GLY A 1 140 ? 9.975   0.761   13.165  1.00 17.74 ? 131 GLY A O   1 
ATOM   1002 N  N   . TRP A 1 141 ? 12.062  -0.183  13.289  1.00 19.30 ? 132 TRP A N   1 
ATOM   1003 C  CA  . TRP A 1 141 ? 11.916  -1.145  12.199  1.00 20.34 ? 132 TRP A CA  1 
ATOM   1004 C  C   . TRP A 1 141 ? 12.421  -2.526  12.639  1.00 20.46 ? 132 TRP A C   1 
ATOM   1005 O  O   . TRP A 1 141 ? 13.421  -2.613  13.388  1.00 20.01 ? 132 TRP A O   1 
ATOM   1006 C  CB  . TRP A 1 141 ? 12.746  -0.682  10.988  1.00 16.50 ? 132 TRP A CB  1 
ATOM   1007 C  CG  . TRP A 1 141 ? 12.134  0.488   10.239  1.00 21.03 ? 132 TRP A CG  1 
ATOM   1008 C  CD1 . TRP A 1 141 ? 12.228  1.803   10.584  1.00 18.31 ? 132 TRP A CD1 1 
ATOM   1009 C  CD2 . TRP A 1 141 ? 11.387  0.460   9.002   1.00 16.26 ? 132 TRP A CD2 1 
ATOM   1010 N  NE1 . TRP A 1 141 ? 11.540  2.583   9.699   1.00 20.04 ? 132 TRP A NE1 1 
ATOM   1011 C  CE2 . TRP A 1 141 ? 10.998  1.789   8.722   1.00 15.20 ? 132 TRP A CE2 1 
ATOM   1012 C  CE3 . TRP A 1 141 ? 10.946  -0.549  8.155   1.00 14.69 ? 132 TRP A CE3 1 
ATOM   1013 C  CZ2 . TRP A 1 141 ? 10.284  2.127   7.598   1.00 19.99 ? 132 TRP A CZ2 1 
ATOM   1014 C  CZ3 . TRP A 1 141 ? 10.239  -0.193  7.006   1.00 18.45 ? 132 TRP A CZ3 1 
ATOM   1015 C  CH2 . TRP A 1 141 ? 9.890   1.106   6.769   1.00 21.92 ? 132 TRP A CH2 1 
ATOM   1016 N  N   . ALA A 1 142 ? 11.747  -3.565  12.141  1.00 18.00 ? 133 ALA A N   1 
ATOM   1017 C  CA  . ALA A 1 142 ? 12.224  -4.954  12.267  1.00 19.82 ? 133 ALA A CA  1 
ATOM   1018 C  C   . ALA A 1 142 ? 12.659  -5.422  10.879  1.00 19.16 ? 133 ALA A C   1 
ATOM   1019 O  O   . ALA A 1 142 ? 11.998  -5.082  9.877   1.00 19.82 ? 133 ALA A O   1 
ATOM   1020 C  CB  . ALA A 1 142 ? 11.176  -5.855  12.813  1.00 23.10 ? 133 ALA A CB  1 
ATOM   1021 N  N   . TRP A 1 143 ? 13.747  -6.205  10.833  1.00 18.37 ? 134 TRP A N   1 
ATOM   1022 C  CA  . TRP A 1 143 ? 14.444  -6.584  9.581   1.00 19.82 ? 134 TRP A CA  1 
ATOM   1023 C  C   . TRP A 1 143 ? 14.914  -8.061  9.547   1.00 20.00 ? 134 TRP A C   1 
ATOM   1024 O  O   . TRP A 1 143 ? 15.231  -8.681  10.582  1.00 19.72 ? 134 TRP A O   1 
ATOM   1025 C  CB  . TRP A 1 143 ? 15.721  -5.762  9.353   1.00 21.91 ? 134 TRP A CB  1 
ATOM   1026 C  CG  . TRP A 1 143 ? 15.609  -4.268  9.468   1.00 20.71 ? 134 TRP A CG  1 
ATOM   1027 C  CD1 . TRP A 1 143 ? 15.914  -3.510  10.572  1.00 23.92 ? 134 TRP A CD1 1 
ATOM   1028 C  CD2 . TRP A 1 143 ? 15.230  -3.356  8.440   1.00 18.35 ? 134 TRP A CD2 1 
ATOM   1029 N  NE1 . TRP A 1 143 ? 15.722  -2.186  10.301  1.00 23.35 ? 134 TRP A NE1 1 
ATOM   1030 C  CE2 . TRP A 1 143 ? 15.330  -2.044  8.992   1.00 18.66 ? 134 TRP A CE2 1 
ATOM   1031 C  CE3 . TRP A 1 143 ? 14.865  -3.500  7.092   1.00 16.57 ? 134 TRP A CE3 1 
ATOM   1032 C  CZ2 . TRP A 1 143 ? 15.014  -0.901  8.265   1.00 21.19 ? 134 TRP A CZ2 1 
ATOM   1033 C  CZ3 . TRP A 1 143 ? 14.545  -2.319  6.348   1.00 22.19 ? 134 TRP A CZ3 1 
ATOM   1034 C  CH2 . TRP A 1 143 ? 14.631  -1.048  6.951   1.00 18.42 ? 134 TRP A CH2 1 
ATOM   1035 N  N   . LEU A 1 144 ? 14.932  -8.584  8.336   1.00 21.35 ? 135 LEU A N   1 
ATOM   1036 C  CA  . LEU A 1 144 ? 15.739  -9.740  7.973   1.00 21.52 ? 135 LEU A CA  1 
ATOM   1037 C  C   . LEU A 1 144 ? 16.779  -9.202  7.034   1.00 21.40 ? 135 LEU A C   1 
ATOM   1038 O  O   . LEU A 1 144 ? 16.469  -8.594  6.030   1.00 19.81 ? 135 LEU A O   1 
ATOM   1039 C  CB  . LEU A 1 144 ? 14.897  -10.820 7.324   1.00 20.73 ? 135 LEU A CB  1 
ATOM   1040 C  CG  . LEU A 1 144 ? 15.659  -12.025 6.687   1.00 22.25 ? 135 LEU A CG  1 
ATOM   1041 C  CD1 . LEU A 1 144 ? 16.302  -12.876 7.788   1.00 23.25 ? 135 LEU A CD1 1 
ATOM   1042 C  CD2 . LEU A 1 144 ? 14.731  -12.862 5.814   1.00 23.70 ? 135 LEU A CD2 1 
ATOM   1043 N  N   . VAL A 1 145 ? 18.042  -9.377  7.412   1.00 20.94 ? 136 VAL A N   1 
ATOM   1044 C  CA  . VAL A 1 145 ? 19.124  -8.835  6.682   1.00 21.42 ? 136 VAL A CA  1 
ATOM   1045 C  C   . VAL A 1 145 ? 20.100  -9.990  6.342   1.00 25.16 ? 136 VAL A C   1 
ATOM   1046 O  O   . VAL A 1 145 ? 20.055  -11.063 6.980   1.00 22.89 ? 136 VAL A O   1 
ATOM   1047 C  CB  . VAL A 1 145 ? 19.936  -7.747  7.510   1.00 21.75 ? 136 VAL A CB  1 
ATOM   1048 C  CG1 . VAL A 1 145 ? 19.027  -6.578  7.971   1.00 23.40 ? 136 VAL A CG1 1 
ATOM   1049 C  CG2 . VAL A 1 145 ? 20.636  -8.376  8.692   1.00 26.58 ? 136 VAL A CG2 1 
ATOM   1050 N  N   . VAL A 1 146 ? 20.944  -9.690  5.348   1.00 27.77 ? 137 VAL A N   1 
ATOM   1051 C  CA  . VAL A 1 146 ? 22.172  -10.423 5.057   1.00 28.20 ? 137 VAL A CA  1 
ATOM   1052 C  C   . VAL A 1 146 ? 23.359  -9.646  5.643   1.00 28.82 ? 137 VAL A C   1 
ATOM   1053 O  O   . VAL A 1 146 ? 23.586  -8.478  5.295   1.00 27.94 ? 137 VAL A O   1 
ATOM   1054 C  CB  . VAL A 1 146 ? 22.349  -10.599 3.539   1.00 29.41 ? 137 VAL A CB  1 
ATOM   1055 C  CG1 . VAL A 1 146 ? 23.739  -11.294 3.215   1.00 38.27 ? 137 VAL A CG1 1 
ATOM   1056 C  CG2 . VAL A 1 146 ? 21.229  -11.392 2.974   1.00 37.62 ? 137 VAL A CG2 1 
ATOM   1057 N  N   . ASN A 1 147 ? 24.071  -10.298 6.560   1.00 28.62 ? 138 ASN A N   1 
ATOM   1058 C  CA  . ASN A 1 147 ? 25.264  -9.761  7.186   1.00 30.96 ? 138 ASN A CA  1 
ATOM   1059 C  C   . ASN A 1 147 ? 26.482  -10.625 6.763   1.00 31.84 ? 138 ASN A C   1 
ATOM   1060 O  O   . ASN A 1 147 ? 26.702  -11.710 7.289   1.00 31.45 ? 138 ASN A O   1 
ATOM   1061 C  CB  . ASN A 1 147 ? 25.103  -9.781  8.687   1.00 31.72 ? 138 ASN A CB  1 
ATOM   1062 C  CG  . ASN A 1 147 ? 26.290  -9.140  9.436   1.00 30.50 ? 138 ASN A CG  1 
ATOM   1063 O  OD1 . ASN A 1 147 ? 26.374  -9.253  10.657  1.00 51.56 ? 138 ASN A OD1 1 
ATOM   1064 N  ND2 . ASN A 1 147 ? 27.163  -8.457  8.722   1.00 28.54 ? 138 ASN A ND2 1 
ATOM   1065 N  N   . ASN A 1 148 ? 27.188  -10.165 5.747   1.00 33.26 ? 139 ASN A N   1 
ATOM   1066 C  CA  . ASN A 1 148 ? 28.373  -10.867 5.249   1.00 34.60 ? 139 ASN A CA  1 
ATOM   1067 C  C   . ASN A 1 148 ? 28.031  -12.294 4.892   1.00 36.02 ? 139 ASN A C   1 
ATOM   1068 O  O   . ASN A 1 148 ? 28.671  -13.229 5.369   1.00 40.18 ? 139 ASN A O   1 
ATOM   1069 C  CB  . ASN A 1 148 ? 29.509  -10.761 6.284   1.00 35.71 ? 139 ASN A CB  1 
ATOM   1070 C  CG  . ASN A 1 148 ? 30.143  -9.379  6.279   1.00 38.39 ? 139 ASN A CG  1 
ATOM   1071 O  OD1 . ASN A 1 148 ? 30.365  -8.798  5.207   1.00 45.50 ? 139 ASN A OD1 1 
ATOM   1072 N  ND2 . ASN A 1 148 ? 30.419  -8.839  7.460   1.00 46.30 ? 139 ASN A ND2 1 
ATOM   1073 N  N   . GLY A 1 149 ? 26.998  -12.435 4.061   1.00 34.16 ? 140 GLY A N   1 
ATOM   1074 C  CA  . GLY A 1 149 ? 26.523  -13.732 3.569   1.00 33.53 ? 140 GLY A CA  1 
ATOM   1075 C  C   . GLY A 1 149 ? 25.614  -14.536 4.500   1.00 31.39 ? 140 GLY A C   1 
ATOM   1076 O  O   . GLY A 1 149 ? 25.155  -15.595 4.133   1.00 33.43 ? 140 GLY A O   1 
ATOM   1077 N  N   . GLU A 1 150 ? 25.346  -14.036 5.692   1.00 30.65 ? 141 GLU A N   1 
ATOM   1078 C  CA  . GLU A 1 150 ? 24.558  -14.759 6.687   1.00 29.83 ? 141 GLU A CA  1 
ATOM   1079 C  C   . GLU A 1 150 ? 23.227  -14.038 7.063   1.00 28.22 ? 141 GLU A C   1 
ATOM   1080 O  O   . GLU A 1 150 ? 23.236  -12.835 7.282   1.00 26.77 ? 141 GLU A O   1 
ATOM   1081 C  CB  . GLU A 1 150 ? 25.418  -14.950 7.920   1.00 29.20 ? 141 GLU A CB  1 
ATOM   1082 C  CG  . GLU A 1 150 ? 26.507  -15.997 7.716   1.00 42.05 ? 141 GLU A CG  1 
ATOM   1083 C  CD  . GLU A 1 150 ? 25.946  -17.422 7.627   1.00 40.85 ? 141 GLU A CD  1 
ATOM   1084 O  OE1 . GLU A 1 150 ? 25.369  -17.909 8.633   1.00 57.91 ? 141 GLU A OE1 1 
ATOM   1085 O  OE2 . GLU A 1 150 ? 26.082  -18.060 6.556   1.00 63.82 ? 141 GLU A OE2 1 
ATOM   1086 N  N   . LEU A 1 151 ? 22.113  -14.787 7.096   1.00 26.72 ? 142 LEU A N   1 
ATOM   1087 C  CA  . LEU A 1 151 ? 20.816  -14.229 7.491   1.00 27.40 ? 142 LEU A CA  1 
ATOM   1088 C  C   . LEU A 1 151 ? 20.767  -13.929 8.978   1.00 27.15 ? 142 LEU A C   1 
ATOM   1089 O  O   . LEU A 1 151 ? 21.133  -14.757 9.827   1.00 23.12 ? 142 LEU A O   1 
ATOM   1090 C  CB  . LEU A 1 151 ? 19.650  -15.168 7.100   1.00 26.36 ? 142 LEU A CB  1 
ATOM   1091 C  CG  . LEU A 1 151 ? 19.307  -15.268 5.601   1.00 26.93 ? 142 LEU A CG  1 
ATOM   1092 C  CD1 . LEU A 1 151 ? 18.167  -16.317 5.328   1.00 26.96 ? 142 LEU A CD1 1 
ATOM   1093 C  CD2 . LEU A 1 151 ? 18.933  -13.927 5.033   1.00 25.78 ? 142 LEU A CD2 1 
ATOM   1094 N  N   . GLU A 1 152 ? 20.265  -12.740 9.311   1.00 27.92 ? 143 GLU A N   1 
ATOM   1095 C  CA  . GLU A 1 152 ? 20.048  -12.399 10.696  1.00 27.70 ? 143 GLU A CA  1 
ATOM   1096 C  C   . GLU A 1 152 ? 18.790  -11.518 10.824  1.00 25.11 ? 143 GLU A C   1 
ATOM   1097 O  O   . GLU A 1 152 ? 18.516  -10.724 9.955   1.00 24.40 ? 143 GLU A O   1 
ATOM   1098 C  CB  . GLU A 1 152 ? 21.310  -11.739 11.283  1.00 29.75 ? 143 GLU A CB  1 
ATOM   1099 C  CG  . GLU A 1 152 ? 21.260  -10.269 11.570  1.00 42.70 ? 143 GLU A CG  1 
ATOM   1100 C  CD  . GLU A 1 152 ? 22.621  -9.672  12.040  1.00 32.12 ? 143 GLU A CD  1 
ATOM   1101 O  OE1 . GLU A 1 152 ? 22.645  -9.063  13.140  1.00 57.84 ? 143 GLU A OE1 1 
ATOM   1102 O  OE2 . GLU A 1 152 ? 23.624  -9.813  11.313  1.00 49.06 ? 143 GLU A OE2 1 
ATOM   1103 N  N   . VAL A 1 153 ? 18.054  -11.716 11.911  1.00 27.00 ? 144 VAL A N   1 
ATOM   1104 C  CA  . VAL A 1 153 ? 16.901  -10.868 12.317  1.00 27.00 ? 144 VAL A CA  1 
ATOM   1105 C  C   . VAL A 1 153 ? 17.390  -9.764  13.259  1.00 25.34 ? 144 VAL A C   1 
ATOM   1106 O  O   . VAL A 1 153 ? 18.071  -10.027 14.263  1.00 23.66 ? 144 VAL A O   1 
ATOM   1107 C  CB  . VAL A 1 153 ? 15.824  -11.673 13.070  1.00 26.25 ? 144 VAL A CB  1 
ATOM   1108 C  CG1 . VAL A 1 153 ? 14.812  -10.709 13.777  1.00 27.57 ? 144 VAL A CG1 1 
ATOM   1109 C  CG2 . VAL A 1 153 ? 15.101  -12.566 12.147  1.00 24.42 ? 144 VAL A CG2 1 
ATOM   1110 N  N   . THR A 1 154 ? 17.055  -8.516  12.921  1.00 26.31 ? 145 THR A N   1 
ATOM   1111 C  CA  . THR A 1 154 ? 17.482  -7.379  13.746  1.00 26.30 ? 145 THR A CA  1 
ATOM   1112 C  C   . THR A 1 154 ? 16.354  -6.367  13.854  1.00 25.20 ? 145 THR A C   1 
ATOM   1113 O  O   . THR A 1 154 ? 15.340  -6.502  13.181  1.00 23.35 ? 145 THR A O   1 
ATOM   1114 C  CB  . THR A 1 154 ? 18.686  -6.636  13.139  1.00 26.88 ? 145 THR A CB  1 
ATOM   1115 O  OG1 . THR A 1 154 ? 18.301  -6.020  11.893  1.00 30.11 ? 145 THR A OG1 1 
ATOM   1116 C  CG2 . THR A 1 154 ? 19.832  -7.574  12.885  1.00 35.61 ? 145 THR A CG2 1 
ATOM   1117 N  N   . SER A 1 155 ? 16.560  -5.374  14.721  1.00 25.41 ? 146 SER A N   1 
ATOM   1118 C  CA  . SER A 1 155 ? 15.692  -4.191  14.800  1.00 25.15 ? 146 SER A CA  1 
ATOM   1119 C  C   . SER A 1 155 ? 16.550  -2.953  14.957  1.00 24.62 ? 146 SER A C   1 
ATOM   1120 O  O   . SER A 1 155 ? 17.689  -3.040  15.416  1.00 25.44 ? 146 SER A O   1 
ATOM   1121 C  CB  . SER A 1 155 ? 14.636  -4.290  15.904  1.00 27.33 ? 146 SER A CB  1 
ATOM   1122 O  OG  . SER A 1 155 ? 15.144  -3.923  17.151  1.00 28.26 ? 146 SER A OG  1 
ATOM   1123 N  N   . THR A 1 156 ? 16.052  -1.818  14.457  1.00 23.86 ? 147 THR A N   1 
ATOM   1124 C  CA  . THR A 1 156 ? 16.748  -0.522  14.472  1.00 21.51 ? 147 THR A CA  1 
ATOM   1125 C  C   . THR A 1 156 ? 15.794  0.529   15.036  1.00 23.05 ? 147 THR A C   1 
ATOM   1126 O  O   . THR A 1 156 ? 14.563  0.390   14.869  1.00 21.52 ? 147 THR A O   1 
ATOM   1127 C  CB  . THR A 1 156 ? 17.267  -0.024  13.084  1.00 20.48 ? 147 THR A CB  1 
ATOM   1128 O  OG1 . THR A 1 156 ? 16.228  -0.015  12.089  1.00 21.94 ? 147 THR A OG1 1 
ATOM   1129 C  CG2 . THR A 1 156 ? 18.461  -0.831  12.546  1.00 22.55 ? 147 THR A CG2 1 
ATOM   1130 N  N   . PRO A 1 157 ? 16.348  1.514   15.792  1.00 22.85 ? 148 PRO A N   1 
ATOM   1131 C  CA  . PRO A 1 157 ? 15.526  2.604   16.363  1.00 22.63 ? 148 PRO A CA  1 
ATOM   1132 C  C   . PRO A 1 157 ? 15.254  3.672   15.318  1.00 21.53 ? 148 PRO A C   1 
ATOM   1133 O  O   . PRO A 1 157 ? 16.072  3.877   14.424  1.00 19.59 ? 148 PRO A O   1 
ATOM   1134 C  CB  . PRO A 1 157 ? 16.410  3.163   17.487  1.00 23.14 ? 148 PRO A CB  1 
ATOM   1135 C  CG  . PRO A 1 157 ? 17.802  2.936   16.964  1.00 23.05 ? 148 PRO A CG  1 
ATOM   1136 C  CD  . PRO A 1 157 ? 17.771  1.666   16.135  1.00 22.20 ? 148 PRO A CD  1 
ATOM   1137 N  N   . ASN A 1 158 ? 14.090  4.328   15.421  1.00 19.75 ? 149 ASN A N   1 
ATOM   1138 C  CA  . ASN A 1 158 ? 13.761  5.498   14.619  1.00 21.24 ? 149 ASN A CA  1 
ATOM   1139 C  C   . ASN A 1 158 ? 13.888  5.231   13.107  1.00 21.43 ? 149 ASN A C   1 
ATOM   1140 O  O   . ASN A 1 158 ? 13.196  4.360   12.603  1.00 19.64 ? 149 ASN A O   1 
ATOM   1141 C  CB  . ASN A 1 158 ? 14.555  6.701   15.143  1.00 22.95 ? 149 ASN A CB  1 
ATOM   1142 C  CG  . ASN A 1 158 ? 14.336  6.917   16.649  1.00 22.95 ? 149 ASN A CG  1 
ATOM   1143 O  OD1 . ASN A 1 158 ? 15.267  7.220   17.409  1.00 27.12 ? 149 ASN A OD1 1 
ATOM   1144 N  ND2 . ASN A 1 158 ? 13.113  6.723   17.080  1.00 18.27 ? 149 ASN A ND2 1 
ATOM   1145 N  N   . GLN A 1 159 ? 14.674  6.006   12.374  1.00 20.78 ? 150 GLN A N   1 
ATOM   1146 C  CA  . GLN A 1 159 ? 14.903  5.710   10.939  1.00 21.76 ? 150 GLN A CA  1 
ATOM   1147 C  C   . GLN A 1 159 ? 16.332  5.195   10.634  1.00 20.99 ? 150 GLN A C   1 
ATOM   1148 O  O   . GLN A 1 159 ? 16.803  5.352   9.512   1.00 20.33 ? 150 GLN A O   1 
ATOM   1149 C  CB  . GLN A 1 159 ? 14.595  6.919   10.069  1.00 20.76 ? 150 GLN A CB  1 
ATOM   1150 C  CG  . GLN A 1 159 ? 13.103  7.416   9.980   1.00 20.99 ? 150 GLN A CG  1 
ATOM   1151 C  CD  . GLN A 1 159 ? 12.098  6.331   9.695   1.00 17.69 ? 150 GLN A CD  1 
ATOM   1152 O  OE1 . GLN A 1 159 ? 12.441  5.287   9.075   1.00 19.75 ? 150 GLN A OE1 1 
ATOM   1153 N  NE2 . GLN A 1 159 ? 10.790  6.593   10.079  1.00 19.29 ? 150 GLN A NE2 1 
ATOM   1154 N  N   . ASP A 1 160 ? 17.040  4.665   11.643  1.00 23.08 ? 151 ASP A N   1 
ATOM   1155 C  CA  . ASP A 1 160 ? 18.359  4.069   11.445  1.00 23.06 ? 151 ASP A CA  1 
ATOM   1156 C  C   . ASP A 1 160 ? 18.194  2.880   10.492  1.00 24.60 ? 151 ASP A C   1 
ATOM   1157 O  O   . ASP A 1 160 ? 17.202  2.125   10.585  1.00 21.59 ? 151 ASP A O   1 
ATOM   1158 C  CB  . ASP A 1 160 ? 18.993  3.642   12.767  1.00 21.83 ? 151 ASP A CB  1 
ATOM   1159 C  CG  . ASP A 1 160 ? 19.391  4.811   13.642  1.00 30.40 ? 151 ASP A CG  1 
ATOM   1160 O  OD1 . ASP A 1 160 ? 19.992  4.575   14.706  1.00 30.71 ? 151 ASP A OD1 1 
ATOM   1161 O  OD2 . ASP A 1 160 ? 19.092  5.977   13.301  1.00 25.56 ? 151 ASP A OD2 1 
ATOM   1162 N  N   . SER A 1 161 ? 19.132  2.768   9.553   1.00 22.92 ? 152 SER A N   1 
ATOM   1163 C  CA  . SER A 1 161 ? 19.125  1.716   8.529   1.00 24.66 ? 152 SER A CA  1 
ATOM   1164 C  C   . SER A 1 161 ? 20.252  0.704   8.780   1.00 25.14 ? 152 SER A C   1 
ATOM   1165 O  O   . SER A 1 161 ? 21.358  1.105   9.117   1.00 22.15 ? 152 SER A O   1 
ATOM   1166 C  CB  . SER A 1 161 ? 19.324  2.308   7.153   1.00 26.33 ? 152 SER A CB  1 
ATOM   1167 O  OG  . SER A 1 161 ? 19.563  1.288   6.185   1.00 23.37 ? 152 SER A OG  1 
ATOM   1168 N  N   . PRO A 1 162 ? 19.978  -0.605  8.562   1.00 25.12 ? 153 PRO A N   1 
ATOM   1169 C  CA  . PRO A 1 162 ? 20.991  -1.679  8.565   1.00 26.62 ? 153 PRO A CA  1 
ATOM   1170 C  C   . PRO A 1 162 ? 22.159  -1.392  7.602   1.00 26.60 ? 153 PRO A C   1 
ATOM   1171 O  O   . PRO A 1 162 ? 23.279  -1.780  7.883   1.00 28.41 ? 153 PRO A O   1 
ATOM   1172 C  CB  . PRO A 1 162 ? 20.205  -2.904  8.073   1.00 23.79 ? 153 PRO A CB  1 
ATOM   1173 C  CG  . PRO A 1 162 ? 18.756  -2.558  8.370   1.00 23.45 ? 153 PRO A CG  1 
ATOM   1174 C  CD  . PRO A 1 162 ? 18.639  -1.127  8.178   1.00 23.67 ? 153 PRO A CD  1 
ATOM   1175 N  N   . LEU A 1 163 ? 21.871  -0.742  6.478   1.00 27.99 ? 154 LEU A N   1 
ATOM   1176 C  CA  . LEU A 1 163 ? 22.878  -0.305  5.492   1.00 26.83 ? 154 LEU A CA  1 
ATOM   1177 C  C   . LEU A 1 163 ? 24.056  0.427   6.123   1.00 29.09 ? 154 LEU A C   1 
ATOM   1178 O  O   . LEU A 1 163 ? 25.183  0.330   5.601   1.00 29.99 ? 154 LEU A O   1 
ATOM   1179 C  CB  . LEU A 1 163 ? 22.247  0.644   4.483   1.00 24.83 ? 154 LEU A CB  1 
ATOM   1180 C  CG  . LEU A 1 163 ? 21.246  0.088   3.460   1.00 33.38 ? 154 LEU A CG  1 
ATOM   1181 C  CD1 . LEU A 1 163 ? 20.721  1.183   2.544   1.00 35.39 ? 154 LEU A CD1 1 
ATOM   1182 C  CD2 . LEU A 1 163 ? 21.887  -1.014  2.652   1.00 30.27 ? 154 LEU A CD2 1 
ATOM   1183 N  N   . THR A 1 164 ? 23.783  1.191   7.198   1.00 27.16 ? 155 THR A N   1 
ATOM   1184 C  CA  . THR A 1 164 ? 24.785  2.015   7.863   1.00 27.94 ? 155 THR A CA  1 
ATOM   1185 C  C   . THR A 1 164 ? 25.803  1.122   8.554   1.00 29.87 ? 155 THR A C   1 
ATOM   1186 O  O   . THR A 1 164 ? 26.947  1.531   8.749   1.00 30.01 ? 155 THR A O   1 
ATOM   1187 C  CB  . THR A 1 164 ? 24.138  2.999   8.881   1.00 26.35 ? 155 THR A CB  1 
ATOM   1188 O  OG1 . THR A 1 164 ? 23.165  3.818   8.214   1.00 27.39 ? 155 THR A OG1 1 
ATOM   1189 C  CG2 . THR A 1 164 ? 25.193  3.918   9.556   1.00 26.66 ? 155 THR A CG2 1 
ATOM   1190 N  N   . GLU A 1 165 ? 25.377  -0.089  8.917   1.00 31.15 ? 156 GLU A N   1 
ATOM   1191 C  CA  . GLU A 1 165 ? 26.225  -1.095  9.549   1.00 31.68 ? 156 GLU A CA  1 
ATOM   1192 C  C   . GLU A 1 165 ? 26.677  -2.152  8.520   1.00 30.46 ? 156 GLU A C   1 
ATOM   1193 O  O   . GLU A 1 165 ? 27.029  -3.240  8.915   1.00 31.18 ? 156 GLU A O   1 
ATOM   1194 C  CB  . GLU A 1 165 ? 25.451  -1.853  10.628  1.00 33.18 ? 156 GLU A CB  1 
ATOM   1195 C  CG  . GLU A 1 165 ? 24.695  -1.077  11.687  1.00 40.62 ? 156 GLU A CG  1 
ATOM   1196 C  CD  . GLU A 1 165 ? 23.652  -1.962  12.409  1.00 35.71 ? 156 GLU A CD  1 
ATOM   1197 O  OE1 . GLU A 1 165 ? 24.080  -2.943  13.056  1.00 57.85 ? 156 GLU A OE1 1 
ATOM   1198 O  OE2 . GLU A 1 165 ? 22.410  -1.694  12.315  1.00 52.24 ? 156 GLU A OE2 1 
ATOM   1199 N  N   . GLY A 1 166 ? 26.619  -1.853  7.224   1.00 30.21 ? 157 GLY A N   1 
ATOM   1200 C  CA  . GLY A 1 166 ? 27.020  -2.801  6.181   1.00 30.71 ? 157 GLY A CA  1 
ATOM   1201 C  C   . GLY A 1 166 ? 26.202  -4.091  6.113   1.00 32.09 ? 157 GLY A C   1 
ATOM   1202 O  O   . GLY A 1 166 ? 26.696  -5.158  5.717   1.00 32.55 ? 157 GLY A O   1 
ATOM   1203 N  N   . LYS A 1 167 ? 24.940  -4.007  6.503   1.00 30.57 ? 158 LYS A N   1 
ATOM   1204 C  CA  . LYS A 1 167 ? 24.022  -5.127  6.348   1.00 29.87 ? 158 LYS A CA  1 
ATOM   1205 C  C   . LYS A 1 167 ? 22.945  -4.777  5.345   1.00 29.57 ? 158 LYS A C   1 
ATOM   1206 O  O   . LYS A 1 167 ? 22.469  -3.641  5.338   1.00 32.51 ? 158 LYS A O   1 
ATOM   1207 C  CB  . LYS A 1 167 ? 23.401  -5.420  7.681   1.00 28.00 ? 158 LYS A CB  1 
ATOM   1208 C  CG  . LYS A 1 167 ? 24.369  -5.651  8.736   1.00 36.11 ? 158 LYS A CG  1 
ATOM   1209 C  CD  . LYS A 1 167 ? 23.687  -6.104  10.008  1.00 31.26 ? 158 LYS A CD  1 
ATOM   1210 C  CE  . LYS A 1 167 ? 24.681  -5.974  11.117  1.00 45.50 ? 158 LYS A CE  1 
ATOM   1211 N  NZ  . LYS A 1 167 ? 24.398  -6.834  12.261  1.00 33.23 ? 158 LYS A NZ  1 
ATOM   1212 N  N   . THR A 1 168 ? 22.529  -5.753  4.538   1.00 27.45 ? 159 THR A N   1 
ATOM   1213 C  CA  . THR A 1 168 ? 21.600  -5.560  3.453   1.00 27.03 ? 159 THR A CA  1 
ATOM   1214 C  C   . THR A 1 168 ? 20.179  -6.098  3.790   1.00 25.10 ? 159 THR A C   1 
ATOM   1215 O  O   . THR A 1 168 ? 20.000  -7.274  3.994   1.00 25.95 ? 159 THR A O   1 
ATOM   1216 C  CB  . THR A 1 168 ? 22.063  -6.306  2.178   1.00 29.92 ? 159 THR A CB  1 
ATOM   1217 O  OG1 . THR A 1 168 ? 23.381  -5.875  1.826   1.00 28.45 ? 159 THR A OG1 1 
ATOM   1218 C  CG2 . THR A 1 168 ? 21.140  -6.032  1.023   1.00 28.35 ? 159 THR A CG2 1 
ATOM   1219 N  N   . PRO A 1 169 ? 19.185  -5.207  3.821   1.00 25.39 ? 160 PRO A N   1 
ATOM   1220 C  CA  . PRO A 1 169 ? 17.816  -5.628  4.061   1.00 24.47 ? 160 PRO A CA  1 
ATOM   1221 C  C   . PRO A 1 169 ? 17.255  -6.573  2.968   1.00 23.49 ? 160 PRO A C   1 
ATOM   1222 O  O   . PRO A 1 169 ? 17.362  -6.301  1.738   1.00 24.00 ? 160 PRO A O   1 
ATOM   1223 C  CB  . PRO A 1 169 ? 17.020  -4.315  4.075   1.00 24.95 ? 160 PRO A CB  1 
ATOM   1224 C  CG  . PRO A 1 169 ? 17.993  -3.236  4.195   1.00 27.51 ? 160 PRO A CG  1 
ATOM   1225 C  CD  . PRO A 1 169 ? 19.268  -3.757  3.587   1.00 26.87 ? 160 PRO A CD  1 
ATOM   1226 N  N   . VAL A 1 170 ? 16.606  -7.632  3.442   1.00 23.38 ? 161 VAL A N   1 
ATOM   1227 C  CA  . VAL A 1 170 ? 15.875  -8.572  2.585   1.00 21.05 ? 161 VAL A CA  1 
ATOM   1228 C  C   . VAL A 1 170 ? 14.347  -8.356  2.716   1.00 18.60 ? 161 VAL A C   1 
ATOM   1229 O  O   . VAL A 1 170 ? 13.643  -8.253  1.699   1.00 20.32 ? 161 VAL A O   1 
ATOM   1230 C  CB  . VAL A 1 170 ? 16.244  -10.037 2.920   1.00 22.14 ? 161 VAL A CB  1 
ATOM   1231 C  CG1 . VAL A 1 170 ? 15.426  -11.005 2.052   1.00 23.40 ? 161 VAL A CG1 1 
ATOM   1232 C  CG2 . VAL A 1 170 ? 17.725  -10.295 2.641   1.00 23.53 ? 161 VAL A CG2 1 
ATOM   1233 N  N   . ILE A 1 171 ? 13.856  -8.372  3.956   1.00 19.53 ? 162 ILE A N   1 
ATOM   1234 C  CA  . ILE A 1 171 ? 12.529  -7.829  4.272   1.00 19.78 ? 162 ILE A CA  1 
ATOM   1235 C  C   . ILE A 1 171 ? 12.621  -6.915  5.502   1.00 18.91 ? 162 ILE A C   1 
ATOM   1236 O  O   . ILE A 1 171 ? 13.614  -6.967  6.307   1.00 19.04 ? 162 ILE A O   1 
ATOM   1237 C  CB  . ILE A 1 171 ? 11.467  -8.933  4.466   1.00 20.66 ? 162 ILE A CB  1 
ATOM   1238 C  CG1 . ILE A 1 171 ? 11.667  -9.719  5.759   1.00 24.04 ? 162 ILE A CG1 1 
ATOM   1239 C  CG2 . ILE A 1 171 ? 11.365  -9.841  3.163   1.00 23.82 ? 162 ILE A CG2 1 
ATOM   1240 C  CD1 . ILE A 1 171 ? 10.411  -10.535 6.209   1.00 23.71 ? 162 ILE A CD1 1 
ATOM   1241 N  N   . GLY A 1 172 ? 11.596  -6.080  5.640   1.00 19.37 ? 163 GLY A N   1 
ATOM   1242 C  CA  . GLY A 1 172 ? 11.464  -5.220  6.820   1.00 17.65 ? 163 GLY A CA  1 
ATOM   1243 C  C   . GLY A 1 172 ? 10.045  -4.741  7.034   1.00 17.90 ? 163 GLY A C   1 
ATOM   1244 O  O   . GLY A 1 172 ? 9.200   -4.762  6.086   1.00 17.39 ? 163 GLY A O   1 
ATOM   1245 N  N   . LEU A 1 173 ? 9.774   -4.350  8.280   1.00 18.60 ? 164 LEU A N   1 
ATOM   1246 C  CA  . LEU A 1 173 ? 8.449   -3.915  8.731   1.00 16.61 ? 164 LEU A CA  1 
ATOM   1247 C  C   . LEU A 1 173 ? 8.578   -2.693  9.623   1.00 17.03 ? 164 LEU A C   1 
ATOM   1248 O  O   . LEU A 1 173 ? 9.299   -2.742  10.652  1.00 16.28 ? 164 LEU A O   1 
ATOM   1249 C  CB  . LEU A 1 173 ? 7.765   -5.019  9.552   1.00 18.03 ? 164 LEU A CB  1 
ATOM   1250 C  CG  . LEU A 1 173 ? 6.339   -4.674  10.061  1.00 17.48 ? 164 LEU A CG  1 
ATOM   1251 C  CD1 . LEU A 1 173 ? 5.414   -4.329  8.874   1.00 18.34 ? 164 LEU A CD1 1 
ATOM   1252 C  CD2 . LEU A 1 173 ? 5.767   -5.829  10.878  1.00 20.68 ? 164 LEU A CD2 1 
ATOM   1253 N  N   . ASP A 1 174 ? 7.873   -1.649  9.232   1.00 17.15 ? 165 ASP A N   1 
ATOM   1254 C  CA  . ASP A 1 174 ? 7.769   -0.353  9.951   1.00 16.52 ? 165 ASP A CA  1 
ATOM   1255 C  C   . ASP A 1 174 ? 6.924   -0.604  11.202  1.00 14.63 ? 165 ASP A C   1 
ATOM   1256 O  O   . ASP A 1 174 ? 5.713   -0.949  11.094  1.00 17.58 ? 165 ASP A O   1 
ATOM   1257 C  CB  . ASP A 1 174 ? 7.095   0.680   9.058   1.00 17.52 ? 165 ASP A CB  1 
ATOM   1258 C  CG  . ASP A 1 174 ? 7.133   2.120   9.604   1.00 15.55 ? 165 ASP A CG  1 
ATOM   1259 O  OD1 . ASP A 1 174 ? 7.740   2.357   10.671  1.00 17.52 ? 165 ASP A OD1 1 
ATOM   1260 O  OD2 . ASP A 1 174 ? 6.626   3.064   8.890   1.00 18.21 ? 165 ASP A OD2 1 
ATOM   1261 N  N   . VAL A 1 175 ? 7.542   -0.429  12.365  1.00 16.29 ? 166 VAL A N   1 
ATOM   1262 C  CA  . VAL A 1 175 ? 6.860   -0.498  13.658  1.00 16.57 ? 166 VAL A CA  1 
ATOM   1263 C  C   . VAL A 1 175 ? 6.699   0.842   14.415  1.00 17.12 ? 166 VAL A C   1 
ATOM   1264 O  O   . VAL A 1 175 ? 6.365   0.851   15.608  1.00 19.15 ? 166 VAL A O   1 
ATOM   1265 C  CB  . VAL A 1 175 ? 7.391   -1.659  14.575  1.00 14.76 ? 166 VAL A CB  1 
ATOM   1266 C  CG1 . VAL A 1 175 ? 7.186   -3.008  13.873  1.00 20.78 ? 166 VAL A CG1 1 
ATOM   1267 C  CG2 . VAL A 1 175 ? 8.852   -1.503  14.996  1.00 24.64 ? 166 VAL A CG2 1 
ATOM   1268 N  N   . TRP A 1 176 ? 6.885   1.969   13.722  1.00 17.85 ? 167 TRP A N   1 
ATOM   1269 C  CA  . TRP A 1 176 ? 6.341   3.236   14.180  1.00 18.17 ? 167 TRP A CA  1 
ATOM   1270 C  C   . TRP A 1 176 ? 4.828   3.107   14.311  1.00 18.21 ? 167 TRP A C   1 
ATOM   1271 O  O   . TRP A 1 176 ? 4.113   2.445   13.473  1.00 16.78 ? 167 TRP A O   1 
ATOM   1272 C  CB  . TRP A 1 176 ? 6.654   4.408   13.216  1.00 17.76 ? 167 TRP A CB  1 
ATOM   1273 C  CG  . TRP A 1 176 ? 8.062   4.838   13.219  1.00 18.65 ? 167 TRP A CG  1 
ATOM   1274 C  CD1 . TRP A 1 176 ? 9.190   4.060   12.956  1.00 20.57 ? 167 TRP A CD1 1 
ATOM   1275 C  CD2 . TRP A 1 176 ? 8.536   6.178   13.385  1.00 26.12 ? 167 TRP A CD2 1 
ATOM   1276 N  NE1 . TRP A 1 176 ? 10.306  4.841   12.983  1.00 21.68 ? 167 TRP A NE1 1 
ATOM   1277 C  CE2 . TRP A 1 176 ? 9.956   6.139   13.257  1.00 21.97 ? 167 TRP A CE2 1 
ATOM   1278 C  CE3 . TRP A 1 176 ? 7.906   7.411   13.662  1.00 26.58 ? 167 TRP A CE3 1 
ATOM   1279 C  CZ2 . TRP A 1 176 ? 10.760  7.285   13.380  1.00 24.94 ? 167 TRP A CZ2 1 
ATOM   1280 C  CZ3 . TRP A 1 176 ? 8.725   8.577   13.781  1.00 23.71 ? 167 TRP A CZ3 1 
ATOM   1281 C  CH2 . TRP A 1 176 ? 10.141  8.488   13.639  1.00 23.04 ? 167 TRP A CH2 1 
ATOM   1282 N  N   . GLU A 1 177 ? 4.307   3.689   15.374  1.00 17.09 ? 168 GLU A N   1 
ATOM   1283 C  CA  . GLU A 1 177 ? 2.849   3.601   15.607  1.00 17.46 ? 168 GLU A CA  1 
ATOM   1284 C  C   . GLU A 1 177 ? 2.015   4.148   14.448  1.00 16.05 ? 168 GLU A C   1 
ATOM   1285 O  O   . GLU A 1 177 ? 0.911   3.665   14.183  1.00 18.65 ? 168 GLU A O   1 
ATOM   1286 C  CB  . GLU A 1 177 ? 2.492   4.320   16.929  1.00 16.41 ? 168 GLU A CB  1 
ATOM   1287 C  CG  . GLU A 1 177 ? 2.704   3.393   18.134  1.00 18.49 ? 168 GLU A CG  1 
ATOM   1288 C  CD  . GLU A 1 177 ? 2.722   4.074   19.503  1.00 19.23 ? 168 GLU A CD  1 
ATOM   1289 O  OE1 . GLU A 1 177 ? 2.904   5.305   19.608  1.00 19.26 ? 168 GLU A OE1 1 
ATOM   1290 O  OE2 . GLU A 1 177 ? 2.637   3.309   20.511  1.00 20.62 ? 168 GLU A OE2 1 
ATOM   1291 N  N   . HIS A 1 178 ? 2.529   5.136   13.708  1.00 16.63 ? 169 HIS A N   1 
ATOM   1292 C  CA  . HIS A 1 178 ? 1.765   5.663   12.507  1.00 17.10 ? 169 HIS A CA  1 
ATOM   1293 C  C   . HIS A 1 178 ? 1.444   4.591   11.438  1.00 15.18 ? 169 HIS A C   1 
ATOM   1294 O  O   . HIS A 1 178 ? 0.467   4.691   10.637  1.00 15.75 ? 169 HIS A O   1 
ATOM   1295 C  CB  . HIS A 1 178 ? 2.469   6.884   11.868  1.00 14.78 ? 169 HIS A CB  1 
ATOM   1296 C  CG  . HIS A 1 178 ? 3.838   6.611   11.240  1.00 18.34 ? 169 HIS A CG  1 
ATOM   1297 N  ND1 . HIS A 1 178 ? 4.987   7.246   11.649  1.00 20.41 ? 169 HIS A ND1 1 
ATOM   1298 C  CD2 . HIS A 1 178 ? 4.210   5.806   10.206  1.00 16.29 ? 169 HIS A CD2 1 
ATOM   1299 C  CE1 . HIS A 1 178 ? 6.017   6.813   10.918  1.00 19.37 ? 169 HIS A CE1 1 
ATOM   1300 N  NE2 . HIS A 1 178 ? 5.574   5.942   10.018  1.00 16.49 ? 169 HIS A NE2 1 
ATOM   1301 N  N   . ALA A 1 179 ? 2.287   3.569   11.385  1.00 17.20 ? 170 ALA A N   1 
ATOM   1302 C  CA  . ALA A 1 179 ? 2.169   2.482   10.400  1.00 16.52 ? 170 ALA A CA  1 
ATOM   1303 C  C   . ALA A 1 179 ? 0.984   1.547   10.692  1.00 15.63 ? 170 ALA A C   1 
ATOM   1304 O  O   . ALA A 1 179 ? 0.550   0.798   9.798   1.00 16.31 ? 170 ALA A O   1 
ATOM   1305 C  CB  . ALA A 1 179 ? 3.461   1.697   10.408  1.00 18.67 ? 170 ALA A CB  1 
ATOM   1306 N  N   . TYR A 1 180 ? 0.510   1.548   11.951  1.00 16.55 ? 171 TYR A N   1 
ATOM   1307 C  CA  . TYR A 1 180 ? -0.482  0.580   12.427  1.00 17.86 ? 171 TYR A CA  1 
ATOM   1308 C  C   . TYR A 1 180 ? -1.645  1.076   13.362  1.00 18.71 ? 171 TYR A C   1 
ATOM   1309 O  O   . TYR A 1 180 ? -2.618  0.300   13.548  1.00 19.68 ? 171 TYR A O   1 
ATOM   1310 C  CB  . TYR A 1 180 ? 0.166   -0.624  13.098  1.00 19.54 ? 171 TYR A CB  1 
ATOM   1311 C  CG  . TYR A 1 180 ? 0.921   -0.430  14.434  1.00 18.08 ? 171 TYR A CG  1 
ATOM   1312 C  CD1 . TYR A 1 180 ? 2.307   -0.292  14.464  1.00 13.80 ? 171 TYR A CD1 1 
ATOM   1313 C  CD2 . TYR A 1 180 ? 0.245   -0.403  15.663  1.00 18.35 ? 171 TYR A CD2 1 
ATOM   1314 C  CE1 . TYR A 1 180 ? 2.993   -0.148  15.591  1.00 17.47 ? 171 TYR A CE1 1 
ATOM   1315 C  CE2 . TYR A 1 180 ? 0.941   -0.249  16.834  1.00 19.64 ? 171 TYR A CE2 1 
ATOM   1316 C  CZ  . TYR A 1 180 ? 2.314   -0.156  16.820  1.00 15.49 ? 171 TYR A CZ  1 
ATOM   1317 O  OH  . TYR A 1 180 ? 3.002   0.006   18.011  1.00 17.78 ? 171 TYR A OH  1 
ATOM   1318 N  N   . TYR A 1 181 ? -1.534  2.292   13.912  1.00 16.83 ? 172 TYR A N   1 
ATOM   1319 C  CA  . TYR A 1 181 ? -2.447  2.773   14.970  1.00 18.62 ? 172 TYR A CA  1 
ATOM   1320 C  C   . TYR A 1 181 ? -3.940  2.869   14.479  1.00 21.09 ? 172 TYR A C   1 
ATOM   1321 O  O   . TYR A 1 181 ? -4.861  2.521   15.224  1.00 21.66 ? 172 TYR A O   1 
ATOM   1322 C  CB  . TYR A 1 181 ? -1.912  4.045   15.686  1.00 20.88 ? 172 TYR A CB  1 
ATOM   1323 C  CG  . TYR A 1 181 ? -2.256  4.005   17.157  1.00 18.42 ? 172 TYR A CG  1 
ATOM   1324 C  CD1 . TYR A 1 181 ? -1.485  3.242   18.048  1.00 18.77 ? 172 TYR A CD1 1 
ATOM   1325 C  CD2 . TYR A 1 181 ? -3.438  4.598   17.636  1.00 21.94 ? 172 TYR A CD2 1 
ATOM   1326 C  CE1 . TYR A 1 181 ? -1.851  3.095   19.378  1.00 20.21 ? 172 TYR A CE1 1 
ATOM   1327 C  CE2 . TYR A 1 181 ? -3.784  4.497   18.969  1.00 19.19 ? 172 TYR A CE2 1 
ATOM   1328 C  CZ  . TYR A 1 181 ? -2.972  3.734   19.840  1.00 22.41 ? 172 TYR A CZ  1 
ATOM   1329 O  OH  . TYR A 1 181 ? -3.339  3.584   21.129  1.00 19.48 ? 172 TYR A OH  1 
ATOM   1330 N  N   . LEU A 1 182 ? -4.153  3.300   13.234  1.00 19.24 ? 173 LEU A N   1 
ATOM   1331 C  CA  . LEU A 1 182 ? -5.535  3.508   12.700  1.00 19.16 ? 173 LEU A CA  1 
ATOM   1332 C  C   . LEU A 1 182 ? -6.327  2.193   12.630  1.00 20.99 ? 173 LEU A C   1 
ATOM   1333 O  O   . LEU A 1 182 ? -7.479  2.129   13.076  1.00 25.62 ? 173 LEU A O   1 
ATOM   1334 C  CB  . LEU A 1 182 ? -5.517  4.211   11.360  1.00 20.11 ? 173 LEU A CB  1 
ATOM   1335 C  CG  . LEU A 1 182 ? -5.052  5.678   11.325  1.00 18.87 ? 173 LEU A CG  1 
ATOM   1336 C  CD1 . LEU A 1 182 ? -5.178  6.273   9.930   1.00 25.98 ? 173 LEU A CD1 1 
ATOM   1337 C  CD2 . LEU A 1 182 ? -5.773  6.559   12.392  1.00 31.72 ? 173 LEU A CD2 1 
ATOM   1338 N  N   . ASN A 1 183 ? -5.697  1.127   12.150  1.00 20.83 ? 174 ASN A N   1 
ATOM   1339 C  CA  . ASN A 1 183 ? -6.322  -0.177  12.059  1.00 20.78 ? 174 ASN A CA  1 
ATOM   1340 C  C   . ASN A 1 183 ? -6.165  -1.081  13.318  1.00 22.24 ? 174 ASN A C   1 
ATOM   1341 O  O   . ASN A 1 183 ? -7.061  -1.909  13.566  1.00 24.65 ? 174 ASN A O   1 
ATOM   1342 C  CB  . ASN A 1 183 ? -5.773  -0.939  10.868  1.00 22.24 ? 174 ASN A CB  1 
ATOM   1343 C  CG  . ASN A 1 183 ? -6.776  -1.963  10.296  1.00 23.56 ? 174 ASN A CG  1 
ATOM   1344 O  OD1 . ASN A 1 183 ? -6.376  -3.048  9.889   1.00 44.78 ? 174 ASN A OD1 1 
ATOM   1345 N  ND2 . ASN A 1 183 ? -8.052  -1.563  10.148  1.00 28.06 ? 174 ASN A ND2 1 
ATOM   1346 N  N   . TYR A 1 184 ? -5.047  -0.953  14.057  1.00 20.52 ? 175 TYR A N   1 
ATOM   1347 C  CA  . TYR A 1 184 ? -4.705  -1.895  15.138  1.00 21.16 ? 175 TYR A CA  1 
ATOM   1348 C  C   . TYR A 1 184 ? -4.578  -1.309  16.544  1.00 21.19 ? 175 TYR A C   1 
ATOM   1349 O  O   . TYR A 1 184 ? -4.492  -2.062  17.514  1.00 21.28 ? 175 TYR A O   1 
ATOM   1350 C  CB  . TYR A 1 184 ? -3.446  -2.751  14.796  1.00 21.28 ? 175 TYR A CB  1 
ATOM   1351 C  CG  . TYR A 1 184 ? -3.616  -3.543  13.516  1.00 17.42 ? 175 TYR A CG  1 
ATOM   1352 C  CD1 . TYR A 1 184 ? -3.170  -3.037  12.279  1.00 24.36 ? 175 TYR A CD1 1 
ATOM   1353 C  CD2 . TYR A 1 184 ? -4.220  -4.792  13.528  1.00 23.90 ? 175 TYR A CD2 1 
ATOM   1354 C  CE1 . TYR A 1 184 ? -3.354  -3.734  11.118  1.00 15.20 ? 175 TYR A CE1 1 
ATOM   1355 C  CE2 . TYR A 1 184 ? -4.406  -5.495  12.393  1.00 22.29 ? 175 TYR A CE2 1 
ATOM   1356 C  CZ  . TYR A 1 184 ? -3.943  -4.999  11.176  1.00 19.39 ? 175 TYR A CZ  1 
ATOM   1357 O  OH  . TYR A 1 184 ? -4.226  -5.727  10.044  1.00 18.23 ? 175 TYR A OH  1 
ATOM   1358 N  N   . GLN A 1 185 ? -4.595  0.018   16.641  1.00 21.41 ? 176 GLN A N   1 
ATOM   1359 C  CA  . GLN A 1 185 ? -4.265  0.740   17.862  1.00 21.03 ? 176 GLN A CA  1 
ATOM   1360 C  C   . GLN A 1 185 ? -3.045  0.128   18.543  1.00 20.98 ? 176 GLN A C   1 
ATOM   1361 O  O   . GLN A 1 185 ? -2.019  0.026   17.880  1.00 20.79 ? 176 GLN A O   1 
ATOM   1362 C  CB  . GLN A 1 185 ? -5.514  0.914   18.753  1.00 22.00 ? 176 GLN A CB  1 
ATOM   1363 C  CG  . GLN A 1 185 ? -6.689  1.671   17.991  1.00 23.77 ? 176 GLN A CG  1 
ATOM   1364 C  CD  . GLN A 1 185 ? -7.500  0.766   17.111  1.00 26.92 ? 176 GLN A CD  1 
ATOM   1365 O  OE1 . GLN A 1 185 ? -8.067  -0.230  17.580  1.00 30.56 ? 176 GLN A OE1 1 
ATOM   1366 N  NE2 . GLN A 1 185 ? -7.608  1.111   15.837  1.00 27.76 ? 176 GLN A NE2 1 
ATOM   1367 N  N   . ASN A 1 186 ? -3.137  -0.331  19.809  1.00 19.00 ? 177 ASN A N   1 
ATOM   1368 C  CA  . ASN A 1 186 ? -1.978  -0.823  20.602  1.00 19.45 ? 177 ASN A CA  1 
ATOM   1369 C  C   . ASN A 1 186 ? -1.582  -2.252  20.207  1.00 18.86 ? 177 ASN A C   1 
ATOM   1370 O  O   . ASN A 1 186 ? -0.543  -2.758  20.650  1.00 20.15 ? 177 ASN A O   1 
ATOM   1371 C  CB  . ASN A 1 186 ? -2.285  -0.819  22.133  1.00 18.44 ? 177 ASN A CB  1 
ATOM   1372 C  CG  . ASN A 1 186 ? -3.490  -1.630  22.490  1.00 17.18 ? 177 ASN A CG  1 
ATOM   1373 O  OD1 . ASN A 1 186 ? -3.393  -2.649  23.199  1.00 29.39 ? 177 ASN A OD1 1 
ATOM   1374 N  ND2 . ASN A 1 186 ? -4.639  -1.237  21.974  1.00 16.85 ? 177 ASN A ND2 1 
ATOM   1375 N  N   . ARG A 1 187 ? -2.377  -2.882  19.339  1.00 20.21 ? 178 ARG A N   1 
ATOM   1376 C  CA  . ARG A 1 187 ? -2.191  -4.322  19.034  1.00 20.03 ? 178 ARG A CA  1 
ATOM   1377 C  C   . ARG A 1 187 ? -1.104  -4.541  17.975  1.00 19.25 ? 178 ARG A C   1 
ATOM   1378 O  O   . ARG A 1 187 ? -1.354  -5.089  16.899  1.00 18.95 ? 178 ARG A O   1 
ATOM   1379 C  CB  . ARG A 1 187 ? -3.514  -4.906  18.547  1.00 20.20 ? 178 ARG A CB  1 
ATOM   1380 C  CG  . ARG A 1 187 ? -4.655  -4.869  19.571  1.00 26.90 ? 178 ARG A CG  1 
ATOM   1381 C  CD  . ARG A 1 187 ? -5.985  -5.383  18.943  1.00 23.09 ? 178 ARG A CD  1 
ATOM   1382 N  NE  . ARG A 1 187 ? -6.768  -4.285  18.389  1.00 31.21 ? 178 ARG A NE  1 
ATOM   1383 C  CZ  . ARG A 1 187 ? -7.235  -4.195  17.150  1.00 40.23 ? 178 ARG A CZ  1 
ATOM   1384 N  NH1 . ARG A 1 187 ? -7.004  -5.149  16.262  1.00 39.05 ? 178 ARG A NH1 1 
ATOM   1385 N  NH2 . ARG A 1 187 ? -7.945  -3.119  16.801  1.00 49.31 ? 178 ARG A NH2 1 
