data_1XV9
# 
_entry.id   1XV9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XV9         
RCSB  RCSB030803   
WWPDB D_1000030803 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XV9 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xu, R.X.'       1  
'Lambert, M.H.'  2  
'Wisely, B.B.'   3  
'Warren, E.N.'   4  
'Weinert, E.E.'  5  
'Waitt, G.M.'    6  
'Williams, J.D.' 7  
'Moore, L.B.'    8  
'Willson, T.M.'  9  
'Moore, J.T.'    10 
# 
_citation.id                        primary 
_citation.title                     'A Structural Basis for Constitutive Activity in the Human CAR/RXRalpha Heterodimer.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            16 
_citation.page_first                919 
_citation.page_last                 928 
_citation.year                      2004 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15610735 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2004.11.042 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xu, R.X.'       1  
primary 'Lambert, M.H.'  2  
primary 'Wisely, B.B.'   3  
primary 'Warren, E.N.'   4  
primary 'Weinert, E.E.'  5  
primary 'Waitt, G.M.'    6  
primary 'Williams, J.D.' 7  
primary 'Collins, J.L.'  8  
primary 'Moore, L.B.'    9  
primary 'Willson, T.M.'  10 
primary 'Moore, J.T.'    11 
# 
_cell.entry_id           1XV9 
_cell.length_a           128.442 
_cell.length_b           128.442 
_cell.length_c           214.530 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1XV9 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Retinoic acid receptor RXR-alpha'         26509.701 2  ? ? 'LBD domain'                   ? 
2 polymer     man 'Orphan nuclear receptor NR1I3'            28278.959 2  ? ? 'LBD domain'                   ? 
3 polymer     syn 'nuclear receptor coactivator 1 isoform 1' 1633.916  4  ? ? 'peptide fragment-13 residues' ? 
4 non-polymer syn 'PENTADECANOIC ACID'                       242.397   2  ? ? ?                              ? 
5 non-polymer syn '(5BETA)-PREGNANE-3,20-DIONE'              316.478   1  ? ? ?                              ? 
6 water       nat water                                      18.015    66 ? ? ?                              ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Retinoid X receptor alpha'                                           
2 'Constitutive androstane receptor, CAR, Orphan nuclear receptor MB67' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;NEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN
ELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP
AEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
;
;NEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN
ELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP
AEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
;
A,C     ? 
2 'polypeptide(L)' no no 
;PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVF
RSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVGFQVEFLELLFHFHGTLRKLQLQEPEYVLL
AAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPL
LQEICS
;
;PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVF
RSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVGFQVEFLELLFHFHGTLRKLQLQEPEYVLL
AAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPL
LQEICS
;
B,D     ? 
3 'polypeptide(L)' no no ERHKILHRLLQEG ERHKILHRLLQEG E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   GLU n 
1 3   ASP n 
1 4   MET n 
1 5   PRO n 
1 6   VAL n 
1 7   GLU n 
1 8   ARG n 
1 9   ILE n 
1 10  LEU n 
1 11  GLU n 
1 12  ALA n 
1 13  GLU n 
1 14  LEU n 
1 15  ALA n 
1 16  VAL n 
1 17  GLU n 
1 18  PRO n 
1 19  LYS n 
1 20  THR n 
1 21  GLU n 
1 22  THR n 
1 23  TYR n 
1 24  VAL n 
1 25  GLU n 
1 26  ALA n 
1 27  ASN n 
1 28  MET n 
1 29  GLY n 
1 30  LEU n 
1 31  ASN n 
1 32  PRO n 
1 33  SER n 
1 34  SER n 
1 35  PRO n 
1 36  ASN n 
1 37  ASP n 
1 38  PRO n 
1 39  VAL n 
1 40  THR n 
1 41  ASN n 
1 42  ILE n 
1 43  CYS n 
1 44  GLN n 
1 45  ALA n 
1 46  ALA n 
1 47  ASP n 
1 48  LYS n 
1 49  GLN n 
1 50  LEU n 
1 51  PHE n 
1 52  THR n 
1 53  LEU n 
1 54  VAL n 
1 55  GLU n 
1 56  TRP n 
1 57  ALA n 
1 58  LYS n 
1 59  ARG n 
1 60  ILE n 
1 61  PRO n 
1 62  HIS n 
1 63  PHE n 
1 64  SER n 
1 65  GLU n 
1 66  LEU n 
1 67  PRO n 
1 68  LEU n 
1 69  ASP n 
1 70  ASP n 
1 71  GLN n 
1 72  VAL n 
1 73  ILE n 
1 74  LEU n 
1 75  LEU n 
1 76  ARG n 
1 77  ALA n 
1 78  GLY n 
1 79  TRP n 
1 80  ASN n 
1 81  GLU n 
1 82  LEU n 
1 83  LEU n 
1 84  ILE n 
1 85  ALA n 
1 86  SER n 
1 87  PHE n 
1 88  SER n 
1 89  HIS n 
1 90  ARG n 
1 91  SER n 
1 92  ILE n 
1 93  ALA n 
1 94  VAL n 
1 95  LYS n 
1 96  ASP n 
1 97  GLY n 
1 98  ILE n 
1 99  LEU n 
1 100 LEU n 
1 101 ALA n 
1 102 THR n 
1 103 GLY n 
1 104 LEU n 
1 105 HIS n 
1 106 VAL n 
1 107 HIS n 
1 108 ARG n 
1 109 ASN n 
1 110 SER n 
1 111 ALA n 
1 112 HIS n 
1 113 SER n 
1 114 ALA n 
1 115 GLY n 
1 116 VAL n 
1 117 GLY n 
1 118 ALA n 
1 119 ILE n 
1 120 PHE n 
1 121 ASP n 
1 122 ARG n 
1 123 VAL n 
1 124 LEU n 
1 125 THR n 
1 126 GLU n 
1 127 LEU n 
1 128 VAL n 
1 129 SER n 
1 130 LYS n 
1 131 MET n 
1 132 ARG n 
1 133 ASP n 
1 134 MET n 
1 135 GLN n 
1 136 MET n 
1 137 ASP n 
1 138 LYS n 
1 139 THR n 
1 140 GLU n 
1 141 LEU n 
1 142 GLY n 
1 143 CYS n 
1 144 LEU n 
1 145 ARG n 
1 146 ALA n 
1 147 ILE n 
1 148 VAL n 
1 149 LEU n 
1 150 PHE n 
1 151 ASN n 
1 152 PRO n 
1 153 ASP n 
1 154 SER n 
1 155 LYS n 
1 156 GLY n 
1 157 LEU n 
1 158 SER n 
1 159 ASN n 
1 160 PRO n 
1 161 ALA n 
1 162 GLU n 
1 163 VAL n 
1 164 GLU n 
1 165 ALA n 
1 166 LEU n 
1 167 ARG n 
1 168 GLU n 
1 169 LYS n 
1 170 VAL n 
1 171 TYR n 
1 172 ALA n 
1 173 SER n 
1 174 LEU n 
1 175 GLU n 
1 176 ALA n 
1 177 TYR n 
1 178 CYS n 
1 179 LYS n 
1 180 HIS n 
1 181 LYS n 
1 182 TYR n 
1 183 PRO n 
1 184 GLU n 
1 185 GLN n 
1 186 PRO n 
1 187 GLY n 
1 188 ARG n 
1 189 PHE n 
1 190 ALA n 
1 191 LYS n 
1 192 LEU n 
1 193 LEU n 
1 194 LEU n 
1 195 ARG n 
1 196 LEU n 
1 197 PRO n 
1 198 ALA n 
1 199 LEU n 
1 200 ARG n 
1 201 SER n 
1 202 ILE n 
1 203 GLY n 
1 204 LEU n 
1 205 LYS n 
1 206 CYS n 
1 207 LEU n 
1 208 GLU n 
1 209 HIS n 
1 210 LEU n 
1 211 PHE n 
1 212 PHE n 
1 213 PHE n 
1 214 LYS n 
1 215 LEU n 
1 216 ILE n 
1 217 GLY n 
1 218 ASP n 
1 219 THR n 
1 220 PRO n 
1 221 ILE n 
1 222 ASP n 
1 223 THR n 
1 224 PHE n 
1 225 LEU n 
1 226 MET n 
1 227 GLU n 
1 228 MET n 
1 229 LEU n 
1 230 GLU n 
1 231 ALA n 
1 232 PRO n 
1 233 HIS n 
1 234 GLN n 
1 235 MET n 
1 236 THR n 
2 1   PRO n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   SER n 
2 6   LYS n 
2 7   GLU n 
2 8   GLN n 
2 9   GLU n 
2 10  GLU n 
2 11  LEU n 
2 12  ILE n 
2 13  ARG n 
2 14  THR n 
2 15  LEU n 
2 16  LEU n 
2 17  GLY n 
2 18  ALA n 
2 19  HIS n 
2 20  THR n 
2 21  ARG n 
2 22  HIS n 
2 23  MET n 
2 24  GLY n 
2 25  THR n 
2 26  MET n 
2 27  PHE n 
2 28  GLU n 
2 29  GLN n 
2 30  PHE n 
2 31  VAL n 
2 32  GLN n 
2 33  PHE n 
2 34  ARG n 
2 35  PRO n 
2 36  PRO n 
2 37  ALA n 
2 38  HIS n 
2 39  LEU n 
2 40  PHE n 
2 41  ILE n 
2 42  HIS n 
2 43  HIS n 
2 44  GLN n 
2 45  PRO n 
2 46  LEU n 
2 47  PRO n 
2 48  THR n 
2 49  LEU n 
2 50  ALA n 
2 51  PRO n 
2 52  VAL n 
2 53  LEU n 
2 54  PRO n 
2 55  LEU n 
2 56  VAL n 
2 57  THR n 
2 58  HIS n 
2 59  PHE n 
2 60  ALA n 
2 61  ASP n 
2 62  ILE n 
2 63  ASN n 
2 64  THR n 
2 65  PHE n 
2 66  MET n 
2 67  VAL n 
2 68  LEU n 
2 69  GLN n 
2 70  VAL n 
2 71  ILE n 
2 72  LYS n 
2 73  PHE n 
2 74  THR n 
2 75  LYS n 
2 76  ASP n 
2 77  LEU n 
2 78  PRO n 
2 79  VAL n 
2 80  PHE n 
2 81  ARG n 
2 82  SER n 
2 83  LEU n 
2 84  PRO n 
2 85  ILE n 
2 86  GLU n 
2 87  ASP n 
2 88  GLN n 
2 89  ILE n 
2 90  SER n 
2 91  LEU n 
2 92  LEU n 
2 93  LYS n 
2 94  GLY n 
2 95  ALA n 
2 96  ALA n 
2 97  VAL n 
2 98  GLU n 
2 99  ILE n 
2 100 CYS n 
2 101 HIS n 
2 102 ILE n 
2 103 VAL n 
2 104 LEU n 
2 105 ASN n 
2 106 THR n 
2 107 THR n 
2 108 PHE n 
2 109 CYS n 
2 110 LEU n 
2 111 GLN n 
2 112 THR n 
2 113 GLN n 
2 114 ASN n 
2 115 PHE n 
2 116 LEU n 
2 117 CYS n 
2 118 GLY n 
2 119 PRO n 
2 120 LEU n 
2 121 ARG n 
2 122 TYR n 
2 123 THR n 
2 124 ILE n 
2 125 GLU n 
2 126 ASP n 
2 127 GLY n 
2 128 ALA n 
2 129 ARG n 
2 130 VAL n 
2 131 GLY n 
2 132 PHE n 
2 133 GLN n 
2 134 VAL n 
2 135 GLU n 
2 136 PHE n 
2 137 LEU n 
2 138 GLU n 
2 139 LEU n 
2 140 LEU n 
2 141 PHE n 
2 142 HIS n 
2 143 PHE n 
2 144 HIS n 
2 145 GLY n 
2 146 THR n 
2 147 LEU n 
2 148 ARG n 
2 149 LYS n 
2 150 LEU n 
2 151 GLN n 
2 152 LEU n 
2 153 GLN n 
2 154 GLU n 
2 155 PRO n 
2 156 GLU n 
2 157 TYR n 
2 158 VAL n 
2 159 LEU n 
2 160 LEU n 
2 161 ALA n 
2 162 ALA n 
2 163 MET n 
2 164 ALA n 
2 165 LEU n 
2 166 PHE n 
2 167 SER n 
2 168 PRO n 
2 169 ASP n 
2 170 ARG n 
2 171 PRO n 
2 172 GLY n 
2 173 VAL n 
2 174 THR n 
2 175 GLN n 
2 176 ARG n 
2 177 ASP n 
2 178 GLU n 
2 179 ILE n 
2 180 ASP n 
2 181 GLN n 
2 182 LEU n 
2 183 GLN n 
2 184 GLU n 
2 185 GLU n 
2 186 MET n 
2 187 ALA n 
2 188 LEU n 
2 189 THR n 
2 190 LEU n 
2 191 GLN n 
2 192 SER n 
2 193 TYR n 
2 194 ILE n 
2 195 LYS n 
2 196 GLY n 
2 197 GLN n 
2 198 GLN n 
2 199 ARG n 
2 200 ARG n 
2 201 PRO n 
2 202 ARG n 
2 203 ASP n 
2 204 ARG n 
2 205 PHE n 
2 206 LEU n 
2 207 TYR n 
2 208 ALA n 
2 209 LYS n 
2 210 LEU n 
2 211 LEU n 
2 212 GLY n 
2 213 LEU n 
2 214 LEU n 
2 215 ALA n 
2 216 GLU n 
2 217 LEU n 
2 218 ARG n 
2 219 SER n 
2 220 ILE n 
2 221 ASN n 
2 222 GLU n 
2 223 ALA n 
2 224 TYR n 
2 225 GLY n 
2 226 TYR n 
2 227 GLN n 
2 228 ILE n 
2 229 GLN n 
2 230 HIS n 
2 231 ILE n 
2 232 GLN n 
2 233 GLY n 
2 234 LEU n 
2 235 SER n 
2 236 ALA n 
2 237 MET n 
2 238 MET n 
2 239 PRO n 
2 240 LEU n 
2 241 LEU n 
2 242 GLN n 
2 243 GLU n 
2 244 ILE n 
2 245 CYS n 
2 246 SER n 
3 1   GLU n 
3 2   ARG n 
3 3   HIS n 
3 4   LYS n 
3 5   ILE n 
3 6   LEU n 
3 7   HIS n 
3 8   ARG n 
3 9   LEU n 
3 10  LEU n 
3 11  GLN n 
3 12  GLU n 
3 13  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'RXRA, NR2B1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ?             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                'Chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NR1I3_HUMAN Q14994   2 
;PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVF
RSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPE
YVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSA
MMPLLQEICS
;
103 ? 
2 UNP RXRA_HUMAN  P19793   1 
;NEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWN
ELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNP
AEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
;
227 ? 
3 GB  NP_003734   22538455 3 ERHKILHRLLQEG 685 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XV9 B 1 ? 246 ? Q14994   103 ? 352 ? 103 348 
2 1 1XV9 D 1 ? 246 ? Q14994   103 ? 352 ? 103 348 
3 2 1XV9 A 1 ? 236 ? P19793   227 ? 462 ? 227 462 
4 2 1XV9 C 1 ? 236 ? P19793   227 ? 462 ? 227 462 
5 3 1XV9 E 1 ? 13  ? 22538455 685 ? 697 ? 628 640 
6 3 1XV9 F 1 ? 13  ? 22538455 685 ? 697 ? 685 697 
7 3 1XV9 G 1 ? 13  ? 22538455 685 ? 697 ? 628 640 
8 3 1XV9 H 1 ? 13  ? 22538455 685 ? 697 ? 685 697 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XV9 ? B ? ? UNP Q14994 VAL 232 DELETION ? 1 
1 1XV9 ? B ? ? UNP Q14994 SER 233 DELETION ? 2 
1 1XV9 ? B ? ? UNP Q14994 PRO 234 DELETION ? 3 
1 1XV9 ? B ? ? UNP Q14994 THR 235 DELETION ? 4 
2 1XV9 ? D ? ? UNP Q14994 VAL 232 DELETION ? 5 
2 1XV9 ? D ? ? UNP Q14994 SER 233 DELETION ? 6 
2 1XV9 ? D ? ? UNP Q14994 PRO 234 DELETION ? 7 
2 1XV9 ? D ? ? UNP Q14994 THR 235 DELETION ? 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'     133.103 
CI2 non-polymer         . '(5BETA)-PREGNANE-3,20-DIONE' ? 'C21 H32 O2'     316.478 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'   121.158 
F15 non-polymer         . 'PENTADECANOIC ACID'          ? 'C15 H30 O2'     242.397 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                         ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XV9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.40 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.9 
_exptl_crystal_grow.pdbx_details    'potassium sodium phosphate, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2004-02-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 channel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1XV9 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.7 
_reflns.d_resolution_low             50 
_reflns.number_all                   56901 
_reflns.number_obs                   49180 
_reflns.percent_possible_obs         86.4 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_Rsym_value              0.062 
_reflns.pdbx_netI_over_sigmaI        37.4 
_reflns.B_iso_Wilson_estimate        61 
_reflns.pdbx_redundancy              6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1XV9 
_refine.ls_d_res_high                            2.7 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     56901 
_refine.ls_number_reflns_obs                     49180 
_refine.ls_number_reflns_R_free                  2834 
_refine.ls_percent_reflns_obs                    86.4 
_refine.ls_R_factor_all                          0.181 
_refine.ls_R_factor_obs                          0.181 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
'Refinement was done on data from twinned crystal. twinning operator= -k,-h,-l  twinning fraction= 0.473' 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8028 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         57 
_refine_hist.number_atoms_solvent             66 
_refine_hist.number_atoms_total               8151 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        50 
# 
_struct.entry_id                  1XV9 
_struct.title                     
'crystal structure of CAR/RXR heterodimer bound with SRC1 peptide, fatty acid, and 5b-pregnane-3,20-dione.' 
_struct.pdbx_descriptor           
'Retinoic acid receptor RXR-alpha, Orphan nuclear receptor NR1I3, nuclear receptor coactivator 1 isoform 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XV9 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'CAR, RXR, SRC1, pregnanedione, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 5   ? GLU A 17  ? PRO A 231 GLU A 243 1 ? 13 
HELX_P HELX_P2  2  ASP A 37  ? ARG A 59  ? ASP A 263 ARG A 285 1 ? 23 
HELX_P HELX_P3  3  PRO A 67  ? ALA A 77  ? PRO A 293 ALA A 303 1 ? 11 
HELX_P HELX_P4  4  GLY A 78  ? SER A 91  ? GLY A 304 SER A 317 1 ? 14 
HELX_P HELX_P5  5  ILE A 92  ? VAL A 94  ? ILE A 318 VAL A 320 5 ? 3  
HELX_P HELX_P6  6  ARG A 108 ? SER A 113 ? ARG A 334 SER A 339 1 ? 6  
HELX_P HELX_P7  7  VAL A 116 ? LEU A 127 ? VAL A 342 LEU A 353 1 ? 12 
HELX_P HELX_P8  8  LEU A 127 ? ASP A 133 ? LEU A 353 ASP A 359 1 ? 7  
HELX_P HELX_P9  9  ASP A 137 ? PHE A 150 ? ASP A 363 PHE A 376 1 ? 14 
HELX_P HELX_P10 10 GLU A 162 ? TYR A 182 ? GLU A 388 TYR A 408 1 ? 21 
HELX_P HELX_P11 11 GLY A 187 ? LEU A 194 ? GLY A 413 LEU A 420 1 ? 8  
HELX_P HELX_P12 12 LEU A 194 ? ILE A 216 ? LEU A 420 ILE A 442 1 ? 23 
HELX_P HELX_P13 13 ASP A 222 ? LEU A 229 ? ASP A 448 LEU A 455 1 ? 8  
HELX_P HELX_P14 14 SER B 5   ? MET B 23  ? SER B 107 MET B 125 1 ? 19 
HELX_P HELX_P15 15 THR B 25  ? PHE B 33  ? THR B 127 PHE B 135 5 ? 9  
HELX_P HELX_P16 16 PRO B 36  ? ILE B 41  ? PRO B 138 ILE B 143 1 ? 6  
HELX_P HELX_P17 17 VAL B 52  ? ASP B 76  ? VAL B 154 ASP B 178 1 ? 25 
HELX_P HELX_P18 18 LEU B 77  ? SER B 82  ? LEU B 179 SER B 184 1 ? 6  
HELX_P HELX_P19 19 PRO B 84  ? ASN B 105 ? PRO B 186 ASN B 207 1 ? 22 
HELX_P HELX_P20 20 THR B 123 ? VAL B 130 ? THR B 225 VAL B 232 1 ? 8  
HELX_P HELX_P21 21 GLN B 133 ? LEU B 150 ? GLN B 235 LEU B 252 1 ? 18 
HELX_P HELX_P22 22 GLN B 153 ? PHE B 166 ? GLN B 255 PHE B 268 1 ? 14 
HELX_P HELX_P23 23 GLN B 175 ? GLY B 196 ? GLN B 277 GLY B 298 1 ? 22 
HELX_P HELX_P24 24 PHE B 205 ? ILE B 231 ? PHE B 307 ILE B 333 1 ? 27 
HELX_P HELX_P25 25 GLY B 233 ? MET B 238 ? GLY B 335 MET B 340 1 ? 6  
HELX_P HELX_P26 26 MET B 238 ? CYS B 245 ? MET B 340 CYS B 347 1 ? 8  
HELX_P HELX_P27 27 PRO C 5   ? ALA C 15  ? PRO C 231 ALA C 241 1 ? 11 
HELX_P HELX_P28 28 ASP C 37  ? ARG C 59  ? ASP C 263 ARG C 285 1 ? 23 
HELX_P HELX_P29 29 PRO C 67  ? ALA C 77  ? PRO C 293 ALA C 303 1 ? 11 
HELX_P HELX_P30 30 GLY C 78  ? SER C 91  ? GLY C 304 SER C 317 1 ? 14 
HELX_P HELX_P31 31 ILE C 92  ? VAL C 94  ? ILE C 318 VAL C 320 5 ? 3  
HELX_P HELX_P32 32 ARG C 108 ? GLY C 115 ? ARG C 334 GLY C 341 1 ? 8  
HELX_P HELX_P33 33 VAL C 116 ? LEU C 127 ? VAL C 342 LEU C 353 1 ? 12 
HELX_P HELX_P34 34 LEU C 127 ? MET C 134 ? LEU C 353 MET C 360 1 ? 8  
HELX_P HELX_P35 35 ASP C 137 ? PHE C 150 ? ASP C 363 PHE C 376 1 ? 14 
HELX_P HELX_P36 36 ASN C 159 ? TYR C 182 ? ASN C 385 TYR C 408 1 ? 24 
HELX_P HELX_P37 37 GLY C 187 ? ILE C 216 ? GLY C 413 ILE C 442 1 ? 30 
HELX_P HELX_P38 38 ASP C 222 ? MET C 228 ? ASP C 448 MET C 454 1 ? 7  
HELX_P HELX_P39 39 SER D 5   ? MET D 23  ? SER D 107 MET D 125 1 ? 19 
HELX_P HELX_P40 40 PHE D 27  ? VAL D 31  ? PHE D 129 VAL D 133 5 ? 5  
HELX_P HELX_P41 41 PRO D 36  ? PHE D 40  ? PRO D 138 PHE D 142 5 ? 5  
HELX_P HELX_P42 42 VAL D 52  ? ASP D 76  ? VAL D 154 ASP D 178 1 ? 25 
HELX_P HELX_P43 43 LEU D 77  ? LEU D 83  ? LEU D 179 LEU D 185 1 ? 7  
HELX_P HELX_P44 44 PRO D 84  ? THR D 106 ? PRO D 186 THR D 208 1 ? 23 
HELX_P HELX_P45 45 THR D 123 ? GLY D 131 ? THR D 225 GLY D 233 1 ? 9  
HELX_P HELX_P46 46 GLN D 133 ? LEU D 150 ? GLN D 235 LEU D 252 1 ? 18 
HELX_P HELX_P47 47 GLN D 153 ? PHE D 166 ? GLN D 255 PHE D 268 1 ? 14 
HELX_P HELX_P48 48 GLN D 175 ? GLY D 196 ? GLN D 277 GLY D 298 1 ? 22 
HELX_P HELX_P49 49 PHE D 205 ? ILE D 231 ? PHE D 307 ILE D 333 1 ? 27 
HELX_P HELX_P50 50 LEU D 234 ? MET D 237 ? LEU D 336 MET D 339 5 ? 4  
HELX_P HELX_P51 51 MET D 238 ? CYS D 245 ? MET D 340 CYS D 347 1 ? 8  
HELX_P HELX_P52 52 HIS E 3   ? GLU E 12  ? HIS E 630 GLU E 639 1 ? 10 
HELX_P HELX_P53 53 HIS F 3   ? LEU F 10  ? HIS F 687 LEU F 694 1 ? 8  
HELX_P HELX_P54 54 HIS G 3   ? LEU G 10  ? HIS G 630 LEU G 637 1 ? 8  
HELX_P HELX_P55 55 HIS H 3   ? LEU H 10  ? HIS H 687 LEU H 694 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 24  ? GLU A 25  ? VAL A 250 GLU A 251 
A 2 LEU A 104 ? HIS A 107 ? LEU A 330 HIS A 333 
A 3 GLY A 97  ? LEU A 99  ? GLY A 323 LEU A 325 
B 1 PHE B 108 ? CYS B 109 ? PHE B 210 CYS B 211 
B 2 ASN B 114 ? CYS B 117 ? ASN B 216 CYS B 219 
B 3 LEU B 120 ? TYR B 122 ? LEU B 222 TYR B 224 
C 1 VAL C 24  ? GLU C 25  ? VAL C 250 GLU C 251 
C 2 LEU C 104 ? HIS C 107 ? LEU C 330 HIS C 333 
C 3 GLY C 97  ? LEU C 100 ? GLY C 323 LEU C 326 
D 1 PHE D 108 ? CYS D 109 ? PHE D 210 CYS D 211 
D 2 ASN D 114 ? CYS D 117 ? ASN D 216 CYS D 219 
D 3 LEU D 120 ? TYR D 122 ? LEU D 222 TYR D 224 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 24  ? N VAL A 250 O HIS A 105 ? O HIS A 331 
A 2 3 O VAL A 106 ? O VAL A 332 N ILE A 98  ? N ILE A 324 
B 1 2 N CYS B 109 ? N CYS B 211 O ASN B 114 ? O ASN B 216 
B 2 3 N PHE B 115 ? N PHE B 217 O TYR B 122 ? O TYR B 224 
C 1 2 N VAL C 24  ? N VAL C 250 O HIS C 105 ? O HIS C 331 
C 2 3 O VAL C 106 ? O VAL C 332 N ILE C 98  ? N ILE C 324 
D 1 2 N CYS D 109 ? N CYS D 211 O ASN D 114 ? O ASN D 216 
D 2 3 N PHE D 115 ? N PHE D 217 O TYR D 122 ? O TYR D 224 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE CI2 D 1001' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE F15 C 1002' 
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE F15 A 1003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 HIS B 58  ? HIS B 160 . ? 1_555 ? 
2  AC1 17 PHE B 59  ? PHE B 161 . ? 1_555 ? 
3  AC1 17 ILE B 62  ? ILE B 164 . ? 1_555 ? 
4  AC1 17 ASN B 63  ? ASN B 165 . ? 1_555 ? 
5  AC1 17 HIS B 101 ? HIS B 203 . ? 1_555 ? 
6  AC1 17 TYR B 122 ? TYR B 224 . ? 1_555 ? 
7  AC1 17 PHE B 136 ? PHE B 238 . ? 1_555 ? 
8  AC1 17 LEU B 140 ? LEU B 242 . ? 1_555 ? 
9  AC1 17 TYR B 224 ? TYR B 326 . ? 1_555 ? 
10 AC1 17 PHE D 59  ? PHE D 161 . ? 1_555 ? 
11 AC1 17 ILE D 62  ? ILE D 164 . ? 1_555 ? 
12 AC1 17 ASN D 63  ? ASN D 165 . ? 1_555 ? 
13 AC1 17 MET D 66  ? MET D 168 . ? 1_555 ? 
14 AC1 17 HIS D 101 ? HIS D 203 . ? 1_555 ? 
15 AC1 17 TYR D 122 ? TYR D 224 . ? 1_555 ? 
16 AC1 17 LEU D 140 ? LEU D 242 . ? 1_555 ? 
17 AC1 17 TYR D 224 ? TYR D 326 . ? 1_555 ? 
18 AC2 9  ALA C 46  ? ALA C 272 . ? 1_555 ? 
19 AC2 9  GLN C 49  ? GLN C 275 . ? 1_555 ? 
20 AC2 9  LEU C 83  ? LEU C 309 . ? 1_555 ? 
21 AC2 9  PHE C 87  ? PHE C 313 . ? 1_555 ? 
22 AC2 9  ARG C 90  ? ARG C 316 . ? 1_555 ? 
23 AC2 9  ALA C 101 ? ALA C 327 . ? 1_555 ? 
24 AC2 9  ILE C 119 ? ILE C 345 . ? 1_555 ? 
25 AC2 9  PHE C 120 ? PHE C 346 . ? 1_555 ? 
26 AC2 9  CYS C 206 ? CYS C 432 . ? 1_555 ? 
27 AC3 7  ILE A 42  ? ILE A 268 . ? 1_555 ? 
28 AC3 7  ALA A 46  ? ALA A 272 . ? 1_555 ? 
29 AC3 7  GLN A 49  ? GLN A 275 . ? 1_555 ? 
30 AC3 7  PHE A 87  ? PHE A 313 . ? 1_555 ? 
31 AC3 7  ARG A 90  ? ARG A 316 . ? 1_555 ? 
32 AC3 7  ALA A 101 ? ALA A 327 . ? 1_555 ? 
33 AC3 7  ILE A 119 ? ILE A 345 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XV9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XV9 
_atom_sites.fract_transf_matrix[1][1]   0.007786 
_atom_sites.fract_transf_matrix[1][2]   0.004495 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008990 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004661 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 1   ? 25.188 26.915 89.995  1.00 126.97 ? 227  ASN A N   1 
ATOM   2    C CA  . ASN A 1 1   ? 24.081 27.217 89.038  1.00 127.98 ? 227  ASN A CA  1 
ATOM   3    C C   . ASN A 1 1   ? 23.995 26.092 88.002  1.00 128.70 ? 227  ASN A C   1 
ATOM   4    O O   . ASN A 1 1   ? 24.618 26.167 86.941  1.00 128.42 ? 227  ASN A O   1 
ATOM   5    C CB  . ASN A 1 1   ? 24.348 28.562 88.343  1.00 127.27 ? 227  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 1   ? 23.113 29.130 87.654  1.00 126.01 ? 227  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 1   ? 22.465 28.454 86.855  1.00 125.15 ? 227  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 1   ? 22.792 30.385 87.956  1.00 124.03 ? 227  ASN A ND2 1 
ATOM   9    N N   . GLU A 1 2   ? 23.218 25.055 88.316  1.00 130.10 ? 228  GLU A N   1 
ATOM   10   C CA  . GLU A 1 2   ? 23.058 23.896 87.430  1.00 131.04 ? 228  GLU A CA  1 
ATOM   11   C C   . GLU A 1 2   ? 22.172 24.133 86.205  1.00 131.32 ? 228  GLU A C   1 
ATOM   12   O O   . GLU A 1 2   ? 22.198 23.344 85.259  1.00 131.23 ? 228  GLU A O   1 
ATOM   13   C CB  . GLU A 1 2   ? 22.499 22.690 88.209  1.00 131.31 ? 228  GLU A CB  1 
ATOM   14   C CG  . GLU A 1 2   ? 20.980 22.699 88.427  1.00 131.23 ? 228  GLU A CG  1 
ATOM   15   C CD  . GLU A 1 2   ? 20.561 23.341 89.738  1.00 130.72 ? 228  GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 2   ? 19.339 23.511 89.945  1.00 129.91 ? 228  GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 2   ? 21.448 23.665 90.560  1.00 130.05 ? 228  GLU A OE2 1 
ATOM   18   N N   . ASP A 1 3   ? 21.391 25.210 86.224  1.00 131.65 ? 229  ASP A N   1 
ATOM   19   C CA  . ASP A 1 3   ? 20.496 25.530 85.115  1.00 131.78 ? 229  ASP A CA  1 
ATOM   20   C C   . ASP A 1 3   ? 21.235 25.716 83.781  1.00 130.44 ? 229  ASP A C   1 
ATOM   21   O O   . ASP A 1 3   ? 20.678 25.421 82.718  1.00 130.71 ? 229  ASP A O   1 
ATOM   22   C CB  . ASP A 1 3   ? 19.668 26.781 85.456  1.00 134.12 ? 229  ASP A CB  1 
ATOM   23   C CG  . ASP A 1 3   ? 18.621 27.107 84.394  1.00 135.89 ? 229  ASP A CG  1 
ATOM   24   O OD1 . ASP A 1 3   ? 18.137 26.169 83.718  1.00 136.53 ? 229  ASP A OD1 1 
ATOM   25   O OD2 . ASP A 1 3   ? 18.269 28.301 84.247  1.00 137.41 ? 229  ASP A OD2 1 
ATOM   26   N N   . MET A 1 4   ? 22.479 26.199 83.838  1.00 127.93 ? 230  MET A N   1 
ATOM   27   C CA  . MET A 1 4   ? 23.289 26.406 82.632  1.00 124.92 ? 230  MET A CA  1 
ATOM   28   C C   . MET A 1 4   ? 24.408 25.361 82.625  1.00 123.28 ? 230  MET A C   1 
ATOM   29   O O   . MET A 1 4   ? 25.489 25.586 83.180  1.00 123.43 ? 230  MET A O   1 
ATOM   30   C CB  . MET A 1 4   ? 23.891 27.823 82.623  1.00 123.29 ? 230  MET A CB  1 
ATOM   31   C CG  . MET A 1 4   ? 24.332 28.338 81.242  1.00 120.50 ? 230  MET A CG  1 
ATOM   32   S SD  . MET A 1 4   ? 22.987 28.771 80.087  1.00 117.11 ? 230  MET A SD  1 
ATOM   33   C CE  . MET A 1 4   ? 22.654 30.475 80.575  1.00 116.36 ? 230  MET A CE  1 
ATOM   34   N N   . PRO A 1 5   ? 24.158 24.203 81.987  1.00 121.19 ? 231  PRO A N   1 
ATOM   35   C CA  . PRO A 1 5   ? 25.114 23.100 81.893  1.00 119.18 ? 231  PRO A CA  1 
ATOM   36   C C   . PRO A 1 5   ? 26.320 23.365 81.000  1.00 117.58 ? 231  PRO A C   1 
ATOM   37   O O   . PRO A 1 5   ? 26.189 23.588 79.792  1.00 116.96 ? 231  PRO A O   1 
ATOM   38   C CB  . PRO A 1 5   ? 24.257 21.957 81.366  1.00 119.26 ? 231  PRO A CB  1 
ATOM   39   C CG  . PRO A 1 5   ? 23.363 22.669 80.411  1.00 119.40 ? 231  PRO A CG  1 
ATOM   40   C CD  . PRO A 1 5   ? 22.942 23.893 81.210  1.00 120.48 ? 231  PRO A CD  1 
ATOM   41   N N   . VAL A 1 6   ? 27.495 23.333 81.617  1.00 115.38 ? 232  VAL A N   1 
ATOM   42   C CA  . VAL A 1 6   ? 28.751 23.527 80.907  1.00 112.84 ? 232  VAL A CA  1 
ATOM   43   C C   . VAL A 1 6   ? 28.893 22.432 79.832  1.00 112.07 ? 232  VAL A C   1 
ATOM   44   O O   . VAL A 1 6   ? 29.546 22.634 78.808  1.00 111.96 ? 232  VAL A O   1 
ATOM   45   C CB  . VAL A 1 6   ? 29.937 23.451 81.898  1.00 111.74 ? 232  VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 6   ? 31.245 23.561 81.159  1.00 111.11 ? 232  VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 6   ? 29.817 24.556 82.937  1.00 110.20 ? 232  VAL A CG2 1 
ATOM   48   N N   . GLU A 1 7   ? 28.263 21.281 80.079  1.00 111.29 ? 233  GLU A N   1 
ATOM   49   C CA  . GLU A 1 7   ? 28.287 20.129 79.176  1.00 109.65 ? 233  GLU A CA  1 
ATOM   50   C C   . GLU A 1 7   ? 27.513 20.377 77.889  1.00 107.59 ? 233  GLU A C   1 
ATOM   51   O O   . GLU A 1 7   ? 27.809 19.769 76.865  1.00 107.19 ? 233  GLU A O   1 
ATOM   52   C CB  . GLU A 1 7   ? 27.715 18.888 79.868  1.00 111.09 ? 233  GLU A CB  1 
ATOM   53   C CG  . GLU A 1 7   ? 28.466 18.430 81.129  1.00 112.85 ? 233  GLU A CG  1 
ATOM   54   C CD  . GLU A 1 7   ? 28.164 19.270 82.380  1.00 113.24 ? 233  GLU A CD  1 
ATOM   55   O OE1 . GLU A 1 7   ? 26.968 19.509 82.677  1.00 113.99 ? 233  GLU A OE1 1 
ATOM   56   O OE2 . GLU A 1 7   ? 29.128 19.674 83.075  1.00 112.14 ? 233  GLU A OE2 1 
ATOM   57   N N   . ARG A 1 8   ? 26.499 21.235 77.951  1.00 105.62 ? 234  ARG A N   1 
ATOM   58   C CA  . ARG A 1 8   ? 25.725 21.587 76.763  1.00 103.90 ? 234  ARG A CA  1 
ATOM   59   C C   . ARG A 1 8   ? 26.591 22.568 75.975  1.00 102.31 ? 234  ARG A C   1 
ATOM   60   O O   . ARG A 1 8   ? 26.604 22.558 74.746  1.00 101.27 ? 234  ARG A O   1 
ATOM   61   C CB  . ARG A 1 8   ? 24.402 22.258 77.157  1.00 104.35 ? 234  ARG A CB  1 
ATOM   62   C CG  . ARG A 1 8   ? 23.252 21.308 77.444  1.00 104.90 ? 234  ARG A CG  1 
ATOM   63   C CD  . ARG A 1 8   ? 22.658 20.730 76.166  1.00 105.77 ? 234  ARG A CD  1 
ATOM   64   N NE  . ARG A 1 8   ? 22.815 19.276 76.107  1.00 107.41 ? 234  ARG A NE  1 
ATOM   65   C CZ  . ARG A 1 8   ? 22.197 18.407 76.911  1.00 107.76 ? 234  ARG A CZ  1 
ATOM   66   N NH1 . ARG A 1 8   ? 21.352 18.826 77.855  1.00 107.41 ? 234  ARG A NH1 1 
ATOM   67   N NH2 . ARG A 1 8   ? 22.439 17.108 76.779  1.00 108.01 ? 234  ARG A NH2 1 
ATOM   68   N N   . ILE A 1 9   ? 27.316 23.413 76.705  1.00 101.46 ? 235  ILE A N   1 
ATOM   69   C CA  . ILE A 1 9   ? 28.214 24.399 76.109  1.00 100.54 ? 235  ILE A CA  1 
ATOM   70   C C   . ILE A 1 9   ? 29.311 23.680 75.323  1.00 100.01 ? 235  ILE A C   1 
ATOM   71   O O   . ILE A 1 9   ? 29.371 23.774 74.098  1.00 100.14 ? 235  ILE A O   1 
ATOM   72   C CB  . ILE A 1 9   ? 28.878 25.284 77.207  1.00 99.78  ? 235  ILE A CB  1 
ATOM   73   C CG1 . ILE A 1 9   ? 27.821 26.155 77.893  1.00 98.36  ? 235  ILE A CG1 1 
ATOM   74   C CG2 . ILE A 1 9   ? 29.982 26.145 76.605  1.00 99.00  ? 235  ILE A CG2 1 
ATOM   75   C CD1 . ILE A 1 9   ? 28.380 27.006 79.012  1.00 95.42  ? 235  ILE A CD1 1 
ATOM   76   N N   . LEU A 1 10  ? 30.172 22.956 76.032  1.00 98.57  ? 236  LEU A N   1 
ATOM   77   C CA  . LEU A 1 10  ? 31.257 22.226 75.395  1.00 97.87  ? 236  LEU A CA  1 
ATOM   78   C C   . LEU A 1 10  ? 30.734 21.316 74.290  1.00 98.10  ? 236  LEU A C   1 
ATOM   79   O O   . LEU A 1 10  ? 31.393 21.117 73.283  1.00 97.64  ? 236  LEU A O   1 
ATOM   80   C CB  . LEU A 1 10  ? 32.013 21.401 76.434  1.00 97.07  ? 236  LEU A CB  1 
ATOM   81   C CG  . LEU A 1 10  ? 33.203 20.599 75.908  1.00 96.45  ? 236  LEU A CG  1 
ATOM   82   C CD1 . LEU A 1 10  ? 34.229 21.545 75.322  1.00 96.14  ? 236  LEU A CD1 1 
ATOM   83   C CD2 . LEU A 1 10  ? 33.812 19.787 77.034  1.00 97.07  ? 236  LEU A CD2 1 
ATOM   84   N N   . GLU A 1 11  ? 29.544 20.764 74.486  1.00 99.81  ? 237  GLU A N   1 
ATOM   85   C CA  . GLU A 1 11  ? 28.925 19.881 73.498  1.00 101.97 ? 237  GLU A CA  1 
ATOM   86   C C   . GLU A 1 11  ? 28.534 20.666 72.244  1.00 102.20 ? 237  GLU A C   1 
ATOM   87   O O   . GLU A 1 11  ? 28.551 20.130 71.129  1.00 101.45 ? 237  GLU A O   1 
ATOM   88   C CB  . GLU A 1 11  ? 27.685 19.224 74.114  1.00 103.61 ? 237  GLU A CB  1 
ATOM   89   C CG  . GLU A 1 11  ? 26.930 18.263 73.219  1.00 104.21 ? 237  GLU A CG  1 
ATOM   90   C CD  . GLU A 1 11  ? 25.732 17.674 73.932  1.00 105.21 ? 237  GLU A CD  1 
ATOM   91   O OE1 . GLU A 1 11  ? 25.931 17.069 75.012  1.00 104.56 ? 237  GLU A OE1 1 
ATOM   92   O OE2 . GLU A 1 11  ? 24.601 17.825 73.416  1.00 106.36 ? 237  GLU A OE2 1 
ATOM   93   N N   . ALA A 1 12  ? 28.166 21.931 72.448  1.00 102.55 ? 238  ALA A N   1 
ATOM   94   C CA  . ALA A 1 12  ? 27.778 22.837 71.368  1.00 102.63 ? 238  ALA A CA  1 
ATOM   95   C C   . ALA A 1 12  ? 29.035 23.271 70.613  1.00 103.01 ? 238  ALA A C   1 
ATOM   96   O O   . ALA A 1 12  ? 29.005 23.480 69.401  1.00 101.96 ? 238  ALA A O   1 
ATOM   97   C CB  . ALA A 1 12  ? 27.058 24.053 71.945  1.00 101.93 ? 238  ALA A CB  1 
ATOM   98   N N   . GLU A 1 13  ? 30.134 23.417 71.351  1.00 104.02 ? 239  GLU A N   1 
ATOM   99   C CA  . GLU A 1 13  ? 31.422 23.786 70.775  1.00 105.14 ? 239  GLU A CA  1 
ATOM   100  C C   . GLU A 1 13  ? 31.906 22.607 69.941  1.00 107.06 ? 239  GLU A C   1 
ATOM   101  O O   . GLU A 1 13  ? 32.307 22.768 68.787  1.00 107.84 ? 239  GLU A O   1 
ATOM   102  C CB  . GLU A 1 13  ? 32.436 24.063 71.885  1.00 103.25 ? 239  GLU A CB  1 
ATOM   103  C CG  . GLU A 1 13  ? 32.155 25.316 72.658  1.00 102.42 ? 239  GLU A CG  1 
ATOM   104  C CD  . GLU A 1 13  ? 32.429 26.551 71.842  1.00 102.51 ? 239  GLU A CD  1 
ATOM   105  O OE1 . GLU A 1 13  ? 31.912 26.651 70.711  1.00 102.36 ? 239  GLU A OE1 1 
ATOM   106  O OE2 . GLU A 1 13  ? 33.167 27.426 72.331  1.00 102.79 ? 239  GLU A OE2 1 
ATOM   107  N N   . LEU A 1 14  ? 31.855 21.423 70.552  1.00 108.69 ? 240  LEU A N   1 
ATOM   108  C CA  . LEU A 1 14  ? 32.268 20.165 69.933  1.00 109.01 ? 240  LEU A CA  1 
ATOM   109  C C   . LEU A 1 14  ? 31.428 19.820 68.703  1.00 110.01 ? 240  LEU A C   1 
ATOM   110  O O   . LEU A 1 14  ? 31.910 19.155 67.788  1.00 110.69 ? 240  LEU A O   1 
ATOM   111  C CB  . LEU A 1 14  ? 32.181 19.034 70.964  1.00 107.83 ? 240  LEU A CB  1 
ATOM   112  C CG  . LEU A 1 14  ? 33.076 19.235 72.192  1.00 106.60 ? 240  LEU A CG  1 
ATOM   113  C CD1 . LEU A 1 14  ? 32.691 18.259 73.285  1.00 106.20 ? 240  LEU A CD1 1 
ATOM   114  C CD2 . LEU A 1 14  ? 34.533 19.079 71.795  1.00 105.94 ? 240  LEU A CD2 1 
ATOM   115  N N   . ALA A 1 15  ? 30.175 20.264 68.685  1.00 110.96 ? 241  ALA A N   1 
ATOM   116  C CA  . ALA A 1 15  ? 29.296 20.014 67.552  1.00 111.98 ? 241  ALA A CA  1 
ATOM   117  C C   . ALA A 1 15  ? 29.721 20.883 66.362  1.00 113.05 ? 241  ALA A C   1 
ATOM   118  O O   . ALA A 1 15  ? 29.698 20.435 65.214  1.00 113.29 ? 241  ALA A O   1 
ATOM   119  C CB  . ALA A 1 15  ? 27.849 20.315 67.937  1.00 111.84 ? 241  ALA A CB  1 
ATOM   120  N N   . VAL A 1 16  ? 30.124 22.119 66.655  1.00 114.60 ? 242  VAL A N   1 
ATOM   121  C CA  . VAL A 1 16  ? 30.550 23.084 65.641  1.00 116.30 ? 242  VAL A CA  1 
ATOM   122  C C   . VAL A 1 16  ? 31.778 22.657 64.831  1.00 117.46 ? 242  VAL A C   1 
ATOM   123  O O   . VAL A 1 16  ? 31.656 22.303 63.658  1.00 117.26 ? 242  VAL A O   1 
ATOM   124  C CB  . VAL A 1 16  ? 30.851 24.470 66.283  1.00 116.53 ? 242  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 16  ? 31.154 25.504 65.203  1.00 116.41 ? 242  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 16  ? 29.676 24.922 67.123  1.00 116.53 ? 242  VAL A CG2 1 
ATOM   127  N N   . GLU A 1 17  ? 32.953 22.694 65.465  1.00 119.02 ? 243  GLU A N   1 
ATOM   128  C CA  . GLU A 1 17  ? 34.222 22.350 64.814  1.00 120.46 ? 243  GLU A CA  1 
ATOM   129  C C   . GLU A 1 17  ? 34.162 21.160 63.863  1.00 120.97 ? 243  GLU A C   1 
ATOM   130  O O   . GLU A 1 17  ? 33.539 20.140 64.164  1.00 120.89 ? 243  GLU A O   1 
ATOM   131  C CB  . GLU A 1 17  ? 35.317 22.107 65.860  1.00 121.28 ? 243  GLU A CB  1 
ATOM   132  C CG  . GLU A 1 17  ? 35.072 20.929 66.792  1.00 122.97 ? 243  GLU A CG  1 
ATOM   133  C CD  . GLU A 1 17  ? 36.319 20.530 67.578  1.00 123.99 ? 243  GLU A CD  1 
ATOM   134  O OE1 . GLU A 1 17  ? 37.287 20.050 66.948  1.00 124.64 ? 243  GLU A OE1 1 
ATOM   135  O OE2 . GLU A 1 17  ? 36.335 20.697 68.820  1.00 124.23 ? 243  GLU A OE2 1 
ATOM   136  N N   . PRO A 1 18  ? 34.827 21.282 62.697  1.00 121.60 ? 244  PRO A N   1 
ATOM   137  C CA  . PRO A 1 18  ? 34.900 20.267 61.637  1.00 122.15 ? 244  PRO A CA  1 
ATOM   138  C C   . PRO A 1 18  ? 35.341 18.889 62.142  1.00 122.66 ? 244  PRO A C   1 
ATOM   139  O O   . PRO A 1 18  ? 35.862 18.767 63.254  1.00 122.73 ? 244  PRO A O   1 
ATOM   140  C CB  . PRO A 1 18  ? 35.900 20.875 60.650  1.00 121.84 ? 244  PRO A CB  1 
ATOM   141  C CG  . PRO A 1 18  ? 35.671 22.347 60.808  1.00 121.83 ? 244  PRO A CG  1 
ATOM   142  C CD  . PRO A 1 18  ? 35.592 22.483 62.314  1.00 121.79 ? 244  PRO A CD  1 
ATOM   143  N N   . LYS A 1 19  ? 35.115 17.855 61.326  1.00 122.60 ? 245  LYS A N   1 
ATOM   144  C CA  . LYS A 1 19  ? 35.501 16.487 61.685  1.00 122.00 ? 245  LYS A CA  1 
ATOM   145  C C   . LYS A 1 19  ? 36.737 16.064 60.883  1.00 121.89 ? 245  LYS A C   1 
ATOM   146  O O   . LYS A 1 19  ? 37.335 15.018 61.147  1.00 122.04 ? 245  LYS A O   1 
ATOM   147  C CB  . LYS A 1 19  ? 34.333 15.514 61.436  1.00 121.32 ? 245  LYS A CB  1 
ATOM   148  C CG  . LYS A 1 19  ? 34.411 14.201 62.235  1.00 120.07 ? 245  LYS A CG  1 
ATOM   149  C CD  . LYS A 1 19  ? 33.081 13.443 62.229  1.00 117.83 ? 245  LYS A CD  1 
ATOM   150  C CE  . LYS A 1 19  ? 33.145 12.176 63.077  1.00 116.76 ? 245  LYS A CE  1 
ATOM   151  N NZ  . LYS A 1 19  ? 31.828 11.473 63.122  1.00 115.17 ? 245  LYS A NZ  1 
ATOM   152  N N   . THR A 1 20  ? 37.113 16.897 59.912  1.00 121.80 ? 246  THR A N   1 
ATOM   153  C CA  . THR A 1 20  ? 38.282 16.668 59.062  1.00 121.40 ? 246  THR A CA  1 
ATOM   154  C C   . THR A 1 20  ? 39.197 17.904 59.113  1.00 120.19 ? 246  THR A C   1 
ATOM   155  O O   . THR A 1 20  ? 39.052 18.835 58.318  1.00 119.46 ? 246  THR A O   1 
ATOM   156  C CB  . THR A 1 20  ? 37.860 16.401 57.589  1.00 122.00 ? 246  THR A CB  1 
ATOM   157  O OG1 . THR A 1 20  ? 37.122 17.524 57.089  1.00 121.55 ? 246  THR A OG1 1 
ATOM   158  C CG2 . THR A 1 20  ? 36.990 15.142 57.497  1.00 121.86 ? 246  THR A CG2 1 
ATOM   159  N N   . GLU A 1 21  ? 40.142 17.901 60.051  1.00 119.14 ? 247  GLU A N   1 
ATOM   160  C CA  . GLU A 1 21  ? 41.057 19.026 60.227  1.00 118.41 ? 247  GLU A CA  1 
ATOM   161  C C   . GLU A 1 21  ? 42.354 19.003 59.424  1.00 116.37 ? 247  GLU A C   1 
ATOM   162  O O   . GLU A 1 21  ? 43.428 18.771 59.989  1.00 116.00 ? 247  GLU A O   1 
ATOM   163  C CB  . GLU A 1 21  ? 41.415 19.176 61.706  1.00 120.45 ? 247  GLU A CB  1 
ATOM   164  C CG  . GLU A 1 21  ? 40.235 19.515 62.598  1.00 124.15 ? 247  GLU A CG  1 
ATOM   165  C CD  . GLU A 1 21  ? 40.540 20.661 63.553  1.00 125.86 ? 247  GLU A CD  1 
ATOM   166  O OE1 . GLU A 1 21  ? 41.571 20.586 64.258  1.00 127.33 ? 247  GLU A OE1 1 
ATOM   167  O OE2 . GLU A 1 21  ? 39.747 21.629 63.602  1.00 126.41 ? 247  GLU A OE2 1 
ATOM   168  N N   . THR A 1 22  ? 42.260 19.255 58.120  1.00 114.02 ? 248  THR A N   1 
ATOM   169  C CA  . THR A 1 22  ? 43.441 19.287 57.254  1.00 112.01 ? 248  THR A CA  1 
ATOM   170  C C   . THR A 1 22  ? 43.748 20.747 56.913  1.00 110.76 ? 248  THR A C   1 
ATOM   171  O O   . THR A 1 22  ? 42.835 21.570 56.855  1.00 110.52 ? 248  THR A O   1 
ATOM   172  C CB  . THR A 1 22  ? 43.215 18.482 55.951  1.00 111.55 ? 248  THR A CB  1 
ATOM   173  O OG1 . THR A 1 22  ? 41.894 18.728 55.453  1.00 112.20 ? 248  THR A OG1 1 
ATOM   174  C CG2 . THR A 1 22  ? 43.399 16.993 56.201  1.00 110.23 ? 248  THR A CG2 1 
ATOM   175  N N   . TYR A 1 23  ? 45.023 21.072 56.694  1.00 108.87 ? 249  TYR A N   1 
ATOM   176  C CA  . TYR A 1 23  ? 45.407 22.453 56.400  1.00 107.59 ? 249  TYR A CA  1 
ATOM   177  C C   . TYR A 1 23  ? 46.445 22.646 55.322  1.00 106.97 ? 249  TYR A C   1 
ATOM   178  O O   . TYR A 1 23  ? 47.449 21.940 55.281  1.00 106.68 ? 249  TYR A O   1 
ATOM   179  C CB  . TYR A 1 23  ? 45.944 23.149 57.651  1.00 107.37 ? 249  TYR A CB  1 
ATOM   180  C CG  . TYR A 1 23  ? 44.906 23.477 58.692  1.00 107.11 ? 249  TYR A CG  1 
ATOM   181  C CD1 . TYR A 1 23  ? 44.312 22.476 59.448  1.00 107.16 ? 249  TYR A CD1 1 
ATOM   182  C CD2 . TYR A 1 23  ? 44.524 24.789 58.924  1.00 106.77 ? 249  TYR A CD2 1 
ATOM   183  C CE1 . TYR A 1 23  ? 43.369 22.770 60.406  1.00 107.17 ? 249  TYR A CE1 1 
ATOM   184  C CE2 . TYR A 1 23  ? 43.580 25.093 59.882  1.00 107.08 ? 249  TYR A CE2 1 
ATOM   185  C CZ  . TYR A 1 23  ? 43.005 24.078 60.622  1.00 106.85 ? 249  TYR A CZ  1 
ATOM   186  O OH  . TYR A 1 23  ? 42.074 24.363 61.594  1.00 106.44 ? 249  TYR A OH  1 
ATOM   187  N N   . VAL A 1 24  ? 46.204 23.638 54.471  1.00 106.91 ? 250  VAL A N   1 
ATOM   188  C CA  . VAL A 1 24  ? 47.123 23.989 53.395  1.00 106.70 ? 250  VAL A CA  1 
ATOM   189  C C   . VAL A 1 24  ? 47.645 25.402 53.643  1.00 106.91 ? 250  VAL A C   1 
ATOM   190  O O   . VAL A 1 24  ? 47.123 26.125 54.489  1.00 106.33 ? 250  VAL A O   1 
ATOM   191  C CB  . VAL A 1 24  ? 46.434 23.939 52.015  1.00 105.80 ? 250  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 24  ? 46.333 22.503 51.527  1.00 105.05 ? 250  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 24  ? 45.056 24.548 52.111  1.00 105.99 ? 250  VAL A CG2 1 
ATOM   194  N N   . GLU A 1 25  ? 48.683 25.785 52.912  1.00 107.62 ? 251  GLU A N   1 
ATOM   195  C CA  . GLU A 1 25  ? 49.275 27.103 53.064  1.00 109.21 ? 251  GLU A CA  1 
ATOM   196  C C   . GLU A 1 25  ? 48.755 28.058 52.003  1.00 112.30 ? 251  GLU A C   1 
ATOM   197  O O   . GLU A 1 25  ? 48.516 27.658 50.858  1.00 112.08 ? 251  GLU A O   1 
ATOM   198  C CB  . GLU A 1 25  ? 50.799 26.999 52.968  1.00 107.28 ? 251  GLU A CB  1 
ATOM   199  C CG  . GLU A 1 25  ? 51.491 26.716 54.284  1.00 104.21 ? 251  GLU A CG  1 
ATOM   200  C CD  . GLU A 1 25  ? 51.616 27.957 55.131  1.00 101.95 ? 251  GLU A CD  1 
ATOM   201  O OE1 . GLU A 1 25  ? 50.612 28.684 55.269  1.00 100.67 ? 251  GLU A OE1 1 
ATOM   202  O OE2 . GLU A 1 25  ? 52.717 28.204 55.660  1.00 101.33 ? 251  GLU A OE2 1 
ATOM   203  N N   . ALA A 1 26  ? 48.588 29.322 52.390  1.00 115.94 ? 252  ALA A N   1 
ATOM   204  C CA  . ALA A 1 26  ? 48.102 30.358 51.480  1.00 120.06 ? 252  ALA A CA  1 
ATOM   205  C C   . ALA A 1 26  ? 49.269 31.140 50.853  1.00 122.93 ? 252  ALA A C   1 
ATOM   206  O O   . ALA A 1 26  ? 50.207 31.537 51.549  1.00 123.26 ? 252  ALA A O   1 
ATOM   207  C CB  . ALA A 1 26  ? 47.170 31.305 52.240  1.00 119.02 ? 252  ALA A CB  1 
ATOM   208  N N   . ASN A 1 27  ? 49.208 31.353 49.539  1.00 126.29 ? 253  ASN A N   1 
ATOM   209  C CA  . ASN A 1 27  ? 50.257 32.084 48.830  1.00 129.75 ? 253  ASN A CA  1 
ATOM   210  C C   . ASN A 1 27  ? 50.429 33.464 49.452  1.00 132.21 ? 253  ASN A C   1 
ATOM   211  O O   . ASN A 1 27  ? 49.675 33.833 50.351  1.00 132.25 ? 253  ASN A O   1 
ATOM   212  C CB  . ASN A 1 27  ? 49.914 32.186 47.328  1.00 129.79 ? 253  ASN A CB  1 
ATOM   213  C CG  . ASN A 1 27  ? 49.054 33.402 46.978  1.00 129.80 ? 253  ASN A CG  1 
ATOM   214  O OD1 . ASN A 1 27  ? 49.576 34.443 46.562  1.00 129.69 ? 253  ASN A OD1 1 
ATOM   215  N ND2 . ASN A 1 27  ? 47.742 33.274 47.139  1.00 129.02 ? 253  ASN A ND2 1 
ATOM   216  N N   . MET A 1 28  ? 51.417 34.228 48.990  1.00 135.46 ? 254  MET A N   1 
ATOM   217  C CA  . MET A 1 28  ? 51.654 35.568 49.541  1.00 138.52 ? 254  MET A CA  1 
ATOM   218  C C   . MET A 1 28  ? 50.596 36.612 49.167  1.00 140.01 ? 254  MET A C   1 
ATOM   219  O O   . MET A 1 28  ? 50.734 37.793 49.488  1.00 139.76 ? 254  MET A O   1 
ATOM   220  C CB  . MET A 1 28  ? 53.041 36.079 49.134  1.00 138.85 ? 254  MET A CB  1 
ATOM   221  C CG  . MET A 1 28  ? 54.202 35.387 49.846  1.00 140.00 ? 254  MET A CG  1 
ATOM   222  S SD  . MET A 1 28  ? 54.126 35.486 51.665  1.00 139.70 ? 254  MET A SD  1 
ATOM   223  C CE  . MET A 1 28  ? 54.056 33.720 52.114  1.00 140.06 ? 254  MET A CE  1 
ATOM   224  N N   . GLY A 1 29  ? 49.545 36.166 48.490  1.00 141.95 ? 255  GLY A N   1 
ATOM   225  C CA  . GLY A 1 29  ? 48.465 37.041 48.089  1.00 143.95 ? 255  GLY A CA  1 
ATOM   226  C C   . GLY A 1 29  ? 48.846 38.366 47.465  1.00 145.48 ? 255  GLY A C   1 
ATOM   227  O O   . GLY A 1 29  ? 48.768 39.407 48.118  1.00 145.41 ? 255  GLY A O   1 
ATOM   228  N N   . LEU A 1 30  ? 49.267 38.326 46.204  1.00 147.06 ? 256  LEU A N   1 
ATOM   229  C CA  . LEU A 1 30  ? 49.616 39.536 45.458  1.00 148.56 ? 256  LEU A CA  1 
ATOM   230  C C   . LEU A 1 30  ? 48.615 39.706 44.309  1.00 149.70 ? 256  LEU A C   1 
ATOM   231  O O   . LEU A 1 30  ? 48.678 40.678 43.553  1.00 150.51 ? 256  LEU A O   1 
ATOM   232  C CB  . LEU A 1 30  ? 51.035 39.445 44.878  1.00 147.95 ? 256  LEU A CB  1 
ATOM   233  C CG  . LEU A 1 30  ? 52.255 39.759 45.751  1.00 147.52 ? 256  LEU A CG  1 
ATOM   234  C CD1 . LEU A 1 30  ? 53.501 39.372 44.980  1.00 147.64 ? 256  LEU A CD1 1 
ATOM   235  C CD2 . LEU A 1 30  ? 52.293 41.239 46.141  1.00 147.16 ? 256  LEU A CD2 1 
ATOM   236  N N   . ASN A 1 31  ? 47.688 38.756 44.198  1.00 150.55 ? 257  ASN A N   1 
ATOM   237  C CA  . ASN A 1 31  ? 46.681 38.762 43.149  1.00 151.10 ? 257  ASN A CA  1 
ATOM   238  C C   . ASN A 1 31  ? 45.343 38.176 43.619  1.00 150.90 ? 257  ASN A C   1 
ATOM   239  O O   . ASN A 1 31  ? 45.300 37.087 44.188  1.00 151.33 ? 257  ASN A O   1 
ATOM   240  C CB  . ASN A 1 31  ? 47.224 37.998 41.919  1.00 151.45 ? 257  ASN A CB  1 
ATOM   241  C CG  . ASN A 1 31  ? 47.434 36.504 42.178  1.00 151.78 ? 257  ASN A CG  1 
ATOM   242  O OD1 . ASN A 1 31  ? 46.553 35.684 41.900  1.00 152.51 ? 257  ASN A OD1 1 
ATOM   243  N ND2 . ASN A 1 31  ? 48.614 36.148 42.707  1.00 151.29 ? 257  ASN A ND2 1 
ATOM   244  N N   . PRO A 1 32  ? 44.239 38.920 43.418  1.00 150.32 ? 258  PRO A N   1 
ATOM   245  C CA  . PRO A 1 32  ? 42.887 38.490 43.808  1.00 149.19 ? 258  PRO A CA  1 
ATOM   246  C C   . PRO A 1 32  ? 42.321 37.328 42.965  1.00 147.98 ? 258  PRO A C   1 
ATOM   247  O O   . PRO A 1 32  ? 41.126 37.028 43.041  1.00 147.82 ? 258  PRO A O   1 
ATOM   248  C CB  . PRO A 1 32  ? 42.064 39.769 43.654  1.00 149.67 ? 258  PRO A CB  1 
ATOM   249  C CG  . PRO A 1 32  ? 43.071 40.860 43.910  1.00 149.56 ? 258  PRO A CG  1 
ATOM   250  C CD  . PRO A 1 32  ? 44.263 40.369 43.133  1.00 150.16 ? 258  PRO A CD  1 
ATOM   251  N N   . SER A 1 33  ? 43.187 36.687 42.173  1.00 146.59 ? 259  SER A N   1 
ATOM   252  C CA  . SER A 1 33  ? 42.811 35.564 41.303  1.00 144.69 ? 259  SER A CA  1 
ATOM   253  C C   . SER A 1 33  ? 43.353 34.203 41.762  1.00 143.09 ? 259  SER A C   1 
ATOM   254  O O   . SER A 1 33  ? 42.906 33.159 41.278  1.00 142.65 ? 259  SER A O   1 
ATOM   255  C CB  . SER A 1 33  ? 43.294 35.812 39.864  1.00 144.80 ? 259  SER A CB  1 
ATOM   256  O OG  . SER A 1 33  ? 44.660 35.464 39.686  1.00 144.38 ? 259  SER A OG  1 
ATOM   257  N N   . SER A 1 34  ? 44.321 34.219 42.676  1.00 141.41 ? 260  SER A N   1 
ATOM   258  C CA  . SER A 1 34  ? 44.921 32.989 43.188  1.00 139.14 ? 260  SER A CA  1 
ATOM   259  C C   . SER A 1 34  ? 43.970 32.299 44.167  1.00 137.70 ? 260  SER A C   1 
ATOM   260  O O   . SER A 1 34  ? 43.301 32.963 44.971  1.00 137.43 ? 260  SER A O   1 
ATOM   261  C CB  . SER A 1 34  ? 46.265 33.290 43.879  1.00 138.31 ? 260  SER A CB  1 
ATOM   262  O OG  . SER A 1 34  ? 46.104 34.115 45.023  1.00 136.17 ? 260  SER A OG  1 
ATOM   263  N N   . PRO A 1 35  ? 43.889 30.952 44.101  1.00 135.81 ? 261  PRO A N   1 
ATOM   264  C CA  . PRO A 1 35  ? 43.020 30.157 44.981  1.00 133.12 ? 261  PRO A CA  1 
ATOM   265  C C   . PRO A 1 35  ? 43.372 30.330 46.463  1.00 130.24 ? 261  PRO A C   1 
ATOM   266  O O   . PRO A 1 35  ? 42.675 29.810 47.338  1.00 130.07 ? 261  PRO A O   1 
ATOM   267  C CB  . PRO A 1 35  ? 43.256 28.720 44.499  1.00 133.72 ? 261  PRO A CB  1 
ATOM   268  C CG  . PRO A 1 35  ? 43.603 28.897 43.045  1.00 134.35 ? 261  PRO A CG  1 
ATOM   269  C CD  . PRO A 1 35  ? 44.530 30.091 43.086  1.00 135.48 ? 261  PRO A CD  1 
ATOM   270  N N   . ASN A 1 36  ? 44.451 31.066 46.732  1.00 126.72 ? 262  ASN A N   1 
ATOM   271  C CA  . ASN A 1 36  ? 44.912 31.306 48.093  1.00 122.98 ? 262  ASN A CA  1 
ATOM   272  C C   . ASN A 1 36  ? 45.068 32.784 48.483  1.00 119.77 ? 262  ASN A C   1 
ATOM   273  O O   . ASN A 1 36  ? 45.842 33.090 49.389  1.00 119.37 ? 262  ASN A O   1 
ATOM   274  C CB  . ASN A 1 36  ? 46.246 30.583 48.324  1.00 124.18 ? 262  ASN A CB  1 
ATOM   275  C CG  . ASN A 1 36  ? 46.143 29.069 48.143  1.00 124.61 ? 262  ASN A CG  1 
ATOM   276  O OD1 . ASN A 1 36  ? 45.834 28.578 47.056  1.00 125.59 ? 262  ASN A OD1 1 
ATOM   277  N ND2 . ASN A 1 36  ? 46.412 28.327 49.209  1.00 123.70 ? 262  ASN A ND2 1 
ATOM   278  N N   . ASP A 1 37  ? 44.352 33.694 47.815  1.00 115.71 ? 263  ASP A N   1 
ATOM   279  C CA  . ASP A 1 37  ? 44.424 35.126 48.151  1.00 111.33 ? 263  ASP A CA  1 
ATOM   280  C C   . ASP A 1 37  ? 43.915 35.312 49.576  1.00 109.18 ? 263  ASP A C   1 
ATOM   281  O O   . ASP A 1 37  ? 42.746 35.065 49.860  1.00 109.82 ? 263  ASP A O   1 
ATOM   282  C CB  . ASP A 1 37  ? 43.565 35.961 47.191  1.00 109.00 ? 263  ASP A CB  1 
ATOM   283  C CG  . ASP A 1 37  ? 43.439 37.432 47.622  1.00 106.67 ? 263  ASP A CG  1 
ATOM   284  O OD1 . ASP A 1 37  ? 42.849 38.219 46.850  1.00 105.89 ? 263  ASP A OD1 1 
ATOM   285  O OD2 . ASP A 1 37  ? 43.916 37.806 48.718  1.00 102.84 ? 263  ASP A OD2 1 
ATOM   286  N N   . PRO A 1 38  ? 44.790 35.761 50.486  1.00 106.47 ? 264  PRO A N   1 
ATOM   287  C CA  . PRO A 1 38  ? 44.490 35.996 51.902  1.00 104.01 ? 264  PRO A CA  1 
ATOM   288  C C   . PRO A 1 38  ? 43.153 36.682 52.196  1.00 101.95 ? 264  PRO A C   1 
ATOM   289  O O   . PRO A 1 38  ? 42.219 36.050 52.690  1.00 101.89 ? 264  PRO A O   1 
ATOM   290  C CB  . PRO A 1 38  ? 45.686 36.816 52.365  1.00 103.94 ? 264  PRO A CB  1 
ATOM   291  C CG  . PRO A 1 38  ? 46.795 36.227 51.570  1.00 104.75 ? 264  PRO A CG  1 
ATOM   292  C CD  . PRO A 1 38  ? 46.181 36.137 50.185  1.00 105.84 ? 264  PRO A CD  1 
ATOM   293  N N   . VAL A 1 39  ? 43.068 37.975 51.910  1.00 98.98  ? 265  VAL A N   1 
ATOM   294  C CA  . VAL A 1 39  ? 41.841 38.720 52.150  1.00 96.02  ? 265  VAL A CA  1 
ATOM   295  C C   . VAL A 1 39  ? 40.630 37.872 51.781  1.00 93.31  ? 265  VAL A C   1 
ATOM   296  O O   . VAL A 1 39  ? 39.825 37.521 52.633  1.00 91.67  ? 265  VAL A O   1 
ATOM   297  C CB  . VAL A 1 39  ? 41.813 40.000 51.306  1.00 97.91  ? 265  VAL A CB  1 
ATOM   298  C CG1 . VAL A 1 39  ? 40.496 40.737 51.515  1.00 98.25  ? 265  VAL A CG1 1 
ATOM   299  C CG2 . VAL A 1 39  ? 42.999 40.878 51.669  1.00 98.46  ? 265  VAL A CG2 1 
ATOM   300  N N   . THR A 1 40  ? 40.537 37.537 50.497  1.00 91.53  ? 266  THR A N   1 
ATOM   301  C CA  . THR A 1 40  ? 39.450 36.744 49.933  1.00 89.18  ? 266  THR A CA  1 
ATOM   302  C C   . THR A 1 40  ? 39.134 35.443 50.674  1.00 87.93  ? 266  THR A C   1 
ATOM   303  O O   . THR A 1 40  ? 37.972 35.047 50.761  1.00 87.58  ? 266  THR A O   1 
ATOM   304  C CB  . THR A 1 40  ? 39.741 36.370 48.463  1.00 88.78  ? 266  THR A CB  1 
ATOM   305  O OG1 . THR A 1 40  ? 40.066 37.542 47.705  1.00 88.34  ? 266  THR A OG1 1 
ATOM   306  C CG2 . THR A 1 40  ? 38.538 35.709 47.856  1.00 88.60  ? 266  THR A CG2 1 
ATOM   307  N N   . ASN A 1 41  ? 40.163 34.768 51.181  1.00 86.79  ? 267  ASN A N   1 
ATOM   308  C CA  . ASN A 1 41  ? 39.984 33.508 51.904  1.00 85.53  ? 267  ASN A CA  1 
ATOM   309  C C   . ASN A 1 41  ? 39.269 33.666 53.244  1.00 85.16  ? 267  ASN A C   1 
ATOM   310  O O   . ASN A 1 41  ? 38.474 32.810 53.638  1.00 85.24  ? 267  ASN A O   1 
ATOM   311  C CB  . ASN A 1 41  ? 41.333 32.829 52.163  1.00 84.31  ? 267  ASN A CB  1 
ATOM   312  C CG  . ASN A 1 41  ? 41.908 32.166 50.939  1.00 82.84  ? 267  ASN A CG  1 
ATOM   313  O OD1 . ASN A 1 41  ? 41.248 31.366 50.270  1.00 82.25  ? 267  ASN A OD1 1 
ATOM   314  N ND2 . ASN A 1 41  ? 43.154 32.487 50.643  1.00 80.87  ? 267  ASN A ND2 1 
ATOM   315  N N   . ILE A 1 42  ? 39.571 34.750 53.948  1.00 84.12  ? 268  ILE A N   1 
ATOM   316  C CA  . ILE A 1 42  ? 38.946 35.020 55.231  1.00 83.24  ? 268  ILE A CA  1 
ATOM   317  C C   . ILE A 1 42  ? 37.452 35.273 55.088  1.00 84.64  ? 268  ILE A C   1 
ATOM   318  O O   . ILE A 1 42  ? 36.669 34.919 55.967  1.00 84.63  ? 268  ILE A O   1 
ATOM   319  C CB  . ILE A 1 42  ? 39.564 36.245 55.901  1.00 81.62  ? 268  ILE A CB  1 
ATOM   320  C CG1 . ILE A 1 42  ? 41.001 35.951 56.296  1.00 79.88  ? 268  ILE A CG1 1 
ATOM   321  C CG2 . ILE A 1 42  ? 38.752 36.637 57.112  1.00 80.56  ? 268  ILE A CG2 1 
ATOM   322  C CD1 . ILE A 1 42  ? 41.536 36.917 57.326  1.00 80.37  ? 268  ILE A CD1 1 
ATOM   323  N N   . CYS A 1 43  ? 37.069 35.898 53.980  1.00 86.61  ? 269  CYS A N   1 
ATOM   324  C CA  . CYS A 1 43  ? 35.676 36.206 53.691  1.00 88.61  ? 269  CYS A CA  1 
ATOM   325  C C   . CYS A 1 43  ? 34.924 34.959 53.274  1.00 89.80  ? 269  CYS A C   1 
ATOM   326  O O   . CYS A 1 43  ? 33.713 34.868 53.480  1.00 90.13  ? 269  CYS A O   1 
ATOM   327  C CB  . CYS A 1 43  ? 35.601 37.258 52.596  1.00 89.99  ? 269  CYS A CB  1 
ATOM   328  S SG  . CYS A 1 43  ? 36.521 38.736 53.039  1.00 94.30  ? 269  CYS A SG  1 
ATOM   329  N N   . GLN A 1 44  ? 35.649 34.015 52.668  1.00 91.43  ? 270  GLN A N   1 
ATOM   330  C CA  . GLN A 1 44  ? 35.088 32.723 52.262  1.00 92.27  ? 270  GLN A CA  1 
ATOM   331  C C   . GLN A 1 44  ? 34.875 31.908 53.552  1.00 91.96  ? 270  GLN A C   1 
ATOM   332  O O   . GLN A 1 44  ? 33.894 31.170 53.682  1.00 92.32  ? 270  GLN A O   1 
ATOM   333  C CB  . GLN A 1 44  ? 36.062 31.942 51.371  1.00 93.65  ? 270  GLN A CB  1 
ATOM   334  C CG  . GLN A 1 44  ? 36.377 32.516 50.004  1.00 96.70  ? 270  GLN A CG  1 
ATOM   335  C CD  . GLN A 1 44  ? 37.464 31.702 49.295  1.00 99.46  ? 270  GLN A CD  1 
ATOM   336  O OE1 . GLN A 1 44  ? 37.807 31.967 48.144  1.00 100.66 ? 270  GLN A OE1 1 
ATOM   337  N NE2 . GLN A 1 44  ? 38.011 30.704 49.993  1.00 100.38 ? 270  GLN A NE2 1 
ATOM   338  N N   . ALA A 1 45  ? 35.816 32.055 54.491  1.00 90.53  ? 271  ALA A N   1 
ATOM   339  C CA  . ALA A 1 45  ? 35.795 31.367 55.779  1.00 87.81  ? 271  ALA A CA  1 
ATOM   340  C C   . ALA A 1 45  ? 34.768 31.948 56.743  1.00 86.45  ? 271  ALA A C   1 
ATOM   341  O O   . ALA A 1 45  ? 34.205 31.215 57.548  1.00 86.59  ? 271  ALA A O   1 
ATOM   342  C CB  . ALA A 1 45  ? 37.182 31.409 56.416  1.00 86.97  ? 271  ALA A CB  1 
ATOM   343  N N   . ALA A 1 46  ? 34.526 33.256 56.670  1.00 85.29  ? 272  ALA A N   1 
ATOM   344  C CA  . ALA A 1 46  ? 33.551 33.902 57.552  1.00 84.85  ? 272  ALA A CA  1 
ATOM   345  C C   . ALA A 1 46  ? 32.102 33.666 57.092  1.00 84.24  ? 272  ALA A C   1 
ATOM   346  O O   . ALA A 1 46  ? 31.173 33.657 57.903  1.00 83.79  ? 272  ALA A O   1 
ATOM   347  C CB  . ALA A 1 46  ? 33.842 35.397 57.659  1.00 83.69  ? 272  ALA A CB  1 
ATOM   348  N N   . ASP A 1 47  ? 31.910 33.486 55.791  1.00 82.92  ? 273  ASP A N   1 
ATOM   349  C CA  . ASP A 1 47  ? 30.588 33.210 55.254  1.00 82.85  ? 273  ASP A CA  1 
ATOM   350  C C   . ASP A 1 47  ? 30.205 31.854 55.858  1.00 83.96  ? 273  ASP A C   1 
ATOM   351  O O   . ASP A 1 47  ? 29.178 31.704 56.516  1.00 83.30  ? 273  ASP A O   1 
ATOM   352  C CB  . ASP A 1 47  ? 30.683 33.096 53.738  1.00 82.19  ? 273  ASP A CB  1 
ATOM   353  C CG  . ASP A 1 47  ? 29.345 33.214 53.059  1.00 81.93  ? 273  ASP A CG  1 
ATOM   354  O OD1 . ASP A 1 47  ? 28.828 34.344 52.979  1.00 81.46  ? 273  ASP A OD1 1 
ATOM   355  O OD2 . ASP A 1 47  ? 28.812 32.176 52.606  1.00 83.11  ? 273  ASP A OD2 1 
ATOM   356  N N   . LYS A 1 48  ? 31.076 30.878 55.617  1.00 86.05  ? 274  LYS A N   1 
ATOM   357  C CA  . LYS A 1 48  ? 30.955 29.504 56.101  1.00 87.04  ? 274  LYS A CA  1 
ATOM   358  C C   . LYS A 1 48  ? 30.699 29.477 57.599  1.00 86.58  ? 274  LYS A C   1 
ATOM   359  O O   . LYS A 1 48  ? 29.643 29.037 58.047  1.00 85.89  ? 274  LYS A O   1 
ATOM   360  C CB  . LYS A 1 48  ? 32.262 28.758 55.787  1.00 89.06  ? 274  LYS A CB  1 
ATOM   361  C CG  . LYS A 1 48  ? 32.437 27.365 56.394  1.00 90.61  ? 274  LYS A CG  1 
ATOM   362  C CD  . LYS A 1 48  ? 33.907 26.920 56.274  1.00 90.62  ? 274  LYS A CD  1 
ATOM   363  C CE  . LYS A 1 48  ? 34.130 25.463 56.680  1.00 90.54  ? 274  LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 48  ? 33.713 24.500 55.617  1.00 89.37  ? 274  LYS A NZ  1 
ATOM   365  N N   . GLN A 1 49  ? 31.673 29.957 58.369  1.00 86.87  ? 275  GLN A N   1 
ATOM   366  C CA  . GLN A 1 49  ? 31.561 29.984 59.824  1.00 88.29  ? 275  GLN A CA  1 
ATOM   367  C C   . GLN A 1 49  ? 30.431 30.849 60.353  1.00 88.45  ? 275  GLN A C   1 
ATOM   368  O O   . GLN A 1 49  ? 30.192 30.889 61.564  1.00 90.09  ? 275  GLN A O   1 
ATOM   369  C CB  . GLN A 1 49  ? 32.876 30.434 60.465  1.00 88.40  ? 275  GLN A CB  1 
ATOM   370  C CG  . GLN A 1 49  ? 33.951 29.376 60.406  1.00 89.70  ? 275  GLN A CG  1 
ATOM   371  C CD  . GLN A 1 49  ? 33.469 28.040 60.936  1.00 89.85  ? 275  GLN A CD  1 
ATOM   372  O OE1 . GLN A 1 49  ? 33.066 27.932 62.096  1.00 90.90  ? 275  GLN A OE1 1 
ATOM   373  N NE2 . GLN A 1 49  ? 33.501 27.013 60.085  1.00 88.44  ? 275  GLN A NE2 1 
ATOM   374  N N   . LEU A 1 50  ? 29.747 31.557 59.463  1.00 86.81  ? 276  LEU A N   1 
ATOM   375  C CA  . LEU A 1 50  ? 28.636 32.372 59.899  1.00 84.96  ? 276  LEU A CA  1 
ATOM   376  C C   . LEU A 1 50  ? 27.468 31.396 59.965  1.00 83.83  ? 276  LEU A C   1 
ATOM   377  O O   . LEU A 1 50  ? 26.741 31.359 60.951  1.00 83.75  ? 276  LEU A O   1 
ATOM   378  C CB  . LEU A 1 50  ? 28.391 33.519 58.912  1.00 83.87  ? 276  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 50  ? 27.865 34.836 59.511  1.00 82.93  ? 276  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 50  ? 28.427 35.060 60.915  1.00 81.24  ? 276  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 50  ? 28.241 35.988 58.594  1.00 81.06  ? 276  LEU A CD2 1 
ATOM   382  N N   . PHE A 1 51  ? 27.316 30.574 58.933  1.00 83.31  ? 277  PHE A N   1 
ATOM   383  C CA  . PHE A 1 51  ? 26.247 29.582 58.926  1.00 84.33  ? 277  PHE A CA  1 
ATOM   384  C C   . PHE A 1 51  ? 26.317 28.766 60.215  1.00 84.38  ? 277  PHE A C   1 
ATOM   385  O O   . PHE A 1 51  ? 25.378 28.744 61.012  1.00 84.34  ? 277  PHE A O   1 
ATOM   386  C CB  . PHE A 1 51  ? 26.389 28.611 57.745  1.00 84.87  ? 277  PHE A CB  1 
ATOM   387  C CG  . PHE A 1 51  ? 25.964 29.179 56.425  1.00 85.89  ? 277  PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 51  ? 26.733 30.129 55.777  1.00 87.63  ? 277  PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 51  ? 24.800 28.746 55.822  1.00 86.57  ? 277  PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 51  ? 26.344 30.637 54.544  1.00 88.29  ? 277  PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 51  ? 24.405 29.248 54.592  1.00 87.57  ? 277  PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 51  ? 25.178 30.194 53.952  1.00 87.99  ? 277  PHE A CZ  1 
ATOM   393  N N   . THR A 1 52  ? 27.446 28.097 60.412  1.00 84.10  ? 278  THR A N   1 
ATOM   394  C CA  . THR A 1 52  ? 27.642 27.259 61.585  1.00 83.94  ? 278  THR A CA  1 
ATOM   395  C C   . THR A 1 52  ? 27.539 28.037 62.890  1.00 83.71  ? 278  THR A C   1 
ATOM   396  O O   . THR A 1 52  ? 27.378 27.447 63.961  1.00 84.10  ? 278  THR A O   1 
ATOM   397  C CB  . THR A 1 52  ? 29.008 26.558 61.545  1.00 84.05  ? 278  THR A CB  1 
ATOM   398  O OG1 . THR A 1 52  ? 29.997 27.398 62.158  1.00 84.64  ? 278  THR A OG1 1 
ATOM   399  C CG2 . THR A 1 52  ? 29.406 26.267 60.101  1.00 83.02  ? 278  THR A CG2 1 
ATOM   400  N N   . LEU A 1 53  ? 27.652 29.357 62.805  1.00 82.78  ? 279  LEU A N   1 
ATOM   401  C CA  . LEU A 1 53  ? 27.549 30.190 63.988  1.00 82.51  ? 279  LEU A CA  1 
ATOM   402  C C   . LEU A 1 53  ? 26.118 30.101 64.508  1.00 82.86  ? 279  LEU A C   1 
ATOM   403  O O   . LEU A 1 53  ? 25.893 29.998 65.718  1.00 82.09  ? 279  LEU A O   1 
ATOM   404  C CB  . LEU A 1 53  ? 27.901 31.635 63.650  1.00 81.66  ? 279  LEU A CB  1 
ATOM   405  C CG  . LEU A 1 53  ? 27.882 32.565 64.858  1.00 82.09  ? 279  LEU A CG  1 
ATOM   406  C CD1 . LEU A 1 53  ? 28.708 31.967 65.988  1.00 81.73  ? 279  LEU A CD1 1 
ATOM   407  C CD2 . LEU A 1 53  ? 28.406 33.922 64.443  1.00 82.39  ? 279  LEU A CD2 1 
ATOM   408  N N   . VAL A 1 54  ? 25.161 30.131 63.578  1.00 83.55  ? 280  VAL A N   1 
ATOM   409  C CA  . VAL A 1 54  ? 23.730 30.039 63.886  1.00 84.26  ? 280  VAL A CA  1 
ATOM   410  C C   . VAL A 1 54  ? 23.438 28.807 64.746  1.00 84.57  ? 280  VAL A C   1 
ATOM   411  O O   . VAL A 1 54  ? 22.818 28.904 65.808  1.00 83.07  ? 280  VAL A O   1 
ATOM   412  C CB  . VAL A 1 54  ? 22.882 29.932 62.583  1.00 84.68  ? 280  VAL A CB  1 
ATOM   413  C CG1 . VAL A 1 54  ? 21.446 29.577 62.925  1.00 85.73  ? 280  VAL A CG1 1 
ATOM   414  C CG2 . VAL A 1 54  ? 22.919 31.247 61.808  1.00 84.42  ? 280  VAL A CG2 1 
ATOM   415  N N   . GLU A 1 55  ? 23.890 27.651 64.264  1.00 85.59  ? 281  GLU A N   1 
ATOM   416  C CA  . GLU A 1 55  ? 23.700 26.378 64.954  1.00 85.67  ? 281  GLU A CA  1 
ATOM   417  C C   . GLU A 1 55  ? 24.390 26.382 66.303  1.00 83.11  ? 281  GLU A C   1 
ATOM   418  O O   . GLU A 1 55  ? 23.827 25.910 67.286  1.00 82.43  ? 281  GLU A O   1 
ATOM   419  C CB  . GLU A 1 55  ? 24.246 25.227 64.108  1.00 89.34  ? 281  GLU A CB  1 
ATOM   420  C CG  . GLU A 1 55  ? 23.630 25.133 62.722  1.00 95.27  ? 281  GLU A CG  1 
ATOM   421  C CD  . GLU A 1 55  ? 22.132 24.894 62.765  1.00 98.50  ? 281  GLU A CD  1 
ATOM   422  O OE1 . GLU A 1 55  ? 21.714 23.826 63.270  1.00 100.58 ? 281  GLU A OE1 1 
ATOM   423  O OE2 . GLU A 1 55  ? 21.379 25.777 62.291  1.00 100.50 ? 281  GLU A OE2 1 
ATOM   424  N N   . TRP A 1 56  ? 25.616 26.897 66.348  1.00 80.60  ? 282  TRP A N   1 
ATOM   425  C CA  . TRP A 1 56  ? 26.338 26.963 67.603  1.00 79.61  ? 282  TRP A CA  1 
ATOM   426  C C   . TRP A 1 56  ? 25.524 27.790 68.593  1.00 81.15  ? 282  TRP A C   1 
ATOM   427  O O   . TRP A 1 56  ? 25.515 27.513 69.795  1.00 81.75  ? 282  TRP A O   1 
ATOM   428  C CB  . TRP A 1 56  ? 27.692 27.624 67.430  1.00 76.34  ? 282  TRP A CB  1 
ATOM   429  C CG  . TRP A 1 56  ? 28.278 27.935 68.753  1.00 74.52  ? 282  TRP A CG  1 
ATOM   430  C CD1 . TRP A 1 56  ? 29.078 27.127 69.507  1.00 73.93  ? 282  TRP A CD1 1 
ATOM   431  C CD2 . TRP A 1 56  ? 28.038 29.113 69.542  1.00 73.80  ? 282  TRP A CD2 1 
ATOM   432  N NE1 . TRP A 1 56  ? 29.349 27.725 70.717  1.00 73.30  ? 282  TRP A NE1 1 
ATOM   433  C CE2 . TRP A 1 56  ? 28.723 28.943 70.764  1.00 73.19  ? 282  TRP A CE2 1 
ATOM   434  C CE3 . TRP A 1 56  ? 27.308 30.289 69.335  1.00 71.89  ? 282  TRP A CE3 1 
ATOM   435  C CZ2 . TRP A 1 56  ? 28.700 29.906 71.772  1.00 72.02  ? 282  TRP A CZ2 1 
ATOM   436  C CZ3 . TRP A 1 56  ? 27.286 31.239 70.337  1.00 71.12  ? 282  TRP A CZ3 1 
ATOM   437  C CH2 . TRP A 1 56  ? 27.977 31.043 71.540  1.00 71.18  ? 282  TRP A CH2 1 
ATOM   438  N N   . ALA A 1 57  ? 24.867 28.829 68.088  1.00 81.55  ? 283  ALA A N   1 
ATOM   439  C CA  . ALA A 1 57  ? 24.035 29.669 68.929  1.00 81.83  ? 283  ALA A CA  1 
ATOM   440  C C   . ALA A 1 57  ? 22.931 28.773 69.480  1.00 82.63  ? 283  ALA A C   1 
ATOM   441  O O   . ALA A 1 57  ? 22.835 28.571 70.687  1.00 81.46  ? 283  ALA A O   1 
ATOM   442  C CB  . ALA A 1 57  ? 23.440 30.792 68.111  1.00 82.06  ? 283  ALA A CB  1 
ATOM   443  N N   . LYS A 1 58  ? 22.108 28.237 68.579  1.00 84.17  ? 284  LYS A N   1 
ATOM   444  C CA  . LYS A 1 58  ? 21.012 27.339 68.937  1.00 86.09  ? 284  LYS A CA  1 
ATOM   445  C C   . LYS A 1 58  ? 21.393 26.389 70.071  1.00 88.83  ? 284  LYS A C   1 
ATOM   446  O O   . LYS A 1 58  ? 20.786 26.410 71.143  1.00 88.77  ? 284  LYS A O   1 
ATOM   447  C CB  . LYS A 1 58  ? 20.602 26.500 67.724  1.00 83.86  ? 284  LYS A CB  1 
ATOM   448  C CG  . LYS A 1 58  ? 19.794 27.230 66.679  1.00 81.14  ? 284  LYS A CG  1 
ATOM   449  C CD  . LYS A 1 58  ? 19.382 26.254 65.599  1.00 80.23  ? 284  LYS A CD  1 
ATOM   450  C CE  . LYS A 1 58  ? 18.359 26.851 64.658  1.00 79.36  ? 284  LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 58  ? 17.878 25.815 63.704  1.00 79.30  ? 284  LYS A NZ  1 
ATOM   452  N N   . ARG A 1 59  ? 22.401 25.557 69.813  1.00 91.81  ? 285  ARG A N   1 
ATOM   453  C CA  . ARG A 1 59  ? 22.903 24.576 70.774  1.00 94.29  ? 285  ARG A CA  1 
ATOM   454  C C   . ARG A 1 59  ? 23.445 25.164 72.087  1.00 95.55  ? 285  ARG A C   1 
ATOM   455  O O   . ARG A 1 59  ? 24.124 24.472 72.841  1.00 96.19  ? 285  ARG A O   1 
ATOM   456  C CB  . ARG A 1 59  ? 23.993 23.719 70.118  1.00 95.50  ? 285  ARG A CB  1 
ATOM   457  C CG  . ARG A 1 59  ? 23.532 22.865 68.934  1.00 98.28  ? 285  ARG A CG  1 
ATOM   458  C CD  . ARG A 1 59  ? 24.739 22.206 68.258  1.00 100.75 ? 285  ARG A CD  1 
ATOM   459  N NE  . ARG A 1 59  ? 24.389 21.391 67.094  1.00 103.21 ? 285  ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 59  ? 23.928 20.145 67.154  1.00 104.87 ? 285  ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 59  ? 23.753 19.546 68.328  1.00 105.59 ? 285  ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 59  ? 23.643 19.495 66.033  1.00 105.70 ? 285  ARG A NH2 1 
ATOM   463  N N   . ILE A 1 60  ? 23.173 26.440 72.346  1.00 97.18  ? 286  ILE A N   1 
ATOM   464  C CA  . ILE A 1 60  ? 23.589 27.092 73.584  1.00 98.95  ? 286  ILE A CA  1 
ATOM   465  C C   . ILE A 1 60  ? 22.339 27.126 74.476  1.00 101.20 ? 286  ILE A C   1 
ATOM   466  O O   . ILE A 1 60  ? 21.261 27.547 74.043  1.00 100.96 ? 286  ILE A O   1 
ATOM   467  C CB  . ILE A 1 60  ? 24.123 28.540 73.327  1.00 97.39  ? 286  ILE A CB  1 
ATOM   468  C CG1 . ILE A 1 60  ? 25.504 28.475 72.677  1.00 96.95  ? 286  ILE A CG1 1 
ATOM   469  C CG2 . ILE A 1 60  ? 24.253 29.308 74.636  1.00 95.27  ? 286  ILE A CG2 1 
ATOM   470  C CD1 . ILE A 1 60  ? 26.553 27.833 73.562  1.00 96.17  ? 286  ILE A CD1 1 
ATOM   471  N N   . PRO A 1 61  ? 22.471 26.659 75.730  1.00 102.83 ? 287  PRO A N   1 
ATOM   472  C CA  . PRO A 1 61  ? 21.367 26.622 76.694  1.00 103.15 ? 287  PRO A CA  1 
ATOM   473  C C   . PRO A 1 61  ? 20.487 27.866 76.762  1.00 103.43 ? 287  PRO A C   1 
ATOM   474  O O   . PRO A 1 61  ? 20.941 28.943 77.142  1.00 102.58 ? 287  PRO A O   1 
ATOM   475  C CB  . PRO A 1 61  ? 22.072 26.322 78.027  1.00 102.57 ? 287  PRO A CB  1 
ATOM   476  C CG  . PRO A 1 61  ? 23.502 26.730 77.791  1.00 102.10 ? 287  PRO A CG  1 
ATOM   477  C CD  . PRO A 1 61  ? 23.736 26.277 76.381  1.00 103.17 ? 287  PRO A CD  1 
ATOM   478  N N   . HIS A 1 62  ? 19.229 27.690 76.366  1.00 104.42 ? 288  HIS A N   1 
ATOM   479  C CA  . HIS A 1 62  ? 18.211 28.738 76.398  1.00 105.65 ? 288  HIS A CA  1 
ATOM   480  C C   . HIS A 1 62  ? 18.100 29.712 75.233  1.00 106.60 ? 288  HIS A C   1 
ATOM   481  O O   . HIS A 1 62  ? 17.116 30.443 75.156  1.00 106.27 ? 288  HIS A O   1 
ATOM   482  C CB  . HIS A 1 62  ? 18.326 29.541 77.698  1.00 105.58 ? 288  HIS A CB  1 
ATOM   483  C CG  . HIS A 1 62  ? 18.216 28.704 78.935  1.00 105.67 ? 288  HIS A CG  1 
ATOM   484  N ND1 . HIS A 1 62  ? 17.139 27.880 79.183  1.00 105.57 ? 288  HIS A ND1 1 
ATOM   485  C CD2 . HIS A 1 62  ? 19.057 28.551 79.985  1.00 105.10 ? 288  HIS A CD2 1 
ATOM   486  C CE1 . HIS A 1 62  ? 17.323 27.253 80.331  1.00 105.12 ? 288  HIS A CE1 1 
ATOM   487  N NE2 . HIS A 1 62  ? 18.479 27.642 80.838  1.00 104.59 ? 288  HIS A NE2 1 
ATOM   488  N N   . PHE A 1 63  ? 19.077 29.739 74.331  1.00 108.62 ? 289  PHE A N   1 
ATOM   489  C CA  . PHE A 1 63  ? 19.005 30.668 73.200  1.00 111.06 ? 289  PHE A CA  1 
ATOM   490  C C   . PHE A 1 63  ? 17.796 30.445 72.288  1.00 112.89 ? 289  PHE A C   1 
ATOM   491  O O   . PHE A 1 63  ? 17.300 31.390 71.672  1.00 113.43 ? 289  PHE A O   1 
ATOM   492  C CB  . PHE A 1 63  ? 20.273 30.608 72.346  1.00 110.93 ? 289  PHE A CB  1 
ATOM   493  C CG  . PHE A 1 63  ? 20.268 31.580 71.185  1.00 110.55 ? 289  PHE A CG  1 
ATOM   494  C CD1 . PHE A 1 63  ? 20.420 32.943 71.400  1.00 109.87 ? 289  PHE A CD1 1 
ATOM   495  C CD2 . PHE A 1 63  ? 20.109 31.128 69.879  1.00 110.06 ? 289  PHE A CD2 1 
ATOM   496  C CE1 . PHE A 1 63  ? 20.417 33.836 70.336  1.00 109.53 ? 289  PHE A CE1 1 
ATOM   497  C CE2 . PHE A 1 63  ? 20.105 32.019 68.811  1.00 108.92 ? 289  PHE A CE2 1 
ATOM   498  C CZ  . PHE A 1 63  ? 20.260 33.372 69.042  1.00 108.97 ? 289  PHE A CZ  1 
ATOM   499  N N   . SER A 1 64  ? 17.334 29.204 72.179  1.00 114.58 ? 290  SER A N   1 
ATOM   500  C CA  . SER A 1 64  ? 16.170 28.916 71.348  1.00 116.46 ? 290  SER A CA  1 
ATOM   501  C C   . SER A 1 64  ? 14.893 29.440 72.019  1.00 118.09 ? 290  SER A C   1 
ATOM   502  O O   . SER A 1 64  ? 13.933 29.810 71.333  1.00 118.14 ? 290  SER A O   1 
ATOM   503  C CB  . SER A 1 64  ? 16.052 27.410 71.099  1.00 116.48 ? 290  SER A CB  1 
ATOM   504  O OG  . SER A 1 64  ? 17.134 26.941 70.312  1.00 116.10 ? 290  SER A OG  1 
ATOM   505  N N   . GLU A 1 65  ? 14.896 29.472 73.356  1.00 119.98 ? 291  GLU A N   1 
ATOM   506  C CA  . GLU A 1 65  ? 13.762 29.959 74.155  1.00 121.72 ? 291  GLU A CA  1 
ATOM   507  C C   . GLU A 1 65  ? 13.391 31.416 73.848  1.00 122.33 ? 291  GLU A C   1 
ATOM   508  O O   . GLU A 1 65  ? 12.210 31.776 73.828  1.00 122.81 ? 291  GLU A O   1 
ATOM   509  C CB  . GLU A 1 65  ? 14.070 29.840 75.659  1.00 121.96 ? 291  GLU A CB  1 
ATOM   510  C CG  . GLU A 1 65  ? 13.617 28.533 76.312  1.00 123.20 ? 291  GLU A CG  1 
ATOM   511  C CD  . GLU A 1 65  ? 14.474 27.336 75.927  1.00 124.21 ? 291  GLU A CD  1 
ATOM   512  O OE1 . GLU A 1 65  ? 15.575 27.179 76.501  1.00 124.46 ? 291  GLU A OE1 1 
ATOM   513  O OE2 . GLU A 1 65  ? 14.047 26.552 75.048  1.00 124.44 ? 291  GLU A OE2 1 
ATOM   514  N N   . LEU A 1 66  ? 14.414 32.236 73.616  1.00 122.49 ? 292  LEU A N   1 
ATOM   515  C CA  . LEU A 1 66  ? 14.274 33.667 73.324  1.00 121.89 ? 292  LEU A CA  1 
ATOM   516  C C   . LEU A 1 66  ? 13.402 34.003 72.105  1.00 120.31 ? 292  LEU A C   1 
ATOM   517  O O   . LEU A 1 66  ? 13.251 33.188 71.189  1.00 120.12 ? 292  LEU A O   1 
ATOM   518  C CB  . LEU A 1 66  ? 15.667 34.276 73.110  1.00 123.02 ? 292  LEU A CB  1 
ATOM   519  C CG  . LEU A 1 66  ? 16.777 33.932 74.112  1.00 123.65 ? 292  LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 66  ? 18.113 34.416 73.565  1.00 124.20 ? 292  LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 66  ? 16.485 34.558 75.467  1.00 123.55 ? 292  LEU A CD2 1 
ATOM   522  N N   . PRO A 1 67  ? 12.816 35.220 72.086  1.00 118.53 ? 293  PRO A N   1 
ATOM   523  C CA  . PRO A 1 67  ? 11.965 35.671 70.975  1.00 116.93 ? 293  PRO A CA  1 
ATOM   524  C C   . PRO A 1 67  ? 12.780 35.620 69.685  1.00 115.46 ? 293  PRO A C   1 
ATOM   525  O O   . PRO A 1 67  ? 13.991 35.852 69.705  1.00 115.73 ? 293  PRO A O   1 
ATOM   526  C CB  . PRO A 1 67  ? 11.608 37.102 71.372  1.00 116.70 ? 293  PRO A CB  1 
ATOM   527  C CG  . PRO A 1 67  ? 11.595 37.037 72.871  1.00 116.83 ? 293  PRO A CG  1 
ATOM   528  C CD  . PRO A 1 67  ? 12.821 36.210 73.179  1.00 117.39 ? 293  PRO A CD  1 
ATOM   529  N N   . LEU A 1 68  ? 12.129 35.326 68.566  1.00 113.43 ? 294  LEU A N   1 
ATOM   530  C CA  . LEU A 1 68  ? 12.850 35.237 67.299  1.00 111.50 ? 294  LEU A CA  1 
ATOM   531  C C   . LEU A 1 68  ? 13.647 36.493 66.941  1.00 109.99 ? 294  LEU A C   1 
ATOM   532  O O   . LEU A 1 68  ? 14.703 36.400 66.312  1.00 109.78 ? 294  LEU A O   1 
ATOM   533  C CB  . LEU A 1 68  ? 11.886 34.897 66.160  1.00 111.42 ? 294  LEU A CB  1 
ATOM   534  C CG  . LEU A 1 68  ? 12.548 34.677 64.798  1.00 111.49 ? 294  LEU A CG  1 
ATOM   535  C CD1 . LEU A 1 68  ? 13.675 33.660 64.921  1.00 111.94 ? 294  LEU A CD1 1 
ATOM   536  C CD2 . LEU A 1 68  ? 11.505 34.198 63.805  1.00 112.39 ? 294  LEU A CD2 1 
ATOM   537  N N   . ASP A 1 69  ? 13.149 37.661 67.340  1.00 108.12 ? 295  ASP A N   1 
ATOM   538  C CA  . ASP A 1 69  ? 13.835 38.914 67.045  1.00 105.34 ? 295  ASP A CA  1 
ATOM   539  C C   . ASP A 1 69  ? 14.989 39.207 68.000  1.00 103.05 ? 295  ASP A C   1 
ATOM   540  O O   . ASP A 1 69  ? 15.968 39.832 67.609  1.00 102.34 ? 295  ASP A O   1 
ATOM   541  C CB  . ASP A 1 69  ? 12.845 40.088 67.039  1.00 105.68 ? 295  ASP A CB  1 
ATOM   542  C CG  . ASP A 1 69  ? 11.844 40.012 65.883  1.00 105.37 ? 295  ASP A CG  1 
ATOM   543  O OD1 . ASP A 1 69  ? 12.163 39.396 64.839  1.00 104.21 ? 295  ASP A OD1 1 
ATOM   544  O OD2 . ASP A 1 69  ? 10.743 40.589 66.017  1.00 105.47 ? 295  ASP A OD2 1 
ATOM   545  N N   . ASP A 1 70  ? 14.882 38.763 69.247  1.00 101.70 ? 296  ASP A N   1 
ATOM   546  C CA  . ASP A 1 70  ? 15.959 38.980 70.213  1.00 101.34 ? 296  ASP A CA  1 
ATOM   547  C C   . ASP A 1 70  ? 17.129 38.029 69.942  1.00 99.71  ? 296  ASP A C   1 
ATOM   548  O O   . ASP A 1 70  ? 18.243 38.224 70.434  1.00 99.09  ? 296  ASP A O   1 
ATOM   549  C CB  . ASP A 1 70  ? 15.439 38.798 71.642  1.00 103.22 ? 296  ASP A CB  1 
ATOM   550  C CG  . ASP A 1 70  ? 14.626 39.994 72.124  1.00 105.06 ? 296  ASP A CG  1 
ATOM   551  O OD1 . ASP A 1 70  ? 13.702 40.412 71.391  1.00 106.69 ? 296  ASP A OD1 1 
ATOM   552  O OD2 . ASP A 1 70  ? 14.909 40.512 73.232  1.00 105.05 ? 296  ASP A OD2 1 
ATOM   553  N N   . GLN A 1 71  ? 16.859 36.989 69.162  1.00 97.61  ? 297  GLN A N   1 
ATOM   554  C CA  . GLN A 1 71  ? 17.888 36.041 68.780  1.00 95.25  ? 297  GLN A CA  1 
ATOM   555  C C   . GLN A 1 71  ? 18.713 36.763 67.712  1.00 93.03  ? 297  GLN A C   1 
ATOM   556  O O   . GLN A 1 71  ? 19.924 36.930 67.866  1.00 92.62  ? 297  GLN A O   1 
ATOM   557  C CB  . GLN A 1 71  ? 17.254 34.771 68.195  1.00 96.51  ? 297  GLN A CB  1 
ATOM   558  C CG  . GLN A 1 71  ? 16.490 33.901 69.205  1.00 96.76  ? 297  GLN A CG  1 
ATOM   559  C CD  . GLN A 1 71  ? 15.853 32.662 68.569  1.00 96.87  ? 297  GLN A CD  1 
ATOM   560  O OE1 . GLN A 1 71  ? 16.502 31.920 67.829  1.00 96.91  ? 297  GLN A OE1 1 
ATOM   561  N NE2 . GLN A 1 71  ? 14.581 32.433 68.869  1.00 96.59  ? 297  GLN A NE2 1 
ATOM   562  N N   . VAL A 1 72  ? 18.031 37.208 66.650  1.00 90.00  ? 298  VAL A N   1 
ATOM   563  C CA  . VAL A 1 72  ? 18.645 37.927 65.525  1.00 85.83  ? 298  VAL A CA  1 
ATOM   564  C C   . VAL A 1 72  ? 19.437 39.145 65.970  1.00 84.32  ? 298  VAL A C   1 
ATOM   565  O O   . VAL A 1 72  ? 20.480 39.460 65.407  1.00 83.38  ? 298  VAL A O   1 
ATOM   566  C CB  . VAL A 1 72  ? 17.589 38.424 64.516  1.00 84.04  ? 298  VAL A CB  1 
ATOM   567  C CG1 . VAL A 1 72  ? 18.257 39.272 63.454  1.00 83.31  ? 298  VAL A CG1 1 
ATOM   568  C CG2 . VAL A 1 72  ? 16.879 37.251 63.871  1.00 83.24  ? 298  VAL A CG2 1 
ATOM   569  N N   . ILE A 1 73  ? 18.912 39.845 66.965  1.00 83.11  ? 299  ILE A N   1 
ATOM   570  C CA  . ILE A 1 73  ? 19.569 41.023 67.500  1.00 82.06  ? 299  ILE A CA  1 
ATOM   571  C C   . ILE A 1 73  ? 20.915 40.609 68.074  1.00 81.75  ? 299  ILE A C   1 
ATOM   572  O O   . ILE A 1 73  ? 21.959 41.099 67.651  1.00 82.54  ? 299  ILE A O   1 
ATOM   573  C CB  . ILE A 1 73  ? 18.723 41.655 68.615  1.00 81.62  ? 299  ILE A CB  1 
ATOM   574  C CG1 . ILE A 1 73  ? 17.416 42.178 68.030  1.00 81.54  ? 299  ILE A CG1 1 
ATOM   575  C CG2 . ILE A 1 73  ? 19.499 42.766 69.300  1.00 81.74  ? 299  ILE A CG2 1 
ATOM   576  C CD1 . ILE A 1 73  ? 16.390 42.542 69.075  1.00 83.47  ? 299  ILE A CD1 1 
ATOM   577  N N   . LEU A 1 74  ? 20.878 39.693 69.034  1.00 80.44  ? 300  LEU A N   1 
ATOM   578  C CA  . LEU A 1 74  ? 22.082 39.200 69.684  1.00 79.32  ? 300  LEU A CA  1 
ATOM   579  C C   . LEU A 1 74  ? 23.101 38.620 68.701  1.00 79.88  ? 300  LEU A C   1 
ATOM   580  O O   . LEU A 1 74  ? 24.305 38.653 68.964  1.00 80.10  ? 300  LEU A O   1 
ATOM   581  C CB  . LEU A 1 74  ? 21.697 38.152 70.725  1.00 77.91  ? 300  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 74  ? 20.856 38.711 71.866  1.00 74.90  ? 300  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 74  ? 20.212 37.581 72.623  1.00 73.34  ? 300  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 74  ? 21.729 39.563 72.768  1.00 73.16  ? 300  LEU A CD2 1 
ATOM   585  N N   . LEU A 1 75  ? 22.623 38.076 67.581  1.00 79.67  ? 301  LEU A N   1 
ATOM   586  C CA  . LEU A 1 75  ? 23.514 37.523 66.566  1.00 79.45  ? 301  LEU A CA  1 
ATOM   587  C C   . LEU A 1 75  ? 24.018 38.654 65.679  1.00 79.94  ? 301  LEU A C   1 
ATOM   588  O O   . LEU A 1 75  ? 25.222 38.884 65.583  1.00 79.69  ? 301  LEU A O   1 
ATOM   589  C CB  . LEU A 1 75  ? 22.792 36.478 65.711  1.00 79.95  ? 301  LEU A CB  1 
ATOM   590  C CG  . LEU A 1 75  ? 22.640 35.070 66.301  1.00 79.84  ? 301  LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 75  ? 22.308 34.100 65.176  1.00 79.07  ? 301  LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 75  ? 23.931 34.638 66.987  1.00 78.28  ? 301  LEU A CD2 1 
ATOM   593  N N   . ARG A 1 76  ? 23.080 39.349 65.034  1.00 81.24  ? 302  ARG A N   1 
ATOM   594  C CA  . ARG A 1 76  ? 23.366 40.496 64.170  1.00 82.04  ? 302  ARG A CA  1 
ATOM   595  C C   . ARG A 1 76  ? 24.524 41.316 64.744  1.00 80.73  ? 302  ARG A C   1 
ATOM   596  O O   . ARG A 1 76  ? 25.473 41.654 64.039  1.00 80.92  ? 302  ARG A O   1 
ATOM   597  C CB  . ARG A 1 76  ? 22.121 41.387 64.077  1.00 84.65  ? 302  ARG A CB  1 
ATOM   598  C CG  . ARG A 1 76  ? 21.437 41.425 62.720  1.00 89.42  ? 302  ARG A CG  1 
ATOM   599  C CD  . ARG A 1 76  ? 21.531 42.824 62.122  1.00 94.32  ? 302  ARG A CD  1 
ATOM   600  N NE  . ARG A 1 76  ? 21.204 43.852 63.114  1.00 99.25  ? 302  ARG A NE  1 
ATOM   601  C CZ  . ARG A 1 76  ? 21.151 45.162 62.871  1.00 101.12 ? 302  ARG A CZ  1 
ATOM   602  N NH1 . ARG A 1 76  ? 21.401 45.638 61.652  1.00 101.50 ? 302  ARG A NH1 1 
ATOM   603  N NH2 . ARG A 1 76  ? 20.851 46.004 63.857  1.00 101.53 ? 302  ARG A NH2 1 
ATOM   604  N N   . ALA A 1 77  ? 24.425 41.632 66.031  1.00 78.88  ? 303  ALA A N   1 
ATOM   605  C CA  . ALA A 1 77  ? 25.440 42.401 66.731  1.00 77.68  ? 303  ALA A CA  1 
ATOM   606  C C   . ALA A 1 77  ? 26.241 41.512 67.681  1.00 77.29  ? 303  ALA A C   1 
ATOM   607  O O   . ALA A 1 77  ? 26.176 41.669 68.904  1.00 78.09  ? 303  ALA A O   1 
ATOM   608  C CB  . ALA A 1 77  ? 24.779 43.527 67.505  1.00 78.80  ? 303  ALA A CB  1 
ATOM   609  N N   . GLY A 1 78  ? 27.001 40.580 67.113  1.00 76.08  ? 304  GLY A N   1 
ATOM   610  C CA  . GLY A 1 78  ? 27.800 39.677 67.927  1.00 73.53  ? 304  GLY A CA  1 
ATOM   611  C C   . GLY A 1 78  ? 28.604 38.706 67.084  1.00 71.72  ? 304  GLY A C   1 
ATOM   612  O O   . GLY A 1 78  ? 29.711 38.319 67.459  1.00 70.68  ? 304  GLY A O   1 
ATOM   613  N N   . TRP A 1 79  ? 28.046 38.325 65.936  1.00 69.60  ? 305  TRP A N   1 
ATOM   614  C CA  . TRP A 1 79  ? 28.685 37.399 65.007  1.00 68.29  ? 305  TRP A CA  1 
ATOM   615  C C   . TRP A 1 79  ? 30.165 37.683 64.829  1.00 66.65  ? 305  TRP A C   1 
ATOM   616  O O   . TRP A 1 79  ? 30.985 36.779 64.678  1.00 65.44  ? 305  TRP A O   1 
ATOM   617  C CB  . TRP A 1 79  ? 28.011 37.488 63.637  1.00 69.80  ? 305  TRP A CB  1 
ATOM   618  C CG  . TRP A 1 79  ? 28.259 38.793 62.920  1.00 70.87  ? 305  TRP A CG  1 
ATOM   619  C CD1 . TRP A 1 79  ? 27.525 39.941 63.016  1.00 71.15  ? 305  TRP A CD1 1 
ATOM   620  C CD2 . TRP A 1 79  ? 29.336 39.083 62.021  1.00 71.24  ? 305  TRP A CD2 1 
ATOM   621  N NE1 . TRP A 1 79  ? 28.074 40.923 62.230  1.00 71.49  ? 305  TRP A NE1 1 
ATOM   622  C CE2 . TRP A 1 79  ? 29.189 40.423 61.609  1.00 71.81  ? 305  TRP A CE2 1 
ATOM   623  C CE3 . TRP A 1 79  ? 30.412 38.339 61.525  1.00 71.36  ? 305  TRP A CE3 1 
ATOM   624  C CZ2 . TRP A 1 79  ? 30.078 41.034 60.725  1.00 71.50  ? 305  TRP A CZ2 1 
ATOM   625  C CZ3 . TRP A 1 79  ? 31.294 38.947 60.648  1.00 71.52  ? 305  TRP A CZ3 1 
ATOM   626  C CH2 . TRP A 1 79  ? 31.121 40.281 60.257  1.00 71.39  ? 305  TRP A CH2 1 
ATOM   627  N N   . ASN A 1 80  ? 30.489 38.963 64.833  1.00 66.61  ? 306  ASN A N   1 
ATOM   628  C CA  . ASN A 1 80  ? 31.841 39.413 64.659  1.00 66.91  ? 306  ASN A CA  1 
ATOM   629  C C   . ASN A 1 80  ? 32.730 38.823 65.743  1.00 65.60  ? 306  ASN A C   1 
ATOM   630  O O   . ASN A 1 80  ? 33.479 37.877 65.490  1.00 64.49  ? 306  ASN A O   1 
ATOM   631  C CB  . ASN A 1 80  ? 31.862 40.937 64.719  1.00 68.99  ? 306  ASN A CB  1 
ATOM   632  C CG  . ASN A 1 80  ? 33.099 41.517 64.092  1.00 71.01  ? 306  ASN A CG  1 
ATOM   633  O OD1 . ASN A 1 80  ? 33.379 41.282 62.909  1.00 70.70  ? 306  ASN A OD1 1 
ATOM   634  N ND2 . ASN A 1 80  ? 33.856 42.277 64.876  1.00 70.88  ? 306  ASN A ND2 1 
ATOM   635  N N   . GLU A 1 81  ? 32.631 39.376 66.951  1.00 64.61  ? 307  GLU A N   1 
ATOM   636  C CA  . GLU A 1 81  ? 33.432 38.912 68.077  1.00 63.60  ? 307  GLU A CA  1 
ATOM   637  C C   . GLU A 1 81  ? 33.280 37.417 68.318  1.00 62.27  ? 307  GLU A C   1 
ATOM   638  O O   . GLU A 1 81  ? 34.123 36.798 68.961  1.00 60.29  ? 307  GLU A O   1 
ATOM   639  C CB  . GLU A 1 81  ? 33.066 39.700 69.323  1.00 64.51  ? 307  GLU A CB  1 
ATOM   640  C CG  . GLU A 1 81  ? 33.348 41.162 69.159  1.00 68.08  ? 307  GLU A CG  1 
ATOM   641  C CD  . GLU A 1 81  ? 32.752 41.986 70.264  1.00 71.31  ? 307  GLU A CD  1 
ATOM   642  O OE1 . GLU A 1 81  ? 33.303 41.973 71.388  1.00 71.80  ? 307  GLU A OE1 1 
ATOM   643  O OE2 . GLU A 1 81  ? 31.719 42.642 70.006  1.00 72.79  ? 307  GLU A OE2 1 
ATOM   644  N N   . LEU A 1 82  ? 32.197 36.841 67.807  1.00 62.28  ? 308  LEU A N   1 
ATOM   645  C CA  . LEU A 1 82  ? 31.975 35.410 67.931  1.00 62.27  ? 308  LEU A CA  1 
ATOM   646  C C   . LEU A 1 82  ? 33.040 34.721 67.075  1.00 61.48  ? 308  LEU A C   1 
ATOM   647  O O   . LEU A 1 82  ? 34.027 34.204 67.601  1.00 63.92  ? 308  LEU A O   1 
ATOM   648  C CB  . LEU A 1 82  ? 30.573 35.023 67.432  1.00 62.05  ? 308  LEU A CB  1 
ATOM   649  C CG  . LEU A 1 82  ? 29.334 35.476 68.225  1.00 61.41  ? 308  LEU A CG  1 
ATOM   650  C CD1 . LEU A 1 82  ? 28.113 34.689 67.728  1.00 58.79  ? 308  LEU A CD1 1 
ATOM   651  C CD2 . LEU A 1 82  ? 29.534 35.251 69.726  1.00 57.35  ? 308  LEU A CD2 1 
ATOM   652  N N   . LEU A 1 83  ? 32.845 34.740 65.758  1.00 58.59  ? 309  LEU A N   1 
ATOM   653  C CA  . LEU A 1 83  ? 33.782 34.136 64.820  1.00 55.38  ? 309  LEU A CA  1 
ATOM   654  C C   . LEU A 1 83  ? 35.253 34.441 65.096  1.00 54.68  ? 309  LEU A C   1 
ATOM   655  O O   . LEU A 1 83  ? 36.114 33.600 64.841  1.00 53.42  ? 309  LEU A O   1 
ATOM   656  C CB  . LEU A 1 83  ? 33.438 34.579 63.409  1.00 54.27  ? 309  LEU A CB  1 
ATOM   657  C CG  . LEU A 1 83  ? 32.067 34.080 62.984  1.00 54.78  ? 309  LEU A CG  1 
ATOM   658  C CD1 . LEU A 1 83  ? 31.943 34.180 61.480  1.00 54.00  ? 309  LEU A CD1 1 
ATOM   659  C CD2 . LEU A 1 83  ? 31.900 32.632 63.425  1.00 55.51  ? 309  LEU A CD2 1 
ATOM   660  N N   . ILE A 1 84  ? 35.537 35.643 65.601  1.00 53.88  ? 310  ILE A N   1 
ATOM   661  C CA  . ILE A 1 84  ? 36.901 36.056 65.918  1.00 53.25  ? 310  ILE A CA  1 
ATOM   662  C C   . ILE A 1 84  ? 37.530 35.175 66.977  1.00 54.47  ? 310  ILE A C   1 
ATOM   663  O O   . ILE A 1 84  ? 38.523 34.506 66.722  1.00 55.70  ? 310  ILE A O   1 
ATOM   664  C CB  . ILE A 1 84  ? 36.968 37.519 66.431  1.00 52.66  ? 310  ILE A CB  1 
ATOM   665  C CG1 . ILE A 1 84  ? 36.708 38.488 65.280  1.00 51.64  ? 310  ILE A CG1 1 
ATOM   666  C CG2 . ILE A 1 84  ? 38.348 37.815 67.050  1.00 51.44  ? 310  ILE A CG2 1 
ATOM   667  C CD1 . ILE A 1 84  ? 37.059 39.920 65.635  1.00 52.15  ? 310  ILE A CD1 1 
ATOM   668  N N   . ALA A 1 85  ? 36.949 35.185 68.172  1.00 56.09  ? 311  ALA A N   1 
ATOM   669  C CA  . ALA A 1 85  ? 37.455 34.392 69.292  1.00 56.60  ? 311  ALA A CA  1 
ATOM   670  C C   . ALA A 1 85  ? 37.505 32.908 68.985  1.00 56.21  ? 311  ALA A C   1 
ATOM   671  O O   . ALA A 1 85  ? 38.296 32.184 69.571  1.00 56.07  ? 311  ALA A O   1 
ATOM   672  C CB  . ALA A 1 85  ? 36.600 34.619 70.507  1.00 58.29  ? 311  ALA A CB  1 
ATOM   673  N N   . SER A 1 86  ? 36.632 32.461 68.089  1.00 56.90  ? 312  SER A N   1 
ATOM   674  C CA  . SER A 1 86  ? 36.582 31.072 67.670  1.00 57.68  ? 312  SER A CA  1 
ATOM   675  C C   . SER A 1 86  ? 37.952 30.718 67.075  1.00 58.52  ? 312  SER A C   1 
ATOM   676  O O   . SER A 1 86  ? 38.697 29.894 67.631  1.00 57.67  ? 312  SER A O   1 
ATOM   677  C CB  . SER A 1 86  ? 35.479 30.900 66.615  1.00 58.34  ? 312  SER A CB  1 
ATOM   678  O OG  . SER A 1 86  ? 35.365 29.560 66.166  1.00 58.54  ? 312  SER A OG  1 
ATOM   679  N N   . PHE A 1 87  ? 38.288 31.365 65.957  1.00 59.34  ? 313  PHE A N   1 
ATOM   680  C CA  . PHE A 1 87  ? 39.562 31.123 65.278  1.00 60.01  ? 313  PHE A CA  1 
ATOM   681  C C   . PHE A 1 87  ? 40.796 31.551 66.086  1.00 59.32  ? 313  PHE A C   1 
ATOM   682  O O   . PHE A 1 87  ? 41.903 31.086 65.835  1.00 59.99  ? 313  PHE A O   1 
ATOM   683  C CB  . PHE A 1 87  ? 39.570 31.795 63.890  1.00 61.02  ? 313  PHE A CB  1 
ATOM   684  C CG  . PHE A 1 87  ? 39.738 33.293 63.922  1.00 63.40  ? 313  PHE A CG  1 
ATOM   685  C CD1 . PHE A 1 87  ? 40.882 33.880 64.458  1.00 64.75  ? 313  PHE A CD1 1 
ATOM   686  C CD2 . PHE A 1 87  ? 38.775 34.115 63.377  1.00 64.12  ? 313  PHE A CD2 1 
ATOM   687  C CE1 . PHE A 1 87  ? 41.065 35.258 64.452  1.00 64.24  ? 313  PHE A CE1 1 
ATOM   688  C CE2 . PHE A 1 87  ? 38.951 35.493 63.365  1.00 65.54  ? 313  PHE A CE2 1 
ATOM   689  C CZ  . PHE A 1 87  ? 40.104 36.063 63.907  1.00 64.29  ? 313  PHE A CZ  1 
ATOM   690  N N   . SER A 1 88  ? 40.624 32.448 67.042  1.00 58.53  ? 314  SER A N   1 
ATOM   691  C CA  . SER A 1 88  ? 41.755 32.854 67.846  1.00 58.58  ? 314  SER A CA  1 
ATOM   692  C C   . SER A 1 88  ? 42.174 31.608 68.642  1.00 59.32  ? 314  SER A C   1 
ATOM   693  O O   . SER A 1 88  ? 43.315 31.158 68.541  1.00 59.47  ? 314  SER A O   1 
ATOM   694  C CB  . SER A 1 88  ? 41.352 34.001 68.784  1.00 59.83  ? 314  SER A CB  1 
ATOM   695  O OG  . SER A 1 88  ? 40.935 35.152 68.061  1.00 58.00  ? 314  SER A OG  1 
ATOM   696  N N   . HIS A 1 89  ? 41.234 31.054 69.416  1.00 59.72  ? 315  HIS A N   1 
ATOM   697  C CA  . HIS A 1 89  ? 41.437 29.842 70.230  1.00 59.53  ? 315  HIS A CA  1 
ATOM   698  C C   . HIS A 1 89  ? 41.961 28.696 69.353  1.00 58.43  ? 315  HIS A C   1 
ATOM   699  O O   . HIS A 1 89  ? 42.973 28.044 69.658  1.00 55.79  ? 315  HIS A O   1 
ATOM   700  C CB  . HIS A 1 89  ? 40.098 29.431 70.866  1.00 61.03  ? 315  HIS A CB  1 
ATOM   701  C CG  . HIS A 1 89  ? 40.144 28.139 71.628  1.00 63.11  ? 315  HIS A CG  1 
ATOM   702  N ND1 . HIS A 1 89  ? 39.442 27.017 71.232  1.00 63.01  ? 315  HIS A ND1 1 
ATOM   703  C CD2 . HIS A 1 89  ? 40.785 27.798 72.775  1.00 62.31  ? 315  HIS A CD2 1 
ATOM   704  C CE1 . HIS A 1 89  ? 39.648 26.044 72.103  1.00 63.63  ? 315  HIS A CE1 1 
ATOM   705  N NE2 . HIS A 1 89  ? 40.458 26.492 73.049  1.00 63.65  ? 315  HIS A NE2 1 
ATOM   706  N N   . ARG A 1 90  ? 41.237 28.454 68.266  1.00 56.03  ? 316  ARG A N   1 
ATOM   707  C CA  . ARG A 1 90  ? 41.597 27.428 67.310  1.00 53.62  ? 316  ARG A CA  1 
ATOM   708  C C   . ARG A 1 90  ? 43.091 27.522 66.925  1.00 53.46  ? 316  ARG A C   1 
ATOM   709  O O   . ARG A 1 90  ? 43.822 26.533 66.974  1.00 55.35  ? 316  ARG A O   1 
ATOM   710  C CB  . ARG A 1 90  ? 40.713 27.590 66.079  1.00 50.82  ? 316  ARG A CB  1 
ATOM   711  C CG  . ARG A 1 90  ? 40.875 26.531 65.035  1.00 49.66  ? 316  ARG A CG  1 
ATOM   712  C CD  . ARG A 1 90  ? 40.208 26.977 63.766  1.00 51.90  ? 316  ARG A CD  1 
ATOM   713  N NE  . ARG A 1 90  ? 38.857 27.466 64.021  1.00 56.25  ? 316  ARG A NE  1 
ATOM   714  C CZ  . ARG A 1 90  ? 38.142 28.175 63.150  1.00 58.13  ? 316  ARG A CZ  1 
ATOM   715  N NH1 . ARG A 1 90  ? 38.647 28.479 61.965  1.00 58.33  ? 316  ARG A NH1 1 
ATOM   716  N NH2 . ARG A 1 90  ? 36.922 28.586 63.461  1.00 58.91  ? 316  ARG A NH2 1 
ATOM   717  N N   . SER A 1 91  ? 43.548 28.720 66.575  1.00 53.24  ? 317  SER A N   1 
ATOM   718  C CA  . SER A 1 91  ? 44.931 28.939 66.149  1.00 52.33  ? 317  SER A CA  1 
ATOM   719  C C   . SER A 1 91  ? 46.040 28.896 67.203  1.00 52.87  ? 317  SER A C   1 
ATOM   720  O O   . SER A 1 91  ? 47.176 29.284 66.911  1.00 51.77  ? 317  SER A O   1 
ATOM   721  C CB  . SER A 1 91  ? 45.018 30.263 65.391  1.00 50.77  ? 317  SER A CB  1 
ATOM   722  O OG  . SER A 1 91  ? 44.119 30.269 64.298  1.00 47.33  ? 317  SER A OG  1 
ATOM   723  N N   . ILE A 1 92  ? 45.727 28.431 68.412  1.00 54.48  ? 318  ILE A N   1 
ATOM   724  C CA  . ILE A 1 92  ? 46.737 28.331 69.473  1.00 55.87  ? 318  ILE A CA  1 
ATOM   725  C C   . ILE A 1 92  ? 47.710 27.205 69.169  1.00 57.04  ? 318  ILE A C   1 
ATOM   726  O O   . ILE A 1 92  ? 48.837 27.216 69.661  1.00 56.98  ? 318  ILE A O   1 
ATOM   727  C CB  . ILE A 1 92  ? 46.142 27.977 70.850  1.00 56.25  ? 318  ILE A CB  1 
ATOM   728  C CG1 . ILE A 1 92  ? 44.984 28.911 71.208  1.00 58.48  ? 318  ILE A CG1 1 
ATOM   729  C CG2 . ILE A 1 92  ? 47.243 28.067 71.898  1.00 53.30  ? 318  ILE A CG2 1 
ATOM   730  C CD1 . ILE A 1 92  ? 44.171 28.461 72.422  1.00 57.96  ? 318  ILE A CD1 1 
ATOM   731  N N   . ALA A 1 93  ? 47.244 26.239 68.370  1.00 58.32  ? 319  ALA A N   1 
ATOM   732  C CA  . ALA A 1 93  ? 47.991 25.045 67.967  1.00 59.48  ? 319  ALA A CA  1 
ATOM   733  C C   . ALA A 1 93  ? 49.037 25.243 66.879  1.00 61.35  ? 319  ALA A C   1 
ATOM   734  O O   . ALA A 1 93  ? 49.401 24.288 66.192  1.00 63.68  ? 319  ALA A O   1 
ATOM   735  C CB  . ALA A 1 93  ? 47.019 23.975 67.521  1.00 59.20  ? 319  ALA A CB  1 
ATOM   736  N N   . VAL A 1 94  ? 49.506 26.478 66.725  1.00 62.72  ? 320  VAL A N   1 
ATOM   737  C CA  . VAL A 1 94  ? 50.523 26.857 65.741  1.00 62.35  ? 320  VAL A CA  1 
ATOM   738  C C   . VAL A 1 94  ? 51.075 28.201 66.220  1.00 63.17  ? 320  VAL A C   1 
ATOM   739  O O   . VAL A 1 94  ? 50.419 28.891 67.007  1.00 64.43  ? 320  VAL A O   1 
ATOM   740  C CB  . VAL A 1 94  ? 49.909 27.069 64.320  1.00 61.54  ? 320  VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 94  ? 49.442 25.736 63.718  1.00 59.13  ? 320  VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 94  ? 48.743 28.061 64.405  1.00 61.39  ? 320  VAL A CG2 1 
ATOM   743  N N   . LYS A 1 95  ? 52.273 28.577 65.780  1.00 63.35  ? 321  LYS A N   1 
ATOM   744  C CA  . LYS A 1 95  ? 52.809 29.876 66.182  1.00 63.76  ? 321  LYS A CA  1 
ATOM   745  C C   . LYS A 1 95  ? 52.860 30.826 64.985  1.00 64.62  ? 321  LYS A C   1 
ATOM   746  O O   . LYS A 1 95  ? 53.072 30.394 63.844  1.00 65.24  ? 321  LYS A O   1 
ATOM   747  C CB  . LYS A 1 95  ? 54.208 29.757 66.791  1.00 61.56  ? 321  LYS A CB  1 
ATOM   748  C CG  . LYS A 1 95  ? 54.471 30.821 67.848  1.00 61.56  ? 321  LYS A CG  1 
ATOM   749  C CD  . LYS A 1 95  ? 55.942 31.152 67.974  1.00 62.85  ? 321  LYS A CD  1 
ATOM   750  C CE  . LYS A 1 95  ? 56.203 32.015 69.204  1.00 64.99  ? 321  LYS A CE  1 
ATOM   751  N NZ  . LYS A 1 95  ? 57.660 32.337 69.369  1.00 66.47  ? 321  LYS A NZ  1 
ATOM   752  N N   . ASP A 1 96  ? 52.644 32.115 65.258  1.00 65.22  ? 322  ASP A N   1 
ATOM   753  C CA  . ASP A 1 96  ? 52.660 33.180 64.244  1.00 64.67  ? 322  ASP A CA  1 
ATOM   754  C C   . ASP A 1 96  ? 51.843 32.855 63.003  1.00 61.92  ? 322  ASP A C   1 
ATOM   755  O O   . ASP A 1 96  ? 52.211 33.228 61.890  1.00 60.84  ? 322  ASP A O   1 
ATOM   756  C CB  . ASP A 1 96  ? 54.103 33.516 63.832  1.00 67.91  ? 322  ASP A CB  1 
ATOM   757  C CG  . ASP A 1 96  ? 54.851 34.290 64.909  1.00 70.82  ? 322  ASP A CG  1 
ATOM   758  O OD1 . ASP A 1 96  ? 54.350 35.369 65.303  1.00 72.39  ? 322  ASP A OD1 1 
ATOM   759  O OD2 . ASP A 1 96  ? 55.929 33.824 65.357  1.00 71.23  ? 322  ASP A OD2 1 
ATOM   760  N N   . GLY A 1 97  ? 50.729 32.165 63.204  1.00 58.41  ? 323  GLY A N   1 
ATOM   761  C CA  . GLY A 1 97  ? 49.891 31.815 62.089  1.00 55.60  ? 323  GLY A CA  1 
ATOM   762  C C   . GLY A 1 97  ? 48.462 31.717 62.550  1.00 54.88  ? 323  GLY A C   1 
ATOM   763  O O   . GLY A 1 97  ? 48.193 31.629 63.749  1.00 53.13  ? 323  GLY A O   1 
ATOM   764  N N   . ILE A 1 98  ? 47.551 31.740 61.584  1.00 54.83  ? 324  ILE A N   1 
ATOM   765  C CA  . ILE A 1 98  ? 46.126 31.648 61.838  1.00 55.00  ? 324  ILE A CA  1 
ATOM   766  C C   . ILE A 1 98  ? 45.541 30.540 61.006  1.00 57.03  ? 324  ILE A C   1 
ATOM   767  O O   . ILE A 1 98  ? 45.696 30.498 59.789  1.00 56.34  ? 324  ILE A O   1 
ATOM   768  C CB  . ILE A 1 98  ? 45.388 32.928 61.461  1.00 54.54  ? 324  ILE A CB  1 
ATOM   769  C CG1 . ILE A 1 98  ? 45.383 33.901 62.635  1.00 53.63  ? 324  ILE A CG1 1 
ATOM   770  C CG2 . ILE A 1 98  ? 43.955 32.593 61.071  1.00 54.65  ? 324  ILE A CG2 1 
ATOM   771  C CD1 . ILE A 1 98  ? 44.344 33.581 63.656  1.00 53.79  ? 324  ILE A CD1 1 
ATOM   772  N N   . LEU A 1 99  ? 44.841 29.653 61.689  1.00 60.67  ? 325  LEU A N   1 
ATOM   773  C CA  . LEU A 1 99  ? 44.209 28.511 61.067  1.00 63.24  ? 325  LEU A CA  1 
ATOM   774  C C   . LEU A 1 99  ? 42.766 28.859 60.708  1.00 63.42  ? 325  LEU A C   1 
ATOM   775  O O   . LEU A 1 99  ? 41.974 29.247 61.569  1.00 62.15  ? 325  LEU A O   1 
ATOM   776  C CB  . LEU A 1 99  ? 44.272 27.327 62.044  1.00 65.01  ? 325  LEU A CB  1 
ATOM   777  C CG  . LEU A 1 99  ? 45.667 27.047 62.640  1.00 65.52  ? 325  LEU A CG  1 
ATOM   778  C CD1 . LEU A 1 99  ? 45.557 26.193 63.901  1.00 65.59  ? 325  LEU A CD1 1 
ATOM   779  C CD2 . LEU A 1 99  ? 46.543 26.370 61.593  1.00 66.60  ? 325  LEU A CD2 1 
ATOM   780  N N   . LEU A 1 100 ? 42.443 28.720 59.427  1.00 65.30  ? 326  LEU A N   1 
ATOM   781  C CA  . LEU A 1 100 ? 41.106 29.011 58.923  1.00 68.72  ? 326  LEU A CA  1 
ATOM   782  C C   . LEU A 1 100 ? 40.116 27.857 58.936  1.00 71.26  ? 326  LEU A C   1 
ATOM   783  O O   . LEU A 1 100 ? 40.484 26.683 58.941  1.00 71.56  ? 326  LEU A O   1 
ATOM   784  C CB  . LEU A 1 100 ? 41.168 29.537 57.498  1.00 67.65  ? 326  LEU A CB  1 
ATOM   785  C CG  . LEU A 1 100 ? 41.743 30.937 57.408  1.00 69.55  ? 326  LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 100 ? 41.211 31.594 56.136  1.00 69.20  ? 326  LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 100 ? 41.355 31.735 58.663  1.00 67.58  ? 326  LEU A CD2 1 
ATOM   788  N N   . ALA A 1 101 ? 38.841 28.225 58.909  1.00 73.89  ? 327  ALA A N   1 
ATOM   789  C CA  . ALA A 1 101 ? 37.758 27.262 58.902  1.00 75.74  ? 327  ALA A CA  1 
ATOM   790  C C   . ALA A 1 101 ? 37.694 26.569 57.540  1.00 76.85  ? 327  ALA A C   1 
ATOM   791  O O   . ALA A 1 101 ? 37.144 25.470 57.421  1.00 77.41  ? 327  ALA A O   1 
ATOM   792  C CB  . ALA A 1 101 ? 36.455 27.964 59.202  1.00 76.76  ? 327  ALA A CB  1 
ATOM   793  N N   . THR A 1 102 ? 38.246 27.222 56.517  1.00 77.28  ? 328  THR A N   1 
ATOM   794  C CA  . THR A 1 102 ? 38.293 26.659 55.169  1.00 77.41  ? 328  THR A CA  1 
ATOM   795  C C   . THR A 1 102 ? 39.458 25.653 55.057  1.00 77.46  ? 328  THR A C   1 
ATOM   796  O O   . THR A 1 102 ? 39.681 25.056 53.997  1.00 77.18  ? 328  THR A O   1 
ATOM   797  C CB  . THR A 1 102 ? 38.459 27.775 54.097  1.00 76.79  ? 328  THR A CB  1 
ATOM   798  O OG1 . THR A 1 102 ? 39.338 28.797 54.587  1.00 76.54  ? 328  THR A OG1 1 
ATOM   799  C CG2 . THR A 1 102 ? 37.119 28.386 53.753  1.00 76.47  ? 328  THR A CG2 1 
ATOM   800  N N   . GLY A 1 103 ? 40.180 25.463 56.162  1.00 76.22  ? 329  GLY A N   1 
ATOM   801  C CA  . GLY A 1 103 ? 41.303 24.542 56.183  1.00 74.36  ? 329  GLY A CA  1 
ATOM   802  C C   . GLY A 1 103 ? 42.471 25.161 55.457  1.00 72.33  ? 329  GLY A C   1 
ATOM   803  O O   . GLY A 1 103 ? 43.001 24.599 54.498  1.00 72.24  ? 329  GLY A O   1 
ATOM   804  N N   . LEU A 1 104 ? 42.884 26.325 55.933  1.00 70.96  ? 330  LEU A N   1 
ATOM   805  C CA  . LEU A 1 104 ? 43.965 27.052 55.301  1.00 70.35  ? 330  LEU A CA  1 
ATOM   806  C C   . LEU A 1 104 ? 44.727 27.839 56.350  1.00 68.61  ? 330  LEU A C   1 
ATOM   807  O O   . LEU A 1 104 ? 44.169 28.705 57.009  1.00 68.93  ? 330  LEU A O   1 
ATOM   808  C CB  . LEU A 1 104 ? 43.371 28.007 54.255  1.00 71.62  ? 330  LEU A CB  1 
ATOM   809  C CG  . LEU A 1 104 ? 44.261 28.839 53.328  1.00 72.42  ? 330  LEU A CG  1 
ATOM   810  C CD1 . LEU A 1 104 ? 44.764 27.984 52.175  1.00 72.35  ? 330  LEU A CD1 1 
ATOM   811  C CD2 . LEU A 1 104 ? 43.456 30.005 52.785  1.00 73.50  ? 330  LEU A CD2 1 
ATOM   812  N N   . HIS A 1 105 ? 46.001 27.531 56.523  1.00 67.07  ? 331  HIS A N   1 
ATOM   813  C CA  . HIS A 1 105 ? 46.793 28.265 57.490  1.00 65.92  ? 331  HIS A CA  1 
ATOM   814  C C   . HIS A 1 105 ? 47.219 29.577 56.846  1.00 66.49  ? 331  HIS A C   1 
ATOM   815  O O   . HIS A 1 105 ? 47.478 29.632 55.637  1.00 67.52  ? 331  HIS A O   1 
ATOM   816  C CB  . HIS A 1 105 ? 48.020 27.452 57.895  1.00 62.73  ? 331  HIS A CB  1 
ATOM   817  C CG  . HIS A 1 105 ? 49.020 28.221 58.700  1.00 60.04  ? 331  HIS A CG  1 
ATOM   818  N ND1 . HIS A 1 105 ? 50.248 28.591 58.199  1.00 59.75  ? 331  HIS A ND1 1 
ATOM   819  C CD2 . HIS A 1 105 ? 48.992 28.656 59.983  1.00 60.00  ? 331  HIS A CD2 1 
ATOM   820  C CE1 . HIS A 1 105 ? 50.938 29.214 59.139  1.00 59.56  ? 331  HIS A CE1 1 
ATOM   821  N NE2 . HIS A 1 105 ? 50.198 29.265 60.232  1.00 59.15  ? 331  HIS A NE2 1 
ATOM   822  N N   . VAL A 1 106 ? 47.270 30.637 57.646  1.00 66.09  ? 332  VAL A N   1 
ATOM   823  C CA  . VAL A 1 106 ? 47.676 31.942 57.148  1.00 66.63  ? 332  VAL A CA  1 
ATOM   824  C C   . VAL A 1 106 ? 48.834 32.512 57.941  1.00 67.50  ? 332  VAL A C   1 
ATOM   825  O O   . VAL A 1 106 ? 48.649 32.992 59.059  1.00 66.86  ? 332  VAL A O   1 
ATOM   826  C CB  . VAL A 1 106 ? 46.551 32.940 57.223  1.00 66.34  ? 332  VAL A CB  1 
ATOM   827  C CG1 . VAL A 1 106 ? 47.068 34.306 56.799  1.00 65.07  ? 332  VAL A CG1 1 
ATOM   828  C CG2 . VAL A 1 106 ? 45.408 32.483 56.341  1.00 66.19  ? 332  VAL A CG2 1 
ATOM   829  N N   . HIS A 1 107 ? 50.024 32.484 57.349  1.00 68.32  ? 333  HIS A N   1 
ATOM   830  C CA  . HIS A 1 107 ? 51.195 32.977 58.047  1.00 69.97  ? 333  HIS A CA  1 
ATOM   831  C C   . HIS A 1 107 ? 51.136 34.476 58.289  1.00 69.49  ? 333  HIS A C   1 
ATOM   832  O O   . HIS A 1 107 ? 50.384 35.184 57.629  1.00 70.66  ? 333  HIS A O   1 
ATOM   833  C CB  . HIS A 1 107 ? 52.479 32.620 57.282  1.00 72.15  ? 333  HIS A CB  1 
ATOM   834  C CG  . HIS A 1 107 ? 53.726 32.821 58.093  1.00 75.64  ? 333  HIS A CG  1 
ATOM   835  N ND1 . HIS A 1 107 ? 53.890 32.275 59.350  1.00 77.48  ? 333  HIS A ND1 1 
ATOM   836  C CD2 . HIS A 1 107 ? 54.835 33.561 57.862  1.00 76.61  ? 333  HIS A CD2 1 
ATOM   837  C CE1 . HIS A 1 107 ? 55.042 32.674 59.860  1.00 76.48  ? 333  HIS A CE1 1 
ATOM   838  N NE2 . HIS A 1 107 ? 55.635 33.457 58.977  1.00 76.69  ? 333  HIS A NE2 1 
ATOM   839  N N   . ARG A 1 108 ? 51.913 34.940 59.264  1.00 68.24  ? 334  ARG A N   1 
ATOM   840  C CA  . ARG A 1 108 ? 52.015 36.353 59.605  1.00 67.75  ? 334  ARG A CA  1 
ATOM   841  C C   . ARG A 1 108 ? 52.626 37.156 58.442  1.00 68.00  ? 334  ARG A C   1 
ATOM   842  O O   . ARG A 1 108 ? 52.362 38.353 58.288  1.00 67.91  ? 334  ARG A O   1 
ATOM   843  C CB  . ARG A 1 108 ? 52.875 36.505 60.861  1.00 67.37  ? 334  ARG A CB  1 
ATOM   844  C CG  . ARG A 1 108 ? 53.615 37.820 60.960  1.00 67.67  ? 334  ARG A CG  1 
ATOM   845  C CD  . ARG A 1 108 ? 54.270 37.945 62.306  1.00 69.59  ? 334  ARG A CD  1 
ATOM   846  N NE  . ARG A 1 108 ? 54.992 39.202 62.453  1.00 72.07  ? 334  ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 108 ? 55.358 39.701 63.628  1.00 74.78  ? 334  ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 108 ? 55.060 39.041 64.742  1.00 75.82  ? 334  ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 108 ? 56.014 40.855 63.694  1.00 75.76  ? 334  ARG A NH2 1 
ATOM   850  N N   . ASN A 1 109 ? 53.440 36.486 57.627  1.00 68.00  ? 335  ASN A N   1 
ATOM   851  C CA  . ASN A 1 109 ? 54.084 37.105 56.475  1.00 67.11  ? 335  ASN A CA  1 
ATOM   852  C C   . ASN A 1 109 ? 53.089 37.392 55.367  1.00 66.41  ? 335  ASN A C   1 
ATOM   853  O O   . ASN A 1 109 ? 53.109 38.478 54.785  1.00 67.24  ? 335  ASN A O   1 
ATOM   854  C CB  . ASN A 1 109 ? 55.192 36.204 55.936  1.00 66.83  ? 335  ASN A CB  1 
ATOM   855  C CG  . ASN A 1 109 ? 56.375 36.116 56.874  1.00 66.23  ? 335  ASN A CG  1 
ATOM   856  O OD1 . ASN A 1 109 ? 56.481 36.878 57.844  1.00 65.92  ? 335  ASN A OD1 1 
ATOM   857  N ND2 . ASN A 1 109 ? 57.284 35.192 56.583  1.00 65.99  ? 335  ASN A ND2 1 
ATOM   858  N N   . SER A 1 110 ? 52.232 36.418 55.064  1.00 65.23  ? 336  SER A N   1 
ATOM   859  C CA  . SER A 1 110 ? 51.211 36.604 54.033  1.00 65.90  ? 336  SER A CA  1 
ATOM   860  C C   . SER A 1 110 ? 50.243 37.708 54.441  1.00 65.10  ? 336  SER A C   1 
ATOM   861  O O   . SER A 1 110 ? 49.489 38.218 53.611  1.00 64.36  ? 336  SER A O   1 
ATOM   862  C CB  . SER A 1 110 ? 50.416 35.318 53.802  1.00 66.99  ? 336  SER A CB  1 
ATOM   863  O OG  . SER A 1 110 ? 51.194 34.336 53.148  1.00 71.35  ? 336  SER A OG  1 
ATOM   864  N N   . ALA A 1 111 ? 50.264 38.053 55.728  1.00 64.92  ? 337  ALA A N   1 
ATOM   865  C CA  . ALA A 1 111 ? 49.420 39.104 56.286  1.00 64.64  ? 337  ALA A CA  1 
ATOM   866  C C   . ALA A 1 111 ? 49.974 40.461 55.869  1.00 63.83  ? 337  ALA A C   1 
ATOM   867  O O   . ALA A 1 111 ? 49.395 41.152 55.027  1.00 63.65  ? 337  ALA A O   1 
ATOM   868  C CB  . ALA A 1 111 ? 49.393 39.001 57.805  1.00 64.65  ? 337  ALA A CB  1 
ATOM   869  N N   . HIS A 1 112 ? 51.098 40.839 56.469  1.00 62.11  ? 338  HIS A N   1 
ATOM   870  C CA  . HIS A 1 112 ? 51.730 42.101 56.136  1.00 60.47  ? 338  HIS A CA  1 
ATOM   871  C C   . HIS A 1 112 ? 51.800 42.242 54.618  1.00 58.60  ? 338  HIS A C   1 
ATOM   872  O O   . HIS A 1 112 ? 51.429 43.274 54.070  1.00 58.18  ? 338  HIS A O   1 
ATOM   873  C CB  . HIS A 1 112 ? 53.125 42.160 56.752  1.00 60.41  ? 338  HIS A CB  1 
ATOM   874  C CG  . HIS A 1 112 ? 53.116 42.175 58.247  1.00 61.59  ? 338  HIS A CG  1 
ATOM   875  N ND1 . HIS A 1 112 ? 53.477 43.284 58.982  1.00 63.92  ? 338  HIS A ND1 1 
ATOM   876  C CD2 . HIS A 1 112 ? 52.755 41.229 59.147  1.00 60.66  ? 338  HIS A CD2 1 
ATOM   877  C CE1 . HIS A 1 112 ? 53.337 43.021 60.270  1.00 63.56  ? 338  HIS A CE1 1 
ATOM   878  N NE2 . HIS A 1 112 ? 52.900 41.780 60.397  1.00 61.24  ? 338  HIS A NE2 1 
ATOM   879  N N   . SER A 1 113 ? 52.243 41.191 53.938  1.00 56.33  ? 339  SER A N   1 
ATOM   880  C CA  . SER A 1 113 ? 52.349 41.222 52.490  1.00 55.26  ? 339  SER A CA  1 
ATOM   881  C C   . SER A 1 113 ? 51.033 41.584 51.797  1.00 54.73  ? 339  SER A C   1 
ATOM   882  O O   . SER A 1 113 ? 51.046 42.074 50.662  1.00 55.64  ? 339  SER A O   1 
ATOM   883  C CB  . SER A 1 113 ? 52.842 39.880 51.969  1.00 55.08  ? 339  SER A CB  1 
ATOM   884  O OG  . SER A 1 113 ? 51.771 38.967 51.854  1.00 57.43  ? 339  SER A OG  1 
ATOM   885  N N   . ALA A 1 114 ? 49.908 41.326 52.467  1.00 54.24  ? 340  ALA A N   1 
ATOM   886  C CA  . ALA A 1 114 ? 48.578 41.647 51.933  1.00 53.54  ? 340  ALA A CA  1 
ATOM   887  C C   . ALA A 1 114 ? 47.989 42.879 52.622  1.00 53.57  ? 340  ALA A C   1 
ATOM   888  O O   . ALA A 1 114 ? 46.772 43.045 52.663  1.00 54.22  ? 340  ALA A O   1 
ATOM   889  C CB  . ALA A 1 114 ? 47.634 40.468 52.090  1.00 49.92  ? 340  ALA A CB  1 
ATOM   890  N N   . GLY A 1 115 ? 48.863 43.720 53.178  1.00 53.21  ? 341  GLY A N   1 
ATOM   891  C CA  . GLY A 1 115 ? 48.448 44.953 53.826  1.00 52.58  ? 341  GLY A CA  1 
ATOM   892  C C   . GLY A 1 115 ? 47.854 44.923 55.225  1.00 52.85  ? 341  GLY A C   1 
ATOM   893  O O   . GLY A 1 115 ? 48.000 45.898 55.972  1.00 54.73  ? 341  GLY A O   1 
ATOM   894  N N   . VAL A 1 116 ? 47.193 43.824 55.591  1.00 50.86  ? 342  VAL A N   1 
ATOM   895  C CA  . VAL A 1 116 ? 46.547 43.697 56.908  1.00 47.14  ? 342  VAL A CA  1 
ATOM   896  C C   . VAL A 1 116 ? 47.412 43.125 58.045  1.00 45.42  ? 342  VAL A C   1 
ATOM   897  O O   . VAL A 1 116 ? 46.933 42.387 58.899  1.00 42.79  ? 342  VAL A O   1 
ATOM   898  C CB  . VAL A 1 116 ? 45.287 42.843 56.788  1.00 44.64  ? 342  VAL A CB  1 
ATOM   899  C CG1 . VAL A 1 116 ? 44.431 43.352 55.668  1.00 43.86  ? 342  VAL A CG1 1 
ATOM   900  C CG2 . VAL A 1 116 ? 45.658 41.422 56.510  1.00 44.95  ? 342  VAL A CG2 1 
ATOM   901  N N   . GLY A 1 117 ? 48.683 43.489 58.069  1.00 44.14  ? 343  GLY A N   1 
ATOM   902  C CA  . GLY A 1 117 ? 49.542 42.980 59.110  1.00 44.67  ? 343  GLY A CA  1 
ATOM   903  C C   . GLY A 1 117 ? 49.166 43.438 60.502  1.00 45.51  ? 343  GLY A C   1 
ATOM   904  O O   . GLY A 1 117 ? 48.878 42.621 61.361  1.00 45.59  ? 343  GLY A O   1 
ATOM   905  N N   . ALA A 1 118 ? 49.177 44.747 60.719  1.00 47.72  ? 344  ALA A N   1 
ATOM   906  C CA  . ALA A 1 118 ? 48.863 45.353 62.017  1.00 48.59  ? 344  ALA A CA  1 
ATOM   907  C C   . ALA A 1 118 ? 47.795 44.685 62.882  1.00 49.56  ? 344  ALA A C   1 
ATOM   908  O O   . ALA A 1 118 ? 48.032 44.456 64.071  1.00 48.81  ? 344  ALA A O   1 
ATOM   909  C CB  . ALA A 1 118 ? 48.497 46.810 61.814  1.00 48.70  ? 344  ALA A CB  1 
ATOM   910  N N   . ILE A 1 119 ? 46.624 44.410 62.295  1.00 49.76  ? 345  ILE A N   1 
ATOM   911  C CA  . ILE A 1 119 ? 45.482 43.777 62.989  1.00 52.01  ? 345  ILE A CA  1 
ATOM   912  C C   . ILE A 1 119 ? 45.721 42.295 63.319  1.00 54.17  ? 345  ILE A C   1 
ATOM   913  O O   . ILE A 1 119 ? 45.245 41.767 64.343  1.00 53.60  ? 345  ILE A O   1 
ATOM   914  C CB  . ILE A 1 119 ? 44.173 43.897 62.135  1.00 51.52  ? 345  ILE A CB  1 
ATOM   915  C CG1 . ILE A 1 119 ? 43.003 43.181 62.833  1.00 49.69  ? 345  ILE A CG1 1 
ATOM   916  C CG2 . ILE A 1 119 ? 44.403 43.338 60.725  1.00 50.52  ? 345  ILE A CG2 1 
ATOM   917  C CD1 . ILE A 1 119 ? 42.551 43.811 64.146  1.00 45.25  ? 345  ILE A CD1 1 
ATOM   918  N N   . PHE A 1 120 ? 46.450 41.644 62.418  1.00 55.34  ? 346  PHE A N   1 
ATOM   919  C CA  . PHE A 1 120 ? 46.839 40.254 62.535  1.00 54.99  ? 346  PHE A CA  1 
ATOM   920  C C   . PHE A 1 120 ? 47.677 40.170 63.805  1.00 54.55  ? 346  PHE A C   1 
ATOM   921  O O   . PHE A 1 120 ? 47.375 39.401 64.704  1.00 55.09  ? 346  PHE A O   1 
ATOM   922  C CB  . PHE A 1 120 ? 47.678 39.886 61.308  1.00 56.11  ? 346  PHE A CB  1 
ATOM   923  C CG  . PHE A 1 120 ? 48.065 38.442 61.235  1.00 56.19  ? 346  PHE A CG  1 
ATOM   924  C CD1 . PHE A 1 120 ? 49.004 37.910 62.108  1.00 56.96  ? 346  PHE A CD1 1 
ATOM   925  C CD2 . PHE A 1 120 ? 47.501 37.616 60.273  1.00 54.55  ? 346  PHE A CD2 1 
ATOM   926  C CE1 . PHE A 1 120 ? 49.375 36.573 62.021  1.00 56.94  ? 346  PHE A CE1 1 
ATOM   927  C CE2 . PHE A 1 120 ? 47.864 36.284 60.179  1.00 55.71  ? 346  PHE A CE2 1 
ATOM   928  C CZ  . PHE A 1 120 ? 48.804 35.760 61.053  1.00 56.39  ? 346  PHE A CZ  1 
ATOM   929  N N   . ASP A 1 121 ? 48.719 40.989 63.871  1.00 53.78  ? 347  ASP A N   1 
ATOM   930  C CA  . ASP A 1 121 ? 49.603 41.023 65.018  1.00 55.53  ? 347  ASP A CA  1 
ATOM   931  C C   . ASP A 1 121 ? 48.864 41.335 66.316  1.00 56.40  ? 347  ASP A C   1 
ATOM   932  O O   . ASP A 1 121 ? 49.279 40.885 67.380  1.00 57.30  ? 347  ASP A O   1 
ATOM   933  C CB  . ASP A 1 121 ? 50.714 42.053 64.787  1.00 56.86  ? 347  ASP A CB  1 
ATOM   934  C CG  . ASP A 1 121 ? 51.731 41.609 63.731  1.00 56.70  ? 347  ASP A CG  1 
ATOM   935  O OD1 . ASP A 1 121 ? 51.394 40.781 62.858  1.00 56.06  ? 347  ASP A OD1 1 
ATOM   936  O OD2 . ASP A 1 121 ? 52.875 42.112 63.772  1.00 58.05  ? 347  ASP A OD2 1 
ATOM   937  N N   . ARG A 1 122 ? 47.777 42.101 66.242  1.00 58.47  ? 348  ARG A N   1 
ATOM   938  C CA  . ARG A 1 122 ? 47.003 42.440 67.445  1.00 60.12  ? 348  ARG A CA  1 
ATOM   939  C C   . ARG A 1 122 ? 46.197 41.229 67.911  1.00 58.45  ? 348  ARG A C   1 
ATOM   940  O O   . ARG A 1 122 ? 45.998 41.018 69.110  1.00 56.71  ? 348  ARG A O   1 
ATOM   941  C CB  . ARG A 1 122 ? 46.058 43.625 67.183  1.00 64.11  ? 348  ARG A CB  1 
ATOM   942  C CG  . ARG A 1 122 ? 45.509 44.277 68.467  1.00 69.05  ? 348  ARG A CG  1 
ATOM   943  C CD  . ARG A 1 122 ? 44.679 45.532 68.176  1.00 73.55  ? 348  ARG A CD  1 
ATOM   944  N NE  . ARG A 1 122 ? 44.159 46.169 69.393  1.00 78.12  ? 348  ARG A NE  1 
ATOM   945  C CZ  . ARG A 1 122 ? 43.493 47.327 69.411  1.00 80.43  ? 348  ARG A CZ  1 
ATOM   946  N NH1 . ARG A 1 122 ? 43.262 47.979 68.276  1.00 82.32  ? 348  ARG A NH1 1 
ATOM   947  N NH2 . ARG A 1 122 ? 43.064 47.847 70.560  1.00 80.22  ? 348  ARG A NH2 1 
ATOM   948  N N   . VAL A 1 123 ? 45.718 40.446 66.950  1.00 57.04  ? 349  VAL A N   1 
ATOM   949  C CA  . VAL A 1 123 ? 44.981 39.235 67.265  1.00 56.07  ? 349  VAL A CA  1 
ATOM   950  C C   . VAL A 1 123 ? 45.986 38.319 67.966  1.00 55.54  ? 349  VAL A C   1 
ATOM   951  O O   . VAL A 1 123 ? 45.780 37.897 69.096  1.00 55.29  ? 349  VAL A O   1 
ATOM   952  C CB  . VAL A 1 123 ? 44.452 38.555 65.980  1.00 55.71  ? 349  VAL A CB  1 
ATOM   953  C CG1 . VAL A 1 123 ? 43.860 37.196 66.307  1.00 54.59  ? 349  VAL A CG1 1 
ATOM   954  C CG2 . VAL A 1 123 ? 43.405 39.437 65.325  1.00 54.11  ? 349  VAL A CG2 1 
ATOM   955  N N   . LEU A 1 124 ? 47.094 38.044 67.296  1.00 54.45  ? 350  LEU A N   1 
ATOM   956  C CA  . LEU A 1 124 ? 48.125 37.194 67.863  1.00 54.02  ? 350  LEU A CA  1 
ATOM   957  C C   . LEU A 1 124 ? 48.481 37.591 69.294  1.00 54.00  ? 350  LEU A C   1 
ATOM   958  O O   . LEU A 1 124 ? 48.335 36.808 70.224  1.00 53.61  ? 350  LEU A O   1 
ATOM   959  C CB  . LEU A 1 124 ? 49.403 37.242 67.005  1.00 54.80  ? 350  LEU A CB  1 
ATOM   960  C CG  . LEU A 1 124 ? 49.440 36.732 65.550  1.00 54.52  ? 350  LEU A CG  1 
ATOM   961  C CD1 . LEU A 1 124 ? 50.897 36.706 65.042  1.00 50.52  ? 350  LEU A CD1 1 
ATOM   962  C CD2 . LEU A 1 124 ? 48.805 35.336 65.468  1.00 52.15  ? 350  LEU A CD2 1 
ATOM   963  N N   . THR A 1 125 ? 48.940 38.817 69.472  1.00 54.17  ? 351  THR A N   1 
ATOM   964  C CA  . THR A 1 125 ? 49.353 39.261 70.788  1.00 55.56  ? 351  THR A CA  1 
ATOM   965  C C   . THR A 1 125 ? 48.268 39.521 71.815  1.00 57.69  ? 351  THR A C   1 
ATOM   966  O O   . THR A 1 125 ? 48.564 39.598 73.007  1.00 57.48  ? 351  THR A O   1 
ATOM   967  C CB  . THR A 1 125 ? 50.186 40.523 70.678  1.00 55.15  ? 351  THR A CB  1 
ATOM   968  O OG1 . THR A 1 125 ? 51.164 40.340 69.649  1.00 56.82  ? 351  THR A OG1 1 
ATOM   969  C CG2 . THR A 1 125 ? 50.883 40.820 72.011  1.00 53.41  ? 351  THR A CG2 1 
ATOM   970  N N   . GLU A 1 126 ? 47.018 39.648 71.377  1.00 59.15  ? 352  GLU A N   1 
ATOM   971  C CA  . GLU A 1 126 ? 45.932 39.947 72.312  1.00 59.25  ? 352  GLU A CA  1 
ATOM   972  C C   . GLU A 1 126 ? 44.966 38.803 72.637  1.00 58.64  ? 352  GLU A C   1 
ATOM   973  O O   . GLU A 1 126 ? 44.460 38.700 73.755  1.00 58.16  ? 352  GLU A O   1 
ATOM   974  C CB  . GLU A 1 126 ? 45.141 41.164 71.806  1.00 58.71  ? 352  GLU A CB  1 
ATOM   975  C CG  . GLU A 1 126 ? 45.972 42.431 71.648  1.00 56.80  ? 352  GLU A CG  1 
ATOM   976  C CD  . GLU A 1 126 ? 46.952 42.657 72.797  1.00 57.47  ? 352  GLU A CD  1 
ATOM   977  O OE1 . GLU A 1 126 ? 46.544 42.628 73.980  1.00 57.59  ? 352  GLU A OE1 1 
ATOM   978  O OE2 . GLU A 1 126 ? 48.145 42.876 72.509  1.00 58.86  ? 352  GLU A OE2 1 
ATOM   979  N N   . LEU A 1 127 ? 44.696 37.958 71.657  1.00 58.30  ? 353  LEU A N   1 
ATOM   980  C CA  . LEU A 1 127 ? 43.799 36.837 71.869  1.00 59.48  ? 353  LEU A CA  1 
ATOM   981  C C   . LEU A 1 127 ? 44.612 35.537 71.962  1.00 60.77  ? 353  LEU A C   1 
ATOM   982  O O   . LEU A 1 127 ? 44.876 35.035 73.067  1.00 61.37  ? 353  LEU A O   1 
ATOM   983  C CB  . LEU A 1 127 ? 42.767 36.750 70.730  1.00 58.18  ? 353  LEU A CB  1 
ATOM   984  C CG  . LEU A 1 127 ? 41.908 38.005 70.526  1.00 58.68  ? 353  LEU A CG  1 
ATOM   985  C CD1 . LEU A 1 127 ? 40.701 37.703 69.618  1.00 56.56  ? 353  LEU A CD1 1 
ATOM   986  C CD2 . LEU A 1 127 ? 41.461 38.518 71.888  1.00 56.32  ? 353  LEU A CD2 1 
ATOM   987  N N   . VAL A 1 128 ? 45.013 35.014 70.801  1.00 60.00  ? 354  VAL A N   1 
ATOM   988  C CA  . VAL A 1 128 ? 45.797 33.781 70.695  1.00 58.13  ? 354  VAL A CA  1 
ATOM   989  C C   . VAL A 1 128 ? 46.918 33.689 71.725  1.00 57.47  ? 354  VAL A C   1 
ATOM   990  O O   . VAL A 1 128 ? 46.869 32.855 72.617  1.00 56.09  ? 354  VAL A O   1 
ATOM   991  C CB  . VAL A 1 128 ? 46.419 33.639 69.292  1.00 56.97  ? 354  VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 128 ? 47.207 32.351 69.202  1.00 56.64  ? 354  VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 128 ? 45.333 33.671 68.237  1.00 57.21  ? 354  VAL A CG2 1 
ATOM   994  N N   . SER A 1 129 ? 47.932 34.534 71.599  1.00 57.81  ? 355  SER A N   1 
ATOM   995  C CA  . SER A 1 129 ? 49.026 34.504 72.551  1.00 59.20  ? 355  SER A CA  1 
ATOM   996  C C   . SER A 1 129 ? 48.436 34.380 73.948  1.00 60.67  ? 355  SER A C   1 
ATOM   997  O O   . SER A 1 129 ? 48.697 33.400 74.643  1.00 62.50  ? 355  SER A O   1 
ATOM   998  C CB  . SER A 1 129 ? 49.864 35.779 72.453  1.00 60.61  ? 355  SER A CB  1 
ATOM   999  O OG  . SER A 1 129 ? 50.877 35.811 73.449  1.00 60.77  ? 355  SER A OG  1 
ATOM   1000 N N   . LYS A 1 130 ? 47.620 35.358 74.341  1.00 60.11  ? 356  LYS A N   1 
ATOM   1001 C CA  . LYS A 1 130 ? 46.991 35.373 75.660  1.00 59.16  ? 356  LYS A CA  1 
ATOM   1002 C C   . LYS A 1 130 ? 46.296 34.094 76.120  1.00 61.02  ? 356  LYS A C   1 
ATOM   1003 O O   . LYS A 1 130 ? 46.427 33.694 77.283  1.00 60.70  ? 356  LYS A O   1 
ATOM   1004 C CB  . LYS A 1 130 ? 46.024 36.540 75.741  1.00 56.48  ? 356  LYS A CB  1 
ATOM   1005 C CG  . LYS A 1 130 ? 46.745 37.792 76.139  1.00 56.06  ? 356  LYS A CG  1 
ATOM   1006 C CD  . LYS A 1 130 ? 47.582 37.480 77.372  1.00 55.86  ? 356  LYS A CD  1 
ATOM   1007 C CE  . LYS A 1 130 ? 48.306 38.694 77.931  1.00 56.13  ? 356  LYS A CE  1 
ATOM   1008 N NZ  . LYS A 1 130 ? 48.945 38.342 79.236  1.00 58.97  ? 356  LYS A NZ  1 
ATOM   1009 N N   . MET A 1 131 ? 45.553 33.462 75.216  1.00 62.25  ? 357  MET A N   1 
ATOM   1010 C CA  . MET A 1 131 ? 44.849 32.221 75.522  1.00 63.35  ? 357  MET A CA  1 
ATOM   1011 C C   . MET A 1 131 ? 45.851 31.108 75.841  1.00 66.07  ? 357  MET A C   1 
ATOM   1012 O O   . MET A 1 131 ? 45.744 30.440 76.869  1.00 66.70  ? 357  MET A O   1 
ATOM   1013 C CB  . MET A 1 131 ? 43.986 31.809 74.333  1.00 61.17  ? 357  MET A CB  1 
ATOM   1014 C CG  . MET A 1 131 ? 42.973 32.852 73.894  1.00 59.11  ? 357  MET A CG  1 
ATOM   1015 S SD  . MET A 1 131 ? 42.052 32.245 72.467  1.00 61.29  ? 357  MET A SD  1 
ATOM   1016 C CE  . MET A 1 131 ? 40.765 33.433 72.304  1.00 58.61  ? 357  MET A CE  1 
ATOM   1017 N N   . ARG A 1 132 ? 46.817 30.926 74.942  1.00 69.19  ? 358  ARG A N   1 
ATOM   1018 C CA  . ARG A 1 132 ? 47.889 29.930 75.059  1.00 71.05  ? 358  ARG A CA  1 
ATOM   1019 C C   . ARG A 1 132 ? 48.621 30.037 76.397  1.00 73.78  ? 358  ARG A C   1 
ATOM   1020 O O   . ARG A 1 132 ? 48.858 29.033 77.079  1.00 74.82  ? 358  ARG A O   1 
ATOM   1021 C CB  . ARG A 1 132 ? 48.891 30.135 73.920  1.00 69.47  ? 358  ARG A CB  1 
ATOM   1022 C CG  . ARG A 1 132 ? 50.130 29.271 73.988  1.00 68.16  ? 358  ARG A CG  1 
ATOM   1023 C CD  . ARG A 1 132 ? 51.174 29.775 73.019  1.00 67.36  ? 358  ARG A CD  1 
ATOM   1024 N NE  . ARG A 1 132 ? 50.660 29.794 71.657  1.00 67.67  ? 358  ARG A NE  1 
ATOM   1025 C CZ  . ARG A 1 132 ? 51.228 30.459 70.659  1.00 68.13  ? 358  ARG A CZ  1 
ATOM   1026 N NH1 . ARG A 1 132 ? 52.333 31.163 70.876  1.00 68.85  ? 358  ARG A NH1 1 
ATOM   1027 N NH2 . ARG A 1 132 ? 50.690 30.424 69.449  1.00 66.78  ? 358  ARG A NH2 1 
ATOM   1028 N N   . ASP A 1 133 ? 48.983 31.264 76.759  1.00 75.94  ? 359  ASP A N   1 
ATOM   1029 C CA  . ASP A 1 133 ? 49.681 31.547 78.012  1.00 78.56  ? 359  ASP A CA  1 
ATOM   1030 C C   . ASP A 1 133 ? 48.692 31.506 79.186  1.00 80.40  ? 359  ASP A C   1 
ATOM   1031 O O   . ASP A 1 133 ? 48.820 32.276 80.147  1.00 81.43  ? 359  ASP A O   1 
ATOM   1032 C CB  . ASP A 1 133 ? 50.316 32.938 77.942  1.00 79.35  ? 359  ASP A CB  1 
ATOM   1033 C CG  . ASP A 1 133 ? 51.365 33.057 76.848  1.00 81.18  ? 359  ASP A CG  1 
ATOM   1034 O OD1 . ASP A 1 133 ? 51.208 32.423 75.774  1.00 82.66  ? 359  ASP A OD1 1 
ATOM   1035 O OD2 . ASP A 1 133 ? 52.346 33.805 77.060  1.00 80.96  ? 359  ASP A OD2 1 
ATOM   1036 N N   . MET A 1 134 ? 47.710 30.611 79.100  1.00 80.54  ? 360  MET A N   1 
ATOM   1037 C CA  . MET A 1 134 ? 46.689 30.480 80.123  1.00 80.53  ? 360  MET A CA  1 
ATOM   1038 C C   . MET A 1 134 ? 45.886 29.195 79.966  1.00 79.59  ? 360  MET A C   1 
ATOM   1039 O O   . MET A 1 134 ? 44.978 28.928 80.745  1.00 79.55  ? 360  MET A O   1 
ATOM   1040 C CB  . MET A 1 134 ? 45.739 31.674 80.058  1.00 84.13  ? 360  MET A CB  1 
ATOM   1041 C CG  . MET A 1 134 ? 44.715 31.701 81.179  1.00 88.36  ? 360  MET A CG  1 
ATOM   1042 S SD  . MET A 1 134 ? 43.326 32.792 80.837  1.00 91.49  ? 360  MET A SD  1 
ATOM   1043 C CE  . MET A 1 134 ? 42.360 31.784 79.671  1.00 88.02  ? 360  MET A CE  1 
ATOM   1044 N N   . GLN A 1 135 ? 46.209 28.397 78.958  1.00 79.43  ? 361  GLN A N   1 
ATOM   1045 C CA  . GLN A 1 135 ? 45.497 27.143 78.750  1.00 79.30  ? 361  GLN A CA  1 
ATOM   1046 C C   . GLN A 1 135 ? 44.002 27.275 79.008  1.00 76.46  ? 361  GLN A C   1 
ATOM   1047 O O   . GLN A 1 135 ? 43.494 26.870 80.052  1.00 76.24  ? 361  GLN A O   1 
ATOM   1048 C CB  . GLN A 1 135 ? 46.049 26.053 79.670  1.00 82.95  ? 361  GLN A CB  1 
ATOM   1049 C CG  . GLN A 1 135 ? 47.321 25.384 79.195  1.00 86.17  ? 361  GLN A CG  1 
ATOM   1050 C CD  . GLN A 1 135 ? 47.504 24.025 79.848  1.00 89.61  ? 361  GLN A CD  1 
ATOM   1051 O OE1 . GLN A 1 135 ? 48.468 23.306 79.561  1.00 92.08  ? 361  GLN A OE1 1 
ATOM   1052 N NE2 . GLN A 1 135 ? 46.568 23.660 80.733  1.00 89.78  ? 361  GLN A NE2 1 
ATOM   1053 N N   . MET A 1 136 ? 43.304 27.842 78.045  1.00 72.56  ? 362  MET A N   1 
ATOM   1054 C CA  . MET A 1 136 ? 41.879 28.022 78.152  1.00 69.65  ? 362  MET A CA  1 
ATOM   1055 C C   . MET A 1 136 ? 41.285 26.890 77.344  1.00 68.38  ? 362  MET A C   1 
ATOM   1056 O O   . MET A 1 136 ? 41.554 26.783 76.151  1.00 67.59  ? 362  MET A O   1 
ATOM   1057 C CB  . MET A 1 136 ? 41.510 29.372 77.538  1.00 70.52  ? 362  MET A CB  1 
ATOM   1058 C CG  . MET A 1 136 ? 40.021 29.677 77.454  1.00 70.55  ? 362  MET A CG  1 
ATOM   1059 S SD  . MET A 1 136 ? 39.658 30.931 76.194  1.00 65.46  ? 362  MET A SD  1 
ATOM   1060 C CE  . MET A 1 136 ? 39.155 29.905 74.868  1.00 66.21  ? 362  MET A CE  1 
ATOM   1061 N N   . ASP A 1 137 ? 40.488 26.039 77.978  1.00 68.51  ? 363  ASP A N   1 
ATOM   1062 C CA  . ASP A 1 137 ? 39.887 24.917 77.257  1.00 69.96  ? 363  ASP A CA  1 
ATOM   1063 C C   . ASP A 1 137 ? 38.656 25.310 76.451  1.00 69.18  ? 363  ASP A C   1 
ATOM   1064 O O   . ASP A 1 137 ? 38.110 26.390 76.635  1.00 67.15  ? 363  ASP A O   1 
ATOM   1065 C CB  . ASP A 1 137 ? 39.545 23.770 78.219  1.00 70.52  ? 363  ASP A CB  1 
ATOM   1066 C CG  . ASP A 1 137 ? 38.731 24.226 79.408  1.00 71.51  ? 363  ASP A CG  1 
ATOM   1067 O OD1 . ASP A 1 137 ? 37.607 24.719 79.193  1.00 71.58  ? 363  ASP A OD1 1 
ATOM   1068 O OD2 . ASP A 1 137 ? 39.219 24.091 80.555  1.00 71.97  ? 363  ASP A OD2 1 
ATOM   1069 N N   . LYS A 1 138 ? 38.233 24.421 75.553  1.00 70.68  ? 364  LYS A N   1 
ATOM   1070 C CA  . LYS A 1 138 ? 37.071 24.665 74.693  1.00 72.36  ? 364  LYS A CA  1 
ATOM   1071 C C   . LYS A 1 138 ? 35.793 24.946 75.476  1.00 73.51  ? 364  LYS A C   1 
ATOM   1072 O O   . LYS A 1 138 ? 34.849 25.509 74.928  1.00 73.88  ? 364  LYS A O   1 
ATOM   1073 C CB  . LYS A 1 138 ? 36.833 23.479 73.743  1.00 72.34  ? 364  LYS A CB  1 
ATOM   1074 C CG  . LYS A 1 138 ? 38.006 23.144 72.829  1.00 72.43  ? 364  LYS A CG  1 
ATOM   1075 C CD  . LYS A 1 138 ? 37.709 21.908 71.999  1.00 72.27  ? 364  LYS A CD  1 
ATOM   1076 C CE  . LYS A 1 138 ? 38.941 21.438 71.254  1.00 71.92  ? 364  LYS A CE  1 
ATOM   1077 N NZ  . LYS A 1 138 ? 38.734 20.091 70.651  1.00 73.16  ? 364  LYS A NZ  1 
ATOM   1078 N N   . THR A 1 139 ? 35.750 24.534 76.743  1.00 75.32  ? 365  THR A N   1 
ATOM   1079 C CA  . THR A 1 139 ? 34.584 24.786 77.596  1.00 74.99  ? 365  THR A CA  1 
ATOM   1080 C C   . THR A 1 139 ? 34.626 26.245 78.053  1.00 72.95  ? 365  THR A C   1 
ATOM   1081 O O   . THR A 1 139 ? 33.599 26.917 78.097  1.00 72.16  ? 365  THR A O   1 
ATOM   1082 C CB  . THR A 1 139 ? 34.563 23.856 78.844  1.00 76.32  ? 365  THR A CB  1 
ATOM   1083 O OG1 . THR A 1 139 ? 33.802 22.673 78.552  1.00 75.83  ? 365  THR A OG1 1 
ATOM   1084 C CG2 . THR A 1 139 ? 33.955 24.582 80.042  1.00 76.40  ? 365  THR A CG2 1 
ATOM   1085 N N   . GLU A 1 140 ? 35.820 26.718 78.397  1.00 70.66  ? 366  GLU A N   1 
ATOM   1086 C CA  . GLU A 1 140 ? 36.008 28.100 78.804  1.00 69.70  ? 366  GLU A CA  1 
ATOM   1087 C C   . GLU A 1 140 ? 35.742 28.984 77.587  1.00 69.13  ? 366  GLU A C   1 
ATOM   1088 O O   . GLU A 1 140 ? 35.136 30.042 77.700  1.00 68.70  ? 366  GLU A O   1 
ATOM   1089 C CB  . GLU A 1 140 ? 37.434 28.311 79.324  1.00 68.95  ? 366  GLU A CB  1 
ATOM   1090 C CG  . GLU A 1 140 ? 37.629 27.832 80.751  1.00 67.95  ? 366  GLU A CG  1 
ATOM   1091 C CD  . GLU A 1 140 ? 39.084 27.713 81.144  1.00 67.17  ? 366  GLU A CD  1 
ATOM   1092 O OE1 . GLU A 1 140 ? 39.360 27.491 82.340  1.00 63.86  ? 366  GLU A OE1 1 
ATOM   1093 O OE2 . GLU A 1 140 ? 39.953 27.827 80.255  1.00 69.03  ? 366  GLU A OE2 1 
ATOM   1094 N N   . LEU A 1 141 ? 36.204 28.550 76.421  1.00 69.36  ? 367  LEU A N   1 
ATOM   1095 C CA  . LEU A 1 141 ? 35.957 29.299 75.202  1.00 69.39  ? 367  LEU A CA  1 
ATOM   1096 C C   . LEU A 1 141 ? 34.441 29.432 75.114  1.00 70.61  ? 367  LEU A C   1 
ATOM   1097 O O   . LEU A 1 141 ? 33.908 30.534 75.068  1.00 71.51  ? 367  LEU A O   1 
ATOM   1098 C CB  . LEU A 1 141 ? 36.470 28.536 73.976  1.00 68.09  ? 367  LEU A CB  1 
ATOM   1099 C CG  . LEU A 1 141 ? 36.253 29.187 72.606  1.00 66.57  ? 367  LEU A CG  1 
ATOM   1100 C CD1 . LEU A 1 141 ? 37.276 30.267 72.420  1.00 64.97  ? 367  LEU A CD1 1 
ATOM   1101 C CD2 . LEU A 1 141 ? 36.372 28.162 71.485  1.00 66.92  ? 367  LEU A CD2 1 
ATOM   1102 N N   . GLY A 1 142 ? 33.756 28.290 75.109  1.00 71.59  ? 368  GLY A N   1 
ATOM   1103 C CA  . GLY A 1 142 ? 32.304 28.269 75.027  1.00 73.49  ? 368  GLY A CA  1 
ATOM   1104 C C   . GLY A 1 142 ? 31.577 29.248 75.936  1.00 74.55  ? 368  GLY A C   1 
ATOM   1105 O O   . GLY A 1 142 ? 30.626 29.898 75.504  1.00 74.53  ? 368  GLY A O   1 
ATOM   1106 N N   . CYS A 1 143 ? 32.001 29.346 77.195  1.00 74.91  ? 369  CYS A N   1 
ATOM   1107 C CA  . CYS A 1 143 ? 31.376 30.270 78.140  1.00 74.26  ? 369  CYS A CA  1 
ATOM   1108 C C   . CYS A 1 143 ? 31.561 31.693 77.658  1.00 72.91  ? 369  CYS A C   1 
ATOM   1109 O O   . CYS A 1 143 ? 30.660 32.515 77.790  1.00 73.68  ? 369  CYS A O   1 
ATOM   1110 C CB  . CYS A 1 143 ? 31.985 30.139 79.540  1.00 75.58  ? 369  CYS A CB  1 
ATOM   1111 S SG  . CYS A 1 143 ? 31.617 28.584 80.372  1.00 79.89  ? 369  CYS A SG  1 
ATOM   1112 N N   . LEU A 1 144 ? 32.734 31.992 77.112  1.00 70.44  ? 370  LEU A N   1 
ATOM   1113 C CA  . LEU A 1 144 ? 32.982 33.330 76.612  1.00 68.91  ? 370  LEU A CA  1 
ATOM   1114 C C   . LEU A 1 144 ? 32.206 33.584 75.322  1.00 69.37  ? 370  LEU A C   1 
ATOM   1115 O O   . LEU A 1 144 ? 31.549 34.614 75.204  1.00 70.15  ? 370  LEU A O   1 
ATOM   1116 C CB  . LEU A 1 144 ? 34.478 33.568 76.402  1.00 66.97  ? 370  LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 144 ? 35.271 33.767 77.692  1.00 65.03  ? 370  LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 144 ? 36.432 34.707 77.455  1.00 62.72  ? 370  LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 144 ? 34.357 34.357 78.735  1.00 65.33  ? 370  LEU A CD2 1 
ATOM   1120 N N   . ARG A 1 145 ? 32.264 32.659 74.361  1.00 69.24  ? 371  ARG A N   1 
ATOM   1121 C CA  . ARG A 1 145 ? 31.520 32.819 73.102  1.00 68.85  ? 371  ARG A CA  1 
ATOM   1122 C C   . ARG A 1 145 ? 30.020 32.986 73.396  1.00 69.96  ? 371  ARG A C   1 
ATOM   1123 O O   . ARG A 1 145 ? 29.256 33.539 72.601  1.00 68.92  ? 371  ARG A O   1 
ATOM   1124 C CB  . ARG A 1 145 ? 31.744 31.610 72.174  1.00 66.10  ? 371  ARG A CB  1 
ATOM   1125 C CG  . ARG A 1 145 ? 33.042 31.654 71.373  1.00 62.10  ? 371  ARG A CG  1 
ATOM   1126 C CD  . ARG A 1 145 ? 32.789 31.666 69.864  1.00 59.79  ? 371  ARG A CD  1 
ATOM   1127 N NE  . ARG A 1 145 ? 32.206 30.423 69.361  1.00 58.66  ? 371  ARG A NE  1 
ATOM   1128 C CZ  . ARG A 1 145 ? 31.740 30.263 68.120  1.00 60.95  ? 371  ARG A CZ  1 
ATOM   1129 N NH1 . ARG A 1 145 ? 31.784 31.267 67.249  1.00 62.50  ? 371  ARG A NH1 1 
ATOM   1130 N NH2 . ARG A 1 145 ? 31.230 29.098 67.736  1.00 61.54  ? 371  ARG A NH2 1 
ATOM   1131 N N   . ALA A 1 146 ? 29.614 32.499 74.559  1.00 72.20  ? 372  ALA A N   1 
ATOM   1132 C CA  . ALA A 1 146 ? 28.238 32.587 75.002  1.00 74.35  ? 372  ALA A CA  1 
ATOM   1133 C C   . ALA A 1 146 ? 27.955 33.970 75.600  1.00 75.56  ? 372  ALA A C   1 
ATOM   1134 O O   . ALA A 1 146 ? 26.993 34.629 75.198  1.00 76.63  ? 372  ALA A O   1 
ATOM   1135 C CB  . ALA A 1 146 ? 27.962 31.490 76.032  1.00 74.62  ? 372  ALA A CB  1 
ATOM   1136 N N   . ILE A 1 147 ? 28.784 34.399 76.557  1.00 75.36  ? 373  ILE A N   1 
ATOM   1137 C CA  . ILE A 1 147 ? 28.626 35.706 77.205  1.00 74.57  ? 373  ILE A CA  1 
ATOM   1138 C C   . ILE A 1 147 ? 28.521 36.840 76.161  1.00 76.43  ? 373  ILE A C   1 
ATOM   1139 O O   . ILE A 1 147 ? 27.804 37.826 76.361  1.00 76.42  ? 373  ILE A O   1 
ATOM   1140 C CB  . ILE A 1 147 ? 29.802 35.992 78.175  1.00 71.47  ? 373  ILE A CB  1 
ATOM   1141 C CG1 . ILE A 1 147 ? 29.915 34.884 79.220  1.00 68.26  ? 373  ILE A CG1 1 
ATOM   1142 C CG2 . ILE A 1 147 ? 29.575 37.310 78.890  1.00 71.84  ? 373  ILE A CG2 1 
ATOM   1143 C CD1 . ILE A 1 147 ? 31.008 35.129 80.244  1.00 66.28  ? 373  ILE A CD1 1 
ATOM   1144 N N   . VAL A 1 148 ? 29.244 36.698 75.053  1.00 78.16  ? 374  VAL A N   1 
ATOM   1145 C CA  . VAL A 1 148 ? 29.190 37.679 73.973  1.00 80.40  ? 374  VAL A CA  1 
ATOM   1146 C C   . VAL A 1 148 ? 27.779 37.608 73.393  1.00 82.70  ? 374  VAL A C   1 
ATOM   1147 O O   . VAL A 1 148 ? 27.142 38.634 73.138  1.00 84.87  ? 374  VAL A O   1 
ATOM   1148 C CB  . VAL A 1 148 ? 30.246 37.358 72.863  1.00 79.69  ? 374  VAL A CB  1 
ATOM   1149 C CG1 . VAL A 1 148 ? 29.862 38.012 71.535  1.00 78.17  ? 374  VAL A CG1 1 
ATOM   1150 C CG2 . VAL A 1 148 ? 31.624 37.850 73.305  1.00 78.48  ? 374  VAL A CG2 1 
ATOM   1151 N N   . LEU A 1 149 ? 27.295 36.385 73.198  1.00 84.31  ? 375  LEU A N   1 
ATOM   1152 C CA  . LEU A 1 149 ? 25.959 36.151 72.669  1.00 86.35  ? 375  LEU A CA  1 
ATOM   1153 C C   . LEU A 1 149 ? 24.920 36.850 73.553  1.00 88.14  ? 375  LEU A C   1 
ATOM   1154 O O   . LEU A 1 149 ? 23.931 37.402 73.061  1.00 88.61  ? 375  LEU A O   1 
ATOM   1155 C CB  . LEU A 1 149 ? 25.688 34.650 72.626  1.00 86.00  ? 375  LEU A CB  1 
ATOM   1156 C CG  . LEU A 1 149 ? 24.508 34.191 71.775  1.00 87.01  ? 375  LEU A CG  1 
ATOM   1157 C CD1 . LEU A 1 149 ? 24.674 34.669 70.334  1.00 86.23  ? 375  LEU A CD1 1 
ATOM   1158 C CD2 . LEU A 1 149 ? 24.433 32.676 71.833  1.00 88.34  ? 375  LEU A CD2 1 
ATOM   1159 N N   . PHE A 1 150 ? 25.156 36.832 74.861  1.00 89.64  ? 376  PHE A N   1 
ATOM   1160 C CA  . PHE A 1 150 ? 24.245 37.463 75.798  1.00 90.85  ? 376  PHE A CA  1 
ATOM   1161 C C   . PHE A 1 150 ? 24.707 38.853 76.208  1.00 89.96  ? 376  PHE A C   1 
ATOM   1162 O O   . PHE A 1 150 ? 25.170 39.077 77.331  1.00 88.71  ? 376  PHE A O   1 
ATOM   1163 C CB  . PHE A 1 150 ? 24.053 36.583 77.037  1.00 94.91  ? 376  PHE A CB  1 
ATOM   1164 C CG  . PHE A 1 150 ? 23.456 35.228 76.733  1.00 98.61  ? 376  PHE A CG  1 
ATOM   1165 C CD1 . PHE A 1 150 ? 22.478 35.088 75.750  1.00 100.37 ? 376  PHE A CD1 1 
ATOM   1166 C CD2 . PHE A 1 150 ? 23.855 34.101 77.440  1.00 99.28  ? 376  PHE A CD2 1 
ATOM   1167 C CE1 . PHE A 1 150 ? 21.909 33.850 75.474  1.00 101.11 ? 376  PHE A CE1 1 
ATOM   1168 C CE2 . PHE A 1 150 ? 23.289 32.860 77.170  1.00 100.67 ? 376  PHE A CE2 1 
ATOM   1169 C CZ  . PHE A 1 150 ? 22.314 32.735 76.184  1.00 101.25 ? 376  PHE A CZ  1 
ATOM   1170 N N   . ASN A 1 151 ? 24.594 39.780 75.263  1.00 89.99  ? 377  ASN A N   1 
ATOM   1171 C CA  . ASN A 1 151 ? 24.943 41.176 75.496  1.00 89.72  ? 377  ASN A CA  1 
ATOM   1172 C C   . ASN A 1 151 ? 23.592 41.870 75.664  1.00 89.97  ? 377  ASN A C   1 
ATOM   1173 O O   . ASN A 1 151 ? 22.940 42.245 74.681  1.00 90.34  ? 377  ASN A O   1 
ATOM   1174 C CB  . ASN A 1 151 ? 25.707 41.759 74.293  1.00 86.73  ? 377  ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 151 ? 26.089 43.219 74.487  1.00 83.35  ? 377  ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 151 ? 26.703 43.592 75.489  1.00 80.30  ? 377  ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 151 ? 25.729 44.051 73.520  1.00 82.98  ? 377  ASN A ND2 1 
ATOM   1178 N N   . PRO A 1 152 ? 23.146 42.028 76.923  1.00 89.39  ? 378  PRO A N   1 
ATOM   1179 C CA  . PRO A 1 152 ? 21.868 42.670 77.255  1.00 89.05  ? 378  PRO A CA  1 
ATOM   1180 C C   . PRO A 1 152 ? 21.730 44.100 76.723  1.00 88.83  ? 378  PRO A C   1 
ATOM   1181 O O   . PRO A 1 152 ? 20.628 44.559 76.411  1.00 88.12  ? 378  PRO A O   1 
ATOM   1182 C CB  . PRO A 1 152 ? 21.853 42.622 78.782  1.00 89.76  ? 378  PRO A CB  1 
ATOM   1183 C CG  . PRO A 1 152 ? 23.320 42.725 79.137  1.00 89.03  ? 378  PRO A CG  1 
ATOM   1184 C CD  . PRO A 1 152 ? 23.939 41.769 78.140  1.00 88.65  ? 378  PRO A CD  1 
ATOM   1185 N N   . ASP A 1 153 ? 22.866 44.784 76.618  1.00 88.46  ? 379  ASP A N   1 
ATOM   1186 C CA  . ASP A 1 153 ? 22.931 46.162 76.164  1.00 87.77  ? 379  ASP A CA  1 
ATOM   1187 C C   . ASP A 1 153 ? 22.683 46.387 74.669  1.00 88.43  ? 379  ASP A C   1 
ATOM   1188 O O   . ASP A 1 153 ? 22.858 47.502 74.181  1.00 88.96  ? 379  ASP A O   1 
ATOM   1189 C CB  . ASP A 1 153 ? 24.288 46.754 76.555  1.00 86.75  ? 379  ASP A CB  1 
ATOM   1190 C CG  . ASP A 1 153 ? 24.754 46.299 77.930  1.00 86.06  ? 379  ASP A CG  1 
ATOM   1191 O OD1 . ASP A 1 153 ? 23.990 46.468 78.909  1.00 86.27  ? 379  ASP A OD1 1 
ATOM   1192 O OD2 . ASP A 1 153 ? 25.888 45.775 78.027  1.00 84.38  ? 379  ASP A OD2 1 
ATOM   1193 N N   . SER A 1 154 ? 22.280 45.351 73.938  1.00 89.40  ? 380  SER A N   1 
ATOM   1194 C CA  . SER A 1 154 ? 22.002 45.510 72.511  1.00 91.03  ? 380  SER A CA  1 
ATOM   1195 C C   . SER A 1 154 ? 20.905 46.561 72.293  1.00 92.98  ? 380  SER A C   1 
ATOM   1196 O O   . SER A 1 154 ? 20.011 46.717 73.131  1.00 93.71  ? 380  SER A O   1 
ATOM   1197 C CB  . SER A 1 154 ? 21.570 44.176 71.885  1.00 89.67  ? 380  SER A CB  1 
ATOM   1198 O OG  . SER A 1 154 ? 22.662 43.289 71.733  1.00 87.37  ? 380  SER A OG  1 
ATOM   1199 N N   . LYS A 1 155 ? 20.979 47.274 71.166  1.00 94.88  ? 381  LYS A N   1 
ATOM   1200 C CA  . LYS A 1 155 ? 20.011 48.322 70.821  1.00 95.81  ? 381  LYS A CA  1 
ATOM   1201 C C   . LYS A 1 155 ? 18.781 47.760 70.106  1.00 95.84  ? 381  LYS A C   1 
ATOM   1202 O O   . LYS A 1 155 ? 18.875 47.251 68.988  1.00 95.06  ? 381  LYS A O   1 
ATOM   1203 C CB  . LYS A 1 155 ? 20.690 49.397 69.951  1.00 96.76  ? 381  LYS A CB  1 
ATOM   1204 C CG  . LYS A 1 155 ? 19.770 50.546 69.510  1.00 98.01  ? 381  LYS A CG  1 
ATOM   1205 C CD  . LYS A 1 155 ? 20.542 51.776 69.003  1.00 97.42  ? 381  LYS A CD  1 
ATOM   1206 C CE  . LYS A 1 155 ? 20.959 52.740 70.132  1.00 97.14  ? 381  LYS A CE  1 
ATOM   1207 N NZ  . LYS A 1 155 ? 22.005 52.215 71.058  1.00 94.90  ? 381  LYS A NZ  1 
ATOM   1208 N N   . GLY A 1 156 ? 17.628 47.864 70.765  1.00 96.73  ? 382  GLY A N   1 
ATOM   1209 C CA  . GLY A 1 156 ? 16.383 47.355 70.203  1.00 97.49  ? 382  GLY A CA  1 
ATOM   1210 C C   . GLY A 1 156 ? 15.898 46.088 70.893  1.00 97.69  ? 382  GLY A C   1 
ATOM   1211 O O   . GLY A 1 156 ? 14.916 45.470 70.474  1.00 96.58  ? 382  GLY A O   1 
ATOM   1212 N N   . LEU A 1 157 ? 16.593 45.714 71.965  1.00 98.54  ? 383  LEU A N   1 
ATOM   1213 C CA  . LEU A 1 157 ? 16.291 44.516 72.741  1.00 98.86  ? 383  LEU A CA  1 
ATOM   1214 C C   . LEU A 1 157 ? 14.926 44.598 73.423  1.00 99.80  ? 383  LEU A C   1 
ATOM   1215 O O   . LEU A 1 157 ? 14.735 45.401 74.342  1.00 99.70  ? 383  LEU A O   1 
ATOM   1216 C CB  . LEU A 1 157 ? 17.383 44.300 73.797  1.00 97.50  ? 383  LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 157 ? 17.797 42.849 74.053  1.00 96.25  ? 383  LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 157 ? 18.299 42.247 72.758  1.00 94.67  ? 383  LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 157 ? 18.872 42.782 75.118  1.00 94.73  ? 383  LEU A CD2 1 
ATOM   1220 N N   . SER A 1 158 ? 13.988 43.756 72.978  1.00 100.45 ? 384  SER A N   1 
ATOM   1221 C CA  . SER A 1 158 ? 12.634 43.724 73.545  1.00 100.79 ? 384  SER A CA  1 
ATOM   1222 C C   . SER A 1 158 ? 12.645 43.471 75.062  1.00 100.88 ? 384  SER A C   1 
ATOM   1223 O O   . SER A 1 158 ? 11.732 43.897 75.776  1.00 100.68 ? 384  SER A O   1 
ATOM   1224 C CB  . SER A 1 158 ? 11.781 42.661 72.843  1.00 99.81  ? 384  SER A CB  1 
ATOM   1225 O OG  . SER A 1 158 ? 12.138 41.365 73.273  1.00 99.71  ? 384  SER A OG  1 
ATOM   1226 N N   . ASN A 1 159 ? 13.661 42.762 75.550  1.00 100.75 ? 385  ASN A N   1 
ATOM   1227 C CA  . ASN A 1 159 ? 13.791 42.530 76.981  1.00 100.09 ? 385  ASN A CA  1 
ATOM   1228 C C   . ASN A 1 159 ? 15.262 42.430 77.382  1.00 99.35  ? 385  ASN A C   1 
ATOM   1229 O O   . ASN A 1 159 ? 15.885 41.375 77.255  1.00 98.36  ? 385  ASN A O   1 
ATOM   1230 C CB  . ASN A 1 159 ? 13.040 41.272 77.427  1.00 100.21 ? 385  ASN A CB  1 
ATOM   1231 C CG  . ASN A 1 159 ? 12.751 41.272 78.931  1.00 100.29 ? 385  ASN A CG  1 
ATOM   1232 O OD1 . ASN A 1 159 ? 13.647 41.486 79.750  1.00 99.71  ? 385  ASN A OD1 1 
ATOM   1233 N ND2 . ASN A 1 159 ? 11.496 41.031 79.295  1.00 100.27 ? 385  ASN A ND2 1 
ATOM   1234 N N   . PRO A 1 160 ? 15.838 43.560 77.830  1.00 99.05  ? 386  PRO A N   1 
ATOM   1235 C CA  . PRO A 1 160 ? 17.218 43.770 78.288  1.00 99.03  ? 386  PRO A CA  1 
ATOM   1236 C C   . PRO A 1 160 ? 17.480 43.258 79.711  1.00 98.65  ? 386  PRO A C   1 
ATOM   1237 O O   . PRO A 1 160 ? 18.615 43.264 80.188  1.00 98.14  ? 386  PRO A O   1 
ATOM   1238 C CB  . PRO A 1 160 ? 17.382 45.287 78.190  1.00 99.87  ? 386  PRO A CB  1 
ATOM   1239 C CG  . PRO A 1 160 ? 16.431 45.660 77.086  1.00 99.39  ? 386  PRO A CG  1 
ATOM   1240 C CD  . PRO A 1 160 ? 15.229 44.850 77.466  1.00 98.85  ? 386  PRO A CD  1 
ATOM   1241 N N   . ALA A 1 161 ? 16.421 42.835 80.392  1.00 98.76  ? 387  ALA A N   1 
ATOM   1242 C CA  . ALA A 1 161 ? 16.539 42.307 81.747  1.00 98.63  ? 387  ALA A CA  1 
ATOM   1243 C C   . ALA A 1 161 ? 16.550 40.783 81.669  1.00 98.25  ? 387  ALA A C   1 
ATOM   1244 O O   . ALA A 1 161 ? 17.138 40.104 82.513  1.00 97.17  ? 387  ALA A O   1 
ATOM   1245 C CB  . ALA A 1 161 ? 15.368 42.783 82.595  1.00 98.85  ? 387  ALA A CB  1 
ATOM   1246 N N   . GLU A 1 162 ? 15.887 40.269 80.636  1.00 98.05  ? 388  GLU A N   1 
ATOM   1247 C CA  . GLU A 1 162 ? 15.773 38.840 80.361  1.00 97.96  ? 388  GLU A CA  1 
ATOM   1248 C C   . GLU A 1 162 ? 17.094 38.291 79.826  1.00 97.35  ? 388  GLU A C   1 
ATOM   1249 O O   . GLU A 1 162 ? 17.547 37.228 80.245  1.00 97.32  ? 388  GLU A O   1 
ATOM   1250 C CB  . GLU A 1 162 ? 14.657 38.618 79.337  1.00 99.31  ? 388  GLU A CB  1 
ATOM   1251 C CG  . GLU A 1 162 ? 14.459 37.187 78.878  1.00 101.38 ? 388  GLU A CG  1 
ATOM   1252 C CD  . GLU A 1 162 ? 13.337 37.063 77.850  1.00 103.09 ? 388  GLU A CD  1 
ATOM   1253 O OE1 . GLU A 1 162 ? 13.157 35.959 77.287  1.00 104.02 ? 388  GLU A OE1 1 
ATOM   1254 O OE2 . GLU A 1 162 ? 12.632 38.070 77.604  1.00 103.28 ? 388  GLU A OE2 1 
ATOM   1255 N N   . VAL A 1 163 ? 17.698 39.023 78.891  1.00 96.78  ? 389  VAL A N   1 
ATOM   1256 C CA  . VAL A 1 163 ? 18.979 38.639 78.306  1.00 95.03  ? 389  VAL A CA  1 
ATOM   1257 C C   . VAL A 1 163 ? 20.087 38.796 79.342  1.00 94.26  ? 389  VAL A C   1 
ATOM   1258 O O   . VAL A 1 163 ? 21.053 38.037 79.345  1.00 93.47  ? 389  VAL A O   1 
ATOM   1259 C CB  . VAL A 1 163 ? 19.330 39.507 77.088  1.00 94.89  ? 389  VAL A CB  1 
ATOM   1260 C CG1 . VAL A 1 163 ? 20.729 39.187 76.622  1.00 95.08  ? 389  VAL A CG1 1 
ATOM   1261 C CG2 . VAL A 1 163 ? 18.337 39.265 75.970  1.00 95.11  ? 389  VAL A CG2 1 
ATOM   1262 N N   . GLU A 1 164 ? 19.956 39.792 80.214  1.00 93.89  ? 390  GLU A N   1 
ATOM   1263 C CA  . GLU A 1 164 ? 20.946 39.989 81.262  1.00 94.02  ? 390  GLU A CA  1 
ATOM   1264 C C   . GLU A 1 164 ? 20.796 38.892 82.313  1.00 93.71  ? 390  GLU A C   1 
ATOM   1265 O O   . GLU A 1 164 ? 21.663 38.705 83.166  1.00 93.23  ? 390  GLU A O   1 
ATOM   1266 C CB  . GLU A 1 164 ? 20.790 41.357 81.925  1.00 94.90  ? 390  GLU A CB  1 
ATOM   1267 C CG  . GLU A 1 164 ? 21.799 41.564 83.043  1.00 96.84  ? 390  GLU A CG  1 
ATOM   1268 C CD  . GLU A 1 164 ? 22.068 43.018 83.330  1.00 98.71  ? 390  GLU A CD  1 
ATOM   1269 O OE1 . GLU A 1 164 ? 21.136 43.711 83.792  1.00 100.23 ? 390  GLU A OE1 1 
ATOM   1270 O OE2 . GLU A 1 164 ? 23.213 43.460 83.088  1.00 99.03  ? 390  GLU A OE2 1 
ATOM   1271 N N   . ALA A 1 165 ? 19.678 38.177 82.253  1.00 93.83  ? 391  ALA A N   1 
ATOM   1272 C CA  . ALA A 1 165 ? 19.411 37.082 83.173  1.00 93.08  ? 391  ALA A CA  1 
ATOM   1273 C C   . ALA A 1 165 ? 20.331 35.933 82.796  1.00 92.08  ? 391  ALA A C   1 
ATOM   1274 O O   . ALA A 1 165 ? 21.078 35.419 83.624  1.00 92.13  ? 391  ALA A O   1 
ATOM   1275 C CB  . ALA A 1 165 ? 17.958 36.646 83.056  1.00 93.66  ? 391  ALA A CB  1 
ATOM   1276 N N   . LEU A 1 166 ? 20.268 35.544 81.529  1.00 90.63  ? 392  LEU A N   1 
ATOM   1277 C CA  . LEU A 1 166 ? 21.086 34.463 81.006  1.00 90.12  ? 392  LEU A CA  1 
ATOM   1278 C C   . LEU A 1 166 ? 22.586 34.674 81.254  1.00 91.28  ? 392  LEU A C   1 
ATOM   1279 O O   . LEU A 1 166 ? 23.273 33.763 81.719  1.00 91.01  ? 392  LEU A O   1 
ATOM   1280 C CB  . LEU A 1 166 ? 20.812 34.308 79.512  1.00 87.68  ? 392  LEU A CB  1 
ATOM   1281 C CG  . LEU A 1 166 ? 19.348 34.012 79.195  1.00 85.67  ? 392  LEU A CG  1 
ATOM   1282 C CD1 . LEU A 1 166 ? 19.099 34.074 77.698  1.00 83.45  ? 392  LEU A CD1 1 
ATOM   1283 C CD2 . LEU A 1 166 ? 18.996 32.643 79.755  1.00 86.75  ? 392  LEU A CD2 1 
ATOM   1284 N N   . ARG A 1 167 ? 23.085 35.875 80.954  1.00 92.59  ? 393  ARG A N   1 
ATOM   1285 C CA  . ARG A 1 167 ? 24.507 36.212 81.128  1.00 93.90  ? 393  ARG A CA  1 
ATOM   1286 C C   . ARG A 1 167 ? 25.025 36.090 82.572  1.00 95.29  ? 393  ARG A C   1 
ATOM   1287 O O   . ARG A 1 167 ? 26.217 35.844 82.792  1.00 94.16  ? 393  ARG A O   1 
ATOM   1288 C CB  . ARG A 1 167 ? 24.769 37.627 80.591  1.00 92.70  ? 393  ARG A CB  1 
ATOM   1289 C CG  . ARG A 1 167 ? 26.181 38.158 80.791  1.00 90.94  ? 393  ARG A CG  1 
ATOM   1290 C CD  . ARG A 1 167 ? 26.281 39.575 80.256  1.00 91.16  ? 393  ARG A CD  1 
ATOM   1291 N NE  . ARG A 1 167 ? 27.246 40.377 81.001  1.00 92.08  ? 393  ARG A NE  1 
ATOM   1292 C CZ  . ARG A 1 167 ? 26.994 41.595 81.477  1.00 92.51  ? 393  ARG A CZ  1 
ATOM   1293 N NH1 . ARG A 1 167 ? 25.804 42.152 81.286  1.00 93.22  ? 393  ARG A NH1 1 
ATOM   1294 N NH2 . ARG A 1 167 ? 27.929 42.263 82.141  1.00 92.18  ? 393  ARG A NH2 1 
ATOM   1295 N N   . GLU A 1 168 ? 24.134 36.272 83.547  1.00 97.62  ? 394  GLU A N   1 
ATOM   1296 C CA  . GLU A 1 168 ? 24.501 36.153 84.962  1.00 98.99  ? 394  GLU A CA  1 
ATOM   1297 C C   . GLU A 1 168 ? 24.528 34.655 85.325  1.00 98.80  ? 394  GLU A C   1 
ATOM   1298 O O   . GLU A 1 168 ? 25.233 34.240 86.248  1.00 98.94  ? 394  GLU A O   1 
ATOM   1299 C CB  . GLU A 1 168 ? 23.489 36.893 85.869  1.00 100.06 ? 394  GLU A CB  1 
ATOM   1300 C CG  . GLU A 1 168 ? 23.325 38.425 85.658  1.00 100.40 ? 394  GLU A CG  1 
ATOM   1301 C CD  . GLU A 1 168 ? 24.284 39.299 86.485  1.00 100.56 ? 394  GLU A CD  1 
ATOM   1302 O OE1 . GLU A 1 168 ? 24.625 38.931 87.631  1.00 100.44 ? 394  GLU A OE1 1 
ATOM   1303 O OE2 . GLU A 1 168 ? 24.674 40.379 85.989  1.00 100.68 ? 394  GLU A OE2 1 
ATOM   1304 N N   . LYS A 1 169 ? 23.750 33.852 84.597  1.00 98.07  ? 395  LYS A N   1 
ATOM   1305 C CA  . LYS A 1 169 ? 23.704 32.409 84.818  1.00 97.80  ? 395  LYS A CA  1 
ATOM   1306 C C   . LYS A 1 169 ? 25.040 31.795 84.370  1.00 97.07  ? 395  LYS A C   1 
ATOM   1307 O O   . LYS A 1 169 ? 25.609 30.948 85.065  1.00 96.83  ? 395  LYS A O   1 
ATOM   1308 C CB  . LYS A 1 169 ? 22.522 31.790 84.042  1.00 98.40  ? 395  LYS A CB  1 
ATOM   1309 C CG  . LYS A 1 169 ? 21.127 32.150 84.611  1.00 98.63  ? 395  LYS A CG  1 
ATOM   1310 C CD  . LYS A 1 169 ? 19.962 31.544 83.803  1.00 98.20  ? 395  LYS A CD  1 
ATOM   1311 C CE  . LYS A 1 169 ? 18.596 31.902 84.413  1.00 98.04  ? 395  LYS A CE  1 
ATOM   1312 N NZ  . LYS A 1 169 ? 17.427 31.437 83.595  1.00 97.65  ? 395  LYS A NZ  1 
ATOM   1313 N N   . VAL A 1 170 ? 25.533 32.242 83.213  1.00 96.23  ? 396  VAL A N   1 
ATOM   1314 C CA  . VAL A 1 170 ? 26.812 31.785 82.657  1.00 94.80  ? 396  VAL A CA  1 
ATOM   1315 C C   . VAL A 1 170 ? 27.954 32.325 83.497  1.00 93.91  ? 396  VAL A C   1 
ATOM   1316 O O   . VAL A 1 170 ? 29.001 31.701 83.617  1.00 92.77  ? 396  VAL A O   1 
ATOM   1317 C CB  . VAL A 1 170 ? 27.020 32.282 81.220  1.00 94.82  ? 396  VAL A CB  1 
ATOM   1318 C CG1 . VAL A 1 170 ? 28.406 31.899 80.748  1.00 94.74  ? 396  VAL A CG1 1 
ATOM   1319 C CG2 . VAL A 1 170 ? 25.962 31.696 80.300  1.00 94.68  ? 396  VAL A CG2 1 
ATOM   1320 N N   . TYR A 1 171 ? 27.752 33.512 84.050  1.00 94.64  ? 397  TYR A N   1 
ATOM   1321 C CA  . TYR A 1 171 ? 28.737 34.128 84.924  1.00 96.06  ? 397  TYR A CA  1 
ATOM   1322 C C   . TYR A 1 171 ? 28.970 33.139 86.081  1.00 94.81  ? 397  TYR A C   1 
ATOM   1323 O O   . TYR A 1 171 ? 30.095 32.981 86.562  1.00 93.71  ? 397  TYR A O   1 
ATOM   1324 C CB  . TYR A 1 171 ? 28.187 35.459 85.481  1.00 99.84  ? 397  TYR A CB  1 
ATOM   1325 C CG  . TYR A 1 171 ? 28.574 36.735 84.732  1.00 102.83 ? 397  TYR A CG  1 
ATOM   1326 C CD1 . TYR A 1 171 ? 29.380 36.695 83.596  1.00 104.02 ? 397  TYR A CD1 1 
ATOM   1327 C CD2 . TYR A 1 171 ? 28.166 37.987 85.198  1.00 102.92 ? 397  TYR A CD2 1 
ATOM   1328 C CE1 . TYR A 1 171 ? 29.774 37.867 82.949  1.00 103.40 ? 397  TYR A CE1 1 
ATOM   1329 C CE2 . TYR A 1 171 ? 28.556 39.162 84.555  1.00 102.91 ? 397  TYR A CE2 1 
ATOM   1330 C CZ  . TYR A 1 171 ? 29.362 39.092 83.433  1.00 102.67 ? 397  TYR A CZ  1 
ATOM   1331 O OH  . TYR A 1 171 ? 29.778 40.239 82.795  1.00 102.60 ? 397  TYR A OH  1 
ATOM   1332 N N   . ALA A 1 172 ? 27.888 32.484 86.513  1.00 94.04  ? 398  ALA A N   1 
ATOM   1333 C CA  . ALA A 1 172 ? 27.914 31.509 87.604  1.00 92.54  ? 398  ALA A CA  1 
ATOM   1334 C C   . ALA A 1 172 ? 28.592 30.218 87.164  1.00 92.11  ? 398  ALA A C   1 
ATOM   1335 O O   . ALA A 1 172 ? 29.606 29.823 87.735  1.00 92.82  ? 398  ALA A O   1 
ATOM   1336 C CB  . ALA A 1 172 ? 26.491 31.220 88.083  1.00 90.97  ? 398  ALA A CB  1 
ATOM   1337 N N   . SER A 1 173 ? 28.032 29.568 86.146  1.00 91.26  ? 399  SER A N   1 
ATOM   1338 C CA  . SER A 1 173 ? 28.586 28.316 85.621  1.00 90.56  ? 399  SER A CA  1 
ATOM   1339 C C   . SER A 1 173 ? 30.095 28.389 85.362  1.00 90.57  ? 399  SER A C   1 
ATOM   1340 O O   . SER A 1 173 ? 30.844 27.474 85.714  1.00 90.63  ? 399  SER A O   1 
ATOM   1341 C CB  . SER A 1 173 ? 27.879 27.927 84.314  1.00 89.55  ? 399  SER A CB  1 
ATOM   1342 O OG  . SER A 1 173 ? 26.479 27.795 84.493  1.00 88.08  ? 399  SER A OG  1 
ATOM   1343 N N   . LEU A 1 174 ? 30.526 29.485 84.744  1.00 90.87  ? 400  LEU A N   1 
ATOM   1344 C CA  . LEU A 1 174 ? 31.927 29.702 84.400  1.00 90.65  ? 400  LEU A CA  1 
ATOM   1345 C C   . LEU A 1 174 ? 32.848 29.838 85.607  1.00 90.55  ? 400  LEU A C   1 
ATOM   1346 O O   . LEU A 1 174 ? 33.883 29.184 85.675  1.00 90.75  ? 400  LEU A O   1 
ATOM   1347 C CB  . LEU A 1 174 ? 32.048 30.936 83.505  1.00 90.68  ? 400  LEU A CB  1 
ATOM   1348 C CG  . LEU A 1 174 ? 33.417 31.210 82.888  1.00 90.42  ? 400  LEU A CG  1 
ATOM   1349 C CD1 . LEU A 1 174 ? 33.974 29.927 82.301  1.00 90.38  ? 400  LEU A CD1 1 
ATOM   1350 C CD2 . LEU A 1 174 ? 33.288 32.287 81.825  1.00 90.47  ? 400  LEU A CD2 1 
ATOM   1351 N N   . GLU A 1 175 ? 32.479 30.692 86.555  1.00 90.51  ? 401  GLU A N   1 
ATOM   1352 C CA  . GLU A 1 175 ? 33.285 30.877 87.754  1.00 90.26  ? 401  GLU A CA  1 
ATOM   1353 C C   . GLU A 1 175 ? 33.284 29.592 88.555  1.00 90.32  ? 401  GLU A C   1 
ATOM   1354 O O   . GLU A 1 175 ? 34.143 29.390 89.405  1.00 90.33  ? 401  GLU A O   1 
ATOM   1355 C CB  . GLU A 1 175 ? 32.713 31.999 88.601  1.00 90.89  ? 401  GLU A CB  1 
ATOM   1356 C CG  . GLU A 1 175 ? 33.433 32.221 89.904  1.00 92.11  ? 401  GLU A CG  1 
ATOM   1357 C CD  . GLU A 1 175 ? 32.815 33.361 90.686  1.00 93.72  ? 401  GLU A CD  1 
ATOM   1358 O OE1 . GLU A 1 175 ? 31.566 33.375 90.792  1.00 93.78  ? 401  GLU A OE1 1 
ATOM   1359 O OE2 . GLU A 1 175 ? 33.568 34.232 91.187  1.00 93.98  ? 401  GLU A OE2 1 
ATOM   1360 N N   . ALA A 1 176 ? 32.298 28.740 88.277  1.00 91.28  ? 402  ALA A N   1 
ATOM   1361 C CA  . ALA A 1 176 ? 32.142 27.439 88.922  1.00 92.96  ? 402  ALA A CA  1 
ATOM   1362 C C   . ALA A 1 176 ? 33.149 26.462 88.330  1.00 94.36  ? 402  ALA A C   1 
ATOM   1363 O O   . ALA A 1 176 ? 33.974 25.900 89.045  1.00 95.09  ? 402  ALA A O   1 
ATOM   1364 C CB  . ALA A 1 176 ? 30.734 26.915 88.702  1.00 92.28  ? 402  ALA A CB  1 
ATOM   1365 N N   . TYR A 1 177 ? 33.067 26.259 87.019  1.00 95.07  ? 403  TYR A N   1 
ATOM   1366 C CA  . TYR A 1 177 ? 33.977 25.370 86.313  1.00 96.03  ? 403  TYR A CA  1 
ATOM   1367 C C   . TYR A 1 177 ? 35.441 25.769 86.534  1.00 95.31  ? 403  TYR A C   1 
ATOM   1368 O O   . TYR A 1 177 ? 36.319 24.916 86.542  1.00 95.87  ? 403  TYR A O   1 
ATOM   1369 C CB  . TYR A 1 177 ? 33.649 25.397 84.820  1.00 100.01 ? 403  TYR A CB  1 
ATOM   1370 C CG  . TYR A 1 177 ? 34.563 24.568 83.930  1.00 104.97 ? 403  TYR A CG  1 
ATOM   1371 C CD1 . TYR A 1 177 ? 34.105 23.402 83.326  1.00 106.02 ? 403  TYR A CD1 1 
ATOM   1372 C CD2 . TYR A 1 177 ? 35.871 24.972 83.659  1.00 107.28 ? 403  TYR A CD2 1 
ATOM   1373 C CE1 . TYR A 1 177 ? 34.922 22.663 82.471  1.00 107.79 ? 403  TYR A CE1 1 
ATOM   1374 C CE2 . TYR A 1 177 ? 36.697 24.238 82.805  1.00 108.20 ? 403  TYR A CE2 1 
ATOM   1375 C CZ  . TYR A 1 177 ? 36.216 23.087 82.213  1.00 108.28 ? 403  TYR A CZ  1 
ATOM   1376 O OH  . TYR A 1 177 ? 37.020 22.371 81.347  1.00 108.51 ? 403  TYR A OH  1 
ATOM   1377 N N   . CYS A 1 178 ? 35.707 27.060 86.710  1.00 94.96  ? 404  CYS A N   1 
ATOM   1378 C CA  . CYS A 1 178 ? 37.072 27.541 86.918  1.00 94.70  ? 404  CYS A CA  1 
ATOM   1379 C C   . CYS A 1 178 ? 37.623 27.260 88.307  1.00 93.90  ? 404  CYS A C   1 
ATOM   1380 O O   . CYS A 1 178 ? 38.651 26.613 88.441  1.00 94.59  ? 404  CYS A O   1 
ATOM   1381 C CB  . CYS A 1 178 ? 37.152 29.039 86.642  1.00 95.93  ? 404  CYS A CB  1 
ATOM   1382 S SG  . CYS A 1 178 ? 36.755 29.466 84.944  1.00 96.75  ? 404  CYS A SG  1 
ATOM   1383 N N   . LYS A 1 179 ? 36.954 27.761 89.339  1.00 93.40  ? 405  LYS A N   1 
ATOM   1384 C CA  . LYS A 1 179 ? 37.390 27.531 90.715  1.00 93.76  ? 405  LYS A CA  1 
ATOM   1385 C C   . LYS A 1 179 ? 37.311 26.034 91.054  1.00 93.68  ? 405  LYS A C   1 
ATOM   1386 O O   . LYS A 1 179 ? 37.909 25.558 92.025  1.00 94.02  ? 405  LYS A O   1 
ATOM   1387 C CB  . LYS A 1 179 ? 36.504 28.326 91.665  1.00 94.48  ? 405  LYS A CB  1 
ATOM   1388 C CG  . LYS A 1 179 ? 36.428 29.804 91.327  1.00 96.96  ? 405  LYS A CG  1 
ATOM   1389 C CD  . LYS A 1 179 ? 37.685 30.548 91.747  1.00 98.44  ? 405  LYS A CD  1 
ATOM   1390 C CE  . LYS A 1 179 ? 37.489 32.055 91.605  1.00 98.58  ? 405  LYS A CE  1 
ATOM   1391 N NZ  . LYS A 1 179 ? 38.331 32.824 92.572  1.00 97.32  ? 405  LYS A NZ  1 
ATOM   1392 N N   . HIS A 1 180 ? 36.557 25.307 90.236  1.00 92.83  ? 406  HIS A N   1 
ATOM   1393 C CA  . HIS A 1 180 ? 36.359 23.870 90.355  1.00 91.35  ? 406  HIS A CA  1 
ATOM   1394 C C   . HIS A 1 180 ? 37.565 23.144 89.744  1.00 89.50  ? 406  HIS A C   1 
ATOM   1395 O O   . HIS A 1 180 ? 38.450 22.680 90.463  1.00 89.57  ? 406  HIS A O   1 
ATOM   1396 C CB  . HIS A 1 180 ? 35.052 23.528 89.623  1.00 93.38  ? 406  HIS A CB  1 
ATOM   1397 C CG  . HIS A 1 180 ? 34.844 22.074 89.331  1.00 96.30  ? 406  HIS A CG  1 
ATOM   1398 N ND1 . HIS A 1 180 ? 34.900 21.096 90.300  1.00 98.06  ? 406  HIS A ND1 1 
ATOM   1399 C CD2 . HIS A 1 180 ? 34.474 21.448 88.187  1.00 96.96  ? 406  HIS A CD2 1 
ATOM   1400 C CE1 . HIS A 1 180 ? 34.566 19.932 89.769  1.00 98.30  ? 406  HIS A CE1 1 
ATOM   1401 N NE2 . HIS A 1 180 ? 34.302 20.119 88.488  1.00 97.93  ? 406  HIS A NE2 1 
ATOM   1402 N N   . LYS A 1 181 ? 37.600 23.091 88.415  1.00 86.90  ? 407  LYS A N   1 
ATOM   1403 C CA  . LYS A 1 181 ? 38.655 22.435 87.650  1.00 83.94  ? 407  LYS A CA  1 
ATOM   1404 C C   . LYS A 1 181 ? 40.062 22.969 87.894  1.00 83.76  ? 407  LYS A C   1 
ATOM   1405 O O   . LYS A 1 181 ? 41.015 22.196 87.942  1.00 82.87  ? 407  LYS A O   1 
ATOM   1406 C CB  . LYS A 1 181 ? 38.331 22.535 86.162  1.00 82.09  ? 407  LYS A CB  1 
ATOM   1407 C CG  . LYS A 1 181 ? 39.443 22.066 85.268  1.00 81.05  ? 407  LYS A CG  1 
ATOM   1408 C CD  . LYS A 1 181 ? 39.576 20.570 85.321  1.00 80.99  ? 407  LYS A CD  1 
ATOM   1409 C CE  . LYS A 1 181 ? 38.538 19.897 84.438  1.00 80.63  ? 407  LYS A CE  1 
ATOM   1410 N NZ  . LYS A 1 181 ? 39.127 19.443 83.130  1.00 81.52  ? 407  LYS A NZ  1 
ATOM   1411 N N   . TYR A 1 182 ? 40.194 24.285 88.041  1.00 84.87  ? 408  TYR A N   1 
ATOM   1412 C CA  . TYR A 1 182 ? 41.504 24.909 88.270  1.00 86.66  ? 408  TYR A CA  1 
ATOM   1413 C C   . TYR A 1 182 ? 41.606 25.585 89.642  1.00 88.25  ? 408  TYR A C   1 
ATOM   1414 O O   . TYR A 1 182 ? 41.717 26.817 89.738  1.00 87.84  ? 408  TYR A O   1 
ATOM   1415 C CB  . TYR A 1 182 ? 41.806 25.949 87.177  1.00 85.28  ? 408  TYR A CB  1 
ATOM   1416 C CG  . TYR A 1 182 ? 41.798 25.408 85.757  1.00 84.15  ? 408  TYR A CG  1 
ATOM   1417 C CD1 . TYR A 1 182 ? 42.983 25.189 85.062  1.00 82.26  ? 408  TYR A CD1 1 
ATOM   1418 C CD2 . TYR A 1 182 ? 40.593 25.133 85.105  1.00 84.25  ? 408  TYR A CD2 1 
ATOM   1419 C CE1 . TYR A 1 182 ? 42.963 24.713 83.751  1.00 82.73  ? 408  TYR A CE1 1 
ATOM   1420 C CE2 . TYR A 1 182 ? 40.564 24.658 83.803  1.00 82.75  ? 408  TYR A CE2 1 
ATOM   1421 C CZ  . TYR A 1 182 ? 41.744 24.452 83.132  1.00 82.77  ? 408  TYR A CZ  1 
ATOM   1422 O OH  . TYR A 1 182 ? 41.692 23.989 81.839  1.00 82.22  ? 408  TYR A OH  1 
ATOM   1423 N N   . PRO A 1 183 ? 41.586 24.778 90.717  1.00 90.26  ? 409  PRO A N   1 
ATOM   1424 C CA  . PRO A 1 183 ? 41.669 25.206 92.119  1.00 92.20  ? 409  PRO A CA  1 
ATOM   1425 C C   . PRO A 1 183 ? 42.959 25.924 92.522  1.00 93.66  ? 409  PRO A C   1 
ATOM   1426 O O   . PRO A 1 183 ? 42.929 26.855 93.326  1.00 93.30  ? 409  PRO A O   1 
ATOM   1427 C CB  . PRO A 1 183 ? 41.463 23.900 92.886  1.00 92.04  ? 409  PRO A CB  1 
ATOM   1428 C CG  . PRO A 1 183 ? 42.018 22.872 91.961  1.00 91.69  ? 409  PRO A CG  1 
ATOM   1429 C CD  . PRO A 1 183 ? 41.470 23.312 90.635  1.00 90.27  ? 409  PRO A CD  1 
ATOM   1430 N N   . GLU A 1 184 ? 44.087 25.487 91.974  1.00 95.99  ? 410  GLU A N   1 
ATOM   1431 C CA  . GLU A 1 184 ? 45.368 26.114 92.284  1.00 99.13  ? 410  GLU A CA  1 
ATOM   1432 C C   . GLU A 1 184 ? 45.320 27.618 91.989  1.00 99.16  ? 410  GLU A C   1 
ATOM   1433 O O   . GLU A 1 184 ? 45.814 28.421 92.781  1.00 98.99  ? 410  GLU A O   1 
ATOM   1434 C CB  . GLU A 1 184 ? 46.512 25.438 91.500  1.00 102.65 ? 410  GLU A CB  1 
ATOM   1435 C CG  . GLU A 1 184 ? 46.412 25.457 89.960  1.00 107.35 ? 410  GLU A CG  1 
ATOM   1436 C CD  . GLU A 1 184 ? 45.256 24.623 89.405  1.00 110.61 ? 410  GLU A CD  1 
ATOM   1437 O OE1 . GLU A 1 184 ? 45.234 23.386 89.619  1.00 111.99 ? 410  GLU A OE1 1 
ATOM   1438 O OE2 . GLU A 1 184 ? 44.366 25.212 88.747  1.00 112.89 ? 410  GLU A OE2 1 
ATOM   1439 N N   . GLN A 1 185 ? 44.734 27.995 90.852  1.00 99.15  ? 411  GLN A N   1 
ATOM   1440 C CA  . GLN A 1 185 ? 44.597 29.402 90.500  1.00 98.53  ? 411  GLN A CA  1 
ATOM   1441 C C   . GLN A 1 185 ? 43.134 29.760 90.740  1.00 98.80  ? 411  GLN A C   1 
ATOM   1442 O O   . GLN A 1 185 ? 42.217 29.302 90.043  1.00 96.43  ? 411  GLN A O   1 
ATOM   1443 C CB  . GLN A 1 185 ? 44.990 29.655 89.047  1.00 97.49  ? 411  GLN A CB  1 
ATOM   1444 C CG  . GLN A 1 185 ? 44.098 28.982 88.047  1.00 97.44  ? 411  GLN A CG  1 
ATOM   1445 C CD  . GLN A 1 185 ? 44.657 29.072 86.656  1.00 97.73  ? 411  GLN A CD  1 
ATOM   1446 O OE1 . GLN A 1 185 ? 44.923 30.169 86.147  1.00 97.21  ? 411  GLN A OE1 1 
ATOM   1447 N NE2 . GLN A 1 185 ? 44.848 27.917 86.024  1.00 96.85  ? 411  GLN A NE2 1 
ATOM   1448 N N   . PRO A 1 186 ? 42.908 30.579 91.768  1.00 99.76  ? 412  PRO A N   1 
ATOM   1449 C CA  . PRO A 1 186 ? 41.587 31.046 92.181  1.00 100.15 ? 412  PRO A CA  1 
ATOM   1450 C C   . PRO A 1 186 ? 41.062 32.013 91.142  1.00 100.90 ? 412  PRO A C   1 
ATOM   1451 O O   . PRO A 1 186 ? 40.091 31.719 90.433  1.00 101.90 ? 412  PRO A O   1 
ATOM   1452 C CB  . PRO A 1 186 ? 41.858 31.761 93.509  1.00 100.20 ? 412  PRO A CB  1 
ATOM   1453 C CG  . PRO A 1 186 ? 43.371 31.581 93.775  1.00 99.87  ? 412  PRO A CG  1 
ATOM   1454 C CD  . PRO A 1 186 ? 43.971 31.346 92.437  1.00 99.62  ? 412  PRO A CD  1 
ATOM   1455 N N   . GLY A 1 187 ? 41.745 33.160 91.062  1.00 100.44 ? 413  GLY A N   1 
ATOM   1456 C CA  . GLY A 1 187 ? 41.396 34.239 90.150  1.00 98.38  ? 413  GLY A CA  1 
ATOM   1457 C C   . GLY A 1 187 ? 41.525 33.935 88.677  1.00 96.37  ? 413  GLY A C   1 
ATOM   1458 O O   . GLY A 1 187 ? 41.842 34.815 87.877  1.00 95.67  ? 413  GLY A O   1 
ATOM   1459 N N   . ARG A 1 188 ? 41.278 32.677 88.334  1.00 94.89  ? 414  ARG A N   1 
ATOM   1460 C CA  . ARG A 1 188 ? 41.326 32.206 86.970  1.00 92.78  ? 414  ARG A CA  1 
ATOM   1461 C C   . ARG A 1 188 ? 40.061 32.626 86.248  1.00 91.91  ? 414  ARG A C   1 
ATOM   1462 O O   . ARG A 1 188 ? 40.095 32.948 85.063  1.00 92.24  ? 414  ARG A O   1 
ATOM   1463 C CB  . ARG A 1 188 ? 41.413 30.693 86.927  1.00 91.94  ? 414  ARG A CB  1 
ATOM   1464 C CG  . ARG A 1 188 ? 41.139 30.197 85.547  1.00 90.24  ? 414  ARG A CG  1 
ATOM   1465 C CD  . ARG A 1 188 ? 41.181 28.711 85.468  1.00 89.64  ? 414  ARG A CD  1 
ATOM   1466 N NE  . ARG A 1 188 ? 41.189 28.268 84.080  1.00 88.08  ? 414  ARG A NE  1 
ATOM   1467 C CZ  . ARG A 1 188 ? 42.160 28.535 83.214  1.00 87.17  ? 414  ARG A CZ  1 
ATOM   1468 N NH1 . ARG A 1 188 ? 43.212 29.251 83.586  1.00 87.41  ? 414  ARG A NH1 1 
ATOM   1469 N NH2 . ARG A 1 188 ? 42.090 28.070 81.978  1.00 86.50  ? 414  ARG A NH2 1 
ATOM   1470 N N   . PHE A 1 189 ? 38.937 32.605 86.954  1.00 90.68  ? 415  PHE A N   1 
ATOM   1471 C CA  . PHE A 1 189 ? 37.684 33.007 86.338  1.00 88.83  ? 415  PHE A CA  1 
ATOM   1472 C C   . PHE A 1 189 ? 37.758 34.421 85.748  1.00 86.35  ? 415  PHE A C   1 
ATOM   1473 O O   . PHE A 1 189 ? 37.224 34.678 84.668  1.00 85.62  ? 415  PHE A O   1 
ATOM   1474 C CB  . PHE A 1 189 ? 36.546 32.949 87.350  1.00 90.68  ? 415  PHE A CB  1 
ATOM   1475 C CG  . PHE A 1 189 ? 35.312 33.661 86.889  1.00 91.15  ? 415  PHE A CG  1 
ATOM   1476 C CD1 . PHE A 1 189 ? 34.654 33.254 85.739  1.00 91.15  ? 415  PHE A CD1 1 
ATOM   1477 C CD2 . PHE A 1 189 ? 34.834 34.764 87.579  1.00 90.70  ? 415  PHE A CD2 1 
ATOM   1478 C CE1 . PHE A 1 189 ? 33.540 33.936 85.285  1.00 91.68  ? 415  PHE A CE1 1 
ATOM   1479 C CE2 . PHE A 1 189 ? 33.723 35.452 87.134  1.00 90.08  ? 415  PHE A CE2 1 
ATOM   1480 C CZ  . PHE A 1 189 ? 33.074 35.038 85.985  1.00 91.44  ? 415  PHE A CZ  1 
ATOM   1481 N N   . ALA A 1 190 ? 38.411 35.331 86.467  1.00 83.42  ? 416  ALA A N   1 
ATOM   1482 C CA  . ALA A 1 190 ? 38.564 36.710 86.018  1.00 80.74  ? 416  ALA A CA  1 
ATOM   1483 C C   . ALA A 1 190 ? 39.625 36.848 84.929  1.00 79.75  ? 416  ALA A C   1 
ATOM   1484 O O   . ALA A 1 190 ? 39.436 37.617 83.992  1.00 79.25  ? 416  ALA A O   1 
ATOM   1485 C CB  . ALA A 1 190 ? 38.915 37.600 87.185  1.00 79.61  ? 416  ALA A CB  1 
ATOM   1486 N N   . LYS A 1 191 ? 40.742 36.121 85.063  1.00 78.90  ? 417  LYS A N   1 
ATOM   1487 C CA  . LYS A 1 191 ? 41.832 36.146 84.070  1.00 76.08  ? 417  LYS A CA  1 
ATOM   1488 C C   . LYS A 1 191 ? 41.220 36.024 82.684  1.00 74.07  ? 417  LYS A C   1 
ATOM   1489 O O   . LYS A 1 191 ? 41.623 36.713 81.746  1.00 73.31  ? 417  LYS A O   1 
ATOM   1490 C CB  . LYS A 1 191 ? 42.794 34.961 84.269  1.00 76.55  ? 417  LYS A CB  1 
ATOM   1491 C CG  . LYS A 1 191 ? 44.072 35.216 85.070  1.00 77.33  ? 417  LYS A CG  1 
ATOM   1492 C CD  . LYS A 1 191 ? 44.841 33.889 85.227  1.00 80.52  ? 417  LYS A CD  1 
ATOM   1493 C CE  . LYS A 1 191 ? 46.157 34.024 85.997  1.00 81.55  ? 417  LYS A CE  1 
ATOM   1494 N NZ  . LYS A 1 191 ? 47.210 34.740 85.212  1.00 83.02  ? 417  LYS A NZ  1 
ATOM   1495 N N   . LEU A 1 192 ? 40.246 35.123 82.585  1.00 73.06  ? 418  LEU A N   1 
ATOM   1496 C CA  . LEU A 1 192 ? 39.512 34.823 81.357  1.00 73.73  ? 418  LEU A CA  1 
ATOM   1497 C C   . LEU A 1 192 ? 38.683 35.982 80.830  1.00 73.31  ? 418  LEU A C   1 
ATOM   1498 O O   . LEU A 1 192 ? 38.495 36.144 79.625  1.00 73.00  ? 418  LEU A O   1 
ATOM   1499 C CB  . LEU A 1 192 ? 38.573 33.643 81.595  1.00 74.10  ? 418  LEU A CB  1 
ATOM   1500 C CG  . LEU A 1 192 ? 39.112 32.212 81.554  1.00 76.16  ? 418  LEU A CG  1 
ATOM   1501 C CD1 . LEU A 1 192 ? 40.378 32.043 82.398  1.00 75.17  ? 418  LEU A CD1 1 
ATOM   1502 C CD2 . LEU A 1 192 ? 37.995 31.301 82.034  1.00 76.99  ? 418  LEU A CD2 1 
ATOM   1503 N N   . LEU A 1 193 ? 38.164 36.778 81.746  1.00 73.01  ? 419  LEU A N   1 
ATOM   1504 C CA  . LEU A 1 193 ? 37.342 37.901 81.368  1.00 72.29  ? 419  LEU A CA  1 
ATOM   1505 C C   . LEU A 1 193 ? 38.173 39.090 80.920  1.00 71.25  ? 419  LEU A C   1 
ATOM   1506 O O   . LEU A 1 193 ? 37.702 39.912 80.142  1.00 72.80  ? 419  LEU A O   1 
ATOM   1507 C CB  . LEU A 1 193 ? 36.447 38.281 82.540  1.00 73.46  ? 419  LEU A CB  1 
ATOM   1508 C CG  . LEU A 1 193 ? 35.551 37.147 83.055  1.00 74.22  ? 419  LEU A CG  1 
ATOM   1509 C CD1 . LEU A 1 193 ? 34.880 37.606 84.340  1.00 75.21  ? 419  LEU A CD1 1 
ATOM   1510 C CD2 . LEU A 1 193 ? 34.515 36.743 81.998  1.00 72.92  ? 419  LEU A CD2 1 
ATOM   1511 N N   . LEU A 1 194 ? 39.413 39.177 81.396  1.00 69.57  ? 420  LEU A N   1 
ATOM   1512 C CA  . LEU A 1 194 ? 40.294 40.283 81.025  1.00 67.53  ? 420  LEU A CA  1 
ATOM   1513 C C   . LEU A 1 194 ? 40.388 40.452 79.506  1.00 66.95  ? 420  LEU A C   1 
ATOM   1514 O O   . LEU A 1 194 ? 40.540 41.570 79.013  1.00 67.26  ? 420  LEU A O   1 
ATOM   1515 C CB  . LEU A 1 194 ? 41.698 40.069 81.604  1.00 66.97  ? 420  LEU A CB  1 
ATOM   1516 C CG  . LEU A 1 194 ? 42.630 41.283 81.576  1.00 66.24  ? 420  LEU A CG  1 
ATOM   1517 C CD1 . LEU A 1 194 ? 41.951 42.433 82.283  1.00 66.66  ? 420  LEU A CD1 1 
ATOM   1518 C CD2 . LEU A 1 194 ? 43.966 40.964 82.251  1.00 67.60  ? 420  LEU A CD2 1 
ATOM   1519 N N   . ARG A 1 195 ? 40.280 39.351 78.764  1.00 65.31  ? 421  ARG A N   1 
ATOM   1520 C CA  . ARG A 1 195 ? 40.370 39.399 77.311  1.00 63.63  ? 421  ARG A CA  1 
ATOM   1521 C C   . ARG A 1 195 ? 39.151 39.952 76.589  1.00 63.64  ? 421  ARG A C   1 
ATOM   1522 O O   . ARG A 1 195 ? 39.140 40.046 75.365  1.00 65.11  ? 421  ARG A O   1 
ATOM   1523 C CB  . ARG A 1 195 ? 40.685 38.011 76.771  1.00 62.43  ? 421  ARG A CB  1 
ATOM   1524 C CG  . ARG A 1 195 ? 42.092 37.578 77.079  1.00 62.45  ? 421  ARG A CG  1 
ATOM   1525 C CD  . ARG A 1 195 ? 43.045 38.697 76.721  1.00 63.07  ? 421  ARG A CD  1 
ATOM   1526 N NE  . ARG A 1 195 ? 43.776 39.170 77.893  1.00 64.86  ? 421  ARG A NE  1 
ATOM   1527 C CZ  . ARG A 1 195 ? 44.492 40.292 77.929  1.00 66.22  ? 421  ARG A CZ  1 
ATOM   1528 N NH1 . ARG A 1 195 ? 44.570 41.070 76.849  1.00 65.95  ? 421  ARG A NH1 1 
ATOM   1529 N NH2 . ARG A 1 195 ? 45.147 40.628 79.040  1.00 66.45  ? 421  ARG A NH2 1 
ATOM   1530 N N   . LEU A 1 196 ? 38.128 40.338 77.337  1.00 63.54  ? 422  LEU A N   1 
ATOM   1531 C CA  . LEU A 1 196 ? 36.906 40.858 76.735  1.00 63.42  ? 422  LEU A CA  1 
ATOM   1532 C C   . LEU A 1 196 ? 37.025 42.254 76.121  1.00 61.87  ? 422  LEU A C   1 
ATOM   1533 O O   . LEU A 1 196 ? 36.607 42.467 74.971  1.00 60.05  ? 422  LEU A O   1 
ATOM   1534 C CB  . LEU A 1 196 ? 35.777 40.798 77.764  1.00 65.39  ? 422  LEU A CB  1 
ATOM   1535 C CG  . LEU A 1 196 ? 35.444 39.331 78.094  1.00 67.26  ? 422  LEU A CG  1 
ATOM   1536 C CD1 . LEU A 1 196 ? 34.426 39.248 79.217  1.00 68.70  ? 422  LEU A CD1 1 
ATOM   1537 C CD2 . LEU A 1 196 ? 34.908 38.638 76.844  1.00 67.32  ? 422  LEU A CD2 1 
ATOM   1538 N N   . PRO A 1 197 ? 37.568 43.230 76.879  1.00 60.45  ? 423  PRO A N   1 
ATOM   1539 C CA  . PRO A 1 197 ? 37.685 44.552 76.262  1.00 59.17  ? 423  PRO A CA  1 
ATOM   1540 C C   . PRO A 1 197 ? 38.439 44.392 74.938  1.00 57.72  ? 423  PRO A C   1 
ATOM   1541 O O   . PRO A 1 197 ? 37.971 44.822 73.887  1.00 57.84  ? 423  PRO A O   1 
ATOM   1542 C CB  . PRO A 1 197 ? 38.472 45.343 77.309  1.00 59.12  ? 423  PRO A CB  1 
ATOM   1543 C CG  . PRO A 1 197 ? 37.946 44.781 78.593  1.00 59.09  ? 423  PRO A CG  1 
ATOM   1544 C CD  . PRO A 1 197 ? 37.928 43.285 78.311  1.00 59.33  ? 423  PRO A CD  1 
ATOM   1545 N N   . ALA A 1 198 ? 39.597 43.742 75.009  1.00 55.85  ? 424  ALA A N   1 
ATOM   1546 C CA  . ALA A 1 198 ? 40.436 43.487 73.849  1.00 53.10  ? 424  ALA A CA  1 
ATOM   1547 C C   . ALA A 1 198 ? 39.652 42.911 72.673  1.00 51.37  ? 424  ALA A C   1 
ATOM   1548 O O   . ALA A 1 198 ? 39.780 43.387 71.549  1.00 51.15  ? 424  ALA A O   1 
ATOM   1549 C CB  . ALA A 1 198 ? 41.553 42.537 74.233  1.00 53.40  ? 424  ALA A CB  1 
ATOM   1550 N N   . LEU A 1 199 ? 38.848 41.883 72.924  1.00 49.38  ? 425  LEU A N   1 
ATOM   1551 C CA  . LEU A 1 199 ? 38.063 41.267 71.857  1.00 49.09  ? 425  LEU A CA  1 
ATOM   1552 C C   . LEU A 1 199 ? 37.113 42.253 71.184  1.00 50.78  ? 425  LEU A C   1 
ATOM   1553 O O   . LEU A 1 199 ? 36.742 42.090 70.010  1.00 48.89  ? 425  LEU A O   1 
ATOM   1554 C CB  . LEU A 1 199 ? 37.234 40.111 72.397  1.00 47.39  ? 425  LEU A CB  1 
ATOM   1555 C CG  . LEU A 1 199 ? 36.328 39.596 71.273  1.00 48.41  ? 425  LEU A CG  1 
ATOM   1556 C CD1 . LEU A 1 199 ? 37.183 39.140 70.094  1.00 48.86  ? 425  LEU A CD1 1 
ATOM   1557 C CD2 . LEU A 1 199 ? 35.466 38.468 71.767  1.00 47.22  ? 425  LEU A CD2 1 
ATOM   1558 N N   . ARG A 1 200 ? 36.692 43.251 71.962  1.00 52.90  ? 426  ARG A N   1 
ATOM   1559 C CA  . ARG A 1 200 ? 35.782 44.295 71.508  1.00 51.62  ? 426  ARG A CA  1 
ATOM   1560 C C   . ARG A 1 200 ? 36.498 45.162 70.506  1.00 50.21  ? 426  ARG A C   1 
ATOM   1561 O O   . ARG A 1 200 ? 36.097 45.246 69.349  1.00 48.99  ? 426  ARG A O   1 
ATOM   1562 C CB  . ARG A 1 200 ? 35.331 45.152 72.688  1.00 52.45  ? 426  ARG A CB  1 
ATOM   1563 C CG  . ARG A 1 200 ? 34.592 46.391 72.265  1.00 53.46  ? 426  ARG A CG  1 
ATOM   1564 C CD  . ARG A 1 200 ? 33.451 46.031 71.341  1.00 54.20  ? 426  ARG A CD  1 
ATOM   1565 N NE  . ARG A 1 200 ? 32.501 45.124 71.976  1.00 58.87  ? 426  ARG A NE  1 
ATOM   1566 C CZ  . ARG A 1 200 ? 31.740 45.431 73.027  1.00 60.74  ? 426  ARG A CZ  1 
ATOM   1567 N NH1 . ARG A 1 200 ? 31.804 46.630 73.586  1.00 60.37  ? 426  ARG A NH1 1 
ATOM   1568 N NH2 . ARG A 1 200 ? 30.896 44.535 73.517  1.00 62.08  ? 426  ARG A NH2 1 
ATOM   1569 N N   . SER A 1 201 ? 37.562 45.808 70.975  1.00 50.05  ? 427  SER A N   1 
ATOM   1570 C CA  . SER A 1 201 ? 38.384 46.669 70.142  1.00 50.06  ? 427  SER A CA  1 
ATOM   1571 C C   . SER A 1 201 ? 38.747 45.900 68.891  1.00 51.31  ? 427  SER A C   1 
ATOM   1572 O O   . SER A 1 201 ? 38.537 46.375 67.775  1.00 51.83  ? 427  SER A O   1 
ATOM   1573 C CB  . SER A 1 201 ? 39.657 47.050 70.883  1.00 49.29  ? 427  SER A CB  1 
ATOM   1574 O OG  . SER A 1 201 ? 39.358 47.687 72.103  1.00 49.94  ? 427  SER A OG  1 
ATOM   1575 N N   . ILE A 1 202 ? 39.301 44.706 69.082  1.00 52.25  ? 428  ILE A N   1 
ATOM   1576 C CA  . ILE A 1 202 ? 39.678 43.861 67.961  1.00 53.38  ? 428  ILE A CA  1 
ATOM   1577 C C   . ILE A 1 202 ? 38.471 43.653 67.037  1.00 53.70  ? 428  ILE A C   1 
ATOM   1578 O O   . ILE A 1 202 ? 38.600 43.724 65.817  1.00 52.87  ? 428  ILE A O   1 
ATOM   1579 C CB  . ILE A 1 202 ? 40.241 42.499 68.462  1.00 53.98  ? 428  ILE A CB  1 
ATOM   1580 C CG1 . ILE A 1 202 ? 41.598 42.728 69.145  1.00 53.48  ? 428  ILE A CG1 1 
ATOM   1581 C CG2 . ILE A 1 202 ? 40.375 41.514 67.298  1.00 53.45  ? 428  ILE A CG2 1 
ATOM   1582 C CD1 . ILE A 1 202 ? 42.264 41.465 69.676  1.00 53.05  ? 428  ILE A CD1 1 
ATOM   1583 N N   . GLY A 1 203 ? 37.301 43.411 67.622  1.00 54.96  ? 429  GLY A N   1 
ATOM   1584 C CA  . GLY A 1 203 ? 36.101 43.235 66.827  1.00 55.71  ? 429  GLY A CA  1 
ATOM   1585 C C   . GLY A 1 203 ? 35.811 44.482 66.002  1.00 56.96  ? 429  GLY A C   1 
ATOM   1586 O O   . GLY A 1 203 ? 35.528 44.394 64.805  1.00 55.31  ? 429  GLY A O   1 
ATOM   1587 N N   . LEU A 1 204 ? 35.885 45.649 66.636  1.00 57.59  ? 430  LEU A N   1 
ATOM   1588 C CA  . LEU A 1 204 ? 35.636 46.913 65.947  1.00 59.46  ? 430  LEU A CA  1 
ATOM   1589 C C   . LEU A 1 204 ? 36.605 47.147 64.789  1.00 61.98  ? 430  LEU A C   1 
ATOM   1590 O O   . LEU A 1 204 ? 36.176 47.420 63.663  1.00 64.30  ? 430  LEU A O   1 
ATOM   1591 C CB  . LEU A 1 204 ? 35.742 48.081 66.921  1.00 57.96  ? 430  LEU A CB  1 
ATOM   1592 C CG  . LEU A 1 204 ? 34.712 48.132 68.048  1.00 57.22  ? 430  LEU A CG  1 
ATOM   1593 C CD1 . LEU A 1 204 ? 35.021 49.307 68.972  1.00 56.31  ? 430  LEU A CD1 1 
ATOM   1594 C CD2 . LEU A 1 204 ? 33.324 48.265 67.457  1.00 56.44  ? 430  LEU A CD2 1 
ATOM   1595 N N   . LYS A 1 205 ? 37.907 47.052 65.061  1.00 62.61  ? 431  LYS A N   1 
ATOM   1596 C CA  . LYS A 1 205 ? 38.906 47.254 64.018  1.00 62.60  ? 431  LYS A CA  1 
ATOM   1597 C C   . LYS A 1 205 ? 38.666 46.299 62.862  1.00 61.69  ? 431  LYS A C   1 
ATOM   1598 O O   . LYS A 1 205 ? 38.794 46.672 61.703  1.00 60.47  ? 431  LYS A O   1 
ATOM   1599 C CB  . LYS A 1 205 ? 40.315 47.039 64.565  1.00 64.20  ? 431  LYS A CB  1 
ATOM   1600 C CG  . LYS A 1 205 ? 41.231 48.247 64.407  1.00 66.57  ? 431  LYS A CG  1 
ATOM   1601 C CD  . LYS A 1 205 ? 41.341 48.703 62.959  1.00 67.88  ? 431  LYS A CD  1 
ATOM   1602 C CE  . LYS A 1 205 ? 42.243 49.926 62.860  1.00 69.59  ? 431  LYS A CE  1 
ATOM   1603 N NZ  . LYS A 1 205 ? 41.719 51.072 63.662  1.00 69.91  ? 431  LYS A NZ  1 
ATOM   1604 N N   . CYS A 1 206 ? 38.311 45.061 63.182  1.00 62.82  ? 432  CYS A N   1 
ATOM   1605 C CA  . CYS A 1 206 ? 38.053 44.060 62.153  1.00 64.29  ? 432  CYS A CA  1 
ATOM   1606 C C   . CYS A 1 206 ? 36.920 44.464 61.240  1.00 64.05  ? 432  CYS A C   1 
ATOM   1607 O O   . CYS A 1 206 ? 36.935 44.148 60.050  1.00 62.82  ? 432  CYS A O   1 
ATOM   1608 C CB  . CYS A 1 206 ? 37.726 42.705 62.782  1.00 65.88  ? 432  CYS A CB  1 
ATOM   1609 S SG  . CYS A 1 206 ? 39.155 41.856 63.471  1.00 66.69  ? 432  CYS A SG  1 
ATOM   1610 N N   . LEU A 1 207 ? 35.928 45.146 61.805  1.00 64.72  ? 433  LEU A N   1 
ATOM   1611 C CA  . LEU A 1 207 ? 34.787 45.597 61.022  1.00 65.60  ? 433  LEU A CA  1 
ATOM   1612 C C   . LEU A 1 207 ? 35.250 46.530 59.923  1.00 66.04  ? 433  LEU A C   1 
ATOM   1613 O O   . LEU A 1 207 ? 35.047 46.274 58.733  1.00 65.40  ? 433  LEU A O   1 
ATOM   1614 C CB  . LEU A 1 207 ? 33.785 46.333 61.904  1.00 64.58  ? 433  LEU A CB  1 
ATOM   1615 C CG  . LEU A 1 207 ? 32.567 45.521 62.337  1.00 64.52  ? 433  LEU A CG  1 
ATOM   1616 C CD1 . LEU A 1 207 ? 31.588 46.468 63.006  1.00 65.17  ? 433  LEU A CD1 1 
ATOM   1617 C CD2 . LEU A 1 207 ? 31.915 44.829 61.138  1.00 62.56  ? 433  LEU A CD2 1 
ATOM   1618 N N   . GLU A 1 208 ? 35.870 47.625 60.341  1.00 66.71  ? 434  GLU A N   1 
ATOM   1619 C CA  . GLU A 1 208 ? 36.383 48.617 59.411  1.00 66.98  ? 434  GLU A CA  1 
ATOM   1620 C C   . GLU A 1 208 ? 36.979 47.911 58.188  1.00 64.92  ? 434  GLU A C   1 
ATOM   1621 O O   . GLU A 1 208 ? 36.576 48.182 57.059  1.00 63.63  ? 434  GLU A O   1 
ATOM   1622 C CB  . GLU A 1 208 ? 37.424 49.487 60.134  1.00 68.61  ? 434  GLU A CB  1 
ATOM   1623 C CG  . GLU A 1 208 ? 36.852 50.241 61.348  1.00 68.46  ? 434  GLU A CG  1 
ATOM   1624 C CD  . GLU A 1 208 ? 37.922 50.699 62.326  1.00 69.47  ? 434  GLU A CD  1 
ATOM   1625 O OE1 . GLU A 1 208 ? 37.560 51.282 63.367  1.00 69.57  ? 434  GLU A OE1 1 
ATOM   1626 O OE2 . GLU A 1 208 ? 39.123 50.473 62.063  1.00 70.17  ? 434  GLU A OE2 1 
ATOM   1627 N N   . HIS A 1 209 ? 37.919 46.996 58.424  1.00 63.54  ? 435  HIS A N   1 
ATOM   1628 C CA  . HIS A 1 209 ? 38.548 46.235 57.350  1.00 62.43  ? 435  HIS A CA  1 
ATOM   1629 C C   . HIS A 1 209 ? 37.497 45.659 56.427  1.00 63.91  ? 435  HIS A C   1 
ATOM   1630 O O   . HIS A 1 209 ? 37.576 45.809 55.213  1.00 64.56  ? 435  HIS A O   1 
ATOM   1631 C CB  . HIS A 1 209 ? 39.363 45.071 57.902  1.00 59.42  ? 435  HIS A CB  1 
ATOM   1632 C CG  . HIS A 1 209 ? 40.718 45.454 58.405  1.00 56.74  ? 435  HIS A CG  1 
ATOM   1633 N ND1 . HIS A 1 209 ? 40.922 46.031 59.639  1.00 56.11  ? 435  HIS A ND1 1 
ATOM   1634 C CD2 . HIS A 1 209 ? 41.946 45.303 57.853  1.00 55.95  ? 435  HIS A CD2 1 
ATOM   1635 C CE1 . HIS A 1 209 ? 42.218 46.214 59.829  1.00 56.08  ? 435  HIS A CE1 1 
ATOM   1636 N NE2 . HIS A 1 209 ? 42.861 45.780 58.760  1.00 56.05  ? 435  HIS A NE2 1 
ATOM   1637 N N   . LEU A 1 210 ? 36.525 44.969 57.012  1.00 66.02  ? 436  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 210 ? 35.442 44.367 56.244  1.00 68.80  ? 436  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 210 ? 34.661 45.406 55.446  1.00 69.96  ? 436  LEU A C   1 
ATOM   1640 O O   . LEU A 1 210 ? 34.279 45.152 54.307  1.00 70.22  ? 436  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 210 ? 34.488 43.623 57.173  1.00 70.79  ? 436  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 210 ? 35.029 42.368 57.858  1.00 72.62  ? 436  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 210 ? 34.007 41.882 58.878  1.00 73.64  ? 436  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 210 ? 35.322 41.286 56.820  1.00 72.94  ? 436  LEU A CD2 1 
ATOM   1645 N N   . PHE A 1 211 ? 34.401 46.564 56.046  1.00 70.49  ? 437  PHE A N   1 
ATOM   1646 C CA  . PHE A 1 211 ? 33.688 47.608 55.334  1.00 72.66  ? 437  PHE A CA  1 
ATOM   1647 C C   . PHE A 1 211 ? 34.530 48.026 54.131  1.00 74.09  ? 437  PHE A C   1 
ATOM   1648 O O   . PHE A 1 211 ? 34.033 48.080 53.006  1.00 73.93  ? 437  PHE A O   1 
ATOM   1649 C CB  . PHE A 1 211 ? 33.435 48.819 56.240  1.00 74.11  ? 437  PHE A CB  1 
ATOM   1650 C CG  . PHE A 1 211 ? 32.362 48.594 57.278  1.00 76.27  ? 437  PHE A CG  1 
ATOM   1651 C CD1 . PHE A 1 211 ? 31.116 48.087 56.916  1.00 77.36  ? 437  PHE A CD1 1 
ATOM   1652 C CD2 . PHE A 1 211 ? 32.599 48.884 58.618  1.00 76.27  ? 437  PHE A CD2 1 
ATOM   1653 C CE1 . PHE A 1 211 ? 30.128 47.869 57.876  1.00 77.47  ? 437  PHE A CE1 1 
ATOM   1654 C CE2 . PHE A 1 211 ? 31.615 48.669 59.582  1.00 76.09  ? 437  PHE A CE2 1 
ATOM   1655 C CZ  . PHE A 1 211 ? 30.383 48.161 59.211  1.00 76.42  ? 437  PHE A CZ  1 
ATOM   1656 N N   . PHE A 1 212 ? 35.811 48.293 54.379  1.00 75.35  ? 438  PHE A N   1 
ATOM   1657 C CA  . PHE A 1 212 ? 36.756 48.716 53.351  1.00 76.59  ? 438  PHE A CA  1 
ATOM   1658 C C   . PHE A 1 212 ? 36.807 47.854 52.087  1.00 78.13  ? 438  PHE A C   1 
ATOM   1659 O O   . PHE A 1 212 ? 36.848 48.391 50.993  1.00 79.85  ? 438  PHE A O   1 
ATOM   1660 C CB  . PHE A 1 212 ? 38.158 48.806 53.945  1.00 77.02  ? 438  PHE A CB  1 
ATOM   1661 C CG  . PHE A 1 212 ? 39.147 49.544 53.078  1.00 78.83  ? 438  PHE A CG  1 
ATOM   1662 C CD1 . PHE A 1 212 ? 39.381 50.899 53.263  1.00 79.21  ? 438  PHE A CD1 1 
ATOM   1663 C CD2 . PHE A 1 212 ? 39.846 48.886 52.076  1.00 80.55  ? 438  PHE A CD2 1 
ATOM   1664 C CE1 . PHE A 1 212 ? 40.297 51.587 52.463  1.00 79.31  ? 438  PHE A CE1 1 
ATOM   1665 C CE2 . PHE A 1 212 ? 40.761 49.569 51.272  1.00 80.26  ? 438  PHE A CE2 1 
ATOM   1666 C CZ  . PHE A 1 212 ? 40.983 50.919 51.469  1.00 79.41  ? 438  PHE A CZ  1 
ATOM   1667 N N   . PHE A 1 213 ? 36.819 46.534 52.207  1.00 80.23  ? 439  PHE A N   1 
ATOM   1668 C CA  . PHE A 1 213 ? 36.874 45.706 51.002  1.00 84.08  ? 439  PHE A CA  1 
ATOM   1669 C C   . PHE A 1 213 ? 35.550 45.681 50.264  1.00 85.14  ? 439  PHE A C   1 
ATOM   1670 O O   . PHE A 1 213 ? 35.479 45.320 49.088  1.00 84.96  ? 439  PHE A O   1 
ATOM   1671 C CB  . PHE A 1 213 ? 37.282 44.289 51.351  1.00 88.00  ? 439  PHE A CB  1 
ATOM   1672 C CG  . PHE A 1 213 ? 38.560 44.217 52.108  1.00 92.58  ? 439  PHE A CG  1 
ATOM   1673 C CD1 . PHE A 1 213 ? 39.731 44.702 51.554  1.00 94.40  ? 439  PHE A CD1 1 
ATOM   1674 C CD2 . PHE A 1 213 ? 38.589 43.697 53.393  1.00 93.83  ? 439  PHE A CD2 1 
ATOM   1675 C CE1 . PHE A 1 213 ? 40.910 44.672 52.273  1.00 96.26  ? 439  PHE A CE1 1 
ATOM   1676 C CE2 . PHE A 1 213 ? 39.759 43.664 54.115  1.00 94.85  ? 439  PHE A CE2 1 
ATOM   1677 C CZ  . PHE A 1 213 ? 40.923 44.152 53.558  1.00 95.83  ? 439  PHE A CZ  1 
ATOM   1678 N N   . LYS A 1 214 ? 34.494 46.040 50.976  1.00 86.76  ? 440  LYS A N   1 
ATOM   1679 C CA  . LYS A 1 214 ? 33.171 46.100 50.397  1.00 88.96  ? 440  LYS A CA  1 
ATOM   1680 C C   . LYS A 1 214 ? 33.228 47.370 49.561  1.00 89.78  ? 440  LYS A C   1 
ATOM   1681 O O   . LYS A 1 214 ? 33.319 47.322 48.337  1.00 90.42  ? 440  LYS A O   1 
ATOM   1682 C CB  . LYS A 1 214 ? 32.132 46.225 51.518  1.00 90.91  ? 440  LYS A CB  1 
ATOM   1683 C CG  . LYS A 1 214 ? 30.686 46.466 51.081  1.00 94.77  ? 440  LYS A CG  1 
ATOM   1684 C CD  . LYS A 1 214 ? 29.797 46.743 52.308  1.00 97.47  ? 440  LYS A CD  1 
ATOM   1685 C CE  . LYS A 1 214 ? 28.355 47.115 51.938  1.00 98.57  ? 440  LYS A CE  1 
ATOM   1686 N NZ  . LYS A 1 214 ? 27.512 47.424 53.148  1.00 99.05  ? 440  LYS A NZ  1 
ATOM   1687 N N   . LEU A 1 215 ? 33.231 48.504 50.254  1.00 90.34  ? 441  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 215 ? 33.268 49.830 49.646  1.00 90.65  ? 441  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 215 ? 34.273 49.932 48.499  1.00 90.29  ? 441  LEU A C   1 
ATOM   1690 O O   . LEU A 1 215 ? 33.928 50.282 47.372  1.00 89.69  ? 441  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 215 ? 33.596 50.873 50.727  1.00 91.71  ? 441  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 215 ? 33.025 50.606 52.137  1.00 93.27  ? 441  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 215 ? 33.301 51.799 53.053  1.00 92.94  ? 441  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 215 ? 31.523 50.335 52.067  1.00 94.20  ? 441  LEU A CD2 1 
ATOM   1695 N N   . ILE A 1 216 ? 35.523 49.617 48.795  1.00 90.79  ? 442  ILE A N   1 
ATOM   1696 C CA  . ILE A 1 216 ? 36.577 49.682 47.802  1.00 91.55  ? 442  ILE A CA  1 
ATOM   1697 C C   . ILE A 1 216 ? 36.871 48.324 47.194  1.00 92.27  ? 442  ILE A C   1 
ATOM   1698 O O   . ILE A 1 216 ? 36.279 47.941 46.187  1.00 91.86  ? 442  ILE A O   1 
ATOM   1699 C CB  . ILE A 1 216 ? 37.862 50.221 48.426  1.00 90.93  ? 442  ILE A CB  1 
ATOM   1700 C CG1 . ILE A 1 216 ? 37.574 51.558 49.105  1.00 90.94  ? 442  ILE A CG1 1 
ATOM   1701 C CG2 . ILE A 1 216 ? 38.923 50.393 47.363  1.00 92.17  ? 442  ILE A CG2 1 
ATOM   1702 C CD1 . ILE A 1 216 ? 38.823 52.315 49.506  1.00 91.62  ? 442  ILE A CD1 1 
ATOM   1703 N N   . GLY A 1 217 ? 37.794 47.611 47.830  1.00 93.72  ? 443  GLY A N   1 
ATOM   1704 C CA  . GLY A 1 217 ? 38.208 46.296 47.384  1.00 96.53  ? 443  GLY A CA  1 
ATOM   1705 C C   . GLY A 1 217 ? 37.369 45.555 46.359  1.00 98.06  ? 443  GLY A C   1 
ATOM   1706 O O   . GLY A 1 217 ? 36.141 45.455 46.455  1.00 97.90  ? 443  GLY A O   1 
ATOM   1707 N N   . ASP A 1 218 ? 38.064 45.028 45.359  1.00 99.45  ? 444  ASP A N   1 
ATOM   1708 C CA  . ASP A 1 218 ? 37.441 44.238 44.311  1.00 101.02 ? 444  ASP A CA  1 
ATOM   1709 C C   . ASP A 1 218 ? 36.988 42.963 45.030  1.00 102.15 ? 444  ASP A C   1 
ATOM   1710 O O   . ASP A 1 218 ? 36.099 42.242 44.560  1.00 101.93 ? 444  ASP A O   1 
ATOM   1711 C CB  . ASP A 1 218 ? 38.493 43.904 43.264  1.00 101.56 ? 444  ASP A CB  1 
ATOM   1712 C CG  . ASP A 1 218 ? 39.607 44.935 43.220  1.00 102.65 ? 444  ASP A CG  1 
ATOM   1713 O OD1 . ASP A 1 218 ? 39.393 46.039 42.664  1.00 101.86 ? 444  ASP A OD1 1 
ATOM   1714 O OD2 . ASP A 1 218 ? 40.695 44.640 43.763  1.00 103.50 ? 444  ASP A OD2 1 
ATOM   1715 N N   . THR A 1 219 ? 37.639 42.721 46.175  1.00 102.48 ? 445  THR A N   1 
ATOM   1716 C CA  . THR A 1 219 ? 37.410 41.602 47.089  1.00 101.86 ? 445  THR A CA  1 
ATOM   1717 C C   . THR A 1 219 ? 35.970 41.091 47.079  1.00 101.75 ? 445  THR A C   1 
ATOM   1718 O O   . THR A 1 219 ? 35.053 41.772 47.547  1.00 101.31 ? 445  THR A O   1 
ATOM   1719 C CB  . THR A 1 219 ? 37.762 42.021 48.544  1.00 101.42 ? 445  THR A CB  1 
ATOM   1720 O OG1 . THR A 1 219 ? 39.062 42.627 48.573  1.00 99.53  ? 445  THR A OG1 1 
ATOM   1721 C CG2 . THR A 1 219 ? 37.738 40.813 49.467  1.00 100.61 ? 445  THR A CG2 1 
ATOM   1722 N N   . PRO A 1 220 ? 35.758 39.877 46.550  1.00 101.90 ? 446  PRO A N   1 
ATOM   1723 C CA  . PRO A 1 220 ? 34.432 39.253 46.469  1.00 102.13 ? 446  PRO A CA  1 
ATOM   1724 C C   . PRO A 1 220 ? 33.816 38.790 47.798  1.00 101.86 ? 446  PRO A C   1 
ATOM   1725 O O   . PRO A 1 220 ? 34.200 37.752 48.343  1.00 101.54 ? 446  PRO A O   1 
ATOM   1726 C CB  . PRO A 1 220 ? 34.659 38.094 45.492  1.00 102.19 ? 446  PRO A CB  1 
ATOM   1727 C CG  . PRO A 1 220 ? 36.090 37.722 45.734  1.00 101.56 ? 446  PRO A CG  1 
ATOM   1728 C CD  . PRO A 1 220 ? 36.764 39.073 45.829  1.00 101.89 ? 446  PRO A CD  1 
ATOM   1729 N N   . ILE A 1 221 ? 32.857 39.565 48.309  1.00 101.51 ? 447  ILE A N   1 
ATOM   1730 C CA  . ILE A 1 221 ? 32.167 39.228 49.557  1.00 100.71 ? 447  ILE A CA  1 
ATOM   1731 C C   . ILE A 1 221 ? 30.922 38.416 49.204  1.00 101.04 ? 447  ILE A C   1 
ATOM   1732 O O   . ILE A 1 221 ? 30.323 38.620 48.147  1.00 101.00 ? 447  ILE A O   1 
ATOM   1733 C CB  . ILE A 1 221 ? 31.729 40.494 50.342  1.00 99.51  ? 447  ILE A CB  1 
ATOM   1734 C CG1 . ILE A 1 221 ? 32.932 41.394 50.615  1.00 98.19  ? 447  ILE A CG1 1 
ATOM   1735 C CG2 . ILE A 1 221 ? 31.121 40.102 51.680  1.00 98.55  ? 447  ILE A CG2 1 
ATOM   1736 C CD1 . ILE A 1 221 ? 32.622 42.525 51.571  1.00 97.51  ? 447  ILE A CD1 1 
ATOM   1737 N N   . ASP A 1 222 ? 30.531 37.499 50.085  1.00 101.42 ? 448  ASP A N   1 
ATOM   1738 C CA  . ASP A 1 222 ? 29.373 36.657 49.824  1.00 102.19 ? 448  ASP A CA  1 
ATOM   1739 C C   . ASP A 1 222 ? 28.179 36.853 50.743  1.00 102.77 ? 448  ASP A C   1 
ATOM   1740 O O   . ASP A 1 222 ? 28.268 37.499 51.786  1.00 102.03 ? 448  ASP A O   1 
ATOM   1741 C CB  . ASP A 1 222 ? 29.787 35.183 49.837  1.00 102.26 ? 448  ASP A CB  1 
ATOM   1742 C CG  . ASP A 1 222 ? 30.655 34.815 48.652  1.00 102.17 ? 448  ASP A CG  1 
ATOM   1743 O OD1 . ASP A 1 222 ? 30.161 34.893 47.504  1.00 102.57 ? 448  ASP A OD1 1 
ATOM   1744 O OD2 . ASP A 1 222 ? 31.831 34.450 48.868  1.00 102.06 ? 448  ASP A OD2 1 
ATOM   1745 N N   . THR A 1 223 ? 27.065 36.260 50.321  1.00 104.29 ? 449  THR A N   1 
ATOM   1746 C CA  . THR A 1 223 ? 25.771 36.306 50.996  1.00 105.72 ? 449  THR A CA  1 
ATOM   1747 C C   . THR A 1 223 ? 25.701 36.510 52.508  1.00 107.45 ? 449  THR A C   1 
ATOM   1748 O O   . THR A 1 223 ? 25.674 37.647 52.976  1.00 108.85 ? 449  THR A O   1 
ATOM   1749 C CB  . THR A 1 223 ? 24.944 35.054 50.637  1.00 104.44 ? 449  THR A CB  1 
ATOM   1750 O OG1 . THR A 1 223 ? 25.738 33.875 50.829  1.00 103.39 ? 449  THR A OG1 1 
ATOM   1751 C CG2 . THR A 1 223 ? 24.487 35.127 49.192  1.00 104.03 ? 449  THR A CG2 1 
ATOM   1752 N N   . PHE A 1 224 ? 25.644 35.415 53.264  1.00 108.60 ? 450  PHE A N   1 
ATOM   1753 C CA  . PHE A 1 224 ? 25.539 35.475 54.722  1.00 109.73 ? 450  PHE A CA  1 
ATOM   1754 C C   . PHE A 1 224 ? 26.386 36.585 55.344  1.00 109.82 ? 450  PHE A C   1 
ATOM   1755 O O   . PHE A 1 224 ? 25.893 37.352 56.177  1.00 110.14 ? 450  PHE A O   1 
ATOM   1756 C CB  . PHE A 1 224 ? 25.919 34.121 55.326  1.00 111.74 ? 450  PHE A CB  1 
ATOM   1757 C CG  . PHE A 1 224 ? 25.021 33.676 56.452  1.00 114.17 ? 450  PHE A CG  1 
ATOM   1758 C CD1 . PHE A 1 224 ? 23.643 33.818 56.358  1.00 115.11 ? 450  PHE A CD1 1 
ATOM   1759 C CD2 . PHE A 1 224 ? 25.551 33.062 57.580  1.00 115.57 ? 450  PHE A CD2 1 
ATOM   1760 C CE1 . PHE A 1 224 ? 22.808 33.352 57.370  1.00 116.89 ? 450  PHE A CE1 1 
ATOM   1761 C CE2 . PHE A 1 224 ? 24.726 32.593 58.595  1.00 116.41 ? 450  PHE A CE2 1 
ATOM   1762 C CZ  . PHE A 1 224 ? 23.354 32.737 58.491  1.00 116.77 ? 450  PHE A CZ  1 
ATOM   1763 N N   . LEU A 1 225 ? 27.652 36.670 54.935  1.00 109.64 ? 451  LEU A N   1 
ATOM   1764 C CA  . LEU A 1 225 ? 28.573 37.693 55.437  1.00 109.20 ? 451  LEU A CA  1 
ATOM   1765 C C   . LEU A 1 225 ? 28.086 39.104 55.093  1.00 109.25 ? 451  LEU A C   1 
ATOM   1766 O O   . LEU A 1 225 ? 27.982 39.967 55.968  1.00 109.90 ? 451  LEU A O   1 
ATOM   1767 C CB  . LEU A 1 225 ? 29.973 37.477 54.848  1.00 107.66 ? 451  LEU A CB  1 
ATOM   1768 C CG  . LEU A 1 225 ? 31.062 38.512 55.152  1.00 106.49 ? 451  LEU A CG  1 
ATOM   1769 C CD1 . LEU A 1 225 ? 31.341 38.578 56.646  1.00 105.64 ? 451  LEU A CD1 1 
ATOM   1770 C CD2 . LEU A 1 225 ? 32.315 38.138 54.393  1.00 105.23 ? 451  LEU A CD2 1 
ATOM   1771 N N   . MET A 1 226 ? 27.790 39.322 53.814  1.00 108.68 ? 452  MET A N   1 
ATOM   1772 C CA  . MET A 1 226 ? 27.312 40.607 53.310  1.00 108.13 ? 452  MET A CA  1 
ATOM   1773 C C   . MET A 1 226 ? 26.199 41.195 54.173  1.00 108.65 ? 452  MET A C   1 
ATOM   1774 O O   . MET A 1 226 ? 26.265 42.357 54.580  1.00 108.18 ? 452  MET A O   1 
ATOM   1775 C CB  . MET A 1 226 ? 26.796 40.435 51.884  1.00 106.62 ? 452  MET A CB  1 
ATOM   1776 C CG  . MET A 1 226 ? 26.847 41.688 51.037  1.00 105.67 ? 452  MET A CG  1 
ATOM   1777 S SD  . MET A 1 226 ? 28.528 42.120 50.552  1.00 104.63 ? 452  MET A SD  1 
ATOM   1778 C CE  . MET A 1 226 ? 28.590 43.837 51.042  1.00 105.41 ? 452  MET A CE  1 
ATOM   1779 N N   . GLU A 1 227 ? 25.180 40.386 54.445  1.00 109.63 ? 453  GLU A N   1 
ATOM   1780 C CA  . GLU A 1 227 ? 24.042 40.817 55.244  1.00 111.09 ? 453  GLU A CA  1 
ATOM   1781 C C   . GLU A 1 227 ? 24.388 41.263 56.662  1.00 112.57 ? 453  GLU A C   1 
ATOM   1782 O O   . GLU A 1 227 ? 23.763 42.181 57.198  1.00 112.98 ? 453  GLU A O   1 
ATOM   1783 C CB  . GLU A 1 227 ? 23.008 39.703 55.313  1.00 110.85 ? 453  GLU A CB  1 
ATOM   1784 C CG  . GLU A 1 227 ? 21.742 40.121 56.025  1.00 112.27 ? 453  GLU A CG  1 
ATOM   1785 C CD  . GLU A 1 227 ? 20.766 38.979 56.183  1.00 113.05 ? 453  GLU A CD  1 
ATOM   1786 O OE1 . GLU A 1 227 ? 20.426 38.347 55.158  1.00 113.48 ? 453  GLU A OE1 1 
ATOM   1787 O OE2 . GLU A 1 227 ? 20.344 38.714 57.330  1.00 113.17 ? 453  GLU A OE2 1 
ATOM   1788 N N   . MET A 1 228 ? 25.377 40.618 57.273  1.00 114.28 ? 454  MET A N   1 
ATOM   1789 C CA  . MET A 1 228 ? 25.774 40.971 58.632  1.00 116.42 ? 454  MET A CA  1 
ATOM   1790 C C   . MET A 1 228 ? 26.359 42.374 58.772  1.00 118.71 ? 454  MET A C   1 
ATOM   1791 O O   . MET A 1 228 ? 26.292 42.960 59.851  1.00 118.44 ? 454  MET A O   1 
ATOM   1792 C CB  . MET A 1 228 ? 26.776 39.954 59.187  1.00 114.83 ? 454  MET A CB  1 
ATOM   1793 C CG  . MET A 1 228 ? 26.233 38.544 59.294  1.00 113.28 ? 454  MET A CG  1 
ATOM   1794 S SD  . MET A 1 228 ? 24.590 38.490 60.032  1.00 112.90 ? 454  MET A SD  1 
ATOM   1795 C CE  . MET A 1 228 ? 24.971 38.537 61.776  1.00 111.16 ? 454  MET A CE  1 
ATOM   1796 N N   . LEU A 1 229 ? 26.930 42.912 57.694  1.00 121.86 ? 455  LEU A N   1 
ATOM   1797 C CA  . LEU A 1 229 ? 27.520 44.249 57.741  1.00 125.20 ? 455  LEU A CA  1 
ATOM   1798 C C   . LEU A 1 229 ? 26.698 45.336 57.036  1.00 128.28 ? 455  LEU A C   1 
ATOM   1799 O O   . LEU A 1 229 ? 26.580 45.362 55.807  1.00 127.72 ? 455  LEU A O   1 
ATOM   1800 C CB  . LEU A 1 229 ? 28.969 44.232 57.200  1.00 123.65 ? 455  LEU A CB  1 
ATOM   1801 C CG  . LEU A 1 229 ? 29.382 43.880 55.762  1.00 122.41 ? 455  LEU A CG  1 
ATOM   1802 C CD1 . LEU A 1 229 ? 30.872 44.108 55.605  1.00 121.49 ? 455  LEU A CD1 1 
ATOM   1803 C CD2 . LEU A 1 229 ? 29.069 42.447 55.443  1.00 121.61 ? 455  LEU A CD2 1 
ATOM   1804 N N   . GLU A 1 230 ? 26.130 46.229 57.846  1.00 132.85 ? 456  GLU A N   1 
ATOM   1805 C CA  . GLU A 1 230 ? 25.318 47.348 57.370  1.00 137.64 ? 456  GLU A CA  1 
ATOM   1806 C C   . GLU A 1 230 ? 25.286 48.510 58.376  1.00 141.11 ? 456  GLU A C   1 
ATOM   1807 O O   . GLU A 1 230 ? 24.311 48.688 59.116  1.00 141.62 ? 456  GLU A O   1 
ATOM   1808 C CB  . GLU A 1 230 ? 23.883 46.898 57.097  1.00 137.26 ? 456  GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 230 ? 23.727 45.873 56.003  1.00 137.13 ? 456  GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 230 ? 22.272 45.588 55.725  1.00 137.40 ? 456  GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 230 ? 21.575 46.493 55.215  1.00 137.70 ? 456  GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 230 ? 21.824 44.465 56.031  1.00 138.04 ? 456  GLU A OE2 1 
ATOM   1813 N N   . ALA A 1 231 ? 26.363 49.289 58.394  1.00 144.98 ? 457  ALA A N   1 
ATOM   1814 C CA  . ALA A 1 231 ? 26.498 50.453 59.270  1.00 148.32 ? 457  ALA A CA  1 
ATOM   1815 C C   . ALA A 1 231 ? 27.429 51.426 58.537  1.00 151.13 ? 457  ALA A C   1 
ATOM   1816 O O   . ALA A 1 231 ? 28.571 51.087 58.220  1.00 151.64 ? 457  ALA A O   1 
ATOM   1817 C CB  . ALA A 1 231 ? 27.099 50.046 60.621  1.00 147.10 ? 457  ALA A CB  1 
ATOM   1818 N N   . PRO A 1 232 ? 26.941 52.645 58.249  1.00 153.52 ? 458  PRO A N   1 
ATOM   1819 C CA  . PRO A 1 232 ? 27.685 53.702 57.546  1.00 154.37 ? 458  PRO A CA  1 
ATOM   1820 C C   . PRO A 1 232 ? 29.165 53.851 57.923  1.00 154.55 ? 458  PRO A C   1 
ATOM   1821 O O   . PRO A 1 232 ? 29.583 53.289 58.961  1.00 154.74 ? 458  PRO A O   1 
ATOM   1822 C CB  . PRO A 1 232 ? 26.872 54.956 57.870  1.00 154.75 ? 458  PRO A CB  1 
ATOM   1823 C CG  . PRO A 1 232 ? 25.467 54.426 57.895  1.00 154.50 ? 458  PRO A CG  1 
ATOM   1824 C CD  . PRO A 1 232 ? 25.620 53.138 58.689  1.00 154.18 ? 458  PRO A CD  1 
ATOM   1825 N N   . PRO B 2 1   ? 34.527 39.796 101.840 1.00 177.22 ? 103  PRO B N   1 
ATOM   1826 C CA  . PRO B 2 1   ? 35.403 40.657 102.674 1.00 177.41 ? 103  PRO B CA  1 
ATOM   1827 C C   . PRO B 2 1   ? 36.848 40.142 102.722 1.00 177.54 ? 103  PRO B C   1 
ATOM   1828 O O   . PRO B 2 1   ? 37.260 39.522 103.706 1.00 177.79 ? 103  PRO B O   1 
ATOM   1829 C CB  . PRO B 2 1   ? 34.786 40.681 104.066 1.00 177.21 ? 103  PRO B CB  1 
ATOM   1830 C CG  . PRO B 2 1   ? 33.309 40.437 103.740 1.00 177.01 ? 103  PRO B CG  1 
ATOM   1831 C CD  . PRO B 2 1   ? 33.327 39.406 102.604 1.00 176.83 ? 103  PRO B CD  1 
ATOM   1832 N N   . VAL B 2 2   ? 37.611 40.412 101.661 1.00 177.23 ? 104  VAL B N   1 
ATOM   1833 C CA  . VAL B 2 2   ? 39.009 39.974 101.564 1.00 176.33 ? 104  VAL B CA  1 
ATOM   1834 C C   . VAL B 2 2   ? 40.038 41.072 101.888 1.00 175.43 ? 104  VAL B C   1 
ATOM   1835 O O   . VAL B 2 2   ? 39.675 42.218 102.172 1.00 175.80 ? 104  VAL B O   1 
ATOM   1836 C CB  . VAL B 2 2   ? 39.318 39.397 100.150 1.00 176.42 ? 104  VAL B CB  1 
ATOM   1837 C CG1 . VAL B 2 2   ? 38.560 38.093 99.939  1.00 176.05 ? 104  VAL B CG1 1 
ATOM   1838 C CG2 . VAL B 2 2   ? 38.936 40.406 99.075  1.00 176.42 ? 104  VAL B CG2 1 
ATOM   1839 N N   . GLN B 2 3   ? 41.321 40.709 101.842 1.00 173.69 ? 105  GLN B N   1 
ATOM   1840 C CA  . GLN B 2 3   ? 42.415 41.636 102.137 1.00 171.43 ? 105  GLN B CA  1 
ATOM   1841 C C   . GLN B 2 3   ? 42.822 42.500 100.951 1.00 170.10 ? 105  GLN B C   1 
ATOM   1842 O O   . GLN B 2 3   ? 42.399 42.281 99.816  1.00 170.17 ? 105  GLN B O   1 
ATOM   1843 C CB  . GLN B 2 3   ? 43.671 40.880 102.593 1.00 171.23 ? 105  GLN B CB  1 
ATOM   1844 C CG  . GLN B 2 3   ? 43.532 40.033 103.843 1.00 170.46 ? 105  GLN B CG  1 
ATOM   1845 C CD  . GLN B 2 3   ? 44.821 39.299 104.185 1.00 169.95 ? 105  GLN B CD  1 
ATOM   1846 O OE1 . GLN B 2 3   ? 44.849 38.471 105.093 1.00 169.93 ? 105  GLN B OE1 1 
ATOM   1847 N NE2 . GLN B 2 3   ? 45.895 39.605 103.459 1.00 169.52 ? 105  GLN B NE2 1 
ATOM   1848 N N   . LEU B 2 4   ? 43.671 43.478 101.247 1.00 168.42 ? 106  LEU B N   1 
ATOM   1849 C CA  . LEU B 2 4   ? 44.222 44.398 100.261 1.00 166.67 ? 106  LEU B CA  1 
ATOM   1850 C C   . LEU B 2 4   ? 45.659 44.640 100.729 1.00 165.39 ? 106  LEU B C   1 
ATOM   1851 O O   . LEU B 2 4   ? 45.925 45.534 101.531 1.00 165.34 ? 106  LEU B O   1 
ATOM   1852 C CB  . LEU B 2 4   ? 43.413 45.706 100.231 1.00 166.32 ? 106  LEU B CB  1 
ATOM   1853 C CG  . LEU B 2 4   ? 42.045 45.660 99.528  1.00 165.76 ? 106  LEU B CG  1 
ATOM   1854 C CD1 . LEU B 2 4   ? 41.161 46.802 100.002 1.00 165.05 ? 106  LEU B CD1 1 
ATOM   1855 C CD2 . LEU B 2 4   ? 42.246 45.722 98.020  1.00 165.16 ? 106  LEU B CD2 1 
ATOM   1856 N N   . SER B 2 5   ? 46.567 43.799 100.236 1.00 163.90 ? 107  SER B N   1 
ATOM   1857 C CA  . SER B 2 5   ? 47.992 43.836 100.573 1.00 162.10 ? 107  SER B CA  1 
ATOM   1858 C C   . SER B 2 5   ? 48.560 45.223 100.826 1.00 160.76 ? 107  SER B C   1 
ATOM   1859 O O   . SER B 2 5   ? 47.910 46.228 100.559 1.00 161.12 ? 107  SER B O   1 
ATOM   1860 C CB  . SER B 2 5   ? 48.806 43.171 99.462  1.00 162.19 ? 107  SER B CB  1 
ATOM   1861 O OG  . SER B 2 5   ? 48.717 43.914 98.257  1.00 161.74 ? 107  SER B OG  1 
ATOM   1862 N N   . LYS B 2 6   ? 49.794 45.266 101.321 1.00 158.90 ? 108  LYS B N   1 
ATOM   1863 C CA  . LYS B 2 6   ? 50.464 46.534 101.616 1.00 156.40 ? 108  LYS B CA  1 
ATOM   1864 C C   . LYS B 2 6   ? 50.703 47.365 100.348 1.00 154.34 ? 108  LYS B C   1 
ATOM   1865 O O   . LYS B 2 6   ? 50.848 48.585 100.424 1.00 154.12 ? 108  LYS B O   1 
ATOM   1866 C CB  . LYS B 2 6   ? 51.795 46.275 102.342 1.00 156.46 ? 108  LYS B CB  1 
ATOM   1867 C CG  . LYS B 2 6   ? 52.156 47.322 103.408 1.00 155.62 ? 108  LYS B CG  1 
ATOM   1868 C CD  . LYS B 2 6   ? 51.245 47.249 104.644 1.00 153.88 ? 108  LYS B CD  1 
ATOM   1869 C CE  . LYS B 2 6   ? 51.526 46.019 105.505 1.00 152.29 ? 108  LYS B CE  1 
ATOM   1870 N NZ  . LYS B 2 6   ? 52.878 46.059 106.129 1.00 151.02 ? 108  LYS B NZ  1 
ATOM   1871 N N   . GLU B 2 7   ? 50.749 46.708 99.188  1.00 151.83 ? 109  GLU B N   1 
ATOM   1872 C CA  . GLU B 2 7   ? 50.938 47.408 97.920  1.00 149.31 ? 109  GLU B CA  1 
ATOM   1873 C C   . GLU B 2 7   ? 49.603 47.950 97.425  1.00 146.89 ? 109  GLU B C   1 
ATOM   1874 O O   . GLU B 2 7   ? 49.484 49.133 97.112  1.00 146.35 ? 109  GLU B O   1 
ATOM   1875 C CB  . GLU B 2 7   ? 51.520 46.478 96.855  1.00 150.34 ? 109  GLU B CB  1 
ATOM   1876 C CG  . GLU B 2 7   ? 52.971 46.096 97.070  1.00 151.73 ? 109  GLU B CG  1 
ATOM   1877 C CD  . GLU B 2 7   ? 53.605 45.511 95.818  1.00 152.78 ? 109  GLU B CD  1 
ATOM   1878 O OE1 . GLU B 2 7   ? 53.054 44.534 95.267  1.00 153.51 ? 109  GLU B OE1 1 
ATOM   1879 O OE2 . GLU B 2 7   ? 54.656 46.028 95.384  1.00 153.46 ? 109  GLU B OE2 1 
ATOM   1880 N N   . GLN B 2 8   ? 48.601 47.075 97.359  1.00 144.19 ? 110  GLN B N   1 
ATOM   1881 C CA  . GLN B 2 8   ? 47.261 47.453 96.914  1.00 141.58 ? 110  GLN B CA  1 
ATOM   1882 C C   . GLN B 2 8   ? 46.728 48.640 97.720  1.00 140.23 ? 110  GLN B C   1 
ATOM   1883 O O   . GLN B 2 8   ? 45.891 49.403 97.239  1.00 139.84 ? 110  GLN B O   1 
ATOM   1884 C CB  . GLN B 2 8   ? 46.304 46.262 97.052  1.00 141.00 ? 110  GLN B CB  1 
ATOM   1885 C CG  . GLN B 2 8   ? 46.767 44.998 96.335  1.00 139.60 ? 110  GLN B CG  1 
ATOM   1886 C CD  . GLN B 2 8   ? 45.760 43.863 96.430  1.00 138.85 ? 110  GLN B CD  1 
ATOM   1887 O OE1 . GLN B 2 8   ? 45.337 43.480 97.520  1.00 137.72 ? 110  GLN B OE1 1 
ATOM   1888 N NE2 . GLN B 2 8   ? 45.376 43.316 95.283  1.00 138.62 ? 110  GLN B NE2 1 
ATOM   1889 N N   . GLU B 2 9   ? 47.219 48.781 98.949  1.00 139.28 ? 111  GLU B N   1 
ATOM   1890 C CA  . GLU B 2 9   ? 46.827 49.868 99.843  1.00 138.31 ? 111  GLU B CA  1 
ATOM   1891 C C   . GLU B 2 9   ? 47.337 51.206 99.317  1.00 136.59 ? 111  GLU B C   1 
ATOM   1892 O O   . GLU B 2 9   ? 46.585 52.176 99.207  1.00 136.39 ? 111  GLU B O   1 
ATOM   1893 C CB  . GLU B 2 9   ? 47.412 49.643 101.243 1.00 139.30 ? 111  GLU B CB  1 