ATOM   1386 N  N   . ARG A 1 188 ? 0.121   -4.143  18.293  1.00 21.32 ? 179 ARG A N   1 
ATOM   1387 C  CA  . ARG A 1 188 ? 1.232   -4.328  17.364  1.00 20.56 ? 179 ARG A CA  1 
ATOM   1388 C  C   . ARG A 1 188 ? 1.427   -5.782  16.918  1.00 21.83 ? 179 ARG A C   1 
ATOM   1389 O  O   . ARG A 1 188 ? 1.700   -6.028  15.738  1.00 22.16 ? 179 ARG A O   1 
ATOM   1390 C  CB  . ARG A 1 188 ? 2.533   -3.782  17.937  1.00 19.46 ? 179 ARG A CB  1 
ATOM   1391 C  CG  . ARG A 1 188 ? 3.619   -3.616  16.905  1.00 22.35 ? 179 ARG A CG  1 
ATOM   1392 C  CD  . ARG A 1 188 ? 5.012   -3.409  17.548  1.00 21.85 ? 179 ARG A CD  1 
ATOM   1393 N  NE  . ARG A 1 188 ? 5.160   -2.035  18.079  1.00 19.61 ? 179 ARG A NE  1 
ATOM   1394 C  CZ  . ARG A 1 188 ? 6.319   -1.481  18.454  1.00 26.43 ? 179 ARG A CZ  1 
ATOM   1395 N  NH1 . ARG A 1 188 ? 7.426   -2.184  18.443  1.00 25.01 ? 179 ARG A NH1 1 
ATOM   1396 N  NH2 . ARG A 1 188 ? 6.361   -0.226  18.911  1.00 27.48 ? 179 ARG A NH2 1 
ATOM   1397 N  N   . PRO A 1 189 ? 1.336   -6.762  17.862  1.00 22.76 ? 180 PRO A N   1 
ATOM   1398 C  CA  . PRO A 1 189 ? 1.446   -8.141  17.424  1.00 20.90 ? 180 PRO A CA  1 
ATOM   1399 C  C   . PRO A 1 189 ? 0.449   -8.557  16.349  1.00 19.38 ? 180 PRO A C   1 
ATOM   1400 O  O   . PRO A 1 189 ? 0.798   -9.365  15.467  1.00 17.22 ? 180 PRO A O   1 
ATOM   1401 C  CB  . PRO A 1 189 ? 1.212   -8.925  18.737  1.00 23.53 ? 180 PRO A CB  1 
ATOM   1402 C  CG  . PRO A 1 189 ? 1.652   -7.995  19.801  1.00 21.90 ? 180 PRO A CG  1 
ATOM   1403 C  CD  . PRO A 1 189 ? 1.166   -6.681  19.328  1.00 23.74 ? 180 PRO A CD  1 
ATOM   1404 N  N   . ASP A 1 190 ? -0.781  -8.043  16.396  1.00 19.24 ? 181 ASP A N   1 
ATOM   1405 C  CA  . ASP A 1 190 ? -1.776  -8.334  15.355  1.00 18.57 ? 181 ASP A CA  1 
ATOM   1406 C  C   . ASP A 1 190 ? -1.405  -7.720  13.984  1.00 19.41 ? 181 ASP A C   1 
ATOM   1407 O  O   . ASP A 1 190 ? -1.559  -8.347  12.965  1.00 20.49 ? 181 ASP A O   1 
ATOM   1408 C  CB  . ASP A 1 190 ? -3.138  -7.781  15.731  1.00 20.62 ? 181 ASP A CB  1 
ATOM   1409 C  CG  . ASP A 1 190 ? -3.821  -8.580  16.872  1.00 27.51 ? 181 ASP A CG  1 
ATOM   1410 O  OD1 . ASP A 1 190 ? -3.266  -9.578  17.363  1.00 27.73 ? 181 ASP A OD1 1 
ATOM   1411 O  OD2 . ASP A 1 190 ? -4.916  -8.173  17.231  1.00 28.73 ? 181 ASP A OD2 1 
ATOM   1412 N  N   . TYR A 1 191 ? -0.890  -6.507  14.006  1.00 18.64 ? 182 TYR A N   1 
ATOM   1413 C  CA  . TYR A 1 191 ? -0.297  -5.890  12.805  1.00 18.87 ? 182 TYR A CA  1 
ATOM   1414 C  C   . TYR A 1 191 ? 0.866   -6.720  12.181  1.00 17.55 ? 182 TYR A C   1 
ATOM   1415 O  O   . TYR A 1 191 ? 0.940   -6.886  10.934  1.00 19.72 ? 182 TYR A O   1 
ATOM   1416 C  CB  . TYR A 1 191 ? 0.159   -4.485  13.205  1.00 17.96 ? 182 TYR A CB  1 
ATOM   1417 C  CG  . TYR A 1 191 ? 1.079   -3.749  12.249  1.00 15.49 ? 182 TYR A CG  1 
ATOM   1418 C  CD1 . TYR A 1 191 ? 0.651   -3.348  10.997  1.00 17.78 ? 182 TYR A CD1 1 
ATOM   1419 C  CD2 . TYR A 1 191 ? 2.409   -3.458  12.625  1.00 18.27 ? 182 TYR A CD2 1 
ATOM   1420 C  CE1 . TYR A 1 191 ? 1.528   -2.657  10.127  1.00 14.90 ? 182 TYR A CE1 1 
ATOM   1421 C  CE2 . TYR A 1 191 ? 3.295   -2.729  11.754  1.00 20.47 ? 182 TYR A CE2 1 
ATOM   1422 C  CZ  . TYR A 1 191 ? 2.864   -2.382  10.525  1.00 14.06 ? 182 TYR A CZ  1 
ATOM   1423 O  OH  . TYR A 1 191 ? 3.632   -1.641  9.611   1.00 18.24 ? 182 TYR A OH  1 
ATOM   1424 N  N   . ILE A 1 192 ? 1.798   -7.175  13.016  1.00 19.59 ? 183 ILE A N   1 
ATOM   1425 C  CA  . ILE A 1 192 ? 2.914   -8.026  12.553  1.00 21.18 ? 183 ILE A CA  1 
ATOM   1426 C  C   . ILE A 1 192 ? 2.361   -9.300  11.868  1.00 22.77 ? 183 ILE A C   1 
ATOM   1427 O  O   . ILE A 1 192 ? 2.830   -9.700  10.766  1.00 21.74 ? 183 ILE A O   1 
ATOM   1428 C  CB  . ILE A 1 192 ? 3.951   -8.336  13.701  1.00 20.94 ? 183 ILE A CB  1 
ATOM   1429 C  CG1 . ILE A 1 192 ? 4.590   -7.013  14.158  1.00 18.51 ? 183 ILE A CG1 1 
ATOM   1430 C  CG2 . ILE A 1 192 ? 5.017   -9.361  13.219  1.00 20.11 ? 183 ILE A CG2 1 
ATOM   1431 C  CD1 . ILE A 1 192 ? 5.388   -7.065  15.479  1.00 21.81 ? 183 ILE A CD1 1 
ATOM   1432 N  N   . GLY A 1 193 ? 1.342   -9.903  12.509  1.00 21.76 ? 184 GLY A N   1 
ATOM   1433 C  CA  . GLY A 1 193 ? 0.565   -11.003 11.901  1.00 21.51 ? 184 GLY A CA  1 
ATOM   1434 C  C   . GLY A 1 193 ? 0.047   -10.710 10.522  1.00 20.78 ? 184 GLY A C   1 
ATOM   1435 O  O   . GLY A 1 193 ? 0.191   -11.538 9.611   1.00 20.37 ? 184 GLY A O   1 
ATOM   1436 N  N   . ALA A 1 194 ? -0.546  -9.525  10.370  1.00 19.26 ? 185 ALA A N   1 
ATOM   1437 C  CA  . ALA A 1 194 ? -1.156  -9.085  9.123   1.00 19.25 ? 185 ALA A CA  1 
ATOM   1438 C  C   . ALA A 1 194 ? -0.083  -8.878  8.002   1.00 17.52 ? 185 ALA A C   1 
ATOM   1439 O  O   . ALA A 1 194 ? -0.345  -9.120  6.844   1.00 19.66 ? 185 ALA A O   1 
ATOM   1440 C  CB  . ALA A 1 194 ? -1.945  -7.774  9.330   1.00 19.52 ? 185 ALA A CB  1 
ATOM   1441 N  N   . PHE A 1 195 ? 1.139   -8.492  8.381   1.00 19.14 ? 186 PHE A N   1 
ATOM   1442 C  CA  . PHE A 1 195 ? 2.249   -8.280  7.435   1.00 17.41 ? 186 PHE A CA  1 
ATOM   1443 C  C   . PHE A 1 195 ? 2.589   -9.537  6.657   1.00 16.68 ? 186 PHE A C   1 
ATOM   1444 O  O   . PHE A 1 195 ? 2.908   -9.463  5.454   1.00 16.07 ? 186 PHE A O   1 
ATOM   1445 C  CB  . PHE A 1 195 ? 3.479   -7.892  8.258   1.00 19.00 ? 186 PHE A CB  1 
ATOM   1446 C  CG  . PHE A 1 195 ? 4.802   -7.886  7.507   1.00 17.42 ? 186 PHE A CG  1 
ATOM   1447 C  CD1 . PHE A 1 195 ? 5.037   -7.028  6.453   1.00 19.58 ? 186 PHE A CD1 1 
ATOM   1448 C  CD2 . PHE A 1 195 ? 5.877   -8.657  7.986   1.00 15.80 ? 186 PHE A CD2 1 
ATOM   1449 C  CE1 . PHE A 1 195 ? 6.328   -6.976  5.830   1.00 15.44 ? 186 PHE A CE1 1 
ATOM   1450 C  CE2 . PHE A 1 195 ? 7.105   -8.623  7.325   1.00 17.72 ? 186 PHE A CE2 1 
ATOM   1451 C  CZ  . PHE A 1 195 ? 7.322   -7.773  6.280   1.00 19.04 ? 186 PHE A CZ  1 
ATOM   1452 N  N   . TRP A 1 196 ? 2.496   -10.699 7.319   1.00 15.24 ? 187 TRP A N   1 
ATOM   1453 C  CA  . TRP A 1 196 ? 2.763   -11.990 6.631   1.00 16.65 ? 187 TRP A CA  1 
ATOM   1454 C  C   . TRP A 1 196 ? 1.859   -12.255 5.423   1.00 17.16 ? 187 TRP A C   1 
ATOM   1455 O  O   . TRP A 1 196 ? 2.235   -12.962 4.475   1.00 20.66 ? 187 TRP A O   1 
ATOM   1456 C  CB  . TRP A 1 196 ? 2.698   -13.165 7.653   1.00 16.37 ? 187 TRP A CB  1 
ATOM   1457 C  CG  . TRP A 1 196 ? 3.646   -13.027 8.788   1.00 14.76 ? 187 TRP A CG  1 
ATOM   1458 C  CD1 . TRP A 1 196 ? 3.329   -13.032 10.109  1.00 15.59 ? 187 TRP A CD1 1 
ATOM   1459 C  CD2 . TRP A 1 196 ? 5.085   -12.827 8.726   1.00 18.12 ? 187 TRP A CD2 1 
ATOM   1460 N  NE1 . TRP A 1 196 ? 4.448   -12.854 10.860  1.00 17.93 ? 187 TRP A NE1 1 
ATOM   1461 C  CE2 . TRP A 1 196 ? 5.531   -12.672 10.055  1.00 18.42 ? 187 TRP A CE2 1 
ATOM   1462 C  CE3 . TRP A 1 196 ? 6.019   -12.684 7.677   1.00 21.36 ? 187 TRP A CE3 1 
ATOM   1463 C  CZ2 . TRP A 1 196 ? 6.905   -12.458 10.399  1.00 16.34 ? 187 TRP A CZ2 1 
ATOM   1464 C  CZ3 . TRP A 1 196 ? 7.369   -12.462 8.004   1.00 20.12 ? 187 TRP A CZ3 1 
ATOM   1465 C  CH2 . TRP A 1 196 ? 7.801   -12.364 9.349   1.00 23.35 ? 187 TRP A CH2 1 
ATOM   1466 N  N   . ASN A 1 197 ? 0.700   -11.636 5.380   1.00 18.90 ? 188 ASN A N   1 
ATOM   1467 C  CA  . ASN A 1 197 ? -0.240  -11.814 4.278   1.00 17.50 ? 188 ASN A CA  1 
ATOM   1468 C  C   . ASN A 1 197 ? 0.039   -10.906 3.048   1.00 18.97 ? 188 ASN A C   1 
ATOM   1469 O  O   . ASN A 1 197 ? -0.535  -11.108 1.990   1.00 17.90 ? 188 ASN A O   1 
ATOM   1470 C  CB  . ASN A 1 197 ? -1.652  -11.534 4.789   1.00 18.56 ? 188 ASN A CB  1 
ATOM   1471 C  CG  . ASN A 1 197 ? -2.145  -12.583 5.774   1.00 22.61 ? 188 ASN A CG  1 
ATOM   1472 O  OD1 . ASN A 1 197 ? -2.131  -13.764 5.464   1.00 31.52 ? 188 ASN A OD1 1 
ATOM   1473 N  ND2 . ASN A 1 197 ? -2.605  -12.161 6.917   1.00 23.24 ? 188 ASN A ND2 1 
ATOM   1474 N  N   . VAL A 1 198 ? 0.845   -9.858  3.230   1.00 19.62 ? 189 VAL A N   1 
ATOM   1475 C  CA  . VAL A 1 198 ? 1.194   -8.930  2.157   1.00 18.85 ? 189 VAL A CA  1 
ATOM   1476 C  C   . VAL A 1 198 ? 2.716   -8.850  1.847   1.00 16.00 ? 189 VAL A C   1 
ATOM   1477 O  O   . VAL A 1 198 ? 3.108   -8.171  0.897   1.00 17.10 ? 189 VAL A O   1 
ATOM   1478 C  CB  . VAL A 1 198 ? 0.674   -7.475  2.438   1.00 18.07 ? 189 VAL A CB  1 
ATOM   1479 C  CG1 . VAL A 1 198 ? -0.890  -7.428  2.365   1.00 20.53 ? 189 VAL A CG1 1 
ATOM   1480 C  CG2 . VAL A 1 198 ? 1.160   -6.944  3.733   1.00 17.10 ? 189 VAL A CG2 1 
ATOM   1481 N  N   . VAL A 1 199 ? 3.569   -9.469  2.642   1.00 19.64 ? 190 VAL A N   1 
ATOM   1482 C  CA  . VAL A 1 199 ? 5.029   -9.471  2.308   1.00 20.08 ? 190 VAL A CA  1 
ATOM   1483 C  C   . VAL A 1 199 ? 5.214   -10.227 0.970   1.00 21.68 ? 190 VAL A C   1 
ATOM   1484 O  O   . VAL A 1 199 ? 4.601   -11.239 0.769   1.00 19.46 ? 190 VAL A O   1 
ATOM   1485 C  CB  . VAL A 1 199 ? 5.924   -10.030 3.445   1.00 21.84 ? 190 VAL A CB  1 
ATOM   1486 C  CG1 . VAL A 1 199 ? 5.671   -11.506 3.708   1.00 21.37 ? 190 VAL A CG1 1 
ATOM   1487 C  CG2 . VAL A 1 199 ? 7.417   -9.732  3.215   1.00 22.94 ? 190 VAL A CG2 1 
ATOM   1488 N  N   . ASP A 1 200 ? 6.064   -9.700  0.092   1.00 21.71 ? 191 ASP A N   1 
ATOM   1489 C  CA  . ASP A 1 200 ? 6.252   -10.220 -1.270  1.00 21.68 ? 191 ASP A CA  1 
ATOM   1490 C  C   . ASP A 1 200 ? 7.512   -11.068 -1.293  1.00 21.91 ? 191 ASP A C   1 
ATOM   1491 O  O   . ASP A 1 200 ? 8.652   -10.546 -1.351  1.00 19.85 ? 191 ASP A O   1 
ATOM   1492 C  CB  . ASP A 1 200 ? 6.340   -9.051  -2.238  1.00 20.74 ? 191 ASP A CB  1 
ATOM   1493 C  CG  . ASP A 1 200 ? 6.530   -9.486  -3.690  1.00 26.91 ? 191 ASP A CG  1 
ATOM   1494 O  OD1 . ASP A 1 200 ? 6.931   -10.653 -3.907  1.00 22.49 ? 191 ASP A OD1 1 
ATOM   1495 O  OD2 . ASP A 1 200 ? 6.335   -8.637  -4.594  1.00 23.29 ? 191 ASP A OD2 1 
ATOM   1496 N  N   . TRP A 1 201 ? 7.337   -12.391 -1.221  1.00 21.40 ? 192 TRP A N   1 
ATOM   1497 C  CA  . TRP A 1 201 ? 8.519   -13.271 -1.103  1.00 21.73 ? 192 TRP A CA  1 
ATOM   1498 C  C   . TRP A 1 201 ? 9.291   -13.373 -2.464  1.00 21.67 ? 192 TRP A C   1 
ATOM   1499 O  O   . TRP A 1 201 ? 10.494  -13.692 -2.512  1.00 20.81 ? 192 TRP A O   1 
ATOM   1500 C  CB  . TRP A 1 201 ? 8.120   -14.641 -0.502  1.00 18.88 ? 192 TRP A CB  1 
ATOM   1501 C  CG  . TRP A 1 201 ? 7.810   -14.595 0.970   1.00 16.42 ? 192 TRP A CG  1 
ATOM   1502 C  CD1 . TRP A 1 201 ? 6.574   -14.675 1.554   1.00 22.93 ? 192 TRP A CD1 1 
ATOM   1503 C  CD2 . TRP A 1 201 ? 8.741   -14.374 2.031   1.00 20.22 ? 192 TRP A CD2 1 
ATOM   1504 N  NE1 . TRP A 1 201 ? 6.696   -14.578 2.932   1.00 19.39 ? 192 TRP A NE1 1 
ATOM   1505 C  CE2 . TRP A 1 201 ? 8.013   -14.343 3.235   1.00 21.14 ? 192 TRP A CE2 1 
ATOM   1506 C  CE3 . TRP A 1 201 ? 10.124  -14.179 2.080   1.00 26.28 ? 192 TRP A CE3 1 
ATOM   1507 C  CZ2 . TRP A 1 201 ? 8.625   -14.162 4.461   1.00 16.75 ? 192 TRP A CZ2 1 
ATOM   1508 C  CZ3 . TRP A 1 201 ? 10.724  -13.998 3.280   1.00 24.56 ? 192 TRP A CZ3 1 
ATOM   1509 C  CH2 . TRP A 1 201 ? 9.977   -13.981 4.468   1.00 23.48 ? 192 TRP A CH2 1 
ATOM   1510 N  N   . ASN A 1 202 ? 8.615   -13.101 -3.582  1.00 21.42 ? 193 ASN A N   1 
ATOM   1511 C  CA  . ASN A 1 202 ? 9.327   -13.046 -4.898  1.00 24.91 ? 193 ASN A CA  1 
ATOM   1512 C  C   . ASN A 1 202 ? 10.312  -11.869 -4.902  1.00 25.15 ? 193 ASN A C   1 
ATOM   1513 O  O   . ASN A 1 202 ? 11.474  -11.982 -5.346  1.00 25.04 ? 193 ASN A O   1 
ATOM   1514 C  CB  . ASN A 1 202 ? 8.329   -12.859 -6.061  1.00 24.48 ? 193 ASN A CB  1 
ATOM   1515 C  CG  . ASN A 1 202 ? 7.583   -14.150 -6.456  1.00 29.85 ? 193 ASN A CG  1 
ATOM   1516 O  OD1 . ASN A 1 202 ? 7.776   -15.220 -5.897  1.00 41.04 ? 193 ASN A OD1 1 
ATOM   1517 N  ND2 . ASN A 1 202 ? 6.698   -14.013 -7.433  1.00 30.78 ? 193 ASN A ND2 1 
ATOM   1518 N  N   . ALA A 1 203 ? 9.846   -10.724 -4.379  1.00 24.78 ? 194 ALA A N   1 
ATOM   1519 C  CA  . ALA A 1 203 ? 10.660  -9.504  -4.282  1.00 24.16 ? 194 ALA A CA  1 
ATOM   1520 C  C   . ALA A 1 203 ? 11.796  -9.717  -3.311  1.00 23.51 ? 194 ALA A C   1 
ATOM   1521 O  O   . ALA A 1 203 ? 12.927  -9.297  -3.585  1.00 22.57 ? 194 ALA A O   1 
ATOM   1522 C  CB  . ALA A 1 203 ? 9.773   -8.280  -3.838  1.00 24.44 ? 194 ALA A CB  1 
ATOM   1523 N  N   . ALA A 1 204 ? 11.515  -10.426 -2.203  1.00 23.57 ? 195 ALA A N   1 
ATOM   1524 C  CA  . ALA A 1 204 ? 12.528  -10.701 -1.184  1.00 22.89 ? 195 ALA A CA  1 
ATOM   1525 C  C   . ALA A 1 204 ? 13.615  -11.594 -1.786  1.00 22.64 ? 195 ALA A C   1 
ATOM   1526 O  O   . ALA A 1 204 ? 14.809  -11.440 -1.486  1.00 22.46 ? 195 ALA A O   1 
ATOM   1527 C  CB  . ALA A 1 204 ? 11.911  -11.380 0.018   1.00 22.22 ? 195 ALA A CB  1 
ATOM   1528 N  N   . GLU A 1 205 ? 13.179  -12.572 -2.580  1.00 24.69 ? 196 GLU A N   1 
ATOM   1529 C  CA  . GLU A 1 205 ? 14.150  -13.488 -3.230  1.00 26.26 ? 196 GLU A CA  1 
ATOM   1530 C  C   . GLU A 1 205 ? 15.135  -12.673 -4.067  1.00 25.46 ? 196 GLU A C   1 
ATOM   1531 O  O   . GLU A 1 205 ? 16.326  -12.865 -3.975  1.00 26.34 ? 196 GLU A O   1 
ATOM   1532 C  CB  . GLU A 1 205 ? 13.427  -14.509 -4.107  1.00 26.76 ? 196 GLU A CB  1 
ATOM   1533 C  CG  . GLU A 1 205 ? 14.350  -15.399 -5.006  1.00 26.20 ? 196 GLU A CG  1 
ATOM   1534 C  CD  . GLU A 1 205 ? 15.379  -16.253 -4.239  1.00 35.96 ? 196 GLU A CD  1 
ATOM   1535 O  OE1 . GLU A 1 205 ? 15.464  -16.180 -2.982  1.00 24.94 ? 196 GLU A OE1 1 
ATOM   1536 O  OE2 . GLU A 1 205 ? 16.099  -17.062 -4.909  1.00 32.22 ? 196 GLU A OE2 1 
ATOM   1537 N  N   . LYS A 1 206 ? 14.629  -11.743 -4.846  1.00 27.60 ? 197 LYS A N   1 
ATOM   1538 C  CA  . LYS A 1 206 ? 15.492  -10.864 -5.658  1.00 30.52 ? 197 LYS A CA  1 
ATOM   1539 C  C   . LYS A 1 206 ? 16.500  -10.028 -4.829  1.00 31.18 ? 197 LYS A C   1 
ATOM   1540 O  O   . LYS A 1 206 ? 17.677  -9.889  -5.199  1.00 30.98 ? 197 LYS A O   1 
ATOM   1541 C  CB  . LYS A 1 206 ? 14.628  -9.989  -6.551  1.00 30.00 ? 197 LYS A CB  1 
ATOM   1542 C  CG  . LYS A 1 206 ? 15.393  -9.215  -7.580  1.00 34.02 ? 197 LYS A CG  1 
ATOM   1543 C  CD  . LYS A 1 206 ? 14.461  -8.375  -8.425  1.00 34.99 ? 197 LYS A CD  1 
ATOM   1544 C  CE  . LYS A 1 206 ? 15.218  -7.685  -9.586  1.00 51.16 ? 197 LYS A CE  1 
ATOM   1545 N  NZ  . LYS A 1 206 ? 15.749  -6.362  -9.165  1.00 40.04 ? 197 LYS A NZ  1 
ATOM   1546 N  N   . ARG A 1 207 ? 16.072  -9.512  -3.684  1.00 30.97 ? 198 ARG A N   1 
ATOM   1547 C  CA  . ARG A 1 207 ? 16.979  -8.762  -2.814  1.00 30.47 ? 198 ARG A CA  1 
ATOM   1548 C  C   . ARG A 1 207 ? 18.050  -9.616  -2.192  1.00 30.48 ? 198 ARG A C   1 
ATOM   1549 O  O   . ARG A 1 207 ? 19.191  -9.149  -1.976  1.00 31.05 ? 198 ARG A O   1 
ATOM   1550 C  CB  . ARG A 1 207 ? 16.187  -7.982  -1.765  1.00 30.54 ? 198 ARG A CB  1 
ATOM   1551 C  CG  . ARG A 1 207 ? 15.356  -6.906  -2.441  1.00 31.48 ? 198 ARG A CG  1 
ATOM   1552 C  CD  . ARG A 1 207 ? 14.772  -6.004  -1.487  1.00 32.83 ? 198 ARG A CD  1 
ATOM   1553 N  NE  . ARG A 1 207 ? 14.172  -4.823  -2.109  1.00 37.20 ? 198 ARG A NE  1 
ATOM   1554 C  CZ  . ARG A 1 207 ? 14.763  -3.632  -2.280  1.00 36.33 ? 198 ARG A CZ  1 
ATOM   1555 N  NH1 . ARG A 1 207 ? 16.020  -3.394  -1.876  1.00 41.31 ? 198 ARG A NH1 1 
ATOM   1556 N  NH2 . ARG A 1 207 ? 14.062  -2.639  -2.812  1.00 29.57 ? 198 ARG A NH2 1 
ATOM   1557 N  N   . TYR A 1 208 ? 17.695  -10.868 -1.917  1.00 30.30 ? 199 TYR A N   1 
ATOM   1558 C  CA  . TYR A 1 208 ? 18.626  -11.859 -1.383  1.00 31.27 ? 199 TYR A CA  1 
ATOM   1559 C  C   . TYR A 1 208 ? 19.667  -12.214 -2.450  1.00 31.00 ? 199 TYR A C   1 
ATOM   1560 O  O   . TYR A 1 208 ? 20.828  -12.281 -2.158  1.00 30.02 ? 199 TYR A O   1 
ATOM   1561 C  CB  . TYR A 1 208 ? 17.885  -13.115 -0.960  1.00 29.63 ? 199 TYR A CB  1 
ATOM   1562 C  CG  . TYR A 1 208 ? 18.786  -14.167 -0.395  1.00 29.15 ? 199 TYR A CG  1 
ATOM   1563 C  CD1 . TYR A 1 208 ? 19.416  -13.986 0.827   1.00 21.32 ? 199 TYR A CD1 1 
ATOM   1564 C  CD2 . TYR A 1 208 ? 19.021  -15.345 -1.083  1.00 25.66 ? 199 TYR A CD2 1 
ATOM   1565 C  CE1 . TYR A 1 208 ? 20.254  -14.947 1.338   1.00 29.61 ? 199 TYR A CE1 1 
ATOM   1566 C  CE2 . TYR A 1 208 ? 19.844  -16.324 -0.565  1.00 32.70 ? 199 TYR A CE2 1 
ATOM   1567 C  CZ  . TYR A 1 208 ? 20.474  -16.112 0.635   1.00 32.37 ? 199 TYR A CZ  1 
ATOM   1568 O  OH  . TYR A 1 208 ? 21.309  -17.092 1.134   1.00 30.36 ? 199 TYR A OH  1 
ATOM   1569 N  N   . GLN A 1 209 ? 19.203  -12.470 -3.660  1.00 31.63 ? 200 GLN A N   1 
ATOM   1570 C  CA  . GLN A 1 209 ? 20.096  -12.706 -4.793  1.00 36.45 ? 200 GLN A CA  1 
ATOM   1571 C  C   . GLN A 1 209 ? 21.071  -11.559 -5.068  1.00 38.95 ? 200 GLN A C   1 
ATOM   1572 O  O   . GLN A 1 209 ? 22.224  -11.796 -5.408  1.00 42.03 ? 200 GLN A O   1 
ATOM   1573 C  CB  . GLN A 1 209 ? 19.280  -13.012 -6.049  1.00 35.89 ? 200 GLN A CB  1 
ATOM   1574 C  CG  . GLN A 1 209 ? 18.498  -14.352 -5.995  1.00 36.01 ? 200 GLN A CG  1 
ATOM   1575 C  CD  . GLN A 1 209 ? 19.378  -15.588 -5.878  1.00 36.43 ? 200 GLN A CD  1 
ATOM   1576 O  OE1 . GLN A 1 209 ? 20.611  -15.509 -5.980  1.00 47.43 ? 200 GLN A OE1 1 
ATOM   1577 N  NE2 . GLN A 1 209 ? 18.755  -16.737 -5.682  1.00 43.58 ? 200 GLN A NE2 1 
ATOM   1578 N  N   . GLU A 1 210 ? 20.638  -10.323 -4.901  1.00 39.75 ? 201 GLU A N   1 
ATOM   1579 C  CA  . GLU A 1 210 ? 21.487  -9.195  -5.208  1.00 41.67 ? 201 GLU A CA  1 
ATOM   1580 C  C   . GLU A 1 210 ? 22.400  -8.790  -4.072  1.00 43.71 ? 201 GLU A C   1 
ATOM   1581 O  O   . GLU A 1 210 ? 23.323  -7.998  -4.282  1.00 44.58 ? 201 GLU A O   1 
ATOM   1582 C  CB  . GLU A 1 210 ? 20.627  -8.039  -5.638  1.00 40.93 ? 201 GLU A CB  1 
ATOM   1583 C  CG  . GLU A 1 210 ? 19.926  -8.347  -6.976  1.00 49.12 ? 201 GLU A CG  1 
ATOM   1584 C  CD  . GLU A 1 210 ? 18.748  -7.462  -7.257  1.00 42.99 ? 201 GLU A CD  1 
ATOM   1585 O  OE1 . GLU A 1 210 ? 18.334  -6.705  -6.341  1.00 63.50 ? 201 GLU A OE1 1 
ATOM   1586 O  OE2 . GLU A 1 210 ? 18.229  -7.528  -8.402  1.00 60.07 ? 201 GLU A OE2 1 
ATOM   1587 N  N   . ALA A 1 211 ? 22.141  -9.323  -2.879  1.00 45.03 ? 202 ALA A N   1 
ATOM   1588 C  CA  . ALA A 1 211 ? 22.915  -9.006  -1.690  1.00 45.27 ? 202 ALA A CA  1 
ATOM   1589 C  C   . ALA A 1 211 ? 24.045  -10.018 -1.581  1.00 48.97 ? 202 ALA A C   1 
ATOM   1590 O  O   . ALA A 1 211 ? 25.148  -9.777  -2.080  1.00 50.34 ? 202 ALA A O   1 
ATOM   1591 C  CB  . ALA A 1 211 ? 22.049  -9.041  -0.460  1.00 45.91 ? 202 ALA A CB  1 
ATOM   1592 N  N   . LYS B 1 12  ? 2.821   -4.646  43.260  1.00 42.74 ? 3   LYS B N   1 
ATOM   1593 C  CA  . LYS B 1 12  ? 1.990   -3.674  44.040  1.00 42.48 ? 3   LYS B CA  1 
ATOM   1594 C  C   . LYS B 1 12  ? 1.948   -2.245  43.424  1.00 40.61 ? 3   LYS B C   1 
ATOM   1595 O  O   . LYS B 1 12  ? 1.589   -1.276  44.093  1.00 41.99 ? 3   LYS B O   1 
ATOM   1596 C  CB  . LYS B 1 12  ? 2.444   -3.618  45.510  1.00 43.90 ? 3   LYS B CB  1 
ATOM   1597 C  CG  . LYS B 1 12  ? 3.920   -4.022  45.775  1.00 45.89 ? 3   LYS B CG  1 
ATOM   1598 C  CD  . LYS B 1 12  ? 4.471   -3.417  47.065  1.00 46.06 ? 3   LYS B CD  1 
ATOM   1599 C  CE  . LYS B 1 12  ? 3.451   -3.409  48.217  1.00 62.57 ? 3   LYS B CE  1 
ATOM   1600 N  NZ  . LYS B 1 12  ? 2.515   -2.233  48.182  1.00 60.33 ? 3   LYS B NZ  1 
ATOM   1601 N  N   . HIS B 1 13  ? 2.336   -2.123  42.159  1.00 38.89 ? 4   HIS B N   1 
ATOM   1602 C  CA  . HIS B 1 13  ? 2.048   -0.911  41.380  1.00 36.01 ? 4   HIS B CA  1 
ATOM   1603 C  C   . HIS B 1 13  ? 0.663   -1.016  40.759  1.00 33.02 ? 4   HIS B C   1 
ATOM   1604 O  O   . HIS B 1 13  ? 0.316   -2.045  40.201  1.00 34.41 ? 4   HIS B O   1 
ATOM   1605 C  CB  . HIS B 1 13  ? 3.127   -0.735  40.333  1.00 35.40 ? 4   HIS B CB  1 
ATOM   1606 C  CG  . HIS B 1 13  ? 4.435   -0.291  40.913  1.00 36.27 ? 4   HIS B CG  1 
ATOM   1607 N  ND1 . HIS B 1 13  ? 4.653   1.002   41.336  1.00 39.11 ? 4   HIS B ND1 1 
ATOM   1608 C  CD2 . HIS B 1 13  ? 5.578   -0.967  41.169  1.00 33.25 ? 4   HIS B CD2 1 
ATOM   1609 C  CE1 . HIS B 1 13  ? 5.891   1.119   41.775  1.00 32.82 ? 4   HIS B CE1 1 
ATOM   1610 N  NE2 . HIS B 1 13  ? 6.476   -0.061  41.686  1.00 42.44 ? 4   HIS B NE2 1 
ATOM   1611 N  N   . GLU B 1 14  ? -0.139  0.032   40.900  1.00 31.16 ? 5   GLU B N   1 
ATOM   1612 C  CA  . GLU B 1 14  ? -1.549  0.009   40.484  1.00 32.76 ? 5   GLU B CA  1 
ATOM   1613 C  C   . GLU B 1 14  ? -1.792  1.123   39.468  1.00 30.37 ? 5   GLU B C   1 
ATOM   1614 O  O   . GLU B 1 14  ? -1.075  2.115   39.463  1.00 29.45 ? 5   GLU B O   1 
ATOM   1615 C  CB  . GLU B 1 14  ? -2.485  0.215   41.691  1.00 30.65 ? 5   GLU B CB  1 
ATOM   1616 C  CG  . GLU B 1 14  ? -2.603  -0.971  42.628  1.00 40.26 ? 5   GLU B CG  1 
ATOM   1617 C  CD  . GLU B 1 14  ? -2.953  -0.565  44.077  1.00 35.54 ? 5   GLU B CD  1 
ATOM   1618 O  OE1 . GLU B 1 14  ? -4.131  -0.273  44.369  1.00 53.99 ? 5   GLU B OE1 1 
ATOM   1619 O  OE2 . GLU B 1 14  ? -2.024  -0.552  44.922  1.00 67.83 ? 5   GLU B OE2 1 
ATOM   1620 N  N   . LEU B 1 15  ? -2.797  0.930   38.611  1.00 31.33 ? 6   LEU B N   1 
ATOM   1621 C  CA  . LEU B 1 15  ? -3.228  1.965   37.694  1.00 30.39 ? 6   LEU B CA  1 
ATOM   1622 C  C   . LEU B 1 15  ? -4.097  2.966   38.443  1.00 30.18 ? 6   LEU B C   1 
ATOM   1623 O  O   . LEU B 1 15  ? -5.182  2.617   38.946  1.00 28.75 ? 6   LEU B O   1 
ATOM   1624 C  CB  . LEU B 1 15  ? -4.019  1.383   36.509  1.00 30.37 ? 6   LEU B CB  1 
ATOM   1625 C  CG  . LEU B 1 15  ? -4.512  2.381   35.462  1.00 30.50 ? 6   LEU B CG  1 
ATOM   1626 C  CD1 . LEU B 1 15  ? -3.375  2.837   34.587  1.00 27.51 ? 6   LEU B CD1 1 
ATOM   1627 C  CD2 . LEU B 1 15  ? -5.593  1.715   34.629  1.00 29.81 ? 6   LEU B CD2 1 
ATOM   1628 N  N   . PRO B 1 16  ? -3.688  4.229   38.428  1.00 31.16 ? 7   PRO B N   1 
ATOM   1629 C  CA  . PRO B 1 16  ? -4.520  5.272   39.033  1.00 30.44 ? 7   PRO B CA  1 
ATOM   1630 C  C   . PRO B 1 16  ? -5.751  5.563   38.192  1.00 31.45 ? 7   PRO B C   1 
ATOM   1631 O  O   . PRO B 1 16  ? -5.696  5.475   36.942  1.00 31.45 ? 7   PRO B O   1 
ATOM   1632 C  CB  . PRO B 1 16  ? -3.577  6.461   39.078  1.00 31.90 ? 7   PRO B CB  1 
ATOM   1633 C  CG  . PRO B 1 16  ? -2.626  6.233   37.949  1.00 31.67 ? 7   PRO B CG  1 
ATOM   1634 C  CD  . PRO B 1 16  ? -2.480  4.779   37.796  1.00 33.17 ? 7   PRO B CD  1 
ATOM   1635 N  N   . ASN B 1 17  ? -6.874  5.873   38.838  1.00 29.33 ? 8   ASN B N   1 
ATOM   1636 C  CA  . ASN B 1 17  ? -8.041  6.304   38.114  1.00 30.19 ? 8   ASN B CA  1 
ATOM   1637 C  C   . ASN B 1 17  ? -7.721  7.695   37.538  1.00 29.87 ? 8   ASN B C   1 
ATOM   1638 O  O   . ASN B 1 17  ? -6.882  8.431   38.091  1.00 31.99 ? 8   ASN B O   1 
ATOM   1639 C  CB  . ASN B 1 17  ? -9.274  6.395   39.013  1.00 31.19 ? 8   ASN B CB  1 
ATOM   1640 C  CG  . ASN B 1 17  ? -9.751  5.023   39.549  1.00 38.42 ? 8   ASN B CG  1 
ATOM   1641 O  OD1 . ASN B 1 17  ? -10.168 4.923   40.710  1.00 51.47 ? 8   ASN B OD1 1 
ATOM   1642 N  ND2 . ASN B 1 17  ? -9.705  3.983   38.711  1.00 32.28 ? 8   ASN B ND2 1 
ATOM   1643 N  N   . LEU B 1 18  ? -8.330  8.010   36.402  1.00 30.41 ? 9   LEU B N   1 
ATOM   1644 C  CA  . LEU B 1 18  ? -8.260  9.364   35.852  1.00 29.54 ? 9   LEU B CA  1 
ATOM   1645 C  C   . LEU B 1 18  ? -8.981  10.302  36.843  1.00 30.29 ? 9   LEU B C   1 
ATOM   1646 O  O   . LEU B 1 18  ? -9.961  9.875   37.495  1.00 30.37 ? 9   LEU B O   1 
ATOM   1647 C  CB  . LEU B 1 18  ? -8.967  9.457   34.490  1.00 30.22 ? 9   LEU B CB  1 
ATOM   1648 C  CG  . LEU B 1 18  ? -8.314  8.860   33.218  1.00 23.77 ? 9   LEU B CG  1 
ATOM   1649 C  CD1 . LEU B 1 18  ? -9.205  9.170   32.015  1.00 25.47 ? 9   LEU B CD1 1 
ATOM   1650 C  CD2 . LEU B 1 18  ? -6.992  9.364   33.025  1.00 24.67 ? 9   LEU B CD2 1 
ATOM   1651 N  N   . PRO B 1 19  ? -8.550  11.575  36.920  1.00 30.34 ? 10  PRO B N   1 
ATOM   1652 C  CA  . PRO B 1 19  ? -9.248  12.543  37.768  1.00 29.69 ? 10  PRO B CA  1 
ATOM   1653 C  C   . PRO B 1 19  ? -10.515 13.127  37.144  1.00 31.40 ? 10  PRO B C   1 
ATOM   1654 O  O   . PRO B 1 19  ? -11.079 14.056  37.717  1.00 33.80 ? 10  PRO B O   1 
ATOM   1655 C  CB  . PRO B 1 19  ? -8.213  13.656  37.961  1.00 31.13 ? 10  PRO B CB  1 
ATOM   1656 C  CG  . PRO B 1 19  ? -7.038  13.328  37.093  1.00 34.61 ? 10  PRO B CG  1 
ATOM   1657 C  CD  . PRO B 1 19  ? -7.399  12.186  36.229  1.00 28.01 ? 10  PRO B CD  1 
ATOM   1658 N  N   . TYR B 1 20  ? -10.944 12.637  35.981  1.00 27.25 ? 11  TYR B N   1 
ATOM   1659 C  CA  . TYR B 1 20  ? -12.070 13.185  35.245  1.00 26.67 ? 11  TYR B CA  1 
ATOM   1660 C  C   . TYR B 1 20  ? -12.648 12.087  34.351  1.00 25.32 ? 11  TYR B C   1 
ATOM   1661 O  O   . TYR B 1 20  ? -12.071 10.995  34.191  1.00 27.42 ? 11  TYR B O   1 
ATOM   1662 C  CB  . TYR B 1 20  ? -11.649 14.457  34.412  1.00 26.69 ? 11  TYR B CB  1 
ATOM   1663 C  CG  . TYR B 1 20  ? -10.253 14.307  33.881  1.00 28.00 ? 11  TYR B CG  1 
ATOM   1664 C  CD1 . TYR B 1 20  ? -9.996  13.396  32.874  1.00 27.49 ? 11  TYR B CD1 1 
ATOM   1665 C  CD2 . TYR B 1 20  ? -9.167  14.958  34.481  1.00 26.27 ? 11  TYR B CD2 1 
ATOM   1666 C  CE1 . TYR B 1 20  ? -8.724  13.156  32.423  1.00 22.63 ? 11  TYR B CE1 1 
ATOM   1667 C  CE2 . TYR B 1 20  ? -7.883  14.745  34.022  1.00 26.41 ? 11  TYR B CE2 1 
ATOM   1668 C  CZ  . TYR B 1 20  ? -7.679  13.813  33.002  1.00 19.40 ? 11  TYR B CZ  1 
ATOM   1669 O  OH  . TYR B 1 20  ? -6.420  13.571  32.565  1.00 26.90 ? 11  TYR B OH  1 
ATOM   1670 N  N   . ALA B 1 21  ? -13.798 12.346  33.767  1.00 25.03 ? 12  ALA B N   1 
ATOM   1671 C  CA  . ALA B 1 21  ? -14.403 11.398  32.835  1.00 25.65 ? 12  ALA B CA  1 
ATOM   1672 C  C   . ALA B 1 21  ? -13.541 11.171  31.567  1.00 24.62 ? 12  ALA B C   1 
ATOM   1673 O  O   . ALA B 1 21  ? -12.697 12.025  31.234  1.00 21.44 ? 12  ALA B O   1 
ATOM   1674 C  CB  . ALA B 1 21  ? -15.738 11.883  32.444  1.00 25.94 ? 12  ALA B CB  1 
ATOM   1675 N  N   . TYR B 1 22  ? -13.783 10.054  30.848  1.00 25.68 ? 13  TYR B N   1 
ATOM   1676 C  CA  . TYR B 1 22  ? -12.974 9.742   29.640  1.00 24.53 ? 13  TYR B CA  1 
ATOM   1677 C  C   . TYR B 1 22  ? -13.183 10.738  28.490  1.00 24.43 ? 13  TYR B C   1 
ATOM   1678 O  O   . TYR B 1 22  ? -12.287 10.879  27.615  1.00 22.73 ? 13  TYR B O   1 
ATOM   1679 C  CB  . TYR B 1 22  ? -13.150 8.296   29.174  1.00 21.82 ? 13  TYR B CB  1 
ATOM   1680 C  CG  . TYR B 1 22  ? -12.410 7.320   30.039  1.00 25.61 ? 13  TYR B CG  1 
ATOM   1681 C  CD1 . TYR B 1 22  ? -13.038 6.688   31.104  1.00 29.88 ? 13  TYR B CD1 1 
ATOM   1682 C  CD2 . TYR B 1 22  ? -11.063 7.076   29.830  1.00 24.83 ? 13  TYR B CD2 1 
ATOM   1683 C  CE1 . TYR B 1 22  ? -12.335 5.812   31.922  1.00 23.71 ? 13  TYR B CE1 1 
ATOM   1684 C  CE2 . TYR B 1 22  ? -10.344 6.205   30.629  1.00 25.66 ? 13  TYR B CE2 1 
ATOM   1685 C  CZ  . TYR B 1 22  ? -10.987 5.573   31.672  1.00 32.32 ? 13  TYR B CZ  1 
ATOM   1686 O  OH  . TYR B 1 22  ? -10.254 4.731   32.463  1.00 23.85 ? 13  TYR B OH  1 
ATOM   1687 N  N   . ASP B 1 23  ? -14.344 11.402  28.477  1.00 23.73 ? 14  ASP B N   1 
ATOM   1688 C  CA  . ASP B 1 23  ? -14.696 12.417  27.454  1.00 25.11 ? 14  ASP B CA  1 
ATOM   1689 C  C   . ASP B 1 23  ? -14.526 13.870  27.918  1.00 26.09 ? 14  ASP B C   1 
ATOM   1690 O  O   . ASP B 1 23  ? -14.860 14.810  27.203  1.00 29.91 ? 14  ASP B O   1 
ATOM   1691 C  CB  . ASP B 1 23  ? -16.124 12.179  26.998  1.00 26.92 ? 14  ASP B CB  1 
ATOM   1692 C  CG  . ASP B 1 23  ? -17.130 12.369  28.113  1.00 27.36 ? 14  ASP B CG  1 
ATOM   1693 O  OD1 . ASP B 1 23  ? -16.715 12.578  29.259  1.00 28.55 ? 14  ASP B OD1 1 
ATOM   1694 O  OD2 . ASP B 1 23  ? -18.328 12.359  27.805  1.00 30.85 ? 14  ASP B OD2 1 
ATOM   1695 N  N   . ALA B 1 24  ? -13.941 14.054  29.088  1.00 27.63 ? 15  ALA B N   1 
ATOM   1696 C  CA  . ALA B 1 24  ? -13.857 15.384  29.706  1.00 25.50 ? 15  ALA B CA  1 
ATOM   1697 C  C   . ALA B 1 24  ? -12.903 16.329  28.975  1.00 26.56 ? 15  ALA B C   1 
ATOM   1698 O  O   . ALA B 1 24  ? -13.046 17.540  29.113  1.00 24.24 ? 15  ALA B O   1 
ATOM   1699 C  CB  . ALA B 1 24  ? -13.433 15.268  31.140  1.00 24.37 ? 15  ALA B CB  1 
ATOM   1700 N  N   . LEU B 1 25  ? -11.951 15.783  28.197  1.00 25.13 ? 16  LEU B N   1 
ATOM   1701 C  CA  . LEU B 1 25  ? -10.962 16.606  27.463  1.00 25.24 ? 16  LEU B CA  1 
ATOM   1702 C  C   . LEU B 1 25  ? -11.291 16.851  26.000  1.00 25.33 ? 16  LEU B C   1 
ATOM   1703 O  O   . LEU B 1 25  ? -10.466 17.393  25.227  1.00 25.71 ? 16  LEU B O   1 
ATOM   1704 C  CB  . LEU B 1 25  ? -9.535  16.053  27.621  1.00 24.25 ? 16  LEU B CB  1 
ATOM   1705 C  CG  . LEU B 1 25  ? -9.051  15.718  29.040  1.00 29.96 ? 16  LEU B CG  1 
ATOM   1706 C  CD1 . LEU B 1 25  ? -7.546  15.379  29.038  1.00 23.16 ? 16  LEU B CD1 1 
ATOM   1707 C  CD2 . LEU B 1 25  ? -9.343  16.870  30.030  1.00 28.83 ? 16  LEU B CD2 1 
ATOM   1708 N  N   . GLU B 1 26  ? -12.512 16.513  25.609  1.00 24.62 ? 17  GLU B N   1 
ATOM   1709 C  CA  . GLU B 1 26  ? -12.966 16.739  24.238  1.00 25.29 ? 17  GLU B CA  1 
ATOM   1710 C  C   . GLU B 1 26  ? -13.276 18.208  23.988  1.00 25.99 ? 17  GLU B C   1 
ATOM   1711 O  O   . GLU B 1 26  ? -13.757 18.880  24.876  1.00 26.00 ? 17  GLU B O   1 
ATOM   1712 C  CB  . GLU B 1 26  ? -14.254 15.997  23.987  1.00 24.42 ? 17  GLU B CB  1 
ATOM   1713 C  CG  . GLU B 1 26  ? -14.152 14.438  24.003  1.00 32.32 ? 17  GLU B CG  1 
ATOM   1714 C  CD  . GLU B 1 26  ? -14.079 13.840  22.629  1.00 32.57 ? 17  GLU B CD  1 
ATOM   1715 O  OE1 . GLU B 1 26  ? -13.792 14.606  21.672  1.00 42.70 ? 17  GLU B OE1 1 
ATOM   1716 O  OE2 . GLU B 1 26  ? -14.249 12.600  22.485  1.00 29.51 ? 17  GLU B OE2 1 
ATOM   1717 N  N   . PRO B 1 27  ? -13.074 18.697  22.746  1.00 26.17 ? 18  PRO B N   1 
ATOM   1718 C  CA  . PRO B 1 27  ? -12.638 18.013  21.554  1.00 25.47 ? 18  PRO B CA  1 
ATOM   1719 C  C   . PRO B 1 27  ? -11.105 17.924  21.432  1.00 23.76 ? 18  PRO B C   1 
ATOM   1720 O  O   . PRO B 1 27  ? -10.601 17.405  20.422  1.00 28.12 ? 18  PRO B O   1 
ATOM   1721 C  CB  . PRO B 1 27  ? -13.246 18.882  20.427  1.00 26.80 ? 18  PRO B CB  1 
ATOM   1722 C  CG  . PRO B 1 27  ? -13.163 20.298  20.990  1.00 27.75 ? 18  PRO B CG  1 
ATOM   1723 C  CD  . PRO B 1 27  ? -13.336 20.134  22.487  1.00 27.02 ? 18  PRO B CD  1 
ATOM   1724 N  N   . HIS B 1 28  ? -10.385 18.347  22.457  1.00 22.37 ? 19  HIS B N   1 
ATOM   1725 C  CA  . HIS B 1 28  ? -8.935  18.542  22.356  1.00 23.30 ? 19  HIS B CA  1 
ATOM   1726 C  C   . HIS B 1 28  ? -8.240  17.178  22.305  1.00 23.43 ? 19  HIS B C   1 
ATOM   1727 O  O   . HIS B 1 28  ? -7.480  16.904  21.375  1.00 22.60 ? 19  HIS B O   1 
ATOM   1728 C  CB  . HIS B 1 28  ? -8.422  19.417  23.513  1.00 22.69 ? 19  HIS B CB  1 
ATOM   1729 C  CG  . HIS B 1 28  ? -9.276  20.635  23.729  1.00 30.31 ? 19  HIS B CG  1 
ATOM   1730 N  ND1 . HIS B 1 28  ? -9.366  21.656  22.798  1.00 26.69 ? 19  HIS B ND1 1 
ATOM   1731 C  CD2 . HIS B 1 28  ? -10.200 20.909  24.685  1.00 26.91 ? 19  HIS B CD2 1 
ATOM   1732 C  CE1 . HIS B 1 28  ? -10.241 22.554  23.234  1.00 33.04 ? 19  HIS B CE1 1 
ATOM   1733 N  NE2 . HIS B 1 28  ? -10.760 22.124  24.375  1.00 24.99 ? 19  HIS B NE2 1 
ATOM   1734 N  N   . PHE B 1 29  ? -8.543  16.324  23.291  1.00 23.05 ? 20  PHE B N   1 
ATOM   1735 C  CA  . PHE B 1 29  ? -8.055  14.926  23.346  1.00 22.88 ? 20  PHE B CA  1 
ATOM   1736 C  C   . PHE B 1 29  ? -9.330  14.028  23.307  1.00 22.45 ? 20  PHE B C   1 
ATOM   1737 O  O   . PHE B 1 29  ? -10.238 14.192  24.164  1.00 22.32 ? 20  PHE B O   1 
ATOM   1738 C  CB  . PHE B 1 29  ? -7.264  14.652  24.626  1.00 20.12 ? 20  PHE B CB  1 
ATOM   1739 C  CG  . PHE B 1 29  ? -5.940  15.378  24.767  1.00 22.55 ? 20  PHE B CG  1 
ATOM   1740 C  CD1 . PHE B 1 29  ? -5.392  16.210  23.757  1.00 20.66 ? 20  PHE B CD1 1 
ATOM   1741 C  CD2 . PHE B 1 29  ? -5.220  15.209  25.928  1.00 22.81 ? 20  PHE B CD2 1 
ATOM   1742 C  CE1 . PHE B 1 29  ? -4.178  16.853  23.963  1.00 18.70 ? 20  PHE B CE1 1 
ATOM   1743 C  CE2 . PHE B 1 29  ? -4.009  15.848  26.127  1.00 19.01 ? 20  PHE B CE2 1 
ATOM   1744 C  CZ  . PHE B 1 29  ? -3.501  16.678  25.139  1.00 18.62 ? 20  PHE B CZ  1 
ATOM   1745 N  N   . ASP B 1 30  ? -9.404  13.125  22.326  1.00 21.77 ? 21  ASP B N   1 
ATOM   1746 C  CA  . ASP B 1 30  ? -10.624 12.325  22.017  1.00 20.61 ? 21  ASP B CA  1 
ATOM   1747 C  C   . ASP B 1 30  ? -10.763 11.222  23.061  1.00 21.92 ? 21  ASP B C   1 
ATOM   1748 O  O   . ASP B 1 30  ? -9.776  10.745  23.615  1.00 18.39 ? 21  ASP B O   1 
ATOM   1749 C  CB  . ASP B 1 30  ? -10.598 11.687  20.637  1.00 20.37 ? 21  ASP B CB  1 
ATOM   1750 C  CG  . ASP B 1 30  ? -9.296  10.947  20.366  1.00 22.38 ? 21  ASP B CG  1 
ATOM   1751 O  OD1 . ASP B 1 30  ? -8.262  11.636  20.390  1.00 23.44 ? 21  ASP B OD1 1 
ATOM   1752 O  OD2 . ASP B 1 30  ? -9.291  9.692   20.200  1.00 24.31 ? 21  ASP B OD2 1 
ATOM   1753 N  N   . LYS B 1 31  ? -12.008 10.841  23.326  1.00 22.88 ? 22  LYS B N   1 
ATOM   1754 C  CA  . LYS B 1 31  ? -12.315 9.870   24.381  1.00 22.31 ? 22  LYS B CA  1 
ATOM   1755 C  C   . LYS B 1 31  ? -11.822 8.452   24.048  1.00 23.00 ? 22  LYS B C   1 
ATOM   1756 O  O   . LYS B 1 31  ? -11.458 7.691   24.935  1.00 23.88 ? 22  LYS B O   1 
ATOM   1757 C  CB  . LYS B 1 31  ? -13.834 9.878   24.680  1.00 22.94 ? 22  LYS B CB  1 
ATOM   1758 C  CG  . LYS B 1 31  ? -14.689 9.247   23.651  1.00 24.10 ? 22  LYS B CG  1 
ATOM   1759 C  CD  . LYS B 1 31  ? -16.148 9.583   23.888  1.00 27.08 ? 22  LYS B CD  1 
ATOM   1760 C  CE  . LYS B 1 31  ? -17.133 8.863   22.964  1.00 28.03 ? 22  LYS B CE  1 
ATOM   1761 N  NZ  . LYS B 1 31  ? -16.993 9.177   21.504  1.00 42.93 ? 22  LYS B NZ  1 
ATOM   1762 N  N   . GLU B 1 32  ? -11.802 8.096   22.771  1.00 22.54 ? 23  GLU B N   1 
ATOM   1763 C  CA  . GLU B 1 32  ? -11.276 6.794   22.358  1.00 21.52 ? 23  GLU B CA  1 
ATOM   1764 C  C   . GLU B 1 32  ? -9.813  6.676   22.763  1.00 22.76 ? 23  GLU B C   1 
ATOM   1765 O  O   . GLU B 1 32  ? -9.385  5.701   23.393  1.00 19.73 ? 23  GLU B O   1 
ATOM   1766 C  CB  . GLU B 1 32  ? -11.429 6.613   20.850  1.00 22.54 ? 23  GLU B CB  1 
ATOM   1767 C  CG  . GLU B 1 32  ? -12.883 6.532   20.319  1.00 29.10 ? 23  GLU B CG  1 
ATOM   1768 C  CD  . GLU B 1 32  ? -13.657 7.860   20.311  1.00 39.13 ? 23  GLU B CD  1 
ATOM   1769 O  OE1 . GLU B 1 32  ? -13.062 8.980   20.222  1.00 27.52 ? 23  GLU B OE1 1 
ATOM   1770 O  OE2 . GLU B 1 32  ? -14.904 7.755   20.422  1.00 33.18 ? 23  GLU B OE2 1 
ATOM   1771 N  N   . THR B 1 33  ? -9.042  7.698   22.431  1.00 20.68 ? 24  THR B N   1 
ATOM   1772 C  CA  . THR B 1 33  ? -7.635  7.743   22.860  1.00 19.76 ? 24  THR B CA  1 
ATOM   1773 C  C   . THR B 1 33  ? -7.500  7.714   24.380  1.00 19.82 ? 24  THR B C   1 
ATOM   1774 O  O   . THR B 1 33  ? -6.677  6.979   24.906  1.00 21.99 ? 24  THR B O   1 
ATOM   1775 C  CB  . THR B 1 33  ? -6.903  8.957   22.218  1.00 20.33 ? 24  THR B CB  1 
ATOM   1776 O  OG1 . THR B 1 33  ? -6.916  8.784   20.774  1.00 21.10 ? 24  THR B OG1 1 
ATOM   1777 C  CG2 . THR B 1 33  ? -5.473  9.063   22.747  1.00 21.53 ? 24  THR B CG2 1 
ATOM   1778 N  N   . MET B 1 34  ? -8.256  8.532   25.112  1.00 19.67 ? 25  MET B N   1 
ATOM   1779 C  CA  . MET B 1 34  ? -8.175  8.523   26.556  1.00 19.86 ? 25  MET B CA  1 
ATOM   1780 C  C   . MET B 1 34  ? -8.368  7.114   27.126  1.00 19.61 ? 25  MET B C   1 
ATOM   1781 O  O   . MET B 1 34  ? -7.626  6.711   28.007  1.00 19.17 ? 25  MET B O   1 
ATOM   1782 C  CB  . MET B 1 34  ? -9.130  9.562   27.204  1.00 19.86 ? 25  MET B CB  1 
ATOM   1783 C  CG  . MET B 1 34  ? -8.837  11.028  26.824  1.00 15.37 ? 25  MET B CG  1 
ATOM   1784 S  SD  . MET B 1 34  ? -7.250  11.629  27.362  1.00 21.04 ? 25  MET B SD  1 
ATOM   1785 C  CE  . MET B 1 34  ? -7.387  11.674  29.161  1.00 33.60 ? 25  MET B CE  1 
ATOM   1786 N  N   . ASN B 1 35  ? -9.374  6.407   26.617  1.00 20.13 ? 26  ASN B N   1 
ATOM   1787 C  CA  . ASN B 1 35  ? -9.605  4.995   26.986  1.00 21.17 ? 26  ASN B CA  1 
ATOM   1788 C  C   . ASN B 1 35  ? -8.393  4.088   26.672  1.00 20.66 ? 26  ASN B C   1 
ATOM   1789 O  O   . ASN B 1 35  ? -7.846  3.428   27.571  1.00 22.05 ? 26  ASN B O   1 
ATOM   1790 C  CB  . ASN B 1 35  ? -10.886 4.454   26.318  1.00 20.74 ? 26  ASN B CB  1 
ATOM   1791 C  CG  . ASN B 1 35  ? -11.097 2.975   26.593  1.00 19.98 ? 26  ASN B CG  1 
ATOM   1792 O  OD1 . ASN B 1 35  ? -11.294 2.135   25.658  1.00 26.22 ? 26  ASN B OD1 1 
ATOM   1793 N  ND2 . ASN B 1 35  ? -11.084 2.648   27.853  1.00 16.71 ? 26  ASN B ND2 1 
ATOM   1794 N  N   . ILE B 1 36  ? -7.956  4.047   25.406  1.00 19.89 ? 27  ILE B N   1 
ATOM   1795 C  CA  . ILE B 1 36  ? -6.894  3.108   25.036  1.00 20.19 ? 27  ILE B CA  1 
ATOM   1796 C  C   . ILE B 1 36  ? -5.560  3.482   25.713  1.00 18.41 ? 27  ILE B C   1 
ATOM   1797 O  O   . ILE B 1 36  ? -4.814  2.621   26.150  1.00 20.87 ? 27  ILE B O   1 
ATOM   1798 C  CB  . ILE B 1 36  ? -6.747  2.985   23.479  1.00 19.13 ? 27  ILE B CB  1 
ATOM   1799 C  CG1 . ILE B 1 36  ? -8.069  2.487   22.871  1.00 24.19 ? 27  ILE B CG1 1 
ATOM   1800 C  CG2 . ILE B 1 36  ? -5.549  2.117   23.137  1.00 22.40 ? 27  ILE B CG2 1 
ATOM   1801 C  CD1 . ILE B 1 36  ? -8.188  2.649   21.374  1.00 24.94 ? 27  ILE B CD1 1 
ATOM   1802 N  N   . HIS B 1 37  ? -5.244  4.774   25.766  1.00 20.12 ? 28  HIS B N   1 
ATOM   1803 C  CA  . HIS B 1 37  ? -3.999  5.261   26.330  1.00 19.40 ? 28  HIS B CA  1 
ATOM   1804 C  C   . HIS B 1 37  ? -3.917  4.916   27.857  1.00 19.77 ? 28  HIS B C   1 
ATOM   1805 O  O   . HIS B 1 37  ? -2.919  4.444   28.377  1.00 19.63 ? 28  HIS B O   1 
ATOM   1806 C  CB  . HIS B 1 37  ? -3.919  6.777   26.035  1.00 20.12 ? 28  HIS B CB  1 
ATOM   1807 C  CG  . HIS B 1 37  ? -2.541  7.352   26.153  1.00 19.09 ? 28  HIS B CG  1 
ATOM   1808 N  ND1 . HIS B 1 37  ? -2.294  8.703   26.090  1.00 16.89 ? 28  HIS B ND1 1 
ATOM   1809 C  CD2 . HIS B 1 37  ? -1.330  6.748   26.258  1.00 19.05 ? 28  HIS B CD2 1 
ATOM   1810 C  CE1 . HIS B 1 37  ? -0.991  8.907   26.202  1.00 20.70 ? 28  HIS B CE1 1 
ATOM   1811 N  NE2 . HIS B 1 37  ? -0.378  7.727   26.245  1.00 14.16 ? 28  HIS B NE2 1 
ATOM   1812 N  N   . HIS B 1 38  ? -5.042  5.055   28.538  1.00 21.10 ? 29  HIS B N   1 
ATOM   1813 C  CA  . HIS B 1 38  ? -5.072  4.831   29.993  1.00 20.60 ? 29  HIS B CA  1 
ATOM   1814 C  C   . HIS B 1 38  ? -5.208  3.301   30.294  1.00 22.04 ? 29  HIS B C   1 
ATOM   1815 O  O   . HIS B 1 38  ? -4.348  2.714   30.947  1.00 22.23 ? 29  HIS B O   1 
ATOM   1816 C  CB  . HIS B 1 38  ? -6.223  5.585   30.623  1.00 19.93 ? 29  HIS B CB  1 
ATOM   1817 C  CG  . HIS B 1 38  ? -6.293  5.422   32.122  1.00 21.25 ? 29  HIS B CG  1 
ATOM   1818 N  ND1 . HIS B 1 38  ? -7.421  4.973   32.786  1.00 24.48 ? 29  HIS B ND1 1 
ATOM   1819 C  CD2 . HIS B 1 38  ? -5.362  5.653   33.069  1.00 26.36 ? 29  HIS B CD2 1 
ATOM   1820 C  CE1 . HIS B 1 38  ? -7.171  4.958   34.085  1.00 24.25 ? 29  HIS B CE1 1 
ATOM   1821 N  NE2 . HIS B 1 38  ? -5.920  5.339   34.281  1.00 23.18 ? 29  HIS B NE2 1 
ATOM   1822 N  N   . THR B 1 39  ? -6.254  2.683   29.767  1.00 21.83 ? 30  THR B N   1 
ATOM   1823 C  CA  . THR B 1 39  ? -6.601  1.281   30.120  1.00 21.91 ? 30  THR B CA  1 
ATOM   1824 C  C   . THR B 1 39  ? -5.811  0.191   29.401  1.00 23.33 ? 30  THR B C   1 
ATOM   1825 O  O   . THR B 1 39  ? -5.853  -0.989  29.854  1.00 23.98 ? 30  THR B O   1 
ATOM   1826 C  CB  . THR B 1 39  ? -8.113  0.967   30.004  1.00 22.25 ? 30  THR B CB  1 
ATOM   1827 O  OG1 . THR B 1 39  ? -8.512  0.743   28.648  1.00 20.21 ? 30  THR B OG1 1 
ATOM   1828 C  CG2 . THR B 1 39  ? -9.001  2.039   30.731  1.00 24.14 ? 30  THR B CG2 1 
ATOM   1829 N  N   . LYS B 1 40  ? -5.109  0.540   28.306  1.00 22.31 ? 31  LYS B N   1 
ATOM   1830 C  CA  A LYS B 1 40  ? -4.260  -0.422  27.595  0.50 22.68 ? 31  LYS B CA  1 
ATOM   1831 C  CA  B LYS B 1 40  ? -4.263  -0.418  27.595  0.50 22.91 ? 31  LYS B CA  1 
ATOM   1832 C  C   . LYS B 1 40  ? -2.781  -0.040  27.709  1.00 22.53 ? 31  LYS B C   1 
ATOM   1833 O  O   . LYS B 1 40  ? -2.011  -0.784  28.275  1.00 22.25 ? 31  LYS B O   1 
ATOM   1834 C  CB  A LYS B 1 40  ? -4.656  -0.596  26.123  0.50 21.94 ? 31  LYS B CB  1 
ATOM   1835 C  CB  B LYS B 1 40  ? -4.689  -0.566  26.133  0.50 23.02 ? 31  LYS B CB  1 
ATOM   1836 C  CG  A LYS B 1 40  ? -6.166  -0.812  25.829  0.50 22.23 ? 31  LYS B CG  1 
ATOM   1837 C  CG  B LYS B 1 40  ? -6.210  -0.798  25.923  0.50 23.44 ? 31  LYS B CG  1 
ATOM   1838 C  CD  A LYS B 1 40  ? -6.775  -2.005  26.544  0.50 15.26 ? 31  LYS B CD  1 
ATOM   1839 C  CD  B LYS B 1 40  ? -6.535  -2.115  25.256  0.50 34.12 ? 31  LYS B CD  1 
ATOM   1840 C  CE  A LYS B 1 40  ? -8.261  -2.215  26.141  0.50 32.40 ? 31  LYS B CE  1 
ATOM   1841 C  CE  B LYS B 1 40  ? -8.018  -2.222  24.888  0.50 35.36 ? 31  LYS B CE  1 
ATOM   1842 N  NZ  A LYS B 1 40  ? -8.515  -2.690  24.710  0.50 24.17 ? 31  LYS B NZ  1 
ATOM   1843 N  NZ  B LYS B 1 40  ? -8.902  -2.513  26.067  0.50 36.04 ? 31  LYS B NZ  1 
ATOM   1844 N  N   . HIS B 1 41  ? -2.381  1.131   27.190  1.00 22.44 ? 32  HIS B N   1 
ATOM   1845 C  CA  . HIS B 1 41  ? -0.970  1.504   27.218  1.00 21.43 ? 32  HIS B CA  1 
ATOM   1846 C  C   . HIS B 1 41  ? -0.422  1.634   28.643  1.00 22.55 ? 32  HIS B C   1 
ATOM   1847 O  O   . HIS B 1 41  ? 0.612   1.033   28.969  1.00 23.94 ? 32  HIS B O   1 
ATOM   1848 C  CB  . HIS B 1 41  ? -0.690  2.806   26.397  1.00 20.67 ? 32  HIS B CB  1 
ATOM   1849 C  CG  . HIS B 1 41  ? -0.821  2.647   24.902  1.00 15.49 ? 32  HIS B CG  1 
ATOM   1850 N  ND1 . HIS B 1 41  ? 0.216   2.189   24.106  1.00 25.78 ? 32  HIS B ND1 1 
ATOM   1851 C  CD2 . HIS B 1 41  ? -1.859  2.891   24.055  1.00 22.67 ? 32  HIS B CD2 1 
ATOM   1852 C  CE1 . HIS B 1 41  ? -0.166  2.186   22.830  1.00 20.62 ? 32  HIS B CE1 1 
ATOM   1853 N  NE2 . HIS B 1 41  ? -1.435  2.576   22.771  1.00 22.15 ? 32  HIS B NE2 1 
ATOM   1854 N  N   . HIS B 1 42  ? -1.043  2.456   29.489  1.00 21.43 ? 33  HIS B N   1 
ATOM   1855 C  CA  . HIS B 1 42  ? -0.512  2.702   30.836  1.00 23.11 ? 33  HIS B CA  1 
ATOM   1856 C  C   . HIS B 1 42  ? -0.567  1.387   31.652  1.00 22.15 ? 33  HIS B C   1 
ATOM   1857 O  O   . HIS B 1 42  ? 0.414   0.976   32.253  1.00 22.07 ? 33  HIS B O   1 
ATOM   1858 C  CB  . HIS B 1 42  ? -1.289  3.849   31.506  1.00 25.49 ? 33  HIS B CB  1 
ATOM   1859 C  CG  . HIS B 1 42  ? -0.687  4.340   32.786  1.00 22.02 ? 33  HIS B CG  1 
ATOM   1860 N  ND1 . HIS B 1 42  ? -1.216  5.410   33.491  1.00 18.40 ? 33  HIS B ND1 1 
ATOM   1861 C  CD2 . HIS B 1 42  ? 0.392   3.920   33.496  1.00 26.51 ? 33  HIS B CD2 1 
ATOM   1862 C  CE1 . HIS B 1 42  ? -0.502  5.603   34.589  1.00 23.77 ? 33  HIS B CE1 1 
ATOM   1863 N  NE2 . HIS B 1 42  ? 0.476   4.716   34.613  1.00 23.62 ? 33  HIS B NE2 1 
ATOM   1864 N  N   . ASN B 1 43  ? -1.693  0.712   31.611  1.00 22.67 ? 34  ASN B N   1 
ATOM   1865 C  CA  . ASN B 1 43  ? -1.844  -0.592  32.278  1.00 22.50 ? 34  ASN B CA  1 
ATOM   1866 C  C   . ASN B 1 43  ? -0.776  -1.603  31.889  1.00 24.49 ? 34  ASN B C   1 
ATOM   1867 O  O   . ASN B 1 43  ? -0.217  -2.313  32.754  1.00 27.09 ? 34  ASN B O   1 
ATOM   1868 C  CB  . ASN B 1 43  ? -3.252  -1.140  31.985  1.00 22.90 ? 34  ASN B CB  1 
ATOM   1869 C  CG  . ASN B 1 43  ? -3.638  -2.219  32.934  1.00 32.30 ? 34  ASN B CG  1 
ATOM   1870 O  OD1 . ASN B 1 43  ? -3.941  -3.351  32.526  1.00 38.65 ? 34  ASN B OD1 1 
ATOM   1871 N  ND2 . ASN B 1 43  ? -3.550  -1.910  34.233  1.00 34.01 ? 34  ASN B ND2 1 
ATOM   1872 N  N   . THR B 1 44  ? -0.414  -1.644  30.608  1.00 23.33 ? 35  THR B N   1 
ATOM   1873 C  CA  . THR B 1 44  ? 0.574   -2.571  30.146  1.00 24.03 ? 35  THR B CA  1 
ATOM   1874 C  C   . THR B 1 44  ? 1.970   -2.247  30.719  1.00 24.99 ? 35  THR B C   1 
ATOM   1875 O  O   . THR B 1 44  ? 2.732   -3.150  31.048  1.00 24.89 ? 35  THR B O   1 
ATOM   1876 C  CB  . THR B 1 44  ? 0.640   -2.624  28.603  1.00 23.65 ? 35  THR B CB  1 
ATOM   1877 O  OG1 . THR B 1 44  ? -0.538  -3.273  28.090  1.00 22.17 ? 35  THR B OG1 1 
ATOM   1878 C  CG2 . THR B 1 44  ? 1.892   -3.365  28.142  1.00 25.92 ? 35  THR B CG2 1 
ATOM   1879 N  N   . TYR B 1 45  ? 2.316   -0.963  30.816  1.00 25.68 ? 36  TYR B N   1 
ATOM   1880 C  CA  . TYR B 1 45  ? 3.535   -0.551  31.497  1.00 25.81 ? 36  TYR B CA  1 
ATOM   1881 C  C   . TYR B 1 45  ? 3.528   -1.066  32.964  1.00 26.72 ? 36  TYR B C   1 
ATOM   1882 O  O   . TYR B 1 45  ? 4.540   -1.585  33.456  1.00 24.51 ? 36  TYR B O   1 
ATOM   1883 C  CB  . TYR B 1 45  ? 3.704   0.986   31.506  1.00 26.83 ? 36  TYR B CB  1 
ATOM   1884 C  CG  . TYR B 1 45  ? 3.984   1.602   30.119  1.00 29.96 ? 36  TYR B CG  1 
ATOM   1885 C  CD1 . TYR B 1 45  ? 5.038   1.144   29.338  1.00 28.11 ? 36  TYR B CD1 1 
ATOM   1886 C  CD2 . TYR B 1 45  ? 3.225   2.670   29.633  1.00 35.22 ? 36  TYR B CD2 1 
ATOM   1887 C  CE1 . TYR B 1 45  ? 5.306   1.707   28.049  1.00 30.03 ? 36  TYR B CE1 1 
ATOM   1888 C  CE2 . TYR B 1 45  ? 3.484   3.245   28.358  1.00 25.48 ? 36  TYR B CE2 1 
ATOM   1889 C  CZ  . TYR B 1 45  ? 4.534   2.777   27.597  1.00 23.53 ? 36  TYR B CZ  1 
ATOM   1890 O  OH  . TYR B 1 45  ? 4.780   3.324   26.322  1.00 33.11 ? 36  TYR B OH  1 
ATOM   1891 N  N   . ILE B 1 46  ? 2.377   -0.965  33.618  1.00 26.94 ? 37  ILE B N   1 
ATOM   1892 C  CA  . ILE B 1 46  ? 2.272   -1.409  35.013  1.00 27.00 ? 37  ILE B CA  1 
ATOM   1893 C  C   . ILE B 1 46  ? 2.459   -2.932  35.091  1.00 28.62 ? 37  ILE B C   1 
ATOM   1894 O  O   . ILE B 1 46  ? 3.199   -3.451  35.951  1.00 30.91 ? 37  ILE B O   1 
ATOM   1895 C  CB  . ILE B 1 46  ? 0.939   -0.960  35.614  1.00 24.18 ? 37  ILE B CB  1 
ATOM   1896 C  CG1 . ILE B 1 46  ? 0.918   0.563   35.676  1.00 29.16 ? 37  ILE B CG1 1 
ATOM   1897 C  CG2 . ILE B 1 46  ? 0.712   -1.557  37.011  1.00 27.29 ? 37  ILE B CG2 1 
ATOM   1898 C  CD1 . ILE B 1 46  ? -0.327  1.080   36.166  1.00 26.85 ? 37  ILE B CD1 1 
ATOM   1899 N  N   . THR B 1 47  ? 1.787   -3.651  34.201  1.00 31.29 ? 38  THR B N   1 
ATOM   1900 C  CA  . THR B 1 47  ? 1.874   -5.111  34.183  1.00 28.88 ? 38  THR B CA  1 
ATOM   1901 C  C   . THR B 1 47  ? 3.343   -5.510  34.068  1.00 30.64 ? 38  THR B C   1 
ATOM   1902 O  O   . THR B 1 47  ? 3.842   -6.338  34.843  1.00 31.47 ? 38  THR B O   1 
ATOM   1903 C  CB  . THR B 1 47  ? 1.083   -5.692  33.038  1.00 28.17 ? 38  THR B CB  1 
ATOM   1904 O  OG1 . THR B 1 47  ? -0.315  -5.473  33.271  1.00 30.43 ? 38  THR B OG1 1 
ATOM   1905 C  CG2 . THR B 1 47  ? 1.352   -7.173  32.881  1.00 35.68 ? 38  THR B CG2 1 
ATOM   1906 N  N   . ASN B 1 48  ? 4.033   -4.884  33.128  1.00 30.39 ? 39  ASN B N   1 
ATOM   1907 C  CA  . ASN B 1 48  ? 5.398   -5.247  32.795  1.00 29.67 ? 39  ASN B CA  1 
ATOM   1908 C  C   . ASN B 1 48  ? 6.405   -4.828  33.856  1.00 31.15 ? 39  ASN B C   1 
ATOM   1909 O  O   . ASN B 1 48  ? 7.443   -5.486  34.050  1.00 29.73 ? 39  ASN B O   1 
ATOM   1910 C  CB  . ASN B 1 48  ? 5.785   -4.624  31.455  1.00 28.85 ? 39  ASN B CB  1 
ATOM   1911 C  CG  . ASN B 1 48  ? 5.094   -5.293  30.249  1.00 33.31 ? 39  ASN B CG  1 
ATOM   1912 O  OD1 . ASN B 1 48  ? 5.212   -4.815  29.121  1.00 35.05 ? 39  ASN B OD1 1 
ATOM   1913 N  ND2 . ASN B 1 48  ? 4.394   -6.391  30.481  1.00 24.11 ? 39  ASN B ND2 1 
ATOM   1914 N  N   . LEU B 1 49  ? 6.121   -3.710  34.513  1.00 31.02 ? 40  LEU B N   1 
ATOM   1915 C  CA  . LEU B 1 49  ? 6.914   -3.250  35.643  1.00 32.47 ? 40  LEU B CA  1 
ATOM   1916 C  C   . LEU B 1 49  ? 6.850   -4.267  36.787  1.00 33.57 ? 40  LEU B C   1 
ATOM   1917 O  O   . LEU B 1 49  ? 7.883   -4.697  37.316  1.00 35.33 ? 40  LEU B O   1 
ATOM   1918 C  CB  . LEU B 1 49  ? 6.395   -1.890  36.132  1.00 32.22 ? 40  LEU B CB  1 
ATOM   1919 C  CG  . LEU B 1 49  ? 7.143   -1.232  37.306  1.00 31.13 ? 40  LEU B CG  1 
ATOM   1920 C  CD1 . LEU B 1 49  ? 8.599   -0.938  36.960  1.00 31.19 ? 40  LEU B CD1 1 
ATOM   1921 C  CD2 . LEU B 1 49  ? 6.426   0.032   37.789  1.00 33.34 ? 40  LEU B CD2 1 
ATOM   1922 N  N   . ASN B 1 50  ? 5.639   -4.655  37.163  1.00 34.48 ? 41  ASN B N   1 
ATOM   1923 C  CA  . ASN B 1 50  ? 5.430   -5.605  38.266  1.00 35.15 ? 41  ASN B CA  1 
ATOM   1924 C  C   . ASN B 1 50  ? 6.108   -6.962  38.006  1.00 36.32 ? 41  ASN B C   1 
ATOM   1925 O  O   . ASN B 1 50  ? 6.671   -7.574  38.926  1.00 36.79 ? 41  ASN B O   1 
ATOM   1926 C  CB  . ASN B 1 50  ? 3.938   -5.797  38.521  1.00 35.77 ? 41  ASN B CB  1 
ATOM   1927 C  CG  . ASN B 1 50  ? 3.282   -4.591  39.219  1.00 32.39 ? 41  ASN B CG  1 
ATOM   1928 O  OD1 . ASN B 1 50  ? 3.916   -3.887  39.990  1.00 34.07 ? 41  ASN B OD1 1 
ATOM   1929 N  ND2 . ASN B 1 50  ? 1.996   -4.376  38.945  1.00 31.08 ? 41  ASN B ND2 1 
ATOM   1930 N  N   . ALA B 1 51  ? 6.052   -7.428  36.761  1.00 36.98 ? 42  ALA B N   1 
ATOM   1931 C  CA  . ALA B 1 51  ? 6.764   -8.634  36.358  1.00 38.08 ? 42  ALA B CA  1 
ATOM   1932 C  C   . ALA B 1 51  ? 8.277   -8.478  36.503  1.00 40.23 ? 42  ALA B C   1 
ATOM   1933 O  O   . ALA B 1 51  ? 8.937   -9.386  37.009  1.00 39.99 ? 42  ALA B O   1 
ATOM   1934 C  CB  . ALA B 1 51  ? 6.403   -9.061  34.935  1.00 38.10 ? 42  ALA B CB  1 
ATOM   1935 N  N   . ALA B 1 52  ? 8.835   -7.347  36.086  1.00 40.11 ? 43  ALA B N   1 
ATOM   1936 C  CA  . ALA B 1 52  ? 10.295  -7.189  36.139  1.00 41.35 ? 43  ALA B CA  1 
ATOM   1937 C  C   . ALA B 1 52  ? 10.785  -7.086  37.595  1.00 42.16 ? 43  ALA B C   1 
ATOM   1938 O  O   . ALA B 1 52  ? 11.927  -7.459  37.904  1.00 42.14 ? 43  ALA B O   1 
ATOM   1939 C  CB  . ALA B 1 52  ? 10.746  -5.980  35.329  1.00 41.24 ? 43  ALA B CB  1 
ATOM   1940 N  N   . LEU B 1 53  ? 9.910   -6.581  38.465  1.00 42.73 ? 44  LEU B N   1 
ATOM   1941 C  CA  . LEU B 1 53  ? 10.162  -6.498  39.907  1.00 44.62 ? 44  LEU B CA  1 
ATOM   1942 C  C   . LEU B 1 53  ? 9.854   -7.785  40.699  1.00 46.21 ? 44  LEU B C   1 
ATOM   1943 O  O   . LEU B 1 53  ? 10.045  -7.796  41.905  1.00 47.38 ? 44  LEU B O   1 
ATOM   1944 C  CB  . LEU B 1 53  ? 9.362   -5.341  40.518  1.00 43.52 ? 44  LEU B CB  1 
ATOM   1945 C  CG  . LEU B 1 53  ? 9.776   -3.936  40.083  1.00 37.39 ? 44  LEU B CG  1 
ATOM   1946 C  CD1 . LEU B 1 53  ? 8.823   -2.881  40.661  1.00 45.79 ? 44  LEU B CD1 1 
ATOM   1947 C  CD2 . LEU B 1 53  ? 11.232  -3.664  40.480  1.00 41.08 ? 44  LEU B CD2 1 
ATOM   1948 N  N   . GLU B 1 54  ? 9.378   -8.847  40.047  1.00 47.59 ? 45  GLU B N   1 
ATOM   1949 C  CA  . GLU B 1 54  ? 9.224   -10.152 40.730  1.00 50.26 ? 45  GLU B CA  1 
ATOM   1950 C  C   . GLU B 1 54  ? 10.607  -10.630 41.163  1.00 50.99 ? 45  GLU B C   1 
ATOM   1951 O  O   . GLU B 1 54  ? 11.502  -10.774 40.322  1.00 50.88 ? 45  GLU B O   1 
ATOM   1952 C  CB  . GLU B 1 54  ? 8.592   -11.202 39.824  1.00 49.67 ? 45  GLU B CB  1 
ATOM   1953 C  CG  . GLU B 1 54  ? 7.082   -11.091 39.690  1.00 55.12 ? 45  GLU B CG  1 
ATOM   1954 C  CD  . GLU B 1 54  ? 6.566   -11.696 38.384  1.00 52.46 ? 45  GLU B CD  1 
ATOM   1955 O  OE1 . GLU B 1 54  ? 7.399   -12.169 37.572  1.00 65.93 ? 45  GLU B OE1 1 
ATOM   1956 O  OE2 . GLU B 1 54  ? 5.327   -11.666 38.154  1.00 65.56 ? 45  GLU B OE2 1 
ATOM   1957 N  N   . GLY B 1 55  ? 10.774  -10.841 42.471  1.00 52.43 ? 46  GLY B N   1 
ATOM   1958 C  CA  . GLY B 1 55  ? 12.052  -11.292 43.035  1.00 52.50 ? 46  GLY B CA  1 
ATOM   1959 C  C   . GLY B 1 55  ? 12.902  -10.188 43.647  1.00 53.33 ? 46  GLY B C   1 
ATOM   1960 O  O   . GLY B 1 55  ? 13.950  -10.471 44.254  1.00 53.57 ? 46  GLY B O   1 
ATOM   1961 N  N   . HIS B 1 56  ? 12.460  -8.939  43.481  1.00 53.18 ? 47  HIS B N   1 
ATOM   1962 C  CA  . HIS B 1 56  ? 13.121  -7.766  44.053  1.00 53.23 ? 47  HIS B CA  1 
ATOM   1963 C  C   . HIS B 1 56  ? 12.115  -7.022  44.929  1.00 53.97 ? 47  HIS B C   1 
ATOM   1964 O  O   . HIS B 1 56  ? 11.842  -5.842  44.717  1.00 52.62 ? 47  HIS B O   1 
ATOM   1965 C  CB  . HIS B 1 56  ? 13.642  -6.859  42.929  1.00 52.42 ? 47  HIS B CB  1 
ATOM   1966 C  CG  . HIS B 1 56  ? 14.406  -7.593  41.870  1.00 45.91 ? 47  HIS B CG  1 
ATOM   1967 N  ND1 . HIS B 1 56  ? 15.760  -7.435  41.683  1.00 39.86 ? 47  HIS B ND1 1 
ATOM   1968 C  CD2 . HIS B 1 56  ? 14.003  -8.494  40.944  1.00 50.03 ? 47  HIS B CD2 1 
ATOM   1969 C  CE1 . HIS B 1 56  ? 16.159  -8.193  40.677  1.00 49.22 ? 47  HIS B CE1 1 
ATOM   1970 N  NE2 . HIS B 1 56  ? 15.112  -8.859  40.218  1.00 36.27 ? 47  HIS B NE2 1 
ATOM   1971 N  N   . ALA B 1 57  ? 11.553  -7.738  45.906  1.00 55.72 ? 48  ALA B N   1 
ATOM   1972 C  CA  . ALA B 1 57  ? 10.466  -7.215  46.764  1.00 56.05 ? 48  ALA B CA  1 
ATOM   1973 C  C   . ALA B 1 57  ? 10.857  -5.948  47.514  1.00 56.53 ? 48  ALA B C   1 
ATOM   1974 O  O   . ALA B 1 57  ? 10.003  -5.109  47.843  1.00 56.98 ? 48  ALA B O   1 
ATOM   1975 C  CB  . ALA B 1 57  ? 9.989   -8.295  47.765  1.00 57.24 ? 48  ALA B CB  1 
ATOM   1976 N  N   . GLU B 1 58  ? 12.150  -5.841  47.798  1.00 57.02 ? 49  GLU B N   1 
ATOM   1977 C  CA  . GLU B 1 58  ? 12.741  -4.638  48.377  1.00 56.13 ? 49  GLU B CA  1 
ATOM   1978 C  C   . GLU B 1 58  ? 12.631  -3.446  47.427  1.00 55.68 ? 49  GLU B C   1 
ATOM   1979 O  O   . GLU B 1 58  ? 12.192  -2.363  47.849  1.00 56.31 ? 49  GLU B O   1 
ATOM   1980 C  CB  . GLU B 1 58  ? 14.210  -4.891  48.814  1.00 57.78 ? 49  GLU B CB  1 
ATOM   1981 C  CG  . GLU B 1 58  ? 15.130  -5.774  47.878  1.00 61.60 ? 49  GLU B CG  1 
ATOM   1982 C  CD  . GLU B 1 58  ? 15.849  -4.974  46.780  1.00 69.68 ? 49  GLU B CD  1 
ATOM   1983 O  OE1 . GLU B 1 58  ? 15.756  -5.368  45.593  1.00 72.98 ? 49  GLU B OE1 1 
ATOM   1984 O  OE2 . GLU B 1 58  ? 16.504  -3.954  47.104  1.00 72.25 ? 49  GLU B OE2 1 
ATOM   1985 N  N   . LEU B 1 59  ? 13.017  -3.639  46.158  1.00 53.67 ? 50  LEU B N   1 
ATOM   1986 C  CA  . LEU B 1 59  ? 12.893  -2.574  45.139  1.00 52.66 ? 50  LEU B CA  1 
ATOM   1987 C  C   . LEU B 1 59  ? 11.426  -2.205  44.919  1.00 50.96 ? 50  LEU B C   1 
ATOM   1988 O  O   . LEU B 1 59  ? 11.086  -1.030  44.772  1.00 49.86 ? 50  LEU B O   1 
ATOM   1989 C  CB  . LEU B 1 59  ? 13.492  -2.998  43.779  1.00 52.34 ? 50  LEU B CB  1 
ATOM   1990 C  CG  . LEU B 1 59  ? 14.874  -2.476  43.361  1.00 53.62 ? 50  LEU B CG  1 
ATOM   1991 C  CD1 . LEU B 1 59  ? 15.202  -2.892  41.917  1.00 45.37 ? 50  LEU B CD1 1 
ATOM   1992 C  CD2 . LEU B 1 59  ? 14.976  -0.974  43.520  1.00 44.64 ? 50  LEU B CD2 1 
ATOM   1993 N  N   . ALA B 1 60  ? 10.572  -3.230  44.903  1.00 50.65 ? 51  ALA B N   1 
ATOM   1994 C  CA  . ALA B 1 60  ? 9.136   -3.077  44.603  1.00 50.51 ? 51  ALA B CA  1 
ATOM   1995 C  C   . ALA B 1 60  ? 8.350   -2.201  45.595  1.00 49.97 ? 51  ALA B C   1 
ATOM   1996 O  O   . ALA B 1 60  ? 7.212   -1.788  45.294  1.00 49.47 ? 51  ALA B O   1 
ATOM   1997 C  CB  . ALA B 1 60  ? 8.472   -4.447  44.467  1.00 50.14 ? 51  ALA B CB  1 
ATOM   1998 N  N   . ASP B 1 61  ? 8.944   -1.914  46.756  1.00 48.79 ? 52  ASP B N   1 
ATOM   1999 C  CA  . ASP B 1 61  ? 8.292   -1.043  47.728  1.00 48.93 ? 52  ASP B CA  1 
ATOM   2000 C  C   . ASP B 1 61  ? 8.676   0.444   47.610  1.00 47.93 ? 52  ASP B C   1 
ATOM   2001 O  O   . ASP B 1 61  ? 8.200   1.266   48.394  1.00 49.38 ? 52  ASP B O   1 
ATOM   2002 C  CB  . ASP B 1 61  ? 8.506   -1.582  49.151  1.00 51.39 ? 52  ASP B CB  1 
ATOM   2003 C  CG  . ASP B 1 61  ? 7.552   -2.739  49.478  1.00 55.55 ? 52  ASP B CG  1 
ATOM   2004 O  OD1 . ASP B 1 61  ? 6.330   -2.483  49.646  1.00 68.76 ? 52  ASP B OD1 1 
ATOM   2005 O  OD2 . ASP B 1 61  ? 8.026   -3.899  49.548  1.00 73.01 ? 52  ASP B OD2 1 
ATOM   2006 N  N   . LYS B 1 62  ? 9.515   0.803   46.632  1.00 46.01 ? 53  LYS B N   1 
ATOM   2007 C  CA  . LYS B 1 62  ? 9.734   2.221   46.308  1.00 43.55 ? 53  LYS B CA  1 
ATOM   2008 C  C   . LYS B 1 62  ? 8.545   2.783   45.508  1.00 41.34 ? 53  LYS B C   1 
ATOM   2009 O  O   . LYS B 1 62  ? 7.835   2.021   44.837  1.00 39.44 ? 53  LYS B O   1 
ATOM   2010 C  CB  . LYS B 1 62  ? 10.994  2.410   45.464  1.00 43.33 ? 53  LYS B CB  1 
ATOM   2011 C  CG  . LYS B 1 62  ? 12.328  2.118   46.124  1.00 49.34 ? 53  LYS B CG  1 
ATOM   2012 C  CD  . LYS B 1 62  ? 13.470  2.751   45.303  1.00 42.32 ? 53  LYS B CD  1 
ATOM   2013 C  CE  . LYS B 1 62  ? 14.832  2.123   45.606  1.00 61.60 ? 53  LYS B CE  1 
ATOM   2014 N  NZ  . LYS B 1 62  ? 15.948  2.748   44.816  1.00 46.32 ? 53  LYS B NZ  1 
ATOM   2015 N  N   . SER B 1 63  ? 8.343   4.104   45.596  1.00 39.89 ? 54  SER B N   1 
ATOM   2016 C  CA  . SER B 1 63  ? 7.456   4.836   44.687  1.00 38.96 ? 54  SER B CA  1 
ATOM   2017 C  C   . SER B 1 63  ? 8.112   4.799   43.319  1.00 37.37 ? 54  SER B C   1 
ATOM   2018 O  O   . SER B 1 63  ? 9.365   4.716   43.192  1.00 33.62 ? 54  SER B O   1 
ATOM   2019 C  CB  . SER B 1 63  ? 7.266   6.300   45.097  1.00 38.76 ? 54  SER B CB  1 
ATOM   2020 O  OG  . SER B 1 63  ? 8.390   7.079   44.701  1.00 31.71 ? 54  SER B OG  1 
ATOM   2021 N  N   . VAL B 1 64  ? 7.276   4.840   42.292  1.00 36.72 ? 55  VAL B N   1 
ATOM   2022 C  CA  . VAL B 1 64  ? 7.804   4.660   40.933  1.00 37.14 ? 55  VAL B CA  1 
ATOM   2023 C  C   . VAL B 1 64  ? 8.739   5.822   40.619  1.00 36.50 ? 55  VAL B C   1 
ATOM   2024 O  O   . VAL B 1 64  ? 9.789   5.633   39.999  1.00 36.02 ? 55  VAL B O   1 
ATOM   2025 C  CB  . VAL B 1 64  ? 6.666   4.489   39.873  1.00 37.43 ? 55  VAL B CB  1 
ATOM   2026 C  CG1 . VAL B 1 64  ? 5.860   5.777   39.720  1.00 36.85 ? 55  VAL B CG1 1 
ATOM   2027 C  CG2 . VAL B 1 64  ? 7.244   3.975   38.520  1.00 36.72 ? 55  VAL B CG2 1 
ATOM   2028 N  N   . GLU B 1 65  ? 8.388   7.000   41.128  1.00 36.49 ? 56  GLU B N   1 
ATOM   2029 C  CA  . GLU B 1 65  ? 9.198   8.216   40.935  1.00 38.69 ? 56  GLU B CA  1 
ATOM   2030 C  C   . GLU B 1 65  ? 10.632  8.077   41.489  1.00 39.76 ? 56  GLU B C   1 
ATOM   2031 O  O   . GLU B 1 65  ? 11.624  8.355   40.783  1.00 38.36 ? 56  GLU B O   1 
ATOM   2032 C  CB  . GLU B 1 65  ? 8.478   9.420   41.552  1.00 39.17 ? 56  GLU B CB  1 
ATOM   2033 C  CG  . GLU B 1 65  ? 7.146   9.824   40.828  1.00 38.20 ? 56  GLU B CG  1 
ATOM   2034 C  CD  . GLU B 1 65  ? 5.909   8.970   41.188  1.00 43.88 ? 56  GLU B CD  1 
ATOM   2035 O  OE1 . GLU B 1 65  ? 5.921   8.237   42.217  1.00 42.73 ? 56  GLU B OE1 1 
ATOM   2036 O  OE2 . GLU B 1 65  ? 4.904   9.036   40.437  1.00 39.34 ? 56  GLU B OE2 1 
ATOM   2037 N  N   . GLU B 1 66  ? 10.742  7.600   42.735  1.00 41.38 ? 57  GLU B N   1 
ATOM   2038 C  CA  . GLU B 1 66  ? 12.059  7.284   43.338  1.00 40.62 ? 57  GLU B CA  1 
ATOM   2039 C  C   . GLU B 1 66  ? 12.792  6.162   42.584  1.00 38.97 ? 57  GLU B C   1 
ATOM   2040 O  O   . GLU B 1 66  ? 14.003  6.220   42.369  1.00 38.84 ? 57  GLU B O   1 
ATOM   2041 C  CB  . GLU B 1 66  ? 11.854  6.860   44.786  1.00 42.39 ? 57  GLU B CB  1 
ATOM   2042 C  CG  . GLU B 1 66  ? 13.128  6.936   45.625  1.00 45.31 ? 57  GLU B CG  1 
ATOM   2043 C  CD  . GLU B 1 66  ? 13.020  6.172   46.938  1.00 44.17 ? 57  GLU B CD  1 
ATOM   2044 O  OE1 . GLU B 1 66  ? 14.095  5.822   47.501  1.00 64.04 ? 57  GLU B OE1 1 
ATOM   2045 O  OE2 . GLU B 1 66  ? 11.872  5.914   47.390  1.00 62.37 ? 57  GLU B OE2 1 
ATOM   2046 N  N   . LEU B 1 67  ? 12.039  5.143   42.171  1.00 38.05 ? 58  LEU B N   1 
ATOM   2047 C  CA  . LEU B 1 67  ? 12.599  4.032   41.418  1.00 37.58 ? 58  LEU B CA  1 
ATOM   2048 C  C   . LEU B 1 67  ? 13.333  4.520   40.152  1.00 37.78 ? 58  LEU B C   1 
ATOM   2049 O  O   . LEU B 1 67  ? 14.462  4.112   39.855  1.00 37.44 ? 58  LEU B O   1 
ATOM   2050 C  CB  . LEU B 1 67  ? 11.480  3.067   41.053  1.00 36.36 ? 58  LEU B CB  1 
ATOM   2051 C  CG  . LEU B 1 67  ? 11.867  1.771   40.348  1.00 38.81 ? 58  LEU B CG  1 
ATOM   2052 C  CD1 . LEU B 1 67  ? 12.706  0.870   41.290  1.00 41.57 ? 58  LEU B CD1 1 
ATOM   2053 C  CD2 . LEU B 1 67  ? 10.613  1.026   39.822  1.00 37.79 ? 58  LEU B CD2 1 
ATOM   2054 N  N   . VAL B 1 68  ? 12.679  5.432   39.438  1.00 36.62 ? 59  VAL B N   1 
ATOM   2055 C  CA  . VAL B 1 68  ? 13.160  5.934   38.164  1.00 38.02 ? 59  VAL B CA  1 
ATOM   2056 C  C   . VAL B 1 68  ? 14.253  6.992   38.333  1.00 37.65 ? 59  VAL B C   1 
ATOM   2057 O  O   . VAL B 1 68  ? 15.128  7.123   37.483  1.00 37.22 ? 59  VAL B O   1 
ATOM   2058 C  CB  . VAL B 1 68  ? 11.970  6.494   37.314  1.00 37.45 ? 59  VAL B CB  1 
ATOM   2059 C  CG1 . VAL B 1 68  ? 12.461  7.255   36.108  1.00 45.53 ? 59  VAL B CG1 1 
ATOM   2060 C  CG2 . VAL B 1 68  ? 11.032  5.345   36.892  1.00 38.34 ? 59  VAL B CG2 1 
ATOM   2061 N  N   . ALA B 1 69  ? 14.188  7.770   39.404  1.00 39.34 ? 60  ALA B N   1 
ATOM   2062 C  CA  . ALA B 1 69  ? 15.231  8.778   39.700  1.00 40.23 ? 60  ALA B CA  1 
ATOM   2063 C  C   . ALA B 1 69  ? 16.614  8.141   39.956  1.00 41.33 ? 60  ALA B C   1 
ATOM   2064 O  O   . ALA B 1 69  ? 17.657  8.731   39.669  1.00 40.92 ? 60  ALA B O   1 
ATOM   2065 C  CB  . ALA B 1 69  ? 14.812  9.600   40.898  1.00 41.55 ? 60  ALA B CB  1 
ATOM   2066 N  N   . ASN B 1 70  ? 16.600  6.935   40.509  1.00 42.16 ? 61  ASN B N   1 
ATOM   2067 C  CA  . ASN B 1 70  ? 17.807  6.227   40.907  1.00 43.33 ? 61  ASN B CA  1 
ATOM   2068 C  C   . ASN B 1 70  ? 17.912  4.935   40.128  1.00 44.07 ? 61  ASN B C   1 
ATOM   2069 O  O   . ASN B 1 70  ? 18.086  3.844   40.694  1.00 43.42 ? 61  ASN B O   1 
ATOM   2070 C  CB  . ASN B 1 70  ? 17.761  5.954   42.410  1.00 45.31 ? 61  ASN B CB  1 
ATOM   2071 C  CG  . ASN B 1 70  ? 17.658  7.224   43.223  1.00 39.63 ? 61  ASN B CG  1 
ATOM   2072 O  OD1 . ASN B 1 70  ? 18.566  8.067   43.204  1.00 52.75 ? 61  ASN B OD1 1 
ATOM   2073 N  ND2 . ASN B 1 70  ? 16.537  7.383   43.928  1.00 63.13 ? 61  ASN B ND2 1 
ATOM   2074 N  N   . LEU B 1 71  ? 17.796  5.094   38.809  1.00 45.45 ? 62  LEU B N   1 
ATOM   2075 C  CA  . LEU B 1 71  ? 17.877  3.999   37.841  1.00 45.66 ? 62  LEU B CA  1 
ATOM   2076 C  C   . LEU B 1 71  ? 19.208  3.273   37.971  1.00 45.71 ? 62  LEU B C   1 
ATOM   2077 O  O   . LEU B 1 71  ? 19.275  2.038   37.891  1.00 44.23 ? 62  LEU B O   1 
ATOM   2078 C  CB  . LEU B 1 71  ? 17.715  4.562   36.411  1.00 45.97 ? 62  LEU B CB  1 
ATOM   2079 C  CG  . LEU B 1 71  ? 16.730  3.897   35.457  1.00 47.19 ? 62  LEU B CG  1 
ATOM   2080 C  CD1 . LEU B 1 71  ? 17.185  2.509   35.118  1.00 52.23 ? 62  LEU B CD1 1 
ATOM   2081 C  CD2 . LEU B 1 71  ? 15.345  3.847   36.062  1.00 49.86 ? 62  LEU B CD2 1 
ATOM   2082 N  N   . ASN B 1 72  ? 20.270  4.062   38.157  1.00 47.90 ? 63  ASN B N   1 
ATOM   2083 C  CA  . ASN B 1 72  ? 21.630  3.536   38.438  1.00 47.97 ? 63  ASN B CA  1 
ATOM   2084 C  C   . ASN B 1 72  ? 21.713  2.334   39.405  1.00 47.72 ? 63  ASN B C   1 
ATOM   2085 O  O   . ASN B 1 72  ? 22.475  1.405   39.162  1.00 49.37 ? 63  ASN B O   1 
ATOM   2086 C  CB  . ASN B 1 72  ? 22.598  4.675   38.878  1.00 49.79 ? 63  ASN B CB  1 
ATOM   2087 C  CG  . ASN B 1 72  ? 21.949  5.754   39.828  1.00 54.86 ? 63  ASN B CG  1 
ATOM   2088 O  OD1 . ASN B 1 72  ? 22.391  6.918   39.853  1.00 66.47 ? 63  ASN B OD1 1 
ATOM   2089 N  ND2 . ASN B 1 72  ? 20.952  5.361   40.611  1.00 63.36 ? 63  ASN B ND2 1 
ATOM   2090 N  N   . GLU B 1 73  ? 20.885  2.343   40.448  1.00 47.12 ? 64  GLU B N   1 
ATOM   2091 C  CA  . GLU B 1 73  ? 20.863  1.326   41.507  1.00 46.30 ? 64  GLU B CA  1 
ATOM   2092 C  C   . GLU B 1 73  ? 19.937  0.130   41.235  1.00 46.27 ? 64  GLU B C   1 
ATOM   2093 O  O   . GLU B 1 73  ? 19.790  -0.766  42.077  1.00 45.47 ? 64  GLU B O   1 
ATOM   2094 C  CB  . GLU B 1 73  ? 20.420  1.988   42.815  1.00 46.84 ? 64  GLU B CB  1 
ATOM   2095 C  CG  . GLU B 1 73  ? 21.333  3.127   43.280  1.00 51.28 ? 64  GLU B CG  1 
ATOM   2096 C  CD  . GLU B 1 73  ? 20.723  3.964   44.393  1.00 46.70 ? 64  GLU B CD  1 
ATOM   2097 O  OE1 . GLU B 1 73  ? 21.121  5.147   44.532  1.00 74.15 ? 64  GLU B OE1 1 
ATOM   2098 O  OE2 . GLU B 1 73  ? 19.832  3.455   45.108  1.00 70.68 ? 64  GLU B OE2 1 
ATOM   2099 N  N   . VAL B 1 74  ? 19.296  0.111   40.073  1.00 44.80 ? 65  VAL B N   1 
ATOM   2100 C  CA  . VAL B 1 74  ? 18.531  -1.056  39.666  1.00 43.84 ? 65  VAL B CA  1 
ATOM   2101 C  C   . VAL B 1 74  ? 19.477  -2.123  39.107  1.00 42.31 ? 65  VAL B C   1 
ATOM   2102 O  O   . VAL B 1 74  ? 20.249  -1.837  38.192  1.00 41.90 ? 65  VAL B O   1 
ATOM   2103 C  CB  . VAL B 1 74  ? 17.491  -0.696  38.567  1.00 43.47 ? 65  VAL B CB  1 
ATOM   2104 C  CG1 . VAL B 1 74  ? 16.817  -1.964  38.027  1.00 45.22 ? 65  VAL B CG1 1 
ATOM   2105 C  CG2 . VAL B 1 74  ? 16.466  0.295   39.117  1.00 40.12 ? 65  VAL B CG2 1 
ATOM   2106 N  N   . PRO B 1 75  ? 19.382  -3.364  39.630  1.00 42.00 ? 66  PRO B N   1 
ATOM   2107 C  CA  . PRO B 1 75  ? 20.192  -4.472  39.102  1.00 43.12 ? 66  PRO B CA  1 
ATOM   2108 C  C   . PRO B 1 75  ? 20.197  -4.508  37.569  1.00 43.10 ? 66  PRO B C   1 
ATOM   2109 O  O   . PRO B 1 75  ? 19.126  -4.467  36.934  1.00 42.63 ? 66  PRO B O   1 
ATOM   2110 C  CB  . PRO B 1 75  ? 19.524  -5.730  39.688  1.00 42.84 ? 66  PRO B CB  1 
ATOM   2111 C  CG  . PRO B 1 75  ? 18.788  -5.261  40.906  1.00 44.76 ? 66  PRO B CG  1 
ATOM   2112 C  CD  . PRO B 1 75  ? 18.513  -3.783  40.752  1.00 41.33 ? 66  PRO B CD  1 
ATOM   2113 N  N   . GLU B 1 76  ? 21.393  -4.588  36.992  1.00 42.23 ? 67  GLU B N   1 
ATOM   2114 C  CA  . GLU B 1 76  ? 21.561  -4.572  35.553  1.00 42.60 ? 67  GLU B CA  1 
ATOM   2115 C  C   . GLU B 1 76  ? 20.559  -5.480  34.815  1.00 42.25 ? 67  GLU B C   1 
ATOM   2116 O  O   . GLU B 1 76  ? 19.988  -5.100  33.798  1.00 42.93 ? 67  GLU B O   1 
ATOM   2117 C  CB  . GLU B 1 76  ? 22.998  -4.957  35.204  1.00 43.64 ? 67  GLU B CB  1 
ATOM   2118 C  CG  . GLU B 1 76  ? 23.446  -4.485  33.819  1.00 44.86 ? 67  GLU B CG  1 
ATOM   2119 C  CD  . GLU B 1 76  ? 22.876  -5.329  32.693  1.00 57.88 ? 67  GLU B CD  1 
ATOM   2120 O  OE1 . GLU B 1 76  ? 22.667  -6.554  32.908  1.00 65.53 ? 67  GLU B OE1 1 
ATOM   2121 O  OE2 . GLU B 1 76  ? 22.638  -4.768  31.592  1.00 62.12 ? 67  GLU B OE2 1 
ATOM   2122 N  N   . ALA B 1 77  ? 20.329  -6.671  35.346  1.00 41.50 ? 68  ALA B N   1 
ATOM   2123 C  CA  . ALA B 1 77  ? 19.483  -7.647  34.682  1.00 41.42 ? 68  ALA B CA  1 
ATOM   2124 C  C   . ALA B 1 77  ? 18.103  -7.075  34.327  1.00 40.00 ? 68  ALA B C   1 
ATOM   2125 O  O   . ALA B 1 77  ? 17.549  -7.400  33.283  1.00 38.20 ? 68  ALA B O   1 
ATOM   2126 C  CB  . ALA B 1 77  ? 19.333  -8.898  35.564  1.00 41.23 ? 68  ALA B CB  1 
ATOM   2127 N  N   . ILE B 1 78  ? 17.546  -6.247  35.213  1.00 39.68 ? 69  ILE B N   1 
ATOM   2128 C  CA  . ILE B 1 78  ? 16.180  -5.729  35.030  1.00 39.40 ? 69  ILE B CA  1 
ATOM   2129 C  C   . ILE B 1 78  ? 16.120  -4.225  34.751  1.00 38.01 ? 69  ILE B C   1 
ATOM   2130 O  O   . ILE B 1 78  ? 15.035  -3.645  34.681  1.00 35.16 ? 69  ILE B O   1 
ATOM   2131 C  CB  . ILE B 1 78  ? 15.270  -6.059  36.229  1.00 38.62 ? 69  ILE B CB  1 
ATOM   2132 C  CG1 . ILE B 1 78  ? 15.815  -5.436  37.521  1.00 38.26 ? 69  ILE B CG1 1 
ATOM   2133 C  CG2 . ILE B 1 78  ? 15.085  -7.557  36.353  1.00 40.41 ? 69  ILE B CG2 1 
ATOM   2134 C  CD1 . ILE B 1 78  ? 14.775  -5.394  38.622  1.00 41.62 ? 69  ILE B CD1 1 
ATOM   2135 N  N   . ARG B 1 79  ? 17.281  -3.610  34.546  1.00 37.31 ? 70  ARG B N   1 
ATOM   2136 C  CA  . ARG B 1 79  ? 17.331  -2.173  34.437  1.00 37.64 ? 70  ARG B CA  1 
ATOM   2137 C  C   . ARG B 1 79  ? 16.558  -1.602  33.225  1.00 37.06 ? 70  ARG B C   1 
ATOM   2138 O  O   . ARG B 1 79  ? 15.818  -0.610  33.375  1.00 37.32 ? 70  ARG B O   1 
ATOM   2139 C  CB  . ARG B 1 79  ? 18.763  -1.671  34.394  1.00 37.08 ? 70  ARG B CB  1 
ATOM   2140 C  CG  . ARG B 1 79  ? 18.864  -0.211  34.803  1.00 38.89 ? 70  ARG B CG  1 
ATOM   2141 C  CD  . ARG B 1 79  ? 20.292  0.225   34.786  1.00 40.02 ? 70  ARG B CD  1 
ATOM   2142 N  NE  . ARG B 1 79  ? 21.021  -0.331  35.934  1.00 36.65 ? 70  ARG B NE  1 
ATOM   2143 C  CZ  . ARG B 1 79  ? 22.319  -0.637  35.918  1.00 56.86 ? 70  ARG B CZ  1 
ATOM   2144 N  NH1 . ARG B 1 79  ? 23.063  -0.454  34.826  1.00 33.31 ? 70  ARG B NH1 1 
ATOM   2145 N  NH2 . ARG B 1 79  ? 22.886  -1.140  37.003  1.00 43.82 ? 70  ARG B NH2 1 
ATOM   2146 N  N   . THR B 1 80  ? 16.732  -2.206  32.058  1.00 35.15 ? 71  THR B N   1 
ATOM   2147 C  CA  . THR B 1 80  ? 16.044  -1.734  30.836  1.00 34.88 ? 71  THR B CA  1 
ATOM   2148 C  C   . THR B 1 80  ? 14.546  -1.825  31.018  1.00 33.54 ? 71  THR B C   1 
ATOM   2149 O  O   . THR B 1 80  ? 13.823  -0.887  30.684  1.00 32.33 ? 71  THR B O   1 
ATOM   2150 C  CB  . THR B 1 80  ? 16.490  -2.498  29.608  1.00 34.87 ? 71  THR B CB  1 
ATOM   2151 O  OG1 . THR B 1 80  ? 17.821  -2.111  29.338  1.00 31.11 ? 71  THR B OG1 1 
ATOM   2152 C  CG2 . THR B 1 80  ? 15.632  -2.155  28.354  1.00 35.67 ? 71  THR B CG2 1 
ATOM   2153 N  N   . ALA B 1 81  ? 14.092  -2.909  31.623  1.00 31.44 ? 72  ALA B N   1 
ATOM   2154 C  CA  . ALA B 1 81  ? 12.666  -3.082  31.875  1.00 33.34 ? 72  ALA B CA  1 
ATOM   2155 C  C   . ALA B 1 81  ? 12.112  -2.051  32.852  1.00 33.05 ? 72  ALA B C   1 
ATOM   2156 O  O   . ALA B 1 81  ? 10.973  -1.595  32.694  1.00 33.24 ? 72  ALA B O   1 