ATOM   1894 C CG  . GLU B 2 9   ? 46.972 48.363 101.936 1.00 140.34 ? 111  GLU B CG  1 
ATOM   1895 C CD  . GLU B 2 9   ? 45.581 48.457 102.523 1.00 141.04 ? 111  GLU B CD  1 
ATOM   1896 O OE1 . GLU B 2 9   ? 45.398 49.215 103.500 1.00 142.00 ? 111  GLU B OE1 1 
ATOM   1897 O OE2 . GLU B 2 9   ? 44.672 47.774 102.010 1.00 141.52 ? 111  GLU B OE2 1 
ATOM   1898 N N   . GLU B 2 10  ? 48.628 51.248 99.003  1.00 134.56 ? 112  GLU B N   1 
ATOM   1899 C CA  . GLU B 2 10  ? 49.254 52.464 98.508  1.00 132.98 ? 112  GLU B CA  1 
ATOM   1900 C C   . GLU B 2 10  ? 48.791 52.826 97.094  1.00 131.13 ? 112  GLU B C   1 
ATOM   1901 O O   . GLU B 2 10  ? 48.697 54.006 96.746  1.00 131.44 ? 112  GLU B O   1 
ATOM   1902 C CB  . GLU B 2 10  ? 50.776 52.313 98.544  1.00 133.81 ? 112  GLU B CB  1 
ATOM   1903 C CG  . GLU B 2 10  ? 51.520 53.639 98.573  1.00 135.81 ? 112  GLU B CG  1 
ATOM   1904 C CD  . GLU B 2 10  ? 51.112 54.514 99.752  1.00 136.98 ? 112  GLU B CD  1 
ATOM   1905 O OE1 . GLU B 2 10  ? 51.209 54.042 100.907 1.00 137.28 ? 112  GLU B OE1 1 
ATOM   1906 O OE2 . GLU B 2 10  ? 50.696 55.673 99.524  1.00 137.58 ? 112  GLU B OE2 1 
ATOM   1907 N N   . LEU B 2 11  ? 48.503 51.813 96.283  1.00 128.48 ? 113  LEU B N   1 
ATOM   1908 C CA  . LEU B 2 11  ? 48.046 52.038 94.914  1.00 125.13 ? 113  LEU B CA  1 
ATOM   1909 C C   . LEU B 2 11  ? 46.826 52.946 94.918  1.00 123.46 ? 113  LEU B C   1 
ATOM   1910 O O   . LEU B 2 11  ? 46.768 53.937 94.190  1.00 123.36 ? 113  LEU B O   1 
ATOM   1911 C CB  . LEU B 2 11  ? 47.687 50.706 94.254  1.00 123.76 ? 113  LEU B CB  1 
ATOM   1912 C CG  . LEU B 2 11  ? 47.293 50.740 92.779  1.00 121.69 ? 113  LEU B CG  1 
ATOM   1913 C CD1 . LEU B 2 11  ? 48.424 51.338 91.965  1.00 120.24 ? 113  LEU B CD1 1 
ATOM   1914 C CD2 . LEU B 2 11  ? 46.975 49.326 92.312  1.00 121.52 ? 113  LEU B CD2 1 
ATOM   1915 N N   . ILE B 2 12  ? 45.852 52.597 95.752  1.00 121.21 ? 114  ILE B N   1 
ATOM   1916 C CA  . ILE B 2 12  ? 44.626 53.369 95.867  1.00 119.11 ? 114  ILE B CA  1 
ATOM   1917 C C   . ILE B 2 12  ? 44.898 54.760 96.444  1.00 118.13 ? 114  ILE B C   1 
ATOM   1918 O O   . ILE B 2 12  ? 44.220 55.726 96.098  1.00 118.13 ? 114  ILE B O   1 
ATOM   1919 C CB  . ILE B 2 12  ? 43.609 52.637 96.764  1.00 118.36 ? 114  ILE B CB  1 
ATOM   1920 C CG1 . ILE B 2 12  ? 43.428 51.199 96.274  1.00 117.38 ? 114  ILE B CG1 1 
ATOM   1921 C CG2 . ILE B 2 12  ? 42.273 53.359 96.735  1.00 118.61 ? 114  ILE B CG2 1 
ATOM   1922 C CD1 . ILE B 2 12  ? 42.365 50.433 97.023  1.00 117.24 ? 114  ILE B CD1 1 
ATOM   1923 N N   . ARG B 2 13  ? 45.896 54.858 97.316  1.00 116.95 ? 115  ARG B N   1 
ATOM   1924 C CA  . ARG B 2 13  ? 46.254 56.125 97.943  1.00 116.35 ? 115  ARG B CA  1 
ATOM   1925 C C   . ARG B 2 13  ? 46.858 57.143 96.972  1.00 115.73 ? 115  ARG B C   1 
ATOM   1926 O O   . ARG B 2 13  ? 46.799 58.348 97.217  1.00 116.07 ? 115  ARG B O   1 
ATOM   1927 C CB  . ARG B 2 13  ? 47.226 55.867 99.096  1.00 117.06 ? 115  ARG B CB  1 
ATOM   1928 C CG  . ARG B 2 13  ? 47.610 57.094 99.905  1.00 118.36 ? 115  ARG B CG  1 
ATOM   1929 C CD  . ARG B 2 13  ? 48.406 56.681 101.135 1.00 120.15 ? 115  ARG B CD  1 
ATOM   1930 N NE  . ARG B 2 13  ? 48.758 57.797 102.014 1.00 122.69 ? 115  ARG B NE  1 
ATOM   1931 C CZ  . ARG B 2 13  ? 47.886 58.529 102.707 1.00 124.41 ? 115  ARG B CZ  1 
ATOM   1932 N NH1 . ARG B 2 13  ? 46.581 58.282 102.637 1.00 125.04 ? 115  ARG B NH1 1 
ATOM   1933 N NH2 . ARG B 2 13  ? 48.324 59.506 103.491 1.00 125.02 ? 115  ARG B NH2 1 
ATOM   1934 N N   . THR B 2 14  ? 47.436 56.667 95.872  1.00 114.80 ? 116  THR B N   1 
ATOM   1935 C CA  . THR B 2 14  ? 48.040 57.564 94.888  1.00 113.66 ? 116  THR B CA  1 
ATOM   1936 C C   . THR B 2 14  ? 47.091 57.883 93.721  1.00 113.24 ? 116  THR B C   1 
ATOM   1937 O O   . THR B 2 14  ? 47.229 58.915 93.058  1.00 113.46 ? 116  THR B O   1 
ATOM   1938 C CB  . THR B 2 14  ? 49.346 56.971 94.329  1.00 113.22 ? 116  THR B CB  1 
ATOM   1939 O OG1 . THR B 2 14  ? 50.136 56.453 95.408  1.00 111.91 ? 116  THR B OG1 1 
ATOM   1940 C CG2 . THR B 2 14  ? 50.144 58.049 93.601  1.00 113.33 ? 116  THR B CG2 1 
ATOM   1941 N N   . LEU B 2 15  ? 46.140 56.986 93.469  1.00 111.99 ? 117  LEU B N   1 
ATOM   1942 C CA  . LEU B 2 15  ? 45.142 57.170 92.418  1.00 110.85 ? 117  LEU B CA  1 
ATOM   1943 C C   . LEU B 2 15  ? 44.281 58.386 92.760  1.00 111.09 ? 117  LEU B C   1 
ATOM   1944 O O   . LEU B 2 15  ? 43.978 59.216 91.904  1.00 110.26 ? 117  LEU B O   1 
ATOM   1945 C CB  . LEU B 2 15  ? 44.244 55.938 92.339  1.00 109.67 ? 117  LEU B CB  1 
ATOM   1946 C CG  . LEU B 2 15  ? 44.668 54.774 91.456  1.00 108.24 ? 117  LEU B CG  1 
ATOM   1947 C CD1 . LEU B 2 15  ? 43.786 53.568 91.714  1.00 106.67 ? 117  LEU B CD1 1 
ATOM   1948 C CD2 . LEU B 2 15  ? 44.563 55.211 90.013  1.00 108.19 ? 117  LEU B CD2 1 
ATOM   1949 N N   . LEU B 2 16  ? 43.879 58.455 94.027  1.00 112.04 ? 118  LEU B N   1 
ATOM   1950 C CA  . LEU B 2 16  ? 43.062 59.539 94.562  1.00 112.27 ? 118  LEU B CA  1 
ATOM   1951 C C   . LEU B 2 16  ? 43.919 60.780 94.772  1.00 112.45 ? 118  LEU B C   1 
ATOM   1952 O O   . LEU B 2 16  ? 43.441 61.904 94.639  1.00 112.84 ? 118  LEU B O   1 
ATOM   1953 C CB  . LEU B 2 16  ? 42.443 59.123 95.899  1.00 112.19 ? 118  LEU B CB  1 
ATOM   1954 C CG  . LEU B 2 16  ? 41.193 58.235 95.912  1.00 112.65 ? 118  LEU B CG  1 
ATOM   1955 C CD1 . LEU B 2 16  ? 41.402 56.952 95.121  1.00 112.72 ? 118  LEU B CD1 1 
ATOM   1956 C CD2 . LEU B 2 16  ? 40.855 57.918 97.356  1.00 113.03 ? 118  LEU B CD2 1 
ATOM   1957 N N   . GLY B 2 17  ? 45.184 60.569 95.125  1.00 112.52 ? 119  GLY B N   1 
ATOM   1958 C CA  . GLY B 2 17  ? 46.079 61.690 95.319  1.00 112.97 ? 119  GLY B CA  1 
ATOM   1959 C C   . GLY B 2 17  ? 46.008 62.590 94.098  1.00 113.64 ? 119  GLY B C   1 
ATOM   1960 O O   . GLY B 2 17  ? 45.787 63.791 94.223  1.00 113.85 ? 119  GLY B O   1 
ATOM   1961 N N   . ALA B 2 18  ? 46.177 61.997 92.916  1.00 113.96 ? 120  ALA B N   1 
ATOM   1962 C CA  . ALA B 2 18  ? 46.137 62.726 91.647  1.00 113.64 ? 120  ALA B CA  1 
ATOM   1963 C C   . ALA B 2 18  ? 44.717 62.946 91.105  1.00 113.93 ? 120  ALA B C   1 
ATOM   1964 O O   . ALA B 2 18  ? 44.491 63.861 90.310  1.00 114.13 ? 120  ALA B O   1 
ATOM   1965 C CB  . ALA B 2 18  ? 46.972 61.995 90.613  1.00 112.82 ? 120  ALA B CB  1 
ATOM   1966 N N   . HIS B 2 19  ? 43.769 62.107 91.522  1.00 113.79 ? 121  HIS B N   1 
ATOM   1967 C CA  . HIS B 2 19  ? 42.383 62.227 91.071  1.00 113.14 ? 121  HIS B CA  1 
ATOM   1968 C C   . HIS B 2 19  ? 41.644 63.372 91.750  1.00 113.75 ? 121  HIS B C   1 
ATOM   1969 O O   . HIS B 2 19  ? 40.979 64.166 91.092  1.00 114.45 ? 121  HIS B O   1 
ATOM   1970 C CB  . HIS B 2 19  ? 41.623 60.922 91.318  1.00 111.72 ? 121  HIS B CB  1 
ATOM   1971 C CG  . HIS B 2 19  ? 40.133 61.066 91.229  1.00 109.96 ? 121  HIS B CG  1 
ATOM   1972 N ND1 . HIS B 2 19  ? 39.347 61.379 92.317  1.00 109.51 ? 121  HIS B ND1 1 
ATOM   1973 C CD2 . HIS B 2 19  ? 39.288 60.951 90.177  1.00 109.06 ? 121  HIS B CD2 1 
ATOM   1974 C CE1 . HIS B 2 19  ? 38.083 61.447 91.941  1.00 109.15 ? 121  HIS B CE1 1 
ATOM   1975 N NE2 . HIS B 2 19  ? 38.019 61.192 90.647  1.00 108.81 ? 121  HIS B NE2 1 
ATOM   1976 N N   . THR B 2 20  ? 41.753 63.451 93.070  1.00 114.05 ? 122  THR B N   1 
ATOM   1977 C CA  . THR B 2 20  ? 41.086 64.508 93.810  1.00 114.28 ? 122  THR B CA  1 
ATOM   1978 C C   . THR B 2 20  ? 41.721 65.867 93.532  1.00 114.58 ? 122  THR B C   1 
ATOM   1979 O O   . THR B 2 20  ? 41.072 66.903 93.689  1.00 113.95 ? 122  THR B O   1 
ATOM   1980 C CB  . THR B 2 20  ? 41.116 64.222 95.312  1.00 114.25 ? 122  THR B CB  1 
ATOM   1981 O OG1 . THR B 2 20  ? 40.427 62.993 95.573  1.00 114.19 ? 122  THR B OG1 1 
ATOM   1982 C CG2 . THR B 2 20  ? 40.432 65.334 96.069  1.00 115.10 ? 122  THR B CG2 1 
ATOM   1983 N N   . ARG B 2 21  ? 42.986 65.857 93.110  1.00 115.31 ? 123  ARG B N   1 
ATOM   1984 C CA  . ARG B 2 21  ? 43.715 67.083 92.784  1.00 115.95 ? 123  ARG B CA  1 
ATOM   1985 C C   . ARG B 2 21  ? 43.432 67.590 91.373  1.00 115.40 ? 123  ARG B C   1 
ATOM   1986 O O   . ARG B 2 21  ? 43.718 68.750 91.071  1.00 116.11 ? 123  ARG B O   1 
ATOM   1987 C CB  . ARG B 2 21  ? 45.225 66.873 92.886  1.00 117.12 ? 123  ARG B CB  1 
ATOM   1988 C CG  . ARG B 2 21  ? 45.772 66.664 94.269  1.00 120.19 ? 123  ARG B CG  1 
ATOM   1989 C CD  . ARG B 2 21  ? 47.231 66.251 94.158  1.00 122.52 ? 123  ARG B CD  1 
ATOM   1990 N NE  . ARG B 2 21  ? 47.779 65.775 95.425  1.00 125.10 ? 123  ARG B NE  1 
ATOM   1991 C CZ  . ARG B 2 21  ? 48.886 65.045 95.534  1.00 125.97 ? 123  ARG B CZ  1 
ATOM   1992 N NH1 . ARG B 2 21  ? 49.311 64.659 96.733  1.00 126.49 ? 123  ARG B NH1 1 
ATOM   1993 N NH2 . ARG B 2 21  ? 49.563 64.690 94.445  1.00 125.59 ? 123  ARG B NH2 1 
ATOM   1994 N N   . HIS B 2 22  ? 42.891 66.734 90.506  1.00 114.25 ? 124  HIS B N   1 
ATOM   1995 C CA  . HIS B 2 22  ? 42.621 67.143 89.130  1.00 113.15 ? 124  HIS B CA  1 
ATOM   1996 C C   . HIS B 2 22  ? 41.211 66.892 88.597  1.00 111.16 ? 124  HIS B C   1 
ATOM   1997 O O   . HIS B 2 22  ? 40.618 67.762 87.956  1.00 111.12 ? 124  HIS B O   1 
ATOM   1998 C CB  . HIS B 2 22  ? 43.646 66.496 88.190  1.00 114.79 ? 124  HIS B CB  1 
ATOM   1999 C CG  . HIS B 2 22  ? 45.059 66.915 88.464  1.00 116.47 ? 124  HIS B CG  1 
ATOM   2000 N ND1 . HIS B 2 22  ? 45.985 66.079 89.050  1.00 116.97 ? 124  HIS B ND1 1 
ATOM   2001 C CD2 . HIS B 2 22  ? 45.694 68.094 88.258  1.00 116.92 ? 124  HIS B CD2 1 
ATOM   2002 C CE1 . HIS B 2 22  ? 47.130 66.723 89.193  1.00 117.37 ? 124  HIS B CE1 1 
ATOM   2003 N NE2 . HIS B 2 22  ? 46.980 67.948 88.720  1.00 117.81 ? 124  HIS B NE2 1 
ATOM   2004 N N   . MET B 2 23  ? 40.673 65.708 88.845  1.00 108.72 ? 125  MET B N   1 
ATOM   2005 C CA  . MET B 2 23  ? 39.338 65.390 88.366  1.00 107.01 ? 125  MET B CA  1 
ATOM   2006 C C   . MET B 2 23  ? 38.402 65.289 89.560  1.00 106.29 ? 125  MET B C   1 
ATOM   2007 O O   . MET B 2 23  ? 38.776 65.658 90.673  1.00 105.52 ? 125  MET B O   1 
ATOM   2008 C CB  . MET B 2 23  ? 39.369 64.066 87.600  1.00 107.14 ? 125  MET B CB  1 
ATOM   2009 C CG  . MET B 2 23  ? 40.625 63.883 86.754  1.00 106.78 ? 125  MET B CG  1 
ATOM   2010 S SD  . MET B 2 23  ? 40.660 62.339 85.816  1.00 106.69 ? 125  MET B SD  1 
ATOM   2011 C CE  . MET B 2 23  ? 40.483 61.139 87.140  1.00 106.13 ? 125  MET B CE  1 
ATOM   2012 N N   . GLY B 2 24  ? 37.189 64.793 89.328  1.00 106.08 ? 126  GLY B N   1 
ATOM   2013 C CA  . GLY B 2 24  ? 36.226 64.653 90.406  1.00 106.19 ? 126  GLY B CA  1 
ATOM   2014 C C   . GLY B 2 24  ? 35.557 65.967 90.769  1.00 106.74 ? 126  GLY B C   1 
ATOM   2015 O O   . GLY B 2 24  ? 34.339 66.099 90.650  1.00 107.60 ? 126  GLY B O   1 
ATOM   2016 N N   . THR B 2 25  ? 36.350 66.939 91.217  1.00 106.37 ? 127  THR B N   1 
ATOM   2017 C CA  . THR B 2 25  ? 35.840 68.258 91.591  1.00 104.74 ? 127  THR B CA  1 
ATOM   2018 C C   . THR B 2 25  ? 35.868 69.250 90.412  1.00 104.72 ? 127  THR B C   1 
ATOM   2019 O O   . THR B 2 25  ? 35.429 70.394 90.542  1.00 105.60 ? 127  THR B O   1 
ATOM   2020 C CB  . THR B 2 25  ? 36.658 68.842 92.756  1.00 103.59 ? 127  THR B CB  1 
ATOM   2021 O OG1 . THR B 2 25  ? 38.010 69.064 92.334  1.00 102.59 ? 127  THR B OG1 1 
ATOM   2022 C CG2 . THR B 2 25  ? 36.661 67.878 93.924  1.00 102.63 ? 127  THR B CG2 1 
ATOM   2023 N N   . MET B 2 26  ? 36.376 68.803 89.265  1.00 103.10 ? 128  MET B N   1 
ATOM   2024 C CA  . MET B 2 26  ? 36.456 69.634 88.068  1.00 101.18 ? 128  MET B CA  1 
ATOM   2025 C C   . MET B 2 26  ? 35.082 69.959 87.478  1.00 101.29 ? 128  MET B C   1 
ATOM   2026 O O   . MET B 2 26  ? 34.962 70.843 86.629  1.00 101.60 ? 128  MET B O   1 
ATOM   2027 C CB  . MET B 2 26  ? 37.283 68.928 86.995  1.00 100.31 ? 128  MET B CB  1 
ATOM   2028 C CG  . MET B 2 26  ? 36.633 67.645 86.463  1.00 99.39  ? 128  MET B CG  1 
ATOM   2029 S SD  . MET B 2 26  ? 37.122 67.190 84.765  1.00 97.00  ? 128  MET B SD  1 
ATOM   2030 C CE  . MET B 2 26  ? 36.025 65.818 84.469  1.00 96.82  ? 128  MET B CE  1 
ATOM   2031 N N   . PHE B 2 27  ? 34.052 69.242 87.918  1.00 101.21 ? 129  PHE B N   1 
ATOM   2032 C CA  . PHE B 2 27  ? 32.697 69.446 87.416  1.00 101.72 ? 129  PHE B CA  1 
ATOM   2033 C C   . PHE B 2 27  ? 32.079 70.746 87.899  1.00 102.49 ? 129  PHE B C   1 
ATOM   2034 O O   . PHE B 2 27  ? 31.150 71.265 87.282  1.00 103.09 ? 129  PHE B O   1 
ATOM   2035 C CB  . PHE B 2 27  ? 31.800 68.279 87.823  1.00 100.41 ? 129  PHE B CB  1 
ATOM   2036 C CG  . PHE B 2 27  ? 32.259 66.955 87.298  1.00 99.87  ? 129  PHE B CG  1 
ATOM   2037 C CD1 . PHE B 2 27  ? 33.396 66.346 87.804  1.00 99.79  ? 129  PHE B CD1 1 
ATOM   2038 C CD2 . PHE B 2 27  ? 31.562 66.324 86.287  1.00 99.75  ? 129  PHE B CD2 1 
ATOM   2039 C CE1 . PHE B 2 27  ? 33.828 65.135 87.314  1.00 99.86  ? 129  PHE B CE1 1 
ATOM   2040 C CE2 . PHE B 2 27  ? 31.986 65.110 85.792  1.00 99.57  ? 129  PHE B CE2 1 
ATOM   2041 C CZ  . PHE B 2 27  ? 33.121 64.515 86.305  1.00 99.87  ? 129  PHE B CZ  1 
ATOM   2042 N N   . GLU B 2 28  ? 32.595 71.264 89.008  1.00 102.73 ? 130  GLU B N   1 
ATOM   2043 C CA  . GLU B 2 28  ? 32.101 72.513 89.572  1.00 102.51 ? 130  GLU B CA  1 
ATOM   2044 C C   . GLU B 2 28  ? 32.805 73.711 88.913  1.00 101.02 ? 130  GLU B C   1 
ATOM   2045 O O   . GLU B 2 28  ? 32.575 74.857 89.288  1.00 99.84  ? 130  GLU B O   1 
ATOM   2046 C CB  . GLU B 2 28  ? 32.351 72.535 91.082  1.00 104.81 ? 130  GLU B CB  1 
ATOM   2047 C CG  . GLU B 2 28  ? 32.017 71.227 91.824  1.00 108.96 ? 130  GLU B CG  1 
ATOM   2048 C CD  . GLU B 2 28  ? 30.524 70.876 91.850  1.00 111.57 ? 130  GLU B CD  1 
ATOM   2049 O OE1 . GLU B 2 28  ? 29.708 71.713 92.301  1.00 113.41 ? 130  GLU B OE1 1 
ATOM   2050 O OE2 . GLU B 2 28  ? 30.169 69.749 91.434  1.00 112.15 ? 130  GLU B OE2 1 
ATOM   2051 N N   . GLN B 2 29  ? 33.662 73.422 87.934  1.00 99.92  ? 131  GLN B N   1 
ATOM   2052 C CA  . GLN B 2 29  ? 34.411 74.431 87.199  1.00 98.80  ? 131  GLN B CA  1 
ATOM   2053 C C   . GLN B 2 29  ? 33.843 74.669 85.806  1.00 96.70  ? 131  GLN B C   1 
ATOM   2054 O O   . GLN B 2 29  ? 34.249 75.603 85.107  1.00 96.67  ? 131  GLN B O   1 
ATOM   2055 C CB  . GLN B 2 29  ? 35.877 74.018 87.066  1.00 101.81 ? 131  GLN B CB  1 
ATOM   2056 C CG  . GLN B 2 29  ? 36.731 74.348 88.283  1.00 106.03 ? 131  GLN B CG  1 
ATOM   2057 C CD  . GLN B 2 29  ? 38.193 73.961 88.106  1.00 107.82 ? 131  GLN B CD  1 
ATOM   2058 O OE1 . GLN B 2 29  ? 38.623 72.893 88.554  1.00 109.80 ? 131  GLN B OE1 1 
ATOM   2059 N NE2 . GLN B 2 29  ? 38.963 74.824 87.443  1.00 107.89 ? 131  GLN B NE2 1 
ATOM   2060 N N   . PHE B 2 30  ? 32.906 73.819 85.402  1.00 93.63  ? 132  PHE B N   1 
ATOM   2061 C CA  . PHE B 2 30  ? 32.264 73.921 84.095  1.00 90.69  ? 132  PHE B CA  1 
ATOM   2062 C C   . PHE B 2 30  ? 31.574 75.268 83.882  1.00 89.86  ? 132  PHE B C   1 
ATOM   2063 O O   . PHE B 2 30  ? 31.491 75.770 82.761  1.00 89.31  ? 132  PHE B O   1 
ATOM   2064 C CB  . PHE B 2 30  ? 31.252 72.781 83.940  1.00 88.16  ? 132  PHE B CB  1 
ATOM   2065 C CG  . PHE B 2 30  ? 31.882 71.425 83.772  1.00 84.93  ? 132  PHE B CG  1 
ATOM   2066 C CD1 . PHE B 2 30  ? 33.176 71.191 84.196  1.00 82.87  ? 132  PHE B CD1 1 
ATOM   2067 C CD2 . PHE B 2 30  ? 31.190 70.396 83.156  1.00 83.81  ? 132  PHE B CD2 1 
ATOM   2068 C CE1 . PHE B 2 30  ? 33.772 69.978 84.010  1.00 81.45  ? 132  PHE B CE1 1 
ATOM   2069 C CE2 . PHE B 2 30  ? 31.787 69.169 82.966  1.00 81.90  ? 132  PHE B CE2 1 
ATOM   2070 C CZ  . PHE B 2 30  ? 33.077 68.962 83.391  1.00 81.24  ? 132  PHE B CZ  1 
ATOM   2071 N N   . VAL B 2 31  ? 31.100 75.870 84.965  1.00 89.10  ? 133  VAL B N   1 
ATOM   2072 C CA  . VAL B 2 31  ? 30.404 77.158 84.884  1.00 88.10  ? 133  VAL B CA  1 
ATOM   2073 C C   . VAL B 2 31  ? 31.224 78.340 84.395  1.00 89.06  ? 133  VAL B C   1 
ATOM   2074 O O   . VAL B 2 31  ? 30.690 79.353 83.984  1.00 88.66  ? 133  VAL B O   1 
ATOM   2075 C CB  . VAL B 2 31  ? 29.800 77.519 86.246  1.00 86.55  ? 133  VAL B CB  1 
ATOM   2076 C CG1 . VAL B 2 31  ? 28.916 76.391 86.709  1.00 84.97  ? 133  VAL B CG1 1 
ATOM   2077 C CG2 . VAL B 2 31  ? 30.909 77.813 87.256  1.00 84.58  ? 133  VAL B CG2 1 
ATOM   2078 N N   . GLN B 2 32  ? 32.535 78.211 84.432  1.00 89.54  ? 134  GLN B N   1 
ATOM   2079 C CA  . GLN B 2 32  ? 33.385 79.306 83.987  1.00 91.01  ? 134  GLN B CA  1 
ATOM   2080 C C   . GLN B 2 32  ? 33.739 79.199 82.523  1.00 90.72  ? 134  GLN B C   1 
ATOM   2081 O O   . GLN B 2 32  ? 34.718 79.826 82.076  1.00 91.56  ? 134  GLN B O   1 
ATOM   2082 C CB  . GLN B 2 32  ? 34.679 79.330 84.775  1.00 93.32  ? 134  GLN B CB  1 
ATOM   2083 C CG  . GLN B 2 32  ? 34.592 78.613 86.097  1.00 96.85  ? 134  GLN B CG  1 
ATOM   2084 C CD  . GLN B 2 32  ? 35.961 78.077 86.447  1.00 100.37 ? 134  GLN B CD  1 
ATOM   2085 O OE1 . GLN B 2 32  ? 36.105 77.225 87.314  1.00 103.39 ? 134  GLN B OE1 1 
ATOM   2086 N NE2 . GLN B 2 32  ? 36.991 78.581 85.751  1.00 102.44 ? 134  GLN B NE2 1 
ATOM   2087 N N   . PHE B 2 33  ? 32.995 78.397 81.767  1.00 89.29  ? 135  PHE B N   1 
ATOM   2088 C CA  . PHE B 2 33  ? 33.304 78.260 80.342  1.00 88.05  ? 135  PHE B CA  1 
ATOM   2089 C C   . PHE B 2 33  ? 32.206 78.907 79.541  1.00 87.03  ? 135  PHE B C   1 
ATOM   2090 O O   . PHE B 2 33  ? 31.809 78.411 78.484  1.00 86.84  ? 135  PHE B O   1 
ATOM   2091 C CB  . PHE B 2 33  ? 33.461 76.782 80.017  1.00 88.87  ? 135  PHE B CB  1 
ATOM   2092 C CG  . PHE B 2 33  ? 34.668 76.172 80.662  1.00 89.46  ? 135  PHE B CG  1 
ATOM   2093 C CD1 . PHE B 2 33  ? 35.907 76.239 80.045  1.00 89.07  ? 135  PHE B CD1 1 
ATOM   2094 C CD2 . PHE B 2 33  ? 34.587 75.648 81.941  1.00 90.18  ? 135  PHE B CD2 1 
ATOM   2095 C CE1 . PHE B 2 33  ? 37.036 75.806 80.700  1.00 89.71  ? 135  PHE B CE1 1 
ATOM   2096 C CE2 . PHE B 2 33  ? 35.715 75.215 82.601  1.00 89.85  ? 135  PHE B CE2 1 
ATOM   2097 C CZ  . PHE B 2 33  ? 36.940 75.297 81.981  1.00 89.87  ? 135  PHE B CZ  1 
ATOM   2098 N N   . ARG B 2 34  ? 31.765 80.058 80.055  1.00 85.92  ? 136  ARG B N   1 
ATOM   2099 C CA  . ARG B 2 34  ? 30.706 80.839 79.427  1.00 85.12  ? 136  ARG B CA  1 
ATOM   2100 C C   . ARG B 2 34  ? 29.518 79.916 79.136  1.00 82.15  ? 136  ARG B C   1 
ATOM   2101 O O   . ARG B 2 34  ? 29.096 79.768 77.983  1.00 82.10  ? 136  ARG B O   1 
ATOM   2102 C CB  . ARG B 2 34  ? 31.240 81.453 78.119  1.00 87.10  ? 136  ARG B CB  1 
ATOM   2103 C CG  . ARG B 2 34  ? 32.707 81.876 78.179  1.00 89.68  ? 136  ARG B CG  1 
ATOM   2104 C CD  . ARG B 2 34  ? 33.461 81.423 76.921  1.00 92.62  ? 136  ARG B CD  1 
ATOM   2105 N NE  . ARG B 2 34  ? 34.913 81.613 77.001  1.00 95.88  ? 136  ARG B NE  1 
ATOM   2106 C CZ  . ARG B 2 34  ? 35.756 80.807 77.648  1.00 97.22  ? 136  ARG B CZ  1 
ATOM   2107 N NH1 . ARG B 2 34  ? 37.055 81.076 77.656  1.00 98.28  ? 136  ARG B NH1 1 
ATOM   2108 N NH2 . ARG B 2 34  ? 35.312 79.730 78.283  1.00 96.78  ? 136  ARG B NH2 1 
ATOM   2109 N N   . PRO B 2 35  ? 28.968 79.278 80.184  1.00 78.33  ? 137  PRO B N   1 
ATOM   2110 C CA  . PRO B 2 35  ? 27.833 78.369 80.011  1.00 76.91  ? 137  PRO B CA  1 
ATOM   2111 C C   . PRO B 2 35  ? 26.531 79.083 79.671  1.00 76.12  ? 137  PRO B C   1 
ATOM   2112 O O   . PRO B 2 35  ? 26.131 80.022 80.368  1.00 76.40  ? 137  PRO B O   1 
ATOM   2113 C CB  . PRO B 2 35  ? 27.769 77.649 81.354  1.00 75.01  ? 137  PRO B CB  1 
ATOM   2114 C CG  . PRO B 2 35  ? 28.199 78.703 82.292  1.00 74.78  ? 137  PRO B CG  1 
ATOM   2115 C CD  . PRO B 2 35  ? 29.361 79.349 81.601  1.00 75.67  ? 137  PRO B CD  1 
ATOM   2116 N N   . PRO B 2 36  ? 25.859 78.655 78.582  1.00 75.07  ? 138  PRO B N   1 
ATOM   2117 C CA  . PRO B 2 36  ? 24.595 79.259 78.156  1.00 74.84  ? 138  PRO B CA  1 
ATOM   2118 C C   . PRO B 2 36  ? 23.623 79.327 79.321  1.00 75.30  ? 138  PRO B C   1 
ATOM   2119 O O   . PRO B 2 36  ? 23.698 78.527 80.255  1.00 76.03  ? 138  PRO B O   1 
ATOM   2120 C CB  . PRO B 2 36  ? 24.129 78.329 77.052  1.00 72.86  ? 138  PRO B CB  1 
ATOM   2121 C CG  . PRO B 2 36  ? 25.412 77.926 76.428  1.00 72.67  ? 138  PRO B CG  1 
ATOM   2122 C CD  . PRO B 2 36  ? 26.268 77.609 77.632  1.00 73.89  ? 138  PRO B CD  1 
ATOM   2123 N N   . ALA B 2 37  ? 22.710 80.284 79.266  1.00 76.02  ? 139  ALA B N   1 
ATOM   2124 C CA  . ALA B 2 37  ? 21.745 80.484 80.341  1.00 76.75  ? 139  ALA B CA  1 
ATOM   2125 C C   . ALA B 2 37  ? 20.902 79.269 80.699  1.00 76.39  ? 139  ALA B C   1 
ATOM   2126 O O   . ALA B 2 37  ? 20.889 78.831 81.852  1.00 75.82  ? 139  ALA B O   1 
ATOM   2127 C CB  . ALA B 2 37  ? 20.834 81.648 79.992  1.00 78.48  ? 139  ALA B CB  1 
ATOM   2128 N N   . HIS B 2 38  ? 20.199 78.739 79.704  1.00 75.76  ? 140  HIS B N   1 
ATOM   2129 C CA  . HIS B 2 38  ? 19.324 77.593 79.893  1.00 76.09  ? 140  HIS B CA  1 
ATOM   2130 C C   . HIS B 2 38  ? 19.912 76.440 80.714  1.00 76.63  ? 140  HIS B C   1 
ATOM   2131 O O   . HIS B 2 38  ? 19.162 75.619 81.234  1.00 77.84  ? 140  HIS B O   1 
ATOM   2132 C CB  . HIS B 2 38  ? 18.876 77.063 78.540  1.00 75.80  ? 140  HIS B CB  1 
ATOM   2133 C CG  . HIS B 2 38  ? 19.923 76.264 77.842  1.00 76.22  ? 140  HIS B CG  1 
ATOM   2134 N ND1 . HIS B 2 38  ? 21.166 76.773 77.537  1.00 76.74  ? 140  HIS B ND1 1 
ATOM   2135 C CD2 . HIS B 2 38  ? 19.926 74.980 77.415  1.00 75.76  ? 140  HIS B CD2 1 
ATOM   2136 C CE1 . HIS B 2 38  ? 21.891 75.836 76.953  1.00 76.27  ? 140  HIS B CE1 1 
ATOM   2137 N NE2 . HIS B 2 38  ? 21.161 74.739 76.868  1.00 76.17  ? 140  HIS B NE2 1 
ATOM   2138 N N   . LEU B 2 39  ? 21.236 76.359 80.817  1.00 76.67  ? 141  LEU B N   1 
ATOM   2139 C CA  . LEU B 2 39  ? 21.880 75.302 81.603  1.00 76.70  ? 141  LEU B CA  1 
ATOM   2140 C C   . LEU B 2 39  ? 21.607 75.524 83.085  1.00 76.79  ? 141  LEU B C   1 
ATOM   2141 O O   . LEU B 2 39  ? 21.356 74.578 83.835  1.00 76.62  ? 141  LEU B O   1 
ATOM   2142 C CB  . LEU B 2 39  ? 23.398 75.295 81.374  1.00 76.50  ? 141  LEU B CB  1 
ATOM   2143 C CG  . LEU B 2 39  ? 23.937 74.910 79.993  1.00 76.20  ? 141  LEU B CG  1 
ATOM   2144 C CD1 . LEU B 2 39  ? 25.453 75.106 79.963  1.00 75.24  ? 141  LEU B CD1 1 
ATOM   2145 C CD2 . LEU B 2 39  ? 23.552 73.467 79.674  1.00 74.71  ? 141  LEU B CD2 1 
ATOM   2146 N N   . PHE B 2 40  ? 21.680 76.784 83.501  1.00 76.86  ? 142  PHE B N   1 
ATOM   2147 C CA  . PHE B 2 40  ? 21.432 77.157 84.885  1.00 77.67  ? 142  PHE B CA  1 
ATOM   2148 C C   . PHE B 2 40  ? 19.957 76.978 85.190  1.00 78.75  ? 142  PHE B C   1 
ATOM   2149 O O   . PHE B 2 40  ? 19.579 76.384 86.202  1.00 78.68  ? 142  PHE B O   1 
ATOM   2150 C CB  . PHE B 2 40  ? 21.822 78.607 85.097  1.00 76.40  ? 142  PHE B CB  1 
ATOM   2151 C CG  . PHE B 2 40  ? 23.271 78.862 84.901  1.00 75.91  ? 142  PHE B CG  1 
ATOM   2152 C CD1 . PHE B 2 40  ? 24.185 78.491 85.874  1.00 74.95  ? 142  PHE B CD1 1 
ATOM   2153 C CD2 . PHE B 2 40  ? 23.728 79.462 83.737  1.00 76.47  ? 142  PHE B CD2 1 
ATOM   2154 C CE1 . PHE B 2 40  ? 25.530 78.715 85.694  1.00 76.01  ? 142  PHE B CE1 1 
ATOM   2155 C CE2 . PHE B 2 40  ? 25.076 79.692 83.544  1.00 77.01  ? 142  PHE B CE2 1 
ATOM   2156 C CZ  . PHE B 2 40  ? 25.981 79.318 84.527  1.00 77.10  ? 142  PHE B CZ  1 
ATOM   2157 N N   . ILE B 2 41  ? 19.128 77.509 84.299  1.00 80.64  ? 143  ILE B N   1 
ATOM   2158 C CA  . ILE B 2 41  ? 17.687 77.410 84.436  1.00 82.69  ? 143  ILE B CA  1 
ATOM   2159 C C   . ILE B 2 41  ? 17.267 76.148 83.695  1.00 84.85  ? 143  ILE B C   1 
ATOM   2160 O O   . ILE B 2 41  ? 16.813 76.188 82.550  1.00 84.23  ? 143  ILE B O   1 
ATOM   2161 C CB  . ILE B 2 41  ? 16.998 78.660 83.848  1.00 81.18  ? 143  ILE B CB  1 
ATOM   2162 C CG1 . ILE B 2 41  ? 16.935 79.774 84.911  1.00 79.24  ? 143  ILE B CG1 1 
ATOM   2163 C CG2 . ILE B 2 41  ? 15.589 78.309 83.367  1.00 82.08  ? 143  ILE B CG2 1 
ATOM   2164 C CD1 . ILE B 2 41  ? 18.271 80.337 85.373  1.00 75.72  ? 143  ILE B CD1 1 
ATOM   2165 N N   . HIS B 2 42  ? 17.444 75.016 84.368  1.00 88.08  ? 144  HIS B N   1 
ATOM   2166 C CA  . HIS B 2 42  ? 17.129 73.727 83.779  1.00 91.02  ? 144  HIS B CA  1 
ATOM   2167 C C   . HIS B 2 42  ? 15.651 73.490 83.546  1.00 91.96  ? 144  HIS B C   1 
ATOM   2168 O O   . HIS B 2 42  ? 15.277 72.489 82.940  1.00 92.84  ? 144  HIS B O   1 
ATOM   2169 C CB  . HIS B 2 42  ? 17.689 72.571 84.629  1.00 92.73  ? 144  HIS B CB  1 
ATOM   2170 C CG  . HIS B 2 42  ? 18.466 73.000 85.839  1.00 94.79  ? 144  HIS B CG  1 
ATOM   2171 N ND1 . HIS B 2 42  ? 17.872 73.265 87.055  1.00 96.84  ? 144  HIS B ND1 1 
ATOM   2172 C CD2 . HIS B 2 42  ? 19.798 73.160 86.030  1.00 95.41  ? 144  HIS B CD2 1 
ATOM   2173 C CE1 . HIS B 2 42  ? 18.804 73.565 87.944  1.00 97.51  ? 144  HIS B CE1 1 
ATOM   2174 N NE2 . HIS B 2 42  ? 19.981 73.508 87.348  1.00 97.11  ? 144  HIS B NE2 1 
ATOM   2175 N N   . HIS B 2 43  ? 14.807 74.408 83.997  1.00 92.06  ? 145  HIS B N   1 
ATOM   2176 C CA  . HIS B 2 43  ? 13.379 74.232 83.832  1.00 93.50  ? 145  HIS B CA  1 
ATOM   2177 C C   . HIS B 2 43  ? 12.840 74.299 82.403  1.00 93.16  ? 145  HIS B C   1 
ATOM   2178 O O   . HIS B 2 43  ? 11.631 74.262 82.197  1.00 93.15  ? 145  HIS B O   1 
ATOM   2179 C CB  . HIS B 2 43  ? 12.655 75.209 84.754  1.00 96.47  ? 145  HIS B CB  1 
ATOM   2180 C CG  . HIS B 2 43  ? 12.765 74.841 86.200  1.00 99.73  ? 145  HIS B CG  1 
ATOM   2181 N ND1 . HIS B 2 43  ? 12.025 73.823 86.764  1.00 101.34 ? 145  HIS B ND1 1 
ATOM   2182 C CD2 . HIS B 2 43  ? 13.579 75.303 87.180  1.00 100.75 ? 145  HIS B CD2 1 
ATOM   2183 C CE1 . HIS B 2 43  ? 12.378 73.673 88.028  1.00 103.12 ? 145  HIS B CE1 1 
ATOM   2184 N NE2 . HIS B 2 43  ? 13.320 74.559 88.305  1.00 103.62 ? 145  HIS B NE2 1 
ATOM   2185 N N   . GLN B 2 44  ? 13.739 74.376 81.422  1.00 93.37  ? 146  GLN B N   1 
ATOM   2186 C CA  . GLN B 2 44  ? 13.366 74.406 80.000  1.00 93.08  ? 146  GLN B CA  1 
ATOM   2187 C C   . GLN B 2 44  ? 14.603 74.310 79.076  1.00 91.35  ? 146  GLN B C   1 
ATOM   2188 O O   . GLN B 2 44  ? 15.708 74.745 79.436  1.00 90.26  ? 146  GLN B O   1 
ATOM   2189 C CB  . GLN B 2 44  ? 12.548 75.677 79.683  1.00 94.79  ? 146  GLN B CB  1 
ATOM   2190 C CG  . GLN B 2 44  ? 12.312 75.977 78.173  1.00 97.32  ? 146  GLN B CG  1 
ATOM   2191 C CD  . GLN B 2 44  ? 11.111 75.246 77.534  1.00 97.93  ? 146  GLN B CD  1 
ATOM   2192 O OE1 . GLN B 2 44  ? 10.922 75.297 76.309  1.00 97.50  ? 146  GLN B OE1 1 
ATOM   2193 N NE2 . GLN B 2 44  ? 10.298 74.585 78.356  1.00 97.92  ? 146  GLN B NE2 1 
ATOM   2194 N N   . PRO B 2 45  ? 14.432 73.695 77.886  1.00 89.60  ? 147  PRO B N   1 
ATOM   2195 C CA  . PRO B 2 45  ? 15.505 73.531 76.903  1.00 89.12  ? 147  PRO B CA  1 
ATOM   2196 C C   . PRO B 2 45  ? 15.821 74.810 76.132  1.00 89.12  ? 147  PRO B C   1 
ATOM   2197 O O   . PRO B 2 45  ? 15.167 75.843 76.321  1.00 89.89  ? 147  PRO B O   1 
ATOM   2198 C CB  . PRO B 2 45  ? 14.966 72.427 75.994  1.00 88.47  ? 147  PRO B CB  1 
ATOM   2199 C CG  . PRO B 2 45  ? 13.507 72.671 76.015  1.00 87.34  ? 147  PRO B CG  1 
ATOM   2200 C CD  . PRO B 2 45  ? 13.253 72.906 77.484  1.00 88.51  ? 147  PRO B CD  1 
ATOM   2201 N N   . LEU B 2 46  ? 16.829 74.725 75.265  1.00 88.53  ? 148  LEU B N   1 
ATOM   2202 C CA  . LEU B 2 46  ? 17.250 75.851 74.439  1.00 87.18  ? 148  LEU B CA  1 
ATOM   2203 C C   . LEU B 2 46  ? 16.064 76.212 73.530  1.00 86.24  ? 148  LEU B C   1 
ATOM   2204 O O   . LEU B 2 46  ? 15.521 75.343 72.838  1.00 85.51  ? 148  LEU B O   1 
ATOM   2205 C CB  . LEU B 2 46  ? 18.481 75.448 73.605  1.00 86.56  ? 148  LEU B CB  1 
ATOM   2206 C CG  . LEU B 2 46  ? 19.463 76.536 73.152  1.00 85.98  ? 148  LEU B CG  1 
ATOM   2207 C CD1 . LEU B 2 46  ? 20.081 77.182 74.378  1.00 86.44  ? 148  LEU B CD1 1 
ATOM   2208 C CD2 . LEU B 2 46  ? 20.553 75.949 72.276  1.00 85.24  ? 148  LEU B CD2 1 
ATOM   2209 N N   . PRO B 2 47  ? 15.638 77.494 73.539  1.00 85.06  ? 149  PRO B N   1 
ATOM   2210 C CA  . PRO B 2 47  ? 14.514 77.948 72.716  1.00 83.65  ? 149  PRO B CA  1 
ATOM   2211 C C   . PRO B 2 47  ? 14.560 77.315 71.349  1.00 82.27  ? 149  PRO B C   1 
ATOM   2212 O O   . PRO B 2 47  ? 15.623 77.185 70.747  1.00 80.78  ? 149  PRO B O   1 
ATOM   2213 C CB  . PRO B 2 47  ? 14.708 79.452 72.678  1.00 84.70  ? 149  PRO B CB  1 
ATOM   2214 C CG  . PRO B 2 47  ? 15.209 79.724 74.049  1.00 84.85  ? 149  PRO B CG  1 
ATOM   2215 C CD  . PRO B 2 47  ? 16.247 78.633 74.248  1.00 84.80  ? 149  PRO B CD  1 
ATOM   2216 N N   . THR B 2 48  ? 13.389 76.926 70.868  1.00 82.10  ? 150  THR B N   1 
ATOM   2217 C CA  . THR B 2 48  ? 13.269 76.260 69.586  1.00 81.54  ? 150  THR B CA  1 
ATOM   2218 C C   . THR B 2 48  ? 14.162 76.849 68.467  1.00 80.28  ? 150  THR B C   1 
ATOM   2219 O O   . THR B 2 48  ? 14.789 76.092 67.722  1.00 80.18  ? 150  THR B O   1 
ATOM   2220 C CB  . THR B 2 48  ? 11.766 76.219 69.147  1.00 82.38  ? 150  THR B CB  1 
ATOM   2221 O OG1 . THR B 2 48  ? 10.922 76.138 70.311  1.00 81.55  ? 150  THR B OG1 1 
ATOM   2222 C CG2 . THR B 2 48  ? 11.495 74.990 68.278  1.00 81.04  ? 150  THR B CG2 1 
ATOM   2223 N N   . LEU B 2 49  ? 14.255 78.181 68.374  1.00 78.89  ? 151  LEU B N   1 
ATOM   2224 C CA  . LEU B 2 49  ? 15.054 78.838 67.318  1.00 76.11  ? 151  LEU B CA  1 
ATOM   2225 C C   . LEU B 2 49  ? 16.290 79.640 67.766  1.00 74.66  ? 151  LEU B C   1 
ATOM   2226 O O   . LEU B 2 49  ? 16.885 80.360 66.958  1.00 73.88  ? 151  LEU B O   1 
ATOM   2227 C CB  . LEU B 2 49  ? 14.177 79.792 66.483  1.00 75.27  ? 151  LEU B CB  1 
ATOM   2228 C CG  . LEU B 2 49  ? 12.731 79.492 66.051  1.00 74.44  ? 151  LEU B CG  1 
ATOM   2229 C CD1 . LEU B 2 49  ? 12.681 78.104 65.437  1.00 74.27  ? 151  LEU B CD1 1 
ATOM   2230 C CD2 . LEU B 2 49  ? 11.753 79.622 67.241  1.00 73.58  ? 151  LEU B CD2 1 
ATOM   2231 N N   . ALA B 2 50  ? 16.674 79.537 69.034  1.00 72.64  ? 152  ALA B N   1 
ATOM   2232 C CA  . ALA B 2 50  ? 17.830 80.275 69.509  1.00 71.88  ? 152  ALA B CA  1 
ATOM   2233 C C   . ALA B 2 50  ? 19.080 79.843 68.747  1.00 73.26  ? 152  ALA B C   1 
ATOM   2234 O O   . ALA B 2 50  ? 19.089 78.809 68.072  1.00 73.36  ? 152  ALA B O   1 
ATOM   2235 C CB  . ALA B 2 50  ? 18.016 80.041 70.992  1.00 69.89  ? 152  ALA B CB  1 
ATOM   2236 N N   . PRO B 2 51  ? 20.153 80.644 68.826  1.00 73.99  ? 153  PRO B N   1 
ATOM   2237 C CA  . PRO B 2 51  ? 21.379 80.268 68.121  1.00 74.85  ? 153  PRO B CA  1 
ATOM   2238 C C   . PRO B 2 51  ? 22.039 79.141 68.926  1.00 75.63  ? 153  PRO B C   1 
ATOM   2239 O O   . PRO B 2 51  ? 22.060 79.177 70.163  1.00 75.86  ? 153  PRO B O   1 
ATOM   2240 C CB  . PRO B 2 51  ? 22.187 81.562 68.140  1.00 74.58  ? 153  PRO B CB  1 
ATOM   2241 C CG  . PRO B 2 51  ? 21.853 82.124 69.491  1.00 73.73  ? 153  PRO B CG  1 
ATOM   2242 C CD  . PRO B 2 51  ? 20.342 81.894 69.585  1.00 73.61  ? 153  PRO B CD  1 
ATOM   2243 N N   . VAL B 2 52  ? 22.573 78.138 68.239  1.00 75.92  ? 154  VAL B N   1 
ATOM   2244 C CA  . VAL B 2 52  ? 23.206 77.017 68.936  1.00 75.00  ? 154  VAL B CA  1 
ATOM   2245 C C   . VAL B 2 52  ? 24.651 77.284 69.341  1.00 74.53  ? 154  VAL B C   1 
ATOM   2246 O O   . VAL B 2 52  ? 25.066 76.935 70.445  1.00 73.74  ? 154  VAL B O   1 
ATOM   2247 C CB  . VAL B 2 52  ? 23.177 75.744 68.080  1.00 73.94  ? 154  VAL B CB  1 
ATOM   2248 C CG1 . VAL B 2 52  ? 23.713 74.588 68.880  1.00 74.12  ? 154  VAL B CG1 1 
ATOM   2249 C CG2 . VAL B 2 52  ? 21.761 75.457 67.620  1.00 74.96  ? 154  VAL B CG2 1 
ATOM   2250 N N   . LEU B 2 53  ? 25.406 77.909 68.442  1.00 74.20  ? 155  LEU B N   1 
ATOM   2251 C CA  . LEU B 2 53  ? 26.818 78.224 68.677  1.00 73.02  ? 155  LEU B CA  1 
ATOM   2252 C C   . LEU B 2 53  ? 27.248 78.625 70.101  1.00 70.61  ? 155  LEU B C   1 
ATOM   2253 O O   . LEU B 2 53  ? 28.325 78.234 70.554  1.00 68.35  ? 155  LEU B O   1 
ATOM   2254 C CB  . LEU B 2 53  ? 27.274 79.296 67.682  1.00 73.42  ? 155  LEU B CB  1 
ATOM   2255 C CG  . LEU B 2 53  ? 28.736 79.704 67.847  1.00 74.06  ? 155  LEU B CG  1 
ATOM   2256 C CD1 . LEU B 2 53  ? 29.630 78.467 67.819  1.00 74.32  ? 155  LEU B CD1 1 
ATOM   2257 C CD2 . LEU B 2 53  ? 29.109 80.679 66.746  1.00 74.76  ? 155  LEU B CD2 1 
ATOM   2258 N N   . PRO B 2 54  ? 26.431 79.419 70.817  1.00 70.14  ? 156  PRO B N   1 
ATOM   2259 C CA  . PRO B 2 54  ? 26.854 79.788 72.175  1.00 70.02  ? 156  PRO B CA  1 
ATOM   2260 C C   . PRO B 2 54  ? 27.129 78.552 73.035  1.00 69.44  ? 156  PRO B C   1 
ATOM   2261 O O   . PRO B 2 54  ? 28.087 78.515 73.809  1.00 69.88  ? 156  PRO B O   1 
ATOM   2262 C CB  . PRO B 2 54  ? 25.667 80.591 72.699  1.00 70.82  ? 156  PRO B CB  1 
ATOM   2263 C CG  . PRO B 2 54  ? 25.111 81.222 71.444  1.00 71.31  ? 156  PRO B CG  1 
ATOM   2264 C CD  . PRO B 2 54  ? 25.169 80.094 70.456  1.00 70.09  ? 156  PRO B CD  1 
ATOM   2265 N N   . LEU B 2 55  ? 26.265 77.550 72.881  1.00 67.92  ? 157  LEU B N   1 
ATOM   2266 C CA  . LEU B 2 55  ? 26.342 76.277 73.603  1.00 65.07  ? 157  LEU B CA  1 
ATOM   2267 C C   . LEU B 2 55  ? 27.527 75.423 73.135  1.00 63.59  ? 157  LEU B C   1 
ATOM   2268 O O   . LEU B 2 55  ? 28.340 74.972 73.943  1.00 62.12  ? 157  LEU B O   1 
ATOM   2269 C CB  . LEU B 2 55  ? 25.020 75.500 73.406  1.00 64.28  ? 157  LEU B CB  1 
ATOM   2270 C CG  . LEU B 2 55  ? 24.800 74.083 73.963  1.00 61.11  ? 157  LEU B CG  1 
ATOM   2271 C CD1 . LEU B 2 55  ? 24.985 74.099 75.475  1.00 59.76  ? 157  LEU B CD1 1 
ATOM   2272 C CD2 . LEU B 2 55  ? 23.401 73.572 73.582  1.00 55.71  ? 157  LEU B CD2 1 
ATOM   2273 N N   . VAL B 2 56  ? 27.612 75.205 71.825  1.00 61.25  ? 158  VAL B N   1 
ATOM   2274 C CA  . VAL B 2 56  ? 28.685 74.409 71.245  1.00 57.86  ? 158  VAL B CA  1 
ATOM   2275 C C   . VAL B 2 56  ? 30.070 74.889 71.653  1.00 57.38  ? 158  VAL B C   1 
ATOM   2276 O O   . VAL B 2 56  ? 30.966 74.088 71.922  1.00 55.77  ? 158  VAL B O   1 
ATOM   2277 C CB  . VAL B 2 56  ? 28.617 74.430 69.726  1.00 55.37  ? 158  VAL B CB  1 
ATOM   2278 C CG1 . VAL B 2 56  ? 29.741 73.596 69.167  1.00 54.95  ? 158  VAL B CG1 1 
ATOM   2279 C CG2 . VAL B 2 56  ? 27.275 73.915 69.263  1.00 52.75  ? 158  VAL B CG2 1 
ATOM   2280 N N   . THR B 2 57  ? 30.244 76.203 71.691  1.00 57.26  ? 159  THR B N   1 
ATOM   2281 C CA  . THR B 2 57  ? 31.524 76.766 72.065  1.00 58.48  ? 159  THR B CA  1 
ATOM   2282 C C   . THR B 2 57  ? 31.819 76.439 73.513  1.00 58.47  ? 159  THR B C   1 
ATOM   2283 O O   . THR B 2 57  ? 32.959 76.474 73.946  1.00 58.40  ? 159  THR B O   1 
ATOM   2284 C CB  . THR B 2 57  ? 31.538 78.271 71.860  1.00 59.00  ? 159  THR B CB  1 
ATOM   2285 O OG1 . THR B 2 57  ? 31.004 78.563 70.560  1.00 60.37  ? 159  THR B OG1 1 
ATOM   2286 C CG2 . THR B 2 57  ? 32.971 78.804 71.953  1.00 58.02  ? 159  THR B CG2 1 
ATOM   2287 N N   . HIS B 2 58  ? 30.776 76.129 74.260  1.00 59.92  ? 160  HIS B N   1 
ATOM   2288 C CA  . HIS B 2 58  ? 30.927 75.748 75.650  1.00 63.20  ? 160  HIS B CA  1 
ATOM   2289 C C   . HIS B 2 58  ? 31.287 74.263 75.656  1.00 64.29  ? 160  HIS B C   1 
ATOM   2290 O O   . HIS B 2 58  ? 32.191 73.838 76.371  1.00 64.44  ? 160  HIS B O   1 
ATOM   2291 C CB  . HIS B 2 58  ? 29.610 75.979 76.399  1.00 64.70  ? 160  HIS B CB  1 
ATOM   2292 C CG  . HIS B 2 58  ? 29.585 75.416 77.788  1.00 65.31  ? 160  HIS B CG  1 
ATOM   2293 N ND1 . HIS B 2 58  ? 30.419 75.862 78.791  1.00 65.98  ? 160  HIS B ND1 1 
ATOM   2294 C CD2 . HIS B 2 58  ? 28.800 74.463 78.348  1.00 65.31  ? 160  HIS B CD2 1 
ATOM   2295 C CE1 . HIS B 2 58  ? 30.148 75.210 79.909  1.00 66.56  ? 160  HIS B CE1 1 
ATOM   2296 N NE2 . HIS B 2 58  ? 29.169 74.356 79.668  1.00 65.22  ? 160  HIS B NE2 1 
ATOM   2297 N N   . PHE B 2 59  ? 30.579 73.475 74.849  1.00 65.84  ? 161  PHE B N   1 
ATOM   2298 C CA  . PHE B 2 59  ? 30.836 72.044 74.779  1.00 66.16  ? 161  PHE B CA  1 
ATOM   2299 C C   . PHE B 2 59  ? 32.308 71.783 74.526  1.00 65.92  ? 161  PHE B C   1 
ATOM   2300 O O   . PHE B 2 59  ? 33.008 71.251 75.381  1.00 64.93  ? 161  PHE B O   1 
ATOM   2301 C CB  . PHE B 2 59  ? 30.022 71.392 73.666  1.00 67.99  ? 161  PHE B CB  1 
ATOM   2302 C CG  . PHE B 2 59  ? 30.467 69.993 73.349  1.00 71.13  ? 161  PHE B CG  1 
ATOM   2303 C CD1 . PHE B 2 59  ? 30.784 69.625 72.054  1.00 72.31  ? 161  PHE B CD1 1 
ATOM   2304 C CD2 . PHE B 2 59  ? 30.612 69.055 74.355  1.00 71.92  ? 161  PHE B CD2 1 
ATOM   2305 C CE1 . PHE B 2 59  ? 31.241 68.345 71.772  1.00 72.23  ? 161  PHE B CE1 1 
ATOM   2306 C CE2 . PHE B 2 59  ? 31.067 67.780 74.076  1.00 72.35  ? 161  PHE B CE2 1 
ATOM   2307 C CZ  . PHE B 2 59  ? 31.381 67.426 72.784  1.00 71.85  ? 161  PHE B CZ  1 
ATOM   2308 N N   . ALA B 2 60  ? 32.772 72.165 73.344  1.00 65.96  ? 162  ALA B N   1 
ATOM   2309 C CA  . ALA B 2 60  ? 34.165 71.981 72.974  1.00 67.55  ? 162  ALA B CA  1 
ATOM   2310 C C   . ALA B 2 60  ? 35.128 72.600 73.992  1.00 68.90  ? 162  ALA B C   1 
ATOM   2311 O O   . ALA B 2 60  ? 36.305 72.241 74.034  1.00 69.21  ? 162  ALA B O   1 
ATOM   2312 C CB  . ALA B 2 60  ? 34.407 72.579 71.606  1.00 67.85  ? 162  ALA B CB  1 
ATOM   2313 N N   . ASP B 2 61  ? 34.624 73.541 74.790  1.00 70.62  ? 163  ASP B N   1 
ATOM   2314 C CA  . ASP B 2 61  ? 35.421 74.211 75.811  1.00 71.24  ? 163  ASP B CA  1 
ATOM   2315 C C   . ASP B 2 61  ? 35.641 73.304 77.008  1.00 69.53  ? 163  ASP B C   1 
ATOM   2316 O O   . ASP B 2 61  ? 36.775 73.153 77.452  1.00 69.71  ? 163  ASP B O   1 
ATOM   2317 C CB  . ASP B 2 61  ? 34.750 75.513 76.294  1.00 75.00  ? 163  ASP B CB  1 
ATOM   2318 C CG  . ASP B 2 61  ? 35.175 76.746 75.488  1.00 76.83  ? 163  ASP B CG  1 
ATOM   2319 O OD1 . ASP B 2 61  ? 34.812 77.878 75.895  1.00 78.36  ? 163  ASP B OD1 1 
ATOM   2320 O OD2 . ASP B 2 61  ? 35.860 76.584 74.453  1.00 77.80  ? 163  ASP B OD2 1 
ATOM   2321 N N   . ILE B 2 62  ? 34.567 72.711 77.538  1.00 68.41  ? 164  ILE B N   1 
ATOM   2322 C CA  . ILE B 2 62  ? 34.690 71.816 78.702  1.00 66.79  ? 164  ILE B CA  1 
ATOM   2323 C C   . ILE B 2 62  ? 35.252 70.431 78.327  1.00 64.99  ? 164  ILE B C   1 
ATOM   2324 O O   . ILE B 2 62  ? 35.748 69.702 79.189  1.00 63.65  ? 164  ILE B O   1 
ATOM   2325 C CB  . ILE B 2 62  ? 33.318 71.635 79.476  1.00 65.78  ? 164  ILE B CB  1 
ATOM   2326 C CG1 . ILE B 2 62  ? 32.235 71.107 78.534  1.00 65.82  ? 164  ILE B CG1 1 
ATOM   2327 C CG2 . ILE B 2 62  ? 32.883 72.948 80.126  1.00 61.80  ? 164  ILE B CG2 1 
ATOM   2328 C CD1 . ILE B 2 62  ? 32.377 69.626 78.169  1.00 67.36  ? 164  ILE B CD1 1 
ATOM   2329 N N   . ASN B 2 63  ? 35.168 70.085 77.042  1.00 63.50  ? 165  ASN B N   1 
ATOM   2330 C CA  . ASN B 2 63  ? 35.666 68.815 76.537  1.00 60.97  ? 165  ASN B CA  1 
ATOM   2331 C C   . ASN B 2 63  ? 37.165 68.946 76.505  1.00 60.51  ? 165  ASN B C   1 
ATOM   2332 O O   . ASN B 2 63  ? 37.884 68.167 77.132  1.00 59.68  ? 165  ASN B O   1 
ATOM   2333 C CB  . ASN B 2 63  ? 35.151 68.557 75.131  1.00 58.97  ? 165  ASN B CB  1 
ATOM   2334 C CG  . ASN B 2 63  ? 34.912 67.103 74.875  1.00 57.30  ? 165  ASN B CG  1 
ATOM   2335 O OD1 . ASN B 2 63  ? 34.371 66.733 73.845  1.00 57.26  ? 165  ASN B OD1 1 
ATOM   2336 N ND2 . ASN B 2 63  ? 35.306 66.262 75.821  1.00 55.18  ? 165  ASN B ND2 1 
ATOM   2337 N N   . THR B 2 64  ? 37.631 69.944 75.765  1.00 60.37  ? 166  THR B N   1 
ATOM   2338 C CA  . THR B 2 64  ? 39.050 70.207 75.688  1.00 61.74  ? 166  THR B CA  1 
ATOM   2339 C C   . THR B 2 64  ? 39.576 70.366 77.119  1.00 63.47  ? 166  THR B C   1 
ATOM   2340 O O   . THR B 2 64  ? 40.657 69.901 77.431  1.00 65.68  ? 166  THR B O   1 
ATOM   2341 C CB  . THR B 2 64  ? 39.336 71.476 74.857  1.00 60.57  ? 166  THR B CB  1 
ATOM   2342 O OG1 . THR B 2 64  ? 39.169 71.184 73.462  1.00 59.91  ? 166  THR B OG1 1 
ATOM   2343 C CG2 . THR B 2 64  ? 40.744 71.970 75.106  1.00 59.18  ? 166  THR B CG2 1 
ATOM   2344 N N   . PHE B 2 65  ? 38.804 70.999 77.995  1.00 64.51  ? 167  PHE B N   1 
ATOM   2345 C CA  . PHE B 2 65  ? 39.209 71.183 79.390  1.00 65.06  ? 167  PHE B CA  1 
ATOM   2346 C C   . PHE B 2 65  ? 39.239 69.875 80.177  1.00 65.24  ? 167  PHE B C   1 
ATOM   2347 O O   . PHE B 2 65  ? 40.135 69.647 80.989  1.00 65.79  ? 167  PHE B O   1 
ATOM   2348 C CB  . PHE B 2 65  ? 38.259 72.159 80.087  1.00 66.24  ? 167  PHE B CB  1 
ATOM   2349 C CG  . PHE B 2 65  ? 38.184 71.984 81.586  1.00 67.56  ? 167  PHE B CG  1 
ATOM   2350 C CD1 . PHE B 2 65  ? 39.297 72.197 82.389  1.00 67.95  ? 167  PHE B CD1 1 
ATOM   2351 C CD2 . PHE B 2 65  ? 36.981 71.639 82.194  1.00 67.56  ? 167  PHE B CD2 1 
ATOM   2352 C CE1 . PHE B 2 65  ? 39.207 72.073 83.768  1.00 67.88  ? 167  PHE B CE1 1 
ATOM   2353 C CE2 . PHE B 2 65  ? 36.885 71.514 83.575  1.00 66.76  ? 167  PHE B CE2 1 
ATOM   2354 C CZ  . PHE B 2 65  ? 37.995 71.732 84.360  1.00 66.67  ? 167  PHE B CZ  1 
ATOM   2355 N N   . MET B 2 66  ? 38.245 69.024 79.961  1.00 65.03  ? 168  MET B N   1 
ATOM   2356 C CA  . MET B 2 66  ? 38.198 67.754 80.666  1.00 64.24  ? 168  MET B CA  1 
ATOM   2357 C C   . MET B 2 66  ? 39.407 66.932 80.307  1.00 63.55  ? 168  MET B C   1 
ATOM   2358 O O   . MET B 2 66  ? 40.130 66.467 81.179  1.00 62.03  ? 168  MET B O   1 
ATOM   2359 C CB  . MET B 2 66  ? 36.961 66.962 80.283  1.00 64.95  ? 168  MET B CB  1 
ATOM   2360 C CG  . MET B 2 66  ? 35.732 67.296 81.066  1.00 64.62  ? 168  MET B CG  1 
ATOM   2361 S SD  . MET B 2 66  ? 34.542 65.973 80.812  1.00 63.77  ? 168  MET B SD  1 
ATOM   2362 C CE  . MET B 2 66  ? 33.742 66.502 79.305  1.00 66.99  ? 168  MET B CE  1 
ATOM   2363 N N   . VAL B 2 67  ? 39.618 66.747 79.011  1.00 63.51  ? 169  VAL B N   1 
ATOM   2364 C CA  . VAL B 2 67  ? 40.752 65.970 78.548  1.00 64.64  ? 169  VAL B CA  1 
ATOM   2365 C C   . VAL B 2 67  ? 42.060 66.514 79.102  1.00 65.95  ? 169  VAL B C   1 
ATOM   2366 O O   . VAL B 2 67  ? 43.042 65.792 79.200  1.00 66.51  ? 169  VAL B O   1 
ATOM   2367 C CB  . VAL B 2 67  ? 40.835 65.960 77.026  1.00 64.17  ? 169  VAL B CB  1 
ATOM   2368 C CG1 . VAL B 2 67  ? 41.980 65.061 76.586  1.00 63.68  ? 169  VAL B CG1 1 
ATOM   2369 C CG2 . VAL B 2 67  ? 39.517 65.485 76.444  1.00 63.01  ? 169  VAL B CG2 1 
ATOM   2370 N N   . LEU B 2 68  ? 42.066 67.793 79.458  1.00 68.26  ? 170  LEU B N   1 
ATOM   2371 C CA  . LEU B 2 68  ? 43.243 68.437 80.019  1.00 70.41  ? 170  LEU B CA  1 
ATOM   2372 C C   . LEU B 2 68  ? 43.469 67.950 81.435  1.00 70.73  ? 170  LEU B C   1 
ATOM   2373 O O   . LEU B 2 68  ? 44.596 67.706 81.835  1.00 70.75  ? 170  LEU B O   1 
ATOM   2374 C CB  . LEU B 2 68  ? 43.069 69.958 80.026  1.00 73.03  ? 170  LEU B CB  1 
ATOM   2375 C CG  . LEU B 2 68  ? 42.895 70.605 78.645  1.00 75.04  ? 170  LEU B CG  1 
ATOM   2376 C CD1 . LEU B 2 68  ? 42.428 72.050 78.793  1.00 74.38  ? 170  LEU B CD1 1 
ATOM   2377 C CD2 . LEU B 2 68  ? 44.205 70.503 77.863  1.00 75.31  ? 170  LEU B CD2 1 
ATOM   2378 N N   . GLN B 2 69  ? 42.397 67.817 82.203  1.00 72.81  ? 171  GLN B N   1 
ATOM   2379 C CA  . GLN B 2 69  ? 42.526 67.339 83.571  1.00 75.15  ? 171  GLN B CA  1 
ATOM   2380 C C   . GLN B 2 69  ? 42.914 65.856 83.578  1.00 76.89  ? 171  GLN B C   1 
ATOM   2381 O O   . GLN B 2 69  ? 43.706 65.421 84.420  1.00 77.10  ? 171  GLN B O   1 
ATOM   2382 C CB  . GLN B 2 69  ? 41.216 67.562 84.339  1.00 75.52  ? 171  GLN B CB  1 
ATOM   2383 C CG  . GLN B 2 69  ? 40.809 69.022 84.446  1.00 73.93  ? 171  GLN B CG  1 
ATOM   2384 C CD  . GLN B 2 69  ? 41.853 69.874 85.144  1.00 73.71  ? 171  GLN B CD  1 
ATOM   2385 O OE1 . GLN B 2 69  ? 42.024 71.046 84.811  1.00 75.02  ? 171  GLN B OE1 1 
ATOM   2386 N NE2 . GLN B 2 69  ? 42.548 69.297 86.120  1.00 71.59  ? 171  GLN B NE2 1 
ATOM   2387 N N   . VAL B 2 70  ? 42.358 65.081 82.645  1.00 77.93  ? 172  VAL B N   1 
ATOM   2388 C CA  . VAL B 2 70  ? 42.688 63.664 82.545  1.00 78.61  ? 172  VAL B CA  1 
ATOM   2389 C C   . VAL B 2 70  ? 44.203 63.579 82.424  1.00 80.07  ? 172  VAL B C   1 
ATOM   2390 O O   . VAL B 2 70  ? 44.837 62.758 83.079  1.00 80.16  ? 172  VAL B O   1 
ATOM   2391 C CB  . VAL B 2 70  ? 42.052 63.016 81.299  1.00 78.79  ? 172  VAL B CB  1 
ATOM   2392 C CG1 . VAL B 2 70  ? 42.543 61.587 81.147  1.00 79.18  ? 172  VAL B CG1 1 
ATOM   2393 C CG2 . VAL B 2 70  ? 40.543 63.036 81.416  1.00 78.39  ? 172  VAL B CG2 1 
ATOM   2394 N N   . ILE B 2 71  ? 44.779 64.439 81.585  1.00 81.82  ? 173  ILE B N   1 
ATOM   2395 C CA  . ILE B 2 71  ? 46.226 64.480 81.396  1.00 84.09  ? 173  ILE B CA  1 
ATOM   2396 C C   . ILE B 2 71  ? 46.954 64.953 82.658  1.00 86.74  ? 173  ILE B C   1 
ATOM   2397 O O   . ILE B 2 71  ? 47.959 64.361 83.044  1.00 88.18  ? 173  ILE B O   1 
ATOM   2398 C CB  . ILE B 2 71  ? 46.625 65.399 80.218  1.00 82.63  ? 173  ILE B CB  1 
ATOM   2399 C CG1 . ILE B 2 71  ? 46.298 64.715 78.889  1.00 81.59  ? 173  ILE B CG1 1 
ATOM   2400 C CG2 . ILE B 2 71  ? 48.106 65.732 80.299  1.00 81.57  ? 173  ILE B CG2 1 
ATOM   2401 C CD1 . ILE B 2 71  ? 46.685 65.523 77.669  1.00 80.22  ? 173  ILE B CD1 1 
ATOM   2402 N N   . LYS B 2 72  ? 46.463 66.017 83.295  1.00 89.03  ? 174  LYS B N   1 
ATOM   2403 C CA  . LYS B 2 72  ? 47.080 66.513 84.532  1.00 89.90  ? 174  LYS B CA  1 
ATOM   2404 C C   . LYS B 2 72  ? 47.134 65.351 85.517  1.00 90.23  ? 174  LYS B C   1 
ATOM   2405 O O   . LYS B 2 72  ? 48.083 65.210 86.286  1.00 89.58  ? 174  LYS B O   1 
ATOM   2406 C CB  . LYS B 2 72  ? 46.248 67.647 85.157  1.00 91.24  ? 174  LYS B CB  1 
ATOM   2407 C CG  . LYS B 2 72  ? 46.557 69.066 84.673  1.00 91.47  ? 174  LYS B CG  1 
ATOM   2408 C CD  . LYS B 2 72  ? 45.837 70.111 85.530  1.00 92.17  ? 174  LYS B CD  1 
ATOM   2409 C CE  . LYS B 2 72  ? 46.108 71.528 85.035  1.00 93.18  ? 174  LYS B CE  1 
ATOM   2410 N NZ  . LYS B 2 72  ? 45.449 72.566 85.887  1.00 93.62  ? 174  LYS B NZ  1 
ATOM   2411 N N   . PHE B 2 73  ? 46.086 64.532 85.471  1.00 91.01  ? 175  PHE B N   1 
ATOM   2412 C CA  . PHE B 2 73  ? 45.920 63.357 86.311  1.00 92.54  ? 175  PHE B CA  1 
ATOM   2413 C C   . PHE B 2 73  ? 46.981 62.281 86.086  1.00 94.31  ? 175  PHE B C   1 
ATOM   2414 O O   . PHE B 2 73  ? 47.562 61.764 87.042  1.00 94.49  ? 175  PHE B O   1 
ATOM   2415 C CB  . PHE B 2 73  ? 44.537 62.763 86.059  1.00 91.22  ? 175  PHE B CB  1 
ATOM   2416 C CG  . PHE B 2 73  ? 44.354 61.396 86.633  1.00 90.34  ? 175  PHE B CG  1 
ATOM   2417 C CD1 . PHE B 2 73  ? 44.468 61.182 87.991  1.00 90.11  ? 175  PHE B CD1 1 
ATOM   2418 C CD2 . PHE B 2 73  ? 44.045 60.326 85.814  1.00 89.88  ? 175  PHE B CD2 1 
ATOM   2419 C CE1 . PHE B 2 73  ? 44.274 59.927 88.525  1.00 90.64  ? 175  PHE B CE1 1 
ATOM   2420 C CE2 . PHE B 2 73  ? 43.851 59.070 86.341  1.00 89.61  ? 175  PHE B CE2 1 
ATOM   2421 C CZ  . PHE B 2 73  ? 43.965 58.869 87.700  1.00 90.56  ? 175  PHE B CZ  1 
ATOM   2422 N N   . THR B 2 74  ? 47.227 61.941 84.822  1.00 96.44  ? 176  THR B N   1 
ATOM   2423 C CA  . THR B 2 74  ? 48.213 60.917 84.480  1.00 98.33  ? 176  THR B CA  1 
ATOM   2424 C C   . THR B 2 74  ? 49.670 61.316 84.760  1.00 100.37 ? 176  THR B C   1 
ATOM   2425 O O   . THR B 2 74  ? 50.550 60.450 84.828  1.00 101.28 ? 176  THR B O   1 
ATOM   2426 C CB  . THR B 2 74  ? 48.082 60.475 82.987  1.00 97.60  ? 176  THR B CB  1 
ATOM   2427 O OG1 . THR B 2 74  ? 48.207 61.611 82.125  1.00 97.50  ? 176  THR B OG1 1 
ATOM   2428 C CG2 . THR B 2 74  ? 46.738 59.813 82.738  1.00 96.89  ? 176  THR B CG2 1 
ATOM   2429 N N   . LYS B 2 75  ? 49.929 62.615 84.921  1.00 102.02 ? 177  LYS B N   1 
ATOM   2430 C CA  . LYS B 2 75  ? 51.285 63.089 85.208  1.00 103.18 ? 177  LYS B CA  1 
ATOM   2431 C C   . LYS B 2 75  ? 51.619 62.972 86.702  1.00 104.07 ? 177  LYS B C   1 
ATOM   2432 O O   . LYS B 2 75  ? 52.795 62.965 87.088  1.00 103.70 ? 177  LYS B O   1 
ATOM   2433 C CB  . LYS B 2 75  ? 51.475 64.530 84.704  1.00 103.02 ? 177  LYS B CB  1 
ATOM   2434 C CG  . LYS B 2 75  ? 51.423 64.628 83.177  1.00 103.07 ? 177  LYS B CG  1 
ATOM   2435 C CD  . LYS B 2 75  ? 52.199 65.812 82.618  1.00 102.77 ? 177  LYS B CD  1 
ATOM   2436 C CE  . LYS B 2 75  ? 51.449 67.111 82.775  1.00 103.06 ? 177  LYS B CE  1 
ATOM   2437 N NZ  . LYS B 2 75  ? 52.157 68.204 82.056  1.00 103.25 ? 177  LYS B NZ  1 
ATOM   2438 N N   . ASP B 2 76  ? 50.581 62.876 87.535  1.00 104.64 ? 178  ASP B N   1 
ATOM   2439 C CA  . ASP B 2 76  ? 50.764 62.695 88.973  1.00 105.30 ? 178  ASP B CA  1 
ATOM   2440 C C   . ASP B 2 76  ? 50.794 61.179 89.199  1.00 105.16 ? 178  ASP B C   1 
ATOM   2441 O O   . ASP B 2 76  ? 50.199 60.663 90.147  1.00 105.75 ? 178  ASP B O   1 
ATOM   2442 C CB  . ASP B 2 76  ? 49.603 63.316 89.774  1.00 105.74 ? 178  ASP B CB  1 
ATOM   2443 C CG  . ASP B 2 76  ? 49.998 64.602 90.509  1.00 106.40 ? 178  ASP B CG  1 
ATOM   2444 O OD1 . ASP B 2 76  ? 51.203 64.804 90.779  1.00 106.61 ? 178  ASP B OD1 1 
ATOM   2445 O OD2 . ASP B 2 76  ? 49.097 65.405 90.836  1.00 105.82 ? 178  ASP B OD2 1 
ATOM   2446 N N   . LEU B 2 77  ? 51.489 60.476 88.306  1.00 104.51 ? 179  LEU B N   1 
ATOM   2447 C CA  . LEU B 2 77  ? 51.625 59.027 88.364  1.00 103.16 ? 179  LEU B CA  1 
ATOM   2448 C C   . LEU B 2 77  ? 53.076 58.629 88.098  1.00 102.79 ? 179  LEU B C   1 
ATOM   2449 O O   . LEU B 2 77  ? 53.632 58.930 87.036  1.00 102.94 ? 179  LEU B O   1 
ATOM   2450 C CB  . LEU B 2 77  ? 50.724 58.373 87.317  1.00 101.75 ? 179  LEU B CB  1 
ATOM   2451 C CG  . LEU B 2 77  ? 49.245 58.746 87.356  1.00 101.40 ? 179  LEU B CG  1 
ATOM   2452 C CD1 . LEU B 2 77  ? 48.522 57.907 86.329  1.00 101.33 ? 179  LEU B CD1 1 
ATOM   2453 C CD2 . LEU B 2 77  ? 48.659 58.509 88.740  1.00 101.16 ? 179  LEU B CD2 1 
ATOM   2454 N N   . PRO B 2 78  ? 53.711 57.956 89.070  1.00 101.63 ? 180  PRO B N   1 
ATOM   2455 C CA  . PRO B 2 78  ? 55.101 57.512 88.944  1.00 101.05 ? 180  PRO B CA  1 
ATOM   2456 C C   . PRO B 2 78  ? 55.219 56.562 87.765  1.00 100.60 ? 180  PRO B C   1 
ATOM   2457 O O   . PRO B 2 78  ? 56.058 56.747 86.882  1.00 100.48 ? 180  PRO B O   1 
ATOM   2458 C CB  . PRO B 2 78  ? 55.357 56.803 90.270  1.00 100.59 ? 180  PRO B CB  1 
ATOM   2459 C CG  . PRO B 2 78  ? 54.435 57.501 91.207  1.00 100.70 ? 180  PRO B CG  1 
ATOM   2460 C CD  . PRO B 2 78  ? 53.176 57.614 90.397  1.00 100.84 ? 180  PRO B CD  1 
ATOM   2461 N N   . VAL B 2 79  ? 54.349 55.552 87.772  1.00 99.93  ? 181  VAL B N   1 
ATOM   2462 C CA  . VAL B 2 79  ? 54.300 54.525 86.736  1.00 99.01  ? 181  VAL B CA  1 
ATOM   2463 C C   . VAL B 2 79  ? 53.981 55.075 85.348  1.00 98.95  ? 181  VAL B C   1 
ATOM   2464 O O   . VAL B 2 79  ? 54.563 54.629 84.360  1.00 100.47 ? 181  VAL B O   1 
ATOM   2465 C CB  . VAL B 2 79  ? 53.257 53.444 87.078  1.00 97.49  ? 181  VAL B CB  1 
ATOM   2466 C CG1 . VAL B 2 79  ? 53.386 52.280 86.118  1.00 97.29  ? 181  VAL B CG1 1 
ATOM   2467 C CG2 . VAL B 2 79  ? 53.443 52.981 88.502  1.00 97.42  ? 181  VAL B CG2 1 
ATOM   2468 N N   . PHE B 2 80  ? 53.058 56.028 85.253  1.00 98.14  ? 182  PHE B N   1 
ATOM   2469 C CA  . PHE B 2 80  ? 52.745 56.566 83.940  1.00 97.60  ? 182  PHE B CA  1 
ATOM   2470 C C   . PHE B 2 80  ? 53.879 57.447 83.436  1.00 97.50  ? 182  PHE B C   1 
ATOM   2471 O O   . PHE B 2 80  ? 54.274 57.368 82.271  1.00 97.04  ? 182  PHE B O   1 
ATOM   2472 C CB  . PHE B 2 80  ? 51.448 57.369 83.946  1.00 96.88  ? 182  PHE B CB  1 
ATOM   2473 C CG  . PHE B 2 80  ? 50.860 57.525 82.578  1.00 96.55  ? 182  PHE B CG  1 
ATOM   2474 C CD1 . PHE B 2 80  ? 50.287 56.437 81.934  1.00 96.56  ? 182  PHE B CD1 1 
ATOM   2475 C CD2 . PHE B 2 80  ? 50.963 58.721 81.894  1.00 96.68  ? 182  PHE B CD2 1 
ATOM   2476 C CE1 . PHE B 2 80  ? 49.834 56.534 80.629  1.00 96.96  ? 182  PHE B CE1 1 
ATOM   2477 C CE2 . PHE B 2 80  ? 50.510 58.825 80.585  1.00 97.70  ? 182  PHE B CE2 1 
ATOM   2478 C CZ  . PHE B 2 80  ? 49.946 57.726 79.952  1.00 97.42  ? 182  PHE B CZ  1 
ATOM   2479 N N   . ARG B 2 81  ? 54.399 58.294 84.315  1.00 97.35  ? 183  ARG B N   1 
ATOM   2480 C CA  . ARG B 2 81  ? 55.510 59.152 83.946  1.00 97.69  ? 183  ARG B CA  1 
ATOM   2481 C C   . ARG B 2 81  ? 56.730 58.284 83.637  1.00 98.81  ? 183  ARG B C   1 
ATOM   2482 O O   . ARG B 2 81  ? 57.650 58.711 82.942  1.00 98.95  ? 183  ARG B O   1 
ATOM   2483 C CB  . ARG B 2 81  ? 55.804 60.131 85.083  1.00 96.75  ? 183  ARG B CB  1 
ATOM   2484 C CG  . ARG B 2 81  ? 54.695 61.164 85.258  1.00 95.68  ? 183  ARG B CG  1 
ATOM   2485 C CD  . ARG B 2 81  ? 54.382 61.837 83.915  1.00 93.98  ? 183  ARG B CD  1 
ATOM   2486 N NE  . ARG B 2 81  ? 55.001 63.156 83.754  1.00 91.47  ? 183  ARG B NE  1 
ATOM   2487 C CZ  . ARG B 2 81  ? 55.260 63.721 82.576  1.00 90.30  ? 183  ARG B CZ  1 
ATOM   2488 N NH1 . ARG B 2 81  ? 54.965 63.081 81.451  1.00 88.92  ? 183  ARG B NH1 1 
ATOM   2489 N NH2 . ARG B 2 81  ? 55.795 64.934 82.519  1.00 89.08  ? 183  ARG B NH2 1 
ATOM   2490 N N   . SER B 2 82  ? 56.708 57.056 84.153  1.00 100.04 ? 184  SER B N   1 
ATOM   2491 C CA  . SER B 2 82  ? 57.764 56.064 83.965  1.00 100.40 ? 184  SER B CA  1 
ATOM   2492 C C   . SER B 2 82  ? 57.711 55.356 82.602  1.00 100.48 ? 184  SER B C   1 
ATOM   2493 O O   . SER B 2 82  ? 58.616 54.600 82.258  1.00 100.50 ? 184  SER B O   1 
ATOM   2494 C CB  . SER B 2 82  ? 57.684 55.025 85.093  1.00 100.24 ? 184  SER B CB  1 
ATOM   2495 O OG  . SER B 2 82  ? 58.050 53.729 84.648  1.00 100.92 ? 184  SER B OG  1 
ATOM   2496 N N   . LEU B 2 83  ? 56.655 55.598 81.830  1.00 101.14 ? 185  LEU B N   1 
ATOM   2497 C CA  . LEU B 2 83  ? 56.504 54.977 80.514  1.00 101.67 ? 185  LEU B CA  1 
ATOM   2498 C C   . LEU B 2 83  ? 57.028 55.906 79.420  1.00 101.85 ? 185  LEU B C   1 
ATOM   2499 O O   . LEU B 2 83  ? 56.853 57.118 79.498  1.00 102.64 ? 185  LEU B O   1 
ATOM   2500 C CB  . LEU B 2 83  ? 55.026 54.669 80.246  1.00 101.70 ? 185  LEU B CB  1 
ATOM   2501 C CG  . LEU B 2 83  ? 54.326 53.625 81.120  1.00 101.66 ? 185  LEU B CG  1 
ATOM   2502 C CD1 . LEU B 2 83  ? 52.829 53.690 80.885  1.00 102.59 ? 185  LEU B CD1 1 
ATOM   2503 C CD2 . LEU B 2 83  ? 54.851 52.238 80.793  1.00 102.34 ? 185  LEU B CD2 1 
ATOM   2504 N N   . PRO B 2 84  ? 57.684 55.353 78.389  1.00 101.72 ? 186  PRO B N   1 
ATOM   2505 C CA  . PRO B 2 84  ? 58.190 56.226 77.324  1.00 102.09 ? 186  PRO B CA  1 
ATOM   2506 C C   . PRO B 2 84  ? 57.056 57.025 76.673  1.00 102.30 ? 186  PRO B C   1 
ATOM   2507 O O   . PRO B 2 84  ? 55.946 56.519 76.500  1.00 102.28 ? 186  PRO B O   1 
ATOM   2508 C CB  . PRO B 2 84  ? 58.865 55.248 76.360  1.00 102.24 ? 186  PRO B CB  1 
ATOM   2509 C CG  . PRO B 2 84  ? 58.136 53.959 76.602  1.00 102.13 ? 186  PRO B CG  1 
ATOM   2510 C CD  . PRO B 2 84  ? 57.979 53.941 78.101  1.00 101.52 ? 186  PRO B CD  1 
ATOM   2511 N N   . ILE B 2 85  ? 57.350 58.273 76.320  1.00 102.18 ? 187  ILE B N   1 
ATOM   2512 C CA  . ILE B 2 85  ? 56.377 59.182 75.714  1.00 101.30 ? 187  ILE B CA  1 
ATOM   2513 C C   . ILE B 2 85  ? 55.503 58.588 74.609  1.00 100.42 ? 187  ILE B C   1 
ATOM   2514 O O   . ILE B 2 85  ? 54.291 58.802 74.587  1.00 100.67 ? 187  ILE B O   1 
ATOM   2515 C CB  . ILE B 2 85  ? 57.075 60.422 75.138  1.00 101.40 ? 187  ILE B CB  1 
ATOM   2516 C CG1 . ILE B 2 85  ? 57.987 61.054 76.196  1.00 101.31 ? 187  ILE B CG1 1 
ATOM   2517 C CG2 . ILE B 2 85  ? 56.030 61.413 74.645  1.00 102.02 ? 187  ILE B CG2 1 
ATOM   2518 C CD1 . ILE B 2 85  ? 57.268 61.666 77.373  1.00 100.51 ? 187  ILE B CD1 1 
ATOM   2519 N N   . GLU B 2 86  ? 56.121 57.853 73.690  1.00 99.25  ? 188  GLU B N   1 
ATOM   2520 C CA  . GLU B 2 86  ? 55.406 57.229 72.580  1.00 98.14  ? 188  GLU B CA  1 
ATOM   2521 C C   . GLU B 2 86  ? 54.245 56.360 73.063  1.00 95.66  ? 188  GLU B C   1 
ATOM   2522 O O   . GLU B 2 86  ? 53.309 56.084 72.312  1.00 94.26  ? 188  GLU B O   1 
ATOM   2523 C CB  . GLU B 2 86  ? 56.383 56.377 71.773  1.00 101.13 ? 188  GLU B CB  1 
ATOM   2524 C CG  . GLU B 2 86  ? 57.678 57.114 71.447  1.00 105.91 ? 188  GLU B CG  1 
ATOM   2525 C CD  . GLU B 2 86  ? 58.784 56.206 70.917  1.00 108.15 ? 188  GLU B CD  1 
ATOM   2526 O OE1 . GLU B 2 86  ? 58.677 55.718 69.767  1.00 108.73 ? 188  GLU B OE1 1 
ATOM   2527 O OE2 . GLU B 2 86  ? 59.765 55.983 71.660  1.00 109.59 ? 188  GLU B OE2 1 
ATOM   2528 N N   . ASP B 2 87  ? 54.322 55.931 74.320  1.00 93.11  ? 189  ASP B N   1 
ATOM   2529 C CA  . ASP B 2 87  ? 53.300 55.094 74.934  1.00 91.11  ? 189  ASP B CA  1 
ATOM   2530 C C   . ASP B 2 87  ? 52.331 55.907 75.772  1.00 89.32  ? 189  ASP B C   1 
ATOM   2531 O O   . ASP B 2 87  ? 51.141 55.608 75.815  1.00 88.96  ? 189  ASP B O   1 
ATOM   2532 C CB  . ASP B 2 87  ? 53.948 54.027 75.811  1.00 92.70  ? 189  ASP B CB  1 
ATOM   2533 C CG  . ASP B 2 87  ? 54.789 53.056 75.013  1.00 93.70  ? 189  ASP B CG  1 
ATOM   2534 O OD1 . ASP B 2 87  ? 55.364 52.131 75.619  1.00 93.25  ? 189  ASP B OD1 1 
ATOM   2535 O OD2 . ASP B 2 87  ? 54.876 53.219 73.776  1.00 95.43  ? 189  ASP B OD2 1 
ATOM   2536 N N   . GLN B 2 88  ? 52.842 56.919 76.463  1.00 87.19  ? 190  GLN B N   1 
ATOM   2537 C CA  . GLN B 2 88  ? 51.979 57.774 77.260  1.00 84.95  ? 190  GLN B CA  1 
ATOM   2538 C C   . GLN B 2 88  ? 50.928 58.325 76.303  1.00 83.53  ? 190  GLN B C   1 
ATOM   2539 O O   . GLN B 2 88  ? 49.735 58.360 76.610  1.00 83.47  ? 190  GLN B O   1 
ATOM   2540 C CB  . GLN B 2 88  ? 52.789 58.909 77.870  1.00 84.73  ? 190  GLN B CB  1 
ATOM   2541 C CG  . GLN B 2 88  ? 53.912 58.420 78.757  1.00 86.65  ? 190  GLN B CG  1 
ATOM   2542 C CD  . GLN B 2 88  ? 54.490 59.518 79.628  1.00 88.15  ? 190  GLN B CD  1 
ATOM   2543 O OE1 . GLN B 2 88  ? 53.815 60.050 80.509  1.00 88.87  ? 190  GLN B OE1 1 
ATOM   2544 N NE2 . GLN B 2 88  ? 55.744 59.864 79.385  1.00 89.45  ? 190  GLN B NE2 1 
ATOM   2545 N N   . ILE B 2 89  ? 51.399 58.742 75.132  1.00 81.20  ? 191  ILE B N   1 
ATOM   2546 C CA  . ILE B 2 89  ? 50.547 59.263 74.076  1.00 78.21  ? 191  ILE B CA  1 
ATOM   2547 C C   . ILE B 2 89  ? 49.537 58.196 73.645  1.00 77.06  ? 191  ILE B C   1 
ATOM   2548 O O   . ILE B 2 89  ? 48.336 58.420 73.727  1.00 76.61  ? 191  ILE B O   1 
ATOM   2549 C CB  . ILE B 2 89  ? 51.401 59.700 72.864  1.00 77.29  ? 191  ILE B CB  1 
ATOM   2550 C CG1 . ILE B 2 89  ? 52.294 60.872 73.269  1.00 77.36  ? 191  ILE B CG1 1 
ATOM   2551 C CG2 . ILE B 2 89  ? 50.522 60.092 71.697  1.00 75.17  ? 191  ILE B CG2 1 
ATOM   2552 C CD1 . ILE B 2 89  ? 53.159 61.378 72.150  1.00 78.62  ? 191  ILE B CD1 1 
ATOM   2553 N N   . SER B 2 90  ? 50.021 57.033 73.210  1.00 75.75  ? 192  SER B N   1 
ATOM   2554 C CA  . SER B 2 90  ? 49.143 55.940 72.768  1.00 74.29  ? 192  SER B CA  1 
ATOM   2555 C C   . SER B 2 90  ? 48.134 55.508 73.827  1.00 71.65  ? 192  SER B C   1 
ATOM   2556 O O   . SER B 2 90  ? 47.053 55.020 73.494  1.00 68.99  ? 192  SER B O   1 
ATOM   2557 C CB  . SER B 2 90  ? 49.977 54.730 72.350  1.00 75.69  ? 192  SER B CB  1 
ATOM   2558 O OG  . SER B 2 90  ? 51.014 55.133 71.474  1.00 79.21  ? 192  SER B OG  1 
ATOM   2559 N N   . LEU B 2 91  ? 48.509 55.676 75.097  1.00 70.69  ? 193  LEU B N   1 
ATOM   2560 C CA  . LEU B 2 91  ? 47.650 55.338 76.235  1.00 69.71  ? 193  LEU B CA  1 
ATOM   2561 C C   . LEU B 2 91  ? 46.627 56.444 76.476  1.00 69.44  ? 193  LEU B C   1 
ATOM   2562 O O   . LEU B 2 91  ? 45.523 56.190 76.953  1.00 69.47  ? 193  LEU B O   1 
ATOM   2563 C CB  . LEU B 2 91  ? 48.480 55.125 77.504  1.00 67.42  ? 193  LEU B CB  1 
ATOM   2564 C CG  . LEU B 2 91  ? 49.215 53.791 77.553  1.00 64.72  ? 193  LEU B CG  1 
ATOM   2565 C CD1 . LEU B 2 91  ? 49.749 53.555 78.949  1.00 62.72  ? 193  LEU B CD1 1 
ATOM   2566 C CD2 . LEU B 2 91  ? 48.256 52.681 77.151  1.00 63.61  ? 193  LEU B CD2 1 
ATOM   2567 N N   . LEU B 2 92  ? 47.003 57.675 76.158  1.00 68.20  ? 194  LEU B N   1 
ATOM   2568 C CA  . LEU B 2 92  ? 46.092 58.792 76.306  1.00 66.32  ? 194  LEU B CA  1 
ATOM   2569 C C   . LEU B 2 92  ? 45.133 58.815 75.113  1.00 65.68  ? 194  LEU B C   1 
ATOM   2570 O O   . LEU B 2 92  ? 43.936 59.013 75.268  1.00 66.49  ? 194  LEU B O   1 
ATOM   2571 C CB  . LEU B 2 92  ? 46.881 60.093 76.410  1.00 65.57  ? 194  LEU B CB  1 
ATOM   2572 C CG  . LEU B 2 92  ? 46.925 60.634 77.841  1.00 65.81  ? 194  LEU B CG  1 
ATOM   2573 C CD1 . LEU B 2 92  ? 46.666 59.508 78.817  1.00 66.83  ? 194  LEU B CD1 1 
ATOM   2574 C CD2 . LEU B 2 92  ? 48.259 61.284 78.117  1.00 66.00  ? 194  LEU B CD2 1 
ATOM   2575 N N   . LYS B 2 93  ? 45.653 58.589 73.916  1.00 64.51  ? 195  LYS B N   1 
ATOM   2576 C CA  . LYS B 2 93  ? 44.811 58.573 72.731  1.00 62.95  ? 195  LYS B CA  1 
ATOM   2577 C C   . LYS B 2 93  ? 43.794 57.449 72.831  1.00 63.12  ? 195  LYS B C   1 
ATOM   2578 O O   . LYS B 2 93  ? 42.693 57.565 72.296  1.00 63.61  ? 195  LYS B O   1 
ATOM   2579 C CB  . LYS B 2 93  ? 45.653 58.341 71.486  1.00 62.37  ? 195  LYS B CB  1 
ATOM   2580 C CG  . LYS B 2 93  ? 46.844 59.250 71.352  1.00 61.11  ? 195  LYS B CG  1 
ATOM   2581 C CD  . LYS B 2 93  ? 47.803 58.667 70.347  1.00 61.51  ? 195  LYS B CD  1 
ATOM   2582 C CE  . LYS B 2 93  ? 47.062 58.242 69.094  1.00 61.53  ? 195  LYS B CE  1 
ATOM   2583 N NZ  . LYS B 2 93  ? 46.369 59.395 68.475  1.00 60.32  ? 195  LYS B NZ  1 
ATOM   2584 N N   . GLY B 2 94  ? 44.177 56.361 73.502  1.00 62.76  ? 196  GLY B N   1 
ATOM   2585 C CA  . GLY B 2 94  ? 43.295 55.213 73.645  1.00 63.81  ? 196  GLY B CA  1 
ATOM   2586 C C   . GLY B 2 94  ? 42.375 55.224 74.854  1.00 65.15  ? 196  GLY B C   1 
ATOM   2587 O O   . GLY B 2 94  ? 41.243 54.747 74.791  1.00 65.03  ? 196  GLY B O   1 
ATOM   2588 N N   . ALA B 2 95  ? 42.854 55.769 75.964  1.00 67.29  ? 197  ALA B N   1 
ATOM   2589 C CA  . ALA B 2 95  ? 42.055 55.824 77.182  1.00 68.41  ? 197  ALA B CA  1 
ATOM   2590 C C   . ALA B 2 95  ? 41.289 57.140 77.353  1.00 69.93  ? 197  ALA B C   1 
ATOM   2591 O O   . ALA B 2 95  ? 40.069 57.118 77.476  1.00 71.48  ? 197  ALA B O   1 
ATOM   2592 C CB  . ALA B 2 95  ? 42.944 55.581 78.382  1.00 66.27  ? 197  ALA B CB  1 
ATOM   2593 N N   . ALA B 2 96  ? 42.013 58.266 77.351  1.00 70.19  ? 198  ALA B N   1 
ATOM   2594 C CA  . ALA B 2 96  ? 41.470 59.630 77.522  1.00 69.28  ? 198  ALA B CA  1 
ATOM   2595 C C   . ALA B 2 96  ? 39.956 59.827 77.463  1.00 69.39  ? 198  ALA B C   1 
ATOM   2596 O O   . ALA B 2 96  ? 39.359 60.266 78.449  1.00 69.43  ? 198  ALA B O   1 
ATOM   2597 C CB  . ALA B 2 96  ? 42.131 60.575 76.535  1.00 68.39  ? 198  ALA B CB  1 
ATOM   2598 N N   . VAL B 2 97  ? 39.343 59.540 76.311  1.00 69.15  ? 199  VAL B N   1 
ATOM   2599 C CA  . VAL B 2 97  ? 37.891 59.692 76.143  1.00 67.89  ? 199  VAL B CA  1 
ATOM   2600 C C   . VAL B 2 97  ? 37.115 58.784 77.094  1.00 69.03  ? 199  VAL B C   1 
ATOM   2601 O O   . VAL B 2 97  ? 36.240 59.251 77.833  1.00 68.74  ? 199  VAL B O   1 
ATOM   2602 C CB  . VAL B 2 97  ? 37.458 59.394 74.691  1.00 66.64  ? 199  VAL B CB  1 
ATOM   2603 C CG1 . VAL B 2 97  ? 35.950 59.228 74.616  1.00 63.45  ? 199  VAL B CG1 1 
ATOM   2604 C CG2 . VAL B 2 97  ? 37.908 60.530 73.784  1.00 65.05  ? 199  VAL B CG2 1 
ATOM   2605 N N   . GLU B 2 98  ? 37.433 57.489 77.066  1.00 69.35  ? 200  GLU B N   1 
ATOM   2606 C CA  . GLU B 2 98  ? 36.808 56.509 77.952  1.00 68.44  ? 200  GLU B CA  1 
ATOM   2607 C C   . GLU B 2 98  ? 36.890 56.997 79.410  1.00 66.52  ? 200  GLU B C   1 
ATOM   2608 O O   . GLU B 2 98  ? 35.904 56.966 80.137  1.00 66.63  ? 200  GLU B O   1 
ATOM   2609 C CB  . GLU B 2 98  ? 37.519 55.152 77.811  1.00 71.03  ? 200  GLU B CB  1 
ATOM   2610 C CG  . GLU B 2 98  ? 37.054 54.304 76.620  1.00 75.77  ? 200  GLU B CG  1 
ATOM   2611 C CD  . GLU B 2 98  ? 38.043 53.196 76.227  1.00 78.58  ? 200  GLU B CD  1 
ATOM   2612 O OE1 . GLU B 2 98  ? 38.485 52.431 77.116  1.00 80.25  ? 200  GLU B OE1 1 
ATOM   2613 O OE2 . GLU B 2 98  ? 38.369 53.088 75.020  1.00 78.73  ? 200  GLU B OE2 1 
ATOM   2614 N N   . ILE B 2 99  ? 38.068 57.463 79.820  1.00 64.24  ? 201  ILE B N   1 
ATOM   2615 C CA  . ILE B 2 99  ? 38.305 57.951 81.182  1.00 62.38  ? 201  ILE B CA  1 
ATOM   2616 C C   . ILE B 2 99  ? 37.398 59.095 81.628  1.00 61.12  ? 201  ILE B C   1 
ATOM   2617 O O   . ILE B 2 99  ? 37.034 59.200 82.804  1.00 58.99  ? 201  ILE B O   1 
ATOM   2618 C CB  . ILE B 2 99  ? 39.756 58.409 81.338  1.00 62.78  ? 201  ILE B CB  1 
ATOM   2619 C CG1 . ILE B 2 99  ? 40.694 57.220 81.116  1.00 61.39  ? 201  ILE B CG1 1 
ATOM   2620 C CG2 . ILE B 2 99  ? 39.951 59.050 82.712  1.00 62.13  ? 201  ILE B CG2 1 
ATOM   2621 C CD1 . ILE B 2 99  ? 42.126 57.622 80.848  1.00 61.55  ? 201  ILE B CD1 1 
ATOM   2622 N N   . CYS B 2 100 ? 37.058 59.965 80.689  1.00 60.33  ? 202  CYS B N   1 
ATOM   2623 C CA  . CYS B 2 100 ? 36.182 61.080 80.984  1.00 59.31  ? 202  CYS B CA  1 
ATOM   2624 C C   . CYS B 2 100 ? 34.787 60.576 81.356  1.00 60.70  ? 202  CYS B C   1 
ATOM   2625 O O   . CYS B 2 100 ? 34.255 60.945 82.404  1.00 60.32  ? 202  CYS B O   1 
ATOM   2626 C CB  . CYS B 2 100 ? 36.127 62.006 79.781  1.00 57.14  ? 202  CYS B CB  1 
ATOM   2627 S SG  . CYS B 2 100 ? 37.687 62.865 79.545  1.00 54.51  ? 202  CYS B SG  1 
ATOM   2628 N N   . HIS B 2 101 ? 34.200 59.731 80.508  1.00 61.21  ? 203  HIS B N   1 
ATOM   2629 C CA  . HIS B 2 101 ? 32.879 59.169 80.786  1.00 62.44  ? 203  HIS B CA  1 
ATOM   2630 C C   . HIS B 2 101 ? 32.836 58.550 82.162  1.00 64.43  ? 203  HIS B C   1 
ATOM   2631 O O   . HIS B 2 101 ? 31.897 58.754 82.923  1.00 64.81  ? 203  HIS B O   1 
ATOM   2632 C CB  . HIS B 2 101 ? 32.538 58.086 79.787  1.00 60.65  ? 203  HIS B CB  1 
ATOM   2633 C CG  . HIS B 2 101 ? 32.111 58.614 78.466  1.00 61.00  ? 203  HIS B CG  1 
ATOM   2634 N ND1 . HIS B 2 101 ? 30.933 59.304 78.294  1.00 61.67  ? 203  HIS B ND1 1 
ATOM   2635 C CD2 . HIS B 2 101 ? 32.703 58.563 77.252  1.00 62.02  ? 203  HIS B CD2 1 
ATOM   2636 C CE1 . HIS B 2 101 ? 30.816 59.655 77.026  1.00 62.72  ? 203  HIS B CE1 1 
ATOM   2637 N NE2 . HIS B 2 101 ? 31.876 59.217 76.372  1.00 62.57  ? 203  HIS B NE2 1 
ATOM   2638 N N   . ILE B 2 102 ? 33.860 57.767 82.463  1.00 66.46  ? 204  ILE B N   1 
ATOM   2639 C CA  . ILE B 2 102 ? 33.956 57.110 83.747  1.00 68.90  ? 204  ILE B CA  1 
ATOM   2640 C C   . ILE B 2 102 ? 33.756 58.125 84.874  1.00 70.08  ? 204  ILE B C   1 
ATOM   2641 O O   . ILE B 2 102 ? 32.886 57.952 85.728  1.00 70.08  ? 204  ILE B O   1 
ATOM   2642 C CB  . ILE B 2 102 ? 35.333 56.415 83.907  1.00 69.60  ? 204  ILE B CB  1 
ATOM   2643 C CG1 . ILE B 2 102 ? 35.657 55.599 82.649  1.00 69.35  ? 204  ILE B CG1 1 
ATOM   2644 C CG2 . ILE B 2 102 ? 35.312 55.496 85.133  1.00 70.53  ? 204  ILE B CG2 1 
ATOM   2645 C CD1 . ILE B 2 102 ? 36.949 54.795 82.727  1.00 68.54  ? 204  ILE B CD1 1 
ATOM   2646 N N   . VAL B 2 103 ? 34.555 59.189 84.872  1.00 71.25  ? 205  VAL B N   1 
ATOM   2647 C CA  . VAL B 2 103 ? 34.446 60.217 85.902  1.00 72.28  ? 205  VAL B CA  1 
ATOM   2648 C C   . VAL B 2 103 ? 33.076 60.887 85.818  1.00 73.50  ? 205  VAL B C   1 
ATOM   2649 O O   . VAL B 2 103 ? 32.343 60.982 86.808  1.00 74.24  ? 205  VAL B O   1 
ATOM   2650 C CB  . VAL B 2 103 ? 35.534 61.286 85.732  1.00 71.01  ? 205  VAL B CB  1 
ATOM   2651 C CG1 . VAL B 2 103 ? 35.548 62.198 86.931  1.00 71.75  ? 205  VAL B CG1 1 
ATOM   2652 C CG2 . VAL B 2 103 ? 36.877 60.624 85.565  1.00 71.07  ? 205  VAL B CG2 1 
ATOM   2653 N N   . LEU B 2 104 ? 32.742 61.335 84.614  1.00 73.65  ? 206  LEU B N   1 
ATOM   2654 C CA  . LEU B 2 104 ? 31.480 62.000 84.335  1.00 73.85  ? 206  LEU B CA  1 
ATOM   2655 C C   . LEU B 2 104 ? 30.279 61.359 85.026  1.00 73.63  ? 206  LEU B C   1 
ATOM   2656 O O   . LEU B 2 104 ? 29.486 62.044 85.672  1.00 74.46  ? 206  LEU B O   1 
ATOM   2657 C CB  . LEU B 2 104 ? 31.239 62.021 82.821  1.00 74.04  ? 206  LEU B CB  1 
ATOM   2658 C CG  . LEU B 2 104 ? 30.008 62.794 82.333  1.00 74.89  ? 206  LEU B CG  1 
ATOM   2659 C CD1 . LEU B 2 104 ? 30.144 64.263 82.721  1.00 76.24  ? 206  LEU B CD1 1 
ATOM   2660 C CD2 . LEU B 2 104 ? 29.850 62.653 80.827  1.00 73.45  ? 206  LEU B CD2 1 
ATOM   2661 N N   . ASN B 2 105 ? 30.156 60.045 84.889  1.00 73.25  ? 207  ASN B N   1 
ATOM   2662 C CA  . ASN B 2 105 ? 29.041 59.298 85.461  1.00 73.85  ? 207  ASN B CA  1 
ATOM   2663 C C   . ASN B 2 105 ? 28.744 59.541 86.948  1.00 73.12  ? 207  ASN B C   1 
ATOM   2664 O O   . ASN B 2 105 ? 27.643 59.256 87.419  1.00 72.47  ? 207  ASN B O   1 
ATOM   2665 C CB  . ASN B 2 105 ? 29.256 57.805 85.197  1.00 75.19  ? 207  ASN B CB  1 
ATOM   2666 C CG  . ASN B 2 105 ? 28.116 56.954 85.704  1.00 77.00  ? 207  ASN B CG  1 
ATOM   2667 O OD1 . ASN B 2 105 ? 27.991 56.723 86.905  1.00 79.24  ? 207  ASN B OD1 1 
ATOM   2668 N ND2 . ASN B 2 105 ? 27.269 56.490 84.794  1.00 76.78  ? 207  ASN B ND2 1 
ATOM   2669 N N   . THR B 2 106 ? 29.712 60.072 87.685  1.00 71.97  ? 208  THR B N   1 
ATOM   2670 C CA  . THR B 2 106 ? 29.513 60.346 89.100  1.00 71.28  ? 208  THR B CA  1 
ATOM   2671 C C   . THR B 2 106 ? 28.558 61.525 89.360  1.00 71.59  ? 208  THR B C   1 
ATOM   2672 O O   . THR B 2 106 ? 28.068 61.696 90.480  1.00 72.68  ? 208  THR B O   1 
ATOM   2673 C CB  . THR B 2 106 ? 30.855 60.616 89.770  1.00 70.96  ? 208  THR B CB  1 
ATOM   2674 O OG1 . THR B 2 106 ? 31.424 61.825 89.252  1.00 71.10  ? 208  THR B OG1 1 
ATOM   2675 C CG2 . THR B 2 106 ? 31.801 59.475 89.476  1.00 70.00  ? 208  THR B CG2 1 
ATOM   2676 N N   . THR B 2 107 ? 28.302 62.330 88.327  1.00 70.40  ? 209  THR B N   1 
ATOM   2677 C CA  . THR B 2 107 ? 27.396 63.480 88.425  1.00 68.87  ? 209  THR B CA  1 
ATOM   2678 C C   . THR B 2 107 ? 26.016 63.110 87.896  1.00 68.65  ? 209  THR B C   1 
ATOM   2679 O O   . THR B 2 107 ? 25.011 63.740 88.223  1.00 68.60  ? 209  THR B O   1 
ATOM   2680 C CB  . THR B 2 107 ? 27.902 64.688 87.602  1.00 67.60  ? 209  THR B CB  1 
ATOM   2681 O OG1 . THR B 2 107 ? 27.985 64.329 86.219  1.00 66.53  ? 209  THR B OG1 1 
ATOM   2682 C CG2 . THR B 2 107 ? 29.259 65.129 88.088  1.00 66.34  ? 209  THR B CG2 1 
ATOM   2683 N N   . PHE B 2 108 ? 25.987 62.084 87.063  1.00 67.96  ? 210  PHE B N   1 
ATOM   2684 C CA  . PHE B 2 108 ? 24.763 61.596 86.470  1.00 68.89  ? 210  PHE B CA  1 
ATOM   2685 C C   . PHE B 2 108 ? 23.655 61.404 87.511  1.00 70.84  ? 210  PHE B C   1 
ATOM   2686 O O   . PHE B 2 108 ? 23.876 60.792 88.556  1.00 71.82  ? 210  PHE B O   1 
ATOM   2687 C CB  . PHE B 2 108 ? 25.058 60.265 85.794  1.00 67.92  ? 210  PHE B CB  1 
ATOM   2688 C CG  . PHE B 2 108 ? 24.000 59.823 84.848  1.00 67.57  ? 210  PHE B CG  1 
ATOM   2689 C CD1 . PHE B 2 108 ? 23.972 60.306 83.553  1.00 67.33  ? 210  PHE B CD1 1 
ATOM   2690 C CD2 . PHE B 2 108 ? 23.028 58.923 85.248  1.00 67.75  ? 210  PHE B CD2 1 
ATOM   2691 C CE1 . PHE B 2 108 ? 22.994 59.899 82.667  1.00 68.62  ? 210  PHE B CE1 1 
ATOM   2692 C CE2 . PHE B 2 108 ? 22.045 58.511 84.369  1.00 69.15  ? 210  PHE B CE2 1 
ATOM   2693 C CZ  . PHE B 2 108 ? 22.027 58.998 83.074  1.00 68.91  ? 210  PHE B CZ  1 
ATOM   2694 N N   . CYS B 2 109 ? 22.465 61.931 87.235  1.00 72.80  ? 211  CYS B N   1 
ATOM   2695 C CA  . CYS B 2 109 ? 21.339 61.766 88.153  1.00 74.89  ? 211  CYS B CA  1 
ATOM   2696 C C   . CYS B 2 109 ? 20.435 60.660 87.617  1.00 77.46  ? 211  CYS B C   1 
ATOM   2697 O O   . CYS B 2 109 ? 19.816 60.800 86.563  1.00 76.80  ? 211  CYS B O   1 
ATOM   2698 C CB  . CYS B 2 109 ? 20.528 63.060 88.295  1.00 73.62  ? 211  CYS B CB  1 
ATOM   2699 S SG  . CYS B 2 109 ? 19.060 62.883 89.346  1.00 70.35  ? 211  CYS B SG  1 
ATOM   2700 N N   . LEU B 2 110 ? 20.373 59.553 88.347  1.00 80.11  ? 212  LEU B N   1 
ATOM   2701 C CA  . LEU B 2 110 ? 19.550 58.418 87.951  1.00 82.09  ? 212  LEU B CA  1 
ATOM   2702 C C   . LEU B 2 110 ? 18.104 58.824 87.656  1.00 84.40  ? 212  LEU B C   1 
ATOM   2703 O O   . LEU B 2 110 ? 17.568 58.489 86.593  1.00 84.90  ? 212  LEU B O   1 
ATOM   2704 C CB  . LEU B 2 110 ? 19.596 57.348 89.051  1.00 81.05  ? 212  LEU B CB  1 
ATOM   2705 C CG  . LEU B 2 110 ? 20.890 56.520 89.107  1.00 79.57  ? 212  LEU B CG  1 
ATOM   2706 C CD1 . LEU B 2 110 ? 21.002 55.779 90.446  1.00 77.93  ? 212  LEU B CD1 1 
ATOM   2707 C CD2 . LEU B 2 110 ? 20.909 55.555 87.915  1.00 76.67  ? 212  LEU B CD2 1 
ATOM   2708 N N   . GLN B 2 111 ? 17.487 59.549 88.594  1.00 86.31  ? 213  GLN B N   1 
ATOM   2709 C CA  . GLN B 2 111 ? 16.101 60.010 88.458  1.00 86.88  ? 213  GLN B CA  1 
ATOM   2710 C C   . GLN B 2 111 ? 15.882 60.798 87.179  1.00 86.61  ? 213  GLN B C   1 
ATOM   2711 O O   . GLN B 2 111 ? 15.243 60.328 86.231  1.00 86.01  ? 213  GLN B O   1 
ATOM   2712 C CB  . GLN B 2 111 ? 15.711 60.930 89.614  1.00 88.87  ? 213  GLN B CB  1 
ATOM   2713 C CG  . GLN B 2 111 ? 15.692 60.331 91.000  1.00 93.38  ? 213  GLN B CG  1 
ATOM   2714 C CD  . GLN B 2 111 ? 15.253 61.361 92.034  1.00 95.78  ? 213  GLN B CD  1 
ATOM   2715 O OE1 . GLN B 2 111 ? 14.130 61.877 91.976  1.00 96.39  ? 213  GLN B OE1 1 
ATOM   2716 N NE2 . GLN B 2 111 ? 16.141 61.675 92.977  1.00 97.04  ? 213  GLN B NE2 1 
ATOM   2717 N N   . THR B 2 112 ? 16.415 62.017 87.188  1.00 86.91  ? 214  THR B N   1 
ATOM   2718 C CA  . THR B 2 112 ? 16.297 62.947 86.074  1.00 87.14  ? 214  THR B CA  1 
ATOM   2719 C C   . THR B 2 112 ? 16.928 62.462 84.759  1.00 87.61  ? 214  THR B C   1 
ATOM   2720 O O   . THR B 2 112 ? 16.410 62.752 83.673  1.00 88.00  ? 214  THR B O   1 
ATOM   2721 C CB  . THR B 2 112 ? 16.894 64.342 86.458  1.00 87.26  ? 214  THR B CB  1 
ATOM   2722 O OG1 . THR B 2 112 ? 18.238 64.189 86.935  1.00 86.92  ? 214  THR B OG1 1 
ATOM   2723 C CG2 . THR B 2 112 ? 16.050 65.006 87.543  1.00 85.93  ? 214  THR B CG2 1 
ATOM   2724 N N   . GLN B 2 113 ? 18.023 61.710 84.860  1.00 86.66  ? 215  GLN B N   1 
ATOM   2725 C CA  . GLN B 2 113 ? 18.737 61.211 83.687  1.00 85.05  ? 215  GLN B CA  1 
ATOM   2726 C C   . GLN B 2 113 ? 19.493 62.406 83.098  1.00 83.51  ? 215  GLN B C   1 
ATOM   2727 O O   . GLN B 2 113 ? 19.578 62.553 81.879  1.00 83.40  ? 215  GLN B O   1 
ATOM   2728 C CB  . GLN B 2 113 ? 17.747 60.659 82.654  1.00 86.39  ? 215  GLN B CB  1 
ATOM   2729 C CG  . GLN B 2 113 ? 18.348 59.762 81.573  1.00 90.15  ? 215  GLN B CG  1 
ATOM   2730 C CD  . GLN B 2 113 ? 18.560 58.324 82.049  1.00 92.50  ? 215  GLN B CD  1 
ATOM   2731 O OE1 . GLN B 2 113 ? 17.792 57.817 82.874  1.00 93.21  ? 215  GLN B OE1 1 
ATOM   2732 N NE2 . GLN B 2 113 ? 19.589 57.656 81.515  1.00 91.41  ? 215  GLN B NE2 1 
ATOM   2733 N N   . ASN B 2 114 ? 20.033 63.251 83.981  1.00 81.86  ? 216  ASN B N   1 
ATOM   2734 C CA  . ASN B 2 114 ? 20.768 64.465 83.605  1.00 79.81  ? 216  ASN B CA  1 
ATOM   2735 C C   . ASN B 2 114 ? 22.098 64.529 84.342  1.00 78.66  ? 216  ASN B C   1 
ATOM   2736 O O   . ASN B 2 114 ? 22.241 63.942 85.406  1.00 78.09  ? 216  ASN B O   1 
ATOM   2737 C CB  . ASN B 2 114 ? 19.982 65.718 84.011  1.00 79.64  ? 216  ASN B CB  1 
ATOM   2738 C CG  . ASN B 2 114 ? 18.713 65.931 83.199  1.00 79.18  ? 216  ASN B CG  1 
ATOM   2739 O OD1 . ASN B 2 114 ? 17.897 66.785 83.547  1.00 78.85  ? 216  ASN B OD1 1 
ATOM   2740 N ND2 . ASN B 2 114 ? 18.545 65.180 82.114  1.00 79.67  ? 216  ASN B ND2 1 
ATOM   2741 N N   . PHE B 2 115 ? 23.061 65.261 83.788  1.00 78.77  ? 217  PHE B N   1 
ATOM   2742 C CA  . PHE B 2 115 ? 24.365 65.422 84.443  1.00 78.83  ? 217  PHE B CA  1 
ATOM   2743 C C   . PHE B 2 115 ? 24.318 66.696 85.271  1.00 77.04  ? 217  PHE B C   1 
ATOM   2744 O O   . PHE B 2 115 ? 24.141 67.787 84.738  1.00 76.52  ? 217  PHE B O   1 
ATOM   2745 C CB  . PHE B 2 115 ? 25.517 65.542 83.429  1.00 79.92  ? 217  PHE B CB  1 
ATOM   2746 C CG  . PHE B 2 115 ? 25.816 64.268 82.682  1.00 82.09  ? 217  PHE B CG  1 
ATOM   2747 C CD1 . PHE B 2 115 ? 25.137 63.953 81.504  1.00 82.67  ? 217  PHE B CD1 1 
ATOM   2748 C CD2 . PHE B 2 115 ? 26.766 63.373 83.165  1.00 81.79  ? 217  PHE B CD2 1 
ATOM   2749 C CE1 . PHE B 2 115 ? 25.401 62.772 80.822  1.00 81.89  ? 217  PHE B CE1 1 
ATOM   2750 C CE2 . PHE B 2 115 ? 27.031 62.192 82.489  1.00 81.35  ? 217  PHE B CE2 1 
ATOM   2751 C CZ  . PHE B 2 115 ? 26.349 61.892 81.316  1.00 81.92  ? 217  PHE B CZ  1 
ATOM   2752 N N   . LEU B 2 116 ? 24.476 66.569 86.576  1.00 75.34  ? 218  LEU B N   1 
ATOM   2753 C CA  . LEU B 2 116 ? 24.431 67.751 87.409  1.00 74.80  ? 218  LEU B CA  1 
ATOM   2754 C C   . LEU B 2 116 ? 25.861 68.103 87.754  1.00 74.78  ? 218  LEU B C   1 
ATOM   2755 O O   . LEU B 2 116 ? 26.450 67.565 88.688  1.00 75.46  ? 218  LEU B O   1 
ATOM   2756 C CB  . LEU B 2 116 ? 23.598 67.470 88.656  1.00 74.07  ? 218  LEU B CB  1 
ATOM   2757 C CG  . LEU B 2 116 ? 22.303 66.736 88.281  1.00 74.92  ? 218  LEU B CG  1 
ATOM   2758 C CD1 . LEU B 2 116 ? 21.395 66.605 89.489  1.00 76.23  ? 218  LEU B CD1 1 
ATOM   2759 C CD2 . LEU B 2 116 ? 21.593 67.487 87.172  1.00 75.34  ? 218  LEU B CD2 1 
ATOM   2760 N N   . CYS B 2 117 ? 26.431 68.995 86.963  1.00 74.43  ? 219  CYS B N   1 
ATOM   2761 C CA  . CYS B 2 117 ? 27.799 69.407 87.184  1.00 74.84  ? 219  CYS B CA  1 
ATOM   2762 C C   . CYS B 2 117 ? 27.769 70.709 87.967  1.00 75.27  ? 219  CYS B C   1 
ATOM   2763 O O   . CYS B 2 117 ? 27.932 71.794 87.415  1.00 74.05  ? 219  CYS B O   1 
ATOM   2764 C CB  . CYS B 2 117 ? 28.515 69.571 85.839  1.00 74.92  ? 219  CYS B CB  1 
ATOM   2765 S SG  . CYS B 2 117 ? 28.412 68.093 84.771  1.00 73.30  ? 219  CYS B SG  1 
ATOM   2766 N N   . GLY B 2 118 ? 27.557 70.577 89.271  1.00 76.73  ? 220  GLY B N   1 
ATOM   2767 C CA  . GLY B 2 118 ? 27.474 71.735 90.135  1.00 78.52  ? 220  GLY B CA  1 
ATOM   2768 C C   . GLY B 2 118 ? 26.088 72.322 89.962  1.00 80.06  ? 220  GLY B C   1 
ATOM   2769 O O   . GLY B 2 118 ? 25.084 71.683 90.299  1.00 80.09  ? 220  GLY B O   1 
ATOM   2770 N N   . PRO B 2 119 ? 26.011 73.553 89.435  1.00 80.67  ? 221  PRO B N   1 
ATOM   2771 C CA  . PRO B 2 119 ? 24.782 74.317 89.169  1.00 79.43  ? 221  PRO B CA  1 
ATOM   2772 C C   . PRO B 2 119 ? 24.135 73.991 87.814  1.00 77.16  ? 221  PRO B C   1 
ATOM   2773 O O   . PRO B 2 119 ? 22.921 74.130 87.632  1.00 76.13  ? 221  PRO B O   1 
ATOM   2774 C CB  . PRO B 2 119 ? 25.264 75.763 89.243  1.00 80.47  ? 221  PRO B CB  1 
ATOM   2775 C CG  . PRO B 2 119 ? 26.644 75.670 88.673  1.00 80.85  ? 221  PRO B CG  1 
ATOM   2776 C CD  . PRO B 2 119 ? 27.198 74.427 89.347  1.00 81.19  ? 221  PRO B CD  1 
ATOM   2777 N N   . LEU B 2 120 ? 24.961 73.565 86.866  1.00 75.28  ? 222  LEU B N   1 
ATOM   2778 C CA  . LEU B 2 120 ? 24.482 73.227 85.542  1.00 73.53  ? 222  LEU B CA  1 
ATOM   2779 C C   . LEU B 2 120 ? 23.855 71.848 85.596  1.00 72.23  ? 222  LEU B C   1 
ATOM   2780 O O   . LEU B 2 120 ? 24.057 71.086 86.546  1.00 71.72  ? 222  LEU B O   1 
ATOM   2781 C CB  . LEU B 2 120 ? 25.639 73.228 84.539  1.00 73.91  ? 222  LEU B CB  1 
ATOM   2782 C CG  . LEU B 2 120 ? 26.656 74.367 84.653  1.00 73.89  ? 222  LEU B CG  1 
ATOM   2783 C CD1 . LEU B 2 120 ? 27.711 74.209 83.576  1.00 74.54  ? 222  LEU B CD1 1 
ATOM   2784 C CD2 . LEU B 2 120 ? 25.962 75.705 84.518  1.00 74.51  ? 222  LEU B CD2 1 
ATOM   2785 N N   . ARG B 2 121 ? 23.084 71.548 84.563  1.00 70.67  ? 223  ARG B N   1 
ATOM   2786 C CA  . ARG B 2 121 ? 22.401 70.275 84.431  1.00 70.59  ? 223  ARG B CA  1 
ATOM   2787 C C   . ARG B 2 121 ? 22.269 70.044 82.934  1.00 69.95  ? 223  ARG B C   1 
ATOM   2788 O O   . ARG B 2 121 ? 21.455 70.695 82.275  1.00 71.05  ? 223  ARG B O   1 
ATOM   2789 C CB  . ARG B 2 121 ? 21.015 70.342 85.093  1.00 71.62  ? 223  ARG B CB  1 
ATOM   2790 C CG  . ARG B 2 121 ? 19.995 69.351 84.536  1.00 74.57  ? 223  ARG B CG  1 
ATOM   2791 C CD  . ARG B 2 121 ? 18.626 69.439 85.213  1.00 75.97  ? 223  ARG B CD  1 
ATOM   2792 N NE  . ARG B 2 121 ? 18.439 68.417 86.240  1.00 78.38  ? 223  ARG B NE  1 
ATOM   2793 C CZ  . ARG B 2 121 ? 18.731 68.576 87.526  1.00 80.51  ? 223  ARG B CZ  1 
ATOM   2794 N NH1 . ARG B 2 121 ? 19.227 69.731 87.960  1.00 80.09  ? 223  ARG B NH1 1 
ATOM   2795 N NH2 . ARG B 2 121 ? 18.529 67.571 88.378  1.00 81.77  ? 223  ARG B NH2 1 
ATOM   2796 N N   . TYR B 2 122 ? 23.087 69.137 82.397  1.00 68.08  ? 224  TYR B N   1 
ATOM   2797 C CA  . TYR B 2 122 ? 23.075 68.830 80.964  1.00 65.44  ? 224  TYR B CA  1 
ATOM   2798 C C   . TYR B 2 122 ? 22.103 67.688 80.685  1.00 64.88  ? 224  TYR B C   1 
ATOM   2799 O O   . TYR B 2 122 ? 22.028 66.713 81.436  1.00 64.39  ? 224  TYR B O   1 
ATOM   2800 C CB  . TYR B 2 122 ? 24.484 68.449 80.463  1.00 63.47  ? 224  TYR B CB  1 
ATOM   2801 C CG  . TYR B 2 122 ? 25.590 69.440 80.809  1.00 62.05  ? 224  TYR B CG  1 
ATOM   2802 C CD1 . TYR B 2 122 ? 26.270 69.371 82.028  1.00 61.81  ? 224  TYR B CD1 1 
ATOM   2803 C CD2 . TYR B 2 122 ? 25.937 70.459 79.931  1.00 60.28  ? 224  TYR B CD2 1 
ATOM   2804 C CE1 . TYR B 2 122 ? 27.260 70.296 82.359  1.00 60.78  ? 224  TYR B CE1 1 
ATOM   2805 C CE2 . TYR B 2 122 ? 26.925 71.385 80.256  1.00 60.18  ? 224  TYR B CE2 1 
ATOM   2806 C CZ  . TYR B 2 122 ? 27.581 71.301 81.468  1.00 60.73  ? 224  TYR B CZ  1 
ATOM   2807 O OH  . TYR B 2 122 ? 28.545 72.231 81.791  1.00 60.77  ? 224  TYR B OH  1 
ATOM   2808 N N   . THR B 2 123 ? 21.357 67.817 79.598  1.00 64.08  ? 225  THR B N   1 
ATOM   2809 C CA  . THR B 2 123 ? 20.381 66.806 79.235  1.00 63.92  ? 225  THR B CA  1 
ATOM   2810 C C   . THR B 2 123 ? 20.702 66.177 77.879  1.00 63.29  ? 225  THR B C   1 
ATOM   2811 O O   . THR B 2 123 ? 21.635 66.590 77.193  1.00 60.26  ? 225  THR B O   1 
ATOM   2812 C CB  . THR B 2 123 ? 18.957 67.415 79.212  1.00 64.56  ? 225  THR B CB  1 
ATOM   2813 O OG1 . THR B 2 123 ? 18.899 68.482 78.256  1.00 63.69  ? 225  THR B OG1 1 
ATOM   2814 C CG2 . THR B 2 123 ? 18.607 67.975 80.577  1.00 65.15  ? 225  THR B CG2 1 
ATOM   2815 N N   . ILE B 2 124 ? 19.914 65.182 77.491  1.00 63.58  ? 226  ILE B N   1 
ATOM   2816 C CA  . ILE B 2 124 ? 20.140 64.494 76.233  1.00 64.31  ? 226  ILE B CA  1 
ATOM   2817 C C   . ILE B 2 124 ? 19.807 65.252 74.943  1.00 66.44  ? 226  ILE B C   1 
ATOM   2818 O O   . ILE B 2 124 ? 20.246 64.841 73.874  1.00 67.29  ? 226  ILE B O   1 
ATOM   2819 C CB  . ILE B 2 124 ? 19.408 63.155 76.231  1.00 63.89  ? 226  ILE B CB  1 
ATOM   2820 C CG1 . ILE B 2 124 ? 19.698 62.403 74.929  1.00 63.74  ? 226  ILE B CG1 1 
ATOM   2821 C CG2 . ILE B 2 124 ? 17.925 63.387 76.447  1.00 63.58  ? 226  ILE B CG2 1 
ATOM   2822 C CD1 . ILE B 2 124 ? 19.773 60.890 75.086  1.00 62.48  ? 226  ILE B CD1 1 
ATOM   2823 N N   . GLU B 2 125 ? 19.031 66.336 75.010  1.00 69.38  ? 227  GLU B N   1 
ATOM   2824 C CA  . GLU B 2 125 ? 18.724 67.099 73.787  1.00 70.60  ? 227  GLU B CA  1 
ATOM   2825 C C   . GLU B 2 125 ? 19.781 68.179 73.610  1.00 69.99  ? 227  GLU B C   1 
ATOM   2826 O O   . GLU B 2 125 ? 19.890 68.764 72.537  1.00 69.43  ? 227  GLU B O   1 
ATOM   2827 C CB  . GLU B 2 125 ? 17.344 67.767 73.823  1.00 72.29  ? 227  GLU B CB  1 
ATOM   2828 C CG  . GLU B 2 125 ? 16.250 66.949 74.472  1.00 77.96  ? 227  GLU B CG  1 
ATOM   2829 C CD  . GLU B 2 125 ? 16.159 67.200 75.977  1.00 81.81  ? 227  GLU B CD  1 
ATOM   2830 O OE1 . GLU B 2 125 ? 15.737 68.312 76.382  1.00 83.05  ? 227  GLU B OE1 1 
ATOM   2831 O OE2 . GLU B 2 125 ? 16.517 66.287 76.757  1.00 84.00  ? 227  GLU B OE2 1 
ATOM   2832 N N   . ASP B 2 126 ? 20.541 68.456 74.671  1.00 69.10  ? 228  ASP B N   1 
ATOM   2833 C CA  . ASP B 2 126 ? 21.619 69.437 74.597  1.00 69.06  ? 228  ASP B CA  1 
ATOM   2834 C C   . ASP B 2 126 ? 22.640 68.852 73.624  1.00 68.05  ? 228  ASP B C   1 
ATOM   2835 O O   . ASP B 2 126 ? 23.049 69.505 72.665  1.00 68.10  ? 228  ASP B O   1 
ATOM   2836 C CB  . ASP B 2 126 ? 22.282 69.655 75.968  1.00 70.43  ? 228  ASP B CB  1 
ATOM   2837 C CG  . ASP B 2 126 ? 21.752 70.893 76.699  1.00 72.04  ? 228  ASP B CG  1 
ATOM   2838 O OD1 . ASP B 2 126 ? 21.344 71.861 76.015  1.00 72.02  ? 228  ASP B OD1 1 
ATOM   2839 O OD2 . ASP B 2 126 ? 21.766 70.909 77.958  1.00 73.01  ? 228  ASP B OD2 1 
ATOM   2840 N N   . GLY B 2 127 ? 23.043 67.611 73.879  1.00 67.29  ? 229  GLY B N   1 
ATOM   2841 C CA  . GLY B 2 127 ? 23.987 66.947 73.003  1.00 65.73  ? 229  GLY B CA  1 
ATOM   2842 C C   . GLY B 2 127 ? 23.414 66.851 71.601  1.00 65.19  ? 229  GLY B C   1 
ATOM   2843 O O   . GLY B 2 127 ? 24.134 67.015 70.626  1.00 66.43  ? 229  GLY B O   1 
ATOM   2844 N N   . ALA B 2 128 ? 22.115 66.585 71.500  1.00 64.03  ? 230  ALA B N   1 
ATOM   2845 C CA  . ALA B 2 128 ? 21.440 66.475 70.215  1.00 62.91  ? 230  ALA B CA  1 
ATOM   2846 C C   . ALA B 2 128 ? 21.507 67.796 69.463  1.00 63.91  ? 230  ALA B C   1 
ATOM   2847 O O   . ALA B 2 128 ? 21.673 67.825 68.243  1.00 61.67  ? 230  ALA B O   1 
ATOM   2848 C CB  . ALA B 2 128 ? 20.000 66.078 70.433  1.00 62.61  ? 230  ALA B CB  1 
ATOM   2849 N N   . ARG B 2 129 ? 21.360 68.893 70.201  1.00 67.03  ? 231  ARG B N   1 
ATOM   2850 C CA  . ARG B 2 129 ? 21.419 70.227 69.612  1.00 70.53  ? 231  ARG B CA  1 
ATOM   2851 C C   . ARG B 2 129 ? 22.822 70.459 69.084  1.00 71.04  ? 231  ARG B C   1 
ATOM   2852 O O   . ARG B 2 129 ? 23.003 70.962 67.974  1.00 73.22  ? 231  ARG B O   1 
ATOM   2853 C CB  . ARG B 2 129 ? 21.065 71.314 70.643  1.00 71.38  ? 231  ARG B CB  1 
ATOM   2854 C CG  . ARG B 2 129 ? 19.567 71.486 70.870  1.00 73.48  ? 231  ARG B CG  1 
ATOM   2855 C CD  . ARG B 2 129 ? 18.857 71.975 69.606  1.00 74.69  ? 231  ARG B CD  1 
ATOM   2856 N NE  . ARG B 2 129 ? 19.001 73.417 69.384  1.00 77.77  ? 231  ARG B NE  1 
ATOM   2857 C CZ  . ARG B 2 129 ? 18.344 74.357 70.064  1.00 77.90  ? 231  ARG B CZ  1 
ATOM   2858 N NH1 . ARG B 2 129 ? 17.485 74.011 71.018  1.00 77.91  ? 231  ARG B NH1 1 
ATOM   2859 N NH2 . ARG B 2 129 ? 18.540 75.644 69.789  1.00 76.58  ? 231  ARG B NH2 1 
ATOM   2860 N N   . VAL B 2 130 ? 23.818 70.078 69.874  1.00 70.01  ? 232  VAL B N   1 
ATOM   2861 C CA  . VAL B 2 130 ? 25.201 70.237 69.464  1.00 69.15  ? 232  VAL B CA  1 
ATOM   2862 C C   . VAL B 2 130 ? 25.508 69.397 68.207  1.00 68.59  ? 232  VAL B C   1 
ATOM   2863 O O   . VAL B 2 130 ? 26.617 69.460 67.674  1.00 68.64  ? 232  VAL B O   1 
ATOM   2864 C CB  . VAL B 2 130 ? 26.160 69.861 70.623  1.00 69.72  ? 232  VAL B CB  1 
ATOM   2865 C CG1 . VAL B 2 130 ? 27.573 70.308 70.306  1.00 70.74  ? 232  VAL B CG1 1 
ATOM   2866 C CG2 . VAL B 2 130 ? 25.699 70.521 71.908  1.00 70.39  ? 232  VAL B CG2 1 
ATOM   2867 N N   . GLY B 2 131 ? 24.532 68.608 67.742  1.00 68.15  ? 233  GLY B N   1 
ATOM   2868 C CA  . GLY B 2 131 ? 24.712 67.818 66.530  1.00 66.85  ? 233  GLY B CA  1 
ATOM   2869 C C   . GLY B 2 131 ? 24.904 66.309 66.578  1.00 65.80  ? 233  GLY B C   1 
ATOM   2870 O O   . GLY B 2 131 ? 24.690 65.646 65.561  1.00 65.94  ? 233  GLY B O   1 
ATOM   2871 N N   . PHE B 2 132 ? 25.301 65.761 67.725  1.00 64.22  ? 234  PHE B N   1 
ATOM   2872 C CA  . PHE B 2 132 ? 25.534 64.325 67.852  1.00 63.98  ? 234  PHE B CA  1 
ATOM   2873 C C   . PHE B 2 132 ? 24.372 63.451 67.405  1.00 64.69  ? 234  PHE B C   1 
ATOM   2874 O O   . PHE B 2 132 ? 23.294 63.533 67.969  1.00 64.40  ? 234  PHE B O   1 
ATOM   2875 C CB  . PHE B 2 132 ? 25.887 63.987 69.291  1.00 61.90  ? 234  PHE B CB  1 
ATOM   2876 C CG  . PHE B 2 132 ? 27.237 64.473 69.707  1.00 61.12  ? 234  PHE B CG  1 
ATOM   2877 C CD1 . PHE B 2 132 ? 27.368 65.469 70.655  1.00 60.64  ? 234  PHE B CD1 1 
ATOM   2878 C CD2 . PHE B 2 132 ? 28.383 63.905 69.173  1.00 61.33  ? 234  PHE B CD2 1 
ATOM   2879 C CE1 . PHE B 2 132 ? 28.620 65.887 71.067  1.00 61.13  ? 234  PHE B CE1 1 
ATOM   2880 C CE2 . PHE B 2 132 ? 29.640 64.315 69.580  1.00 60.88  ? 234  PHE B CE2 1 
ATOM   2881 C CZ  . PHE B 2 132 ? 29.759 65.306 70.529  1.00 60.97  ? 234  PHE B CZ  1 
ATOM   2882 N N   . GLN B 2 133 ? 24.599 62.605 66.400  1.00 66.18  ? 235  GLN B N   1 
ATOM   2883 C CA  . GLN B 2 133 ? 23.544 61.733 65.901  1.00 68.27  ? 235  GLN B CA  1 
ATOM   2884 C C   . GLN B 2 133 ? 22.783 61.159 67.088  1.00 69.42  ? 235  GLN B C   1 
ATOM   2885 O O   . GLN B 2 133 ? 23.337 60.988 68.183  1.00 69.33  ? 235  GLN B O   1 
ATOM   2886 C CB  . GLN B 2 133 ? 24.118 60.599 65.029  1.00 70.95  ? 235  GLN B CB  1 
ATOM   2887 C CG  . GLN B 2 133 ? 24.908 61.074 63.789  1.00 74.75  ? 235  GLN B CG  1 
ATOM   2888 C CD  . GLN B 2 133 ? 24.881 60.076 62.619  1.00 76.26  ? 235  GLN B CD  1 
ATOM   2889 O OE1 . GLN B 2 133 ? 23.832 59.845 62.010  1.00 78.00  ? 235  GLN B OE1 1 
ATOM   2890 N NE2 . GLN B 2 133 ? 26.036 59.490 62.304  1.00 77.07  ? 235  GLN B NE2 1 
ATOM   2891 N N   . VAL B 2 134 ? 21.505 60.873 66.871  1.00 70.22  ? 236  VAL B N   1 
ATOM   2892 C CA  . VAL B 2 134 ? 20.649 60.349 67.927  1.00 71.28  ? 236  VAL B CA  1 
ATOM   2893 C C   . VAL B 2 134 ? 21.134 59.076 68.620  1.00 72.75  ? 236  VAL B C   1 
ATOM   2894 O O   . VAL B 2 134 ? 21.338 59.073 69.831  1.00 72.00  ? 236  VAL B O   1 
ATOM   2895 C CB  . VAL B 2 134 ? 19.218 60.113 67.401  1.00 70.88  ? 236  VAL B CB  1 
ATOM   2896 C CG1 . VAL B 2 134 ? 19.251 59.343 66.075  1.00 69.45  ? 236  VAL B CG1 1 
ATOM   2897 C CG2 . VAL B 2 134 ? 18.409 59.369 68.449  1.00 70.26  ? 236  VAL B CG2 1 
ATOM   2898 N N   . GLU B 2 135 ? 21.317 58.006 67.850  1.00 74.41  ? 237  GLU B N   1 
ATOM   2899 C CA  . GLU B 2 135 ? 21.758 56.725 68.382  1.00 74.64  ? 237  GLU B CA  1 
ATOM   2900 C C   . GLU B 2 135 ? 22.955 56.830 69.297  1.00 73.12  ? 237  GLU B C   1 
ATOM   2901 O O   . GLU B 2 135 ? 22.978 56.219 70.360  1.00 73.27  ? 237  GLU B O   1 
ATOM   2902 C CB  . GLU B 2 135 ? 22.081 55.777 67.242  1.00 78.45  ? 237  GLU B CB  1 
ATOM   2903 C CG  . GLU B 2 135 ? 20.849 55.261 66.549  1.00 86.16  ? 237  GLU B CG  1 
ATOM   2904 C CD  . GLU B 2 135 ? 21.185 54.413 65.342  1.00 90.83  ? 237  GLU B CD  1 
ATOM   2905 O OE1 . GLU B 2 135 ? 21.758 54.963 64.375  1.00 94.31  ? 237  GLU B OE1 1 
ATOM   2906 O OE2 . GLU B 2 135 ? 20.878 53.199 65.361  1.00 93.89  ? 237  GLU B OE2 1 
ATOM   2907 N N   . PHE B 2 136 ? 23.956 57.593 68.875  1.00 70.78  ? 238  PHE B N   1 
ATOM   2908 C CA  . PHE B 2 136 ? 25.151 57.770 69.684  1.00 68.33  ? 238  PHE B CA  1 
ATOM   2909 C C   . PHE B 2 136 ? 24.774 58.228 71.084  1.00 68.60  ? 238  PHE B C   1 
ATOM   2910 O O   . PHE B 2 136 ? 25.286 57.718 72.075  1.00 67.27  ? 238  PHE B O   1 
ATOM   2911 C CB  . PHE B 2 136 ? 26.066 58.808 69.053  1.00 66.49  ? 238  PHE B CB  1 
ATOM   2912 C CG  . PHE B 2 136 ? 27.215 59.195 69.924  1.00 63.88  ? 238  PHE B CG  1 
ATOM   2913 C CD1 . PHE B 2 136 ? 28.220 58.293 70.206  1.00 63.89  ? 238  PHE B CD1 1 
ATOM   2914 C CD2 . PHE B 2 136 ? 27.289 60.460 70.467  1.00 62.88  ? 238  PHE B CD2 1 
ATOM   2915 C CE1 . PHE B 2 136 ? 29.283 58.650 71.015  1.00 63.81  ? 238  PHE B CE1 1 
ATOM   2916 C CE2 . PHE B 2 136 ? 28.348 60.822 71.276  1.00 62.93  ? 238  PHE B CE2 1 
ATOM   2917 C CZ  . PHE B 2 136 ? 29.346 59.919 71.550  1.00 63.22  ? 238  PHE B CZ  1 
ATOM   2918 N N   . LEU B 2 137 ? 23.878 59.207 71.150  1.00 69.64  ? 239  LEU B N   1 
ATOM   2919 C CA  . LEU B 2 137 ? 23.408 59.754 72.418  1.00 70.09  ? 239  LEU B CA  1 
ATOM   2920 C C   . LEU B 2 137 ? 22.539 58.750 73.168  1.00 71.54  ? 239  LEU B C   1 
ATOM   2921 O O   . LEU B 2 137 ? 22.552 58.702 74.396  1.00 70.45  ? 239  LEU B O   1 
ATOM   2922 C CB  . LEU B 2 137 ? 22.608 61.027 72.162  1.00 67.89  ? 239  LEU B CB  1 
ATOM   2923 C CG  . LEU B 2 137 ? 23.369 62.241 71.635  1.00 65.18  ? 239  LEU B CG  1 
ATOM   2924 C CD1 . LEU B 2 137 ? 22.368 63.213 71.059  1.00 63.88  ? 239  LEU B CD1 1 
ATOM   2925 C CD2 . LEU B 2 137 ? 24.196 62.887 72.748  1.00 61.05  ? 239  LEU B CD2 1 
ATOM   2926 N N   . GLU B 2 138 ? 21.763 57.971 72.420  1.00 74.51  ? 240  GLU B N   1 
ATOM   2927 C CA  . GLU B 2 138 ? 20.907 56.949 73.007  1.00 77.58  ? 240  GLU B CA  1 
ATOM   2928 C C   . GLU B 2 138 ? 21.805 55.915 73.666  1.00 77.57  ? 240  GLU B C   1 
ATOM   2929 O O   . GLU B 2 138 ? 21.655 55.589 74.851  1.00 77.02  ? 240  GLU B O   1 
ATOM   2930 C CB  . GLU B 2 138 ? 20.060 56.283 71.924  1.00 80.03  ? 240  GLU B CB  1 
ATOM   2931 C CG  . GLU B 2 138 ? 18.685 56.905 71.766  1.00 85.81  ? 240  GLU B CG  1 
ATOM   2932 C CD  . GLU B 2 138 ? 17.827 56.164 70.759  1.00 89.78  ? 240  GLU B CD  1 
ATOM   2933 O OE1 . GLU B 2 138 ? 17.957 54.919 70.674  1.00 93.05  ? 240  GLU B OE1 1 
ATOM   2934 O OE2 . GLU B 2 138 ? 17.016 56.821 70.066  1.00 91.01  ? 240  GLU B OE2 1 
ATOM   2935 N N   . LEU B 2 139 ? 22.738 55.407 72.869  1.00 78.25  ? 241  LEU B N   1 
ATOM   2936 C CA  . LEU B 2 139 ? 23.720 54.423 73.302  1.00 78.93  ? 241  LEU B CA  1 
ATOM   2937 C C   . LEU B 2 139 ? 24.475 54.962 74.524  1.00 78.18  ? 241  LEU B C   1 
ATOM   2938 O O   . LEU B 2 139 ? 24.429 54.392 75.620  1.00 77.20  ? 241  LEU B O   1 
ATOM   2939 C CB  . LEU B 2 139 ? 24.704 54.166 72.156  1.00 79.48  ? 241  LEU B CB  1 
ATOM   2940 C CG  . LEU B 2 139 ? 25.799 53.136 72.427  1.00 80.71  ? 241  LEU B CG  1 
ATOM   2941 C CD1 . LEU B 2 139 ? 25.158 51.746 72.480  1.00 81.34  ? 241  LEU B CD1 1 
ATOM   2942 C CD2 . LEU B 2 139 ? 26.887 53.213 71.354  1.00 80.05  ? 241  LEU B CD2 1 
ATOM   2943 N N   . LEU B 2 140 ? 25.166 56.072 74.300  1.00 78.23  ? 242  LEU B N   1 
ATOM   2944 C CA  . LEU B 2 140 ? 25.949 56.759 75.315  1.00 78.63  ? 242  LEU B CA  1 
ATOM   2945 C C   . LEU B 2 140 ? 25.201 56.999 76.637  1.00 79.36  ? 242  LEU B C   1 
ATOM   2946 O O   . LEU B 2 140 ? 25.807 56.950 77.710  1.00 77.96  ? 242  LEU B O   1 
ATOM   2947 C CB  . LEU B 2 140 ? 26.445 58.083 74.730  1.00 78.16  ? 242  LEU B CB  1 
ATOM   2948 C CG  . LEU B 2 140 ? 26.371 59.324 75.615  1.00 78.79  ? 242  LEU B CG  1 
ATOM   2949 C CD1 . LEU B 2 140 ? 27.363 59.216 76.757  1.00 79.92  ? 242  LEU B CD1 1 
ATOM   2950 C CD2 . LEU B 2 140 ? 26.659 60.541 74.770  1.00 78.44  ? 242  LEU B CD2 1 
ATOM   2951 N N   . PHE B 2 141 ? 23.895 57.265 76.567  1.00 81.24  ? 243  PHE B N   1 
ATOM   2952 C CA  . PHE B 2 141 ? 23.102 57.504 77.779  1.00 81.71  ? 243  PHE B CA  1 
ATOM   2953 C C   . PHE B 2 141 ? 22.743 56.211 78.497  1.00 80.78  ? 243  PHE B C   1 
ATOM   2954 O O   . PHE B 2 141 ? 22.618 56.184 79.727  1.00 80.83  ? 243  PHE B O   1 
ATOM   2955 C CB  . PHE B 2 141 ? 21.826 58.311 77.469  1.00 82.73  ? 243  PHE B CB  1 
ATOM   2956 C CG  . PHE B 2 141 ? 21.899 59.750 77.933  1.00 83.51  ? 243  PHE B CG  1 
ATOM   2957 C CD1 . PHE B 2 141 ? 22.420 60.739 77.110  1.00 83.11  ? 243  PHE B CD1 1 
ATOM   2958 C CD2 . PHE B 2 141 ? 21.523 60.098 79.228  1.00 83.11  ? 243  PHE B CD2 1 
ATOM   2959 C CE1 . PHE B 2 141 ? 22.568 62.042 77.570  1.00 81.54  ? 243  PHE B CE1 1 
ATOM   2960 C CE2 . PHE B 2 141 ? 21.671 61.402 79.690  1.00 81.60  ? 243  PHE B CE2 1 
ATOM   2961 C CZ  . PHE B 2 141 ? 22.194 62.372 78.861  1.00 81.41  ? 243  PHE B CZ  1 
ATOM   2962 N N   . HIS B 2 142 ? 22.569 55.139 77.734  1.00 79.28  ? 244  HIS B N   1 
ATOM   2963 C CA  . HIS B 2 142 ? 22.273 53.869 78.354  1.00 78.06  ? 244  HIS B CA  1 
ATOM   2964 C C   . HIS B 2 142 ? 23.476 53.521 79.228  1.00 76.22  ? 244  HIS B C   1 
ATOM   2965 O O   . HIS B 2 142 ? 23.335 53.186 80.404  1.00 75.96  ? 244  HIS B O   1 