ATOM   2157 C  CB  . ALA B 1 81  ? 12.376  -4.502  32.357  1.00 34.07 ? 72  ALA B CB  1 
ATOM   2158 N  N   . VAL B 1 82  ? 12.920  -1.648  33.833  1.00 32.46 ? 73  VAL B N   1 
ATOM   2159 C  CA  . VAL B 1 82  ? 12.507  -0.613  34.785  1.00 31.01 ? 73  VAL B CA  1 
ATOM   2160 C  C   . VAL B 1 82  ? 12.528  0.789   34.169  1.00 29.89 ? 73  VAL B C   1 
ATOM   2161 O  O   . VAL B 1 82  ? 11.590  1.572   34.361  1.00 30.70 ? 73  VAL B O   1 
ATOM   2162 C  CB  . VAL B 1 82  ? 13.355  -0.665  36.053  1.00 30.21 ? 73  VAL B CB  1 
ATOM   2163 C  CG1 . VAL B 1 82  ? 13.056  0.556   36.994  1.00 33.45 ? 73  VAL B CG1 1 
ATOM   2164 C  CG2 . VAL B 1 82  ? 13.095  -1.994  36.779  1.00 37.79 ? 73  VAL B CG2 1 
ATOM   2165 N  N   . ARG B 1 83  ? 13.581  1.083   33.421  1.00 27.09 ? 74  ARG B N   1 
ATOM   2166 C  CA  . ARG B 1 83  ? 13.693  2.323   32.680  1.00 28.44 ? 74  ARG B CA  1 
ATOM   2167 C  C   . ARG B 1 83  ? 12.459  2.530   31.812  1.00 26.37 ? 74  ARG B C   1 
ATOM   2168 O  O   . ARG B 1 83  ? 11.867  3.597   31.817  1.00 27.41 ? 74  ARG B O   1 
ATOM   2169 C  CB  . ARG B 1 83  ? 14.934  2.257   31.767  1.00 28.34 ? 74  ARG B CB  1 
ATOM   2170 C  CG  . ARG B 1 83  ? 15.258  3.521   31.009  1.00 28.62 ? 74  ARG B CG  1 
ATOM   2171 C  CD  . ARG B 1 83  ? 16.538  3.342   30.195  1.00 29.79 ? 74  ARG B CD  1 
ATOM   2172 N  NE  . ARG B 1 83  ? 16.885  4.510   29.391  1.00 28.98 ? 74  ARG B NE  1 
ATOM   2173 C  CZ  . ARG B 1 83  ? 17.989  4.624   28.638  1.00 40.09 ? 74  ARG B CZ  1 
ATOM   2174 N  NH1 . ARG B 1 83  ? 18.866  3.630   28.563  1.00 45.02 ? 74  ARG B NH1 1 
ATOM   2175 N  NH2 . ARG B 1 83  ? 18.233  5.735   27.956  1.00 34.13 ? 74  ARG B NH2 1 
ATOM   2176 N  N   . ASN B 1 84  ? 12.101  1.493   31.055  1.00 25.54 ? 75  ASN B N   1 
ATOM   2177 C  CA  . ASN B 1 84  ? 11.073  1.629   30.030  1.00 25.86 ? 75  ASN B CA  1 
ATOM   2178 C  C   . ASN B 1 84  ? 9.685   1.588   30.613  1.00 26.28 ? 75  ASN B C   1 
ATOM   2179 O  O   . ASN B 1 84  ? 8.873   2.440   30.273  1.00 24.87 ? 75  ASN B O   1 
ATOM   2180 C  CB  . ASN B 1 84  ? 11.210  0.523   28.972  1.00 27.85 ? 75  ASN B CB  1 
ATOM   2181 C  CG  . ASN B 1 84  ? 12.392  0.728   28.021  1.00 27.49 ? 75  ASN B CG  1 
ATOM   2182 O  OD1 . ASN B 1 84  ? 13.030  1.786   27.979  1.00 28.44 ? 75  ASN B OD1 1 
ATOM   2183 N  ND2 . ASN B 1 84  ? 12.696  -0.321  27.253  1.00 26.48 ? 75  ASN B ND2 1 
ATOM   2184 N  N   . ASN B 1 85  ? 9.412   0.609   31.481  1.00 23.99 ? 76  ASN B N   1 
ATOM   2185 C  CA  . ASN B 1 85  ? 8.089   0.421   32.071  1.00 25.19 ? 76  ASN B CA  1 
ATOM   2186 C  C   . ASN B 1 85  ? 7.845   1.245   33.322  1.00 24.58 ? 76  ASN B C   1 
ATOM   2187 O  O   . ASN B 1 85  ? 6.729   1.719   33.529  1.00 24.91 ? 76  ASN B O   1 
ATOM   2188 C  CB  . ASN B 1 85  ? 7.826   -1.065  32.335  1.00 24.75 ? 76  ASN B CB  1 
ATOM   2189 C  CG  . ASN B 1 85  ? 7.895   -1.871  31.065  1.00 36.76 ? 76  ASN B CG  1 
ATOM   2190 O  OD1 . ASN B 1 85  ? 7.015   -1.759  30.205  1.00 26.99 ? 76  ASN B OD1 1 
ATOM   2191 N  ND2 . ASN B 1 85  ? 8.982   -2.628  30.893  1.00 34.79 ? 76  ASN B ND2 1 
ATOM   2192 N  N   . GLY B 1 86  ? 8.866   1.363   34.169  1.00 26.15 ? 77  GLY B N   1 
ATOM   2193 C  CA  . GLY B 1 86  ? 8.848   2.330   35.294  1.00 26.13 ? 77  GLY B CA  1 
ATOM   2194 C  C   . GLY B 1 86  ? 8.726   3.758   34.775  1.00 25.50 ? 77  GLY B C   1 
ATOM   2195 O  O   . GLY B 1 86  ? 7.921   4.545   35.282  1.00 25.92 ? 77  GLY B O   1 
ATOM   2196 N  N   . GLY B 1 87  ? 9.484   4.073   33.719  1.00 25.44 ? 78  GLY B N   1 
ATOM   2197 C  CA  . GLY B 1 87  ? 9.288   5.306   32.953  1.00 25.43 ? 78  GLY B CA  1 
ATOM   2198 C  C   . GLY B 1 87  ? 7.876   5.541   32.481  1.00 25.27 ? 78  GLY B C   1 
ATOM   2199 O  O   . GLY B 1 87  ? 7.292   6.575   32.766  1.00 26.41 ? 78  GLY B O   1 
ATOM   2200 N  N   . GLY B 1 88  ? 7.306   4.564   31.779  1.00 24.53 ? 79  GLY B N   1 
ATOM   2201 C  CA  . GLY B 1 88  ? 5.931   4.658   31.313  1.00 25.06 ? 79  GLY B CA  1 
ATOM   2202 C  C   . GLY B 1 88  ? 4.956   4.938   32.440  1.00 26.01 ? 79  GLY B C   1 
ATOM   2203 O  O   . GLY B 1 88  ? 4.128   5.844   32.348  1.00 23.47 ? 79  GLY B O   1 
ATOM   2204 N  N   . HIS B 1 89  ? 5.106   4.217   33.562  1.00 26.94 ? 80  HIS B N   1 
ATOM   2205 C  CA  . HIS B 1 89  ? 4.215   4.425   34.709  1.00 25.64 ? 80  HIS B CA  1 
ATOM   2206 C  C   . HIS B 1 89  ? 4.375   5.819   35.320  1.00 25.44 ? 80  HIS B C   1 
ATOM   2207 O  O   . HIS B 1 89  ? 3.409   6.554   35.464  1.00 25.28 ? 80  HIS B O   1 
ATOM   2208 C  CB  . HIS B 1 89  ? 4.461   3.338   35.757  1.00 25.55 ? 80  HIS B CB  1 
ATOM   2209 C  CG  . HIS B 1 89  ? 3.509   3.354   36.913  1.00 26.94 ? 80  HIS B CG  1 
ATOM   2210 N  ND1 . HIS B 1 89  ? 2.169   3.675   36.797  1.00 24.12 ? 80  HIS B ND1 1 
ATOM   2211 C  CD2 . HIS B 1 89  ? 3.710   3.031   38.214  1.00 25.24 ? 80  HIS B CD2 1 
ATOM   2212 C  CE1 . HIS B 1 89  ? 1.595   3.569   37.986  1.00 37.24 ? 80  HIS B CE1 1 
ATOM   2213 N  NE2 . HIS B 1 89  ? 2.499   3.140   38.854  1.00 29.70 ? 80  HIS B NE2 1 
ATOM   2214 N  N   . ALA B 1 90  ? 5.609   6.220   35.599  1.00 26.17 ? 81  ALA B N   1 
ATOM   2215 C  CA  . ALA B 1 90  ? 5.854   7.531   36.189  1.00 26.16 ? 81  ALA B CA  1 
ATOM   2216 C  C   . ALA B 1 90  ? 5.333   8.628   35.274  1.00 25.90 ? 81  ALA B C   1 
ATOM   2217 O  O   . ALA B 1 90  ? 4.618   9.522   35.726  1.00 23.88 ? 81  ALA B O   1 
ATOM   2218 C  CB  . ALA B 1 90  ? 7.337   7.741   36.433  1.00 26.15 ? 81  ALA B CB  1 
ATOM   2219 N  N   . ASN B 1 91  ? 5.674   8.545   33.972  1.00 26.26 ? 82  ASN B N   1 
ATOM   2220 C  CA  . ASN B 1 91  ? 5.290   9.596   32.998  1.00 25.69 ? 82  ASN B CA  1 
ATOM   2221 C  C   . ASN B 1 91  ? 3.774   9.771   32.772  1.00 24.86 ? 82  ASN B C   1 
ATOM   2222 O  O   . ASN B 1 91  ? 3.272   10.928  32.747  1.00 23.79 ? 82  ASN B O   1 
ATOM   2223 C  CB  . ASN B 1 91  ? 5.990   9.375   31.651  1.00 24.28 ? 82  ASN B CB  1 
ATOM   2224 C  CG  . ASN B 1 91  ? 7.510   9.596   31.728  1.00 25.15 ? 82  ASN B CG  1 
ATOM   2225 O  OD1 . ASN B 1 91  ? 8.011   10.205  32.663  1.00 28.51 ? 82  ASN B OD1 1 
ATOM   2226 N  ND2 . ASN B 1 91  ? 8.237   9.106   30.732  1.00 26.47 ? 82  ASN B ND2 1 
ATOM   2227 N  N   . HIS B 1 92  ? 3.056   8.663   32.612  1.00 22.43 ? 83  HIS B N   1 
ATOM   2228 C  CA  . HIS B 1 92  ? 1.614   8.749   32.382  1.00 25.41 ? 83  HIS B CA  1 
ATOM   2229 C  C   . HIS B 1 92  ? 0.894   9.094   33.680  1.00 25.88 ? 83  HIS B C   1 
ATOM   2230 O  O   . HIS B 1 92  ? -0.074  9.829   33.666  1.00 25.23 ? 83  HIS B O   1 
ATOM   2231 C  CB  . HIS B 1 92  ? 1.030   7.509   31.720  1.00 25.19 ? 83  HIS B CB  1 
ATOM   2232 C  CG  . HIS B 1 92  ? 1.522   7.291   30.305  1.00 29.91 ? 83  HIS B CG  1 
ATOM   2233 N  ND1 . HIS B 1 92  ? 2.747   6.716   30.030  1.00 21.67 ? 83  HIS B ND1 1 
ATOM   2234 C  CD2 . HIS B 1 92  ? 0.965   7.590   29.102  1.00 29.46 ? 83  HIS B CD2 1 
ATOM   2235 C  CE1 . HIS B 1 92  ? 2.918   6.672   28.710  1.00 22.15 ? 83  HIS B CE1 1 
ATOM   2236 N  NE2 . HIS B 1 92  ? 1.860   7.215   28.121  1.00 28.79 ? 83  HIS B NE2 1 
ATOM   2237 N  N   . THR B 1 93  ? 1.364   8.570   34.812  1.00 27.29 ? 84  THR B N   1 
ATOM   2238 C  CA  . THR B 1 93  ? 0.753   8.968   36.078  1.00 26.88 ? 84  THR B CA  1 
ATOM   2239 C  C   . THR B 1 93  ? 0.758   10.503  36.234  1.00 27.63 ? 84  THR B C   1 
ATOM   2240 O  O   . THR B 1 93  ? -0.283  11.118  36.478  1.00 29.36 ? 84  THR B O   1 
ATOM   2241 C  CB  . THR B 1 93  ? 1.457   8.313   37.276  1.00 27.69 ? 84  THR B CB  1 
ATOM   2242 O  OG1 . THR B 1 93  ? 1.297   6.881   37.207  1.00 28.43 ? 84  THR B OG1 1 
ATOM   2243 C  CG2 . THR B 1 93  ? 0.825   8.830   38.590  1.00 28.56 ? 84  THR B CG2 1 
ATOM   2244 N  N   . PHE B 1 94  ? 1.942   11.095  36.089  1.00 24.56 ? 85  PHE B N   1 
ATOM   2245 C  CA  . PHE B 1 94  ? 2.130   12.551  36.035  1.00 24.87 ? 85  PHE B CA  1 
ATOM   2246 C  C   . PHE B 1 94  ? 1.162   13.239  35.060  1.00 25.58 ? 85  PHE B C   1 
ATOM   2247 O  O   . PHE B 1 94  ? 0.372   14.119  35.438  1.00 25.95 ? 85  PHE B O   1 
ATOM   2248 C  CB  . PHE B 1 94  ? 3.569   12.853  35.644  1.00 23.86 ? 85  PHE B CB  1 
ATOM   2249 C  CG  . PHE B 1 94  ? 3.857   14.321  35.515  1.00 26.07 ? 85  PHE B CG  1 
ATOM   2250 C  CD1 . PHE B 1 94  ? 4.152   15.076  36.636  1.00 33.95 ? 85  PHE B CD1 1 
ATOM   2251 C  CD2 . PHE B 1 94  ? 3.874   14.945  34.253  1.00 33.28 ? 85  PHE B CD2 1 
ATOM   2252 C  CE1 . PHE B 1 94  ? 4.450   16.455  36.525  1.00 31.27 ? 85  PHE B CE1 1 
ATOM   2253 C  CE2 . PHE B 1 94  ? 4.171   16.323  34.135  1.00 26.22 ? 85  PHE B CE2 1 
ATOM   2254 C  CZ  . PHE B 1 94  ? 4.442   17.071  35.270  1.00 33.84 ? 85  PHE B CZ  1 
ATOM   2255 N  N   . PHE B 1 95  ? 1.174   12.771  33.812  1.00 23.04 ? 86  PHE B N   1 
ATOM   2256 C  CA  . PHE B 1 95  ? 0.401   13.354  32.707  1.00 23.13 ? 86  PHE B CA  1 
ATOM   2257 C  C   . PHE B 1 95  ? -1.074  13.546  33.025  1.00 24.86 ? 86  PHE B C   1 
ATOM   2258 O  O   . PHE B 1 95  ? -1.619  14.647  32.830  1.00 25.12 ? 86  PHE B O   1 
ATOM   2259 C  CB  . PHE B 1 95  ? 0.551   12.429  31.468  1.00 24.97 ? 86  PHE B CB  1 
ATOM   2260 C  CG  . PHE B 1 95  ? 0.017   12.988  30.175  1.00 21.50 ? 86  PHE B CG  1 
ATOM   2261 C  CD1 . PHE B 1 95  ? 0.365   14.288  29.741  1.00 27.09 ? 86  PHE B CD1 1 
ATOM   2262 C  CD2 . PHE B 1 95  ? -0.754  12.194  29.323  1.00 21.47 ? 86  PHE B CD2 1 
ATOM   2263 C  CE1 . PHE B 1 95  ? -0.053  14.774  28.504  1.00 22.59 ? 86  PHE B CE1 1 
ATOM   2264 C  CE2 . PHE B 1 95  ? -1.203  12.694  28.094  1.00 21.57 ? 86  PHE B CE2 1 
ATOM   2265 C  CZ  . PHE B 1 95  ? -0.864  13.982  27.677  1.00 26.77 ? 86  PHE B CZ  1 
ATOM   2266 N  N   . TRP B 1 96  ? -1.725  12.498  33.504  1.00 23.52 ? 87  TRP B N   1 
ATOM   2267 C  CA  . TRP B 1 96  ? -3.153  12.570  33.722  1.00 22.96 ? 87  TRP B CA  1 
ATOM   2268 C  C   . TRP B 1 96  ? -3.456  13.716  34.703  1.00 21.95 ? 87  TRP B C   1 
ATOM   2269 O  O   . TRP B 1 96  ? -4.528  14.294  34.648  1.00 24.04 ? 87  TRP B O   1 
ATOM   2270 C  CB  . TRP B 1 96  ? -3.746  11.283  34.295  1.00 23.58 ? 87  TRP B CB  1 
ATOM   2271 C  CG  . TRP B 1 96  ? -3.387  10.022  33.577  1.00 24.40 ? 87  TRP B CG  1 
ATOM   2272 C  CD1 . TRP B 1 96  ? -2.852  8.901   34.136  1.00 30.00 ? 87  TRP B CD1 1 
ATOM   2273 C  CD2 . TRP B 1 96  ? -3.432  9.789   32.157  1.00 18.69 ? 87  TRP B CD2 1 
ATOM   2274 N  NE1 . TRP B 1 96  ? -2.590  7.965   33.158  1.00 22.76 ? 87  TRP B NE1 1 
ATOM   2275 C  CE2 . TRP B 1 96  ? -2.944  8.484   31.936  1.00 22.66 ? 87  TRP B CE2 1 
ATOM   2276 C  CE3 . TRP B 1 96  ? -3.873  10.549  31.052  1.00 25.61 ? 87  TRP B CE3 1 
ATOM   2277 C  CZ2 . TRP B 1 96  ? -2.870  7.916   30.658  1.00 24.37 ? 87  TRP B CZ2 1 
ATOM   2278 C  CZ3 . TRP B 1 96  ? -3.822  9.960   29.775  1.00 22.75 ? 87  TRP B CZ3 1 
ATOM   2279 C  CH2 . TRP B 1 96  ? -3.294  8.665   29.600  1.00 26.10 ? 87  TRP B CH2 1 
ATOM   2280 N  N   . THR B 1 97  ? -2.535  13.984  35.624  1.00 22.57 ? 88  THR B N   1 
ATOM   2281 C  CA  . THR B 1 97  ? -2.754  14.954  36.697  1.00 24.83 ? 88  THR B CA  1 
ATOM   2282 C  C   . THR B 1 97  ? -2.352  16.401  36.339  1.00 27.70 ? 88  THR B C   1 
ATOM   2283 O  O   . THR B 1 97  ? -2.522  17.301  37.184  1.00 27.84 ? 88  THR B O   1 
ATOM   2284 C  CB  . THR B 1 97  ? -1.987  14.541  37.978  1.00 23.98 ? 88  THR B CB  1 
ATOM   2285 O  OG1 . THR B 1 97  ? -0.569  14.699  37.784  1.00 27.13 ? 88  THR B OG1 1 
ATOM   2286 C  CG2 . THR B 1 97  ? -2.290  13.120  38.350  1.00 35.75 ? 88  THR B CG2 1 
ATOM   2287 N  N   . ILE B 1 98  ? -1.798  16.635  35.134  1.00 27.72 ? 89  ILE B N   1 
ATOM   2288 C  CA  . ILE B 1 98  ? -1.548  18.029  34.675  1.00 26.11 ? 89  ILE B CA  1 
ATOM   2289 C  C   . ILE B 1 98  ? -2.528  18.437  33.551  1.00 25.65 ? 89  ILE B C   1 
ATOM   2290 O  O   . ILE B 1 98  ? -2.356  19.461  32.903  1.00 26.06 ? 89  ILE B O   1 
ATOM   2291 C  CB  . ILE B 1 98  ? -0.063  18.353  34.348  1.00 29.99 ? 89  ILE B CB  1 
ATOM   2292 C  CG1 . ILE B 1 98  ? 0.546   17.360  33.355  1.00 28.12 ? 89  ILE B CG1 1 
ATOM   2293 C  CG2 . ILE B 1 98  ? 0.801   18.448  35.669  1.00 32.23 ? 89  ILE B CG2 1 
ATOM   2294 C  CD1 . ILE B 1 98  ? 0.141   17.594  31.994  1.00 27.04 ? 89  ILE B CD1 1 
ATOM   2295 N  N   . LEU B 1 99  ? -3.595  17.663  33.386  1.00 24.23 ? 90  LEU B N   1 
ATOM   2296 C  CA  . LEU B 1 99  ? -4.652  17.959  32.446  1.00 25.32 ? 90  LEU B CA  1 
ATOM   2297 C  C   . LEU B 1 99  ? -5.929  18.151  33.238  1.00 25.99 ? 90  LEU B C   1 
ATOM   2298 O  O   . LEU B 1 99  ? -6.031  17.595  34.345  1.00 26.88 ? 90  LEU B O   1 
ATOM   2299 C  CB  . LEU B 1 99  ? -4.882  16.792  31.433  1.00 25.88 ? 90  LEU B CB  1 
ATOM   2300 C  CG  . LEU B 1 99  ? -3.624  16.231  30.744  1.00 25.77 ? 90  LEU B CG  1 
ATOM   2301 C  CD1 . LEU B 1 99  ? -3.984  14.962  29.975  1.00 23.52 ? 90  LEU B CD1 1 
ATOM   2302 C  CD2 . LEU B 1 99  ? -3.012  17.235  29.830  1.00 23.64 ? 90  LEU B CD2 1 
ATOM   2303 N  N   . SER B 1 100 ? -6.893  18.871  32.659  1.00 25.90 ? 91  SER B N   1 
ATOM   2304 C  CA  . SER B 1 100 ? -8.199  19.144  33.304  1.00 25.54 ? 91  SER B CA  1 
ATOM   2305 C  C   . SER B 1 100 ? -9.204  19.684  32.320  1.00 23.56 ? 91  SER B C   1 
ATOM   2306 O  O   . SER B 1 100 ? -8.833  20.470  31.421  1.00 22.44 ? 91  SER B O   1 
ATOM   2307 C  CB  . SER B 1 100 ? -8.038  20.136  34.479  1.00 29.37 ? 91  SER B CB  1 
ATOM   2308 O  OG  . SER B 1 100 ? -9.315  20.558  35.028  1.00 26.09 ? 91  SER B OG  1 
ATOM   2309 N  N   . PRO B 1 101 ? -10.507 19.349  32.517  1.00 23.07 ? 92  PRO B N   1 
ATOM   2310 C  CA  . PRO B 1 101 ? -11.556 19.975  31.733  1.00 25.37 ? 92  PRO B CA  1 
ATOM   2311 C  C   . PRO B 1 101 ? -11.743 21.490  32.131  1.00 26.97 ? 92  PRO B C   1 
ATOM   2312 O  O   . PRO B 1 101 ? -12.399 22.247  31.397  1.00 25.43 ? 92  PRO B O   1 
ATOM   2313 C  CB  . PRO B 1 101 ? -12.792 19.181  32.097  1.00 25.24 ? 92  PRO B CB  1 
ATOM   2314 C  CG  . PRO B 1 101 ? -12.492 18.584  33.404  1.00 26.30 ? 92  PRO B CG  1 
ATOM   2315 C  CD  . PRO B 1 101 ? -11.040 18.400  33.512  1.00 25.44 ? 92  PRO B CD  1 
ATOM   2316 N  N   . ASN B 1 102 ? -11.183 21.859  33.288  1.00 27.64 ? 93  ASN B N   1 
ATOM   2317 C  CA  . ASN B 1 102 ? -11.064 23.278  33.757  1.00 27.93 ? 93  ASN B CA  1 
ATOM   2318 C  C   . ASN B 1 102 ? -9.645  23.866  33.548  1.00 29.65 ? 93  ASN B C   1 
ATOM   2319 O  O   . ASN B 1 102 ? -9.182  24.800  34.258  1.00 29.76 ? 93  ASN B O   1 
ATOM   2320 C  CB  . ASN B 1 102 ? -11.381 23.329  35.254  1.00 27.39 ? 93  ASN B CB  1 
ATOM   2321 C  CG  . ASN B 1 102 ? -11.568 24.761  35.754  1.00 29.28 ? 93  ASN B CG  1 
ATOM   2322 O  OD1 . ASN B 1 102 ? -10.919 25.194  36.714  1.00 38.42 ? 93  ASN B OD1 1 
ATOM   2323 N  ND2 . ASN B 1 102 ? -12.455 25.500  35.092  1.00 30.08 ? 93  ASN B ND2 1 
ATOM   2324 N  N   . GLY B 1 103 ? -8.909  23.283  32.601  1.00 28.21 ? 94  GLY B N   1 
ATOM   2325 C  CA  . GLY B 1 103 ? -7.547  23.720  32.341  1.00 27.83 ? 94  GLY B CA  1 
ATOM   2326 C  C   . GLY B 1 103 ? -7.606  24.756  31.248  1.00 26.70 ? 94  GLY B C   1 
ATOM   2327 O  O   . GLY B 1 103 ? -8.673  25.314  30.956  1.00 27.75 ? 94  GLY B O   1 
ATOM   2328 N  N   . GLY B 1 104 ? -6.475  24.970  30.588  1.00 23.15 ? 95  GLY B N   1 
ATOM   2329 C  CA  . GLY B 1 104 ? -6.350  26.006  29.584  1.00 25.01 ? 95  GLY B CA  1 
ATOM   2330 C  C   . GLY B 1 104 ? -6.074  27.395  30.162  1.00 25.67 ? 95  GLY B C   1 
ATOM   2331 O  O   . GLY B 1 104 ? -5.897  27.587  31.376  1.00 27.33 ? 95  GLY B O   1 
ATOM   2332 N  N   . GLY B 1 105 ? -5.969  28.361  29.264  1.00 26.67 ? 96  GLY B N   1 
ATOM   2333 C  CA  . GLY B 1 105 ? -5.691  29.739  29.647  1.00 25.05 ? 96  GLY B CA  1 
ATOM   2334 C  C   . GLY B 1 105 ? -4.254  30.063  30.040  1.00 27.05 ? 96  GLY B C   1 
ATOM   2335 O  O   . GLY B 1 105 ? -3.312  29.319  29.745  1.00 23.84 ? 96  GLY B O   1 
ATOM   2336 N  N   . GLN B 1 106 ? -4.100  31.207  30.719  1.00 24.68 ? 97  GLN B N   1 
ATOM   2337 C  CA  . GLN B 1 106 ? -2.787  31.734  31.090  1.00 24.53 ? 97  GLN B CA  1 
ATOM   2338 C  C   . GLN B 1 106 ? -2.266  31.048  32.313  1.00 24.59 ? 97  GLN B C   1 
ATOM   2339 O  O   . GLN B 1 106 ? -3.047  30.583  33.169  1.00 25.21 ? 97  GLN B O   1 
ATOM   2340 C  CB  . GLN B 1 106 ? -2.829  33.269  31.343  1.00 24.18 ? 97  GLN B CB  1 
ATOM   2341 C  CG  . GLN B 1 106 ? -3.496  34.048  30.263  1.00 27.28 ? 97  GLN B CG  1 
ATOM   2342 C  CD  . GLN B 1 106 ? -2.675  34.050  28.993  1.00 31.84 ? 97  GLN B CD  1 
ATOM   2343 O  OE1 . GLN B 1 106 ? -3.009  33.397  28.012  1.00 37.65 ? 97  GLN B OE1 1 
ATOM   2344 N  NE2 . GLN B 1 106 ? -1.573  34.758  29.030  1.00 24.68 ? 97  GLN B NE2 1 
ATOM   2345 N  N   . PRO B 1 107 ? -0.943  30.980  32.419  1.00 26.74 ? 98  PRO B N   1 
ATOM   2346 C  CA  . PRO B 1 107 ? -0.335  30.510  33.631  1.00 27.99 ? 98  PRO B CA  1 
ATOM   2347 C  C   . PRO B 1 107 ? -0.741  31.392  34.826  1.00 28.72 ? 98  PRO B C   1 
ATOM   2348 O  O   . PRO B 1 107 ? -1.101  32.565  34.630  1.00 26.45 ? 98  PRO B O   1 
ATOM   2349 C  CB  . PRO B 1 107 ? 1.156   30.652  33.356  1.00 29.35 ? 98  PRO B CB  1 
ATOM   2350 C  CG  . PRO B 1 107 ? 1.283   30.654  31.890  1.00 33.01 ? 98  PRO B CG  1 
ATOM   2351 C  CD  . PRO B 1 107 ? 0.064   31.326  31.391  1.00 27.11 ? 98  PRO B CD  1 
ATOM   2352 N  N   . VAL B 1 108 ? -0.688  30.812  36.015  1.00 28.30 ? 99  VAL B N   1 
ATOM   2353 C  CA  . VAL B 1 108 ? -1.021  31.516  37.259  1.00 29.94 ? 99  VAL B CA  1 
ATOM   2354 C  C   . VAL B 1 108 ? 0.126   31.436  38.258  1.00 31.90 ? 99  VAL B C   1 
ATOM   2355 O  O   . VAL B 1 108 ? 1.100   30.686  38.065  1.00 30.69 ? 99  VAL B O   1 
ATOM   2356 C  CB  . VAL B 1 108 ? -2.306  30.968  37.893  1.00 29.53 ? 99  VAL B CB  1 
ATOM   2357 C  CG1 . VAL B 1 108 ? -3.419  30.989  36.892  1.00 30.13 ? 99  VAL B CG1 1 
ATOM   2358 C  CG2 . VAL B 1 108 ? -2.148  29.558  38.461  1.00 27.17 ? 99  VAL B CG2 1 
ATOM   2359 N  N   . GLY B 1 109 ? 0.045   32.257  39.311  1.00 32.87 ? 100 GLY B N   1 
ATOM   2360 C  CA  . GLY B 1 109 ? 0.948   32.098  40.448  1.00 33.21 ? 100 GLY B CA  1 
ATOM   2361 C  C   . GLY B 1 109 ? 2.389   32.445  40.186  1.00 31.55 ? 100 GLY B C   1 
ATOM   2362 O  O   . GLY B 1 109 ? 2.713   33.150  39.241  1.00 31.56 ? 100 GLY B O   1 
ATOM   2363 N  N   . GLU B 1 110 ? 3.279   31.920  41.014  1.00 33.49 ? 101 GLU B N   1 
ATOM   2364 C  CA  . GLU B 1 110 ? 4.694   32.270  40.887  1.00 35.28 ? 101 GLU B CA  1 
ATOM   2365 C  C   . GLU B 1 110 ? 5.305   31.625  39.660  1.00 35.16 ? 101 GLU B C   1 
ATOM   2366 O  O   . GLU B 1 110 ? 6.205   32.193  39.034  1.00 34.65 ? 101 GLU B O   1 
ATOM   2367 C  CB  . GLU B 1 110 ? 5.440   31.852  42.128  1.00 36.73 ? 101 GLU B CB  1 
ATOM   2368 C  CG  . GLU B 1 110 ? 4.840   32.509  43.409  1.00 42.54 ? 101 GLU B CG  1 
ATOM   2369 C  CD  . GLU B 1 110 ? 5.655   32.237  44.655  1.00 38.30 ? 101 GLU B CD  1 
ATOM   2370 O  OE1 . GLU B 1 110 ? 6.905   32.143  44.559  1.00 59.79 ? 101 GLU B OE1 1 
ATOM   2371 O  OE2 . GLU B 1 110 ? 5.029   32.102  45.726  1.00 63.58 ? 101 GLU B OE2 1 
ATOM   2372 N  N   . LEU B 1 111 ? 4.801   30.449  39.302  1.00 34.61 ? 102 LEU B N   1 
ATOM   2373 C  CA  . LEU B 1 111 ? 5.199   29.819  38.027  1.00 33.74 ? 102 LEU B CA  1 
ATOM   2374 C  C   . LEU B 1 111 ? 5.009   30.774  36.839  1.00 32.71 ? 102 LEU B C   1 
ATOM   2375 O  O   . LEU B 1 111 ? 5.879   30.864  35.987  1.00 35.09 ? 102 LEU B O   1 
ATOM   2376 C  CB  . LEU B 1 111 ? 4.459   28.502  37.787  1.00 32.06 ? 102 LEU B CB  1 
ATOM   2377 C  CG  . LEU B 1 111 ? 4.709   27.814  36.426  1.00 34.96 ? 102 LEU B CG  1 
ATOM   2378 C  CD1 . LEU B 1 111 ? 6.210   27.638  36.200  1.00 28.40 ? 102 LEU B CD1 1 
ATOM   2379 C  CD2 . LEU B 1 111 ? 3.967   26.485  36.315  1.00 30.66 ? 102 LEU B CD2 1 
ATOM   2380 N  N   . ALA B 1 112 ? 3.873   31.470  36.783  1.00 34.87 ? 103 ALA B N   1 
ATOM   2381 C  CA  . ALA B 1 112 ? 3.593   32.429  35.706  1.00 34.16 ? 103 ALA B CA  1 
ATOM   2382 C  C   . ALA B 1 112 ? 4.653   33.510  35.623  1.00 34.75 ? 103 ALA B C   1 
ATOM   2383 O  O   . ALA B 1 112 ? 5.135   33.867  34.527  1.00 33.10 ? 103 ALA B O   1 
ATOM   2384 C  CB  . ALA B 1 112 ? 2.245   33.088  35.914  1.00 33.93 ? 103 ALA B CB  1 
ATOM   2385 N  N   . THR B 1 113 ? 4.985   34.059  36.791  1.00 35.29 ? 104 THR B N   1 
ATOM   2386 C  CA  . THR B 1 113 ? 5.976   35.109  36.885  1.00 35.54 ? 104 THR B CA  1 
ATOM   2387 C  C   . THR B 1 113 ? 7.335   34.585  36.444  1.00 36.50 ? 104 THR B C   1 
ATOM   2388 O  O   . THR B 1 113 ? 8.075   35.260  35.703  1.00 37.79 ? 104 THR B O   1 
ATOM   2389 C  CB  . THR B 1 113 ? 6.013   35.648  38.369  1.00 37.27 ? 104 THR B CB  1 
ATOM   2390 O  OG1 . THR B 1 113 ? 4.699   36.138  38.723  1.00 38.26 ? 104 THR B OG1 1 
ATOM   2391 C  CG2 . THR B 1 113 ? 7.030   36.743  38.523  1.00 36.70 ? 104 THR B CG2 1 
ATOM   2392 N  N   . ALA B 1 114 ? 7.661   33.373  36.872  1.00 36.24 ? 105 ALA B N   1 
ATOM   2393 C  CA  . ALA B 1 114 ? 8.931   32.738  36.498  1.00 34.90 ? 105 ALA B CA  1 
ATOM   2394 C  C   . ALA B 1 114 ? 9.029   32.448  34.997  1.00 34.77 ? 105 ALA B C   1 
ATOM   2395 O  O   . ALA B 1 114 ? 10.114  32.551  34.399  1.00 31.47 ? 105 ALA B O   1 
ATOM   2396 C  CB  . ALA B 1 114 ? 9.132   31.493  37.274  1.00 36.17 ? 105 ALA B CB  1 
ATOM   2397 N  N   . ILE B 1 115 ? 7.899   32.101  34.383  1.00 35.20 ? 106 ILE B N   1 
ATOM   2398 C  CA  . ILE B 1 115 ? 7.856   31.823  32.950  1.00 35.10 ? 106 ILE B CA  1 
ATOM   2399 C  C   . ILE B 1 115 ? 8.136   33.108  32.199  1.00 36.02 ? 106 ILE B C   1 
ATOM   2400 O  O   . ILE B 1 115 ? 8.966   33.141  31.284  1.00 37.10 ? 106 ILE B O   1 
ATOM   2401 C  CB  . ILE B 1 115 ? 6.470   31.230  32.514  1.00 35.69 ? 106 ILE B CB  1 
ATOM   2402 C  CG1 . ILE B 1 115 ? 6.402   29.727  32.864  1.00 28.10 ? 106 ILE B CG1 1 
ATOM   2403 C  CG2 . ILE B 1 115 ? 6.174   31.514  31.030  1.00 35.65 ? 106 ILE B CG2 1 
ATOM   2404 C  CD1 . ILE B 1 115 ? 5.008   29.172  32.720  1.00 32.63 ? 106 ILE B CD1 1 
ATOM   2405 N  N   . GLU B 1 116 ? 7.451   34.175  32.597  1.00 36.98 ? 107 GLU B N   1 
ATOM   2406 C  CA  . GLU B 1 116 ? 7.703   35.486  32.005  1.00 38.03 ? 107 GLU B CA  1 
ATOM   2407 C  C   . GLU B 1 116 ? 9.171   35.867  32.074  1.00 37.68 ? 107 GLU B C   1 
ATOM   2408 O  O   . GLU B 1 116 ? 9.717   36.334  31.084  1.00 37.56 ? 107 GLU B O   1 
ATOM   2409 C  CB  . GLU B 1 116 ? 6.854   36.557  32.681  1.00 39.03 ? 107 GLU B CB  1 
ATOM   2410 C  CG  . GLU B 1 116 ? 5.387   36.477  32.318  1.00 40.37 ? 107 GLU B CG  1 
ATOM   2411 C  CD  . GLU B 1 116 ? 4.565   37.580  32.975  1.00 41.37 ? 107 GLU B CD  1 
ATOM   2412 O  OE1 . GLU B 1 116 ? 4.450   37.566  34.225  1.00 69.59 ? 107 GLU B OE1 1 
ATOM   2413 O  OE2 . GLU B 1 116 ? 4.042   38.450  32.234  1.00 64.84 ? 107 GLU B OE2 1 
ATOM   2414 N  N   . ALA B 1 117 ? 9.797   35.664  33.232  1.00 38.07 ? 108 ALA B N   1 
ATOM   2415 C  CA  . ALA B 1 117 ? 11.206  36.048  33.443  1.00 39.03 ? 108 ALA B CA  1 
ATOM   2416 C  C   . ALA B 1 117 ? 12.166  35.229  32.596  1.00 40.46 ? 108 ALA B C   1 
ATOM   2417 O  O   . ALA B 1 117 ? 13.023  35.788  31.881  1.00 38.43 ? 108 ALA B O   1 
ATOM   2418 C  CB  . ALA B 1 117 ? 11.575  35.901  34.891  1.00 39.31 ? 108 ALA B CB  1 
ATOM   2419 N  N   . LYS B 1 118 ? 12.013  33.896  32.679  1.00 40.47 ? 109 LYS B N   1 
ATOM   2420 C  CA  . LYS B 1 118 ? 12.868  32.970  31.931  1.00 40.15 ? 109 LYS B CA  1 
ATOM   2421 C  C   . LYS B 1 118 ? 12.653  33.054  30.431  1.00 38.71 ? 109 LYS B C   1 
ATOM   2422 O  O   . LYS B 1 118 ? 13.628  33.128  29.684  1.00 37.26 ? 109 LYS B O   1 
ATOM   2423 C  CB  . LYS B 1 118 ? 12.652  31.523  32.379  1.00 41.92 ? 109 LYS B CB  1 
ATOM   2424 C  CG  . LYS B 1 118 ? 13.932  30.689  32.423  1.00 49.65 ? 109 LYS B CG  1 
ATOM   2425 C  CD  . LYS B 1 118 ? 14.488  30.360  31.051  1.00 50.98 ? 109 LYS B CD  1 
ATOM   2426 C  CE  . LYS B 1 118 ? 15.970  30.027  31.132  1.00 62.20 ? 109 LYS B CE  1 
ATOM   2427 N  NZ  . LYS B 1 118 ? 16.436  29.202  29.984  1.00 61.32 ? 109 LYS B NZ  1 
ATOM   2428 N  N   . PHE B 1 119 ? 11.401  33.039  29.978  1.00 39.06 ? 110 PHE B N   1 
ATOM   2429 C  CA  . PHE B 1 119 ? 11.128  32.961  28.536  1.00 39.50 ? 110 PHE B CA  1 
ATOM   2430 C  C   . PHE B 1 119 ? 10.791  34.268  27.880  1.00 40.08 ? 110 PHE B C   1 
ATOM   2431 O  O   . PHE B 1 119 ? 10.716  34.337  26.651  1.00 40.27 ? 110 PHE B O   1 
ATOM   2432 C  CB  . PHE B 1 119 ? 10.034  31.911  28.262  1.00 39.11 ? 110 PHE B CB  1 
ATOM   2433 C  CG  . PHE B 1 119 ? 10.390  30.560  28.797  1.00 36.36 ? 110 PHE B CG  1 
ATOM   2434 C  CD1 . PHE B 1 119 ? 9.942   30.159  30.046  1.00 33.63 ? 110 PHE B CD1 1 
ATOM   2435 C  CD2 . PHE B 1 119 ? 11.258  29.724  28.095  1.00 34.34 ? 110 PHE B CD2 1 
ATOM   2436 C  CE1 . PHE B 1 119 ? 10.302  28.930  30.579  1.00 39.04 ? 110 PHE B CE1 1 
ATOM   2437 C  CE2 . PHE B 1 119 ? 11.633  28.493  28.622  1.00 26.68 ? 110 PHE B CE2 1 
ATOM   2438 C  CZ  . PHE B 1 119 ? 11.154  28.091  29.863  1.00 41.97 ? 110 PHE B CZ  1 
ATOM   2439 N  N   . GLY B 1 120 ? 10.583  35.317  28.672  1.00 40.59 ? 111 GLY B N   1 
ATOM   2440 C  CA  . GLY B 1 120 ? 10.147  36.594  28.107  1.00 40.33 ? 111 GLY B CA  1 
ATOM   2441 C  C   . GLY B 1 120 ? 8.650   36.772  28.264  1.00 41.55 ? 111 GLY B C   1 
ATOM   2442 O  O   . GLY B 1 120 ? 8.192   37.761  28.860  1.00 42.51 ? 111 GLY B O   1 
ATOM   2443 N  N   . SER B 1 121 ? 7.884   35.816  27.743  1.00 39.81 ? 112 SER B N   1 
ATOM   2444 C  CA  . SER B 1 121 ? 6.425   35.844  27.816  1.00 38.68 ? 112 SER B CA  1 
ATOM   2445 C  C   . SER B 1 121 ? 5.856   34.443  27.710  1.00 38.48 ? 112 SER B C   1 
ATOM   2446 O  O   . SER B 1 121 ? 6.561   33.521  27.331  1.00 36.71 ? 112 SER B O   1 
ATOM   2447 C  CB  . SER B 1 121 ? 5.845   36.655  26.665  1.00 38.48 ? 112 SER B CB  1 
ATOM   2448 O  OG  . SER B 1 121 ? 6.036   35.999  25.427  1.00 39.05 ? 112 SER B OG  1 
ATOM   2449 N  N   . PHE B 1 122 ? 4.560   34.309  27.990  1.00 37.12 ? 113 PHE B N   1 
ATOM   2450 C  CA  . PHE B 1 122 ? 3.894   32.989  27.908  1.00 36.22 ? 113 PHE B CA  1 
ATOM   2451 C  C   . PHE B 1 122 ? 3.839   32.498  26.448  1.00 35.62 ? 113 PHE B C   1 
ATOM   2452 O  O   . PHE B 1 122 ? 4.067   31.298  26.178  1.00 34.10 ? 113 PHE B O   1 
ATOM   2453 C  CB  . PHE B 1 122 ? 2.494   33.054  28.540  1.00 35.95 ? 113 PHE B CB  1 
ATOM   2454 C  CG  . PHE B 1 122 ? 1.668   31.815  28.352  1.00 33.88 ? 113 PHE B CG  1 
ATOM   2455 C  CD1 . PHE B 1 122 ? 2.175   30.561  28.690  1.00 34.54 ? 113 PHE B CD1 1 
ATOM   2456 C  CD2 . PHE B 1 122 ? 0.377   31.895  27.857  1.00 30.25 ? 113 PHE B CD2 1 
ATOM   2457 C  CE1 . PHE B 1 122 ? 1.418   29.413  28.526  1.00 31.86 ? 113 PHE B CE1 1 
ATOM   2458 C  CE2 . PHE B 1 122 ? -0.392  30.750  27.704  1.00 26.32 ? 113 PHE B CE2 1 
ATOM   2459 C  CZ  . PHE B 1 122 ? 0.132   29.504  28.045  1.00 31.54 ? 113 PHE B CZ  1 
ATOM   2460 N  N   . ASP B 1 123 ? 3.549   33.404  25.521  1.00 34.32 ? 114 ASP B N   1 
ATOM   2461 C  CA  . ASP B 1 123 ? 3.583   33.071  24.091  1.00 34.47 ? 114 ASP B CA  1 
ATOM   2462 C  C   . ASP B 1 123 ? 4.957   32.568  23.632  1.00 33.98 ? 114 ASP B C   1 
ATOM   2463 O  O   . ASP B 1 123 ? 5.045   31.598  22.877  1.00 32.09 ? 114 ASP B O   1 
ATOM   2464 C  CB  . ASP B 1 123 ? 3.111   34.260  23.245  1.00 34.59 ? 114 ASP B CB  1 
ATOM   2465 C  CG  . ASP B 1 123 ? 1.611   34.482  23.326  1.00 39.22 ? 114 ASP B CG  1 
ATOM   2466 O  OD1 . ASP B 1 123 ? 0.909   33.688  23.987  1.00 47.34 ? 114 ASP B OD1 1 
ATOM   2467 O  OD2 . ASP B 1 123 ? 1.113   35.460  22.726  1.00 42.43 ? 114 ASP B OD2 1 
ATOM   2468 N  N   . ALA B 1 124 ? 6.034   33.178  24.131  1.00 34.27 ? 115 ALA B N   1 
ATOM   2469 C  CA  . ALA B 1 124 ? 7.387   32.763  23.738  1.00 32.78 ? 115 ALA B CA  1 
ATOM   2470 C  C   . ALA B 1 124 ? 7.725   31.376  24.298  1.00 31.01 ? 115 ALA B C   1 
ATOM   2471 O  O   . ALA B 1 124 ? 8.332   30.538  23.611  1.00 27.94 ? 115 ALA B O   1 
ATOM   2472 C  CB  . ALA B 1 124 ? 8.403   33.782  24.202  1.00 34.16 ? 115 ALA B CB  1 
ATOM   2473 N  N   . PHE B 1 125 ? 7.327   31.146  25.554  1.00 29.88 ? 116 PHE B N   1 
ATOM   2474 C  CA  . PHE B 1 125 ? 7.423   29.811  26.181  1.00 30.31 ? 116 PHE B CA  1 
ATOM   2475 C  C   . PHE B 1 125 ? 6.665   28.757  25.363  1.00 28.93 ? 116 PHE B C   1 
ATOM   2476 O  O   . PHE B 1 125 ? 7.193   27.687  25.070  1.00 27.14 ? 116 PHE B O   1 
ATOM   2477 C  CB  . PHE B 1 125 ? 6.883   29.792  27.625  1.00 29.67 ? 116 PHE B CB  1 
ATOM   2478 C  CG  . PHE B 1 125 ? 6.524   28.417  28.084  1.00 28.08 ? 116 PHE B CG  1 
ATOM   2479 C  CD1 . PHE B 1 125 ? 7.517   27.511  28.407  1.00 23.10 ? 116 PHE B CD1 1 
ATOM   2480 C  CD2 . PHE B 1 125 ? 5.193   27.984  28.101  1.00 33.10 ? 116 PHE B CD2 1 
ATOM   2481 C  CE1 . PHE B 1 125 ? 7.187   26.174  28.777  1.00 23.18 ? 116 PHE B CE1 1 
ATOM   2482 C  CE2 . PHE B 1 125 ? 4.866   26.662  28.475  1.00 26.86 ? 116 PHE B CE2 1 
ATOM   2483 C  CZ  . PHE B 1 125 ? 5.852   25.777  28.808  1.00 24.55 ? 116 PHE B CZ  1 
ATOM   2484 N  N   . LYS B 1 126 ? 5.435   29.055  25.003  1.00 26.99 ? 117 LYS B N   1 
ATOM   2485 C  CA  . LYS B 1 126 ? 4.643   28.097  24.237  1.00 27.47 ? 117 LYS B CA  1 
ATOM   2486 C  C   . LYS B 1 126 ? 5.393   27.739  22.983  1.00 27.71 ? 117 LYS B C   1 
ATOM   2487 O  O   . LYS B 1 126 ? 5.459   26.557  22.590  1.00 26.16 ? 117 LYS B O   1 
ATOM   2488 C  CB  . LYS B 1 126 ? 3.245   28.634  23.903  1.00 24.07 ? 117 LYS B CB  1 
ATOM   2489 C  CG  . LYS B 1 126 ? 2.290   28.628  25.115  1.00 25.23 ? 117 LYS B CG  1 
ATOM   2490 C  CD  . LYS B 1 126 ? 0.837   28.723  24.670  1.00 26.51 ? 117 LYS B CD  1 
ATOM   2491 C  CE  . LYS B 1 126 ? 0.497   30.122  24.286  1.00 25.23 ? 117 LYS B CE  1 
ATOM   2492 N  NZ  . LYS B 1 126 ? -0.953  30.270  23.994  1.00 20.29 ? 117 LYS B NZ  1 
ATOM   2493 N  N   . GLU B 1 127 ? 5.991   28.744  22.349  1.00 29.08 ? 118 GLU B N   1 
ATOM   2494 C  CA  . GLU B 1 127 ? 6.756   28.487  21.108  1.00 30.24 ? 118 GLU B CA  1 
ATOM   2495 C  C   . GLU B 1 127 ? 7.918   27.564  21.297  1.00 29.84 ? 118 GLU B C   1 
ATOM   2496 O  O   . GLU B 1 127 ? 8.135   26.682  20.467  1.00 29.80 ? 118 GLU B O   1 
ATOM   2497 C  CB  . GLU B 1 127 ? 7.217   29.793  20.472  1.00 30.17 ? 118 GLU B CB  1 
ATOM   2498 C  CG  . GLU B 1 127 ? 6.061   30.493  19.753  1.00 36.09 ? 118 GLU B CG  1 
ATOM   2499 C  CD  . GLU B 1 127 ? 6.392   31.948  19.354  1.00 37.01 ? 118 GLU B CD  1 
ATOM   2500 O  OE1 . GLU B 1 127 ? 7.609   32.294  19.270  1.00 49.75 ? 118 GLU B OE1 1 
ATOM   2501 O  OE2 . GLU B 1 127 ? 5.428   32.726  19.153  1.00 53.42 ? 118 GLU B OE2 1 
ATOM   2502 N  N   . GLU B 1 128 ? 8.686   27.764  22.370  1.00 29.96 ? 119 GLU B N   1 
ATOM   2503 C  CA  . GLU B 1 128 ? 9.841   26.931  22.640  1.00 29.62 ? 119 GLU B CA  1 
ATOM   2504 C  C   . GLU B 1 128 ? 9.411   25.514  22.962  1.00 27.45 ? 119 GLU B C   1 
ATOM   2505 O  O   . GLU B 1 128 ? 10.040  24.539  22.533  1.00 27.06 ? 119 GLU B O   1 
ATOM   2506 C  CB  . GLU B 1 128 ? 10.655  27.531  23.795  1.00 30.36 ? 119 GLU B CB  1 
ATOM   2507 C  CG  . GLU B 1 128 ? 11.768  26.659  24.332  1.00 32.91 ? 119 GLU B CG  1 
ATOM   2508 C  CD  . GLU B 1 128 ? 12.857  27.422  25.078  1.00 33.35 ? 119 GLU B CD  1 
ATOM   2509 O  OE1 . GLU B 1 128 ? 12.728  28.658  25.217  1.00 45.31 ? 119 GLU B OE1 1 
ATOM   2510 O  OE2 . GLU B 1 128 ? 13.853  26.784  25.498  1.00 48.30 ? 119 GLU B OE2 1 
ATOM   2511 N  N   . PHE B 1 129 ? 8.347   25.384  23.745  1.00 27.11 ? 120 PHE B N   1 
ATOM   2512 C  CA  . PHE B 1 129 ? 7.808   24.043  24.094  1.00 26.92 ? 120 PHE B CA  1 
ATOM   2513 C  C   . PHE B 1 129 ? 7.314   23.296  22.854  1.00 26.58 ? 120 PHE B C   1 
ATOM   2514 O  O   . PHE B 1 129 ? 7.619   22.110  22.676  1.00 24.12 ? 120 PHE B O   1 
ATOM   2515 C  CB  . PHE B 1 129 ? 6.675   24.185  25.125  1.00 26.27 ? 120 PHE B CB  1 
ATOM   2516 C  CG  . PHE B 1 129 ? 6.210   22.893  25.701  1.00 24.20 ? 120 PHE B CG  1 
ATOM   2517 C  CD1 . PHE B 1 129 ? 6.708   22.427  26.913  1.00 21.95 ? 120 PHE B CD1 1 
ATOM   2518 C  CD2 . PHE B 1 129 ? 5.217   22.173  25.076  1.00 23.66 ? 120 PHE B CD2 1 
ATOM   2519 C  CE1 . PHE B 1 129 ? 6.237   21.228  27.462  1.00 25.84 ? 120 PHE B CE1 1 
ATOM   2520 C  CE2 . PHE B 1 129 ? 4.737   20.992  25.624  1.00 25.27 ? 120 PHE B CE2 1 
ATOM   2521 C  CZ  . PHE B 1 129 ? 5.258   20.514  26.807  1.00 25.31 ? 120 PHE B CZ  1 
ATOM   2522 N  N   . ALA B 1 130 ? 6.579   23.994  21.984  1.00 26.03 ? 121 ALA B N   1 
ATOM   2523 C  CA  . ALA B 1 130 ? 6.079   23.402  20.744  1.00 26.33 ? 121 ALA B CA  1 
ATOM   2524 C  C   . ALA B 1 130 ? 7.208   22.981  19.793  1.00 26.34 ? 121 ALA B C   1 
ATOM   2525 O  O   . ALA B 1 130 ? 7.117   21.940  19.094  1.00 24.74 ? 121 ALA B O   1 
ATOM   2526 C  CB  . ALA B 1 130 ? 5.141   24.383  20.055  1.00 27.85 ? 121 ALA B CB  1 
ATOM   2527 N  N   . LYS B 1 131 ? 8.276   23.774  19.755  1.00 27.35 ? 122 LYS B N   1 
ATOM   2528 C  CA  . LYS B 1 131 ? 9.473   23.406  18.961  1.00 27.67 ? 122 LYS B CA  1 
ATOM   2529 C  C   . LYS B 1 131 ? 10.195  22.171  19.555  1.00 27.11 ? 122 LYS B C   1 
ATOM   2530 O  O   . LYS B 1 131 ? 10.653  21.283  18.820  1.00 27.37 ? 122 LYS B O   1 
ATOM   2531 C  CB  . LYS B 1 131 ? 10.403  24.634  18.797  1.00 30.22 ? 122 LYS B CB  1 
ATOM   2532 C  CG  . LYS B 1 131 ? 11.838  24.359  18.244  1.00 28.23 ? 122 LYS B CG  1 
ATOM   2533 C  CD  . LYS B 1 131 ? 11.878  23.553  16.918  1.00 56.98 ? 122 LYS B CD  1 
ATOM   2534 C  CE  . LYS B 1 131 ? 11.853  24.396  15.632  1.00 49.32 ? 122 LYS B CE  1 
ATOM   2535 N  NZ  . LYS B 1 131 ? 10.475  24.453  15.007  1.00 63.91 ? 122 LYS B NZ  1 
ATOM   2536 N  N   . ALA B 1 132 ? 10.310  22.093  20.875  1.00 26.91 ? 123 ALA B N   1 
ATOM   2537 C  CA  . ALA B 1 132 ? 10.850  20.896  21.527  1.00 27.95 ? 123 ALA B CA  1 
ATOM   2538 C  C   . ALA B 1 132 ? 10.003  19.654  21.228  1.00 27.52 ? 123 ALA B C   1 
ATOM   2539 O  O   . ALA B 1 132 ? 10.522  18.581  20.922  1.00 29.85 ? 123 ALA B O   1 
ATOM   2540 C  CB  . ALA B 1 132 ? 10.969  21.109  23.034  1.00 29.45 ? 123 ALA B CB  1 
ATOM   2541 N  N   . GLY B 1 133 ? 8.697   19.822  21.286  1.00 28.21 ? 124 GLY B N   1 
ATOM   2542 C  CA  . GLY B 1 133 ? 7.758   18.746  20.950  1.00 27.98 ? 124 GLY B CA  1 
ATOM   2543 C  C   . GLY B 1 133 ? 7.842   18.309  19.499  1.00 28.67 ? 124 GLY B C   1 
ATOM   2544 O  O   . GLY B 1 133 ? 7.814   17.120  19.203  1.00 30.02 ? 124 GLY B O   1 
ATOM   2545 N  N   . ALA B 1 134 ? 7.894   19.262  18.580  1.00 28.19 ? 125 ALA B N   1 
ATOM   2546 C  CA  . ALA B 1 134 ? 7.902   18.937  17.162  1.00 28.50 ? 125 ALA B CA  1 
ATOM   2547 C  C   . ALA B 1 134 ? 9.190   18.231  16.734  1.00 29.62 ? 125 ALA B C   1 
ATOM   2548 O  O   . ALA B 1 134 ? 9.162   17.314  15.892  1.00 32.29 ? 125 ALA B O   1 
ATOM   2549 C  CB  . ALA B 1 134 ? 7.714   20.195  16.364  1.00 29.77 ? 125 ALA B CB  1 
ATOM   2550 N  N   . THR B 1 135 ? 10.292  18.648  17.348  1.00 30.06 ? 126 THR B N   1 
ATOM   2551 C  CA  . THR B 1 135 ? 11.676  18.274  17.036  1.00 28.99 ? 126 THR B CA  1 
ATOM   2552 C  C   . THR B 1 135 ? 12.155  16.943  17.655  1.00 28.05 ? 126 THR B C   1 
ATOM   2553 O  O   . THR B 1 135 ? 13.258  16.457  17.338  1.00 27.98 ? 126 THR B O   1 
ATOM   2554 C  CB  . THR B 1 135 ? 12.606  19.431  17.598  1.00 27.25 ? 126 THR B CB  1 
ATOM   2555 O  OG1 . THR B 1 135 ? 12.433  20.574  16.772  1.00 36.52 ? 126 THR B OG1 1 
ATOM   2556 C  CG2 . THR B 1 135 ? 14.043  19.118  17.629  1.00 35.05 ? 126 THR B CG2 1 
ATOM   2557 N  N   . ARG B 1 136 ? 11.380  16.404  18.580  1.00 25.03 ? 127 ARG B N   1 
ATOM   2558 C  CA  . ARG B 1 136 ? 11.702  15.129  19.206  1.00 25.46 ? 127 ARG B CA  1 
ATOM   2559 C  C   . ARG B 1 136 ? 11.406  14.014  18.184  1.00 26.06 ? 127 ARG B C   1 
ATOM   2560 O  O   . ARG B 1 136 ? 10.227  13.671  17.906  1.00 26.32 ? 127 ARG B O   1 
ATOM   2561 C  CB  . ARG B 1 136 ? 10.905  14.967  20.506  1.00 25.96 ? 127 ARG B CB  1 
ATOM   2562 C  CG  . ARG B 1 136 ? 10.818  13.579  21.106  1.00 24.48 ? 127 ARG B CG  1 
ATOM   2563 C  CD  . ARG B 1 136 ? 12.146  12.880  21.211  1.00 28.46 ? 127 ARG B CD  1 
ATOM   2564 N  NE  . ARG B 1 136 ? 13.084  13.637  22.043  1.00 24.96 ? 127 ARG B NE  1 
ATOM   2565 C  CZ  . ARG B 1 136 ? 14.312  13.233  22.304  1.00 29.98 ? 127 ARG B CZ  1 
ATOM   2566 N  NH1 . ARG B 1 136 ? 14.746  12.088  21.809  1.00 31.91 ? 127 ARG B NH1 1 
ATOM   2567 N  NH2 . ARG B 1 136 ? 15.107  13.958  23.069  1.00 30.87 ? 127 ARG B NH2 1 
ATOM   2568 N  N   . PHE B 1 137 ? 12.475  13.464  17.616  1.00 24.13 ? 128 PHE B N   1 
ATOM   2569 C  CA  . PHE B 1 137 ? 12.309  12.558  16.469  1.00 23.91 ? 128 PHE B CA  1 
ATOM   2570 C  C   . PHE B 1 137 ? 12.047  11.154  17.015  1.00 23.01 ? 128 PHE B C   1 
ATOM   2571 O  O   . PHE B 1 137 ? 12.784  10.678  17.833  1.00 22.39 ? 128 PHE B O   1 
ATOM   2572 C  CB  . PHE B 1 137 ? 13.563  12.574  15.567  1.00 22.96 ? 128 PHE B CB  1 
ATOM   2573 C  CG  . PHE B 1 137 ? 13.373  11.899  14.261  1.00 24.10 ? 128 PHE B CG  1 
ATOM   2574 C  CD1 . PHE B 1 137 ? 12.659  12.523  13.252  1.00 22.65 ? 128 PHE B CD1 1 
ATOM   2575 C  CD2 . PHE B 1 137 ? 13.902  10.621  14.029  1.00 20.17 ? 128 PHE B CD2 1 
ATOM   2576 C  CE1 . PHE B 1 137 ? 12.449  11.878  11.996  1.00 26.31 ? 128 PHE B CE1 1 
ATOM   2577 C  CE2 . PHE B 1 137 ? 13.737  9.985   12.779  1.00 31.39 ? 128 PHE B CE2 1 
ATOM   2578 C  CZ  . PHE B 1 137 ? 13.022  10.598  11.759  1.00 22.31 ? 128 PHE B CZ  1 
ATOM   2579 N  N   . GLY B 1 138 ? 10.968  10.524  16.557  1.00 21.09 ? 129 GLY B N   1 
ATOM   2580 C  CA  . GLY B 1 138 ? 10.537  9.224   17.098  1.00 21.05 ? 129 GLY B CA  1 
ATOM   2581 C  C   . GLY B 1 138 ? 9.622   9.436   18.278  1.00 20.79 ? 129 GLY B C   1 
ATOM   2582 O  O   . GLY B 1 138 ? 8.923   10.429  18.333  1.00 21.64 ? 129 GLY B O   1 
ATOM   2583 N  N   . SER B 1 139 ? 9.587   8.477   19.181  1.00 20.44 ? 130 SER B N   1 
ATOM   2584 C  CA  . SER B 1 139 ? 8.781   8.537   20.374  1.00 19.22 ? 130 SER B CA  1 
ATOM   2585 C  C   . SER B 1 139 ? 9.460   9.338   21.505  1.00 20.08 ? 130 SER B C   1 
ATOM   2586 O  O   . SER B 1 139 ? 10.706  9.336   21.648  1.00 22.00 ? 130 SER B O   1 
ATOM   2587 C  CB  . SER B 1 139 ? 8.481   7.095   20.843  1.00 19.15 ? 130 SER B CB  1 
ATOM   2588 O  OG  . SER B 1 139 ? 7.834   6.303   19.828  1.00 21.93 ? 130 SER B OG  1 
ATOM   2589 N  N   . GLY B 1 140 ? 8.640   10.029  22.310  1.00 20.27 ? 131 GLY B N   1 
ATOM   2590 C  CA  . GLY B 1 140 ? 9.145   10.712  23.502  1.00 19.94 ? 131 GLY B CA  1 
ATOM   2591 C  C   . GLY B 1 140 ? 8.172   11.704  24.122  1.00 18.60 ? 131 GLY B C   1 
ATOM   2592 O  O   . GLY B 1 140 ? 6.934   11.626  23.940  1.00 19.56 ? 131 GLY B O   1 
ATOM   2593 N  N   . TRP B 1 141 ? 8.738   12.635  24.888  1.00 19.91 ? 132 TRP B N   1 
ATOM   2594 C  CA  . TRP B 1 141 ? 7.964   13.556  25.739  1.00 21.54 ? 132 TRP B CA  1 
ATOM   2595 C  C   . TRP B 1 141 ? 8.570   14.932  25.605  1.00 22.55 ? 132 TRP B C   1 
ATOM   2596 O  O   . TRP B 1 141 ? 9.796   15.077  25.428  1.00 20.97 ? 132 TRP B O   1 
ATOM   2597 C  CB  . TRP B 1 141 ? 8.010   13.121  27.230  1.00 21.69 ? 132 TRP B CB  1 
ATOM   2598 C  CG  . TRP B 1 141 ? 7.155   11.945  27.541  1.00 22.28 ? 132 TRP B CG  1 
ATOM   2599 C  CD1 . TRP B 1 141 ? 7.455   10.651  27.276  1.00 22.04 ? 132 TRP B CD1 1 
ATOM   2600 C  CD2 . TRP B 1 141 ? 5.861   11.938  28.174  1.00 23.95 ? 132 TRP B CD2 1 
ATOM   2601 N  NE1 . TRP B 1 141 ? 6.431   9.841   27.650  1.00 20.50 ? 132 TRP B NE1 1 
ATOM   2602 C  CE2 . TRP B 1 141 ? 5.428   10.593  28.208  1.00 19.80 ? 132 TRP B CE2 1 
ATOM   2603 C  CE3 . TRP B 1 141 ? 5.028   12.927  28.703  1.00 24.59 ? 132 TRP B CE3 1 
ATOM   2604 C  CZ2 . TRP B 1 141 ? 4.214   10.210  28.769  1.00 28.40 ? 132 TRP B CZ2 1 
ATOM   2605 C  CZ3 . TRP B 1 141 ? 3.814   12.539  29.263  1.00 22.09 ? 132 TRP B CZ3 1 
ATOM   2606 C  CH2 . TRP B 1 141 ? 3.432   11.188  29.298  1.00 23.82 ? 132 TRP B CH2 1 
ATOM   2607 N  N   . ALA B 1 142 ? 7.732   15.940  25.710  1.00 19.44 ? 133 ALA B N   1 
ATOM   2608 C  CA  . ALA B 1 142 ? 8.203   17.322  25.837  1.00 21.56 ? 133 ALA B CA  1 
ATOM   2609 C  C   . ALA B 1 142 ? 7.859   17.788  27.261  1.00 23.66 ? 133 ALA B C   1 
ATOM   2610 O  O   . ALA B 1 142 ? 6.792   17.447  27.771  1.00 23.96 ? 133 ALA B O   1 
ATOM   2611 C  CB  . ALA B 1 142 ? 7.592   18.258  24.823  1.00 20.36 ? 133 ALA B CB  1 
ATOM   2612 N  N   . TRP B 1 143 ? 8.766   18.579  27.863  1.00 23.60 ? 134 TRP B N   1 
ATOM   2613 C  CA  . TRP B 1 143 ? 8.649   19.009  29.278  1.00 24.14 ? 134 TRP B CA  1 
ATOM   2614 C  C   . TRP B 1 143 ? 9.029   20.476  29.521  1.00 26.48 ? 134 TRP B C   1 
ATOM   2615 O  O   . TRP B 1 143 ? 9.889   21.059  28.822  1.00 25.91 ? 134 TRP B O   1 
ATOM   2616 C  CB  . TRP B 1 143 ? 9.582   18.202  30.190  1.00 23.08 ? 134 TRP B CB  1 
ATOM   2617 C  CG  . TRP B 1 143 ? 9.579   16.697  30.039  1.00 25.23 ? 134 TRP B CG  1 
ATOM   2618 C  CD1 . TRP B 1 143 ? 10.400  15.960  29.248  1.00 21.43 ? 134 TRP B CD1 1 
ATOM   2619 C  CD2 . TRP B 1 143 ? 8.752   15.771  30.733  1.00 23.28 ? 134 TRP B CD2 1 
ATOM   2620 N  NE1 . TRP B 1 143 ? 10.147  14.626  29.403  1.00 23.98 ? 134 TRP B NE1 1 
ATOM   2621 C  CE2 . TRP B 1 143 ? 9.120   14.475  30.295  1.00 29.87 ? 134 TRP B CE2 1 
ATOM   2622 C  CE3 . TRP B 1 143 ? 7.713   15.903  31.651  1.00 22.48 ? 134 TRP B CE3 1 
ATOM   2623 C  CZ2 . TRP B 1 143 ? 8.495   13.326  30.760  1.00 25.86 ? 134 TRP B CZ2 1 
ATOM   2624 C  CZ3 . TRP B 1 143 ? 7.077   14.736  32.131  1.00 27.88 ? 134 TRP B CZ3 1 
ATOM   2625 C  CH2 . TRP B 1 143 ? 7.472   13.472  31.671  1.00 32.33 ? 134 TRP B CH2 1 
ATOM   2626 N  N   . LEU B 1 144 ? 8.366   21.042  30.529  1.00 27.24 ? 135 LEU B N   1 
ATOM   2627 C  CA  . LEU B 1 144 ? 8.860   22.171  31.300  1.00 28.96 ? 135 LEU B CA  1 
ATOM   2628 C  C   . LEU B 1 144 ? 9.318   21.629  32.671  1.00 28.90 ? 135 LEU B C   1 
ATOM   2629 O  O   . LEU B 1 144 ? 8.538   20.990  33.404  1.00 27.07 ? 135 LEU B O   1 
ATOM   2630 C  CB  . LEU B 1 144 ? 7.762   23.230  31.478  1.00 27.65 ? 135 LEU B CB  1 
ATOM   2631 C  CG  . LEU B 1 144 ? 8.129   24.431  32.385  1.00 27.80 ? 135 LEU B CG  1 
ATOM   2632 C  CD1 . LEU B 1 144 ? 9.369   25.201  31.858  1.00 25.82 ? 135 LEU B CD1 1 
ATOM   2633 C  CD2 . LEU B 1 144 ? 6.938   25.359  32.542  1.00 28.26 ? 135 LEU B CD2 1 
ATOM   2634 N  N   . VAL B 1 145 ? 10.589  21.847  32.993  1.00 29.38 ? 136 VAL B N   1 
ATOM   2635 C  CA  . VAL B 1 145 ? 11.166  21.306  34.220  1.00 33.00 ? 136 VAL B CA  1 
ATOM   2636 C  C   . VAL B 1 145 ? 11.812  22.410  35.065  1.00 34.68 ? 136 VAL B C   1 
ATOM   2637 O  O   . VAL B 1 145 ? 12.069  23.510  34.570  1.00 34.21 ? 136 VAL B O   1 
ATOM   2638 C  CB  . VAL B 1 145 ? 12.264  20.220  33.923  1.00 34.08 ? 136 VAL B CB  1 
ATOM   2639 C  CG1 . VAL B 1 145 ? 11.662  18.985  33.170  1.00 33.08 ? 136 VAL B CG1 1 
ATOM   2640 C  CG2 . VAL B 1 145 ? 13.438  20.819  33.157  1.00 38.40 ? 136 VAL B CG2 1 
ATOM   2641 N  N   . VAL B 1 146 ? 12.073  22.066  36.326  1.00 37.25 ? 137 VAL B N   1 
ATOM   2642 C  CA  . VAL B 1 146 ? 12.926  22.828  37.238  1.00 38.67 ? 137 VAL B CA  1 
ATOM   2643 C  C   . VAL B 1 146 ? 14.257  22.089  37.383  1.00 39.67 ? 137 VAL B C   1 
ATOM   2644 O  O   . VAL B 1 146 ? 14.271  20.943  37.847  1.00 40.40 ? 137 VAL B O   1 
ATOM   2645 C  CB  . VAL B 1 146 ? 12.292  22.905  38.642  1.00 39.92 ? 137 VAL B CB  1 
ATOM   2646 C  CG1 . VAL B 1 146 ? 13.263  23.648  39.644  1.00 42.24 ? 137 VAL B CG1 1 
ATOM   2647 C  CG2 . VAL B 1 146 ? 10.952  23.586  38.566  1.00 39.97 ? 137 VAL B CG2 1 
ATOM   2648 N  N   . ASN B 1 147 ? 15.348  22.731  36.997  1.00 40.60 ? 138 ASN B N   1 
ATOM   2649 C  CA  A ASN B 1 147 ? 16.672  22.164  37.180  0.50 41.52 ? 138 ASN B CA  1 
ATOM   2650 C  CA  B ASN B 1 147 ? 16.706  22.242  37.112  0.50 41.22 ? 138 ASN B CA  1 
ATOM   2651 C  C   A ASN B 1 147 ? 17.505  22.854  38.262  0.50 44.15 ? 138 ASN B C   1 
ATOM   2652 C  C   B ASN B 1 147 ? 17.473  23.242  37.982  0.50 42.05 ? 138 ASN B C   1 
ATOM   2653 O  O   A ASN B 1 147 ? 17.799  22.269  39.298  0.50 44.63 ? 138 ASN B O   1 
ATOM   2654 O  O   B ASN B 1 147 ? 17.734  24.374  37.550  0.50 40.72 ? 138 ASN B O   1 
ATOM   2655 C  CB  . ASN B 1 147 ? 17.425  22.183  35.859  1.00 42.07 ? 138 ASN B CB  1 
ATOM   2656 C  CG  . ASN B 1 147 ? 18.778  21.509  35.883  1.00 41.64 ? 138 ASN B CG  1 
ATOM   2657 O  OD1 . ASN B 1 147 ? 19.066  20.704  36.760  1.00 51.74 ? 138 ASN B OD1 1 
ATOM   2658 N  ND2 . ASN B 1 147 ? 19.611  21.835  34.916  1.00 42.47 ? 138 ASN B ND2 1 
ATOM   2659 N  N   A ASN B 1 148 ? 17.901  24.093  38.014  0.50 45.08 ? 139 ASN B N   1 
ATOM   2660 N  N   B ASN B 1 148 ? 17.829  22.840  39.200  0.50 42.58 ? 139 ASN B N   1 
ATOM   2661 C  CA  A ASN B 1 148 ? 18.636  24.832  39.033  0.50 45.97 ? 139 ASN B CA  1 
ATOM   2662 C  CA  B ASN B 1 148 ? 18.635  23.697  40.054  0.50 43.19 ? 139 ASN B CA  1 
ATOM   2663 C  C   A ASN B 1 148 ? 17.808  24.873  40.303  0.50 45.63 ? 139 ASN B C   1 
ATOM   2664 C  C   B ASN B 1 148 ? 17.907  25.009  40.353  0.50 43.70 ? 139 ASN B C   1 
ATOM   2665 O  O   A ASN B 1 148 ? 17.647  23.870  40.969  0.50 45.86 ? 139 ASN B O   1 
ATOM   2666 O  O   B ASN B 1 148 ? 18.534  26.067  40.425  0.50 44.38 ? 139 ASN B O   1 
ATOM   2667 C  CB  A ASN B 1 148 ? 19.963  24.137  39.324  0.50 46.34 ? 139 ASN B CB  1 
ATOM   2668 C  CB  B ASN B 1 148 ? 19.957  24.008  39.344  0.50 43.44 ? 139 ASN B CB  1 
ATOM   2669 C  CG  A ASN B 1 148 ? 20.816  23.990  38.093  0.50 47.15 ? 139 ASN B CG  1 
ATOM   2670 C  CG  B ASN B 1 148 ? 20.896  22.830  39.301  0.50 42.60 ? 139 ASN B CG  1 
ATOM   2671 O  OD1 A ASN B 1 148 ? 21.762  23.206  38.066  0.50 55.43 ? 139 ASN B OD1 1 
ATOM   2672 O  OD1 B ASN B 1 148 ? 20.818  21.919  40.130  0.50 52.16 ? 139 ASN B OD1 1 
ATOM   2673 N  ND2 A ASN B 1 148 ? 20.487  24.750  37.059  0.50 54.12 ? 139 ASN B ND2 1 
ATOM   2674 N  ND2 B ASN B 1 148 ? 21.807  22.843  38.330  0.50 52.18 ? 139 ASN B ND2 1 
ATOM   2675 N  N   A GLY B 1 149 ? 17.268  26.035  40.622  0.50 45.37 ? 140 GLY B N   1 
ATOM   2676 N  N   B GLY B 1 149 ? 16.582  24.943  40.492  0.50 44.09 ? 140 GLY B N   1 
ATOM   2677 C  CA  A GLY B 1 149 ? 15.835  26.198  40.710  0.50 44.65 ? 140 GLY B CA  1 
ATOM   2678 C  CA  B GLY B 1 149 ? 15.777  26.138  40.767  0.50 43.97 ? 140 GLY B CA  1 
ATOM   2679 C  C   . GLY B 1 149 ? 15.323  26.994  39.536  1.00 44.38 ? 140 GLY B C   1 
ATOM   2680 O  O   . GLY B 1 149 ? 14.516  27.905  39.650  1.00 43.52 ? 140 GLY B O   1 
ATOM   2681 N  N   . GLU B 1 150 ? 15.828  26.613  38.374  1.00 43.60 ? 141 GLU B N   1 
ATOM   2682 C  CA  . GLU B 1 150 ? 15.587  27.324  37.135  1.00 42.69 ? 141 GLU B CA  1 
ATOM   2683 C  C   . GLU B 1 150 ? 14.724  26.478  36.179  1.00 40.61 ? 141 GLU B C   1 
ATOM   2684 O  O   . GLU B 1 150 ? 14.867  25.245  36.106  1.00 36.64 ? 141 GLU B O   1 
ATOM   2685 C  CB  . GLU B 1 150 ? 16.924  27.651  36.441  1.00 44.63 ? 141 GLU B CB  1 
ATOM   2686 C  CG  . GLU B 1 150 ? 17.795  28.702  37.154  1.00 49.98 ? 141 GLU B CG  1 
ATOM   2687 C  CD  . GLU B 1 150 ? 17.118  30.066  37.247  1.00 58.05 ? 141 GLU B CD  1 
ATOM   2688 O  OE1 . GLU B 1 150 ? 16.487  30.352  38.287  1.00 60.54 ? 141 GLU B OE1 1 
ATOM   2689 O  OE2 . GLU B 1 150 ? 17.202  30.847  36.275  1.00 56.63 ? 141 GLU B OE2 1 
ATOM   2690 N  N   . LEU B 1 151 ? 13.839  27.182  35.467  1.00 40.71 ? 142 LEU B N   1 
ATOM   2691 C  CA  . LEU B 1 151 ? 12.964  26.601  34.442  1.00 39.00 ? 142 LEU B CA  1 
ATOM   2692 C  C   . LEU B 1 151 ? 13.729  26.301  33.152  1.00 37.78 ? 142 LEU B C   1 
ATOM   2693 O  O   . LEU B 1 151 ? 14.448  27.136  32.621  1.00 35.04 ? 142 LEU B O   1 
ATOM   2694 C  CB  . LEU B 1 151 ? 11.789  27.539  34.124  1.00 39.72 ? 142 LEU B CB  1 
ATOM   2695 C  CG  . LEU B 1 151 ? 10.726  27.827  35.198  1.00 37.25 ? 142 LEU B CG  1 
ATOM   2696 C  CD1 . LEU B 1 151 ? 9.764   28.905  34.711  1.00 41.52 ? 142 LEU B CD1 1 
ATOM   2697 C  CD2 . LEU B 1 151 ? 9.943   26.589  35.614  1.00 40.65 ? 142 LEU B CD2 1 
ATOM   2698 N  N   . GLU B 1 152 ? 13.497  25.097  32.628  1.00 37.34 ? 143 GLU B N   1 
ATOM   2699 C  CA  . GLU B 1 152 ? 14.052  24.677  31.355  1.00 35.68 ? 143 GLU B CA  1 
ATOM   2700 C  C   . GLU B 1 152 ? 13.007  23.943  30.531  1.00 32.70 ? 143 GLU B C   1 
ATOM   2701 O  O   . GLU B 1 152 ? 12.213  23.171  31.085  1.00 29.35 ? 143 GLU B O   1 
ATOM   2702 C  CB  . GLU B 1 152 ? 15.218  23.719  31.592  1.00 36.65 ? 143 GLU B CB  1 
ATOM   2703 C  CG  . GLU B 1 152 ? 16.422  24.316  32.293  1.00 40.88 ? 143 GLU B CG  1 
ATOM   2704 C  CD  . GLU B 1 152 ? 17.589  23.334  32.300  1.00 39.26 ? 143 GLU B CD  1 
ATOM   2705 O  OE1 . GLU B 1 152 ? 17.348  22.135  32.003  1.00 54.58 ? 143 GLU B OE1 1 
ATOM   2706 O  OE2 . GLU B 1 152 ? 18.735  23.750  32.589  1.00 42.61 ? 143 GLU B OE2 1 
ATOM   2707 N  N   . VAL B 1 153 ? 12.998  24.206  29.227  1.00 31.55 ? 144 VAL B N   1 
ATOM   2708 C  CA  . VAL B 1 153 ? 12.218  23.383  28.293  1.00 32.67 ? 144 VAL B CA  1 
ATOM   2709 C  C   . VAL B 1 153 ? 13.145  22.256  27.819  1.00 32.67 ? 144 VAL B C   1 
ATOM   2710 O  O   . VAL B 1 153 ? 14.259  22.525  27.377  1.00 34.47 ? 144 VAL B O   1 
ATOM   2711 C  CB  . VAL B 1 153 ? 11.711  24.190  27.061  1.00 33.43 ? 144 VAL B CB  1 
ATOM   2712 C  CG1 . VAL B 1 153 ? 11.381  23.230  25.878  1.00 30.75 ? 144 VAL B CG1 1 
ATOM   2713 C  CG2 . VAL B 1 153 ? 10.448  25.044  27.422  1.00 30.86 ? 144 VAL B CG2 1 
ATOM   2714 N  N   . THR B 1 154 ? 12.701  20.997  27.908  1.00 30.74 ? 145 THR B N   1 
ATOM   2715 C  CA  . THR B 1 154 ? 13.507  19.862  27.396  1.00 29.77 ? 145 THR B CA  1 
ATOM   2716 C  C   . THR B 1 154 ? 12.611  18.853  26.637  1.00 28.83 ? 145 THR B C   1 
ATOM   2717 O  O   . THR B 1 154 ? 11.374  18.978  26.636  1.00 25.94 ? 145 THR B O   1 
ATOM   2718 C  CB  . THR B 1 154 ? 14.231  19.122  28.556  1.00 30.54 ? 145 THR B CB  1 
ATOM   2719 O  OG1 . THR B 1 154 ? 13.273  18.448  29.390  1.00 34.32 ? 145 THR B OG1 1 
ATOM   2720 C  CG2 . THR B 1 154 ? 14.975  20.073  29.426  1.00 38.45 ? 145 THR B CG2 1 
ATOM   2721 N  N   . SER B 1 155 ? 13.230  17.857  26.019  1.00 28.21 ? 146 SER B N   1 
ATOM   2722 C  CA  . SER B 1 155 ? 12.480  16.681  25.556  1.00 28.29 ? 146 SER B CA  1 
ATOM   2723 C  C   . SER B 1 155 ? 13.288  15.418  25.871  1.00 28.50 ? 146 SER B C   1 
ATOM   2724 O  O   . SER B 1 155 ? 14.499  15.491  26.023  1.00 29.27 ? 146 SER B O   1 
ATOM   2725 C  CB  . SER B 1 155 ? 12.150  16.821  24.060  1.00 28.46 ? 146 SER B CB  1 
ATOM   2726 O  OG  . SER B 1 155 ? 13.169  16.307  23.245  1.00 32.39 ? 146 SER B OG  1 
ATOM   2727 N  N   . THR B 1 156 ? 12.616  14.282  26.058  1.00 27.43 ? 147 THR B N   1 
ATOM   2728 C  CA  . THR B 1 156 ? 13.282  13.010  26.366  1.00 25.26 ? 147 THR B CA  1 
ATOM   2729 C  C   . THR B 1 156 ? 12.783  11.928  25.382  1.00 24.96 ? 147 THR B C   1 
ATOM   2730 O  O   . THR B 1 156 ? 11.628  11.992  24.909  1.00 24.18 ? 147 THR B O   1 
ATOM   2731 C  CB  . THR B 1 156 ? 13.017  12.520  27.805  1.00 22.48 ? 147 THR B CB  1 
ATOM   2732 O  OG1 . THR B 1 156 ? 11.604  12.405  28.061  1.00 27.45 ? 147 THR B OG1 1 
ATOM   2733 C  CG2 . THR B 1 156 ? 13.601  13.477  28.857  1.00 33.44 ? 147 THR B CG2 1 
ATOM   2734 N  N   . PRO B 1 157 ? 13.672  10.975  25.033  1.00 26.11 ? 148 PRO B N   1 
ATOM   2735 C  CA  . PRO B 1 157 ? 13.266  9.817   24.255  1.00 24.50 ? 148 PRO B CA  1 
ATOM   2736 C  C   . PRO B 1 157 ? 12.497  8.751   25.021  1.00 23.70 ? 148 PRO B C   1 
ATOM   2737 O  O   . PRO B 1 157 ? 12.749  8.484   26.200  1.00 21.28 ? 148 PRO B O   1 
ATOM   2738 C  CB  . PRO B 1 157 ? 14.581  9.231   23.765  1.00 24.80 ? 148 PRO B CB  1 
ATOM   2739 C  CG  . PRO B 1 157 ? 15.599  9.656   24.749  1.00 30.47 ? 148 PRO B CG  1 
ATOM   2740 C  CD  . PRO B 1 157 ? 15.118  10.992  25.298  1.00 25.50 ? 148 PRO B CD  1 
ATOM   2741 N  N   . ASN B 1 158 ? 11.588  8.122   24.285  1.00 22.41 ? 149 ASN B N   1 
ATOM   2742 C  CA  . ASN B 1 158 ? 10.881  6.902   24.687  1.00 23.39 ? 149 ASN B CA  1 
ATOM   2743 C  C   . ASN B 1 158 ? 10.178  7.176   26.026  1.00 23.17 ? 149 ASN B C   1 
ATOM   2744 O  O   . ASN B 1 158 ? 9.357   8.078   26.068  1.00 22.95 ? 149 ASN B O   1 
ATOM   2745 C  CB  . ASN B 1 158 ? 11.812  5.673   24.646  1.00 22.03 ? 149 ASN B CB  1 
ATOM   2746 C  CG  . ASN B 1 158 ? 12.490  5.501   23.282  1.00 28.38 ? 149 ASN B CG  1 
ATOM   2747 O  OD1 . ASN B 1 158 ? 13.705  5.261   23.184  1.00 28.24 ? 149 ASN B OD1 1 
ATOM   2748 N  ND2 . ASN B 1 158 ? 11.724  5.689   22.239  1.00 18.69 ? 149 ASN B ND2 1 
ATOM   2749 N  N   . GLN B 1 159 ? 10.460  6.418   27.079  1.00 22.33 ? 150 GLN B N   1 
ATOM   2750 C  CA  . GLN B 1 159 ? 9.876   6.719   28.376  1.00 24.45 ? 150 GLN B CA  1 
ATOM   2751 C  C   . GLN B 1 159 ? 10.923  7.215   29.352  1.00 25.18 ? 150 GLN B C   1 
ATOM   2752 O  O   . GLN B 1 159 ? 10.706  7.083   30.543  1.00 25.42 ? 150 GLN B O   1 
ATOM   2753 C  CB  . GLN B 1 159 ? 9.142   5.512   28.978  1.00 22.57 ? 150 GLN B CB  1 
ATOM   2754 C  CG  . GLN B 1 159 ? 7.914   5.037   28.242  1.00 27.71 ? 150 GLN B CG  1 
ATOM   2755 C  CD  . GLN B 1 159 ? 6.863   6.089   27.982  1.00 28.40 ? 150 GLN B CD  1 
ATOM   2756 O  OE1 . GLN B 1 159 ? 6.805   7.150   28.655  1.00 23.37 ? 150 GLN B OE1 1 
ATOM   2757 N  NE2 . GLN B 1 159 ? 5.971   5.783   27.031  1.00 25.34 ? 150 GLN B NE2 1 
ATOM   2758 N  N   . ASP B 1 160 ? 12.047  7.764   28.867  1.00 26.07 ? 151 ASP B N   1 
ATOM   2759 C  CA  . ASP B 1 160 ? 13.056  8.331   29.780  1.00 28.08 ? 151 ASP B CA  1 
ATOM   2760 C  C   . ASP B 1 160 ? 12.401  9.505   30.534  1.00 30.48 ? 151 ASP B C   1 
ATOM   2761 O  O   . ASP B 1 160 ? 11.537  10.199  29.995  1.00 28.66 ? 151 ASP B O   1 
ATOM   2762 C  CB  . ASP B 1 160 ? 14.335  8.787   29.050  1.00 27.66 ? 151 ASP B CB  1 
ATOM   2763 C  CG  . ASP B 1 160 ? 15.121  7.620   28.428  1.00 32.42 ? 151 ASP B CG  1 
ATOM   2764 O  OD1 . ASP B 1 160 ? 16.181  7.905   27.857  1.00 30.06 ? 151 ASP B OD1 1 
ATOM   2765 O  OD2 . ASP B 1 160 ? 14.706  6.424   28.497  1.00 28.69 ? 151 ASP B OD2 1 
ATOM   2766 N  N   . SER B 1 161 ? 12.780  9.669   31.805  1.00 31.38 ? 152 SER B N   1 
ATOM   2767 C  CA  . SER B 1 161 ? 12.184  10.679  32.709  1.00 31.30 ? 152 SER B CA  1 
ATOM   2768 C  C   . SER B 1 161 ? 13.224  11.749  33.056  1.00 30.77 ? 152 SER B C   1 
ATOM   2769 O  O   . SER B 1 161 ? 14.403  11.434  33.255  1.00 30.02 ? 152 SER B O   1 
ATOM   2770 C  CB  . SER B 1 161 ? 11.671  10.005  33.999  1.00 32.72 ? 152 SER B CB  1 
ATOM   2771 O  OG  . SER B 1 161 ? 11.269  10.929  34.999  1.00 27.50 ? 152 SER B OG  1 
ATOM   2772 N  N   . PRO B 1 162 ? 12.812  13.024  33.101  1.00 32.01 ? 153 PRO B N   1 
ATOM   2773 C  CA  . PRO B 1 162 ? 13.695  14.069  33.615  1.00 32.55 ? 153 PRO B CA  1 
ATOM   2774 C  C   . PRO B 1 162 ? 14.197  13.799  35.049  1.00 33.31 ? 153 PRO B C   1 
ATOM   2775 O  O   . PRO B 1 162 ? 15.339  14.152  35.375  1.00 37.26 ? 153 PRO B O   1 
ATOM   2776 C  CB  . PRO B 1 162 ? 12.791  15.305  33.611  1.00 31.82 ? 153 PRO B CB  1 
ATOM   2777 C  CG  . PRO B 1 162 ? 11.801  15.005  32.564  1.00 30.72 ? 153 PRO B CG  1 
ATOM   2778 C  CD  . PRO B 1 162 ? 11.499  13.586  32.729  1.00 30.91 ? 153 PRO B CD  1 
ATOM   2779 N  N   . LEU B 1 163 ? 13.350  13.206  35.890  1.00 34.71 ? 154 LEU B N   1 
ATOM   2780 C  CA  . LEU B 1 163 ? 13.738  12.775  37.258  1.00 33.22 ? 154 LEU B CA  1 
ATOM   2781 C  C   . LEU B 1 163 ? 15.062  12.027  37.323  1.00 34.82 ? 154 LEU B C   1 
ATOM   2782 O  O   . LEU B 1 163 ? 15.747  12.066  38.363  1.00 34.21 ? 154 LEU B O   1 
ATOM   2783 C  CB  . LEU B 1 163 ? 12.711  11.824  37.833  1.00 32.45 ? 154 LEU B CB  1 
ATOM   2784 C  CG  . LEU B 1 163 ? 11.294  12.345  38.074  1.00 33.45 ? 154 LEU B CG  1 
ATOM   2785 C  CD1 . LEU B 1 163 ? 10.394  11.252  38.604  1.00 40.02 ? 154 LEU B CD1 1 
ATOM   2786 C  CD2 . LEU B 1 163 ? 11.349  13.525  39.030  1.00 36.40 ? 154 LEU B CD2 1 
ATOM   2787 N  N   . THR B 1 164 ? 15.378  11.279  36.266  1.00 33.26 ? 155 THR B N   1 
ATOM   2788 C  CA  . THR B 1 164 ? 16.599  10.487  36.216  1.00 35.14 ? 155 THR B CA  1 
ATOM   2789 C  C   . THR B 1 164 ? 17.809  11.409  36.081  1.00 37.75 ? 155 THR B C   1 
ATOM   2790 O  O   . THR B 1 164 ? 18.892  11.082  36.556  1.00 38.05 ? 155 THR B O   1 
ATOM   2791 C  CB  . THR B 1 164 ? 16.550  9.454   35.061  1.00 34.36 ? 155 THR B CB  1 
ATOM   2792 O  OG1 . THR B 1 164 ? 15.360  8.656   35.167  1.00 32.13 ? 155 THR B OG1 1 
ATOM   2793 C  CG2 . THR B 1 164 ? 17.765  8.514   35.093  1.00 32.49 ? 155 THR B CG2 1 
ATOM   2794 N  N   . GLU B 1 165 ? 17.605  12.557  35.430  1.00 39.86 ? 156 GLU B N   1 
ATOM   2795 C  CA  . GLU B 1 165 ? 18.624  13.603  35.282  1.00 40.59 ? 156 GLU B CA  1 
ATOM   2796 C  C   . GLU B 1 165 ? 18.635  14.605  36.469  1.00 40.91 ? 156 GLU B C   1 
ATOM   2797 O  O   . GLU B 1 165 ? 19.262  15.651  36.371  1.00 41.71 ? 156 GLU B O   1 
ATOM   2798 C  CB  . GLU B 1 165 ? 18.340  14.418  34.015  1.00 40.97 ? 156 GLU B CB  1 
ATOM   2799 C  CG  . GLU B 1 165 ? 18.228  13.614  32.709  1.00 48.37 ? 156 GLU B CG  1 
ATOM   2800 C  CD  . GLU B 1 165 ? 17.626  14.442  31.560  1.00 42.90 ? 156 GLU B CD  1 
ATOM   2801 O  OE1 . GLU B 1 165 ? 18.281  15.431  31.150  1.00 58.05 ? 156 GLU B OE1 1 
ATOM   2802 O  OE2 . GLU B 1 165 ? 16.511  14.100  31.076  1.00 50.19 ? 156 GLU B OE2 1 
ATOM   2803 N  N   . GLY B 1 166 ? 17.885  14.322  37.532  1.00 41.13 ? 157 GLY B N   1 
ATOM   2804 C  CA  . GLY B 1 166 ? 17.768  15.242  38.653  1.00 41.54 ? 157 GLY B CA  1 
ATOM   2805 C  C   . GLY B 1 166 ? 16.910  16.465  38.384  1.00 43.28 ? 157 GLY B C   1 
ATOM   2806 O  O   . GLY B 1 166 ? 17.035  17.476  39.084  1.00 44.38 ? 157 GLY B O   1 
ATOM   2807 N  N   . LYS B 1 167 ? 16.029  16.396  37.380  1.00 42.65 ? 158 LYS B N   1 
ATOM   2808 C  CA  . LYS B 1 167 ? 15.189  17.543  37.004  1.00 39.36 ? 158 LYS B CA  1 
ATOM   2809 C  C   . LYS B 1 167 ? 13.745  17.228  37.371  1.00 38.34 ? 158 LYS B C   1 
ATOM   2810 O  O   . LYS B 1 167 ? 13.321  16.069  37.292  1.00 37.89 ? 158 LYS B O   1 
ATOM   2811 C  CB  . LYS B 1 167 ? 15.315  17.803  35.509  1.00 38.52 ? 158 LYS B CB  1 
ATOM   2812 C  CG  . LYS B 1 167 ? 16.648  18.387  35.061  1.00 39.66 ? 158 LYS B CG  1 
ATOM   2813 C  CD  . LYS B 1 167 ? 16.725  18.325  33.566  1.00 39.74 ? 158 LYS B CD  1 
ATOM   2814 C  CE  . LYS B 1 167 ? 17.670  19.329  32.966  1.00 50.17 ? 158 LYS B CE  1 
ATOM   2815 N  NZ  . LYS B 1 167 ? 18.959  18.745  32.612  1.00 39.40 ? 158 LYS B NZ  1 
ATOM   2816 N  N   . THR B 1 168 ? 12.980  18.243  37.755  1.00 37.60 ? 159 THR B N   1 
ATOM   2817 C  CA  . THR B 1 168 ? 11.614  18.018  38.253  1.00 36.78 ? 159 THR B CA  1 
ATOM   2818 C  C   . THR B 1 168 ? 10.591  18.536  37.248  1.00 34.98 ? 159 THR B C   1 
ATOM   2819 O  O   . THR B 1 168 ? 10.592  19.723  36.917  1.00 34.69 ? 159 THR B O   1 
ATOM   2820 C  CB  . THR B 1 168 ? 11.371  18.658  39.648  1.00 37.30 ? 159 THR B CB  1 
ATOM   2821 O  OG1 . THR B 1 168 ? 12.339  18.156  40.570  1.00 37.36 ? 159 THR B OG1 1 
ATOM   2822 C  CG2 . THR B 1 168 ? 9.987   18.288  40.183  1.00 38.63 ? 159 THR B CG2 1 
ATOM   2823 N  N   . PRO B 1 169 ? 9.740   17.639  36.734  1.00 34.88 ? 160 PRO B N   1 
ATOM   2824 C  CA  . PRO B 1 169 ? 8.655   18.005  35.835  1.00 33.96 ? 160 PRO B CA  1 
ATOM   2825 C  C   . PRO B 1 169 ? 7.590   18.927  36.449  1.00 33.82 ? 160 PRO B C   1 
ATOM   2826 O  O   . PRO B 1 169 ? 7.056   18.645  37.553  1.00 33.88 ? 160 PRO B O   1 
ATOM   2827 C  CB  . PRO B 1 169 ? 8.021   16.647  35.472  1.00 34.88 ? 160 PRO B CB  1 
ATOM   2828 C  CG  . PRO B 1 169 ? 9.042   15.636  35.772  1.00 32.82 ? 160 PRO B CG  1 
ATOM   2829 C  CD  . PRO B 1 169 ? 9.793   16.177  36.937  1.00 35.69 ? 160 PRO B CD  1 
ATOM   2830 N  N   . VAL B 1 170 ? 7.297   19.999  35.712  1.00 31.37 ? 161 VAL B N   1 
ATOM   2831 C  CA  . VAL B 1 170 ? 6.247   20.970  36.041  1.00 29.98 ? 161 VAL B CA  1 
ATOM   2832 C  C   . VAL B 1 170 ? 5.048   20.771  35.106  1.00 27.53 ? 161 VAL B C   1 
ATOM   2833 O  O   . VAL B 1 170 ? 3.922   20.607  35.573  1.00 26.80 ? 161 VAL B O   1 
ATOM   2834 C  CB  . VAL B 1 170 ? 6.787   22.445  35.993  1.00 29.94 ? 161 VAL B CB  1 
ATOM   2835 C  CG1 . VAL B 1 170 ? 5.668   23.452  36.150  1.00 34.93 ? 161 VAL B CG1 1 
ATOM   2836 C  CG2 . VAL B 1 170 ? 7.819   22.670  37.114  1.00 29.63 ? 161 VAL B CG2 1 
ATOM   2837 N  N   . ILE B 1 171 ? 5.282   20.769  33.796  1.00 26.40 ? 162 ILE B N   1 
ATOM   2838 C  CA  . ILE B 1 171 ? 4.294   20.206  32.872  1.00 26.99 ? 162 ILE B CA  1 
ATOM   2839 C  C   . ILE B 1 171 ? 5.015   19.323  31.837  1.00 24.32 ? 162 ILE B C   1 
ATOM   2840 O  O   . ILE B 1 171 ? 6.271   19.348  31.700  1.00 24.21 ? 162 ILE B O   1 
ATOM   2841 C  CB  . ILE B 1 171 ? 3.416   21.295  32.141  1.00 28.98 ? 162 ILE B CB  1 
ATOM   2842 C  CG1 . ILE B 1 171 ? 4.220   22.102  31.091  1.00 28.39 ? 162 ILE B CG1 1 
ATOM   2843 C  CG2 . ILE B 1 171 ? 2.727   22.249  33.154  1.00 33.37 ? 162 ILE B CG2 1 
ATOM   2844 C  CD1 . ILE B 1 171 ? 3.320   22.692  29.999  1.00 28.37 ? 162 ILE B CD1 1 
ATOM   2845 N  N   . GLY B 1 172 ? 4.209   18.551  31.134  1.00 23.36 ? 163 GLY B N   1 
ATOM   2846 C  CA  . GLY B 1 172 ? 4.726   17.649  30.104  1.00 23.76 ? 163 GLY B CA  1 
ATOM   2847 C  C   . GLY B 1 172 ? 3.683   17.169  29.141  1.00 23.14 ? 163 GLY B C   1 
ATOM   2848 O  O   . GLY B 1 172 ? 2.484   17.147  29.462  1.00 23.14 ? 163 GLY B O   1 
ATOM   2849 N  N   . LEU B 1 173 ? 4.154   16.777  27.942  1.00 21.83 ? 164 LEU B N   1 
ATOM   2850 C  CA  . LEU B 1 173 ? 3.265   16.303  26.902  1.00 20.85 ? 164 LEU B CA  1 
ATOM   2851 C  C   . LEU B 1 173 ? 3.858   15.077  26.222  1.00 19.37 ? 164 LEU B C   1 
ATOM   2852 O  O   . LEU B 1 173 ? 5.040   15.092  25.796  1.00 20.33 ? 164 LEU B O   1 
ATOM   2853 C  CB  . LEU B 1 173 ? 3.017   17.357  25.818  1.00 22.48 ? 164 LEU B CB  1 
ATOM   2854 C  CG  . LEU B 1 173 ? 2.079   16.964  24.667  1.00 17.90 ? 164 LEU B CG  1 
ATOM   2855 C  CD1 . LEU B 1 173 ? 0.603   16.620  25.099  1.00 21.58 ? 164 LEU B CD1 1 
ATOM   2856 C  CD2 . LEU B 1 173 ? 2.060   18.102  23.670  1.00 21.01 ? 164 LEU B CD2 1 
ATOM   2857 N  N   . ASP B 1 174 ? 3.008   14.053  26.147  1.00 19.01 ? 165 ASP B N   1 
ATOM   2858 C  CA  . ASP B 1 174 ? 3.326   12.764  25.499  1.00 20.67 ? 165 ASP B CA  1 
ATOM   2859 C  C   . ASP B 1 174 ? 3.279   12.977  23.983  1.00 19.06 ? 165 ASP B C   1 
ATOM   2860 O  O   . ASP B 1 174 ? 2.214   13.248  23.399  1.00 20.65 ? 165 ASP B O   1 
ATOM   2861 C  CB  . ASP B 1 174 ? 2.301   11.713  25.967  1.00 20.70 ? 165 ASP B CB  1 
ATOM   2862 C  CG  . ASP B 1 174 ? 2.614   10.279  25.517  1.00 18.04 ? 165 ASP B CG  1 
ATOM   2863 O  OD1 . ASP B 1 174 ? 3.690   10.099  24.914  1.00 18.85 ? 165 ASP B OD1 1 
ATOM   2864 O  OD2 . ASP B 1 174 ? 1.766   9.347   25.835  1.00 22.65 ? 165 ASP B OD2 1 
ATOM   2865 N  N   . VAL B 1 175 ? 4.435   12.859  23.342  1.00 17.77 ? 166 VAL B N   1 
ATOM   2866 C  CA  . VAL B 1 175 ? 4.486   12.886  21.876  1.00 19.29 ? 166 VAL B CA  1 
ATOM   2867 C  C   . VAL B 1 175 ? 4.757   11.545  21.147  1.00 19.72 ? 166 VAL B C   1 
ATOM   2868 O  O   . VAL B 1 175 ? 5.107   11.540  19.956  1.00 21.45 ? 166 VAL B O   1 
ATOM   2869 C  CB  . VAL B 1 175 ? 5.413   14.061  21.378  1.00 18.36 ? 166 VAL B CB  1 
ATOM   2870 C  CG1 . VAL B 1 175 ? 4.886   15.386  21.912  1.00 22.24 ? 166 VAL B CG1 1 
ATOM   2871 C  CG2 . VAL B 1 175 ? 6.881   13.874  21.745  1.00 23.80 ? 166 VAL B CG2 1 
ATOM   2872 N  N   . TRP B 1 176 ? 4.497   10.410  21.810  1.00 20.07 ? 167 TRP B N   1 
ATOM   2873 C  CA  . TRP B 1 176 ? 4.369   9.152   21.100  1.00 18.54 ? 167 TRP B CA  1 
ATOM   2874 C  C   . TRP B 1 176 ? 3.146   9.270   20.185  1.00 19.94 ? 167 TRP B C   1 
ATOM   2875 O  O   . TRP B 1 176 ? 2.126   9.870   20.551  1.00 17.81 ? 167 TRP B O   1 
ATOM   2876 C  CB  . TRP B 1 176 ? 4.178   7.965   22.069  1.00 18.14 ? 167 TRP B CB  1 
ATOM   2877 C  CG  . TRP B 1 176 ? 5.342   7.585   22.886  1.00 18.36 ? 167 TRP B CG  1 
ATOM   2878 C  CD1 . TRP B 1 176 ? 6.097   8.365   23.751  1.00 19.40 ? 167 TRP B CD1 1 
ATOM   2879 C  CD2 . TRP B 1 176 ? 5.829   6.248   23.032  1.00 26.19 ? 167 TRP B CD2 1 
ATOM   2880 N  NE1 . TRP B 1 176 ? 7.056   7.592   24.348  1.00 26.59 ? 167 TRP B NE1 1 
ATOM   2881 C  CE2 . TRP B 1 176 ? 6.914   6.288   23.927  1.00 25.94 ? 167 TRP B CE2 1 
ATOM   2882 C  CE3 . TRP B 1 176 ? 5.475   5.023   22.446  1.00 24.35 ? 167 TRP B CE3 1 
ATOM   2883 C  CZ2 . TRP B 1 176 ? 7.611   5.134   24.287  1.00 24.06 ? 167 TRP B CZ2 1 
ATOM   2884 C  CZ3 . TRP B 1 176 ? 6.195   3.882   22.787  1.00 24.85 ? 167 TRP B CZ3 1 
ATOM   2885 C  CH2 . TRP B 1 176 ? 7.239   3.948   23.703  1.00 22.43 ? 167 TRP B CH2 1 
ATOM   2886 N  N   . GLU B 1 177 ? 3.241   8.740   18.973  1.00 17.70 ? 168 GLU B N   1 
ATOM   2887 C  CA  . GLU B 1 177 ? 2.076   8.742   18.064  1.00 18.89 ? 168 GLU B CA  1 
ATOM   2888 C  C   . GLU B 1 177 ? 0.757   8.172   18.629  1.00 18.64 ? 168 GLU B C   1 
ATOM   2889 O  O   . GLU B 1 177 ? -0.341  8.659   18.250  1.00 19.62 ? 168 GLU B O   1 
ATOM   2890 C  CB  . GLU B 1 177 ? 2.495   8.123   16.711  1.00 15.31 ? 168 GLU B CB  1 
ATOM   2891 C  CG  . GLU B 1 177 ? 3.425   9.050   15.918  1.00 15.08 ? 168 GLU B CG  1 
ATOM   2892 C  CD  . GLU B 1 177 ? 4.165   8.383   14.726  1.00 19.39 ? 168 GLU B CD  1 
ATOM   2893 O  OE1 . GLU B 1 177 ? 4.472   7.172   14.751  1.00 16.67 ? 168 GLU B OE1 1 
ATOM   2894 O  OE2 . GLU B 1 177 ? 4.483   9.132   13.780  1.00 19.12 ? 168 GLU B OE2 1 
ATOM   2895 N  N   . HIS B 1 178 ? 0.809   7.190   19.527  1.00 19.50 ? 169 HIS B N   1 
ATOM   2896 C  CA  . HIS B 1 178 ? -0.431  6.637   20.141  1.00 19.77 ? 169 HIS B CA  1 
ATOM   2897 C  C   . HIS B 1 178 ? -1.222  7.759   20.853  1.00 18.76 ? 169 HIS B C   1 
ATOM   2898 O  O   . HIS B 1 178 ? -2.442  7.650   21.022  1.00 19.71 ? 169 HIS B O   1 
ATOM   2899 C  CB  . HIS B 1 178 ? -0.159  5.433   21.103  1.00 20.56 ? 169 HIS B CB  1 
ATOM   2900 C  CG  . HIS B 1 178 ? 0.661   5.742   22.344  1.00 21.99 ? 169 HIS B CG  1 
ATOM   2901 N  ND1 . HIS B 1 178 ? 1.855   5.112   22.631  1.00 21.98 ? 169 HIS B ND1 1 
ATOM   2902 C  CD2 . HIS B 1 178 ? 0.417   6.572   23.398  1.00 18.42 ? 169 HIS B CD2 1 
ATOM   2903 C  CE1 . HIS B 1 178 ? 2.328   5.591   23.785  1.00 21.88 ? 169 HIS B CE1 1 
ATOM   2904 N  NE2 . HIS B 1 178 ? 1.480   6.484   24.268  1.00 25.21 ? 169 HIS B NE2 1 
ATOM   2905 N  N   . ALA B 1 179 ? -0.513  8.786   21.312  1.00 19.97 ? 170 ALA B N   1 
ATOM   2906 C  CA  . ALA B 1 179 ? -1.150  9.895   22.094  1.00 19.65 ? 170 ALA B CA  1 
ATOM   2907 C  C   . ALA B 1 179 ? -2.052  10.796  21.244  1.00 18.19 ? 170 ALA B C   1 
ATOM   2908 O  O   . ALA B 1 179 ? -2.914  11.489  21.763  1.00 18.74 ? 170 ALA B O   1 
ATOM   2909 C  CB  . ALA B 1 179 ? -0.091  10.713  22.776  1.00 20.13 ? 170 ALA B CB  1 
ATOM   2910 N  N   . TYR B 1 180 ? -1.794  10.835  19.928  1.00 16.90 ? 171 TYR B N   1 
ATOM   2911 C  CA  . TYR B 1 180 ? -2.456  11.768  18.996  1.00 18.10 ? 171 TYR B CA  1 
ATOM   2912 C  C   . TYR B 1 180 ? -2.941  11.229  17.609  1.00 19.00 ? 171 TYR B C   1 
ATOM   2913 O  O   . TYR B 1 180 ? -3.698  11.918  16.934  1.00 18.32 ? 171 TYR B O   1 
ATOM   2914 C  CB  . TYR B 1 180 ? -1.550  13.003  18.795  1.00 20.36 ? 171 TYR B CB  1 
ATOM   2915 C  CG  . TYR B 1 180 ? -0.193  12.785  18.075  1.00 16.94 ? 171 TYR B CG  1 
ATOM   2916 C  CD1 . TYR B 1 180 ? -0.096  12.769  16.674  1.00 18.71 ? 171 TYR B CD1 1 
ATOM   2917 C  CD2 . TYR B 1 180 ? 0.970   12.692  18.803  1.00 15.70 ? 171 TYR B CD2 1 
ATOM   2918 C  CE1 . TYR B 1 180 ? 1.146   12.590  16.041  1.00 15.32 ? 171 TYR B CE1 1 
ATOM   2919 C  CE2 . TYR B 1 180 ? 2.171   12.529  18.224  1.00 16.87 ? 171 TYR B CE2 1 
ATOM   2920 C  CZ  . TYR B 1 180 ? 2.286   12.521  16.820  1.00 16.80 ? 171 TYR B CZ  1 
ATOM   2921 O  OH  . TYR B 1 180 ? 3.522   12.381  16.237  1.00 16.22 ? 171 TYR B OH  1 
ATOM   2922 N  N   . TYR B 1 181 ? -2.564  10.003  17.244  1.00 18.55 ? 172 TYR B N   1 
ATOM   2923 C  CA  . TYR B 1 181 ? -2.708  9.553   15.869  1.00 17.20 ? 172 TYR B CA  1 
ATOM   2924 C  C   . TYR B 1 181 ? -4.223  9.474   15.536  1.00 17.77 ? 172 TYR B C   1 
ATOM   2925 O  O   . TYR B 1 181 ? -4.615  9.811   14.440  1.00 18.85 ? 172 TYR B O   1 
ATOM   2926 C  CB  . TYR B 1 181 ? -1.943  8.235   15.551  1.00 16.67 ? 172 TYR B CB  1 