ATOM   2966 C CB  . HIS B 2 142 ? 22.067 52.784 77.305  1.00 78.63  ? 244  HIS B CB  1 
ATOM   2967 C CG  . HIS B 2 142 ? 21.718 51.457 77.896  1.00 80.96  ? 244  HIS B CG  1 
ATOM   2968 N ND1 . HIS B 2 142 ? 21.401 50.356 77.130  1.00 81.92  ? 244  HIS B ND1 1 
ATOM   2969 C CD2 . HIS B 2 142 ? 21.642 51.053 79.188  1.00 81.75  ? 244  HIS B CD2 1 
ATOM   2970 C CE1 . HIS B 2 142 ? 21.146 49.331 77.926  1.00 83.37  ? 244  HIS B CE1 1 
ATOM   2971 N NE2 . HIS B 2 142 ? 21.286 49.727 79.179  1.00 82.58  ? 244  HIS B NE2 1 
ATOM   2972 N N   . PHE B 2 143 ? 24.659 53.615 78.634  1.00 73.93  ? 245  PHE B N   1 
ATOM   2973 C CA  . PHE B 2 143 ? 25.901 53.328 79.329  1.00 72.25  ? 245  PHE B CA  1 
ATOM   2974 C C   . PHE B 2 143 ? 25.900 53.864 80.748  1.00 70.79  ? 245  PHE B C   1 
ATOM   2975 O O   . PHE B 2 143 ? 26.142 53.136 81.702  1.00 69.71  ? 245  PHE B O   1 
ATOM   2976 C CB  . PHE B 2 143 ? 27.077 53.947 78.569  1.00 72.01  ? 245  PHE B CB  1 
ATOM   2977 C CG  . PHE B 2 143 ? 28.399 53.812 79.277  1.00 71.27  ? 245  PHE B CG  1 
ATOM   2978 C CD1 . PHE B 2 143 ? 29.068 52.599 79.304  1.00 70.39  ? 245  PHE B CD1 1 
ATOM   2979 C CD2 . PHE B 2 143 ? 28.965 54.900 79.926  1.00 69.96  ? 245  PHE B CD2 1 
ATOM   2980 C CE1 . PHE B 2 143 ? 30.268 52.483 79.963  1.00 70.31  ? 245  PHE B CE1 1 
ATOM   2981 C CE2 . PHE B 2 143 ? 30.169 54.790 80.589  1.00 68.83  ? 245  PHE B CE2 1 
ATOM   2982 C CZ  . PHE B 2 143 ? 30.821 53.586 80.609  1.00 69.98  ? 245  PHE B CZ  1 
ATOM   2983 N N   . HIS B 2 144 ? 25.627 55.147 80.893  1.00 70.76  ? 246  HIS B N   1 
ATOM   2984 C CA  . HIS B 2 144 ? 25.639 55.733 82.215  1.00 71.95  ? 246  HIS B CA  1 
ATOM   2985 C C   . HIS B 2 144 ? 24.535 55.215 83.120  1.00 72.02  ? 246  HIS B C   1 
ATOM   2986 O O   . HIS B 2 144 ? 24.741 55.075 84.330  1.00 71.37  ? 246  HIS B O   1 
ATOM   2987 C CB  . HIS B 2 144 ? 25.574 57.246 82.106  1.00 74.60  ? 246  HIS B CB  1 
ATOM   2988 C CG  . HIS B 2 144 ? 26.874 57.872 81.705  1.00 77.84  ? 246  HIS B CG  1 
ATOM   2989 N ND1 . HIS B 2 144 ? 27.406 57.752 80.437  1.00 79.41  ? 246  HIS B ND1 1 
ATOM   2990 C CD2 . HIS B 2 144 ? 27.765 58.602 82.418  1.00 78.66  ? 246  HIS B CD2 1 
ATOM   2991 C CE1 . HIS B 2 144 ? 28.568 58.380 80.387  1.00 79.77  ? 246  HIS B CE1 1 
ATOM   2992 N NE2 . HIS B 2 144 ? 28.810 58.905 81.576  1.00 80.58  ? 246  HIS B NE2 1 
ATOM   2993 N N   . GLY B 2 145 ? 23.360 54.953 82.549  1.00 71.62  ? 247  GLY B N   1 
ATOM   2994 C CA  . GLY B 2 145 ? 22.282 54.422 83.359  1.00 70.83  ? 247  GLY B CA  1 
ATOM   2995 C C   . GLY B 2 145 ? 22.900 53.213 84.025  1.00 71.02  ? 247  GLY B C   1 
ATOM   2996 O O   . GLY B 2 145 ? 23.053 53.154 85.247  1.00 70.88  ? 247  GLY B O   1 
ATOM   2997 N N   . THR B 2 146 ? 23.295 52.271 83.174  1.00 70.41  ? 248  THR B N   1 
ATOM   2998 C CA  . THR B 2 146 ? 23.936 51.021 83.550  1.00 69.59  ? 248  THR B CA  1 
ATOM   2999 C C   . THR B 2 146 ? 25.051 51.187 84.593  1.00 70.92  ? 248  THR B C   1 
ATOM   3000 O O   . THR B 2 146 ? 25.018 50.588 85.664  1.00 70.96  ? 248  THR B O   1 
ATOM   3001 C CB  . THR B 2 146 ? 24.512 50.353 82.278  1.00 68.67  ? 248  THR B CB  1 
ATOM   3002 O OG1 . THR B 2 146 ? 23.436 49.888 81.454  1.00 67.00  ? 248  THR B OG1 1 
ATOM   3003 C CG2 . THR B 2 146 ? 25.420 49.202 82.628  1.00 68.72  ? 248  THR B CG2 1 
ATOM   3004 N N   . LEU B 2 147 ? 26.036 52.010 84.274  1.00 72.64  ? 249  LEU B N   1 
ATOM   3005 C CA  . LEU B 2 147 ? 27.165 52.238 85.158  1.00 74.74  ? 249  LEU B CA  1 
ATOM   3006 C C   . LEU B 2 147 ? 26.838 52.857 86.508  1.00 75.99  ? 249  LEU B C   1 
ATOM   3007 O O   . LEU B 2 147 ? 27.362 52.427 87.532  1.00 75.97  ? 249  LEU B O   1 
ATOM   3008 C CB  . LEU B 2 147 ? 28.187 53.112 84.445  1.00 77.17  ? 249  LEU B CB  1 
ATOM   3009 C CG  . LEU B 2 147 ? 29.193 53.837 85.342  1.00 80.15  ? 249  LEU B CG  1 
ATOM   3010 C CD1 . LEU B 2 147 ? 29.981 52.827 86.157  1.00 81.28  ? 249  LEU B CD1 1 
ATOM   3011 C CD2 . LEU B 2 147 ? 30.126 54.688 84.477  1.00 81.38  ? 249  LEU B CD2 1 
ATOM   3012 N N   . ARG B 2 148 ? 25.993 53.880 86.513  1.00 77.62  ? 250  ARG B N   1 
ATOM   3013 C CA  . ARG B 2 148 ? 25.631 54.552 87.759  1.00 79.63  ? 250  ARG B CA  1 
ATOM   3014 C C   . ARG B 2 148 ? 24.866 53.606 88.690  1.00 80.54  ? 250  ARG B C   1 
ATOM   3015 O O   . ARG B 2 148 ? 25.035 53.656 89.914  1.00 78.67  ? 250  ARG B O   1 
ATOM   3016 C CB  . ARG B 2 148 ? 24.775 55.794 87.455  1.00 80.16  ? 250  ARG B CB  1 
ATOM   3017 C CG  . ARG B 2 148 ? 25.050 57.033 88.336  1.00 79.76  ? 250  ARG B CG  1 
ATOM   3018 C CD  . ARG B 2 148 ? 24.720 56.806 89.807  1.00 80.35  ? 250  ARG B CD  1 
ATOM   3019 N NE  . ARG B 2 148 ? 24.739 58.041 90.592  1.00 80.46  ? 250  ARG B NE  1 
ATOM   3020 C CZ  . ARG B 2 148 ? 25.833 58.737 90.896  1.00 81.65  ? 250  ARG B CZ  1 
ATOM   3021 N NH1 . ARG B 2 148 ? 27.028 58.332 90.486  1.00 81.16  ? 250  ARG B NH1 1 
ATOM   3022 N NH2 . ARG B 2 148 ? 25.731 59.846 91.623  1.00 83.72  ? 250  ARG B NH2 1 
ATOM   3023 N N   . LYS B 2 149 ? 24.037 52.747 88.088  1.00 82.82  ? 251  LYS B N   1 
ATOM   3024 C CA  . LYS B 2 149 ? 23.210 51.771 88.807  1.00 84.58  ? 251  LYS B CA  1 
ATOM   3025 C C   . LYS B 2 149 ? 24.004 50.789 89.659  1.00 86.05  ? 251  LYS B C   1 
ATOM   3026 O O   . LYS B 2 149 ? 23.522 50.333 90.694  1.00 86.53  ? 251  LYS B O   1 
ATOM   3027 C CB  . LYS B 2 149 ? 22.329 50.991 87.821  1.00 84.04  ? 251  LYS B CB  1 
ATOM   3028 C CG  . LYS B 2 149 ? 21.297 51.852 87.103  1.00 84.84  ? 251  LYS B CG  1 
ATOM   3029 C CD  . LYS B 2 149 ? 20.520 51.052 86.071  1.00 86.41  ? 251  LYS B CD  1 
ATOM   3030 C CE  . LYS B 2 149 ? 19.586 51.945 85.253  1.00 87.55  ? 251  LYS B CE  1 
ATOM   3031 N NZ  . LYS B 2 149 ? 18.888 51.204 84.148  1.00 87.99  ? 251  LYS B NZ  1 
ATOM   3032 N N   . LEU B 2 150 ? 25.216 50.461 89.228  1.00 88.00  ? 252  LEU B N   1 
ATOM   3033 C CA  . LEU B 2 150 ? 26.060 49.542 89.977  1.00 89.71  ? 252  LEU B CA  1 
ATOM   3034 C C   . LEU B 2 150 ? 26.452 50.090 91.347  1.00 90.42  ? 252  LEU B C   1 
ATOM   3035 O O   . LEU B 2 150 ? 26.779 49.325 92.254  1.00 90.37  ? 252  LEU B O   1 
ATOM   3036 C CB  . LEU B 2 150 ? 27.312 49.226 89.174  1.00 90.43  ? 252  LEU B CB  1 
ATOM   3037 C CG  . LEU B 2 150 ? 27.011 48.538 87.847  1.00 91.51  ? 252  LEU B CG  1 
ATOM   3038 C CD1 . LEU B 2 150 ? 28.327 48.153 87.200  1.00 92.84  ? 252  LEU B CD1 1 
ATOM   3039 C CD2 . LEU B 2 150 ? 26.136 47.306 88.078  1.00 91.87  ? 252  LEU B CD2 1 
ATOM   3040 N N   . GLN B 2 151 ? 26.420 51.412 91.488  1.00 91.67  ? 253  GLN B N   1 
ATOM   3041 C CA  . GLN B 2 151 ? 26.756 52.056 92.747  1.00 92.77  ? 253  GLN B CA  1 
ATOM   3042 C C   . GLN B 2 151 ? 28.185 51.683 93.072  1.00 93.68  ? 253  GLN B C   1 
ATOM   3043 O O   . GLN B 2 151 ? 28.438 50.689 93.755  1.00 93.66  ? 253  GLN B O   1 
ATOM   3044 C CB  . GLN B 2 151 ? 25.833 51.549 93.854  1.00 93.64  ? 253  GLN B CB  1 
ATOM   3045 C CG  . GLN B 2 151 ? 24.347 51.620 93.525  1.00 95.11  ? 253  GLN B CG  1 
ATOM   3046 C CD  . GLN B 2 151 ? 23.530 50.610 94.316  1.00 95.59  ? 253  GLN B CD  1 
ATOM   3047 O OE1 . GLN B 2 151 ? 23.567 50.590 95.548  1.00 96.73  ? 253  GLN B OE1 1 
ATOM   3048 N NE2 . GLN B 2 151 ? 22.790 49.763 93.608  1.00 95.01  ? 253  GLN B NE2 1 
ATOM   3049 N N   . LEU B 2 152 ? 29.126 52.479 92.587  1.00 95.59  ? 254  LEU B N   1 
ATOM   3050 C CA  . LEU B 2 152 ? 30.528 52.179 92.831  1.00 97.95  ? 254  LEU B CA  1 
ATOM   3051 C C   . LEU B 2 152 ? 31.228 53.225 93.698  1.00 98.83  ? 254  LEU B C   1 
ATOM   3052 O O   . LEU B 2 152 ? 31.464 54.347 93.264  1.00 99.25  ? 254  LEU B O   1 
ATOM   3053 C CB  . LEU B 2 152 ? 31.275 52.029 91.499  1.00 98.76  ? 254  LEU B CB  1 
ATOM   3054 C CG  . LEU B 2 152 ? 30.656 51.248 90.328  1.00 99.33  ? 254  LEU B CG  1 
ATOM   3055 C CD1 . LEU B 2 152 ? 31.790 50.829 89.399  1.00 98.98  ? 254  LEU B CD1 1 
ATOM   3056 C CD2 . LEU B 2 152 ? 29.901 50.012 90.798  1.00 100.08 ? 254  LEU B CD2 1 
ATOM   3057 N N   . GLN B 2 153 ? 31.558 52.848 94.927  1.00 100.92 ? 255  GLN B N   1 
ATOM   3058 C CA  . GLN B 2 153 ? 32.238 53.743 95.857  1.00 103.67 ? 255  GLN B CA  1 
ATOM   3059 C C   . GLN B 2 153 ? 33.349 54.470 95.098  1.00 104.00 ? 255  GLN B C   1 
ATOM   3060 O O   . GLN B 2 153 ? 33.824 53.956 94.091  1.00 103.33 ? 255  GLN B O   1 
ATOM   3061 C CB  . GLN B 2 153 ? 32.799 52.917 97.018  1.00 105.70 ? 255  GLN B CB  1 
ATOM   3062 C CG  . GLN B 2 153 ? 31.755 51.966 97.620  1.00 109.93 ? 255  GLN B CG  1 
ATOM   3063 C CD  . GLN B 2 153 ? 32.297 51.091 98.741  1.00 112.46 ? 255  GLN B CD  1 
ATOM   3064 O OE1 . GLN B 2 153 ? 31.603 50.188 99.238  1.00 115.30 ? 255  GLN B OE1 1 
ATOM   3065 N NE2 . GLN B 2 153 ? 33.534 51.354 99.152  1.00 113.48 ? 255  GLN B NE2 1 
ATOM   3066 N N   . GLU B 2 154 ? 33.750 55.660 95.555  1.00 105.83 ? 256  GLU B N   1 
ATOM   3067 C CA  . GLU B 2 154 ? 34.802 56.419 94.860  1.00 107.52 ? 256  GLU B CA  1 
ATOM   3068 C C   . GLU B 2 154 ? 35.981 55.537 94.447  1.00 108.22 ? 256  GLU B C   1 
ATOM   3069 O O   . GLU B 2 154 ? 36.307 55.456 93.262  1.00 108.37 ? 256  GLU B O   1 
ATOM   3070 C CB  . GLU B 2 154 ? 35.324 57.607 95.696  1.00 108.08 ? 256  GLU B CB  1 
ATOM   3071 C CG  . GLU B 2 154 ? 36.442 58.399 94.975  1.00 109.81 ? 256  GLU B CG  1 
ATOM   3072 C CD  . GLU B 2 154 ? 37.023 59.562 95.786  1.00 111.28 ? 256  GLU B CD  1 
ATOM   3073 O OE1 . GLU B 2 154 ? 37.351 59.365 96.978  1.00 111.46 ? 256  GLU B OE1 1 
ATOM   3074 O OE2 . GLU B 2 154 ? 37.171 60.673 95.223  1.00 111.59 ? 256  GLU B OE2 1 
ATOM   3075 N N   . PRO B 2 155 ? 36.645 54.870 95.412  1.00 108.75 ? 257  PRO B N   1 
ATOM   3076 C CA  . PRO B 2 155 ? 37.772 54.020 95.003  1.00 108.41 ? 257  PRO B CA  1 
ATOM   3077 C C   . PRO B 2 155 ? 37.383 53.023 93.899  1.00 107.44 ? 257  PRO B C   1 
ATOM   3078 O O   . PRO B 2 155 ? 38.141 52.796 92.954  1.00 106.57 ? 257  PRO B O   1 
ATOM   3079 C CB  . PRO B 2 155 ? 38.194 53.342 96.315  1.00 108.75 ? 257  PRO B CB  1 
ATOM   3080 C CG  . PRO B 2 155 ? 36.950 53.411 97.177  1.00 108.92 ? 257  PRO B CG  1 
ATOM   3081 C CD  . PRO B 2 155 ? 36.422 54.782 96.866  1.00 108.52 ? 257  PRO B CD  1 
ATOM   3082 N N   . GLU B 2 156 ? 36.193 52.442 94.019  1.00 106.66 ? 258  GLU B N   1 
ATOM   3083 C CA  . GLU B 2 156 ? 35.700 51.505 93.021  1.00 105.51 ? 258  GLU B CA  1 
ATOM   3084 C C   . GLU B 2 156 ? 35.643 52.185 91.649  1.00 104.41 ? 258  GLU B C   1 
ATOM   3085 O O   . GLU B 2 156 ? 35.684 51.521 90.615  1.00 104.30 ? 258  GLU B O   1 
ATOM   3086 C CB  . GLU B 2 156 ? 34.309 50.989 93.419  1.00 106.39 ? 258  GLU B CB  1 
ATOM   3087 C CG  . GLU B 2 156 ? 34.286 50.154 94.703  1.00 107.19 ? 258  GLU B CG  1 
ATOM   3088 C CD  . GLU B 2 156 ? 32.962 49.412 94.913  1.00 108.53 ? 258  GLU B CD  1 
ATOM   3089 O OE1 . GLU B 2 156 ? 31.932 50.066 95.189  1.00 109.92 ? 258  GLU B OE1 1 
ATOM   3090 O OE2 . GLU B 2 156 ? 32.949 48.168 94.795  1.00 108.59 ? 258  GLU B OE2 1 
ATOM   3091 N N   . TYR B 2 157 ? 35.543 53.512 91.650  1.00 103.01 ? 259  TYR B N   1 
ATOM   3092 C CA  . TYR B 2 157 ? 35.507 54.297 90.422  1.00 102.64 ? 259  TYR B CA  1 
ATOM   3093 C C   . TYR B 2 157 ? 36.918 54.561 89.865  1.00 102.75 ? 259  TYR B C   1 
ATOM   3094 O O   . TYR B 2 157 ? 37.177 54.327 88.676  1.00 103.13 ? 259  TYR B O   1 
ATOM   3095 C CB  . TYR B 2 157 ? 34.802 55.647 90.656  1.00 101.91 ? 259  TYR B CB  1 
ATOM   3096 C CG  . TYR B 2 157 ? 33.342 55.686 90.239  1.00 101.91 ? 259  TYR B CG  1 
ATOM   3097 C CD1 . TYR B 2 157 ? 32.910 55.021 89.098  1.00 102.64 ? 259  TYR B CD1 1 
ATOM   3098 C CD2 . TYR B 2 157 ? 32.396 56.395 90.979  1.00 101.82 ? 259  TYR B CD2 1 
ATOM   3099 C CE1 . TYR B 2 157 ? 31.575 55.052 88.704  1.00 102.31 ? 259  TYR B CE1 1 
ATOM   3100 C CE2 . TYR B 2 157 ? 31.054 56.433 90.590  1.00 101.47 ? 259  TYR B CE2 1 
ATOM   3101 C CZ  . TYR B 2 157 ? 30.653 55.754 89.451  1.00 101.47 ? 259  TYR B CZ  1 
ATOM   3102 O OH  . TYR B 2 157 ? 29.333 55.744 89.058  1.00 100.66 ? 259  TYR B OH  1 
ATOM   3103 N N   . VAL B 2 158 ? 37.825 55.041 90.720  1.00 101.45 ? 260  VAL B N   1 
ATOM   3104 C CA  . VAL B 2 158 ? 39.193 55.358 90.295  1.00 99.65  ? 260  VAL B CA  1 
ATOM   3105 C C   . VAL B 2 158 ? 39.909 54.179 89.637  1.00 99.33  ? 260  VAL B C   1 
ATOM   3106 O O   . VAL B 2 158 ? 40.512 54.331 88.572  1.00 100.74 ? 260  VAL B O   1 
ATOM   3107 C CB  . VAL B 2 158 ? 40.070 55.862 91.474  1.00 98.86  ? 260  VAL B CB  1 
ATOM   3108 C CG1 . VAL B 2 158 ? 41.369 56.450 90.937  1.00 98.07  ? 260  VAL B CG1 1 
ATOM   3109 C CG2 . VAL B 2 158 ? 39.324 56.902 92.279  1.00 98.41  ? 260  VAL B CG2 1 
ATOM   3110 N N   . LEU B 2 159 ? 39.852 53.011 90.271  1.00 97.35  ? 261  LEU B N   1 
ATOM   3111 C CA  . LEU B 2 159 ? 40.495 51.820 89.724  1.00 95.14  ? 261  LEU B CA  1 
ATOM   3112 C C   . LEU B 2 159 ? 40.078 51.586 88.276  1.00 93.23  ? 261  LEU B C   1 
ATOM   3113 O O   . LEU B 2 159 ? 40.922 51.428 87.392  1.00 93.01  ? 261  LEU B O   1 
ATOM   3114 C CB  . LEU B 2 159 ? 40.138 50.588 90.557  1.00 95.58  ? 261  LEU B CB  1 
ATOM   3115 C CG  . LEU B 2 159 ? 40.812 50.471 91.917  1.00 95.43  ? 261  LEU B CG  1 
ATOM   3116 C CD1 . LEU B 2 159 ? 40.491 49.125 92.512  1.00 95.92  ? 261  LEU B CD1 1 
ATOM   3117 C CD2 . LEU B 2 159 ? 42.313 50.628 91.762  1.00 95.73  ? 261  LEU B CD2 1 
ATOM   3118 N N   . LEU B 2 160 ? 38.768 51.557 88.049  1.00 90.53  ? 262  LEU B N   1 
ATOM   3119 C CA  . LEU B 2 160 ? 38.211 51.351 86.721  1.00 88.10  ? 262  LEU B CA  1 
ATOM   3120 C C   . LEU B 2 160 ? 38.883 52.303 85.735  1.00 86.69  ? 262  LEU B C   1 
ATOM   3121 O O   . LEU B 2 160 ? 39.261 51.902 84.629  1.00 86.28  ? 262  LEU B O   1 
ATOM   3122 C CB  . LEU B 2 160 ? 36.709 51.599 86.766  1.00 87.77  ? 262  LEU B CB  1 
ATOM   3123 C CG  . LEU B 2 160 ? 35.899 51.261 85.522  1.00 87.23  ? 262  LEU B CG  1 
ATOM   3124 C CD1 . LEU B 2 160 ? 36.138 49.820 85.082  1.00 87.47  ? 262  LEU B CD1 1 
ATOM   3125 C CD2 . LEU B 2 160 ? 34.441 51.488 85.857  1.00 87.63  ? 262  LEU B CD2 1 
ATOM   3126 N N   . ALA B 2 161 ? 39.022 53.565 86.146  1.00 84.28  ? 263  ALA B N   1 
ATOM   3127 C CA  . ALA B 2 161 ? 39.679 54.578 85.332  1.00 82.13  ? 263  ALA B CA  1 
ATOM   3128 C C   . ALA B 2 161 ? 41.046 54.022 84.938  1.00 81.01  ? 263  ALA B C   1 
ATOM   3129 O O   . ALA B 2 161 ? 41.364 53.892 83.753  1.00 80.86  ? 263  ALA B O   1 
ATOM   3130 C CB  . ALA B 2 161 ? 39.845 55.855 86.133  1.00 80.31  ? 263  ALA B CB  1 
ATOM   3131 N N   . ALA B 2 162 ? 41.841 53.687 85.949  1.00 79.25  ? 264  ALA B N   1 
ATOM   3132 C CA  . ALA B 2 162 ? 43.164 53.118 85.744  1.00 78.64  ? 264  ALA B CA  1 
ATOM   3133 C C   . ALA B 2 162 ? 43.134 51.984 84.719  1.00 78.97  ? 264  ALA B C   1 
ATOM   3134 O O   . ALA B 2 162 ? 43.972 51.941 83.821  1.00 79.59  ? 264  ALA B O   1 
ATOM   3135 C CB  . ALA B 2 162 ? 43.708 52.605 87.059  1.00 77.25  ? 264  ALA B CB  1 
ATOM   3136 N N   . MET B 2 163 ? 42.174 51.069 84.856  1.00 78.40  ? 265  MET B N   1 
ATOM   3137 C CA  . MET B 2 163 ? 42.051 49.941 83.938  1.00 77.33  ? 265  MET B CA  1 
ATOM   3138 C C   . MET B 2 163 ? 41.811 50.349 82.506  1.00 76.58  ? 265  MET B C   1 
ATOM   3139 O O   . MET B 2 163 ? 42.340 49.730 81.587  1.00 76.49  ? 265  MET B O   1 
ATOM   3140 C CB  . MET B 2 163 ? 40.944 48.994 84.383  1.00 78.54  ? 265  MET B CB  1 
ATOM   3141 C CG  . MET B 2 163 ? 41.391 48.057 85.486  1.00 80.48  ? 265  MET B CG  1 
ATOM   3142 S SD  . MET B 2 163 ? 40.250 46.700 85.792  1.00 83.07  ? 265  MET B SD  1 
ATOM   3143 C CE  . MET B 2 163 ? 40.484 45.689 84.288  1.00 82.90  ? 265  MET B CE  1 
ATOM   3144 N N   . ALA B 2 164 ? 40.997 51.377 82.304  1.00 76.35  ? 266  ALA B N   1 
ATOM   3145 C CA  . ALA B 2 164 ? 40.743 51.851 80.952  1.00 75.94  ? 266  ALA B CA  1 
ATOM   3146 C C   . ALA B 2 164 ? 42.099 52.272 80.393  1.00 74.95  ? 266  ALA B C   1 
ATOM   3147 O O   . ALA B 2 164 ? 42.516 51.832 79.315  1.00 74.71  ? 266  ALA B O   1 
ATOM   3148 C CB  . ALA B 2 164 ? 39.786 53.045 80.984  1.00 75.91  ? 266  ALA B CB  1 
ATOM   3149 N N   . LEU B 2 165 ? 42.786 53.106 81.172  1.00 73.44  ? 267  LEU B N   1 
ATOM   3150 C CA  . LEU B 2 165 ? 44.097 53.649 80.825  1.00 73.09  ? 267  LEU B CA  1 
ATOM   3151 C C   . LEU B 2 165 ? 45.119 52.606 80.401  1.00 73.26  ? 267  LEU B C   1 
ATOM   3152 O O   . LEU B 2 165 ? 45.475 52.502 79.222  1.00 74.04  ? 267  LEU B O   1 
ATOM   3153 C CB  . LEU B 2 165 ? 44.661 54.442 82.009  1.00 69.98  ? 267  LEU B CB  1 
ATOM   3154 C CG  . LEU B 2 165 ? 45.983 55.162 81.746  1.00 68.16  ? 267  LEU B CG  1 
ATOM   3155 C CD1 . LEU B 2 165 ? 45.823 56.165 80.615  1.00 67.55  ? 267  LEU B CD1 1 
ATOM   3156 C CD2 . LEU B 2 165 ? 46.422 55.863 83.006  1.00 67.80  ? 267  LEU B CD2 1 
ATOM   3157 N N   . PHE B 2 166 ? 45.584 51.845 81.383  1.00 73.40  ? 268  PHE B N   1 
ATOM   3158 C CA  . PHE B 2 166 ? 46.580 50.813 81.176  1.00 72.87  ? 268  PHE B CA  1 
ATOM   3159 C C   . PHE B 2 166 ? 46.089 49.606 80.412  1.00 72.42  ? 268  PHE B C   1 
ATOM   3160 O O   . PHE B 2 166 ? 45.906 48.529 80.976  1.00 72.19  ? 268  PHE B O   1 
ATOM   3161 C CB  . PHE B 2 166 ? 47.149 50.372 82.520  1.00 73.34  ? 268  PHE B CB  1 
ATOM   3162 C CG  . PHE B 2 166 ? 47.984 51.423 83.185  1.00 74.82  ? 268  PHE B CG  1 
ATOM   3163 C CD1 . PHE B 2 166 ? 47.702 51.845 84.476  1.00 74.88  ? 268  PHE B CD1 1 
ATOM   3164 C CD2 . PHE B 2 166 ? 49.051 52.000 82.513  1.00 75.41  ? 268  PHE B CD2 1 
ATOM   3165 C CE1 . PHE B 2 166 ? 48.474 52.827 85.085  1.00 75.47  ? 268  PHE B CE1 1 
ATOM   3166 C CE2 . PHE B 2 166 ? 49.827 52.981 83.116  1.00 76.07  ? 268  PHE B CE2 1 
ATOM   3167 C CZ  . PHE B 2 166 ? 49.539 53.396 84.404  1.00 75.37  ? 268  PHE B CZ  1 
ATOM   3168 N N   . SER B 2 167 ? 45.869 49.806 79.122  1.00 72.37  ? 269  SER B N   1 
ATOM   3169 C CA  . SER B 2 167 ? 45.447 48.742 78.237  1.00 72.77  ? 269  SER B CA  1 
ATOM   3170 C C   . SER B 2 167 ? 46.604 48.584 77.259  1.00 73.80  ? 269  SER B C   1 
ATOM   3171 O O   . SER B 2 167 ? 46.935 49.509 76.505  1.00 73.99  ? 269  SER B O   1 
ATOM   3172 C CB  . SER B 2 167 ? 44.165 49.121 77.493  1.00 71.64  ? 269  SER B CB  1 
ATOM   3173 O OG  . SER B 2 167 ? 43.059 49.145 78.373  1.00 69.58  ? 269  SER B OG  1 
ATOM   3174 N N   . PRO B 2 168 ? 47.263 47.416 77.290  1.00 73.86  ? 270  PRO B N   1 
ATOM   3175 C CA  . PRO B 2 168 ? 48.398 47.102 76.416  1.00 73.92  ? 270  PRO B CA  1 
ATOM   3176 C C   . PRO B 2 168 ? 48.026 46.972 74.922  1.00 73.85  ? 270  PRO B C   1 
ATOM   3177 O O   . PRO B 2 168 ? 48.826 47.288 74.025  1.00 72.98  ? 270  PRO B O   1 
ATOM   3178 C CB  . PRO B 2 168 ? 48.921 45.795 77.018  1.00 74.25  ? 270  PRO B CB  1 
ATOM   3179 C CG  . PRO B 2 168 ? 47.674 45.158 77.575  1.00 72.60  ? 270  PRO B CG  1 
ATOM   3180 C CD  . PRO B 2 168 ? 47.029 46.328 78.255  1.00 72.68  ? 270  PRO B CD  1 
ATOM   3181 N N   . ASP B 2 169 ? 46.802 46.521 74.666  1.00 72.29  ? 271  ASP B N   1 
ATOM   3182 C CA  . ASP B 2 169 ? 46.326 46.329 73.311  1.00 70.62  ? 271  ASP B CA  1 
ATOM   3183 C C   . ASP B 2 169 ? 46.190 47.587 72.476  1.00 70.82  ? 271  ASP B C   1 
ATOM   3184 O O   . ASP B 2 169 ? 46.048 47.498 71.262  1.00 71.31  ? 271  ASP B O   1 
ATOM   3185 C CB  . ASP B 2 169 ? 45.011 45.557 73.332  1.00 68.89  ? 271  ASP B CB  1 
ATOM   3186 C CG  . ASP B 2 169 ? 43.990 46.166 74.251  1.00 67.73  ? 271  ASP B CG  1 
ATOM   3187 O OD1 . ASP B 2 169 ? 44.368 46.844 75.225  1.00 66.02  ? 271  ASP B OD1 1 
ATOM   3188 O OD2 . ASP B 2 169 ? 42.792 45.942 74.002  1.00 68.59  ? 271  ASP B OD2 1 
ATOM   3189 N N   . ARG B 2 170 ? 46.241 48.755 73.110  1.00 71.99  ? 272  ARG B N   1 
ATOM   3190 C CA  . ARG B 2 170 ? 46.145 50.034 72.391  1.00 73.39  ? 272  ARG B CA  1 
ATOM   3191 C C   . ARG B 2 170 ? 47.172 50.105 71.244  1.00 74.82  ? 272  ARG B C   1 
ATOM   3192 O O   . ARG B 2 170 ? 48.300 49.617 71.386  1.00 75.57  ? 272  ARG B O   1 
ATOM   3193 C CB  . ARG B 2 170 ? 46.447 51.201 73.340  1.00 71.83  ? 272  ARG B CB  1 
ATOM   3194 C CG  . ARG B 2 170 ? 45.697 51.212 74.645  1.00 70.22  ? 272  ARG B CG  1 
ATOM   3195 C CD  . ARG B 2 170 ? 44.219 51.372 74.432  1.00 68.26  ? 272  ARG B CD  1 
ATOM   3196 N NE  . ARG B 2 170 ? 43.589 51.914 75.626  1.00 68.32  ? 272  ARG B NE  1 
ATOM   3197 C CZ  . ARG B 2 170 ? 42.279 52.022 75.783  1.00 68.74  ? 272  ARG B CZ  1 
ATOM   3198 N NH1 . ARG B 2 170 ? 41.781 52.532 76.899  1.00 68.11  ? 272  ARG B NH1 1 
ATOM   3199 N NH2 . ARG B 2 170 ? 41.466 51.607 74.822  1.00 69.94  ? 272  ARG B NH2 1 
ATOM   3200 N N   . PRO B 2 171 ? 46.801 50.699 70.091  1.00 75.29  ? 273  PRO B N   1 
ATOM   3201 C CA  . PRO B 2 171 ? 47.813 50.758 69.034  1.00 77.01  ? 273  PRO B CA  1 
ATOM   3202 C C   . PRO B 2 171 ? 48.886 51.799 69.397  1.00 79.67  ? 273  PRO B C   1 
ATOM   3203 O O   . PRO B 2 171 ? 48.586 52.842 69.997  1.00 79.07  ? 273  PRO B O   1 
ATOM   3204 C CB  . PRO B 2 171 ? 47.001 51.135 67.793  1.00 74.53  ? 273  PRO B CB  1 
ATOM   3205 C CG  . PRO B 2 171 ? 45.881 51.919 68.349  1.00 74.00  ? 273  PRO B CG  1 
ATOM   3206 C CD  . PRO B 2 171 ? 45.490 51.118 69.571  1.00 74.80  ? 273  PRO B CD  1 
ATOM   3207 N N   . GLY B 2 172 ? 50.137 51.495 69.056  1.00 81.89  ? 274  GLY B N   1 
ATOM   3208 C CA  . GLY B 2 172 ? 51.229 52.405 69.357  1.00 84.07  ? 274  GLY B CA  1 
ATOM   3209 C C   . GLY B 2 172 ? 52.043 52.046 70.591  1.00 85.81  ? 274  GLY B C   1 
ATOM   3210 O O   . GLY B 2 172 ? 53.167 52.537 70.753  1.00 85.69  ? 274  GLY B O   1 
ATOM   3211 N N   . VAL B 2 173 ? 51.476 51.209 71.465  1.00 87.16  ? 275  VAL B N   1 
ATOM   3212 C CA  . VAL B 2 173 ? 52.155 50.767 72.688  1.00 87.79  ? 275  VAL B CA  1 
ATOM   3213 C C   . VAL B 2 173 ? 53.447 50.044 72.316  1.00 88.80  ? 275  VAL B C   1 
ATOM   3214 O O   . VAL B 2 173 ? 53.454 49.218 71.399  1.00 88.26  ? 275  VAL B O   1 
ATOM   3215 C CB  . VAL B 2 173 ? 51.269 49.795 73.524  1.00 87.03  ? 275  VAL B CB  1 
ATOM   3216 C CG1 . VAL B 2 173 ? 50.041 50.522 74.046  1.00 86.99  ? 275  VAL B CG1 1 
ATOM   3217 C CG2 . VAL B 2 173 ? 50.854 48.597 72.679  1.00 86.07  ? 275  VAL B CG2 1 
ATOM   3218 N N   . THR B 2 174 ? 54.533 50.358 73.024  1.00 90.29  ? 276  THR B N   1 
ATOM   3219 C CA  . THR B 2 174 ? 55.840 49.741 72.760  1.00 90.88  ? 276  THR B CA  1 
ATOM   3220 C C   . THR B 2 174 ? 56.354 48.798 73.877  1.00 91.26  ? 276  THR B C   1 
ATOM   3221 O O   . THR B 2 174 ? 57.080 47.837 73.610  1.00 90.69  ? 276  THR B O   1 
ATOM   3222 C CB  . THR B 2 174 ? 56.913 50.837 72.427  1.00 90.01  ? 276  THR B CB  1 
ATOM   3223 O OG1 . THR B 2 174 ? 56.939 51.833 73.458  1.00 89.39  ? 276  THR B OG1 1 
ATOM   3224 C CG2 . THR B 2 174 ? 56.594 51.507 71.084  1.00 87.75  ? 276  THR B CG2 1 
ATOM   3225 N N   . GLN B 2 175 ? 55.973 49.063 75.121  1.00 92.32  ? 277  GLN B N   1 
ATOM   3226 C CA  . GLN B 2 175 ? 56.386 48.211 76.231  1.00 93.34  ? 277  GLN B CA  1 
ATOM   3227 C C   . GLN B 2 175 ? 55.151 47.411 76.603  1.00 92.36  ? 277  GLN B C   1 
ATOM   3228 O O   . GLN B 2 175 ? 54.734 47.419 77.765  1.00 92.30  ? 277  GLN B O   1 
ATOM   3229 C CB  . GLN B 2 175 ? 56.815 49.047 77.448  1.00 95.69  ? 277  GLN B CB  1 
ATOM   3230 C CG  . GLN B 2 175 ? 57.413 50.427 77.133  1.00 100.27 ? 277  GLN B CG  1 
ATOM   3231 C CD  . GLN B 2 175 ? 58.777 50.371 76.448  1.00 102.42 ? 277  GLN B CD  1 
ATOM   3232 O OE1 . GLN B 2 175 ? 59.724 49.786 76.973  1.00 104.46 ? 277  GLN B OE1 1 
ATOM   3233 N NE2 . GLN B 2 175 ? 58.883 50.995 75.277  1.00 102.41 ? 277  GLN B NE2 1 
ATOM   3234 N N   . ARG B 2 176 ? 54.556 46.721 75.631  1.00 90.86  ? 278  ARG B N   1 
ATOM   3235 C CA  . ARG B 2 176 ? 53.353 45.965 75.933  1.00 90.49  ? 278  ARG B CA  1 
ATOM   3236 C C   . ARG B 2 176 ? 53.548 44.976 77.074  1.00 91.17  ? 278  ARG B C   1 
ATOM   3237 O O   . ARG B 2 176 ? 52.574 44.496 77.642  1.00 91.43  ? 278  ARG B O   1 
ATOM   3238 C CB  . ARG B 2 176 ? 52.813 45.220 74.713  1.00 88.98  ? 278  ARG B CB  1 
ATOM   3239 C CG  . ARG B 2 176 ? 51.375 44.808 74.957  1.00 88.48  ? 278  ARG B CG  1 
ATOM   3240 C CD  . ARG B 2 176 ? 50.879 43.635 74.138  1.00 89.81  ? 278  ARG B CD  1 
ATOM   3241 N NE  . ARG B 2 176 ? 49.614 43.149 74.698  1.00 91.97  ? 278  ARG B NE  1 
ATOM   3242 C CZ  . ARG B 2 176 ? 49.510 42.277 75.701  1.00 93.79  ? 278  ARG B CZ  1 
ATOM   3243 N NH1 . ARG B 2 176 ? 50.601 41.765 76.266  1.00 94.81  ? 278  ARG B NH1 1 
ATOM   3244 N NH2 . ARG B 2 176 ? 48.309 41.935 76.162  1.00 93.00  ? 278  ARG B NH2 1 
ATOM   3245 N N   . ASP B 2 177 ? 54.800 44.660 77.400  1.00 92.17  ? 279  ASP B N   1 
ATOM   3246 C CA  . ASP B 2 177 ? 55.093 43.752 78.503  1.00 93.03  ? 279  ASP B CA  1 
ATOM   3247 C C   . ASP B 2 177 ? 54.768 44.446 79.816  1.00 92.60  ? 279  ASP B C   1 
ATOM   3248 O O   . ASP B 2 177 ? 54.019 43.925 80.637  1.00 91.60  ? 279  ASP B O   1 
ATOM   3249 C CB  . ASP B 2 177 ? 56.570 43.365 78.509  1.00 95.33  ? 279  ASP B CB  1 
ATOM   3250 C CG  . ASP B 2 177 ? 56.917 42.400 77.409  1.00 97.20  ? 279  ASP B CG  1 
ATOM   3251 O OD1 . ASP B 2 177 ? 58.115 42.072 77.260  1.00 97.42  ? 279  ASP B OD1 1 
ATOM   3252 O OD2 . ASP B 2 177 ? 55.983 41.969 76.699  1.00 99.08  ? 279  ASP B OD2 1 
ATOM   3253 N N   . GLU B 2 178 ? 55.345 45.625 80.010  1.00 92.69  ? 280  GLU B N   1 
ATOM   3254 C CA  . GLU B 2 178 ? 55.111 46.382 81.225  1.00 93.43  ? 280  GLU B CA  1 
ATOM   3255 C C   . GLU B 2 178 ? 53.630 46.703 81.378  1.00 92.55  ? 280  GLU B C   1 
ATOM   3256 O O   . GLU B 2 178 ? 53.037 46.430 82.420  1.00 92.08  ? 280  GLU B O   1 
ATOM   3257 C CB  . GLU B 2 178 ? 55.909 47.678 81.194  1.00 96.08  ? 280  GLU B CB  1 
ATOM   3258 C CG  . GLU B 2 178 ? 55.976 48.388 82.536  1.00 100.85 ? 280  GLU B CG  1 
ATOM   3259 C CD  . GLU B 2 178 ? 56.567 49.789 82.427  1.00 104.81 ? 280  GLU B CD  1 
ATOM   3260 O OE1 . GLU B 2 178 ? 57.184 50.093 81.376  1.00 106.56 ? 280  GLU B OE1 1 
ATOM   3261 O OE2 . GLU B 2 178 ? 56.421 50.582 83.391  1.00 106.22 ? 280  GLU B OE2 1 
ATOM   3262 N N   . ILE B 2 179 ? 53.037 47.280 80.335  1.00 91.76  ? 281  ILE B N   1 
ATOM   3263 C CA  . ILE B 2 179 ? 51.622 47.647 80.359  1.00 90.97  ? 281  ILE B CA  1 
ATOM   3264 C C   . ILE B 2 179 ? 50.697 46.452 80.568  1.00 91.36  ? 281  ILE B C   1 
ATOM   3265 O O   . ILE B 2 179 ? 49.686 46.552 81.256  1.00 91.32  ? 281  ILE B O   1 
ATOM   3266 C CB  . ILE B 2 179 ? 51.212 48.360 79.064  1.00 89.79  ? 281  ILE B CB  1 
ATOM   3267 C CG1 . ILE B 2 179 ? 51.959 49.689 78.949  1.00 89.69  ? 281  ILE B CG1 1 
ATOM   3268 C CG2 . ILE B 2 179 ? 49.720 48.595 79.060  1.00 88.15  ? 281  ILE B CG2 1 
ATOM   3269 C CD1 . ILE B 2 179 ? 51.639 50.469 77.693  1.00 89.60  ? 281  ILE B CD1 1 
ATOM   3270 N N   . ASP B 2 180 ? 51.047 45.324 79.963  1.00 91.68  ? 282  ASP B N   1 
ATOM   3271 C CA  . ASP B 2 180 ? 50.272 44.097 80.089  1.00 91.29  ? 282  ASP B CA  1 
ATOM   3272 C C   . ASP B 2 180 ? 50.213 43.641 81.547  1.00 91.29  ? 282  ASP B C   1 
ATOM   3273 O O   . ASP B 2 180 ? 49.212 43.086 81.996  1.00 89.55  ? 282  ASP B O   1 
ATOM   3274 C CB  . ASP B 2 180 ? 50.913 43.010 79.232  1.00 91.13  ? 282  ASP B CB  1 
ATOM   3275 C CG  . ASP B 2 180 ? 50.316 41.653 79.473  1.00 92.21  ? 282  ASP B CG  1 
ATOM   3276 O OD1 . ASP B 2 180 ? 49.105 41.480 79.208  1.00 92.58  ? 282  ASP B OD1 1 
ATOM   3277 O OD2 . ASP B 2 180 ? 51.065 40.759 79.924  1.00 93.42  ? 282  ASP B OD2 1 
ATOM   3278 N N   . GLN B 2 181 ? 51.303 43.872 82.273  1.00 93.00  ? 283  GLN B N   1 
ATOM   3279 C CA  . GLN B 2 181 ? 51.395 43.497 83.679  1.00 94.67  ? 283  GLN B CA  1 
ATOM   3280 C C   . GLN B 2 181 ? 50.835 44.572 84.583  1.00 94.61  ? 283  GLN B C   1 
ATOM   3281 O O   . GLN B 2 181 ? 50.439 44.294 85.712  1.00 93.69  ? 283  GLN B O   1 
ATOM   3282 C CB  . GLN B 2 181 ? 52.841 43.211 84.071  1.00 96.89  ? 283  GLN B CB  1 
ATOM   3283 C CG  . GLN B 2 181 ? 53.330 41.836 83.667  1.00 98.96  ? 283  GLN B CG  1 
ATOM   3284 C CD  . GLN B 2 181 ? 54.697 41.536 84.241  1.00 100.71 ? 283  GLN B CD  1 
ATOM   3285 O OE1 . GLN B 2 181 ? 54.896 41.581 85.458  1.00 101.37 ? 283  GLN B OE1 1 
ATOM   3286 N NE2 . GLN B 2 181 ? 55.652 41.229 83.368  1.00 102.21 ? 283  GLN B NE2 1 
ATOM   3287 N N   . LEU B 2 182 ? 50.841 45.810 84.101  1.00 95.72  ? 284  LEU B N   1 
ATOM   3288 C CA  . LEU B 2 182 ? 50.267 46.909 84.864  1.00 96.58  ? 284  LEU B CA  1 
ATOM   3289 C C   . LEU B 2 182 ? 48.757 46.682 84.795  1.00 97.76  ? 284  LEU B C   1 
ATOM   3290 O O   . LEU B 2 182 ? 48.035 46.941 85.751  1.00 97.59  ? 284  LEU B O   1 
ATOM   3291 C CB  . LEU B 2 182 ? 50.637 48.254 84.237  1.00 95.29  ? 284  LEU B CB  1 
ATOM   3292 C CG  . LEU B 2 182 ? 52.057 48.729 84.541  1.00 95.17  ? 284  LEU B CG  1 
ATOM   3293 C CD1 . LEU B 2 182 ? 52.379 50.002 83.772  1.00 94.90  ? 284  LEU B CD1 1 
ATOM   3294 C CD2 . LEU B 2 182 ? 52.174 48.960 86.033  1.00 94.46  ? 284  LEU B CD2 1 
ATOM   3295 N N   . GLN B 2 183 ? 48.304 46.179 83.647  1.00 99.29  ? 285  GLN B N   1 
ATOM   3296 C CA  . GLN B 2 183 ? 46.902 45.854 83.391  1.00 100.85 ? 285  GLN B CA  1 
ATOM   3297 C C   . GLN B 2 183 ? 46.523 44.654 84.270  1.00 102.19 ? 285  GLN B C   1 
ATOM   3298 O O   . GLN B 2 183 ? 45.485 44.653 84.940  1.00 102.24 ? 285  GLN B O   1 
ATOM   3299 C CB  . GLN B 2 183 ? 46.742 45.501 81.911  1.00 100.41 ? 285  GLN B CB  1 
ATOM   3300 C CG  . GLN B 2 183 ? 45.411 44.911 81.525  1.00 101.04 ? 285  GLN B CG  1 
ATOM   3301 C CD  . GLN B 2 183 ? 45.511 44.107 80.244  1.00 103.39 ? 285  GLN B CD  1 
ATOM   3302 O OE1 . GLN B 2 183 ? 46.288 43.149 80.162  1.00 104.70 ? 285  GLN B OE1 1 
ATOM   3303 N NE2 . GLN B 2 183 ? 44.729 44.488 79.234  1.00 104.06 ? 285  GLN B NE2 1 
ATOM   3304 N N   . GLU B 2 184 ? 47.381 43.633 84.249  1.00 103.62 ? 286  GLU B N   1 
ATOM   3305 C CA  . GLU B 2 184 ? 47.211 42.416 85.045  1.00 103.74 ? 286  GLU B CA  1 
ATOM   3306 C C   . GLU B 2 184 ? 47.135 42.844 86.515  1.00 102.13 ? 286  GLU B C   1 
ATOM   3307 O O   . GLU B 2 184 ? 46.317 42.346 87.281  1.00 102.02 ? 286  GLU B O   1 
ATOM   3308 C CB  . GLU B 2 184 ? 48.427 41.500 84.827  1.00 106.19 ? 286  GLU B CB  1 
ATOM   3309 C CG  . GLU B 2 184 ? 48.250 40.022 85.183  1.00 108.64 ? 286  GLU B CG  1 
ATOM   3310 C CD  . GLU B 2 184 ? 49.461 39.182 84.765  1.00 109.86 ? 286  GLU B CD  1 
ATOM   3311 O OE1 . GLU B 2 184 ? 50.524 39.312 85.408  1.00 110.19 ? 286  GLU B OE1 1 
ATOM   3312 O OE2 . GLU B 2 184 ? 49.356 38.403 83.786  1.00 110.31 ? 286  GLU B OE2 1 
ATOM   3313 N N   . GLU B 2 185 ? 47.996 43.788 86.879  1.00 100.39 ? 287  GLU B N   1 
ATOM   3314 C CA  . GLU B 2 185 ? 48.087 44.331 88.228  1.00 99.44  ? 287  GLU B CA  1 
ATOM   3315 C C   . GLU B 2 185 ? 46.816 45.038 88.683  1.00 98.27  ? 287  GLU B C   1 
ATOM   3316 O O   . GLU B 2 185 ? 46.241 44.696 89.711  1.00 97.76  ? 287  GLU B O   1 
ATOM   3317 C CB  . GLU B 2 185 ? 49.252 45.314 88.287  1.00 100.81 ? 287  GLU B CB  1 
ATOM   3318 C CG  . GLU B 2 185 ? 49.613 45.791 89.672  1.00 101.57 ? 287  GLU B CG  1 
ATOM   3319 C CD  . GLU B 2 185 ? 50.799 46.729 89.648  1.00 102.23 ? 287  GLU B CD  1 
ATOM   3320 O OE1 . GLU B 2 185 ? 51.654 46.581 88.742  1.00 101.43 ? 287  GLU B OE1 1 
ATOM   3321 O OE2 . GLU B 2 185 ? 50.880 47.599 90.539  1.00 102.69 ? 287  GLU B OE2 1 
ATOM   3322 N N   . MET B 2 186 ? 46.397 46.043 87.923  1.00 97.66  ? 288  MET B N   1 
ATOM   3323 C CA  . MET B 2 186 ? 45.194 46.801 88.248  1.00 96.83  ? 288  MET B CA  1 
ATOM   3324 C C   . MET B 2 186 ? 44.034 45.840 88.382  1.00 95.99  ? 288  MET B C   1 
ATOM   3325 O O   . MET B 2 186 ? 43.414 45.751 89.433  1.00 96.10  ? 288  MET B O   1 
ATOM   3326 C CB  . MET B 2 186 ? 44.854 47.801 87.141  1.00 97.57  ? 288  MET B CB  1 
ATOM   3327 C CG  . MET B 2 186 ? 45.949 48.791 86.783  1.00 97.97  ? 288  MET B CG  1 
ATOM   3328 S SD  . MET B 2 186 ? 46.447 49.832 88.154  1.00 96.08  ? 288  MET B SD  1 
ATOM   3329 C CE  . MET B 2 186 ? 48.038 49.097 88.574  1.00 98.00  ? 288  MET B CE  1 
ATOM   3330 N N   . ALA B 2 187 ? 43.742 45.130 87.297  1.00 95.09  ? 289  ALA B N   1 
ATOM   3331 C CA  . ALA B 2 187 ? 42.652 44.171 87.278  1.00 95.49  ? 289  ALA B CA  1 
ATOM   3332 C C   . ALA B 2 187 ? 42.508 43.471 88.628  1.00 96.29  ? 289  ALA B C   1 
ATOM   3333 O O   . ALA B 2 187 ? 41.435 43.486 89.232  1.00 95.51  ? 289  ALA B O   1 
ATOM   3334 C CB  . ALA B 2 187 ? 42.885 43.151 86.175  1.00 94.94  ? 289  ALA B CB  1 
ATOM   3335 N N   . LEU B 2 188 ? 43.601 42.876 89.102  1.00 97.84  ? 290  LEU B N   1 
ATOM   3336 C CA  . LEU B 2 188 ? 43.617 42.156 90.374  1.00 99.20  ? 290  LEU B CA  1 
ATOM   3337 C C   . LEU B 2 188 ? 43.353 43.031 91.597  1.00 99.87  ? 290  LEU B C   1 
ATOM   3338 O O   . LEU B 2 188 ? 42.541 42.672 92.452  1.00 100.91 ? 290  LEU B O   1 
ATOM   3339 C CB  . LEU B 2 188 ? 44.957 41.440 90.560  1.00 99.87  ? 290  LEU B CB  1 
ATOM   3340 C CG  . LEU B 2 188 ? 45.395 40.493 89.438  1.00 101.19 ? 290  LEU B CG  1 
ATOM   3341 C CD1 . LEU B 2 188 ? 46.642 39.734 89.881  1.00 101.24 ? 290  LEU B CD1 1 
ATOM   3342 C CD2 . LEU B 2 188 ? 44.267 39.525 89.098  1.00 101.63 ? 290  LEU B CD2 1 
ATOM   3343 N N   . THR B 2 189 ? 44.046 44.163 91.693  1.00 100.10 ? 291  THR B N   1 
ATOM   3344 C CA  . THR B 2 189 ? 43.863 45.076 92.823  1.00 100.43 ? 291  THR B CA  1 
ATOM   3345 C C   . THR B 2 189 ? 42.379 45.407 93.051  1.00 100.79 ? 291  THR B C   1 
ATOM   3346 O O   . THR B 2 189 ? 41.929 45.529 94.195  1.00 101.81 ? 291  THR B O   1 
ATOM   3347 C CB  . THR B 2 189 ? 44.642 46.410 92.616  1.00 100.07 ? 291  THR B CB  1 
ATOM   3348 O OG1 . THR B 2 189 ? 46.042 46.138 92.480  1.00 100.22 ? 291  THR B OG1 1 
ATOM   3349 C CG2 . THR B 2 189 ? 44.440 47.339 93.804  1.00 98.36  ? 291  THR B CG2 1 
ATOM   3350 N N   . LEU B 2 190 ? 41.623 45.542 91.962  1.00 99.84  ? 292  LEU B N   1 
ATOM   3351 C CA  . LEU B 2 190 ? 40.202 45.862 92.042  1.00 98.10  ? 292  LEU B CA  1 
ATOM   3352 C C   . LEU B 2 190 ? 39.350 44.652 92.416  1.00 98.28  ? 292  LEU B C   1 
ATOM   3353 O O   . LEU B 2 190 ? 38.424 44.761 93.218  1.00 98.62  ? 292  LEU B O   1 
ATOM   3354 C CB  . LEU B 2 190 ? 39.732 46.454 90.710  1.00 95.92  ? 292  LEU B CB  1 
ATOM   3355 C CG  . LEU B 2 190 ? 38.326 47.048 90.684  1.00 94.07  ? 292  LEU B CG  1 
ATOM   3356 C CD1 . LEU B 2 190 ? 38.210 48.058 89.573  1.00 92.72  ? 292  LEU B CD1 1 
ATOM   3357 C CD2 . LEU B 2 190 ? 37.317 45.941 90.509  1.00 94.41  ? 292  LEU B CD2 1 
ATOM   3358 N N   . GLN B 2 191 ? 39.664 43.497 91.840  1.00 98.28  ? 293  GLN B N   1 
ATOM   3359 C CA  . GLN B 2 191 ? 38.923 42.276 92.132  1.00 98.11  ? 293  GLN B CA  1 
ATOM   3360 C C   . GLN B 2 191 ? 38.881 41.991 93.624  1.00 98.11  ? 293  GLN B C   1 
ATOM   3361 O O   . GLN B 2 191 ? 37.957 41.346 94.110  1.00 96.62  ? 293  GLN B O   1 
ATOM   3362 C CB  . GLN B 2 191 ? 39.561 41.101 91.404  1.00 98.77  ? 293  GLN B CB  1 
ATOM   3363 C CG  . GLN B 2 191 ? 39.552 41.253 89.898  1.00 100.00 ? 293  GLN B CG  1 
ATOM   3364 C CD  . GLN B 2 191 ? 40.301 40.143 89.189  1.00 101.35 ? 293  GLN B CD  1 
ATOM   3365 O OE1 . GLN B 2 191 ? 39.998 38.962 89.363  1.00 102.47 ? 293  GLN B OE1 1 
ATOM   3366 N NE2 . GLN B 2 191 ? 41.281 40.518 88.375  1.00 102.49 ? 293  GLN B NE2 1 
ATOM   3367 N N   . SER B 2 192 ? 39.895 42.471 94.337  1.00 100.14 ? 294  SER B N   1 
ATOM   3368 C CA  . SER B 2 192 ? 40.003 42.302 95.783  1.00 102.86 ? 294  SER B CA  1 
ATOM   3369 C C   . SER B 2 192 ? 38.997 43.210 96.497  1.00 105.04 ? 294  SER B C   1 
ATOM   3370 O O   . SER B 2 192 ? 38.274 42.780 97.402  1.00 104.76 ? 294  SER B O   1 
ATOM   3371 C CB  . SER B 2 192 ? 41.419 42.657 96.234  1.00 102.09 ? 294  SER B CB  1 
ATOM   3372 O OG  . SER B 2 192 ? 42.376 42.014 95.410  1.00 101.32 ? 294  SER B OG  1 
ATOM   3373 N N   . TYR B 2 193 ? 38.957 44.471 96.083  1.00 107.55 ? 295  TYR B N   1 
ATOM   3374 C CA  . TYR B 2 193 ? 38.046 45.436 96.674  1.00 110.18 ? 295  TYR B CA  1 
ATOM   3375 C C   . TYR B 2 193 ? 36.589 45.011 96.489  1.00 111.48 ? 295  TYR B C   1 
ATOM   3376 O O   . TYR B 2 193 ? 35.786 45.120 97.414  1.00 111.67 ? 295  TYR B O   1 
ATOM   3377 C CB  . TYR B 2 193 ? 38.278 46.807 96.045  1.00 111.85 ? 295  TYR B CB  1 
ATOM   3378 C CG  . TYR B 2 193 ? 37.771 47.957 96.877  1.00 114.59 ? 295  TYR B CG  1 
ATOM   3379 C CD1 . TYR B 2 193 ? 36.409 48.224 96.979  1.00 115.77 ? 295  TYR B CD1 1 
ATOM   3380 C CD2 . TYR B 2 193 ? 38.653 48.767 97.578  1.00 116.11 ? 295  TYR B CD2 1 
ATOM   3381 C CE1 . TYR B 2 193 ? 35.937 49.265 97.758  1.00 117.46 ? 295  TYR B CE1 1 
ATOM   3382 C CE2 . TYR B 2 193 ? 38.192 49.813 98.363  1.00 118.43 ? 295  TYR B CE2 1 
ATOM   3383 C CZ  . TYR B 2 193 ? 36.829 50.059 98.453  1.00 118.59 ? 295  TYR B CZ  1 
ATOM   3384 O OH  . TYR B 2 193 ? 36.348 51.085 99.244  1.00 118.46 ? 295  TYR B OH  1 
ATOM   3385 N N   . ILE B 2 194 ? 36.251 44.527 95.297  1.00 112.96 ? 296  ILE B N   1 
ATOM   3386 C CA  . ILE B 2 194 ? 34.889 44.094 95.013  1.00 115.50 ? 296  ILE B CA  1 
ATOM   3387 C C   . ILE B 2 194 ? 34.401 43.054 95.997  1.00 118.05 ? 296  ILE B C   1 
ATOM   3388 O O   . ILE B 2 194 ? 33.263 43.122 96.456  1.00 118.81 ? 296  ILE B O   1 
ATOM   3389 C CB  . ILE B 2 194 ? 34.754 43.500 93.607  1.00 115.42 ? 296  ILE B CB  1 
ATOM   3390 C CG1 . ILE B 2 194 ? 34.839 44.614 92.573  1.00 115.17 ? 296  ILE B CG1 1 
ATOM   3391 C CG2 . ILE B 2 194 ? 33.421 42.769 93.468  1.00 115.39 ? 296  ILE B CG2 1 
ATOM   3392 C CD1 . ILE B 2 194 ? 34.497 44.159 91.192  1.00 115.42 ? 296  ILE B CD1 1 
ATOM   3393 N N   . LYS B 2 195 ? 35.255 42.081 96.305  1.00 121.15 ? 297  LYS B N   1 
ATOM   3394 C CA  . LYS B 2 195 ? 34.905 41.026 97.254  1.00 124.28 ? 297  LYS B CA  1 
ATOM   3395 C C   . LYS B 2 195 ? 34.762 41.609 98.662  1.00 126.32 ? 297  LYS B C   1 
ATOM   3396 O O   . LYS B 2 195 ? 33.945 41.136 99.455  1.00 126.73 ? 297  LYS B O   1 
ATOM   3397 C CB  . LYS B 2 195 ? 35.970 39.921 97.249  1.00 124.29 ? 297  LYS B CB  1 
ATOM   3398 C CG  . LYS B 2 195 ? 36.087 39.155 95.932  1.00 124.39 ? 297  LYS B CG  1 
ATOM   3399 C CD  . LYS B 2 195 ? 34.768 38.487 95.556  1.00 124.82 ? 297  LYS B CD  1 
ATOM   3400 C CE  . LYS B 2 195 ? 34.844 37.770 94.205  1.00 125.00 ? 297  LYS B CE  1 
ATOM   3401 N NZ  . LYS B 2 195 ? 35.776 36.600 94.202  1.00 124.91 ? 297  LYS B NZ  1 
ATOM   3402 N N   . GLY B 2 196 ? 35.559 42.634 98.966  1.00 128.14 ? 298  GLY B N   1 
ATOM   3403 C CA  . GLY B 2 196 ? 35.484 43.279 100.263 1.00 130.70 ? 298  GLY B CA  1 
ATOM   3404 C C   . GLY B 2 196 ? 34.359 44.297 100.259 1.00 133.11 ? 298  GLY B C   1 
ATOM   3405 O O   . GLY B 2 196 ? 34.576 45.480 100.530 1.00 133.10 ? 298  GLY B O   1 
ATOM   3406 N N   . GLN B 2 197 ? 33.154 43.833 99.932  1.00 135.79 ? 299  GLN B N   1 
ATOM   3407 C CA  . GLN B 2 197 ? 31.979 44.690 99.883  1.00 138.39 ? 299  GLN B CA  1 
ATOM   3408 C C   . GLN B 2 197 ? 31.273 44.684 101.230 1.00 141.03 ? 299  GLN B C   1 
ATOM   3409 O O   . GLN B 2 197 ? 30.533 43.753 101.569 1.00 140.61 ? 299  GLN B O   1 
ATOM   3410 C CB  . GLN B 2 197 ? 31.003 44.239 98.779  1.00 137.20 ? 299  GLN B CB  1 
ATOM   3411 C CG  . GLN B 2 197 ? 30.246 42.935 99.044  1.00 134.64 ? 299  GLN B CG  1 
ATOM   3412 C CD  . GLN B 2 197 ? 29.127 42.695 98.043  1.00 133.12 ? 299  GLN B CD  1 
ATOM   3413 O OE1 . GLN B 2 197 ? 28.363 41.741 98.170  1.00 131.94 ? 299  GLN B OE1 1 
ATOM   3414 N NE2 . GLN B 2 197 ? 29.027 43.563 97.042  1.00 132.19 ? 299  GLN B NE2 1 
ATOM   3415 N N   . GLN B 2 198 ? 31.537 45.732 102.004 1.00 144.59 ? 300  GLN B N   1 
ATOM   3416 C CA  . GLN B 2 198 ? 30.936 45.898 103.320 1.00 147.24 ? 300  GLN B CA  1 
ATOM   3417 C C   . GLN B 2 198 ? 29.432 45.730 103.114 1.00 148.47 ? 300  GLN B C   1 
ATOM   3418 O O   . GLN B 2 198 ? 28.874 44.663 103.394 1.00 148.60 ? 300  GLN B O   1 
ATOM   3419 C CB  . GLN B 2 198 ? 31.278 47.294 103.862 1.00 147.81 ? 300  GLN B CB  1 
ATOM   3420 C CG  . GLN B 2 198 ? 32.787 47.579 103.907 1.00 148.05 ? 300  GLN B CG  1 
ATOM   3421 C CD  . GLN B 2 198 ? 33.169 48.894 103.234 1.00 148.35 ? 300  GLN B CD  1 
ATOM   3422 O OE1 . GLN B 2 198 ? 32.737 49.967 103.658 1.00 149.22 ? 300  GLN B OE1 1 
ATOM   3423 N NE2 . GLN B 2 198 ? 33.981 48.812 102.181 1.00 147.26 ? 300  GLN B NE2 1 
ATOM   3424 N N   . ARG B 2 199 ? 28.779 46.776 102.615 1.00 149.68 ? 301  ARG B N   1 
ATOM   3425 C CA  . ARG B 2 199 ? 27.354 46.687 102.342 1.00 150.94 ? 301  ARG B CA  1 
ATOM   3426 C C   . ARG B 2 199 ? 27.220 45.991 101.000 1.00 151.31 ? 301  ARG B C   1 
ATOM   3427 O O   . ARG B 2 199 ? 27.948 46.300 100.056 1.00 151.26 ? 301  ARG B O   1 
ATOM   3428 C CB  . ARG B 2 199 ? 26.701 48.075 102.269 1.00 151.39 ? 301  ARG B CB  1 
ATOM   3429 C CG  . ARG B 2 199 ? 26.245 48.641 103.619 1.00 152.49 ? 301  ARG B CG  1 
ATOM   3430 C CD  . ARG B 2 199 ? 25.114 47.821 104.280 1.00 152.81 ? 301  ARG B CD  1 
ATOM   3431 N NE  . ARG B 2 199 ? 23.818 47.954 103.605 1.00 152.84 ? 301  ARG B NE  1 
ATOM   3432 C CZ  . ARG B 2 199 ? 22.675 47.434 104.053 1.00 152.23 ? 301  ARG B CZ  1 
ATOM   3433 N NH1 . ARG B 2 199 ? 22.651 46.739 105.184 1.00 152.17 ? 301  ARG B NH1 1 
ATOM   3434 N NH2 . ARG B 2 199 ? 21.551 47.610 103.370 1.00 151.57 ? 301  ARG B NH2 1 
ATOM   3435 N N   . ARG B 2 200 ? 26.298 45.041 100.924 1.00 151.85 ? 302  ARG B N   1 
ATOM   3436 C CA  . ARG B 2 200 ? 26.060 44.311 99.691  1.00 152.11 ? 302  ARG B CA  1 
ATOM   3437 C C   . ARG B 2 200 ? 24.826 44.904 98.992  1.00 152.06 ? 302  ARG B C   1 
ATOM   3438 O O   . ARG B 2 200 ? 23.846 44.208 98.743  1.00 152.24 ? 302  ARG B O   1 
ATOM   3439 C CB  . ARG B 2 200 ? 25.866 42.820 100.022 1.00 152.83 ? 302  ARG B CB  1 
ATOM   3440 C CG  . ARG B 2 200 ? 25.559 41.880 98.852  1.00 154.50 ? 302  ARG B CG  1 
ATOM   3441 C CD  . ARG B 2 200 ? 24.057 41.642 98.703  1.00 156.78 ? 302  ARG B CD  1 
ATOM   3442 N NE  . ARG B 2 200 ? 23.414 41.386 99.993  1.00 159.63 ? 302  ARG B NE  1 
ATOM   3443 C CZ  . ARG B 2 200 ? 22.096 41.330 100.189 1.00 160.67 ? 302  ARG B CZ  1 
ATOM   3444 N NH1 . ARG B 2 200 ? 21.255 41.511 99.176  1.00 160.81 ? 302  ARG B NH1 1 
ATOM   3445 N NH2 . ARG B 2 200 ? 21.616 41.099 101.406 1.00 161.20 ? 302  ARG B NH2 1 
ATOM   3446 N N   . PRO B 2 201 ? 24.841 46.216 98.684  1.00 151.83 ? 303  PRO B N   1 
ATOM   3447 C CA  . PRO B 2 201 ? 23.620 46.668 98.017  1.00 151.67 ? 303  PRO B CA  1 
ATOM   3448 C C   . PRO B 2 201 ? 23.734 46.422 96.510  1.00 151.74 ? 303  PRO B C   1 
ATOM   3449 O O   . PRO B 2 201 ? 22.742 46.528 95.779  1.00 152.17 ? 303  PRO B O   1 
ATOM   3450 C CB  . PRO B 2 201 ? 23.585 48.149 98.361  1.00 151.25 ? 303  PRO B CB  1 
ATOM   3451 C CG  . PRO B 2 201 ? 25.034 48.518 98.253  1.00 150.80 ? 303  PRO B CG  1 
ATOM   3452 C CD  . PRO B 2 201 ? 25.740 47.360 98.946  1.00 151.26 ? 303  PRO B CD  1 
ATOM   3453 N N   . ARG B 2 202 ? 24.952 46.075 96.075  1.00 150.87 ? 304  ARG B N   1 
ATOM   3454 C CA  . ARG B 2 202 ? 25.287 45.820 94.671  1.00 149.09 ? 304  ARG B CA  1 
ATOM   3455 C C   . ARG B 2 202 ? 25.416 44.347 94.272  1.00 147.69 ? 304  ARG B C   1 
ATOM   3456 O O   . ARG B 2 202 ? 25.267 43.436 95.090  1.00 148.15 ? 304  ARG B O   1 
ATOM   3457 C CB  . ARG B 2 202 ? 26.592 46.534 94.319  1.00 148.62 ? 304  ARG B CB  1 
ATOM   3458 C CG  . ARG B 2 202 ? 27.778 46.011 95.091  1.00 147.27 ? 304  ARG B CG  1 
ATOM   3459 C CD  . ARG B 2 202 ? 28.697 47.138 95.448  1.00 146.32 ? 304  ARG B CD  1 
ATOM   3460 N NE  . ARG B 2 202 ? 29.054 47.074 96.857  1.00 146.04 ? 304  ARG B NE  1 
ATOM   3461 C CZ  . ARG B 2 202 ? 29.590 48.085 97.524  1.00 145.83 ? 304  ARG B CZ  1 
ATOM   3462 N NH1 . ARG B 2 202 ? 29.822 49.230 96.898  1.00 145.09 ? 304  ARG B NH1 1 
ATOM   3463 N NH2 . ARG B 2 202 ? 29.891 47.955 98.810  1.00 145.55 ? 304  ARG B NH2 1 
ATOM   3464 N N   . ASP B 2 203 ? 25.723 44.148 92.994  1.00 145.61 ? 305  ASP B N   1 
ATOM   3465 C CA  . ASP B 2 203 ? 25.863 42.829 92.391  1.00 143.08 ? 305  ASP B CA  1 
ATOM   3466 C C   . ASP B 2 203 ? 26.953 41.939 92.983  1.00 140.66 ? 305  ASP B C   1 
ATOM   3467 O O   . ASP B 2 203 ? 27.746 42.356 93.835  1.00 140.05 ? 305  ASP B O   1 
ATOM   3468 C CB  . ASP B 2 203 ? 26.117 42.980 90.882  1.00 143.52 ? 305  ASP B CB  1 
ATOM   3469 C CG  . ASP B 2 203 ? 25.107 43.892 90.202  1.00 143.67 ? 305  ASP B CG  1 
ATOM   3470 O OD1 . ASP B 2 203 ? 23.904 43.555 90.195  1.00 144.06 ? 305  ASP B OD1 1 
ATOM   3471 O OD2 . ASP B 2 203 ? 25.522 44.947 89.675  1.00 142.70 ? 305  ASP B OD2 1 
ATOM   3472 N N   . ARG B 2 204 ? 26.958 40.697 92.507  1.00 137.81 ? 306  ARG B N   1 
ATOM   3473 C CA  . ARG B 2 204 ? 27.928 39.683 92.897  1.00 134.23 ? 306  ARG B CA  1 
ATOM   3474 C C   . ARG B 2 204 ? 29.016 39.700 91.820  1.00 130.94 ? 306  ARG B C   1 
ATOM   3475 O O   . ARG B 2 204 ? 30.214 39.717 92.116  1.00 130.91 ? 306  ARG B O   1 
ATOM   3476 C CB  . ARG B 2 204 ? 27.252 38.302 92.948  1.00 135.25 ? 306  ARG B CB  1 
ATOM   3477 C CG  . ARG B 2 204 ? 26.454 37.925 91.694  1.00 136.15 ? 306  ARG B CG  1 
ATOM   3478 C CD  . ARG B 2 204 ? 25.968 36.478 91.725  1.00 138.12 ? 306  ARG B CD  1 
ATOM   3479 N NE  . ARG B 2 204 ? 27.047 35.534 92.024  1.00 140.30 ? 306  ARG B NE  1 
ATOM   3480 C CZ  . ARG B 2 204 ? 26.958 34.211 91.880  1.00 141.14 ? 306  ARG B CZ  1 
ATOM   3481 N NH1 . ARG B 2 204 ? 25.836 33.659 91.434  1.00 141.42 ? 306  ARG B NH1 1 
ATOM   3482 N NH2 . ARG B 2 204 ? 27.994 33.435 92.186  1.00 141.13 ? 306  ARG B NH2 1 
ATOM   3483 N N   . PHE B 2 205 ? 28.572 39.716 90.565  1.00 126.55 ? 307  PHE B N   1 
ATOM   3484 C CA  . PHE B 2 205 ? 29.456 39.744 89.412  1.00 121.38 ? 307  PHE B CA  1 
ATOM   3485 C C   . PHE B 2 205 ? 29.643 41.188 88.964  1.00 117.73 ? 307  PHE B C   1 
ATOM   3486 O O   . PHE B 2 205 ? 29.486 41.505 87.789  1.00 117.00 ? 307  PHE B O   1 
ATOM   3487 C CB  . PHE B 2 205 ? 28.855 38.927 88.263  1.00 121.60 ? 307  PHE B CB  1 
ATOM   3488 C CG  . PHE B 2 205 ? 28.744 37.450 88.551  1.00 121.57 ? 307  PHE B CG  1 
ATOM   3489 C CD1 . PHE B 2 205 ? 29.872 36.700 88.859  1.00 121.53 ? 307  PHE B CD1 1 
ATOM   3490 C CD2 . PHE B 2 205 ? 27.515 36.806 88.495  1.00 121.21 ? 307  PHE B CD2 1 
ATOM   3491 C CE1 . PHE B 2 205 ? 29.779 35.335 89.104  1.00 120.71 ? 307  PHE B CE1 1 
ATOM   3492 C CE2 . PHE B 2 205 ? 27.416 35.442 88.739  1.00 120.68 ? 307  PHE B CE2 1 
ATOM   3493 C CZ  . PHE B 2 205 ? 28.553 34.705 89.044  1.00 120.59 ? 307  PHE B CZ  1 
ATOM   3494 N N   . LEU B 2 206 ? 29.975 42.061 89.907  1.00 113.18 ? 308  LEU B N   1 
ATOM   3495 C CA  . LEU B 2 206 ? 30.188 43.464 89.594  1.00 108.57 ? 308  LEU B CA  1 
ATOM   3496 C C   . LEU B 2 206 ? 31.342 43.561 88.607  1.00 105.62 ? 308  LEU B C   1 
ATOM   3497 O O   . LEU B 2 206 ? 31.178 44.077 87.505  1.00 105.24 ? 308  LEU B O   1 
ATOM   3498 C CB  . LEU B 2 206 ? 30.518 44.240 90.869  1.00 108.63 ? 308  LEU B CB  1 
ATOM   3499 C CG  . LEU B 2 206 ? 30.336 45.759 90.838  1.00 107.81 ? 308  LEU B CG  1 
ATOM   3500 C CD1 . LEU B 2 206 ? 28.922 46.099 90.387  1.00 107.79 ? 308  LEU B CD1 1 
ATOM   3501 C CD2 . LEU B 2 206 ? 30.607 46.330 92.225  1.00 106.89 ? 308  LEU B CD2 1 
ATOM   3502 N N   . TYR B 2 207 ? 32.505 43.050 89.006  1.00 102.43 ? 309  TYR B N   1 
ATOM   3503 C CA  . TYR B 2 207 ? 33.699 43.064 88.159  1.00 99.30  ? 309  TYR B CA  1 
ATOM   3504 C C   . TYR B 2 207 ? 33.369 42.522 86.773  1.00 95.09  ? 309  TYR B C   1 
ATOM   3505 O O   . TYR B 2 207 ? 33.631 43.163 85.766  1.00 94.68  ? 309  TYR B O   1 
ATOM   3506 C CB  . TYR B 2 207 ? 34.810 42.205 88.787  1.00 102.06 ? 309  TYR B CB  1 
ATOM   3507 C CG  . TYR B 2 207 ? 36.153 42.260 88.064  1.00 104.68 ? 309  TYR B CG  1 
ATOM   3508 C CD1 . TYR B 2 207 ? 37.061 43.295 88.297  1.00 105.30 ? 309  TYR B CD1 1 
ATOM   3509 C CD2 . TYR B 2 207 ? 36.514 41.272 87.150  1.00 105.72 ? 309  TYR B CD2 1 
ATOM   3510 C CE1 . TYR B 2 207 ? 38.299 43.338 87.635  1.00 106.10 ? 309  TYR B CE1 1 
ATOM   3511 C CE2 . TYR B 2 207 ? 37.744 41.306 86.485  1.00 106.66 ? 309  TYR B CE2 1 
ATOM   3512 C CZ  . TYR B 2 207 ? 38.634 42.340 86.730  1.00 106.29 ? 309  TYR B CZ  1 
ATOM   3513 O OH  . TYR B 2 207 ? 39.850 42.359 86.071  1.00 104.61 ? 309  TYR B OH  1 
ATOM   3514 N N   . ALA B 2 208 ? 32.791 41.331 86.733  1.00 90.23  ? 310  ALA B N   1 
ATOM   3515 C CA  . ALA B 2 208 ? 32.430 40.708 85.472  1.00 85.57  ? 310  ALA B CA  1 
ATOM   3516 C C   . ALA B 2 208 ? 31.614 41.657 84.598  1.00 83.08  ? 310  ALA B C   1 
ATOM   3517 O O   . ALA B 2 208 ? 31.792 41.695 83.379  1.00 82.76  ? 310  ALA B O   1 
ATOM   3518 C CB  . ALA B 2 208 ? 31.652 39.434 85.737  1.00 85.59  ? 310  ALA B CB  1 
ATOM   3519 N N   . LYS B 2 209 ? 30.723 42.420 85.225  1.00 80.12  ? 311  LYS B N   1 
ATOM   3520 C CA  . LYS B 2 209 ? 29.887 43.368 84.505  1.00 77.77  ? 311  LYS B CA  1 
ATOM   3521 C C   . LYS B 2 209 ? 30.680 44.607 84.073  1.00 75.50  ? 311  LYS B C   1 
ATOM   3522 O O   . LYS B 2 209 ? 30.477 45.126 82.959  1.00 74.45  ? 311  LYS B O   1 
ATOM   3523 C CB  . LYS B 2 209 ? 28.679 43.762 85.371  1.00 79.45  ? 311  LYS B CB  1 
ATOM   3524 C CG  . LYS B 2 209 ? 27.914 42.566 85.946  1.00 81.05  ? 311  LYS B CG  1 
ATOM   3525 C CD  . LYS B 2 209 ? 26.508 42.929 86.435  1.00 81.46  ? 311  LYS B CD  1 
ATOM   3526 C CE  . LYS B 2 209 ? 25.595 43.328 85.268  1.00 81.07  ? 311  LYS B CE  1 
ATOM   3527 N NZ  . LYS B 2 209 ? 24.183 43.559 85.694  1.00 80.40  ? 311  LYS B NZ  1 
ATOM   3528 N N   . LEU B 2 210 ? 31.588 45.061 84.947  1.00 71.80  ? 312  LEU B N   1 
ATOM   3529 C CA  . LEU B 2 210 ? 32.454 46.229 84.698  1.00 69.03  ? 312  LEU B CA  1 
ATOM   3530 C C   . LEU B 2 210 ? 33.324 46.085 83.448  1.00 68.89  ? 312  LEU B C   1 
ATOM   3531 O O   . LEU B 2 210 ? 33.634 47.068 82.780  1.00 69.60  ? 312  LEU B O   1 
ATOM   3532 C CB  . LEU B 2 210 ? 33.388 46.478 85.885  1.00 65.19  ? 312  LEU B CB  1 
ATOM   3533 C CG  . LEU B 2 210 ? 32.797 46.849 87.242  1.00 63.49  ? 312  LEU B CG  1 
ATOM   3534 C CD1 . LEU B 2 210 ? 33.929 47.253 88.153  1.00 61.39  ? 312  LEU B CD1 1 
ATOM   3535 C CD2 . LEU B 2 210 ? 31.809 47.991 87.107  1.00 62.61  ? 312  LEU B CD2 1 
ATOM   3536 N N   . LEU B 2 211 ? 33.740 44.854 83.168  1.00 69.05  ? 313  LEU B N   1 
ATOM   3537 C CA  . LEU B 2 211 ? 34.565 44.531 82.009  1.00 67.47  ? 313  LEU B CA  1 
ATOM   3538 C C   . LEU B 2 211 ? 33.691 44.698 80.794  1.00 66.02  ? 313  LEU B C   1 
ATOM   3539 O O   . LEU B 2 211 ? 34.137 45.193 79.764  1.00 66.07  ? 313  LEU B O   1 
ATOM   3540 C CB  . LEU B 2 211 ? 35.046 43.089 82.104  1.00 68.66  ? 313  LEU B CB  1 
ATOM   3541 C CG  . LEU B 2 211 ? 35.632 42.758 83.478  1.00 69.78  ? 313  LEU B CG  1 
ATOM   3542 C CD1 . LEU B 2 211 ? 35.954 41.288 83.541  1.00 71.25  ? 313  LEU B CD1 1 
ATOM   3543 C CD2 . LEU B 2 211 ? 36.878 43.606 83.740  1.00 70.05  ? 313  LEU B CD2 1 
ATOM   3544 N N   . GLY B 2 212 ? 32.444 44.256 80.916  1.00 64.81  ? 314  GLY B N   1 
ATOM   3545 C CA  . GLY B 2 212 ? 31.514 44.422 79.826  1.00 64.51  ? 314  GLY B CA  1 
ATOM   3546 C C   . GLY B 2 212 ? 31.517 45.905 79.518  1.00 64.66  ? 314  GLY B C   1 
ATOM   3547 O O   . GLY B 2 212 ? 31.498 46.300 78.358  1.00 65.19  ? 314  GLY B O   1 
ATOM   3548 N N   . LEU B 2 213 ? 31.562 46.728 80.567  1.00 64.40  ? 315  LEU B N   1 
ATOM   3549 C CA  . LEU B 2 213 ? 31.585 48.181 80.423  1.00 62.67  ? 315  LEU B CA  1 
ATOM   3550 C C   . LEU B 2 213 ? 32.918 48.720 79.899  1.00 60.52  ? 315  LEU B C   1 
ATOM   3551 O O   . LEU B 2 213 ? 32.932 49.649 79.103  1.00 61.88  ? 315  LEU B O   1 
ATOM   3552 C CB  . LEU B 2 213 ? 31.211 48.853 81.751  1.00 62.48  ? 315  LEU B CB  1 
ATOM   3553 C CG  . LEU B 2 213 ? 29.713 48.808 82.107  1.00 62.98  ? 315  LEU B CG  1 
ATOM   3554 C CD1 . LEU B 2 213 ? 29.510 49.504 83.441  1.00 63.29  ? 315  LEU B CD1 1 
ATOM   3555 C CD2 . LEU B 2 213 ? 28.860 49.481 81.019  1.00 61.62  ? 315  LEU B CD2 1 
ATOM   3556 N N   . LEU B 2 214 ? 34.038 48.167 80.341  1.00 57.89  ? 316  LEU B N   1 
ATOM   3557 C CA  . LEU B 2 214 ? 35.320 48.616 79.807  1.00 55.48  ? 316  LEU B CA  1 
ATOM   3558 C C   . LEU B 2 214 ? 35.300 48.327 78.313  1.00 53.90  ? 316  LEU B C   1 
ATOM   3559 O O   . LEU B 2 214 ? 35.926 49.029 77.528  1.00 52.77  ? 316  LEU B O   1 
ATOM   3560 C CB  . LEU B 2 214 ? 36.479 47.846 80.431  1.00 55.66  ? 316  LEU B CB  1 
ATOM   3561 C CG  . LEU B 2 214 ? 37.026 48.385 81.742  1.00 54.41  ? 316  LEU B CG  1 
ATOM   3562 C CD1 . LEU B 2 214 ? 38.253 47.594 82.111  1.00 54.87  ? 316  LEU B CD1 1 
ATOM   3563 C CD2 . LEU B 2 214 ? 37.381 49.850 81.584  1.00 54.16  ? 316  LEU B CD2 1 
ATOM   3564 N N   . ALA B 2 215 ? 34.590 47.264 77.945  1.00 53.31  ? 317  ALA B N   1 
ATOM   3565 C CA  . ALA B 2 215 ? 34.441 46.852 76.562  1.00 55.01  ? 317  ALA B CA  1 
ATOM   3566 C C   . ALA B 2 215 ? 33.505 47.831 75.869  1.00 56.73  ? 317  ALA B C   1 
ATOM   3567 O O   . ALA B 2 215 ? 33.762 48.254 74.746  1.00 58.75  ? 317  ALA B O   1 
ATOM   3568 C CB  . ALA B 2 215 ? 33.862 45.452 76.492  1.00 52.66  ? 317  ALA B CB  1 
ATOM   3569 N N   . GLU B 2 216 ? 32.414 48.187 76.540  1.00 57.67  ? 318  GLU B N   1 
ATOM   3570 C CA  . GLU B 2 216 ? 31.450 49.131 75.985  1.00 57.11  ? 318  GLU B CA  1 
ATOM   3571 C C   . GLU B 2 216 ? 32.114 50.493 75.795  1.00 57.09  ? 318  GLU B C   1 
ATOM   3572 O O   . GLU B 2 216 ? 31.842 51.187 74.819  1.00 55.03  ? 318  GLU B O   1 
ATOM   3573 C CB  . GLU B 2 216 ? 30.219 49.236 76.898  1.00 56.84  ? 318  GLU B CB  1 
ATOM   3574 C CG  . GLU B 2 216 ? 29.360 47.973 76.899  1.00 56.39  ? 318  GLU B CG  1 
ATOM   3575 C CD  . GLU B 2 216 ? 28.928 47.554 75.485  1.00 59.40  ? 318  GLU B CD  1 
ATOM   3576 O OE1 . GLU B 2 216 ? 28.222 48.339 74.815  1.00 61.18  ? 318  GLU B OE1 1 
ATOM   3577 O OE2 . GLU B 2 216 ? 29.290 46.444 75.032  1.00 59.39  ? 318  GLU B OE2 1 
ATOM   3578 N N   . LEU B 2 217 ? 32.994 50.865 76.724  1.00 57.85  ? 319  LEU B N   1 
ATOM   3579 C CA  . LEU B 2 217 ? 33.728 52.126 76.639  1.00 59.22  ? 319  LEU B CA  1 
ATOM   3580 C C   . LEU B 2 217 ? 34.635 52.164 75.399  1.00 60.38  ? 319  LEU B C   1 
ATOM   3581 O O   . LEU B 2 217 ? 34.968 53.235 74.894  1.00 61.57  ? 319  LEU B O   1 
ATOM   3582 C CB  . LEU B 2 217 ? 34.564 52.341 77.904  1.00 58.00  ? 319  LEU B CB  1 
ATOM   3583 C CG  . LEU B 2 217 ? 33.813 53.015 79.053  1.00 56.57  ? 319  LEU B CG  1 
ATOM   3584 C CD1 . LEU B 2 217 ? 34.712 53.120 80.273  1.00 55.09  ? 319  LEU B CD1 1 
ATOM   3585 C CD2 . LEU B 2 217 ? 33.354 54.391 78.599  1.00 54.59  ? 319  LEU B CD2 1 
ATOM   3586 N N   . ARG B 2 218 ? 35.046 50.992 74.924  1.00 61.40  ? 320  ARG B N   1 
ATOM   3587 C CA  . ARG B 2 218 ? 35.877 50.892 73.727  1.00 60.85  ? 320  ARG B CA  1 
ATOM   3588 C C   . ARG B 2 218 ? 34.989 51.265 72.545  1.00 60.50  ? 320  ARG B C   1 
ATOM   3589 O O   . ARG B 2 218 ? 35.355 52.096 71.708  1.00 59.83  ? 320  ARG B O   1 
ATOM   3590 C CB  . ARG B 2 218 ? 36.393 49.467 73.582  1.00 59.16  ? 320  ARG B CB  1 
ATOM   3591 C CG  . ARG B 2 218 ? 37.049 48.984 74.849  1.00 59.72  ? 320  ARG B CG  1 
ATOM   3592 C CD  . ARG B 2 218 ? 38.328 48.310 74.523  1.00 61.01  ? 320  ARG B CD  1 
ATOM   3593 N NE  . ARG B 2 218 ? 39.224 48.246 75.661  1.00 62.00  ? 320  ARG B NE  1 
ATOM   3594 C CZ  . ARG B 2 218 ? 40.536 48.097 75.540  1.00 63.15  ? 320  ARG B CZ  1 
ATOM   3595 N NH1 . ARG B 2 218 ? 41.080 48.005 74.336  1.00 62.86  ? 320  ARG B NH1 1 
ATOM   3596 N NH2 . ARG B 2 218 ? 41.304 48.035 76.615  1.00 65.17  ? 320  ARG B NH2 1 
ATOM   3597 N N   . SER B 2 219 ? 33.818 50.635 72.495  1.00 59.97  ? 321  SER B N   1 
ATOM   3598 C CA  . SER B 2 219 ? 32.830 50.904 71.462  1.00 59.70  ? 321  SER B CA  1 
ATOM   3599 C C   . SER B 2 219 ? 32.641 52.419 71.443  1.00 61.06  ? 321  SER B C   1 
ATOM   3600 O O   . SER B 2 219 ? 32.695 53.056 70.390  1.00 60.83  ? 321  SER B O   1 
ATOM   3601 C CB  . SER B 2 219 ? 31.493 50.214 71.805  1.00 57.89  ? 321  SER B CB  1 
ATOM   3602 O OG  . SER B 2 219 ? 31.237 49.074 70.997  1.00 53.74  ? 321  SER B OG  1 
ATOM   3603 N N   . ILE B 2 220 ? 32.437 52.981 72.630  1.00 63.08  ? 322  ILE B N   1 
ATOM   3604 C CA  . ILE B 2 220 ? 32.234 54.412 72.800  1.00 65.61  ? 322  ILE B CA  1 
ATOM   3605 C C   . ILE B 2 220 ? 33.383 55.271 72.280  1.00 67.17  ? 322  ILE B C   1 
ATOM   3606 O O   . ILE B 2 220 ? 33.155 56.228 71.534  1.00 67.45  ? 322  ILE B O   1 
ATOM   3607 C CB  . ILE B 2 220 ? 31.969 54.758 74.295  1.00 65.71  ? 322  ILE B CB  1 
ATOM   3608 C CG1 . ILE B 2 220 ? 30.525 54.399 74.656  1.00 66.42  ? 322  ILE B CG1 1 
ATOM   3609 C CG2 . ILE B 2 220 ? 32.236 56.233 74.563  1.00 65.15  ? 322  ILE B CG2 1 
ATOM   3610 C CD1 . ILE B 2 220 ? 30.108 54.834 76.043  1.00 67.50  ? 322  ILE B CD1 1 
ATOM   3611 N N   . ASN B 2 221 ? 34.614 54.941 72.660  1.00 68.95  ? 323  ASN B N   1 
ATOM   3612 C CA  . ASN B 2 221 ? 35.746 55.733 72.204  1.00 70.07  ? 323  ASN B CA  1 
ATOM   3613 C C   . ASN B 2 221 ? 35.668 55.851 70.676  1.00 70.84  ? 323  ASN B C   1 
ATOM   3614 O O   . ASN B 2 221 ? 35.693 56.951 70.132  1.00 70.15  ? 323  ASN B O   1 
ATOM   3615 C CB  . ASN B 2 221 ? 37.076 55.099 72.662  1.00 68.58  ? 323  ASN B CB  1 
ATOM   3616 C CG  . ASN B 2 221 ? 38.047 56.133 73.239  1.00 68.45  ? 323  ASN B CG  1 
ATOM   3617 O OD1 . ASN B 2 221 ? 38.394 57.107 72.575  1.00 69.75  ? 323  ASN B OD1 1 
ATOM   3618 N ND2 . ASN B 2 221 ? 38.485 55.922 74.473  1.00 65.83  ? 323  ASN B ND2 1 
ATOM   3619 N N   . GLU B 2 222 ? 35.517 54.719 69.996  1.00 73.06  ? 324  GLU B N   1 
ATOM   3620 C CA  . GLU B 2 222 ? 35.446 54.706 68.539  1.00 75.12  ? 324  GLU B CA  1 
ATOM   3621 C C   . GLU B 2 222 ? 34.254 55.451 67.930  1.00 74.57  ? 324  GLU B C   1 
ATOM   3622 O O   . GLU B 2 222 ? 34.402 56.143 66.923  1.00 74.41  ? 324  GLU B O   1 
ATOM   3623 C CB  . GLU B 2 222 ? 35.472 53.256 68.028  1.00 77.87  ? 324  GLU B CB  1 
ATOM   3624 C CG  . GLU B 2 222 ? 35.439 53.143 66.503  1.00 83.49  ? 324  GLU B CG  1 
ATOM   3625 C CD  . GLU B 2 222 ? 36.108 51.878 65.970  1.00 86.39  ? 324  GLU B CD  1 
ATOM   3626 O OE1 . GLU B 2 222 ? 37.291 51.644 66.313  1.00 87.24  ? 324  GLU B OE1 1 
ATOM   3627 O OE2 . GLU B 2 222 ? 35.458 51.126 65.200  1.00 88.55  ? 324  GLU B OE2 1 
ATOM   3628 N N   . ALA B 2 223 ? 33.079 55.313 68.534  1.00 74.54  ? 325  ALA B N   1 
ATOM   3629 C CA  . ALA B 2 223 ? 31.874 55.973 68.026  1.00 74.35  ? 325  ALA B CA  1 
ATOM   3630 C C   . ALA B 2 223 ? 31.920 57.488 68.156  1.00 74.83  ? 325  ALA B C   1 
ATOM   3631 O O   . ALA B 2 223 ? 31.418 58.207 67.294  1.00 74.26  ? 325  ALA B O   1 
ATOM   3632 C CB  . ALA B 2 223 ? 30.655 55.443 68.739  1.00 74.48  ? 325  ALA B CB  1 
ATOM   3633 N N   . TYR B 2 224 ? 32.503 57.968 69.249  1.00 75.36  ? 326  TYR B N   1 
ATOM   3634 C CA  . TYR B 2 224 ? 32.624 59.398 69.481  1.00 75.33  ? 326  TYR B CA  1 
ATOM   3635 C C   . TYR B 2 224 ? 33.537 60.005 68.439  1.00 74.53  ? 326  TYR B C   1 
ATOM   3636 O O   . TYR B 2 224 ? 33.221 61.037 67.860  1.00 74.60  ? 326  TYR B O   1 
ATOM   3637 C CB  . TYR B 2 224 ? 33.204 59.670 70.865  1.00 76.96  ? 326  TYR B CB  1 
ATOM   3638 C CG  . TYR B 2 224 ? 33.586 61.121 71.099  1.00 78.63  ? 326  TYR B CG  1 
ATOM   3639 C CD1 . TYR B 2 224 ? 32.629 62.133 71.090  1.00 78.99  ? 326  TYR B CD1 1 
ATOM   3640 C CD2 . TYR B 2 224 ? 34.903 61.471 71.366  1.00 79.15  ? 326  TYR B CD2 1 
ATOM   3641 C CE1 . TYR B 2 224 ? 32.978 63.442 71.346  1.00 78.54  ? 326  TYR B CE1 1 
ATOM   3642 C CE2 . TYR B 2 224 ? 35.257 62.776 71.620  1.00 78.92  ? 326  TYR B CE2 1 
ATOM   3643 C CZ  . TYR B 2 224 ? 34.294 63.750 71.612  1.00 78.94  ? 326  TYR B CZ  1 
ATOM   3644 O OH  . TYR B 2 224 ? 34.668 65.036 71.881  1.00 81.52  ? 326  TYR B OH  1 
ATOM   3645 N N   . GLY B 2 225 ? 34.676 59.356 68.217  1.00 73.97  ? 327  GLY B N   1 
ATOM   3646 C CA  . GLY B 2 225 ? 35.635 59.835 67.240  1.00 74.69  ? 327  GLY B CA  1 
ATOM   3647 C C   . GLY B 2 225 ? 35.009 60.082 65.884  1.00 75.00  ? 327  GLY B C   1 
ATOM   3648 O O   . GLY B 2 225 ? 35.347 61.055 65.218  1.00 74.46  ? 327  GLY B O   1 
ATOM   3649 N N   . TYR B 2 226 ? 34.107 59.193 65.473  1.00 76.53  ? 328  TYR B N   1 
ATOM   3650 C CA  . TYR B 2 226 ? 33.410 59.326 64.197  1.00 77.95  ? 328  TYR B CA  1 
ATOM   3651 C C   . TYR B 2 226 ? 32.437 60.502 64.254  1.00 77.24  ? 328  TYR B C   1 
ATOM   3652 O O   . TYR B 2 226 ? 32.195 61.168 63.252  1.00 77.39  ? 328  TYR B O   1 
ATOM   3653 C CB  . TYR B 2 226 ? 32.630 58.047 63.872  1.00 80.83  ? 328  TYR B CB  1 
ATOM   3654 C CG  . TYR B 2 226 ? 31.723 58.178 62.662  1.00 84.61  ? 328  TYR B CG  1 
ATOM   3655 C CD1 . TYR B 2 226 ? 32.167 57.840 61.386  1.00 86.69  ? 328  TYR B CD1 1 
ATOM   3656 C CD2 . TYR B 2 226 ? 30.431 58.674 62.793  1.00 86.61  ? 328  TYR B CD2 1 
ATOM   3657 C CE1 . TYR B 2 226 ? 31.348 57.994 60.271  1.00 88.81  ? 328  TYR B CE1 1 
ATOM   3658 C CE2 . TYR B 2 226 ? 29.605 58.834 61.689  1.00 89.43  ? 328  TYR B CE2 1 
ATOM   3659 C CZ  . TYR B 2 226 ? 30.065 58.495 60.428  1.00 90.63  ? 328  TYR B CZ  1 
ATOM   3660 O OH  . TYR B 2 226 ? 29.236 58.672 59.332  1.00 93.20  ? 328  TYR B OH  1 
ATOM   3661 N N   . GLN B 2 227 ? 31.873 60.751 65.429  1.00 77.36  ? 329  GLN B N   1 
ATOM   3662 C CA  . GLN B 2 227 ? 30.932 61.851 65.592  1.00 77.14  ? 329  GLN B CA  1 
ATOM   3663 C C   . GLN B 2 227 ? 31.562 63.235 65.382  1.00 77.90  ? 329  GLN B C   1 
ATOM   3664 O O   . GLN B 2 227 ? 31.083 64.002 64.545  1.00 77.19  ? 329  GLN B O   1 
ATOM   3665 C CB  . GLN B 2 227 ? 30.264 61.790 66.977  1.00 74.83  ? 329  GLN B CB  1 
ATOM   3666 C CG  . GLN B 2 227 ? 29.238 60.674 67.140  1.00 72.10  ? 329  GLN B CG  1 
ATOM   3667 C CD  . GLN B 2 227 ? 28.081 60.772 66.157  1.00 69.96  ? 329  GLN B CD  1 
ATOM   3668 O OE1 . GLN B 2 227 ? 27.393 61.784 66.096  1.00 69.87  ? 329  GLN B OE1 1 
ATOM   3669 N NE2 . GLN B 2 227 ? 27.859 59.710 65.391  1.00 68.11  ? 329  GLN B NE2 1 
ATOM   3670 N N   . ILE B 2 228 ? 32.635 63.549 66.115  1.00 78.69  ? 330  ILE B N   1 
ATOM   3671 C CA  . ILE B 2 228 ? 33.283 64.858 66.006  1.00 80.02  ? 330  ILE B CA  1 
ATOM   3672 C C   . ILE B 2 228 ? 34.017 65.191 64.698  1.00 83.54  ? 330  ILE B C   1 
ATOM   3673 O O   . ILE B 2 228 ? 34.869 66.081 64.668  1.00 84.27  ? 330  ILE B O   1 
ATOM   3674 C CB  . ILE B 2 228 ? 34.251 65.111 67.189  1.00 77.38  ? 330  ILE B CB  1 
ATOM   3675 C CG1 . ILE B 2 228 ? 35.372 64.084 67.210  1.00 75.24  ? 330  ILE B CG1 1 
ATOM   3676 C CG2 . ILE B 2 228 ? 33.495 65.053 68.484  1.00 76.19  ? 330  ILE B CG2 1 
ATOM   3677 C CD1 . ILE B 2 228 ? 36.360 64.327 68.320  1.00 73.16  ? 330  ILE B CD1 1 
ATOM   3678 N N   . GLN B 2 229 ? 33.680 64.482 63.623  1.00 86.76  ? 331  GLN B N   1 
ATOM   3679 C CA  . GLN B 2 229 ? 34.260 64.717 62.300  1.00 89.36  ? 331  GLN B CA  1 
ATOM   3680 C C   . GLN B 2 229 ? 33.074 64.775 61.339  1.00 89.86  ? 331  GLN B C   1 
ATOM   3681 O O   . GLN B 2 229 ? 33.047 65.574 60.406  1.00 89.68  ? 331  GLN B O   1 
ATOM   3682 C CB  . GLN B 2 229 ? 35.233 63.592 61.941  1.00 91.00  ? 331  GLN B CB  1 
ATOM   3683 C CG  . GLN B 2 229 ? 36.300 63.397 63.021  1.00 95.24  ? 331  GLN B CG  1 
ATOM   3684 C CD  . GLN B 2 229 ? 37.397 62.426 62.626  1.00 97.08  ? 331  GLN B CD  1 
ATOM   3685 O OE1 . GLN B 2 229 ? 38.117 62.657 61.656  1.00 98.88  ? 331  GLN B OE1 1 
ATOM   3686 N NE2 . GLN B 2 229 ? 37.536 61.338 63.384  1.00 97.52  ? 331  GLN B NE2 1 
ATOM   3687 N N   . HIS B 2 230 ? 32.080 63.933 61.605  1.00 91.41  ? 332  HIS B N   1 
ATOM   3688 C CA  . HIS B 2 230 ? 30.839 63.898 60.837  1.00 93.46  ? 332  HIS B CA  1 
ATOM   3689 C C   . HIS B 2 230 ? 30.046 65.178 61.177  1.00 92.91  ? 332  HIS B C   1 
ATOM   3690 O O   . HIS B 2 230 ? 29.005 65.473 60.584  1.00 93.43  ? 332  HIS B O   1 
ATOM   3691 C CB  . HIS B 2 230 ? 30.065 62.618 61.210  1.00 96.56  ? 332  HIS B CB  1 
ATOM   3692 C CG  . HIS B 2 230 ? 28.574 62.722 61.085  1.00 99.77  ? 332  HIS B CG  1 
ATOM   3693 N ND1 . HIS B 2 230 ? 27.771 63.201 62.100  1.00 100.75 ? 332  HIS B ND1 1 
ATOM   3694 C CD2 . HIS B 2 230 ? 27.738 62.366 60.079  1.00 100.64 ? 332  HIS B CD2 1 
ATOM   3695 C CE1 . HIS B 2 230 ? 26.505 63.133 61.726  1.00 102.15 ? 332  HIS B CE1 1 
ATOM   3696 N NE2 . HIS B 2 230 ? 26.457 62.630 60.505  1.00 102.53 ? 332  HIS B NE2 1 
ATOM   3697 N N   . ILE B 2 231 ? 30.569 65.940 62.133  1.00 91.65  ? 333  ILE B N   1 
ATOM   3698 C CA  . ILE B 2 231 ? 29.967 67.183 62.569  1.00 90.36  ? 333  ILE B CA  1 
ATOM   3699 C C   . ILE B 2 231 ? 30.839 68.338 62.113  1.00 90.72  ? 333  ILE B C   1 
ATOM   3700 O O   . ILE B 2 231 ? 31.938 68.548 62.628  1.00 89.78  ? 333  ILE B O   1 
ATOM   3701 C CB  . ILE B 2 231 ? 29.847 67.224 64.087  1.00 89.61  ? 333  ILE B CB  1 
ATOM   3702 C CG1 . ILE B 2 231 ? 28.828 66.181 64.543  1.00 88.79  ? 333  ILE B CG1 1 
ATOM   3703 C CG2 . ILE B 2 231 ? 29.463 68.618 64.537  1.00 89.12  ? 333  ILE B CG2 1 
ATOM   3704 C CD1 . ILE B 2 231 ? 28.707 66.069 66.041  1.00 88.15  ? 333  ILE B CD1 1 
ATOM   3705 N N   . GLN B 2 232 ? 30.322 69.077 61.137  1.00 91.63  ? 334  GLN B N   1 
ATOM   3706 C CA  . GLN B 2 232 ? 31.003 70.220 60.547  1.00 92.19  ? 334  GLN B CA  1 
ATOM   3707 C C   . GLN B 2 232 ? 31.813 71.080 61.506  1.00 91.76  ? 334  GLN B C   1 
ATOM   3708 O O   . GLN B 2 232 ? 31.309 71.540 62.529  1.00 90.45  ? 334  GLN B O   1 
ATOM   3709 C CB  . GLN B 2 232 ? 29.988 71.102 59.816  1.00 93.06  ? 334  GLN B CB  1 
ATOM   3710 C CG  . GLN B 2 232 ? 29.401 70.471 58.558  1.00 95.36  ? 334  GLN B CG  1 
ATOM   3711 C CD  . GLN B 2 232 ? 30.428 70.286 57.440  1.00 97.28  ? 334  GLN B CD  1 
ATOM   3712 O OE1 . GLN B 2 232 ? 30.952 71.261 56.889  1.00 97.31  ? 334  GLN B OE1 1 
ATOM   3713 N NE2 . GLN B 2 232 ? 30.724 69.026 57.108  1.00 97.81  ? 334  GLN B NE2 1 
ATOM   3714 N N   . GLY B 2 233 ? 33.079 71.283 61.157  1.00 92.45  ? 335  GLY B N   1 
ATOM   3715 C CA  . GLY B 2 233 ? 33.967 72.115 61.947  1.00 93.91  ? 335  GLY B CA  1 
ATOM   3716 C C   . GLY B 2 233 ? 34.161 71.833 63.425  1.00 94.70  ? 335  GLY B C   1 
ATOM   3717 O O   . GLY B 2 233 ? 35.144 72.295 64.000  1.00 95.14  ? 335  GLY B O   1 
ATOM   3718 N N   . LEU B 2 234 ? 33.250 71.091 64.047  1.00 95.31  ? 336  LEU B N   1 
ATOM   3719 C CA  . LEU B 2 234 ? 33.358 70.780 65.469  1.00 96.42  ? 336  LEU B CA  1 
ATOM   3720 C C   . LEU B 2 234 ? 34.744 70.272 65.848  1.00 96.06  ? 336  LEU B C   1 
ATOM   3721 O O   . LEU B 2 234 ? 35.364 70.766 66.795  1.00 95.86  ? 336  LEU B O   1 
ATOM   3722 C CB  . LEU B 2 234 ? 32.312 69.739 65.858  1.00 98.11  ? 336  LEU B CB  1 
ATOM   3723 C CG  . LEU B 2 234 ? 32.447 69.216 67.292  1.00 99.24  ? 336  LEU B CG  1 
ATOM   3724 C CD1 . LEU B 2 234 ? 32.445 70.389 68.258  1.00 98.88  ? 336  LEU B CD1 1 
ATOM   3725 C CD2 . LEU B 2 234 ? 31.315 68.244 67.608  1.00 99.28  ? 336  LEU B CD2 1 
ATOM   3726 N N   . SER B 2 235 ? 35.207 69.267 65.111  1.00 95.78  ? 337  SER B N   1 
ATOM   3727 C CA  . SER B 2 235 ? 36.526 68.682 65.324  1.00 95.40  ? 337  SER B CA  1 
ATOM   3728 C C   . SER B 2 235 ? 37.526 69.817 65.562  1.00 94.47  ? 337  SER B C   1 
ATOM   3729 O O   . SER B 2 235 ? 38.244 69.844 66.573  1.00 93.82  ? 337  SER B O   1 
ATOM   3730 C CB  . SER B 2 235 ? 36.924 67.882 64.078  1.00 96.48  ? 337  SER B CB  1 
ATOM   3731 O OG  . SER B 2 235 ? 38.217 67.324 64.204  1.00 97.80  ? 337  SER B OG  1 
ATOM   3732 N N   . ALA B 2 236 ? 37.539 70.756 64.616  1.00 92.67  ? 338  ALA B N   1 
ATOM   3733 C CA  . ALA B 2 236 ? 38.406 71.925 64.637  1.00 90.72  ? 338  ALA B CA  1 
ATOM   3734 C C   . ALA B 2 236 ? 38.378 72.713 65.952  1.00 89.71  ? 338  ALA B C   1 
ATOM   3735 O O   . ALA B 2 236 ? 39.413 73.195 66.406  1.00 90.13  ? 338  ALA B O   1 
ATOM   3736 C CB  . ALA B 2 236 ? 38.040 72.840 63.475  1.00 89.07  ? 338  ALA B CB  1 
ATOM   3737 N N   . MET B 2 237 ? 37.204 72.844 66.562  1.00 88.07  ? 339  MET B N   1 
ATOM   3738 C CA  . MET B 2 237 ? 37.070 73.592 67.810  1.00 86.24  ? 339  MET B CA  1 
ATOM   3739 C C   . MET B 2 237 ? 37.908 73.102 68.996  1.00 85.96  ? 339  MET B C   1 
ATOM   3740 O O   . MET B 2 237 ? 38.358 73.897 69.827  1.00 85.81  ? 339  MET B O   1 
ATOM   3741 C CB  . MET B 2 237 ? 35.599 73.655 68.223  1.00 85.22  ? 339  MET B CB  1 
ATOM   3742 C CG  . MET B 2 237 ? 34.901 74.914 67.757  1.00 83.86  ? 339  MET B CG  1 
ATOM   3743 S SD  . MET B 2 237 ? 33.370 75.256 68.630  1.00 81.66  ? 339  MET B SD  1 
ATOM   3744 C CE  . MET B 2 237 ? 32.343 75.732 67.263  1.00 81.71  ? 339  MET B CE  1 
ATOM   3745 N N   . MET B 2 238 ? 38.115 71.797 69.083  1.00 85.47  ? 340  MET B N   1 
ATOM   3746 C CA  . MET B 2 238 ? 38.892 71.232 70.176  1.00 84.82  ? 340  MET B CA  1 
ATOM   3747 C C   . MET B 2 238 ? 40.038 70.421 69.579  1.00 84.25  ? 340  MET B C   1 
ATOM   3748 O O   . MET B 2 238 ? 39.946 69.201 69.414  1.00 84.90  ? 340  MET B O   1 
ATOM   3749 C CB  . MET B 2 238 ? 37.975 70.360 71.030  1.00 84.93  ? 340  MET B CB  1 
ATOM   3750 C CG  . MET B 2 238 ? 37.099 69.440 70.189  1.00 83.22  ? 340  MET B CG  1 
ATOM   3751 S SD  . MET B 2 238 ? 35.608 68.877 71.011  1.00 80.49  ? 340  MET B SD  1 
ATOM   3752 C CE  . MET B 2 238 ? 34.632 68.354 69.602  1.00 77.83  ? 340  MET B CE  1 
ATOM   3753 N N   . PRO B 2 239 ? 41.139 71.104 69.233  1.00 83.11  ? 341  PRO B N   1 
ATOM   3754 C CA  . PRO B 2 239 ? 42.334 70.492 68.642  1.00 81.10  ? 341  PRO B CA  1 
ATOM   3755 C C   . PRO B 2 239 ? 43.013 69.434 69.517  1.00 78.80  ? 341  PRO B C   1 
ATOM   3756 O O   . PRO B 2 239 ? 43.735 68.578 69.012  1.00 77.60  ? 341  PRO B O   1 
ATOM   3757 C CB  . PRO B 2 239 ? 43.228 71.699 68.355  1.00 82.04  ? 341  PRO B CB  1 
ATOM   3758 C CG  . PRO B 2 239 ? 42.860 72.659 69.451  1.00 82.87  ? 341  PRO B CG  1 
ATOM   3759 C CD  . PRO B 2 239 ? 41.351 72.541 69.485  1.00 83.55  ? 341  PRO B CD  1 
ATOM   3760 N N   . LEU B 2 240 ? 42.788 69.496 70.824  1.00 76.01  ? 342  LEU B N   1 
ATOM   3761 C CA  . LEU B 2 240 ? 43.372 68.519 71.726  1.00 73.88  ? 342  LEU B CA  1 
ATOM   3762 C C   . LEU B 2 240 ? 42.731 67.177 71.448  1.00 72.83  ? 342  LEU B C   1 
ATOM   3763 O O   . LEU B 2 240 ? 43.407 66.194 71.154  1.00 72.29  ? 342  LEU B O   1 
ATOM   3764 C CB  . LEU B 2 240 ? 43.104 68.908 73.176  1.00 74.84  ? 342  LEU B CB  1 
ATOM   3765 C CG  . LEU B 2 240 ? 43.446 67.847 74.230  1.00 74.62  ? 342  LEU B CG  1 
ATOM   3766 C CD1 . LEU B 2 240 ? 44.918 67.455 74.113  1.00 74.32  ? 342  LEU B CD1 1 
ATOM   3767 C CD2 . LEU B 2 240 ? 43.129 68.388 75.625  1.00 73.01  ? 342  LEU B CD2 1 
ATOM   3768 N N   . LEU B 2 241 ? 41.409 67.147 71.550  1.00 72.30  ? 343  LEU B N   1 
ATOM   3769 C CA  . LEU B 2 241 ? 40.657 65.926 71.303  1.00 72.18  ? 343  LEU B CA  1 
ATOM   3770 C C   . LEU B 2 241 ? 41.015 65.373 69.934  1.00 72.00  ? 343  LEU B C   1 
ATOM   3771 O O   . LEU B 2 241 ? 41.261 64.184 69.787  1.00 71.41  ? 343  LEU B O   1 
ATOM   3772 C CB  . LEU B 2 241 ? 39.151 66.201 71.380  1.00 69.45  ? 343  LEU B CB  1 
ATOM   3773 C CG  . LEU B 2 241 ? 38.539 66.193 72.780  1.00 66.52  ? 343  LEU B CG  1 
ATOM   3774 C CD1 . LEU B 2 241 ? 38.411 64.763 73.274  1.00 64.78  ? 343  LEU B CD1 1 
ATOM   3775 C CD2 . LEU B 2 241 ? 39.383 67.026 73.721  1.00 63.95  ? 343  LEU B CD2 1 
ATOM   3776 N N   . GLN B 2 242 ? 41.036 66.257 68.942  1.00 72.51  ? 344  GLN B N   1 
ATOM   3777 C CA  . GLN B 2 242 ? 41.378 65.924 67.561  1.00 73.02  ? 344  GLN B CA  1 
ATOM   3778 C C   . GLN B 2 242 ? 42.592 64.974 67.501  1.00 72.50  ? 344  GLN B C   1 
ATOM   3779 O O   . GLN B 2 242 ? 42.622 64.052 66.680  1.00 71.94  ? 344  GLN B O   1 
ATOM   3780 C CB  . GLN B 2 242 ? 41.670 67.232 66.807  1.00 74.62  ? 344  GLN B CB  1 
ATOM   3781 C CG  . GLN B 2 242 ? 41.348 67.221 65.313  1.00 76.55  ? 344  GLN B CG  1 
ATOM   3782 C CD  . GLN B 2 242 ? 41.419 68.615 64.677  1.00 77.36  ? 344  GLN B CD  1 
ATOM   3783 O OE1 . GLN B 2 242 ? 41.289 68.759 63.457  1.00 76.35  ? 344  GLN B OE1 1 
ATOM   3784 N NE2 . GLN B 2 242 ? 41.622 69.642 65.504  1.00 76.86  ? 344  GLN B NE2 1 
ATOM   3785 N N   . GLU B 2 243 ? 43.582 65.213 68.369  1.00 71.88  ? 345  GLU B N   1 
ATOM   3786 C CA  . GLU B 2 243 ? 44.797 64.390 68.460  1.00 70.91  ? 345  GLU B CA  1 
ATOM   3787 C C   . GLU B 2 243 ? 44.531 63.104 69.224  1.00 70.38  ? 345  GLU B C   1 
ATOM   3788 O O   . GLU B 2 243 ? 45.109 62.064 68.924  1.00 71.08  ? 345  GLU B O   1 
ATOM   3789 C CB  . GLU B 2 243 ? 45.924 65.131 69.185  1.00 70.68  ? 345  GLU B CB  1 
ATOM   3790 C CG  . GLU B 2 243 ? 46.584 66.233 68.381  1.00 70.93  ? 345  GLU B CG  1 
ATOM   3791 C CD  . GLU B 2 243 ? 47.786 66.819 69.092  1.00 69.88  ? 345  GLU B CD  1 
ATOM   3792 O OE1 . GLU B 2 243 ? 48.370 67.808 68.591  1.00 68.79  ? 345  GLU B OE1 1 
ATOM   3793 O OE2 . GLU B 2 243 ? 48.143 66.278 70.155  1.00 68.48  ? 345  GLU B OE2 1 
ATOM   3794 N N   . ILE B 2 244 ? 43.687 63.190 70.241  1.00 68.88  ? 346  ILE B N   1 
ATOM   3795 C CA  . ILE B 2 244 ? 43.330 62.025 71.030  1.00 67.90  ? 346  ILE B CA  1 
ATOM   3796 C C   . ILE B 2 244 ? 42.587 61.029 70.147  1.00 67.07  ? 346  ILE B C   1 
ATOM   3797 O O   . ILE B 2 244 ? 42.667 59.813 70.343  1.00 67.80  ? 346  ILE B O   1 
ATOM   3798 C CB  . ILE B 2 244 ? 42.419 62.420 72.196  1.00 68.39  ? 346  ILE B CB  1 
ATOM   3799 C CG1 . ILE B 2 244 ? 43.162 63.404 73.103  1.00 68.10  ? 346  ILE B CG1 1 
ATOM   3800 C CG2 . ILE B 2 244 ? 41.952 61.171 72.951  1.00 68.70  ? 346  ILE B CG2 1 
ATOM   3801 C CD1 . ILE B 2 244 ? 44.521 62.912 73.562  1.00 65.57  ? 346  ILE B CD1 1 
ATOM   3802 N N   . CYS B 2 245 ? 41.871 61.562 69.165  1.00 65.76  ? 347  CYS B N   1 
ATOM   3803 C CA  . CYS B 2 245 ? 41.097 60.753 68.245  1.00 65.12  ? 347  CYS B CA  1 
ATOM   3804 C C   . CYS B 2 245 ? 41.818 60.450 66.930  1.00 65.36  ? 347  CYS B C   1 
ATOM   3805 O O   . CYS B 2 245 ? 41.302 59.711 66.096  1.00 65.04  ? 347  CYS B O   1 
ATOM   3806 C CB  . CYS B 2 245 ? 39.756 61.445 67.956  1.00 64.76  ? 347  CYS B CB  1 
ATOM   3807 S SG  . CYS B 2 245 ? 38.666 61.663 69.405  1.00 62.51  ? 347  CYS B SG  1 
ATOM   3808 N N   . SER B 2 246 ? 43.008 61.011 66.742  1.00 66.14  ? 348  SER B N   1 
ATOM   3809 C CA  . SER B 2 246 ? 43.770 60.788 65.515  1.00 66.83  ? 348  SER B CA  1 
ATOM   3810 C C   . SER B 2 246 ? 44.347 59.374 65.428  1.00 67.48  ? 348  SER B C   1 
ATOM   3811 O O   . SER B 2 246 ? 44.497 58.869 64.291  1.00 67.59  ? 348  SER B O   1 
ATOM   3812 C CB  . SER B 2 246 ? 44.900 61.818 65.397  1.00 67.29  ? 348  SER B CB  1 
ATOM   3813 O OG  . SER B 2 246 ? 45.816 61.717 66.474  1.00 69.13  ? 348  SER B OG  1 
ATOM   3814 O OXT . SER B 2 246 ? 44.658 58.795 66.493  1.00 67.66  ? 348  SER B OXT 1 
ATOM   3815 N N   . ASN C 1 1   ? 56.826 77.977 24.135  1.00 121.50 ? 227  ASN C N   1 
ATOM   3816 C CA  . ASN C 1 1   ? 57.868 78.825 23.497  1.00 120.36 ? 227  ASN C CA  1 
ATOM   3817 C C   . ASN C 1 1   ? 58.176 80.022 24.382  1.00 120.21 ? 227  ASN C C   1 
ATOM   3818 O O   . ASN C 1 1   ? 58.970 79.947 25.328  1.00 119.90 ? 227  ASN C O   1 
ATOM   3819 C CB  . ASN C 1 1   ? 57.374 79.353 22.147  1.00 120.34 ? 227  ASN C CB  1 
ATOM   3820 C CG  . ASN C 1 1   ? 56.734 78.287 21.299  1.00 120.02 ? 227  ASN C CG  1 
ATOM   3821 O OD1 . ASN C 1 1   ? 57.355 77.277 20.978  1.00 121.25 ? 227  ASN C OD1 1 
ATOM   3822 N ND2 . ASN C 1 1   ? 55.481 78.506 20.924  1.00 119.25 ? 227  ASN C ND2 1 
ATOM   3823 N N   . GLU C 1 2   ? 57.511 81.123 24.042  1.00 119.73 ? 228  GLU C N   1 
ATOM   3824 C CA  . GLU C 1 2   ? 57.650 82.404 24.713  1.00 118.85 ? 228  GLU C CA  1 
ATOM   3825 C C   . GLU C 1 2   ? 56.693 82.514 25.906  1.00 118.31 ? 228  GLU C C   1 
ATOM   3826 O O   . GLU C 1 2   ? 57.059 83.052 26.954  1.00 118.28 ? 228  GLU C O   1 
ATOM   3827 C CB  . GLU C 1 2   ? 57.364 83.540 23.715  1.00 119.61 ? 228  GLU C CB  1 
ATOM   3828 C CG  . GLU C 1 2   ? 58.047 83.447 22.328  1.00 119.25 ? 228  GLU C CG  1 
ATOM   3829 C CD  . GLU C 1 2   ? 57.371 82.462 21.363  1.00 119.54 ? 228  GLU C CD  1 
ATOM   3830 O OE1 . GLU C 1 2   ? 56.125 82.356 21.379  1.00 118.17 ? 228  GLU C OE1 1 
ATOM   3831 O OE2 . GLU C 1 2   ? 58.086 81.802 20.575  1.00 119.52 ? 228  GLU C OE2 1 
ATOM   3832 N N   . ASP C 1 3   ? 55.468 82.012 25.736  1.00 117.48 ? 229  ASP C N   1 
ATOM   3833 C CA  . ASP C 1 3   ? 54.453 82.049 26.795  1.00 116.64 ? 229  ASP C CA  1 
ATOM   3834 C C   . ASP C 1 3   ? 54.775 81.087 27.938  1.00 114.56 ? 229  ASP C C   1 
ATOM   3835 O O   . ASP C 1 3   ? 54.539 81.398 29.111  1.00 114.34 ? 229  ASP C O   1 
ATOM   3836 C CB  . ASP C 1 3   ? 53.065 81.711 26.227  1.00 118.82 ? 229  ASP C CB  1 
ATOM   3837 C CG  . ASP C 1 3   ? 52.190 82.946 26.018  1.00 120.10 ? 229  ASP C CG  1 
ATOM   3838 O OD1 . ASP C 1 3   ? 51.914 83.669 27.006  1.00 120.03 ? 229  ASP C OD1 1 
ATOM   3839 O OD2 . ASP C 1 3   ? 51.772 83.184 24.864  1.00 120.65 ? 229  ASP C OD2 1 
ATOM   3840 N N   . MET C 1 4   ? 55.301 79.915 27.586  1.00 111.51 ? 230  MET C N   1 
ATOM   3841 C CA  . MET C 1 4   ? 55.666 78.910 28.575  1.00 108.08 ? 230  MET C CA  1 
ATOM   3842 C C   . MET C 1 4   ? 57.171 78.648 28.497  1.00 106.21 ? 230  MET C C   1 
ATOM   3843 O O   . MET C 1 4   ? 57.631 77.762 27.767  1.00 105.72 ? 230  MET C O   1 
ATOM   3844 C CB  . MET C 1 4   ? 54.879 77.619 28.331  1.00 106.81 ? 230  MET C CB  1 
ATOM   3845 C CG  . MET C 1 4   ? 54.440 76.933 29.609  1.00 105.78 ? 230  MET C CG  1 
ATOM   3846 S SD  . MET C 1 4   ? 53.574 78.073 30.720  1.00 104.88 ? 230  MET C SD  1 
ATOM   3847 C CE  . MET C 1 4   ? 51.887 77.567 30.492  1.00 105.67 ? 230  MET C CE  1 
ATOM   3848 N N   . PRO C 1 5   ? 57.959 79.437 29.254  1.00 104.37 ? 231  PRO C N   1 
ATOM   3849 C CA  . PRO C 1 5   ? 59.421 79.360 29.328  1.00 102.52 ? 231  PRO C CA  1 
ATOM   3850 C C   . PRO C 1 5   ? 59.952 78.032 29.866  1.00 100.43 ? 231  PRO C C   1 
ATOM   3851 O O   . PRO C 1 5   ? 59.984 77.812 31.078  1.00 99.76  ? 231  PRO C O   1 
ATOM   3852 C CB  . PRO C 1 5   ? 59.778 80.535 30.238  1.00 102.62 ? 231  PRO C CB  1 
ATOM   3853 C CG  . PRO C 1 5   ? 58.598 80.616 31.153  1.00 103.01 ? 231  PRO C CG  1 
ATOM   3854 C CD  . PRO C 1 5   ? 57.451 80.464 30.183  1.00 103.73 ? 231  PRO C CD  1 
ATOM   3855 N N   . VAL C 1 6   ? 60.375 77.159 28.955  1.00 98.02  ? 232  VAL C N   1 
ATOM   3856 C CA  . VAL C 1 6   ? 60.926 75.852 29.314  1.00 95.38  ? 232  VAL C CA  1 
ATOM   3857 C C   . VAL C 1 6   ? 62.116 75.994 30.289  1.00 93.96  ? 232  VAL C C   1 
ATOM   3858 O O   . VAL C 1 6   ? 62.422 75.078 31.055  1.00 92.72  ? 232  VAL C O   1 
ATOM   3859 C CB  . VAL C 1 6   ? 61.364 75.091 28.027  1.00 94.99  ? 232  VAL C CB  1 
ATOM   3860 C CG1 . VAL C 1 6   ? 61.923 73.734 28.375  1.00 94.19  ? 232  VAL C CG1 1 
ATOM   3861 C CG2 . VAL C 1 6   ? 60.177 74.944 27.084  1.00 93.96  ? 232  VAL C CG2 1 
ATOM   3862 N N   . GLU C 1 7   ? 62.773 77.152 30.253  1.00 93.41  ? 233  GLU C N   1 
ATOM   3863 C CA  . GLU C 1 7   ? 63.911 77.453 31.120  1.00 92.71  ? 233  GLU C CA  1 
ATOM   3864 C C   . GLU C 1 7   ? 63.435 77.790 32.530  1.00 91.45  ? 233  GLU C C   1 
ATOM   3865 O O   . GLU C 1 7   ? 64.176 77.616 33.494  1.00 90.46  ? 233  GLU C O   1 
ATOM   3866 C CB  . GLU C 1 7   ? 64.706 78.650 30.581  1.00 93.46  ? 233  GLU C CB  1 
ATOM   3867 C CG  . GLU C 1 7   ? 65.313 78.490 29.187  1.00 95.02  ? 233  GLU C CG  1 
ATOM   3868 C CD  . GLU C 1 7   ? 64.296 78.636 28.056  1.00 96.38  ? 233  GLU C CD  1 
ATOM   3869 O OE1 . GLU C 1 7   ? 63.436 79.545 28.131  1.00 96.27  ? 233  GLU C OE1 1 
ATOM   3870 O OE2 . GLU C 1 7   ? 64.372 77.850 27.084  1.00 96.93  ? 233  GLU C OE2 1 
ATOM   3871 N N   . ARG C 1 8   ? 62.209 78.304 32.629  1.00 90.58  ? 234  ARG C N   1 
ATOM   3872 C CA  . ARG C 1 8   ? 61.595 78.673 33.903  1.00 90.17  ? 234  ARG C CA  1 
ATOM   3873 C C   . ARG C 1 8   ? 60.798 77.513 34.492  1.00 89.05  ? 234  ARG C C   1 
ATOM   3874 O O   . ARG C 1 8   ? 60.532 77.476 35.698  1.00 87.88  ? 234  ARG C O   1 
ATOM   3875 C CB  . ARG C 1 8   ? 60.678 79.884 33.728  1.00 91.80  ? 234  ARG C CB  1 
ATOM   3876 C CG  . ARG C 1 8   ? 61.420 81.191 33.530  1.00 94.76  ? 234  ARG C CG  1 
ATOM   3877 C CD  . ARG C 1 8   ? 60.464 82.378 33.556  1.00 97.62  ? 234  ARG C CD  1 
ATOM   3878 N NE  . ARG C 1 8   ? 59.668 82.437 34.781  1.00 99.91  ? 234  ARG C NE  1 
ATOM   3879 C CZ  . ARG C 1 8   ? 58.832 83.428 35.087  1.00 101.12 ? 234  ARG C CZ  1 
ATOM   3880 N NH1 . ARG C 1 8   ? 58.677 84.457 34.258  1.00 100.96 ? 234  ARG C NH1 1 
ATOM   3881 N NH2 . ARG C 1 8   ? 58.145 83.391 36.223  1.00 101.76 ? 234  ARG C NH2 1 
ATOM   3882 N N   . ILE C 1 9   ? 60.391 76.586 33.630  1.00 87.59  ? 235  ILE C N   1 
ATOM   3883 C CA  . ILE C 1 9   ? 59.671 75.401 34.070  1.00 85.93  ? 235  ILE C CA  1 
ATOM   3884 C C   . ILE C 1 9   ? 60.758 74.519 34.664  1.00 86.07  ? 235  ILE C C   1 
ATOM   3885 O O   . ILE C 1 9   ? 60.702 74.160 35.833  1.00 86.00  ? 235  ILE C O   1 
ATOM   3886 C CB  . ILE C 1 9   ? 58.995 74.668 32.891  1.00 84.82  ? 235  ILE C CB  1 
ATOM   3887 C CG1 . ILE C 1 9   ? 57.705 75.389 32.495  1.00 83.45  ? 235  ILE C CG1 1 
ATOM   3888 C CG2 . ILE C 1 9   ? 58.706 73.228 33.263  1.00 83.47  ? 235  ILE C CG2 1 
ATOM   3889 C CD1 . ILE C 1 9   ? 56.961 74.704 31.361  1.00 82.02  ? 235  ILE C CD1 1 
ATOM   3890 N N   . LEU C 1 10  ? 61.762 74.188 33.859  1.00 85.97  ? 236  LEU C N   1 
ATOM   3891 C CA  . LEU C 1 10  ? 62.868 73.382 34.349  1.00 85.64  ? 236  LEU C CA  1 
ATOM   3892 C C   . LEU C 1 10  ? 63.467 74.093 35.562  1.00 86.32  ? 236  LEU C C   1 
ATOM   3893 O O   . LEU C 1 10  ? 63.848 73.455 36.536  1.00 84.56  ? 236  LEU C O   1 
ATOM   3894 C CB  . LEU C 1 10  ? 63.930 73.224 33.265  1.00 84.58  ? 236  LEU C CB  1 
ATOM   3895 C CG  . LEU C 1 10  ? 65.191 72.488 33.714  1.00 83.74  ? 236  LEU C CG  1 
ATOM   3896 C CD1 . LEU C 1 10  ? 64.828 71.097 34.189  1.00 83.84  ? 236  LEU C CD1 1 
ATOM   3897 C CD2 . LEU C 1 10  ? 66.173 72.417 32.571  1.00 83.50  ? 236  LEU C CD2 1 
ATOM   3898 N N   . GLU C 1 11  ? 63.537 75.422 35.491  1.00 89.40  ? 237  GLU C N   1 
ATOM   3899 C CA  . GLU C 1 11  ? 64.072 76.250 36.574  1.00 92.35  ? 237  GLU C CA  1 
ATOM   3900 C C   . GLU C 1 11  ? 63.263 76.040 37.847  1.00 93.02  ? 237  GLU C C   1 
ATOM   3901 O O   . GLU C 1 11  ? 63.766 76.230 38.954  1.00 92.31  ? 237  GLU C O   1 
ATOM   3902 C CB  . GLU C 1 11  ? 64.035 77.735 36.173  1.00 94.06  ? 237  GLU C CB  1 
ATOM   3903 C CG  . GLU C 1 11  ? 64.705 78.697 37.159  1.00 97.81  ? 237  GLU C CG  1 
ATOM   3904 C CD  . GLU C 1 11  ? 64.822 80.125 36.615  1.00 99.93  ? 237  GLU C CD  1 
ATOM   3905 O OE1 . GLU C 1 11  ? 65.415 80.299 35.525  1.00 101.79 ? 237  GLU C OE1 1 
ATOM   3906 O OE2 . GLU C 1 11  ? 64.331 81.070 37.278  1.00 99.94  ? 237  GLU C OE2 1 
ATOM   3907 N N   . ALA C 1 12  ? 62.001 75.658 37.672  1.00 95.06  ? 238  ALA C N   1 
ATOM   3908 C CA  . ALA C 1 12  ? 61.094 75.393 38.785  1.00 97.13  ? 238  ALA C CA  1 
ATOM   3909 C C   . ALA C 1 12  ? 61.305 73.976 39.325  1.00 98.47  ? 238  ALA C C   1 
ATOM   3910 O O   . ALA C 1 12  ? 61.005 73.704 40.489  1.00 98.30  ? 238  ALA C O   1 
ATOM   3911 C CB  . ALA C 1 12  ? 59.654 75.573 38.334  1.00 96.26  ? 238  ALA C CB  1 
ATOM   3912 N N   . GLU C 1 13  ? 61.807 73.081 38.469  1.00 99.78  ? 239  GLU C N   1 
ATOM   3913 C CA  . GLU C 1 13  ? 62.092 71.694 38.844  1.00 100.78 ? 239  GLU C CA  1 
ATOM   3914 C C   . GLU C 1 13  ? 63.349 71.685 39.698  1.00 102.19 ? 239  GLU C C   1 
ATOM   3915 O O   . GLU C 1 13  ? 63.345 71.227 40.839  1.00 102.12 ? 239  GLU C O   1 
ATOM   3916 C CB  . GLU C 1 13  ? 62.350 70.829 37.599  1.00 100.14 ? 239  GLU C CB  1 
ATOM   3917 C CG  . GLU C 1 13  ? 61.118 70.501 36.768  1.00 100.70 ? 239  GLU C CG  1 
ATOM   3918 C CD  . GLU C 1 13  ? 60.256 69.406 37.382  1.00 100.15 ? 239  GLU C CD  1 
ATOM   3919 O OE1 . GLU C 1 13  ? 59.962 69.484 38.590  1.00 101.04 ? 239  GLU C OE1 1 
ATOM   3920 O OE2 . GLU C 1 13  ? 59.864 68.467 36.656  1.00 98.88  ? 239  GLU C OE2 1 
ATOM   3921 N N   . LEU C 1 14  ? 64.423 72.212 39.121  1.00 104.11 ? 240  LEU C N   1 
ATOM   3922 C CA  . LEU C 1 14  ? 65.721 72.278 39.771  1.00 105.94 ? 240  LEU C CA  1 
ATOM   3923 C C   . LEU C 1 14  ? 65.714 73.028 41.098  1.00 107.05 ? 240  LEU C C   1 
ATOM   3924 O O   . LEU C 1 14  ? 66.381 72.619 42.050  1.00 106.80 ? 240  LEU C O   1 
ATOM   3925 C CB  . LEU C 1 14  ? 66.727 72.909 38.812  1.00 106.33 ? 240  LEU C CB  1 
ATOM   3926 C CG  . LEU C 1 14  ? 66.708 72.220 37.442  1.00 107.29 ? 240  LEU C CG  1 
ATOM   3927 C CD1 . LEU C 1 14  ? 67.714 72.882 36.511  1.00 108.11 ? 240  LEU C CD1 1 
ATOM   3928 C CD2 . LEU C 1 14  ? 67.007 70.731 37.610  1.00 106.59 ? 240  LEU C CD2 1 
ATOM   3929 N N   . ALA C 1 15  ? 64.957 74.118 41.168  1.00 108.69 ? 241  ALA C N   1 
ATOM   3930 C CA  . ALA C 1 15  ? 64.878 74.907 42.395  1.00 110.48 ? 241  ALA C CA  1 
ATOM   3931 C C   . ALA C 1 15  ? 63.992 74.262 43.471  1.00 111.41 ? 241  ALA C C   1 
ATOM   3932 O O   . ALA C 1 15  ? 63.545 74.943 44.399  1.00 111.39 ? 241  ALA C O   1 
ATOM   3933 C CB  . ALA C 1 15  ? 64.373 76.317 42.077  1.00 110.62 ? 241  ALA C CB  1 
ATOM   3934 N N   . VAL C 1 16  ? 63.753 72.953 43.350  1.00 112.45 ? 242  VAL C N   1 
ATOM   3935 C CA  . VAL C 1 16  ? 62.919 72.211 44.302  1.00 112.91 ? 242  VAL C CA  1 
ATOM   3936 C C   . VAL C 1 16  ? 63.612 70.993 44.926  1.00 112.34 ? 242  VAL C C   1 
ATOM   3937 O O   . VAL C 1 16  ? 63.277 70.591 46.041  1.00 111.52 ? 242  VAL C O   1 
ATOM   3938 C CB  . VAL C 1 16  ? 61.594 71.738 43.634  1.00 113.44 ? 242  VAL C CB  1 
ATOM   3939 C CG1 . VAL C 1 16  ? 60.795 70.878 44.601  1.00 113.25 ? 242  VAL C CG1 1 
ATOM   3940 C CG2 . VAL C 1 16  ? 60.762 72.943 43.209  1.00 113.62 ? 242  VAL C CG2 1 
ATOM   3941 N N   . GLU C 1 17  ? 64.575 70.410 44.216  1.00 112.23 ? 243  GLU C N   1 
ATOM   3942 C CA  . GLU C 1 17  ? 65.287 69.240 44.724  1.00 112.48 ? 243  GLU C CA  1 
ATOM   3943 C C   . GLU C 1 17  ? 66.326 69.595 45.791  1.00 112.67 ? 243  GLU C C   1 
ATOM   3944 O O   . GLU C 1 17  ? 67.049 70.588 45.665  1.00 112.87 ? 243  GLU C O   1 
ATOM   3945 C CB  . GLU C 1 17  ? 65.935 68.477 43.562  1.00 112.33 ? 243  GLU C CB  1 
ATOM   3946 C CG  . GLU C 1 17  ? 66.879 69.283 42.688  1.00 112.00 ? 243  GLU C CG  1 
ATOM   3947 C CD  . GLU C 1 17  ? 67.106 68.625 41.334  1.00 112.50 ? 243  GLU C CD  1 
ATOM   3948 O OE1 . GLU C 1 17  ? 67.358 67.403 41.294  1.00 113.42 ? 243  GLU C OE1 1 
ATOM   3949 O OE2 . GLU C 1 17  ? 67.036 69.327 40.306  1.00 113.24 ? 243  GLU C OE2 1 
ATOM   3950 N N   . PRO C 1 18  ? 66.400 68.781 46.866  1.00 112.62 ? 244  PRO C N   1 
ATOM   3951 C CA  . PRO C 1 18  ? 67.300 68.902 48.025  1.00 112.20 ? 244  PRO C CA  1 
ATOM   3952 C C   . PRO C 1 18  ? 68.798 68.899 47.709  1.00 111.17 ? 244  PRO C C   1 
ATOM   3953 O O   . PRO C 1 18  ? 69.250 68.206 46.792  1.00 111.43 ? 244  PRO C O   1 
ATOM   3954 C CB  . PRO C 1 18  ? 66.896 67.713 48.902  1.00 112.63 ? 244  PRO C CB  1 
ATOM   3955 C CG  . PRO C 1 18  ? 65.444 67.538 48.585  1.00 112.63 ? 244  PRO C CG  1 
ATOM   3956 C CD  . PRO C 1 18  ? 65.454 67.670 47.074  1.00 112.92 ? 244  PRO C CD  1 
ATOM   3957 N N   . LYS C 1 19  ? 69.563 69.665 48.486  1.00 109.29 ? 245  LYS C N   1 
ATOM   3958 C CA  . LYS C 1 19  ? 71.006 69.755 48.282  1.00 107.36 ? 245  LYS C CA  1 
ATOM   3959 C C   . LYS C 1 19  ? 71.795 68.693 49.060  1.00 106.70 ? 245  LYS C C   1 
ATOM   3960 O O   . LYS C 1 19  ? 73.025 68.745 49.125  1.00 107.42 ? 245  LYS C O   1 
ATOM   3961 C CB  . LYS C 1 19  ? 71.503 71.163 48.646  1.00 105.74 ? 245  LYS C CB  1 
ATOM   3962 C CG  . LYS C 1 19  ? 72.404 71.769 47.571  1.00 103.56 ? 245  LYS C CG  1 
ATOM   3963 C CD  . LYS C 1 19  ? 72.887 73.172 47.904  1.00 100.80 ? 245  LYS C CD  1 
ATOM   3964 C CE  . LYS C 1 19  ? 73.787 73.691 46.786  1.00 99.40  ? 245  LYS C CE  1 
ATOM   3965 N NZ  . LYS C 1 19  ? 74.372 75.028 47.072  1.00 98.70  ? 245  LYS C NZ  1 
ATOM   3966 N N   . THR C 1 20  ? 71.083 67.726 49.634  1.00 105.67 ? 246  THR C N   1 
ATOM   3967 C CA  . THR C 1 20  ? 71.701 66.643 50.401  1.00 103.81 ? 246  THR C CA  1 
ATOM   3968 C C   . THR C 1 20  ? 70.821 65.384 50.364  1.00 102.17 ? 246  THR C C   1 
ATOM   3969 O O   . THR C 1 20  ? 70.055 65.125 51.298  1.00 101.83 ? 246  THR C O   1 
ATOM   3970 C CB  . THR C 1 20  ? 71.919 67.060 51.886  1.00 104.20 ? 246  THR C CB  1 
ATOM   3971 O OG1 . THR C 1 20  ? 70.675 67.499 52.454  1.00 104.67 ? 246  THR C OG1 1 
ATOM   3972 C CG2 . THR C 1 20  ? 72.954 68.181 51.990  1.00 102.62 ? 246  THR C CG2 1 
ATOM   3973 N N   . GLU C 1 21  ? 70.937 64.603 49.290  1.00 99.93  ? 247  GLU C N   1 
ATOM   3974 C CA  . GLU C 1 21  ? 70.134 63.388 49.143  1.00 97.92  ? 247  GLU C CA  1 
ATOM   3975 C C   . GLU C 1 21  ? 70.880 62.130 49.579  1.00 95.84  ? 247  GLU C C   1 
ATOM   3976 O O   . GLU C 1 21  ? 71.749 61.641 48.858  1.00 96.11  ? 247  GLU C O   1 
ATOM   3977 C CB  . GLU C 1 21  ? 69.671 63.204 47.683  1.00 98.83  ? 247  GLU C CB  1 
ATOM   3978 C CG  . GLU C 1 21  ? 69.135 64.469 46.994  1.00 100.36 ? 247  GLU C CG  1 
ATOM   3979 C CD  . GLU C 1 21  ? 68.322 64.185 45.722  1.00 101.26 ? 247  GLU C CD  1 
ATOM   3980 O OE1 . GLU C 1 21  ? 68.627 63.209 44.996  1.00 100.67 ? 247  GLU C OE1 1 
ATOM   3981 O OE2 . GLU C 1 21  ? 67.379 64.959 45.444  1.00 100.96 ? 247  GLU C OE2 1 
ATOM   3982 N N   . THR C 1 22  ? 70.536 61.607 50.755  1.00 93.54  ? 248  THR C N   1 
ATOM   3983 C CA  . THR C 1 22  ? 71.161 60.389 51.274  1.00 91.20  ? 248  THR C CA  1 
ATOM   3984 C C   . THR C 1 22  ? 70.145 59.264 51.211  1.00 90.57  ? 248  THR C C   1 
ATOM   3985 O O   . THR C 1 22  ? 68.952 59.521 51.072  1.00 91.43  ? 248  THR C O   1 
ATOM   3986 C CB  . THR C 1 22  ? 71.577 60.537 52.729  1.00 89.72  ? 248  THR C CB  1 
ATOM   3987 O OG1 . THR C 1 22  ? 70.418 60.813 53.522  1.00 89.33  ? 248  THR C OG1 1 
ATOM   3988 C CG2 . THR C 1 22  ? 72.575 61.659 52.881  1.00 90.14  ? 248  THR C CG2 1 
ATOM   3989 N N   . TYR C 1 23  ? 70.604 58.019 51.316  1.00 89.47  ? 249  TYR C N   1 
ATOM   3990 C CA  . TYR C 1 23  ? 69.681 56.892 51.262  1.00 88.56  ? 249  TYR C CA  1 
ATOM   3991 C C   . TYR C 1 23  ? 69.990 55.710 52.165  1.00 87.22  ? 249  TYR C C   1 
ATOM   3992 O O   . TYR C 1 23  ? 71.063 55.105 52.107  1.00 86.56  ? 249  TYR C O   1 
ATOM   3993 C CB  . TYR C 1 23  ? 69.511 56.410 49.823  1.00 89.81  ? 249  TYR C CB  1 
ATOM   3994 C CG  . TYR C 1 23  ? 68.847 57.447 48.951  1.00 93.12  ? 249  TYR C CG  1 
ATOM   3995 C CD1 . TYR C 1 23  ? 69.604 58.303 48.162  1.00 94.42  ? 249  TYR C CD1 1 
ATOM   3996 C CD2 . TYR C 1 23  ? 67.461 57.605 48.950  1.00 93.96  ? 249  TYR C CD2 1 
ATOM   3997 C CE1 . TYR C 1 23  ? 69.006 59.290 47.394  1.00 95.61  ? 249  TYR C CE1 1 
ATOM   3998 C CE2 . TYR C 1 23  ? 66.852 58.592 48.184  1.00 94.65  ? 249  TYR C CE2 1 
ATOM   3999 C CZ  . TYR C 1 23  ? 67.634 59.430 47.406  1.00 95.02  ? 249  TYR C CZ  1 
ATOM   4000 O OH  . TYR C 1 23  ? 67.055 60.405 46.627  1.00 94.02  ? 249  TYR C OH  1 
ATOM   4001 N N   . VAL C 1 24  ? 69.001 55.394 52.994  1.00 85.57  ? 250  VAL C N   1 
ATOM   4002 C CA  . VAL C 1 24  ? 69.065 54.308 53.953  1.00 82.92  ? 250  VAL C CA  1 
ATOM   4003 C C   . VAL C 1 24  ? 68.051 53.248 53.530  1.00 82.34  ? 250  VAL C C   1 
ATOM   4004 O O   . VAL C 1 24  ? 66.912 53.564 53.194  1.00 82.51  ? 250  VAL C O   1 
ATOM   4005 C CB  . VAL C 1 24  ? 68.721 54.839 55.361  1.00 81.74  ? 250  VAL C CB  1 
ATOM   4006 C CG1 . VAL C 1 24  ? 69.554 56.080 55.662  1.00 80.96  ? 250  VAL C CG1 1 
ATOM   4007 C CG2 . VAL C 1 24  ? 67.249 55.188 55.445  1.00 81.48  ? 250  VAL C CG2 1 
ATOM   4008 N N   . GLU C 1 25  ? 68.465 51.991 53.518  1.00 82.10  ? 251  GLU C N   1 
ATOM   4009 C CA  . GLU C 1 25  ? 67.552 50.926 53.137  1.00 82.77  ? 251  GLU C CA  1 
ATOM   4010 C C   . GLU C 1 25  ? 66.380 50.873 54.109  1.00 84.32  ? 251  GLU C C   1 
ATOM   4011 O O   . GLU C 1 25  ? 66.540 51.124 55.308  1.00 84.36  ? 251  GLU C O   1 
ATOM   4012 C CB  . GLU C 1 25  ? 68.278 49.578 53.126  1.00 81.89  ? 251  GLU C CB  1 
ATOM   4013 C CG  . GLU C 1 25  ? 68.662 49.107 51.747  1.00 81.29  ? 251  GLU C CG  1 
ATOM   4014 C CD  . GLU C 1 25  ? 67.458 48.694 50.923  1.00 82.36  ? 251  GLU C CD  1 
ATOM   4015 O OE1 . GLU C 1 25  ? 66.368 49.281 51.098  1.00 83.07  ? 251  GLU C OE1 1 
ATOM   4016 O OE2 . GLU C 1 25  ? 67.604 47.782 50.085  1.00 82.52  ? 251  GLU C OE2 1 
ATOM   4017 N N   . ALA C 1 26  ? 65.201 50.555 53.585  1.00 85.93  ? 252  ALA C N   1 
ATOM   4018 C CA  . ALA C 1 26  ? 63.995 50.452 54.403  1.00 87.67  ? 252  ALA C CA  1 
ATOM   4019 C C   . ALA C 1 26  ? 63.813 48.989 54.822  1.00 88.58  ? 252  ALA C C   1 
ATOM   4020 O O   . ALA C 1 26  ? 64.068 48.083 54.018  1.00 88.20  ? 252  ALA C O   1 
ATOM   4021 C CB  . ALA C 1 26  ? 62.788 50.925 53.602  1.00 87.32  ? 252  ALA C CB  1 
ATOM   4022 N N   . ASN C 1 27  ? 63.378 48.756 56.068  1.00 88.97  ? 253  ASN C N   1 
ATOM   4023 C CA  . ASN C 1 27  ? 63.192 47.385 56.560  1.00 88.66  ? 253  ASN C CA  1 
ATOM   4024 C C   . ASN C 1 27  ? 61.927 46.706 56.045  1.00 88.32  ? 253  ASN C C   1 
ATOM   4025 O O   . ASN C 1 27  ? 61.313 47.185 55.092  1.00 89.21  ? 253  ASN C O   1 
ATOM   4026 C CB  . ASN C 1 27  ? 63.258 47.327 58.100  1.00 89.02  ? 253  ASN C CB  1 
ATOM   4027 C CG  . ASN C 1 27  ? 62.286 48.273 58.787  1.00 89.78  ? 253  ASN C CG  1 
ATOM   4028 O OD1 . ASN C 1 27  ? 61.068 48.082 58.745  1.00 89.81  ? 253  ASN C OD1 1 
ATOM   4029 N ND2 . ASN C 1 27  ? 62.829 49.295 59.445  1.00 90.44  ? 253  ASN C ND2 1 
ATOM   4030 N N   . MET C 1 28  ? 61.543 45.586 56.656  1.00 87.97  ? 254  MET C N   1 
ATOM   4031 C CA  . MET C 1 28  ? 60.362 44.835 56.211  1.00 87.31  ? 254  MET C CA  1 
ATOM   4032 C C   . MET C 1 28  ? 59.002 45.315 56.714  1.00 86.68  ? 254  MET C C   1 
ATOM   4033 O O   . MET C 1 28  ? 57.966 44.795 56.296  1.00 84.31  ? 254  MET C O   1 
ATOM   4034 C CB  . MET C 1 28  ? 60.529 43.353 56.552  1.00 87.34  ? 254  MET C CB  1 
ATOM   4035 C CG  . MET C 1 28  ? 61.710 42.687 55.854  1.00 86.87  ? 254  MET C CG  1 
ATOM   4036 S SD  . MET C 1 28  ? 61.655 42.808 54.040  1.00 88.07  ? 254  MET C SD  1 