ATOM   2927 C  CG  . TYR B 1 181 ? -1.415  8.315   14.130  1.00 15.94 ? 172 TYR B CG  1 
ATOM   2928 C  CD1 . TYR B 1 181 ? -0.322  9.123   13.829  1.00 17.26 ? 172 TYR B CD1 1 
ATOM   2929 C  CD2 . TYR B 1 181 ? -2.114  7.729   13.063  1.00 20.35 ? 172 TYR B CD2 1 
ATOM   2930 C  CE1 . TYR B 1 181 ? 0.098   9.331   12.487  1.00 16.79 ? 172 TYR B CE1 1 
ATOM   2931 C  CE2 . TYR B 1 181 ? -1.688  7.890   11.770  1.00 19.20 ? 172 TYR B CE2 1 
ATOM   2932 C  CZ  . TYR B 1 181 ? -0.588  8.698   11.481  1.00 21.55 ? 172 TYR B CZ  1 
ATOM   2933 O  OH  . TYR B 1 181 ? -0.167  8.858   10.198  1.00 20.86 ? 172 TYR B OH  1 
ATOM   2934 N  N   . LEU B 1 182 ? -5.057  9.000   16.489  1.00 16.96 ? 173 LEU B N   1 
ATOM   2935 C  CA  . LEU B 1 182 ? -6.509  8.820   16.163  1.00 18.64 ? 173 LEU B CA  1 
ATOM   2936 C  C   . LEU B 1 182 ? -7.202  10.123  15.762  1.00 20.30 ? 173 LEU B C   1 
ATOM   2937 O  O   . LEU B 1 182 ? -7.983  10.138  14.796  1.00 22.38 ? 173 LEU B O   1 
ATOM   2938 C  CB  . LEU B 1 182 ? -7.253  8.095   17.294  1.00 18.50 ? 173 LEU B CB  1 
ATOM   2939 C  CG  . LEU B 1 182 ? -6.853  6.610   17.527  1.00 19.01 ? 173 LEU B CG  1 
ATOM   2940 C  CD1 . LEU B 1 182 ? -7.640  6.056   18.682  1.00 20.30 ? 173 LEU B CD1 1 
ATOM   2941 C  CD2 . LEU B 1 182 ? -7.017  5.739   16.246  1.00 29.68 ? 173 LEU B CD2 1 
ATOM   2942 N  N   . ASN B 1 183 ? -6.879  11.218  16.454  1.00 20.56 ? 174 ASN B N   1 
ATOM   2943 C  CA  . ASN B 1 183 ? -7.533  12.499  16.234  1.00 21.56 ? 174 ASN B CA  1 
ATOM   2944 C  C   . ASN B 1 183 ? -6.781  13.435  15.246  1.00 22.46 ? 174 ASN B C   1 
ATOM   2945 O  O   . ASN B 1 183 ? -7.423  14.223  14.542  1.00 27.34 ? 174 ASN B O   1 
ATOM   2946 C  CB  . ASN B 1 183 ? -7.732  13.195  17.588  1.00 22.52 ? 174 ASN B CB  1 
ATOM   2947 C  CG  . ASN B 1 183 ? -8.903  14.167  17.597  1.00 30.10 ? 174 ASN B CG  1 
ATOM   2948 O  OD1 . ASN B 1 183 ? -8.854  15.170  18.300  1.00 36.58 ? 174 ASN B OD1 1 
ATOM   2949 N  ND2 . ASN B 1 183 ? -9.990  13.837  16.879  1.00 26.72 ? 174 ASN B ND2 1 
ATOM   2950 N  N   . TYR B 1 184 ? -5.454  13.328  15.180  1.00 21.64 ? 175 TYR B N   1 
ATOM   2951 C  CA  . TYR B 1 184 ? -4.632  14.259  14.454  1.00 20.65 ? 175 TYR B CA  1 
ATOM   2952 C  C   . TYR B 1 184 ? -3.763  13.613  13.371  1.00 20.44 ? 175 TYR B C   1 
ATOM   2953 O  O   . TYR B 1 184 ? -3.136  14.330  12.615  1.00 20.73 ? 175 TYR B O   1 
ATOM   2954 C  CB  . TYR B 1 184 ? -3.724  15.019  15.417  1.00 20.88 ? 175 TYR B CB  1 
ATOM   2955 C  CG  . TYR B 1 184 ? -4.520  15.860  16.420  1.00 20.78 ? 175 TYR B CG  1 
ATOM   2956 C  CD1 . TYR B 1 184 ? -5.078  17.067  16.041  1.00 23.58 ? 175 TYR B CD1 1 
ATOM   2957 C  CD2 . TYR B 1 184 ? -4.719  15.407  17.745  1.00 23.08 ? 175 TYR B CD2 1 
ATOM   2958 C  CE1 . TYR B 1 184 ? -5.830  17.814  16.932  1.00 24.69 ? 175 TYR B CE1 1 
ATOM   2959 C  CE2 . TYR B 1 184 ? -5.493  16.134  18.639  1.00 24.60 ? 175 TYR B CE2 1 
ATOM   2960 C  CZ  . TYR B 1 184 ? -6.037  17.339  18.223  1.00 27.33 ? 175 TYR B CZ  1 
ATOM   2961 O  OH  . TYR B 1 184 ? -6.817  18.071  19.099  1.00 24.20 ? 175 TYR B OH  1 
ATOM   2962 N  N   . GLN B 1 185 ? -3.710  12.291  13.309  1.00 18.38 ? 176 GLN B N   1 
ATOM   2963 C  CA  . GLN B 1 185 ? -2.736  11.618  12.454  1.00 22.04 ? 176 GLN B CA  1 
ATOM   2964 C  C   . GLN B 1 185 ? -1.346  12.251  12.545  1.00 18.37 ? 176 GLN B C   1 
ATOM   2965 O  O   . GLN B 1 185 ? -0.812  12.413  13.632  1.00 18.27 ? 176 GLN B O   1 
ATOM   2966 C  CB  . GLN B 1 185 ? -3.300  11.559  11.010  1.00 22.86 ? 176 GLN B CB  1 
ATOM   2967 C  CG  . GLN B 1 185 ? -4.621  10.778  10.944  1.00 25.84 ? 176 GLN B CG  1 
ATOM   2968 C  CD  . GLN B 1 185 ? -5.845  11.634  11.287  1.00 29.77 ? 176 GLN B CD  1 
ATOM   2969 O  OE1 . GLN B 1 185 ? -6.585  11.327  12.215  1.00 37.71 ? 176 GLN B OE1 1 
ATOM   2970 N  NE2 . GLN B 1 185 ? -6.059  12.691  10.536  1.00 27.80 ? 176 GLN B NE2 1 
ATOM   2971 N  N   . ASN B 1 186 ? -0.742  12.632  11.406  1.00 21.05 ? 177 ASN B N   1 
ATOM   2972 C  CA  . ASN B 1 186 ? 0.634   13.132  11.360  1.00 21.61 ? 177 ASN B CA  1 
ATOM   2973 C  C   . ASN B 1 186 ? 0.704   14.576  11.862  1.00 21.90 ? 177 ASN B C   1 
ATOM   2974 O  O   . ASN B 1 186 ? 1.782   15.144  11.962  1.00 20.74 ? 177 ASN B O   1 
ATOM   2975 C  CB  . ASN B 1 186 ? 1.192   13.079  9.899   1.00 22.61 ? 177 ASN B CB  1 
ATOM   2976 C  CG  . ASN B 1 186 ? 0.393   13.908  8.959   1.00 22.28 ? 177 ASN B CG  1 
ATOM   2977 O  OD1 . ASN B 1 186 ? -0.800  13.617  8.707   1.00 19.38 ? 177 ASN B OD1 1 
ATOM   2978 N  ND2 . ASN B 1 186 ? 1.002   14.989  8.447   1.00 21.22 ? 177 ASN B ND2 1 
ATOM   2979 N  N   . ARG B 1 187 ? -0.452  15.182  12.168  1.00 20.04 ? 178 ARG B N   1 
ATOM   2980 C  CA  . ARG B 1 187 ? -0.454  16.597  12.569  1.00 21.80 ? 178 ARG B CA  1 
ATOM   2981 C  C   . ARG B 1 187 ? -0.041  16.848  14.029  1.00 20.26 ? 178 ARG B C   1 
ATOM   2982 O  O   . ARG B 1 187 ? -0.828  17.382  14.809  1.00 20.64 ? 178 ARG B O   1 
ATOM   2983 C  CB  . ARG B 1 187 ? -1.820  17.202  12.230  1.00 21.98 ? 178 ARG B CB  1 
ATOM   2984 C  CG  . ARG B 1 187 ? -2.134  17.044  10.697  1.00 23.21 ? 178 ARG B CG  1 
ATOM   2985 C  CD  . ARG B 1 187 ? -3.466  17.659  10.313  1.00 24.45 ? 178 ARG B CD  1 
ATOM   2986 N  NE  . ARG B 1 187 ? -4.593  16.769  10.650  1.00 29.24 ? 178 ARG B NE  1 
ATOM   2987 C  CZ  . ARG B 1 187 ? -5.438  16.956  11.656  1.00 42.26 ? 178 ARG B CZ  1 
ATOM   2988 N  NH1 . ARG B 1 187 ? -5.296  17.985  12.483  1.00 41.93 ? 178 ARG B NH1 1 
ATOM   2989 N  NH2 . ARG B 1 187 ? -6.431  16.097  11.840  1.00 49.68 ? 178 ARG B NH2 1 
ATOM   2990 N  N   . ARG B 1 188 ? 1.211   16.519  14.384  1.00 19.98 ? 179 ARG B N   1 
ATOM   2991 C  CA  . ARG B 1 188 ? 1.708   16.690  15.743  1.00 22.09 ? 179 ARG B CA  1 
ATOM   2992 C  C   . ARG B 1 188 ? 1.538   18.134  16.257  1.00 23.35 ? 179 ARG B C   1 
ATOM   2993 O  O   . ARG B 1 188 ? 1.076   18.334  17.412  1.00 23.58 ? 179 ARG B O   1 
ATOM   2994 C  CB  . ARG B 1 188 ? 3.161   16.205  15.912  1.00 23.90 ? 179 ARG B CB  1 
ATOM   2995 C  CG  . ARG B 1 188 ? 3.554   16.033  17.364  1.00 21.47 ? 179 ARG B CG  1 
ATOM   2996 C  CD  . ARG B 1 188 ? 5.039   15.806  17.583  1.00 24.33 ? 179 ARG B CD  1 
ATOM   2997 N  NE  . ARG B 1 188 ? 5.390   14.415  17.271  1.00 21.76 ? 179 ARG B NE  1 
ATOM   2998 C  CZ  . ARG B 1 188 ? 6.587   13.866  17.471  1.00 28.87 ? 179 ARG B CZ  1 
ATOM   2999 N  NH1 . ARG B 1 188 ? 7.570   14.589  17.965  1.00 22.02 ? 179 ARG B NH1 1 
ATOM   3000 N  NH2 . ARG B 1 188 ? 6.801   12.577  17.164  1.00 25.60 ? 179 ARG B NH2 1 
ATOM   3001 N  N   . PRO B 1 189 ? 1.938   19.151  15.433  1.00 22.41 ? 180 PRO B N   1 
ATOM   3002 C  CA  . PRO B 1 189 ? 1.785   20.545  15.866  1.00 21.27 ? 180 PRO B CA  1 
ATOM   3003 C  C   . PRO B 1 189 ? 0.378   20.939  16.250  1.00 20.75 ? 180 PRO B C   1 
ATOM   3004 O  O   . PRO B 1 189 ? 0.241   21.663  17.207  1.00 22.29 ? 180 PRO B O   1 
ATOM   3005 C  CB  . PRO B 1 189 ? 2.279   21.356  14.642  1.00 22.34 ? 180 PRO B CB  1 
ATOM   3006 C  CG  . PRO B 1 189 ? 3.271   20.478  14.019  1.00 21.61 ? 180 PRO B CG  1 
ATOM   3007 C  CD  . PRO B 1 189 ? 2.619   19.086  14.126  1.00 23.72 ? 180 PRO B CD  1 
ATOM   3008 N  N   . ASP B 1 190 ? -0.638  20.452  15.528  1.00 20.35 ? 181 ASP B N   1 
ATOM   3009 C  CA  . ASP B 1 190 ? -2.076  20.713  15.835  1.00 19.53 ? 181 ASP B CA  1 
ATOM   3010 C  C   . ASP B 1 190 ? -2.460  20.068  17.204  1.00 21.51 ? 181 ASP B C   1 
ATOM   3011 O  O   . ASP B 1 190 ? -3.126  20.662  18.056  1.00 20.63 ? 181 ASP B O   1 
ATOM   3012 C  CB  . ASP B 1 190 ? -2.982  20.134  14.763  1.00 18.26 ? 181 ASP B CB  1 
ATOM   3013 C  CG  . ASP B 1 190 ? -2.929  20.890  13.431  1.00 27.79 ? 181 ASP B CG  1 
ATOM   3014 O  OD1 . ASP B 1 190 ? -2.201  21.877  13.322  1.00 32.18 ? 181 ASP B OD1 1 
ATOM   3015 O  OD2 . ASP B 1 190 ? -3.627  20.455  12.510  1.00 29.20 ? 181 ASP B OD2 1 
ATOM   3016 N  N   . TYR B 1 191 ? -1.992  18.839  17.429  1.00 20.50 ? 182 TYR B N   1 
ATOM   3017 C  CA  . TYR B 1 191 ? -2.075  18.228  18.766  1.00 20.45 ? 182 TYR B CA  1 
ATOM   3018 C  C   . TYR B 1 191 ? -1.445  19.079  19.896  1.00 20.17 ? 182 TYR B C   1 
ATOM   3019 O  O   . TYR B 1 191 ? -2.087  19.298  20.956  1.00 20.12 ? 182 TYR B O   1 
ATOM   3020 C  CB  . TYR B 1 191 ? -1.501  16.804  18.704  1.00 19.64 ? 182 TYR B CB  1 
ATOM   3021 C  CG  . TYR B 1 191 ? -1.214  16.095  20.016  1.00 19.72 ? 182 TYR B CG  1 
ATOM   3022 C  CD1 . TYR B 1 191 ? -2.243  15.612  20.811  1.00 20.32 ? 182 TYR B CD1 1 
ATOM   3023 C  CD2 . TYR B 1 191 ? 0.078   15.914  20.439  1.00 21.37 ? 182 TYR B CD2 1 
ATOM   3024 C  CE1 . TYR B 1 191 ? -1.987  14.944  21.985  1.00 22.43 ? 182 TYR B CE1 1 
ATOM   3025 C  CE2 . TYR B 1 191 ? 0.346   15.234  21.653  1.00 19.77 ? 182 TYR B CE2 1 
ATOM   3026 C  CZ  . TYR B 1 191 ? -0.722  14.782  22.411  1.00 17.53 ? 182 TYR B CZ  1 
ATOM   3027 O  OH  . TYR B 1 191 ? -0.466  14.061  23.554  1.00 23.54 ? 182 TYR B OH  1 
ATOM   3028 N  N   . ILE B 1 192 ? -0.200  19.512  19.732  1.00 21.53 ? 183 ILE B N   1 
ATOM   3029 C  CA  . ILE B 1 192 ? 0.476   20.360  20.729  1.00 23.25 ? 183 ILE B CA  1 
ATOM   3030 C  C   . ILE B 1 192 ? -0.355  21.634  20.981  1.00 24.29 ? 183 ILE B C   1 
ATOM   3031 O  O   . ILE B 1 192 ? -0.487  22.089  22.144  1.00 24.90 ? 183 ILE B O   1 
ATOM   3032 C  CB  . ILE B 1 192 ? 1.945   20.683  20.331  1.00 23.10 ? 183 ILE B CB  1 
ATOM   3033 C  CG1 . ILE B 1 192 ? 2.726   19.363  20.247  1.00 21.29 ? 183 ILE B CG1 1 
ATOM   3034 C  CG2 . ILE B 1 192 ? 2.642   21.635  21.387  1.00 21.75 ? 183 ILE B CG2 1 
ATOM   3035 C  CD1 . ILE B 1 192 ? 3.981   19.433  19.396  1.00 26.17 ? 183 ILE B CD1 1 
ATOM   3036 N  N   . GLY B 1 193 ? -0.914  22.195  19.908  1.00 22.76 ? 184 GLY B N   1 
ATOM   3037 C  CA  . GLY B 1 193 ? -1.797  23.376  20.006  1.00 23.49 ? 184 GLY B CA  1 
ATOM   3038 C  C   . GLY B 1 193 ? -2.992  23.057  20.869  1.00 24.74 ? 184 GLY B C   1 
ATOM   3039 O  O   . GLY B 1 193 ? -3.370  23.858  21.744  1.00 26.41 ? 184 GLY B O   1 
ATOM   3040 N  N   . ALA B 1 194 ? -3.568  21.872  20.677  1.00 22.95 ? 185 ALA B N   1 
ATOM   3041 C  CA  . ALA B 1 194 ? -4.734  21.446  21.480  1.00 24.21 ? 185 ALA B CA  1 
ATOM   3042 C  C   . ALA B 1 194 ? -4.428  21.248  22.980  1.00 24.44 ? 185 ALA B C   1 
ATOM   3043 O  O   . ALA B 1 194 ? -5.287  21.502  23.846  1.00 24.45 ? 185 ALA B O   1 
ATOM   3044 C  CB  . ALA B 1 194 ? -5.356  20.186  20.907  1.00 27.31 ? 185 ALA B CB  1 
ATOM   3045 N  N   . PHE B 1 195 ? -3.198  20.839  23.291  1.00 23.05 ? 186 PHE B N   1 
ATOM   3046 C  CA  . PHE B 1 195 ? -2.765  20.640  24.662  1.00 23.45 ? 186 PHE B CA  1 
ATOM   3047 C  C   . PHE B 1 195 ? -2.905  21.889  25.537  1.00 23.67 ? 186 PHE B C   1 
ATOM   3048 O  O   . PHE B 1 195 ? -3.079  21.789  26.771  1.00 22.79 ? 186 PHE B O   1 
ATOM   3049 C  CB  . PHE B 1 195 ? -1.319  20.281  24.617  1.00 23.62 ? 186 PHE B CB  1 
ATOM   3050 C  CG  . PHE B 1 195 ? -0.646  20.258  25.933  1.00 18.62 ? 186 PHE B CG  1 
ATOM   3051 C  CD1 . PHE B 1 195 ? -1.064  19.403  26.953  1.00 20.01 ? 186 PHE B CD1 1 
ATOM   3052 C  CD2 . PHE B 1 195 ? 0.517   20.969  26.109  1.00 17.01 ? 186 PHE B CD2 1 
ATOM   3053 C  CE1 . PHE B 1 195 ? -0.344  19.332  28.106  1.00 20.67 ? 186 PHE B CE1 1 
ATOM   3054 C  CE2 . PHE B 1 195 ? 1.177   20.957  27.270  1.00 20.37 ? 186 PHE B CE2 1 
ATOM   3055 C  CZ  . PHE B 1 195 ? 0.775   20.119  28.281  1.00 16.84 ? 186 PHE B CZ  1 
ATOM   3056 N  N   . TRP B 1 196 ? -2.782  23.064  24.901  1.00 24.46 ? 187 TRP B N   1 
ATOM   3057 C  CA  . TRP B 1 196 ? -2.836  24.328  25.676  1.00 22.37 ? 187 TRP B CA  1 
ATOM   3058 C  C   . TRP B 1 196 ? -4.194  24.595  26.260  1.00 22.50 ? 187 TRP B C   1 
ATOM   3059 O  O   . TRP B 1 196 ? -4.313  25.335  27.233  1.00 23.58 ? 187 TRP B O   1 
ATOM   3060 C  CB  . TRP B 1 196 ? -2.386  25.518  24.807  1.00 22.87 ? 187 TRP B CB  1 
ATOM   3061 C  CG  . TRP B 1 196 ? -1.004  25.392  24.330  1.00 15.52 ? 187 TRP B CG  1 
ATOM   3062 C  CD1 . TRP B 1 196 ? -0.598  25.396  23.027  1.00 22.58 ? 187 TRP B CD1 1 
ATOM   3063 C  CD2 . TRP B 1 196 ? 0.189   25.215  25.115  1.00 19.97 ? 187 TRP B CD2 1 
ATOM   3064 N  NE1 . TRP B 1 196 ? 0.724   25.228  22.956  1.00 19.36 ? 187 TRP B NE1 1 
ATOM   3065 C  CE2 . TRP B 1 196 ? 1.255   25.103  24.205  1.00 20.65 ? 187 TRP B CE2 1 
ATOM   3066 C  CE3 . TRP B 1 196 ? 0.456   25.115  26.484  1.00 23.86 ? 187 TRP B CE3 1 
ATOM   3067 C  CZ2 . TRP B 1 196 ? 2.573   24.913  24.613  1.00 22.25 ? 187 TRP B CZ2 1 
ATOM   3068 C  CZ3 . TRP B 1 196 ? 1.750   24.923  26.900  1.00 24.21 ? 187 TRP B CZ3 1 
ATOM   3069 C  CH2 . TRP B 1 196 ? 2.813   24.828  25.969  1.00 28.99 ? 187 TRP B CH2 1 
ATOM   3070 N  N   . ASN B 1 197 ? -5.227  24.009  25.659  1.00 20.54 ? 188 ASN B N   1 
ATOM   3071 C  CA  . ASN B 1 197 ? -6.584  24.153  26.098  1.00 22.00 ? 188 ASN B CA  1 
ATOM   3072 C  C   . ASN B 1 197 ? -6.999  23.203  27.235  1.00 24.77 ? 188 ASN B C   1 
ATOM   3073 O  O   . ASN B 1 197 ? -8.130  23.297  27.725  1.00 24.56 ? 188 ASN B O   1 
ATOM   3074 C  CB  . ASN B 1 197 ? -7.502  23.890  24.911  1.00 21.30 ? 188 ASN B CB  1 
ATOM   3075 C  CG  . ASN B 1 197 ? -7.350  24.909  23.805  1.00 29.89 ? 188 ASN B CG  1 
ATOM   3076 O  OD1 . ASN B 1 197 ? -7.375  26.089  24.070  1.00 37.52 ? 188 ASN B OD1 1 
ATOM   3077 N  ND2 . ASN B 1 197 ? -7.200  24.455  22.572  1.00 26.76 ? 188 ASN B ND2 1 
ATOM   3078 N  N   . VAL B 1 198 ? -6.117  22.269  27.601  1.00 22.35 ? 189 VAL B N   1 
ATOM   3079 C  CA  . VAL B 1 198 ? -6.403  21.294  28.661  1.00 21.79 ? 189 VAL B CA  1 
ATOM   3080 C  C   . VAL B 1 198 ? -5.308  21.185  29.715  1.00 21.66 ? 189 VAL B C   1 
ATOM   3081 O  O   . VAL B 1 198 ? -5.507  20.535  30.727  1.00 23.76 ? 189 VAL B O   1 
ATOM   3082 C  CB  . VAL B 1 198 ? -6.734  19.862  28.051  1.00 18.82 ? 189 VAL B CB  1 
ATOM   3083 C  CG1 . VAL B 1 198 ? -8.021  19.910  27.344  1.00 23.35 ? 189 VAL B CG1 1 
ATOM   3084 C  CG2 . VAL B 1 198 ? -5.620  19.346  27.112  1.00 20.32 ? 189 VAL B CG2 1 
ATOM   3085 N  N   . VAL B 1 199 ? -4.164  21.828  29.508  1.00 22.23 ? 190 VAL B N   1 
ATOM   3086 C  CA  . VAL B 1 199 ? -3.123  21.815  30.515  1.00 22.34 ? 190 VAL B CA  1 
ATOM   3087 C  C   . VAL B 1 199 ? -3.679  22.599  31.732  1.00 24.87 ? 190 VAL B C   1 
ATOM   3088 O  O   . VAL B 1 199 ? -4.369  23.592  31.581  1.00 24.40 ? 190 VAL B O   1 
ATOM   3089 C  CB  . VAL B 1 199 ? -1.809  22.378  30.034  1.00 21.12 ? 190 VAL B CB  1 
ATOM   3090 C  CG1 . VAL B 1 199 ? -1.913  23.824  29.710  1.00 27.90 ? 190 VAL B CG1 1 
ATOM   3091 C  CG2 . VAL B 1 199 ? -0.716  22.112  31.047  1.00 24.46 ? 190 VAL B CG2 1 
ATOM   3092 N  N   . ASP B 1 200 ? -3.434  22.068  32.916  1.00 27.31 ? 191 ASP B N   1 
ATOM   3093 C  CA  . ASP B 1 200 ? -3.994  22.627  34.166  1.00 26.86 ? 191 ASP B CA  1 
ATOM   3094 C  C   . ASP B 1 200 ? -2.909  23.459  34.851  1.00 27.35 ? 191 ASP B C   1 
ATOM   3095 O  O   . ASP B 1 200 ? -2.000  22.932  35.501  1.00 26.61 ? 191 ASP B O   1 
ATOM   3096 C  CB  . ASP B 1 200 ? -4.483  21.460  35.034  1.00 27.53 ? 191 ASP B CB  1 
ATOM   3097 C  CG  . ASP B 1 200 ? -5.081  21.918  36.373  1.00 30.18 ? 191 ASP B CG  1 
ATOM   3098 O  OD1 . ASP B 1 200 ? -4.869  23.089  36.726  1.00 30.16 ? 191 ASP B OD1 1 
ATOM   3099 O  OD2 . ASP B 1 200 ? -5.717  21.081  37.047  1.00 25.97 ? 191 ASP B OD2 1 
ATOM   3100 N  N   . TRP B 1 201 ? -2.978  24.776  34.668  1.00 26.63 ? 192 TRP B N   1 
ATOM   3101 C  CA  . TRP B 1 201 ? -1.975  25.691  35.252  1.00 27.64 ? 192 TRP B CA  1 
ATOM   3102 C  C   . TRP B 1 201 ? -2.064  25.800  36.806  1.00 27.33 ? 192 TRP B C   1 
ATOM   3103 O  O   . TRP B 1 201 ? -1.032  26.053  37.500  1.00 27.87 ? 192 TRP B O   1 
ATOM   3104 C  CB  . TRP B 1 201 ? -2.033  27.071  34.538  1.00 26.88 ? 192 TRP B CB  1 
ATOM   3105 C  CG  . TRP B 1 201 ? -1.587  27.014  33.086  1.00 24.95 ? 192 TRP B CG  1 
ATOM   3106 C  CD1 . TRP B 1 201 ? -2.373  27.105  31.963  1.00 22.06 ? 192 TRP B CD1 1 
ATOM   3107 C  CD2 . TRP B 1 201 ? -0.267  26.832  32.641  1.00 26.48 ? 192 TRP B CD2 1 
ATOM   3108 N  NE1 . TRP B 1 201 ? -1.579  27.000  30.808  1.00 23.94 ? 192 TRP B NE1 1 
ATOM   3109 C  CE2 . TRP B 1 201 ? -0.281  26.809  31.225  1.00 22.61 ? 192 TRP B CE2 1 
ATOM   3110 C  CE3 . TRP B 1 201 ? 0.953   26.680  33.305  1.00 20.71 ? 192 TRP B CE3 1 
ATOM   3111 C  CZ2 . TRP B 1 201 ? 0.869   26.639  30.483  1.00 23.52 ? 192 TRP B CZ2 1 
ATOM   3112 C  CZ3 . TRP B 1 201 ? 2.090   26.510  32.567  1.00 30.85 ? 192 TRP B CZ3 1 
ATOM   3113 C  CH2 . TRP B 1 201 ? 2.053   26.499  31.179  1.00 23.53 ? 192 TRP B CH2 1 
ATOM   3114 N  N   . ASN B 1 202 ? -3.229  25.497  37.365  1.00 28.09 ? 193 ASN B N   1 
ATOM   3115 C  CA  . ASN B 1 202 ? -3.342  25.411  38.858  1.00 31.20 ? 193 ASN B CA  1 
ATOM   3116 C  C   . ASN B 1 202 ? -2.497  24.256  39.393  1.00 31.94 ? 193 ASN B C   1 
ATOM   3117 O  O   . ASN B 1 202 ? -1.680  24.429  40.328  1.00 32.80 ? 193 ASN B O   1 
ATOM   3118 C  CB  . ASN B 1 202 ? -4.809  25.260  39.295  1.00 32.11 ? 193 ASN B CB  1 
ATOM   3119 C  CG  . ASN B 1 202 ? -5.615  26.572  39.185  1.00 33.65 ? 193 ASN B CG  1 
ATOM   3120 O  OD1 . ASN B 1 202 ? -5.072  27.632  38.894  1.00 45.96 ? 193 ASN B OD1 1 
ATOM   3121 N  ND2 . ASN B 1 202 ? -6.946  26.477  39.397  1.00 36.83 ? 193 ASN B ND2 1 
ATOM   3122 N  N   . ALA B 1 203 ? -2.672  23.070  38.781  1.00 31.14 ? 194 ALA B N   1 
ATOM   3123 C  CA  . ALA B 1 203 ? -1.881  21.917  39.124  1.00 30.69 ? 194 ALA B CA  1 
ATOM   3124 C  C   . ALA B 1 203 ? -0.396  22.162  38.852  1.00 30.26 ? 194 ALA B C   1 
ATOM   3125 O  O   . ALA B 1 203 ? 0.472   21.747  39.630  1.00 29.25 ? 194 ALA B O   1 
ATOM   3126 C  CB  . ALA B 1 203 ? -2.367  20.709  38.334  1.00 31.84 ? 194 ALA B CB  1 
ATOM   3127 N  N   . ALA B 1 204 ? -0.096  22.828  37.743  1.00 29.87 ? 195 ALA B N   1 
ATOM   3128 C  CA  . ALA B 1 204 ? 1.282   23.143  37.416  1.00 29.71 ? 195 ALA B CA  1 
ATOM   3129 C  C   . ALA B 1 204 ? 1.949   24.014  38.489  1.00 31.95 ? 195 ALA B C   1 
ATOM   3130 O  O   . ALA B 1 204 ? 3.121   23.801  38.859  1.00 30.82 ? 195 ALA B O   1 
ATOM   3131 C  CB  . ALA B 1 204 ? 1.331   23.852  36.075  1.00 30.05 ? 195 ALA B CB  1 
ATOM   3132 N  N   . GLU B 1 205 ? 1.213   25.027  38.945  1.00 32.80 ? 196 GLU B N   1 
ATOM   3133 C  CA  . GLU B 1 205 ? 1.694   25.919  40.027  1.00 33.31 ? 196 GLU B CA  1 
ATOM   3134 C  C   . GLU B 1 205 ? 2.092   25.081  41.240  1.00 33.76 ? 196 GLU B C   1 
ATOM   3135 O  O   . GLU B 1 205 ? 3.207   25.221  41.764  1.00 33.73 ? 196 GLU B O   1 
ATOM   3136 C  CB  . GLU B 1 205 ? 0.609   26.971  40.347  1.00 34.12 ? 196 GLU B CB  1 
ATOM   3137 C  CG  . GLU B 1 205 ? 0.897   27.908  41.564  1.00 33.81 ? 196 GLU B CG  1 
ATOM   3138 C  CD  . GLU B 1 205 ? 2.161   28.758  41.456  1.00 46.19 ? 196 GLU B CD  1 
ATOM   3139 O  OE1 . GLU B 1 205 ? 2.913   28.631  40.469  1.00 35.62 ? 196 GLU B OE1 1 
ATOM   3140 O  OE2 . GLU B 1 205 ? 2.414   29.571  42.395  1.00 43.49 ? 196 GLU B OE2 1 
ATOM   3141 N  N   . LYS B 1 206 ? 1.213   24.169  41.648  1.00 34.47 ? 197 LYS B N   1 
ATOM   3142 C  CA  . LYS B 1 206 ? 1.500   23.281  42.786  1.00 37.90 ? 197 LYS B CA  1 
ATOM   3143 C  C   . LYS B 1 206 ? 2.795   22.519  42.590  1.00 37.94 ? 197 LYS B C   1 
ATOM   3144 O  O   . LYS B 1 206 ? 3.658   22.454  43.474  1.00 34.88 ? 197 LYS B O   1 
ATOM   3145 C  CB  . LYS B 1 206 ? 0.388   22.260  42.986  1.00 37.33 ? 197 LYS B CB  1 
ATOM   3146 C  CG  . LYS B 1 206 ? -0.641  22.640  43.994  1.00 48.00 ? 197 LYS B CG  1 
ATOM   3147 C  CD  . LYS B 1 206 ? -1.099  21.405  44.756  1.00 43.28 ? 197 LYS B CD  1 
ATOM   3148 C  CE  . LYS B 1 206 ? -2.393  21.672  45.569  1.00 65.89 ? 197 LYS B CE  1 
ATOM   3149 N  NZ  . LYS B 1 206 ? -2.682  20.590  46.584  1.00 58.22 ? 197 LYS B NZ  1 
ATOM   3150 N  N   . ARG B 1 207 ? 2.932   21.914  41.419  1.00 39.88 ? 198 ARG B N   1 
ATOM   3151 C  CA  . ARG B 1 207 ? 4.164   21.198  41.109  1.00 41.70 ? 198 ARG B CA  1 
ATOM   3152 C  C   . ARG B 1 207 ? 5.392   22.088  41.109  1.00 41.99 ? 198 ARG B C   1 
ATOM   3153 O  O   . ARG B 1 207 ? 6.475   21.652  41.509  1.00 41.75 ? 198 ARG B O   1 
ATOM   3154 C  CB  . ARG B 1 207 ? 4.016   20.459  39.792  1.00 43.66 ? 198 ARG B CB  1 
ATOM   3155 C  CG  . ARG B 1 207 ? 3.068   19.288  39.971  1.00 38.88 ? 198 ARG B CG  1 
ATOM   3156 C  CD  . ARG B 1 207 ? 2.861   18.534  38.725  1.00 45.50 ? 198 ARG B CD  1 
ATOM   3157 N  NE  . ARG B 1 207 ? 2.775   17.104  39.007  1.00 41.15 ? 198 ARG B NE  1 
ATOM   3158 C  CZ  . ARG B 1 207 ? 1.659   16.440  39.271  1.00 66.41 ? 198 ARG B CZ  1 
ATOM   3159 N  NH1 . ARG B 1 207 ? 0.464   17.065  39.322  1.00 61.29 ? 198 ARG B NH1 1 
ATOM   3160 N  NH2 . ARG B 1 207 ? 1.754   15.127  39.486  1.00 38.03 ? 198 ARG B NH2 1 
ATOM   3161 N  N   . TYR B 1 208 ? 5.229   23.329  40.666  1.00 44.08 ? 199 TYR B N   1 
ATOM   3162 C  CA  . TYR B 1 208 ? 6.327   24.300  40.714  1.00 45.31 ? 199 TYR B CA  1 
ATOM   3163 C  C   . TYR B 1 208 ? 6.680   24.664  42.161  1.00 46.59 ? 199 TYR B C   1 
ATOM   3164 O  O   . TYR B 1 208 ? 7.843   24.590  42.573  1.00 43.64 ? 199 TYR B O   1 
ATOM   3165 C  CB  . TYR B 1 208 ? 5.956   25.556  39.948  1.00 43.88 ? 199 TYR B CB  1 
ATOM   3166 C  CG  . TYR B 1 208 ? 7.027   26.599  39.981  1.00 44.63 ? 199 TYR B CG  1 
ATOM   3167 C  CD1 . TYR B 1 208 ? 8.277   26.344  39.416  1.00 34.12 ? 199 TYR B CD1 1 
ATOM   3168 C  CD2 . TYR B 1 208 ? 6.806   27.853  40.586  1.00 40.86 ? 199 TYR B CD2 1 
ATOM   3169 C  CE1 . TYR B 1 208 ? 9.269   27.293  39.424  1.00 38.24 ? 199 TYR B CE1 1 
ATOM   3170 C  CE2 . TYR B 1 208 ? 7.822   28.828  40.607  1.00 46.51 ? 199 TYR B CE2 1 
ATOM   3171 C  CZ  . TYR B 1 208 ? 9.045   28.531  40.035  1.00 43.45 ? 199 TYR B CZ  1 
ATOM   3172 O  OH  . TYR B 1 208 ? 10.064  29.449  40.029  1.00 39.04 ? 199 TYR B OH  1 
ATOM   3173 N  N   . GLN B 1 209 ? 5.662   25.058  42.914  1.00 49.24 ? 200 GLN B N   1 
ATOM   3174 C  CA  . GLN B 1 209 ? 5.818   25.319  44.353  1.00 51.32 ? 200 GLN B CA  1 
ATOM   3175 C  C   . GLN B 1 209 ? 6.363   24.087  45.084  1.00 53.17 ? 200 GLN B C   1 
ATOM   3176 O  O   . GLN B 1 209 ? 7.303   24.215  45.866  1.00 54.23 ? 200 GLN B O   1 
ATOM   3177 C  CB  . GLN B 1 209 ? 4.482   25.740  44.982  1.00 51.65 ? 200 GLN B CB  1 
ATOM   3178 C  CG  . GLN B 1 209 ? 3.903   27.057  44.463  1.00 51.61 ? 200 GLN B CG  1 
ATOM   3179 C  CD  . GLN B 1 209 ? 4.730   28.281  44.842  1.00 53.57 ? 200 GLN B CD  1 
ATOM   3180 O  OE1 . GLN B 1 209 ? 5.658   28.200  45.649  1.00 60.42 ? 200 GLN B OE1 1 
ATOM   3181 N  NE2 . GLN B 1 209 ? 4.379   29.427  44.268  1.00 49.17 ? 200 GLN B NE2 1 
ATOM   3182 N  N   . GLU B 1 210 ? 5.818   22.902  44.805  1.00 54.55 ? 201 GLU B N   1 
ATOM   3183 C  CA  . GLU B 1 210 ? 6.201   21.688  45.542  1.00 56.44 ? 201 GLU B CA  1 
ATOM   3184 C  C   . GLU B 1 210 ? 7.558   21.103  45.126  1.00 57.47 ? 201 GLU B C   1 
ATOM   3185 O  O   . GLU B 1 210 ? 7.800   19.920  45.339  1.00 59.38 ? 201 GLU B O   1 
ATOM   3186 C  CB  . GLU B 1 210 ? 5.111   20.595  45.444  1.00 56.63 ? 201 GLU B CB  1 
ATOM   3187 C  CG  . GLU B 1 210 ? 3.826   20.887  46.250  1.00 61.28 ? 201 GLU B CG  1 
ATOM   3188 C  CD  . GLU B 1 210 ? 2.743   19.807  46.076  1.00 58.32 ? 201 GLU B CD  1 
ATOM   3189 O  OE1 . GLU B 1 210 ? 3.086   18.663  45.692  1.00 71.36 ? 201 GLU B OE1 1 
ATOM   3190 O  OE2 . GLU B 1 210 ? 1.546   20.106  46.326  1.00 71.19 ? 201 GLU B OE2 1 
ATOM   3191 N  N   . ALA B 1 211 ? 8.448   21.921  44.565  1.00 58.55 ? 202 ALA B N   1 
ATOM   3192 C  CA  . ALA B 1 211 ? 9.755   21.454  44.102  1.00 58.82 ? 202 ALA B CA  1 
ATOM   3193 C  C   . ALA B 1 211 ? 10.840  22.473  44.435  1.00 60.34 ? 202 ALA B C   1 
ATOM   3194 O  O   . ALA B 1 211 ? 11.009  23.472  43.727  1.00 61.69 ? 202 ALA B O   1 
ATOM   3195 C  CB  . ALA B 1 211 ? 9.718   21.188  42.596  1.00 59.25 ? 202 ALA B CB  1 
HETATM 3196 MN MN  . MN  C 2 .   ? 6.707   4.949   8.587   1.00 14.90 ? 204 MN  A MN  1 
HETATM 3197 MN MN  . MN  D 2 .   ? 1.637   7.426   26.100  1.00 18.05 ? 204 MN  B MN  1 
HETATM 3198 O  O   . HOH E 3 .   ? -3.316  1.170   10.509  1.00 15.42 ? 205 HOH A O   1 
HETATM 3199 O  O   . HOH E 3 .   ? 8.419   4.975   9.958   1.00 16.74 ? 206 HOH A O   1 
HETATM 3200 O  O   . HOH E 3 .   ? 4.630   -13.718 -1.546  1.00 18.81 ? 207 HOH A O   1 
HETATM 3201 O  O   . HOH E 3 .   ? -6.276  8.912   4.165   1.00 18.27 ? 208 HOH A O   1 
HETATM 3202 O  O   . HOH E 3 .   ? 1.453   0.611   20.049  1.00 18.32 ? 209 HOH A O   1 
HETATM 3203 O  O   . HOH E 3 .   ? 1.608   1.540   5.441   1.00 18.62 ? 210 HOH A O   1 
HETATM 3204 O  O   . HOH E 3 .   ? 9.524   2.713   -3.489  1.00 19.17 ? 211 HOH A O   1 
HETATM 3205 O  O   . HOH E 3 .   ? -6.511  6.026   0.479   1.00 19.08 ? 212 HOH A O   1 
HETATM 3206 O  O   . HOH E 3 .   ? -4.238  -1.079  1.138   1.00 19.05 ? 213 HOH A O   1 
HETATM 3207 O  O   . HOH E 3 .   ? 2.711   -16.811 6.430   1.00 19.38 ? 214 HOH A O   1 
HETATM 3208 O  O   . HOH E 3 .   ? -2.116  3.787   10.958  1.00 18.89 ? 215 HOH A O   1 
HETATM 3209 O  O   . HOH E 3 .   ? 4.180   -15.006 4.750   1.00 19.25 ? 216 HOH A O   1 
HETATM 3210 O  O   . HOH E 3 .   ? 1.841   -0.148  7.708   1.00 19.36 ? 217 HOH A O   1 
HETATM 3211 O  O   . HOH E 3 .   ? -3.155  -2.459  -7.381  1.00 19.33 ? 218 HOH A O   1 
HETATM 3212 O  O   . HOH E 3 .   ? 7.507   12.338  8.258   1.00 20.48 ? 219 HOH A O   1 
HETATM 3213 O  O   . HOH E 3 .   ? 11.547  6.150   19.366  1.00 19.85 ? 220 HOH A O   1 
HETATM 3214 O  O   . HOH E 3 .   ? 4.796   -17.116 -1.381  1.00 20.30 ? 221 HOH A O   1 
HETATM 3215 O  O   . HOH E 3 .   ? 11.526  -15.812 -0.926  1.00 20.52 ? 222 HOH A O   1 
HETATM 3216 O  O   . HOH E 3 .   ? 2.885   -11.191 15.901  1.00 21.01 ? 223 HOH A O   1 
HETATM 3217 O  O   . HOH E 3 .   ? 0.035   6.493   8.420   1.00 21.10 ? 224 HOH A O   1 
HETATM 3218 O  O   . HOH E 3 .   ? 16.879  7.820   12.640  1.00 21.49 ? 225 HOH A O   1 
HETATM 3219 O  O   . HOH E 3 .   ? 7.416   1.976   -4.818  1.00 21.18 ? 226 HOH A O   1 
HETATM 3220 O  O   . HOH E 3 .   ? 13.257  2.935   19.457  1.00 21.74 ? 227 HOH A O   1 
HETATM 3221 O  O   . HOH E 3 .   ? 6.158   5.914   16.651  1.00 22.16 ? 228 HOH A O   1 
HETATM 3222 O  O   . HOH E 3 .   ? 19.390  6.359   8.712   1.00 22.90 ? 229 HOH A O   1 
HETATM 3223 O  O   . HOH E 3 .   ? 6.056   2.567   17.813  1.00 22.60 ? 230 HOH A O   1 
HETATM 3224 O  O   . HOH E 3 .   ? -8.209  3.269   8.572   1.00 23.55 ? 231 HOH A O   1 
HETATM 3225 O  O   . HOH E 3 .   ? 8.027   -22.178 -1.653  1.00 23.70 ? 232 HOH A O   1 
HETATM 3226 O  O   . HOH E 3 .   ? 21.302  4.830   9.714   1.00 22.95 ? 233 HOH A O   1 
HETATM 3227 O  O   . HOH E 3 .   ? 14.933  7.578   20.385  1.00 24.18 ? 234 HOH A O   1 
HETATM 3228 O  O   . HOH E 3 .   ? 1.669   -1.016  22.083  1.00 23.11 ? 235 HOH A O   1 
HETATM 3229 O  O   . HOH E 3 .   ? 8.452   14.214  -5.188  1.00 24.35 ? 236 HOH A O   1 
HETATM 3230 O  O   . HOH E 3 .   ? 3.470   -12.908 13.734  1.00 24.19 ? 237 HOH A O   1 
HETATM 3231 O  O   . HOH E 3 .   ? 15.870  1.903   -0.009  1.00 24.42 ? 238 HOH A O   1 
HETATM 3232 O  O   . HOH E 3 .   ? -0.787  4.043   -6.201  1.00 25.09 ? 239 HOH A O   1 
HETATM 3233 O  O   . HOH E 3 .   ? 7.090   0.391   22.334  1.00 24.66 ? 240 HOH A O   1 
HETATM 3234 O  O   . HOH E 3 .   ? -1.973  -1.129  8.955   1.00 24.64 ? 241 HOH A O   1 
HETATM 3235 O  O   . HOH E 3 .   ? -1.121  -9.934  -0.388  1.00 26.37 ? 242 HOH A O   1 
HETATM 3236 O  O   . HOH E 3 .   ? -0.223  -15.526 3.687   1.00 25.80 ? 243 HOH A O   1 
HETATM 3237 O  O   . HOH E 3 .   ? -5.282  3.921   -5.682  1.00 25.87 ? 244 HOH A O   1 
HETATM 3238 O  O   . HOH E 3 .   ? -10.198 0.919   5.157   1.00 25.95 ? 245 HOH A O   1 
HETATM 3239 O  O   . HOH E 3 .   ? -5.363  14.479  3.634   1.00 26.80 ? 246 HOH A O   1 
HETATM 3240 O  O   . HOH E 3 .   ? 7.773   -20.608 -6.318  1.00 25.73 ? 247 HOH A O   1 
HETATM 3241 O  O   . HOH E 3 .   ? 5.222   13.568  9.268   1.00 25.65 ? 248 HOH A O   1 
HETATM 3242 O  O   . HOH E 3 .   ? 1.297   6.063   -5.584  1.00 25.70 ? 249 HOH A O   1 
HETATM 3243 O  O   . HOH E 3 .   ? 16.051  9.338   -3.988  1.00 26.91 ? 250 HOH A O   1 
HETATM 3244 O  O   . HOH E 3 .   ? 12.787  20.854  0.689   1.00 27.05 ? 251 HOH A O   1 
HETATM 3245 O  O   . HOH E 3 .   ? 18.073  7.555   -4.278  1.00 26.36 ? 252 HOH A O   1 
HETATM 3246 O  O   . HOH E 3 .   ? 0.634   -1.273  24.787  1.00 26.93 ? 253 HOH A O   1 
HETATM 3247 O  O   . HOH E 3 .   ? 14.192  -1.515  22.041  1.00 27.48 ? 254 HOH A O   1 
HETATM 3248 O  O   . HOH E 3 .   ? -5.942  -7.827  9.844   1.00 27.75 ? 255 HOH A O   1 
HETATM 3249 O  O   . HOH E 3 .   ? -0.220  -14.231 9.517   1.00 27.29 ? 256 HOH A O   1 
HETATM 3250 O  O   . HOH E 3 .   ? -4.485  -7.376  0.051   1.00 26.29 ? 257 HOH A O   1 
HETATM 3251 O  O   . HOH E 3 .   ? 13.744  -5.680  18.900  1.00 27.16 ? 258 HOH A O   1 
HETATM 3252 O  O   . HOH E 3 .   ? 4.775   -9.835  17.783  1.00 27.62 ? 259 HOH A O   1 
HETATM 3253 O  O   . HOH E 3 .   ? -5.147  -9.768  8.346   1.00 27.87 ? 260 HOH A O   1 
HETATM 3254 O  O   . HOH E 3 .   ? 7.484   -23.571 8.542   1.00 27.92 ? 261 HOH A O   1 
HETATM 3255 O  O   . HOH E 3 .   ? -3.453  -10.364 12.496  1.00 27.39 ? 262 HOH A O   1 
HETATM 3256 O  O   . HOH E 3 .   ? 18.067  6.843   16.024  1.00 28.25 ? 263 HOH A O   1 
HETATM 3257 O  O   . HOH E 3 .   ? -8.294  -8.440  -0.060  1.00 28.88 ? 264 HOH A O   1 
HETATM 3258 O  O   . HOH E 3 .   ? 9.433   -22.108 1.734   1.00 28.71 ? 265 HOH A O   1 
HETATM 3259 O  O   . HOH E 3 .   ? 23.725  17.228  12.459  1.00 28.77 ? 266 HOH A O   1 
HETATM 3260 O  O   . HOH E 3 .   ? -3.866  5.747   22.667  1.00 28.91 ? 267 HOH A O   1 
HETATM 3261 O  O   . HOH E 3 .   ? 18.257  -4.878  -0.300  1.00 29.37 ? 268 HOH A O   1 
HETATM 3262 O  O   . HOH E 3 .   ? 7.670   -2.406  22.400  1.00 28.46 ? 269 HOH A O   1 
HETATM 3263 O  O   . HOH E 3 .   ? 21.365  17.900  11.226  1.00 29.59 ? 270 HOH A O   1 
HETATM 3264 O  O   . HOH E 3 .   ? 7.374   -14.322 18.646  1.00 29.81 ? 271 HOH A O   1 
HETATM 3265 O  O   . HOH E 3 .   ? 22.411  -17.566 6.340   1.00 29.20 ? 272 HOH A O   1 
HETATM 3266 O  O   . HOH E 3 .   ? -1.796  -17.707 3.281   1.00 30.22 ? 273 HOH A O   1 
HETATM 3267 O  O   . HOH E 3 .   ? 7.484   -9.293  -7.038  1.00 30.19 ? 274 HOH A O   1 
HETATM 3268 O  O   . HOH E 3 .   ? 17.311  0.249   1.951   1.00 29.35 ? 275 HOH A O   1 
HETATM 3269 O  O   . HOH E 3 .   ? 14.033  -11.966 17.891  1.00 29.58 ? 276 HOH A O   1 
HETATM 3270 O  O   . HOH E 3 .   ? -2.317  -12.934 1.253   1.00 30.10 ? 277 HOH A O   1 
HETATM 3271 O  O   . HOH E 3 .   ? 17.472  1.305   4.536   1.00 31.19 ? 278 HOH A O   1 
HETATM 3272 O  O   . HOH E 3 .   ? 11.458  2.519   -5.405  1.00 31.49 ? 279 HOH A O   1 
HETATM 3273 O  O   . HOH E 3 .   ? 9.222   13.687  10.022  1.00 30.21 ? 280 HOH A O   1 
HETATM 3274 O  O   . HOH E 3 .   ? 11.648  -21.074 3.899   1.00 31.86 ? 281 HOH A O   1 
HETATM 3275 O  O   . HOH E 3 .   ? 14.352  10.468  -6.423  1.00 30.87 ? 282 HOH A O   1 
HETATM 3276 O  O   . HOH E 3 .   ? -1.325  -4.542  -8.522  1.00 30.93 ? 283 HOH A O   1 
HETATM 3277 O  O   . HOH E 3 .   ? 19.568  -6.445  -2.306  1.00 30.95 ? 284 HOH A O   1 
HETATM 3278 O  O   . HOH E 3 .   ? 21.223  -20.033 5.900   1.00 32.07 ? 285 HOH A O   1 
HETATM 3279 O  O   . HOH E 3 .   ? 0.304   -15.734 6.722   1.00 30.67 ? 286 HOH A O   1 
HETATM 3280 O  O   . HOH E 3 .   ? 17.667  4.128   20.683  1.00 31.54 ? 287 HOH A O   1 
HETATM 3281 O  O   . HOH E 3 .   ? 5.185   -23.621 6.665   1.00 31.22 ? 288 HOH A O   1 
HETATM 3282 O  O   . HOH E 3 .   ? 6.752   -12.182 20.400  1.00 31.32 ? 289 HOH A O   1 
HETATM 3283 O  O   . HOH E 3 .   ? 14.987  0.245   -2.011  1.00 31.69 ? 290 HOH A O   1 
HETATM 3284 O  O   . HOH E 3 .   ? 4.625   -4.446  20.728  1.00 32.48 ? 291 HOH A O   1 
HETATM 3285 O  O   . HOH E 3 .   ? 19.022  -13.693 13.886  1.00 31.89 ? 292 HOH A O   1 
HETATM 3286 O  O   . HOH E 3 .   ? 21.842  12.534  -2.011  1.00 32.21 ? 293 HOH A O   1 
HETATM 3287 O  O   . HOH E 3 .   ? 7.188   10.313  10.320  1.00 31.58 ? 294 HOH A O   1 
HETATM 3288 O  O   . HOH E 3 .   ? 22.664  5.118   12.172  1.00 32.40 ? 295 HOH A O   1 
HETATM 3289 O  O   . HOH E 3 .   ? -7.794  8.514   8.711   1.00 33.77 ? 296 HOH A O   1 
HETATM 3290 O  O   . HOH E 3 .   ? 8.883   16.103  -0.796  1.00 32.10 ? 297 HOH A O   1 
HETATM 3291 O  O   . HOH E 3 .   ? 16.295  19.220  7.246   1.00 32.33 ? 298 HOH A O   1 
HETATM 3292 O  O   . HOH E 3 .   ? 12.031  -5.068  -3.805  1.00 32.01 ? 299 HOH A O   1 
HETATM 3293 O  O   . HOH E 3 .   ? 18.950  5.967   18.249  1.00 32.01 ? 300 HOH A O   1 
HETATM 3294 O  O   . HOH E 3 .   ? 13.142  -23.287 -2.179  1.00 33.58 ? 301 HOH A O   1 
HETATM 3295 O  O   . HOH E 3 .   ? 10.679  -21.286 -5.453  1.00 33.83 ? 302 HOH A O   1 
HETATM 3296 O  O   . HOH E 3 .   ? 9.049   11.444  11.807  1.00 33.56 ? 303 HOH A O   1 
HETATM 3297 O  O   . HOH E 3 .   ? 8.222   -4.860  -5.639  1.00 32.91 ? 304 HOH A O   1 
HETATM 3298 O  O   . HOH E 3 .   ? 13.588  6.325   -3.680  1.00 33.58 ? 305 HOH A O   1 
HETATM 3299 O  O   . HOH E 3 .   ? -14.003 4.418   2.625   1.00 34.47 ? 306 HOH A O   1 
HETATM 3300 O  O   . HOH E 3 .   ? 4.970   -15.377 14.804  1.00 32.87 ? 307 HOH A O   1 
HETATM 3301 O  O   . HOH E 3 .   ? 13.120  -7.190  -5.328  1.00 33.99 ? 308 HOH A O   1 
HETATM 3302 O  O   . HOH E 3 .   ? 4.388   -10.718 19.937  1.00 33.46 ? 309 HOH A O   1 
HETATM 3303 O  O   . HOH E 3 .   ? 19.936  -21.112 -0.177  1.00 33.90 ? 310 HOH A O   1 
HETATM 3304 O  O   . HOH E 3 .   ? 18.796  20.062  -2.102  1.00 33.42 ? 311 HOH A O   1 
HETATM 3305 O  O   . HOH E 3 .   ? -7.100  2.713   -4.063  1.00 34.61 ? 312 HOH A O   1 
HETATM 3306 O  O   . HOH E 3 .   ? -1.782  -12.799 -2.355  1.00 34.07 ? 313 HOH A O   1 
HETATM 3307 O  O   . HOH E 3 .   ? 20.919  -22.143 1.995   1.00 34.07 ? 314 HOH A O   1 
HETATM 3308 O  O   . HOH E 3 .   ? -3.290  -13.746 9.281   1.00 33.86 ? 315 HOH A O   1 
HETATM 3309 O  O   . HOH E 3 .   ? -9.222  5.759   9.713   1.00 35.08 ? 316 HOH A O   1 
HETATM 3310 O  O   . HOH E 3 .   ? -1.496  -17.725 7.523   1.00 35.76 ? 317 HOH A O   1 
HETATM 3311 O  O   . HOH E 3 .   ? -6.968  -2.154  21.903  1.00 35.36 ? 318 HOH A O   1 
HETATM 3312 O  O   . HOH E 3 .   ? 7.894   6.622   -9.018  1.00 34.87 ? 319 HOH A O   1 
HETATM 3313 O  O   . HOH E 3 .   ? 18.065  1.666   20.129  1.00 34.64 ? 320 HOH A O   1 
HETATM 3314 O  O   . HOH E 3 .   ? -7.397  -1.966  -5.729  1.00 35.90 ? 321 HOH A O   1 
HETATM 3315 O  O   . HOH E 3 .   ? -10.704 7.073   2.975   1.00 35.97 ? 322 HOH A O   1 
HETATM 3316 O  O   . HOH E 3 .   ? 12.193  -13.503 -7.432  1.00 36.66 ? 323 HOH A O   1 
HETATM 3317 O  O   . HOH E 3 .   ? 6.633   17.620  2.760   1.00 35.01 ? 324 HOH A O   1 
HETATM 3318 O  O   . HOH E 3 .   ? -3.826  -11.212 9.929   1.00 35.58 ? 325 HOH A O   1 
HETATM 3319 O  O   . HOH E 3 .   ? 17.186  13.346  16.280  1.00 35.83 ? 326 HOH A O   1 
HETATM 3320 O  O   . HOH E 3 .   ? 11.933  -18.855 16.700  1.00 36.77 ? 327 HOH A O   1 
HETATM 3321 O  O   . HOH E 3 .   ? -5.220  -11.468 1.143   1.00 36.47 ? 328 HOH A O   1 
HETATM 3322 O  O   . HOH E 3 .   ? -3.594  -10.624 -5.929  1.00 35.67 ? 329 HOH A O   1 
HETATM 3323 O  O   . HOH E 3 .   ? 4.844   -15.145 17.347  1.00 36.31 ? 330 HOH A O   1 
HETATM 3324 O  O   . HOH E 3 .   ? 24.736  6.805   13.050  1.00 36.26 ? 331 HOH A O   1 
HETATM 3325 O  O   . HOH E 3 .   ? 18.806  -1.911  0.275   1.00 36.16 ? 332 HOH A O   1 
HETATM 3326 O  O   . HOH E 3 .   ? 12.616  4.671   -6.094  1.00 36.90 ? 333 HOH A O   1 
HETATM 3327 O  O   . HOH E 3 .   ? 11.605  -16.732 18.541  1.00 36.48 ? 334 HOH A O   1 
HETATM 3328 O  O   . HOH E 3 .   ? 21.215  2.507   15.705  1.00 37.28 ? 335 HOH A O   1 
HETATM 3329 O  O   . HOH E 3 .   ? -8.794  -4.153  -1.964  1.00 37.20 ? 336 HOH A O   1 
HETATM 3330 O  O   . HOH E 3 .   ? -7.765  5.166   -1.956  1.00 36.18 ? 337 HOH A O   1 
HETATM 3331 O  O   . HOH E 3 .   ? -6.152  -8.900  12.606  1.00 37.01 ? 338 HOH A O   1 
HETATM 3332 O  O   . HOH E 3 .   ? 15.546  15.199  12.795  1.00 37.07 ? 339 HOH A O   1 
HETATM 3333 O  O   . HOH E 3 .   ? 17.522  -25.539 4.004   1.00 36.03 ? 340 HOH A O   1 
HETATM 3334 O  O   . HOH E 3 .   ? 11.316  14.869  9.547   1.00 37.35 ? 341 HOH A O   1 
HETATM 3335 O  O   . HOH E 3 .   ? 1.095   -14.092 13.813  1.00 36.91 ? 342 HOH A O   1 
HETATM 3336 O  O   . HOH E 3 .   ? -2.622  -13.654 -5.637  1.00 38.72 ? 343 HOH A O   1 
HETATM 3337 O  O   . HOH E 3 .   ? -2.145  -7.940  19.757  1.00 37.83 ? 344 HOH A O   1 
HETATM 3338 O  O   . HOH E 3 .   ? 10.957  -7.205  -7.271  1.00 37.92 ? 345 HOH A O   1 
HETATM 3339 O  O   . HOH E 3 .   ? 15.059  -3.874  20.868  1.00 37.78 ? 346 HOH A O   1 
HETATM 3340 O  O   . HOH E 3 .   ? 16.630  -11.859 17.098  1.00 38.90 ? 347 HOH A O   1 
HETATM 3341 O  O   . HOH E 3 .   ? 1.815   -16.762 10.814  1.00 37.32 ? 348 HOH A O   1 
HETATM 3342 O  O   . HOH E 3 .   ? -4.101  -9.736  -0.916  1.00 37.67 ? 349 HOH A O   1 
HETATM 3343 O  O   . HOH E 3 .   ? 6.102   -4.026  -9.400  1.00 37.62 ? 350 HOH A O   1 
HETATM 3344 O  O   . HOH E 3 .   ? 8.967   19.768  5.922   1.00 39.73 ? 351 HOH A O   1 
HETATM 3345 O  O   . HOH E 3 .   ? -9.444  4.026   13.442  1.00 38.27 ? 352 HOH A O   1 
HETATM 3346 O  O   . HOH E 3 .   ? 21.869  0.865   11.665  1.00 37.88 ? 353 HOH A O   1 
HETATM 3347 O  O   . HOH E 3 .   ? 3.929   -8.655  22.415  1.00 38.57 ? 354 HOH A O   1 
HETATM 3348 O  O   . HOH E 3 .   ? 9.792   -9.542  -7.579  1.00 38.01 ? 355 HOH A O   1 
HETATM 3349 O  O   . HOH E 3 .   ? 2.535   -13.216 17.558  1.00 39.28 ? 356 HOH A O   1 
HETATM 3350 O  O   . HOH E 3 .   ? -6.039  -6.297  -3.679  1.00 39.19 ? 357 HOH A O   1 
HETATM 3351 O  O   . HOH E 3 .   ? 15.911  2.290   -4.609  1.00 38.33 ? 358 HOH A O   1 
HETATM 3352 O  O   . HOH E 3 .   ? 12.321  -3.321  -6.307  1.00 37.82 ? 359 HOH A O   1 
HETATM 3353 O  O   . HOH E 3 .   ? 7.190   -17.661 -6.680  1.00 39.47 ? 360 HOH A O   1 
HETATM 3354 O  O   . HOH E 3 .   ? 3.611   -5.924  -6.612  1.00 38.33 ? 361 HOH A O   1 
HETATM 3355 O  O   . HOH E 3 .   ? -2.677  6.067   -7.312  1.00 37.06 ? 362 HOH A O   1 
HETATM 3356 O  O   . HOH E 3 .   ? 26.474  -7.686  4.344   1.00 38.04 ? 363 HOH A O   1 
HETATM 3357 O  O   . HOH E 3 .   ? 12.895  18.961  11.061  1.00 39.30 ? 364 HOH A O   1 
HETATM 3358 O  O   . HOH E 3 .   ? 7.012   7.131   8.205   1.00 39.67 ? 365 HOH A O   1 
HETATM 3359 O  O   . HOH E 3 .   ? 15.116  18.116  9.291   1.00 39.14 ? 366 HOH A O   1 
HETATM 3360 O  O   . HOH E 3 .   ? -8.345  -2.328  6.609   1.00 39.34 ? 367 HOH A O   1 
HETATM 3361 O  O   . HOH E 3 .   ? -9.273  0.983   9.769   1.00 38.96 ? 368 HOH A O   1 
HETATM 3362 O  O   . HOH E 3 .   ? -11.910 -8.100  3.606   1.00 39.70 ? 369 HOH A O   1 
HETATM 3363 O  O   . HOH E 3 .   ? 11.724  -4.320  24.734  1.00 40.79 ? 370 HOH A O   1 
HETATM 3364 O  O   . HOH E 3 .   ? -9.794  -0.133  14.320  1.00 40.57 ? 371 HOH A O   1 
HETATM 3365 O  O   . HOH E 3 .   ? -7.785  -4.555  13.309  1.00 41.92 ? 372 HOH A O   1 
HETATM 3366 O  O   . HOH E 3 .   ? 6.066   14.458  -3.583  1.00 41.74 ? 373 HOH A O   1 
HETATM 3367 O  O   . HOH E 3 .   ? -0.252  9.861   -4.435  1.00 41.81 ? 374 HOH A O   1 
HETATM 3368 O  O   . HOH E 3 .   ? 4.738   -12.706 -4.321  1.00 40.51 ? 375 HOH A O   1 
HETATM 3369 O  O   . HOH E 3 .   ? 15.027  -18.423 15.935  1.00 40.48 ? 376 HOH A O   1 
HETATM 3370 O  O   . HOH E 3 .   ? 11.144  -15.910 -7.366  1.00 41.54 ? 377 HOH A O   1 
HETATM 3371 O  O   . HOH E 3 .   ? 25.947  -0.771  3.418   1.00 39.80 ? 378 HOH A O   1 
HETATM 3372 O  O   . HOH E 3 .   ? 20.484  1.598   19.630  1.00 41.38 ? 379 HOH A O   1 
HETATM 3373 O  O   . HOH E 3 .   ? 9.595   -24.069 6.326   1.00 39.58 ? 380 HOH A O   1 
HETATM 3374 O  O   . HOH E 3 .   ? 14.845  -18.298 -7.153  1.00 41.09 ? 381 HOH A O   1 
HETATM 3375 O  O   . HOH E 3 .   ? 11.043  -24.186 0.668   1.00 41.92 ? 382 HOH A O   1 
HETATM 3376 O  O   . HOH E 3 .   ? 4.054   16.186  3.025   1.00 41.35 ? 383 HOH A O   1 
HETATM 3377 O  O   . HOH E 3 .   ? 10.921  -26.615 2.031   1.00 41.82 ? 384 HOH A O   1 
HETATM 3378 O  O   . HOH E 3 .   ? 18.806  17.916  12.660  1.00 40.37 ? 385 HOH A O   1 
HETATM 3379 O  O   . HOH E 3 .   ? 3.485   -20.856 7.615   1.00 40.73 ? 386 HOH A O   1 
HETATM 3380 O  O   . HOH E 3 .   ? 3.843   -1.640  21.313  1.00 41.74 ? 387 HOH A O   1 
HETATM 3381 O  O   . HOH E 3 .   ? 5.270   -5.545  -4.904  1.00 40.75 ? 388 HOH A O   1 
HETATM 3382 O  O   . HOH E 3 .   ? 12.457  8.090   -5.803  1.00 41.64 ? 389 HOH A O   1 
HETATM 3383 O  O   . HOH E 3 .   ? 13.885  -10.066 19.978  1.00 41.33 ? 390 HOH A O   1 
HETATM 3384 O  O   . HOH E 3 .   ? 8.467   -2.267  -7.144  1.00 41.02 ? 391 HOH A O   1 
HETATM 3385 O  O   . HOH E 3 .   ? 20.597  -4.087  11.804  1.00 40.97 ? 392 HOH A O   1 
HETATM 3386 O  O   . HOH E 3 .   ? -10.961 -3.514  4.288   1.00 41.68 ? 393 HOH A O   1 
HETATM 3387 O  O   . HOH E 3 .   ? -11.304 1.118   -1.626  1.00 42.08 ? 394 HOH A O   1 
HETATM 3388 O  O   . HOH E 3 .   ? 18.428  4.411   23.048  1.00 42.12 ? 395 HOH A O   1 
HETATM 3389 O  O   . HOH E 3 .   ? 21.805  11.858  15.470  1.00 41.57 ? 396 HOH A O   1 
HETATM 3390 O  O   . HOH E 3 .   ? 8.446   0.638   -6.905  1.00 41.45 ? 397 HOH A O   1 
HETATM 3391 O  O   . HOH E 3 .   ? 5.162   -19.106 13.271  1.00 41.22 ? 398 HOH A O   1 
HETATM 3392 O  O   . HOH E 3 .   ? 2.687   -12.469 19.879  1.00 42.44 ? 399 HOH A O   1 
HETATM 3393 O  O   . HOH E 3 .   ? 12.260  -18.278 -6.855  1.00 41.90 ? 400 HOH A O   1 
HETATM 3394 O  O   . HOH E 3 .   ? -1.927  -6.792  21.652  1.00 43.11 ? 401 HOH A O   1 
HETATM 3395 O  O   . HOH E 3 .   ? -2.475  -6.773  -8.585  1.00 44.29 ? 402 HOH A O   1 
HETATM 3396 O  O   . HOH E 3 .   ? 20.667  20.266  9.198   1.00 43.08 ? 403 HOH A O   1 
HETATM 3397 O  O   . HOH E 3 .   ? 22.643  -21.604 7.866   1.00 41.06 ? 404 HOH A O   1 
HETATM 3398 O  O   . HOH E 3 .   ? 15.116  21.690  -0.873  1.00 42.05 ? 405 HOH A O   1 
HETATM 3399 O  O   . HOH E 3 .   ? 23.351  2.585   12.903  1.00 42.88 ? 406 HOH A O   1 
HETATM 3400 O  O   . HOH E 3 .   ? 17.588  -23.506 -3.060  1.00 43.15 ? 407 HOH A O   1 
HETATM 3401 O  O   . HOH E 3 .   ? 22.795  -16.589 3.610   1.00 42.47 ? 408 HOH A O   1 
HETATM 3402 O  O   . HOH E 3 .   ? 22.717  -5.563  13.224  1.00 42.44 ? 409 HOH A O   1 
HETATM 3403 O  O   . HOH E 3 .   ? -10.272 -0.432  7.483   1.00 42.00 ? 410 HOH A O   1 
HETATM 3404 O  O   . HOH E 3 .   ? -1.135  -2.898  24.913  1.00 43.95 ? 411 HOH A O   1 
HETATM 3405 O  O   . HOH E 3 .   ? 22.147  -19.134 -1.178  1.00 44.26 ? 412 HOH A O   1 
HETATM 3406 O  O   . HOH E 3 .   ? -3.501  -0.730  -9.412  1.00 44.05 ? 413 HOH A O   1 
HETATM 3407 O  O   . HOH E 3 .   ? 19.607  17.848  14.978  1.00 42.93 ? 414 HOH A O   1 
HETATM 3408 O  O   . HOH E 3 .   ? -8.329  -1.065  20.109  1.00 43.74 ? 415 HOH A O   1 
HETATM 3409 O  O   . HOH E 3 .   ? 18.199  -5.285  -4.404  1.00 43.89 ? 416 HOH A O   1 
HETATM 3410 O  O   . HOH E 3 .   ? 1.770   -4.720  -7.399  1.00 43.98 ? 417 HOH A O   1 
HETATM 3411 O  O   . HOH E 3 .   ? 22.774  3.477   -4.680  1.00 43.53 ? 418 HOH A O   1 
HETATM 3412 O  O   . HOH E 3 .   ? 16.415  16.834  11.399  1.00 43.81 ? 419 HOH A O   1 
HETATM 3413 O  O   . HOH E 3 .   ? 25.044  -7.944  1.994   1.00 44.69 ? 420 HOH A O   1 
HETATM 3414 O  O   . HOH E 3 .   ? -2.178  -9.341  -7.304  1.00 43.80 ? 421 HOH A O   1 
HETATM 3415 O  O   . HOH E 3 .   ? -6.859  -7.290  14.621  1.00 43.50 ? 422 HOH A O   1 
HETATM 3416 O  O   . HOH E 3 .   ? 2.250   -19.314 4.524   1.00 43.14 ? 423 HOH A O   1 
HETATM 3417 O  O   . HOH E 3 .   ? 25.219  9.168   12.374  1.00 44.00 ? 424 HOH A O   1 
HETATM 3418 O  O   . HOH E 3 .   ? -1.318  -11.259 17.376  1.00 42.35 ? 425 HOH A O   1 
HETATM 3419 O  O   . HOH E 3 .   ? -9.188  -8.113  15.537  1.00 42.04 ? 426 HOH A O   1 
HETATM 3420 O  O   . HOH E 3 .   ? 0.195   -5.328  22.460  1.00 44.68 ? 427 HOH A O   1 
HETATM 3421 O  O   . HOH E 3 .   ? 22.385  -21.223 3.942   1.00 44.38 ? 428 HOH A O   1 
HETATM 3422 O  O   . HOH E 3 .   ? 6.287   -10.827 -8.796  1.00 45.12 ? 429 HOH A O   1 
HETATM 3423 O  O   . HOH E 3 .   ? 24.867  -3.348  2.825   1.00 44.83 ? 430 HOH A O   1 
HETATM 3424 O  O   . HOH E 3 .   ? 15.311  -13.915 -8.167  1.00 44.75 ? 431 HOH A O   1 
HETATM 3425 O  O   . HOH E 3 .   ? 15.325  -27.286 8.147   1.00 45.22 ? 432 HOH A O   1 
HETATM 3426 O  O   . HOH E 3 .   ? 16.078  5.306   -3.664  1.00 45.00 ? 433 HOH A O   1 
HETATM 3427 O  O   . HOH E 3 .   ? 15.508  -21.413 -6.815  1.00 44.52 ? 434 HOH A O   1 
HETATM 3428 O  O   . HOH E 3 .   ? -10.926 -5.910  2.397   1.00 45.83 ? 435 HOH A O   1 
HETATM 3429 O  O   . HOH E 3 .   ? 17.891  -26.431 9.366   1.00 44.89 ? 436 HOH A O   1 
HETATM 3430 O  O   . HOH E 3 .   ? -11.135 0.302   16.499  1.00 46.29 ? 437 HOH A O   1 
HETATM 3431 O  O   . HOH E 3 .   ? 14.125  1.485   22.924  1.00 46.08 ? 438 HOH A O   1 
HETATM 3432 O  O   . HOH E 3 .   ? 17.406  -0.723  -2.239  1.00 45.23 ? 439 HOH A O   1 
HETATM 3433 O  O   . HOH E 3 .   ? 19.218  -0.134  18.817  1.00 44.93 ? 440 HOH A O   1 
HETATM 3434 O  O   . HOH E 3 .   ? 4.882   -11.355 -6.571  1.00 44.87 ? 441 HOH A O   1 
HETATM 3435 O  O   . HOH E 3 .   ? 28.558  0.736   5.696   1.00 46.58 ? 442 HOH A O   1 
HETATM 3436 O  O   . HOH E 3 .   ? -11.570 -0.009  1.249   1.00 49.00 ? 443 HOH A O   1 
HETATM 3437 O  O   . HOH E 3 .   ? 15.939  -7.794  18.278  1.00 46.33 ? 444 HOH A O   1 
HETATM 3438 O  O   . HOH E 3 .   ? 22.041  22.770  9.532   1.00 45.17 ? 445 HOH A O   1 
HETATM 3439 O  O   . HOH E 3 .   ? 13.239  21.226  6.126   1.00 48.14 ? 446 HOH A O   1 
HETATM 3440 O  O   . HOH E 3 .   ? 29.976  -0.826  6.914   1.00 48.94 ? 447 HOH A O   1 
HETATM 3441 O  O   . HOH E 3 .   ? 20.521  19.261  -6.082  1.00 48.39 ? 448 HOH A O   1 
HETATM 3442 O  O   . HOH E 3 .   ? 4.497   0.984   21.225  1.00 48.18 ? 449 HOH A O   1 
HETATM 3443 O  O   . HOH E 3 .   ? 4.765   9.944   -6.123  1.00 47.52 ? 450 HOH A O   1 
HETATM 3444 O  O   . HOH E 3 .   ? 11.142  22.843  4.328   1.00 48.48 ? 451 HOH A O   1 
HETATM 3445 O  O   . HOH E 3 .   ? 28.315  5.990   8.989   1.00 50.25 ? 452 HOH A O   1 
HETATM 3446 O  O   . HOH E 3 .   ? 3.444   -17.120 13.233  1.00 48.01 ? 453 HOH A O   1 
HETATM 3447 O  O   . HOH E 3 .   ? 12.278  -25.062 13.834  1.00 49.90 ? 454 HOH A O   1 
HETATM 3448 O  O   . HOH E 3 .   ? -0.790  -11.070 20.715  1.00 48.83 ? 455 HOH A O   1 
HETATM 3449 O  O   . HOH E 3 .   ? 32.312  18.228  13.058  1.00 50.23 ? 456 HOH A O   1 
HETATM 3450 O  O   . HOH E 3 .   ? 15.367  -5.987  -5.995  1.00 49.55 ? 457 HOH A O   1 
HETATM 3451 O  O   . HOH E 3 .   ? 18.779  7.167   -6.769  1.00 50.78 ? 458 HOH A O   1 
HETATM 3452 O  O   . HOH E 3 .   ? -5.212  -3.586  -6.386  1.00 49.34 ? 459 HOH A O   1 
HETATM 3453 O  O   . HOH E 3 .   ? 18.936  17.073  -2.866  1.00 50.44 ? 460 HOH A O   1 
HETATM 3454 O  O   . HOH E 3 .   ? 24.709  14.235  14.037  1.00 53.72 ? 461 HOH A O   1 
HETATM 3455 O  O   . HOH E 3 .   ? 31.958  14.102  -2.429  1.00 52.89 ? 462 HOH A O   1 
HETATM 3456 O  O   . HOH E 3 .   ? 14.111  -24.992 0.735   1.00 53.99 ? 463 HOH A O   1 
HETATM 3457 O  O   . HOH E 3 .   ? 12.180  -26.953 8.404   1.00 53.45 ? 464 HOH A O   1 
HETATM 3458 O  O   . HOH E 3 .   ? 28.439  8.629   11.436  1.00 52.66 ? 465 HOH A O   1 
HETATM 3459 O  O   . HOH E 3 .   ? 21.260  3.867   18.350  1.00 52.67 ? 466 HOH A O   1 
HETATM 3460 O  O   . HOH E 3 .   ? 1.052   3.593   -8.166  1.00 51.86 ? 467 HOH A O   1 
HETATM 3461 O  O   . HOH E 3 .   ? 23.358  7.050   18.383  1.00 53.95 ? 468 HOH A O   1 
HETATM 3462 O  O   . HOH E 3 .   ? 3.932   -17.573 18.379  1.00 57.98 ? 469 HOH A O   1 
HETATM 3463 O  O   . HOH E 3 .   ? 24.493  1.019   0.416   1.00 59.51 ? 470 HOH A O   1 
HETATM 3464 O  O   . HOH E 3 .   ? 22.165  22.307  3.915   1.00 58.23 ? 471 HOH A O   1 
HETATM 3465 O  O   . HOH E 3 .   ? 32.107  10.731  -1.617  1.00 59.39 ? 472 HOH A O   1 
HETATM 3466 O  O   . HOH E 3 .   ? 24.551  -12.212 -0.353  1.00 58.43 ? 473 HOH A O   1 
HETATM 3467 O  O   . HOH E 3 .   ? 26.884  18.848  16.142  1.00 64.03 ? 474 HOH A O   1 
HETATM 3468 O  O   . HOH F 3 .   ? 3.361   11.605  13.601  1.00 17.63 ? 205 HOH B O   1 
HETATM 3469 O  O   . HOH F 3 .   ? 3.693   7.379   26.044  1.00 17.46 ? 206 HOH B O   1 
HETATM 3470 O  O   . HOH F 3 .   ? -4.485  8.488   19.408  1.00 18.95 ? 207 HOH B O   1 
HETATM 3471 O  O   . HOH F 3 .   ? 5.360   6.456   18.964  1.00 19.79 ? 208 HOH B O   1 
HETATM 3472 O  O   . HOH F 3 .   ? 14.852  4.846   20.463  1.00 20.20 ? 209 HOH B O   1 
HETATM 3473 O  O   . HOH F 3 .   ? 9.192   11.929  14.630  1.00 21.13 ? 210 HOH B O   1 
HETATM 3474 O  O   . HOH F 3 .   ? -4.323  10.803  26.021  1.00 20.99 ? 211 HOH B O   1 
HETATM 3475 O  O   . HOH F 3 .   ? -5.783  11.170  19.180  1.00 21.25 ? 212 HOH B O   1 
HETATM 3476 O  O   . HOH F 3 .   ? -2.644  27.329  28.004  1.00 22.97 ? 213 HOH B O   1 
HETATM 3477 O  O   . HOH F 3 .   ? 4.451   13.488  11.872  1.00 24.16 ? 214 HOH B O   1 
HETATM 3478 O  O   . HOH F 3 .   ? -3.028  12.395  24.324  1.00 23.89 ? 215 HOH B O   1 
HETATM 3479 O  O   . HOH F 3 .   ? -11.750 3.394   23.079  1.00 23.77 ? 216 HOH B O   1 
HETATM 3480 O  O   . HOH F 3 .   ? -15.161 14.764  34.434  1.00 24.42 ? 217 HOH B O   1 
HETATM 3481 O  O   . HOH F 3 .   ? 2.089   23.635  17.902  1.00 23.91 ? 218 HOH B O   1 
HETATM 3482 O  O   . HOH F 3 .   ? -5.395  13.481  21.264  1.00 24.21 ? 219 HOH B O   1 
HETATM 3483 O  O   . HOH F 3 .   ? 2.219   0.059   26.838  1.00 24.73 ? 220 HOH B O   1 
HETATM 3484 O  O   . HOH F 3 .   ? 13.054  9.537   20.416  1.00 24.45 ? 221 HOH B O   1 
HETATM 3485 O  O   . HOH F 3 .   ? -5.535  26.000  33.561  1.00 25.02 ? 222 HOH B O   1 
HETATM 3486 O  O   . HOH F 3 .   ? -13.836 6.348   25.971  1.00 24.81 ? 223 HOH B O   1 
HETATM 3487 O  O   . HOH F 3 .   ? -11.665 13.461  26.509  1.00 25.45 ? 224 HOH B O   1 
HETATM 3488 O  O   . HOH F 3 .   ? -8.652  22.028  20.118  1.00 25.64 ? 225 HOH B O   1 
HETATM 3489 O  O   . HOH F 3 .   ? -11.210 -2.044  23.876  1.00 27.02 ? 226 HOH B O   1 
HETATM 3490 O  O   . HOH F 3 .   ? -2.903  29.146  25.862  1.00 26.57 ? 227 HOH B O   1 
HETATM 3491 O  O   . HOH F 3 .   ? 12.402  4.538   28.059  1.00 26.92 ? 228 HOH B O   1 
HETATM 3492 O  O   . HOH F 3 .   ? 15.110  14.045  18.636  1.00 27.35 ? 229 HOH B O   1 
HETATM 3493 O  O   . HOH F 3 .   ? 12.519  6.183   32.663  1.00 27.49 ? 230 HOH B O   1 
HETATM 3494 O  O   . HOH F 3 .   ? -5.291  29.404  33.552  1.00 27.04 ? 231 HOH B O   1 
HETATM 3495 O  O   . HOH F 3 .   ? -2.106  9.674   37.850  1.00 27.57 ? 232 HOH B O   1 
HETATM 3496 O  O   . HOH F 3 .   ? -9.865  22.399  29.567  1.00 28.19 ? 233 HOH B O   1 
HETATM 3497 O  O   . HOH F 3 .   ? 7.444   26.703  17.879  1.00 28.50 ? 234 HOH B O   1 
HETATM 3498 O  O   . HOH F 3 .   ? 3.409   27.690  19.998  1.00 28.38 ? 235 HOH B O   1 
HETATM 3499 O  O   . HOH F 3 .   ? 1.715   25.459  20.227  1.00 29.29 ? 236 HOH B O   1 
HETATM 3500 O  O   . HOH F 3 .   ? 0.816   28.318  36.602  1.00 29.04 ? 237 HOH B O   1 
HETATM 3501 O  O   . HOH F 3 .   ? 6.064   9.820   17.936  1.00 29.84 ? 238 HOH B O   1 
HETATM 3502 O  O   . HOH F 3 .   ? 4.630   27.533  17.748  1.00 28.49 ? 239 HOH B O   1 
HETATM 3503 O  O   . HOH F 3 .   ? -16.137 8.560   31.757  1.00 29.31 ? 240 HOH B O   1 
HETATM 3504 O  O   . HOH F 3 .   ? 17.336  6.463   24.397  1.00 29.77 ? 241 HOH B O   1 
HETATM 3505 O  O   . HOH F 3 .   ? -14.428 11.335  20.148  1.00 29.87 ? 242 HOH B O   1 
HETATM 3506 O  O   . HOH F 3 .   ? -7.002  27.844  26.577  1.00 29.08 ? 243 HOH B O   1 
HETATM 3507 O  O   . HOH F 3 .   ? -5.170  10.337  37.739  1.00 29.78 ? 244 HOH B O   1 
HETATM 3508 O  O   . HOH F 3 .   ? -5.501  32.861  39.216  1.00 31.39 ? 245 HOH B O   1 
HETATM 3509 O  O   . HOH F 3 .   ? -8.418  20.081  18.227  1.00 30.73 ? 246 HOH B O   1 
HETATM 3510 O  O   . HOH F 3 .   ? -3.798  -1.890  38.512  1.00 31.27 ? 247 HOH B O   1 
HETATM 3511 O  O   . HOH F 3 .   ? -12.642 8.278   34.608  1.00 30.54 ? 248 HOH B O   1 
HETATM 3512 O  O   . HOH F 3 .   ? 17.448  8.318   21.695  1.00 30.38 ? 249 HOH B O   1 
HETATM 3513 O  O   . HOH F 3 .   ? -12.361 19.791  27.457  1.00 30.43 ? 250 HOH B O   1 
HETATM 3514 O  O   . HOH F 3 .   ? -4.215  26.480  21.716  1.00 30.02 ? 251 HOH B O   1 
HETATM 3515 O  O   . HOH F 3 .   ? 4.809   22.019  17.312  1.00 30.44 ? 252 HOH B O   1 
HETATM 3516 O  O   . HOH F 3 .   ? -10.302 6.324   35.240  1.00 31.18 ? 253 HOH B O   1 
HETATM 3517 O  O   . HOH F 3 .   ? 14.617  7.809   32.697  1.00 30.05 ? 254 HOH B O   1 
HETATM 3518 O  O   . HOH F 3 .   ? -11.157 9.112   18.211  1.00 31.47 ? 255 HOH B O   1 
HETATM 3519 O  O   . HOH F 3 .   ? 13.152  18.219  21.167  1.00 31.01 ? 256 HOH B O   1 
HETATM 3520 O  O   . HOH F 3 .   ? -6.493  23.532  19.161  1.00 31.85 ? 257 HOH B O   1 
HETATM 3521 O  O   . HOH F 3 .   ? 4.521   -1.181  26.309  1.00 31.12 ? 258 HOH B O   1 
HETATM 3522 O  O   . HOH F 3 .   ? -4.951  22.530  17.325  1.00 31.50 ? 259 HOH B O   1 
HETATM 3523 O  O   . HOH F 3 .   ? 5.434   0.961   24.673  1.00 31.09 ? 260 HOH B O   1 
HETATM 3524 O  O   . HOH F 3 .   ? 2.297   36.018  26.236  1.00 32.05 ? 261 HOH B O   1 
HETATM 3525 O  O   . HOH F 3 .   ? 6.463   16.478  14.807  1.00 33.20 ? 262 HOH B O   1 
HETATM 3526 O  O   . HOH F 3 .   ? -10.083 25.163  27.457  1.00 31.85 ? 263 HOH B O   1 
HETATM 3527 O  O   . HOH F 3 .   ? 15.345  5.419   25.714  1.00 32.21 ? 264 HOH B O   1 
HETATM 3528 O  O   . HOH F 3 .   ? -2.996  34.426  35.420  1.00 33.77 ? 265 HOH B O   1 
HETATM 3529 O  O   . HOH F 3 .   ? -2.805  14.539  7.338   1.00 32.55 ? 266 HOH B O   1 
HETATM 3530 O  O   . HOH F 3 .   ? 4.818   10.456  38.342  1.00 32.63 ? 267 HOH B O   1 
HETATM 3531 O  O   . HOH F 3 .   ? 2.749   25.450  16.197  1.00 32.38 ? 268 HOH B O   1 
HETATM 3532 O  O   . HOH F 3 .   ? 10.001  14.879  14.771  1.00 33.72 ? 269 HOH B O   1 
HETATM 3533 O  O   . HOH F 3 .   ? -4.986  28.056  23.727  1.00 34.36 ? 270 HOH B O   1 
HETATM 3534 O  O   . HOH F 3 .   ? 8.790   11.262  35.184  1.00 33.94 ? 271 HOH B O   1 
HETATM 3535 O  O   . HOH F 3 .   ? -15.507 20.646  25.268  1.00 34.84 ? 272 HOH B O   1 
HETATM 3536 O  O   . HOH F 3 .   ? 3.653   15.680  8.538   1.00 34.86 ? 273 HOH B O   1 
HETATM 3537 O  O   . HOH F 3 .   ? 17.340  10.939  22.340  1.00 34.17 ? 274 HOH B O   1 
HETATM 3538 O  O   . HOH F 3 .   ? -1.927  9.636   40.414  1.00 35.55 ? 275 HOH B O   1 
HETATM 3539 O  O   . HOH F 3 .   ? -15.664 18.557  29.645  1.00 35.42 ? 276 HOH B O   1 
HETATM 3540 O  O   . HOH F 3 .   ? -16.108 5.265   21.569  1.00 35.08 ? 277 HOH B O   1 
HETATM 3541 O  O   . HOH F 3 .   ? 6.472   16.977  39.585  1.00 35.73 ? 278 HOH B O   1 
HETATM 3542 O  O   . HOH F 3 .   ? 17.809  9.936   27.661  1.00 35.07 ? 279 HOH B O   1 
HETATM 3543 O  O   . HOH F 3 .   ? 5.926   23.011  15.106  1.00 35.45 ? 280 HOH B O   1 
HETATM 3544 O  O   . HOH F 3 .   ? 7.211   12.132  37.308  1.00 35.79 ? 281 HOH B O   1 
HETATM 3545 O  O   . HOH F 3 .   ? 18.028  -4.887  31.644  1.00 35.13 ? 282 HOH B O   1 
HETATM 3546 O  O   . HOH F 3 .   ? 12.694  24.451  21.717  1.00 34.21 ? 283 HOH B O   1 
HETATM 3547 O  O   . HOH F 3 .   ? -6.030  30.204  39.254  1.00 35.60 ? 284 HOH B O   1 
HETATM 3548 O  O   . HOH F 3 .   ? 2.769   -8.350  36.096  1.00 36.20 ? 285 HOH B O   1 
HETATM 3549 O  O   . HOH F 3 .   ? 2.984   12.105  39.581  1.00 35.45 ? 286 HOH B O   1 
HETATM 3550 O  O   . HOH F 3 .   ? 3.524   17.673  10.781  1.00 37.21 ? 287 HOH B O   1 
HETATM 3551 O  O   . HOH F 3 .   ? -11.318 11.200  16.713  1.00 36.10 ? 288 HOH B O   1 
HETATM 3552 O  O   . HOH F 3 .   ? 6.053   14.039  13.717  1.00 35.13 ? 289 HOH B O   1 
HETATM 3553 O  O   . HOH F 3 .   ? 2.986   1.863   25.004  1.00 35.56 ? 290 HOH B O   1 
HETATM 3554 O  O   . HOH F 3 .   ? 15.081  26.095  28.287  1.00 37.45 ? 291 HOH B O   1 
HETATM 3555 O  O   . HOH F 3 .   ? 15.577  -5.415  31.475  1.00 37.50 ? 292 HOH B O   1 
HETATM 3556 O  O   . HOH F 3 .   ? -5.095  11.845  40.066  1.00 36.64 ? 293 HOH B O   1 
HETATM 3557 O  O   . HOH F 3 .   ? 16.952  7.176   31.547  1.00 37.15 ? 294 HOH B O   1 
HETATM 3558 O  O   . HOH F 3 .   ? 0.235   34.516  33.318  1.00 37.00 ? 295 HOH B O   1 
HETATM 3559 O  O   . HOH F 3 .   ? 4.345   4.820   42.777  1.00 37.46 ? 296 HOH B O   1 
HETATM 3560 O  O   . HOH F 3 .   ? -6.546  -1.390  32.459  1.00 36.86 ? 297 HOH B O   1 
HETATM 3561 O  O   . HOH F 3 .   ? -0.239  19.541  41.254  1.00 37.84 ? 298 HOH B O   1 
HETATM 3562 O  O   . HOH F 3 .   ? 2.800   3.029   41.585  1.00 36.75 ? 299 HOH B O   1 
HETATM 3563 O  O   . HOH F 3 .   ? -4.368  31.260  27.176  1.00 36.88 ? 300 HOH B O   1 
HETATM 3564 O  O   . HOH F 3 .   ? 6.284   -2.397  27.743  1.00 36.85 ? 301 HOH B O   1 
HETATM 3565 O  O   . HOH F 3 .   ? 0.349   1.938   42.686  1.00 37.06 ? 302 HOH B O   1 
HETATM 3566 O  O   . HOH F 3 .   ? -1.457  -3.890  35.398  1.00 38.44 ? 303 HOH B O   1 
HETATM 3567 O  O   . HOH F 3 .   ? -7.023  21.217  15.809  1.00 38.76 ? 304 HOH B O   1 
HETATM 3568 O  O   . HOH F 3 .   ? 6.702   18.920  42.069  1.00 38.22 ? 305 HOH B O   1 
HETATM 3569 O  O   . HOH F 3 .   ? 15.994  11.660  31.216  1.00 36.50 ? 306 HOH B O   1 
HETATM 3570 O  O   . HOH F 3 .   ? -5.272  13.695  8.295   1.00 38.42 ? 307 HOH B O   1 
HETATM 3571 O  O   . HOH F 3 .   ? -0.658  23.815  14.583  1.00 37.80 ? 308 HOH B O   1 
HETATM 3572 O  O   . HOH F 3 .   ? 14.651  16.539  14.975  1.00 38.07 ? 309 HOH B O   1 
HETATM 3573 O  O   . HOH F 3 .   ? -1.366  15.626  41.544  1.00 37.99 ? 310 HOH B O   1 
HETATM 3574 O  O   . HOH F 3 .   ? 18.120  0.160   28.542  1.00 38.64 ? 311 HOH B O   1 
HETATM 3575 O  O   . HOH F 3 .   ? 12.566  32.511  35.568  1.00 38.87 ? 312 HOH B O   1 
HETATM 3576 O  O   . HOH F 3 .   ? 18.095  9.739   31.370  1.00 40.36 ? 313 HOH B O   1 
HETATM 3577 O  O   . HOH F 3 .   ? 14.947  2.838   26.096  1.00 38.36 ? 314 HOH B O   1 
HETATM 3578 O  O   . HOH F 3 .   ? -11.152 6.631   16.792  1.00 39.29 ? 315 HOH B O   1 
HETATM 3579 O  O   . HOH F 3 .   ? -11.570 24.844  30.697  1.00 39.12 ? 316 HOH B O   1 
HETATM 3580 O  O   . HOH F 3 .   ? -0.779  35.967  26.823  1.00 39.73 ? 317 HOH B O   1 
HETATM 3581 O  O   . HOH F 3 .   ? 7.904   24.504  16.350  1.00 40.03 ? 318 HOH B O   1 
HETATM 3582 O  O   . HOH F 3 .   ? 19.199  5.685   31.915  1.00 40.49 ? 319 HOH B O   1 
HETATM 3583 O  O   . HOH F 3 .   ? -9.681  8.186   13.696  1.00 39.64 ? 320 HOH B O   1 
HETATM 3584 O  O   . HOH F 3 .   ? -9.141  12.613  12.564  1.00 40.88 ? 321 HOH B O   1 
HETATM 3585 O  O   . HOH F 3 .   ? -10.303 26.195  25.375  1.00 39.71 ? 322 HOH B O   1 
HETATM 3586 O  O   . HOH F 3 .   ? 15.046  16.258  20.235  1.00 41.08 ? 323 HOH B O   1 
HETATM 3587 O  O   . HOH F 3 .   ? -12.169 20.828  37.192  1.00 41.16 ? 324 HOH B O   1 
HETATM 3588 O  O   . HOH F 3 .   ? 4.179   -5.926  26.601  1.00 40.63 ? 325 HOH B O   1 
HETATM 3589 O  O   . HOH F 3 .   ? 0.995   5.906   40.253  1.00 40.41 ? 326 HOH B O   1 
HETATM 3590 O  O   . HOH F 3 .   ? 15.203  16.491  30.630  1.00 39.78 ? 327 HOH B O   1 
HETATM 3591 O  O   . HOH F 3 .   ? -12.717 23.588  25.621  1.00 40.61 ? 328 HOH B O   1 
HETATM 3592 O  O   . HOH F 3 .   ? 1.067   35.703  38.404  1.00 40.23 ? 329 HOH B O   1 
HETATM 3593 O  O   . HOH F 3 .   ? -17.233 16.234  26.794  1.00 40.49 ? 330 HOH B O   1 
HETATM 3594 O  O   . HOH F 3 .   ? -6.749  19.666  13.783  1.00 39.80 ? 331 HOH B O   1 
HETATM 3595 O  O   . HOH F 3 .   ? 21.214  6.740   29.673  1.00 42.53 ? 332 HOH B O   1 
HETATM 3596 O  O   . HOH F 3 .   ? -15.829 15.881  20.490  1.00 40.77 ? 333 HOH B O   1 
HETATM 3597 O  O   . HOH F 3 .   ? -0.016  35.363  30.619  1.00 41.49 ? 334 HOH B O   1 
HETATM 3598 O  O   . HOH F 3 .   ? -13.996 21.290  35.765  1.00 40.62 ? 335 HOH B O   1 
HETATM 3599 O  O   . HOH F 3 .   ? -2.217  26.017  42.466  1.00 40.37 ? 336 HOH B O   1 
HETATM 3600 O  O   . HOH F 3 .   ? -8.830  16.870  14.335  1.00 41.26 ? 337 HOH B O   1 
HETATM 3601 O  O   . HOH F 3 .   ? 13.873  30.252  35.859  1.00 39.87 ? 338 HOH B O   1 
HETATM 3602 O  O   . HOH F 3 .   ? -1.670  28.729  21.532  1.00 40.83 ? 339 HOH B O   1 
HETATM 3603 O  O   . HOH F 3 .   ? -12.208 14.673  19.684  1.00 40.72 ? 340 HOH B O   1 
HETATM 3604 O  O   . HOH F 3 .   ? 6.687   21.396  12.988  1.00 41.32 ? 341 HOH B O   1 
HETATM 3605 O  O   . HOH F 3 .   ? -13.274 12.648  17.933  1.00 41.58 ? 342 HOH B O   1 
HETATM 3606 O  O   . HOH F 3 .   ? 14.708  -0.560  25.391  1.00 40.14 ? 343 HOH B O   1 
HETATM 3607 O  O   . HOH F 3 .   ? 19.450  8.009   20.417  1.00 42.34 ? 344 HOH B O   1 
HETATM 3608 O  O   . HOH F 3 .   ? 6.568   11.319  14.522  1.00 40.91 ? 345 HOH B O   1 
HETATM 3609 O  O   . HOH F 3 .   ? 8.263   -3.797  26.714  1.00 41.20 ? 346 HOH B O   1 
HETATM 3610 O  O   . HOH F 3 .   ? -1.049  4.055   41.402  1.00 40.22 ? 347 HOH B O   1 
HETATM 3611 O  O   . HOH F 3 .   ? 16.043  2.893   41.994  1.00 41.80 ? 348 HOH B O   1 
HETATM 3612 O  O   . HOH F 3 .   ? -14.298 16.699  36.225  1.00 42.49 ? 349 HOH B O   1 
HETATM 3613 O  O   . HOH F 3 .   ? -4.563  21.324  10.358  1.00 43.98 ? 350 HOH B O   1 
HETATM 3614 O  O   . HOH F 3 .   ? 8.947   -6.921  32.232  1.00 43.03 ? 351 HOH B O   1 
HETATM 3615 O  O   . HOH F 3 .   ? 8.357   -8.215  43.813  1.00 43.91 ? 352 HOH B O   1 
HETATM 3616 O  O   . HOH F 3 .   ? 9.076   0.232   42.830  1.00 42.39 ? 353 HOH B O   1 
HETATM 3617 O  O   . HOH F 3 .   ? 8.254   33.367  40.439  1.00 43.30 ? 354 HOH B O   1 
HETATM 3618 O  O   . HOH F 3 .   ? -16.744 9.361   29.287  1.00 43.67 ? 355 HOH B O   1 
HETATM 3619 O  O   . HOH F 3 .   ? -6.728  25.315  36.181  1.00 42.61 ? 356 HOH B O   1 
HETATM 3620 O  O   . HOH F 3 .   ? 3.939   -9.416  38.727  1.00 43.30 ? 357 HOH B O   1 
HETATM 3621 O  O   . HOH F 3 .   ? 2.636   36.328  29.611  1.00 43.16 ? 358 HOH B O   1 
HETATM 3622 O  O   . HOH F 3 .   ? -17.900 12.142  22.123  1.00 43.17 ? 359 HOH B O   1 
HETATM 3623 O  O   . HOH F 3 .   ? 11.716  -2.886  27.410  1.00 45.78 ? 360 HOH B O   1 
HETATM 3624 O  O   . HOH F 3 .   ? -6.353  21.723  39.314  1.00 44.66 ? 361 HOH B O   1 
HETATM 3625 O  O   . HOH F 3 .   ? -2.818  33.644  39.916  1.00 44.61 ? 362 HOH B O   1 
HETATM 3626 O  O   . HOH F 3 .   ? -3.375  24.638  16.184  1.00 44.41 ? 363 HOH B O   1 
HETATM 3627 O  O   . HOH F 3 .   ? -1.989  30.542  41.993  1.00 45.74 ? 364 HOH B O   1 
HETATM 3628 O  O   . HOH F 3 .   ? 1.827   23.822  12.221  1.00 45.03 ? 365 HOH B O   1 
HETATM 3629 O  O   . HOH F 3 .   ? -13.932 25.987  33.046  1.00 46.70 ? 366 HOH B O   1 
HETATM 3630 O  O   . HOH F 3 .   ? -11.213 2.429   33.761  1.00 46.39 ? 367 HOH B O   1 
HETATM 3631 O  O   . HOH F 3 .   ? 1.168   36.448  35.048  1.00 44.92 ? 368 HOH B O   1 
HETATM 3632 O  O   . HOH F 3 .   ? 17.584  13.052  23.866  1.00 45.11 ? 369 HOH B O   1 
HETATM 3633 O  O   . HOH F 3 .   ? -17.986 14.319  30.954  1.00 46.50 ? 370 HOH B O   1 
HETATM 3634 O  O   . HOH F 3 .   ? 0.179   20.176  12.053  1.00 44.62 ? 371 HOH B O   1 
HETATM 3635 O  O   . HOH F 3 .   ? 1.351   19.179  10.416  1.00 46.67 ? 372 HOH B O   1 
HETATM 3636 O  O   . HOH F 3 .   ? -9.626  18.380  37.182  1.00 46.76 ? 373 HOH B O   1 
HETATM 3637 O  O   . HOH F 3 .   ? 17.090  30.561  34.003  1.00 48.71 ? 374 HOH B O   1 
HETATM 3638 O  O   . HOH F 3 .   ? 8.359   38.009  35.554  1.00 48.85 ? 375 HOH B O   1 
HETATM 3639 O  O   . HOH F 3 .   ? -2.913  19.596  41.930  1.00 48.84 ? 376 HOH B O   1 
HETATM 3640 O  O   . HOH F 3 .   ? -0.901  26.764  19.337  1.00 48.61 ? 377 HOH B O   1 
HETATM 3641 O  O   . HOH F 3 .   ? -6.548  17.885  36.850  1.00 48.16 ? 378 HOH B O   1 
HETATM 3642 O  O   . HOH F 3 .   ? -8.429  23.973  38.417  1.00 48.31 ? 379 HOH B O   1 
HETATM 3643 O  O   . HOH F 3 .   ? 19.032  8.463   25.794  1.00 46.86 ? 380 HOH B O   1 
HETATM 3644 O  O   . HOH F 3 .   ? 5.380   0.870   45.973  1.00 49.82 ? 381 HOH B O   1 
HETATM 3645 O  O   . HOH F 3 .   ? -18.091 15.772  24.339  1.00 50.80 ? 382 HOH B O   1 
HETATM 3646 O  O   . HOH F 3 .   ? -1.255  -5.397  30.907  1.00 48.36 ? 383 HOH B O   1 
HETATM 3647 O  O   . HOH F 3 .   ? 14.359  24.292  24.544  1.00 48.71 ? 384 HOH B O   1 
HETATM 3648 O  O   . HOH F 3 .   ? 14.102  -7.634  32.655  1.00 47.35 ? 385 HOH B O   1 
HETATM 3649 O  O   . HOH F 3 .   ? -15.817 6.920   27.498  1.00 48.64 ? 386 HOH B O   1 
HETATM 3650 O  O   . HOH F 3 .   ? -7.658  2.425   37.553  1.00 48.41 ? 387 HOH B O   1 
HETATM 3651 O  O   . HOH F 3 .   ? 15.491  13.560  40.198  1.00 50.82 ? 388 HOH B O   1 
HETATM 3652 O  O   . HOH F 3 .   ? 0.054   25.994  44.906  1.00 51.46 ? 389 HOH B O   1 
HETATM 3653 O  O   . HOH F 3 .   ? 10.245  34.695  38.797  1.00 50.05 ? 390 HOH B O   1 
HETATM 3654 O  O   . HOH F 3 .   ? 14.546  20.219  21.969  1.00 47.46 ? 391 HOH B O   1 
HETATM 3655 O  O   . HOH F 3 .   ? -14.571 22.852  33.428  1.00 53.26 ? 392 HOH B O   1 
HETATM 3656 O  O   . HOH F 3 .   ? 21.761  -8.272  37.412  1.00 50.05 ? 393 HOH B O   1 
HETATM 3657 O  O   . HOH F 3 .   ? 15.885  18.674  25.440  1.00 49.38 ? 394 HOH B O   1 
HETATM 3658 O  O   . HOH F 3 .   ? 18.686  11.148  39.781  1.00 49.43 ? 395 HOH B O   1 
HETATM 3659 O  O   . HOH F 3 .   ? -3.866  23.409  43.301  1.00 49.49 ? 396 HOH B O   1 
HETATM 3660 O  O   . HOH F 3 .   ? 5.487   -4.662  42.395  1.00 48.76 ? 397 HOH B O   1 
HETATM 3661 O  O   . HOH F 3 .   ? 18.721  -0.656  44.305  1.00 52.86 ? 398 HOH B O   1 
HETATM 3662 O  O   . HOH F 3 .   ? -4.342  1.849   46.216  1.00 54.25 ? 399 HOH B O   1 
HETATM 3663 O  O   . HOH F 3 .   ? -4.372  22.191  41.156  1.00 55.26 ? 400 HOH B O   1 
HETATM 3664 O  O   . HOH F 3 .   ? -8.521  17.983  9.784   1.00 53.22 ? 401 HOH B O   1 
HETATM 3665 O  O   . HOH F 3 .   ? 1.539   18.818  43.021  1.00 54.55 ? 402 HOH B O   1 
HETATM 3666 O  O   . HOH F 3 .   ? 21.843  25.476  41.296  1.00 59.40 ? 403 HOH B O   1 
HETATM 3667 O  O   . HOH F 3 .   ? -6.165  6.274   41.846  1.00 56.92 ? 404 HOH B O   1 
HETATM 3668 O  O   . HOH F 3 .   ? -5.547  -1.773  40.714  1.00 55.70 ? 405 HOH B O   1 
HETATM 3669 O  O   . HOH F 3 .   ? 15.255  -10.532 38.284  1.00 55.10 ? 406 HOH B O   1 
HETATM 3670 O  O   . HOH F 3 .   ? 5.697   34.639  20.952  1.00 57.71 ? 407 HOH B O   1 
HETATM 3671 O  O   . HOH F 3 .   ? -18.421 10.932  30.585  1.00 59.17 ? 408 HOH B O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'chirality error at ASN139B' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -8  ?   ?   ?   A . n 
A 1 2   SER 2   -7  ?   ?   ?   A . n 
A 1 3   SER 3   -6  ?   ?   ?   A . n 
A 1 4   HIS 4   -5  ?   ?   ?   A . n 
A 1 5   HIS 5   -4  ?   ?   ?   A . n 
A 1 6   HIS 6   -3  ?   ?   ?   A . n 
A 1 7   HIS 7   -2  ?   ?   ?   A . n 
A 1 8   HIS 8   -1  ?   ?   ?   A . n 
A 1 9   HIS 9   0   ?   ?   ?   A . n 
A 1 10  MET 10  1   ?   ?   ?   A . n 
A 1 11  ALA 11  2   ?   ?   ?   A . n 
A 1 12  LYS 12  3   3   LYS LYS A . n 
A 1 13  HIS 13  4   4   HIS HIS A . n 
A 1 14  GLU 14  5   5   GLU GLU A . n 
A 1 15  LEU 15  6   6   LEU LEU A . n 
A 1 16  PRO 16  7   7   PRO PRO A . n 
A 1 17  ASN 17  8   8   ASN ASN A . n 
A 1 18  LEU 18  9   9   LEU LEU A . n 
A 1 19  PRO 19  10  10  PRO PRO A . n 
A 1 20  TYR 20  11  11  TYR TYR A . n 
A 1 21  ALA 21  12  12  ALA ALA A . n 
A 1 22  TYR 22  13  13  TYR TYR A . n 
A 1 23  ASP 23  14  14  ASP ASP A . n 
A 1 24  ALA 24  15  15  ALA ALA A . n 
A 1 25  LEU 25  16  16  LEU LEU A . n 
A 1 26  GLU 26  17  17  GLU GLU A . n 
A 1 27  PRO 27  18  18  PRO PRO A . n 
A 1 28  HIS 28  19  19  HIS HIS A . n 
A 1 29  PHE 29  20  20  PHE PHE A . n 
A 1 30  ASP 30  21  21  ASP ASP A . n 
A 1 31  LYS 31  22  22  LYS LYS A . n 
A 1 32  GLU 32  23  23  GLU GLU A . n 
A 1 33  THR 33  24  24  THR THR A . n 
A 1 34  MET 34  25  25  MET MET A . n 
A 1 35  ASN 35  26  26  ASN ASN A . n 
A 1 36  ILE 36  27  27  ILE ILE A . n 
A 1 37  HIS 37  28  28  HIS HIS A . n 
A 1 38  HIS 38  29  29  HIS HIS A . n 
A 1 39  THR 39  30  30  THR THR A . n 
A 1 40  LYS 40  31  31  LYS LYS A . n 
A 1 41  HIS 41  32  32  HIS HIS A . n 
A 1 42  HIS 42  33  33  HIS HIS A . n 
A 1 43  ASN 43  34  34  ASN ASN A . n 
A 1 44  THR 44  35  35  THR THR A . n 
A 1 45  TYR 45  36  36  TYR TYR A . n 
A 1 46  ILE 46  37  37  ILE ILE A . n 
A 1 47  THR 47  38  38  THR THR A . n 
A 1 48  ASN 48  39  39  ASN ASN A . n 
A 1 49  LEU 49  40  40  LEU LEU A . n 
A 1 50  ASN 50  41  41  ASN ASN A . n 
A 1 51  ALA 51  42  42  ALA ALA A . n 
A 1 52  ALA 52  43  43  ALA ALA A . n 
A 1 53  LEU 53  44  44  LEU LEU A . n 
A 1 54  GLU 54  45  45  GLU GLU A . n 
A 1 55  GLY 55  46  46  GLY GLY A . n 