ATOM   4037 C CE  . MET C 1 28  ? 60.834 41.250 53.579  1.00 85.79  ? 254  MET C CE  1 
ATOM   4038 N N   . GLY C 1 29  ? 59.010 46.298 57.609  1.00 87.58  ? 255  GLY C N   1 
ATOM   4039 C CA  . GLY C 1 29  ? 57.770 46.837 58.133  1.00 89.24  ? 255  GLY C CA  1 
ATOM   4040 C C   . GLY C 1 29  ? 57.052 45.918 59.096  1.00 90.55  ? 255  GLY C C   1 
ATOM   4041 O O   . GLY C 1 29  ? 55.901 46.168 59.458  1.00 90.29  ? 255  GLY C O   1 
ATOM   4042 N N   . LEU C 1 30  ? 57.718 44.847 59.513  1.00 92.10  ? 256  LEU C N   1 
ATOM   4043 C CA  . LEU C 1 30  ? 57.123 43.911 60.461  1.00 93.54  ? 256  LEU C CA  1 
ATOM   4044 C C   . LEU C 1 30  ? 57.082 44.509 61.878  1.00 95.07  ? 256  LEU C C   1 
ATOM   4045 O O   . LEU C 1 30  ? 56.913 43.788 62.866  1.00 96.29  ? 256  LEU C O   1 
ATOM   4046 C CB  . LEU C 1 30  ? 57.904 42.590 60.457  1.00 92.01  ? 256  LEU C CB  1 
ATOM   4047 C CG  . LEU C 1 30  ? 57.574 41.617 59.324  1.00 90.24  ? 256  LEU C CG  1 
ATOM   4048 C CD1 . LEU C 1 30  ? 58.543 40.466 59.341  1.00 90.96  ? 256  LEU C CD1 1 
ATOM   4049 C CD2 . LEU C 1 30  ? 56.165 41.100 59.488  1.00 88.91  ? 256  LEU C CD2 1 
ATOM   4050 N N   . ASN C 1 31  ? 57.241 45.829 61.960  1.00 95.78  ? 257  ASN C N   1 
ATOM   4051 C CA  . ASN C 1 31  ? 57.210 46.566 63.214  1.00 96.42  ? 257  ASN C CA  1 
ATOM   4052 C C   . ASN C 1 31  ? 57.135 48.039 62.826  1.00 96.50  ? 257  ASN C C   1 
ATOM   4053 O O   . ASN C 1 31  ? 58.148 48.678 62.545  1.00 96.65  ? 257  ASN C O   1 
ATOM   4054 C CB  . ASN C 1 31  ? 58.468 46.277 64.041  1.00 97.04  ? 257  ASN C CB  1 
ATOM   4055 C CG  . ASN C 1 31  ? 59.689 47.018 63.535  1.00 98.71  ? 257  ASN C CG  1 
ATOM   4056 O OD1 . ASN C 1 31  ? 59.970 47.039 62.331  1.00 98.81  ? 257  ASN C OD1 1 
ATOM   4057 N ND2 . ASN C 1 31  ? 60.429 47.631 64.458  1.00 99.67  ? 257  ASN C ND2 1 
ATOM   4058 N N   . PRO C 1 32  ? 55.910 48.588 62.777  1.00 96.81  ? 258  PRO C N   1 
ATOM   4059 C CA  . PRO C 1 32  ? 55.587 49.980 62.425  1.00 96.56  ? 258  PRO C CA  1 
ATOM   4060 C C   . PRO C 1 32  ? 56.339 51.089 63.184  1.00 95.76  ? 258  PRO C C   1 
ATOM   4061 O O   . PRO C 1 32  ? 56.434 52.225 62.708  1.00 95.48  ? 258  PRO C O   1 
ATOM   4062 C CB  . PRO C 1 32  ? 54.075 50.038 62.642  1.00 96.75  ? 258  PRO C CB  1 
ATOM   4063 C CG  . PRO C 1 32  ? 53.644 48.647 62.256  1.00 96.54  ? 258  PRO C CG  1 
ATOM   4064 C CD  . PRO C 1 32  ? 54.677 47.801 62.967  1.00 96.64  ? 258  PRO C CD  1 
ATOM   4065 N N   . SER C 1 33  ? 56.871 50.760 64.357  1.00 94.82  ? 259  SER C N   1 
ATOM   4066 C CA  . SER C 1 33  ? 57.609 51.724 65.164  1.00 93.54  ? 259  SER C CA  1 
ATOM   4067 C C   . SER C 1 33  ? 59.081 51.846 64.756  1.00 92.77  ? 259  SER C C   1 
ATOM   4068 O O   . SER C 1 33  ? 59.824 52.640 65.336  1.00 92.69  ? 259  SER C O   1 
ATOM   4069 C CB  . SER C 1 33  ? 57.515 51.333 66.638  1.00 93.81  ? 259  SER C CB  1 
ATOM   4070 O OG  . SER C 1 33  ? 57.951 49.996 66.824  1.00 93.93  ? 259  SER C OG  1 
ATOM   4071 N N   . SER C 1 34  ? 59.500 51.051 63.772  1.00 91.73  ? 260  SER C N   1 
ATOM   4072 C CA  . SER C 1 34  ? 60.877 51.081 63.283  1.00 90.76  ? 260  SER C CA  1 
ATOM   4073 C C   . SER C 1 34  ? 61.101 52.395 62.549  1.00 90.62  ? 260  SER C C   1 
ATOM   4074 O O   . SER C 1 34  ? 60.229 52.845 61.802  1.00 90.61  ? 260  SER C O   1 
ATOM   4075 C CB  . SER C 1 34  ? 61.137 49.906 62.331  1.00 90.40  ? 260  SER C CB  1 
ATOM   4076 O OG  . SER C 1 34  ? 60.194 49.868 61.270  1.00 88.49  ? 260  SER C OG  1 
ATOM   4077 N N   . PRO C 1 35  ? 62.279 53.022 62.735  1.00 90.17  ? 261  PRO C N   1 
ATOM   4078 C CA  . PRO C 1 35  ? 62.551 54.297 62.062  1.00 89.78  ? 261  PRO C CA  1 
ATOM   4079 C C   . PRO C 1 35  ? 62.400 54.237 60.534  1.00 89.49  ? 261  PRO C C   1 
ATOM   4080 O O   . PRO C 1 35  ? 62.023 55.230 59.896  1.00 89.33  ? 261  PRO C O   1 
ATOM   4081 C CB  . PRO C 1 35  ? 63.977 54.627 62.515  1.00 88.43  ? 261  PRO C CB  1 
ATOM   4082 C CG  . PRO C 1 35  ? 64.595 53.281 62.664  1.00 88.76  ? 261  PRO C CG  1 
ATOM   4083 C CD  . PRO C 1 35  ? 63.505 52.492 63.361  1.00 90.06  ? 261  PRO C CD  1 
ATOM   4084 N N   . ASN C 1 36  ? 62.671 53.068 59.956  1.00 88.81  ? 262  ASN C N   1 
ATOM   4085 C CA  . ASN C 1 36  ? 62.579 52.884 58.514  1.00 87.69  ? 262  ASN C CA  1 
ATOM   4086 C C   . ASN C 1 36  ? 61.433 51.993 58.044  1.00 87.01  ? 262  ASN C C   1 
ATOM   4087 O O   . ASN C 1 36  ? 61.633 51.151 57.166  1.00 86.98  ? 262  ASN C O   1 
ATOM   4088 C CB  . ASN C 1 36  ? 63.899 52.326 57.972  1.00 88.12  ? 262  ASN C CB  1 
ATOM   4089 C CG  . ASN C 1 36  ? 65.047 53.300 58.127  1.00 88.39  ? 262  ASN C CG  1 
ATOM   4090 O OD1 . ASN C 1 36  ? 65.021 54.403 57.571  1.00 88.97  ? 262  ASN C OD1 1 
ATOM   4091 N ND2 . ASN C 1 36  ? 66.063 52.903 58.884  1.00 87.57  ? 262  ASN C ND2 1 
ATOM   4092 N N   . ASP C 1 37  ? 60.241 52.168 58.618  1.00 85.44  ? 263  ASP C N   1 
ATOM   4093 C CA  . ASP C 1 37  ? 59.083 51.377 58.197  1.00 83.90  ? 263  ASP C CA  1 
ATOM   4094 C C   . ASP C 1 37  ? 58.677 51.837 56.798  1.00 81.71  ? 263  ASP C C   1 
ATOM   4095 O O   . ASP C 1 37  ? 58.552 53.031 56.534  1.00 80.86  ? 263  ASP C O   1 
ATOM   4096 C CB  . ASP C 1 37  ? 57.898 51.556 59.163  1.00 85.46  ? 263  ASP C CB  1 
ATOM   4097 C CG  . ASP C 1 37  ? 56.667 50.725 58.756  1.00 86.96  ? 263  ASP C CG  1 
ATOM   4098 O OD1 . ASP C 1 37  ? 56.036 51.032 57.724  1.00 87.36  ? 263  ASP C OD1 1 
ATOM   4099 O OD2 . ASP C 1 37  ? 56.329 49.755 59.468  1.00 87.89  ? 263  ASP C OD2 1 
ATOM   4100 N N   . PRO C 1 38  ? 58.471 50.888 55.879  1.00 80.19  ? 264  PRO C N   1 
ATOM   4101 C CA  . PRO C 1 38  ? 58.081 51.239 54.512  1.00 78.98  ? 264  PRO C CA  1 
ATOM   4102 C C   . PRO C 1 38  ? 56.892 52.206 54.412  1.00 77.16  ? 264  PRO C C   1 
ATOM   4103 O O   . PRO C 1 38  ? 57.026 53.311 53.889  1.00 75.96  ? 264  PRO C O   1 
ATOM   4104 C CB  . PRO C 1 38  ? 57.784 49.872 53.880  1.00 79.50  ? 264  PRO C CB  1 
ATOM   4105 C CG  . PRO C 1 38  ? 58.755 48.975 54.569  1.00 79.62  ? 264  PRO C CG  1 
ATOM   4106 C CD  . PRO C 1 38  ? 58.630 49.429 56.019  1.00 80.09  ? 264  PRO C CD  1 
ATOM   4107 N N   . VAL C 1 39  ? 55.740 51.781 54.930  1.00 75.93  ? 265  VAL C N   1 
ATOM   4108 C CA  . VAL C 1 39  ? 54.505 52.566 54.879  1.00 73.03  ? 265  VAL C CA  1 
ATOM   4109 C C   . VAL C 1 39  ? 54.441 53.832 55.751  1.00 72.60  ? 265  VAL C C   1 
ATOM   4110 O O   . VAL C 1 39  ? 53.784 54.796 55.376  1.00 70.71  ? 265  VAL C O   1 
ATOM   4111 C CB  . VAL C 1 39  ? 53.292 51.680 55.222  1.00 71.85  ? 265  VAL C CB  1 
ATOM   4112 C CG1 . VAL C 1 39  ? 52.024 52.350 54.767  1.00 71.15  ? 265  VAL C CG1 1 
ATOM   4113 C CG2 . VAL C 1 39  ? 53.437 50.325 54.577  1.00 70.55  ? 265  VAL C CG2 1 
ATOM   4114 N N   . THR C 1 40  ? 55.095 53.835 56.911  1.00 72.92  ? 266  THR C N   1 
ATOM   4115 C CA  . THR C 1 40  ? 55.073 55.023 57.768  1.00 73.51  ? 266  THR C CA  1 
ATOM   4116 C C   . THR C 1 40  ? 55.985 56.101 57.190  1.00 73.65  ? 266  THR C C   1 
ATOM   4117 O O   . THR C 1 40  ? 55.863 57.278 57.526  1.00 72.35  ? 266  THR C O   1 
ATOM   4118 C CB  . THR C 1 40  ? 55.537 54.712 59.193  1.00 73.89  ? 266  THR C CB  1 
ATOM   4119 O OG1 . THR C 1 40  ? 54.913 53.504 59.644  1.00 75.67  ? 266  THR C OG1 1 
ATOM   4120 C CG2 . THR C 1 40  ? 55.146 55.853 60.128  1.00 73.84  ? 266  THR C CG2 1 
ATOM   4121 N N   . ASN C 1 41  ? 56.915 55.675 56.337  1.00 74.71  ? 267  ASN C N   1 
ATOM   4122 C CA  . ASN C 1 41  ? 57.835 56.584 55.665  1.00 75.57  ? 267  ASN C CA  1 
ATOM   4123 C C   . ASN C 1 41  ? 57.190 57.127 54.371  1.00 76.55  ? 267  ASN C C   1 
ATOM   4124 O O   . ASN C 1 41  ? 57.515 58.230 53.936  1.00 78.61  ? 267  ASN C O   1 
ATOM   4125 C CB  . ASN C 1 41  ? 59.170 55.883 55.338  1.00 75.20  ? 267  ASN C CB  1 
ATOM   4126 C CG  . ASN C 1 41  ? 60.207 56.012 56.462  1.00 75.39  ? 267  ASN C CG  1 
ATOM   4127 O OD1 . ASN C 1 41  ? 60.507 57.111 56.939  1.00 75.34  ? 267  ASN C OD1 1 
ATOM   4128 N ND2 . ASN C 1 41  ? 60.767 54.885 56.871  1.00 75.02  ? 267  ASN C ND2 1 
ATOM   4129 N N   . ILE C 1 42  ? 56.284 56.364 53.753  1.00 76.13  ? 268  ILE C N   1 
ATOM   4130 C CA  . ILE C 1 42  ? 55.594 56.822 52.530  1.00 73.69  ? 268  ILE C CA  1 
ATOM   4131 C C   . ILE C 1 42  ? 54.662 57.996 52.871  1.00 73.73  ? 268  ILE C C   1 
ATOM   4132 O O   . ILE C 1 42  ? 54.538 58.950 52.105  1.00 71.59  ? 268  ILE C O   1 
ATOM   4133 C CB  . ILE C 1 42  ? 54.719 55.699 51.896  1.00 71.87  ? 268  ILE C CB  1 
ATOM   4134 C CG1 . ILE C 1 42  ? 55.587 54.524 51.451  1.00 69.54  ? 268  ILE C CG1 1 
ATOM   4135 C CG2 . ILE C 1 42  ? 53.943 56.244 50.713  1.00 69.16  ? 268  ILE C CG2 1 
ATOM   4136 C CD1 . ILE C 1 42  ? 54.778 53.384 50.881  1.00 68.90  ? 268  ILE C CD1 1 
ATOM   4137 N N   . CYS C 1 43  ? 54.009 57.895 54.030  1.00 74.80  ? 269  CYS C N   1 
ATOM   4138 C CA  . CYS C 1 43  ? 53.080 58.904 54.535  1.00 75.42  ? 269  CYS C CA  1 
ATOM   4139 C C   . CYS C 1 43  ? 53.839 60.147 54.975  1.00 77.10  ? 269  CYS C C   1 
ATOM   4140 O O   . CYS C 1 43  ? 53.341 61.266 54.838  1.00 77.51  ? 269  CYS C O   1 
ATOM   4141 C CB  . CYS C 1 43  ? 52.283 58.343 55.726  1.00 75.33  ? 269  CYS C CB  1 
ATOM   4142 S SG  . CYS C 1 43  ? 51.305 56.833 55.379  1.00 72.40  ? 269  CYS C SG  1 
ATOM   4143 N N   . GLN C 1 44  ? 55.037 59.936 55.519  1.00 78.93  ? 270  GLN C N   1 
ATOM   4144 C CA  . GLN C 1 44  ? 55.904 61.023 55.971  1.00 80.82  ? 270  GLN C CA  1 
ATOM   4145 C C   . GLN C 1 44  ? 56.579 61.764 54.802  1.00 80.85  ? 270  GLN C C   1 
ATOM   4146 O O   . GLN C 1 44  ? 56.850 62.968 54.891  1.00 81.63  ? 270  GLN C O   1 
ATOM   4147 C CB  . GLN C 1 44  ? 56.986 60.481 56.905  1.00 83.07  ? 270  GLN C CB  1 
ATOM   4148 C CG  . GLN C 1 44  ? 56.539 60.234 58.327  1.00 86.99  ? 270  GLN C CG  1 
ATOM   4149 C CD  . GLN C 1 44  ? 57.716 60.131 59.290  1.00 90.02  ? 270  GLN C CD  1 
ATOM   4150 O OE1 . GLN C 1 44  ? 57.552 60.308 60.501  1.00 91.95  ? 270  GLN C OE1 1 
ATOM   4151 N NE2 . GLN C 1 44  ? 58.908 59.840 58.758  1.00 91.00  ? 270  GLN C NE2 1 
ATOM   4152 N N   . ALA C 1 45  ? 56.861 61.040 53.718  1.00 79.68  ? 271  ALA C N   1 
ATOM   4153 C CA  . ALA C 1 45  ? 57.497 61.614 52.530  1.00 77.65  ? 271  ALA C CA  1 
ATOM   4154 C C   . ALA C 1 45  ? 56.479 62.381 51.687  1.00 76.28  ? 271  ALA C C   1 
ATOM   4155 O O   . ALA C 1 45  ? 56.709 63.532 51.334  1.00 76.03  ? 271  ALA C O   1 
ATOM   4156 C CB  . ALA C 1 45  ? 58.144 60.507 51.692  1.00 76.68  ? 271  ALA C CB  1 
ATOM   4157 N N   . ALA C 1 46  ? 55.359 61.737 51.366  1.00 74.81  ? 272  ALA C N   1 
ATOM   4158 C CA  . ALA C 1 46  ? 54.313 62.373 50.577  1.00 72.90  ? 272  ALA C CA  1 
ATOM   4159 C C   . ALA C 1 46  ? 53.879 63.658 51.252  1.00 72.64  ? 272  ALA C C   1 
ATOM   4160 O O   . ALA C 1 46  ? 53.681 64.665 50.579  1.00 72.43  ? 272  ALA C O   1 
ATOM   4161 C CB  . ALA C 1 46  ? 53.131 61.451 50.428  1.00 71.60  ? 272  ALA C CB  1 
ATOM   4162 N N   . ASP C 1 47  ? 53.725 63.624 52.577  1.00 72.18  ? 273  ASP C N   1 
ATOM   4163 C CA  . ASP C 1 47  ? 53.321 64.814 53.332  1.00 72.47  ? 273  ASP C CA  1 
ATOM   4164 C C   . ASP C 1 47  ? 54.339 65.945 53.210  1.00 72.82  ? 273  ASP C C   1 
ATOM   4165 O O   . ASP C 1 47  ? 53.966 67.115 53.190  1.00 73.03  ? 273  ASP C O   1 
ATOM   4166 C CB  . ASP C 1 47  ? 53.130 64.488 54.814  1.00 73.18  ? 273  ASP C CB  1 
ATOM   4167 C CG  . ASP C 1 47  ? 52.894 65.735 55.656  1.00 74.24  ? 273  ASP C CG  1 
ATOM   4168 O OD1 . ASP C 1 47  ? 51.737 66.200 55.733  1.00 74.03  ? 273  ASP C OD1 1 
ATOM   4169 O OD2 . ASP C 1 47  ? 53.872 66.265 56.229  1.00 75.82  ? 273  ASP C OD2 1 
ATOM   4170 N N   . LYS C 1 48  ? 55.621 65.585 53.152  1.00 73.76  ? 274  LYS C N   1 
ATOM   4171 C CA  . LYS C 1 48  ? 56.714 66.548 53.006  1.00 74.06  ? 274  LYS C CA  1 
ATOM   4172 C C   . LYS C 1 48  ? 56.736 67.113 51.581  1.00 73.69  ? 274  LYS C C   1 
ATOM   4173 O O   . LYS C 1 48  ? 56.771 68.330 51.380  1.00 71.99  ? 274  LYS C O   1 
ATOM   4174 C CB  . LYS C 1 48  ? 58.056 65.860 53.310  1.00 75.33  ? 274  LYS C CB  1 
ATOM   4175 C CG  . LYS C 1 48  ? 59.283 66.588 52.750  1.00 77.76  ? 274  LYS C CG  1 
ATOM   4176 C CD  . LYS C 1 48  ? 60.598 65.888 53.106  1.00 77.10  ? 274  LYS C CD  1 
ATOM   4177 C CE  . LYS C 1 48  ? 61.775 66.582 52.437  1.00 76.80  ? 274  LYS C CE  1 
ATOM   4178 N NZ  . LYS C 1 48  ? 61.724 68.067 52.609  1.00 76.35  ? 274  LYS C NZ  1 
ATOM   4179 N N   . GLN C 1 49  ? 56.696 66.203 50.607  1.00 74.06  ? 275  GLN C N   1 
ATOM   4180 C CA  . GLN C 1 49  ? 56.716 66.511 49.176  1.00 75.14  ? 275  GLN C CA  1 
ATOM   4181 C C   . GLN C 1 49  ? 55.474 67.219 48.663  1.00 75.78  ? 275  GLN C C   1 
ATOM   4182 O O   . GLN C 1 49  ? 55.359 67.498 47.468  1.00 76.85  ? 275  GLN C O   1 
ATOM   4183 C CB  . GLN C 1 49  ? 56.908 65.221 48.378  1.00 76.61  ? 275  GLN C CB  1 
ATOM   4184 C CG  . GLN C 1 49  ? 58.198 64.531 48.696  1.00 78.50  ? 275  GLN C CG  1 
ATOM   4185 C CD  . GLN C 1 49  ? 59.361 65.451 48.444  1.00 79.97  ? 275  GLN C CD  1 
ATOM   4186 O OE1 . GLN C 1 49  ? 59.627 65.811 47.298  1.00 81.29  ? 275  GLN C OE1 1 
ATOM   4187 N NE2 . GLN C 1 49  ? 60.049 65.862 49.510  1.00 78.91  ? 275  GLN C NE2 1 
ATOM   4188 N N   . LEU C 1 50  ? 54.537 67.493 49.560  1.00 75.76  ? 276  LEU C N   1 
ATOM   4189 C CA  . LEU C 1 50  ? 53.308 68.176 49.191  1.00 75.93  ? 276  LEU C CA  1 
ATOM   4190 C C   . LEU C 1 50  ? 53.544 69.681 49.350  1.00 76.50  ? 276  LEU C C   1 
ATOM   4191 O O   . LEU C 1 50  ? 53.118 70.483 48.515  1.00 75.49  ? 276  LEU C O   1 
ATOM   4192 C CB  . LEU C 1 50  ? 52.166 67.691 50.092  1.00 75.55  ? 276  LEU C CB  1 
ATOM   4193 C CG  . LEU C 1 50  ? 50.826 67.274 49.469  1.00 74.11  ? 276  LEU C CG  1 
ATOM   4194 C CD1 . LEU C 1 50  ? 51.033 66.286 48.340  1.00 73.48  ? 276  LEU C CD1 1 
ATOM   4195 C CD2 . LEU C 1 50  ? 49.951 66.662 50.549  1.00 73.49  ? 276  LEU C CD2 1 
ATOM   4196 N N   . PHE C 1 51  ? 54.239 70.058 50.419  1.00 77.63  ? 277  PHE C N   1 
ATOM   4197 C CA  . PHE C 1 51  ? 54.546 71.459 50.661  1.00 79.95  ? 277  PHE C CA  1 
ATOM   4198 C C   . PHE C 1 51  ? 55.426 71.964 49.528  1.00 80.53  ? 277  PHE C C   1 
ATOM   4199 O O   . PHE C 1 51  ? 55.191 73.031 48.957  1.00 80.79  ? 277  PHE C O   1 
ATOM   4200 C CB  . PHE C 1 51  ? 55.297 71.631 51.980  1.00 81.68  ? 277  PHE C CB  1 
ATOM   4201 C CG  . PHE C 1 51  ? 54.475 71.330 53.204  1.00 84.09  ? 277  PHE C CG  1 
ATOM   4202 C CD1 . PHE C 1 51  ? 54.250 70.023 53.610  1.00 84.65  ? 277  PHE C CD1 1 
ATOM   4203 C CD2 . PHE C 1 51  ? 53.955 72.366 53.974  1.00 85.08  ? 277  PHE C CD2 1 
ATOM   4204 C CE1 . PHE C 1 51  ? 53.525 69.757 54.768  1.00 86.03  ? 277  PHE C CE1 1 
ATOM   4205 C CE2 . PHE C 1 51  ? 53.229 72.110 55.132  1.00 84.68  ? 277  PHE C CE2 1 
ATOM   4206 C CZ  . PHE C 1 51  ? 53.015 70.806 55.529  1.00 85.80  ? 277  PHE C CZ  1 
ATOM   4207 N N   . THR C 1 52  ? 56.454 71.187 49.218  1.00 81.30  ? 278  THR C N   1 
ATOM   4208 C CA  . THR C 1 52  ? 57.374 71.540 48.156  1.00 83.35  ? 278  THR C CA  1 
ATOM   4209 C C   . THR C 1 52  ? 56.645 71.567 46.814  1.00 84.36  ? 278  THR C C   1 
ATOM   4210 O O   . THR C 1 52  ? 56.989 72.353 45.931  1.00 85.49  ? 278  THR C O   1 
ATOM   4211 C CB  . THR C 1 52  ? 58.536 70.540 48.086  1.00 84.25  ? 278  THR C CB  1 
ATOM   4212 O OG1 . THR C 1 52  ? 58.061 69.294 47.560  1.00 85.31  ? 278  THR C OG1 1 
ATOM   4213 C CG2 . THR C 1 52  ? 59.122 70.310 49.480  1.00 85.15  ? 278  THR C CG2 1 
ATOM   4214 N N   . LEU C 1 53  ? 55.640 70.707 46.659  1.00 84.84  ? 279  LEU C N   1 
ATOM   4215 C CA  . LEU C 1 53  ? 54.858 70.667 45.428  1.00 84.53  ? 279  LEU C CA  1 
ATOM   4216 C C   . LEU C 1 53  ? 54.169 72.025 45.238  1.00 85.08  ? 279  LEU C C   1 
ATOM   4217 O O   . LEU C 1 53  ? 54.043 72.515 44.113  1.00 84.37  ? 279  LEU C O   1 
ATOM   4218 C CB  . LEU C 1 53  ? 53.805 69.567 45.504  1.00 82.90  ? 279  LEU C CB  1 
ATOM   4219 C CG  . LEU C 1 53  ? 53.223 69.262 44.130  1.00 82.07  ? 279  LEU C CG  1 
ATOM   4220 C CD1 . LEU C 1 53  ? 54.361 68.789 43.239  1.00 81.89  ? 279  LEU C CD1 1 
ATOM   4221 C CD2 . LEU C 1 53  ? 52.133 68.211 44.224  1.00 81.86  ? 279  LEU C CD2 1 
ATOM   4222 N N   . VAL C 1 54  ? 53.715 72.613 46.348  1.00 85.63  ? 280  VAL C N   1 
ATOM   4223 C CA  . VAL C 1 54  ? 53.070 73.926 46.345  1.00 85.50  ? 280  VAL C CA  1 
ATOM   4224 C C   . VAL C 1 54  ? 54.051 74.910 45.714  1.00 86.91  ? 280  VAL C C   1 
ATOM   4225 O O   . VAL C 1 54  ? 53.750 75.543 44.700  1.00 87.48  ? 280  VAL C O   1 
ATOM   4226 C CB  . VAL C 1 54  ? 52.746 74.401 47.783  1.00 84.31  ? 280  VAL C CB  1 
ATOM   4227 C CG1 . VAL C 1 54  ? 52.104 75.772 47.755  1.00 82.45  ? 280  VAL C CG1 1 
ATOM   4228 C CG2 . VAL C 1 54  ? 51.829 73.406 48.456  1.00 83.71  ? 280  VAL C CG2 1 
ATOM   4229 N N   . GLU C 1 55  ? 55.230 75.033 46.317  1.00 87.20  ? 281  GLU C N   1 
ATOM   4230 C CA  . GLU C 1 55  ? 56.252 75.919 45.783  1.00 87.40  ? 281  GLU C CA  1 
ATOM   4231 C C   . GLU C 1 55  ? 56.501 75.619 44.318  1.00 86.94  ? 281  GLU C C   1 
ATOM   4232 O O   . GLU C 1 55  ? 56.667 76.534 43.516  1.00 86.79  ? 281  GLU C O   1 
ATOM   4233 C CB  . GLU C 1 55  ? 57.554 75.765 46.563  1.00 89.25  ? 281  GLU C CB  1 
ATOM   4234 C CG  . GLU C 1 55  ? 57.461 76.395 47.918  1.00 92.37  ? 281  GLU C CG  1 
ATOM   4235 C CD  . GLU C 1 55  ? 56.834 77.770 47.827  1.00 95.27  ? 281  GLU C CD  1 
ATOM   4236 O OE1 . GLU C 1 55  ? 57.520 78.724 47.374  1.00 96.72  ? 281  GLU C OE1 1 
ATOM   4237 O OE2 . GLU C 1 55  ? 55.641 77.885 48.192  1.00 95.60  ? 281  GLU C OE2 1 
ATOM   4238 N N   . TRP C 1 56  ? 56.527 74.333 43.976  1.00 87.01  ? 282  TRP C N   1 
ATOM   4239 C CA  . TRP C 1 56  ? 56.748 73.904 42.601  1.00 87.12  ? 282  TRP C CA  1 
ATOM   4240 C C   . TRP C 1 56  ? 55.724 74.513 41.663  1.00 87.26  ? 282  TRP C C   1 
ATOM   4241 O O   . TRP C 1 56  ? 56.061 74.963 40.568  1.00 88.25  ? 282  TRP C O   1 
ATOM   4242 C CB  . TRP C 1 56  ? 56.649 72.388 42.472  1.00 86.47  ? 282  TRP C CB  1 
ATOM   4243 C CG  . TRP C 1 56  ? 56.866 71.945 41.058  1.00 87.33  ? 282  TRP C CG  1 
ATOM   4244 C CD1 . TRP C 1 56  ? 58.056 71.871 40.409  1.00 87.87  ? 282  TRP C CD1 1 
ATOM   4245 C CD2 . TRP C 1 56  ? 55.864 71.544 40.104  1.00 88.45  ? 282  TRP C CD2 1 
ATOM   4246 N NE1 . TRP C 1 56  ? 57.868 71.448 39.114  1.00 88.02  ? 282  TRP C NE1 1 
ATOM   4247 C CE2 . TRP C 1 56  ? 56.532 71.242 38.901  1.00 87.83  ? 282  TRP C CE2 1 
ATOM   4248 C CE3 . TRP C 1 56  ? 54.469 71.414 40.151  1.00 89.39  ? 282  TRP C CE3 1 
ATOM   4249 C CZ2 . TRP C 1 56  ? 55.857 70.810 37.756  1.00 87.39  ? 282  TRP C CZ2 1 
ATOM   4250 C CZ3 . TRP C 1 56  ? 53.799 70.983 39.006  1.00 87.76  ? 282  TRP C CZ3 1 
ATOM   4251 C CH2 . TRP C 1 56  ? 54.496 70.689 37.829  1.00 87.48  ? 282  TRP C CH2 1 
ATOM   4252 N N   . ALA C 1 57  ? 54.466 74.496 42.093  1.00 86.61  ? 283  ALA C N   1 
ATOM   4253 C CA  . ALA C 1 57  ? 53.375 75.039 41.303  1.00 86.16  ? 283  ALA C CA  1 
ATOM   4254 C C   . ALA C 1 57  ? 53.493 76.555 41.162  1.00 85.80  ? 283  ALA C C   1 
ATOM   4255 O O   . ALA C 1 57  ? 53.381 77.096 40.060  1.00 84.91  ? 283  ALA C O   1 
ATOM   4256 C CB  . ALA C 1 57  ? 52.064 74.674 41.940  1.00 86.92  ? 283  ALA C CB  1 
ATOM   4257 N N   . LYS C 1 58  ? 53.707 77.240 42.280  1.00 85.32  ? 284  LYS C N   1 
ATOM   4258 C CA  . LYS C 1 58  ? 53.860 78.687 42.253  1.00 85.47  ? 284  LYS C CA  1 
ATOM   4259 C C   . LYS C 1 58  ? 54.875 79.068 41.181  1.00 87.13  ? 284  LYS C C   1 
ATOM   4260 O O   . LYS C 1 58  ? 54.578 79.877 40.300  1.00 87.40  ? 284  LYS C O   1 
ATOM   4261 C CB  . LYS C 1 58  ? 54.347 79.194 43.604  1.00 82.91  ? 284  LYS C CB  1 
ATOM   4262 C CG  . LYS C 1 58  ? 53.401 78.930 44.738  1.00 79.60  ? 284  LYS C CG  1 
ATOM   4263 C CD  . LYS C 1 58  ? 53.844 79.717 45.943  1.00 78.28  ? 284  LYS C CD  1 
ATOM   4264 C CE  . LYS C 1 58  ? 52.766 79.785 46.995  1.00 78.01  ? 284  LYS C CE  1 
ATOM   4265 N NZ  . LYS C 1 58  ? 53.095 80.870 47.949  1.00 79.30  ? 284  LYS C NZ  1 
ATOM   4266 N N   . ARG C 1 59  ? 56.066 78.471 41.261  1.00 89.08  ? 285  ARG C N   1 
ATOM   4267 C CA  . ARG C 1 59  ? 57.150 78.718 40.307  1.00 91.13  ? 285  ARG C CA  1 
ATOM   4268 C C   . ARG C 1 59  ? 56.892 78.166 38.889  1.00 92.28  ? 285  ARG C C   1 
ATOM   4269 O O   . ARG C 1 59  ? 57.829 77.806 38.169  1.00 92.93  ? 285  ARG C O   1 
ATOM   4270 C CB  . ARG C 1 59  ? 58.472 78.149 40.851  1.00 91.44  ? 285  ARG C CB  1 
ATOM   4271 C CG  . ARG C 1 59  ? 58.931 78.790 42.139  1.00 92.39  ? 285  ARG C CG  1 
ATOM   4272 C CD  . ARG C 1 59  ? 60.351 78.400 42.500  1.00 94.40  ? 285  ARG C CD  1 
ATOM   4273 N NE  . ARG C 1 59  ? 60.716 78.966 43.796  1.00 98.90  ? 285  ARG C NE  1 
ATOM   4274 C CZ  . ARG C 1 59  ? 60.907 80.265 44.035  1.00 101.29 ? 285  ARG C CZ  1 
ATOM   4275 N NH1 . ARG C 1 59  ? 60.779 81.160 43.059  1.00 101.78 ? 285  ARG C NH1 1 
ATOM   4276 N NH2 . ARG C 1 59  ? 61.205 80.675 45.266  1.00 101.90 ? 285  ARG C NH2 1 
ATOM   4277 N N   . ILE C 1 60  ? 55.622 78.101 38.497  1.00 92.83  ? 286  ILE C N   1 
ATOM   4278 C CA  . ILE C 1 60  ? 55.230 77.624 37.175  1.00 92.93  ? 286  ILE C CA  1 
ATOM   4279 C C   . ILE C 1 60  ? 54.750 78.840 36.383  1.00 95.18  ? 286  ILE C C   1 
ATOM   4280 O O   . ILE C 1 60  ? 53.862 79.571 36.836  1.00 94.70  ? 286  ILE C O   1 
ATOM   4281 C CB  . ILE C 1 60  ? 54.092 76.572 37.277  1.00 90.36  ? 286  ILE C CB  1 
ATOM   4282 C CG1 . ILE C 1 60  ? 54.678 75.201 37.599  1.00 88.40  ? 286  ILE C CG1 1 
ATOM   4283 C CG2 . ILE C 1 60  ? 53.328 76.488 35.980  1.00 89.75  ? 286  ILE C CG2 1 
ATOM   4284 C CD1 . ILE C 1 60  ? 55.553 74.656 36.498  1.00 86.81  ? 286  ILE C CD1 1 
ATOM   4285 N N   . PRO C 1 61  ? 55.349 79.086 35.197  1.00 97.02  ? 287  PRO C N   1 
ATOM   4286 C CA  . PRO C 1 61  ? 54.942 80.234 34.381  1.00 98.23  ? 287  PRO C CA  1 
ATOM   4287 C C   . PRO C 1 61  ? 53.431 80.322 34.114  1.00 100.10 ? 287  PRO C C   1 
ATOM   4288 O O   . PRO C 1 61  ? 52.885 79.575 33.290  1.00 99.72  ? 287  PRO C O   1 
ATOM   4289 C CB  . PRO C 1 61  ? 55.779 80.069 33.101  1.00 97.29  ? 287  PRO C CB  1 
ATOM   4290 C CG  . PRO C 1 61  ? 56.119 78.606 33.072  1.00 96.10  ? 287  PRO C CG  1 
ATOM   4291 C CD  . PRO C 1 61  ? 56.404 78.311 34.516  1.00 96.46  ? 287  PRO C CD  1 
ATOM   4292 N N   . HIS C 1 62  ? 52.784 81.241 34.842  1.00 102.09 ? 288  HIS C N   1 
ATOM   4293 C CA  . HIS C 1 62  ? 51.345 81.535 34.761  1.00 103.77 ? 288  HIS C CA  1 
ATOM   4294 C C   . HIS C 1 62  ? 50.444 80.746 35.728  1.00 103.87 ? 288  HIS C C   1 
ATOM   4295 O O   . HIS C 1 62  ? 49.271 80.513 35.429  1.00 103.79 ? 288  HIS C O   1 
ATOM   4296 C CB  . HIS C 1 62  ? 50.814 81.348 33.321  1.00 105.16 ? 288  HIS C CB  1 
ATOM   4297 C CG  . HIS C 1 62  ? 51.497 82.203 32.291  1.00 106.24 ? 288  HIS C CG  1 
ATOM   4298 N ND1 . HIS C 1 62  ? 51.686 83.561 32.448  1.00 106.07 ? 288  HIS C ND1 1 
ATOM   4299 C CD2 . HIS C 1 62  ? 52.008 81.892 31.073  1.00 105.97 ? 288  HIS C CD2 1 
ATOM   4300 C CE1 . HIS C 1 62  ? 52.284 84.048 31.374  1.00 106.28 ? 288  HIS C CE1 1 
ATOM   4301 N NE2 . HIS C 1 62  ? 52.490 83.055 30.525  1.00 106.07 ? 288  HIS C NE2 1 
ATOM   4302 N N   . PHE C 1 63  ? 50.968 80.340 36.882  1.00 103.69 ? 289  PHE C N   1 
ATOM   4303 C CA  . PHE C 1 63  ? 50.142 79.593 37.828  1.00 103.78 ? 289  PHE C CA  1 
ATOM   4304 C C   . PHE C 1 63  ? 49.550 80.468 38.927  1.00 104.80 ? 289  PHE C C   1 
ATOM   4305 O O   . PHE C 1 63  ? 48.371 80.339 39.256  1.00 104.93 ? 289  PHE C O   1 
ATOM   4306 C CB  . PHE C 1 63  ? 50.926 78.457 38.487  1.00 102.82 ? 289  PHE C CB  1 
ATOM   4307 C CG  . PHE C 1 63  ? 50.106 77.658 39.477  1.00 101.32 ? 289  PHE C CG  1 
ATOM   4308 C CD1 . PHE C 1 63  ? 49.278 76.631 39.048  1.00 99.96  ? 289  PHE C CD1 1 
ATOM   4309 C CD2 . PHE C 1 63  ? 50.119 77.977 40.833  1.00 99.88  ? 289  PHE C CD2 1 
ATOM   4310 C CE1 . PHE C 1 63  ? 48.480 75.944 39.950  1.00 98.66  ? 289  PHE C CE1 1 
ATOM   4311 C CE2 . PHE C 1 63  ? 49.322 77.292 41.735  1.00 97.38  ? 289  PHE C CE2 1 
ATOM   4312 C CZ  . PHE C 1 63  ? 48.504 76.279 41.294  1.00 97.51  ? 289  PHE C CZ  1 
ATOM   4313 N N   . SER C 1 64  ? 50.363 81.346 39.510  1.00 106.08 ? 290  SER C N   1 
ATOM   4314 C CA  . SER C 1 64  ? 49.878 82.232 40.570  1.00 107.53 ? 290  SER C CA  1 
ATOM   4315 C C   . SER C 1 64  ? 49.017 83.378 40.019  1.00 109.19 ? 290  SER C C   1 
ATOM   4316 O O   . SER C 1 64  ? 48.665 84.309 40.752  1.00 108.54 ? 290  SER C O   1 
ATOM   4317 C CB  . SER C 1 64  ? 51.057 82.807 41.358  1.00 107.21 ? 290  SER C CB  1 
ATOM   4318 O OG  . SER C 1 64  ? 51.851 81.774 41.916  1.00 106.08 ? 290  SER C OG  1 
ATOM   4319 N N   . GLU C 1 65  ? 48.696 83.298 38.725  1.00 111.51 ? 291  GLU C N   1 
ATOM   4320 C CA  . GLU C 1 65  ? 47.861 84.281 38.022  1.00 112.99 ? 291  GLU C CA  1 
ATOM   4321 C C   . GLU C 1 65  ? 46.403 83.807 37.928  1.00 113.40 ? 291  GLU C C   1 
ATOM   4322 O O   . GLU C 1 65  ? 45.504 84.599 37.640  1.00 114.13 ? 291  GLU C O   1 
ATOM   4323 C CB  . GLU C 1 65  ? 48.389 84.537 36.598  1.00 113.32 ? 291  GLU C CB  1 
ATOM   4324 C CG  . GLU C 1 65  ? 49.581 85.476 36.514  1.00 113.59 ? 291  GLU C CG  1 
ATOM   4325 C CD  . GLU C 1 65  ? 50.802 84.922 37.209  1.00 114.00 ? 291  GLU C CD  1 
ATOM   4326 O OE1 . GLU C 1 65  ? 51.430 83.990 36.655  1.00 114.31 ? 291  GLU C OE1 1 
ATOM   4327 O OE2 . GLU C 1 65  ? 51.120 85.411 38.316  1.00 113.08 ? 291  GLU C OE2 1 
ATOM   4328 N N   . LEU C 1 66  ? 46.178 82.515 38.159  1.00 113.19 ? 292  LEU C N   1 
ATOM   4329 C CA  . LEU C 1 66  ? 44.839 81.941 38.108  1.00 112.36 ? 292  LEU C CA  1 
ATOM   4330 C C   . LEU C 1 66  ? 44.166 82.145 39.463  1.00 112.32 ? 292  LEU C C   1 
ATOM   4331 O O   . LEU C 1 66  ? 44.824 82.108 40.505  1.00 111.97 ? 292  LEU C O   1 
ATOM   4332 C CB  . LEU C 1 66  ? 44.922 80.449 37.785  1.00 111.62 ? 292  LEU C CB  1 
ATOM   4333 C CG  . LEU C 1 66  ? 45.869 80.089 36.638  1.00 111.16 ? 292  LEU C CG  1 
ATOM   4334 C CD1 . LEU C 1 66  ? 45.857 78.588 36.424  1.00 111.04 ? 292  LEU C CD1 1 
ATOM   4335 C CD2 . LEU C 1 66  ? 45.456 80.818 35.374  1.00 110.11 ? 292  LEU C CD2 1 
ATOM   4336 N N   . PRO C 1 67  ? 42.841 82.366 39.463  1.00 112.37 ? 293  PRO C N   1 
ATOM   4337 C CA  . PRO C 1 67  ? 42.060 82.581 40.689  1.00 111.72 ? 293  PRO C CA  1 
ATOM   4338 C C   . PRO C 1 67  ? 42.454 81.603 41.794  1.00 110.53 ? 293  PRO C C   1 
ATOM   4339 O O   . PRO C 1 67  ? 42.635 80.410 41.543  1.00 110.47 ? 293  PRO C O   1 
ATOM   4340 C CB  . PRO C 1 67  ? 40.622 82.385 40.215  1.00 112.59 ? 293  PRO C CB  1 
ATOM   4341 C CG  . PRO C 1 67  ? 40.676 82.906 38.798  1.00 112.75 ? 293  PRO C CG  1 
ATOM   4342 C CD  . PRO C 1 67  ? 41.964 82.305 38.278  1.00 112.54 ? 293  PRO C CD  1 
ATOM   4343 N N   . LEU C 1 68  ? 42.588 82.111 43.015  1.00 108.80 ? 294  LEU C N   1 
ATOM   4344 C CA  . LEU C 1 68  ? 42.978 81.266 44.140  1.00 107.86 ? 294  LEU C CA  1 
ATOM   4345 C C   . LEU C 1 68  ? 42.162 79.975 44.181  1.00 107.31 ? 294  LEU C C   1 
ATOM   4346 O O   . LEU C 1 68  ? 42.725 78.882 44.248  1.00 106.81 ? 294  LEU C O   1 
ATOM   4347 C CB  . LEU C 1 68  ? 42.827 82.038 45.461  1.00 107.20 ? 294  LEU C CB  1 
ATOM   4348 C CG  . LEU C 1 68  ? 43.515 81.460 46.704  1.00 106.17 ? 294  LEU C CG  1 
ATOM   4349 C CD1 . LEU C 1 68  ? 44.973 81.170 46.386  1.00 106.67 ? 294  LEU C CD1 1 
ATOM   4350 C CD2 . LEU C 1 68  ? 43.412 82.436 47.865  1.00 105.44 ? 294  LEU C CD2 1 
ATOM   4351 N N   . ASP C 1 69  ? 40.838 80.108 44.124  1.00 107.29 ? 295  ASP C N   1 
ATOM   4352 C CA  . ASP C 1 69  ? 39.943 78.954 44.157  1.00 107.28 ? 295  ASP C CA  1 
ATOM   4353 C C   . ASP C 1 69  ? 40.243 77.923 43.072  1.00 106.14 ? 295  ASP C C   1 
ATOM   4354 O O   . ASP C 1 69  ? 40.186 76.719 43.321  1.00 105.99 ? 295  ASP C O   1 
ATOM   4355 C CB  . ASP C 1 69  ? 38.477 79.401 44.044  1.00 109.02 ? 295  ASP C CB  1 
ATOM   4356 C CG  . ASP C 1 69  ? 37.952 80.037 45.327  1.00 110.59 ? 295  ASP C CG  1 
ATOM   4357 O OD1 . ASP C 1 69  ? 38.531 79.779 46.410  1.00 111.28 ? 295  ASP C OD1 1 
ATOM   4358 O OD2 . ASP C 1 69  ? 36.946 80.781 45.252  1.00 111.30 ? 295  ASP C OD2 1 
ATOM   4359 N N   . ASP C 1 70  ? 40.550 78.383 41.867  1.00 104.74 ? 296  ASP C N   1 
ATOM   4360 C CA  . ASP C 1 70  ? 40.856 77.454 40.794  1.00 103.85 ? 296  ASP C CA  1 
ATOM   4361 C C   . ASP C 1 70  ? 42.218 76.798 40.996  1.00 102.55 ? 296  ASP C C   1 
ATOM   4362 O O   . ASP C 1 70  ? 42.432 75.668 40.561  1.00 102.58 ? 296  ASP C O   1 
ATOM   4363 C CB  . ASP C 1 70  ? 40.800 78.158 39.439  1.00 105.38 ? 296  ASP C CB  1 
ATOM   4364 C CG  . ASP C 1 70  ? 39.390 78.562 39.056  1.00 106.40 ? 296  ASP C CG  1 
ATOM   4365 O OD1 . ASP C 1 70  ? 38.454 77.801 39.390  1.00 106.24 ? 296  ASP C OD1 1 
ATOM   4366 O OD2 . ASP C 1 70  ? 39.222 79.625 38.412  1.00 107.08 ? 296  ASP C OD2 1 
ATOM   4367 N N   . GLN C 1 71  ? 43.142 77.500 41.646  1.00 100.83 ? 297  GLN C N   1 
ATOM   4368 C CA  . GLN C 1 71  ? 44.457 76.923 41.909  1.00 98.97  ? 297  GLN C CA  1 
ATOM   4369 C C   . GLN C 1 71  ? 44.225 75.731 42.832  1.00 97.41  ? 297  GLN C C   1 
ATOM   4370 O O   . GLN C 1 71  ? 44.731 74.641 42.589  1.00 96.71  ? 297  GLN C O   1 
ATOM   4371 C CB  . GLN C 1 71  ? 45.379 77.944 42.586  1.00 99.23  ? 297  GLN C CB  1 
ATOM   4372 C CG  . GLN C 1 71  ? 45.637 79.209 41.769  1.00 99.32  ? 297  GLN C CG  1 
ATOM   4373 C CD  . GLN C 1 71  ? 46.743 80.070 42.358  1.00 99.45  ? 297  GLN C CD  1 
ATOM   4374 O OE1 . GLN C 1 71  ? 47.888 79.634 42.463  1.00 100.28 ? 297  GLN C OE1 1 
ATOM   4375 N NE2 . GLN C 1 71  ? 46.404 81.295 42.747  1.00 98.49  ? 297  GLN C NE2 1 
ATOM   4376 N N   . VAL C 1 72  ? 43.434 75.957 43.879  1.00 96.17  ? 298  VAL C N   1 
ATOM   4377 C CA  . VAL C 1 72  ? 43.077 74.928 44.855  1.00 94.65  ? 298  VAL C CA  1 
ATOM   4378 C C   . VAL C 1 72  ? 42.494 73.675 44.209  1.00 94.25  ? 298  VAL C C   1 
ATOM   4379 O O   . VAL C 1 72  ? 42.793 72.561 44.629  1.00 94.35  ? 298  VAL C O   1 
ATOM   4380 C CB  . VAL C 1 72  ? 42.038 75.464 45.866  1.00 94.02  ? 298  VAL C CB  1 
ATOM   4381 C CG1 . VAL C 1 72  ? 41.233 74.320 46.457  1.00 93.15  ? 298  VAL C CG1 1 
ATOM   4382 C CG2 . VAL C 1 72  ? 42.738 76.225 46.965  1.00 93.56  ? 298  VAL C CG2 1 
ATOM   4383 N N   . ILE C 1 73  ? 41.652 73.871 43.197  1.00 93.91  ? 299  ILE C N   1 
ATOM   4384 C CA  . ILE C 1 73  ? 41.006 72.771 42.488  1.00 93.11  ? 299  ILE C CA  1 
ATOM   4385 C C   . ILE C 1 73  ? 41.965 71.994 41.591  1.00 92.86  ? 299  ILE C C   1 
ATOM   4386 O O   . ILE C 1 73  ? 41.911 70.765 41.541  1.00 92.66  ? 299  ILE C O   1 
ATOM   4387 C CB  . ILE C 1 73  ? 39.800 73.299 41.659  1.00 93.02  ? 299  ILE C CB  1 
ATOM   4388 C CG1 . ILE C 1 73  ? 38.620 73.552 42.601  1.00 92.88  ? 299  ILE C CG1 1 
ATOM   4389 C CG2 . ILE C 1 73  ? 39.423 72.315 40.559  1.00 93.23  ? 299  ILE C CG2 1 
ATOM   4390 C CD1 . ILE C 1 73  ? 37.418 74.142 41.947  1.00 91.68  ? 299  ILE C CD1 1 
ATOM   4391 N N   . LEU C 1 74  ? 42.848 72.707 40.896  1.00 93.05  ? 300  LEU C N   1 
ATOM   4392 C CA  . LEU C 1 74  ? 43.822 72.074 40.008  1.00 92.32  ? 300  LEU C CA  1 
ATOM   4393 C C   . LEU C 1 74  ? 44.845 71.241 40.778  1.00 92.16  ? 300  LEU C C   1 
ATOM   4394 O O   . LEU C 1 74  ? 45.414 70.287 40.244  1.00 91.68  ? 300  LEU C O   1 
ATOM   4395 C CB  . LEU C 1 74  ? 44.549 73.132 39.168  1.00 91.10  ? 300  LEU C CB  1 
ATOM   4396 C CG  . LEU C 1 74  ? 43.768 73.801 38.035  1.00 89.17  ? 300  LEU C CG  1 
ATOM   4397 C CD1 . LEU C 1 74  ? 44.653 74.817 37.334  1.00 88.82  ? 300  LEU C CD1 1 
ATOM   4398 C CD2 . LEU C 1 74  ? 43.300 72.748 37.050  1.00 88.77  ? 300  LEU C CD2 1 
ATOM   4399 N N   . LEU C 1 75  ? 45.069 71.606 42.034  1.00 92.36  ? 301  LEU C N   1 
ATOM   4400 C CA  . LEU C 1 75  ? 46.014 70.901 42.892  1.00 93.70  ? 301  LEU C CA  1 
ATOM   4401 C C   . LEU C 1 75  ? 45.428 69.579 43.387  1.00 93.58  ? 301  LEU C C   1 
ATOM   4402 O O   . LEU C 1 75  ? 45.920 68.498 43.050  1.00 92.54  ? 301  LEU C O   1 
ATOM   4403 C CB  . LEU C 1 75  ? 46.357 71.776 44.092  1.00 95.64  ? 301  LEU C CB  1 
ATOM   4404 C CG  . LEU C 1 75  ? 46.709 73.225 43.756  1.00 98.09  ? 301  LEU C CG  1 
ATOM   4405 C CD1 . LEU C 1 75  ? 47.080 73.958 45.034  1.00 100.14 ? 301  LEU C CD1 1 
ATOM   4406 C CD2 . LEU C 1 75  ? 47.852 73.269 42.752  1.00 98.92  ? 301  LEU C CD2 1 
ATOM   4407 N N   . ARG C 1 76  ? 44.384 69.690 44.208  1.00 93.93  ? 302  ARG C N   1 
ATOM   4408 C CA  . ARG C 1 76  ? 43.688 68.535 44.764  1.00 93.09  ? 302  ARG C CA  1 
ATOM   4409 C C   . ARG C 1 76  ? 43.551 67.440 43.714  1.00 91.39  ? 302  ARG C C   1 
ATOM   4410 O O   . ARG C 1 76  ? 43.981 66.307 43.921  1.00 92.01  ? 302  ARG C O   1 
ATOM   4411 C CB  . ARG C 1 76  ? 42.272 68.915 45.234  1.00 95.39  ? 302  ARG C CB  1 
ATOM   4412 C CG  . ARG C 1 76  ? 42.150 69.734 46.518  1.00 96.79  ? 302  ARG C CG  1 
ATOM   4413 C CD  . ARG C 1 76  ? 40.732 69.572 47.097  1.00 99.55  ? 302  ARG C CD  1 
ATOM   4414 N NE  . ARG C 1 76  ? 39.672 70.243 46.333  1.00 102.07 ? 302  ARG C NE  1 
ATOM   4415 C CZ  . ARG C 1 76  ? 38.364 70.054 46.531  1.00 102.71 ? 302  ARG C CZ  1 
ATOM   4416 N NH1 . ARG C 1 76  ? 37.947 69.204 47.464  1.00 103.21 ? 302  ARG C NH1 1 
ATOM   4417 N NH2 . ARG C 1 76  ? 37.468 70.727 45.813  1.00 102.03 ? 302  ARG C NH2 1 
ATOM   4418 N N   . ALA C 1 77  ? 42.950 67.802 42.584  1.00 88.82  ? 303  ALA C N   1 
ATOM   4419 C CA  . ALA C 1 77  ? 42.690 66.884 41.483  1.00 86.89  ? 303  ALA C CA  1 
ATOM   4420 C C   . ALA C 1 77  ? 43.861 66.103 40.859  1.00 85.66  ? 303  ALA C C   1 
ATOM   4421 O O   . ALA C 1 77  ? 43.650 65.322 39.926  1.00 85.68  ? 303  ALA C O   1 
ATOM   4422 C CB  . ALA C 1 77  ? 41.929 67.631 40.395  1.00 86.55  ? 303  ALA C CB  1 
ATOM   4423 N N   . GLY C 1 78  ? 45.082 66.281 41.355  1.00 83.93  ? 304  GLY C N   1 
ATOM   4424 C CA  . GLY C 1 78  ? 46.180 65.542 40.762  1.00 81.98  ? 304  GLY C CA  1 
ATOM   4425 C C   . GLY C 1 78  ? 47.513 65.480 41.483  1.00 80.57  ? 304  GLY C C   1 
ATOM   4426 O O   . GLY C 1 78  ? 48.435 64.840 40.977  1.00 80.56  ? 304  GLY C O   1 
ATOM   4427 N N   . TRP C 1 79  ? 47.631 66.120 42.647  1.00 78.90  ? 305  TRP C N   1 
ATOM   4428 C CA  . TRP C 1 79  ? 48.884 66.109 43.412  1.00 76.89  ? 305  TRP C CA  1 
ATOM   4429 C C   . TRP C 1 79  ? 49.436 64.698 43.528  1.00 75.78  ? 305  TRP C C   1 
ATOM   4430 O O   . TRP C 1 79  ? 50.646 64.491 43.658  1.00 74.84  ? 305  TRP C O   1 
ATOM   4431 C CB  . TRP C 1 79  ? 48.659 66.660 44.819  1.00 76.62  ? 305  TRP C CB  1 
ATOM   4432 C CG  . TRP C 1 79  ? 47.637 65.889 45.580  1.00 78.68  ? 305  TRP C CG  1 
ATOM   4433 C CD1 . TRP C 1 79  ? 46.299 66.137 45.636  1.00 79.98  ? 305  TRP C CD1 1 
ATOM   4434 C CD2 . TRP C 1 79  ? 47.851 64.678 46.314  1.00 79.67  ? 305  TRP C CD2 1 
ATOM   4435 N NE1 . TRP C 1 79  ? 45.663 65.156 46.359  1.00 80.10  ? 305  TRP C NE1 1 
ATOM   4436 C CE2 . TRP C 1 79  ? 46.595 64.250 46.789  1.00 79.90  ? 305  TRP C CE2 1 
ATOM   4437 C CE3 . TRP C 1 79  ? 48.983 63.918 46.623  1.00 80.06  ? 305  TRP C CE3 1 
ATOM   4438 C CZ2 . TRP C 1 79  ? 46.439 63.086 47.540  1.00 80.03  ? 305  TRP C CZ2 1 
ATOM   4439 C CZ3 . TRP C 1 79  ? 48.826 62.764 47.368  1.00 80.25  ? 305  TRP C CZ3 1 
ATOM   4440 C CH2 . TRP C 1 79  ? 47.564 62.362 47.824  1.00 80.32  ? 305  TRP C CH2 1 
ATOM   4441 N N   . ASN C 1 80  ? 48.521 63.735 43.496  1.00 74.92  ? 306  ASN C N   1 
ATOM   4442 C CA  . ASN C 1 80  ? 48.842 62.325 43.595  1.00 74.12  ? 306  ASN C CA  1 
ATOM   4443 C C   . ASN C 1 80  ? 49.658 61.918 42.378  1.00 73.53  ? 306  ASN C C   1 
ATOM   4444 O O   . ASN C 1 80  ? 50.851 61.630 42.499  1.00 74.56  ? 306  ASN C O   1 
ATOM   4445 C CB  . ASN C 1 80  ? 47.539 61.524 43.676  1.00 73.43  ? 306  ASN C CB  1 
ATOM   4446 C CG  . ASN C 1 80  ? 47.769 60.064 43.977  1.00 71.42  ? 306  ASN C CG  1 
ATOM   4447 O OD1 . ASN C 1 80  ? 48.377 59.699 44.991  1.00 69.40  ? 306  ASN C OD1 1 
ATOM   4448 N ND2 . ASN C 1 80  ? 47.280 59.216 43.096  1.00 69.80  ? 306  ASN C ND2 1 
ATOM   4449 N N   . GLU C 1 81  ? 49.024 61.912 41.205  1.00 71.93  ? 307  GLU C N   1 
ATOM   4450 C CA  . GLU C 1 81  ? 49.729 61.550 39.982  1.00 71.26  ? 307  GLU C CA  1 
ATOM   4451 C C   . GLU C 1 81  ? 51.013 62.375 39.837  1.00 68.87  ? 307  GLU C C   1 
ATOM   4452 O O   . GLU C 1 81  ? 51.982 61.935 39.218  1.00 67.82  ? 307  GLU C O   1 
ATOM   4453 C CB  . GLU C 1 81  ? 48.819 61.746 38.762  1.00 73.40  ? 307  GLU C CB  1 
ATOM   4454 C CG  . GLU C 1 81  ? 47.773 60.641 38.585  1.00 78.01  ? 307  GLU C CG  1 
ATOM   4455 C CD  . GLU C 1 81  ? 46.882 60.827 37.353  1.00 80.71  ? 307  GLU C CD  1 
ATOM   4456 O OE1 . GLU C 1 81  ? 47.390 60.748 36.209  1.00 81.86  ? 307  GLU C OE1 1 
ATOM   4457 O OE2 . GLU C 1 81  ? 45.663 61.047 37.534  1.00 81.89  ? 307  GLU C OE2 1 
ATOM   4458 N N   . LEU C 1 82  ? 51.004 63.572 40.417  1.00 66.85  ? 308  LEU C N   1 
ATOM   4459 C CA  . LEU C 1 82  ? 52.148 64.471 40.384  1.00 64.45  ? 308  LEU C CA  1 
ATOM   4460 C C   . LEU C 1 82  ? 53.295 63.895 41.185  1.00 63.12  ? 308  LEU C C   1 
ATOM   4461 O O   . LEU C 1 82  ? 54.382 63.663 40.660  1.00 64.25  ? 308  LEU C O   1 
ATOM   4462 C CB  . LEU C 1 82  ? 51.793 65.831 40.985  1.00 63.40  ? 308  LEU C CB  1 
ATOM   4463 C CG  . LEU C 1 82  ? 51.023 66.877 40.186  1.00 62.04  ? 308  LEU C CG  1 
ATOM   4464 C CD1 . LEU C 1 82  ? 51.247 68.193 40.894  1.00 60.06  ? 308  LEU C CD1 1 
ATOM   4465 C CD2 . LEU C 1 82  ? 51.508 66.968 38.735  1.00 60.46  ? 308  LEU C CD2 1 
ATOM   4466 N N   . LEU C 1 83  ? 53.056 63.699 42.475  1.00 59.95  ? 309  LEU C N   1 
ATOM   4467 C CA  . LEU C 1 83  ? 54.073 63.154 43.344  1.00 57.70  ? 309  LEU C CA  1 
ATOM   4468 C C   . LEU C 1 83  ? 54.570 61.836 42.783  1.00 56.99  ? 309  LEU C C   1 
ATOM   4469 O O   . LEU C 1 83  ? 55.773 61.553 42.807  1.00 56.04  ? 309  LEU C O   1 
ATOM   4470 C CB  . LEU C 1 83  ? 53.503 62.976 44.738  1.00 57.13  ? 309  LEU C CB  1 
ATOM   4471 C CG  . LEU C 1 83  ? 53.219 64.350 45.333  1.00 56.82  ? 309  LEU C CG  1 
ATOM   4472 C CD1 . LEU C 1 83  ? 52.967 64.246 46.823  1.00 55.93  ? 309  LEU C CD1 1 
ATOM   4473 C CD2 . LEU C 1 83  ? 54.427 65.235 45.074  1.00 57.13  ? 309  LEU C CD2 1 
ATOM   4474 N N   . ILE C 1 84  ? 53.635 61.043 42.263  1.00 55.61  ? 310  ILE C N   1 
ATOM   4475 C CA  . ILE C 1 84  ? 53.954 59.758 41.668  1.00 54.37  ? 310  ILE C CA  1 
ATOM   4476 C C   . ILE C 1 84  ? 54.826 59.970 40.433  1.00 55.92  ? 310  ILE C C   1 
ATOM   4477 O O   . ILE C 1 84  ? 55.481 59.045 39.961  1.00 56.50  ? 310  ILE C O   1 
ATOM   4478 C CB  . ILE C 1 84  ? 52.676 59.004 41.293  1.00 52.42  ? 310  ILE C CB  1 
ATOM   4479 C CG1 . ILE C 1 84  ? 51.821 58.787 42.545  1.00 51.17  ? 310  ILE C CG1 1 
ATOM   4480 C CG2 . ILE C 1 84  ? 53.019 57.667 40.692  1.00 52.40  ? 310  ILE C CG2 1 
ATOM   4481 C CD1 . ILE C 1 84  ? 50.514 58.051 42.283  1.00 49.20  ? 310  ILE C CD1 1 
ATOM   4482 N N   . ALA C 1 85  ? 54.831 61.195 39.915  1.00 57.79  ? 311  ALA C N   1 
ATOM   4483 C CA  . ALA C 1 85  ? 55.655 61.567 38.766  1.00 58.18  ? 311  ALA C CA  1 
ATOM   4484 C C   . ALA C 1 85  ? 57.051 61.891 39.290  1.00 58.63  ? 311  ALA C C   1 
ATOM   4485 O O   . ALA C 1 85  ? 58.049 61.463 38.711  1.00 59.64  ? 311  ALA C O   1 
ATOM   4486 C CB  . ALA C 1 85  ? 55.073 62.780 38.068  1.00 57.18  ? 311  ALA C CB  1 
ATOM   4487 N N   . SER C 1 86  ? 57.108 62.642 40.391  1.00 58.36  ? 312  SER C N   1 
ATOM   4488 C CA  . SER C 1 86  ? 58.370 63.017 41.027  1.00 59.45  ? 312  SER C CA  1 
ATOM   4489 C C   . SER C 1 86  ? 59.257 61.819 41.374  1.00 59.67  ? 312  SER C C   1 
ATOM   4490 O O   . SER C 1 86  ? 60.223 61.534 40.662  1.00 60.06  ? 312  SER C O   1 
ATOM   4491 C CB  . SER C 1 86  ? 58.108 63.820 42.306  1.00 59.83  ? 312  SER C CB  1 
ATOM   4492 O OG  . SER C 1 86  ? 57.865 65.186 42.021  1.00 59.87  ? 312  SER C OG  1 
ATOM   4493 N N   . PHE C 1 87  ? 58.928 61.120 42.462  1.00 59.49  ? 313  PHE C N   1 
ATOM   4494 C CA  . PHE C 1 87  ? 59.715 59.964 42.897  1.00 59.36  ? 313  PHE C CA  1 
ATOM   4495 C C   . PHE C 1 87  ? 59.884 58.866 41.836  1.00 59.15  ? 313  PHE C C   1 
ATOM   4496 O O   . PHE C 1 87  ? 60.809 58.054 41.913  1.00 58.36  ? 313  PHE C O   1 
ATOM   4497 C CB  . PHE C 1 87  ? 59.125 59.361 44.191  1.00 60.36  ? 313  PHE C CB  1 
ATOM   4498 C CG  . PHE C 1 87  ? 57.850 58.543 43.995  1.00 60.92  ? 313  PHE C CG  1 
ATOM   4499 C CD1 . PHE C 1 87  ? 57.856 57.361 43.256  1.00 59.34  ? 313  PHE C CD1 1 
ATOM   4500 C CD2 . PHE C 1 87  ? 56.660 58.936 44.594  1.00 59.96  ? 313  PHE C CD2 1 
ATOM   4501 C CE1 . PHE C 1 87  ? 56.715 56.599 43.123  1.00 58.26  ? 313  PHE C CE1 1 
ATOM   4502 C CE2 . PHE C 1 87  ? 55.514 58.171 44.462  1.00 58.59  ? 313  PHE C CE2 1 
ATOM   4503 C CZ  . PHE C 1 87  ? 55.544 57.002 43.726  1.00 58.05  ? 313  PHE C CZ  1 
ATOM   4504 N N   . SER C 1 88  ? 58.986 58.825 40.858  1.00 58.85  ? 314  SER C N   1 
ATOM   4505 C CA  . SER C 1 88  ? 59.089 57.824 39.813  1.00 58.68  ? 314  SER C CA  1 
ATOM   4506 C C   . SER C 1 88  ? 60.383 58.110 39.065  1.00 58.24  ? 314  SER C C   1 
ATOM   4507 O O   . SER C 1 88  ? 61.239 57.231 38.940  1.00 58.33  ? 314  SER C O   1 
ATOM   4508 C CB  . SER C 1 88  ? 57.891 57.913 38.854  1.00 59.36  ? 314  SER C CB  1 
ATOM   4509 O OG  . SER C 1 88  ? 57.069 56.754 38.922  1.00 58.59  ? 314  SER C OG  1 
ATOM   4510 N N   . HIS C 1 89  ? 60.520 59.350 38.590  1.00 56.77  ? 315  HIS C N   1 
ATOM   4511 C CA  . HIS C 1 89  ? 61.699 59.795 37.841  1.00 56.57  ? 315  HIS C CA  1 
ATOM   4512 C C   . HIS C 1 89  ? 62.977 59.663 38.680  1.00 56.71  ? 315  HIS C C   1 
ATOM   4513 O O   . HIS C 1 89  ? 63.997 59.097 38.253  1.00 55.45  ? 315  HIS C O   1 
ATOM   4514 C CB  . HIS C 1 89  ? 61.516 61.257 37.422  1.00 54.51  ? 315  HIS C CB  1 
ATOM   4515 C CG  . HIS C 1 89  ? 62.451 61.697 36.336  1.00 52.37  ? 315  HIS C CG  1 
ATOM   4516 N ND1 . HIS C 1 89  ? 63.306 62.770 36.476  1.00 49.07  ? 315  HIS C ND1 1 
ATOM   4517 C CD2 . HIS C 1 89  ? 62.636 61.228 35.078  1.00 49.87  ? 315  HIS C CD2 1 
ATOM   4518 C CE1 . HIS C 1 89  ? 63.973 62.944 35.349  1.00 48.79  ? 315  HIS C CE1 1 
ATOM   4519 N NE2 . HIS C 1 89  ? 63.585 62.023 34.485  1.00 48.27  ? 315  HIS C NE2 1 
ATOM   4520 N N   . ARG C 1 90  ? 62.903 60.222 39.877  1.00 56.00  ? 316  ARG C N   1 
ATOM   4521 C CA  . ARG C 1 90  ? 63.985 60.180 40.822  1.00 54.78  ? 316  ARG C CA  1 
ATOM   4522 C C   . ARG C 1 90  ? 64.526 58.753 40.932  1.00 55.41  ? 316  ARG C C   1 
ATOM   4523 O O   . ARG C 1 90  ? 65.735 58.540 40.957  1.00 55.54  ? 316  ARG C O   1 
ATOM   4524 C CB  . ARG C 1 90  ? 63.452 60.643 42.157  1.00 53.68  ? 316  ARG C CB  1 
ATOM   4525 C CG  . ARG C 1 90  ? 64.460 60.681 43.238  1.00 57.65  ? 316  ARG C CG  1 
ATOM   4526 C CD  . ARG C 1 90  ? 63.748 60.783 44.548  1.00 60.04  ? 316  ARG C CD  1 
ATOM   4527 N NE  . ARG C 1 90  ? 62.845 61.925 44.576  1.00 64.40  ? 316  ARG C NE  1 
ATOM   4528 C CZ  . ARG C 1 90  ? 61.803 62.026 45.395  1.00 67.03  ? 316  ARG C CZ  1 
ATOM   4529 N NH1 . ARG C 1 90  ? 61.542 61.045 46.245  1.00 68.45  ? 316  ARG C NH1 1 
ATOM   4530 N NH2 . ARG C 1 90  ? 61.024 63.102 45.370  1.00 67.49  ? 316  ARG C NH2 1 
ATOM   4531 N N   . SER C 1 91  ? 63.622 57.777 40.982  1.00 57.04  ? 317  SER C N   1 
ATOM   4532 C CA  . SER C 1 91  ? 63.989 56.362 41.105  1.00 57.37  ? 317  SER C CA  1 
ATOM   4533 C C   . SER C 1 91  ? 64.512 55.679 39.833  1.00 57.62  ? 317  SER C C   1 
ATOM   4534 O O   . SER C 1 91  ? 64.620 54.447 39.787  1.00 56.18  ? 317  SER C O   1 
ATOM   4535 C CB  . SER C 1 91  ? 62.798 55.564 41.638  1.00 56.48  ? 317  SER C CB  1 
ATOM   4536 O OG  . SER C 1 91  ? 62.255 56.184 42.782  1.00 55.01  ? 317  SER C OG  1 
ATOM   4537 N N   . ILE C 1 92  ? 64.819 56.465 38.804  1.00 57.85  ? 318  ILE C N   1 
ATOM   4538 C CA  . ILE C 1 92  ? 65.348 55.903 37.566  1.00 60.12  ? 318  ILE C CA  1 
ATOM   4539 C C   . ILE C 1 92  ? 66.794 55.482 37.809  1.00 61.36  ? 318  ILE C C   1 
ATOM   4540 O O   . ILE C 1 92  ? 67.317 54.566 37.154  1.00 61.24  ? 318  ILE C O   1 
ATOM   4541 C CB  . ILE C 1 92  ? 65.333 56.934 36.416  1.00 61.25  ? 318  ILE C CB  1 
ATOM   4542 C CG1 . ILE C 1 92  ? 63.892 57.327 36.080  1.00 61.29  ? 318  ILE C CG1 1 
ATOM   4543 C CG2 . ILE C 1 92  ? 66.010 56.339 35.178  1.00 61.52  ? 318  ILE C CG2 1 
ATOM   4544 C CD1 . ILE C 1 92  ? 63.773 58.238 34.872  1.00 60.97  ? 318  ILE C CD1 1 
ATOM   4545 N N   . ALA C 1 93  ? 67.411 56.179 38.767  1.00 61.67  ? 319  ALA C N   1 
ATOM   4546 C CA  . ALA C 1 93  ? 68.793 55.992 39.206  1.00 61.61  ? 319  ALA C CA  1 
ATOM   4547 C C   . ALA C 1 93  ? 69.106 54.630 39.812  1.00 62.29  ? 319  ALA C C   1 
ATOM   4548 O O   . ALA C 1 93  ? 70.261 54.204 39.803  1.00 63.44  ? 319  ALA C O   1 
ATOM   4549 C CB  . ALA C 1 93  ? 69.149 57.078 40.223  1.00 60.30  ? 319  ALA C CB  1 
ATOM   4550 N N   . VAL C 1 94  ? 68.086 53.966 40.353  1.00 62.36  ? 320  VAL C N   1 
ATOM   4551 C CA  . VAL C 1 94  ? 68.245 52.663 40.994  1.00 60.74  ? 320  VAL C CA  1 
ATOM   4552 C C   . VAL C 1 94  ? 67.505 51.553 40.252  1.00 60.90  ? 320  VAL C C   1 
ATOM   4553 O O   . VAL C 1 94  ? 66.575 51.814 39.489  1.00 61.69  ? 320  VAL C O   1 
ATOM   4554 C CB  . VAL C 1 94  ? 67.740 52.719 42.466  1.00 60.02  ? 320  VAL C CB  1 
ATOM   4555 C CG1 . VAL C 1 94  ? 68.584 53.692 43.265  1.00 59.53  ? 320  VAL C CG1 1 
ATOM   4556 C CG2 . VAL C 1 94  ? 66.292 53.171 42.513  1.00 58.41  ? 320  VAL C CG2 1 
ATOM   4557 N N   . LYS C 1 95  ? 67.927 50.312 40.477  1.00 60.55  ? 321  LYS C N   1 
ATOM   4558 C CA  . LYS C 1 95  ? 67.292 49.163 39.845  1.00 59.61  ? 321  LYS C CA  1 
ATOM   4559 C C   . LYS C 1 95  ? 66.452 48.467 40.917  1.00 60.23  ? 321  LYS C C   1 
ATOM   4560 O O   . LYS C 1 95  ? 66.891 48.340 42.068  1.00 60.31  ? 321  LYS C O   1 
ATOM   4561 C CB  . LYS C 1 95  ? 68.357 48.208 39.297  1.00 59.42  ? 321  LYS C CB  1 
ATOM   4562 C CG  . LYS C 1 95  ? 67.816 47.001 38.539  1.00 59.73  ? 321  LYS C CG  1 
ATOM   4563 C CD  . LYS C 1 95  ? 67.122 47.390 37.252  1.00 59.28  ? 321  LYS C CD  1 
ATOM   4564 C CE  . LYS C 1 95  ? 66.714 46.143 36.491  1.00 61.21  ? 321  LYS C CE  1 
ATOM   4565 N NZ  . LYS C 1 95  ? 66.023 46.455 35.198  1.00 64.55  ? 321  LYS C NZ  1 
ATOM   4566 N N   . ASP C 1 96  ? 65.241 48.047 40.538  1.00 59.28  ? 322  ASP C N   1 
ATOM   4567 C CA  . ASP C 1 96  ? 64.310 47.355 41.433  1.00 56.00  ? 322  ASP C CA  1 
ATOM   4568 C C   . ASP C 1 96  ? 63.996 48.084 42.721  1.00 54.98  ? 322  ASP C C   1 
ATOM   4569 O O   . ASP C 1 96  ? 63.749 47.442 43.733  1.00 55.14  ? 322  ASP C O   1 
ATOM   4570 C CB  . ASP C 1 96  ? 64.835 45.969 41.811  1.00 55.28  ? 322  ASP C CB  1 
ATOM   4571 C CG  . ASP C 1 96  ? 64.903 45.039 40.637  1.00 56.75  ? 322  ASP C CG  1 
ATOM   4572 O OD1 . ASP C 1 96  ? 64.276 45.352 39.600  1.00 56.09  ? 322  ASP C OD1 1 
ATOM   4573 O OD2 . ASP C 1 96  ? 65.576 43.993 40.760  1.00 56.42  ? 322  ASP C OD2 1 
ATOM   4574 N N   . GLY C 1 97  ? 63.996 49.409 42.713  1.00 53.24  ? 323  GLY C N   1 
ATOM   4575 C CA  . GLY C 1 97  ? 63.704 50.100 43.952  1.00 52.48  ? 323  GLY C CA  1 
ATOM   4576 C C   . GLY C 1 97  ? 63.016 51.418 43.721  1.00 52.58  ? 323  GLY C C   1 
ATOM   4577 O O   . GLY C 1 97  ? 62.772 51.807 42.578  1.00 53.89  ? 323  GLY C O   1 
ATOM   4578 N N   . ILE C 1 98  ? 62.689 52.100 44.810  1.00 52.23  ? 324  ILE C N   1 
ATOM   4579 C CA  . ILE C 1 98  ? 62.038 53.400 44.729  1.00 52.15  ? 324  ILE C CA  1 
ATOM   4580 C C   . ILE C 1 98  ? 62.747 54.328 45.678  1.00 52.29  ? 324  ILE C C   1 
ATOM   4581 O O   . ILE C 1 98  ? 62.835 54.065 46.877  1.00 49.74  ? 324  ILE C O   1 
ATOM   4582 C CB  . ILE C 1 98  ? 60.561 53.365 45.169  1.00 53.26  ? 324  ILE C CB  1 
ATOM   4583 C CG1 . ILE C 1 98  ? 59.716 52.524 44.196  1.00 53.86  ? 324  ILE C CG1 1 
ATOM   4584 C CG2 . ILE C 1 98  ? 60.048 54.800 45.308  1.00 51.60  ? 324  ILE C CG2 1 
ATOM   4585 C CD1 . ILE C 1 98  ? 59.411 53.178 42.858  1.00 52.94  ? 324  ILE C CD1 1 
ATOM   4586 N N   . LEU C 1 99  ? 63.245 55.421 45.128  1.00 55.57  ? 325  LEU C N   1 
ATOM   4587 C CA  . LEU C 1 99  ? 63.961 56.422 45.906  1.00 59.03  ? 325  LEU C CA  1 
ATOM   4588 C C   . LEU C 1 99  ? 62.979 57.421 46.516  1.00 59.49  ? 325  LEU C C   1 
ATOM   4589 O O   . LEU C 1 99  ? 62.538 58.362 45.859  1.00 58.91  ? 325  LEU C O   1 
ATOM   4590 C CB  . LEU C 1 99  ? 64.998 57.119 45.004  1.00 59.39  ? 325  LEU C CB  1 
ATOM   4591 C CG  . LEU C 1 99  ? 66.106 56.174 44.484  1.00 58.69  ? 325  LEU C CG  1 
ATOM   4592 C CD1 . LEU C 1 99  ? 66.635 56.612 43.118  1.00 56.53  ? 325  LEU C CD1 1 
ATOM   4593 C CD2 . LEU C 1 99  ? 67.220 56.118 45.516  1.00 56.81  ? 325  LEU C CD2 1 
ATOM   4594 N N   . LEU C 1 100 ? 62.640 57.184 47.782  1.00 61.56  ? 326  LEU C N   1 
ATOM   4595 C CA  . LEU C 1 100 ? 61.701 58.019 48.529  1.00 64.11  ? 326  LEU C CA  1 
ATOM   4596 C C   . LEU C 1 100 ? 62.321 59.314 49.009  1.00 65.46  ? 326  LEU C C   1 
ATOM   4597 O O   . LEU C 1 100 ? 63.520 59.374 49.262  1.00 67.51  ? 326  LEU C O   1 
ATOM   4598 C CB  . LEU C 1 100 ? 61.163 57.256 49.739  1.00 64.41  ? 326  LEU C CB  1 
ATOM   4599 C CG  . LEU C 1 100 ? 60.422 55.960 49.421  1.00 64.05  ? 326  LEU C CG  1 
ATOM   4600 C CD1 . LEU C 1 100 ? 59.728 55.444 50.678  1.00 62.67  ? 326  LEU C CD1 1 
ATOM   4601 C CD2 . LEU C 1 100 ? 59.418 56.222 48.300  1.00 62.58  ? 326  LEU C CD2 1 
ATOM   4602 N N   . ALA C 1 101 ? 61.482 60.332 49.181  1.00 67.00  ? 327  ALA C N   1 
ATOM   4603 C CA  . ALA C 1 101 ? 61.922 61.661 49.599  1.00 68.49  ? 327  ALA C CA  1 
ATOM   4604 C C   . ALA C 1 101 ? 62.307 61.851 51.071  1.00 70.06  ? 327  ALA C C   1 
ATOM   4605 O O   . ALA C 1 101 ? 62.416 62.989 51.543  1.00 70.04  ? 327  ALA C O   1 
ATOM   4606 C CB  . ALA C 1 101 ? 60.869 62.680 49.209  1.00 68.96  ? 327  ALA C CB  1 
ATOM   4607 N N   . THR C 1 102 ? 62.497 60.750 51.797  1.00 71.54  ? 328  THR C N   1 
ATOM   4608 C CA  . THR C 1 102 ? 62.913 60.806 53.204  1.00 72.00  ? 328  THR C CA  1 
ATOM   4609 C C   . THR C 1 102 ? 64.318 60.192 53.318  1.00 72.06  ? 328  THR C C   1 
ATOM   4610 O O   . THR C 1 102 ? 64.879 60.048 54.417  1.00 72.64  ? 328  THR C O   1 
ATOM   4611 C CB  . THR C 1 102 ? 61.952 60.011 54.114  1.00 71.97  ? 328  THR C CB  1 
ATOM   4612 O OG1 . THR C 1 102 ? 62.032 58.612 53.801  1.00 71.57  ? 328  THR C OG1 1 
ATOM   4613 C CG2 . THR C 1 102 ? 60.531 60.496 53.920  1.00 71.74  ? 328  THR C CG2 1 
ATOM   4614 N N   . GLY C 1 103 ? 64.880 59.853 52.159  1.00 70.78  ? 329  GLY C N   1 
ATOM   4615 C CA  . GLY C 1 103 ? 66.189 59.246 52.110  1.00 68.17  ? 329  GLY C CA  1 
ATOM   4616 C C   . GLY C 1 103 ? 66.005 57.807 52.512  1.00 65.88  ? 329  GLY C C   1 
ATOM   4617 O O   . GLY C 1 103 ? 66.678 57.316 53.418  1.00 67.13  ? 329  GLY C O   1 
ATOM   4618 N N   . LEU C 1 104 ? 65.067 57.135 51.858  1.00 62.64  ? 330  LEU C N   1 
ATOM   4619 C CA  . LEU C 1 104 ? 64.818 55.746 52.174  1.00 60.32  ? 330  LEU C CA  1 
ATOM   4620 C C   . LEU C 1 104 ? 64.534 54.965 50.923  1.00 58.61  ? 330  LEU C C   1 
ATOM   4621 O O   . LEU C 1 104 ? 63.415 54.951 50.432  1.00 58.92  ? 330  LEU C O   1 
ATOM   4622 C CB  . LEU C 1 104 ? 63.633 55.592 53.131  1.00 59.70  ? 330  LEU C CB  1 
ATOM   4623 C CG  . LEU C 1 104 ? 63.343 54.142 53.536  1.00 57.89  ? 330  LEU C CG  1 
ATOM   4624 C CD1 . LEU C 1 104 ? 64.225 53.763 54.710  1.00 57.38  ? 330  LEU C CD1 1 
ATOM   4625 C CD2 . LEU C 1 104 ? 61.887 53.987 53.905  1.00 57.34  ? 330  LEU C CD2 1 
ATOM   4626 N N   . HIS C 1 105 ? 65.556 54.329 50.385  1.00 56.89  ? 331  HIS C N   1 
ATOM   4627 C CA  . HIS C 1 105 ? 65.335 53.515 49.218  1.00 56.10  ? 331  HIS C CA  1 
ATOM   4628 C C   . HIS C 1 105 ? 64.518 52.351 49.749  1.00 55.92  ? 331  HIS C C   1 
ATOM   4629 O O   . HIS C 1 105 ? 64.710 51.917 50.884  1.00 57.50  ? 331  HIS C O   1 
ATOM   4630 C CB  . HIS C 1 105 ? 66.664 53.016 48.660  1.00 54.60  ? 331  HIS C CB  1 
ATOM   4631 C CG  . HIS C 1 105 ? 66.535 51.862 47.712  1.00 52.59  ? 331  HIS C CG  1 
ATOM   4632 N ND1 . HIS C 1 105 ? 66.473 50.551 48.137  1.00 53.48  ? 331  HIS C ND1 1 
ATOM   4633 C CD2 . HIS C 1 105 ? 66.470 51.820 46.359  1.00 52.62  ? 331  HIS C CD2 1 
ATOM   4634 C CE1 . HIS C 1 105 ? 66.381 49.753 47.087  1.00 53.89  ? 331  HIS C CE1 1 
ATOM   4635 N NE2 . HIS C 1 105 ? 66.377 50.498 45.996  1.00 52.97  ? 331  HIS C NE2 1 
ATOM   4636 N N   . VAL C 1 106 ? 63.587 51.859 48.954  1.00 54.01  ? 332  VAL C N   1 
ATOM   4637 C CA  . VAL C 1 106 ? 62.810 50.734 49.402  1.00 54.10  ? 332  VAL C CA  1 
ATOM   4638 C C   . VAL C 1 106 ? 62.831 49.711 48.282  1.00 54.56  ? 332  VAL C C   1 
ATOM   4639 O O   . VAL C 1 106 ? 62.235 49.920 47.225  1.00 54.53  ? 332  VAL C O   1 
ATOM   4640 C CB  . VAL C 1 106 ? 61.379 51.156 49.715  1.00 55.02  ? 332  VAL C CB  1 
ATOM   4641 C CG1 . VAL C 1 106 ? 60.688 50.060 50.485  1.00 57.99  ? 332  VAL C CG1 1 
ATOM   4642 C CG2 . VAL C 1 106 ? 61.380 52.447 50.527  1.00 55.78  ? 332  VAL C CG2 1 
ATOM   4643 N N   . HIS C 1 107 ? 63.538 48.607 48.504  1.00 54.98  ? 333  HIS C N   1 
ATOM   4644 C CA  . HIS C 1 107 ? 63.638 47.571 47.482  1.00 55.76  ? 333  HIS C CA  1 
ATOM   4645 C C   . HIS C 1 107 ? 62.274 46.987 47.095  1.00 55.97  ? 333  HIS C C   1 
ATOM   4646 O O   . HIS C 1 107 ? 61.275 47.210 47.779  1.00 56.43  ? 333  HIS C O   1 
ATOM   4647 C CB  . HIS C 1 107 ? 64.596 46.451 47.951  1.00 55.56  ? 333  HIS C CB  1 
ATOM   4648 C CG  . HIS C 1 107 ? 65.050 45.538 46.846  1.00 55.05  ? 333  HIS C CG  1 
ATOM   4649 N ND1 . HIS C 1 107 ? 64.510 44.287 46.637  1.00 55.30  ? 333  HIS C ND1 1 
ATOM   4650 C CD2 . HIS C 1 107 ? 65.917 45.743 45.825  1.00 55.62  ? 333  HIS C CD2 1 
ATOM   4651 C CE1 . HIS C 1 107 ? 65.016 43.766 45.532  1.00 55.11  ? 333  HIS C CE1 1 
ATOM   4652 N NE2 . HIS C 1 107 ? 65.871 44.630 45.019  1.00 55.21  ? 333  HIS C NE2 1 
ATOM   4653 N N   . ARG C 1 108 ? 62.254 46.257 45.978  1.00 56.57  ? 334  ARG C N   1 
ATOM   4654 C CA  . ARG C 1 108 ? 61.078 45.574 45.437  1.00 57.45  ? 334  ARG C CA  1 
ATOM   4655 C C   . ARG C 1 108 ? 60.601 44.465 46.390  1.00 60.34  ? 334  ARG C C   1 
ATOM   4656 O O   . ARG C 1 108 ? 59.655 43.744 46.083  1.00 61.29  ? 334  ARG C O   1 
ATOM   4657 C CB  . ARG C 1 108 ? 61.432 44.968 44.070  1.00 56.15  ? 334  ARG C CB  1 
ATOM   4658 C CG  . ARG C 1 108 ? 60.364 44.071 43.471  1.00 59.64  ? 334  ARG C CG  1 
ATOM   4659 C CD  . ARG C 1 108 ? 60.603 43.751 42.001  1.00 62.13  ? 334  ARG C CD  1 
ATOM   4660 N NE  . ARG C 1 108 ? 60.424 44.918 41.135  1.00 64.75  ? 334  ARG C NE  1 
ATOM   4661 C CZ  . ARG C 1 108 ? 60.170 44.835 39.833  1.00 65.63  ? 334  ARG C CZ  1 
ATOM   4662 N NH1 . ARG C 1 108 ? 60.069 43.638 39.269  1.00 67.82  ? 334  ARG C NH1 1 
ATOM   4663 N NH2 . ARG C 1 108 ? 60.004 45.930 39.099  1.00 63.70  ? 334  ARG C NH2 1 
ATOM   4664 N N   . ASN C 1 109 ? 61.245 44.350 47.554  1.00 63.38  ? 335  ASN C N   1 
ATOM   4665 C CA  . ASN C 1 109 ? 60.908 43.328 48.531  1.00 64.51  ? 335  ASN C CA  1 
ATOM   4666 C C   . ASN C 1 109 ? 60.385 43.831 49.854  1.00 64.50  ? 335  ASN C C   1 
ATOM   4667 O O   . ASN C 1 109 ? 59.660 43.117 50.537  1.00 64.55  ? 335  ASN C O   1 
ATOM   4668 C CB  . ASN C 1 109 ? 62.101 42.404 48.722  1.00 66.41  ? 335  ASN C CB  1 
ATOM   4669 C CG  . ASN C 1 109 ? 62.332 41.520 47.513  1.00 68.75  ? 335  ASN C CG  1 
ATOM   4670 O OD1 . ASN C 1 109 ? 63.428 41.002 47.319  1.00 69.28  ? 335  ASN C OD1 1 
ATOM   4671 N ND2 . ASN C 1 109 ? 61.292 41.338 46.692  1.00 70.07  ? 335  ASN C ND2 1 
ATOM   4672 N N   . SER C 1 110 ? 60.755 45.047 50.231  1.00 64.91  ? 336  SER C N   1 
ATOM   4673 C CA  . SER C 1 110 ? 60.201 45.626 51.449  1.00 66.79  ? 336  SER C CA  1 
ATOM   4674 C C   . SER C 1 110 ? 58.776 46.036 51.044  1.00 68.32  ? 336  SER C C   1 
ATOM   4675 O O   . SER C 1 110 ? 57.915 46.291 51.891  1.00 69.07  ? 336  SER C O   1 
ATOM   4676 C CB  . SER C 1 110 ? 60.966 46.884 51.871  1.00 66.09  ? 336  SER C CB  1 
ATOM   4677 O OG  . SER C 1 110 ? 62.361 46.683 51.837  1.00 69.82  ? 336  SER C OG  1 
ATOM   4678 N N   . ALA C 1 111 ? 58.561 46.112 49.729  1.00 69.69  ? 337  ALA C N   1 
ATOM   4679 C CA  . ALA C 1 111 ? 57.287 46.491 49.126  1.00 69.98  ? 337  ALA C CA  1 
ATOM   4680 C C   . ALA C 1 111 ? 56.319 45.352 49.238  1.00 70.23  ? 337  ALA C C   1 
ATOM   4681 O O   . ALA C 1 111 ? 55.334 45.424 49.971  1.00 71.54  ? 337  ALA C O   1 
ATOM   4682 C CB  . ALA C 1 111 ? 57.482 46.834 47.660  1.00 70.21  ? 337  ALA C CB  1 
ATOM   4683 N N   . HIS C 1 112 ? 56.597 44.296 48.491  1.00 69.23  ? 338  HIS C N   1 
ATOM   4684 C CA  . HIS C 1 112 ? 55.738 43.136 48.525  1.00 69.78  ? 338  HIS C CA  1 
ATOM   4685 C C   . HIS C 1 112 ? 55.448 42.750 49.973  1.00 70.09  ? 338  HIS C C   1 
ATOM   4686 O O   . HIS C 1 112 ? 54.307 42.434 50.318  1.00 70.70  ? 338  HIS C O   1 
ATOM   4687 C CB  . HIS C 1 112 ? 56.401 41.999 47.760  1.00 69.16  ? 338  HIS C CB  1 
ATOM   4688 C CG  . HIS C 1 112 ? 56.393 42.207 46.279  1.00 68.52  ? 338  HIS C CG  1 
ATOM   4689 N ND1 . HIS C 1 112 ? 56.850 43.366 45.692  1.00 66.39  ? 338  HIS C ND1 1 
ATOM   4690 C CD2 . HIS C 1 112 ? 55.933 41.430 45.270  1.00 68.45  ? 338  HIS C CD2 1 
ATOM   4691 C CE1 . HIS C 1 112 ? 56.667 43.296 44.386  1.00 67.26  ? 338  HIS C CE1 1 
ATOM   4692 N NE2 . HIS C 1 112 ? 56.112 42.132 44.103  1.00 67.85  ? 338  HIS C NE2 1 
ATOM   4693 N N   . SER C 1 113 ? 56.488 42.812 50.807  1.00 69.65  ? 339  SER C N   1 
ATOM   4694 C CA  . SER C 1 113 ? 56.416 42.503 52.236  1.00 67.99  ? 339  SER C CA  1 
ATOM   4695 C C   . SER C 1 113 ? 55.543 43.472 53.035  1.00 67.99  ? 339  SER C C   1 
ATOM   4696 O O   . SER C 1 113 ? 54.742 43.039 53.858  1.00 69.12  ? 339  SER C O   1 
ATOM   4697 C CB  . SER C 1 113 ? 57.830 42.492 52.839  1.00 66.95  ? 339  SER C CB  1 
ATOM   4698 O OG  . SER C 1 113 ? 57.847 42.995 54.171  1.00 62.82  ? 339  SER C OG  1 
ATOM   4699 N N   . ALA C 1 114 ? 55.699 44.774 52.802  1.00 67.21  ? 340  ALA C N   1 
ATOM   4700 C CA  . ALA C 1 114 ? 54.918 45.776 53.530  1.00 66.20  ? 340  ALA C CA  1 
ATOM   4701 C C   . ALA C 1 114 ? 53.439 45.882 53.106  1.00 65.09  ? 340  ALA C C   1 
ATOM   4702 O O   . ALA C 1 114 ? 52.656 46.574 53.755  1.00 65.81  ? 340  ALA C O   1 
ATOM   4703 C CB  . ALA C 1 114 ? 55.604 47.148 53.436  1.00 64.73  ? 340  ALA C CB  1 
ATOM   4704 N N   . GLY C 1 115 ? 53.055 45.204 52.027  1.00 63.14  ? 341  GLY C N   1 
ATOM   4705 C CA  . GLY C 1 115 ? 51.664 45.240 51.601  1.00 61.44  ? 341  GLY C CA  1 
ATOM   4706 C C   . GLY C 1 115 ? 51.348 46.080 50.379  1.00 60.16  ? 341  GLY C C   1 
ATOM   4707 O O   . GLY C 1 115 ? 50.178 46.382 50.098  1.00 60.26  ? 341  GLY C O   1 
ATOM   4708 N N   . VAL C 1 116 ? 52.392 46.434 49.637  1.00 57.52  ? 342  VAL C N   1 
ATOM   4709 C CA  . VAL C 1 116 ? 52.253 47.260 48.442  1.00 52.79  ? 342  VAL C CA  1 
ATOM   4710 C C   . VAL C 1 116 ? 53.035 46.709 47.243  1.00 50.39  ? 342  VAL C C   1 
ATOM   4711 O O   . VAL C 1 116 ? 53.542 47.466 46.418  1.00 48.59  ? 342  VAL C O   1 
ATOM   4712 C CB  . VAL C 1 116 ? 52.714 48.681 48.770  1.00 51.33  ? 342  VAL C CB  1 
ATOM   4713 C CG1 . VAL C 1 116 ? 51.683 49.354 49.674  1.00 51.26  ? 342  VAL C CG1 1 
ATOM   4714 C CG2 . VAL C 1 116 ? 54.034 48.628 49.507  1.00 49.65  ? 342  VAL C CG2 1 
ATOM   4715 N N   . GLY C 1 117 ? 53.098 45.381 47.151  1.00 47.86  ? 343  GLY C N   1 
ATOM   4716 C CA  . GLY C 1 117 ? 53.827 44.728 46.085  1.00 44.57  ? 343  GLY C CA  1 
ATOM   4717 C C   . GLY C 1 117 ? 53.358 44.992 44.675  1.00 42.98  ? 343  GLY C C   1 
ATOM   4718 O O   . GLY C 1 117 ? 54.050 45.661 43.922  1.00 41.79  ? 343  GLY C O   1 
ATOM   4719 N N   . ALA C 1 118 ? 52.187 44.470 44.319  1.00 42.86  ? 344  ALA C N   1 
ATOM   4720 C CA  . ALA C 1 118 ? 51.626 44.622 42.973  1.00 43.69  ? 344  ALA C CA  1 
ATOM   4721 C C   . ALA C 1 118 ? 51.623 46.031 42.361  1.00 44.47  ? 344  ALA C C   1 
ATOM   4722 O O   . ALA C 1 118 ? 51.710 46.174 41.142  1.00 43.12  ? 344  ALA C O   1 
ATOM   4723 C CB  . ALA C 1 118 ? 50.230 44.040 42.942  1.00 43.70  ? 344  ALA C CB  1 
ATOM   4724 N N   . ILE C 1 119 ? 51.502 47.058 43.202  1.00 46.81  ? 345  ILE C N   1 
ATOM   4725 C CA  . ILE C 1 119 ? 51.522 48.467 42.762  1.00 49.45  ? 345  ILE C CA  1 
ATOM   4726 C C   . ILE C 1 119 ? 52.981 48.911 42.496  1.00 50.69  ? 345  ILE C C   1 
ATOM   4727 O O   . ILE C 1 119 ? 53.288 49.496 41.455  1.00 49.88  ? 345  ILE C O   1 
ATOM   4728 C CB  . ILE C 1 119 ? 50.859 49.415 43.849  1.00 50.11  ? 345  ILE C CB  1 
ATOM   4729 C CG1 . ILE C 1 119 ? 50.935 50.884 43.406  1.00 47.02  ? 345  ILE C CG1 1 
ATOM   4730 C CG2 . ILE C 1 119 ? 51.517 49.216 45.219  1.00 49.59  ? 345  ILE C CG2 1 
ATOM   4731 C CD1 . ILE C 1 119 ? 50.014 51.235 42.242  1.00 44.20  ? 345  ILE C CD1 1 
ATOM   4732 N N   . PHE C 1 120 ? 53.862 48.623 43.455  1.00 52.02  ? 346  PHE C N   1 
ATOM   4733 C CA  . PHE C 1 120 ? 55.283 48.923 43.356  1.00 51.65  ? 346  PHE C CA  1 
ATOM   4734 C C   . PHE C 1 120 ? 55.731 48.461 41.971  1.00 50.59  ? 346  PHE C C   1 
ATOM   4735 O O   . PHE C 1 120 ? 56.268 49.237 41.191  1.00 48.84  ? 346  PHE C O   1 
ATOM   4736 C CB  . PHE C 1 120 ? 56.033 48.160 44.464  1.00 53.17  ? 346  PHE C CB  1 
ATOM   4737 C CG  . PHE C 1 120 ? 57.535 48.267 44.382  1.00 55.10  ? 346  PHE C CG  1 
ATOM   4738 C CD1 . PHE C 1 120 ? 58.248 47.550 43.427  1.00 54.39  ? 346  PHE C CD1 1 
ATOM   4739 C CD2 . PHE C 1 120 ? 58.232 49.114 45.241  1.00 55.01  ? 346  PHE C CD2 1 
ATOM   4740 C CE1 . PHE C 1 120 ? 59.619 47.680 43.330  1.00 54.60  ? 346  PHE C CE1 1 
ATOM   4741 C CE2 . PHE C 1 120 ? 59.609 49.248 45.147  1.00 53.70  ? 346  PHE C CE2 1 
ATOM   4742 C CZ  . PHE C 1 120 ? 60.301 48.533 44.192  1.00 54.52  ? 346  PHE C CZ  1 
ATOM   4743 N N   . ASP C 1 121 ? 55.497 47.189 41.673  1.00 51.15  ? 347  ASP C N   1 
ATOM   4744 C CA  . ASP C 1 121 ? 55.848 46.642 40.380  1.00 52.84  ? 347  ASP C CA  1 
ATOM   4745 C C   . ASP C 1 121 ? 55.367 47.588 39.308  1.00 54.16  ? 347  ASP C C   1 
ATOM   4746 O O   . ASP C 1 121 ? 56.163 48.085 38.530  1.00 55.50  ? 347  ASP C O   1 
ATOM   4747 C CB  . ASP C 1 121 ? 55.185 45.286 40.183  1.00 52.42  ? 347  ASP C CB  1 
ATOM   4748 C CG  . ASP C 1 121 ? 55.734 44.242 41.116  1.00 52.25  ? 347  ASP C CG  1 
ATOM   4749 O OD1 . ASP C 1 121 ? 56.623 44.601 41.916  1.00 51.95  ? 347  ASP C OD1 1 
ATOM   4750 O OD2 . ASP C 1 121 ? 55.288 43.073 41.047  1.00 51.55  ? 347  ASP C OD2 1 
ATOM   4751 N N   . ARG C 1 122 ? 54.060 47.840 39.292  1.00 56.05  ? 348  ARG C N   1 
ATOM   4752 C CA  . ARG C 1 122 ? 53.428 48.724 38.311  1.00 56.75  ? 348  ARG C CA  1 
ATOM   4753 C C   . ARG C 1 122 ? 54.106 50.096 38.210  1.00 53.91  ? 348  ARG C C   1 
ATOM   4754 O O   . ARG C 1 122 ? 54.323 50.598 37.109  1.00 51.32  ? 348  ARG C O   1 
ATOM   4755 C CB  . ARG C 1 122 ? 51.928 48.890 38.632  1.00 61.58  ? 348  ARG C CB  1 
ATOM   4756 C CG  . ARG C 1 122 ? 51.027 49.125 37.403  1.00 67.12  ? 348  ARG C CG  1 
ATOM   4757 C CD  . ARG C 1 122 ? 49.565 49.370 37.795  1.00 72.84  ? 348  ARG C CD  1 
ATOM   4758 N NE  . ARG C 1 122 ? 48.713 49.687 36.642  1.00 79.15  ? 348  ARG C NE  1 
ATOM   4759 C CZ  . ARG C 1 122 ? 47.396 49.907 36.708  1.00 81.51  ? 348  ARG C CZ  1 
ATOM   4760 N NH1 . ARG C 1 122 ? 46.761 49.850 37.878  1.00 82.95  ? 348  ARG C NH1 1 
ATOM   4761 N NH2 . ARG C 1 122 ? 46.704 50.177 35.603  1.00 81.59  ? 348  ARG C NH2 1 
ATOM   4762 N N   . VAL C 1 123 ? 54.436 50.712 39.339  1.00 52.56  ? 349  VAL C N   1 
ATOM   4763 C CA  . VAL C 1 123 ? 55.113 51.999 39.273  1.00 51.87  ? 349  VAL C CA  1 
ATOM   4764 C C   . VAL C 1 123 ? 56.463 51.803 38.564  1.00 52.38  ? 349  VAL C C   1 
ATOM   4765 O O   . VAL C 1 123 ? 56.811 52.581 37.682  1.00 51.80  ? 349  VAL C O   1 
ATOM   4766 C CB  . VAL C 1 123 ? 55.333 52.625 40.681  1.00 50.70  ? 349  VAL C CB  1 
ATOM   4767 C CG1 . VAL C 1 123 ? 56.145 53.906 40.570  1.00 47.78  ? 349  VAL C CG1 1 
ATOM   4768 C CG2 . VAL C 1 123 ? 53.999 52.939 41.316  1.00 48.80  ? 349  VAL C CG2 1 
ATOM   4769 N N   . LEU C 1 124 ? 57.219 50.765 38.924  1.00 52.82  ? 350  LEU C N   1 
ATOM   4770 C CA  . LEU C 1 124 ? 58.501 50.535 38.260  1.00 53.07  ? 350  LEU C CA  1 
ATOM   4771 C C   . LEU C 1 124 ? 58.254 50.211 36.803  1.00 54.77  ? 350  LEU C C   1 
ATOM   4772 O O   . LEU C 1 124 ? 58.415 51.074 35.953  1.00 56.80  ? 350  LEU C O   1 
ATOM   4773 C CB  . LEU C 1 124 ? 59.299 49.393 38.895  1.00 51.42  ? 350  LEU C CB  1 
ATOM   4774 C CG  . LEU C 1 124 ? 59.857 49.534 40.318  1.00 51.28  ? 350  LEU C CG  1 
ATOM   4775 C CD1 . LEU C 1 124 ? 61.194 48.828 40.343  1.00 50.86  ? 350  LEU C CD1 1 
ATOM   4776 C CD2 . LEU C 1 124 ? 60.039 50.979 40.732  1.00 50.23  ? 350  LEU C CD2 1 
ATOM   4777 N N   . THR C 1 125 ? 57.845 48.979 36.508  1.00 55.96  ? 351  THR C N   1 
ATOM   4778 C CA  . THR C 1 125 ? 57.589 48.567 35.123  1.00 56.50  ? 351  THR C CA  1 
ATOM   4779 C C   . THR C 1 125 ? 56.854 49.552 34.199  1.00 58.35  ? 351  THR C C   1 
ATOM   4780 O O   . THR C 1 125 ? 57.217 49.695 33.023  1.00 57.56  ? 351  THR C O   1 
ATOM   4781 C CB  . THR C 1 125 ? 56.828 47.227 35.061  1.00 55.12  ? 351  THR C CB  1 
ATOM   4782 O OG1 . THR C 1 125 ? 56.265 47.069 33.754  1.00 52.75  ? 351  THR C OG1 1 
ATOM   4783 C CG2 . THR C 1 125 ? 55.726 47.183 36.086  1.00 55.40  ? 351  THR C CG2 1 
ATOM   4784 N N   . GLU C 1 126 ? 55.835 50.231 34.721  1.00 60.25  ? 352  GLU C N   1 
ATOM   4785 C CA  . GLU C 1 126 ? 55.055 51.173 33.916  1.00 61.02  ? 352  GLU C CA  1 
ATOM   4786 C C   . GLU C 1 126 ? 55.570 52.605 33.896  1.00 60.48  ? 352  GLU C C   1 
ATOM   4787 O O   . GLU C 1 126 ? 55.463 53.289 32.879  1.00 58.58  ? 352  GLU C O   1 
ATOM   4788 C CB  . GLU C 1 126 ? 53.590 51.188 34.384  1.00 62.22  ? 352  GLU C CB  1 
ATOM   4789 C CG  . GLU C 1 126 ? 52.824 49.882 34.168  1.00 62.15  ? 352  GLU C CG  1 
ATOM   4790 C CD  . GLU C 1 126 ? 52.935 49.367 32.742  1.00 63.13  ? 352  GLU C CD  1 
ATOM   4791 O OE1 . GLU C 1 126 ? 52.960 50.187 31.790  1.00 62.98  ? 352  GLU C OE1 1 
ATOM   4792 O OE2 . GLU C 1 126 ? 52.987 48.132 32.573  1.00 63.94  ? 352  GLU C OE2 1 
ATOM   4793 N N   . LEU C 1 127 ? 56.117 53.056 35.020  1.00 60.98  ? 353  LEU C N   1 
ATOM   4794 C CA  . LEU C 1 127 ? 56.616 54.424 35.131  1.00 62.46  ? 353  LEU C CA  1 
ATOM   4795 C C   . LEU C 1 127 ? 58.144 54.555 35.141  1.00 64.63  ? 353  LEU C C   1 
ATOM   4796 O O   . LEU C 1 127 ? 58.727 55.092 34.187  1.00 64.77  ? 353  LEU C O   1 
ATOM   4797 C CB  . LEU C 1 127 ? 56.025 55.084 36.382  1.00 60.87  ? 353  LEU C CB  1 
ATOM   4798 C CG  . LEU C 1 127 ? 54.493 55.046 36.426  1.00 59.91  ? 353  LEU C CG  1 
ATOM   4799 C CD1 . LEU C 1 127 ? 53.977 55.924 37.555  1.00 59.01  ? 353  LEU C CD1 1 
ATOM   4800 C CD2 . LEU C 1 127 ? 53.938 55.524 35.100  1.00 58.65  ? 353  LEU C CD2 1 
ATOM   4801 N N   . VAL C 1 128 ? 58.779 54.083 36.222  1.00 65.90  ? 354  VAL C N   1 
ATOM   4802 C CA  . VAL C 1 128 ? 60.246 54.116 36.390  1.00 64.35  ? 354  VAL C CA  1 
ATOM   4803 C C   . VAL C 1 128 ? 61.007 53.542 35.187  1.00 64.21  ? 354  VAL C C   1 
ATOM   4804 O O   . VAL C 1 128 ? 61.857 54.210 34.596  1.00 63.09  ? 354  VAL C O   1 
ATOM   4805 C CB  . VAL C 1 128 ? 60.660 53.345 37.663  1.00 62.63  ? 354  VAL C CB  1 
ATOM   4806 C CG1 . VAL C 1 128 ? 62.120 52.987 37.612  1.00 62.33  ? 354  VAL C CG1 1 
ATOM   4807 C CG2 . VAL C 1 128 ? 60.378 54.192 38.881  1.00 62.69  ? 354  VAL C CG2 1 
ATOM   4808 N N   . SER C 1 129 ? 60.687 52.305 34.828  1.00 63.87  ? 355  SER C N   1 
ATOM   4809 C CA  . SER C 1 129 ? 61.317 51.650 33.697  1.00 65.03  ? 355  SER C CA  1 
ATOM   4810 C C   . SER C 1 129 ? 61.209 52.478 32.410  1.00 66.20  ? 355  SER C C   1 
ATOM   4811 O O   . SER C 1 129 ? 62.218 52.822 31.804  1.00 67.67  ? 355  SER C O   1 
ATOM   4812 C CB  . SER C 1 129 ? 60.682 50.281 33.483  1.00 64.64  ? 355  SER C CB  1 
ATOM   4813 O OG  . SER C 1 129 ? 61.333 49.588 32.440  1.00 66.41  ? 355  SER C OG  1 
ATOM   4814 N N   . LYS C 1 130 ? 59.983 52.792 31.996  1.00 67.49  ? 356  LYS C N   1 
ATOM   4815 C CA  . LYS C 1 130 ? 59.731 53.577 30.780  1.00 67.06  ? 356  LYS C CA  1 
ATOM   4816 C C   . LYS C 1 130 ? 60.442 54.930 30.744  1.00 67.29  ? 356  LYS C C   1 
ATOM   4817 O O   . LYS C 1 130 ? 61.086 55.268 29.753  1.00 66.51  ? 356  LYS C O   1 
ATOM   4818 C CB  . LYS C 1 130 ? 58.228 53.805 30.598  1.00 65.69  ? 356  LYS C CB  1 
ATOM   4819 C CG  . LYS C 1 130 ? 57.452 52.564 30.243  1.00 65.45  ? 356  LYS C CG  1 
ATOM   4820 C CD  . LYS C 1 130 ? 57.881 52.050 28.893  1.00 66.77  ? 356  LYS C CD  1 
ATOM   4821 C CE  . LYS C 1 130 ? 56.944 50.962 28.386  1.00 68.26  ? 356  LYS C CE  1 
ATOM   4822 N NZ  . LYS C 1 130 ? 57.233 50.609 26.961  1.00 69.60  ? 356  LYS C NZ  1 
ATOM   4823 N N   . MET C 1 131 ? 60.307 55.711 31.811  1.00 67.54  ? 357  MET C N   1 
ATOM   4824 C CA  . MET C 1 131 ? 60.959 57.011 31.874  1.00 69.00  ? 357  MET C CA  1 
ATOM   4825 C C   . MET C 1 131 ? 62.445 56.827 31.555  1.00 72.61  ? 357  MET C C   1 
ATOM   4826 O O   . MET C 1 131 ? 63.055 57.634 30.840  1.00 73.38  ? 357  MET C O   1 
ATOM   4827 C CB  . MET C 1 131 ? 60.804 57.617 33.274  1.00 66.74  ? 357  MET C CB  1 
ATOM   4828 C CG  . MET C 1 131 ? 59.374 57.952 33.683  1.00 63.08  ? 357  MET C CG  1 
ATOM   4829 S SD  . MET C 1 131 ? 59.223 58.550 35.405  1.00 61.42  ? 357  MET C SD  1 
ATOM   4830 C CE  . MET C 1 131 ? 58.839 60.284 35.214  1.00 58.80  ? 357  MET C CE  1 
ATOM   4831 N N   . ARG C 1 132 ? 63.009 55.745 32.094  1.00 75.24  ? 358  ARG C N   1 
ATOM   4832 C CA  . ARG C 1 132 ? 64.415 55.381 31.922  1.00 76.60  ? 358  ARG C CA  1 
ATOM   4833 C C   . ARG C 1 132 ? 64.820 55.041 30.492  1.00 77.03  ? 358  ARG C C   1 
ATOM   4834 O O   . ARG C 1 132 ? 65.648 55.729 29.901  1.00 76.18  ? 358  ARG C O   1 
ATOM   4835 C CB  . ARG C 1 132 ? 64.743 54.190 32.828  1.00 77.35  ? 358  ARG C CB  1 
ATOM   4836 C CG  . ARG C 1 132 ? 66.096 53.534 32.576  1.00 77.33  ? 358  ARG C CG  1 
ATOM   4837 C CD  . ARG C 1 132 ? 66.236 52.281 33.419  1.00 75.16  ? 358  ARG C CD  1 
ATOM   4838 N NE  . ARG C 1 132 ? 66.091 52.589 34.835  1.00 72.38  ? 358  ARG C NE  1 
ATOM   4839 C CZ  . ARG C 1 132 ? 65.796 51.683 35.752  1.00 72.66  ? 358  ARG C CZ  1 
ATOM   4840 N NH1 . ARG C 1 132 ? 65.616 50.417 35.397  1.00 73.06  ? 358  ARG C NH1 1 
ATOM   4841 N NH2 . ARG C 1 132 ? 65.667 52.044 37.017  1.00 72.10  ? 358  ARG C NH2 1 
ATOM   4842 N N   . ASP C 1 133 ? 64.230 53.976 29.951  1.00 78.85  ? 359  ASP C N   1 
ATOM   4843 C CA  . ASP C 1 133 ? 64.526 53.495 28.602  1.00 81.93  ? 359  ASP C CA  1 
ATOM   4844 C C   . ASP C 1 133 ? 64.560 54.516 27.462  1.00 83.32  ? 359  ASP C C   1 
ATOM   4845 O O   . ASP C 1 133 ? 65.021 54.199 26.360  1.00 84.14  ? 359  ASP C O   1 
ATOM   4846 C CB  . ASP C 1 133 ? 63.569 52.361 28.221  1.00 84.32  ? 359  ASP C CB  1 
ATOM   4847 C CG  . ASP C 1 133 ? 63.845 51.076 28.989  1.00 86.74  ? 359  ASP C CG  1 
ATOM   4848 O OD1 . ASP C 1 133 ? 65.027 50.723 29.173  1.00 89.47  ? 359  ASP C OD1 1 
ATOM   4849 O OD2 . ASP C 1 133 ? 62.878 50.404 29.398  1.00 88.97  ? 359  ASP C OD2 1 
ATOM   4850 N N   . MET C 1 134 ? 64.057 55.722 27.701  1.00 84.30  ? 360  MET C N   1 
ATOM   4851 C CA  . MET C 1 134 ? 64.088 56.765 26.683  1.00 85.02  ? 360  MET C CA  1 
ATOM   4852 C C   . MET C 1 134 ? 64.547 58.073 27.313  1.00 83.79  ? 360  MET C C   1 
ATOM   4853 O O   . MET C 1 134 ? 64.031 59.141 26.993  1.00 83.66  ? 360  MET C O   1 
ATOM   4854 C CB  . MET C 1 134 ? 62.712 56.942 26.035  1.00 87.03  ? 360  MET C CB  1 
ATOM   4855 C CG  . MET C 1 134 ? 61.581 57.122 27.023  1.00 90.99  ? 360  MET C CG  1 
ATOM   4856 S SD  . MET C 1 134 ? 60.110 57.809 26.237  1.00 93.99  ? 360  MET C SD  1 
ATOM   4857 C CE  . MET C 1 134 ? 60.227 59.546 26.786  1.00 93.79  ? 360  MET C CE  1 
ATOM   4858 N N   . GLN C 1 135 ? 65.537 57.964 28.196  1.00 83.01  ? 361  GLN C N   1 
ATOM   4859 C CA  . GLN C 1 135 ? 66.109 59.102 28.910  1.00 82.99  ? 361  GLN C CA  1 
ATOM   4860 C C   . GLN C 1 135 ? 65.247 60.358 28.873  1.00 79.71  ? 361  GLN C C   1 
ATOM   4861 O O   . GLN C 1 135 ? 65.559 61.329 28.184  1.00 80.03  ? 361  GLN C O   1 
ATOM   4862 C CB  . GLN C 1 135 ? 67.519 59.438 28.382  1.00 87.20  ? 361  GLN C CB  1 
ATOM   4863 C CG  . GLN C 1 135 ? 68.639 58.484 28.836  1.00 91.10  ? 361  GLN C CG  1 
ATOM   4864 C CD  . GLN C 1 135 ? 69.896 59.217 29.338  1.00 92.70  ? 361  GLN C CD  1 
ATOM   4865 O OE1 . GLN C 1 135 ? 70.902 58.582 29.666  1.00 93.87  ? 361  GLN C OE1 1 
ATOM   4866 N NE2 . GLN C 1 135 ? 69.834 60.552 29.406  1.00 92.15  ? 361  GLN C NE2 1 
ATOM   4867 N N   . MET C 1 136 ? 64.152 60.329 29.613  1.00 75.05  ? 362  MET C N   1 
ATOM   4868 C CA  . MET C 1 136 ? 63.277 61.473 29.677  1.00 71.00  ? 362  MET C CA  1 
ATOM   4869 C C   . MET C 1 136 ? 63.973 62.364 30.693  1.00 68.67  ? 362  MET C C   1 
ATOM   4870 O O   . MET C 1 136 ? 64.174 61.943 31.824  1.00 68.23  ? 362  MET C O   1 
ATOM   4871 C CB  . MET C 1 136 ? 61.922 61.014 30.192  1.00 71.57  ? 362  MET C CB  1 
ATOM   4872 C CG  . MET C 1 136 ? 60.851 62.072 30.192  1.00 72.24  ? 362  MET C CG  1 
ATOM   4873 S SD  . MET C 1 136 ? 59.721 61.783 31.548  1.00 68.63  ? 362  MET C SD  1 
ATOM   4874 C CE  . MET C 1 136 ? 60.505 62.701 32.801  1.00 69.01  ? 362  MET C CE  1 
ATOM   4875 N N   . ASP C 1 137 ? 64.353 63.579 30.311  1.00 66.86  ? 363  ASP C N   1 
ATOM   4876 C CA  . ASP C 1 137 ? 65.060 64.451 31.250  1.00 67.32  ? 363  ASP C CA  1 
ATOM   4877 C C   . ASP C 1 137 ? 64.200 65.282 32.199  1.00 66.27  ? 363  ASP C C   1 
ATOM   4878 O O   . ASP C 1 137 ? 62.981 65.193 32.176  1.00 66.34  ? 363  ASP C O   1 
ATOM   4879 C CB  . ASP C 1 137 ? 66.016 65.362 30.491  1.00 68.43  ? 363  ASP C CB  1 
ATOM   4880 C CG  . ASP C 1 137 ? 65.332 66.119 29.390  1.00 69.82  ? 363  ASP C CG  1 
ATOM   4881 O OD1 . ASP C 1 137 ? 64.514 67.010 29.700  1.00 69.89  ? 363  ASP C OD1 1 
ATOM   4882 O OD2 . ASP C 1 137 ? 65.610 65.818 28.211  1.00 69.94  ? 363  ASP C OD2 1 
ATOM   4883 N N   . LYS C 1 138 ? 64.850 66.086 33.042  1.00 65.61  ? 364  LYS C N   1 
ATOM   4884 C CA  . LYS C 1 138 ? 64.149 66.914 34.028  1.00 64.07  ? 364  LYS C CA  1 
ATOM   4885 C C   . LYS C 1 138 ? 63.443 68.108 33.402  1.00 63.78  ? 364  LYS C C   1 
ATOM   4886 O O   . LYS C 1 138 ? 62.789 68.880 34.096  1.00 64.55  ? 364  LYS C O   1 
ATOM   4887 C CB  . LYS C 1 138 ? 65.118 67.422 35.111  1.00 63.89  ? 364  LYS C CB  1 
ATOM   4888 C CG  . LYS C 1 138 ? 65.997 66.355 35.770  1.00 62.64  ? 364  LYS C CG  1 
ATOM   4889 C CD  . LYS C 1 138 ? 66.804 66.954 36.925  1.00 63.92  ? 364  LYS C CD  1 
ATOM   4890 C CE  . LYS C 1 138 ? 67.880 66.004 37.440  1.00 63.46  ? 364  LYS C CE  1 
ATOM   4891 N NZ  . LYS C 1 138 ? 68.939 65.753 36.418  1.00 65.19  ? 364  LYS C NZ  1 
ATOM   4892 N N   . THR C 1 139 ? 63.605 68.276 32.096  1.00 63.61  ? 365  THR C N   1 
ATOM   4893 C CA  . THR C 1 139 ? 62.959 69.366 31.373  1.00 63.39  ? 365  THR C CA  1 
ATOM   4894 C C   . THR C 1 139 ? 61.628 68.831 30.867  1.00 61.95  ? 365  THR C C   1 
ATOM   4895 O O   . THR C 1 139 ? 60.579 69.400 31.148  1.00 61.99  ? 365  THR C O   1 
ATOM   4896 C CB  . THR C 1 139 ? 63.805 69.823 30.172  1.00 64.32  ? 365  THR C CB  1 
ATOM   4897 O OG1 . THR C 1 139 ? 65.014 70.430 30.644  1.00 65.77  ? 365  THR C OG1 1 
ATOM   4898 C CG2 . THR C 1 139 ? 63.033 70.819 29.331  1.00 64.94  ? 365  THR C CG2 1 
ATOM   4899 N N   . GLU C 1 140 ? 61.692 67.725 30.123  1.00 60.45  ? 366  GLU C N   1 
ATOM   4900 C CA  . GLU C 1 140 ? 60.512 67.052 29.585  1.00 57.75  ? 366  GLU C CA  1 
ATOM   4901 C C   . GLU C 1 140 ? 59.599 66.606 30.725  1.00 58.76  ? 366  GLU C C   1 
ATOM   4902 O O   . GLU C 1 140 ? 58.377 66.606 30.578  1.00 60.02  ? 366  GLU C O   1 
ATOM   4903 C CB  . GLU C 1 140 ? 60.925 65.832 28.779  1.00 53.25  ? 366  GLU C CB  1 
ATOM   4904 C CG  . GLU C 1 140 ? 62.126 66.078 27.924  1.00 51.34  ? 366  GLU C CG  1 
ATOM   4905 C CD  . GLU C 1 140 ? 62.348 64.980 26.922  1.00 51.82  ? 366  GLU C CD  1 
ATOM   4906 O OE1 . GLU C 1 140 ? 61.951 65.151 25.751  1.00 53.22  ? 366  GLU C OE1 1 
ATOM   4907 O OE2 . GLU C 1 140 ? 62.910 63.940 27.308  1.00 51.54  ? 366  GLU C OE2 1 
ATOM   4908 N N   . LEU C 1 141 ? 60.200 66.203 31.846  1.00 59.35  ? 367  LEU C N   1 
ATOM   4909 C CA  . LEU C 1 141 ? 59.452 65.784 33.026  1.00 59.03  ? 367  LEU C CA  1 
ATOM   4910 C C   . LEU C 1 141 ? 58.531 66.935 33.383  1.00 61.48  ? 367  LEU C C   1 
ATOM   4911 O O   . LEU C 1 141 ? 57.341 66.887 33.108  1.00 63.40  ? 367  LEU C O   1 
ATOM   4912 C CB  . LEU C 1 141 ? 60.386 65.523 34.211  1.00 56.68  ? 367  LEU C CB  1 
ATOM   4913 C CG  . LEU C 1 141 ? 59.706 65.154 35.536  1.00 54.29  ? 367  LEU C CG  1 
ATOM   4914 C CD1 . LEU C 1 141 ? 59.242 63.722 35.458  1.00 52.89  ? 367  LEU C CD1 1 
ATOM   4915 C CD2 . LEU C 1 141 ? 60.657 65.315 36.710  1.00 52.73  ? 367  LEU C CD2 1 
ATOM   4916 N N   . GLY C 1 142 ? 59.102 67.978 33.982  1.00 63.50  ? 368  GLY C N   1 
ATOM   4917 C CA  . GLY C 1 142 ? 58.340 69.154 34.383  1.00 65.30  ? 368  GLY C CA  1 
ATOM   4918 C C   . GLY C 1 142 ? 57.264 69.669 33.434  1.00 66.33  ? 368  GLY C C   1 
ATOM   4919 O O   . GLY C 1 142 ? 56.291 70.275 33.886  1.00 66.18  ? 368  GLY C O   1 
ATOM   4920 N N   . CYS C 1 143 ? 57.433 69.475 32.129  1.00 66.85  ? 369  CYS C N   1 
ATOM   4921 C CA  . CYS C 1 143 ? 56.416 69.917 31.189  1.00 67.16  ? 369  CYS C CA  1 
ATOM   4922 C C   . CYS C 1 143 ? 55.195 69.038 31.366  1.00 66.90  ? 369  CYS C C   1 
ATOM   4923 O O   . CYS C 1 143 ? 54.085 69.542 31.526  1.00 67.40  ? 369  CYS C O   1 
ATOM   4924 C CB  . CYS C 1 143 ? 56.934 69.846 29.761  1.00 67.62  ? 369  CYS C CB  1 
ATOM   4925 S SG  . CYS C 1 143 ? 57.983 71.251 29.415  1.00 69.37  ? 369  CYS C SG  1 
ATOM   4926 N N   . LEU C 1 144 ? 55.394 67.725 31.341  1.00 66.35  ? 370  LEU C N   1 
ATOM   4927 C CA  . LEU C 1 144 ? 54.277 66.819 31.564  1.00 66.59  ? 370  LEU C CA  1 
ATOM   4928 C C   . LEU C 1 144 ? 53.677 67.157 32.927  1.00 64.85  ? 370  LEU C C   1 
ATOM   4929 O O   . LEU C 1 144 ? 52.463 67.231 33.070  1.00 64.53  ? 370  LEU C O   1 
ATOM   4930 C CB  . LEU C 1 144 ? 54.723 65.354 31.538  1.00 67.63  ? 370  LEU C CB  1 
ATOM   4931 C CG  . LEU C 1 144 ? 55.105 64.782 30.172  1.00 69.60  ? 370  LEU C CG  1 
ATOM   4932 C CD1 . LEU C 1 144 ? 54.763 63.303 30.152  1.00 70.18  ? 370  LEU C CD1 1 
ATOM   4933 C CD2 . LEU C 1 144 ? 54.334 65.484 29.065  1.00 70.71  ? 370  LEU C CD2 1 
ATOM   4934 N N   . ARG C 1 145 ? 54.537 67.383 33.920  1.00 63.65  ? 371  ARG C N   1 
ATOM   4935 C CA  . ARG C 1 145 ? 54.098 67.735 35.273  1.00 62.22  ? 371  ARG C CA  1 
ATOM   4936 C C   . ARG C 1 145 ? 53.230 68.997 35.261  1.00 61.77  ? 371  ARG C C   1 
ATOM   4937 O O   . ARG C 1 145 ? 52.505 69.270 36.220  1.00 63.07  ? 371  ARG C O   1 
ATOM   4938 C CB  . ARG C 1 145 ? 55.307 67.951 36.203  1.00 60.14  ? 371  ARG C CB  1 
ATOM   4939 C CG  . ARG C 1 145 ? 56.083 66.691 36.585  1.00 57.92  ? 371  ARG C CG  1 
ATOM   4940 C CD  . ARG C 1 145 ? 55.899 66.341 38.061  1.00 58.98  ? 371  ARG C CD  1 
ATOM   4941 N NE  . ARG C 1 145 ? 56.437 67.366 38.956  1.00 59.68  ? 371  ARG C NE  1 
ATOM   4942 C CZ  . ARG C 1 145 ? 56.212 67.420 40.269  1.00 61.02  ? 371  ARG C CZ  1 
ATOM   4943 N NH1 . ARG C 1 145 ? 55.451 66.509 40.865  1.00 61.38  ? 371  ARG C NH1 1 
ATOM   4944 N NH2 . ARG C 1 145 ? 56.754 68.389 40.997  1.00 62.02  ? 371  ARG C NH2 1 
ATOM   4945 N N   . ALA C 1 146 ? 53.316 69.766 34.179  1.00 59.96  ? 372  ALA C N   1 
ATOM   4946 C CA  . ALA C 1 146 ? 52.537 70.986 34.029  1.00 59.16  ? 372  ALA C CA  1 
ATOM   4947 C C   . ALA C 1 146 ? 51.246 70.649 33.309  1.00 58.48  ? 372  ALA C C   1 
ATOM   4948 O O   . ALA C 1 146 ? 50.188 71.168 33.643  1.00 58.05  ? 372  ALA C O   1 
ATOM   4949 C CB  . ALA C 1 146 ? 53.323 72.007 33.234  1.00 59.49  ? 372  ALA C CB  1 
ATOM   4950 N N   . ILE C 1 147 ? 51.352 69.782 32.306  1.00 58.01  ? 373  ILE C N   1 
ATOM   4951 C CA  . ILE C 1 147 ? 50.205 69.339 31.527  1.00 57.02  ? 373  ILE C CA  1 
ATOM   4952 C C   . ILE C 1 147 ? 49.138 68.752 32.450  1.00 58.09  ? 373  ILE C C   1 
ATOM   4953 O O   . ILE C 1 147 ? 47.935 68.937 32.236  1.00 56.82  ? 373  ILE C O   1 
ATOM   4954 C CB  . ILE C 1 147 ? 50.640 68.291 30.499  1.00 54.13  ? 373  ILE C CB  1 
ATOM   4955 C CG1 . ILE C 1 147 ? 51.477 68.965 29.416  1.00 51.91  ? 373  ILE C CG1 1 
ATOM   4956 C CG2 . ILE C 1 147 ? 49.430 67.589 29.924  1.00 55.71  ? 373  ILE C CG2 1 
ATOM   4957 C CD1 . ILE C 1 147 ? 51.819 68.065 28.258  1.00 51.56  ? 373  ILE C CD1 1 
ATOM   4958 N N   . VAL C 1 148 ? 49.599 68.035 33.473  1.00 60.16  ? 374  VAL C N   1 
ATOM   4959 C CA  . VAL C 1 148 ? 48.721 67.447 34.474  1.00 61.10  ? 374  VAL C CA  1 
ATOM   4960 C C   . VAL C 1 148 ? 48.095 68.611 35.239  1.00 65.40  ? 374  VAL C C   1 
ATOM   4961 O O   . VAL C 1 148 ? 46.883 68.832 35.130  1.00 69.51  ? 374  VAL C O   1 
ATOM   4962 C CB  . VAL C 1 148 ? 49.496 66.523 35.459  1.00 57.41  ? 374  VAL C CB  1 
ATOM   4963 C CG1 . VAL C 1 148 ? 48.802 66.475 36.812  1.00 54.13  ? 374  VAL C CG1 1 
ATOM   4964 C CG2 . VAL C 1 148 ? 49.580 65.112 34.885  1.00 53.83  ? 374  VAL C CG2 1 
ATOM   4965 N N   . LEU C 1 149 ? 48.913 69.375 35.972  1.00 66.53  ? 375  LEU C N   1 
ATOM   4966 C CA  . LEU C 1 149 ? 48.409 70.511 36.745  1.00 68.49  ? 375  LEU C CA  1 
ATOM   4967 C C   . LEU C 1 149 ? 47.310 71.283 35.991  1.00 71.03  ? 375  LEU C C   1 
ATOM   4968 O O   . LEU C 1 149 ? 46.239 71.562 36.548  1.00 71.50  ? 375  LEU C O   1 
ATOM   4969 C CB  . LEU C 1 149 ? 49.564 71.452 37.130  1.00 66.81  ? 375  LEU C CB  1 
ATOM   4970 C CG  . LEU C 1 149 ? 49.208 72.716 37.937  1.00 66.35  ? 375  LEU C CG  1 
ATOM   4971 C CD1 . LEU C 1 149 ? 48.380 72.347 39.147  1.00 64.45  ? 375  LEU C CD1 1 
ATOM   4972 C CD2 . LEU C 1 149 ? 50.471 73.452 38.363  1.00 65.53  ? 375  LEU C CD2 1 
ATOM   4973 N N   . PHE C 1 150 ? 47.562 71.609 34.723  1.00 73.19  ? 376  PHE C N   1 
ATOM   4974 C CA  . PHE C 1 150 ? 46.581 72.331 33.914  1.00 74.23  ? 376  PHE C CA  1 
ATOM   4975 C C   . PHE C 1 150 ? 45.588 71.366 33.252  1.00 74.47  ? 376  PHE C C   1 
ATOM   4976 O O   . PHE C 1 150 ? 45.698 71.048 32.069  1.00 73.77  ? 376  PHE C O   1 
ATOM   4977 C CB  . PHE C 1 150 ? 47.286 73.195 32.847  1.00 74.76  ? 376  PHE C CB  1 
ATOM   4978 C CG  . PHE C 1 150 ? 48.183 74.282 33.420  1.00 75.64  ? 376  PHE C CG  1 
ATOM   4979 C CD1 . PHE C 1 150 ? 47.861 74.925 34.615  1.00 76.33  ? 376  PHE C CD1 1 
ATOM   4980 C CD2 . PHE C 1 150 ? 49.329 74.687 32.745  1.00 76.39  ? 376  PHE C CD2 1 
ATOM   4981 C CE1 . PHE C 1 150 ? 48.666 75.955 35.125  1.00 76.53  ? 376  PHE C CE1 1 
ATOM   4982 C CE2 . PHE C 1 150 ? 50.137 75.716 33.247  1.00 76.49  ? 376  PHE C CE2 1 
ATOM   4983 C CZ  . PHE C 1 150 ? 49.803 76.349 34.439  1.00 76.53  ? 376  PHE C CZ  1 
ATOM   4984 N N   . ASN C 1 151 ? 44.631 70.891 34.044  1.00 75.86  ? 377  ASN C N   1 
ATOM   4985 C CA  . ASN C 1 151 ? 43.590 69.982 33.561  1.00 77.36  ? 377  ASN C CA  1 
ATOM   4986 C C   . ASN C 1 151 ? 42.210 70.626 33.750  1.00 77.16  ? 377  ASN C C   1 
ATOM   4987 O O   . ASN C 1 151 ? 41.691 70.721 34.865  1.00 75.85  ? 377  ASN C O   1 
ATOM   4988 C CB  . ASN C 1 151 ? 43.648 68.636 34.308  1.00 77.94  ? 377  ASN C CB  1 
ATOM   4989 C CG  . ASN C 1 151 ? 42.486 67.702 33.944  1.00 77.07  ? 377  ASN C CG  1 
ATOM   4990 O OD1 . ASN C 1 151 ? 42.243 67.418 32.769  1.00 77.20  ? 377  ASN C OD1 1 
ATOM   4991 N ND2 . ASN C 1 151 ? 41.775 67.216 34.959  1.00 75.75  ? 377  ASN C ND2 1 
ATOM   4992 N N   . PRO C 1 152 ? 41.609 71.092 32.646  1.00 77.35  ? 378  PRO C N   1 
ATOM   4993 C CA  . PRO C 1 152 ? 40.290 71.735 32.638  1.00 76.30  ? 378  PRO C CA  1 
ATOM   4994 C C   . PRO C 1 152 ? 39.148 70.849 33.139  1.00 74.40  ? 378  PRO C C   1 
ATOM   4995 O O   . PRO C 1 152 ? 38.157 71.342 33.677  1.00 74.39  ? 378  PRO C O   1 
ATOM   4996 C CB  . PRO C 1 152 ? 40.117 72.147 31.172  1.00 78.02  ? 378  PRO C CB  1 
ATOM   4997 C CG  . PRO C 1 152 ? 40.987 71.163 30.418  1.00 78.53  ? 378  PRO C CG  1 
ATOM   4998 C CD  . PRO C 1 152 ? 42.204 71.084 31.296  1.00 77.41  ? 378  PRO C CD  1 
ATOM   4999 N N   . ASP C 1 153 ? 39.305 69.540 32.969  1.00 72.69  ? 379  ASP C N   1 
ATOM   5000 C CA  . ASP C 1 153 ? 38.306 68.564 33.384  1.00 71.14  ? 379  ASP C CA  1 
ATOM   5001 C C   . ASP C 1 153 ? 38.258 68.389 34.901  1.00 70.99  ? 379  ASP C C   1 
ATOM   5002 O O   . ASP C 1 153 ? 38.011 67.295 35.406  1.00 70.16  ? 379  ASP C O   1 
ATOM   5003 C CB  . ASP C 1 153 ? 38.591 67.218 32.710  1.00 69.86  ? 379  ASP C CB  1 
ATOM   5004 C CG  . ASP C 1 153 ? 38.650 67.323 31.191  1.00 69.04  ? 379  ASP C CG  1 
ATOM   5005 O OD1 . ASP C 1 153 ? 38.460 68.436 30.651  1.00 68.52  ? 379  ASP C OD1 1 
ATOM   5006 O OD2 . ASP C 1 153 ? 38.886 66.285 30.534  1.00 68.93  ? 379  ASP C OD2 1 
ATOM   5007 N N   . SER C 1 154 ? 38.515 69.470 35.623  1.00 71.49  ? 380  SER C N   1 
ATOM   5008 C CA  . SER C 1 154 ? 38.471 69.445 37.068  1.00 74.18  ? 380  SER C CA  1 
ATOM   5009 C C   . SER C 1 154 ? 37.171 70.096 37.461  1.00 76.71  ? 380  SER C C   1 
ATOM   5010 O O   . SER C 1 154 ? 36.890 71.226 37.066  1.00 76.29  ? 380  SER C O   1 
ATOM   5011 C CB  . SER C 1 154 ? 39.621 70.237 37.663  1.00 74.12  ? 380  SER C CB  1 
ATOM   5012 O OG  . SER C 1 154 ? 40.841 69.571 37.441  1.00 75.84  ? 380  SER C OG  1 
ATOM   5013 N N   . LYS C 1 155 ? 36.370 69.374 38.230  1.00 80.31  ? 381  LYS C N   1 
ATOM   5014 C CA  . LYS C 1 155 ? 35.096 69.902 38.660  1.00 82.63  ? 381  LYS C CA  1 
ATOM   5015 C C   . LYS C 1 155 ? 35.340 71.078 39.567  1.00 84.53  ? 381  LYS C C   1 
ATOM   5016 O O   . LYS C 1 155 ? 36.323 71.110 40.308  1.00 83.75  ? 381  LYS C O   1 
ATOM   5017 C CB  . LYS C 1 155 ? 34.272 68.814 39.348  1.00 82.26  ? 381  LYS C CB  1 
ATOM   5018 C CG  . LYS C 1 155 ? 33.801 67.742 38.365  1.00 82.75  ? 381  LYS C CG  1 
ATOM   5019 C CD  . LYS C 1 155 ? 33.161 68.363 37.102  1.00 81.86  ? 381  LYS C CD  1 
ATOM   5020 C CE  . LYS C 1 155 ? 34.191 68.726 36.022  1.00 80.88  ? 381  LYS C CE  1 
ATOM   5021 N NZ  . LYS C 1 155 ? 33.692 69.728 35.033  1.00 78.96  ? 381  LYS C NZ  1 
ATOM   5022 N N   . GLY C 1 156 ? 34.444 72.055 39.481  1.00 87.31  ? 382  GLY C N   1 
ATOM   5023 C CA  . GLY C 1 156 ? 34.576 73.260 40.274  1.00 91.13  ? 382  GLY C CA  1 
ATOM   5024 C C   . GLY C 1 156 ? 35.458 74.275 39.562  1.00 93.54  ? 382  GLY C C   1 
ATOM   5025 O O   . GLY C 1 156 ? 35.754 75.343 40.104  1.00 94.11  ? 382  GLY C O   1 
ATOM   5026 N N   . LEU C 1 157 ? 35.880 73.949 38.342  1.00 95.45  ? 383  LEU C N   1 
ATOM   5027 C CA  . LEU C 1 157 ? 36.740 74.845 37.576  1.00 97.71  ? 383  LEU C CA  1 
ATOM   5028 C C   . LEU C 1 157 ? 35.918 76.027 37.053  1.00 100.26 ? 383  LEU C C   1 
ATOM   5029 O O   . LEU C 1 157 ? 35.176 75.899 36.073  1.00 100.76 ? 383  LEU C O   1 
ATOM   5030 C CB  . LEU C 1 157 ? 37.405 74.077 36.417  1.00 94.91  ? 383  LEU C CB  1 
ATOM   5031 C CG  . LEU C 1 157 ? 38.832 74.495 36.032  1.00 91.26  ? 383  LEU C CG  1 
ATOM   5032 C CD1 . LEU C 1 157 ? 39.678 74.679 37.277  1.00 89.03  ? 383  LEU C CD1 1 
ATOM   5033 C CD2 . LEU C 1 157 ? 39.440 73.443 35.140  1.00 88.42  ? 383  LEU C CD2 1 
ATOM   5034 N N   . SER C 1 158 ? 36.055 77.170 37.730  1.00 102.90 ? 384  SER C N   1 
ATOM   5035 C CA  . SER C 1 158 ? 35.342 78.404 37.378  1.00 104.80 ? 384  SER C CA  1 
ATOM   5036 C C   . SER C 1 158 ? 35.820 79.059 36.070  1.00 105.75 ? 384  SER C C   1 
ATOM   5037 O O   . SER C 1 158 ? 35.097 79.854 35.462  1.00 106.71 ? 384  SER C O   1 
ATOM   5038 C CB  . SER C 1 158 ? 35.434 79.410 38.535  1.00 105.02 ? 384  SER C CB  1 
ATOM   5039 O OG  . SER C 1 158 ? 36.779 79.671 38.905  1.00 105.00 ? 384  SER C OG  1 
ATOM   5040 N N   . ASN C 1 159 ? 37.038 78.741 35.646  1.00 105.73 ? 385  ASN C N   1 
ATOM   5041 C CA  . ASN C 1 159 ? 37.548 79.275 34.396  1.00 105.07 ? 385  ASN C CA  1 
ATOM   5042 C C   . ASN C 1 159 ? 38.290 78.195 33.631  1.00 103.66 ? 385  ASN C C   1 
ATOM   5043 O O   . ASN C 1 159 ? 39.508 78.247 33.470  1.00 102.83 ? 385  ASN C O   1 
ATOM   5044 C CB  . ASN C 1 159 ? 38.479 80.452 34.631  1.00 107.07 ? 385  ASN C CB  1 
ATOM   5045 C CG  . ASN C 1 159 ? 38.762 81.207 33.353  1.00 109.22 ? 385  ASN C CG  1 
ATOM   5046 O OD1 . ASN C 1 159 ? 39.086 80.608 32.322  1.00 109.06 ? 385  ASN C OD1 1 
ATOM   5047 N ND2 . ASN C 1 159 ? 38.636 82.529 33.406  1.00 110.76 ? 385  ASN C ND2 1 
ATOM   5048 N N   . PRO C 1 160 ? 37.552 77.196 33.146  1.00 102.95 ? 386  PRO C N   1 
ATOM   5049 C CA  . PRO C 1 160 ? 38.098 76.072 32.384  1.00 103.20 ? 386  PRO C CA  1 
ATOM   5050 C C   . PRO C 1 160 ? 38.907 76.582 31.197  1.00 103.24 ? 386  PRO C C   1 
ATOM   5051 O O   . PRO C 1 160 ? 39.949 76.032 30.840  1.00 103.42 ? 386  PRO C O   1 
ATOM   5052 C CB  . PRO C 1 160 ? 36.843 75.325 31.936  1.00 103.44 ? 386  PRO C CB  1 
ATOM   5053 C CG  . PRO C 1 160 ? 35.847 75.652 33.013  1.00 103.42 ? 386  PRO C CG  1 
ATOM   5054 C CD  . PRO C 1 160 ? 36.085 77.116 33.217  1.00 102.90 ? 386  PRO C CD  1 
ATOM   5055 N N   . ALA C 1 161 ? 38.394 77.639 30.584  1.00 103.56 ? 387  ALA C N   1 
ATOM   5056 C CA  . ALA C 1 161 ? 39.026 78.260 29.435  1.00 103.19 ? 387  ALA C CA  1 
ATOM   5057 C C   . ALA C 1 161 ? 40.511 78.458 29.696  1.00 102.36 ? 387  ALA C C   1 
ATOM   5058 O O   . ALA C 1 161 ? 41.352 77.693 29.219  1.00 101.99 ? 387  ALA C O   1 
ATOM   5059 C CB  . ALA C 1 161 ? 38.357 79.606 29.154  1.00 104.06 ? 387  ALA C CB  1 
ATOM   5060 N N   . GLU C 1 162 ? 40.803 79.504 30.462  1.00 101.09 ? 388  GLU C N   1 
ATOM   5061 C CA  . GLU C 1 162 ? 42.152 79.885 30.844  1.00 100.04 ? 388  GLU C CA  1 
ATOM   5062 C C   . GLU C 1 162 ? 43.025 78.654 31.022  1.00 98.11  ? 388  GLU C C   1 
ATOM   5063 O O   . GLU C 1 162 ? 44.079 78.542 30.402  1.00 97.38  ? 388  GLU C O   1 
ATOM   5064 C CB  . GLU C 1 162 ? 42.084 80.681 32.148  1.00 102.74 ? 388  GLU C CB  1 
ATOM   5065 C CG  . GLU C 1 162 ? 43.295 81.546 32.469  1.00 106.48 ? 388  GLU C CG  1 
ATOM   5066 C CD  . GLU C 1 162 ? 43.085 82.395 33.731  1.00 108.59 ? 388  GLU C CD  1 
ATOM   5067 O OE1 . GLU C 1 162 ? 44.002 83.160 34.099  1.00 109.77 ? 388  GLU C OE1 1 
ATOM   5068 O OE2 . GLU C 1 162 ? 42.003 82.299 34.357  1.00 109.02 ? 388  GLU C OE2 1 
ATOM   5069 N N   . VAL C 1 163 ? 42.568 77.729 31.862  1.00 96.35  ? 389  VAL C N   1 
ATOM   5070 C CA  . VAL C 1 163 ? 43.291 76.493 32.145  1.00 94.82  ? 389  VAL C CA  1 
ATOM   5071 C C   . VAL C 1 163 ? 43.743 75.700 30.921  1.00 93.87  ? 389  VAL C C   1 
ATOM   5072 O O   . VAL C 1 163 ? 44.929 75.425 30.762  1.00 93.73  ? 389  VAL C O   1 
ATOM   5073 C CB  . VAL C 1 163 ? 42.457 75.563 33.037  1.00 94.50  ? 389  VAL C CB  1 
ATOM   5074 C CG1 . VAL C 1 163 ? 43.097 74.186 33.092  1.00 94.37  ? 389  VAL C CG1 1 
ATOM   5075 C CG2 . VAL C 1 163 ? 42.353 76.151 34.431  1.00 94.23  ? 389  VAL C CG2 1 
ATOM   5076 N N   . GLU C 1 164 ? 42.808 75.315 30.062  1.00 93.16  ? 390  GLU C N   1 
ATOM   5077 C CA  . GLU C 1 164 ? 43.187 74.562 28.876  1.00 92.86  ? 390  GLU C CA  1 
ATOM   5078 C C   . GLU C 1 164 ? 44.021 75.396 27.900  1.00 92.08  ? 390  GLU C C   1 
ATOM   5079 O O   . GLU C 1 164 ? 44.720 74.853 27.045  1.00 91.55  ? 390  GLU C O   1 
ATOM   5080 C CB  . GLU C 1 164 ? 41.959 74.038 28.157  1.00 93.67  ? 390  GLU C CB  1 
ATOM   5081 C CG  . GLU C 1 164 ? 42.320 73.370 26.861  1.00 95.74  ? 390  GLU C CG  1 
ATOM   5082 C CD  . GLU C 1 164 ? 41.109 72.973 26.083  1.00 97.92  ? 390  GLU C CD  1 
ATOM   5083 O OE1 . GLU C 1 164 ? 40.221 73.838 25.914  1.00 99.64  ? 390  GLU C OE1 1 
ATOM   5084 O OE2 . GLU C 1 164 ? 41.048 71.807 25.640  1.00 98.61  ? 390  GLU C OE2 1 
ATOM   5085 N N   . ALA C 1 165 ? 43.924 76.718 28.016  1.00 90.94  ? 391  ALA C N   1 
ATOM   5086 C CA  . ALA C 1 165 ? 44.700 77.614 27.171  1.00 88.45  ? 391  ALA C CA  1 
ATOM   5087 C C   . ALA C 1 165 ? 46.139 77.428 27.621  1.00 86.98  ? 391  ALA C C   1 
ATOM   5088 O O   . ALA C 1 165 ? 47.031 77.204 26.811  1.00 85.76  ? 391  ALA C O   1 
ATOM   5089 C CB  . ALA C 1 165 ? 44.263 79.049 27.392  1.00 88.36  ? 391  ALA C CB  1 
ATOM   5090 N N   . LEU C 1 166 ? 46.341 77.518 28.932  1.00 86.26  ? 392  LEU C N   1 
ATOM   5091 C CA  . LEU C 1 166 ? 47.652 77.348 29.534  1.00 86.11  ? 392  LEU C CA  1 
ATOM   5092 C C   . LEU C 1 166 ? 48.182 75.964 29.211  1.00 87.01  ? 392  LEU C C   1 
ATOM   5093 O O   . LEU C 1 166 ? 49.308 75.821 28.744  1.00 87.69  ? 392  LEU C O   1 
ATOM   5094 C CB  . LEU C 1 166 ? 47.566 77.513 31.050  1.00 84.66  ? 392  LEU C CB  1 
ATOM   5095 C CG  . LEU C 1 166 ? 47.097 78.879 31.545  1.00 84.56  ? 392  LEU C CG  1 
ATOM   5096 C CD1 . LEU C 1 166 ? 46.982 78.865 33.059  1.00 82.88  ? 392  LEU C CD1 1 
ATOM   5097 C CD2 . LEU C 1 166 ? 48.075 79.949 31.073  1.00 84.16  ? 392  LEU C CD2 1 
ATOM   5098 N N   . ARG C 1 167 ? 47.370 74.942 29.469  1.00 88.09  ? 393  ARG C N   1 
ATOM   5099 C CA  . ARG C 1 167 ? 47.759 73.561 29.196  1.00 89.10  ? 393  ARG C CA  1 
ATOM   5100 C C   . ARG C 1 167 ? 48.122 73.388 27.723  1.00 89.63  ? 393  ARG C C   1 
ATOM   5101 O O   . ARG C 1 167 ? 48.879 72.490 27.368  1.00 89.40  ? 393  ARG C O   1 
ATOM   5102 C CB  . ARG C 1 167 ? 46.623 72.616 29.577  1.00 89.75  ? 393  ARG C CB  1 
ATOM   5103 C CG  . ARG C 1 167 ? 46.820 71.176 29.160  1.00 90.76  ? 393  ARG C CG  1 
ATOM   5104 C CD  . ARG C 1 167 ? 45.523 70.430 29.382  1.00 94.99  ? 393  ARG C CD  1 
ATOM   5105 N NE  . ARG C 1 167 ? 45.484 69.124 28.736  1.00 98.95  ? 393  ARG C NE  1 
ATOM   5106 C CZ  . ARG C 1 167 ? 44.390 68.370 28.653  1.00 101.04 ? 393  ARG C CZ  1 
ATOM   5107 N NH1 . ARG C 1 167 ? 43.247 68.802 29.177  1.00 101.50 ? 393  ARG C NH1 1 
ATOM   5108 N NH2 . ARG C 1 167 ? 44.434 67.189 28.043  1.00 102.46 ? 393  ARG C NH2 1 
ATOM   5109 N N   . GLU C 1 168 ? 47.568 74.246 26.868  1.00 90.83  ? 394  GLU C N   1 
ATOM   5110 C CA  . GLU C 1 168 ? 47.864 74.211 25.442  1.00 92.16  ? 394  GLU C CA  1 
ATOM   5111 C C   . GLU C 1 168 ? 49.258 74.795 25.201  1.00 92.31  ? 394  GLU C C   1 
ATOM   5112 O O   . GLU C 1 168 ? 50.006 74.289 24.361  1.00 92.42  ? 394  GLU C O   1 
ATOM   5113 C CB  . GLU C 1 168 ? 46.813 75.004 24.657  1.00 94.04  ? 394  GLU C CB  1 
ATOM   5114 C CG  . GLU C 1 168 ? 45.540 74.221 24.356  1.00 97.67  ? 394  GLU C CG  1 
ATOM   5115 C CD  . GLU C 1 168 ? 45.741 73.150 23.286  1.00 99.74  ? 394  GLU C CD  1 
ATOM   5116 O OE1 . GLU C 1 168 ? 45.837 73.502 22.087  1.00 100.44 ? 394  GLU C OE1 1 
ATOM   5117 O OE2 . GLU C 1 168 ? 45.811 71.954 23.647  1.00 100.96 ? 394  GLU C OE2 1 
ATOM   5118 N N   . LYS C 1 169 ? 49.596 75.858 25.940  1.00 92.43  ? 395  LYS C N   1 
ATOM   5119 C CA  . LYS C 1 169 ? 50.909 76.516 25.844  1.00 92.03  ? 395  LYS C CA  1 
ATOM   5120 C C   . LYS C 1 169 ? 52.032 75.528 26.192  1.00 91.91  ? 395  LYS C C   1 
ATOM   5121 O O   . LYS C 1 169 ? 53.102 75.550 25.576  1.00 92.20  ? 395  LYS C O   1 
ATOM   5122 C CB  . LYS C 1 169 ? 50.989 77.735 26.791  1.00 91.62  ? 395  LYS C CB  1 
ATOM   5123 C CG  . LYS C 1 169 ? 50.139 78.937 26.376  1.00 91.30  ? 395  LYS C CG  1 
ATOM   5124 C CD  . LYS C 1 169 ? 50.240 80.104 27.368  1.00 91.46  ? 395  LYS C CD  1 
ATOM   5125 C CE  . LYS C 1 169 ? 49.313 81.266 26.954  1.00 91.68  ? 395  LYS C CE  1 
ATOM   5126 N NZ  . LYS C 1 169 ? 49.322 82.462 27.863  1.00 89.63  ? 395  LYS C NZ  1 
ATOM   5127 N N   . VAL C 1 170 ? 51.780 74.673 27.185  1.00 90.51  ? 396  VAL C N   1 
ATOM   5128 C CA  . VAL C 1 170 ? 52.744 73.667 27.616  1.00 88.27  ? 396  VAL C CA  1 
ATOM   5129 C C   . VAL C 1 170 ? 52.854 72.537 26.595  1.00 88.44  ? 396  VAL C C   1 
ATOM   5130 O O   . VAL C 1 170 ? 53.860 71.834 26.540  1.00 87.69  ? 396  VAL C O   1 
ATOM   5131 C CB  . VAL C 1 170 ? 52.361 73.100 28.984  1.00 86.97  ? 396  VAL C CB  1 
ATOM   5132 C CG1 . VAL C 1 170 ? 53.240 71.917 29.322  1.00 86.24  ? 396  VAL C CG1 1 
ATOM   5133 C CG2 . VAL C 1 170 ? 52.513 74.180 30.036  1.00 85.20  ? 396  VAL C CG2 1 
ATOM   5134 N N   . TYR C 1 171 ? 51.809 72.362 25.794  1.00 89.53  ? 397  TYR C N   1 
ATOM   5135 C CA  . TYR C 1 171 ? 51.810 71.361 24.732  1.00 91.79  ? 397  TYR C CA  1 
ATOM   5136 C C   . TYR C 1 171 ? 52.740 71.886 23.630  1.00 92.33  ? 397  TYR C C   1 
ATOM   5137 O O   . TYR C 1 171 ? 53.267 71.114 22.824  1.00 92.95  ? 397  TYR C O   1 
ATOM   5138 C CB  . TYR C 1 171 ? 50.404 71.186 24.148  1.00 94.28  ? 397  TYR C CB  1 
ATOM   5139 C CG  . TYR C 1 171 ? 49.535 70.113 24.782  1.00 97.16  ? 397  TYR C CG  1 
ATOM   5140 C CD1 . TYR C 1 171 ? 49.925 68.778 24.781  1.00 97.65  ? 397  TYR C CD1 1 
ATOM   5141 C CD2 . TYR C 1 171 ? 48.289 70.429 25.324  1.00 98.52  ? 397  TYR C CD2 1 
ATOM   5142 C CE1 . TYR C 1 171 ? 49.094 67.784 25.300  1.00 98.01  ? 397  TYR C CE1 1 
ATOM   5143 C CE2 . TYR C 1 171 ? 47.451 69.440 25.843  1.00 98.91  ? 397  TYR C CE2 1 
ATOM   5144 C CZ  . TYR C 1 171 ? 47.857 68.119 25.826  1.00 98.04  ? 397  TYR C CZ  1 
ATOM   5145 O OH  . TYR C 1 171 ? 47.017 67.136 26.313  1.00 95.59  ? 397  TYR C OH  1 
ATOM   5146 N N   . ALA C 1 172 ? 52.918 73.210 23.601  1.00 92.26  ? 398  ALA C N   1 
ATOM   5147 C CA  . ALA C 1 172 ? 53.778 73.892 22.628  1.00 91.18  ? 398  ALA C CA  1 
ATOM   5148 C C   . ALA C 1 172 ? 55.241 73.828 23.061  1.00 90.41  ? 398  ALA C C   1 
ATOM   5149 O O   . ALA C 1 172 ? 56.077 73.247 22.370  1.00 90.24  ? 398  ALA C O   1 
ATOM   5150 C CB  . ALA C 1 172 ? 53.350 75.346 22.490  1.00 90.69  ? 398  ALA C CB  1 
ATOM   5151 N N   . SER C 1 173 ? 55.541 74.434 24.207  1.00 89.26  ? 399  SER C N   1 
ATOM   5152 C CA  . SER C 1 173 ? 56.895 74.444 24.739  1.00 88.35  ? 399  SER C CA  1 
ATOM   5153 C C   . SER C 1 173 ? 57.488 73.038 24.822  1.00 88.84  ? 399  SER C C   1 
ATOM   5154 O O   . SER C 1 173 ? 58.680 72.862 24.577  1.00 90.17  ? 399  SER C O   1 
ATOM   5155 C CB  . SER C 1 173 ? 56.919 75.071 26.134  1.00 87.19  ? 399  SER C CB  1 
ATOM   5156 O OG  . SER C 1 173 ? 56.201 76.289 26.172  1.00 85.67  ? 399  SER C OG  1 
ATOM   5157 N N   . LEU C 1 174 ? 56.671 72.041 25.168  1.00 88.69  ? 400  LEU C N   1 
ATOM   5158 C CA  . LEU C 1 174 ? 57.157 70.661 25.291  1.00 89.14  ? 400  LEU C CA  1 
ATOM   5159 C C   . LEU C 1 174 ? 57.513 69.984 23.973  1.00 88.54  ? 400  LEU C C   1 
ATOM   5160 O O   . LEU C 1 174 ? 58.369 69.099 23.939  1.00 87.13  ? 400  LEU C O   1 
ATOM   5161 C CB  . LEU C 1 174 ? 56.149 69.791 26.051  1.00 90.48  ? 400  LEU C CB  1 
ATOM   5162 C CG  . LEU C 1 174 ? 56.534 68.312 26.198  1.00 90.37  ? 400  LEU C CG  1 
ATOM   5163 C CD1 . LEU C 1 174 ? 57.991 68.183 26.617  1.00 90.08  ? 400  LEU C CD1 1 
ATOM   5164 C CD2 . LEU C 1 174 ? 55.625 67.661 27.221  1.00 90.80  ? 400  LEU C CD2 1 
ATOM   5165 N N   . GLU C 1 175 ? 56.842 70.367 22.893  1.00 88.56  ? 401  GLU C N   1 
ATOM   5166 C CA  . GLU C 1 175 ? 57.179 69.786 21.605  1.00 89.51  ? 401  GLU C CA  1 
ATOM   5167 C C   . GLU C 1 175 ? 58.314 70.607 21.006  1.00 89.97  ? 401  GLU C C   1 
ATOM   5168 O O   . GLU C 1 175 ? 59.120 70.094 20.237  1.00 90.46  ? 401  GLU C O   1 
ATOM   5169 C CB  . GLU C 1 175 ? 55.991 69.787 20.656  1.00 89.89  ? 401  GLU C CB  1 
ATOM   5170 C CG  . GLU C 1 175 ? 56.359 69.227 19.298  1.00 91.26  ? 401  GLU C CG  1 
ATOM   5171 C CD  . GLU C 1 175 ? 55.182 69.156 18.363  1.00 92.47  ? 401  GLU C CD  1 
ATOM   5172 O OE1 . GLU C 1 175 ? 54.394 70.126 18.343  1.00 93.13  ? 401  GLU C OE1 1 
ATOM   5173 O OE2 . GLU C 1 175 ? 55.052 68.139 17.645  1.00 93.25  ? 401  GLU C OE2 1 
ATOM   5174 N N   . ALA C 1 176 ? 58.361 71.892 21.354  1.00 90.15  ? 402  ALA C N   1 
ATOM   5175 C CA  . ALA C 1 176 ? 59.424 72.773 20.892  1.00 89.49  ? 402  ALA C CA  1 
ATOM   5176 C C   . ALA C 1 176 ? 60.695 72.169 21.477  1.00 89.43  ? 402  ALA C C   1 
ATOM   5177 O O   . ALA C 1 176 ? 61.516 71.612 20.752  1.00 89.89  ? 402  ALA C O   1 
ATOM   5178 C CB  . ALA C 1 176 ? 59.211 74.189 21.424  1.00 89.14  ? 402  ALA C CB  1 
ATOM   5179 N N   . TYR C 1 177 ? 60.845 72.257 22.796  1.00 89.02  ? 403  TYR C N   1 
ATOM   5180 C CA  . TYR C 1 177 ? 62.012 71.685 23.449  1.00 89.47  ? 403  TYR C CA  1 
ATOM   5181 C C   . TYR C 1 177 ? 62.252 70.245 22.994  1.00 90.19  ? 403  TYR C C   1 
ATOM   5182 O O   . TYR C 1 177 ? 63.394 69.822 22.865  1.00 90.73  ? 403  TYR C O   1 
ATOM   5183 C CB  . TYR C 1 177 ? 61.853 71.684 24.970  1.00 88.01  ? 403  TYR C CB  1 
ATOM   5184 C CG  . TYR C 1 177 ? 62.892 70.811 25.635  1.00 87.50  ? 403  TYR C CG  1 
ATOM   5185 C CD1 . TYR C 1 177 ? 64.091 71.341 26.088  1.00 87.16  ? 403  TYR C CD1 1 
ATOM   5186 C CD2 . TYR C 1 177 ? 62.708 69.431 25.730  1.00 87.55  ? 403  TYR C CD2 1 
ATOM   5187 C CE1 . TYR C 1 177 ? 65.081 70.520 26.616  1.00 87.15  ? 403  TYR C CE1 1 
ATOM   5188 C CE2 . TYR C 1 177 ? 63.691 68.607 26.249  1.00 87.27  ? 403  TYR C CE2 1 
ATOM   5189 C CZ  . TYR C 1 177 ? 64.876 69.154 26.691  1.00 86.56  ? 403  TYR C CZ  1 
ATOM   5190 O OH  . TYR C 1 177 ? 65.854 68.333 27.203  1.00 84.96  ? 403  TYR C OH  1 
ATOM   5191 N N   . CYS C 1 178 ? 61.179 69.492 22.773  1.00 91.66  ? 404  CYS C N   1 
ATOM   5192 C CA  . CYS C 1 178 ? 61.289 68.097 22.350  1.00 93.24  ? 404  CYS C CA  1 
ATOM   5193 C C   . CYS C 1 178 ? 61.969 67.919 20.990  1.00 93.97  ? 404  CYS C C   1 
ATOM   5194 O O   . CYS C 1 178 ? 62.811 67.040 20.827  1.00 93.93  ? 404  CYS C O   1 
ATOM   5195 C CB  . CYS C 1 178 ? 59.904 67.442 22.317  1.00 93.24  ? 404  CYS C CB  1 
ATOM   5196 S SG  . CYS C 1 178 ? 59.796 65.858 23.185  1.00 91.75  ? 404  CYS C SG  1 
ATOM   5197 N N   . LYS C 1 179 ? 61.599 68.737 20.011  1.00 95.67  ? 405  LYS C N   1 
ATOM   5198 C CA  . LYS C 1 179 ? 62.202 68.643 18.682  1.00 97.95  ? 405  LYS C CA  1 
ATOM   5199 C C   . LYS C 1 179 ? 63.595 69.265 18.687  1.00 98.61  ? 405  LYS C C   1 
ATOM   5200 O O   . LYS C 1 179 ? 64.532 68.717 18.110  1.00 97.82  ? 405  LYS C O   1 
ATOM   5201 C CB  . LYS C 1 179 ? 61.330 69.349 17.641  1.00 99.31  ? 405  LYS C CB  1 
ATOM   5202 C CG  . LYS C 1 179 ? 59.945 68.731 17.429  1.00 102.27 ? 405  LYS C CG  1 
ATOM   5203 C CD  . LYS C 1 179 ? 59.971 67.419 16.632  1.00 103.70 ? 405  LYS C CD  1 
ATOM   5204 C CE  . LYS C 1 179 ? 58.540 66.937 16.349  1.00 104.67 ? 405  LYS C CE  1 
ATOM   5205 N NZ  . LYS C 1 179 ? 58.460 65.663 15.572  1.00 104.77 ? 405  LYS C NZ  1 
ATOM   5206 N N   . HIS C 1 180 ? 63.727 70.419 19.333  1.00 99.79  ? 406  HIS C N   1 
ATOM   5207 C CA  . HIS C 1 180 ? 65.018 71.082 19.419  1.00 100.76 ? 406  HIS C CA  1 
ATOM   5208 C C   . HIS C 1 180 ? 66.074 70.118 19.962  1.00 100.16 ? 406  HIS C C   1 
ATOM   5209 O O   . HIS C 1 180 ? 67.036 69.792 19.274  1.00 100.31 ? 406  HIS C O   1 
ATOM   5210 C CB  . HIS C 1 180 ? 64.940 72.307 20.336  1.00 102.94 ? 406  HIS C CB  1 
ATOM   5211 C CG  . HIS C 1 180 ? 66.264 72.707 20.910  1.00 106.55 ? 406  HIS C CG  1 
ATOM   5212 N ND1 . HIS C 1 180 ? 67.325 73.107 20.125  1.00 107.86 ? 406  HIS C ND1 1 
ATOM   5213 C CD2 . HIS C 1 180 ? 66.719 72.710 22.187  1.00 107.80 ? 406  HIS C CD2 1 
ATOM   5214 C CE1 . HIS C 1 180 ? 68.377 73.336 20.892  1.00 108.10 ? 406  HIS C CE1 1 
ATOM   5215 N NE2 . HIS C 1 180 ? 68.036 73.103 22.147  1.00 108.79 ? 406  HIS C NE2 1 
ATOM   5216 N N   . LYS C 1 181 ? 65.869 69.652 21.193  1.00 99.23  ? 407  LYS C N   1 
ATOM   5217 C CA  . LYS C 1 181 ? 66.804 68.754 21.865  1.00 97.82  ? 407  LYS C CA  1 
ATOM   5218 C C   . LYS C 1 181 ? 66.896 67.340 21.274  1.00 96.01  ? 407  LYS C C   1 
ATOM   5219 O O   . LYS C 1 181 ? 67.993 66.812 21.090  1.00 96.24  ? 407  LYS C O   1 
ATOM   5220 C CB  . LYS C 1 181 ? 66.446 68.679 23.359  1.00 98.89  ? 407  LYS C CB  1 
ATOM   5221 C CG  . LYS C 1 181 ? 67.625 68.405 24.299  1.00 99.49  ? 407  LYS C CG  1 
ATOM   5222 C CD  . LYS C 1 181 ? 68.635 69.563 24.328  1.00 99.34  ? 407  LYS C CD  1 
ATOM   5223 C CE  . LYS C 1 181 ? 68.025 70.863 24.851  1.00 99.00  ? 407  LYS C CE  1 
ATOM   5224 N NZ  . LYS C 1 181 ? 69.043 71.953 24.978  1.00 98.95  ? 407  LYS C NZ  1 
ATOM   5225 N N   . TYR C 1 182 ? 65.759 66.727 20.966  1.00 93.59  ? 408  TYR C N   1 
ATOM   5226 C CA  . TYR C 1 182 ? 65.780 65.373 20.418  1.00 92.19  ? 408  TYR C CA  1 
ATOM   5227 C C   . TYR C 1 182 ? 65.174 65.297 19.022  1.00 92.09  ? 408  TYR C C   1 
ATOM   5228 O O   . TYR C 1 182 ? 64.220 64.547 18.792  1.00 91.62  ? 408  TYR C O   1 
ATOM   5229 C CB  . TYR C 1 182 ? 65.033 64.421 21.360  1.00 90.94  ? 408  TYR C CB  1 
ATOM   5230 C CG  . TYR C 1 182 ? 65.529 64.490 22.787  1.00 89.72  ? 408  TYR C CG  1 
ATOM   5231 C CD1 . TYR C 1 182 ? 66.470 63.586 23.266  1.00 87.98  ? 408  TYR C CD1 1 
ATOM   5232 C CD2 . TYR C 1 182 ? 65.101 65.510 23.639  1.00 89.48  ? 408  TYR C CD2 1 
ATOM   5233 C CE1 . TYR C 1 182 ? 66.971 63.699 24.550  1.00 87.93  ? 408  TYR C CE1 1 
ATOM   5234 C CE2 . TYR C 1 182 ? 65.599 65.636 24.916  1.00 88.14  ? 408  TYR C CE2 1 
ATOM   5235 C CZ  . TYR C 1 182 ? 66.531 64.730 25.368  1.00 87.73  ? 408  TYR C CZ  1 
ATOM   5236 O OH  . TYR C 1 182 ? 67.021 64.866 26.642  1.00 86.35  ? 408  TYR C OH  1 
ATOM   5237 N N   . PRO C 1 183 ? 65.732 66.064 18.065  1.00 92.10  ? 409  PRO C N   1 
ATOM   5238 C CA  . PRO C 1 183 ? 65.248 66.087 16.683  1.00 92.31  ? 409  PRO C CA  1 
ATOM   5239 C C   . PRO C 1 183 ? 65.692 64.878 15.876  1.00 93.03  ? 409  PRO C C   1 
ATOM   5240 O O   . PRO C 1 183 ? 65.574 64.864 14.660  1.00 92.63  ? 409  PRO C O   1 
ATOM   5241 C CB  . PRO C 1 183 ? 65.837 67.376 16.143  1.00 91.59  ? 409  PRO C CB  1 
ATOM   5242 C CG  . PRO C 1 183 ? 67.162 67.388 16.787  1.00 91.87  ? 409  PRO C CG  1 
ATOM   5243 C CD  . PRO C 1 183 ? 66.863 66.995 18.218  1.00 91.62  ? 409  PRO C CD  1 
ATOM   5244 N N   . GLU C 1 184 ? 66.220 63.871 16.557  1.00 94.96  ? 410  GLU C N   1 
ATOM   5245 C CA  . GLU C 1 184 ? 66.655 62.648 15.900  1.00 97.72  ? 410  GLU C CA  1 
ATOM   5246 C C   . GLU C 1 184 ? 65.529 61.617 15.989  1.00 98.81  ? 410  GLU C C   1 
ATOM   5247 O O   . GLU C 1 184 ? 65.387 60.759 15.114  1.00 97.60  ? 410  GLU C O   1 
ATOM   5248 C CB  . GLU C 1 184 ? 67.913 62.092 16.577  1.00 99.41  ? 410  GLU C CB  1 
ATOM   5249 C CG  . GLU C 1 184 ? 67.744 61.763 18.062  1.00 102.37 ? 410  GLU C CG  1 
ATOM   5250 C CD  . GLU C 1 184 ? 68.154 62.905 18.988  1.00 104.54 ? 410  GLU C CD  1 
ATOM   5251 O OE1 . GLU C 1 184 ? 67.759 64.067 18.744  1.00 105.53 ? 410  GLU C OE1 1 
ATOM   5252 O OE2 . GLU C 1 184 ? 68.870 62.632 19.977  1.00 105.81 ? 410  GLU C OE2 1 
ATOM   5253 N N   . GLN C 1 185 ? 64.727 61.720 17.051  1.00 100.73 ? 411  GLN C N   1 
ATOM   5254 C CA  . GLN C 1 185 ? 63.614 60.805 17.285  1.00 101.68 ? 411  GLN C CA  1 
ATOM   5255 C C   . GLN C 1 185 ? 62.240 61.389 16.956  1.00 101.36 ? 411  GLN C C   1 
ATOM   5256 O O   . GLN C 1 185 ? 61.835 62.437 17.483  1.00 100.29 ? 411  GLN C O   1 
ATOM   5257 C CB  . GLN C 1 185 ? 63.658 60.279 18.733  1.00 102.29 ? 411  GLN C CB  1 
ATOM   5258 C CG  . GLN C 1 185 ? 64.103 61.284 19.797  1.00 102.20 ? 411  GLN C CG  1 
ATOM   5259 C CD  . GLN C 1 185 ? 64.767 60.599 20.987  1.00 102.00 ? 411  GLN C CD  1 
ATOM   5260 O OE1 . GLN C 1 185 ? 64.251 59.612 21.518  1.00 102.84 ? 411  GLN C OE1 1 
ATOM   5261 N NE2 . GLN C 1 185 ? 65.914 61.119 21.410  1.00 100.97 ? 411  GLN C NE2 1 
ATOM   5262 N N   . PRO C 1 186 ? 61.510 60.691 16.068  1.00 101.03 ? 412  PRO C N   1 
ATOM   5263 C CA  . PRO C 1 186 ? 60.177 60.947 15.521  1.00 101.19 ? 412  PRO C CA  1 
ATOM   5264 C C   . PRO C 1 186 ? 59.173 61.510 16.527  1.00 101.21 ? 412  PRO C C   1 
ATOM   5265 O O   . PRO C 1 186 ? 59.375 62.599 17.080  1.00 102.35 ? 412  PRO C O   1 
ATOM   5266 C CB  . PRO C 1 186 ? 59.767 59.577 14.989  1.00 100.89 ? 412  PRO C CB  1 
ATOM   5267 C CG  . PRO C 1 186 ? 61.054 59.024 14.515  1.00 100.21 ? 412  PRO C CG  1 
ATOM   5268 C CD  . PRO C 1 186 ? 61.981 59.356 15.655  1.00 100.54 ? 412  PRO C CD  1 
ATOM   5269 N N   . GLY C 1 187 ? 58.092 60.763 16.753  1.00 99.78  ? 413  GLY C N   1 
ATOM   5270 C CA  . GLY C 1 187 ? 57.060 61.193 17.680  1.00 96.70  ? 413  GLY C CA  1 
ATOM   5271 C C   . GLY C 1 187 ? 57.403 60.955 19.139  1.00 94.41  ? 413  GLY C C   1 
ATOM   5272 O O   . GLY C 1 187 ? 56.697 60.216 19.835  1.00 94.21  ? 413  GLY C O   1 
ATOM   5273 N N   . ARG C 1 188 ? 58.493 61.570 19.599  1.00 91.15  ? 414  ARG C N   1 
ATOM   5274 C CA  . ARG C 1 188 ? 58.917 61.444 20.988  1.00 86.52  ? 414  ARG C CA  1 
ATOM   5275 C C   . ARG C 1 188 ? 57.926 62.233 21.844  1.00 86.00  ? 414  ARG C C   1 
ATOM   5276 O O   . ARG C 1 188 ? 57.756 61.943 23.027  1.00 87.06  ? 414  ARG C O   1 
ATOM   5277 C CB  . ARG C 1 188 ? 60.328 61.997 21.179  1.00 83.12  ? 414  ARG C CB  1 
ATOM   5278 C CG  . ARG C 1 188 ? 60.855 61.825 22.590  1.00 77.38  ? 414  ARG C CG  1 
ATOM   5279 C CD  . ARG C 1 188 ? 62.066 62.704 22.840  1.00 73.11  ? 414  ARG C CD  1 
ATOM   5280 N NE  . ARG C 1 188 ? 62.518 62.672 24.229  1.00 68.53  ? 414  ARG C NE  1 
ATOM   5281 C CZ  . ARG C 1 188 ? 63.125 61.640 24.808  1.00 67.05  ? 414  ARG C CZ  1 
ATOM   5282 N NH1 . ARG C 1 188 ? 63.369 60.528 24.133  1.00 66.92  ? 414  ARG C NH1 1 
ATOM   5283 N NH2 . ARG C 1 188 ? 63.498 61.719 26.070  1.00 65.80  ? 414  ARG C NH2 1 
ATOM   5284 N N   . PHE C 1 189 ? 57.286 63.239 21.243  1.00 84.19  ? 415  PHE C N   1 
ATOM   5285 C CA  . PHE C 1 189 ? 56.275 64.043 21.934  1.00 81.37  ? 415  PHE C CA  1 
ATOM   5286 C C   . PHE C 1 189 ? 55.114 63.106 22.262  1.00 79.43  ? 415  PHE C C   1 
ATOM   5287 O O   . PHE C 1 189 ? 54.582 63.100 23.370  1.00 78.34  ? 415  PHE C O   1 
ATOM   5288 C CB  . PHE C 1 189 ? 55.776 65.165 21.027  1.00 80.03  ? 415  PHE C CB  1 
ATOM   5289 C CG  . PHE C 1 189 ? 54.748 66.041 21.671  1.00 78.03  ? 415  PHE C CG  1 
ATOM   5290 C CD1 . PHE C 1 189 ? 55.040 66.725 22.843  1.00 77.54  ? 415  PHE C CD1 1 
ATOM   5291 C CD2 . PHE C 1 189 ? 53.494 66.194 21.104  1.00 76.38  ? 415  PHE C CD2 1 
ATOM   5292 C CE1 . PHE C 1 189 ? 54.098 67.549 23.436  1.00 76.74  ? 415  PHE C CE1 1 
ATOM   5293 C CE2 . PHE C 1 189 ? 52.545 67.019 21.694  1.00 75.60  ? 415  PHE C CE2 1 
ATOM   5294 C CZ  . PHE C 1 189 ? 52.846 67.697 22.859  1.00 75.42  ? 415  PHE C CZ  1 
ATOM   5295 N N   . ALA C 1 190 ? 54.722 62.322 21.266  1.00 77.69  ? 416  ALA C N   1 
ATOM   5296 C CA  . ALA C 1 190 ? 53.666 61.346 21.428  1.00 75.57  ? 416  ALA C CA  1 
ATOM   5297 C C   . ALA C 1 190 ? 54.086 60.415 22.551  1.00 74.45  ? 416  ALA C C   1 
ATOM   5298 O O   . ALA C 1 190 ? 53.299 60.133 23.447  1.00 74.98  ? 416  ALA C O   1 
ATOM   5299 C CB  . ALA C 1 190 ? 53.494 60.565 20.155  1.00 75.60  ? 416  ALA C CB  1 
ATOM   5300 N N   . LYS C 1 191 ? 55.329 59.934 22.482  1.00 73.83  ? 417  LYS C N   1 
ATOM   5301 C CA  . LYS C 1 191 ? 55.895 59.039 23.496  1.00 72.97  ? 417  LYS C CA  1 
ATOM   5302 C C   . LYS C 1 191 ? 55.724 59.614 24.903  1.00 70.77  ? 417  LYS C C   1 
ATOM   5303 O O   . LYS C 1 191 ? 55.159 58.969 25.783  1.00 69.97  ? 417  LYS C O   1 
ATOM   5304 C CB  . LYS C 1 191 ? 57.395 58.804 23.241  1.00 74.48  ? 417  LYS C CB  1 
ATOM   5305 C CG  . LYS C 1 191 ? 57.768 57.520 22.474  1.00 74.86  ? 417  LYS C CG  1 
ATOM   5306 C CD  . LYS C 1 191 ? 59.301 57.386 22.363  1.00 74.88  ? 417  LYS C CD  1 
ATOM   5307 C CE  . LYS C 1 191 ? 59.741 56.078 21.711  1.00 73.78  ? 417  LYS C CE  1 
ATOM   5308 N NZ  . LYS C 1 191 ? 59.405 54.885 22.538  1.00 71.69  ? 417  LYS C NZ  1 
ATOM   5309 N N   . LEU C 1 192 ? 56.227 60.825 25.113  1.00 68.91  ? 418  LEU C N   1 
ATOM   5310 C CA  . LEU C 1 192 ? 56.123 61.485 26.409  1.00 68.30  ? 418  LEU C CA  1 
ATOM   5311 C C   . LEU C 1 192 ? 54.712 61.417 26.983  1.00 68.43  ? 418  LEU C C   1 
ATOM   5312 O O   . LEU C 1 192 ? 54.515 61.100 28.155  1.00 68.66  ? 418  LEU C O   1 
ATOM   5313 C CB  . LEU C 1 192 ? 56.541 62.955 26.289  1.00 68.66  ? 418  LEU C CB  1 
ATOM   5314 C CG  . LEU C 1 192 ? 57.972 63.352 26.667  1.00 68.58  ? 418  LEU C CG  1 
ATOM   5315 C CD1 . LEU C 1 192 ? 58.970 62.474 25.930  1.00 68.32  ? 418  LEU C CD1 1 
ATOM   5316 C CD2 . LEU C 1 192 ? 58.189 64.825 26.344  1.00 67.56  ? 418  LEU C CD2 1 
ATOM   5317 N N   . LEU C 1 193 ? 53.730 61.713 26.143  1.00 68.19  ? 419  LEU C N   1 
ATOM   5318 C CA  . LEU C 1 193 ? 52.336 61.714 26.556  1.00 67.05  ? 419  LEU C CA  1 
ATOM   5319 C C   . LEU C 1 193 ? 51.713 60.335 26.780  1.00 66.31  ? 419  LEU C C   1 
ATOM   5320 O O   . LEU C 1 193 ? 50.787 60.198 27.580  1.00 65.69  ? 419  LEU C O   1 
ATOM   5321 C CB  . LEU C 1 193 ? 51.532 62.486 25.527  1.00 66.09  ? 419  LEU C CB  1 
ATOM   5322 C CG  . LEU C 1 193 ? 52.228 63.813 25.247  1.00 65.94  ? 419  LEU C CG  1 
ATOM   5323 C CD1 . LEU C 1 193 ? 51.490 64.517 24.136  1.00 67.42  ? 419  LEU C CD1 1 
ATOM   5324 C CD2 . LEU C 1 193 ? 52.286 64.667 26.513  1.00 63.47  ? 419  LEU C CD2 1 
ATOM   5325 N N   . LEU C 1 194 ? 52.221 59.317 26.086  1.00 65.52  ? 420  LEU C N   1 
ATOM   5326 C CA  . LEU C 1 194 ? 51.700 57.955 26.218  1.00 65.47  ? 420  LEU C CA  1 
ATOM   5327 C C   . LEU C 1 194 ? 51.706 57.484 27.672  1.00 66.14  ? 420  LEU C C   1 
ATOM   5328 O O   . LEU C 1 194 ? 51.039 56.506 28.018  1.00 65.76  ? 420  LEU C O   1 
ATOM   5329 C CB  . LEU C 1 194 ? 52.521 56.975 25.375  1.00 65.45  ? 420  LEU C CB  1 
ATOM   5330 C CG  . LEU C 1 194 ? 51.791 55.713 24.902  1.00 66.10  ? 420  LEU C CG  1 
ATOM   5331 C CD1 . LEU C 1 194 ? 51.007 56.081 23.652  1.00 67.81  ? 420  LEU C CD1 1 
ATOM   5332 C CD2 . LEU C 1 194 ? 52.766 54.568 24.587  1.00 66.25  ? 420  LEU C CD2 1 
ATOM   5333 N N   . ARG C 1 195 ? 52.465 58.174 28.519  1.00 67.25  ? 421  ARG C N   1 
ATOM   5334 C CA  . ARG C 1 195 ? 52.545 57.828 29.931  1.00 68.85  ? 421  ARG C CA  1 
ATOM   5335 C C   . ARG C 1 195 ? 51.328 58.282 30.742  1.00 69.97  ? 421  ARG C C   1 
ATOM   5336 O O   . ARG C 1 195 ? 50.850 57.555 31.617  1.00 71.03  ? 421  ARG C O   1 
ATOM   5337 C CB  . ARG C 1 195 ? 53.817 58.416 30.547  1.00 66.85  ? 421  ARG C CB  1 
ATOM   5338 C CG  . ARG C 1 195 ? 55.095 57.755 30.078  1.00 64.14  ? 421  ARG C CG  1 
ATOM   5339 C CD  . ARG C 1 195 ? 55.040 56.270 30.326  1.00 64.61  ? 421  ARG C CD  1 
ATOM   5340 N NE  . ARG C 1 195 ? 54.815 55.513 29.098  1.00 66.05  ? 421  ARG C NE  1 
ATOM   5341 C CZ  . ARG C 1 195 ? 54.198 54.333 29.048  1.00 67.67  ? 421  ARG C CZ  1 
ATOM   5342 N NH1 . ARG C 1 195 ? 53.731 53.772 30.163  1.00 68.16  ? 421  ARG C NH1 1 
ATOM   5343 N NH2 . ARG C 1 195 ? 54.063 53.701 27.886  1.00 67.29  ? 421  ARG C NH2 1 
ATOM   5344 N N   . LEU C 1 196 ? 50.834 59.482 30.447  1.00 70.21  ? 422  LEU C N   1 
ATOM   5345 C CA  . LEU C 1 196 ? 49.682 60.057 31.142  1.00 69.21  ? 422  LEU C CA  1 
ATOM   5346 C C   . LEU C 1 196 ? 48.532 59.120 31.513  1.00 68.93  ? 422  LEU C C   1 
ATOM   5347 O O   . LEU C 1 196 ? 47.994 59.220 32.629  1.00 68.80  ? 422  LEU C O   1 
ATOM   5348 C CB  . LEU C 1 196 ? 49.162 61.238 30.337  1.00 69.08  ? 422  LEU C CB  1 
ATOM   5349 C CG  . LEU C 1 196 ? 50.237 62.314 30.442  1.00 68.96  ? 422  LEU C CG  1 
ATOM   5350 C CD1 . LEU C 1 196 ? 49.863 63.555 29.653  1.00 69.07  ? 422  LEU C CD1 1 
ATOM   5351 C CD2 . LEU C 1 196 ? 50.418 62.631 31.923  1.00 68.02  ? 422  LEU C CD2 1 
ATOM   5352 N N   . PRO C 1 197 ? 48.117 58.224 30.585  1.00 67.70  ? 423  PRO C N   1 
ATOM   5353 C CA  . PRO C 1 197 ? 47.025 57.280 30.870  1.00 66.45  ? 423  PRO C CA  1 
ATOM   5354 C C   . PRO C 1 197 ? 47.395 56.305 32.001  1.00 63.97  ? 423  PRO C C   1 
ATOM   5355 O O   . PRO C 1 197 ? 46.664 56.163 32.993  1.00 63.44  ? 423  PRO C O   1 
ATOM   5356 C CB  . PRO C 1 197 ? 46.827 56.567 29.527  1.00 66.22  ? 423  PRO C CB  1 
ATOM   5357 C CG  . PRO C 1 197 ? 47.144 57.634 28.543  1.00 65.95  ? 423  PRO C CG  1 
ATOM   5358 C CD  . PRO C 1 197 ? 48.406 58.239 29.137  1.00 66.92  ? 423  PRO C CD  1 
ATOM   5359 N N   . ALA C 1 198 ? 48.539 55.644 31.834  1.00 60.15  ? 424  ALA C N   1 
ATOM   5360 C CA  . ALA C 1 198 ? 49.044 54.696 32.813  1.00 56.72  ? 424  ALA C CA  1 
ATOM   5361 C C   . ALA C 1 198 ? 49.237 55.329 34.198  1.00 54.31  ? 424  ALA C C   1 
ATOM   5362 O O   . ALA C 1 198 ? 49.142 54.641 35.219  1.00 51.74  ? 424  ALA C O   1 
ATOM   5363 C CB  . ALA C 1 198 ? 50.346 54.120 32.317  1.00 58.61  ? 424  ALA C CB  1 
ATOM   5364 N N   . LEU C 1 199 ? 49.523 56.633 34.220  1.00 53.05  ? 425  LEU C N   1 
ATOM   5365 C CA  . LEU C 1 199 ? 49.715 57.385 35.465  1.00 52.33  ? 425  LEU C CA  1 
ATOM   5366 C C   . LEU C 1 199 ? 48.385 57.643 36.156  1.00 53.56  ? 425  LEU C C   1 
ATOM   5367 O O   . LEU C 1 199 ? 48.321 57.701 37.390  1.00 53.30  ? 425  LEU C O   1 
ATOM   5368 C CB  . LEU C 1 199 ? 50.375 58.737 35.203  1.00 49.73  ? 425  LEU C CB  1 
ATOM   5369 C CG  . LEU C 1 199 ? 50.296 59.652 36.433  1.00 48.64  ? 425  LEU C CG  1 
ATOM   5370 C CD1 . LEU C 1 199 ? 51.039 59.013 37.584  1.00 49.64  ? 425  LEU C CD1 1 
ATOM   5371 C CD2 . LEU C 1 199 ? 50.880 61.008 36.133  1.00 46.68  ? 425  LEU C CD2 1 
ATOM   5372 N N   . ARG C 1 200 ? 47.336 57.839 35.350  1.00 54.60  ? 426  ARG C N   1 
ATOM   5373 C CA  . ARG C 1 200 ? 45.987 58.070 35.864  1.00 52.58  ? 426  ARG C CA  1 
ATOM   5374 C C   . ARG C 1 200 ? 45.577 56.808 36.621  1.00 50.65  ? 426  ARG C C   1 
ATOM   5375 O O   . ARG C 1 200 ? 45.339 56.855 37.829  1.00 48.99  ? 426  ARG C O   1 
ATOM   5376 C CB  . ARG C 1 200 ? 45.023 58.362 34.706  1.00 51.30  ? 426  ARG C CB  1 
ATOM   5377 C CG  . ARG C 1 200 ? 43.551 58.353 35.086  1.00 50.84  ? 426  ARG C CG  1 
ATOM   5378 C CD  . ARG C 1 200 ? 43.230 59.238 36.282  1.00 50.50  ? 426  ARG C CD  1 
ATOM   5379 N NE  . ARG C 1 200 ? 43.329 60.679 36.026  1.00 50.99  ? 426  ARG C NE  1 
ATOM   5380 C CZ  . ARG C 1 200 ? 42.531 61.382 35.221  1.00 51.16  ? 426  ARG C CZ  1 
ATOM   5381 N NH1 . ARG C 1 200 ? 41.548 60.796 34.556  1.00 49.33  ? 426  ARG C NH1 1 
ATOM   5382 N NH2 . ARG C 1 200 ? 42.698 62.694 35.108  1.00 49.33  ? 426  ARG C NH2 1 
ATOM   5383 N N   . SER C 1 201 ? 45.528 55.681 35.912  1.00 47.79  ? 427  SER C N   1 
ATOM   5384 C CA  . SER C 1 201 ? 45.172 54.417 36.537  1.00 47.16  ? 427  SER C CA  1 
ATOM   5385 C C   . SER C 1 201 ? 46.017 54.160 37.764  1.00 46.49  ? 427  SER C C   1 
ATOM   5386 O O   . SER C 1 201 ? 45.499 53.843 38.826  1.00 46.24  ? 427  SER C O   1 
ATOM   5387 C CB  . SER C 1 201 ? 45.352 53.253 35.565  1.00 47.32  ? 427  SER C CB  1 
ATOM   5388 O OG  . SER C 1 201 ? 44.207 53.074 34.757  1.00 49.47  ? 427  SER C OG  1 
ATOM   5389 N N   . ILE C 1 202 ? 47.329 54.289 37.622  1.00 48.01  ? 428  ILE C N   1 
ATOM   5390 C CA  . ILE C 1 202 ? 48.216 54.048 38.753  1.00 48.40  ? 428  ILE C CA  1 
ATOM   5391 C C   . ILE C 1 202 ? 47.946 55.022 39.897  1.00 49.07  ? 428  ILE C C   1 
ATOM   5392 O O   . ILE C 1 202 ? 47.830 54.612 41.044  1.00 48.73  ? 428  ILE C O   1 
ATOM   5393 C CB  . ILE C 1 202 ? 49.708 54.082 38.313  1.00 47.41  ? 428  ILE C CB  1 
ATOM   5394 C CG1 . ILE C 1 202 ? 50.087 52.705 37.747  1.00 45.38  ? 428  ILE C CG1 1 
ATOM   5395 C CG2 . ILE C 1 202 ? 50.606 54.499 39.481  1.00 45.82  ? 428  ILE C CG2 1 
ATOM   5396 C CD1 . ILE C 1 202 ? 51.521 52.559 37.332  1.00 45.27  ? 428  ILE C CD1 1 
ATOM   5397 N N   . GLY C 1 203 ? 47.834 56.306 39.591  1.00 48.85  ? 429  GLY C N   1 
ATOM   5398 C CA  . GLY C 1 203 ? 47.541 57.253 40.638  1.00 48.78  ? 429  GLY C CA  1 
ATOM   5399 C C   . GLY C 1 203 ? 46.260 56.845 41.355  1.00 49.88  ? 429  GLY C C   1 
ATOM   5400 O O   . GLY C 1 203 ? 46.174 56.928 42.577  1.00 47.92  ? 429  GLY C O   1 
ATOM   5401 N N   . LEU C 1 204 ? 45.252 56.399 40.609  1.00 51.83  ? 430  LEU C N   1 
ATOM   5402 C CA  . LEU C 1 204 ? 43.993 55.981 41.233  1.00 53.13  ? 430  LEU C CA  1 
ATOM   5403 C C   . LEU C 1 204 ? 44.170 54.824 42.222  1.00 55.69  ? 430  LEU C C   1 
ATOM   5404 O O   . LEU C 1 204 ? 43.629 54.866 43.336  1.00 56.97  ? 430  LEU C O   1 
ATOM   5405 C CB  . LEU C 1 204 ? 42.963 55.581 40.173  1.00 48.88  ? 430  LEU C CB  1 
ATOM   5406 C CG  . LEU C 1 204 ? 42.461 56.739 39.317  1.00 47.97  ? 430  LEU C CG  1 
ATOM   5407 C CD1 . LEU C 1 204 ? 41.594 56.221 38.197  1.00 47.22  ? 430  LEU C CD1 1 
ATOM   5408 C CD2 . LEU C 1 204 ? 41.689 57.708 40.186  1.00 47.57  ? 430  LEU C CD2 1 
ATOM   5409 N N   . LYS C 1 205 ? 44.925 53.797 41.820  1.00 56.59  ? 431  LYS C N   1 
ATOM   5410 C CA  . LYS C 1 205 ? 45.159 52.637 42.678  1.00 55.36  ? 431  LYS C CA  1 
ATOM   5411 C C   . LYS C 1 205 ? 46.028 52.956 43.894  1.00 54.28  ? 431  LYS C C   1 
ATOM   5412 O O   . LYS C 1 205 ? 46.012 52.232 44.879  1.00 53.93  ? 431  LYS C O   1 
ATOM   5413 C CB  . LYS C 1 205 ? 45.775 51.498 41.863  1.00 55.67  ? 431  LYS C CB  1 
ATOM   5414 C CG  . LYS C 1 205 ? 46.121 50.265 42.688  1.00 57.54  ? 431  LYS C CG  1 
ATOM   5415 C CD  . LYS C 1 205 ? 44.895 49.592 43.314  1.00 57.47  ? 431  LYS C CD  1 
ATOM   5416 C CE  . LYS C 1 205 ? 45.305 48.429 44.221  1.00 57.31  ? 431  LYS C CE  1 
ATOM   5417 N NZ  . LYS C 1 205 ? 44.137 47.682 44.781  1.00 58.40  ? 431  LYS C NZ  1 
ATOM   5418 N N   . CYS C 1 206 ? 46.782 54.044 43.825  1.00 55.64  ? 432  CYS C N   1 
ATOM   5419 C CA  . CYS C 1 206 ? 47.625 54.458 44.938  1.00 58.20  ? 432  CYS C CA  1 
ATOM   5420 C C   . CYS C 1 206 ? 46.805 55.188 45.988  1.00 59.39  ? 432  CYS C C   1 
ATOM   5421 O O   . CYS C 1 206 ? 47.244 55.353 47.116  1.00 59.02  ? 432  CYS C O   1 
ATOM   5422 C CB  . CYS C 1 206 ? 48.748 55.378 44.462  1.00 60.17  ? 432  CYS C CB  1 
ATOM   5423 S SG  . CYS C 1 206 ? 50.047 54.567 43.503  1.00 65.45  ? 432  CYS C SG  1 
ATOM   5424 N N   . LEU C 1 207 ? 45.624 55.657 45.610  1.00 61.73  ? 433  LEU C N   1 
ATOM   5425 C CA  . LEU C 1 207 ? 44.755 56.332 46.561  1.00 63.67  ? 433  LEU C CA  1 
ATOM   5426 C C   . LEU C 1 207 ? 44.043 55.279 47.398  1.00 65.41  ? 433  LEU C C   1 
ATOM   5427 O O   . LEU C 1 207 ? 43.858 55.466 48.598  1.00 65.23  ? 433  LEU C O   1 
ATOM   5428 C CB  . LEU C 1 207 ? 43.748 57.201 45.828  1.00 64.78  ? 433  LEU C CB  1 
ATOM   5429 C CG  . LEU C 1 207 ? 44.360 58.546 45.443  1.00 66.62  ? 433  LEU C CG  1 
ATOM   5430 C CD1 . LEU C 1 207 ? 43.539 59.183 44.342  1.00 66.68  ? 433  LEU C CD1 1 
ATOM   5431 C CD2 . LEU C 1 207 ? 44.448 59.447 46.681  1.00 66.19  ? 433  LEU C CD2 1 
ATOM   5432 N N   . GLU C 1 208 ? 43.640 54.176 46.763  1.00 66.37  ? 434  GLU C N   1 
ATOM   5433 C CA  . GLU C 1 208 ? 43.000 53.089 47.486  1.00 66.56  ? 434  GLU C CA  1 
ATOM   5434 C C   . GLU C 1 208 ? 43.905 52.787 48.674  1.00 66.48  ? 434  GLU C C   1 
ATOM   5435 O O   . GLU C 1 208 ? 43.476 52.883 49.820  1.00 67.08  ? 434  GLU C O   1 
ATOM   5436 C CB  . GLU C 1 208 ? 42.880 51.848 46.608  1.00 66.85  ? 434  GLU C CB  1 
ATOM   5437 C CG  . GLU C 1 208 ? 41.810 51.936 45.546  1.00 71.41  ? 434  GLU C CG  1 
ATOM   5438 C CD  . GLU C 1 208 ? 41.680 50.637 44.769  1.00 74.98  ? 434  GLU C CD  1 
ATOM   5439 O OE1 . GLU C 1 208 ? 41.906 49.570 45.384  1.00 77.02  ? 434  GLU C OE1 1 
ATOM   5440 O OE2 . GLU C 1 208 ? 41.345 50.673 43.558  1.00 75.98  ? 434  GLU C OE2 1 
ATOM   5441 N N   . HIS C 1 209 ? 45.164 52.442 48.396  1.00 66.27  ? 435  HIS C N   1 
ATOM   5442 C CA  . HIS C 1 209 ? 46.133 52.141 49.453  1.00 65.34  ? 435  HIS C CA  1 
ATOM   5443 C C   . HIS C 1 209 ? 46.166 53.278 50.457  1.00 64.30  ? 435  HIS C C   1 
ATOM   5444 O O   . HIS C 1 209 ? 46.142 53.054 51.659  1.00 63.73  ? 435  HIS C O   1 
ATOM   5445 C CB  . HIS C 1 209 ? 47.558 51.961 48.898  1.00 65.26  ? 435  HIS C CB  1 
ATOM   5446 C CG  . HIS C 1 209 ? 47.793 50.666 48.179  1.00 64.68  ? 435  HIS C CG  1 
ATOM   5447 N ND1 . HIS C 1 209 ? 47.581 50.513 46.824  1.00 63.60  ? 435  HIS C ND1 1 
ATOM   5448 C CD2 . HIS C 1 209 ? 48.277 49.480 48.619  1.00 64.51  ? 435  HIS C CD2 1 
ATOM   5449 C CE1 . HIS C 1 209 ? 47.928 49.292 46.459  1.00 63.68  ? 435  HIS C CE1 1 
ATOM   5450 N NE2 . HIS C 1 209 ? 48.354 48.645 47.529  1.00 65.43  ? 435  HIS C NE2 1 
ATOM   5451 N N   . LEU C 1 210 ? 46.232 54.502 49.953  1.00 65.24  ? 436  LEU C N   1 
ATOM   5452 C CA  . LEU C 1 210 ? 46.281 55.668 50.818  1.00 67.84  ? 436  LEU C CA  1 
ATOM   5453 C C   . LEU C 1 210 ? 45.127 55.695 51.806  1.00 69.60  ? 436  LEU C C   1 
ATOM   5454 O O   . LEU C 1 210 ? 45.316 55.974 52.989  1.00 70.25  ? 436  LEU C O   1 
ATOM   5455 C CB  . LEU C 1 210 ? 46.279 56.948 49.986  1.00 67.40  ? 436  LEU C CB  1 
ATOM   5456 C CG  . LEU C 1 210 ? 47.541 57.168 49.160  1.00 66.06  ? 436  LEU C CG  1 
ATOM   5457 C CD1 . LEU C 1 210 ? 47.379 58.448 48.373  1.00 66.36  ? 436  LEU C CD1 1 
ATOM   5458 C CD2 . LEU C 1 210 ? 48.778 57.211 50.068  1.00 63.92  ? 436  LEU C CD2 1 
ATOM   5459 N N   . PHE C 1 211 ? 43.923 55.418 51.331  1.00 70.81  ? 437  PHE C N   1 
ATOM   5460 C CA  . PHE C 1 211 ? 42.793 55.409 52.233  1.00 71.78  ? 437  PHE C CA  1 
ATOM   5461 C C   . PHE C 1 211 ? 42.968 54.317 53.281  1.00 71.48  ? 437  PHE C C   1 
ATOM   5462 O O   . PHE C 1 211 ? 42.790 54.574 54.466  1.00 71.95  ? 437  PHE C O   1 
ATOM   5463 C CB  . PHE C 1 211 ? 41.500 55.225 51.449  1.00 74.68  ? 437  PHE C CB  1 
ATOM   5464 C CG  . PHE C 1 211 ? 41.071 56.463 50.713  1.00 78.27  ? 437  PHE C CG  1 
ATOM   5465 C CD1 . PHE C 1 211 ? 40.865 57.651 51.405  1.00 78.98  ? 437  PHE C CD1 1 
ATOM   5466 C CD2 . PHE C 1 211 ? 40.895 56.450 49.335  1.00 80.01  ? 437  PHE C CD2 1 
ATOM   5467 C CE1 . PHE C 1 211 ? 40.494 58.802 50.741  1.00 80.03  ? 437  PHE C CE1 1 
ATOM   5468 C CE2 . PHE C 1 211 ? 40.523 57.601 48.661  1.00 80.06  ? 437  PHE C CE2 1 
ATOM   5469 C CZ  . PHE C 1 211 ? 40.322 58.778 49.364  1.00 81.11  ? 437  PHE C CZ  1 
ATOM   5470 N N   . PHE C 1 212 ? 43.345 53.112 52.855  1.00 70.29  ? 438  PHE C N   1 
ATOM   5471 C CA  . PHE C 1 212 ? 43.542 52.019 53.793  1.00 69.92  ? 438  PHE C CA  1 
ATOM   5472 C C   . PHE C 1 212 ? 44.458 52.429 54.930  1.00 69.87  ? 438  PHE C C   1 
ATOM   5473 O O   . PHE C 1 212 ? 44.158 52.172 56.088  1.00 70.33  ? 438  PHE C O   1 
ATOM   5474 C CB  . PHE C 1 212 ? 44.138 50.787 53.104  1.00 71.31  ? 438  PHE C CB  1 
ATOM   5475 C CG  . PHE C 1 212 ? 44.275 49.580 54.018  1.00 73.92  ? 438  PHE C CG  1 
ATOM   5476 C CD1 . PHE C 1 212 ? 43.532 48.429 53.789  1.00 73.92  ? 438  PHE C CD1 1 
ATOM   5477 C CD2 . PHE C 1 212 ? 45.140 49.601 55.115  1.00 75.25  ? 438  PHE C CD2 1 
ATOM   5478 C CE1 . PHE C 1 212 ? 43.651 47.331 54.631  1.00 74.28  ? 438  PHE C CE1 1 
ATOM   5479 C CE2 . PHE C 1 212 ? 45.262 48.503 55.964  1.00 74.14  ? 438  PHE C CE2 1 
ATOM   5480 C CZ  . PHE C 1 212 ? 44.518 47.370 55.721  1.00 74.22  ? 438  PHE C CZ  1 
ATOM   5481 N N   . PHE C 1 213 ? 45.582 53.059 54.613  1.00 70.51  ? 439  PHE C N   1 
ATOM   5482 C CA  . PHE C 1 213 ? 46.518 53.456 55.659  1.00 72.39  ? 439  PHE C CA  1 
ATOM   5483 C C   . PHE C 1 213 ? 45.882 54.379 56.689  1.00 73.12  ? 439  PHE C C   1 
ATOM   5484 O O   . PHE C 1 213 ? 46.164 54.271 57.881  1.00 72.84  ? 439  PHE C O   1 
ATOM   5485 C CB  . PHE C 1 213 ? 47.753 54.163 55.074  1.00 73.64  ? 439  PHE C CB  1 
ATOM   5486 C CG  . PHE C 1 213 ? 48.449 53.399 53.971  1.00 75.54  ? 439  PHE C CG  1 
ATOM   5487 C CD1 . PHE C 1 213 ? 48.633 52.026 54.056  1.00 76.29  ? 439  PHE C CD1 1 
ATOM   5488 C CD2 . PHE C 1 213 ? 48.924 54.063 52.848  1.00 76.41  ? 439  PHE C CD2 1 
ATOM   5489 C CE1 . PHE C 1 213 ? 49.274 51.328 53.039  1.00 76.91  ? 439  PHE C CE1 1 
ATOM   5490 C CE2 . PHE C 1 213 ? 49.565 53.372 51.829  1.00 77.62  ? 439  PHE C CE2 1 
ATOM   5491 C CZ  . PHE C 1 213 ? 49.739 52.003 51.924  1.00 77.00  ? 439  PHE C CZ  1 
ATOM   5492 N N   . LYS C 1 214 ? 45.024 55.281 56.217  1.00 75.46  ? 440  LYS C N   1 
ATOM   5493 C CA  . LYS C 1 214 ? 44.347 56.279 57.055  1.00 77.23  ? 440  LYS C CA  1 
ATOM   5494 C C   . LYS C 1 214 ? 43.158 55.794 57.868  1.00 76.41  ? 440  LYS C C   1 
ATOM   5495 O O   . LYS C 1 214 ? 43.150 55.884 59.101  1.00 74.72  ? 440  LYS C O   1 
ATOM   5496 C CB  . LYS C 1 214 ? 43.870 57.446 56.177  1.00 79.84  ? 440  LYS C CB  1 
ATOM   5497 C CG  . LYS C 1 214 ? 43.038 58.504 56.906  1.00 81.94  ? 440  LYS C CG  1 
ATOM   5498 C CD  . LYS C 1 214 ? 42.400 59.461 55.907  1.00 83.88  ? 440  LYS C CD  1 
ATOM   5499 C CE  . LYS C 1 214 ? 41.299 60.298 56.548  1.00 85.79  ? 440  LYS C CE  1 
ATOM   5500 N NZ  . LYS C 1 214 ? 40.481 61.047 55.535  1.00 86.23  ? 440  LYS C NZ  1 
ATOM   5501 N N   . LEU C 1 215 ? 42.150 55.312 57.142  1.00 76.58  ? 441  LEU C N   1 
ATOM   5502 C CA  . LEU C 1 215 ? 40.886 54.828 57.690  1.00 76.86  ? 441  LEU C CA  1 
ATOM   5503 C C   . LEU C 1 215 ? 40.986 53.548 58.508  1.00 78.08  ? 441  LEU C C   1 
ATOM   5504 O O   . LEU C 1 215 ? 40.311 53.397 59.531  1.00 78.91  ? 441  LEU C O   1 
ATOM   5505 C CB  . LEU C 1 215 ? 39.890 54.622 56.544  1.00 74.15  ? 441  LEU C CB  1 
ATOM   5506 C CG  . LEU C 1 215 ? 39.756 55.818 55.596  1.00 72.40  ? 441  LEU C CG  1 
ATOM   5507 C CD1 . LEU C 1 215 ? 38.896 55.446 54.413  1.00 71.09  ? 441  LEU C CD1 1 
ATOM   5508 C CD2 . LEU C 1 215 ? 39.173 57.005 56.339  1.00 70.81  ? 441  LEU C CD2 1 
ATOM   5509 N N   . ILE C 1 216 ? 41.834 52.632 58.060  1.00 78.98  ? 442  ILE C N   1 
ATOM   5510 C CA  . ILE C 1 216 ? 42.000 51.359 58.736  1.00 80.21  ? 442  ILE C CA  1 
ATOM   5511 C C   . ILE C 1 216 ? 43.231 51.302 59.655  1.00 82.70  ? 442  ILE C C   1 
ATOM   5512 O O   . ILE C 1 216 ? 43.147 51.675 60.830  1.00 82.58  ? 442  ILE C O   1 
ATOM   5513 C CB  . ILE C 1 216 ? 42.057 50.246 57.693  1.00 78.03  ? 442  ILE C CB  1 
ATOM   5514 C CG1 . ILE C 1 216 ? 40.865 50.366 56.753  1.00 74.83  ? 442  ILE C CG1 1 
ATOM   5515 C CG2 . ILE C 1 216 ? 41.982 48.915 58.356  1.00 80.10  ? 442  ILE C CG2 1 
ATOM   5516 C CD1 . ILE C 1 216 ? 40.745 49.194 55.858  1.00 73.88  ? 442  ILE C CD1 1 
ATOM   5517 N N   . GLY C 1 217 ? 44.363 50.835 59.119  1.00 85.83  ? 443  GLY C N   1 
ATOM   5518 C CA  . GLY C 1 217 ? 45.595 50.742 59.894  1.00 88.99  ? 443  GLY C CA  1 
ATOM   5519 C C   . GLY C 1 217 ? 45.841 52.014 60.677  1.00 90.80  ? 443  GLY C C   1 
ATOM   5520 O O   . GLY C 1 217 ? 45.277 53.059 60.358  1.00 91.36  ? 443  GLY C O   1 
ATOM   5521 N N   . ASP C 1 218 ? 46.683 51.957 61.697  1.00 92.46  ? 444  ASP C N   1 
ATOM   5522 C CA  . ASP C 1 218 ? 46.906 53.161 62.478  1.00 94.63  ? 444  ASP C CA  1 
ATOM   5523 C C   . ASP C 1 218 ? 48.186 53.918 62.168  1.00 94.69  ? 444  ASP C C   1 
ATOM   5524 O O   . ASP C 1 218 ? 48.831 54.450 63.070  1.00 94.29  ? 444  ASP C O   1 
ATOM   5525 C CB  . ASP C 1 218 ? 46.818 52.833 63.971  1.00 97.43  ? 444  ASP C CB  1 
ATOM   5526 C CG  . ASP C 1 218 ? 45.420 52.368 64.381  1.00 99.67  ? 444  ASP C CG  1 
ATOM   5527 O OD1 . ASP C 1 218 ? 44.445 53.116 64.139  1.00 100.48 ? 444  ASP C OD1 1 
ATOM   5528 O OD2 . ASP C 1 218 ? 45.297 51.255 64.942  1.00 101.46 ? 444  ASP C OD2 1 
ATOM   5529 N N   . THR C 1 219 ? 48.547 53.973 60.887  1.00 95.19  ? 445  THR C N   1 
ATOM   5530 C CA  . THR C 1 219 ? 49.738 54.706 60.479  1.00 94.87  ? 445  THR C CA  1 
ATOM   5531 C C   . THR C 1 219 ? 49.396 56.143 60.790  1.00 95.72  ? 445  THR C C   1 
ATOM   5532 O O   . THR C 1 219 ? 48.509 56.716 60.160  1.00 94.96  ? 445  THR C O   1 
ATOM   5533 C CB  . THR C 1 219 ? 50.010 54.641 58.954  1.00 93.72  ? 445  THR C CB  1 
ATOM   5534 O OG1 . THR C 1 219 ? 50.024 53.280 58.508  1.00 93.02  ? 445  THR C OG1 1 
ATOM   5535 C CG2 . THR C 1 219 ? 51.356 55.294 58.637  1.00 92.07  ? 445  THR C CG2 1 
ATOM   5536 N N   . PRO C 1 220 ? 50.062 56.742 61.785  1.00 97.22  ? 446  PRO C N   1 
ATOM   5537 C CA  . PRO C 1 220 ? 49.688 58.136 62.032  1.00 97.58  ? 446  PRO C CA  1 
ATOM   5538 C C   . PRO C 1 220 ? 49.960 58.942 60.759  1.00 97.47  ? 446  PRO C C   1 
ATOM   5539 O O   . PRO C 1 220 ? 51.068 58.909 60.212  1.00 97.99  ? 446  PRO C O   1 
ATOM   5540 C CB  . PRO C 1 220 ? 50.578 58.529 63.211  1.00 98.19  ? 446  PRO C CB  1 
ATOM   5541 C CG  . PRO C 1 220 ? 51.801 57.645 63.028  1.00 98.35  ? 446  PRO C CG  1 
ATOM   5542 C CD  . PRO C 1 220 ? 51.198 56.322 62.626  1.00 97.55  ? 446  PRO C CD  1 
ATOM   5543 N N   . ILE C 1 221 ? 48.934 59.632 60.269  1.00 97.09  ? 447  ILE C N   1 
ATOM   5544 C CA  . ILE C 1 221 ? 49.061 60.430 59.054  1.00 95.98  ? 447  ILE C CA  1 
ATOM   5545 C C   . ILE C 1 221 ? 49.234 61.897 59.372  1.00 96.29  ? 447  ILE C C   1 
ATOM   5546 O O   . ILE C 1 221 ? 48.478 62.459 60.160  1.00 96.52  ? 447  ILE C O   1 
ATOM   5547 C CB  . ILE C 1 221 ? 47.834 60.289 58.169  1.00 94.92  ? 447  ILE C CB  1 
ATOM   5548 C CG1 . ILE C 1 221 ? 47.775 58.874 57.610  1.00 93.72  ? 447  ILE C CG1 1 
ATOM   5549 C CG2 . ILE C 1 221 ? 47.876 61.315 57.056  1.00 94.62  ? 447  ILE C CG2 1 
ATOM   5550 C CD1 . ILE C 1 221 ? 46.657 58.678 56.661  1.00 92.37  ? 447  ILE C CD1 1 
ATOM   5551 N N   . ASP C 1 222 ? 50.221 62.522 58.743  1.00 96.82  ? 448  ASP C N   1 
ATOM   5552 C CA  . ASP C 1 222 ? 50.482 63.924 59.001  1.00 97.01  ? 448  ASP C CA  1 
ATOM   5553 C C   . ASP C 1 222 ? 49.487 64.888 58.392  1.00 95.68  ? 448  ASP C C   1 
ATOM   5554 O O   . ASP C 1 222 ? 48.880 64.621 57.361  1.00 94.01  ? 448  ASP C O   1 
ATOM   5555 C CB  . ASP C 1 222 ? 51.903 64.285 58.574  1.00 98.64  ? 448  ASP C CB  1 
ATOM   5556 C CG  . ASP C 1 222 ? 52.923 63.957 59.646  1.00 100.24 ? 448  ASP C CG  1 
ATOM   5557 O OD1 . ASP C 1 222 ? 52.853 64.571 60.741  1.00 100.90 ? 448  ASP C OD1 1 
ATOM   5558 O OD2 . ASP C 1 222 ? 53.783 63.082 59.396  1.00 101.08 ? 448  ASP C OD2 1 
ATOM   5559 N N   . THR C 1 223 ? 49.345 66.015 59.075  1.00 95.37  ? 449  THR C N   1 
ATOM   5560 C CA  . THR C 1 223 ? 48.443 67.097 58.716  1.00 96.41  ? 449  THR C CA  1 
ATOM   5561 C C   . THR C 1 223 ? 48.158 67.342 57.235  1.00 96.15  ? 449  THR C C   1 
ATOM   5562 O O   . THR C 1 223 ? 47.155 66.868 56.715  1.00 96.64  ? 449  THR C O   1 
ATOM   5563 C CB  . THR C 1 223 ? 48.938 68.406 59.335  1.00 97.23  ? 449  THR C CB  1 
ATOM   5564 O OG1 . THR C 1 223 ? 50.155 68.814 58.696  1.00 98.23  ? 449  THR C OG1 1 
ATOM   5565 C CG2 . THR C 1 223 ? 49.216 68.199 60.818  1.00 98.41  ? 449  THR C CG2 1 
ATOM   5566 N N   . PHE C 1 224 ? 49.026 68.100 56.570  1.00 95.61  ? 450  PHE C N   1 
ATOM   5567 C CA  . PHE C 1 224 ? 48.858 68.437 55.158  1.00 95.56  ? 450  PHE C CA  1 
ATOM   5568 C C   . PHE C 1 224 ? 48.356 67.253 54.340  1.00 94.74  ? 450  PHE C C   1 
ATOM   5569 O O   . PHE C 1 224 ? 47.421 67.377 53.554  1.00 94.65  ? 450  PHE C O   1 
ATOM   5570 C CB  . PHE C 1 224 ? 50.185 68.936 54.584  1.00 97.27  ? 450  PHE C CB  1 
ATOM   5571 C CG  . PHE C 1 224 ? 50.036 69.860 53.396  1.00 98.31  ? 450  PHE C CG  1 
ATOM   5572 C CD1 . PHE C 1 224 ? 49.442 71.105 53.533  1.00 98.73  ? 450  PHE C CD1 1 
ATOM   5573 C CD2 . PHE C 1 224 ? 50.518 69.497 52.153  1.00 98.34  ? 450  PHE C CD2 1 
ATOM   5574 C CE1 . PHE C 1 224 ? 49.338 71.966 52.449  1.00 98.91  ? 450  PHE C CE1 1 
ATOM   5575 C CE2 . PHE C 1 224 ? 50.415 70.355 51.067  1.00 98.31  ? 450  PHE C CE2 1 
ATOM   5576 C CZ  . PHE C 1 224 ? 49.826 71.587 51.215  1.00 97.97  ? 450  PHE C CZ  1 
ATOM   5577 N N   . LEU C 1 225 ? 48.996 66.107 54.525  1.00 94.06  ? 451  LEU C N   1 
ATOM   5578 C CA  . LEU C 1 225 ? 48.629 64.881 53.832  1.00 92.93  ? 451  LEU C CA  1 
ATOM   5579 C C   . LEU C 1 225 ? 47.169 64.535 54.105  1.00 92.90  ? 451  LEU C C   1 
ATOM   5580 O O   . LEU C 1 225 ? 46.388 64.320 53.184  1.00 91.41  ? 451  LEU C O   1 
ATOM   5581 C CB  . LEU C 1 225 ? 49.531 63.757 54.323  1.00 92.47  ? 451  LEU C CB  1 
ATOM   5582 C CG  . LEU C 1 225 ? 49.202 62.340 53.891  1.00 91.10  ? 451  LEU C CG  1 
ATOM   5583 C CD1 . LEU C 1 225 ? 48.978 62.297 52.390  1.00 90.32  ? 451  LEU C CD1 1 
ATOM   5584 C CD2 . LEU C 1 225 ? 50.339 61.431 54.323  1.00 90.97  ? 451  LEU C CD2 1 
ATOM   5585 N N   . MET C 1 226 ? 46.831 64.479 55.390  1.00 94.40  ? 452  MET C N   1 
ATOM   5586 C CA  . MET C 1 226 ? 45.487 64.186 55.884  1.00 96.21  ? 452  MET C CA  1 
ATOM   5587 C C   . MET C 1 226 ? 44.420 65.073 55.245  1.00 96.77  ? 452  MET C C   1 
ATOM   5588 O O   . MET C 1 226 ? 43.375 64.597 54.795  1.00 96.73  ? 452  MET C O   1 
ATOM   5589 C CB  . MET C 1 226 ? 45.458 64.399 57.394  1.00 97.46  ? 452  MET C CB  1 
ATOM   5590 C CG  . MET C 1 226 ? 44.080 64.344 58.001  1.00 99.83  ? 452  MET C CG  1 
ATOM   5591 S SD  . MET C 1 226 ? 43.527 62.669 58.299  1.00 103.08 ? 452  MET C SD  1 
ATOM   5592 C CE  . MET C 1 226 ? 43.853 62.523 60.096  1.00 102.41 ? 452  MET C CE  1 
ATOM   5593 N N   . GLU C 1 227 ? 44.689 66.371 55.234  1.00 97.48  ? 453  GLU C N   1 
ATOM   5594 C CA  . GLU C 1 227 ? 43.788 67.359 54.662  1.00 98.53  ? 453  GLU C CA  1 
ATOM   5595 C C   . GLU C 1 227 ? 43.518 67.160 53.166  1.00 99.24  ? 453  GLU C C   1 
ATOM   5596 O O   . GLU C 1 227 ? 42.483 67.582 52.655  1.00 99.25  ? 453  GLU C O   1 
ATOM   5597 C CB  . GLU C 1 227 ? 44.370 68.749 54.891  1.00 99.24  ? 453  GLU C CB  1 
ATOM   5598 C CG  . GLU C 1 227 ? 43.653 69.856 54.148  1.00 101.42 ? 453  GLU C CG  1 
ATOM   5599 C CD  . GLU C 1 227 ? 44.410 71.167 54.206  1.00 101.68 ? 453  GLU C CD  1 
ATOM   5600 O OE1 . GLU C 1 227 ? 44.795 71.561 55.327  1.00 101.84 ? 453  GLU C OE1 1 
ATOM   5601 O OE2 . GLU C 1 227 ? 44.613 71.799 53.141  1.00 101.02 ? 453  GLU C OE2 1 
ATOM   5602 N N   . MET C 1 228 ? 44.443 66.515 52.465  1.00 100.33 ? 454  MET C N   1 
ATOM   5603 C CA  . MET C 1 228 ? 44.286 66.292 51.038  1.00 101.60 ? 454  MET C CA  1 
ATOM   5604 C C   . MET C 1 228 ? 43.418 65.125 50.611  1.00 103.83 ? 454  MET C C   1 
ATOM   5605 O O   . MET C 1 228 ? 43.305 64.867 49.416  1.00 104.13 ? 454  MET C O   1 
ATOM   5606 C CB  . MET C 1 228 ? 45.649 66.138 50.377  1.00 100.50 ? 454  MET C CB  1 
ATOM   5607 C CG  . MET C 1 228 ? 46.411 67.424 50.286  1.00 99.72  ? 454  MET C CG  1 
ATOM   5608 S SD  . MET C 1 228 ? 45.339 68.681 49.627  1.00 98.97  ? 454  MET C SD  1 
ATOM   5609 C CE  . MET C 1 228 ? 44.827 67.909 48.103  1.00 98.57  ? 454  MET C CE  1 
ATOM   5610 N N   . LEU C 1 229 ? 42.800 64.419 51.553  1.00 106.94 ? 455  LEU C N   1 
ATOM   5611 C CA  . LEU C 1 229 ? 41.964 63.288 51.167  1.00 110.56 ? 455  LEU C CA  1 
ATOM   5612 C C   . LEU C 1 229 ? 40.700 63.045 52.000  1.00 113.59 ? 455  LEU C C   1 
ATOM   5613 O O   . LEU C 1 229 ? 40.720 63.116 53.233  1.00 113.28 ? 455  LEU C O   1 
ATOM   5614 C CB  . LEU C 1 229 ? 42.814 62.000 51.088  1.00 109.90 ? 455  LEU C CB  1 
ATOM   5615 C CG  . LEU C 1 229 ? 43.482 61.276 52.266  1.00 108.57 ? 455  LEU C CG  1 
ATOM   5616 C CD1 . LEU C 1 229 ? 44.279 60.105 51.714  1.00 107.23 ? 455  LEU C CD1 1 
ATOM   5617 C CD2 . LEU C 1 229 ? 44.402 62.192 53.037  1.00 108.42 ? 455  LEU C CD2 1 
ATOM   5618 N N   . GLU C 1 230 ? 39.606 62.765 51.283  1.00 117.27 ? 456  GLU C N   1 
ATOM   5619 C CA  . GLU C 1 230 ? 38.268 62.490 51.834  1.00 120.82 ? 456  GLU C CA  1 
ATOM   5620 C C   . GLU C 1 230 ? 37.400 61.957 50.674  1.00 123.21 ? 456  GLU C C   1 
ATOM   5621 O O   . GLU C 1 230 ? 37.004 62.738 49.802  1.00 124.12 ? 456  GLU C O   1 
ATOM   5622 C CB  . GLU C 1 230 ? 37.617 63.781 52.355  1.00 120.36 ? 456  GLU C CB  1 
ATOM   5623 C CG  . GLU C 1 230 ? 38.430 64.590 53.340  1.00 119.75 ? 456  GLU C CG  1 
ATOM   5624 C CD  . GLU C 1 230 ? 37.984 66.031 53.380  1.00 120.39 ? 456  GLU C CD  1 
ATOM   5625 O OE1 . GLU C 1 230 ? 36.826 66.288 53.772  1.00 120.81 ? 456  GLU C OE1 1 
ATOM   5626 O OE2 . GLU C 1 230 ? 38.792 66.907 53.011  1.00 121.22 ? 456  GLU C OE2 1 
ATOM   5627 N N   . ALA C 1 231 ? 37.094 60.657 50.644  1.00 125.30 ? 457  ALA C N   1 
ATOM   5628 C CA  . ALA C 1 231 ? 36.277 60.125 49.543  1.00 127.25 ? 457  ALA C CA  1 
ATOM   5629 C C   . ALA C 1 231 ? 35.535 58.816 49.813  1.00 128.69 ? 457  ALA C C   1 
ATOM   5630 O O   . ALA C 1 231 ? 36.146 57.741 49.845  1.00 128.20 ? 457  ALA C O   1 
ATOM   5631 C CB  . ALA C 1 231 ? 37.136 59.970 48.282  1.00 126.83 ? 457  ALA C CB  1 
ATOM   5632 N N   . PRO C 1 232 ? 34.197 58.897 49.995  1.00 130.36 ? 458  PRO C N   1 
ATOM   5633 C CA  . PRO C 1 232 ? 33.280 57.778 50.263  1.00 130.53 ? 458  PRO C CA  1 
ATOM   5634 C C   . PRO C 1 232 ? 33.197 56.770 49.112  1.00 130.32 ? 458  PRO C C   1 
ATOM   5635 O O   . PRO C 1 232 ? 33.856 56.989 48.067  1.00 129.99 ? 458  PRO C O   1 
ATOM   5636 C CB  . PRO C 1 232 ? 31.936 58.475 50.504  1.00 130.63 ? 458  PRO C CB  1 
ATOM   5637 C CG  . PRO C 1 232 ? 32.336 59.804 51.065  1.00 130.71 ? 458  PRO C CG  1 
ATOM   5638 C CD  . PRO C 1 232 ? 33.494 60.184 50.163  1.00 130.92 ? 458  PRO C CD  1 
ATOM   5639 N N   . PRO D 2 1   ? 50.610 66.803 6.471   1.00 173.34 ? 103  PRO D N   1 
ATOM   5640 C CA  . PRO D 2 1   ? 50.004 65.456 6.344   1.00 173.45 ? 103  PRO D CA  1 
ATOM   5641 C C   . PRO D 2 1   ? 51.060 64.342 6.299   1.00 173.42 ? 103  PRO D C   1 
ATOM   5642 O O   . PRO D 2 1   ? 52.047 64.442 5.567   1.00 174.01 ? 103  PRO D O   1 
ATOM   5643 C CB  . PRO D 2 1   ? 49.172 65.474 5.067   1.00 173.24 ? 103  PRO D CB  1 
ATOM   5644 C CG  . PRO D 2 1   ? 48.808 66.949 4.970   1.00 173.15 ? 103  PRO D CG  1 
ATOM   5645 C CD  . PRO D 2 1   ? 50.079 67.691 5.421   1.00 173.28 ? 103  PRO D CD  1 
ATOM   5646 N N   . VAL D 2 2   ? 50.847 63.289 7.089   1.00 172.80 ? 104  VAL D N   1 
ATOM   5647 C CA  . VAL D 2 2   ? 51.769 62.150 7.141   1.00 171.63 ? 104  VAL D CA  1 
ATOM   5648 C C   . VAL D 2 2   ? 51.146 60.915 6.479   1.00 171.09 ? 104  VAL D C   1 
ATOM   5649 O O   . VAL D 2 2   ? 49.940 60.679 6.600   1.00 171.40 ? 104  VAL D O   1 
ATOM   5650 C CB  . VAL D 2 2   ? 52.141 61.793 8.601   1.00 171.37 ? 104  VAL D CB  1 
ATOM   5651 C CG1 . VAL D 2 2   ? 52.974 62.903 9.223   1.00 170.99 ? 104  VAL D CG1 1 
ATOM   5652 C CG2 . VAL D 2 2   ? 50.883 61.564 9.409   1.00 170.88 ? 104  VAL D CG2 1 
ATOM   5653 N N   . GLN D 2 3   ? 51.976 60.131 5.787   1.00 169.82 ? 105  GLN D N   1 
ATOM   5654 C CA  . GLN D 2 3   ? 51.523 58.922 5.086   1.00 168.48 ? 105  GLN D CA  1 
ATOM   5655 C C   . GLN D 2 3   ? 50.923 57.832 5.984   1.00 166.35 ? 105  GLN D C   1 
ATOM   5656 O O   . GLN D 2 3   ? 50.748 58.011 7.193   1.00 166.70 ? 105  GLN D O   1 
ATOM   5657 C CB  . GLN D 2 3   ? 52.678 58.290 4.286   1.00 170.06 ? 105  GLN D CB  1 
ATOM   5658 C CG  . GLN D 2 3   ? 53.160 59.062 3.058   1.00 171.96 ? 105  GLN D CG  1 
ATOM   5659 C CD  . GLN D 2 3   ? 54.158 58.262 2.215   1.00 172.88 ? 105  GLN D CD  1 
ATOM   5660 O OE1 . GLN D 2 3   ? 54.731 58.779 1.252   1.00 173.32 ? 105  GLN D OE1 1 
ATOM   5661 N NE2 . GLN D 2 3   ? 54.362 56.995 2.574   1.00 173.06 ? 105  GLN D NE2 1 
ATOM   5662 N N   . LEU D 2 4   ? 50.611 56.701 5.354   1.00 162.94 ? 106  LEU D N   1 
ATOM   5663 C CA  . LEU D 2 4   ? 50.055 55.521 6.012   1.00 158.71 ? 106  LEU D CA  1 
ATOM   5664 C C   . LEU D 2 4   ? 50.480 54.322 5.154   1.00 155.68 ? 106  LEU D C   1 
ATOM   5665 O O   . LEU D 2 4   ? 49.820 53.987 4.172   1.00 155.30 ? 106  LEU D O   1 
ATOM   5666 C CB  . LEU D 2 4   ? 48.517 55.613 6.094   1.00 158.37 ? 106  LEU D CB  1 
ATOM   5667 C CG  . LEU D 2 4   ? 47.857 56.486 7.178   1.00 157.23 ? 106  LEU D CG  1 
ATOM   5668 C CD1 . LEU D 2 4   ? 46.425 56.818 6.791   1.00 156.49 ? 106  LEU D CD1 1 
ATOM   5669 C CD2 . LEU D 2 4   ? 47.893 55.762 8.513   1.00 156.43 ? 106  LEU D CD2 1 
ATOM   5670 N N   . SER D 2 5   ? 51.601 53.700 5.515   1.00 152.18 ? 107  SER D N   1 
ATOM   5671 C CA  . SER D 2 5   ? 52.128 52.547 4.787   1.00 148.67 ? 107  SER D CA  1 
ATOM   5672 C C   . SER D 2 5   ? 51.064 51.470 4.647   1.00 146.13 ? 107  SER D C   1 
ATOM   5673 O O   . SER D 2 5   ? 49.972 51.611 5.179   1.00 145.77 ? 107  SER D O   1 
ATOM   5674 C CB  . SER D 2 5   ? 53.329 51.963 5.529   1.00 148.86 ? 107  SER D CB  1 
ATOM   5675 O OG  . SER D 2 5   ? 52.952 51.522 6.825   1.00 148.11 ? 107  SER D OG  1 
ATOM   5676 N N   . LYS D 2 6   ? 51.385 50.386 3.949   1.00 143.45 ? 108  LYS D N   1 
ATOM   5677 C CA  . LYS D 2 6   ? 50.425 49.299 3.771   1.00 140.85 ? 108  LYS D CA  1 
ATOM   5678 C C   . LYS D 2 6   ? 50.116 48.575 5.088   1.00 139.69 ? 108  LYS D C   1 
ATOM   5679 O O   . LYS D 2 6   ? 49.214 47.737 5.139   1.00 139.45 ? 108  LYS D O   1 
ATOM   5680 C CB  . LYS D 2 6   ? 50.942 48.296 2.735   1.00 140.19 ? 108  LYS D CB  1 
ATOM   5681 C CG  . LYS D 2 6   ? 49.923 47.237 2.326   1.00 139.48 ? 108  LYS D CG  1 
ATOM   5682 C CD  . LYS D 2 6   ? 48.683 47.858 1.690   1.00 138.60 ? 108  LYS D CD  1 
ATOM   5683 C CE  . LYS D 2 6   ? 48.975 48.452 0.318   1.00 137.88 ? 108  LYS D CE  1 
ATOM   5684 N NZ  . LYS D 2 6   ? 49.347 47.411 -0.680  1.00 137.47 ? 108  LYS D NZ  1 
ATOM   5685 N N   . GLU D 2 7   ? 50.866 48.897 6.144   1.00 138.33 ? 109  GLU D N   1 
ATOM   5686 C CA  . GLU D 2 7   ? 50.663 48.299 7.467   1.00 136.70 ? 109  GLU D CA  1 
ATOM   5687 C C   . GLU D 2 7   ? 49.571 49.030 8.241   1.00 135.25 ? 109  GLU D C   1 
ATOM   5688 O O   . GLU D 2 7   ? 48.654 48.414 8.783   1.00 135.18 ? 109  GLU D O   1 
ATOM   5689 C CB  . GLU D 2 7   ? 51.955 48.338 8.288   1.00 136.80 ? 109  GLU D CB  1 
ATOM   5690 C CG  . GLU D 2 7   ? 53.005 47.335 7.855   1.00 137.52 ? 109  GLU D CG  1 
ATOM   5691 C CD  . GLU D 2 7   ? 54.086 47.136 8.903   1.00 138.17 ? 109  GLU D CD  1 
ATOM   5692 O OE1 . GLU D 2 7   ? 54.779 48.119 9.241   1.00 138.35 ? 109  GLU D OE1 1 
ATOM   5693 O OE2 . GLU D 2 7   ? 54.239 45.996 9.392   1.00 138.37 ? 109  GLU D OE2 1 
ATOM   5694 N N   . GLN D 2 8   ? 49.685 50.352 8.293   1.00 133.58 ? 110  GLN D N   1 
ATOM   5695 C CA  . GLN D 2 8   ? 48.712 51.189 8.985   1.00 131.67 ? 110  GLN D CA  1 
ATOM   5696 C C   . GLN D 2 8   ? 47.391 51.209 8.211   1.00 131.35 ? 110  GLN D C   1 
ATOM   5697 O O   . GLN D 2 8   ? 46.335 51.478 8.779   1.00 131.03 ? 110  GLN D O   1 
ATOM   5698 C CB  . GLN D 2 8   ? 49.285 52.599 9.125   1.00 129.81 ? 110  GLN D CB  1 
ATOM   5699 C CG  . GLN D 2 8   ? 50.761 52.571 9.498   1.00 126.74 ? 110  GLN D CG  1 
ATOM   5700 C CD  . GLN D 2 8   ? 51.359 53.939 9.679   1.00 124.78 ? 110  GLN D CD  1 
ATOM   5701 O OE1 . GLN D 2 8   ? 51.245 54.802 8.810   1.00 123.07 ? 110  GLN D OE1 1 
ATOM   5702 N NE2 . GLN D 2 8   ? 52.014 54.145 10.811  1.00 124.03 ? 110  GLN D NE2 1 
ATOM   5703 N N   . GLU D 2 9   ? 47.466 50.922 6.912   1.00 131.59 ? 111  GLU D N   1 
ATOM   5704 C CA  . GLU D 2 9   ? 46.292 50.875 6.041   1.00 131.59 ? 111  GLU D CA  1 
ATOM   5705 C C   . GLU D 2 9   ? 45.501 49.609 6.343   1.00 130.28 ? 111  GLU D C   1 
ATOM   5706 O O   . GLU D 2 9   ? 44.280 49.647 6.495   1.00 130.50 ? 111  GLU D O   1 
ATOM   5707 C CB  . GLU D 2 9   ? 46.709 50.865 4.562   1.00 133.70 ? 111  GLU D CB  1 
ATOM   5708 C CG  . GLU D 2 9   ? 47.423 52.127 4.075   1.00 137.02 ? 111  GLU D CG  1 
ATOM   5709 C CD  . GLU D 2 9   ? 46.566 53.383 4.182   1.00 138.60 ? 111  GLU D CD  1 
ATOM   5710 O OE1 . GLU D 2 9   ? 46.223 53.962 3.126   1.00 139.52 ? 111  GLU D OE1 1 
ATOM   5711 O OE2 . GLU D 2 9   ? 46.241 53.791 5.322   1.00 139.57 ? 111  GLU D OE2 1 
ATOM   5712 N N   . GLU D 2 10  ? 46.204 48.483 6.417   1.00 128.67 ? 112  GLU D N   1 
ATOM   5713 C CA  . GLU D 2 10  ? 45.565 47.209 6.720   1.00 127.39 ? 112  GLU D CA  1 
ATOM   5714 C C   . GLU D 2 10  ? 44.995 47.228 8.148   1.00 125.97 ? 112  GLU D C   1 
ATOM   5715 O O   . GLU D 2 10  ? 44.021 46.533 8.454   1.00 125.94 ? 112  GLU D O   1 
ATOM   5716 C CB  . GLU D 2 10  ? 46.573 46.070 6.564   1.00 128.20 ? 112  GLU D CB  1 
ATOM   5717 C CG  . GLU D 2 10  ? 45.978 44.691 6.798   1.00 130.18 ? 112  GLU D CG  1 
ATOM   5718 C CD  . GLU D 2 10  ? 44.778 44.418 5.909   1.00 131.13 ? 112  GLU D CD  1 
ATOM   5719 O OE1 . GLU D 2 10  ? 44.927 44.530 4.676   1.00 131.32 ? 112  GLU D OE1 1 
ATOM   5720 O OE2 . GLU D 2 10  ? 43.690 44.092 6.439   1.00 132.39 ? 112  GLU D OE2 1 
ATOM   5721 N N   . LEU D 2 11  ? 45.610 48.030 9.016   1.00 123.39 ? 113  LEU D N   1 
ATOM   5722 C CA  . LEU D 2 11  ? 45.168 48.169 10.399  1.00 120.18 ? 113  LEU D CA  1 
ATOM   5723 C C   . LEU D 2 11  ? 43.769 48.793 10.417  1.00 117.82 ? 113  LEU D C   1 
ATOM   5724 O O   . LEU D 2 11  ? 42.795 48.132 10.769  1.00 117.68 ? 113  LEU D O   1 
ATOM   5725 C CB  . LEU D 2 11  ? 46.167 49.046 11.173  1.00 119.99 ? 113  LEU D CB  1 
ATOM   5726 C CG  . LEU D 2 11  ? 45.954 49.380 12.658  1.00 119.18 ? 113  LEU D CG  1 
ATOM   5727 C CD1 . LEU D 2 11  ? 45.555 48.136 13.429  1.00 118.04 ? 113  LEU D CD1 1 
ATOM   5728 C CD2 . LEU D 2 11  ? 47.235 49.981 13.225  1.00 117.64 ? 113  LEU D CD2 1 
ATOM   5729 N N   . ILE D 2 12  ? 43.676 50.058 10.014  1.00 114.82 ? 114  ILE D N   1 
ATOM   5730 C CA  . ILE D 2 12  ? 42.406 50.780 9.975   1.00 111.86 ? 114  ILE D CA  1 
ATOM   5731 C C   . ILE D 2 12  ? 41.335 50.031 9.179   1.00 109.94 ? 114  ILE D C   1 
ATOM   5732 O O   . ILE D 2 12  ? 40.143 50.161 9.448   1.00 108.47 ? 114  ILE D O   1 
ATOM   5733 C CB  . ILE D 2 12  ? 42.596 52.185 9.360   1.00 112.05 ? 114  ILE D CB  1 
ATOM   5734 C CG1 . ILE D 2 12  ? 43.645 52.966 10.159  1.00 111.88 ? 114  ILE D CG1 1 
ATOM   5735 C CG2 . ILE D 2 12  ? 41.271 52.935 9.348   1.00 112.57 ? 114  ILE D CG2 1 
ATOM   5736 C CD1 . ILE D 2 12  ? 43.952 54.348 9.609   1.00 111.05 ? 114  ILE D CD1 1 
ATOM   5737 N N   . ARG D 2 13  ? 41.766 49.254 8.193   1.00 109.20 ? 115  ARG D N   1 
ATOM   5738 C CA  . ARG D 2 13  ? 40.854 48.472 7.363   1.00 108.89 ? 115  ARG D CA  1 
ATOM   5739 C C   . ARG D 2 13  ? 40.259 47.336 8.211   1.00 107.67 ? 115  ARG D C   1 
ATOM   5740 O O   . ARG D 2 13  ? 39.041 47.149 8.250   1.00 107.33 ? 115  ARG D O   1 
ATOM   5741 C CB  . ARG D 2 13  ? 41.620 47.907 6.154   1.00 109.60 ? 115  ARG D CB  1 
ATOM   5742 C CG  . ARG D 2 13  ? 40.780 47.204 5.081   1.00 111.13 ? 115  ARG D CG  1 
ATOM   5743 C CD  . ARG D 2 13  ? 39.871 48.165 4.315   1.00 112.69 ? 115  ARG D CD  1 
ATOM   5744 N NE  . ARG D 2 13  ? 39.416 47.617 3.032   1.00 115.42 ? 115  ARG D NE  1 
ATOM   5745 C CZ  . ARG D 2 13  ? 38.528 46.633 2.880   1.00 116.00 ? 115  ARG D CZ  1 
ATOM   5746 N NH1 . ARG D 2 13  ? 37.965 46.058 3.936   1.00 115.87 ? 115  ARG D NH1 1 
ATOM   5747 N NH2 . ARG D 2 13  ? 38.199 46.223 1.660   1.00 115.58 ? 115  ARG D NH2 1 
ATOM   5748 N N   . THR D 2 14  ? 41.125 46.591 8.895   1.00 105.68 ? 116  THR D N   1 
ATOM   5749 C CA  . THR D 2 14  ? 40.693 45.485 9.742   1.00 103.57 ? 116  THR D CA  1 
ATOM   5750 C C   . THR D 2 14  ? 39.804 45.978 10.892  1.00 103.30 ? 116  THR D C   1 
ATOM   5751 O O   . THR D 2 14  ? 38.745 45.404 11.152  1.00 103.60 ? 116  THR D O   1 
ATOM   5752 C CB  . THR D 2 14  ? 41.910 44.736 10.317  1.00 102.48 ? 116  THR D CB  1 
ATOM   5753 O OG1 . THR D 2 14  ? 42.771 44.339 9.244   1.00 101.38 ? 116  THR D OG1 1 
ATOM   5754 C CG2 . THR D 2 14  ? 41.467 43.496 11.075  1.00 102.03 ? 116  THR D CG2 1 
ATOM   5755 N N   . LEU D 2 15  ? 40.239 47.041 11.572  1.00 102.09 ? 117  LEU D N   1 
ATOM   5756 C CA  . LEU D 2 15  ? 39.484 47.632 12.683  1.00 99.69  ? 117  LEU D CA  1 
ATOM   5757 C C   . LEU D 2 15  ? 38.106 48.093 12.239  1.00 99.71  ? 117  LEU D C   1 
ATOM   5758 O O   . LEU D 2 15  ? 37.102 47.638 12.779  1.00 99.70  ? 117  LEU D O   1 
ATOM   5759 C CB  . LEU D 2 15  ? 40.225 48.827 13.274  1.00 96.58  ? 117  LEU D CB  1 
ATOM   5760 C CG  . LEU D 2 15  ? 41.395 48.471 14.165  1.00 93.45  ? 117  LEU D CG  1 
ATOM   5761 C CD1 . LEU D 2 15  ? 41.845 49.695 14.928  1.00 92.63  ? 117  LEU D CD1 1 
ATOM   5762 C CD2 . LEU D 2 15  ? 40.948 47.377 15.102  1.00 91.47  ? 117  LEU D CD2 1 
ATOM   5763 N N   . LEU D 2 16  ? 38.061 49.014 11.274  1.00 99.00  ? 118  LEU D N   1 
ATOM   5764 C CA  . LEU D 2 16  ? 36.784 49.501 10.760  1.00 97.88  ? 118  LEU D CA  1 
ATOM   5765 C C   . LEU D 2 16  ? 36.024 48.330 10.134  1.00 98.03  ? 118  LEU D C   1 
ATOM   5766 O O   . LEU D 2 16  ? 34.794 48.341 10.057  1.00 98.81  ? 118  LEU D O   1 
ATOM   5767 C CB  . LEU D 2 16  ? 36.987 50.628 9.732   1.00 95.49  ? 118  LEU D CB  1 
ATOM   5768 C CG  . LEU D 2 16  ? 36.858 52.052 10.290  1.00 93.28  ? 118  LEU D CG  1 
ATOM   5769 C CD1 . LEU D 2 16  ? 37.987 52.329 11.247  1.00 93.35  ? 118  LEU D CD1 1 
ATOM   5770 C CD2 . LEU D 2 16  ? 36.886 53.060 9.168   1.00 92.65  ? 118  LEU D CD2 1 
ATOM   5771 N N   . GLY D 2 17  ? 36.761 47.316 9.691   1.00 97.47  ? 119  GLY D N   1 
ATOM   5772 C CA  . GLY D 2 17  ? 36.120 46.152 9.125   1.00 97.63  ? 119  GLY D CA  1 
ATOM   5773 C C   . GLY D 2 17  ? 35.281 45.528 10.223  1.00 98.41  ? 119  GLY D C   1 
ATOM   5774 O O   . GLY D 2 17  ? 34.058 45.449 10.102  1.00 98.85  ? 119  GLY D O   1 
ATOM   5775 N N   . ALA D 2 18  ? 35.941 45.116 11.306  1.00 98.65  ? 120  ALA D N   1 
ATOM   5776 C CA  . ALA D 2 18  ? 35.288 44.481 12.456  1.00 98.78  ? 120  ALA D CA  1 
ATOM   5777 C C   . ALA D 2 18  ? 34.413 45.411 13.303  1.00 98.96  ? 120  ALA D C   1 
ATOM   5778 O O   . ALA D 2 18  ? 33.495 44.954 13.981  1.00 98.74  ? 120  ALA D O   1 
ATOM   5779 C CB  . ALA D 2 18  ? 36.338 43.824 13.346  1.00 97.67  ? 120  ALA D CB  1 
ATOM   5780 N N   . HIS D 2 19  ? 34.700 46.707 13.274  1.00 99.34  ? 121  HIS D N   1 
ATOM   5781 C CA  . HIS D 2 19  ? 33.928 47.674 14.042  1.00 99.12  ? 121  HIS D CA  1 
ATOM   5782 C C   . HIS D 2 19  ? 32.561 47.950 13.438  1.00 100.13 ? 121  HIS D C   1 
ATOM   5783 O O   . HIS D 2 19  ? 31.574 48.003 14.162  1.00 100.87 ? 121  HIS D O   1 
ATOM   5784 C CB  . HIS D 2 19  ? 34.686 48.989 14.177  1.00 98.32  ? 121  HIS D CB  1 
ATOM   5785 C CG  . HIS D 2 19  ? 33.789 50.177 14.321  1.00 97.90  ? 121  HIS D CG  1 
ATOM   5786 N ND1 . HIS D 2 19  ? 33.609 51.100 13.313  1.00 98.15  ? 121  HIS D ND1 1 
ATOM   5787 C CD2 . HIS D 2 19  ? 32.989 50.571 15.339  1.00 97.55  ? 121  HIS D CD2 1 
ATOM   5788 C CE1 . HIS D 2 19  ? 32.736 52.011 13.704  1.00 98.18  ? 121  HIS D CE1 1 
ATOM   5789 N NE2 . HIS D 2 19  ? 32.344 51.713 14.930  1.00 97.41  ? 121  HIS D NE2 1 
ATOM   5790 N N   . THR D 2 20  ? 32.498 48.144 12.121  1.00 101.13 ? 122  THR D N   1 
ATOM   5791 C CA  . THR D 2 20  ? 31.217 48.397 11.469  1.00 101.59 ? 122  THR D CA  1 
ATOM   5792 C C   . THR D 2 20  ? 30.404 47.117 11.486  1.00 103.36 ? 122  THR D C   1 
ATOM   5793 O O   . THR D 2 20  ? 29.173 47.155 11.467  1.00 104.20 ? 122  THR D O   1 
ATOM   5794 C CB  . THR D 2 20  ? 31.372 48.815 10.013  1.00 100.52 ? 122  THR D CB  1 
ATOM   5795 O OG1 . THR D 2 20  ? 32.324 49.878 9.916   1.00 100.24 ? 122  THR D OG1 1 
ATOM   5796 C CG2 . THR D 2 20  ? 30.033 49.297 9.477   1.00 100.55 ? 122  THR D CG2 1 
ATOM   5797 N N   . ARG D 2 21  ? 31.109 45.986 11.510  1.00 105.05 ? 123  ARG D N   1 
ATOM   5798 C CA  . ARG D 2 21  ? 30.490 44.667 11.551  1.00 106.45 ? 123  ARG D CA  1 
ATOM   5799 C C   . ARG D 2 21  ? 29.637 44.456 12.806  1.00 106.30 ? 123  ARG D C   1 
ATOM   5800 O O   . ARG D 2 21  ? 28.491 44.013 12.719  1.00 106.20 ? 123  ARG D O   1 
ATOM   5801 C CB  . ARG D 2 21  ? 31.563 43.566 11.504  1.00 107.96 ? 123  ARG D CB  1 
ATOM   5802 C CG  . ARG D 2 21  ? 32.158 43.291 10.137  1.00 111.34 ? 123  ARG D CG  1 
ATOM   5803 C CD  . ARG D 2 21  ? 32.986 41.998 10.136  1.00 114.65 ? 123  ARG D CD  1 
ATOM   5804 N NE  . ARG D 2 21  ? 33.275 41.534 8.775   1.00 118.77 ? 123  ARG D NE  1 
ATOM   5805 C CZ  . ARG D 2 21  ? 34.273 41.979 8.011   1.00 120.49 ? 123  ARG D CZ  1 
ATOM   5806 N NH1 . ARG D 2 21  ? 35.109 42.904 8.467   1.00 121.77 ? 123  ARG D NH1 1 
ATOM   5807 N NH2 . ARG D 2 21  ? 34.422 41.515 6.772   1.00 121.04 ? 123  ARG D NH2 1 
ATOM   5808 N N   . HIS D 2 22  ? 30.193 44.784 13.970  1.00 105.81 ? 124  HIS D N   1 
ATOM   5809 C CA  . HIS D 2 22  ? 29.493 44.573 15.232  1.00 105.58 ? 124  HIS D CA  1 
ATOM   5810 C C   . HIS D 2 22  ? 28.955 45.804 15.940  1.00 104.51 ? 124  HIS D C   1 
ATOM   5811 O O   . HIS D 2 22  ? 27.766 45.895 16.242  1.00 105.19 ? 124  HIS D O   1 
ATOM   5812 C CB  . HIS D 2 22  ? 30.400 43.820 16.207  1.00 107.22 ? 124  HIS D CB  1 
ATOM   5813 C CG  . HIS D 2 22  ? 30.887 42.503 15.689  1.00 108.71 ? 124  HIS D CG  1 
ATOM   5814 N ND1 . HIS D 2 22  ? 31.945 42.390 14.813  1.00 109.09 ? 124  HIS D ND1 1 
ATOM   5815 C CD2 . HIS D 2 22  ? 30.452 41.241 15.919  1.00 109.28 ? 124  HIS D CD2 1 
ATOM   5816 C CE1 . HIS D 2 22  ? 32.144 41.116 14.527  1.00 109.70 ? 124  HIS D CE1 1 
ATOM   5817 N NE2 . HIS D 2 22  ? 31.251 40.398 15.185  1.00 110.12 ? 124  HIS D NE2 1 
ATOM   5818 N N   . MET D 2 23  ? 29.836 46.746 16.225  1.00 103.15 ? 125  MET D N   1 
ATOM   5819 C CA  . MET D 2 23  ? 29.431 47.942 16.929  1.00 102.12 ? 125  MET D CA  1 
ATOM   5820 C C   . MET D 2 23  ? 29.143 49.076 15.967  1.00 101.37 ? 125  MET D C   1 
ATOM   5821 O O   . MET D 2 23  ? 29.277 48.920 14.759  1.00 101.27 ? 125  MET D O   1 
ATOM   5822 C CB  . MET D 2 23  ? 30.524 48.319 17.916  1.00 102.98 ? 125  MET D CB  1 
ATOM   5823 C CG  . MET D 2 23  ? 31.101 47.096 18.616  1.00 103.45 ? 125  MET D CG  1 
ATOM   5824 S SD  . MET D 2 23  ? 32.245 47.497 19.933  1.00 104.51 ? 125  MET D SD  1 
ATOM   5825 C CE  . MET D 2 23  ? 33.169 48.809 19.161  1.00 103.59 ? 125  MET D CE  1 
ATOM   5826 N N   . GLY D 2 24  ? 28.736 50.220 16.500  1.00 101.23 ? 126  GLY D N   1 
ATOM   5827 C CA  . GLY D 2 24  ? 28.409 51.345 15.643  1.00 101.24 ? 126  GLY D CA  1 
ATOM   5828 C C   . GLY D 2 24  ? 27.030 51.168 15.021  1.00 101.54 ? 126  GLY D C   1 
ATOM   5829 O O   . GLY D 2 24  ? 26.326 52.146 14.756  1.00 102.35 ? 126  GLY D O   1 
ATOM   5830 N N   . THR D 2 25  ? 26.643 49.914 14.794  1.00 100.67 ? 127  THR D N   1 
ATOM   5831 C CA  . THR D 2 25  ? 25.353 49.571 14.205  1.00 99.69  ? 127  THR D CA  1 
ATOM   5832 C C   . THR D 2 25  ? 24.393 49.002 15.260  1.00 99.52  ? 127  THR D C   1 
ATOM   5833 O O   . THR D 2 25  ? 23.248 48.660 14.957  1.00 99.21  ? 127  THR D O   1 
ATOM   5834 C CB  . THR D 2 25  ? 25.544 48.520 13.095  1.00 99.47  ? 127  THR D CB  1 
ATOM   5835 O OG1 . THR D 2 25  ? 26.071 47.316 13.666  1.00 97.47  ? 127  THR D OG1 1 
ATOM   5836 C CG2 . THR D 2 25  ? 26.524 49.033 12.034  1.00 99.39  ? 127  THR D CG2 1 
ATOM   5837 N N   . MET D 2 26  ? 24.868 48.923 16.500  1.00 99.33  ? 128  MET D N   1 
ATOM   5838 C CA  . MET D 2 26  ? 24.103 48.377 17.619  1.00 99.31  ? 128  MET D CA  1 
ATOM   5839 C C   . MET D 2 26  ? 23.294 49.375 18.443  1.00 98.85  ? 128  MET D C   1 
ATOM   5840 O O   . MET D 2 26  ? 22.560 48.979 19.348  1.00 98.64  ? 128  MET D O   1 
ATOM   5841 C CB  . MET D 2 26  ? 25.050 47.626 18.560  1.00 99.85  ? 128  MET D CB  1 
ATOM   5842 C CG  . MET D 2 26  ? 26.332 48.388 18.872  1.00 100.76 ? 128  MET D CG  1 
ATOM   5843 S SD  . MET D 2 26  ? 26.943 48.123 20.548  1.00 101.66 ? 128  MET D SD  1 
ATOM   5844 C CE  . MET D 2 26  ? 27.117 49.814 21.109  1.00 99.19  ? 128  MET D CE  1 
ATOM   5845 N N   . PHE D 2 27  ? 23.415 50.661 18.149  1.00 98.51  ? 129  PHE D N   1 
ATOM   5846 C CA  . PHE D 2 27  ? 22.683 51.649 18.924  1.00 99.08  ? 129  PHE D CA  1 
ATOM   5847 C C   . PHE D 2 27  ? 21.201 51.692 18.588  1.00 99.79  ? 129  PHE D C   1 
ATOM   5848 O O   . PHE D 2 27  ? 20.364 51.921 19.460  1.00 100.02 ? 129  PHE D O   1 
ATOM   5849 C CB  . PHE D 2 27  ? 23.324 53.025 18.752  1.00 98.98  ? 129  PHE D CB  1 
ATOM   5850 C CG  . PHE D 2 27  ? 24.731 53.092 19.275  1.00 100.55 ? 129  PHE D CG  1 
ATOM   5851 C CD1 . PHE D 2 27  ? 25.797 52.630 18.512  1.00 101.36 ? 129  PHE D CD1 1 
ATOM   5852 C CD2 . PHE D 2 27  ? 24.986 53.557 20.556  1.00 100.32 ? 129  PHE D CD2 1 
ATOM   5853 C CE1 . PHE D 2 27  ? 27.087 52.628 19.020  1.00 100.76 ? 129  PHE D CE1 1 
ATOM   5854 C CE2 . PHE D 2 27  ? 26.273 53.556 21.065  1.00 99.92  ? 129  PHE D CE2 1 
ATOM   5855 C CZ  . PHE D 2 27  ? 27.323 53.092 20.298  1.00 100.32 ? 129  PHE D CZ  1 
ATOM   5856 N N   . GLU D 2 28  ? 20.880 51.445 17.323  1.00 101.01 ? 130  GLU D N   1 
ATOM   5857 C CA  . GLU D 2 28  ? 19.494 51.443 16.857  1.00 101.87 ? 130  GLU D CA  1 
ATOM   5858 C C   . GLU D 2 28  ? 18.790 50.168 17.328  1.00 100.29 ? 130  GLU D C   1 
ATOM   5859 O O   . GLU D 2 28  ? 17.561 50.123 17.425  1.00 100.72 ? 130  GLU D O   1 
ATOM   5860 C CB  . GLU D 2 28  ? 19.444 51.520 15.320  1.00 104.31 ? 130  GLU D CB  1 
ATOM   5861 C CG  . GLU D 2 28  ? 20.179 52.717 14.702  1.00 107.73 ? 130  GLU D CG  1 
ATOM   5862 C CD  . GLU D 2 28  ? 21.689 52.676 14.943  1.00 109.90 ? 130  GLU D CD  1 
ATOM   5863 O OE1 . GLU D 2 28  ? 22.321 51.656 14.586  1.00 110.52 ? 130  GLU D OE1 1 
ATOM   5864 O OE2 . GLU D 2 28  ? 22.242 53.658 15.495  1.00 110.48 ? 130  GLU D OE2 1 
ATOM   5865 N N   . GLN D 2 29  ? 19.589 49.142 17.622  1.00 97.75  ? 131  GLN D N   1 
ATOM   5866 C CA  . GLN D 2 29  ? 19.095 47.848 18.081  1.00 94.62  ? 131  GLN D CA  1 
ATOM   5867 C C   . GLN D 2 29  ? 18.794 47.778 19.577  1.00 92.23  ? 131  GLN D C   1 
ATOM   5868 O O   . GLN D 2 29  ? 18.532 46.699 20.112  1.00 90.22  ? 131  GLN D O   1 
ATOM   5869 C CB  . GLN D 2 29  ? 20.096 46.761 17.709  1.00 95.23  ? 131  GLN D CB  1 
ATOM   5870 C CG  . GLN D 2 29  ? 20.389 46.723 16.227  1.00 97.89  ? 131  GLN D CG  1 
ATOM   5871 C CD  . GLN D 2 29  ? 21.183 45.505 15.816  1.00 99.02  ? 131  GLN D CD  1 
ATOM   5872 O OE1 . GLN D 2 29  ? 22.338 45.331 16.215  1.00 99.96  ? 131  GLN D OE1 1 
ATOM   5873 N NE2 . GLN D 2 29  ? 20.564 44.646 15.013  1.00 99.41  ? 131  GLN D NE2 1 
ATOM   5874 N N   . PHE D 2 30  ? 18.843 48.925 20.248  1.00 90.29  ? 132  PHE D N   1 
ATOM   5875 C CA  . PHE D 2 30  ? 18.538 48.978 21.671  1.00 88.68  ? 132  PHE D CA  1 
ATOM   5876 C C   . PHE D 2 30  ? 17.039 48.797 21.841  1.00 88.53  ? 132  PHE D C   1 
ATOM   5877 O O   . PHE D 2 30  ? 16.570 48.190 22.806  1.00 88.83  ? 132  PHE D O   1 
ATOM   5878 C CB  . PHE D 2 30  ? 18.957 50.318 22.270  1.00 86.40  ? 132  PHE D CB  1 
ATOM   5879 C CG  . PHE D 2 30  ? 20.432 50.465 22.434  1.00 84.00  ? 132  PHE D CG  1 
ATOM   5880 C CD1 . PHE D 2 30  ? 21.250 49.348 22.464  1.00 83.36  ? 132  PHE D CD1 1 
ATOM   5881 C CD2 . PHE D 2 30  ? 20.999 51.713 22.588  1.00 82.01  ? 132  PHE D CD2 1 
ATOM   5882 C CE1 . PHE D 2 30  ? 22.600 49.473 22.644  1.00 81.93  ? 132  PHE D CE1 1 
ATOM   5883 C CE2 . PHE D 2 30  ? 22.346 51.846 22.769  1.00 81.53  ? 132  PHE D CE2 1 
ATOM   5884 C CZ  . PHE D 2 30  ? 23.151 50.724 22.797  1.00 82.11  ? 132  PHE D CZ  1 
ATOM   5885 N N   . VAL D 2 31  ? 16.290 49.336 20.891  1.00 88.01  ? 133  VAL D N   1 
ATOM   5886 C CA  . VAL D 2 31  ? 14.846 49.228 20.903  1.00 87.41  ? 133  VAL D CA  1 
ATOM   5887 C C   . VAL D 2 31  ? 14.437 47.787 21.250  1.00 88.16  ? 133  VAL D C   1 
ATOM   5888 O O   . VAL D 2 31  ? 13.463 47.552 21.973  1.00 88.48  ? 133  VAL D O   1 
ATOM   5889 C CB  . VAL D 2 31  ? 14.269 49.625 19.509  1.00 86.47  ? 133  VAL D CB  1 
ATOM   5890 C CG1 . VAL D 2 31  ? 14.742 51.021 19.135  1.00 85.16  ? 133  VAL D CG1 1 
ATOM   5891 C CG2 . VAL D 2 31  ? 14.699 48.622 18.434  1.00 84.14  ? 133  VAL D CG2 1 
ATOM   5892 N N   . GLN D 2 32  ? 15.217 46.834 20.751  1.00 87.79  ? 134  GLN D N   1 
ATOM   5893 C CA  . GLN D 2 32  ? 14.980 45.412 20.933  1.00 87.90  ? 134  GLN D CA  1 
ATOM   5894 C C   . GLN D 2 32  ? 15.163 44.839 22.339  1.00 86.57  ? 134  GLN D C   1 
ATOM   5895 O O   . GLN D 2 32  ? 15.287 43.622 22.502  1.00 85.01  ? 134  GLN D O   1 
ATOM   5896 C CB  . GLN D 2 32  ? 15.870 44.672 19.946  1.00 90.68  ? 134  GLN D CB  1 
ATOM   5897 C CG  . GLN D 2 32  ? 15.515 44.970 18.489  1.00 95.92  ? 134  GLN D CG  1 
ATOM   5898 C CD  . GLN D 2 32  ? 16.734 45.173 17.591  1.00 99.03  ? 134  GLN D CD  1 
ATOM   5899 O OE1 . GLN D 2 32  ? 17.770 44.517 17.760  1.00 99.81  ? 134  GLN D OE1 1 
ATOM   5900 N NE2 . GLN D 2 32  ? 16.606 46.077 16.616  1.00 100.14 ? 134  GLN D NE2 1 
ATOM   5901 N N   . PHE D 2 33  ? 15.156 45.705 23.351  1.00 86.40  ? 135  PHE D N   1 
ATOM   5902 C CA  . PHE D 2 33  ? 15.341 45.268 24.734  1.00 86.03  ? 135  PHE D CA  1 
ATOM   5903 C C   . PHE D 2 33  ? 14.355 45.845 25.727  1.00 84.74  ? 135  PHE D C   1 
ATOM   5904 O O   . PHE D 2 33  ? 14.747 46.267 26.816  1.00 84.48  ? 135  PHE D O   1 
ATOM   5905 C CB  . PHE D 2 33  ? 16.757 45.593 25.188  1.00 87.13  ? 135  PHE D CB  1 
ATOM   5906 C CG  . PHE D 2 33  ? 17.794 44.825 24.447  1.00 88.83  ? 135  PHE D CG  1 
ATOM   5907 C CD1 . PHE D 2 33  ? 17.998 43.481 24.721  1.00 89.44  ? 135  PHE D CD1 1 
ATOM   5908 C CD2 . PHE D 2 33  ? 18.503 45.415 23.412  1.00 89.53  ? 135  PHE D CD2 1 
ATOM   5909 C CE1 . PHE D 2 33  ? 18.885 42.737 23.976  1.00 89.35  ? 135  PHE D CE1 1 
ATOM   5910 C CE2 . PHE D 2 33  ? 19.391 44.679 22.661  1.00 89.69  ? 135  PHE D CE2 1 
ATOM   5911 C CZ  . PHE D 2 33  ? 19.582 43.335 22.942  1.00 89.86  ? 135  PHE D CZ  1 
ATOM   5912 N N   . ARG D 2 34  ? 13.080 45.844 25.349  1.00 82.97  ? 136  ARG D N   1 
ATOM   5913 C CA  . ARG D 2 34  ? 12.008 46.357 26.193  1.00 81.22  ? 136  ARG D CA  1 
ATOM   5914 C C   . ARG D 2 34  ? 12.235 47.789 26.699  1.00 77.96  ? 136  ARG D C   1 
ATOM   5915 O O   . ARG D 2 34  ? 12.142 48.049 27.899  1.00 77.50  ? 136  ARG D O   1 
ATOM   5916 C CB  . ARG D 2 34  ? 11.795 45.417 27.392  1.00 84.30  ? 136  ARG D CB  1 
ATOM   5917 C CG  . ARG D 2 34  ? 11.344 43.996 27.039  1.00 87.01  ? 136  ARG D CG  1 
ATOM   5918 C CD  . ARG D 2 34  ? 11.807 42.992 28.108  1.00 91.60  ? 136  ARG D CD  1 
ATOM   5919 N NE  . ARG D 2 34  ? 13.268 42.976 28.270  1.00 94.83  ? 136  ARG D NE  1 
ATOM   5920 C CZ  . ARG D 2 34  ? 14.128 42.453 27.392  1.00 96.57  ? 136  ARG D CZ  1 
ATOM   5921 N NH1 . ARG D 2 34  ? 15.433 42.495 27.627  1.00 95.67  ? 136  ARG D NH1 1 
ATOM   5922 N NH2 . ARG D 2 34  ? 13.690 41.869 26.280  1.00 97.17  ? 136  ARG D NH2 1 
ATOM   5923 N N   . PRO D 2 35  ? 12.542 48.739 25.796  1.00 75.21  ? 137  PRO D N   1 
ATOM   5924 C CA  . PRO D 2 35  ? 12.746 50.095 26.304  1.00 74.71  ? 137  PRO D CA  1 
ATOM   5925 C C   . PRO D 2 35  ? 11.443 50.762 26.759  1.00 74.67  ? 137  PRO D C   1 
ATOM   5926 O O   . PRO D 2 35  ? 10.493 50.906 25.975  1.00 74.30  ? 137  PRO D O   1 
ATOM   5927 C CB  . PRO D 2 35  ? 13.404 50.813 25.123  1.00 73.33  ? 137  PRO D CB  1 
ATOM   5928 C CG  . PRO D 2 35  ? 12.863 50.111 23.953  1.00 73.96  ? 137  PRO D CG  1 
ATOM   5929 C CD  . PRO D 2 35  ? 12.914 48.666 24.374  1.00 74.95  ? 137  PRO D CD  1 
ATOM   5930 N N   . PRO D 2 36  ? 11.382 51.165 28.047  1.00 74.20  ? 138  PRO D N   1 
ATOM   5931 C CA  . PRO D 2 36  ? 10.187 51.815 28.585  1.00 73.37  ? 138  PRO D CA  1 
ATOM   5932 C C   . PRO D 2 36  ? 9.735  52.872 27.598  1.00 73.18  ? 138  PRO D C   1 
ATOM   5933 O O   . PRO D 2 36  ? 10.526 53.701 27.157  1.00 73.14  ? 138  PRO D O   1 
ATOM   5934 C CB  . PRO D 2 36  ? 10.683 52.412 29.893  1.00 72.85  ? 138  PRO D CB  1 
ATOM   5935 C CG  . PRO D 2 36  ? 11.696 51.411 30.332  1.00 72.91  ? 138  PRO D CG  1 
ATOM   5936 C CD  . PRO D 2 36  ? 12.452 51.124 29.062  1.00 73.19  ? 138  PRO D CD  1 
ATOM   5937 N N   . ALA D 2 37  ? 8.461  52.825 27.240  1.00 73.75  ? 139  ALA D N   1 
ATOM   5938 C CA  . ALA D 2 37  ? 7.885  53.762 26.284  1.00 72.77  ? 139  ALA D CA  1 
ATOM   5939 C C   . ALA D 2 37  ? 8.387  55.216 26.331  1.00 71.90  ? 139  ALA D C   1 
ATOM   5940 O O   . ALA D 2 37  ? 8.604  55.807 25.279  1.00 73.24  ? 139  ALA D O   1 
ATOM   5941 C CB  . ALA D 2 37  ? 6.364  53.735 26.403  1.00 72.59  ? 139  ALA D CB  1 
ATOM   5942 N N   . HIS D 2 38  ? 8.584  55.799 27.516  1.00 69.80  ? 140  HIS D N   1 
ATOM   5943 C CA  . HIS D 2 38  ? 9.033  57.197 27.592  1.00 67.69  ? 140  HIS D CA  1 
ATOM   5944 C C   . HIS D 2 38  ? 10.348 57.519 26.868  1.00 65.47  ? 140  HIS D C   1 
ATOM   5945 O O   . HIS D 2 38  ? 10.697 58.689 26.679  1.00 62.87  ? 140  HIS D O   1 
ATOM   5946 C CB  . HIS D 2 38  ? 9.105  57.657 29.051  1.00 70.10  ? 140  HIS D CB  1 
ATOM   5947 C CG  . HIS D 2 38  ? 10.322 57.190 29.785  1.00 73.68  ? 140  HIS D CG  1 
ATOM   5948 N ND1 . HIS D 2 38  ? 10.738 55.875 29.784  1.00 75.28  ? 140  HIS D ND1 1 
ATOM   5949 C CD2 . HIS D 2 38  ? 11.188 57.858 30.583  1.00 74.11  ? 140  HIS D CD2 1 
ATOM   5950 C CE1 . HIS D 2 38  ? 11.808 55.754 30.551  1.00 74.54  ? 140  HIS D CE1 1 
ATOM   5951 N NE2 . HIS D 2 38  ? 12.101 56.942 31.048  1.00 73.82  ? 140  HIS D NE2 1 
ATOM   5952 N N   . LEU D 2 39  ? 11.071 56.477 26.470  1.00 64.37  ? 141  LEU D N   1 
ATOM   5953 C CA  . LEU D 2 39  ? 12.316 56.633 25.728  1.00 64.16  ? 141  LEU D CA  1 
ATOM   5954 C C   . LEU D 2 39  ? 11.962 56.920 24.267  1.00 66.76  ? 141  LEU D C   1 
ATOM   5955 O O   . LEU D 2 39  ? 12.795 57.408 23.505  1.00 67.74  ? 141  LEU D O   1 
ATOM   5956 C CB  . LEU D 2 39  ? 13.167 55.355 25.802  1.00 57.30  ? 141  LEU D CB  1 
ATOM   5957 C CG  . LEU D 2 39  ? 13.698 54.923 27.165  1.00 52.80  ? 141  LEU D CG  1 
ATOM   5958 C CD1 . LEU D 2 39  ? 14.462 53.647 27.004  1.00 50.74  ? 141  LEU D CD1 1 
ATOM   5959 C CD2 . LEU D 2 39  ? 14.581 56.001 27.765  1.00 51.12  ? 141  LEU D CD2 1 
ATOM   5960 N N   . PHE D 2 40  ? 10.721 56.614 23.884  1.00 69.77  ? 142  PHE D N   1 
ATOM   5961 C CA  . PHE D 2 40  ? 10.239 56.827 22.516  1.00 72.17  ? 142  PHE D CA  1 
ATOM   5962 C C   . PHE D 2 40  ? 9.773  58.269 22.270  1.00 74.34  ? 142  PHE D C   1 
ATOM   5963 O O   . PHE D 2 40  ? 10.217 58.915 21.312  1.00 75.41  ? 142  PHE D O   1 
ATOM   5964 C CB  . PHE D 2 40  ? 9.113  55.832 22.190  1.00 69.88  ? 142  PHE D CB  1 
ATOM   5965 C CG  . PHE D 2 40  ? 9.592  54.408 21.994  1.00 68.88  ? 142  PHE D CG  1 
ATOM   5966 C CD1 . PHE D 2 40  ? 10.181 54.015 20.800  1.00 68.09  ? 142  PHE D CD1 1 
ATOM   5967 C CD2 . PHE D 2 40  ? 9.456  53.464 23.005  1.00 68.82  ? 142  PHE D CD2 1 
ATOM   5968 C CE1 . PHE D 2 40  ? 10.626 52.703 20.614  1.00 66.80  ? 142  PHE D CE1 1 
ATOM   5969 C CE2 . PHE D 2 40  ? 9.900  52.152 22.825  1.00 67.92  ? 142  PHE D CE2 1 
ATOM   5970 C CZ  . PHE D 2 40  ? 10.485 51.775 21.625  1.00 66.05  ? 142  PHE D CZ  1 
ATOM   5971 N N   . ILE D 2 41  ? 8.891  58.782 23.125  1.00 75.90  ? 143  ILE D N   1 
ATOM   5972 C CA  . ILE D 2 41  ? 8.419  60.155 22.954  1.00 78.51  ? 143  ILE D CA  1 
ATOM   5973 C C   . ILE D 2 41  ? 9.223  61.074 23.883  1.00 80.78  ? 143  ILE D C   1 
ATOM   5974 O O   . ILE D 2 41  ? 8.830  61.365 25.021  1.00 79.35  ? 143  ILE D O   1 
ATOM   5975 C CB  . ILE D 2 41  ? 6.882  60.296 23.227  1.00 77.86  ? 143  ILE D CB  1 
ATOM   5976 C CG1 . ILE D 2 41  ? 6.058  59.559 22.147  1.00 74.63  ? 143  ILE D CG1 1 
ATOM   5977 C CG2 . ILE D 2 41  ? 6.491  61.781 23.198  1.00 78.08  ? 143  ILE D CG2 1 
ATOM   5978 C CD1 . ILE D 2 41  ? 6.083  58.040 22.204  1.00 70.39  ? 143  ILE D CD1 1 
ATOM   5979 N N   . HIS D 2 42  ? 10.364 61.514 23.355  1.00 84.27  ? 144  HIS D N   1 
ATOM   5980 C CA  . HIS D 2 42  ? 11.319 62.369 24.052  1.00 87.15  ? 144  HIS D CA  1 
ATOM   5981 C C   . HIS D 2 42  ? 10.946 63.841 24.222  1.00 88.36  ? 144  HIS D C   1 
ATOM   5982 O O   . HIS D 2 42  ? 11.686 64.734 23.799  1.00 88.60  ? 144  HIS D O   1 
ATOM   5983 C CB  . HIS D 2 42  ? 12.694 62.264 23.368  1.00 89.57  ? 144  HIS D CB  1 
ATOM   5984 C CG  . HIS D 2 42  ? 12.651 62.294 21.866  1.00 92.14  ? 144  HIS D CG  1 
ATOM   5985 N ND1 . HIS D 2 42  ? 12.794 61.159 21.096  1.00 92.59  ? 144  HIS D ND1 1 
ATOM   5986 C CD2 . HIS D 2 42  ? 12.550 63.329 20.992  1.00 93.34  ? 144  HIS D CD2 1 
ATOM   5987 C CE1 . HIS D 2 42  ? 12.791 61.493 19.816  1.00 94.18  ? 144  HIS D CE1 1 
ATOM   5988 N NE2 . HIS D 2 42  ? 12.644 62.804 19.725  1.00 93.16  ? 144  HIS D NE2 1 
ATOM   5989 N N   . HIS D 2 43  ? 9.808  64.087 24.860  1.00 89.78  ? 145  HIS D N   1 
ATOM   5990 C CA  . HIS D 2 43  ? 9.326  65.445 25.096  1.00 91.54  ? 145  HIS D CA  1 
ATOM   5991 C C   . HIS D 2 43  ? 9.034  65.579 26.576  1.00 90.39  ? 145  HIS D C   1 
ATOM   5992 O O   . HIS D 2 43  ? 9.395  66.568 27.207  1.00 90.05  ? 145  HIS D O   1 
ATOM   5993 C CB  . HIS D 2 43  ? 8.047  65.719 24.284  1.00 95.67  ? 145  HIS D CB  1 
ATOM   5994 C CG  . HIS D 2 43  ? 8.266  65.802 22.799  1.00 99.55  ? 145  HIS D CG  1 
ATOM   5995 N ND1 . HIS D 2 43  ? 9.025  66.794 22.209  1.00 100.60 ? 145  HIS D ND1 1 
ATOM   5996 C CD2 . HIS D 2 43  ? 7.821  65.020 21.785  1.00 100.01 ? 145  HIS D CD2 1 
ATOM   5997 C CE1 . HIS D 2 43  ? 9.038  66.619 20.900  1.00 100.56 ? 145  HIS D CE1 1 
ATOM   5998 N NE2 . HIS D 2 43  ? 8.315  65.549 20.616  1.00 101.39 ? 145  HIS D NE2 1 
ATOM   5999 N N   . GLN D 2 44  ? 8.356  64.573 27.115  1.00 90.78  ? 146  GLN D N   1 
ATOM   6000 C CA  . GLN D 2 44  ? 8.024  64.524 28.532  1.00 92.41  ? 146  GLN D CA  1 
ATOM   6001 C C   . GLN D 2 44  ? 8.800  63.313 29.048  1.00 92.65  ? 146  GLN D C   1 
ATOM   6002 O O   . GLN D 2 44  ? 8.843  62.257 28.401  1.00 93.85  ? 146  GLN D O   1 
ATOM   6003 C CB  . GLN D 2 44  ? 6.517  64.315 28.755  1.00 93.38  ? 146  GLN D CB  1 
ATOM   6004 C CG  . GLN D 2 44  ? 5.613  65.034 27.756  1.00 94.89  ? 146  GLN D CG  1 
ATOM   6005 C CD  . GLN D 2 44  ? 4.913  64.074 26.793  1.00 95.24  ? 146  GLN D CD  1 
ATOM   6006 O OE1 . GLN D 2 44  ? 4.569  64.445 25.668  1.00 95.44  ? 146  GLN D OE1 1 
ATOM   6007 N NE2 . GLN D 2 44  ? 4.688  62.840 27.240  1.00 95.79  ? 146  GLN D NE2 1 
ATOM   6008 N N   . PRO D 2 45  ? 9.435  63.461 30.217  1.00 91.81  ? 147  PRO D N   1 
ATOM   6009 C CA  . PRO D 2 45  ? 10.247 62.450 30.909  1.00 90.78  ? 147  PRO D CA  1 
ATOM   6010 C C   . PRO D 2 45  ? 9.497  61.220 31.455  1.00 89.73  ? 147  PRO D C   1 
ATOM   6011 O O   . PRO D 2 45  ? 8.547  60.724 30.839  1.00 90.36  ? 147  PRO D O   1 
ATOM   6012 C CB  . PRO D 2 45  ? 10.912 63.267 32.015  1.00 90.96  ? 147  PRO D CB  1 
ATOM   6013 C CG  . PRO D 2 45  ? 9.866  64.295 32.341  1.00 91.44  ? 147  PRO D CG  1 
ATOM   6014 C CD  . PRO D 2 45  ? 9.388  64.722 30.982  1.00 91.43  ? 147  PRO D CD  1 
ATOM   6015 N N   . LEU D 2 46  ? 9.969  60.721 32.597  1.00 87.49  ? 148  LEU D N   1 
ATOM   6016 C CA  . LEU D 2 46  ? 9.367  59.580 33.282  1.00 85.60  ? 148  LEU D CA  1 
ATOM   6017 C C   . LEU D 2 46  ? 8.584  60.195 34.439  1.00 85.35  ? 148  LEU D C   1 
ATOM   6018 O O   . LEU D 2 46  ? 9.131  60.983 35.224  1.00 85.00  ? 148  LEU D O   1 
ATOM   6019 C CB  . LEU D 2 46  ? 10.449 58.640 33.826  1.00 84.31  ? 148  LEU D CB  1 
ATOM   6020 C CG  . LEU D 2 46  ? 9.996  57.473 34.708  1.00 82.86  ? 148  LEU D CG  1 
ATOM   6021 C CD1 . LEU D 2 46  ? 9.096  56.552 33.922  1.00 83.07  ? 148  LEU D CD1 1 
ATOM   6022 C CD2 . LEU D 2 46  ? 11.200 56.714 35.212  1.00 81.90  ? 148  LEU D CD2 1 
ATOM   6023 N N   . PRO D 2 47  ? 7.287  59.864 34.556  1.00 84.30  ? 149  PRO D N   1 
ATOM   6024 C CA  . PRO D 2 47  ? 6.564  60.472 35.669  1.00 83.33  ? 149  PRO D CA  1 
ATOM   6025 C C   . PRO D 2 47  ? 7.321  60.120 36.939  1.00 83.00  ? 149  PRO D C   1 
ATOM   6026 O O   . PRO D 2 47  ? 7.794  58.991 37.093  1.00 83.50  ? 149  PRO D O   1 
ATOM   6027 C CB  . PRO D 2 47  ? 5.189  59.807 35.595  1.00 83.30  ? 149  PRO D CB  1 
ATOM   6028 C CG  . PRO D 2 47  ? 5.071  59.398 34.151  1.00 82.64  ? 149  PRO D CG  1 
ATOM   6029 C CD  . PRO D 2 47  ? 6.447  58.875 33.864  1.00 82.89  ? 149  PRO D CD  1 
ATOM   6030 N N   . THR D 2 48  ? 7.457  61.092 37.831  1.00 81.68  ? 150  THR D N   1 
ATOM   6031 C CA  . THR D 2 48  ? 8.157  60.883 39.087  1.00 80.26  ? 150  THR D CA  1 
ATOM   6032 C C   . THR D 2 48  ? 7.782  59.568 39.770  1.00 80.17  ? 150  THR D C   1 
ATOM   6033 O O   . THR D 2 48  ? 8.657  58.832 40.224  1.00 81.27  ? 150  THR D O   1 
ATOM   6034 C CB  . THR D 2 48  ? 7.856  62.013 40.080  1.00 79.22  ? 150  THR D CB  1 
ATOM   6035 O OG1 . THR D 2 48  ? 8.004  63.274 39.426  1.00 79.77  ? 150  THR D OG1 1 
ATOM   6036 C CG2 . THR D 2 48  ? 8.808  61.951 41.258  1.00 78.38  ? 150  THR D CG2 1 
ATOM   6037 N N   . LEU D 2 49  ? 6.485  59.263 39.823  1.00 79.83  ? 151  LEU D N   1 
ATOM   6038 C CA  . LEU D 2 49  ? 5.997  58.062 40.510  1.00 78.83  ? 151  LEU D CA  1 
ATOM   6039 C C   . LEU D 2 49  ? 5.895  56.735 39.745  1.00 77.78  ? 151  LEU D C   1 
ATOM   6040 O O   . LEU D 2 49  ? 5.472  55.722 40.316  1.00 78.26  ? 151  LEU D O   1 
ATOM   6041 C CB  . LEU D 2 49  ? 4.643  58.366 41.172  1.00 78.85  ? 151  LEU D CB  1 
ATOM   6042 C CG  . LEU D 2 49  ? 4.557  59.362 42.347  1.00 78.77  ? 151  LEU D CG  1 
ATOM   6043 C CD1 . LEU D 2 49  ? 5.576  58.971 43.407  1.00 77.80  ? 151  LEU D CD1 1 
ATOM   6044 C CD2 . LEU D 2 49  ? 4.790  60.803 41.881  1.00 79.07  ? 151  LEU D CD2 1 
ATOM   6045 N N   . ALA D 2 50  ? 6.281  56.722 38.474  1.00 75.31  ? 152  ALA D N   1 
ATOM   6046 C CA  . ALA D 2 50  ? 6.224  55.489 37.699  1.00 74.89  ? 152  ALA D CA  1 
ATOM   6047 C C   . ALA D 2 50  ? 7.326  54.523 38.168  1.00 75.28  ? 152  ALA D C   1 
ATOM   6048 O O   . ALA D 2 50  ? 8.449  54.950 38.462  1.00 75.98  ? 152  ALA D O   1 
ATOM   6049 C CB  . ALA D 2 50  ? 6.392  55.804 36.218  1.00 73.81  ? 152  ALA D CB  1 
ATOM   6050 N N   . PRO D 2 51  ? 7.022  53.209 38.257  1.00 74.35  ? 153  PRO D N   1 
ATOM   6051 C CA  . PRO D 2 51  ? 8.050  52.253 38.697  1.00 73.23  ? 153  PRO D CA  1 
ATOM   6052 C C   . PRO D 2 51  ? 9.276  52.282 37.782  1.00 71.39  ? 153  PRO D C   1 
ATOM   6053 O O   . PRO D 2 51  ? 9.157  52.147 36.557  1.00 70.87  ? 153  PRO D O   1 
ATOM   6054 C CB  . PRO D 2 51  ? 7.316  50.907 38.661  1.00 73.58  ? 153  PRO D CB  1 
ATOM   6055 C CG  . PRO D 2 51  ? 6.302  51.104 37.576  1.00 73.37  ? 153  PRO D CG  1 
ATOM   6056 C CD  . PRO D 2 51  ? 5.790  52.502 37.869  1.00 73.29  ? 153  PRO D CD  1 
ATOM   6057 N N   . VAL D 2 52  ? 10.449 52.468 38.386  1.00 69.78  ? 154  VAL D N   1 
ATOM   6058 C CA  . VAL D 2 52  ? 11.712 52.530 37.645  1.00 66.50  ? 154  VAL D CA  1 
ATOM   6059 C C   . VAL D 2 52  ? 12.144 51.191 37.045  1.00 65.39  ? 154  VAL D C   1 
ATOM   6060 O O   . VAL D 2 52  ? 12.793 51.159 36.004  1.00 64.63  ? 154  VAL D O   1 
ATOM   6061 C CB  . VAL D 2 52  ? 12.858 53.056 38.535  1.00 63.82  ? 154  VAL D CB  1 
ATOM   6062 C CG1 . VAL D 2 52  ? 14.175 52.760 37.880  1.00 64.38  ? 154  VAL D CG1 1 
ATOM   6063 C CG2 . VAL D 2 52  ? 12.721 54.560 38.751  1.00 61.82  ? 154  VAL D CG2 1 
ATOM   6064 N N   . LEU D 2 53  ? 11.771 50.099 37.708  1.00 64.39  ? 155  LEU D N   1 
ATOM   6065 C CA  . LEU D 2 53  ? 12.111 48.748 37.273  1.00 63.74  ? 155  LEU D CA  1 
ATOM   6066 C C   . LEU D 2 53  ? 12.147 48.463 35.768  1.00 63.12  ? 155  LEU D C   1 
ATOM   6067 O O   . LEU D 2 53  ? 13.072 47.811 35.290  1.00 61.79  ? 155  LEU D O   1 
ATOM   6068 C CB  . LEU D 2 53  ? 11.179 47.739 37.939  1.00 65.03  ? 155  LEU D CB  1 
ATOM   6069 C CG  . LEU D 2 53  ? 11.237 46.344 37.310  1.00 65.72  ? 155  LEU D CG  1 
ATOM   6070 C CD1 . LEU D 2 53  ? 12.615 45.751 37.520  1.00 65.70  ? 155  LEU D CD1 1 
ATOM   6071 C CD2 . LEU D 2 53  ? 10.175 45.457 37.926  1.00 66.01  ? 155  LEU D CD2 1 
ATOM   6072 N N   . PRO D 2 54  ? 11.134 48.911 35.006  1.00 63.54  ? 156  PRO D N   1 
ATOM   6073 C CA  . PRO D 2 54  ? 11.163 48.640 33.559  1.00 65.04  ? 156  PRO D CA  1 
ATOM   6074 C C   . PRO D 2 54  ? 12.314 49.328 32.809  1.00 65.83  ? 156  PRO D C   1 
ATOM   6075 O O   . PRO D 2 54  ? 12.752 48.847 31.752  1.00 65.62  ? 156  PRO D O   1 
ATOM   6076 C CB  . PRO D 2 54  ? 9.795  49.123 33.094  1.00 64.51  ? 156  PRO D CB  1 
ATOM   6077 C CG  . PRO D 2 54  ? 8.933  48.866 34.306  1.00 65.07  ? 156  PRO D CG  1 
ATOM   6078 C CD  . PRO D 2 54  ? 9.803  49.388 35.417  1.00 63.14  ? 156  PRO D CD  1 
ATOM   6079 N N   . LEU D 2 55  ? 12.776 50.457 33.359  1.00 65.75  ? 157  LEU D N   1 
ATOM   6080 C CA  . LEU D 2 55  ? 13.893 51.245 32.809  1.00 64.74  ? 157  LEU D CA  1 
ATOM   6081 C C   . LEU D 2 55  ? 15.210 50.608 33.213  1.00 64.92  ? 157  LEU D C   1 
ATOM   6082 O O   . LEU D 2 55  ? 16.124 50.474 32.400  1.00 64.99  ? 157  LEU D O   1 
ATOM   6083 C CB  . LEU D 2 55  ? 13.876 52.674 33.362  1.00 63.91  ? 157  LEU D CB  1 
ATOM   6084 C CG  . LEU D 2 55  ? 15.127 53.529 33.096  1.00 61.77  ? 157  LEU D CG  1 
ATOM   6085 C CD1 . LEU D 2 55  ? 15.273 53.761 31.601  1.00 60.30  ? 157  LEU D CD1 1 
ATOM   6086 C CD2 . LEU D 2 55  ? 15.026 54.863 33.837  1.00 59.59  ? 157  LEU D CD2 1 
ATOM   6087 N N   . VAL D 2 56  ? 15.295 50.250 34.495  1.00 64.65  ? 158  VAL D N   1 
ATOM   6088 C CA  . VAL D 2 56  ? 16.470 49.609 35.064  1.00 62.77  ? 158  VAL D CA  1 
ATOM   6089 C C   . VAL D 2 56  ? 16.720 48.274 34.404  1.00 63.06  ? 158  VAL D C   1 
ATOM   6090 O O   . VAL D 2 56  ? 17.860 47.897 34.176  1.00 63.78  ? 158  VAL D O   1 
ATOM   6091 C CB  . VAL D 2 56  ? 16.312 49.375 36.563  1.00 61.20  ? 158  VAL D CB  1 
ATOM   6092 C CG1 . VAL D 2 56  ? 17.331 48.363 37.017  1.00 61.01  ? 158  VAL D CG1 1 
ATOM   6093 C CG2 . VAL D 2 56  ? 16.507 50.682 37.323  1.00 59.82  ? 158  VAL D CG2 1 
ATOM   6094 N N   . THR D 2 57  ? 15.655 47.542 34.119  1.00 64.78  ? 159  THR D N   1 
ATOM   6095 C CA  . THR D 2 57  ? 15.810 46.268 33.441  1.00 67.49  ? 159  THR D CA  1 
ATOM   6096 C C   . THR D 2 57  ? 16.315 46.579 32.033  1.00 68.25  ? 159  THR D C   1 
ATOM   6097 O O   . THR D 2 57  ? 17.093 45.822 31.468  1.00 68.11  ? 159  THR D O   1 
ATOM   6098 C CB  . THR D 2 57  ? 14.476 45.505 33.358  1.00 68.21  ? 159  THR D CB  1 
ATOM   6099 O OG1 . THR D 2 57  ? 13.995 45.264 34.685  1.00 68.60  ? 159  THR D OG1 1 
ATOM   6100 C CG2 . THR D 2 57  ? 14.653 44.163 32.630  1.00 67.75  ? 159  THR D CG2 1 
ATOM   6101 N N   . HIS D 2 58  ? 15.879 47.700 31.467  1.00 69.47  ? 160  HIS D N   1 
ATOM   6102 C CA  . HIS D 2 58  ? 16.333 48.082 30.137  1.00 71.20  ? 160  HIS D CA  1 
ATOM   6103 C C   . HIS D 2 58  ? 17.825 48.432 30.170  1.00 71.57  ? 160  HIS D C   1 
ATOM   6104 O O   . HIS D 2 58  ? 18.603 47.941 29.351  1.00 70.95  ? 160  HIS D O   1 
ATOM   6105 C CB  . HIS D 2 58  ? 15.526 49.274 29.610  1.00 72.24  ? 160  HIS D CB  1 
ATOM   6106 C CG  . HIS D 2 58  ? 15.955 49.738 28.250  1.00 73.33  ? 160  HIS D CG  1 
ATOM   6107 N ND1 . HIS D 2 58  ? 16.038 48.888 27.166  1.00 73.44  ? 160  HIS D ND1 1 
ATOM   6108 C CD2 . HIS D 2 58  ? 16.347 50.956 27.806  1.00 73.40  ? 160  HIS D CD2 1 
ATOM   6109 C CE1 . HIS D 2 58  ? 16.466 49.565 26.114  1.00 74.01  ? 160  HIS D CE1 1 
ATOM   6110 N NE2 . HIS D 2 58  ? 16.661 50.821 26.474  1.00 72.40  ? 160  HIS D NE2 1 
ATOM   6111 N N   . PHE D 2 59  ? 18.218 49.282 31.117  1.00 72.23  ? 161  PHE D N   1 
ATOM   6112 C CA  . PHE D 2 59  ? 19.611 49.682 31.260  1.00 72.98  ? 161  PHE D CA  1 
ATOM   6113 C C   . PHE D 2 59  ? 20.516 48.475 31.486  1.00 72.90  ? 161  PHE D C   1 
ATOM   6114 O O   . PHE D 2 59  ? 21.506 48.283 30.785  1.00 72.09  ? 161  PHE D O   1 
ATOM   6115 C CB  . PHE D 2 59  ? 19.772 50.648 32.430  1.00 75.38  ? 161  PHE D CB  1 
ATOM   6116 C CG  . PHE D 2 59  ? 21.183 50.721 32.952  1.00 79.93  ? 161  PHE D CG  1 
ATOM   6117 C CD1 . PHE D 2 59  ? 21.538 50.081 34.130  1.00 80.94  ? 161  PHE D CD1 1 
ATOM   6118 C CD2 . PHE D 2 59  ? 22.174 51.385 32.234  1.00 80.92  ? 161  PHE D CD2 1 
ATOM   6119 C CE1 . PHE D 2 59  ? 22.859 50.101 34.577  1.00 82.28  ? 161  PHE D CE1 1 
ATOM   6120 C CE2 . PHE D 2 59  ? 23.491 51.407 32.676  1.00 81.10  ? 161  PHE D CE2 1 
ATOM   6121 C CZ  . PHE D 2 59  ? 23.834 50.766 33.845  1.00 81.37  ? 161  PHE D CZ  1 
ATOM   6122 N N   . ALA D 2 60  ? 20.173 47.669 32.482  1.00 72.61  ? 162  ALA D N   1 
ATOM   6123 C CA  . ALA D 2 60  ? 20.942 46.481 32.806  1.00 72.06  ? 162  ALA D CA  1 
ATOM   6124 C C   . ALA D 2 60  ? 21.104 45.607 31.572  1.00 72.23  ? 162  ALA D C   1 
ATOM   6125 O O   . ALA D 2 60  ? 22.167 45.042 31.341  1.00 73.20  ? 162  ALA D O   1 
ATOM   6126 C CB  . ALA D 2 60  ? 20.240 45.695 33.919  1.00 71.61  ? 162  ALA D CB  1 
ATOM   6127 N N   . ASP D 2 61  ? 20.047 45.515 30.773  1.00 72.93  ? 163  ASP D N   1 
ATOM   6128 C CA  . ASP D 2 61  ? 20.052 44.690 29.571  1.00 74.10  ? 163  ASP D CA  1 
ATOM   6129 C C   . ASP D 2 61  ? 20.908 45.194 28.395  1.00 72.86  ? 163  ASP D C   1 
ATOM   6130 O O   . ASP D 2 61  ? 21.766 44.459 27.910  1.00 72.33  ? 163  ASP D O   1 
ATOM   6131 C CB  . ASP D 2 61  ? 18.607 44.442 29.100  1.00 78.51  ? 163  ASP D CB  1 
ATOM   6132 C CG  . ASP D 2 61  ? 17.760 43.699 30.140  1.00 82.27  ? 163  ASP D CG  1 
ATOM   6133 O OD1 . ASP D 2 61  ? 16.624 43.281 29.806  1.00 84.48  ? 163  ASP D OD1 1 
ATOM   6134 O OD2 . ASP D 2 61  ? 18.222 43.542 31.295  1.00 83.94  ? 163  ASP D OD2 1 
ATOM   6135 N N   . ILE D 2 62  ? 20.683 46.421 27.917  1.00 71.27  ? 164  ILE D N   1 
ATOM   6136 C CA  . ILE D 2 62  ? 21.487 46.933 26.798  1.00 68.48  ? 164  ILE D CA  1 
ATOM   6137 C C   . ILE D 2 62  ? 22.934 47.214 27.246  1.00 68.12  ? 164  ILE D C   1 
ATOM   6138 O O   . ILE D 2 62  ? 23.852 47.281 26.424  1.00 68.09  ? 164  ILE D O   1 
ATOM   6139 C CB  . ILE D 2 62  ? 20.857 48.221 26.147  1.00 66.94  ? 164  ILE D CB  1 
ATOM   6140 C CG1 . ILE D 2 62  ? 20.824 49.375 27.143  1.00 67.12  ? 164  ILE D CG1 1 
ATOM   6141 C CG2 . ILE D 2 62  ? 19.471 47.927 25.632  1.00 64.30  ? 164  ILE D CG2 1 
ATOM   6142 C CD1 . ILE D 2 62  ? 22.135 50.127 27.215  1.00 68.35  ? 164  ILE D CD1 1 
ATOM   6143 N N   . ASN D 2 63  ? 23.133 47.370 28.554  1.00 66.77  ? 165  ASN D N   1 
ATOM   6144 C CA  . ASN D 2 63  ? 24.459 47.601 29.103  1.00 64.13  ? 165  ASN D CA  1 
ATOM   6145 C C   . ASN D 2 63  ? 25.221 46.330 28.775  1.00 63.09  ? 165  ASN D C   1 
ATOM   6146 O O   . ASN D 2 63  ? 26.205 46.372 28.049  1.00 62.97  ? 165  ASN D O   1 
ATOM   6147 C CB  . ASN D 2 63  ? 24.380 47.815 30.616  1.00 63.20  ? 165  ASN D CB  1 
ATOM   6148 C CG  . ASN D 2 63  ? 25.676 48.344 31.205  1.00 62.81  ? 165  ASN D CG  1 
ATOM   6149 O OD1 . ASN D 2 63  ? 25.663 49.074 32.204  1.00 61.48  ? 165  ASN D OD1 1 
ATOM   6150 N ND2 . ASN D 2 63  ? 26.806 47.974 30.600  1.00 60.48  ? 165  ASN D ND2 1 
ATOM   6151 N N   . THR D 2 64  ? 24.747 45.199 29.294  1.00 62.78  ? 166  THR D N   1 
ATOM   6152 C CA  . THR D 2 64  ? 25.368 43.897 29.031  1.00 63.32  ? 166  THR D CA  1 
ATOM   6153 C C   . THR D 2 64  ? 25.480 43.626 27.519  1.00 64.77  ? 166  THR D C   1 
ATOM   6154 O O   . THR D 2 64  ? 26.346 42.870 27.072  1.00 63.99  ? 166  THR D O   1 
ATOM   6155 C CB  . THR D 2 64  ? 24.546 42.734 29.692  1.00 61.97  ? 166  THR D CB  1 
ATOM   6156 O OG1 . THR D 2 64  ? 24.785 42.697 31.110  1.00 60.81  ? 166  THR D OG1 1 
ATOM   6157 C CG2 . THR D 2 64  ? 24.919 41.396 29.078  1.00 59.25  ? 166  THR D CG2 1 
ATOM   6158 N N   . PHE D 2 65  ? 24.599 44.255 26.742  1.00 67.29  ? 167  PHE D N   1 
ATOM   6159 C CA  . PHE D 2 65  ? 24.561 44.099 25.285  1.00 68.58  ? 167  PHE D CA  1 
ATOM   6160 C C   . PHE D 2 65  ? 25.724 44.758 24.546  1.00 69.19  ? 167  PHE D C   1 
ATOM   6161 O O   . PHE D 2 65  ? 26.279 44.178 23.611  1.00 69.01  ? 167  PHE D O   1 
ATOM   6162 C CB  . PHE D 2 65  ? 23.242 44.651 24.735  1.00 68.00  ? 167  PHE D CB  1 
ATOM   6163 C CG  . PHE D 2 65  ? 23.232 44.825 23.238  1.00 67.21  ? 167  PHE D CG  1 
ATOM   6164 C CD1 . PHE D 2 65  ? 23.390 43.729 22.398  1.00 65.00  ? 167  PHE D CD1 1 
ATOM   6165 C CD2 . PHE D 2 65  ? 23.064 46.089 22.673  1.00 66.79  ? 167  PHE D CD2 1 
ATOM   6166 C CE1 . PHE D 2 65  ? 23.382 43.887 21.025  1.00 64.57  ? 167  PHE D CE1 1 
ATOM   6167 C CE2 . PHE D 2 65  ? 23.054 46.256 21.299  1.00 66.15  ? 167  PHE D CE2 1 
ATOM   6168 C CZ  . PHE D 2 65  ? 23.214 45.153 20.473  1.00 65.32  ? 167  PHE D CZ  1 
ATOM   6169 N N   . MET D 2 66  ? 26.077 45.975 24.941  1.00 69.94  ? 168  MET D N   1 
ATOM   6170 C CA  . MET D 2 66  ? 27.183 46.654 24.290  1.00 71.48  ? 168  MET D CA  1 
ATOM   6171 C C   . MET D 2 66  ? 28.460 45.850 24.484  1.00 73.74  ? 168  MET D C   1 
ATOM   6172 O O   . MET D 2 66  ? 29.186 45.595 23.522  1.00 75.13  ? 168  MET D O   1 
ATOM   6173 C CB  . MET D 2 66  ? 27.381 48.050 24.866  1.00 69.63  ? 168  MET D CB  1 
ATOM   6174 C CG  . MET D 2 66  ? 26.275 49.012 24.552  1.00 67.95  ? 168  MET D CG  1 
ATOM   6175 S SD  . MET D 2 66  ? 26.725 50.672 25.055  1.00 65.87  ? 168  MET D SD  1 
ATOM   6176 C CE  . MET D 2 66  ? 26.197 50.669 26.756  1.00 68.53  ? 168  MET D CE  1 
ATOM   6177 N N   . VAL D 2 67  ? 28.731 45.460 25.730  1.00 74.77  ? 169  VAL D N   1 
ATOM   6178 C CA  . VAL D 2 67  ? 29.920 44.680 26.059  1.00 75.36  ? 169  VAL D CA  1 
ATOM   6179 C C   . VAL D 2 67  ? 30.022 43.398 25.227  1.00 76.82  ? 169  VAL D C   1 