A 1 56  HIS 56  47  47  HIS HIS A . n 
A 1 57  ALA 57  48  48  ALA ALA A . n 
A 1 58  GLU 58  49  49  GLU GLU A . n 
A 1 59  LEU 59  50  50  LEU LEU A . n 
A 1 60  ALA 60  51  51  ALA ALA A . n 
A 1 61  ASP 61  52  52  ASP ASP A . n 
A 1 62  LYS 62  53  53  LYS LYS A . n 
A 1 63  SER 63  54  54  SER SER A . n 
A 1 64  VAL 64  55  55  VAL VAL A . n 
A 1 65  GLU 65  56  56  GLU GLU A . n 
A 1 66  GLU 66  57  57  GLU GLU A . n 
A 1 67  LEU 67  58  58  LEU LEU A . n 
A 1 68  VAL 68  59  59  VAL VAL A . n 
A 1 69  ALA 69  60  60  ALA ALA A . n 
A 1 70  ASN 70  61  61  ASN ASN A . n 
A 1 71  LEU 71  62  62  LEU LEU A . n 
A 1 72  ASN 72  63  63  ASN ASN A . n 
A 1 73  GLU 73  64  64  GLU GLU A . n 
A 1 74  VAL 74  65  65  VAL VAL A . n 
A 1 75  PRO 75  66  66  PRO PRO A . n 
A 1 76  GLU 76  67  67  GLU GLU A . n 
A 1 77  ALA 77  68  68  ALA ALA A . n 
A 1 78  ILE 78  69  69  ILE ILE A . n 
A 1 79  ARG 79  70  70  ARG ARG A . n 
A 1 80  THR 80  71  71  THR THR A . n 
A 1 81  ALA 81  72  72  ALA ALA A . n 
A 1 82  VAL 82  73  73  VAL VAL A . n 
A 1 83  ARG 83  74  74  ARG ARG A . n 
A 1 84  ASN 84  75  75  ASN ASN A . n 
A 1 85  ASN 85  76  76  ASN ASN A . n 
A 1 86  GLY 86  77  77  GLY GLY A . n 
A 1 87  GLY 87  78  78  GLY GLY A . n 
A 1 88  GLY 88  79  79  GLY GLY A . n 
A 1 89  HIS 89  80  80  HIS HIS A . n 
A 1 90  ALA 90  81  81  ALA ALA A . n 
A 1 91  ASN 91  82  82  ASN ASN A . n 
A 1 92  HIS 92  83  83  HIS HIS A . n 
A 1 93  THR 93  84  84  THR THR A . n 
A 1 94  PHE 94  85  85  PHE PHE A . n 
A 1 95  PHE 95  86  86  PHE PHE A . n 
A 1 96  TRP 96  87  87  TRP TRP A . n 
A 1 97  THR 97  88  88  THR THR A . n 
A 1 98  ILE 98  89  89  ILE ILE A . n 
A 1 99  LEU 99  90  90  LEU LEU A . n 
A 1 100 SER 100 91  91  SER SER A . n 
A 1 101 PRO 101 92  92  PRO PRO A . n 
A 1 102 ASN 102 93  93  ASN ASN A . n 
A 1 103 GLY 103 94  94  GLY GLY A . n 
A 1 104 GLY 104 95  95  GLY GLY A . n 
A 1 105 GLY 105 96  96  GLY GLY A . n 
A 1 106 GLN 106 97  97  GLN GLN A . n 
A 1 107 PRO 107 98  98  PRO PRO A . n 
A 1 108 VAL 108 99  99  VAL VAL A . n 
A 1 109 GLY 109 100 100 GLY GLY A . n 
A 1 110 GLU 110 101 101 GLU GLU A . n 
A 1 111 LEU 111 102 102 LEU LEU A . n 
A 1 112 ALA 112 103 103 ALA ALA A . n 
A 1 113 THR 113 104 104 THR THR A . n 
A 1 114 ALA 114 105 105 ALA ALA A . n 
A 1 115 ILE 115 106 106 ILE ILE A . n 
A 1 116 GLU 116 107 107 GLU GLU A . n 
A 1 117 ALA 117 108 108 ALA ALA A . n 
A 1 118 LYS 118 109 109 LYS LYS A . n 
A 1 119 PHE 119 110 110 PHE PHE A . n 
A 1 120 GLY 120 111 111 GLY GLY A . n 
A 1 121 SER 121 112 112 SER SER A . n 
A 1 122 PHE 122 113 113 PHE PHE A . n 
A 1 123 ASP 123 114 114 ASP ASP A . n 
A 1 124 ALA 124 115 115 ALA ALA A . n 
A 1 125 PHE 125 116 116 PHE PHE A . n 
A 1 126 LYS 126 117 117 LYS LYS A . n 
A 1 127 GLU 127 118 118 GLU GLU A . n 
A 1 128 GLU 128 119 119 GLU GLU A . n 
A 1 129 PHE 129 120 120 PHE PHE A . n 
A 1 130 ALA 130 121 121 ALA ALA A . n 
A 1 131 LYS 131 122 122 LYS LYS A . n 
A 1 132 ALA 132 123 123 ALA ALA A . n 
A 1 133 GLY 133 124 124 GLY GLY A . n 
A 1 134 ALA 134 125 125 ALA ALA A . n 
A 1 135 THR 135 126 126 THR THR A . n 
A 1 136 ARG 136 127 127 ARG ARG A . n 
A 1 137 PHE 137 128 128 PHE PHE A . n 
A 1 138 GLY 138 129 129 GLY GLY A . n 
A 1 139 SER 139 130 130 SER SER A . n 
A 1 140 GLY 140 131 131 GLY GLY A . n 
A 1 141 TRP 141 132 132 TRP TRP A . n 
A 1 142 ALA 142 133 133 ALA ALA A . n 
A 1 143 TRP 143 134 134 TRP TRP A . n 
A 1 144 LEU 144 135 135 LEU LEU A . n 
A 1 145 VAL 145 136 136 VAL VAL A . n 
A 1 146 VAL 146 137 137 VAL VAL A . n 
A 1 147 ASN 147 138 138 ASN ASN A . n 
A 1 148 ASN 148 139 139 ASN ASN A . n 
A 1 149 GLY 149 140 140 GLY GLY A . n 
A 1 150 GLU 150 141 141 GLU GLU A . n 
A 1 151 LEU 151 142 142 LEU LEU A . n 
A 1 152 GLU 152 143 143 GLU GLU A . n 
A 1 153 VAL 153 144 144 VAL VAL A . n 
A 1 154 THR 154 145 145 THR THR A . n 
A 1 155 SER 155 146 146 SER SER A . n 
A 1 156 THR 156 147 147 THR THR A . n 
A 1 157 PRO 157 148 148 PRO PRO A . n 
A 1 158 ASN 158 149 149 ASN ASN A . n 
A 1 159 GLN 159 150 150 GLN GLN A . n 
A 1 160 ASP 160 151 151 ASP ASP A . n 
A 1 161 SER 161 152 152 SER SER A . n 
A 1 162 PRO 162 153 153 PRO PRO A . n 
A 1 163 LEU 163 154 154 LEU LEU A . n 
A 1 164 THR 164 155 155 THR THR A . n 
A 1 165 GLU 165 156 156 GLU GLU A . n 
A 1 166 GLY 166 157 157 GLY GLY A . n 
A 1 167 LYS 167 158 158 LYS LYS A . n 
A 1 168 THR 168 159 159 THR THR A . n 
A 1 169 PRO 169 160 160 PRO PRO A . n 
A 1 170 VAL 170 161 161 VAL VAL A . n 
A 1 171 ILE 171 162 162 ILE ILE A . n 
A 1 172 GLY 172 163 163 GLY GLY A . n 
A 1 173 LEU 173 164 164 LEU LEU A . n 
A 1 174 ASP 174 165 165 ASP ASP A . n 
A 1 175 VAL 175 166 166 VAL VAL A . n 
A 1 176 TRP 176 167 167 TRP TRP A . n 
A 1 177 GLU 177 168 168 GLU GLU A . n 
A 1 178 HIS 178 169 169 HIS HIS A . n 
A 1 179 ALA 179 170 170 ALA ALA A . n 
A 1 180 TYR 180 171 171 TYR TYR A . n 
A 1 181 TYR 181 172 172 TYR TYR A . n 
A 1 182 LEU 182 173 173 LEU LEU A . n 
A 1 183 ASN 183 174 174 ASN ASN A . n 
A 1 184 TYR 184 175 175 TYR TYR A . n 
A 1 185 GLN 185 176 176 GLN GLN A . n 
A 1 186 ASN 186 177 177 ASN ASN A . n 
A 1 187 ARG 187 178 178 ARG ARG A . n 
A 1 188 ARG 188 179 179 ARG ARG A . n 
A 1 189 PRO 189 180 180 PRO PRO A . n 
A 1 190 ASP 190 181 181 ASP ASP A . n 
A 1 191 TYR 191 182 182 TYR TYR A . n 
A 1 192 ILE 192 183 183 ILE ILE A . n 
A 1 193 GLY 193 184 184 GLY GLY A . n 
A 1 194 ALA 194 185 185 ALA ALA A . n 
A 1 195 PHE 195 186 186 PHE PHE A . n 
A 1 196 TRP 196 187 187 TRP TRP A . n 
A 1 197 ASN 197 188 188 ASN ASN A . n 
A 1 198 VAL 198 189 189 VAL VAL A . n 
A 1 199 VAL 199 190 190 VAL VAL A . n 
A 1 200 ASP 200 191 191 ASP ASP A . n 
A 1 201 TRP 201 192 192 TRP TRP A . n 
A 1 202 ASN 202 193 193 ASN ASN A . n 
A 1 203 ALA 203 194 194 ALA ALA A . n 
A 1 204 ALA 204 195 195 ALA ALA A . n 
A 1 205 GLU 205 196 196 GLU GLU A . n 
A 1 206 LYS 206 197 197 LYS LYS A . n 
A 1 207 ARG 207 198 198 ARG ARG A . n 
A 1 208 TYR 208 199 199 TYR TYR A . n 
A 1 209 GLN 209 200 200 GLN GLN A . n 
A 1 210 GLU 210 201 201 GLU GLU A . n 
A 1 211 ALA 211 202 202 ALA ALA A . n 
A 1 212 LYS 212 203 ?   ?   ?   A . n 
B 1 1   GLY 1   -8  ?   ?   ?   B . n 
B 1 2   SER 2   -7  ?   ?   ?   B . n 
B 1 3   SER 3   -6  ?   ?   ?   B . n 
B 1 4   HIS 4   -5  ?   ?   ?   B . n 
B 1 5   HIS 5   -4  ?   ?   ?   B . n 
B 1 6   HIS 6   -3  ?   ?   ?   B . n 
B 1 7   HIS 7   -2  ?   ?   ?   B . n 
B 1 8   HIS 8   -1  ?   ?   ?   B . n 
B 1 9   HIS 9   0   ?   ?   ?   B . n 
B 1 10  MET 10  1   ?   ?   ?   B . n 
B 1 11  ALA 11  2   ?   ?   ?   B . n 
B 1 12  LYS 12  3   3   LYS LYS B . n 
B 1 13  HIS 13  4   4   HIS HIS B . n 
B 1 14  GLU 14  5   5   GLU GLU B . n 
B 1 15  LEU 15  6   6   LEU LEU B . n 
B 1 16  PRO 16  7   7   PRO PRO B . n 
B 1 17  ASN 17  8   8   ASN ASN B . n 
B 1 18  LEU 18  9   9   LEU LEU B . n 
B 1 19  PRO 19  10  10  PRO PRO B . n 
B 1 20  TYR 20  11  11  TYR TYR B . n 
B 1 21  ALA 21  12  12  ALA ALA B . n 
B 1 22  TYR 22  13  13  TYR TYR B . n 
B 1 23  ASP 23  14  14  ASP ASP B . n 
B 1 24  ALA 24  15  15  ALA ALA B . n 
B 1 25  LEU 25  16  16  LEU LEU B . n 
B 1 26  GLU 26  17  17  GLU GLU B . n 
B 1 27  PRO 27  18  18  PRO PRO B . n 
B 1 28  HIS 28  19  19  HIS HIS B . n 
B 1 29  PHE 29  20  20  PHE PHE B . n 
B 1 30  ASP 30  21  21  ASP ASP B . n 
B 1 31  LYS 31  22  22  LYS LYS B . n 
B 1 32  GLU 32  23  23  GLU GLU B . n 
B 1 33  THR 33  24  24  THR THR B . n 
B 1 34  MET 34  25  25  MET MET B . n 
B 1 35  ASN 35  26  26  ASN ASN B . n 
B 1 36  ILE 36  27  27  ILE ILE B . n 
B 1 37  HIS 37  28  28  HIS HIS B . n 
B 1 38  HIS 38  29  29  HIS HIS B . n 
B 1 39  THR 39  30  30  THR THR B . n 
B 1 40  LYS 40  31  31  LYS LYS B . n 
B 1 41  HIS 41  32  32  HIS HIS B . n 
B 1 42  HIS 42  33  33  HIS HIS B . n 
B 1 43  ASN 43  34  34  ASN ASN B . n 
B 1 44  THR 44  35  35  THR THR B . n 
B 1 45  TYR 45  36  36  TYR TYR B . n 
B 1 46  ILE 46  37  37  ILE ILE B . n 
B 1 47  THR 47  38  38  THR THR B . n 
B 1 48  ASN 48  39  39  ASN ASN B . n 
B 1 49  LEU 49  40  40  LEU LEU B . n 
B 1 50  ASN 50  41  41  ASN ASN B . n 
B 1 51  ALA 51  42  42  ALA ALA B . n 
B 1 52  ALA 52  43  43  ALA ALA B . n 
B 1 53  LEU 53  44  44  LEU LEU B . n 
B 1 54  GLU 54  45  45  GLU GLU B . n 
B 1 55  GLY 55  46  46  GLY GLY B . n 
B 1 56  HIS 56  47  47  HIS HIS B . n 
B 1 57  ALA 57  48  48  ALA ALA B . n 
B 1 58  GLU 58  49  49  GLU GLU B . n 
B 1 59  LEU 59  50  50  LEU LEU B . n 
B 1 60  ALA 60  51  51  ALA ALA B . n 
B 1 61  ASP 61  52  52  ASP ASP B . n 
B 1 62  LYS 62  53  53  LYS LYS B . n 
B 1 63  SER 63  54  54  SER SER B . n 
B 1 64  VAL 64  55  55  VAL VAL B . n 
B 1 65  GLU 65  56  56  GLU GLU B . n 
B 1 66  GLU 66  57  57  GLU GLU B . n 
B 1 67  LEU 67  58  58  LEU LEU B . n 
B 1 68  VAL 68  59  59  VAL VAL B . n 
B 1 69  ALA 69  60  60  ALA ALA B . n 
B 1 70  ASN 70  61  61  ASN ASN B . n 
B 1 71  LEU 71  62  62  LEU LEU B . n 
B 1 72  ASN 72  63  63  ASN ASN B . n 
B 1 73  GLU 73  64  64  GLU GLU B . n 
B 1 74  VAL 74  65  65  VAL VAL B . n 
B 1 75  PRO 75  66  66  PRO PRO B . n 
B 1 76  GLU 76  67  67  GLU GLU B . n 
B 1 77  ALA 77  68  68  ALA ALA B . n 
B 1 78  ILE 78  69  69  ILE ILE B . n 
B 1 79  ARG 79  70  70  ARG ARG B . n 
B 1 80  THR 80  71  71  THR THR B . n 
B 1 81  ALA 81  72  72  ALA ALA B . n 
B 1 82  VAL 82  73  73  VAL VAL B . n 
B 1 83  ARG 83  74  74  ARG ARG B . n 
B 1 84  ASN 84  75  75  ASN ASN B . n 
B 1 85  ASN 85  76  76  ASN ASN B . n 
B 1 86  GLY 86  77  77  GLY GLY B . n 
B 1 87  GLY 87  78  78  GLY GLY B . n 
B 1 88  GLY 88  79  79  GLY GLY B . n 
B 1 89  HIS 89  80  80  HIS HIS B . n 
B 1 90  ALA 90  81  81  ALA ALA B . n 
B 1 91  ASN 91  82  82  ASN ASN B . n 
B 1 92  HIS 92  83  83  HIS HIS B . n 
B 1 93  THR 93  84  84  THR THR B . n 
B 1 94  PHE 94  85  85  PHE PHE B . n 
B 1 95  PHE 95  86  86  PHE PHE B . n 
B 1 96  TRP 96  87  87  TRP TRP B . n 
B 1 97  THR 97  88  88  THR THR B . n 
B 1 98  ILE 98  89  89  ILE ILE B . n 
B 1 99  LEU 99  90  90  LEU LEU B . n 
B 1 100 SER 100 91  91  SER SER B . n 
B 1 101 PRO 101 92  92  PRO PRO B . n 
B 1 102 ASN 102 93  93  ASN ASN B . n 
B 1 103 GLY 103 94  94  GLY GLY B . n 
B 1 104 GLY 104 95  95  GLY GLY B . n 
B 1 105 GLY 105 96  96  GLY GLY B . n 
B 1 106 GLN 106 97  97  GLN GLN B . n 
B 1 107 PRO 107 98  98  PRO PRO B . n 
B 1 108 VAL 108 99  99  VAL VAL B . n 
B 1 109 GLY 109 100 100 GLY GLY B . n 
B 1 110 GLU 110 101 101 GLU GLU B . n 
B 1 111 LEU 111 102 102 LEU LEU B . n 
B 1 112 ALA 112 103 103 ALA ALA B . n 
B 1 113 THR 113 104 104 THR THR B . n 
B 1 114 ALA 114 105 105 ALA ALA B . n 
B 1 115 ILE 115 106 106 ILE ILE B . n 
B 1 116 GLU 116 107 107 GLU GLU B . n 
B 1 117 ALA 117 108 108 ALA ALA B . n 
B 1 118 LYS 118 109 109 LYS LYS B . n 
B 1 119 PHE 119 110 110 PHE PHE B . n 
B 1 120 GLY 120 111 111 GLY GLY B . n 
B 1 121 SER 121 112 112 SER SER B . n 
B 1 122 PHE 122 113 113 PHE PHE B . n 
B 1 123 ASP 123 114 114 ASP ASP B . n 
B 1 124 ALA 124 115 115 ALA ALA B . n 
B 1 125 PHE 125 116 116 PHE PHE B . n 
B 1 126 LYS 126 117 117 LYS LYS B . n 
B 1 127 GLU 127 118 118 GLU GLU B . n 
B 1 128 GLU 128 119 119 GLU GLU B . n 
B 1 129 PHE 129 120 120 PHE PHE B . n 
B 1 130 ALA 130 121 121 ALA ALA B . n 
B 1 131 LYS 131 122 122 LYS LYS B . n 
B 1 132 ALA 132 123 123 ALA ALA B . n 
B 1 133 GLY 133 124 124 GLY GLY B . n 
B 1 134 ALA 134 125 125 ALA ALA B . n 
B 1 135 THR 135 126 126 THR THR B . n 
B 1 136 ARG 136 127 127 ARG ARG B . n 
B 1 137 PHE 137 128 128 PHE PHE B . n 
B 1 138 GLY 138 129 129 GLY GLY B . n 
B 1 139 SER 139 130 130 SER SER B . n 
B 1 140 GLY 140 131 131 GLY GLY B . n 
B 1 141 TRP 141 132 132 TRP TRP B . n 
B 1 142 ALA 142 133 133 ALA ALA B . n 
B 1 143 TRP 143 134 134 TRP TRP B . n 
B 1 144 LEU 144 135 135 LEU LEU B . n 
B 1 145 VAL 145 136 136 VAL VAL B . n 
B 1 146 VAL 146 137 137 VAL VAL B . n 
B 1 147 ASN 147 138 138 ASN ASN B . n 
B 1 148 ASN 148 139 139 ASN ASN B . n 
B 1 149 GLY 149 140 140 GLY GLY B . n 
B 1 150 GLU 150 141 141 GLU GLU B . n 
B 1 151 LEU 151 142 142 LEU LEU B . n 
B 1 152 GLU 152 143 143 GLU GLU B . n 
B 1 153 VAL 153 144 144 VAL VAL B . n 
B 1 154 THR 154 145 145 THR THR B . n 
B 1 155 SER 155 146 146 SER SER B . n 
B 1 156 THR 156 147 147 THR THR B . n 
B 1 157 PRO 157 148 148 PRO PRO B . n 
B 1 158 ASN 158 149 149 ASN ASN B . n 
B 1 159 GLN 159 150 150 GLN GLN B . n 
B 1 160 ASP 160 151 151 ASP ASP B . n 
B 1 161 SER 161 152 152 SER SER B . n 
B 1 162 PRO 162 153 153 PRO PRO B . n 
B 1 163 LEU 163 154 154 LEU LEU B . n 
B 1 164 THR 164 155 155 THR THR B . n 
B 1 165 GLU 165 156 156 GLU GLU B . n 
B 1 166 GLY 166 157 157 GLY GLY B . n 
B 1 167 LYS 167 158 158 LYS LYS B . n 
B 1 168 THR 168 159 159 THR THR B . n 
B 1 169 PRO 169 160 160 PRO PRO B . n 
B 1 170 VAL 170 161 161 VAL VAL B . n 
B 1 171 ILE 171 162 162 ILE ILE B . n 
B 1 172 GLY 172 163 163 GLY GLY B . n 
B 1 173 LEU 173 164 164 LEU LEU B . n 
B 1 174 ASP 174 165 165 ASP ASP B . n 
B 1 175 VAL 175 166 166 VAL VAL B . n 
B 1 176 TRP 176 167 167 TRP TRP B . n 
B 1 177 GLU 177 168 168 GLU GLU B . n 
B 1 178 HIS 178 169 169 HIS HIS B . n 
B 1 179 ALA 179 170 170 ALA ALA B . n 
B 1 180 TYR 180 171 171 TYR TYR B . n 
B 1 181 TYR 181 172 172 TYR TYR B . n 
B 1 182 LEU 182 173 173 LEU LEU B . n 
B 1 183 ASN 183 174 174 ASN ASN B . n 
B 1 184 TYR 184 175 175 TYR TYR B . n 
B 1 185 GLN 185 176 176 GLN GLN B . n 
B 1 186 ASN 186 177 177 ASN ASN B . n 
B 1 187 ARG 187 178 178 ARG ARG B . n 
B 1 188 ARG 188 179 179 ARG ARG B . n 
B 1 189 PRO 189 180 180 PRO PRO B . n 
B 1 190 ASP 190 181 181 ASP ASP B . n 
B 1 191 TYR 191 182 182 TYR TYR B . n 
B 1 192 ILE 192 183 183 ILE ILE B . n 
B 1 193 GLY 193 184 184 GLY GLY B . n 
B 1 194 ALA 194 185 185 ALA ALA B . n 
B 1 195 PHE 195 186 186 PHE PHE B . n 
B 1 196 TRP 196 187 187 TRP TRP B . n 
B 1 197 ASN 197 188 188 ASN ASN B . n 
B 1 198 VAL 198 189 189 VAL VAL B . n 
B 1 199 VAL 199 190 190 VAL VAL B . n 
B 1 200 ASP 200 191 191 ASP ASP B . n 
B 1 201 TRP 201 192 192 TRP TRP B . n 
B 1 202 ASN 202 193 193 ASN ASN B . n 
B 1 203 ALA 203 194 194 ALA ALA B . n 
B 1 204 ALA 204 195 195 ALA ALA B . n 
B 1 205 GLU 205 196 196 GLU GLU B . n 
B 1 206 LYS 206 197 197 LYS LYS B . n 
B 1 207 ARG 207 198 198 ARG ARG B . n 
B 1 208 TYR 208 199 199 TYR TYR B . n 
B 1 209 GLN 209 200 200 GLN GLN B . n 
B 1 210 GLU 210 201 201 GLU GLU B . n 
B 1 211 ALA 211 202 202 ALA ALA B . n 
B 1 212 LYS 212 203 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   204 2   MN  MN  A . 
D 2 MN  1   204 1   MN  MN  B . 
E 3 HOH 1   205 1   HOH HOH A . 
E 3 HOH 2   206 2   HOH HOH A . 
E 3 HOH 3   207 5   HOH HOH A . 
E 3 HOH 4   208 6   HOH HOH A . 
E 3 HOH 5   209 7   HOH HOH A . 
E 3 HOH 6   210 8   HOH HOH A . 
E 3 HOH 7   211 9   HOH HOH A . 
E 3 HOH 8   212 11  HOH HOH A . 
E 3 HOH 9   213 12  HOH HOH A . 
E 3 HOH 10  214 13  HOH HOH A . 
E 3 HOH 11  215 14  HOH HOH A . 
E 3 HOH 12  216 15  HOH HOH A . 
E 3 HOH 13  217 16  HOH HOH A . 
E 3 HOH 14  218 17  HOH HOH A . 
E 3 HOH 15  219 19  HOH HOH A . 
E 3 HOH 16  220 20  HOH HOH A . 
E 3 HOH 17  221 22  HOH HOH A . 
E 3 HOH 18  222 23  HOH HOH A . 
E 3 HOH 19  223 26  HOH HOH A . 
E 3 HOH 20  224 28  HOH HOH A . 
E 3 HOH 21  225 29  HOH HOH A . 
E 3 HOH 22  226 30  HOH HOH A . 
E 3 HOH 23  227 31  HOH HOH A . 
E 3 HOH 24  228 32  HOH HOH A . 
E 3 HOH 25  229 33  HOH HOH A . 
E 3 HOH 26  230 34  HOH HOH A . 
E 3 HOH 27  231 36  HOH HOH A . 
E 3 HOH 28  232 37  HOH HOH A . 
E 3 HOH 29  233 38  HOH HOH A . 
E 3 HOH 30  234 40  HOH HOH A . 
E 3 HOH 31  235 43  HOH HOH A . 
E 3 HOH 32  236 45  HOH HOH A . 
E 3 HOH 33  237 47  HOH HOH A . 
E 3 HOH 34  238 49  HOH HOH A . 
E 3 HOH 35  239 52  HOH HOH A . 
E 3 HOH 36  240 54  HOH HOH A . 
E 3 HOH 37  241 56  HOH HOH A . 
E 3 HOH 38  242 57  HOH HOH A . 
E 3 HOH 39  243 58  HOH HOH A . 
E 3 HOH 40  244 61  HOH HOH A . 
E 3 HOH 41  245 62  HOH HOH A . 
E 3 HOH 42  246 63  HOH HOH A . 
E 3 HOH 43  247 64  HOH HOH A . 
E 3 HOH 44  248 65  HOH HOH A . 
E 3 HOH 45  249 66  HOH HOH A . 
E 3 HOH 46  250 68  HOH HOH A . 
E 3 HOH 47  251 69  HOH HOH A . 
E 3 HOH 48  252 70  HOH HOH A . 
E 3 HOH 49  253 71  HOH HOH A . 
E 3 HOH 50  254 72  HOH HOH A . 
E 3 HOH 51  255 75  HOH HOH A . 
E 3 HOH 52  256 76  HOH HOH A . 
E 3 HOH 53  257 77  HOH HOH A . 
E 3 HOH 54  258 78  HOH HOH A . 
E 3 HOH 55  259 80  HOH HOH A . 
E 3 HOH 56  260 81  HOH HOH A . 
E 3 HOH 57  261 85  HOH HOH A . 
E 3 HOH 58  262 86  HOH HOH A . 
E 3 HOH 59  263 88  HOH HOH A . 
E 3 HOH 60  264 89  HOH HOH A . 
E 3 HOH 61  265 90  HOH HOH A . 
E 3 HOH 62  266 91  HOH HOH A . 
E 3 HOH 63  267 93  HOH HOH A . 
E 3 HOH 64  268 94  HOH HOH A . 
E 3 HOH 65  269 96  HOH HOH A . 
E 3 HOH 66  270 102 HOH HOH A . 
E 3 HOH 67  271 105 HOH HOH A . 
E 3 HOH 68  272 106 HOH HOH A . 
E 3 HOH 69  273 107 HOH HOH A . 
E 3 HOH 70  274 110 HOH HOH A . 
E 3 HOH 71  275 112 HOH HOH A . 
E 3 HOH 72  276 113 HOH HOH A . 
E 3 HOH 73  277 116 HOH HOH A . 
E 3 HOH 74  278 118 HOH HOH A . 
E 3 HOH 75  279 120 HOH HOH A . 
E 3 HOH 76  280 123 HOH HOH A . 
E 3 HOH 77  281 124 HOH HOH A . 
E 3 HOH 78  282 125 HOH HOH A . 
E 3 HOH 79  283 130 HOH HOH A . 
E 3 HOH 80  284 131 HOH HOH A . 
E 3 HOH 81  285 135 HOH HOH A . 
E 3 HOH 82  286 136 HOH HOH A . 
E 3 HOH 83  287 137 HOH HOH A . 
E 3 HOH 84  288 138 HOH HOH A . 
E 3 HOH 85  289 139 HOH HOH A . 
E 3 HOH 86  290 142 HOH HOH A . 
E 3 HOH 87  291 143 HOH HOH A . 
E 3 HOH 88  292 144 HOH HOH A . 
E 3 HOH 89  293 145 HOH HOH A . 
E 3 HOH 90  294 146 HOH HOH A . 
E 3 HOH 91  295 147 HOH HOH A . 
E 3 HOH 92  296 149 HOH HOH A . 
E 3 HOH 93  297 154 HOH HOH A . 
E 3 HOH 94  298 155 HOH HOH A . 
E 3 HOH 95  299 156 HOH HOH A . 
E 3 HOH 96  300 157 HOH HOH A . 
E 3 HOH 97  301 160 HOH HOH A . 
E 3 HOH 98  302 161 HOH HOH A . 
E 3 HOH 99  303 162 HOH HOH A . 
E 3 HOH 100 304 163 HOH HOH A . 
E 3 HOH 101 305 165 HOH HOH A . 
E 3 HOH 102 306 166 HOH HOH A . 
E 3 HOH 103 307 167 HOH HOH A . 
E 3 HOH 104 308 168 HOH HOH A . 
E 3 HOH 105 309 169 HOH HOH A . 
E 3 HOH 106 310 170 HOH HOH A . 
E 3 HOH 107 311 173 HOH HOH A . 
E 3 HOH 108 312 174 HOH HOH A . 
E 3 HOH 109 313 176 HOH HOH A . 
E 3 HOH 110 314 179 HOH HOH A . 
E 3 HOH 111 315 181 HOH HOH A . 
E 3 HOH 112 316 182 HOH HOH A . 
E 3 HOH 113 317 183 HOH HOH A . 
E 3 HOH 114 318 187 HOH HOH A . 
E 3 HOH 115 319 188 HOH HOH A . 
E 3 HOH 116 320 190 HOH HOH A . 
E 3 HOH 117 321 191 HOH HOH A . 
E 3 HOH 118 322 192 HOH HOH A . 
E 3 HOH 119 323 193 HOH HOH A . 
E 3 HOH 120 324 195 HOH HOH A . 
E 3 HOH 121 325 196 HOH HOH A . 
E 3 HOH 122 326 197 HOH HOH A . 
E 3 HOH 123 327 201 HOH HOH A . 
E 3 HOH 124 328 203 HOH HOH A . 
E 3 HOH 125 329 204 HOH HOH A . 
E 3 HOH 126 330 205 HOH HOH A . 
E 3 HOH 127 331 206 HOH HOH A . 
E 3 HOH 128 332 208 HOH HOH A . 
E 3 HOH 129 333 210 HOH HOH A . 
E 3 HOH 130 334 214 HOH HOH A . 
E 3 HOH 131 335 219 HOH HOH A . 
E 3 HOH 132 336 222 HOH HOH A . 
E 3 HOH 133 337 223 HOH HOH A . 
E 3 HOH 134 338 224 HOH HOH A . 
E 3 HOH 135 339 226 HOH HOH A . 
E 3 HOH 136 340 227 HOH HOH A . 
E 3 HOH 137 341 230 HOH HOH A . 
E 3 HOH 138 342 235 HOH HOH A . 
E 3 HOH 139 343 236 HOH HOH A . 
E 3 HOH 140 344 237 HOH HOH A . 
E 3 HOH 141 345 238 HOH HOH A . 
E 3 HOH 142 346 239 HOH HOH A . 
E 3 HOH 143 347 240 HOH HOH A . 
E 3 HOH 144 348 241 HOH HOH A . 
E 3 HOH 145 349 242 HOH HOH A . 
E 3 HOH 146 350 243 HOH HOH A . 
E 3 HOH 147 351 244 HOH HOH A . 
E 3 HOH 148 352 245 HOH HOH A . 
E 3 HOH 149 353 247 HOH HOH A . 
E 3 HOH 150 354 249 HOH HOH A . 
E 3 HOH 151 355 251 HOH HOH A . 
E 3 HOH 152 356 254 HOH HOH A . 
E 3 HOH 153 357 257 HOH HOH A . 
E 3 HOH 154 358 260 HOH HOH A . 
E 3 HOH 155 359 261 HOH HOH A . 
E 3 HOH 156 360 262 HOH HOH A . 
E 3 HOH 157 361 263 HOH HOH A . 
E 3 HOH 158 362 265 HOH HOH A . 
E 3 HOH 159 363 266 HOH HOH A . 
E 3 HOH 160 364 267 HOH HOH A . 
E 3 HOH 161 365 270 HOH HOH A . 
E 3 HOH 162 366 273 HOH HOH A . 
E 3 HOH 163 367 275 HOH HOH A . 
E 3 HOH 164 368 276 HOH HOH A . 
E 3 HOH 165 369 277 HOH HOH A . 
E 3 HOH 166 370 278 HOH HOH A . 
E 3 HOH 167 371 285 HOH HOH A . 
E 3 HOH 168 372 287 HOH HOH A . 
E 3 HOH 169 373 295 HOH HOH A . 
E 3 HOH 170 374 298 HOH HOH A . 
E 3 HOH 171 375 299 HOH HOH A . 
E 3 HOH 172 376 303 HOH HOH A . 
E 3 HOH 173 377 304 HOH HOH A . 
E 3 HOH 174 378 305 HOH HOH A . 
E 3 HOH 175 379 306 HOH HOH A . 
E 3 HOH 176 380 307 HOH HOH A . 
E 3 HOH 177 381 308 HOH HOH A . 
E 3 HOH 178 382 313 HOH HOH A . 
E 3 HOH 179 383 314 HOH HOH A . 
E 3 HOH 180 384 320 HOH HOH A . 
E 3 HOH 181 385 322 HOH HOH A . 
E 3 HOH 182 386 323 HOH HOH A . 
E 3 HOH 183 387 324 HOH HOH A . 
E 3 HOH 184 388 326 HOH HOH A . 
E 3 HOH 185 389 327 HOH HOH A . 
E 3 HOH 186 390 328 HOH HOH A . 
E 3 HOH 187 391 329 HOH HOH A . 
E 3 HOH 188 392 330 HOH HOH A . 
E 3 HOH 189 393 331 HOH HOH A . 
E 3 HOH 190 394 332 HOH HOH A . 
E 3 HOH 191 395 334 HOH HOH A . 
E 3 HOH 192 396 335 HOH HOH A . 
E 3 HOH 193 397 336 HOH HOH A . 
E 3 HOH 194 398 337 HOH HOH A . 
E 3 HOH 195 399 338 HOH HOH A . 
E 3 HOH 196 400 341 HOH HOH A . 
E 3 HOH 197 401 342 HOH HOH A . 
E 3 HOH 198 402 345 HOH HOH A . 
E 3 HOH 199 403 346 HOH HOH A . 
E 3 HOH 200 404 347 HOH HOH A . 
E 3 HOH 201 405 348 HOH HOH A . 
E 3 HOH 202 406 349 HOH HOH A . 
E 3 HOH 203 407 350 HOH HOH A . 
E 3 HOH 204 408 352 HOH HOH A . 
E 3 HOH 205 409 354 HOH HOH A . 
E 3 HOH 206 410 355 HOH HOH A . 
E 3 HOH 207 411 359 HOH HOH A . 
E 3 HOH 208 412 360 HOH HOH A . 
E 3 HOH 209 413 361 HOH HOH A . 
E 3 HOH 210 414 362 HOH HOH A . 
E 3 HOH 211 415 363 HOH HOH A . 
E 3 HOH 212 416 364 HOH HOH A . 
E 3 HOH 213 417 365 HOH HOH A . 
E 3 HOH 214 418 366 HOH HOH A . 
E 3 HOH 215 419 367 HOH HOH A . 
E 3 HOH 216 420 368 HOH HOH A . 
E 3 HOH 217 421 369 HOH HOH A . 
E 3 HOH 218 422 370 HOH HOH A . 
E 3 HOH 219 423 371 HOH HOH A . 
E 3 HOH 220 424 372 HOH HOH A . 
E 3 HOH 221 425 373 HOH HOH A . 
E 3 HOH 222 426 376 HOH HOH A . 
E 3 HOH 223 427 378 HOH HOH A . 
E 3 HOH 224 428 379 HOH HOH A . 
E 3 HOH 225 429 381 HOH HOH A . 
E 3 HOH 226 430 383 HOH HOH A . 
E 3 HOH 227 431 384 HOH HOH A . 
E 3 HOH 228 432 386 HOH HOH A . 
E 3 HOH 229 433 388 HOH HOH A . 
E 3 HOH 230 434 390 HOH HOH A . 
E 3 HOH 231 435 391 HOH HOH A . 
E 3 HOH 232 436 392 HOH HOH A . 
E 3 HOH 233 437 393 HOH HOH A . 
E 3 HOH 234 438 395 HOH HOH A . 
E 3 HOH 235 439 398 HOH HOH A . 
E 3 HOH 236 440 401 HOH HOH A . 
E 3 HOH 237 441 403 HOH HOH A . 
E 3 HOH 238 442 408 HOH HOH A . 
E 3 HOH 239 443 409 HOH HOH A . 
E 3 HOH 240 444 410 HOH HOH A . 
E 3 HOH 241 445 411 HOH HOH A . 
E 3 HOH 242 446 412 HOH HOH A . 
E 3 HOH 243 447 413 HOH HOH A . 
E 3 HOH 244 448 415 HOH HOH A . 
E 3 HOH 245 449 418 HOH HOH A . 
E 3 HOH 246 450 421 HOH HOH A . 
E 3 HOH 247 451 423 HOH HOH A . 
E 3 HOH 248 452 424 HOH HOH A . 
E 3 HOH 249 453 429 HOH HOH A . 
E 3 HOH 250 454 431 HOH HOH A . 
E 3 HOH 251 455 436 HOH HOH A . 
E 3 HOH 252 456 437 HOH HOH A . 
E 3 HOH 253 457 438 HOH HOH A . 
E 3 HOH 254 458 444 HOH HOH A . 
E 3 HOH 255 459 446 HOH HOH A . 
E 3 HOH 256 460 449 HOH HOH A . 
E 3 HOH 257 461 450 HOH HOH A . 
E 3 HOH 258 462 451 HOH HOH A . 
E 3 HOH 259 463 452 HOH HOH A . 
E 3 HOH 260 464 453 HOH HOH A . 
E 3 HOH 261 465 454 HOH HOH A . 
E 3 HOH 262 466 457 HOH HOH A . 
E 3 HOH 263 467 458 HOH HOH A . 
E 3 HOH 264 468 459 HOH HOH A . 
E 3 HOH 265 469 468 HOH HOH A . 
E 3 HOH 266 470 470 HOH HOH A . 
E 3 HOH 267 471 471 HOH HOH A . 
E 3 HOH 268 472 472 HOH HOH A . 
E 3 HOH 269 473 473 HOH HOH A . 
E 3 HOH 270 474 475 HOH HOH A . 
F 3 HOH 1   205 3   HOH HOH B . 
F 3 HOH 2   206 4   HOH HOH B . 
F 3 HOH 3   207 10  HOH HOH B . 
F 3 HOH 4   208 18  HOH HOH B . 
F 3 HOH 5   209 21  HOH HOH B . 
F 3 HOH 6   210 24  HOH HOH B . 
F 3 HOH 7   211 25  HOH HOH B . 
F 3 HOH 8   212 27  HOH HOH B . 
F 3 HOH 9   213 35  HOH HOH B . 
F 3 HOH 10  214 39  HOH HOH B . 
F 3 HOH 11  215 41  HOH HOH B . 
F 3 HOH 12  216 42  HOH HOH B . 
F 3 HOH 13  217 44  HOH HOH B . 
F 3 HOH 14  218 46  HOH HOH B . 
F 3 HOH 15  219 48  HOH HOH B . 
F 3 HOH 16  220 50  HOH HOH B . 
F 3 HOH 17  221 51  HOH HOH B . 
F 3 HOH 18  222 53  HOH HOH B . 
F 3 HOH 19  223 55  HOH HOH B . 
F 3 HOH 20  224 59  HOH HOH B . 
F 3 HOH 21  225 60  HOH HOH B . 
F 3 HOH 22  226 67  HOH HOH B . 
F 3 HOH 23  227 73  HOH HOH B . 
F 3 HOH 24  228 74  HOH HOH B . 
F 3 HOH 25  229 79  HOH HOH B . 
F 3 HOH 26  230 82  HOH HOH B . 
F 3 HOH 27  231 83  HOH HOH B . 
F 3 HOH 28  232 84  HOH HOH B . 
F 3 HOH 29  233 87  HOH HOH B . 
F 3 HOH 30  234 92  HOH HOH B . 
F 3 HOH 31  235 95  HOH HOH B . 
F 3 HOH 32  236 97  HOH HOH B . 
F 3 HOH 33  237 98  HOH HOH B . 
F 3 HOH 34  238 99  HOH HOH B . 
F 3 HOH 35  239 100 HOH HOH B . 
F 3 HOH 36  240 101 HOH HOH B . 
F 3 HOH 37  241 103 HOH HOH B . 
F 3 HOH 38  242 104 HOH HOH B . 
F 3 HOH 39  243 108 HOH HOH B . 
F 3 HOH 40  244 109 HOH HOH B . 
F 3 HOH 41  245 111 HOH HOH B . 
F 3 HOH 42  246 114 HOH HOH B . 
F 3 HOH 43  247 115 HOH HOH B . 
F 3 HOH 44  248 117 HOH HOH B . 
F 3 HOH 45  249 119 HOH HOH B . 
F 3 HOH 46  250 121 HOH HOH B . 
F 3 HOH 47  251 122 HOH HOH B . 
F 3 HOH 48  252 126 HOH HOH B . 
F 3 HOH 49  253 127 HOH HOH B . 
F 3 HOH 50  254 128 HOH HOH B . 
F 3 HOH 51  255 129 HOH HOH B . 
F 3 HOH 52  256 132 HOH HOH B . 
F 3 HOH 53  257 133 HOH HOH B . 
F 3 HOH 54  258 134 HOH HOH B . 
F 3 HOH 55  259 140 HOH HOH B . 
F 3 HOH 56  260 141 HOH HOH B . 
F 3 HOH 57  261 148 HOH HOH B . 
F 3 HOH 58  262 150 HOH HOH B . 
F 3 HOH 59  263 151 HOH HOH B . 
F 3 HOH 60  264 152 HOH HOH B . 
F 3 HOH 61  265 153 HOH HOH B . 
F 3 HOH 62  266 158 HOH HOH B . 
F 3 HOH 63  267 159 HOH HOH B . 
F 3 HOH 64  268 164 HOH HOH B . 
F 3 HOH 65  269 171 HOH HOH B . 
F 3 HOH 66  270 172 HOH HOH B . 
F 3 HOH 67  271 175 HOH HOH B . 
F 3 HOH 68  272 177 HOH HOH B . 
F 3 HOH 69  273 178 HOH HOH B . 
F 3 HOH 70  274 180 HOH HOH B . 
F 3 HOH 71  275 184 HOH HOH B . 
F 3 HOH 72  276 185 HOH HOH B . 
F 3 HOH 73  277 186 HOH HOH B . 
F 3 HOH 74  278 189 HOH HOH B . 
F 3 HOH 75  279 194 HOH HOH B . 
F 3 HOH 76  280 198 HOH HOH B . 
F 3 HOH 77  281 199 HOH HOH B . 
F 3 HOH 78  282 200 HOH HOH B . 
F 3 HOH 79  283 202 HOH HOH B . 
F 3 HOH 80  284 207 HOH HOH B . 
F 3 HOH 81  285 209 HOH HOH B . 
F 3 HOH 82  286 211 HOH HOH B . 
F 3 HOH 83  287 212 HOH HOH B . 
F 3 HOH 84  288 213 HOH HOH B . 
F 3 HOH 85  289 215 HOH HOH B . 
F 3 HOH 86  290 216 HOH HOH B . 
F 3 HOH 87  291 217 HOH HOH B . 
F 3 HOH 88  292 218 HOH HOH B . 
F 3 HOH 89  293 220 HOH HOH B . 
F 3 HOH 90  294 221 HOH HOH B . 
F 3 HOH 91  295 225 HOH HOH B . 
F 3 HOH 92  296 228 HOH HOH B . 
F 3 HOH 93  297 229 HOH HOH B . 
F 3 HOH 94  298 231 HOH HOH B . 
F 3 HOH 95  299 232 HOH HOH B . 
F 3 HOH 96  300 233 HOH HOH B . 
F 3 HOH 97  301 234 HOH HOH B . 
F 3 HOH 98  302 246 HOH HOH B . 
F 3 HOH 99  303 248 HOH HOH B . 
F 3 HOH 100 304 250 HOH HOH B . 
F 3 HOH 101 305 252 HOH HOH B . 
F 3 HOH 102 306 253 HOH HOH B . 
F 3 HOH 103 307 255 HOH HOH B . 
F 3 HOH 104 308 256 HOH HOH B . 
F 3 HOH 105 309 258 HOH HOH B . 
F 3 HOH 106 310 259 HOH HOH B . 
F 3 HOH 107 311 264 HOH HOH B . 
F 3 HOH 108 312 268 HOH HOH B . 
F 3 HOH 109 313 269 HOH HOH B . 
F 3 HOH 110 314 271 HOH HOH B . 
F 3 HOH 111 315 272 HOH HOH B . 
F 3 HOH 112 316 274 HOH HOH B . 
F 3 HOH 113 317 279 HOH HOH B . 
F 3 HOH 114 318 280 HOH HOH B . 
F 3 HOH 115 319 281 HOH HOH B . 
F 3 HOH 116 320 282 HOH HOH B . 
F 3 HOH 117 321 283 HOH HOH B . 
F 3 HOH 118 322 284 HOH HOH B . 
F 3 HOH 119 323 286 HOH HOH B . 
F 3 HOH 120 324 288 HOH HOH B . 
F 3 HOH 121 325 289 HOH HOH B . 
F 3 HOH 122 326 290 HOH HOH B . 
F 3 HOH 123 327 291 HOH HOH B . 
F 3 HOH 124 328 292 HOH HOH B . 
F 3 HOH 125 329 293 HOH HOH B . 
F 3 HOH 126 330 294 HOH HOH B . 
F 3 HOH 127 331 296 HOH HOH B . 
F 3 HOH 128 332 297 HOH HOH B . 
F 3 HOH 129 333 300 HOH HOH B . 
F 3 HOH 130 334 301 HOH HOH B . 
F 3 HOH 131 335 302 HOH HOH B . 
F 3 HOH 132 336 309 HOH HOH B . 
F 3 HOH 133 337 310 HOH HOH B . 
F 3 HOH 134 338 311 HOH HOH B . 
F 3 HOH 135 339 312 HOH HOH B . 
F 3 HOH 136 340 315 HOH HOH B . 
F 3 HOH 137 341 316 HOH HOH B . 
F 3 HOH 138 342 317 HOH HOH B . 
F 3 HOH 139 343 318 HOH HOH B . 
F 3 HOH 140 344 319 HOH HOH B . 
F 3 HOH 141 345 321 HOH HOH B . 
F 3 HOH 142 346 325 HOH HOH B . 
F 3 HOH 143 347 333 HOH HOH B . 
F 3 HOH 144 348 339 HOH HOH B . 
F 3 HOH 145 349 340 HOH HOH B . 
F 3 HOH 146 350 343 HOH HOH B . 
F 3 HOH 147 351 344 HOH HOH B . 
F 3 HOH 148 352 351 HOH HOH B . 
F 3 HOH 149 353 353 HOH HOH B . 
F 3 HOH 150 354 356 HOH HOH B . 
F 3 HOH 151 355 357 HOH HOH B . 
F 3 HOH 152 356 358 HOH HOH B . 
F 3 HOH 153 357 374 HOH HOH B . 
F 3 HOH 154 358 375 HOH HOH B . 
F 3 HOH 155 359 377 HOH HOH B . 
F 3 HOH 156 360 380 HOH HOH B . 
F 3 HOH 157 361 382 HOH HOH B . 
F 3 HOH 158 362 385 HOH HOH B . 
F 3 HOH 159 363 387 HOH HOH B . 
F 3 HOH 160 364 389 HOH HOH B . 
F 3 HOH 161 365 394 HOH HOH B . 
F 3 HOH 162 366 396 HOH HOH B . 
F 3 HOH 163 367 397 HOH HOH B . 
F 3 HOH 164 368 399 HOH HOH B . 
F 3 HOH 165 369 400 HOH HOH B . 
F 3 HOH 166 370 402 HOH HOH B . 
F 3 HOH 167 371 404 HOH HOH B . 
F 3 HOH 168 372 405 HOH HOH B . 
F 3 HOH 169 373 406 HOH HOH B . 
F 3 HOH 170 374 407 HOH HOH B . 
F 3 HOH 171 375 414 HOH HOH B . 
F 3 HOH 172 376 416 HOH HOH B . 
F 3 HOH 173 377 417 HOH HOH B . 
F 3 HOH 174 378 419 HOH HOH B . 
F 3 HOH 175 379 420 HOH HOH B . 
F 3 HOH 176 380 422 HOH HOH B . 
F 3 HOH 177 381 425 HOH HOH B . 
F 3 HOH 178 382 426 HOH HOH B . 
F 3 HOH 179 383 427 HOH HOH B . 
F 3 HOH 180 384 428 HOH HOH B . 
F 3 HOH 181 385 430 HOH HOH B . 
F 3 HOH 182 386 432 HOH HOH B . 
F 3 HOH 183 387 433 HOH HOH B . 
F 3 HOH 184 388 434 HOH HOH B . 
F 3 HOH 185 389 435 HOH HOH B . 
F 3 HOH 186 390 439 HOH HOH B . 
F 3 HOH 187 391 440 HOH HOH B . 
F 3 HOH 188 392 441 HOH HOH B . 
F 3 HOH 189 393 442 HOH HOH B . 
F 3 HOH 190 394 443 HOH HOH B . 
F 3 HOH 191 395 445 HOH HOH B . 
F 3 HOH 192 396 447 HOH HOH B . 
F 3 HOH 193 397 448 HOH HOH B . 
F 3 HOH 194 398 455 HOH HOH B . 
F 3 HOH 195 399 456 HOH HOH B . 
F 3 HOH 196 400 460 HOH HOH B . 
F 3 HOH 197 401 461 HOH HOH B . 
F 3 HOH 198 402 462 HOH HOH B . 
F 3 HOH 199 403 463 HOH HOH B . 
F 3 HOH 200 404 465 HOH HOH B . 
F 3 HOH 201 405 466 HOH HOH B . 
F 3 HOH 202 406 467 HOH HOH B . 
F 3 HOH 203 407 469 HOH HOH B . 
F 3 HOH 204 408 474 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 O   ? E HOH .   ? A HOH 365 ? 1_555 174.5 ? 
2  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 O   ? E HOH .   ? A HOH 206 ? 1_555 86.9  ? 
3  O   ? E HOH .   ? A HOH 365 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 O   ? E HOH .   ? A HOH 206 ? 1_555 89.4  ? 
4  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 85.6  ? 
5  O   ? E HOH .   ? A HOH 365 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 98.1  ? 
6  O   ? E HOH .   ? A HOH 206 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 172.4 ? 
7  OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 104.1 ? 
8  O   ? E HOH .   ? A HOH 365 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 72.0  ? 
9  O   ? E HOH .   ? A HOH 206 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 90.4  ? 
10 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 90.5  ? 
11 OD2 ? A ASP 174 ? A ASP 165 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 109.8 ? 
12 O   ? E HOH .   ? A HOH 365 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 74.1  ? 
13 O   ? E HOH .   ? A HOH 206 ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 89.4  ? 
14 NE2 ? A HIS 37  ? A HIS 28  ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 94.0  ? 
15 NE2 ? A HIS 92  ? A HIS 83  ? 1_555 MN ? C MN . ? A MN 204 ? 1_555 NE2 ? A HIS 178 ? A HIS 169 ? 1_555 146.0 ? 
16 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 O   ? F HOH .   ? B HOH 206 ? 1_555 87.3  ? 
17 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 86.0  ? 
18 O   ? F HOH .   ? B HOH 206 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 172.4 ? 
19 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 103.3 ? 
20 O   ? F HOH .   ? B HOH 206 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 85.2  ? 
21 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 93.0  ? 
22 OD2 ? B ASP 174 ? B ASP 165 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 109.6 ? 
23 O   ? F HOH .   ? B HOH 206 ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 92.4  ? 
24 NE2 ? B HIS 37  ? B HIS 28  ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 93.2  ? 
25 NE2 ? B HIS 92  ? B HIS 83  ? 1_555 MN ? D MN . ? B MN 204 ? 1_555 NE2 ? B HIS 178 ? B HIS 169 ? 1_555 146.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-19 
2 'Structure model' 1 1 2007-10-16 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 49  ? ? -27.24  -58.95  
2  1 ALA A 51  ? ? -69.35  6.48    
3  1 ASN A 61  ? ? -117.26 50.46   
4  1 ASN A 149 ? ? 55.20   -124.23 
5  1 GLN A 176 ? ? 42.41   -121.60 
6  1 ASN B 61  ? ? -118.71 51.79   
7  1 ASN B 138 ? ? -108.49 -68.25  
8  1 ASN B 139 ? A -56.43  -108.15 
9  1 ASN B 149 ? ? 56.32   -121.88 
10 1 GLN B 176 ? ? 43.55   -126.53 
11 1 GLU B 201 ? ? -76.67  23.93   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    139 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   A 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    140 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   A 
_pdbx_validate_peptide_omega.omega            118.31 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    A 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    ASN 
_pdbx_validate_chiral.auth_seq_id     139 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -8  ? A GLY 1   
2  1 Y 1 A SER -7  ? A SER 2   
3  1 Y 1 A SER -6  ? A SER 3   
4  1 Y 1 A HIS -5  ? A HIS 4   
5  1 Y 1 A HIS -4  ? A HIS 5   
6  1 Y 1 A HIS -3  ? A HIS 6   
7  1 Y 1 A HIS -2  ? A HIS 7   
8  1 Y 1 A HIS -1  ? A HIS 8   
9  1 Y 1 A HIS 0   ? A HIS 9   
10 1 Y 1 A MET 1   ? A MET 10  
11 1 Y 1 A ALA 2   ? A ALA 11  
12 1 Y 1 A LYS 203 ? A LYS 212 
13 1 Y 1 B GLY -8  ? B GLY 1   
14 1 Y 1 B SER -7  ? B SER 2   
15 1 Y 1 B SER -6  ? B SER 3   
16 1 Y 1 B HIS -5  ? B HIS 4   
17 1 Y 1 B HIS -4  ? B HIS 5   
18 1 Y 1 B HIS -3  ? B HIS 6   
19 1 Y 1 B HIS -2  ? B HIS 7   
20 1 Y 1 B HIS -1  ? B HIS 8   
21 1 Y 1 B HIS 0   ? B HIS 9   
22 1 Y 1 B MET 1   ? B MET 10  
23 1 Y 1 B ALA 2   ? B ALA 11  
24 1 Y 1 B LYS 203 ? B LYS 212 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 water                HOH 
#