ATOM   6180 O O   . VAL D 2 67  ? 31.117 42.982 24.851  1.00 78.02  ? 169  VAL D O   1 
ATOM   6181 C CB  . VAL D 2 67  ? 29.948 44.333 27.558  1.00 74.57  ? 169  VAL D CB  1 
ATOM   6182 C CG1 . VAL D 2 67  ? 31.108 43.408 27.854  1.00 74.95  ? 169  VAL D CG1 1 
ATOM   6183 C CG2 . VAL D 2 67  ? 30.068 45.613 28.380  1.00 72.61  ? 169  VAL D CG2 1 
ATOM   6184 N N   . LEU D 2 68  ? 28.883 42.776 24.936  1.00 78.19  ? 170  LEU D N   1 
ATOM   6185 C CA  . LEU D 2 68  ? 28.855 41.567 24.108  1.00 79.21  ? 170  LEU D CA  1 
ATOM   6186 C C   . LEU D 2 68  ? 29.325 41.865 22.686  1.00 78.46  ? 170  LEU D C   1 
ATOM   6187 O O   . LEU D 2 68  ? 29.771 40.970 21.977  1.00 77.12  ? 170  LEU D O   1 
ATOM   6188 C CB  . LEU D 2 68  ? 27.439 40.988 24.056  1.00 81.96  ? 170  LEU D CB  1 
ATOM   6189 C CG  . LEU D 2 68  ? 26.968 40.231 25.301  1.00 83.53  ? 170  LEU D CG  1 
ATOM   6190 C CD1 . LEU D 2 68  ? 25.486 39.863 25.170  1.00 83.46  ? 170  LEU D CD1 1 
ATOM   6191 C CD2 . LEU D 2 68  ? 27.831 38.981 25.472  1.00 83.80  ? 170  LEU D CD2 1 
ATOM   6192 N N   . GLN D 2 69  ? 29.191 43.127 22.280  1.00 79.06  ? 171  GLN D N   1 
ATOM   6193 C CA  . GLN D 2 69  ? 29.619 43.599 20.967  1.00 79.59  ? 171  GLN D CA  1 
ATOM   6194 C C   . GLN D 2 69  ? 31.077 44.037 21.060  1.00 79.51  ? 171  GLN D C   1 
ATOM   6195 O O   . GLN D 2 69  ? 31.831 43.919 20.100  1.00 79.40  ? 171  GLN D O   1 
ATOM   6196 C CB  . GLN D 2 69  ? 28.756 44.778 20.503  1.00 79.89  ? 171  GLN D CB  1 
ATOM   6197 C CG  . GLN D 2 69  ? 27.308 44.427 20.196  1.00 79.93  ? 171  GLN D CG  1 
ATOM   6198 C CD  . GLN D 2 69  ? 27.170 43.156 19.364  1.00 80.77  ? 171  GLN D CD  1 
ATOM   6199 O OE1 . GLN D 2 69  ? 27.154 42.041 19.900  1.00 80.80  ? 171  GLN D OE1 1 
ATOM   6200 N NE2 . GLN D 2 69  ? 27.079 43.318 18.049  1.00 80.15  ? 171  GLN D NE2 1 
ATOM   6201 N N   . VAL D 2 70  ? 31.458 44.572 22.215  1.00 79.62  ? 172  VAL D N   1 
ATOM   6202 C CA  . VAL D 2 70  ? 32.836 44.982 22.454  1.00 79.57  ? 172  VAL D CA  1 
ATOM   6203 C C   . VAL D 2 70  ? 33.627 43.683 22.392  1.00 78.95  ? 172  VAL D C   1 
ATOM   6204 O O   . VAL D 2 70  ? 34.711 43.619 21.825  1.00 78.62  ? 172  VAL D O   1 
ATOM   6205 C CB  . VAL D 2 70  ? 32.992 45.647 23.855  1.00 80.28  ? 172  VAL D CB  1 
ATOM   6206 C CG1 . VAL D 2 70  ? 34.444 45.607 24.307  1.00 79.59  ? 172  VAL D CG1 1 
ATOM   6207 C CG2 . VAL D 2 70  ? 32.497 47.098 23.803  1.00 79.48  ? 172  VAL D CG2 1 
ATOM   6208 N N   . ILE D 2 71  ? 33.057 42.639 22.972  1.00 79.15  ? 173  ILE D N   1 
ATOM   6209 C CA  . ILE D 2 71  ? 33.673 41.333 22.955  1.00 81.07  ? 173  ILE D CA  1 
ATOM   6210 C C   . ILE D 2 71  ? 33.605 40.764 21.542  1.00 83.76  ? 173  ILE D C   1 
ATOM   6211 O O   . ILE D 2 71  ? 34.588 40.226 21.039  1.00 84.51  ? 173  ILE D O   1 
ATOM   6212 C CB  . ILE D 2 71  ? 32.960 40.393 23.917  1.00 79.29  ? 173  ILE D CB  1 
ATOM   6213 C CG1 . ILE D 2 71  ? 33.351 40.761 25.343  1.00 78.94  ? 173  ILE D CG1 1 
ATOM   6214 C CG2 . ILE D 2 71  ? 33.299 38.955 23.595  1.00 78.55  ? 173  ILE D CG2 1 
ATOM   6215 C CD1 . ILE D 2 71  ? 32.601 40.007 26.388  1.00 79.29  ? 173  ILE D CD1 1 
ATOM   6216 N N   . LYS D 2 72  ? 32.447 40.884 20.898  1.00 87.12  ? 174  LYS D N   1 
ATOM   6217 C CA  . LYS D 2 72  ? 32.289 40.382 19.534  1.00 89.72  ? 174  LYS D CA  1 
ATOM   6218 C C   . LYS D 2 72  ? 33.280 41.086 18.610  1.00 90.66  ? 174  LYS D C   1 
ATOM   6219 O O   . LYS D 2 72  ? 34.025 40.442 17.873  1.00 91.19  ? 174  LYS D O   1 
ATOM   6220 C CB  . LYS D 2 72  ? 30.854 40.606 19.029  1.00 91.22  ? 174  LYS D CB  1 
ATOM   6221 C CG  . LYS D 2 72  ? 29.813 39.632 19.584  1.00 91.99  ? 174  LYS D CG  1 
ATOM   6222 C CD  . LYS D 2 72  ? 28.509 39.698 18.799  1.00 93.62  ? 174  LYS D CD  1 
ATOM   6223 C CE  . LYS D 2 72  ? 27.479 38.726 19.364  1.00 95.36  ? 174  LYS D CE  1 
ATOM   6224 N NZ  . LYS D 2 72  ? 26.291 38.562 18.475  1.00 97.74  ? 174  LYS D NZ  1 
ATOM   6225 N N   . PHE D 2 73  ? 33.279 42.412 18.660  1.00 91.40  ? 175  PHE D N   1 
ATOM   6226 C CA  . PHE D 2 73  ? 34.174 43.227 17.853  1.00 92.86  ? 175  PHE D CA  1 
ATOM   6227 C C   . PHE D 2 73  ? 35.610 42.720 17.890  1.00 93.60  ? 175  PHE D C   1 
ATOM   6228 O O   . PHE D 2 73  ? 36.184 42.380 16.860  1.00 93.70  ? 175  PHE D O   1 
ATOM   6229 C CB  . PHE D 2 73  ? 34.141 44.669 18.353  1.00 93.58  ? 175  PHE D CB  1 
ATOM   6230 C CG  . PHE D 2 73  ? 35.296 45.512 17.873  1.00 95.25  ? 175  PHE D CG  1 
ATOM   6231 C CD1 . PHE D 2 73  ? 35.415 45.867 16.536  1.00 96.43  ? 175  PHE D CD1 1 
ATOM   6232 C CD2 . PHE D 2 73  ? 36.251 45.970 18.770  1.00 94.48  ? 175  PHE D CD2 1 
ATOM   6233 C CE1 . PHE D 2 73  ? 36.464 46.671 16.106  1.00 96.05  ? 175  PHE D CE1 1 
ATOM   6234 C CE2 . PHE D 2 73  ? 37.298 46.770 18.347  1.00 94.06  ? 175  PHE D CE2 1 
ATOM   6235 C CZ  . PHE D 2 73  ? 37.403 47.121 17.015  1.00 95.16  ? 175  PHE D CZ  1 
ATOM   6236 N N   . THR D 2 74  ? 36.182 42.665 19.086  1.00 94.80  ? 176  THR D N   1 
ATOM   6237 C CA  . THR D 2 74  ? 37.556 42.232 19.263  1.00 97.14  ? 176  THR D CA  1 
ATOM   6238 C C   . THR D 2 74  ? 37.856 40.776 18.914  1.00 100.76 ? 176  THR D C   1 
ATOM   6239 O O   . THR D 2 74  ? 38.972 40.463 18.489  1.00 102.28 ? 176  THR D O   1 
ATOM   6240 C CB  . THR D 2 74  ? 37.997 42.494 20.683  1.00 95.83  ? 176  THR D CB  1 
ATOM   6241 O OG1 . THR D 2 74  ? 37.226 41.689 21.576  1.00 96.95  ? 176  THR D OG1 1 
ATOM   6242 C CG2 . THR D 2 74  ? 37.775 43.942 21.021  1.00 95.16  ? 176  THR D CG2 1 
ATOM   6243 N N   . LYS D 2 75  ? 36.886 39.881 19.101  1.00 104.05 ? 177  LYS D N   1 
ATOM   6244 C CA  . LYS D 2 75  ? 37.097 38.468 18.761  1.00 106.53 ? 177  LYS D CA  1 
ATOM   6245 C C   . LYS D 2 75  ? 37.229 38.306 17.245  1.00 108.08 ? 177  LYS D C   1 
ATOM   6246 O O   . LYS D 2 75  ? 37.697 37.276 16.751  1.00 108.03 ? 177  LYS D O   1 
ATOM   6247 C CB  . LYS D 2 75  ? 35.948 37.596 19.276  1.00 106.65 ? 177  LYS D CB  1 
ATOM   6248 C CG  . LYS D 2 75  ? 35.919 37.414 20.785  1.00 107.58 ? 177  LYS D CG  1 
ATOM   6249 C CD  . LYS D 2 75  ? 35.225 36.109 21.152  1.00 107.60 ? 177  LYS D CD  1 
ATOM   6250 C CE  . LYS D 2 75  ? 33.911 35.958 20.403  1.00 107.85 ? 177  LYS D CE  1 
ATOM   6251 N NZ  . LYS D 2 75  ? 33.341 34.585 20.514  1.00 108.41 ? 177  LYS D NZ  1 
ATOM   6252 N N   . ASP D 2 76  ? 36.796 39.334 16.518  1.00 110.06 ? 178  ASP D N   1 
ATOM   6253 C CA  . ASP D 2 76  ? 36.886 39.376 15.065  1.00 112.15 ? 178  ASP D CA  1 
ATOM   6254 C C   . ASP D 2 76  ? 38.149 40.207 14.776  1.00 113.06 ? 178  ASP D C   1 
ATOM   6255 O O   . ASP D 2 76  ? 38.142 41.093 13.917  1.00 113.43 ? 178  ASP D O   1 
ATOM   6256 C CB  . ASP D 2 76  ? 35.637 40.062 14.480  1.00 112.93 ? 178  ASP D CB  1 
ATOM   6257 C CG  . ASP D 2 76  ? 35.451 39.801 12.983  1.00 113.94 ? 178  ASP D CG  1 
ATOM   6258 O OD1 . ASP D 2 76  ? 35.301 38.622 12.588  1.00 113.45 ? 178  ASP D OD1 1 
ATOM   6259 O OD2 . ASP D 2 76  ? 35.442 40.781 12.203  1.00 114.90 ? 178  ASP D OD2 1 
ATOM   6260 N N   . LEU D 2 77  ? 39.216 39.916 15.529  1.00 113.77 ? 179  LEU D N   1 
ATOM   6261 C CA  . LEU D 2 77  ? 40.519 40.582 15.409  1.00 114.24 ? 179  LEU D CA  1 
ATOM   6262 C C   . LEU D 2 77  ? 41.652 39.614 15.789  1.00 114.54 ? 179  LEU D C   1 
ATOM   6263 O O   . LEU D 2 77  ? 41.881 39.328 16.973  1.00 114.00 ? 179  LEU D O   1 
ATOM   6264 C CB  . LEU D 2 77  ? 40.566 41.828 16.296  1.00 113.80 ? 179  LEU D CB  1 
ATOM   6265 C CG  . LEU D 2 77  ? 39.673 42.988 15.838  1.00 114.12 ? 179  LEU D CG  1 
ATOM   6266 C CD1 . LEU D 2 77  ? 39.728 44.095 16.872  1.00 114.36 ? 179  LEU D CD1 1 
ATOM   6267 C CD2 . LEU D 2 77  ? 40.121 43.508 14.474  1.00 113.43 ? 179  LEU D CD2 1 
ATOM   6268 N N   . PRO D 2 78  ? 42.381 39.116 14.768  1.00 114.62 ? 180  PRO D N   1 
ATOM   6269 C CA  . PRO D 2 78  ? 43.511 38.176 14.754  1.00 114.56 ? 180  PRO D CA  1 
ATOM   6270 C C   . PRO D 2 78  ? 44.564 38.353 15.842  1.00 114.38 ? 180  PRO D C   1 
ATOM   6271 O O   . PRO D 2 78  ? 44.968 37.391 16.501  1.00 113.93 ? 180  PRO D O   1 
ATOM   6272 C CB  . PRO D 2 78  ? 44.104 38.382 13.362  1.00 114.92 ? 180  PRO D CB  1 
ATOM   6273 C CG  . PRO D 2 78  ? 42.921 38.725 12.546  1.00 114.32 ? 180  PRO D CG  1 
ATOM   6274 C CD  . PRO D 2 78  ? 42.202 39.706 13.428  1.00 114.23 ? 180  PRO D CD  1 
ATOM   6275 N N   . VAL D 2 79  ? 45.013 39.590 16.001  1.00 114.31 ? 181  VAL D N   1 
ATOM   6276 C CA  . VAL D 2 79  ? 46.035 39.939 16.975  1.00 114.86 ? 181  VAL D CA  1 
ATOM   6277 C C   . VAL D 2 79  ? 45.593 39.804 18.438  1.00 115.36 ? 181  VAL D C   1 
ATOM   6278 O O   . VAL D 2 79  ? 46.410 39.509 19.320  1.00 115.66 ? 181  VAL D O   1 
ATOM   6279 C CB  . VAL D 2 79  ? 46.524 41.367 16.712  1.00 114.63 ? 181  VAL D CB  1 
ATOM   6280 C CG1 . VAL D 2 79  ? 47.595 41.744 17.709  1.00 115.41 ? 181  VAL D CG1 1 
ATOM   6281 C CG2 . VAL D 2 79  ? 47.049 41.467 15.288  1.00 114.29 ? 181  VAL D CG2 1 
ATOM   6282 N N   . PHE D 2 80  ? 44.307 40.022 18.698  1.00 114.96 ? 182  PHE D N   1 
ATOM   6283 C CA  . PHE D 2 80  ? 43.792 39.897 20.052  1.00 114.20 ? 182  PHE D CA  1 
ATOM   6284 C C   . PHE D 2 80  ? 43.636 38.412 20.384  1.00 113.89 ? 182  PHE D C   1 
ATOM   6285 O O   . PHE D 2 80  ? 44.084 37.951 21.437  1.00 113.53 ? 182  PHE D O   1 
ATOM   6286 C CB  . PHE D 2 80  ? 42.441 40.598 20.182  1.00 113.96 ? 182  PHE D CB  1 
ATOM   6287 C CG  . PHE D 2 80  ? 42.031 40.844 21.605  1.00 114.09 ? 182  PHE D CG  1 
ATOM   6288 C CD1 . PHE D 2 80  ? 42.601 41.877 22.335  1.00 113.73 ? 182  PHE D CD1 1 
ATOM   6289 C CD2 . PHE D 2 80  ? 41.111 40.017 22.232  1.00 113.64 ? 182  PHE D CD2 1 
ATOM   6290 C CE1 . PHE D 2 80  ? 42.264 42.076 23.662  1.00 113.14 ? 182  PHE D CE1 1 
ATOM   6291 C CE2 . PHE D 2 80  ? 40.772 40.213 23.560  1.00 112.94 ? 182  PHE D CE2 1 
ATOM   6292 C CZ  . PHE D 2 80  ? 41.350 41.244 24.274  1.00 112.84 ? 182  PHE D CZ  1 
ATOM   6293 N N   . ARG D 2 81  ? 43.002 37.672 19.475  1.00 113.43 ? 183  ARG D N   1 
ATOM   6294 C CA  . ARG D 2 81  ? 42.789 36.232 19.640  1.00 112.71 ? 183  ARG D CA  1 
ATOM   6295 C C   . ARG D 2 81  ? 44.111 35.462 19.733  1.00 111.69 ? 183  ARG D C   1 
ATOM   6296 O O   . ARG D 2 81  ? 44.182 34.405 20.367  1.00 111.45 ? 183  ARG D O   1 
ATOM   6297 C CB  . ARG D 2 81  ? 41.959 35.688 18.474  1.00 113.17 ? 183  ARG D CB  1 
ATOM   6298 C CG  . ARG D 2 81  ? 40.513 36.156 18.466  1.00 112.99 ? 183  ARG D CG  1 
ATOM   6299 C CD  . ARG D 2 81  ? 39.823 35.751 19.749  1.00 113.38 ? 183  ARG D CD  1 
ATOM   6300 N NE  . ARG D 2 81  ? 40.033 34.336 20.040  1.00 114.17 ? 183  ARG D NE  1 
ATOM   6301 C CZ  . ARG D 2 81  ? 39.598 33.726 21.136  1.00 114.33 ? 183  ARG D CZ  1 
ATOM   6302 N NH1 . ARG D 2 81  ? 38.923 34.406 22.051  1.00 113.80 ? 183  ARG D NH1 1 
ATOM   6303 N NH2 . ARG D 2 81  ? 39.845 32.435 21.322  1.00 115.19 ? 183  ARG D NH2 1 
ATOM   6304 N N   . SER D 2 82  ? 45.147 35.993 19.085  1.00 110.53 ? 184  SER D N   1 
ATOM   6305 C CA  . SER D 2 82  ? 46.479 35.397 19.100  1.00 108.86 ? 184  SER D CA  1 
ATOM   6306 C C   . SER D 2 82  ? 46.978 35.288 20.542  1.00 107.35 ? 184  SER D C   1 
ATOM   6307 O O   . SER D 2 82  ? 47.540 34.268 20.939  1.00 107.80 ? 184  SER D O   1 
ATOM   6308 C CB  . SER D 2 82  ? 47.446 36.257 18.279  1.00 108.85 ? 184  SER D CB  1 
ATOM   6309 O OG  . SER D 2 82  ? 48.774 35.775 18.383  1.00 109.34 ? 184  SER D OG  1 
ATOM   6310 N N   . LEU D 2 83  ? 46.767 36.347 21.318  1.00 104.61 ? 185  LEU D N   1 
ATOM   6311 C CA  . LEU D 2 83  ? 47.176 36.380 22.716  1.00 101.92 ? 185  LEU D CA  1 
ATOM   6312 C C   . LEU D 2 83  ? 46.627 35.205 23.503  1.00 100.36 ? 185  LEU D C   1 
ATOM   6313 O O   . LEU D 2 83  ? 45.685 34.540 23.077  1.00 99.23  ? 185  LEU D O   1 
ATOM   6314 C CB  . LEU D 2 83  ? 46.691 37.672 23.369  1.00 101.76 ? 185  LEU D CB  1 
ATOM   6315 C CG  . LEU D 2 83  ? 47.573 38.903 23.195  1.00 101.77 ? 185  LEU D CG  1 
ATOM   6316 C CD1 . LEU D 2 83  ? 46.813 40.141 23.613  1.00 101.46 ? 185  LEU D CD1 1 
ATOM   6317 C CD2 . LEU D 2 83  ? 48.836 38.736 24.031  1.00 101.90 ? 185  LEU D CD2 1 
ATOM   6318 N N   . PRO D 2 84  ? 47.221 34.926 24.669  1.00 99.78  ? 186  PRO D N   1 
ATOM   6319 C CA  . PRO D 2 84  ? 46.730 33.812 25.478  1.00 100.50 ? 186  PRO D CA  1 
ATOM   6320 C C   . PRO D 2 84  ? 45.317 34.171 25.921  1.00 101.33 ? 186  PRO D C   1 
ATOM   6321 O O   . PRO D 2 84  ? 44.926 35.339 25.853  1.00 102.32 ? 186  PRO D O   1 
ATOM   6322 C CB  . PRO D 2 84  ? 47.715 33.777 26.645  1.00 99.48  ? 186  PRO D CB  1 
ATOM   6323 C CG  . PRO D 2 84  ? 48.098 35.211 26.794  1.00 99.09  ? 186  PRO D CG  1 
ATOM   6324 C CD  . PRO D 2 84  ? 48.313 35.632 25.358  1.00 99.42  ? 186  PRO D CD  1 
ATOM   6325 N N   . ILE D 2 85  ? 44.549 33.185 26.365  1.00 100.74 ? 187  ILE D N   1 
ATOM   6326 C CA  . ILE D 2 85  ? 43.189 33.456 26.812  1.00 100.06 ? 187  ILE D CA  1 
ATOM   6327 C C   . ILE D 2 85  ? 43.162 34.445 27.974  1.00 99.01  ? 187  ILE D C   1 
ATOM   6328 O O   . ILE D 2 85  ? 42.319 35.338 28.016  1.00 99.02  ? 187  ILE D O   1 
ATOM   6329 C CB  . ILE D 2 85  ? 42.481 32.158 27.234  1.00 101.11 ? 187  ILE D CB  1 
ATOM   6330 C CG1 . ILE D 2 85  ? 42.144 31.332 25.990  1.00 101.33 ? 187  ILE D CG1 1 
ATOM   6331 C CG2 . ILE D 2 85  ? 41.226 32.478 28.029  1.00 101.43 ? 187  ILE D CG2 1 
ATOM   6332 C CD1 . ILE D 2 85  ? 41.208 32.032 25.031  1.00 100.50 ? 187  ILE D CD1 1 
ATOM   6333 N N   . GLU D 2 86  ? 44.098 34.292 28.906  1.00 98.00  ? 188  GLU D N   1 
ATOM   6334 C CA  . GLU D 2 86  ? 44.180 35.159 30.077  1.00 96.49  ? 188  GLU D CA  1 
ATOM   6335 C C   . GLU D 2 86  ? 44.347 36.638 29.810  1.00 94.45  ? 188  GLU D C   1 
ATOM   6336 O O   . GLU D 2 86  ? 43.669 37.458 30.418  1.00 93.22  ? 188  GLU D O   1 
ATOM   6337 C CB  . GLU D 2 86  ? 45.322 34.725 30.968  1.00 98.12  ? 188  GLU D CB  1 
ATOM   6338 C CG  . GLU D 2 86  ? 44.924 33.747 32.012  1.00 102.15 ? 188  GLU D CG  1 
ATOM   6339 C CD  . GLU D 2 86  ? 45.873 33.801 33.173  1.00 105.88 ? 188  GLU D CD  1 
ATOM   6340 O OE1 . GLU D 2 86  ? 47.070 33.496 32.968  1.00 109.06 ? 188  GLU D OE1 1 
ATOM   6341 O OE2 . GLU D 2 86  ? 45.427 34.163 34.284  1.00 107.31 ? 188  GLU D OE2 1 
ATOM   6342 N N   . ASP D 2 87  ? 45.277 36.980 28.928  1.00 93.28  ? 189  ASP D N   1 
ATOM   6343 C CA  . ASP D 2 87  ? 45.525 38.378 28.609  1.00 92.02  ? 189  ASP D CA  1 
ATOM   6344 C C   . ASP D 2 87  ? 44.329 39.032 27.949  1.00 91.12  ? 189  ASP D C   1 
ATOM   6345 O O   . ASP D 2 87  ? 43.976 40.161 28.282  1.00 91.60  ? 189  ASP D O   1 
ATOM   6346 C CB  . ASP D 2 87  ? 46.751 38.522 27.712  1.00 92.59  ? 189  ASP D CB  1 
ATOM   6347 C CG  . ASP D 2 87  ? 48.036 38.318 28.466  1.00 91.92  ? 189  ASP D CG  1 
ATOM   6348 O OD1 . ASP D 2 87  ? 49.106 38.693 27.945  1.00 91.39  ? 189  ASP D OD1 1 
ATOM   6349 O OD2 . ASP D 2 87  ? 47.967 37.776 29.586  1.00 91.64  ? 189  ASP D OD2 1 
ATOM   6350 N N   . GLN D 2 88  ? 43.709 38.335 27.005  1.00 89.27  ? 190  GLN D N   1 
ATOM   6351 C CA  . GLN D 2 88  ? 42.532 38.882 26.346  1.00 86.49  ? 190  GLN D CA  1 
ATOM   6352 C C   . GLN D 2 88  ? 41.583 39.339 27.450  1.00 83.77  ? 190  GLN D C   1 
ATOM   6353 O O   . GLN D 2 88  ? 41.070 40.456 27.431  1.00 82.82  ? 190  GLN D O   1 
ATOM   6354 C CB  . GLN D 2 88  ? 41.877 37.806 25.489  1.00 86.40  ? 190  GLN D CB  1 
ATOM   6355 C CG  . GLN D 2 88  ? 42.869 37.110 24.595  1.00 88.71  ? 190  GLN D CG  1 
ATOM   6356 C CD  . GLN D 2 88  ? 42.220 36.114 23.673  1.00 90.78  ? 190  GLN D CD  1 
ATOM   6357 O OE1 . GLN D 2 88  ? 41.486 36.488 22.758  1.00 91.98  ? 190  GLN D OE1 1 
ATOM   6358 N NE2 . GLN D 2 88  ? 42.482 34.830 23.906  1.00 92.18  ? 190  GLN D NE2 1 
ATOM   6359 N N   . ILE D 2 89  ? 41.372 38.468 28.426  1.00 81.01  ? 191  ILE D N   1 
ATOM   6360 C CA  . ILE D 2 89  ? 40.510 38.783 29.540  1.00 78.88  ? 191  ILE D CA  1 
ATOM   6361 C C   . ILE D 2 89  ? 40.938 40.067 30.236  1.00 78.58  ? 191  ILE D C   1 
ATOM   6362 O O   . ILE D 2 89  ? 40.140 40.986 30.363  1.00 79.59  ? 191  ILE D O   1 
ATOM   6363 C CB  . ILE D 2 89  ? 40.504 37.650 30.549  1.00 78.18  ? 191  ILE D CB  1 
ATOM   6364 C CG1 . ILE D 2 89  ? 39.802 36.435 29.941  1.00 78.52  ? 191  ILE D CG1 1 
ATOM   6365 C CG2 . ILE D 2 89  ? 39.831 38.108 31.818  1.00 77.16  ? 191  ILE D CG2 1 
ATOM   6366 C CD1 . ILE D 2 89  ? 39.878 35.182 30.795  1.00 79.69  ? 191  ILE D CD1 1 
ATOM   6367 N N   . SER D 2 90  ? 42.191 40.137 30.681  1.00 77.78  ? 192  SER D N   1 
ATOM   6368 C CA  . SER D 2 90  ? 42.703 41.336 31.362  1.00 75.86  ? 192  SER D CA  1 
ATOM   6369 C C   . SER D 2 90  ? 42.554 42.594 30.515  1.00 74.18  ? 192  SER D C   1 
ATOM   6370 O O   . SER D 2 90  ? 42.353 43.692 31.035  1.00 73.52  ? 192  SER D O   1 
ATOM   6371 C CB  . SER D 2 90  ? 44.175 41.159 31.721  1.00 75.68  ? 192  SER D CB  1 
ATOM   6372 O OG  . SER D 2 90  ? 44.352 40.019 32.532  1.00 76.26  ? 192  SER D OG  1 
ATOM   6373 N N   . LEU D 2 91  ? 42.674 42.429 29.207  1.00 72.84  ? 193  LEU D N   1 
ATOM   6374 C CA  . LEU D 2 91  ? 42.536 43.538 28.284  1.00 72.95  ? 193  LEU D CA  1 
ATOM   6375 C C   . LEU D 2 91  ? 41.070 43.960 28.204  1.00 72.91  ? 193  LEU D C   1 
ATOM   6376 O O   . LEU D 2 91  ? 40.764 45.146 28.063  1.00 74.56  ? 193  LEU D O   1 
ATOM   6377 C CB  . LEU D 2 91  ? 43.031 43.119 26.906  1.00 73.81  ? 193  LEU D CB  1 
ATOM   6378 C CG  . LEU D 2 91  ? 44.478 42.631 26.891  1.00 74.11  ? 193  LEU D CG  1 
ATOM   6379 C CD1 . LEU D 2 91  ? 44.852 42.157 25.492  1.00 73.76  ? 193  LEU D CD1 1 
ATOM   6380 C CD2 . LEU D 2 91  ? 45.391 43.758 27.354  1.00 74.37  ? 193  LEU D CD2 1 
ATOM   6381 N N   . LEU D 2 92  ? 40.170 42.983 28.287  1.00 71.38  ? 194  LEU D N   1 
ATOM   6382 C CA  . LEU D 2 92  ? 38.732 43.238 28.244  1.00 69.16  ? 194  LEU D CA  1 
ATOM   6383 C C   . LEU D 2 92  ? 38.197 43.774 29.572  1.00 68.68  ? 194  LEU D C   1 
ATOM   6384 O O   . LEU D 2 92  ? 37.208 44.500 29.597  1.00 69.96  ? 194  LEU D O   1 
ATOM   6385 C CB  . LEU D 2 92  ? 37.976 41.961 27.895  1.00 66.36  ? 194  LEU D CB  1 
ATOM   6386 C CG  . LEU D 2 92  ? 38.057 41.443 26.467  1.00 64.52  ? 194  LEU D CG  1 
ATOM   6387 C CD1 . LEU D 2 92  ? 37.508 40.047 26.438  1.00 65.81  ? 194  LEU D CD1 1 
ATOM   6388 C CD2 . LEU D 2 92  ? 37.274 42.330 25.533  1.00 63.78  ? 194  LEU D CD2 1 
ATOM   6389 N N   . LYS D 2 93  ? 38.842 43.403 30.674  1.00 66.57  ? 195  LYS D N   1 
ATOM   6390 C CA  . LYS D 2 93  ? 38.425 43.854 31.993  1.00 64.64  ? 195  LYS D CA  1 
ATOM   6391 C C   . LYS D 2 93  ? 38.805 45.312 32.246  1.00 65.33  ? 195  LYS D C   1 
ATOM   6392 O O   . LYS D 2 93  ? 38.209 45.987 33.089  1.00 66.06  ? 195  LYS D O   1 
ATOM   6393 C CB  . LYS D 2 93  ? 39.049 42.966 33.069  1.00 63.21  ? 195  LYS D CB  1 
ATOM   6394 C CG  . LYS D 2 93  ? 38.362 41.626 33.251  1.00 61.73  ? 195  LYS D CG  1 
ATOM   6395 C CD  . LYS D 2 93  ? 39.126 40.752 34.223  1.00 60.40  ? 195  LYS D CD  1 
ATOM   6396 C CE  . LYS D 2 93  ? 39.568 41.544 35.445  1.00 60.00  ? 195  LYS D CE  1 
ATOM   6397 N NZ  . LYS D 2 93  ? 38.448 42.155 36.203  1.00 58.23  ? 195  LYS D NZ  1 
ATOM   6398 N N   . GLY D 2 94  ? 39.789 45.809 31.514  1.00 64.90  ? 196  GLY D N   1 
ATOM   6399 C CA  . GLY D 2 94  ? 40.190 47.180 31.733  1.00 66.83  ? 196  GLY D CA  1 
ATOM   6400 C C   . GLY D 2 94  ? 39.692 48.166 30.699  1.00 67.36  ? 196  GLY D C   1 
ATOM   6401 O O   . GLY D 2 94  ? 39.577 49.362 30.985  1.00 67.47  ? 196  GLY D O   1 
ATOM   6402 N N   . ALA D 2 95  ? 39.381 47.681 29.502  1.00 67.18  ? 197  ALA D N   1 
ATOM   6403 C CA  . ALA D 2 95  ? 38.938 48.581 28.455  1.00 68.87  ? 197  ALA D CA  1 
ATOM   6404 C C   . ALA D 2 95  ? 37.533 48.384 27.905  1.00 70.34  ? 197  ALA D C   1 
ATOM   6405 O O   . ALA D 2 95  ? 37.060 49.243 27.161  1.00 72.20  ? 197  ALA D O   1 
ATOM   6406 C CB  . ALA D 2 95  ? 39.931 48.555 27.323  1.00 67.94  ? 197  ALA D CB  1 
ATOM   6407 N N   . ALA D 2 96  ? 36.860 47.284 28.256  1.00 70.86  ? 198  ALA D N   1 
ATOM   6408 C CA  . ALA D 2 96  ? 35.496 47.025 27.755  1.00 70.06  ? 198  ALA D CA  1 
ATOM   6409 C C   . ALA D 2 96  ? 34.530 48.175 28.056  1.00 68.85  ? 198  ALA D C   1 
ATOM   6410 O O   . ALA D 2 96  ? 33.815 48.637 27.164  1.00 68.29  ? 198  ALA D O   1 
ATOM   6411 C CB  . ALA D 2 96  ? 34.948 45.719 28.335  1.00 69.31  ? 198  ALA D CB  1 
ATOM   6412 N N   . VAL D 2 97  ? 34.514 48.631 29.308  1.00 67.00  ? 199  VAL D N   1 
ATOM   6413 C CA  . VAL D 2 97  ? 33.648 49.737 29.712  1.00 64.65  ? 199  VAL D CA  1 
ATOM   6414 C C   . VAL D 2 97  ? 34.066 51.052 29.028  1.00 65.52  ? 199  VAL D C   1 
ATOM   6415 O O   . VAL D 2 97  ? 33.213 51.846 28.610  1.00 65.96  ? 199  VAL D O   1 
ATOM   6416 C CB  . VAL D 2 97  ? 33.669 49.919 31.258  1.00 62.75  ? 199  VAL D CB  1 
ATOM   6417 C CG1 . VAL D 2 97  ? 32.888 51.162 31.672  1.00 58.72  ? 199  VAL D CG1 1 
ATOM   6418 C CG2 . VAL D 2 97  ? 33.087 48.695 31.920  1.00 60.23  ? 199  VAL D CG2 1 
ATOM   6419 N N   . GLU D 2 98  ? 35.376 51.270 28.910  1.00 64.35  ? 200  GLU D N   1 
ATOM   6420 C CA  . GLU D 2 98  ? 35.915 52.474 28.284  1.00 62.08  ? 200  GLU D CA  1 
ATOM   6421 C C   . GLU D 2 98  ? 35.608 52.531 26.804  1.00 60.62  ? 200  GLU D C   1 
ATOM   6422 O O   . GLU D 2 98  ? 35.409 53.609 26.252  1.00 60.74  ? 200  GLU D O   1 
ATOM   6423 C CB  . GLU D 2 98  ? 37.420 52.531 28.495  1.00 63.51  ? 200  GLU D CB  1 
ATOM   6424 C CG  . GLU D 2 98  ? 37.787 53.002 29.868  1.00 66.04  ? 200  GLU D CG  1 
ATOM   6425 C CD  . GLU D 2 98  ? 39.191 52.643 30.251  1.00 67.45  ? 200  GLU D CD  1 
ATOM   6426 O OE1 . GLU D 2 98  ? 40.094 52.787 29.398  1.00 68.29  ? 200  GLU D OE1 1 
ATOM   6427 O OE2 . GLU D 2 98  ? 39.386 52.225 31.412  1.00 68.73  ? 200  GLU D OE2 1 
ATOM   6428 N N   . ILE D 2 99  ? 35.579 51.362 26.172  1.00 58.37  ? 201  ILE D N   1 
ATOM   6429 C CA  . ILE D 2 99  ? 35.285 51.244 24.752  1.00 57.40  ? 201  ILE D CA  1 
ATOM   6430 C C   . ILE D 2 99  ? 33.847 51.609 24.463  1.00 56.98  ? 201  ILE D C   1 
ATOM   6431 O O   . ILE D 2 99  ? 33.536 52.236 23.453  1.00 56.51  ? 201  ILE D O   1 
ATOM   6432 C CB  . ILE D 2 99  ? 35.490 49.827 24.271  1.00 57.67  ? 201  ILE D CB  1 
ATOM   6433 C CG1 . ILE D 2 99  ? 36.985 49.501 24.294  1.00 57.94  ? 201  ILE D CG1 1 
ATOM   6434 C CG2 . ILE D 2 99  ? 34.852 49.658 22.894  1.00 56.44  ? 201  ILE D CG2 1 
ATOM   6435 C CD1 . ILE D 2 99  ? 37.294 48.023 24.188  1.00 57.31  ? 201  ILE D CD1 1 
ATOM   6436 N N   . CYS D 2 100 ? 32.964 51.187 25.352  1.00 56.33  ? 202  CYS D N   1 
ATOM   6437 C CA  . CYS D 2 100 ? 31.562 51.491 25.205  1.00 56.13  ? 202  CYS D CA  1 
ATOM   6438 C C   . CYS D 2 100 ? 31.339 52.989 25.125  1.00 56.84  ? 202  CYS D C   1 
ATOM   6439 O O   . CYS D 2 100 ? 30.503 53.446 24.361  1.00 55.55  ? 202  CYS D O   1 
ATOM   6440 C CB  . CYS D 2 100 ? 30.796 50.890 26.366  1.00 54.63  ? 202  CYS D CB  1 
ATOM   6441 S SG  . CYS D 2 100 ? 30.734 49.114 26.207  1.00 54.83  ? 202  CYS D SG  1 
ATOM   6442 N N   . HIS D 2 101 ? 32.087 53.757 25.904  1.00 59.53  ? 203  HIS D N   1 
ATOM   6443 C CA  . HIS D 2 101 ? 31.955 55.206 25.869  1.00 64.44  ? 203  HIS D CA  1 
ATOM   6444 C C   . HIS D 2 101 ? 32.481 55.802 24.562  1.00 66.10  ? 203  HIS D C   1 
ATOM   6445 O O   . HIS D 2 101 ? 31.936 56.781 24.045  1.00 66.39  ? 203  HIS D O   1 
ATOM   6446 C CB  . HIS D 2 101 ? 32.680 55.816 27.058  1.00 67.06  ? 203  HIS D CB  1 
ATOM   6447 C CG  . HIS D 2 101 ? 32.046 55.478 28.366  1.00 70.55  ? 203  HIS D CG  1 
ATOM   6448 N ND1 . HIS D 2 101 ? 30.762 55.862 28.688  1.00 70.32  ? 203  HIS D ND1 1 
ATOM   6449 C CD2 . HIS D 2 101 ? 32.505 54.769 29.424  1.00 72.07  ? 203  HIS D CD2 1 
ATOM   6450 C CE1 . HIS D 2 101 ? 30.456 55.405 29.887  1.00 70.91  ? 203  HIS D CE1 1 
ATOM   6451 N NE2 . HIS D 2 101 ? 31.496 54.738 30.355  1.00 73.07  ? 203  HIS D NE2 1 
ATOM   6452 N N   . ILE D 2 102 ? 33.547 55.213 24.035  1.00 67.31  ? 204  ILE D N   1 
ATOM   6453 C CA  . ILE D 2 102 ? 34.121 55.659 22.771  1.00 67.71  ? 204  ILE D CA  1 
ATOM   6454 C C   . ILE D 2 102 ? 33.043 55.462 21.707  1.00 66.16  ? 204  ILE D C   1 
ATOM   6455 O O   . ILE D 2 102 ? 32.553 56.417 21.100  1.00 64.29  ? 204  ILE D O   1 
ATOM   6456 C CB  . ILE D 2 102 ? 35.368 54.796 22.403  1.00 70.06  ? 204  ILE D CB  1 
ATOM   6457 C CG1 . ILE D 2 102 ? 36.432 54.936 23.499  1.00 69.75  ? 204  ILE D CG1 1 
ATOM   6458 C CG2 . ILE D 2 102 ? 35.914 55.200 21.031  1.00 70.18  ? 204  ILE D CG2 1 
ATOM   6459 C CD1 . ILE D 2 102 ? 37.640 54.058 23.301  1.00 68.49  ? 204  ILE D CD1 1 
ATOM   6460 N N   . VAL D 2 103 ? 32.677 54.196 21.525  1.00 65.28  ? 205  VAL D N   1 
ATOM   6461 C CA  . VAL D 2 103 ? 31.669 53.756 20.570  1.00 64.77  ? 205  VAL D CA  1 
ATOM   6462 C C   . VAL D 2 103 ? 30.310 54.453 20.749  1.00 65.22  ? 205  VAL D C   1 
ATOM   6463 O O   . VAL D 2 103 ? 29.649 54.829 19.777  1.00 63.72  ? 205  VAL D O   1 
ATOM   6464 C CB  . VAL D 2 103 ? 31.481 52.232 20.695  1.00 63.51  ? 205  VAL D CB  1 
ATOM   6465 C CG1 . VAL D 2 103 ? 30.690 51.705 19.521  1.00 63.52  ? 205  VAL D CG1 1 
ATOM   6466 C CG2 . VAL D 2 103 ? 32.837 51.557 20.779  1.00 61.88  ? 205  VAL D CG2 1 
ATOM   6467 N N   . LEU D 2 104 ? 29.908 54.621 22.003  1.00 66.20  ? 206  LEU D N   1 
ATOM   6468 C CA  . LEU D 2 104 ? 28.645 55.264 22.356  1.00 67.41  ? 206  LEU D CA  1 
ATOM   6469 C C   . LEU D 2 104 ? 28.647 56.781 22.108  1.00 68.35  ? 206  LEU D C   1 
ATOM   6470 O O   . LEU D 2 104 ? 27.595 57.386 21.915  1.00 69.13  ? 206  LEU D O   1 
ATOM   6471 C CB  . LEU D 2 104 ? 28.338 55.002 23.833  1.00 66.59  ? 206  LEU D CB  1 
ATOM   6472 C CG  . LEU D 2 104 ? 26.951 55.334 24.377  1.00 65.42  ? 206  LEU D CG  1 
ATOM   6473 C CD1 . LEU D 2 104 ? 26.052 54.122 24.247  1.00 64.47  ? 206  LEU D CD1 1 
ATOM   6474 C CD2 . LEU D 2 104 ? 27.063 55.730 25.830  1.00 64.81  ? 206  LEU D CD2 1 
ATOM   6475 N N   . ASN D 2 105 ? 29.824 57.396 22.122  1.00 68.89  ? 207  ASN D N   1 
ATOM   6476 C CA  . ASN D 2 105 ? 29.930 58.835 21.914  1.00 67.92  ? 207  ASN D CA  1 
ATOM   6477 C C   . ASN D 2 105 ? 29.446 59.268 20.533  1.00 67.86  ? 207  ASN D C   1 
ATOM   6478 O O   . ASN D 2 105 ? 28.968 60.387 20.346  1.00 67.89  ? 207  ASN D O   1 
ATOM   6479 C CB  . ASN D 2 105 ? 31.372 59.276 22.119  1.00 66.88  ? 207  ASN D CB  1 
ATOM   6480 C CG  . ASN D 2 105 ? 31.545 60.757 21.944  1.00 67.23  ? 207  ASN D CG  1 
ATOM   6481 O OD1 . ASN D 2 105 ? 31.959 61.224 20.881  1.00 68.62  ? 207  ASN D OD1 1 
ATOM   6482 N ND2 . ASN D 2 105 ? 31.211 61.517 22.983  1.00 65.03  ? 207  ASN D ND2 1 
ATOM   6483 N N   . THR D 2 106 ? 29.567 58.366 19.569  1.00 68.18  ? 208  THR D N   1 
ATOM   6484 C CA  . THR D 2 106 ? 29.149 58.628 18.202  1.00 68.57  ? 208  THR D CA  1 
ATOM   6485 C C   . THR D 2 106 ? 27.673 58.997 18.087  1.00 69.05  ? 208  THR D C   1 
ATOM   6486 O O   . THR D 2 106 ? 27.263 59.616 17.099  1.00 70.43  ? 208  THR D O   1 
ATOM   6487 C CB  . THR D 2 106 ? 29.415 57.403 17.317  1.00 69.45  ? 208  THR D CB  1 
ATOM   6488 O OG1 . THR D 2 106 ? 28.601 56.303 17.750  1.00 69.29  ? 208  THR D OG1 1 
ATOM   6489 C CG2 . THR D 2 106 ? 30.881 57.010 17.408  1.00 69.98  ? 208  THR D CG2 1 
ATOM   6490 N N   . THR D 2 107 ? 26.879 58.612 19.089  1.00 67.91  ? 209  THR D N   1 
ATOM   6491 C CA  . THR D 2 107 ? 25.443 58.897 19.105  1.00 65.73  ? 209  THR D CA  1 
ATOM   6492 C C   . THR D 2 107 ? 25.083 60.195 19.844  1.00 65.87  ? 209  THR D C   1 
ATOM   6493 O O   . THR D 2 107 ? 24.088 60.851 19.521  1.00 66.51  ? 209  THR D O   1 
ATOM   6494 C CB  . THR D 2 107 ? 24.650 57.735 19.748  1.00 63.80  ? 209  THR D CB  1 
ATOM   6495 O OG1 . THR D 2 107 ? 24.866 57.730 21.163  1.00 62.50  ? 209  THR D OG1 1 
ATOM   6496 C CG2 . THR D 2 107 ? 25.092 56.404 19.163  1.00 60.97  ? 209  THR D CG2 1 
ATOM   6497 N N   . PHE D 2 108 ? 25.892 60.566 20.830  1.00 64.62  ? 210  PHE D N   1 
ATOM   6498 C CA  . PHE D 2 108 ? 25.650 61.774 21.603  1.00 64.93  ? 210  PHE D CA  1 
ATOM   6499 C C   . PHE D 2 108 ? 25.275 62.962 20.704  1.00 67.05  ? 210  PHE D C   1 
ATOM   6500 O O   . PHE D 2 108 ? 25.835 63.150 19.618  1.00 67.32  ? 210  PHE D O   1 
ATOM   6501 C CB  . PHE D 2 108 ? 26.907 62.112 22.420  1.00 62.31  ? 210  PHE D CB  1 
ATOM   6502 C CG  . PHE D 2 108 ? 26.667 63.060 23.578  1.00 59.52  ? 210  PHE D CG  1 
ATOM   6503 C CD1 . PHE D 2 108 ? 26.128 62.602 24.772  1.00 57.13  ? 210  PHE D CD1 1 
ATOM   6504 C CD2 . PHE D 2 108 ? 27.022 64.404 23.484  1.00 58.41  ? 210  PHE D CD2 1 
ATOM   6505 C CE1 . PHE D 2 108 ? 25.952 63.464 25.851  1.00 56.65  ? 210  PHE D CE1 1 
ATOM   6506 C CE2 . PHE D 2 108 ? 26.846 65.274 24.562  1.00 56.73  ? 210  PHE D CE2 1 
ATOM   6507 C CZ  . PHE D 2 108 ? 26.312 64.801 25.743  1.00 55.90  ? 210  PHE D CZ  1 
ATOM   6508 N N   . CYS D 2 109 ? 24.292 63.738 21.152  1.00 69.55  ? 211  CYS D N   1 
ATOM   6509 C CA  . CYS D 2 109 ? 23.860 64.941 20.448  1.00 71.14  ? 211  CYS D CA  1 
ATOM   6510 C C   . CYS D 2 109 ? 24.309 66.045 21.381  1.00 73.12  ? 211  CYS D C   1 
ATOM   6511 O O   . CYS D 2 109 ? 23.927 66.059 22.552  1.00 72.73  ? 211  CYS D O   1 
ATOM   6512 C CB  . CYS D 2 109 ? 22.341 65.005 20.307  1.00 70.31  ? 211  CYS D CB  1 
ATOM   6513 S SG  . CYS D 2 109 ? 21.737 66.675 19.944  1.00 68.64  ? 211  CYS D SG  1 
ATOM   6514 N N   . LEU D 2 110 ? 25.122 66.965 20.876  1.00 75.11  ? 212  LEU D N   1 
ATOM   6515 C CA  . LEU D 2 110 ? 25.630 68.044 21.713  1.00 76.81  ? 212  LEU D CA  1 
ATOM   6516 C C   . LEU D 2 110 ? 24.607 69.095 22.178  1.00 78.04  ? 212  LEU D C   1 
ATOM   6517 O O   . LEU D 2 110 ? 24.691 69.560 23.319  1.00 77.87  ? 212  LEU D O   1 
ATOM   6518 C CB  . LEU D 2 110 ? 26.818 68.735 21.020  1.00 76.96  ? 212  LEU D CB  1 
ATOM   6519 C CG  . LEU D 2 110 ? 28.148 67.973 20.912  1.00 75.54  ? 212  LEU D CG  1 
ATOM   6520 C CD1 . LEU D 2 110 ? 29.190 68.880 20.299  1.00 73.73  ? 212  LEU D CD1 1 
ATOM   6521 C CD2 . LEU D 2 110 ? 28.620 67.520 22.287  1.00 76.20  ? 212  LEU D CD2 1 
ATOM   6522 N N   . GLN D 2 111 ? 23.650 69.470 21.323  1.00 79.50  ? 213  GLN D N   1 
ATOM   6523 C CA  . GLN D 2 111 ? 22.649 70.475 21.707  1.00 80.01  ? 213  GLN D CA  1 
ATOM   6524 C C   . GLN D 2 111 ? 21.814 69.949 22.855  1.00 79.70  ? 213  GLN D C   1 
ATOM   6525 O O   . GLN D 2 111 ? 21.857 70.459 23.978  1.00 79.87  ? 213  GLN D O   1 
ATOM   6526 C CB  . GLN D 2 111 ? 21.679 70.791 20.574  1.00 81.47  ? 213  GLN D CB  1 
ATOM   6527 C CG  . GLN D 2 111 ? 22.080 70.352 19.198  1.00 86.64  ? 213  GLN D CG  1 
ATOM   6528 C CD  . GLN D 2 111 ? 20.863 70.252 18.290  1.00 90.98  ? 213  GLN D CD  1 
ATOM   6529 O OE1 . GLN D 2 111 ? 19.961 71.105 18.338  1.00 91.79  ? 213  GLN D OE1 1 
ATOM   6530 N NE2 . GLN D 2 111 ? 20.826 69.208 17.457  1.00 92.89  ? 213  GLN D NE2 1 
ATOM   6531 N N   . THR D 2 112 ? 21.029 68.927 22.544  1.00 78.97  ? 214  THR D N   1 
ATOM   6532 C CA  . THR D 2 112 ? 20.165 68.300 23.524  1.00 79.08  ? 214  THR D CA  1 
ATOM   6533 C C   . THR D 2 112 ? 20.940 67.833 24.767  1.00 79.37  ? 214  THR D C   1 
ATOM   6534 O O   . THR D 2 112 ? 20.479 68.005 25.898  1.00 78.58  ? 214  THR D O   1 
ATOM   6535 C CB  . THR D 2 112 ? 19.432 67.099 22.886  1.00 78.61  ? 214  THR D CB  1 
ATOM   6536 O OG1 . THR D 2 112 ? 20.391 66.170 22.363  1.00 78.29  ? 214  THR D OG1 1 
ATOM   6537 C CG2 . THR D 2 112 ? 18.550 67.565 21.746  1.00 78.10  ? 214  THR D CG2 1 
ATOM   6538 N N   . GLN D 2 113 ? 22.125 67.269 24.535  1.00 80.34  ? 215  GLN D N   1 
ATOM   6539 C CA  . GLN D 2 113 ? 22.993 66.728 25.585  1.00 80.58  ? 215  GLN D CA  1 
ATOM   6540 C C   . GLN D 2 113 ? 22.459 65.335 25.917  1.00 79.07  ? 215  GLN D C   1 
ATOM   6541 O O   . GLN D 2 113 ? 22.528 64.882 27.058  1.00 77.85  ? 215  GLN D O   1 
ATOM   6542 C CB  . GLN D 2 113 ? 22.945 67.604 26.842  1.00 83.29  ? 215  GLN D CB  1 
ATOM   6543 C CG  . GLN D 2 113 ? 24.222 67.554 27.662  1.00 87.35  ? 215  GLN D CG  1 
ATOM   6544 C CD  . GLN D 2 113 ? 25.297 68.481 27.111  1.00 89.63  ? 215  GLN D CD  1 
ATOM   6545 O OE1 . GLN D 2 113 ? 25.263 69.693 27.348  1.00 89.56  ? 215  GLN D OE1 1 
ATOM   6546 N NE2 . GLN D 2 113 ? 26.251 67.919 26.361  1.00 89.64  ? 215  GLN D NE2 1 
ATOM   6547 N N   . ASN D 2 114 ? 21.927 64.666 24.898  1.00 77.86  ? 216  ASN D N   1 
ATOM   6548 C CA  . ASN D 2 114 ? 21.320 63.353 25.057  1.00 76.68  ? 216  ASN D CA  1 
ATOM   6549 C C   . ASN D 2 114 ? 21.879 62.398 24.025  1.00 75.62  ? 216  ASN D C   1 
ATOM   6550 O O   . ASN D 2 114 ? 22.445 62.820 23.020  1.00 73.48  ? 216  ASN D O   1 
ATOM   6551 C CB  . ASN D 2 114 ? 19.797 63.426 24.834  1.00 77.93  ? 216  ASN D CB  1 
ATOM   6552 C CG  . ASN D 2 114 ? 19.094 64.486 25.699  1.00 79.34  ? 216  ASN D CG  1 
ATOM   6553 O OD1 . ASN D 2 114 ? 18.067 65.033 25.290  1.00 79.87  ? 216  ASN D OD1 1 
ATOM   6554 N ND2 . ASN D 2 114 ? 19.622 64.756 26.894  1.00 80.28  ? 216  ASN D ND2 1 
ATOM   6555 N N   . PHE D 2 115 ? 21.690 61.107 24.281  1.00 75.77  ? 217  PHE D N   1 
ATOM   6556 C CA  . PHE D 2 115 ? 22.135 60.055 23.379  1.00 75.99  ? 217  PHE D CA  1 
ATOM   6557 C C   . PHE D 2 115 ? 20.940 59.666 22.545  1.00 75.58  ? 217  PHE D C   1 
ATOM   6558 O O   . PHE D 2 115 ? 19.867 59.422 23.074  1.00 74.94  ? 217  PHE D O   1 
ATOM   6559 C CB  . PHE D 2 115 ? 22.642 58.837 24.156  1.00 76.09  ? 217  PHE D CB  1 
ATOM   6560 C CG  . PHE D 2 115 ? 23.942 59.078 24.878  1.00 77.69  ? 217  PHE D CG  1 
ATOM   6561 C CD1 . PHE D 2 115 ? 23.966 59.718 26.108  1.00 77.32  ? 217  PHE D CD1 1 
ATOM   6562 C CD2 . PHE D 2 115 ? 25.149 58.691 24.307  1.00 78.49  ? 217  PHE D CD2 1 
ATOM   6563 C CE1 . PHE D 2 115 ? 25.165 59.970 26.758  1.00 77.55  ? 217  PHE D CE1 1 
ATOM   6564 C CE2 . PHE D 2 115 ? 26.352 58.941 24.953  1.00 78.69  ? 217  PHE D CE2 1 
ATOM   6565 C CZ  . PHE D 2 115 ? 26.355 59.582 26.180  1.00 78.04  ? 217  PHE D CZ  1 
ATOM   6566 N N   . LEU D 2 116 ? 21.124 59.610 21.237  1.00 77.03  ? 218  LEU D N   1 
ATOM   6567 C CA  . LEU D 2 116 ? 20.022 59.275 20.349  1.00 79.29  ? 218  LEU D CA  1 
ATOM   6568 C C   . LEU D 2 116 ? 20.323 57.980 19.604  1.00 79.88  ? 218  LEU D C   1 
ATOM   6569 O O   . LEU D 2 116 ? 21.072 57.960 18.625  1.00 79.47  ? 218  LEU D O   1 
ATOM   6570 C CB  . LEU D 2 116 ? 19.783 60.435 19.376  1.00 80.76  ? 218  LEU D CB  1 
ATOM   6571 C CG  . LEU D 2 116 ? 19.812 61.834 20.022  1.00 81.33  ? 218  LEU D CG  1 
ATOM   6572 C CD1 . LEU D 2 116 ? 19.457 62.884 18.984  1.00 81.47  ? 218  LEU D CD1 1 
ATOM   6573 C CD2 . LEU D 2 116 ? 18.846 61.903 21.200  1.00 80.86  ? 218  LEU D CD2 1 
ATOM   6574 N N   . CYS D 2 117 ? 19.716 56.902 20.086  1.00 81.16  ? 219  CYS D N   1 
ATOM   6575 C CA  . CYS D 2 117 ? 19.916 55.567 19.535  1.00 82.23  ? 219  CYS D CA  1 
ATOM   6576 C C   . CYS D 2 117 ? 18.616 55.050 18.902  1.00 83.02  ? 219  CYS D C   1 
ATOM   6577 O O   . CYS D 2 117 ? 17.776 54.463 19.590  1.00 82.91  ? 219  CYS D O   1 
ATOM   6578 C CB  . CYS D 2 117 ? 20.373 54.635 20.667  1.00 82.61  ? 219  CYS D CB  1 
ATOM   6579 S SG  . CYS D 2 117 ? 21.435 55.423 21.953  1.00 81.57  ? 219  CYS D SG  1 
ATOM   6580 N N   . GLY D 2 118 ? 18.469 55.252 17.590  1.00 83.85  ? 220  GLY D N   1 
ATOM   6581 C CA  . GLY D 2 118 ? 17.252 54.849 16.893  1.00 82.93  ? 220  GLY D CA  1 
ATOM   6582 C C   . GLY D 2 118 ? 16.206 55.909 17.219  1.00 81.83  ? 220  GLY D C   1 
ATOM   6583 O O   . GLY D 2 118 ? 16.476 57.108 17.068  1.00 82.32  ? 220  GLY D O   1 
ATOM   6584 N N   . PRO D 2 119 ? 14.991 55.512 17.637  1.00 80.13  ? 221  PRO D N   1 
ATOM   6585 C CA  . PRO D 2 119 ? 13.957 56.498 17.983  1.00 77.71  ? 221  PRO D CA  1 
ATOM   6586 C C   . PRO D 2 119 ? 14.072 56.852 19.476  1.00 75.07  ? 221  PRO D C   1 
ATOM   6587 O O   . PRO D 2 119 ? 13.367 57.732 19.979  1.00 73.54  ? 221  PRO D O   1 
ATOM   6588 C CB  . PRO D 2 119 ? 12.664 55.762 17.657  1.00 78.16  ? 221  PRO D CB  1 
ATOM   6589 C CG  . PRO D 2 119 ? 13.001 54.359 18.040  1.00 78.46  ? 221  PRO D CG  1 
ATOM   6590 C CD  . PRO D 2 119 ? 14.396 54.175 17.460  1.00 79.79  ? 221  PRO D CD  1 
ATOM   6591 N N   . LEU D 2 120 ? 14.986 56.149 20.154  1.00 72.98  ? 222  LEU D N   1 
ATOM   6592 C CA  . LEU D 2 120 ? 15.266 56.299 21.579  1.00 70.35  ? 222  LEU D CA  1 
ATOM   6593 C C   . LEU D 2 120 ? 16.167 57.476 21.886  1.00 68.59  ? 222  LEU D C   1 
ATOM   6594 O O   . LEU D 2 120 ? 17.130 57.745 21.179  1.00 67.99  ? 222  LEU D O   1 
ATOM   6595 C CB  . LEU D 2 120 ? 15.919 55.029 22.131  1.00 69.63  ? 222  LEU D CB  1 
ATOM   6596 C CG  . LEU D 2 120 ? 15.082 53.749 22.090  1.00 70.59  ? 222  LEU D CG  1 
ATOM   6597 C CD1 . LEU D 2 120 ? 15.972 52.546 22.318  1.00 70.52  ? 222  LEU D CD1 1 
ATOM   6598 C CD2 . LEU D 2 120 ? 13.980 53.811 23.134  1.00 71.02  ? 222  LEU D CD2 1 
ATOM   6599 N N   . ARG D 2 121 ? 15.830 58.170 22.961  1.00 67.65  ? 223  ARG D N   1 
ATOM   6600 C CA  . ARG D 2 121 ? 16.580 59.317 23.423  1.00 67.39  ? 223  ARG D CA  1 
ATOM   6601 C C   . ARG D 2 121 ? 16.757 59.191 24.933  1.00 66.31  ? 223  ARG D C   1 
ATOM   6602 O O   . ARG D 2 121 ? 15.792 59.324 25.697  1.00 66.20  ? 223  ARG D O   1 
ATOM   6603 C CB  . ARG D 2 121 ? 15.842 60.625 23.090  1.00 69.59  ? 223  ARG D CB  1 
ATOM   6604 C CG  . ARG D 2 121 ? 16.391 61.838 23.855  1.00 74.27  ? 223  ARG D CG  1 
ATOM   6605 C CD  . ARG D 2 121 ? 15.842 63.178 23.376  1.00 77.44  ? 223  ARG D CD  1 
ATOM   6606 N NE  . ARG D 2 121 ? 16.092 63.408 21.951  1.00 82.36  ? 223  ARG D NE  1 
ATOM   6607 C CZ  . ARG D 2 121 ? 16.001 64.594 21.350  1.00 83.96  ? 223  ARG D CZ  1 
ATOM   6608 N NH1 . ARG D 2 121 ? 15.671 65.678 22.048  1.00 85.11  ? 223  ARG D NH1 1 
ATOM   6609 N NH2 . ARG D 2 121 ? 16.224 64.694 20.044  1.00 84.66  ? 223  ARG D NH2 1 
ATOM   6610 N N   . TYR D 2 122 ? 17.995 58.915 25.350  1.00 64.62  ? 224  TYR D N   1 
ATOM   6611 C CA  . TYR D 2 122 ? 18.341 58.784 26.767  1.00 60.62  ? 224  TYR D CA  1 
ATOM   6612 C C   . TYR D 2 122 ? 18.873 60.123 27.275  1.00 59.33  ? 224  TYR D C   1 
ATOM   6613 O O   . TYR D 2 122 ? 19.523 60.865 26.540  1.00 58.52  ? 224  TYR D O   1 
ATOM   6614 C CB  . TYR D 2 122 ? 19.419 57.722 26.967  1.00 57.75  ? 224  TYR D CB  1 
ATOM   6615 C CG  . TYR D 2 122 ? 19.082 56.354 26.434  1.00 55.71  ? 224  TYR D CG  1 
ATOM   6616 C CD1 . TYR D 2 122 ? 19.323 56.019 25.109  1.00 54.82  ? 224  TYR D CD1 1 
ATOM   6617 C CD2 . TYR D 2 122 ? 18.560 55.376 27.272  1.00 56.24  ? 224  TYR D CD2 1 
ATOM   6618 C CE1 . TYR D 2 122 ? 19.057 54.731 24.633  1.00 55.57  ? 224  TYR D CE1 1 
ATOM   6619 C CE2 . TYR D 2 122 ? 18.290 54.087 26.808  1.00 56.12  ? 224  TYR D CE2 1 
ATOM   6620 C CZ  . TYR D 2 122 ? 18.542 53.766 25.489  1.00 55.44  ? 224  TYR D CZ  1 
ATOM   6621 O OH  . TYR D 2 122 ? 18.297 52.481 25.042  1.00 53.26  ? 224  TYR D OH  1 
ATOM   6622 N N   . THR D 2 123 ? 18.594 60.438 28.530  1.00 57.99  ? 225  THR D N   1 
ATOM   6623 C CA  . THR D 2 123 ? 19.072 61.686 29.089  1.00 57.25  ? 225  THR D CA  1 
ATOM   6624 C C   . THR D 2 123 ? 19.743 61.411 30.408  1.00 57.21  ? 225  THR D C   1 
ATOM   6625 O O   . THR D 2 123 ? 19.711 60.290 30.924  1.00 57.98  ? 225  THR D O   1 
ATOM   6626 C CB  . THR D 2 123 ? 17.948 62.649 29.362  1.00 57.01  ? 225  THR D CB  1 
ATOM   6627 O OG1 . THR D 2 123 ? 17.112 62.098 30.377  1.00 57.70  ? 225  THR D OG1 1 
ATOM   6628 C CG2 . THR D 2 123 ? 17.133 62.877 28.123  1.00 59.11  ? 225  THR D CG2 1 
ATOM   6629 N N   . ILE D 2 124 ? 20.337 62.452 30.966  1.00 55.65  ? 226  ILE D N   1 
ATOM   6630 C CA  . ILE D 2 124 ? 21.034 62.310 32.228  1.00 56.26  ? 226  ILE D CA  1 
ATOM   6631 C C   . ILE D 2 124 ? 20.081 61.893 33.347  1.00 56.15  ? 226  ILE D C   1 
ATOM   6632 O O   . ILE D 2 124 ? 20.426 61.108 34.243  1.00 54.28  ? 226  ILE D O   1 
ATOM   6633 C CB  . ILE D 2 124 ? 21.786 63.631 32.557  1.00 57.33  ? 226  ILE D CB  1 
ATOM   6634 C CG1 . ILE D 2 124 ? 22.224 63.636 34.022  1.00 57.52  ? 226  ILE D CG1 1 
ATOM   6635 C CG2 . ILE D 2 124 ? 20.945 64.836 32.127  1.00 55.61  ? 226  ILE D CG2 1 
ATOM   6636 C CD1 . ILE D 2 124 ? 23.253 64.693 34.322  1.00 58.45  ? 226  ILE D CD1 1 
ATOM   6637 N N   . GLU D 2 125 ? 18.861 62.406 33.255  1.00 56.99  ? 227  GLU D N   1 
ATOM   6638 C CA  . GLU D 2 125 ? 17.810 62.126 34.212  1.00 55.66  ? 227  GLU D CA  1 
ATOM   6639 C C   . GLU D 2 125 ? 17.508 60.631 34.228  1.00 54.39  ? 227  GLU D C   1 
ATOM   6640 O O   . GLU D 2 125 ? 17.072 60.100 35.243  1.00 52.31  ? 227  GLU D O   1 
ATOM   6641 C CB  . GLU D 2 125 ? 16.560 62.916 33.834  1.00 57.72  ? 227  GLU D CB  1 
ATOM   6642 C CG  . GLU D 2 125 ? 16.719 64.452 33.784  1.00 62.15  ? 227  GLU D CG  1 
ATOM   6643 C CD  . GLU D 2 125 ? 17.473 64.991 32.550  1.00 65.39  ? 227  GLU D CD  1 
ATOM   6644 O OE1 . GLU D 2 125 ? 17.344 64.421 31.440  1.00 67.43  ? 227  GLU D OE1 1 
ATOM   6645 O OE2 . GLU D 2 125 ? 18.181 66.015 32.690  1.00 65.82  ? 227  GLU D OE2 1 
ATOM   6646 N N   . ASP D 2 126 ? 17.734 59.962 33.098  1.00 54.60  ? 228  ASP D N   1 
ATOM   6647 C CA  . ASP D 2 126 ? 17.507 58.522 32.991  1.00 56.15  ? 228  ASP D CA  1 
ATOM   6648 C C   . ASP D 2 126 ? 18.548 57.738 33.759  1.00 56.94  ? 228  ASP D C   1 
ATOM   6649 O O   . ASP D 2 126 ? 18.296 56.617 34.206  1.00 56.24  ? 228  ASP D O   1 
ATOM   6650 C CB  . ASP D 2 126 ? 17.521 58.077 31.538  1.00 56.33  ? 228  ASP D CB  1 
ATOM   6651 C CG  . ASP D 2 126 ? 16.262 58.457 30.823  1.00 58.54  ? 228  ASP D CG  1 
ATOM   6652 O OD1 . ASP D 2 126 ? 15.188 58.283 31.431  1.00 57.04  ? 228  ASP D OD1 1 
ATOM   6653 O OD2 . ASP D 2 126 ? 16.338 58.923 29.667  1.00 62.03  ? 228  ASP D OD2 1 
ATOM   6654 N N   . GLY D 2 127 ? 19.735 58.321 33.879  1.00 57.85  ? 229  GLY D N   1 
ATOM   6655 C CA  . GLY D 2 127 ? 20.777 57.673 34.639  1.00 57.67  ? 229  GLY D CA  1 
ATOM   6656 C C   . GLY D 2 127 ? 20.376 57.931 36.070  1.00 57.35  ? 229  GLY D C   1 
ATOM   6657 O O   . GLY D 2 127 ? 20.432 57.049 36.916  1.00 56.55  ? 229  GLY D O   1 
ATOM   6658 N N   . ALA D 2 128 ? 19.942 59.157 36.326  1.00 59.07  ? 230  ALA D N   1 
ATOM   6659 C CA  . ALA D 2 128 ? 19.503 59.559 37.653  1.00 63.78  ? 230  ALA D CA  1 
ATOM   6660 C C   . ALA D 2 128 ? 18.450 58.599 38.243  1.00 66.36  ? 230  ALA D C   1 
ATOM   6661 O O   . ALA D 2 128 ? 18.565 58.162 39.398  1.00 66.31  ? 230  ALA D O   1 
ATOM   6662 C CB  . ALA D 2 128 ? 18.950 60.978 37.592  1.00 64.51  ? 230  ALA D CB  1 
ATOM   6663 N N   . ARG D 2 129 ? 17.426 58.280 37.449  1.00 68.95  ? 231  ARG D N   1 
ATOM   6664 C CA  . ARG D 2 129 ? 16.359 57.375 37.878  1.00 69.81  ? 231  ARG D CA  1 
ATOM   6665 C C   . ARG D 2 129 ? 16.924 56.002 38.188  1.00 69.72  ? 231  ARG D C   1 
ATOM   6666 O O   . ARG D 2 129 ? 16.656 55.434 39.253  1.00 69.95  ? 231  ARG D O   1 
ATOM   6667 C CB  . ARG D 2 129 ? 15.282 57.255 36.795  1.00 69.68  ? 231  ARG D CB  1 
ATOM   6668 C CG  . ARG D 2 129 ? 14.537 58.544 36.558  1.00 70.69  ? 231  ARG D CG  1 
ATOM   6669 C CD  . ARG D 2 129 ? 14.000 59.071 37.875  1.00 73.50  ? 231  ARG D CD  1 
ATOM   6670 N NE  . ARG D 2 129 ? 13.059 58.140 38.502  1.00 74.51  ? 231  ARG D NE  1 
ATOM   6671 C CZ  . ARG D 2 129 ? 11.738 58.207 38.373  1.00 72.69  ? 231  ARG D CZ  1 
ATOM   6672 N NH1 . ARG D 2 129 ? 11.189 59.165 37.637  1.00 70.91  ? 231  ARG D NH1 1 
ATOM   6673 N NH2 . ARG D 2 129 ? 10.968 57.320 38.990  1.00 71.96  ? 231  ARG D NH2 1 
ATOM   6674 N N   . VAL D 2 130 ? 17.703 55.477 37.248  1.00 69.00  ? 232  VAL D N   1 
ATOM   6675 C CA  . VAL D 2 130 ? 18.322 54.179 37.418  1.00 69.60  ? 232  VAL D CA  1 
ATOM   6676 C C   . VAL D 2 130 ? 18.980 54.094 38.798  1.00 70.21  ? 232  VAL D C   1 
ATOM   6677 O O   . VAL D 2 130 ? 18.783 53.112 39.519  1.00 70.47  ? 232  VAL D O   1 
ATOM   6678 C CB  . VAL D 2 130 ? 19.355 53.919 36.308  1.00 69.57  ? 232  VAL D CB  1 
ATOM   6679 C CG1 . VAL D 2 130 ? 20.084 52.624 36.577  1.00 69.59  ? 232  VAL D CG1 1 
ATOM   6680 C CG2 . VAL D 2 130 ? 18.651 53.845 34.959  1.00 69.40  ? 232  VAL D CG2 1 
ATOM   6681 N N   . GLY D 2 131 ? 19.748 55.119 39.172  1.00 70.52  ? 233  GLY D N   1 
ATOM   6682 C CA  . GLY D 2 131 ? 20.375 55.123 40.487  1.00 71.14  ? 233  GLY D CA  1 
ATOM   6683 C C   . GLY D 2 131 ? 21.813 55.595 40.630  1.00 71.54  ? 233  GLY D C   1 
ATOM   6684 O O   . GLY D 2 131 ? 22.410 55.388 41.689  1.00 70.95  ? 233  GLY D O   1 
ATOM   6685 N N   . PHE D 2 132 ? 22.367 56.223 39.591  1.00 71.75  ? 234  PHE D N   1 
ATOM   6686 C CA  . PHE D 2 132 ? 23.746 56.710 39.617  1.00 73.34  ? 234  PHE D CA  1 
ATOM   6687 C C   . PHE D 2 132 ? 23.878 58.048 40.339  1.00 75.06  ? 234  PHE D C   1 
ATOM   6688 O O   . PHE D 2 132 ? 23.080 58.951 40.116  1.00 75.71  ? 234  PHE D O   1 
ATOM   6689 C CB  . PHE D 2 132 ? 24.287 56.855 38.194  1.00 72.01  ? 234  PHE D CB  1 
ATOM   6690 C CG  . PHE D 2 132 ? 24.318 55.567 37.417  1.00 70.73  ? 234  PHE D CG  1 
ATOM   6691 C CD1 . PHE D 2 132 ? 23.383 55.312 36.427  1.00 71.65  ? 234  PHE D CD1 1 
ATOM   6692 C CD2 . PHE D 2 132 ? 25.291 54.615 37.665  1.00 71.23  ? 234  PHE D CD2 1 
ATOM   6693 C CE1 . PHE D 2 132 ? 23.418 54.128 35.693  1.00 71.57  ? 234  PHE D CE1 1 
ATOM   6694 C CE2 . PHE D 2 132 ? 25.331 53.430 36.937  1.00 71.07  ? 234  PHE D CE2 1 
ATOM   6695 C CZ  . PHE D 2 132 ? 24.394 53.190 35.951  1.00 70.34  ? 234  PHE D CZ  1 
ATOM   6696 N N   . GLN D 2 133 ? 24.891 58.180 41.195  1.00 76.96  ? 235  GLN D N   1 
ATOM   6697 C CA  . GLN D 2 133 ? 25.089 59.414 41.946  1.00 79.30  ? 235  GLN D CA  1 
ATOM   6698 C C   . GLN D 2 133 ? 25.262 60.602 41.039  1.00 79.37  ? 235  GLN D C   1 
ATOM   6699 O O   . GLN D 2 133 ? 25.907 60.513 39.995  1.00 78.90  ? 235  GLN D O   1 
ATOM   6700 C CB  . GLN D 2 133 ? 26.292 59.314 42.888  1.00 82.59  ? 235  GLN D CB  1 
ATOM   6701 C CG  . GLN D 2 133 ? 25.899 59.057 44.339  1.00 86.79  ? 235  GLN D CG  1 
ATOM   6702 C CD  . GLN D 2 133 ? 27.076 59.136 45.292  1.00 89.25  ? 235  GLN D CD  1 
ATOM   6703 O OE1 . GLN D 2 133 ? 28.030 58.354 45.194  1.00 89.92  ? 235  GLN D OE1 1 
ATOM   6704 N NE2 . GLN D 2 133 ? 27.013 60.082 46.228  1.00 90.39  ? 235  GLN D NE2 1 
ATOM   6705 N N   . VAL D 2 134 ? 24.672 61.714 41.462  1.00 79.76  ? 236  VAL D N   1 
ATOM   6706 C CA  . VAL D 2 134 ? 24.709 62.969 40.723  1.00 79.78  ? 236  VAL D CA  1 
ATOM   6707 C C   . VAL D 2 134 ? 26.089 63.287 40.146  1.00 79.87  ? 236  VAL D C   1 
ATOM   6708 O O   . VAL D 2 134 ? 26.213 63.553 38.951  1.00 79.93  ? 236  VAL D O   1 
ATOM   6709 C CB  . VAL D 2 134 ? 24.218 64.151 41.619  1.00 80.52  ? 236  VAL D CB  1 
ATOM   6710 C CG1 . VAL D 2 134 ? 24.949 64.145 42.977  1.00 81.21  ? 236  VAL D CG1 1 
ATOM   6711 C CG2 . VAL D 2 134 ? 24.420 65.471 40.897  1.00 78.70  ? 236  VAL D CG2 1 
ATOM   6712 N N   . GLU D 2 135 ? 27.120 63.239 40.989  1.00 79.47  ? 237  GLU D N   1 
ATOM   6713 C CA  . GLU D 2 135 ? 28.488 63.530 40.570  1.00 77.65  ? 237  GLU D CA  1 
ATOM   6714 C C   . GLU D 2 135 ? 28.915 62.670 39.384  1.00 74.34  ? 237  GLU D C   1 
ATOM   6715 O O   . GLU D 2 135 ? 29.422 63.171 38.386  1.00 72.76  ? 237  GLU D O   1 
ATOM   6716 C CB  . GLU D 2 135 ? 29.441 63.298 41.746  1.00 81.77  ? 237  GLU D CB  1 
ATOM   6717 C CG  . GLU D 2 135 ? 29.103 64.116 42.993  1.00 88.72  ? 237  GLU D CG  1 
ATOM   6718 C CD  . GLU D 2 135 ? 29.901 63.686 44.226  1.00 93.35  ? 237  GLU D CD  1 
ATOM   6719 O OE1 . GLU D 2 135 ? 29.644 62.571 44.745  1.00 95.87  ? 237  GLU D OE1 1 
ATOM   6720 O OE2 . GLU D 2 135 ? 30.785 64.461 44.671  1.00 94.49  ? 237  GLU D OE2 1 
ATOM   6721 N N   . PHE D 2 136 ? 28.706 61.369 39.495  1.00 71.61  ? 238  PHE D N   1 
ATOM   6722 C CA  . PHE D 2 136 ? 29.095 60.470 38.425  1.00 69.76  ? 238  PHE D CA  1 
ATOM   6723 C C   . PHE D 2 136 ? 28.466 60.815 37.094  1.00 69.84  ? 238  PHE D C   1 
ATOM   6724 O O   . PHE D 2 136 ? 29.113 60.738 36.055  1.00 68.87  ? 238  PHE D O   1 
ATOM   6725 C CB  . PHE D 2 136 ? 28.718 59.043 38.764  1.00 68.49  ? 238  PHE D CB  1 
ATOM   6726 C CG  . PHE D 2 136 ? 29.056 58.075 37.682  1.00 68.33  ? 238  PHE D CG  1 
ATOM   6727 C CD1 . PHE D 2 136 ? 30.352 57.989 37.203  1.00 68.20  ? 238  PHE D CD1 1 
ATOM   6728 C CD2 . PHE D 2 136 ? 28.088 57.255 37.135  1.00 69.26  ? 238  PHE D CD2 1 
ATOM   6729 C CE1 . PHE D 2 136 ? 30.681 57.106 36.201  1.00 68.55  ? 238  PHE D CE1 1 
ATOM   6730 C CE2 . PHE D 2 136 ? 28.411 56.365 36.127  1.00 70.12  ? 238  PHE D CE2 1 
ATOM   6731 C CZ  . PHE D 2 136 ? 29.711 56.292 35.661  1.00 70.72  ? 238  PHE D CZ  1 
ATOM   6732 N N   . LEU D 2 137 ? 27.187 61.164 37.129  1.00 70.93  ? 239  LEU D N   1 
ATOM   6733 C CA  . LEU D 2 137 ? 26.476 61.500 35.916  1.00 71.54  ? 239  LEU D CA  1 
ATOM   6734 C C   . LEU D 2 137 ? 27.084 62.679 35.213  1.00 72.61  ? 239  LEU D C   1 
ATOM   6735 O O   . LEU D 2 137 ? 27.704 62.507 34.169  1.00 72.72  ? 239  LEU D O   1 
ATOM   6736 C CB  . LEU D 2 137 ? 25.014 61.781 36.209  1.00 70.19  ? 239  LEU D CB  1 
ATOM   6737 C CG  . LEU D 2 137 ? 24.210 60.503 36.404  1.00 68.86  ? 239  LEU D CG  1 
ATOM   6738 C CD1 . LEU D 2 137 ? 22.739 60.862 36.481  1.00 70.11  ? 239  LEU D CD1 1 
ATOM   6739 C CD2 . LEU D 2 137 ? 24.468 59.545 35.249  1.00 66.48  ? 239  LEU D CD2 1 
ATOM   6740 N N   . GLU D 2 138 ? 26.909 63.875 35.769  1.00 75.10  ? 240  GLU D N   1 
ATOM   6741 C CA  . GLU D 2 138 ? 27.461 65.078 35.148  1.00 78.17  ? 240  GLU D CA  1 
ATOM   6742 C C   . GLU D 2 138 ? 28.930 64.891 34.761  1.00 78.67  ? 240  GLU D C   1 
ATOM   6743 O O   . GLU D 2 138 ? 29.367 65.349 33.697  1.00 79.26  ? 240  GLU D O   1 
ATOM   6744 C CB  . GLU D 2 138 ? 27.293 66.280 36.078  1.00 79.39  ? 240  GLU D CB  1 
ATOM   6745 C CG  . GLU D 2 138 ? 27.167 65.947 37.555  1.00 83.59  ? 240  GLU D CG  1 
ATOM   6746 C CD  . GLU D 2 138 ? 26.700 67.140 38.342  1.00 87.53  ? 240  GLU D CD  1 
ATOM   6747 O OE1 . GLU D 2 138 ? 25.739 67.807 37.883  1.00 88.16  ? 240  GLU D OE1 1 
ATOM   6748 O OE2 . GLU D 2 138 ? 27.289 67.419 39.416  1.00 90.63  ? 240  GLU D OE2 1 
ATOM   6749 N N   . LEU D 2 139 ? 29.693 64.234 35.626  1.00 78.21  ? 241  LEU D N   1 
ATOM   6750 C CA  . LEU D 2 139 ? 31.070 63.973 35.297  1.00 77.83  ? 241  LEU D CA  1 
ATOM   6751 C C   . LEU D 2 139 ? 31.082 63.211 33.974  1.00 77.71  ? 241  LEU D C   1 
ATOM   6752 O O   . LEU D 2 139 ? 31.665 63.659 32.994  1.00 79.78  ? 241  LEU D O   1 
ATOM   6753 C CB  . LEU D 2 139 ? 31.726 63.116 36.356  1.00 77.28  ? 241  LEU D CB  1 
ATOM   6754 C CG  . LEU D 2 139 ? 33.066 62.682 35.767  1.00 77.77  ? 241  LEU D CG  1 
ATOM   6755 C CD1 . LEU D 2 139 ? 34.013 63.872 35.818  1.00 77.94  ? 241  LEU D CD1 1 
ATOM   6756 C CD2 . LEU D 2 139 ? 33.627 61.507 36.526  1.00 77.20  ? 241  LEU D CD2 1 
ATOM   6757 N N   . LEU D 2 140 ? 30.422 62.060 33.955  1.00 76.18  ? 242  LEU D N   1 
ATOM   6758 C CA  . LEU D 2 140 ? 30.336 61.220 32.765  1.00 75.25  ? 242  LEU D CA  1 
ATOM   6759 C C   . LEU D 2 140 ? 29.830 61.955 31.517  1.00 76.08  ? 242  LEU D C   1 
ATOM   6760 O O   . LEU D 2 140 ? 30.183 61.599 30.391  1.00 76.07  ? 242  LEU D O   1 
ATOM   6761 C CB  . LEU D 2 140 ? 29.435 60.022 33.058  1.00 74.34  ? 242  LEU D CB  1 
ATOM   6762 C CG  . LEU D 2 140 ? 29.000 59.217 31.835  1.00 73.91  ? 242  LEU D CG  1 
ATOM   6763 C CD1 . LEU D 2 140 ? 30.212 58.822 31.008  1.00 73.21  ? 242  LEU D CD1 1 
ATOM   6764 C CD2 . LEU D 2 140 ? 28.242 57.994 32.297  1.00 73.79  ? 242  LEU D CD2 1 
ATOM   6765 N N   . PHE D 2 141 ? 29.003 62.978 31.712  1.00 76.64  ? 243  PHE D N   1 
ATOM   6766 C CA  . PHE D 2 141 ? 28.480 63.750 30.591  1.00 76.93  ? 243  PHE D CA  1 
ATOM   6767 C C   . PHE D 2 141 ? 29.506 64.701 30.005  1.00 76.40  ? 243  PHE D C   1 
ATOM   6768 O O   . PHE D 2 141 ? 29.636 64.801 28.784  1.00 76.15  ? 243  PHE D O   1 
ATOM   6769 C CB  . PHE D 2 141 ? 27.235 64.525 31.004  1.00 79.27  ? 243  PHE D CB  1 
ATOM   6770 C CG  . PHE D 2 141 ? 25.972 63.849 30.596  1.00 80.98  ? 243  PHE D CG  1 
ATOM   6771 C CD1 . PHE D 2 141 ? 25.545 62.706 31.245  1.00 80.89  ? 243  PHE D CD1 1 
ATOM   6772 C CD2 . PHE D 2 141 ? 25.258 64.301 29.496  1.00 82.15  ? 243  PHE D CD2 1 
ATOM   6773 C CE1 . PHE D 2 141 ? 24.434 62.026 30.797  1.00 81.41  ? 243  PHE D CE1 1 
ATOM   6774 C CE2 . PHE D 2 141 ? 24.147 63.624 29.044  1.00 81.65  ? 243  PHE D CE2 1 
ATOM   6775 C CZ  . PHE D 2 141 ? 23.734 62.486 29.692  1.00 81.30  ? 243  PHE D CZ  1 
ATOM   6776 N N   . HIS D 2 142 ? 30.223 65.404 30.876  1.00 75.62  ? 244  HIS D N   1 
ATOM   6777 C CA  . HIS D 2 142 ? 31.270 66.320 30.442  1.00 75.00  ? 244  HIS D CA  1 
ATOM   6778 C C   . HIS D 2 142 ? 32.220 65.575 29.511  1.00 73.14  ? 244  HIS D C   1 
ATOM   6779 O O   . HIS D 2 142 ? 32.588 66.076 28.452  1.00 72.78  ? 244  HIS D O   1 
ATOM   6780 C CB  . HIS D 2 142 ? 32.054 66.835 31.645  1.00 76.78  ? 244  HIS D CB  1 
ATOM   6781 C CG  . HIS D 2 142 ? 33.156 67.784 31.287  1.00 79.22  ? 244  HIS D CG  1 
ATOM   6782 N ND1 . HIS D 2 142 ? 34.050 68.269 32.219  1.00 80.34  ? 244  HIS D ND1 1 
ATOM   6783 C CD2 . HIS D 2 142 ? 33.507 68.341 30.103  1.00 80.03  ? 244  HIS D CD2 1 
ATOM   6784 C CE1 . HIS D 2 142 ? 34.905 69.082 31.624  1.00 81.12  ? 244  HIS D CE1 1 
ATOM   6785 N NE2 . HIS D 2 142 ? 34.599 69.142 30.340  1.00 81.73  ? 244  HIS D NE2 1 
ATOM   6786 N N   . PHE D 2 143 ? 32.621 64.377 29.920  1.00 71.63  ? 245  PHE D N   1 
ATOM   6787 C CA  . PHE D 2 143 ? 33.511 63.565 29.113  1.00 71.54  ? 245  PHE D CA  1 
ATOM   6788 C C   . PHE D 2 143 ? 32.978 63.459 27.708  1.00 71.02  ? 245  PHE D C   1 
ATOM   6789 O O   . PHE D 2 143 ? 33.607 63.923 26.764  1.00 72.63  ? 245  PHE D O   1 
ATOM   6790 C CB  . PHE D 2 143 ? 33.632 62.147 29.659  1.00 71.86  ? 245  PHE D CB  1 
ATOM   6791 C CG  . PHE D 2 143 ? 34.476 61.246 28.794  1.00 73.19  ? 245  PHE D CG  1 
ATOM   6792 C CD1 . PHE D 2 143 ? 35.862 61.328 28.827  1.00 73.05  ? 245  PHE D CD1 1 
ATOM   6793 C CD2 . PHE D 2 143 ? 33.886 60.345 27.920  1.00 73.47  ? 245  PHE D CD2 1 
ATOM   6794 C CE1 . PHE D 2 143 ? 36.641 60.528 28.004  1.00 72.73  ? 245  PHE D CE1 1 
ATOM   6795 C CE2 . PHE D 2 143 ? 34.662 59.541 27.093  1.00 73.70  ? 245  PHE D CE2 1 
ATOM   6796 C CZ  . PHE D 2 143 ? 36.039 59.635 27.138  1.00 72.49  ? 245  PHE D CZ  1 
ATOM   6797 N N   . HIS D 2 144 ? 31.814 62.829 27.581  1.00 70.39  ? 246  HIS D N   1 
ATOM   6798 C CA  . HIS D 2 144 ? 31.173 62.631 26.290  1.00 69.32  ? 246  HIS D CA  1 
ATOM   6799 C C   . HIS D 2 144 ? 30.990 63.883 25.456  1.00 68.67  ? 246  HIS D C   1 
ATOM   6800 O O   . HIS D 2 144 ? 31.054 63.821 24.230  1.00 67.81  ? 246  HIS D O   1 
ATOM   6801 C CB  . HIS D 2 144 ? 29.844 61.935 26.494  1.00 68.87  ? 246  HIS D CB  1 
ATOM   6802 C CG  . HIS D 2 144 ? 29.963 60.450 26.509  1.00 69.41  ? 246  HIS D CG  1 
ATOM   6803 N ND1 . HIS D 2 144 ? 30.085 59.706 25.354  1.00 69.49  ? 246  HIS D ND1 1 
ATOM   6804 C CD2 . HIS D 2 144 ? 30.041 59.571 27.535  1.00 69.58  ? 246  HIS D CD2 1 
ATOM   6805 C CE1 . HIS D 2 144 ? 30.231 58.431 25.669  1.00 69.45  ? 246  HIS D CE1 1 
ATOM   6806 N NE2 . HIS D 2 144 ? 30.209 58.322 26.985  1.00 70.10  ? 246  HIS D NE2 1 
ATOM   6807 N N   . GLY D 2 145 ? 30.752 65.013 26.117  1.00 67.72  ? 247  GLY D N   1 
ATOM   6808 C CA  . GLY D 2 145 ? 30.607 66.264 25.396  1.00 66.66  ? 247  GLY D CA  1 
ATOM   6809 C C   . GLY D 2 145 ? 31.956 66.624 24.800  1.00 66.46  ? 247  GLY D C   1 
ATOM   6810 O O   . GLY D 2 145 ? 32.052 67.023 23.637  1.00 66.80  ? 247  GLY D O   1 
ATOM   6811 N N   . THR D 2 146 ? 32.997 66.466 25.617  1.00 65.57  ? 248  THR D N   1 
ATOM   6812 C CA  . THR D 2 146 ? 34.379 66.733 25.245  1.00 63.61  ? 248  THR D CA  1 
ATOM   6813 C C   . THR D 2 146 ? 34.810 65.865 24.065  1.00 64.09  ? 248  THR D C   1 
ATOM   6814 O O   . THR D 2 146 ? 35.248 66.377 23.035  1.00 64.23  ? 248  THR D O   1 
ATOM   6815 C CB  . THR D 2 146 ? 35.301 66.463 26.443  1.00 62.54  ? 248  THR D CB  1 
ATOM   6816 O OG1 . THR D 2 146 ? 34.944 67.339 27.516  1.00 62.95  ? 248  THR D OG1 1 
ATOM   6817 C CG2 . THR D 2 146 ? 36.740 66.709 26.082  1.00 63.83  ? 248  THR D CG2 1 
ATOM   6818 N N   . LEU D 2 147 ? 34.680 64.551 24.219  1.00 65.02  ? 249  LEU D N   1 
ATOM   6819 C CA  . LEU D 2 147 ? 35.043 63.594 23.177  1.00 66.74  ? 249  LEU D CA  1 
ATOM   6820 C C   . LEU D 2 147 ? 34.304 63.789 21.842  1.00 70.07  ? 249  LEU D C   1 
ATOM   6821 O O   . LEU D 2 147 ? 34.902 63.687 20.768  1.00 72.62  ? 249  LEU D O   1 
ATOM   6822 C CB  . LEU D 2 147 ? 34.810 62.168 23.687  1.00 64.74  ? 249  LEU D CB  1 
ATOM   6823 C CG  . LEU D 2 147 ? 34.627 61.082 22.619  1.00 64.04  ? 249  LEU D CG  1 
ATOM   6824 C CD1 . LEU D 2 147 ? 35.784 61.094 21.652  1.00 64.37  ? 249  LEU D CD1 1 
ATOM   6825 C CD2 . LEU D 2 147 ? 34.511 59.722 23.273  1.00 63.66  ? 249  LEU D CD2 1 
ATOM   6826 N N   . ARG D 2 148 ? 33.006 64.064 21.897  1.00 72.64  ? 250  ARG D N   1 
ATOM   6827 C CA  . ARG D 2 148 ? 32.225 64.251 20.677  1.00 73.88  ? 250  ARG D CA  1 
ATOM   6828 C C   . ARG D 2 148 ? 32.633 65.507 19.913  1.00 74.03  ? 250  ARG D C   1 
ATOM   6829 O O   . ARG D 2 148 ? 32.718 65.478 18.683  1.00 73.36  ? 250  ARG D O   1 
ATOM   6830 C CB  . ARG D 2 148 ? 30.740 64.313 21.027  1.00 74.98  ? 250  ARG D CB  1 
ATOM   6831 C CG  . ARG D 2 148 ? 29.810 64.458 19.845  1.00 77.88  ? 250  ARG D CG  1 
ATOM   6832 C CD  . ARG D 2 148 ? 29.855 63.268 18.898  1.00 80.80  ? 250  ARG D CD  1 
ATOM   6833 N NE  . ARG D 2 148 ? 28.633 63.225 18.100  1.00 84.34  ? 250  ARG D NE  1 
ATOM   6834 C CZ  . ARG D 2 148 ? 28.454 62.475 17.017  1.00 87.58  ? 250  ARG D CZ  1 
ATOM   6835 N NH1 . ARG D 2 148 ? 29.431 61.684 16.575  1.00 88.94  ? 250  ARG D NH1 1 
ATOM   6836 N NH2 . ARG D 2 148 ? 27.289 62.518 16.375  1.00 89.09  ? 250  ARG D NH2 1 
ATOM   6837 N N   . LYS D 2 149 ? 32.892 66.589 20.662  1.00 74.64  ? 251  LYS D N   1 
ATOM   6838 C CA  . LYS D 2 149 ? 33.295 67.911 20.140  1.00 74.23  ? 251  LYS D CA  1 
ATOM   6839 C C   . LYS D 2 149 ? 34.496 67.981 19.205  1.00 75.32  ? 251  LYS D C   1 
ATOM   6840 O O   . LYS D 2 149 ? 34.625 68.932 18.439  1.00 75.77  ? 251  LYS D O   1 
ATOM   6841 C CB  . LYS D 2 149 ? 33.577 68.877 21.286  1.00 71.36  ? 251  LYS D CB  1 
ATOM   6842 C CG  . LYS D 2 149 ? 32.376 69.589 21.842  1.00 70.93  ? 251  LYS D CG  1 
ATOM   6843 C CD  . LYS D 2 149 ? 32.842 70.632 22.845  1.00 70.28  ? 251  LYS D CD  1 
ATOM   6844 C CE  . LYS D 2 149 ? 31.706 71.489 23.378  1.00 70.80  ? 251  LYS D CE  1 
ATOM   6845 N NZ  . LYS D 2 149 ? 32.170 72.532 24.351  1.00 71.14  ? 251  LYS D NZ  1 
ATOM   6846 N N   . LEU D 2 150 ? 35.389 67.003 19.280  1.00 76.17  ? 252  LEU D N   1 
ATOM   6847 C CA  . LEU D 2 150 ? 36.563 66.998 18.420  1.00 76.47  ? 252  LEU D CA  1 
ATOM   6848 C C   . LEU D 2 150 ? 36.223 66.531 17.001  1.00 77.10  ? 252  LEU D C   1 
ATOM   6849 O O   . LEU D 2 150 ? 37.067 66.546 16.099  1.00 77.64  ? 252  LEU D O   1 
ATOM   6850 C CB  . LEU D 2 150 ? 37.649 66.114 19.041  1.00 75.83  ? 252  LEU D CB  1 
ATOM   6851 C CG  . LEU D 2 150 ? 38.012 66.458 20.494  1.00 73.68  ? 252  LEU D CG  1 
ATOM   6852 C CD1 . LEU D 2 150 ? 39.299 65.747 20.845  1.00 73.55  ? 252  LEU D CD1 1 
ATOM   6853 C CD2 . LEU D 2 150 ? 38.184 67.959 20.682  1.00 71.96  ? 252  LEU D CD2 1 
ATOM   6854 N N   . GLN D 2 151 ? 34.978 66.116 16.812  1.00 78.52  ? 253  GLN D N   1 
ATOM   6855 C CA  . GLN D 2 151 ? 34.511 65.674 15.510  1.00 79.28  ? 253  GLN D CA  1 
ATOM   6856 C C   . GLN D 2 151 ? 35.304 64.479 15.045  1.00 78.90  ? 253  GLN D C   1 
ATOM   6857 O O   . GLN D 2 151 ? 35.761 64.433 13.907  1.00 78.08  ? 253  GLN D O   1 
ATOM   6858 C CB  . GLN D 2 151 ? 34.650 66.815 14.512  1.00 80.05  ? 253  GLN D CB  1 
ATOM   6859 C CG  . GLN D 2 151 ? 33.941 68.075 14.971  1.00 81.98  ? 253  GLN D CG  1 
ATOM   6860 C CD  . GLN D 2 151 ? 34.547 69.321 14.381  1.00 84.26  ? 253  GLN D CD  1 
ATOM   6861 O OE1 . GLN D 2 151 ? 34.493 69.539 13.170  1.00 86.47  ? 253  GLN D OE1 1 
ATOM   6862 N NE2 . GLN D 2 151 ? 35.144 70.149 15.235  1.00 85.01  ? 253  GLN D NE2 1 
ATOM   6863 N N   . LEU D 2 152 ? 35.477 63.513 15.934  1.00 79.50  ? 254  LEU D N   1 
ATOM   6864 C CA  . LEU D 2 152 ? 36.212 62.320 15.568  1.00 80.52  ? 254  LEU D CA  1 
ATOM   6865 C C   . LEU D 2 152 ? 35.556 61.753 14.329  1.00 81.59  ? 254  LEU D C   1 
ATOM   6866 O O   . LEU D 2 152 ? 34.346 61.868 14.148  1.00 81.82  ? 254  LEU D O   1 
ATOM   6867 C CB  . LEU D 2 152 ? 36.150 61.287 16.685  1.00 79.74  ? 254  LEU D CB  1 
ATOM   6868 C CG  . LEU D 2 152 ? 37.238 61.290 17.751  1.00 78.49  ? 254  LEU D CG  1 
ATOM   6869 C CD1 . LEU D 2 152 ? 38.410 60.475 17.237  1.00 76.29  ? 254  LEU D CD1 1 
ATOM   6870 C CD2 . LEU D 2 152 ? 37.621 62.732 18.123  1.00 77.01  ? 254  LEU D CD2 1 
ATOM   6871 N N   . GLN D 2 153 ? 36.363 61.160 13.465  1.00 83.45  ? 255  GLN D N   1 
ATOM   6872 C CA  . GLN D 2 153 ? 35.851 60.554 12.255  1.00 86.08  ? 255  GLN D CA  1 
ATOM   6873 C C   . GLN D 2 153 ? 35.803 59.083 12.603  1.00 87.33  ? 255  GLN D C   1 
ATOM   6874 O O   . GLN D 2 153 ? 36.494 58.658 13.517  1.00 86.34  ? 255  GLN D O   1 
ATOM   6875 C CB  . GLN D 2 153 ? 36.815 60.797 11.109  1.00 87.16  ? 255  GLN D CB  1 
ATOM   6876 C CG  . GLN D 2 153 ? 37.271 62.237 11.005  1.00 90.02  ? 255  GLN D CG  1 
ATOM   6877 C CD  . GLN D 2 153 ? 38.188 62.474 9.828   1.00 92.73  ? 255  GLN D CD  1 
ATOM   6878 O OE1 . GLN D 2 153 ? 38.633 63.604 9.585   1.00 94.26  ? 255  GLN D OE1 1 
ATOM   6879 N NE2 . GLN D 2 153 ? 38.477 61.411 9.082   1.00 93.78  ? 255  GLN D NE2 1 
ATOM   6880 N N   . GLU D 2 154 ? 34.987 58.306 11.900  1.00 90.20  ? 256  GLU D N   1 
ATOM   6881 C CA  . GLU D 2 154 ? 34.878 56.880 12.198  1.00 92.59  ? 256  GLU D CA  1 
ATOM   6882 C C   . GLU D 2 154 ? 36.229 56.219 12.478  1.00 92.89  ? 256  GLU D C   1 
ATOM   6883 O O   . GLU D 2 154 ? 36.443 55.694 13.569  1.00 93.04  ? 256  GLU D O   1 
ATOM   6884 C CB  . GLU D 2 154 ? 34.161 56.131 11.070  1.00 94.41  ? 256  GLU D CB  1 
ATOM   6885 C CG  . GLU D 2 154 ? 33.823 54.692 11.442  1.00 97.48  ? 256  GLU D CG  1 
ATOM   6886 C CD  . GLU D 2 154 ? 33.077 53.957 10.347  1.00 100.13 ? 256  GLU D CD  1 
ATOM   6887 O OE1 . GLU D 2 154 ? 32.053 54.489 9.864   1.00 101.09 ? 256  GLU D OE1 1 
ATOM   6888 O OE2 . GLU D 2 154 ? 33.514 52.843 9.977   1.00 101.70 ? 256  GLU D OE2 1 
ATOM   6889 N N   . PRO D 2 155 ? 37.155 56.219 11.500  1.00 93.37  ? 257  PRO D N   1 
ATOM   6890 C CA  . PRO D 2 155 ? 38.443 55.581 11.804  1.00 93.60  ? 257  PRO D CA  1 
ATOM   6891 C C   . PRO D 2 155 ? 39.152 56.199 13.026  1.00 93.25  ? 257  PRO D C   1 
ATOM   6892 O O   . PRO D 2 155 ? 39.845 55.500 13.772  1.00 92.36  ? 257  PRO D O   1 
ATOM   6893 C CB  . PRO D 2 155 ? 39.226 55.731 10.491  1.00 93.55  ? 257  PRO D CB  1 
ATOM   6894 C CG  . PRO D 2 155 ? 38.571 56.910 9.816   1.00 93.66  ? 257  PRO D CG  1 
ATOM   6895 C CD  . PRO D 2 155 ? 37.120 56.696 10.106  1.00 93.57  ? 257  PRO D CD  1 
ATOM   6896 N N   . GLU D 2 156 ? 38.965 57.504 13.226  1.00 92.91  ? 258  GLU D N   1 
ATOM   6897 C CA  . GLU D 2 156 ? 39.545 58.210 14.369  1.00 92.10  ? 258  GLU D CA  1 
ATOM   6898 C C   . GLU D 2 156 ? 38.930 57.695 15.677  1.00 91.45  ? 258  GLU D C   1 
ATOM   6899 O O   . GLU D 2 156 ? 39.556 57.754 16.737  1.00 91.07  ? 258  GLU D O   1 
ATOM   6900 C CB  . GLU D 2 156 ? 39.311 59.718 14.245  1.00 92.86  ? 258  GLU D CB  1 
ATOM   6901 C CG  . GLU D 2 156 ? 39.991 60.363 13.041  1.00 94.16  ? 258  GLU D CG  1 
ATOM   6902 C CD  . GLU D 2 156 ? 40.035 61.883 13.131  1.00 94.22  ? 258  GLU D CD  1 
ATOM   6903 O OE1 . GLU D 2 156 ? 38.968 62.514 13.298  1.00 94.92  ? 258  GLU D OE1 1 
ATOM   6904 O OE2 . GLU D 2 156 ? 41.143 62.447 13.027  1.00 93.00  ? 258  GLU D OE2 1 
ATOM   6905 N N   . TYR D 2 157 ? 37.691 57.217 15.601  1.00 90.47  ? 259  TYR D N   1 
ATOM   6906 C CA  . TYR D 2 157 ? 37.019 56.649 16.760  1.00 88.78  ? 259  TYR D CA  1 
ATOM   6907 C C   . TYR D 2 157 ? 37.570 55.229 16.941  1.00 87.93  ? 259  TYR D C   1 
ATOM   6908 O O   . TYR D 2 157 ? 38.134 54.907 17.987  1.00 88.19  ? 259  TYR D O   1 
ATOM   6909 C CB  . TYR D 2 157 ? 35.494 56.610 16.550  1.00 87.79  ? 259  TYR D CB  1 
ATOM   6910 C CG  . TYR D 2 157 ? 34.762 57.853 17.034  1.00 86.69  ? 259  TYR D CG  1 
ATOM   6911 C CD1 . TYR D 2 157 ? 34.893 58.291 18.349  1.00 85.87  ? 259  TYR D CD1 1 
ATOM   6912 C CD2 . TYR D 2 157 ? 33.958 58.594 16.177  1.00 85.80  ? 259  TYR D CD2 1 
ATOM   6913 C CE1 . TYR D 2 157 ? 34.249 59.438 18.797  1.00 85.07  ? 259  TYR D CE1 1 
ATOM   6914 C CE2 . TYR D 2 157 ? 33.308 59.745 16.618  1.00 85.89  ? 259  TYR D CE2 1 
ATOM   6915 C CZ  . TYR D 2 157 ? 33.461 60.168 17.929  1.00 84.76  ? 259  TYR D CZ  1 
ATOM   6916 O OH  . TYR D 2 157 ? 32.881 61.349 18.360  1.00 82.40  ? 259  TYR D OH  1 
ATOM   6917 N N   . VAL D 2 158 ? 37.433 54.397 15.909  1.00 86.25  ? 260  VAL D N   1 
ATOM   6918 C CA  . VAL D 2 158 ? 37.913 53.013 15.944  1.00 84.66  ? 260  VAL D CA  1 
ATOM   6919 C C   . VAL D 2 158 ? 39.333 52.820 16.466  1.00 83.78  ? 260  VAL D C   1 
ATOM   6920 O O   . VAL D 2 158 ? 39.596 51.879 17.205  1.00 83.55  ? 260  VAL D O   1 
ATOM   6921 C CB  . VAL D 2 158 ? 37.859 52.362 14.555  1.00 84.83  ? 260  VAL D CB  1 
ATOM   6922 C CG1 . VAL D 2 158 ? 38.404 50.943 14.628  1.00 81.51  ? 260  VAL D CG1 1 
ATOM   6923 C CG2 . VAL D 2 158 ? 36.432 52.373 14.038  1.00 84.88  ? 260  VAL D CG2 1 
ATOM   6924 N N   . LEU D 2 159 ? 40.254 53.689 16.066  1.00 83.23  ? 261  LEU D N   1 
ATOM   6925 C CA  . LEU D 2 159 ? 41.634 53.574 16.529  1.00 82.68  ? 261  LEU D CA  1 
ATOM   6926 C C   . LEU D 2 159 ? 41.780 54.008 17.993  1.00 81.44  ? 261  LEU D C   1 
ATOM   6927 O O   . LEU D 2 159 ? 42.583 53.448 18.747  1.00 80.32  ? 261  LEU D O   1 
ATOM   6928 C CB  . LEU D 2 159 ? 42.567 54.403 15.639  1.00 83.28  ? 261  LEU D CB  1 
ATOM   6929 C CG  . LEU D 2 159 ? 42.653 53.982 14.170  1.00 83.24  ? 261  LEU D CG  1 
ATOM   6930 C CD1 . LEU D 2 159 ? 43.754 54.780 13.500  1.00 83.06  ? 261  LEU D CD1 1 
ATOM   6931 C CD2 . LEU D 2 159 ? 42.940 52.494 14.056  1.00 82.86  ? 261  LEU D CD2 1 
ATOM   6932 N N   . LEU D 2 160 ? 41.007 55.010 18.394  1.00 79.56  ? 262  LEU D N   1 
ATOM   6933 C CA  . LEU D 2 160 ? 41.052 55.476 19.769  1.00 78.11  ? 262  LEU D CA  1 
ATOM   6934 C C   . LEU D 2 160 ? 40.679 54.337 20.705  1.00 78.18  ? 262  LEU D C   1 
ATOM   6935 O O   . LEU D 2 160 ? 41.288 54.162 21.761  1.00 77.26  ? 262  LEU D O   1 
ATOM   6936 C CB  . LEU D 2 160 ? 40.084 56.631 19.961  1.00 77.34  ? 262  LEU D CB  1 
ATOM   6937 C CG  . LEU D 2 160 ? 39.936 57.077 21.413  1.00 76.44  ? 262  LEU D CG  1 
ATOM   6938 C CD1 . LEU D 2 160 ? 41.256 56.948 22.155  1.00 75.96  ? 262  LEU D CD1 1 
ATOM   6939 C CD2 . LEU D 2 160 ? 39.448 58.509 21.428  1.00 76.47  ? 262  LEU D CD2 1 
ATOM   6940 N N   . ALA D 2 161 ? 39.666 53.571 20.315  1.00 79.26  ? 263  ALA D N   1 
ATOM   6941 C CA  . ALA D 2 161 ? 39.224 52.435 21.110  1.00 80.66  ? 263  ALA D CA  1 
ATOM   6942 C C   . ALA D 2 161 ? 40.262 51.310 21.074  1.00 81.83  ? 263  ALA D C   1 
ATOM   6943 O O   . ALA D 2 161 ? 40.328 50.493 21.994  1.00 82.25  ? 263  ALA D O   1 
ATOM   6944 C CB  . ALA D 2 161 ? 37.878 51.930 20.601  1.00 80.27  ? 263  ALA D CB  1 
ATOM   6945 N N   . ALA D 2 162 ? 41.071 51.270 20.015  1.00 82.27  ? 264  ALA D N   1 
ATOM   6946 C CA  . ALA D 2 162 ? 42.117 50.254 19.878  1.00 81.63  ? 264  ALA D CA  1 
ATOM   6947 C C   . ALA D 2 162 ? 43.130 50.377 21.018  1.00 81.45  ? 264  ALA D C   1 
ATOM   6948 O O   . ALA D 2 162 ? 43.594 49.374 21.567  1.00 80.99  ? 264  ALA D O   1 
ATOM   6949 C CB  . ALA D 2 162 ? 42.822 50.414 18.545  1.00 80.89  ? 264  ALA D CB  1 
ATOM   6950 N N   . MET D 2 163 ? 43.466 51.620 21.357  1.00 80.83  ? 265  MET D N   1 
ATOM   6951 C CA  . MET D 2 163 ? 44.410 51.916 22.426  1.00 80.27  ? 265  MET D CA  1 
ATOM   6952 C C   . MET D 2 163 ? 43.821 51.649 23.803  1.00 79.69  ? 265  MET D C   1 
ATOM   6953 O O   . MET D 2 163 ? 44.536 51.272 24.734  1.00 80.05  ? 265  MET D O   1 
ATOM   6954 C CB  . MET D 2 163 ? 44.853 53.369 22.336  1.00 81.25  ? 265  MET D CB  1 
ATOM   6955 C CG  . MET D 2 163 ? 45.541 53.700 21.031  1.00 80.92  ? 265  MET D CG  1 
ATOM   6956 S SD  . MET D 2 163 ? 46.084 55.401 20.993  1.00 82.76  ? 265  MET D SD  1 
ATOM   6957 C CE  . MET D 2 163 ? 47.628 55.277 21.924  1.00 81.88  ? 265  MET D CE  1 
ATOM   6958 N N   . ALA D 2 164 ? 42.521 51.869 23.945  1.00 78.33  ? 266  ALA D N   1 
ATOM   6959 C CA  . ALA D 2 164 ? 41.872 51.604 25.216  1.00 76.60  ? 266  ALA D CA  1 
ATOM   6960 C C   . ALA D 2 164 ? 42.053 50.112 25.469  1.00 75.28  ? 266  ALA D C   1 
ATOM   6961 O O   . ALA D 2 164 ? 42.526 49.696 26.528  1.00 74.09  ? 266  ALA D O   1 
ATOM   6962 C CB  . ALA D 2 164 ? 40.401 51.948 25.128  1.00 76.72  ? 266  ALA D CB  1 
ATOM   6963 N N   . LEU D 2 165 ? 41.684 49.328 24.459  1.00 74.88  ? 267  LEU D N   1 
ATOM   6964 C CA  . LEU D 2 165 ? 41.770 47.868 24.475  1.00 75.10  ? 267  LEU D CA  1 
ATOM   6965 C C   . LEU D 2 165 ? 43.171 47.362 24.744  1.00 76.12  ? 267  LEU D C   1 
ATOM   6966 O O   . LEU D 2 165 ? 43.390 46.536 25.634  1.00 76.20  ? 267  LEU D O   1 
ATOM   6967 C CB  . LEU D 2 165 ? 41.325 47.294 23.125  1.00 72.76  ? 267  LEU D CB  1 
ATOM   6968 C CG  . LEU D 2 165 ? 41.654 45.813 22.932  1.00 70.52  ? 267  LEU D CG  1 
ATOM   6969 C CD1 . LEU D 2 165 ? 40.897 44.994 23.966  1.00 70.40  ? 267  LEU D CD1 1 
ATOM   6970 C CD2 . LEU D 2 165 ? 41.305 45.375 21.524  1.00 68.60  ? 267  LEU D CD2 1 
ATOM   6971 N N   . PHE D 2 166 ? 44.105 47.855 23.934  1.00 77.11  ? 268  PHE D N   1 
ATOM   6972 C CA  . PHE D 2 166 ? 45.513 47.480 24.002  1.00 77.54  ? 268  PHE D CA  1 
ATOM   6973 C C   . PHE D 2 166 ? 46.324 48.265 25.048  1.00 77.89  ? 268  PHE D C   1 
ATOM   6974 O O   . PHE D 2 166 ? 47.075 49.189 24.722  1.00 78.05  ? 268  PHE D O   1 
ATOM   6975 C CB  . PHE D 2 166 ? 46.120 47.634 22.606  1.00 76.20  ? 268  PHE D CB  1 
ATOM   6976 C CG  . PHE D 2 166 ? 45.700 46.557 21.646  1.00 76.49  ? 268  PHE D CG  1 
ATOM   6977 C CD1 . PHE D 2 166 ? 45.549 46.827 20.295  1.00 76.22  ? 268  PHE D CD1 1 
ATOM   6978 C CD2 . PHE D 2 166 ? 45.489 45.255 22.097  1.00 76.83  ? 268  PHE D CD2 1 
ATOM   6979 C CE1 . PHE D 2 166 ? 45.198 45.817 19.410  1.00 76.66  ? 268  PHE D CE1 1 
ATOM   6980 C CE2 . PHE D 2 166 ? 45.137 44.235 21.220  1.00 76.20  ? 268  PHE D CE2 1 
ATOM   6981 C CZ  . PHE D 2 166 ? 44.992 44.516 19.876  1.00 76.66  ? 268  PHE D CZ  1 
ATOM   6982 N N   . SER D 2 167 ? 46.162 47.883 26.311  1.00 77.22  ? 269  SER D N   1 
ATOM   6983 C CA  . SER D 2 167 ? 46.862 48.538 27.404  1.00 76.15  ? 269  SER D CA  1 
ATOM   6984 C C   . SER D 2 167 ? 47.722 47.500 28.133  1.00 76.11  ? 269  SER D C   1 
ATOM   6985 O O   . SER D 2 167 ? 47.209 46.558 28.749  1.00 75.89  ? 269  SER D O   1 
ATOM   6986 C CB  . SER D 2 167 ? 45.846 49.185 28.352  1.00 75.72  ? 269  SER D CB  1 
ATOM   6987 O OG  . SER D 2 167 ? 44.964 50.049 27.645  1.00 73.22  ? 269  SER D OG  1 
ATOM   6988 N N   . PRO D 2 168 ? 49.053 47.661 28.067  1.00 75.16  ? 270  PRO D N   1 
ATOM   6989 C CA  . PRO D 2 168 ? 49.923 46.701 28.735  1.00 72.71  ? 270  PRO D CA  1 
ATOM   6990 C C   . PRO D 2 168 ? 49.824 46.755 30.261  1.00 70.57  ? 270  PRO D C   1 
ATOM   6991 O O   . PRO D 2 168 ? 50.044 45.748 30.933  1.00 69.27  ? 270  PRO D O   1 
ATOM   6992 C CB  . PRO D 2 168 ? 51.303 47.083 28.205  1.00 73.63  ? 270  PRO D CB  1 
ATOM   6993 C CG  . PRO D 2 168 ? 51.208 48.576 28.123  1.00 74.03  ? 270  PRO D CG  1 
ATOM   6994 C CD  . PRO D 2 168 ? 49.840 48.775 27.498  1.00 75.01  ? 270  PRO D CD  1 
ATOM   6995 N N   . ASP D 2 169 ? 49.469 47.912 30.815  1.00 69.13  ? 271  ASP D N   1 
ATOM   6996 C CA  . ASP D 2 169 ? 49.396 48.010 32.265  1.00 68.80  ? 271  ASP D CA  1 
ATOM   6997 C C   . ASP D 2 169 ? 48.141 47.477 32.946  1.00 70.41  ? 271  ASP D C   1 
ATOM   6998 O O   . ASP D 2 169 ? 48.062 47.513 34.173  1.00 70.71  ? 271  ASP D O   1 
ATOM   6999 C CB  . ASP D 2 169 ? 49.666 49.448 32.726  1.00 65.65  ? 271  ASP D CB  1 
ATOM   7000 C CG  . ASP D 2 169 ? 48.533 50.399 32.419  1.00 62.23  ? 271  ASP D CG  1 
ATOM   7001 O OD1 . ASP D 2 169 ? 48.094 50.451 31.246  1.00 59.91  ? 271  ASP D OD1 1 
ATOM   7002 O OD2 . ASP D 2 169 ? 48.109 51.107 33.363  1.00 57.70  ? 271  ASP D OD2 1 
ATOM   7003 N N   . ARG D 2 170 ? 47.173 46.976 32.174  1.00 71.73  ? 272  ARG D N   1 
ATOM   7004 C CA  . ARG D 2 170 ? 45.948 46.422 32.760  1.00 72.30  ? 272  ARG D CA  1 
ATOM   7005 C C   . ARG D 2 170 ? 46.323 45.260 33.658  1.00 74.07  ? 272  ARG D C   1 
ATOM   7006 O O   . ARG D 2 170 ? 46.930 44.293 33.201  1.00 74.08  ? 272  ARG D O   1 
ATOM   7007 C CB  . ARG D 2 170 ? 45.003 45.882 31.690  1.00 70.04  ? 272  ARG D CB  1 
ATOM   7008 C CG  . ARG D 2 170 ? 44.487 46.896 30.729  1.00 68.13  ? 272  ARG D CG  1 
ATOM   7009 C CD  . ARG D 2 170 ? 43.737 48.003 31.409  1.00 65.85  ? 272  ARG D CD  1 
ATOM   7010 N NE  . ARG D 2 170 ? 43.103 48.821 30.388  1.00 64.16  ? 272  ARG D NE  1 
ATOM   7011 C CZ  . ARG D 2 170 ? 42.675 50.055 30.579  1.00 63.49  ? 272  ARG D CZ  1 
ATOM   7012 N NH1 . ARG D 2 170 ? 42.106 50.718 29.580  1.00 62.67  ? 272  ARG D NH1 1 
ATOM   7013 N NH2 . ARG D 2 170 ? 42.827 50.619 31.768  1.00 63.84  ? 272  ARG D NH2 1 
ATOM   7014 N N   . PRO D 2 171 ? 45.954 45.328 34.945  1.00 75.85  ? 273  PRO D N   1 
ATOM   7015 C CA  . PRO D 2 171 ? 46.282 44.242 35.872  1.00 78.03  ? 273  PRO D CA  1 
ATOM   7016 C C   . PRO D 2 171 ? 45.866 42.877 35.330  1.00 80.49  ? 273  PRO D C   1 
ATOM   7017 O O   . PRO D 2 171 ? 44.729 42.700 34.890  1.00 81.56  ? 273  PRO D O   1 
ATOM   7018 C CB  . PRO D 2 171 ? 45.523 44.632 37.141  1.00 76.89  ? 273  PRO D CB  1 
ATOM   7019 C CG  . PRO D 2 171 ? 44.372 45.434 36.619  1.00 76.06  ? 273  PRO D CG  1 
ATOM   7020 C CD  . PRO D 2 171 ? 45.030 46.288 35.569  1.00 75.77  ? 273  PRO D CD  1 
ATOM   7021 N N   . GLY D 2 172 ? 46.795 41.925 35.341  1.00 82.25  ? 274  GLY D N   1 
ATOM   7022 C CA  . GLY D 2 172 ? 46.479 40.595 34.853  1.00 83.84  ? 274  GLY D CA  1 
ATOM   7023 C C   . GLY D 2 172 ? 47.058 40.154 33.513  1.00 85.26  ? 274  GLY D C   1 
ATOM   7024 O O   . GLY D 2 172 ? 46.765 39.043 33.065  1.00 85.96  ? 274  GLY D O   1 
ATOM   7025 N N   . VAL D 2 173 ? 47.858 40.988 32.853  1.00 86.11  ? 275  VAL D N   1 
ATOM   7026 C CA  . VAL D 2 173 ? 48.434 40.571 31.578  1.00 87.02  ? 275  VAL D CA  1 
ATOM   7027 C C   . VAL D 2 173 ? 49.705 39.784 31.850  1.00 88.30  ? 275  VAL D C   1 
ATOM   7028 O O   . VAL D 2 173 ? 50.451 40.087 32.790  1.00 88.34  ? 275  VAL D O   1 
ATOM   7029 C CB  . VAL D 2 173 ? 48.784 41.764 30.654  1.00 86.38  ? 275  VAL D CB  1 
ATOM   7030 C CG1 . VAL D 2 173 ? 47.531 42.535 30.298  1.00 86.10  ? 275  VAL D CG1 1 
ATOM   7031 C CG2 . VAL D 2 173 ? 49.809 42.663 31.325  1.00 87.02  ? 275  VAL D CG2 1 
ATOM   7032 N N   . THR D 2 174 ? 49.930 38.763 31.029  1.00 89.03  ? 276  THR D N   1 
ATOM   7033 C CA  . THR D 2 174 ? 51.100 37.908 31.143  1.00 89.35  ? 276  THR D CA  1 
ATOM   7034 C C   . THR D 2 174 ? 52.087 38.207 30.014  1.00 89.35  ? 276  THR D C   1 
ATOM   7035 O O   . THR D 2 174 ? 53.233 38.559 30.277  1.00 89.68  ? 276  THR D O   1 
ATOM   7036 C CB  . THR D 2 174 ? 50.700 36.402 31.133  1.00 89.78  ? 276  THR D CB  1 
ATOM   7037 O OG1 . THR D 2 174 ? 49.848 36.123 30.014  1.00 90.19  ? 276  THR D OG1 1 
ATOM   7038 C CG2 . THR D 2 174 ? 49.966 36.040 32.421  1.00 89.23  ? 276  THR D CG2 1 
ATOM   7039 N N   . GLN D 2 175 ? 51.644 38.091 28.765  1.00 89.78  ? 277  GLN D N   1 
ATOM   7040 C CA  . GLN D 2 175 ? 52.503 38.371 27.612  1.00 90.42  ? 277  GLN D CA  1 
ATOM   7041 C C   . GLN D 2 175 ? 52.501 39.889 27.405  1.00 90.37  ? 277  GLN D C   1 
ATOM   7042 O O   . GLN D 2 175 ? 52.111 40.389 26.353  1.00 88.60  ? 277  GLN D O   1 
ATOM   7043 C CB  . GLN D 2 175 ? 51.967 37.655 26.360  1.00 90.72  ? 277  GLN D CB  1 
ATOM   7044 C CG  . GLN D 2 175 ? 51.392 36.230 26.603  1.00 91.16  ? 277  GLN D CG  1 
ATOM   7045 C CD  . GLN D 2 175 ? 52.405 35.199 27.132  1.00 90.61  ? 277  GLN D CD  1 
ATOM   7046 O OE1 . GLN D 2 175 ? 53.359 34.830 26.442  1.00 90.96  ? 277  GLN D OE1 1 
ATOM   7047 N NE2 . GLN D 2 175 ? 52.183 34.724 28.358  1.00 89.08  ? 277  GLN D NE2 1 
ATOM   7048 N N   . ARG D 2 176 ? 52.969 40.597 28.430  1.00 92.41  ? 278  ARG D N   1 
ATOM   7049 C CA  . ARG D 2 176 ? 53.011 42.053 28.481  1.00 95.86  ? 278  ARG D CA  1 
ATOM   7050 C C   . ARG D 2 176 ? 53.767 42.831 27.401  1.00 99.14  ? 278  ARG D C   1 
ATOM   7051 O O   . ARG D 2 176 ? 53.283 43.868 26.939  1.00 99.92  ? 278  ARG D O   1 
ATOM   7052 C CB  . ARG D 2 176 ? 53.534 42.494 29.849  1.00 94.85  ? 278  ARG D CB  1 
ATOM   7053 C CG  . ARG D 2 176 ? 53.224 43.938 30.138  1.00 93.91  ? 278  ARG D CG  1 
ATOM   7054 C CD  . ARG D 2 176 ? 54.226 44.582 31.063  1.00 93.19  ? 278  ARG D CD  1 
ATOM   7055 N NE  . ARG D 2 176 ? 54.115 46.037 30.989  1.00 93.04  ? 278  ARG D NE  1 
ATOM   7056 C CZ  . ARG D 2 176 ? 54.440 46.768 29.922  1.00 93.29  ? 278  ARG D CZ  1 
ATOM   7057 N NH1 . ARG D 2 176 ? 54.909 46.188 28.824  1.00 93.80  ? 278  ARG D NH1 1 
ATOM   7058 N NH2 . ARG D 2 176 ? 54.284 48.085 29.946  1.00 92.98  ? 278  ARG D NH2 1 
ATOM   7059 N N   . ASP D 2 177 ? 54.952 42.362 27.014  1.00 102.99 ? 279  ASP D N   1 
ATOM   7060 C CA  . ASP D 2 177 ? 55.763 43.053 25.994  1.00 106.03 ? 279  ASP D CA  1 
ATOM   7061 C C   . ASP D 2 177 ? 55.183 42.948 24.578  1.00 105.71 ? 279  ASP D C   1 
ATOM   7062 O O   . ASP D 2 177 ? 55.281 43.882 23.781  1.00 104.04 ? 279  ASP D O   1 
ATOM   7063 C CB  . ASP D 2 177 ? 57.203 42.508 25.998  1.00 109.77 ? 279  ASP D CB  1 
ATOM   7064 C CG  . ASP D 2 177 ? 58.009 42.954 27.223  1.00 112.21 ? 279  ASP D CG  1 
ATOM   7065 O OD1 . ASP D 2 177 ? 57.532 42.767 28.371  1.00 113.40 ? 279  ASP D OD1 1 
ATOM   7066 O OD2 . ASP D 2 177 ? 59.129 43.482 27.028  1.00 113.01 ? 279  ASP D OD2 1 
ATOM   7067 N N   . GLU D 2 178 ? 54.599 41.793 24.277  1.00 106.41 ? 280  GLU D N   1 
ATOM   7068 C CA  . GLU D 2 178 ? 53.973 41.536 22.988  1.00 107.52 ? 280  GLU D CA  1 
ATOM   7069 C C   . GLU D 2 178 ? 52.836 42.541 22.810  1.00 107.29 ? 280  GLU D C   1 
ATOM   7070 O O   . GLU D 2 178 ? 52.544 42.984 21.696  1.00 105.84 ? 280  GLU D O   1 
ATOM   7071 C CB  . GLU D 2 178 ? 53.418 40.117 22.988  1.00 109.63 ? 280  GLU D CB  1 
ATOM   7072 C CG  . GLU D 2 178 ? 52.740 39.688 21.708  1.00 113.62 ? 280  GLU D CG  1 
ATOM   7073 C CD  . GLU D 2 178 ? 51.674 38.628 21.961  1.00 116.91 ? 280  GLU D CD  1 
ATOM   7074 O OE1 . GLU D 2 178 ? 51.870 37.790 22.873  1.00 118.30 ? 280  GLU D OE1 1 
ATOM   7075 O OE2 . GLU D 2 178 ? 50.642 38.628 21.249  1.00 118.77 ? 280  GLU D OE2 1 
ATOM   7076 N N   . ILE D 2 179 ? 52.204 42.874 23.937  1.00 107.99 ? 281  ILE D N   1 
ATOM   7077 C CA  . ILE D 2 179 ? 51.097 43.827 24.031  1.00 108.36 ? 281  ILE D CA  1 
ATOM   7078 C C   . ILE D 2 179 ? 51.592 45.270 24.016  1.00 108.41 ? 281  ILE D C   1 
ATOM   7079 O O   . ILE D 2 179 ? 50.857 46.185 23.642  1.00 108.33 ? 281  ILE D O   1 
ATOM   7080 C CB  . ILE D 2 179 ? 50.296 43.611 25.330  1.00 108.67 ? 281  ILE D CB  1 
ATOM   7081 C CG1 . ILE D 2 179 ? 49.369 42.408 25.165  1.00 109.36 ? 281  ILE D CG1 1 
ATOM   7082 C CG2 . ILE D 2 179 ? 49.532 44.877 25.699  1.00 108.03 ? 281  ILE D CG2 1 
ATOM   7083 C CD1 . ILE D 2 179 ? 48.599 42.052 26.423  1.00 110.74 ? 281  ILE D CD1 1 
ATOM   7084 N N   . ASP D 2 180 ? 52.833 45.476 24.442  1.00 108.12 ? 282  ASP D N   1 
ATOM   7085 C CA  . ASP D 2 180 ? 53.408 46.811 24.430  1.00 107.86 ? 282  ASP D CA  1 
ATOM   7086 C C   . ASP D 2 180 ? 53.697 47.194 22.964  1.00 107.27 ? 282  ASP D C   1 
ATOM   7087 O O   . ASP D 2 180 ? 53.722 48.377 22.614  1.00 106.25 ? 282  ASP D O   1 
ATOM   7088 C CB  . ASP D 2 180 ? 54.697 46.840 25.257  1.00 108.39 ? 282  ASP D CB  1 
ATOM   7089 C CG  . ASP D 2 180 ? 55.077 48.245 25.696  1.00 108.72 ? 282  ASP D CG  1 
ATOM   7090 O OD1 . ASP D 2 180 ? 54.398 48.798 26.592  1.00 108.68 ? 282  ASP D OD1 1 
ATOM   7091 O OD2 . ASP D 2 180 ? 56.048 48.795 25.135  1.00 109.11 ? 282  ASP D OD2 1 
ATOM   7092 N N   . GLN D 2 181 ? 53.906 46.178 22.120  1.00 106.83 ? 283  GLN D N   1 
ATOM   7093 C CA  . GLN D 2 181 ? 54.176 46.358 20.687  1.00 105.98 ? 283  GLN D CA  1 
ATOM   7094 C C   . GLN D 2 181 ? 52.918 46.830 19.965  1.00 103.84 ? 283  GLN D C   1 
ATOM   7095 O O   . GLN D 2 181 ? 52.915 47.854 19.276  1.00 103.04 ? 283  GLN D O   1 
ATOM   7096 C CB  . GLN D 2 181 ? 54.639 45.034 20.060  1.00 107.18 ? 283  GLN D CB  1 
ATOM   7097 C CG  . GLN D 2 181 ? 55.978 44.523 20.571  1.00 108.92 ? 283  GLN D CG  1 
ATOM   7098 C CD  . GLN D 2 181 ? 56.321 43.144 20.034  1.00 109.66 ? 283  GLN D CD  1 
ATOM   7099 O OE1 . GLN D 2 181 ? 56.292 42.912 18.824  1.00 109.62 ? 283  GLN D OE1 1 
ATOM   7100 N NE2 . GLN D 2 181 ? 56.658 42.223 20.935  1.00 110.03 ? 283  GLN D NE2 1 
ATOM   7101 N N   . LEU D 2 182 ? 51.850 46.058 20.125  1.00 101.49 ? 284  LEU D N   1 
ATOM   7102 C CA  . LEU D 2 182 ? 50.569 46.375 19.515  1.00 98.90  ? 284  LEU D CA  1 
ATOM   7103 C C   . LEU D 2 182 ? 50.110 47.751 19.997  1.00 98.05  ? 284  LEU D C   1 
ATOM   7104 O O   . LEU D 2 182 ? 49.514 48.515 19.241  1.00 97.26  ? 284  LEU D O   1 
ATOM   7105 C CB  . LEU D 2 182 ? 49.546 45.304 19.898  1.00 96.49  ? 284  LEU D CB  1 
ATOM   7106 C CG  . LEU D 2 182 ? 50.047 43.869 19.702  1.00 94.89  ? 284  LEU D CG  1 
ATOM   7107 C CD1 . LEU D 2 182 ? 49.059 42.877 20.279  1.00 94.03  ? 284  LEU D CD1 1 
ATOM   7108 C CD2 . LEU D 2 182 ? 50.278 43.618 18.227  1.00 94.36  ? 284  LEU D CD2 1 
ATOM   7109 N N   . GLN D 2 183 ? 50.401 48.063 21.257  1.00 97.65  ? 285  GLN D N   1 
ATOM   7110 C CA  . GLN D 2 183 ? 50.022 49.345 21.832  1.00 98.17  ? 285  GLN D CA  1 
ATOM   7111 C C   . GLN D 2 183 ? 50.541 50.494 20.985  1.00 99.37  ? 285  GLN D C   1 
ATOM   7112 O O   . GLN D 2 183 ? 49.767 51.225 20.368  1.00 99.22  ? 285  GLN D O   1 
ATOM   7113 C CB  . GLN D 2 183 ? 50.580 49.504 23.253  1.00 97.56  ? 285  GLN D CB  1 
ATOM   7114 C CG  . GLN D 2 183 ? 50.261 50.868 23.878  1.00 95.16  ? 285  GLN D CG  1 
ATOM   7115 C CD  . GLN D 2 183 ? 51.158 51.234 25.048  1.00 94.58  ? 285  GLN D CD  1 
ATOM   7116 O OE1 . GLN D 2 183 ? 51.073 52.336 25.572  1.00 94.62  ? 285  GLN D OE1 1 
ATOM   7117 N NE2 . GLN D 2 183 ? 52.020 50.314 25.459  1.00 94.73  ? 285  GLN D NE2 1 
ATOM   7118 N N   . GLU D 2 184 ? 51.862 50.645 20.961  1.00 100.89 ? 286  GLU D N   1 
ATOM   7119 C CA  . GLU D 2 184 ? 52.502 51.721 20.215  1.00 101.84 ? 286  GLU D CA  1 
ATOM   7120 C C   . GLU D 2 184 ? 52.082 51.747 18.750  1.00 101.87 ? 286  GLU D C   1 
ATOM   7121 O O   . GLU D 2 184 ? 51.997 52.818 18.147  1.00 102.16 ? 286  GLU D O   1 
ATOM   7122 C CB  . GLU D 2 184 ? 54.019 51.595 20.318  1.00 103.05 ? 286  GLU D CB  1 
ATOM   7123 C CG  . GLU D 2 184 ? 54.748 52.922 20.327  1.00 104.10 ? 286  GLU D CG  1 
ATOM   7124 C CD  . GLU D 2 184 ? 56.197 52.767 20.728  1.00 105.39 ? 286  GLU D CD  1 
ATOM   7125 O OE1 . GLU D 2 184 ? 56.964 52.156 19.953  1.00 106.45 ? 286  GLU D OE1 1 
ATOM   7126 O OE2 . GLU D 2 184 ? 56.563 53.246 21.823  1.00 106.15 ? 286  GLU D OE2 1 
ATOM   7127 N N   . GLU D 2 185 ? 51.817 50.570 18.183  1.00 101.59 ? 287  GLU D N   1 
ATOM   7128 C CA  . GLU D 2 185 ? 51.393 50.467 16.786  1.00 100.71 ? 287  GLU D CA  1 
ATOM   7129 C C   . GLU D 2 185 ? 50.187 51.356 16.509  1.00 99.80  ? 287  GLU D C   1 
ATOM   7130 O O   . GLU D 2 185 ? 50.113 52.036 15.481  1.00 98.29  ? 287  GLU D O   1 
ATOM   7131 C CB  . GLU D 2 185 ? 51.038 49.024 16.444  1.00 100.47 ? 287  GLU D CB  1 
ATOM   7132 C CG  . GLU D 2 185 ? 50.591 48.865 15.013  1.00 101.74 ? 287  GLU D CG  1 
ATOM   7133 C CD  . GLU D 2 185 ? 50.516 47.421 14.599  1.00 102.51 ? 287  GLU D CD  1 
ATOM   7134 O OE1 . GLU D 2 185 ? 50.986 46.559 15.376  1.00 103.11 ? 287  GLU D OE1 1 
ATOM   7135 O OE2 . GLU D 2 185 ? 49.998 47.150 13.493  1.00 102.41 ? 287  GLU D OE2 1 
ATOM   7136 N N   . MET D 2 186 ? 49.244 51.326 17.446  1.00 99.85  ? 288  MET D N   1 
ATOM   7137 C CA  . MET D 2 186 ? 48.027 52.119 17.372  1.00 99.00  ? 288  MET D CA  1 
ATOM   7138 C C   . MET D 2 186 ? 48.372 53.592 17.539  1.00 97.11  ? 288  MET D C   1 
ATOM   7139 O O   . MET D 2 186 ? 48.078 54.403 16.665  1.00 97.68  ? 288  MET D O   1 
ATOM   7140 C CB  . MET D 2 186 ? 47.059 51.712 18.484  1.00 101.07 ? 288  MET D CB  1 
ATOM   7141 C CG  . MET D 2 186 ? 46.753 50.232 18.549  1.00 102.68 ? 288  MET D CG  1 
ATOM   7142 S SD  . MET D 2 186 ? 46.222 49.572 16.969  1.00 105.42 ? 288  MET D SD  1 
ATOM   7143 C CE  . MET D 2 186 ? 47.560 48.443 16.634  1.00 105.69 ? 288  MET D CE  1 
ATOM   7144 N N   . ALA D 2 187 ? 48.986 53.931 18.671  1.00 93.73  ? 289  ALA D N   1 
ATOM   7145 C CA  . ALA D 2 187 ? 49.362 55.307 18.948  1.00 90.98  ? 289  ALA D CA  1 
ATOM   7146 C C   . ALA D 2 187 ? 49.890 55.985 17.681  1.00 90.05  ? 289  ALA D C   1 
ATOM   7147 O O   . ALA D 2 187 ? 49.433 57.068 17.314  1.00 89.79  ? 289  ALA D O   1 
ATOM   7148 C CB  . ALA D 2 187 ? 50.409 55.343 20.051  1.00 90.09  ? 289  ALA D CB  1 
ATOM   7149 N N   . LEU D 2 188 ? 50.834 55.324 17.009  1.00 88.35  ? 290  LEU D N   1 
ATOM   7150 C CA  . LEU D 2 188 ? 51.452 55.834 15.787  1.00 86.06  ? 290  LEU D CA  1 
ATOM   7151 C C   . LEU D 2 188 ? 50.495 55.861 14.615  1.00 84.42  ? 290  LEU D C   1 
ATOM   7152 O O   . LEU D 2 188 ? 50.383 56.866 13.925  1.00 81.96  ? 290  LEU D O   1 
ATOM   7153 C CB  . LEU D 2 188 ? 52.662 54.981 15.425  1.00 86.40  ? 290  LEU D CB  1 
ATOM   7154 C CG  . LEU D 2 188 ? 53.662 54.862 16.574  1.00 87.49  ? 290  LEU D CG  1 
ATOM   7155 C CD1 . LEU D 2 188 ? 54.777 53.911 16.183  1.00 87.54  ? 290  LEU D CD1 1 
ATOM   7156 C CD2 . LEU D 2 188 ? 54.209 56.244 16.934  1.00 86.80  ? 290  LEU D CD2 1 
ATOM   7157 N N   . THR D 2 189 ? 49.815 54.743 14.389  1.00 84.75  ? 291  THR D N   1 
ATOM   7158 C CA  . THR D 2 189 ? 48.844 54.630 13.302  1.00 85.75  ? 291  THR D CA  1 
ATOM   7159 C C   . THR D 2 189 ? 47.713 55.670 13.458  1.00 86.28  ? 291  THR D C   1 
ATOM   7160 O O   . THR D 2 189 ? 46.973 55.960 12.509  1.00 85.68  ? 291  THR D O   1 
ATOM   7161 C CB  . THR D 2 189 ? 48.230 53.203 13.261  1.00 85.94  ? 291  THR D CB  1 
ATOM   7162 O OG1 . THR D 2 189 ? 49.278 52.220 13.239  1.00 84.51  ? 291  THR D OG1 1 
ATOM   7163 C CG2 . THR D 2 189 ? 47.356 53.035 12.023  1.00 85.95  ? 291  THR D CG2 1 
ATOM   7164 N N   . LEU D 2 190 ? 47.589 56.218 14.665  1.00 86.89  ? 292  LEU D N   1 
ATOM   7165 C CA  . LEU D 2 190 ? 46.586 57.224 14.977  1.00 88.05  ? 292  LEU D CA  1 
ATOM   7166 C C   . LEU D 2 190 ? 47.224 58.608 14.850  1.00 89.80  ? 292  LEU D C   1 
ATOM   7167 O O   . LEU D 2 190 ? 46.533 59.590 14.571  1.00 91.28  ? 292  LEU D O   1 
ATOM   7168 C CB  . LEU D 2 190 ? 46.048 57.011 16.396  1.00 87.18  ? 292  LEU D CB  1 
ATOM   7169 C CG  . LEU D 2 190 ? 44.709 57.665 16.767  1.00 87.27  ? 292  LEU D CG  1 
ATOM   7170 C CD1 . LEU D 2 190 ? 44.204 57.081 18.081  1.00 86.98  ? 292  LEU D CD1 1 
ATOM   7171 C CD2 . LEU D 2 190 ? 44.860 59.174 16.869  1.00 86.33  ? 292  LEU D CD2 1 
ATOM   7172 N N   . GLN D 2 191 ? 48.540 58.682 15.061  1.00 91.18  ? 293  GLN D N   1 
ATOM   7173 C CA  . GLN D 2 191 ? 49.285 59.940 14.937  1.00 91.53  ? 293  GLN D CA  1 
ATOM   7174 C C   . GLN D 2 191 ? 49.378 60.334 13.458  1.00 92.42  ? 293  GLN D C   1 
ATOM   7175 O O   . GLN D 2 191 ? 49.523 61.510 13.132  1.00 91.00  ? 293  GLN D O   1 
ATOM   7176 C CB  . GLN D 2 191 ? 50.697 59.786 15.520  1.00 90.36  ? 293  GLN D CB  1 
ATOM   7177 C CG  . GLN D 2 191 ? 50.738 59.632 17.039  1.00 90.56  ? 293  GLN D CG  1 
ATOM   7178 C CD  . GLN D 2 191 ? 52.134 59.321 17.585  1.00 90.90  ? 293  GLN D CD  1 
ATOM   7179 O OE1 . GLN D 2 191 ? 53.104 60.017 17.280  1.00 91.92  ? 293  GLN D OE1 1 
ATOM   7180 N NE2 . GLN D 2 191 ? 52.231 58.279 18.408  1.00 89.53  ? 293  GLN D NE2 1 
ATOM   7181 N N   . SER D 2 192 ? 49.281 59.330 12.581  1.00 94.82  ? 294  SER D N   1 
ATOM   7182 C CA  . SER D 2 192 ? 49.348 59.497 11.125  1.00 96.52  ? 294  SER D CA  1 
ATOM   7183 C C   . SER D 2 192 ? 48.051 60.071 10.611  1.00 97.16  ? 294  SER D C   1 
ATOM   7184 O O   . SER D 2 192 ? 48.025 61.092 9.925   1.00 96.20  ? 294  SER D O   1 
ATOM   7185 C CB  . SER D 2 192 ? 49.561 58.146 10.446  1.00 97.25  ? 294  SER D CB  1 
ATOM   7186 O OG  . SER D 2 192 ? 50.318 57.279 11.268  1.00 98.92  ? 294  SER D OG  1 
ATOM   7187 N N   . TYR D 2 193 ? 46.972 59.376 10.935  1.00 98.41  ? 295  TYR D N   1 
ATOM   7188 C CA  . TYR D 2 193 ? 45.657 59.808 10.532  1.00 100.90 ? 295  TYR D CA  1 
ATOM   7189 C C   . TYR D 2 193 ? 45.390 61.213 11.084  1.00 102.32 ? 295  TYR D C   1 
ATOM   7190 O O   . TYR D 2 193 ? 44.672 61.996 10.471  1.00 102.22 ? 295  TYR D O   1 
ATOM   7191 C CB  . TYR D 2 193 ? 44.618 58.822 11.055  1.00 102.14 ? 295  TYR D CB  1 
ATOM   7192 C CG  . TYR D 2 193 ? 43.311 58.854 10.301  1.00 103.53 ? 295  TYR D CG  1 
ATOM   7193 C CD1 . TYR D 2 193 ? 42.502 59.984 10.315  1.00 103.93 ? 295  TYR D CD1 1 
ATOM   7194 C CD2 . TYR D 2 193 ? 42.898 57.759 9.555   1.00 104.03 ? 295  TYR D CD2 1 
ATOM   7195 C CE1 . TYR D 2 193 ? 41.322 60.023 9.607   1.00 105.24 ? 295  TYR D CE1 1 
ATOM   7196 C CE2 . TYR D 2 193 ? 41.721 57.787 8.844   1.00 105.82 ? 295  TYR D CE2 1 
ATOM   7197 C CZ  . TYR D 2 193 ? 40.933 58.925 8.871   1.00 106.60 ? 295  TYR D CZ  1 
ATOM   7198 O OH  . TYR D 2 193 ? 39.754 58.966 8.159   1.00 107.88 ? 295  TYR D OH  1 
ATOM   7199 N N   . ILE D 2 194 ? 45.966 61.536 12.240  1.00 104.41 ? 296  ILE D N   1 
ATOM   7200 C CA  . ILE D 2 194 ? 45.771 62.858 12.824  1.00 107.59 ? 296  ILE D CA  1 
ATOM   7201 C C   . ILE D 2 194 ? 46.403 63.946 11.968  1.00 111.26 ? 296  ILE D C   1 
ATOM   7202 O O   . ILE D 2 194 ? 45.731 64.895 11.573  1.00 112.28 ? 296  ILE D O   1 
ATOM   7203 C CB  . ILE D 2 194 ? 46.348 62.959 14.262  1.00 106.06 ? 296  ILE D CB  1 
ATOM   7204 C CG1 . ILE D 2 194 ? 45.390 62.286 15.241  1.00 105.14 ? 296  ILE D CG1 1 
ATOM   7205 C CG2 . ILE D 2 194 ? 46.555 64.420 14.660  1.00 104.06 ? 296  ILE D CG2 1 
ATOM   7206 C CD1 . ILE D 2 194 ? 45.349 62.945 16.581  1.00 103.64 ? 296  ILE D CD1 1 
ATOM   7207 N N   . LYS D 2 195 ? 47.691 63.816 11.675  1.00 115.38 ? 297  LYS D N   1 
ATOM   7208 C CA  . LYS D 2 195 ? 48.367 64.814 10.858  1.00 119.27 ? 297  LYS D CA  1 
ATOM   7209 C C   . LYS D 2 195 ? 47.723 64.893 9.476   1.00 121.68 ? 297  LYS D C   1 
ATOM   7210 O O   . LYS D 2 195 ? 47.567 65.981 8.918   1.00 121.58 ? 297  LYS D O   1 
ATOM   7211 C CB  . LYS D 2 195 ? 49.852 64.473 10.725  1.00 120.19 ? 297  LYS D CB  1 
ATOM   7212 C CG  . LYS D 2 195 ? 50.631 64.514 12.039  1.00 122.09 ? 297  LYS D CG  1 
ATOM   7213 C CD  . LYS D 2 195 ? 50.610 65.909 12.665  1.00 123.12 ? 297  LYS D CD  1 
ATOM   7214 C CE  . LYS D 2 195 ? 51.455 65.984 13.943  1.00 122.98 ? 297  LYS D CE  1 
ATOM   7215 N NZ  . LYS D 2 195 ? 52.913 65.746 13.705  1.00 122.41 ? 297  LYS D NZ  1 
ATOM   7216 N N   . GLY D 2 196 ? 47.340 63.741 8.931   1.00 124.29 ? 298  GLY D N   1 
ATOM   7217 C CA  . GLY D 2 196 ? 46.718 63.720 7.620   1.00 128.29 ? 298  GLY D CA  1 
ATOM   7218 C C   . GLY D 2 196 ? 45.223 63.978 7.640   1.00 131.70 ? 298  GLY D C   1 
ATOM   7219 O O   . GLY D 2 196 ? 44.465 63.279 6.963   1.00 131.50 ? 298  GLY D O   1 
ATOM   7220 N N   . GLN D 2 197 ? 44.799 64.981 8.409   1.00 135.39 ? 299  GLN D N   1 
ATOM   7221 C CA  . GLN D 2 197 ? 43.384 65.330 8.513   1.00 138.72 ? 299  GLN D CA  1 
ATOM   7222 C C   . GLN D 2 197 ? 42.918 65.972 7.215   1.00 141.59 ? 299  GLN D C   1 
ATOM   7223 O O   . GLN D 2 197 ? 43.618 66.808 6.631   1.00 141.82 ? 299  GLN D O   1 
ATOM   7224 C CB  . GLN D 2 197 ? 43.141 66.305 9.672   1.00 137.84 ? 299  GLN D CB  1 
ATOM   7225 C CG  . GLN D 2 197 ? 43.750 67.687 9.461   1.00 137.49 ? 299  GLN D CG  1 
ATOM   7226 C CD  . GLN D 2 197 ? 43.358 68.688 10.540  1.00 137.29 ? 299  GLN D CD  1 
ATOM   7227 O OE1 . GLN D 2 197 ? 43.765 69.848 10.497  1.00 136.66 ? 299  GLN D OE1 1 
ATOM   7228 N NE2 . GLN D 2 197 ? 42.565 68.242 11.510  1.00 136.43 ? 299  GLN D NE2 1 
ATOM   7229 N N   . GLN D 2 198 ? 41.731 65.568 6.771   1.00 144.65 ? 300  GLN D N   1 
ATOM   7230 C CA  . GLN D 2 198 ? 41.143 66.086 5.540   1.00 147.32 ? 300  GLN D CA  1 
ATOM   7231 C C   . GLN D 2 198 ? 40.851 67.581 5.677   1.00 148.48 ? 300  GLN D C   1 
ATOM   7232 O O   . GLN D 2 198 ? 41.379 68.406 4.925   1.00 148.91 ? 300  GLN D O   1 
ATOM   7233 C CB  . GLN D 2 198 ? 39.851 65.316 5.220   1.00 148.24 ? 300  GLN D CB  1 
ATOM   7234 C CG  . GLN D 2 198 ? 40.069 63.826 4.947   1.00 150.23 ? 300  GLN D CG  1 
ATOM   7235 C CD  . GLN D 2 198 ? 38.775 63.064 4.705   1.00 151.76 ? 300  GLN D CD  1 
ATOM   7236 O OE1 . GLN D 2 198 ? 37.972 63.436 3.847   1.00 152.62 ? 300  GLN D OE1 1 
ATOM   7237 N NE2 . GLN D 2 198 ? 38.571 61.987 5.459   1.00 152.45 ? 300  GLN D NE2 1 
ATOM   7238 N N   . ARG D 2 199 ? 40.016 67.917 6.654   1.00 149.36 ? 301  ARG D N   1 
ATOM   7239 C CA  . ARG D 2 199 ? 39.630 69.296 6.917   1.00 149.69 ? 301  ARG D CA  1 
ATOM   7240 C C   . ARG D 2 199 ? 40.217 69.762 8.246   1.00 148.81 ? 301  ARG D C   1 
ATOM   7241 O O   . ARG D 2 199 ? 40.309 68.988 9.197   1.00 148.68 ? 301  ARG D O   1 
ATOM   7242 C CB  . ARG D 2 199 ? 38.105 69.394 6.959   1.00 151.42 ? 301  ARG D CB  1 
ATOM   7243 C CG  . ARG D 2 199 ? 37.420 69.205 5.611   1.00 153.67 ? 301  ARG D CG  1 
ATOM   7244 C CD  . ARG D 2 199 ? 37.349 70.524 4.869   1.00 155.36 ? 301  ARG D CD  1 
ATOM   7245 N NE  . ARG D 2 199 ? 36.721 71.542 5.705   1.00 156.90 ? 301  ARG D NE  1 
ATOM   7246 C CZ  . ARG D 2 199 ? 36.599 72.822 5.372   1.00 157.60 ? 301  ARG D CZ  1 
ATOM   7247 N NH1 . ARG D 2 199 ? 37.066 73.253 4.206   1.00 158.15 ? 301  ARG D NH1 1 
ATOM   7248 N NH2 . ARG D 2 199 ? 36.015 73.669 6.210   1.00 157.89 ? 301  ARG D NH2 1 
ATOM   7249 N N   . ARG D 2 200 ? 40.601 71.032 8.317   1.00 148.06 ? 302  ARG D N   1 
ATOM   7250 C CA  . ARG D 2 200 ? 41.170 71.576 9.543   1.00 147.30 ? 302  ARG D CA  1 
ATOM   7251 C C   . ARG D 2 200 ? 40.173 72.368 10.409  1.00 146.57 ? 302  ARG D C   1 
ATOM   7252 O O   . ARG D 2 200 ? 40.533 73.374 11.020  1.00 146.47 ? 302  ARG D O   1 
ATOM   7253 C CB  . ARG D 2 200 ? 42.387 72.446 9.190   1.00 147.86 ? 302  ARG D CB  1 
ATOM   7254 C CG  . ARG D 2 200 ? 43.141 73.050 10.376  1.00 148.87 ? 302  ARG D CG  1 
ATOM   7255 C CD  . ARG D 2 200 ? 42.869 74.544 10.483  1.00 149.29 ? 302  ARG D CD  1 
ATOM   7256 N NE  . ARG D 2 200 ? 43.201 75.235 9.240   1.00 149.43 ? 302  ARG D NE  1 
ATOM   7257 C CZ  . ARG D 2 200 ? 42.892 76.501 8.981   1.00 149.36 ? 302  ARG D CZ  1 
ATOM   7258 N NH1 . ARG D 2 200 ? 42.237 77.224 9.879   1.00 149.27 ? 302  ARG D NH1 1 
ATOM   7259 N NH2 . ARG D 2 200 ? 43.246 77.049 7.827   1.00 149.26 ? 302  ARG D NH2 1 
ATOM   7260 N N   . PRO D 2 201 ? 38.900 71.929 10.486  1.00 145.88 ? 303  PRO D N   1 
ATOM   7261 C CA  . PRO D 2 201 ? 38.043 72.750 11.341  1.00 145.21 ? 303  PRO D CA  1 
ATOM   7262 C C   . PRO D 2 201 ? 38.159 72.283 12.794  1.00 144.41 ? 303  PRO D C   1 
ATOM   7263 O O   . PRO D 2 201 ? 37.145 72.107 13.473  1.00 145.05 ? 303  PRO D O   1 
ATOM   7264 C CB  . PRO D 2 201 ? 36.658 72.496 10.764  1.00 145.59 ? 303  PRO D CB  1 
ATOM   7265 C CG  . PRO D 2 201 ? 36.725 71.039 10.462  1.00 145.64 ? 303  PRO D CG  1 
ATOM   7266 C CD  . PRO D 2 201 ? 38.099 70.886 9.816   1.00 145.64 ? 303  PRO D CD  1 
ATOM   7267 N N   . ARG D 2 202 ? 39.393 72.067 13.257  1.00 142.32 ? 304  ARG D N   1 
ATOM   7268 C CA  . ARG D 2 202 ? 39.636 71.623 14.626  1.00 139.30 ? 304  ARG D CA  1 
ATOM   7269 C C   . ARG D 2 202 ? 41.077 71.798 15.103  1.00 137.90 ? 304  ARG D C   1 
ATOM   7270 O O   . ARG D 2 202 ? 41.981 72.128 14.326  1.00 137.56 ? 304  ARG D O   1 
ATOM   7271 C CB  . ARG D 2 202 ? 39.211 70.165 14.793  1.00 137.83 ? 304  ARG D CB  1 
ATOM   7272 C CG  . ARG D 2 202 ? 39.906 69.216 13.867  1.00 135.33 ? 304  ARG D CG  1 
ATOM   7273 C CD  . ARG D 2 202 ? 39.183 67.907 13.864  1.00 133.43 ? 304  ARG D CD  1 
ATOM   7274 N NE  . ARG D 2 202 ? 39.821 66.973 12.959  1.00 132.86 ? 304  ARG D NE  1 
ATOM   7275 C CZ  . ARG D 2 202 ? 39.261 65.846 12.550  1.00 133.27 ? 304  ARG D CZ  1 
ATOM   7276 N NH1 . ARG D 2 202 ? 38.046 65.523 12.970  1.00 132.57 ? 304  ARG D NH1 1 
ATOM   7277 N NH2 . ARG D 2 202 ? 39.914 65.046 11.719  1.00 133.52 ? 304  ARG D NH2 1 
ATOM   7278 N N   . ASP D 2 203 ? 41.259 71.564 16.402  1.00 136.14 ? 305  ASP D N   1 
ATOM   7279 C CA  . ASP D 2 203 ? 42.534 71.696 17.103  1.00 133.78 ? 305  ASP D CA  1 
ATOM   7280 C C   . ASP D 2 203 ? 43.796 71.226 16.419  1.00 131.82 ? 305  ASP D C   1 
ATOM   7281 O O   . ASP D 2 203 ? 43.796 70.735 15.287  1.00 131.94 ? 305  ASP D O   1 
ATOM   7282 C CB  . ASP D 2 203 ? 42.458 70.998 18.459  1.00 133.80 ? 305  ASP D CB  1 
ATOM   7283 C CG  . ASP D 2 203 ? 41.477 71.652 19.381  1.00 134.39 ? 305  ASP D CG  1 
ATOM   7284 O OD1 . ASP D 2 203 ? 41.666 72.849 19.690  1.00 134.48 ? 305  ASP D OD1 1 
ATOM   7285 O OD2 . ASP D 2 203 ? 40.516 70.970 19.798  1.00 135.29 ? 305  ASP D OD2 1 
ATOM   7286 N N   . ARG D 2 204 ? 44.887 71.397 17.151  1.00 128.73 ? 306  ARG D N   1 
ATOM   7287 C CA  . ARG D 2 204 ? 46.192 70.986 16.689  1.00 124.96 ? 306  ARG D CA  1 
ATOM   7288 C C   . ARG D 2 204 ? 46.580 69.730 17.456  1.00 121.70 ? 306  ARG D C   1 
ATOM   7289 O O   . ARG D 2 204 ? 46.862 68.691 16.861  1.00 122.05 ? 306  ARG D O   1 
ATOM   7290 C CB  . ARG D 2 204 ? 47.216 72.110 16.912  1.00 125.86 ? 306  ARG D CB  1 
ATOM   7291 C CG  . ARG D 2 204 ? 47.172 72.815 18.272  1.00 126.14 ? 306  ARG D CG  1 
ATOM   7292 C CD  . ARG D 2 204 ? 48.254 73.898 18.333  1.00 126.80 ? 306  ARG D CD  1 
ATOM   7293 N NE  . ARG D 2 204 ? 49.580 73.361 18.016  1.00 126.89 ? 306  ARG D NE  1 
ATOM   7294 C CZ  . ARG D 2 204 ? 50.685 74.092 17.884  1.00 126.01 ? 306  ARG D CZ  1 
ATOM   7295 N NH1 . ARG D 2 204 ? 50.639 75.409 18.039  1.00 124.96 ? 306  ARG D NH1 1 
ATOM   7296 N NH2 . ARG D 2 204 ? 51.840 73.498 17.598  1.00 124.94 ? 306  ARG D NH2 1 
ATOM   7297 N N   . PHE D 2 205 ? 46.553 69.824 18.782  1.00 116.94 ? 307  PHE D N   1 
ATOM   7298 C CA  . PHE D 2 205 ? 46.902 68.706 19.637  1.00 110.92 ? 307  PHE D CA  1 
ATOM   7299 C C   . PHE D 2 205 ? 45.735 67.758 19.835  1.00 107.11 ? 307  PHE D C   1 
ATOM   7300 O O   . PHE D 2 205 ? 45.291 67.553 20.956  1.00 106.06 ? 307  PHE D O   1 
ATOM   7301 C CB  . PHE D 2 205 ? 47.368 69.227 20.989  1.00 110.70 ? 307  PHE D CB  1 
ATOM   7302 C CG  . PHE D 2 205 ? 48.621 70.041 20.919  1.00 110.01 ? 307  PHE D CG  1 
ATOM   7303 C CD1 . PHE D 2 205 ? 49.807 69.474 20.475  1.00 109.71 ? 307  PHE D CD1 1 
ATOM   7304 C CD2 . PHE D 2 205 ? 48.618 71.373 21.296  1.00 109.82 ? 307  PHE D CD2 1 
ATOM   7305 C CE1 . PHE D 2 205 ? 50.967 70.218 20.409  1.00 109.46 ? 307  PHE D CE1 1 
ATOM   7306 C CE2 . PHE D 2 205 ? 49.777 72.121 21.230  1.00 109.91 ? 307  PHE D CE2 1 
ATOM   7307 C CZ  . PHE D 2 205 ? 50.957 71.545 20.786  1.00 109.80 ? 307  PHE D CZ  1 
ATOM   7308 N N   . LEU D 2 206 ? 45.244 67.180 18.745  1.00 103.00 ? 308  LEU D N   1 
ATOM   7309 C CA  . LEU D 2 206 ? 44.132 66.257 18.841  1.00 99.12  ? 308  LEU D CA  1 
ATOM   7310 C C   . LEU D 2 206 ? 44.569 64.971 19.520  1.00 96.22  ? 308  LEU D C   1 
ATOM   7311 O O   . LEU D 2 206 ? 43.870 64.471 20.397  1.00 96.52  ? 308  LEU D O   1 
ATOM   7312 C CB  . LEU D 2 206 ? 43.554 65.946 17.468  1.00 100.06 ? 308  LEU D CB  1 
ATOM   7313 C CG  . LEU D 2 206 ? 42.045 65.702 17.588  1.00 101.19 ? 308  LEU D CG  1 
ATOM   7314 C CD1 . LEU D 2 206 ? 41.416 66.914 18.274  1.00 101.84 ? 308  LEU D CD1 1 
ATOM   7315 C CD2 . LEU D 2 206 ? 41.418 65.473 16.223  1.00 101.56 ? 308  LEU D CD2 1 
ATOM   7316 N N   . TYR D 2 207 ? 45.720 64.439 19.117  1.00 92.67  ? 309  TYR D N   1 
ATOM   7317 C CA  . TYR D 2 207 ? 46.263 63.216 19.716  1.00 89.56  ? 309  TYR D CA  1 
ATOM   7318 C C   . TYR D 2 207 ? 46.552 63.502 21.181  1.00 87.66  ? 309  TYR D C   1 
ATOM   7319 O O   . TYR D 2 207 ? 46.215 62.719 22.072  1.00 86.65  ? 309  TYR D O   1 
ATOM   7320 C CB  . TYR D 2 207 ? 47.565 62.799 19.015  1.00 88.77  ? 309  TYR D CB  1 
ATOM   7321 C CG  . TYR D 2 207 ? 48.242 61.574 19.606  1.00 88.22  ? 309  TYR D CG  1 
ATOM   7322 C CD1 . TYR D 2 207 ? 48.033 60.306 19.070  1.00 88.26  ? 309  TYR D CD1 1 
ATOM   7323 C CD2 . TYR D 2 207 ? 49.099 61.689 20.697  1.00 88.52  ? 309  TYR D CD2 1 
ATOM   7324 C CE1 . TYR D 2 207 ? 48.669 59.176 19.606  1.00 89.02  ? 309  TYR D CE1 1 
ATOM   7325 C CE2 . TYR D 2 207 ? 49.737 60.574 21.244  1.00 89.13  ? 309  TYR D CE2 1 
ATOM   7326 C CZ  . TYR D 2 207 ? 49.523 59.317 20.694  1.00 89.46  ? 309  TYR D CZ  1 
ATOM   7327 O OH  . TYR D 2 207 ? 50.186 58.220 21.220  1.00 87.74  ? 309  TYR D OH  1 
ATOM   7328 N N   . ALA D 2 208 ? 47.186 64.643 21.418  1.00 85.81  ? 310  ALA D N   1 
ATOM   7329 C CA  . ALA D 2 208 ? 47.531 65.084 22.764  1.00 84.52  ? 310  ALA D CA  1 
ATOM   7330 C C   . ALA D 2 208 ? 46.320 64.979 23.690  1.00 84.28  ? 310  ALA D C   1 
ATOM   7331 O O   . ALA D 2 208 ? 46.330 64.220 24.657  1.00 83.63  ? 310  ALA D O   1 
ATOM   7332 C CB  . ALA D 2 208 ? 48.012 66.514 22.707  1.00 83.66  ? 310  ALA D CB  1 
ATOM   7333 N N   . LYS D 2 209 ? 45.289 65.758 23.369  1.00 84.49  ? 311  LYS D N   1 
ATOM   7334 C CA  . LYS D 2 209 ? 44.046 65.796 24.122  1.00 82.79  ? 311  LYS D CA  1 
ATOM   7335 C C   . LYS D 2 209 ? 43.390 64.425 24.308  1.00 80.71  ? 311  LYS D C   1 
ATOM   7336 O O   . LYS D 2 209 ? 42.870 64.119 25.391  1.00 78.78  ? 311  LYS D O   1 
ATOM   7337 C CB  . LYS D 2 209 ? 43.088 66.767 23.443  1.00 83.63  ? 311  LYS D CB  1 
ATOM   7338 C CG  . LYS D 2 209 ? 43.742 68.091 23.169  1.00 85.75  ? 311  LYS D CG  1 
ATOM   7339 C CD  . LYS D 2 209 ? 42.805 69.049 22.482  1.00 89.85  ? 311  LYS D CD  1 
ATOM   7340 C CE  . LYS D 2 209 ? 43.554 70.302 22.060  1.00 92.50  ? 311  LYS D CE  1 
ATOM   7341 N NZ  . LYS D 2 209 ? 42.702 71.518 22.151  1.00 94.43  ? 311  LYS D NZ  1 
ATOM   7342 N N   . LEU D 2 210 ? 43.417 63.600 23.260  1.00 78.18  ? 312  LEU D N   1 
ATOM   7343 C CA  . LEU D 2 210 ? 42.849 62.241 23.307  1.00 77.07  ? 312  LEU D CA  1 
ATOM   7344 C C   . LEU D 2 210 ? 43.403 61.366 24.438  1.00 77.36  ? 312  LEU D C   1 
ATOM   7345 O O   . LEU D 2 210 ? 42.700 60.486 24.950  1.00 78.01  ? 312  LEU D O   1 
ATOM   7346 C CB  . LEU D 2 210 ? 43.087 61.514 21.986  1.00 75.04  ? 312  LEU D CB  1 
ATOM   7347 C CG  . LEU D 2 210 ? 42.201 61.878 20.797  1.00 74.34  ? 312  LEU D CG  1 
ATOM   7348 C CD1 . LEU D 2 210 ? 42.467 60.886 19.671  1.00 73.61  ? 312  LEU D CD1 1 
ATOM   7349 C CD2 . LEU D 2 210 ? 40.739 61.828 21.204  1.00 73.02  ? 312  LEU D CD2 1 
ATOM   7350 N N   . LEU D 2 211 ? 44.663 61.584 24.813  1.00 76.40  ? 313  LEU D N   1 
ATOM   7351 C CA  . LEU D 2 211 ? 45.262 60.815 25.906  1.00 74.05  ? 313  LEU D CA  1 
ATOM   7352 C C   . LEU D 2 211 ? 44.824 61.422 27.239  1.00 72.23  ? 313  LEU D C   1 
ATOM   7353 O O   . LEU D 2 211 ? 45.012 60.821 28.297  1.00 72.42  ? 313  LEU D O   1 
ATOM   7354 C CB  . LEU D 2 211 ? 46.792 60.816 25.806  1.00 74.36  ? 313  LEU D CB  1 
ATOM   7355 C CG  . LEU D 2 211 ? 47.460 60.392 24.486  1.00 73.44  ? 313  LEU D CG  1 
ATOM   7356 C CD1 . LEU D 2 211 ? 48.862 59.949 24.829  1.00 73.36  ? 313  LEU D CD1 1 
ATOM   7357 C CD2 . LEU D 2 211 ? 46.709 59.259 23.780  1.00 72.39  ? 313  LEU D CD2 1 
ATOM   7358 N N   . GLY D 2 212 ? 44.261 62.629 27.176  1.00 70.76  ? 314  GLY D N   1 
ATOM   7359 C CA  . GLY D 2 212 ? 43.760 63.293 28.368  1.00 68.14  ? 314  GLY D CA  1 
ATOM   7360 C C   . GLY D 2 212 ? 42.415 62.664 28.655  1.00 66.03  ? 314  GLY D C   1 
ATOM   7361 O O   . GLY D 2 212 ? 41.973 62.561 29.798  1.00 64.80  ? 314  GLY D O   1 
ATOM   7362 N N   . LEU D 2 213 ? 41.770 62.236 27.577  1.00 65.13  ? 315  LEU D N   1 
ATOM   7363 C CA  . LEU D 2 213 ? 40.479 61.587 27.646  1.00 64.09  ? 315  LEU D CA  1 
ATOM   7364 C C   . LEU D 2 213 ? 40.677 60.131 28.006  1.00 63.52  ? 315  LEU D C   1 
ATOM   7365 O O   . LEU D 2 213 ? 39.922 59.592 28.803  1.00 64.89  ? 315  LEU D O   1 
ATOM   7366 C CB  . LEU D 2 213 ? 39.745 61.705 26.309  1.00 62.06  ? 315  LEU D CB  1 
ATOM   7367 C CG  . LEU D 2 213 ? 39.276 63.110 25.913  1.00 60.77  ? 315  LEU D CG  1 
ATOM   7368 C CD1 . LEU D 2 213 ? 38.186 62.942 24.882  1.00 59.63  ? 315  LEU D CD1 1 
ATOM   7369 C CD2 . LEU D 2 213 ? 38.745 63.911 27.123  1.00 58.96  ? 315  LEU D CD2 1 
ATOM   7370 N N   . LEU D 2 214 ? 41.679 59.490 27.409  1.00 62.24  ? 316  LEU D N   1 
ATOM   7371 C CA  . LEU D 2 214 ? 41.975 58.096 27.724  1.00 62.09  ? 316  LEU D CA  1 
ATOM   7372 C C   . LEU D 2 214 ? 42.420 57.973 29.195  1.00 62.54  ? 316  LEU D C   1 
ATOM   7373 O O   . LEU D 2 214 ? 42.329 56.901 29.805  1.00 61.74  ? 316  LEU D O   1 
ATOM   7374 C CB  . LEU D 2 214 ? 43.060 57.566 26.790  1.00 60.48  ? 316  LEU D CB  1 
ATOM   7375 C CG  . LEU D 2 214 ? 42.537 56.915 25.518  1.00 59.41  ? 316  LEU D CG  1 
ATOM   7376 C CD1 . LEU D 2 214 ? 43.622 56.901 24.479  1.00 60.84  ? 316  LEU D CD1 1 
ATOM   7377 C CD2 . LEU D 2 214 ? 42.067 55.510 25.824  1.00 59.22  ? 316  LEU D CD2 1 
ATOM   7378 N N   . ALA D 2 215 ? 42.915 59.082 29.744  1.00 62.25  ? 317  ALA D N   1 
ATOM   7379 C CA  . ALA D 2 215 ? 43.331 59.156 31.136  1.00 61.76  ? 317  ALA D CA  1 
ATOM   7380 C C   . ALA D 2 215 ? 42.035 59.230 31.928  1.00 62.53  ? 317  ALA D C   1 
ATOM   7381 O O   . ALA D 2 215 ? 41.923 58.634 32.999  1.00 62.31  ? 317  ALA D O   1 
ATOM   7382 C CB  . ALA D 2 215 ? 44.152 60.409 31.370  1.00 61.00  ? 317  ALA D CB  1 
ATOM   7383 N N   . GLU D 2 216 ? 41.062 59.970 31.377  1.00 63.78  ? 318  GLU D N   1 
ATOM   7384 C CA  . GLU D 2 216 ? 39.729 60.143 31.972  1.00 63.14  ? 318  GLU D CA  1 
ATOM   7385 C C   . GLU D 2 216 ? 38.855 58.876 31.878  1.00 61.68  ? 318  GLU D C   1 
ATOM   7386 O O   . GLU D 2 216 ? 38.082 58.601 32.792  1.00 62.60  ? 318  GLU D O   1 
ATOM   7387 C CB  . GLU D 2 216 ? 38.992 61.328 31.330  1.00 63.58  ? 318  GLU D CB  1 
ATOM   7388 C CG  . GLU D 2 216 ? 39.443 62.728 31.800  1.00 68.31  ? 318  GLU D CG  1 
ATOM   7389 C CD  . GLU D 2 216 ? 39.314 62.966 33.316  1.00 70.48  ? 318  GLU D CD  1 
ATOM   7390 O OE1 . GLU D 2 216 ? 38.269 62.620 33.912  1.00 73.00  ? 318  GLU D OE1 1 
ATOM   7391 O OE2 . GLU D 2 216 ? 40.262 63.522 33.914  1.00 71.86  ? 318  GLU D OE2 1 
ATOM   7392 N N   . LEU D 2 217 ? 38.973 58.111 30.791  1.00 58.79  ? 319  LEU D N   1 
ATOM   7393 C CA  . LEU D 2 217 ? 38.215 56.868 30.630  1.00 58.07  ? 319  LEU D CA  1 
ATOM   7394 C C   . LEU D 2 217 ? 38.616 55.814 31.676  1.00 58.59  ? 319  LEU D C   1 
ATOM   7395 O O   . LEU D 2 217 ? 37.920 54.833 31.891  1.00 57.46  ? 319  LEU D O   1 
ATOM   7396 C CB  . LEU D 2 217 ? 38.423 56.296 29.223  1.00 57.05  ? 319  LEU D CB  1 
ATOM   7397 C CG  . LEU D 2 217 ? 37.487 56.752 28.096  1.00 57.17  ? 319  LEU D CG  1 
ATOM   7398 C CD1 . LEU D 2 217 ? 38.011 56.218 26.780  1.00 56.38  ? 319  LEU D CD1 1 
ATOM   7399 C CD2 . LEU D 2 217 ? 36.059 56.254 28.329  1.00 55.58  ? 319  LEU D CD2 1 
ATOM   7400 N N   . ARG D 2 218 ? 39.759 56.014 32.314  1.00 61.27  ? 320  ARG D N   1 
ATOM   7401 C CA  . ARG D 2 218 ? 40.236 55.096 33.339  1.00 61.94  ? 320  ARG D CA  1 
ATOM   7402 C C   . ARG D 2 218 ? 39.651 55.590 34.642  1.00 60.56  ? 320  ARG D C   1 
ATOM   7403 O O   . ARG D 2 218 ? 39.168 54.801 35.448  1.00 60.02  ? 320  ARG D O   1 
ATOM   7404 C CB  . ARG D 2 218 ? 41.770 55.102 33.389  1.00 64.83  ? 320  ARG D CB  1 
ATOM   7405 C CG  . ARG D 2 218 ? 42.405 54.814 32.025  1.00 69.46  ? 320  ARG D CG  1 
ATOM   7406 C CD  . ARG D 2 218 ? 43.651 53.947 32.110  1.00 71.79  ? 320  ARG D CD  1 
ATOM   7407 N NE  . ARG D 2 218 ? 44.079 53.518 30.781  1.00 74.78  ? 320  ARG D NE  1 
ATOM   7408 C CZ  . ARG D 2 218 ? 45.078 52.671 30.553  1.00 76.19  ? 320  ARG D CZ  1 
ATOM   7409 N NH1 . ARG D 2 218 ? 45.395 52.339 29.308  1.00 76.65  ? 320  ARG D NH1 1 
ATOM   7410 N NH2 . ARG D 2 218 ? 45.759 52.154 31.569  1.00 76.11  ? 320  ARG D NH2 1 
ATOM   7411 N N   . SER D 2 219 ? 39.697 56.910 34.832  1.00 59.75  ? 321  SER D N   1 
ATOM   7412 C CA  . SER D 2 219 ? 39.130 57.563 36.011  1.00 58.60  ? 321  SER D CA  1 
ATOM   7413 C C   . SER D 2 219 ? 37.620 57.230 35.972  1.00 60.59  ? 321  SER D C   1 
ATOM   7414 O O   . SER D 2 219 ? 36.945 57.203 37.000  1.00 59.65  ? 321  SER D O   1 
ATOM   7415 C CB  . SER D 2 219 ? 39.351 59.089 35.917  1.00 54.55  ? 321  SER D CB  1 
ATOM   7416 O OG  . SER D 2 219 ? 39.706 59.687 37.156  1.00 46.68  ? 321  SER D OG  1 
ATOM   7417 N N   . ILE D 2 220 ? 37.121 56.953 34.768  1.00 62.30  ? 322  ILE D N   1 
ATOM   7418 C CA  . ILE D 2 220 ? 35.721 56.628 34.524  1.00 64.83  ? 322  ILE D CA  1 
ATOM   7419 C C   . ILE D 2 220 ? 35.392 55.137 34.626  1.00 65.70  ? 322  ILE D C   1 
ATOM   7420 O O   . ILE D 2 220 ? 34.408 54.772 35.268  1.00 66.24  ? 322  ILE D O   1 
ATOM   7421 C CB  . ILE D 2 220 ? 35.283 57.158 33.131  1.00 66.76  ? 322  ILE D CB  1 
ATOM   7422 C CG1 . ILE D 2 220 ? 34.810 58.615 33.257  1.00 65.90  ? 322  ILE D CG1 1 
ATOM   7423 C CG2 . ILE D 2 220 ? 34.217 56.247 32.513  1.00 67.61  ? 322  ILE D CG2 1 
ATOM   7424 C CD1 . ILE D 2 220 ? 34.340 59.211 31.944  1.00 63.59  ? 322  ILE D CD1 1 
ATOM   7425 N N   . ASN D 2 221 ? 36.194 54.275 33.997  1.00 66.93  ? 323  ASN D N   1 
ATOM   7426 C CA  . ASN D 2 221 ? 35.951 52.829 34.076  1.00 67.83  ? 323  ASN D CA  1 
ATOM   7427 C C   . ASN D 2 221 ? 36.028 52.466 35.560  1.00 68.53  ? 323  ASN D C   1 
ATOM   7428 O O   . ASN D 2 221 ? 35.450 51.470 35.998  1.00 68.65  ? 323  ASN D O   1 
ATOM   7429 C CB  . ASN D 2 221 ? 37.014 52.036 33.286  1.00 67.92  ? 323  ASN D CB  1 
ATOM   7430 C CG  . ASN D 2 221 ? 36.626 50.560 33.068  1.00 68.54  ? 323  ASN D CG  1 
ATOM   7431 O OD1 . ASN D 2 221 ? 36.141 49.882 33.981  1.00 68.72  ? 323  ASN D OD1 1 
ATOM   7432 N ND2 . ASN D 2 221 ? 36.864 50.058 31.857  1.00 67.88  ? 323  ASN D ND2 1 
ATOM   7433 N N   . GLU D 2 222 ? 36.745 53.288 36.327  1.00 69.42  ? 324  GLU D N   1 
ATOM   7434 C CA  . GLU D 2 222 ? 36.902 53.080 37.755  1.00 71.18  ? 324  GLU D CA  1 
ATOM   7435 C C   . GLU D 2 222 ? 35.612 53.422 38.485  1.00 70.85  ? 324  GLU D C   1 
ATOM   7436 O O   . GLU D 2 222 ? 34.943 52.532 39.008  1.00 71.14  ? 324  GLU D O   1 
ATOM   7437 C CB  . GLU D 2 222 ? 38.047 53.942 38.306  1.00 73.55  ? 324  GLU D CB  1 
ATOM   7438 C CG  . GLU D 2 222 ? 38.427 53.621 39.767  1.00 77.47  ? 324  GLU D CG  1 
ATOM   7439 C CD  . GLU D 2 222 ? 39.253 52.331 39.924  1.00 79.04  ? 324  GLU D CD  1 
ATOM   7440 O OE1 . GLU D 2 222 ? 39.111 51.413 39.079  1.00 79.72  ? 324  GLU D OE1 1 
ATOM   7441 O OE2 . GLU D 2 222 ? 40.033 52.237 40.906  1.00 78.87  ? 324  GLU D OE2 1 
ATOM   7442 N N   . ALA D 2 223 ? 35.265 54.707 38.519  1.00 71.44  ? 325  ALA D N   1 
ATOM   7443 C CA  . ALA D 2 223 ? 34.048 55.159 39.200  1.00 71.68  ? 325  ALA D CA  1 
ATOM   7444 C C   . ALA D 2 223 ? 32.815 54.335 38.822  1.00 71.99  ? 325  ALA D C   1 
ATOM   7445 O O   . ALA D 2 223 ? 31.965 54.066 39.674  1.00 72.91  ? 325  ALA D O   1 
ATOM   7446 C CB  . ALA D 2 223 ? 33.799 56.622 38.909  1.00 70.48  ? 325  ALA D CB  1 
ATOM   7447 N N   . TYR D 2 224 ? 32.710 53.944 37.550  1.00 70.86  ? 326  TYR D N   1 
ATOM   7448 C CA  . TYR D 2 224 ? 31.586 53.132 37.098  1.00 69.24  ? 326  TYR D CA  1 
ATOM   7449 C C   . TYR D 2 224 ? 31.464 51.925 38.000  1.00 68.66  ? 326  TYR D C   1 
ATOM   7450 O O   . TYR D 2 224 ? 30.423 51.708 38.609  1.00 69.79  ? 326  TYR D O   1 
ATOM   7451 C CB  . TYR D 2 224 ? 31.803 52.649 35.670  1.00 69.93  ? 326  TYR D CB  1 
ATOM   7452 C CG  . TYR D 2 224 ? 30.837 51.563 35.251  1.00 71.85  ? 326  TYR D CG  1 
ATOM   7453 C CD1 . TYR D 2 224 ? 29.484 51.836 35.054  1.00 72.00  ? 326  TYR D CD1 1 
ATOM   7454 C CD2 . TYR D 2 224 ? 31.271 50.254 35.081  1.00 74.36  ? 326  TYR D CD2 1 
ATOM   7455 C CE1 . TYR D 2 224 ? 28.591 50.829 34.704  1.00 72.78  ? 326  TYR D CE1 1 
ATOM   7456 C CE2 . TYR D 2 224 ? 30.386 49.238 34.733  1.00 74.73  ? 326  TYR D CE2 1 
ATOM   7457 C CZ  . TYR D 2 224 ? 29.056 49.531 34.549  1.00 73.83  ? 326  TYR D CZ  1 
ATOM   7458 O OH  . TYR D 2 224 ? 28.195 48.512 34.240  1.00 74.77  ? 326  TYR D OH  1 
ATOM   7459 N N   . GLY D 2 225 ? 32.537 51.143 38.082  1.00 67.74  ? 327  GLY D N   1 
ATOM   7460 C CA  . GLY D 2 225 ? 32.540 49.958 38.919  1.00 67.88  ? 327  GLY D CA  1 
ATOM   7461 C C   . GLY D 2 225 ? 31.904 50.125 40.288  1.00 68.10  ? 327  GLY D C   1 
ATOM   7462 O O   . GLY D 2 225 ? 31.151 49.261 40.715  1.00 66.12  ? 327  GLY D O   1 
ATOM   7463 N N   . TYR D 2 226 ? 32.203 51.223 40.978  1.00 71.52  ? 328  TYR D N   1 
ATOM   7464 C CA  . TYR D 2 226 ? 31.646 51.478 42.310  1.00 75.04  ? 328  TYR D CA  1 
ATOM   7465 C C   . TYR D 2 226 ? 30.138 51.682 42.307  1.00 74.86  ? 328  TYR D C   1 
ATOM   7466 O O   . TYR D 2 226 ? 29.429 51.148 43.156  1.00 75.10  ? 328  TYR D O   1 
ATOM   7467 C CB  . TYR D 2 226 ? 32.308 52.709 42.959  1.00 78.91  ? 328  TYR D CB  1 
ATOM   7468 C CG  . TYR D 2 226 ? 31.589 53.198 44.214  1.00 83.44  ? 328  TYR D CG  1 
ATOM   7469 C CD1 . TYR D 2 226 ? 31.259 52.315 45.247  1.00 85.44  ? 328  TYR D CD1 1 
ATOM   7470 C CD2 . TYR D 2 226 ? 31.208 54.530 44.350  1.00 85.70  ? 328  TYR D CD2 1 
ATOM   7471 C CE1 . TYR D 2 226 ? 30.562 52.744 46.378  1.00 86.80  ? 328  TYR D CE1 1 
ATOM   7472 C CE2 . TYR D 2 226 ? 30.510 54.972 45.479  1.00 88.13  ? 328  TYR D CE2 1 
ATOM   7473 C CZ  . TYR D 2 226 ? 30.187 54.074 46.489  1.00 88.48  ? 328  TYR D CZ  1 
ATOM   7474 O OH  . TYR D 2 226 ? 29.474 54.505 47.595  1.00 89.26  ? 328  TYR D OH  1 
ATOM   7475 N N   . GLN D 2 227 ? 29.651 52.462 41.354  1.00 75.18  ? 329  GLN D N   1 
ATOM   7476 C CA  . GLN D 2 227 ? 28.229 52.740 41.262  1.00 75.99  ? 329  GLN D CA  1 
ATOM   7477 C C   . GLN D 2 227 ? 27.365 51.483 41.037  1.00 75.64  ? 329  GLN D C   1 
ATOM   7478 O O   . GLN D 2 227 ? 26.231 51.422 41.512  1.00 75.70  ? 329  GLN D O   1 
ATOM   7479 C CB  . GLN D 2 227 ? 27.994 53.799 40.175  1.00 76.83  ? 329  GLN D CB  1 
ATOM   7480 C CG  . GLN D 2 227 ? 28.738 55.134 40.431  1.00 77.14  ? 329  GLN D CG  1 
ATOM   7481 C CD  . GLN D 2 227 ? 28.023 56.073 41.405  1.00 77.11  ? 329  GLN D CD  1 
ATOM   7482 O OE1 . GLN D 2 227 ? 26.912 56.510 41.139  1.00 77.33  ? 329  GLN D OE1 1 
ATOM   7483 N NE2 . GLN D 2 227 ? 28.667 56.390 42.529  1.00 76.53  ? 329  GLN D NE2 1 
ATOM   7484 N N   . ILE D 2 228 ? 27.877 50.473 40.339  1.00 75.01  ? 330  ILE D N   1 
ATOM   7485 C CA  . ILE D 2 228 ? 27.079 49.264 40.160  1.00 76.37  ? 330  ILE D CA  1 
ATOM   7486 C C   . ILE D 2 228 ? 27.143 48.407 41.434  1.00 78.81  ? 330  ILE D C   1 
ATOM   7487 O O   . ILE D 2 228 ? 26.658 47.277 41.477  1.00 78.39  ? 330  ILE D O   1 
ATOM   7488 C CB  . ILE D 2 228 ? 27.550 48.419 38.965  1.00 75.72  ? 330  ILE D CB  1 
ATOM   7489 C CG1 . ILE D 2 228 ? 28.714 47.534 39.377  1.00 77.09  ? 330  ILE D CG1 1 
ATOM   7490 C CG2 . ILE D 2 228 ? 27.951 49.316 37.819  1.00 73.95  ? 330  ILE D CG2 1 
ATOM   7491 C CD1 . ILE D 2 228 ? 28.975 46.409 38.399  1.00 79.09  ? 330  ILE D CD1 1 
ATOM   7492 N N   . GLN D 2 229 ? 27.765 48.966 42.466  1.00 82.58  ? 331  GLN D N   1 
ATOM   7493 C CA  . GLN D 2 229 ? 27.891 48.338 43.773  1.00 86.04  ? 331  GLN D CA  1 
ATOM   7494 C C   . GLN D 2 229 ? 26.879 49.077 44.621  1.00 87.44  ? 331  GLN D C   1 
ATOM   7495 O O   . GLN D 2 229 ? 26.019 48.472 45.249  1.00 88.33  ? 331  GLN D O   1 
ATOM   7496 C CB  . GLN D 2 229 ? 29.280 48.574 44.370  1.00 88.39  ? 331  GLN D CB  1 
ATOM   7497 C CG  . GLN D 2 229 ? 30.433 48.138 43.491  1.00 91.94  ? 331  GLN D CG  1 
ATOM   7498 C CD  . GLN D 2 229 ? 30.584 46.633 43.421  1.00 93.92  ? 331  GLN D CD  1 
ATOM   7499 O OE1 . GLN D 2 229 ? 31.364 46.111 42.619  1.00 96.13  ? 331  GLN D OE1 1 
ATOM   7500 N NE2 . GLN D 2 229 ? 29.848 45.924 44.269  1.00 95.37  ? 331  GLN D NE2 1 
ATOM   7501 N N   . HIS D 2 230 ? 27.000 50.401 44.622  1.00 89.65  ? 332  HIS D N   1 
ATOM   7502 C CA  . HIS D 2 230 ? 26.108 51.278 45.369  1.00 92.47  ? 332  HIS D CA  1 
ATOM   7503 C C   . HIS D 2 230 ? 24.658 50.831 45.153  1.00 92.74  ? 332  HIS D C   1 
ATOM   7504 O O   . HIS D 2 230 ? 23.963 50.455 46.106  1.00 93.31  ? 332  HIS D O   1 
ATOM   7505 C CB  . HIS D 2 230 ? 26.279 52.734 44.891  1.00 94.56  ? 332  HIS D CB  1 
ATOM   7506 C CG  . HIS D 2 230 ? 25.794 53.764 45.870  1.00 97.66  ? 332  HIS D CG  1 
ATOM   7507 N ND1 . HIS D 2 230 ? 25.136 54.913 45.482  1.00 98.44  ? 332  HIS D ND1 1 
ATOM   7508 C CD2 . HIS D 2 230 ? 25.906 53.837 47.221  1.00 99.01  ? 332  HIS D CD2 1 
ATOM   7509 C CE1 . HIS D 2 230 ? 24.862 55.646 46.547  1.00 99.19  ? 332  HIS D CE1 1 
ATOM   7510 N NE2 . HIS D 2 230 ? 25.320 55.016 47.615  1.00 99.41  ? 332  HIS D NE2 1 
ATOM   7511 N N   . ILE D 2 231 ? 24.215 50.855 43.896  1.00 92.43  ? 333  ILE D N   1 
ATOM   7512 C CA  . ILE D 2 231 ? 22.847 50.483 43.555  1.00 91.36  ? 333  ILE D CA  1 
ATOM   7513 C C   . ILE D 2 231 ? 22.542 49.028 43.838  1.00 91.60  ? 333  ILE D C   1 
ATOM   7514 O O   . ILE D 2 231 ? 23.153 48.121 43.268  1.00 91.30  ? 333  ILE D O   1 
ATOM   7515 C CB  . ILE D 2 231 ? 22.534 50.778 42.085  1.00 90.13  ? 333  ILE D CB  1 
ATOM   7516 C CG1 . ILE D 2 231 ? 22.780 52.259 41.791  1.00 88.50  ? 333  ILE D CG1 1 
ATOM   7517 C CG2 . ILE D 2 231 ? 21.083 50.443 41.797  1.00 90.03  ? 333  ILE D CG2 1 
ATOM   7518 C CD1 . ILE D 2 231 ? 22.651 52.618 40.338  1.00 87.06  ? 333  ILE D CD1 1 
ATOM   7519 N N   . GLN D 2 232 ? 21.574 48.831 44.726  1.00 92.42  ? 334  GLN D N   1 
ATOM   7520 C CA  . GLN D 2 232 ? 21.133 47.513 45.165  1.00 93.54  ? 334  GLN D CA  1 
ATOM   7521 C C   . GLN D 2 232 ? 20.605 46.615 44.055  1.00 92.32  ? 334  GLN D C   1 
ATOM   7522 O O   . GLN D 2 232 ? 19.893 47.073 43.159  1.00 91.35  ? 334  GLN D O   1 
ATOM   7523 C CB  . GLN D 2 232 ? 20.037 47.667 46.215  1.00 96.30  ? 334  GLN D CB  1 
ATOM   7524 C CG  . GLN D 2 232 ? 20.393 48.563 47.384  1.00 99.87  ? 334  GLN D CG  1 
ATOM   7525 C CD  . GLN D 2 232 ? 19.262 48.657 48.396  1.00 102.14 ? 334  GLN D CD  1 
ATOM   7526 O OE1 . GLN D 2 232 ? 18.743 47.637 48.868  1.00 103.58 ? 334  GLN D OE1 1 
ATOM   7527 N NE2 . GLN D 2 232 ? 18.875 49.884 48.738  1.00 102.85 ? 334  GLN D NE2 1 
ATOM   7528 N N   . GLY D 2 233 ? 20.950 45.331 44.138  1.00 91.91  ? 335  GLY D N   1 
ATOM   7529 C CA  . GLY D 2 233 ? 20.501 44.356 43.154  1.00 91.52  ? 335  GLY D CA  1 
ATOM   7530 C C   . GLY D 2 233 ? 20.750 44.699 41.693  1.00 90.59  ? 335  GLY D C   1 
ATOM   7531 O O   . GLY D 2 233 ? 20.282 43.996 40.790  1.00 89.80  ? 335  GLY D O   1 
ATOM   7532 N N   . LEU D 2 234 ? 21.489 45.781 41.463  1.00 89.68  ? 336  LEU D N   1 
ATOM   7533 C CA  . LEU D 2 234 ? 21.822 46.247 40.129  1.00 87.77  ? 336  LEU D CA  1 
ATOM   7534 C C   . LEU D 2 234 ? 22.914 45.361 39.566  1.00 86.96  ? 336  LEU D C   1 
ATOM   7535 O O   . LEU D 2 234 ? 22.821 44.877 38.438  1.00 85.49  ? 336  LEU D O   1 
ATOM   7536 C CB  . LEU D 2 234 ? 22.310 47.691 40.190  1.00 87.24  ? 336  LEU D CB  1 
ATOM   7537 C CG  . LEU D 2 234 ? 22.747 48.261 38.847  1.00 86.80  ? 336  LEU D CG  1 
ATOM   7538 C CD1 . LEU D 2 234 ? 21.757 47.864 37.768  1.00 86.55  ? 336  LEU D CD1 1 
ATOM   7539 C CD2 . LEU D 2 234 ? 22.858 49.765 38.955  1.00 86.89  ? 336  LEU D CD2 1 
ATOM   7540 N N   . SER D 2 235 ? 23.953 45.156 40.366  1.00 86.57  ? 337  SER D N   1 
ATOM   7541 C CA  . SER D 2 235 ? 25.061 44.311 39.963  1.00 86.95  ? 337  SER D CA  1 
ATOM   7542 C C   . SER D 2 235 ? 24.482 42.951 39.538  1.00 86.70  ? 337  SER D C   1 
ATOM   7543 O O   . SER D 2 235 ? 24.839 42.398 38.489  1.00 86.40  ? 337  SER D O   1 
ATOM   7544 C CB  . SER D 2 235 ? 26.029 44.153 41.143  1.00 88.01  ? 337  SER D CB  1 
ATOM   7545 O OG  . SER D 2 235 ? 27.268 43.593 40.735  1.00 90.24  ? 337  SER D OG  1 
ATOM   7546 N N   . ALA D 2 236 ? 23.569 42.437 40.360  1.00 85.69  ? 338  ALA D N   1 
ATOM   7547 C CA  . ALA D 2 236 ? 22.907 41.160 40.123  1.00 84.15  ? 338  ALA D CA  1 
ATOM   7548 C C   . ALA D 2 236 ? 22.204 41.056 38.760  1.00 83.05  ? 338  ALA D C   1 
ATOM   7549 O O   . ALA D 2 236 ? 22.109 39.972 38.180  1.00 81.35  ? 338  ALA D O   1 
ATOM   7550 C CB  . ALA D 2 236 ? 21.910 40.903 41.244  1.00 83.83  ? 338  ALA D CB  1 
ATOM   7551 N N   . MET D 2 237 ? 21.716 42.179 38.247  1.00 82.44  ? 339  MET D N   1 
ATOM   7552 C CA  . MET D 2 237 ? 21.018 42.186 36.967  1.00 82.53  ? 339  MET D CA  1 
ATOM   7553 C C   . MET D 2 237 ? 21.877 42.083 35.712  1.00 81.91  ? 339  MET D C   1 
ATOM   7554 O O   . MET D 2 237 ? 21.353 42.047 34.595  1.00 82.10  ? 339  MET D O   1 
ATOM   7555 C CB  . MET D 2 237 ? 20.120 43.418 36.864  1.00 84.34  ? 339  MET D CB  1 
ATOM   7556 C CG  . MET D 2 237 ? 18.706 43.146 37.333  1.00 87.04  ? 339  MET D CG  1 
ATOM   7557 S SD  . MET D 2 237 ? 17.600 44.547 37.181  1.00 88.83  ? 339  MET D SD  1 
ATOM   7558 C CE  . MET D 2 237 ? 17.341 44.920 38.947  1.00 89.64  ? 339  MET D CE  1 
ATOM   7559 N N   . MET D 2 238 ? 23.191 42.050 35.890  1.00 80.95  ? 340  MET D N   1 
ATOM   7560 C CA  . MET D 2 238 ? 24.118 41.923 34.768  1.00 78.79  ? 340  MET D CA  1 
ATOM   7561 C C   . MET D 2 238 ? 25.419 41.335 35.291  1.00 79.06  ? 340  MET D C   1 
ATOM   7562 O O   . MET D 2 238 ? 26.355 42.050 35.648  1.00 80.18  ? 340  MET D O   1 
ATOM   7563 C CB  . MET D 2 238 ? 24.358 43.277 34.097  1.00 74.04  ? 340  MET D CB  1 
ATOM   7564 C CG  . MET D 2 238 ? 24.593 44.402 35.060  1.00 68.53  ? 340  MET D CG  1 
ATOM   7565 S SD  . MET D 2 238 ? 24.584 45.953 34.200  1.00 64.43  ? 340  MET D SD  1 
ATOM   7566 C CE  . MET D 2 238 ? 25.033 47.091 35.534  1.00 61.10  ? 340  MET D CE  1 
ATOM   7567 N N   . PRO D 2 239 ? 25.477 40.001 35.349  1.00 78.62  ? 341  PRO D N   1 
ATOM   7568 C CA  . PRO D 2 239 ? 26.615 39.210 35.816  1.00 77.74  ? 341  PRO D CA  1 
ATOM   7569 C C   . PRO D 2 239 ? 27.880 39.509 35.023  1.00 77.01  ? 341  PRO D C   1 
ATOM   7570 O O   . PRO D 2 239 ? 28.983 39.481 35.562  1.00 77.22  ? 341  PRO D O   1 
ATOM   7571 C CB  . PRO D 2 239 ? 26.132 37.780 35.622  1.00 78.77  ? 341  PRO D CB  1 
ATOM   7572 C CG  . PRO D 2 239 ? 25.236 37.893 34.409  1.00 79.51  ? 341  PRO D CG  1 
ATOM   7573 C CD  . PRO D 2 239 ? 24.455 39.139 34.728  1.00 79.31  ? 341  PRO D CD  1 
ATOM   7574 N N   . LEU D 2 240 ? 27.708 39.792 33.737  1.00 75.94  ? 342  LEU D N   1 
ATOM   7575 C CA  . LEU D 2 240 ? 28.829 40.100 32.881  1.00 74.53  ? 342  LEU D CA  1 
ATOM   7576 C C   . LEU D 2 240 ? 29.545 41.340 33.367  1.00 73.72  ? 342  LEU D C   1 
ATOM   7577 O O   . LEU D 2 240 ? 30.733 41.296 33.660  1.00 72.87  ? 342  LEU D O   1 
ATOM   7578 C CB  . LEU D 2 240 ? 28.367 40.333 31.456  1.00 74.96  ? 342  LEU D CB  1 
ATOM   7579 C CG  . LEU D 2 240 ? 29.578 40.714 30.607  1.00 76.09  ? 342  LEU D CG  1 
ATOM   7580 C CD1 . LEU D 2 240 ? 30.558 39.558 30.643  1.00 76.42  ? 342  LEU D CD1 1 
ATOM   7581 C CD2 . LEU D 2 240 ? 29.175 41.035 29.179  1.00 76.92  ? 342  LEU D CD2 1 
ATOM   7582 N N   . LEU D 2 241 ? 28.825 42.455 33.440  1.00 74.26  ? 343  LEU D N   1 
ATOM   7583 C CA  . LEU D 2 241 ? 29.424 43.709 33.905  1.00 75.73  ? 343  LEU D CA  1 
ATOM   7584 C C   . LEU D 2 241 ? 29.995 43.531 35.305  1.00 76.64  ? 343  LEU D C   1 
ATOM   7585 O O   . LEU D 2 241 ? 30.929 44.221 35.716  1.00 75.76  ? 343  LEU D O   1 
ATOM   7586 C CB  . LEU D 2 241 ? 28.387 44.833 33.898  1.00 73.64  ? 343  LEU D CB  1 
ATOM   7587 C CG  . LEU D 2 241 ? 28.289 45.647 32.602  1.00 72.15  ? 343  LEU D CG  1 
ATOM   7588 C CD1 . LEU D 2 241 ? 29.548 46.480 32.424  1.00 70.27  ? 343  LEU D CD1 1 
ATOM   7589 C CD2 . LEU D 2 241 ? 28.078 44.724 31.421  1.00 69.93  ? 343  LEU D CD2 1 
ATOM   7590 N N   . GLN D 2 242 ? 29.404 42.581 36.016  1.00 78.51  ? 344  GLN D N   1 
ATOM   7591 C CA  . GLN D 2 242 ? 29.781 42.200 37.362  1.00 80.24  ? 344  GLN D CA  1 
ATOM   7592 C C   . GLN D 2 242 ? 31.167 41.522 37.348  1.00 80.41  ? 344  GLN D C   1 
ATOM   7593 O O   . GLN D 2 242 ? 31.968 41.707 38.266  1.00 79.41  ? 344  GLN D O   1 
ATOM   7594 C CB  . GLN D 2 242 ? 28.672 41.281 37.880  1.00 81.16  ? 344  GLN D CB  1 
ATOM   7595 C CG  . GLN D 2 242 ? 29.037 40.257 38.904  1.00 83.81  ? 344  GLN D CG  1 
ATOM   7596 C CD  . GLN D 2 242 ? 27.902 39.270 39.106  1.00 85.47  ? 344  GLN D CD  1 
ATOM   7597 O OE1 . GLN D 2 242 ? 26.808 39.644 39.538  1.00 86.17  ? 344  GLN D OE1 1 
ATOM   7598 N NE2 . GLN D 2 242 ? 28.151 38.002 38.777  1.00 86.09  ? 344  GLN D NE2 1 
ATOM   7599 N N   . GLU D 2 243 ? 31.446 40.757 36.293  1.00 81.53  ? 345  GLU D N   1 
ATOM   7600 C CA  . GLU D 2 243 ? 32.732 40.079 36.130  1.00 83.17  ? 345  GLU D CA  1 
ATOM   7601 C C   . GLU D 2 243 ? 33.783 41.005 35.539  1.00 83.95  ? 345  GLU D C   1 
ATOM   7602 O O   . GLU D 2 243 ? 34.959 40.915 35.883  1.00 85.59  ? 345  GLU D O   1 
ATOM   7603 C CB  . GLU D 2 243 ? 32.613 38.879 35.203  1.00 83.96  ? 345  GLU D CB  1 
ATOM   7604 C CG  . GLU D 2 243 ? 31.957 37.665 35.800  1.00 86.89  ? 345  GLU D CG  1 
ATOM   7605 C CD  . GLU D 2 243 ? 32.277 36.423 34.994  1.00 88.27  ? 345  GLU D CD  1 
ATOM   7606 O OE1 . GLU D 2 243 ? 31.730 35.340 35.303  1.00 89.34  ? 345  GLU D OE1 1 
ATOM   7607 O OE2 . GLU D 2 243 ? 33.090 36.535 34.045  1.00 88.03  ? 345  GLU D OE2 1 
ATOM   7608 N N   . ILE D 2 244 ? 33.367 41.872 34.622  1.00 83.85  ? 346  ILE D N   1 
ATOM   7609 C CA  . ILE D 2 244 ? 34.294 42.807 34.006  1.00 83.42  ? 346  ILE D CA  1 
ATOM   7610 C C   . ILE D 2 244 ? 34.870 43.750 35.053  1.00 85.28  ? 346  ILE D C   1 
ATOM   7611 O O   . ILE D 2 244 ? 36.025 44.164 34.962  1.00 86.03  ? 346  ILE D O   1 
ATOM   7612 C CB  . ILE D 2 244 ? 33.609 43.633 32.928  1.00 81.15  ? 346  ILE D CB  1 
ATOM   7613 C CG1 . ILE D 2 244 ? 33.237 42.734 31.756  1.00 80.18  ? 346  ILE D CG1 1 
ATOM   7614 C CG2 . ILE D 2 244 ? 34.540 44.727 32.451  1.00 81.18  ? 346  ILE D CG2 1 
ATOM   7615 C CD1 . ILE D 2 244 ? 34.430 42.202 31.020  1.00 80.01  ? 346  ILE D CD1 1 
ATOM   7616 N N   . CYS D 2 245 ? 34.065 44.082 36.057  1.00 87.19  ? 347  CYS D N   1 
ATOM   7617 C CA  . CYS D 2 245 ? 34.514 44.972 37.123  1.00 89.20  ? 347  CYS D CA  1 
ATOM   7618 C C   . CYS D 2 245 ? 35.063 44.231 38.350  1.00 89.88  ? 347  CYS D C   1 
ATOM   7619 O O   . CYS D 2 245 ? 35.334 44.848 39.385  1.00 90.43  ? 347  CYS D O   1 
ATOM   7620 C CB  . CYS D 2 245 ? 33.367 45.908 37.536  1.00 89.64  ? 347  CYS D CB  1 
ATOM   7621 S SG  . CYS D 2 245 ? 32.930 47.140 36.263  1.00 90.43  ? 347  CYS D SG  1 
ATOM   7622 N N   . SER D 2 246 ? 35.241 42.917 38.225  1.00 90.43  ? 348  SER D N   1 
ATOM   7623 C CA  . SER D 2 246 ? 35.757 42.095 39.318  1.00 91.11  ? 348  SER D CA  1 
ATOM   7624 C C   . SER D 2 246 ? 37.143 42.542 39.784  1.00 91.92  ? 348  SER D C   1 
ATOM   7625 O O   . SER D 2 246 ? 37.345 42.577 41.019  1.00 92.22  ? 348  SER D O   1 
ATOM   7626 C CB  . SER D 2 246 ? 35.806 40.623 38.900  1.00 90.60  ? 348  SER D CB  1 
ATOM   7627 O OG  . SER D 2 246 ? 36.651 40.444 37.778  1.00 90.70  ? 348  SER D OG  1 
ATOM   7628 O OXT . SER D 2 246 ? 38.007 42.837 38.921  1.00 92.06  ? 348  SER D OXT 1 
ATOM   7629 N N   . HIS E 3 3   ? 16.640 41.277 56.342  1.00 113.42 ? 630  HIS E N   1 
ATOM   7630 C CA  . HIS E 3 3   ? 17.643 40.207 56.659  1.00 114.11 ? 630  HIS E CA  1 
ATOM   7631 C C   . HIS E 3 3   ? 17.178 38.809 56.234  1.00 113.76 ? 630  HIS E C   1 
ATOM   7632 O O   . HIS E 3 3   ? 16.995 37.933 57.080  1.00 113.53 ? 630  HIS E O   1 
ATOM   7633 C CB  . HIS E 3 3   ? 17.952 40.177 58.164  1.00 114.94 ? 630  HIS E CB  1 
ATOM   7634 C CG  . HIS E 3 3   ? 18.686 41.383 58.668  1.00 117.03 ? 630  HIS E CG  1 
ATOM   7635 N ND1 . HIS E 3 3   ? 19.658 42.029 57.933  1.00 118.39 ? 630  HIS E ND1 1 
ATOM   7636 C CD2 . HIS E 3 3   ? 18.610 42.042 59.849  1.00 117.21 ? 630  HIS E CD2 1 
ATOM   7637 C CE1 . HIS E 3 3   ? 20.146 43.036 58.637  1.00 118.71 ? 630  HIS E CE1 1 
ATOM   7638 N NE2 . HIS E 3 3   ? 19.527 43.066 59.803  1.00 118.05 ? 630  HIS E NE2 1 
ATOM   7639 N N   . LYS E 3 4   ? 17.021 38.600 54.926  1.00 113.37 ? 631  LYS E N   1 
ATOM   7640 C CA  . LYS E 3 4   ? 16.564 37.322 54.363  1.00 112.50 ? 631  LYS E CA  1 
ATOM   7641 C C   . LYS E 3 4   ? 17.165 36.047 54.969  1.00 112.23 ? 631  LYS E C   1 
ATOM   7642 O O   . LYS E 3 4   ? 16.476 35.277 55.640  1.00 111.54 ? 631  LYS E O   1 
ATOM   7643 C CB  . LYS E 3 4   ? 16.790 37.320 52.844  1.00 111.16 ? 631  LYS E CB  1 
ATOM   7644 N N   . ILE E 3 5   ? 18.452 35.837 54.719  1.00 112.71 ? 632  ILE E N   1 
ATOM   7645 C CA  . ILE E 3 5   ? 19.178 34.653 55.180  1.00 112.62 ? 632  ILE E CA  1 
ATOM   7646 C C   . ILE E 3 5   ? 19.160 34.368 56.671  1.00 113.22 ? 632  ILE E C   1 
ATOM   7647 O O   . ILE E 3 5   ? 18.835 33.262 57.089  1.00 113.23 ? 632  ILE E O   1 
ATOM   7648 C CB  . ILE E 3 5   ? 20.648 34.716 54.765  1.00 111.82 ? 632  ILE E CB  1 
ATOM   7649 C CG1 . ILE E 3 5   ? 20.836 35.762 53.666  1.00 111.40 ? 632  ILE E CG1 1 
ATOM   7650 C CG2 . ILE E 3 5   ? 21.092 33.356 54.274  1.00 111.81 ? 632  ILE E CG2 1 
ATOM   7651 C CD1 . ILE E 3 5   ? 22.271 36.122 53.416  1.00 110.98 ? 632  ILE E CD1 1 
ATOM   7652 N N   . LEU E 3 6   ? 19.536 35.353 57.474  1.00 114.64 ? 633  LEU E N   1 
ATOM   7653 C CA  . LEU E 3 6   ? 19.567 35.170 58.916  1.00 117.00 ? 633  LEU E CA  1 
ATOM   7654 C C   . LEU E 3 6   ? 18.257 34.620 59.468  1.00 119.39 ? 633  LEU E C   1 
ATOM   7655 O O   . LEU E 3 6   ? 18.274 33.708 60.288  1.00 120.09 ? 633  LEU E O   1 
ATOM   7656 C CB  . LEU E 3 6   ? 19.905 36.491 59.609  1.00 116.97 ? 633  LEU E CB  1 
ATOM   7657 C CG  . LEU E 3 6   ? 20.005 36.443 61.137  1.00 117.16 ? 633  LEU E CG  1 
ATOM   7658 C CD1 . LEU E 3 6   ? 20.879 35.280 61.559  1.00 116.46 ? 633  LEU E CD1 1 
ATOM   7659 C CD2 . LEU E 3 6   ? 20.574 37.756 61.659  1.00 118.08 ? 633  LEU E CD2 1 
ATOM   7660 N N   . HIS E 3 7   ? 17.130 35.161 59.011  1.00 121.87 ? 634  HIS E N   1 
ATOM   7661 C CA  . HIS E 3 7   ? 15.805 34.734 59.477  1.00 123.84 ? 634  HIS E CA  1 
ATOM   7662 C C   . HIS E 3 7   ? 15.487 33.263 59.210  1.00 123.92 ? 634  HIS E C   1 
ATOM   7663 O O   . HIS E 3 7   ? 15.037 32.542 60.103  1.00 123.80 ? 634  HIS E O   1 
ATOM   7664 C CB  . HIS E 3 7   ? 14.722 35.603 58.835  1.00 126.09 ? 634  HIS E CB  1 
ATOM   7665 C CG  . HIS E 3 7   ? 14.860 37.063 59.139  1.00 129.11 ? 634  HIS E CG  1 
ATOM   7666 N ND1 . HIS E 3 7   ? 14.150 38.034 58.464  1.00 130.34 ? 634  HIS E ND1 1 
ATOM   7667 C CD2 . HIS E 3 7   ? 15.634 37.718 60.038  1.00 130.38 ? 634  HIS E CD2 1 
ATOM   7668 C CE1 . HIS E 3 7   ? 14.483 39.225 58.932  1.00 131.36 ? 634  HIS E CE1 1 
ATOM   7669 N NE2 . HIS E 3 7   ? 15.382 39.060 59.887  1.00 131.95 ? 634  HIS E NE2 1 
ATOM   7670 N N   . ARG E 3 8   ? 15.714 32.827 57.977  1.00 123.98 ? 635  ARG E N   1 
ATOM   7671 C CA  . ARG E 3 8   ? 15.457 31.447 57.578  1.00 124.22 ? 635  ARG E CA  1 
ATOM   7672 C C   . ARG E 3 8   ? 16.162 30.423 58.470  1.00 124.60 ? 635  ARG E C   1 
ATOM   7673 O O   . ARG E 3 8   ? 15.549 29.446 58.898  1.00 124.86 ? 635  ARG E O   1 
ATOM   7674 C CB  . ARG E 3 8   ? 15.887 31.257 56.124  1.00 124.21 ? 635  ARG E CB  1 
ATOM   7675 C CG  . ARG E 3 8   ? 15.687 29.865 55.566  1.00 124.58 ? 635  ARG E CG  1 
ATOM   7676 C CD  . ARG E 3 8   ? 15.958 29.879 54.071  1.00 125.58 ? 635  ARG E CD  1 
ATOM   7677 N NE  . ARG E 3 8   ? 17.277 30.433 53.768  1.00 126.28 ? 635  ARG E NE  1 
ATOM   7678 C CZ  . ARG E 3 8   ? 17.670 30.845 52.564  1.00 126.45 ? 635  ARG E CZ  1 
ATOM   7679 N NH1 . ARG E 3 8   ? 16.850 30.774 51.520  1.00 125.59 ? 635  ARG E NH1 1 
ATOM   7680 N NH2 . ARG E 3 8   ? 18.891 31.335 52.404  1.00 127.08 ? 635  ARG E NH2 1 
ATOM   7681 N N   . LEU E 3 9   ? 17.444 30.653 58.749  1.00 124.84 ? 636  LEU E N   1 
ATOM   7682 C CA  . LEU E 3 9   ? 18.242 29.750 59.583  1.00 124.78 ? 636  LEU E CA  1 
ATOM   7683 C C   . LEU E 3 9   ? 17.751 29.616 61.018  1.00 124.22 ? 636  LEU E C   1 
ATOM   7684 O O   . LEU E 3 9   ? 17.622 28.503 61.529  1.00 124.05 ? 636  LEU E O   1 
ATOM   7685 C CB  . LEU E 3 9   ? 19.709 30.189 59.602  1.00 125.48 ? 636  LEU E CB  1 
ATOM   7686 C CG  . LEU E 3 9   ? 20.613 29.565 58.538  1.00 126.53 ? 636  LEU E CG  1 
ATOM   7687 C CD1 . LEU E 3 9   ? 20.620 28.051 58.718  1.00 126.50 ? 636  LEU E CD1 1 
ATOM   7688 C CD2 . LEU E 3 9   ? 20.126 29.940 57.141  1.00 126.87 ? 636  LEU E CD2 1 
ATOM   7689 N N   . LEU E 3 10  ? 17.486 30.745 61.671  1.00 123.77 ? 637  LEU E N   1 
ATOM   7690 C CA  . LEU E 3 10  ? 17.003 30.732 63.051  1.00 123.62 ? 637  LEU E CA  1 
ATOM   7691 C C   . LEU E 3 10  ? 15.677 30.001 63.200  1.00 123.59 ? 637  LEU E C   1 
ATOM   7692 O O   . LEU E 3 10  ? 15.218 29.757 64.315  1.00 123.92 ? 637  LEU E O   1 
ATOM   7693 C CB  . LEU E 3 10  ? 16.840 32.157 63.585  1.00 123.07 ? 637  LEU E CB  1 
ATOM   7694 C CG  . LEU E 3 10  ? 18.074 32.801 64.216  1.00 122.62 ? 637  LEU E CG  1 
ATOM   7695 C CD1 . LEU E 3 10  ? 17.721 34.185 64.712  1.00 122.76 ? 637  LEU E CD1 1 
ATOM   7696 C CD2 . LEU E 3 10  ? 18.568 31.944 65.366  1.00 122.38 ? 637  LEU E CD2 1 
ATOM   7697 N N   . GLN E 3 11  ? 15.060 29.658 62.077  1.00 123.36 ? 638  GLN E N   1 
ATOM   7698 C CA  . GLN E 3 11  ? 13.790 28.964 62.101  1.00 123.61 ? 638  GLN E CA  1 
ATOM   7699 C C   . GLN E 3 11  ? 13.943 27.456 61.876  1.00 123.73 ? 638  GLN E C   1 
ATOM   7700 O O   . GLN E 3 11  ? 13.864 26.678 62.829  1.00 123.54 ? 638  GLN E O   1 
ATOM   7701 C CB  . GLN E 3 11  ? 12.848 29.593 61.062  1.00 123.84 ? 638  GLN E CB  1 
ATOM   7702 C CG  . GLN E 3 11  ? 12.491 31.060 61.369  1.00 122.86 ? 638  GLN E CG  1 
ATOM   7703 C CD  . GLN E 3 11  ? 11.501 31.669 60.385  1.00 121.76 ? 638  GLN E CD  1 
ATOM   7704 O OE1 . GLN E 3 11  ? 11.810 31.859 59.209  1.00 121.47 ? 638  GLN E OE1 1 
ATOM   7705 N NE2 . GLN E 3 11  ? 10.301 31.976 60.868  1.00 120.76 ? 638  GLN E NE2 1 
ATOM   7706 N N   . GLU E 3 12  ? 14.175 27.056 60.625  1.00 123.95 ? 639  GLU E N   1 
ATOM   7707 C CA  . GLU E 3 12  ? 14.331 25.647 60.247  1.00 123.37 ? 639  GLU E CA  1 
ATOM   7708 C C   . GLU E 3 12  ? 15.072 24.774 61.258  1.00 122.94 ? 639  GLU E C   1 
ATOM   7709 O O   . GLU E 3 12  ? 15.630 25.314 62.235  1.00 122.63 ? 639  GLU E O   1 
ATOM   7710 C CB  . GLU E 3 12  ? 15.035 25.544 58.885  1.00 123.43 ? 639  GLU E CB  1 
ATOM   7711 C CG  . GLU E 3 12  ? 16.342 26.329 58.790  1.00 123.23 ? 639  GLU E CG  1 
ATOM   7712 C CD  . GLU E 3 12  ? 17.003 26.226 57.424  1.00 123.43 ? 639  GLU E CD  1 
ATOM   7713 O OE1 . GLU E 3 12  ? 16.319 26.463 56.405  1.00 123.42 ? 639  GLU E OE1 1 
ATOM   7714 O OE2 . GLU E 3 12  ? 18.212 25.915 57.372  1.00 123.31 ? 639  GLU E OE2 1 
ATOM   7715 N N   . ARG F 3 2   ? 52.890 66.376 63.856  1.00 99.03  ? 686  ARG F N   1 
ATOM   7716 C CA  . ARG F 3 2   ? 52.694 65.080 64.577  1.00 100.48 ? 686  ARG F CA  1 
ATOM   7717 C C   . ARG F 3 2   ? 52.374 65.221 66.060  1.00 100.54 ? 686  ARG F C   1 
ATOM   7718 O O   . ARG F 3 2   ? 53.257 65.552 66.853  1.00 100.98 ? 686  ARG F O   1 
ATOM   7719 C CB  . ARG F 3 2   ? 53.943 64.205 64.481  1.00 101.55 ? 686  ARG F CB  1 
ATOM   7720 C CG  . ARG F 3 2   ? 53.912 63.035 65.478  1.00 102.49 ? 686  ARG F CG  1 
ATOM   7721 C CD  . ARG F 3 2   ? 55.277 62.744 66.105  1.00 103.25 ? 686  ARG F CD  1 
ATOM   7722 N NE  . ARG F 3 2   ? 56.230 62.209 65.133  1.00 103.95 ? 686  ARG F NE  1 
ATOM   7723 C CZ  . ARG F 3 2   ? 57.472 61.822 65.421  1.00 103.15 ? 686  ARG F CZ  1 
ATOM   7724 N NH1 . ARG F 3 2   ? 57.932 61.903 66.666  1.00 101.49 ? 686  ARG F NH1 1 
ATOM   7725 N NH2 . ARG F 3 2   ? 58.257 61.355 64.455  1.00 101.78 ? 686  ARG F NH2 1 
ATOM   7726 N N   . HIS F 3 3   ? 51.127 64.943 66.434  1.00 100.34 ? 687  HIS F N   1 
ATOM   7727 C CA  . HIS F 3 3   ? 50.697 65.004 67.835  1.00 100.29 ? 687  HIS F CA  1 
ATOM   7728 C C   . HIS F 3 3   ? 51.402 66.137 68.564  1.00 99.65  ? 687  HIS F C   1 
ATOM   7729 O O   . HIS F 3 3   ? 51.982 65.933 69.628  1.00 99.12  ? 687  HIS F O   1 
ATOM   7730 C CB  . HIS F 3 3   ? 51.013 63.683 68.562  1.00 101.39 ? 687  HIS F CB  1 
ATOM   7731 C CG  . HIS F 3 3   ? 50.403 62.468 67.927  1.00 102.96 ? 687  HIS F CG  1 
ATOM   7732 N ND1 . HIS F 3 3   ? 50.809 61.979 66.702  1.00 104.01 ? 687  HIS F ND1 1 
ATOM   7733 C CD2 . HIS F 3 3   ? 49.410 61.648 68.347  1.00 103.09 ? 687  HIS F CD2 1 
ATOM   7734 C CE1 . HIS F 3 3   ? 50.092 60.914 66.394  1.00 104.07 ? 687  HIS F CE1 1 
ATOM   7735 N NE2 . HIS F 3 3   ? 49.236 60.692 67.376  1.00 103.98 ? 687  HIS F NE2 1 
ATOM   7736 N N   . LYS F 3 4   ? 51.340 67.331 67.990  1.00 99.53  ? 688  LYS F N   1 
ATOM   7737 C CA  . LYS F 3 4   ? 51.997 68.495 68.563  1.00 99.76  ? 688  LYS F CA  1 
ATOM   7738 C C   . LYS F 3 4   ? 51.674 68.773 70.034  1.00 99.86  ? 688  LYS F C   1 
ATOM   7739 O O   . LYS F 3 4   ? 52.514 68.572 70.917  1.00 98.43  ? 688  LYS F O   1 
ATOM   7740 C CB  . LYS F 3 4   ? 51.673 69.725 67.717  1.00 99.35  ? 688  LYS F CB  1 
ATOM   7741 N N   . ILE F 3 5   ? 50.450 69.231 70.283  1.00 100.77 ? 689  ILE F N   1 
ATOM   7742 C CA  . ILE F 3 5   ? 49.999 69.590 71.625  1.00 101.25 ? 689  ILE F CA  1 
ATOM   7743 C C   . ILE F 3 5   ? 50.168 68.524 72.705  1.00 101.46 ? 689  ILE F C   1 
ATOM   7744 O O   . ILE F 3 5   ? 50.531 68.856 73.826  1.00 101.61 ? 689  ILE F O   1 
ATOM   7745 C CB  . ILE F 3 5   ? 48.516 70.089 71.599  1.00 101.40 ? 689  ILE F CB  1 
ATOM   7746 C CG1 . ILE F 3 5   ? 48.135 70.711 72.942  1.00 101.00 ? 689  ILE F CG1 1 
ATOM   7747 C CG2 . ILE F 3 5   ? 47.572 68.947 71.303  1.00 102.10 ? 689  ILE F CG2 1 
ATOM   7748 C CD1 . ILE F 3 5   ? 46.753 71.346 72.949  1.00 100.43 ? 689  ILE F CD1 1 
ATOM   7749 N N   . LEU F 3 6   ? 49.914 67.255 72.389  1.00 102.33 ? 690  LEU F N   1 
ATOM   7750 C CA  . LEU F 3 6   ? 50.076 66.183 73.380  1.00 102.15 ? 690  LEU F CA  1 
ATOM   7751 C C   . LEU F 3 6   ? 51.541 66.119 73.781  1.00 102.45 ? 690  LEU F C   1 
ATOM   7752 O O   . LEU F 3 6   ? 51.867 66.090 74.970  1.00 100.44 ? 690  LEU F O   1 
ATOM   7753 C CB  . LEU F 3 6   ? 49.623 64.846 72.793  1.00 101.71 ? 690  LEU F CB  1 
ATOM   7754 C CG  . LEU F 3 6   ? 48.117 64.826 72.519  1.00 101.50 ? 690  LEU F CG  1 
ATOM   7755 C CD1 . LEU F 3 6   ? 47.735 63.573 71.747  1.00 101.26 ? 690  LEU F CD1 1 
ATOM   7756 C CD2 . LEU F 3 6   ? 47.368 64.927 73.844  1.00 100.45 ? 690  LEU F CD2 1 
ATOM   7757 N N   . HIS F 3 7   ? 52.416 66.088 72.777  1.00 104.14 ? 691  HIS F N   1 
ATOM   7758 C CA  . HIS F 3 7   ? 53.850 66.079 73.023  1.00 105.33 ? 691  HIS F CA  1 
ATOM   7759 C C   . HIS F 3 7   ? 54.023 67.248 73.985  1.00 106.10 ? 691  HIS F C   1 
ATOM   7760 O O   . HIS F 3 7   ? 54.414 67.070 75.139  1.00 105.95 ? 691  HIS F O   1 
ATOM   7761 C CB  . HIS F 3 7   ? 54.631 66.327 71.714  1.00 104.56 ? 691  HIS F CB  1 
ATOM   7762 C CG  . HIS F 3 7   ? 55.000 65.076 70.967  1.00 104.39 ? 691  HIS F CG  1 
ATOM   7763 N ND1 . HIS F 3 7   ? 54.920 64.971 69.592  1.00 104.60 ? 691  HIS F ND1 1 
ATOM   7764 C CD2 . HIS F 3 7   ? 55.481 63.886 71.402  1.00 103.51 ? 691  HIS F CD2 1 
ATOM   7765 C CE1 . HIS F 3 7   ? 55.332 63.774 69.214  1.00 102.88 ? 691  HIS F CE1 1 
ATOM   7766 N NE2 . HIS F 3 7   ? 55.678 63.096 70.294  1.00 104.14 ? 691  HIS F NE2 1 
ATOM   7767 N N   . ARG F 3 8   ? 53.679 68.437 73.506  1.00 107.73 ? 692  ARG F N   1 
ATOM   7768 C CA  . ARG F 3 8   ? 53.773 69.659 74.290  1.00 110.20 ? 692  ARG F CA  1 
ATOM   7769 C C   . ARG F 3 8   ? 53.332 69.425 75.736  1.00 111.64 ? 692  ARG F C   1 
ATOM   7770 O O   . ARG F 3 8   ? 54.116 69.583 76.669  1.00 112.20 ? 692  ARG F O   1 
ATOM   7771 C CB  . ARG F 3 8   ? 52.896 70.737 73.647  1.00 110.39 ? 692  ARG F CB  1 
ATOM   7772 C CG  . ARG F 3 8   ? 53.238 72.174 74.020  1.00 110.79 ? 692  ARG F CG  1 
ATOM   7773 C CD  . ARG F 3 8   ? 52.202 73.131 73.438  1.00 110.73 ? 692  ARG F CD  1 
ATOM   7774 N NE  . ARG F 3 8   ? 50.946 73.105 74.192  1.00 111.45 ? 692  ARG F NE  1 
ATOM   7775 C CZ  . ARG F 3 8   ? 49.790 73.593 73.746  1.00 111.21 ? 692  ARG F CZ  1 
ATOM   7776 N NH1 . ARG F 3 8   ? 49.725 74.139 72.540  1.00 111.16 ? 692  ARG F NH1 1 
ATOM   7777 N NH2 . ARG F 3 8   ? 48.702 73.554 74.510  1.00 110.51 ? 692  ARG F NH2 1 
ATOM   7778 N N   . LEU F 3 9   ? 52.076 69.028 75.905  1.00 113.59 ? 693  LEU F N   1 
ATOM   7779 C CA  . LEU F 3 9   ? 51.480 68.786 77.216  1.00 115.27 ? 693  LEU F CA  1 
ATOM   7780 C C   . LEU F 3 9   ? 52.247 67.850 78.154  1.00 117.03 ? 693  LEU F C   1 
ATOM   7781 O O   . LEU F 3 9   ? 52.585 68.238 79.276  1.00 116.50 ? 693  LEU F O   1 
ATOM   7782 C CB  . LEU F 3 9   ? 50.047 68.267 77.034  1.00 114.36 ? 693  LEU F CB  1 
ATOM   7783 C CG  . LEU F 3 9   ? 49.069 69.157 76.256  1.00 113.29 ? 693  LEU F CG  1 
ATOM   7784 C CD1 . LEU F 3 9   ? 47.720 68.462 76.098  1.00 112.30 ? 693  LEU F CD1 1 
ATOM   7785 C CD2 . LEU F 3 9   ? 48.910 70.478 76.978  1.00 112.63 ? 693  LEU F CD2 1 
ATOM   7786 N N   . LEU F 3 10  ? 52.522 66.627 77.701  1.00 119.33 ? 694  LEU F N   1 
ATOM   7787 C CA  . LEU F 3 10  ? 53.229 65.632 78.523  1.00 121.74 ? 694  LEU F CA  1 
ATOM   7788 C C   . LEU F 3 10  ? 54.690 65.947 78.862  1.00 122.95 ? 694  LEU F C   1 
ATOM   7789 O O   . LEU F 3 10  ? 55.386 65.130 79.466  1.00 122.67 ? 694  LEU F O   1 
ATOM   7790 C CB  . LEU F 3 10  ? 53.153 64.248 77.861  1.00 121.83 ? 694  LEU F CB  1 
ATOM   7791 C CG  . LEU F 3 10  ? 51.813 63.498 77.889  1.00 121.75 ? 694  LEU F CG  1 
ATOM   7792 C CD1 . LEU F 3 10  ? 51.949 62.182 77.119  1.00 122.61 ? 694  LEU F CD1 1 
ATOM   7793 C CD2 . LEU F 3 10  ? 51.384 63.235 79.334  1.00 120.35 ? 694  LEU F CD2 1 
ATOM   7794 N N   . GLN F 3 11  ? 55.150 67.131 78.480  1.00 124.84 ? 695  GLN F N   1 
ATOM   7795 C CA  . GLN F 3 11  ? 56.515 67.542 78.757  1.00 126.88 ? 695  GLN F CA  1 
ATOM   7796 C C   . GLN F 3 11  ? 56.796 67.585 80.257  1.00 128.18 ? 695  GLN F C   1 
ATOM   7797 O O   . GLN F 3 11  ? 57.437 66.688 80.798  1.00 127.54 ? 695  GLN F O   1 
ATOM   7798 C CB  . GLN F 3 11  ? 56.764 68.918 78.151  1.00 127.00 ? 695  GLN F CB  1 
ATOM   7799 C CG  . GLN F 3 11  ? 58.097 69.529 78.515  1.00 127.68 ? 695  GLN F CG  1 
ATOM   7800 C CD  . GLN F 3 11  ? 58.094 71.031 78.340  1.00 128.38 ? 695  GLN F CD  1 
ATOM   7801 O OE1 . GLN F 3 11  ? 59.076 71.705 78.648  1.00 129.78 ? 695  GLN F OE1 1 
ATOM   7802 N NE2 . GLN F 3 11  ? 56.984 71.566 77.846  1.00 128.29 ? 695  GLN F NE2 1 
ATOM   7803 N N   . GLU F 3 12  ? 56.302 68.629 80.921  1.00 130.47 ? 696  GLU F N   1 
ATOM   7804 C CA  . GLU F 3 12  ? 56.510 68.816 82.357  1.00 132.56 ? 696  GLU F CA  1 
ATOM   7805 C C   . GLU F 3 12  ? 55.348 69.495 83.085  1.00 133.15 ? 696  GLU F C   1 
ATOM   7806 O O   . GLU F 3 12  ? 54.367 69.911 82.463  1.00 133.61 ? 696  GLU F O   1 
ATOM   7807 C CB  . GLU F 3 12  ? 57.789 69.623 82.599  1.00 133.30 ? 696  GLU F CB  1 
ATOM   7808 C CG  . GLU F 3 12  ? 59.037 68.805 82.437  1.00 134.19 ? 696  GLU F CG  1 
ATOM   7809 C CD  . GLU F 3 12  ? 58.985 67.563 83.291  1.00 134.96 ? 696  GLU F CD  1 
ATOM   7810 O OE1 . GLU F 3 12  ? 58.878 67.705 84.528  1.00 135.18 ? 696  GLU F OE1 1 
ATOM   7811 O OE2 . GLU F 3 12  ? 59.037 66.451 82.725  1.00 135.61 ? 696  GLU F OE2 1 
ATOM   7812 N N   . GLY F 3 13  ? 55.484 69.602 84.408  1.00 133.02 ? 697  GLY F N   1 
ATOM   7813 C CA  . GLY F 3 13  ? 54.464 70.220 85.236  1.00 132.35 ? 697  GLY F CA  1 
ATOM   7814 C C   . GLY F 3 13  ? 53.700 71.329 84.542  1.00 132.17 ? 697  GLY F C   1 
ATOM   7815 O O   . GLY F 3 13  ? 52.452 71.254 84.505  1.00 132.04 ? 697  GLY F O   1 
ATOM   7816 O OXT . GLY F 3 13  ? 54.347 72.273 84.037  1.00 131.66 ? 697  GLY F OXT 1 
ATOM   7817 N N   . GLU G 3 1   ? 37.798 77.487 54.679  1.00 141.28 ? 628  GLU G N   1 
ATOM   7818 C CA  . GLU G 3 1   ? 36.702 76.617 55.195  1.00 141.04 ? 628  GLU G CA  1 
ATOM   7819 C C   . GLU G 3 1   ? 37.197 75.178 55.366  1.00 139.53 ? 628  GLU G C   1 
ATOM   7820 O O   . GLU G 3 1   ? 37.565 74.777 56.473  1.00 139.97 ? 628  GLU G O   1 
ATOM   7821 C CB  . GLU G 3 1   ? 35.495 76.642 54.245  1.00 142.97 ? 628  GLU G CB  1 
ATOM   7822 C CG  . GLU G 3 1   ? 35.088 78.033 53.770  1.00 145.33 ? 628  GLU G CG  1 
ATOM   7823 C CD  . GLU G 3 1   ? 35.944 78.525 52.613  1.00 147.12 ? 628  GLU G CD  1 
ATOM   7824 O OE1 . GLU G 3 1   ? 35.867 77.923 51.517  1.00 148.43 ? 628  GLU G OE1 1 
ATOM   7825 O OE2 . GLU G 3 1   ? 36.698 79.504 52.806  1.00 147.38 ? 628  GLU G OE2 1 
ATOM   7826 N N   . ARG G 3 2   ? 37.216 74.406 54.277  1.00 137.08 ? 629  ARG G N   1 
ATOM   7827 C CA  . ARG G 3 2   ? 37.668 73.016 54.349  1.00 133.64 ? 629  ARG G CA  1 
ATOM   7828 C C   . ARG G 3 2   ? 39.188 72.894 54.292  1.00 131.51 ? 629  ARG G C   1 
ATOM   7829 O O   . ARG G 3 2   ? 39.821 72.490 55.268  1.00 131.40 ? 629  ARG G O   1 
ATOM   7830 C CB  . ARG G 3 2   ? 37.047 72.172 53.224  1.00 132.62 ? 629  ARG G CB  1 
ATOM   7831 C CG  . ARG G 3 2   ? 36.370 70.909 53.744  1.00 130.25 ? 629  ARG G CG  1 
ATOM   7832 C CD  . ARG G 3 2   ? 36.576 69.705 52.840  1.00 127.74 ? 629  ARG G CD  1 
ATOM   7833 N NE  . ARG G 3 2   ? 36.036 69.901 51.500  1.00 125.13 ? 629  ARG G NE  1 
ATOM   7834 C CZ  . ARG G 3 2   ? 35.777 68.911 50.653  1.00 123.55 ? 629  ARG G CZ  1 
ATOM   7835 N NH1 . ARG G 3 2   ? 36.005 67.652 51.007  1.00 121.67 ? 629  ARG G NH1 1 
ATOM   7836 N NH2 . ARG G 3 2   ? 35.292 69.181 49.451  1.00 123.70 ? 629  ARG G NH2 1 
ATOM   7837 N N   . HIS G 3 3   ? 39.770 73.244 53.150  1.00 128.59 ? 630  HIS G N   1 
ATOM   7838 C CA  . HIS G 3 3   ? 41.215 73.163 52.974  1.00 125.18 ? 630  HIS G CA  1 
ATOM   7839 C C   . HIS G 3 3   ? 41.883 74.386 53.591  1.00 123.12 ? 630  HIS G C   1 
ATOM   7840 O O   . HIS G 3 3   ? 42.059 75.403 52.930  1.00 122.46 ? 630  HIS G O   1 
ATOM   7841 C CB  . HIS G 3 3   ? 41.553 73.046 51.483  1.00 124.62 ? 630  HIS G CB  1 
ATOM   7842 C CG  . HIS G 3 3   ? 41.058 71.777 50.852  1.00 124.20 ? 630  HIS G CG  1 
ATOM   7843 N ND1 . HIS G 3 3   ? 39.723 71.534 50.604  1.00 124.21 ? 630  HIS G ND1 1 
ATOM   7844 C CD2 . HIS G 3 3   ? 41.717 70.655 50.477  1.00 124.10 ? 630  HIS G CD2 1 
ATOM   7845 C CE1 . HIS G 3 3   ? 39.582 70.317 50.109  1.00 123.86 ? 630  HIS G CE1 1 
ATOM   7846 N NE2 . HIS G 3 3   ? 40.777 69.762 50.023  1.00 123.10 ? 630  HIS G NE2 1 
ATOM   7847 N N   . LYS G 3 4   ? 42.255 74.264 54.865  1.00 121.29 ? 631  LYS G N   1 
ATOM   7848 C CA  . LYS G 3 4   ? 42.880 75.342 55.636  1.00 119.21 ? 631  LYS G CA  1 
ATOM   7849 C C   . LYS G 3 4   ? 44.355 75.630 55.357  1.00 117.73 ? 631  LYS G C   1 
ATOM   7850 O O   . LYS G 3 4   ? 44.729 76.783 55.159  1.00 117.61 ? 631  LYS G O   1 
ATOM   7851 C CB  . LYS G 3 4   ? 42.686 75.080 57.131  1.00 119.03 ? 631  LYS G CB  1 
ATOM   7852 N N   . ILE G 3 5   ? 45.197 74.601 55.359  1.00 116.44 ? 632  ILE G N   1 
ATOM   7853 C CA  . ILE G 3 5   ? 46.624 74.806 55.106  1.00 115.51 ? 632  ILE G CA  1 
ATOM   7854 C C   . ILE G 3 5   ? 46.943 75.140 53.646  1.00 115.38 ? 632  ILE G C   1 
ATOM   7855 O O   . ILE G 3 5   ? 47.857 75.916 53.368  1.00 114.88 ? 632  ILE G O   1 
ATOM   7856 C CB  . ILE G 3 5   ? 47.466 73.572 55.510  1.00 114.86 ? 632  ILE G CB  1 
ATOM   7857 C CG1 . ILE G 3 5   ? 47.340 73.309 57.011  1.00 115.12 ? 632  ILE G CG1 1 
ATOM   7858 C CG2 . ILE G 3 5   ? 48.923 73.816 55.200  1.00 114.70 ? 632  ILE G CG2 1 
ATOM   7859 C CD1 . ILE G 3 5   ? 48.319 72.263 57.524  1.00 114.62 ? 632  ILE G CD1 1 
ATOM   7860 N N   . LEU G 3 6   ? 46.194 74.559 52.714  1.00 115.36 ? 633  LEU G N   1 
ATOM   7861 C CA  . LEU G 3 6   ? 46.421 74.814 51.298  1.00 116.41 ? 633  LEU G CA  1 
ATOM   7862 C C   . LEU G 3 6   ? 46.176 76.276 50.889  1.00 119.03 ? 633  LEU G C   1 
ATOM   7863 O O   . LEU G 3 6   ? 46.841 76.787 49.980  1.00 119.92 ? 633  LEU G O   1 
ATOM   7864 C CB  . LEU G 3 6   ? 45.548 73.882 50.458  1.00 114.03 ? 633  LEU G CB  1 
ATOM   7865 C CG  . LEU G 3 6   ? 45.658 74.101 48.951  1.00 112.29 ? 633  LEU G CG  1 
ATOM   7866 C CD1 . LEU G 3 6   ? 47.115 74.188 48.570  1.00 111.58 ? 633  LEU G CD1 1 
ATOM   7867 C CD2 . LEU G 3 6   ? 44.964 72.976 48.202  1.00 111.84 ? 633  LEU G CD2 1 
ATOM   7868 N N   . HIS G 3 7   ? 45.225 76.939 51.557  1.00 121.13 ? 634  HIS G N   1 
ATOM   7869 C CA  . HIS G 3 7   ? 44.885 78.349 51.286  1.00 121.95 ? 634  HIS G CA  1 
ATOM   7870 C C   . HIS G 3 7   ? 45.962 79.297 51.818  1.00 121.43 ? 634  HIS G C   1 
ATOM   7871 O O   . HIS G 3 7   ? 46.296 80.302 51.191  1.00 121.46 ? 634  HIS G O   1 
ATOM   7872 C CB  . HIS G 3 7   ? 43.537 78.716 51.927  1.00 122.99 ? 634  HIS G CB  1 
ATOM   7873 C CG  . HIS G 3 7   ? 42.342 78.210 51.176  1.00 124.12 ? 634  HIS G CG  1 
ATOM   7874 N ND1 . HIS G 3 7   ? 41.057 78.315 51.665  1.00 124.77 ? 634  HIS G ND1 1 
ATOM   7875 C CD2 . HIS G 3 7   ? 42.234 77.609 49.966  1.00 124.35 ? 634  HIS G CD2 1 
ATOM   7876 C CE1 . HIS G 3 7   ? 40.210 77.800 50.790  1.00 124.99 ? 634  HIS G CE1 1 
ATOM   7877 N NE2 . HIS G 3 7   ? 40.899 77.365 49.750  1.00 124.78 ? 634  HIS G NE2 1 
ATOM   7878 N N   . ARG G 3 8   ? 46.484 78.970 52.992  1.00 120.65 ? 635  ARG G N   1 
ATOM   7879 C CA  . ARG G 3 8   ? 47.534 79.743 53.631  1.00 120.37 ? 635  ARG G CA  1 
ATOM   7880 C C   . ARG G 3 8   ? 48.780 79.748 52.728  1.00 121.49 ? 635  ARG G C   1 
ATOM   7881 O O   . ARG G 3 8   ? 49.428 80.782 52.542  1.00 121.49 ? 635  ARG G O   1 
ATOM   7882 C CB  . ARG G 3 8   ? 47.852 79.091 54.977  1.00 118.83 ? 635  ARG G CB  1 
ATOM   7883 C CG  . ARG G 3 8   ? 48.845 79.817 55.851  1.00 117.71 ? 635  ARG G CG  1 
ATOM   7884 C CD  . ARG G 3 8   ? 49.199 78.953 57.055  1.00 116.66 ? 635  ARG G CD  1 
ATOM   7885 N NE  . ARG G 3 8   ? 50.034 77.809 56.689  1.00 115.53 ? 635  ARG G NE  1 
ATOM   7886 C CZ  . ARG G 3 8   ? 50.321 76.796 57.503  1.00 114.81 ? 635  ARG G CZ  1 
ATOM   7887 N NH1 . ARG G 3 8   ? 49.838 76.771 58.737  1.00 114.68 ? 635  ARG G NH1 1 
ATOM   7888 N NH2 . ARG G 3 8   ? 51.108 75.814 57.089  1.00 114.48 ? 635  ARG G NH2 1 
ATOM   7889 N N   . LEU G 3 9   ? 49.089 78.582 52.160  1.00 122.48 ? 636  LEU G N   1 
ATOM   7890 C CA  . LEU G 3 9   ? 50.249 78.388 51.288  1.00 123.29 ? 636  LEU G CA  1 
ATOM   7891 C C   . LEU G 3 9   ? 50.227 79.104 49.942  1.00 124.01 ? 636  LEU G C   1 
ATOM   7892 O O   . LEU G 3 9   ? 51.193 79.765 49.574  1.00 123.94 ? 636  LEU G O   1 
ATOM   7893 C CB  . LEU G 3 9   ? 50.474 76.893 51.045  1.00 122.70 ? 636  LEU G CB  1 
ATOM   7894 C CG  . LEU G 3 9   ? 51.357 76.156 52.053  1.00 121.94 ? 636  LEU G CG  1 
ATOM   7895 C CD1 . LEU G 3 9   ? 50.816 76.327 53.464  1.00 121.20 ? 636  LEU G CD1 1 
ATOM   7896 C CD2 . LEU G 3 9   ? 51.431 74.689 51.666  1.00 121.39 ? 636  LEU G CD2 1 
ATOM   7897 N N   . LEU G 3 10  ? 49.140 78.963 49.197  1.00 124.88 ? 637  LEU G N   1 
ATOM   7898 C CA  . LEU G 3 10  ? 49.036 79.609 47.894  1.00 126.57 ? 637  LEU G CA  1 
ATOM   7899 C C   . LEU G 3 10  ? 49.029 81.139 47.944  1.00 128.13 ? 637  LEU G C   1 
ATOM   7900 O O   . LEU G 3 10  ? 48.773 81.791 46.928  1.00 128.44 ? 637  LEU G O   1 
ATOM   7901 C CB  . LEU G 3 10  ? 47.772 79.136 47.181  1.00 126.45 ? 637  LEU G CB  1 
ATOM   7902 C CG  . LEU G 3 10  ? 47.910 78.012 46.161  1.00 126.11 ? 637  LEU G CG  1 
ATOM   7903 C CD1 . LEU G 3 10  ? 46.535 77.668 45.614  1.00 125.85 ? 637  LEU G CD1 1 
ATOM   7904 C CD2 . LEU G 3 10  ? 48.837 78.451 45.038  1.00 125.82 ? 637  LEU G CD2 1 
ATOM   7905 N N   . GLN G 3 11  ? 49.311 81.715 49.110  1.00 129.40 ? 638  GLN G N   1 
ATOM   7906 C CA  . GLN G 3 11  ? 49.309 83.163 49.256  1.00 130.76 ? 638  GLN G CA  1 
ATOM   7907 C C   . GLN G 3 11  ? 50.630 83.756 49.739  1.00 131.66 ? 638  GLN G C   1 
ATOM   7908 O O   . GLN G 3 11  ? 51.416 84.276 48.943  1.00 131.68 ? 638  GLN G O   1 
ATOM   7909 C CB  . GLN G 3 11  ? 48.182 83.578 50.205  1.00 130.51 ? 638  GLN G CB  1 
ATOM   7910 C CG  . GLN G 3 11  ? 46.800 83.200 49.706  1.00 130.65 ? 638  GLN G CG  1 
ATOM   7911 C CD  . GLN G 3 11  ? 45.737 83.347 50.771  1.00 131.23 ? 638  GLN G CD  1 
ATOM   7912 O OE1 . GLN G 3 11  ? 44.572 83.014 50.551  1.00 131.15 ? 638  GLN G OE1 1 
ATOM   7913 N NE2 . GLN G 3 11  ? 46.132 83.845 51.937  1.00 131.71 ? 638  GLN G NE2 1 
ATOM   7914 N N   . GLU G 3 12  ? 50.866 83.675 51.045  1.00 132.45 ? 639  GLU G N   1 
ATOM   7915 C CA  . GLU G 3 12  ? 52.071 84.227 51.664  1.00 132.90 ? 639  GLU G CA  1 
ATOM   7916 C C   . GLU G 3 12  ? 53.383 84.127 50.873  1.00 133.20 ? 639  GLU G C   1 
ATOM   7917 O O   . GLU G 3 12  ? 53.422 83.450 49.820  1.00 133.53 ? 639  GLU G O   1 
ATOM   7918 C CB  . GLU G 3 12  ? 52.253 83.613 53.059  1.00 132.57 ? 639  GLU G CB  1 
ATOM   7919 C CG  . GLU G 3 12  ? 52.141 82.095 53.121  1.00 131.45 ? 639  GLU G CG  1 
ATOM   7920 C CD  . GLU G 3 12  ? 52.180 81.575 54.546  1.00 130.58 ? 639  GLU G CD  1 
ATOM   7921 O OE1 . GLU G 3 12  ? 51.362 82.046 55.364  1.00 129.63 ? 639  GLU G OE1 1 
ATOM   7922 O OE2 . GLU G 3 12  ? 53.020 80.699 54.851  1.00 129.61 ? 639  GLU G OE2 1 
ATOM   7923 N N   . GLU H 3 1   ? 38.659 34.469 41.664  1.00 142.45 ? 685  GLU H N   1 
ATOM   7924 C CA  . GLU H 3 1   ? 38.058 34.764 40.331  1.00 142.42 ? 685  GLU H CA  1 
ATOM   7925 C C   . GLU H 3 1   ? 38.190 33.576 39.386  1.00 141.33 ? 685  GLU H C   1 
ATOM   7926 O O   . GLU H 3 1   ? 39.272 33.005 39.217  1.00 141.18 ? 685  GLU H O   1 
ATOM   7927 C CB  . GLU H 3 1   ? 38.733 35.980 39.683  1.00 144.02 ? 685  GLU H CB  1 
ATOM   7928 C CG  . GLU H 3 1   ? 40.154 35.711 39.197  1.00 146.16 ? 685  GLU H CG  1 
ATOM   7929 C CD  . GLU H 3 1   ? 40.713 36.821 38.319  1.00 147.52 ? 685  GLU H CD  1 
ATOM   7930 O OE1 . GLU H 3 1   ? 40.734 37.990 38.766  1.00 148.72 ? 685  GLU H OE1 1 
ATOM   7931 O OE2 . GLU H 3 1   ? 41.140 36.519 37.181  1.00 148.26 ? 685  GLU H OE2 1 
ATOM   7932 N N   . ARG H 3 2   ? 37.076 33.209 38.770  1.00 139.60 ? 686  ARG H N   1 
ATOM   7933 C CA  . ARG H 3 2   ? 37.058 32.105 37.829  1.00 137.69 ? 686  ARG H CA  1 
ATOM   7934 C C   . ARG H 3 2   ? 36.669 32.667 36.471  1.00 136.08 ? 686  ARG H C   1 
ATOM   7935 O O   . ARG H 3 2   ? 37.185 32.238 35.440  1.00 136.38 ? 686  ARG H O   1 
ATOM   7936 C CB  . ARG H 3 2   ? 36.052 31.052 38.286  1.00 138.51 ? 686  ARG H CB  1 
ATOM   7937 C CG  . ARG H 3 2   ? 34.612 31.528 38.299  1.00 139.32 ? 686  ARG H CG  1 
ATOM   7938 C CD  . ARG H 3 2   ? 33.737 30.612 39.128  1.00 140.37 ? 686  ARG H CD  1 
ATOM   7939 N NE  . ARG H 3 2   ? 32.448 30.351 38.492  1.00 141.43 ? 686  ARG H NE  1 
ATOM   7940 C CZ  . ARG H 3 2   ? 32.266 29.508 37.478  1.00 141.92 ? 686  ARG H CZ  1 
ATOM   7941 N NH1 . ARG H 3 2   ? 33.293 28.831 36.973  1.00 141.93 ? 686  ARG H NH1 1 
ATOM   7942 N NH2 . ARG H 3 2   ? 31.052 29.334 36.972  1.00 142.10 ? 686  ARG H NH2 1 
ATOM   7943 N N   . HIS H 3 3   ? 35.762 33.640 36.486  1.00 133.81 ? 687  HIS H N   1 
ATOM   7944 C CA  . HIS H 3 3   ? 35.300 34.293 35.275  1.00 132.02 ? 687  HIS H CA  1 
ATOM   7945 C C   . HIS H 3 3   ? 34.919 33.273 34.211  1.00 131.49 ? 687  HIS H C   1 
ATOM   7946 O O   . HIS H 3 3   ? 35.472 33.272 33.115  1.00 131.03 ? 687  HIS H O   1 
ATOM   7947 C CB  . HIS H 3 3   ? 36.401 35.218 34.758  1.00 131.49 ? 687  HIS H CB  1 
ATOM   7948 C CG  . HIS H 3 3   ? 36.809 36.272 35.741  1.00 131.71 ? 687  HIS H CG  1 
ATOM   7949 N ND1 . HIS H 3 3   ? 37.992 36.972 35.636  1.00 131.91 ? 687  HIS H ND1 1 
ATOM   7950 C CD2 . HIS H 3 3   ? 36.186 36.752 36.843  1.00 131.83 ? 687  HIS H CD2 1 
ATOM   7951 C CE1 . HIS H 3 3   ? 38.081 37.836 36.632  1.00 131.58 ? 687  HIS H CE1 1 
ATOM   7952 N NE2 . HIS H 3 3   ? 36.998 37.722 37.379  1.00 131.47 ? 687  HIS H NE2 1 
ATOM   7953 N N   . LYS H 3 4   ? 33.966 32.408 34.543  1.00 131.13 ? 688  LYS H N   1 
ATOM   7954 C CA  . LYS H 3 4   ? 33.512 31.371 33.620  1.00 130.93 ? 688  LYS H CA  1 
ATOM   7955 C C   . LYS H 3 4   ? 32.807 31.930 32.387  1.00 130.58 ? 688  LYS H C   1 
ATOM   7956 O O   . LYS H 3 4   ? 33.079 31.506 31.262  1.00 130.36 ? 688  LYS H O   1 
ATOM   7957 C CB  . LYS H 3 4   ? 32.588 30.409 34.341  1.00 130.28 ? 688  LYS H CB  1 
ATOM   7958 N N   . ILE H 3 5   ? 31.897 32.876 32.609  1.00 130.38 ? 689  ILE H N   1 
ATOM   7959 C CA  . ILE H 3 5   ? 31.134 33.491 31.525  1.00 130.16 ? 689  ILE H CA  1 
ATOM   7960 C C   . ILE H 3 5   ? 32.053 33.969 30.397  1.00 130.29 ? 689  ILE H C   1 
ATOM   7961 O O   . ILE H 3 5   ? 31.766 33.762 29.218  1.00 130.01 ? 689  ILE H O   1 
ATOM   7962 C CB  . ILE H 3 5   ? 30.252 34.673 32.066  1.00 129.59 ? 689  ILE H CB  1 
ATOM   7963 C CG1 . ILE H 3 5   ? 29.205 35.087 31.038  1.00 129.06 ? 689  ILE H CG1 1 
ATOM   7964 C CG2 . ILE H 3 5   ? 31.088 35.888 32.352  1.00 129.27 ? 689  ILE H CG2 1 
ATOM   7965 C CD1 . ILE H 3 5   ? 28.333 36.236 31.517  1.00 128.34 ? 689  ILE H CD1 1 
ATOM   7966 N N   . LEU H 3 6   ? 33.169 34.586 30.765  1.00 130.93 ? 690  LEU H N   1 
ATOM   7967 C CA  . LEU H 3 6   ? 34.129 35.084 29.795  1.00 131.28 ? 690  LEU H CA  1 
ATOM   7968 C C   . LEU H 3 6   ? 34.724 33.911 29.023  1.00 131.74 ? 690  LEU H C   1 
ATOM   7969 O O   . LEU H 3 6   ? 34.687 33.894 27.792  1.00 131.16 ? 690  LEU H O   1 
ATOM   7970 C CB  . LEU H 3 6   ? 35.213 35.882 30.524  1.00 130.93 ? 690  LEU H CB  1 
ATOM   7971 C CG  . LEU H 3 6   ? 34.643 37.113 31.240  1.00 130.13 ? 690  LEU H CG  1 
ATOM   7972 C CD1 . LEU H 3 6   ? 35.596 37.612 32.314  1.00 129.99 ? 690  LEU H CD1 1 
ATOM   7973 C CD2 . LEU H 3 6   ? 34.358 38.191 30.206  1.00 129.84 ? 690  LEU H CD2 1 
ATOM   7974 N N   . HIS H 3 7   ? 35.263 32.934 29.750  1.00 132.48 ? 691  HIS H N   1 
ATOM   7975 C CA  . HIS H 3 7   ? 35.836 31.740 29.137  1.00 133.29 ? 691  HIS H CA  1 
ATOM   7976 C C   . HIS H 3 7   ? 34.975 31.363 27.940  1.00 133.56 ? 691  HIS H C   1 
ATOM   7977 O O   . HIS H 3 7   ? 35.467 31.248 26.815  1.00 133.72 ? 691  HIS H O   1 
ATOM   7978 C CB  . HIS H 3 7   ? 35.849 30.590 30.150  1.00 134.04 ? 691  HIS H CB  1 
ATOM   7979 C CG  . HIS H 3 7   ? 37.043 30.591 31.055  1.00 135.01 ? 691  HIS H CG  1 
ATOM   7980 N ND1 . HIS H 3 7   ? 36.978 30.218 32.382  1.00 134.88 ? 691  HIS H ND1 1 
ATOM   7981 C CD2 . HIS H 3 7   ? 38.344 30.876 30.809  1.00 135.01 ? 691  HIS H CD2 1 
ATOM   7982 C CE1 . HIS H 3 7   ? 38.187 30.273 32.913  1.00 134.26 ? 691  HIS H CE1 1 
ATOM   7983 N NE2 . HIS H 3 7   ? 39.033 30.669 31.979  1.00 134.98 ? 691  HIS H NE2 1 
ATOM   7984 N N   . ARG H 3 8   ? 33.682 31.189 28.197  1.00 133.83 ? 692  ARG H N   1 
ATOM   7985 C CA  . ARG H 3 8   ? 32.714 30.832 27.171  1.00 134.52 ? 692  ARG H CA  1 
ATOM   7986 C C   . ARG H 3 8   ? 32.954 31.538 25.835  1.00 134.86 ? 692  ARG H C   1 
ATOM   7987 O O   . ARG H 3 8   ? 33.275 30.897 24.830  1.00 135.17 ? 692  ARG H O   1 
ATOM   7988 C CB  . ARG H 3 8   ? 31.295 31.135 27.681  1.00 134.58 ? 692  ARG H CB  1 
ATOM   7989 C CG  . ARG H 3 8   ? 30.176 30.928 26.651  1.00 134.89 ? 692  ARG H CG  1 
ATOM   7990 C CD  . ARG H 3 8   ? 28.809 30.743 27.321  1.00 134.22 ? 692  ARG H CD  1 
ATOM   7991 N NE  . ARG H 3 8   ? 28.259 31.970 27.898  1.00 133.30 ? 692  ARG H NE  1 
ATOM   7992 C CZ  . ARG H 3 8   ? 27.203 32.004 28.707  1.00 132.64 ? 692  ARG H CZ  1 
ATOM   7993 N NH1 . ARG H 3 8   ? 26.587 30.878 29.041  1.00 132.25 ? 692  ARG H NH1 1 
ATOM   7994 N NH2 . ARG H 3 8   ? 26.749 33.162 29.172  1.00 131.83 ? 692  ARG H NH2 1 
ATOM   7995 N N   . LEU H 3 9   ? 32.816 32.859 25.825  1.00 134.97 ? 693  LEU H N   1 
ATOM   7996 C CA  . LEU H 3 9   ? 32.987 33.621 24.594  1.00 135.45 ? 693  LEU H CA  1 
ATOM   7997 C C   . LEU H 3 9   ? 34.406 33.680 24.036  1.00 135.82 ? 693  LEU H C   1 
ATOM   7998 O O   . LEU H 3 9   ? 34.601 33.909 22.843  1.00 135.36 ? 693  LEU H O   1 
ATOM   7999 C CB  . LEU H 3 9   ? 32.445 35.035 24.793  1.00 135.06 ? 693  LEU H CB  1 
ATOM   8000 C CG  . LEU H 3 9   ? 30.969 35.083 25.196  1.00 134.62 ? 693  LEU H CG  1 
ATOM   8001 C CD1 . LEU H 3 9   ? 30.483 36.523 25.180  1.00 134.25 ? 693  LEU H CD1 1 
ATOM   8002 C CD2 . LEU H 3 9   ? 30.145 34.233 24.234  1.00 134.35 ? 693  LEU H CD2 1 
ATOM   8003 N N   . LEU H 3 10  ? 35.401 33.469 24.885  1.00 136.36 ? 694  LEU H N   1 
ATOM   8004 C CA  . LEU H 3 10  ? 36.770 33.513 24.410  1.00 137.13 ? 694  LEU H CA  1 
ATOM   8005 C C   . LEU H 3 10  ? 37.301 32.130 24.073  1.00 138.23 ? 694  LEU H C   1 
ATOM   8006 O O   . LEU H 3 10  ? 38.301 31.674 24.628  1.00 138.04 ? 694  LEU H O   1 
ATOM   8007 C CB  . LEU H 3 10  ? 37.659 34.198 25.442  1.00 136.29 ? 694  LEU H CB  1 
ATOM   8008 C CG  . LEU H 3 10  ? 37.234 35.653 25.643  1.00 135.38 ? 694  LEU H CG  1 
ATOM   8009 C CD1 . LEU H 3 10  ? 38.288 36.403 26.441  1.00 135.29 ? 694  LEU H CD1 1 
ATOM   8010 C CD2 . LEU H 3 10  ? 37.038 36.305 24.282  1.00 134.91 ? 694  LEU H CD2 1 
ATOM   8011 N N   . GLN H 3 11  ? 36.612 31.467 23.153  1.00 139.90 ? 695  GLN H N   1 
ATOM   8012 C CA  . GLN H 3 11  ? 37.004 30.145 22.707  1.00 142.28 ? 695  GLN H CA  1 
ATOM   8013 C C   . GLN H 3 11  ? 36.719 29.988 21.221  1.00 143.94 ? 695  GLN H C   1 
ATOM   8014 O O   . GLN H 3 11  ? 37.646 29.898 20.412  1.00 144.42 ? 695  GLN H O   1 
ATOM   8015 C CB  . GLN H 3 11  ? 36.271 29.067 23.508  1.00 142.26 ? 695  GLN H CB  1 
ATOM   8016 C CG  . GLN H 3 11  ? 36.636 29.042 24.987  1.00 143.02 ? 695  GLN H CG  1 
ATOM   8017 C CD  . GLN H 3 11  ? 38.094 28.669 25.258  1.00 143.57 ? 695  GLN H CD  1 
ATOM   8018 O OE1 . GLN H 3 11  ? 38.558 28.753 26.396  1.00 144.03 ? 695  GLN H OE1 1 
ATOM   8019 N NE2 . GLN H 3 11  ? 38.816 28.249 24.221  1.00 143.17 ? 695  GLN H NE2 1 
ATOM   8020 N N   . GLU H 3 12  ? 35.441 29.960 20.854  1.00 145.51 ? 696  GLU H N   1 
ATOM   8021 C CA  . GLU H 3 12  ? 35.082 29.823 19.449  1.00 147.16 ? 696  GLU H CA  1 
ATOM   8022 C C   . GLU H 3 12  ? 34.960 31.197 18.797  1.00 147.93 ? 696  GLU H C   1 
ATOM   8023 O O   . GLU H 3 12  ? 35.834 31.533 17.962  1.00 148.50 ? 696  GLU H O   1 
ATOM   8024 C CB  . GLU H 3 12  ? 33.767 29.047 19.309  1.00 147.82 ? 696  GLU H CB  1 
ATOM   8025 C CG  . GLU H 3 12  ? 33.836 27.622 19.849  1.00 148.97 ? 696  GLU H CG  1 
ATOM   8026 C CD  . GLU H 3 12  ? 32.605 26.794 19.509  1.00 149.82 ? 696  GLU H CD  1 
ATOM   8027 O OE1 . GLU H 3 12  ? 32.372 26.526 18.309  1.00 149.93 ? 696  GLU H OE1 1 
ATOM   8028 O OE2 . GLU H 3 12  ? 31.868 26.408 20.445  1.00 150.18 ? 696  GLU H OE2 1 
HETATM 8029 C C1  . F15 I 4 .   ? 37.003 31.358 61.080  1.00 75.64  ? 1003 F15 A C1  1 
HETATM 8030 O O2  . F15 I 4 .   ? 36.505 31.037 62.165  1.00 75.39  ? 1003 F15 A O2  1 
HETATM 8031 O O3  . F15 I 4 .   ? 37.883 30.650 60.595  1.00 71.55  ? 1003 F15 A O3  1 
HETATM 8032 C C4  . F15 I 4 .   ? 36.474 32.615 60.249  1.00 76.84  ? 1003 F15 A C4  1 
HETATM 8033 C C5  . F15 I 4 .   ? 36.755 34.089 60.785  1.00 77.54  ? 1003 F15 A C5  1 
HETATM 8034 C C6  . F15 I 4 .   ? 36.640 36.549 60.945  1.00 78.13  ? 1003 F15 A C6  1 
HETATM 8035 C C7  . F15 I 4 .   ? 36.014 37.919 60.728  1.00 79.32  ? 1003 F15 A C7  1 
HETATM 8036 C C8  . F15 I 4 .   ? 36.114 35.364 60.117  1.00 77.41  ? 1003 F15 A C8  1 
HETATM 8037 C C9  . F15 I 4 .   ? 36.695 38.654 59.542  1.00 80.66  ? 1003 F15 A C9  1 
HETATM 8038 C C10 . F15 I 4 .   ? 37.236 40.085 59.807  1.00 81.47  ? 1003 F15 A C10 1 
HETATM 8039 C C11 . F15 I 4 .   ? 38.743 40.217 59.564  1.00 82.98  ? 1003 F15 A C11 1 
HETATM 8040 C C12 . F15 I 4 .   ? 39.315 41.005 58.327  1.00 83.17  ? 1003 F15 A C12 1 
HETATM 8041 C C13 . F15 I 4 .   ? 40.877 40.800 58.053  1.00 82.82  ? 1003 F15 A C13 1 
HETATM 8042 C C2  . F15 I 4 .   ? 41.965 41.321 59.070  1.00 82.60  ? 1003 F15 A C2  1 
HETATM 8043 C C3  . F15 I 4 .   ? 42.393 40.435 60.266  1.00 82.74  ? 1003 F15 A C3  1 
HETATM 8044 C C14 . F15 I 4 .   ? 42.965 39.103 59.817  1.00 82.37  ? 1003 F15 A C14 1 
HETATM 8045 C C15 . F15 I 4 .   ? 43.514 38.405 61.047  1.00 82.67  ? 1003 F15 A C15 1 
HETATM 8046 H H22 . F15 I 4 .   ? 35.406 32.497 60.150  1.00 77.03  ? 1003 F15 A H22 1 
HETATM 8047 H H23 . F15 I 4 .   ? 36.857 32.521 59.243  1.00 76.90  ? 1003 F15 A H23 1 
HETATM 8048 H H24 . F15 I 4 .   ? 37.822 34.244 60.800  1.00 77.47  ? 1003 F15 A H24 1 
HETATM 8049 H H25 . F15 I 4 .   ? 36.463 34.124 61.825  1.00 77.55  ? 1003 F15 A H25 1 
HETATM 8050 H H26 . F15 I 4 .   ? 36.496 36.321 61.990  1.00 78.07  ? 1003 F15 A H26 1 
HETATM 8051 H H1  . F15 I 4 .   ? 37.709 36.626 60.806  1.00 78.04  ? 1003 F15 A H1  1 
HETATM 8052 H H27 . F15 I 4 .   ? 36.162 38.493 61.634  1.00 79.20  ? 1003 F15 A H27 1 
HETATM 8053 H H2  . F15 I 4 .   ? 34.943 37.830 60.594  1.00 79.17  ? 1003 F15 A H2  1 
HETATM 8054 H H28 . F15 I 4 .   ? 35.036 35.352 60.160  1.00 77.44  ? 1003 F15 A H28 1 
HETATM 8055 H H29 . F15 I 4 .   ? 36.383 35.460 59.078  1.00 77.40  ? 1003 F15 A H29 1 
HETATM 8056 H H30 . F15 I 4 .   ? 35.979 38.729 58.738  1.00 80.65  ? 1003 F15 A H30 1 
HETATM 8057 H H31 . F15 I 4 .   ? 37.479 38.025 59.153  1.00 80.55  ? 1003 F15 A H31 1 
HETATM 8058 H H33 . F15 I 4 .   ? 36.717 40.803 59.207  1.00 81.60  ? 1003 F15 A H33 1 
HETATM 8059 H H5  . F15 I 4 .   ? 37.042 40.341 60.839  1.00 81.59  ? 1003 F15 A H5  1 
HETATM 8060 H H34 . F15 I 4 .   ? 39.138 39.211 59.528  1.00 83.05  ? 1003 F15 A H34 1 
HETATM 8061 H H6  . F15 I 4 .   ? 39.161 40.650 60.465  1.00 82.93  ? 1003 F15 A H6  1 
HETATM 8062 H H36 . F15 I 4 .   ? 39.121 42.057 58.449  1.00 83.24  ? 1003 F15 A H36 1 
HETATM 8063 H H37 . F15 I 4 .   ? 38.779 40.712 57.439  1.00 83.05  ? 1003 F15 A H37 1 
HETATM 8064 H H3  . F15 I 4 .   ? 41.098 41.322 57.136  1.00 82.82  ? 1003 F15 A H3  1 
HETATM 8065 H H4  . F15 I 4 .   ? 41.104 39.765 57.835  1.00 82.89  ? 1003 F15 A H4  1 
HETATM 8066 H H7  . F15 I 4 .   ? 41.704 42.298 59.453  1.00 82.71  ? 1003 F15 A H7  1 
HETATM 8067 H H8  . F15 I 4 .   ? 42.880 41.460 58.512  1.00 82.76  ? 1003 F15 A H8  1 
HETATM 8068 H H9  . F15 I 4 .   ? 41.570 40.277 60.954  1.00 82.61  ? 1003 F15 A H9  1 
HETATM 8069 H H10 . F15 I 4 .   ? 43.163 40.928 60.849  1.00 82.52  ? 1003 F15 A H10 1 
HETATM 8070 H H11 . F15 I 4 .   ? 43.738 39.278 59.090  1.00 82.49  ? 1003 F15 A H11 1 
HETATM 8071 H H12 . F15 I 4 .   ? 42.210 38.514 59.325  1.00 82.39  ? 1003 F15 A H12 1 
HETATM 8072 H H13 . F15 I 4 .   ? 42.750 38.241 61.789  1.00 82.64  ? 1003 F15 A H13 1 
HETATM 8073 H H14 . F15 I 4 .   ? 44.296 38.988 61.500  1.00 82.67  ? 1003 F15 A H14 1 
HETATM 8074 H H15 . F15 I 4 .   ? 43.917 37.452 60.743  1.00 82.81  ? 1003 F15 A H15 1 
HETATM 8075 C C1  . F15 J 4 .   ? 57.838 61.395 46.758  1.00 107.10 ? 1002 F15 C C1  1 
HETATM 8076 O O2  . F15 J 4 .   ? 58.872 60.758 46.966  1.00 105.81 ? 1002 F15 C O2  1 
HETATM 8077 O O3  . F15 J 4 .   ? 57.616 61.897 45.646  1.00 105.65 ? 1002 F15 C O3  1 
HETATM 8078 C C4  . F15 J 4 .   ? 56.836 61.529 47.971  1.00 107.63 ? 1002 F15 C C4  1 
HETATM 8079 C C5  . F15 J 4 .   ? 55.716 60.387 48.097  1.00 107.66 ? 1002 F15 C C5  1 
HETATM 8080 C C6  . F15 J 4 .   ? 53.152 59.629 47.718  1.00 105.17 ? 1002 F15 C C6  1 
HETATM 8081 C C7  . F15 J 4 .   ? 52.496 58.761 46.604  1.00 103.43 ? 1002 F15 C C7  1 
HETATM 8082 C C8  . F15 J 4 .   ? 54.337 60.578 47.356  1.00 106.74 ? 1002 F15 C C8  1 
HETATM 8083 C C9  . F15 J 4 .   ? 51.277 57.972 47.207  1.00 101.65 ? 1002 F15 C C9  1 
HETATM 8084 C C10 . F15 J 4 .   ? 50.869 56.625 46.568  1.00 100.01 ? 1002 F15 C C10 1 
HETATM 8085 C C11 . F15 J 4 .   ? 51.818 55.465 46.962  1.00 99.04  ? 1002 F15 C C11 1 
HETATM 8086 C C12 . F15 J 4 .   ? 51.280 54.197 47.677  1.00 98.00  ? 1002 F15 C C12 1 
HETATM 8087 C C13 . F15 J 4 .   ? 52.396 53.129 47.754  1.00 97.31  ? 1002 F15 C C13 1 
HETATM 8088 C C2  . F15 J 4 .   ? 52.661 52.406 46.402  1.00 96.94  ? 1002 F15 C C2  1 
HETATM 8089 C C3  . F15 J 4 .   ? 53.997 51.628 46.233  1.00 96.34  ? 1002 F15 C C3  1 
HETATM 8090 C C14 . F15 J 4 .   ? 55.067 52.462 45.504  1.00 95.74  ? 1002 F15 C C14 1 
HETATM 8091 C C15 . F15 J 4 .   ? 56.476 52.246 46.017  1.00 95.30  ? 1002 F15 C C15 1 
HETATM 8092 H H22 . F15 J 4 .   ? 56.408 62.520 47.974  1.00 107.47 ? 1002 F15 C H22 1 
HETATM 8093 H H23 . F15 J 4 .   ? 57.453 61.491 48.864  1.00 107.32 ? 1002 F15 C H23 1 
HETATM 8094 H H24 . F15 J 4 .   ? 55.490 60.277 49.146  1.00 107.41 ? 1002 F15 C H24 1 
HETATM 8095 H H25 . F15 J 4 .   ? 56.131 59.429 47.809  1.00 107.44 ? 1002 F15 C H25 1 
HETATM 8096 H H26 . F15 J 4 .   ? 53.429 59.009 48.558  1.00 105.17 ? 1002 F15 C H26 1 
HETATM 8097 H H1  . F15 J 4 .   ? 52.350 60.250 48.099  1.00 105.13 ? 1002 F15 C H1  1 
HETATM 8098 H H27 . F15 J 4 .   ? 53.235 58.087 46.202  1.00 103.32 ? 1002 F15 C H27 1 
HETATM 8099 H H2  . F15 J 4 .   ? 52.170 59.383 45.780  1.00 103.31 ? 1002 F15 C H2  1 
HETATM 8100 H H28 . F15 J 4 .   ? 54.473 60.592 46.286  1.00 106.62 ? 1002 F15 C H28 1 
HETATM 8101 H H29 . F15 J 4 .   ? 53.983 61.562 47.642  1.00 106.68 ? 1002 F15 C H29 1 
HETATM 8102 H H30 . F15 J 4 .   ? 50.414 58.624 47.191  1.00 101.65 ? 1002 F15 C H30 1 
HETATM 8103 H H31 . F15 J 4 .   ? 51.460 57.780 48.257  1.00 101.58 ? 1002 F15 C H31 1 
HETATM 8104 H H33 . F15 J 4 .   ? 49.859 56.392 46.868  1.00 100.00 ? 1002 F15 C H33 1 
HETATM 8105 H H5  . F15 J 4 .   ? 50.854 56.755 45.498  1.00 99.90  ? 1002 F15 C H5  1 
HETATM 8106 H H34 . F15 J 4 .   ? 52.602 55.862 47.585  1.00 99.02  ? 1002 F15 C H34 1 
HETATM 8107 H H6  . F15 J 4 .   ? 52.306 55.163 46.051  1.00 98.89  ? 1002 F15 C H6  1 
HETATM 8108 H H36 . F15 J 4 .   ? 50.421 53.789 47.166  1.00 97.89  ? 1002 F15 C H36 1 
HETATM 8109 H H37 . F15 J 4 .   ? 50.952 54.440 48.677  1.00 97.80  ? 1002 F15 C H37 1 
HETATM 8110 H H3  . F15 J 4 .   ? 52.104 52.390 48.483  1.00 97.36  ? 1002 F15 C H3  1 
HETATM 8111 H H4  . F15 J 4 .   ? 53.303 53.587 48.121  1.00 97.24  ? 1002 F15 C H4  1 
HETATM 8112 H H7  . F15 J 4 .   ? 52.618 53.136 45.613  1.00 97.00  ? 1002 F15 C H7  1 
HETATM 8113 H H8  . F15 J 4 .   ? 51.826 51.753 46.196  1.00 96.88  ? 1002 F15 C H8  1 
HETATM 8114 H H9  . F15 J 4 .   ? 53.831 50.727 45.652  1.00 96.13  ? 1002 F15 C H9  1 
HETATM 8115 H H10 . F15 J 4 .   ? 54.358 51.305 47.194  1.00 96.34  ? 1002 F15 C H10 1 
HETATM 8116 H H11 . F15 J 4 .   ? 54.847 53.509 45.621  1.00 95.68  ? 1002 F15 C H11 1 
HETATM 8117 H H12 . F15 J 4 .   ? 55.040 52.262 44.442  1.00 95.75  ? 1002 F15 C H12 1 
HETATM 8118 H H13 . F15 J 4 .   ? 57.192 52.794 45.422  1.00 95.26  ? 1002 F15 C H13 1 
HETATM 8119 H H14 . F15 J 4 .   ? 56.737 51.203 45.990  1.00 95.28  ? 1002 F15 C H14 1 
HETATM 8120 H H15 . F15 J 4 .   ? 56.559 52.596 47.033  1.00 95.14  ? 1002 F15 C H15 1 
HETATM 8121 C C1  A CI2 K 5 .   ? 33.387 63.746 74.776  0.50 84.23  ? 1001 CI2 D C1  1 
HETATM 8122 C C1  B CI2 K 5 .   ? 28.323 50.892 31.423  0.50 99.54  ? 1001 CI2 D C1  1 
HETATM 8123 C C2  A CI2 K 5 .   ? 32.114 62.938 74.612  0.50 84.54  ? 1001 CI2 D C2  1 
HETATM 8124 C C2  B CI2 K 5 .   ? 28.336 52.346 31.879  0.50 99.49  ? 1001 CI2 D C2  1 
HETATM 8125 O O3  A CI2 K 5 .   ? 32.124 61.753 74.503  0.50 83.75  ? 1001 CI2 D O3  1 
HETATM 8126 O O3  B CI2 K 5 .   ? 29.346 52.932 32.103  0.50 98.92  ? 1001 CI2 D O3  1 
HETATM 8127 C C4  A CI2 K 5 .   ? 30.831 63.730 74.542  0.50 85.77  ? 1001 CI2 D C4  1 
HETATM 8128 C C4  B CI2 K 5 .   ? 26.975 52.997 32.104  0.50 100.29 ? 1001 CI2 D C4  1 
HETATM 8129 C C5  A CI2 K 5 .   ? 29.586 63.039 73.871  0.50 86.38  ? 1001 CI2 D C5  1 
HETATM 8130 C C5  B CI2 K 5 .   ? 27.011 54.199 33.106  0.50 100.66 ? 1001 CI2 D C5  1 
HETATM 8131 C C6  A CI2 K 5 .   ? 28.346 63.741 74.460  0.50 86.38  ? 1001 CI2 D C6  1 
HETATM 8132 C C6  B CI2 K 5 .   ? 25.919 55.173 32.619  0.50 100.59 ? 1001 CI2 D C6  1 
HETATM 8133 C C7  A CI2 K 5 .   ? 28.995 64.775 75.403  0.50 86.83  ? 1001 CI2 D C7  1 
HETATM 8134 C C7  B CI2 K 5 .   ? 25.239 54.382 31.491  0.50 100.48 ? 1001 CI2 D C7  1 
HETATM 8135 C C8  A CI2 K 5 .   ? 28.146 65.474 76.479  0.50 87.38  ? 1001 CI2 D C8  1 
HETATM 8136 C C8  B CI2 K 5 .   ? 24.249 55.065 30.525  0.50 100.59 ? 1001 CI2 D C8  1 
HETATM 8137 C C9  A CI2 K 5 .   ? 26.914 66.109 75.800  0.50 86.99  ? 1001 CI2 D C9  1 
HETATM 8138 C C9  B CI2 K 5 .   ? 23.149 55.847 31.319  0.50 100.77 ? 1001 CI2 D C9  1 
HETATM 8139 C C10 A CI2 K 5 .   ? 26.115 66.923 76.834  0.50 86.78  ? 1001 CI2 D C10 1 
HETATM 8140 C C10 B CI2 K 5 .   ? 22.080 56.464 30.379  0.50 100.69 ? 1001 CI2 D C10 1 
HETATM 8141 C C11 A CI2 K 5 .   ? 26.913 67.970 77.606  0.50 86.27  ? 1001 CI2 D C11 1 
HETATM 8142 C C11 B CI2 K 5 .   ? 21.425 55.408 29.451  0.50 100.68 ? 1001 CI2 D C11 1 
HETATM 8143 C C12 A CI2 K 5 .   ? 27.218 69.095 76.607  0.50 86.23  ? 1001 CI2 D C12 1 
HETATM 8144 C C12 B CI2 K 5 .   ? 20.415 54.569 30.298  0.50 101.02 ? 1001 CI2 D C12 1 
HETATM 8145 C C13 A CI2 K 5 .   ? 28.221 70.121 77.124  0.50 85.77  ? 1001 CI2 D C13 1 
HETATM 8146 C C13 B CI2 K 5 .   ? 19.874 53.283 29.625  0.50 100.55 ? 1001 CI2 D C13 1 
HETATM 8147 O O14 A CI2 K 5 .   ? 28.233 71.218 76.667  0.50 85.66  ? 1001 CI2 D O14 1 
HETATM 8148 O O14 B CI2 K 5 .   ? 18.808 52.836 29.944  0.50 100.51 ? 1001 CI2 D O14 1 
HETATM 8149 C C15 A CI2 K 5 .   ? 29.309 69.685 78.078  0.50 85.80  ? 1001 CI2 D C15 1 
HETATM 8150 C C15 B CI2 K 5 .   ? 20.810 52.536 28.654  0.50 99.92  ? 1001 CI2 D C15 1 
HETATM 8151 C C16 A CI2 K 5 .   ? 28.958 68.518 78.999  0.50 86.57  ? 1001 CI2 D C16 1 
HETATM 8152 C C16 B CI2 K 5 .   ? 21.724 53.470 27.839  0.50 99.98  ? 1001 CI2 D C16 1 
HETATM 8153 C C17 A CI2 K 5 .   ? 28.156 67.380 78.308  0.50 86.80  ? 1001 CI2 D C17 1 
HETATM 8154 C C17 B CI2 K 5 .   ? 22.474 54.571 28.646  0.50 100.32 ? 1001 CI2 D C17 1 
HETATM 8155 C C18 A CI2 K 5 .   ? 27.677 66.470 79.447  0.50 87.02  ? 1001 CI2 D C18 1 
HETATM 8156 C C18 B CI2 K 5 .   ? 23.113 55.538 27.638  0.50 100.03 ? 1001 CI2 D C18 1 
HETATM 8157 C C19 A CI2 K 5 .   ? 29.003 66.562 77.255  0.50 87.52  ? 1001 CI2 D C19 1 
HETATM 8158 C C19 B CI2 K 5 .   ? 23.597 53.983 29.588  0.50 100.54 ? 1001 CI2 D C19 1 
HETATM 8159 C C20 A CI2 K 5 .   ? 30.392 66.013 77.757  0.50 87.26  ? 1001 CI2 D C20 1 
HETATM 8160 C C20 B CI2 K 5 .   ? 24.679 53.102 28.894  0.50 100.27 ? 1001 CI2 D C20 1 
HETATM 8161 C C21 A CI2 K 5 .   ? 31.175 65.236 76.630  0.50 86.67  ? 1001 CI2 D C21 1 
HETATM 8162 C C21 B CI2 K 5 .   ? 25.672 52.477 29.904  0.50 100.13 ? 1001 CI2 D C21 1 
HETATM 8163 C C22 A CI2 K 5 .   ? 30.324 64.178 75.899  0.50 85.91  ? 1001 CI2 D C22 1 
HETATM 8164 C C22 B CI2 K 5 .   ? 26.328 53.534 30.814  0.50 99.92  ? 1001 CI2 D C22 1 
HETATM 8165 C C23 A CI2 K 5 .   ? 30.199 62.994 76.839  0.50 85.84  ? 1001 CI2 D C23 1 
HETATM 8166 C C23 B CI2 K 5 .   ? 27.346 54.312 29.981  0.50 99.57  ? 1001 CI2 D C23 1 
HETATM 8167 H H24 A CI2 K 5 .   ? 34.220 63.138 74.463  0.50 84.41  ? 1001 CI2 D H24 1 
HETATM 8168 H H24 B CI2 K 5 .   ? 29.344 50.546 31.377  0.50 99.56  ? 1001 CI2 D H24 1 
HETATM 8169 H H25 A CI2 K 5 .   ? 33.527 64.018 75.813  0.50 84.34  ? 1001 CI2 D H25 1 
HETATM 8170 H H25 B CI2 K 5 .   ? 27.931 50.837 30.410  0.50 99.55  ? 1001 CI2 D H25 1 
HETATM 8171 H H26 A CI2 K 5 .   ? 33.346 64.633 74.174  0.50 84.22  ? 1001 CI2 D H26 1 
HETATM 8172 H H26 B CI2 K 5 .   ? 27.747 50.286 32.141  0.50 99.50  ? 1001 CI2 D H26 1 
HETATM 8173 H H27 A CI2 K 5 .   ? 31.078 64.617 73.977  0.50 85.75  ? 1001 CI2 D H27 1 
HETATM 8174 H H27 B CI2 K 5 .   ? 26.321 52.248 32.538  0.50 100.20 ? 1001 CI2 D H27 1 
HETATM 8175 H H28 A CI2 K 5 .   ? 29.533 61.993 74.129  0.50 86.31  ? 1001 CI2 D H28 1 
HETATM 8176 H H28 B CI2 K 5 .   ? 27.974 54.697 33.092  0.50 100.56 ? 1001 CI2 D H28 1 
HETATM 8177 H H29 A CI2 K 5 .   ? 29.609 63.114 72.794  0.50 86.31  ? 1001 CI2 D H29 1 
HETATM 8178 H H29 B CI2 K 5 .   ? 26.839 53.877 34.127  0.50 100.52 ? 1001 CI2 D H29 1 
HETATM 8179 H H30 A CI2 K 5 .   ? 27.713 64.213 73.722  0.50 86.41  ? 1001 CI2 D H30 1 
HETATM 8180 H H30 B CI2 K 5 .   ? 25.226 55.425 33.410  0.50 100.55 ? 1001 CI2 D H30 1 
HETATM 8181 H H31 A CI2 K 5 .   ? 27.728 63.058 75.013  0.50 86.43  ? 1001 CI2 D H31 1 
HETATM 8182 H H31 B CI2 K 5 .   ? 26.356 56.080 32.227  0.50 100.58 ? 1001 CI2 D H31 1 
HETATM 8183 H H32 A CI2 K 5 .   ? 29.276 65.595 74.756  0.50 86.71  ? 1001 CI2 D H32 1 
HETATM 8184 H H32 B CI2 K 5 .   ? 24.630 53.677 32.025  0.50 100.46 ? 1001 CI2 D H32 1 
HETATM 8185 H H33 A CI2 K 5 .   ? 27.814 64.742 77.197  0.50 87.36  ? 1001 CI2 D H33 1 
HETATM 8186 H H33 B CI2 K 5 .   ? 24.806 55.738 29.896  0.50 100.62 ? 1001 CI2 D H33 1 
HETATM 8187 H H34 A CI2 K 5 .   ? 26.288 65.346 75.358  0.50 86.79  ? 1001 CI2 D H34 1 
HETATM 8188 H H34 B CI2 K 5 .   ? 23.612 56.623 31.905  0.50 100.73 ? 1001 CI2 D H34 1 
HETATM 8189 H H35 A CI2 K 5 .   ? 27.230 66.728 74.976  0.50 86.88  ? 1001 CI2 D H35 1 
HETATM 8190 H H35 B CI2 K 5 .   ? 22.675 55.198 32.040  0.50 100.68 ? 1001 CI2 D H35 1 
HETATM 8191 H H36 A CI2 K 5 .   ? 25.718 66.232 77.563  0.50 86.84  ? 1001 CI2 D H36 1 
HETATM 8192 H H36 B CI2 K 5 .   ? 22.540 57.215 29.752  0.50 100.63 ? 1001 CI2 D H36 1 
HETATM 8193 H H37 A CI2 K 5 .   ? 25.285 67.410 76.343  0.50 86.92  ? 1001 CI2 D H37 1 
HETATM 8194 H H37 B CI2 K 5 .   ? 21.329 56.981 30.962  0.50 100.68 ? 1001 CI2 D H37 1 
HETATM 8195 H H38 A CI2 K 5 .   ? 26.286 68.364 78.383  0.50 86.40  ? 1001 CI2 D H38 1 
HETATM 8196 H H38 B CI2 K 5 .   ? 20.854 55.947 28.713  0.50 100.70 ? 1001 CI2 D H38 1 
HETATM 8197 H H39 A CI2 K 5 .   ? 27.639 68.683 75.708  0.50 86.16  ? 1001 CI2 D H39 1 
HETATM 8198 H H39 B CI2 K 5 .   ? 20.914 54.252 31.202  0.50 101.05 ? 1001 CI2 D H39 1 
HETATM 8199 H H40 A CI2 K 5 .   ? 26.310 69.595 76.308  0.50 86.16  ? 1001 CI2 D H40 1 
HETATM 8200 H H40 B CI2 K 5 .   ? 19.581 55.175 30.627  0.50 100.95 ? 1001 CI2 D H40 1 
HETATM 8201 H H41 A CI2 K 5 .   ? 29.634 70.539 78.644  0.50 85.99  ? 1001 CI2 D H41 1 
HETATM 8202 H H41 B CI2 K 5 .   ? 20.215 51.933 27.992  0.50 99.99  ? 1001 CI2 D H41 1 
HETATM 8203 H H42 A CI2 K 5 .   ? 30.086 69.383 77.416  0.50 86.08  ? 1001 CI2 D H42 1 
HETATM 8204 H H42 B CI2 K 5 .   ? 21.414 51.864 29.237  0.50 100.03 ? 1001 CI2 D H42 1 
HETATM 8205 H H43 A CI2 K 5 .   ? 29.858 68.135 79.466  0.50 86.52  ? 1001 CI2 D H43 1 
HETATM 8206 H H43 B CI2 K 5 .   ? 22.428 52.889 27.268  0.50 99.99  ? 1001 CI2 D H43 1 
HETATM 8207 H H44 A CI2 K 5 .   ? 28.348 68.911 79.798  0.50 86.69  ? 1001 CI2 D H44 1 
HETATM 8208 H H44 B CI2 K 5 .   ? 21.107 53.967 27.111  0.50 100.02 ? 1001 CI2 D H44 1 
HETATM 8209 H H45 A CI2 K 5 .   ? 27.016 67.016 80.107  0.50 86.98  ? 1001 CI2 D H45 1 
HETATM 8210 H H45 B CI2 K 5 .   ? 22.358 55.999 27.022  0.50 100.12 ? 1001 CI2 D H45 1 
HETATM 8211 H H46 A CI2 K 5 .   ? 28.519 66.098 80.023  0.50 87.00  ? 1001 CI2 D H46 1 
HETATM 8212 H H46 B CI2 K 5 .   ? 23.821 55.029 26.999  0.50 100.13 ? 1001 CI2 D H46 1 
HETATM 8213 H H47 A CI2 K 5 .   ? 27.132 65.613 79.076  0.50 86.90  ? 1001 CI2 D H47 1 
HETATM 8214 H H47 B CI2 K 5 .   ? 23.644 56.341 28.127  0.50 100.04 ? 1001 CI2 D H47 1 
HETATM 8215 H H48 A CI2 K 5 .   ? 29.270 67.278 76.489  0.50 87.55  ? 1001 CI2 D H48 1 
HETATM 8216 H H48 B CI2 K 5 .   ? 23.090 53.307 30.262  0.50 100.61 ? 1001 CI2 D H48 1 
HETATM 8217 H H49 A CI2 K 5 .   ? 31.004 66.837 78.117  0.50 87.20  ? 1001 CI2 D H49 1 
HETATM 8218 H H49 B CI2 K 5 .   ? 24.201 52.292 28.360  0.50 100.39 ? 1001 CI2 D H49 1 
HETATM 8219 H H50 A CI2 K 5 .   ? 30.240 65.380 78.620  0.50 87.27  ? 1001 CI2 D H50 1 
HETATM 8220 H H50 B CI2 K 5 .   ? 25.222 53.688 28.166  0.50 100.31 ? 1001 CI2 D H50 1 
HETATM 8221 H H51 A CI2 K 5 .   ? 31.562 65.950 75.921  0.50 86.82  ? 1001 CI2 D H51 1 
HETATM 8222 H H51 B CI2 K 5 .   ? 25.140 51.752 30.508  0.50 100.18 ? 1001 CI2 D H51 1 
HETATM 8223 H H52 A CI2 K 5 .   ? 32.044 64.762 77.061  0.50 86.72  ? 1001 CI2 D H52 1 
HETATM 8224 H H52 B CI2 K 5 .   ? 26.426 51.931 29.359  0.50 100.12 ? 1001 CI2 D H52 1 
HETATM 8225 H H53 A CI2 K 5 .   ? 29.756 63.291 77.772  0.50 85.87  ? 1001 CI2 D H53 1 
HETATM 8226 H H53 B CI2 K 5 .   ? 26.869 54.774 29.137  0.50 99.62  ? 1001 CI2 D H53 1 
HETATM 8227 H H54 A CI2 K 5 .   ? 31.182 62.604 77.051  0.50 85.93  ? 1001 CI2 D H54 1 
HETATM 8228 H H54 B CI2 K 5 .   ? 28.131 53.676 29.610  0.50 99.55  ? 1001 CI2 D H54 1 
HETATM 8229 H H55 A CI2 K 5 .   ? 29.590 62.214 76.419  0.50 85.90  ? 1001 CI2 D H55 1 
HETATM 8230 H H55 B CI2 K 5 .   ? 27.807 55.086 30.567  0.50 99.65  ? 1001 CI2 D H55 1 
HETATM 8231 O O   . HOH L 6 .   ? 49.761 31.542 66.830  1.00 57.78  ? 6    HOH A O   1 
HETATM 8232 O O   . HOH L 6 .   ? 33.325 36.137 51.246  1.00 64.16  ? 9    HOH A O   1 
HETATM 8233 O O   . HOH L 6 .   ? 50.989 45.145 56.725  1.00 39.13  ? 10   HOH A O   1 
HETATM 8234 O O   . HOH L 6 .   ? 46.360 45.670 59.781  1.00 61.15  ? 13   HOH A O   1 
HETATM 8235 O O   . HOH L 6 .   ? 53.129 32.527 73.350  1.00 49.97  ? 15   HOH A O   1 
HETATM 8236 O O   . HOH L 6 .   ? 48.273 47.108 58.860  1.00 38.33  ? 16   HOH A O   1 
HETATM 8237 O O   . HOH L 6 .   ? 45.177 32.663 89.814  1.00 44.87  ? 19   HOH A O   1 
HETATM 8238 O O   . HOH L 6 .   ? 53.587 39.779 67.037  1.00 39.73  ? 20   HOH A O   1 
HETATM 8239 O O   . HOH L 6 .   ? 27.356 43.878 61.897  1.00 42.47  ? 36   HOH A O   1 
HETATM 8240 O O   . HOH L 6 .   ? 18.738 27.104 73.563  1.00 65.43  ? 39   HOH A O   1 
HETATM 8241 O O   . HOH L 6 .   ? 43.333 25.005 70.103  1.00 42.71  ? 43   HOH A O   1 
HETATM 8242 O O   . HOH L 6 .   ? 28.265 40.184 77.190  1.00 49.09  ? 46   HOH A O   1 
HETATM 8243 O O   . HOH L 6 .   ? 38.494 46.037 39.661  1.00 57.82  ? 54   HOH A O   1 
HETATM 8244 O O   . HOH L 6 .   ? 54.507 28.285 58.051  1.00 30.66  ? 58   HOH A O   1 
HETATM 8245 O O   . HOH L 6 .   ? 56.476 31.963 55.081  1.00 52.38  ? 69   HOH A O   1 
HETATM 8246 O O   . HOH M 6 .   ? 26.734 47.125 72.558  1.00 30.85  ? 4    HOH B O   1 
HETATM 8247 O O   . HOH M 6 .   ? 42.605 44.748 71.958  1.00 21.01  ? 5    HOH B O   1 
HETATM 8248 O O   . HOH M 6 .   ? 20.886 77.611 65.567  1.00 37.28  ? 14   HOH B O   1 
HETATM 8249 O O   . HOH M 6 .   ? 40.419 58.123 74.082  1.00 41.12  ? 17   HOH B O   1 
HETATM 8250 O O   . HOH M 6 .   ? 30.463 73.394 86.851  1.00 43.20  ? 18   HOH B O   1 
HETATM 8251 O O   . HOH M 6 .   ? 20.611 61.289 64.080  1.00 40.28  ? 21   HOH B O   1 
HETATM 8252 O O   . HOH M 6 .   ? 22.813 45.282 108.240 1.00 65.21  ? 37   HOH B O   1 
HETATM 8253 O O   . HOH M 6 .   ? 22.642 71.513 89.185  1.00 35.34  ? 38   HOH B O   1 
HETATM 8254 O O   . HOH M 6 .   ? 18.050 66.725 91.208  1.00 64.84  ? 40   HOH B O   1 
HETATM 8255 O O   . HOH M 6 .   ? 40.747 49.231 79.081  1.00 60.38  ? 41   HOH B O   1 
HETATM 8256 O O   . HOH M 6 .   ? 23.917 79.447 65.725  1.00 34.31  ? 53   HOH B O   1 
HETATM 8257 O O   . HOH M 6 .   ? 29.357 73.544 58.666  1.00 46.98  ? 56   HOH B O   1 
HETATM 8258 O O   . HOH M 6 .   ? 35.921 76.578 72.127  1.00 30.89  ? 61   HOH B O   1 
HETATM 8259 O O   . HOH N 6 .   ? 46.671 47.497 51.622  1.00 41.59  ? 3    HOH C O   1 
HETATM 8260 O O   . HOH N 6 .   ? 45.702 67.218 31.606  1.00 24.73  ? 8    HOH C O   1 
HETATM 8261 O O   . HOH N 6 .   ? 60.422 59.034 19.451  1.00 39.97  ? 22   HOH C O   1 
HETATM 8262 O O   . HOH N 6 .   ? 63.816 44.259 37.578  1.00 40.26  ? 26   HOH C O   1 
HETATM 8263 O O   . HOH N 6 .   ? 49.589 46.986 45.473  1.00 32.43  ? 28   HOH C O   1 
HETATM 8264 O O   . HOH N 6 .   ? 60.705 76.130 24.066  1.00 47.92  ? 29   HOH C O   1 
HETATM 8265 O O   . HOH N 6 .   ? 45.381 67.596 37.917  1.00 43.95  ? 32   HOH C O   1 
HETATM 8266 O O   . HOH N 6 .   ? 63.884 50.612 39.186  1.00 35.00  ? 33   HOH C O   1 
HETATM 8267 O O   . HOH N 6 .   ? 67.020 64.037 40.747  1.00 49.36  ? 35   HOH C O   1 
HETATM 8268 O O   . HOH N 6 .   ? 47.829 60.011 63.167  1.00 52.97  ? 44   HOH C O   1 
HETATM 8269 O O   . HOH N 6 .   ? 40.314 64.653 55.924  1.00 42.29  ? 47   HOH C O   1 
HETATM 8270 O O   . HOH N 6 .   ? 57.338 64.997 45.487  1.00 68.25  ? 55   HOH C O   1 
HETATM 8271 O O   . HOH N 6 .   ? 43.184 52.164 66.653  1.00 76.94  ? 62   HOH C O   1 
HETATM 8272 O O   . HOH N 6 .   ? 56.338 42.770 38.552  1.00 55.79  ? 66   HOH C O   1 
HETATM 8273 O O   . HOH N 6 .   ? 67.178 52.971 61.451  1.00 86.30  ? 68   HOH C O   1 
HETATM 8274 O O   . HOH O 6 .   ? 5.864  64.470 37.508  1.00 31.55  ? 1    HOH D O   1 
HETATM 8275 O O   . HOH O 6 .   ? 4.676  65.142 23.128  1.00 72.49  ? 2    HOH D O   1 
HETATM 8276 O O   . HOH O 6 .   ? 50.030 42.573 34.718  1.00 58.60  ? 7    HOH D O   1 
HETATM 8277 O O   . HOH O 6 .   ? 42.418 47.251 28.163  1.00 68.95  ? 12   HOH D O   1 
HETATM 8278 O O   . HOH O 6 .   ? 23.427 61.712 44.205  1.00 46.63  ? 24   HOH D O   1 
HETATM 8279 O O   . HOH O 6 .   ? 39.863 50.943 33.967  1.00 17.20  ? 27   HOH D O   1 
HETATM 8280 O O   . HOH O 6 .   ? 18.430 66.488 18.214  1.00 52.89  ? 30   HOH D O   1 
HETATM 8281 O O   . HOH O 6 .   ? 28.861 57.081 48.472  1.00 62.36  ? 31   HOH D O   1 
HETATM 8282 O O   . HOH O 6 .   ? 11.459 68.192 22.729  1.00 69.06  ? 34   HOH D O   1 
HETATM 8283 O O   . HOH O 6 .   ? 10.295 50.699 40.871  1.00 23.10  ? 42   HOH D O   1 
HETATM 8284 O O   . HOH O 6 .   ? 22.814 67.536 16.564  1.00 45.84  ? 45   HOH D O   1 
HETATM 8285 O O   . HOH O 6 .   ? 42.264 43.905 33.644  1.00 71.32  ? 49   HOH D O   1 
HETATM 8286 O O   . HOH O 6 .   ? 39.832 64.589 36.344  1.00 48.13  ? 50   HOH D O   1 
HETATM 8287 O O   . HOH O 6 .   ? 27.856 62.622 47.435  1.00 50.49  ? 52   HOH D O   1 
HETATM 8288 O O   . HOH O 6 .   ? 16.011 50.266 48.678  1.00 72.33  ? 59   HOH D O   1 
HETATM 8289 O O   . HOH O 6 .   ? 43.886 49.082 34.169  1.00 31.83  ? 60   HOH D O   1 
HETATM 8290 O O   . HOH O 6 .   ? 7.908  62.590 20.223  1.00 42.06  ? 64   HOH D O   1 
HETATM 8291 O O   . HOH O 6 .   ? 20.714 65.962 29.517  1.00 31.88  ? 65   HOH D O   1 
HETATM 8292 O O   . HOH O 6 .   ? 32.234 63.957 13.980  1.00 68.59  ? 67   HOH D O   1 
HETATM 8293 O O   . HOH O 6 .   ? 26.217 70.701 36.862  1.00 75.03  ? 70   HOH D O   1 
HETATM 8294 O O   . HOH O 6 .   ? 24.099 67.643 30.859  1.00 35.61  ? 71   HOH D O   1 
HETATM 8295 O O   . HOH P 6 .   ? 21.561 40.529 59.999  1.00 67.80  ? 25   HOH E O   1 
HETATM 8296 O O   . HOH Q 6 .   ? 33.778 34.731 38.073  1.00 55.71  ? 48   HOH H O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   227 227 ASN ASN A . n 
A 1 2   GLU 2   228 228 GLU GLU A . n 
A 1 3   ASP 3   229 229 ASP ASP A . n 
A 1 4   MET 4   230 230 MET MET A . n 
A 1 5   PRO 5   231 231 PRO PRO A . n 
A 1 6   VAL 6   232 232 VAL VAL A . n 
A 1 7   GLU 7   233 233 GLU GLU A . n 
A 1 8   ARG 8   234 234 ARG ARG A . n 
A 1 9   ILE 9   235 235 ILE ILE A . n 
A 1 10  LEU 10  236 236 LEU LEU A . n 
A 1 11  GLU 11  237 237 GLU GLU A . n 
A 1 12  ALA 12  238 238 ALA ALA A . n 
A 1 13  GLU 13  239 239 GLU GLU A . n 
A 1 14  LEU 14  240 240 LEU LEU A . n 
A 1 15  ALA 15  241 241 ALA ALA A . n 
A 1 16  VAL 16  242 242 VAL VAL A . n 
A 1 17  GLU 17  243 243 GLU GLU A . n 
A 1 18  PRO 18  244 244 PRO PRO A . n 
A 1 19  LYS 19  245 245 LYS LYS A . n 
A 1 20  THR 20  246 246 THR THR A . n 
A 1 21  GLU 21  247 247 GLU GLU A . n 
A 1 22  THR 22  248 248 THR THR A . n 
A 1 23  TYR 23  249 249 TYR TYR A . n 
A 1 24  VAL 24  250 250 VAL VAL A . n 
A 1 25  GLU 25  251 251 GLU GLU A . n 
A 1 26  ALA 26  252 252 ALA ALA A . n 
A 1 27  ASN 27  253 253 ASN ASN A . n 
A 1 28  MET 28  254 254 MET MET A . n 
A 1 29  GLY 29  255 255 GLY GLY A . n 
A 1 30  LEU 30  256 256 LEU LEU A . n 
A 1 31  ASN 31  257 257 ASN ASN A . n 
A 1 32  PRO 32  258 258 PRO PRO A . n 
A 1 33  SER 33  259 259 SER SER A . n 
A 1 34  SER 34  260 260 SER SER A . n 
A 1 35  PRO 35  261 261 PRO PRO A . n 
A 1 36  ASN 36  262 262 ASN ASN A . n 
A 1 37  ASP 37  263 263 ASP ASP A . n 
A 1 38  PRO 38  264 264 PRO PRO A . n 
A 1 39  VAL 39  265 265 VAL VAL A . n 
A 1 40  THR 40  266 266 THR THR A . n 
A 1 41  ASN 41  267 267 ASN ASN A . n 
A 1 42  ILE 42  268 268 ILE ILE A . n 
A 1 43  CYS 43  269 269 CYS CYS A . n 
A 1 44  GLN 44  270 270 GLN GLN A . n 
A 1 45  ALA 45  271 271 ALA ALA A . n 
A 1 46  ALA 46  272 272 ALA ALA A . n 
A 1 47  ASP 47  273 273 ASP ASP A . n 
A 1 48  LYS 48  274 274 LYS LYS A . n 
A 1 49  GLN 49  275 275 GLN GLN A . n 
A 1 50  LEU 50  276 276 LEU LEU A . n 
A 1 51  PHE 51  277 277 PHE PHE A . n 
A 1 52  THR 52  278 278 THR THR A . n 
A 1 53  LEU 53  279 279 LEU LEU A . n 
A 1 54  VAL 54  280 280 VAL VAL A . n 
A 1 55  GLU 55  281 281 GLU GLU A . n 
A 1 56  TRP 56  282 282 TRP TRP A . n 
A 1 57  ALA 57  283 283 ALA ALA A . n 
A 1 58  LYS 58  284 284 LYS LYS A . n 
A 1 59  ARG 59  285 285 ARG ARG A . n 
A 1 60  ILE 60  286 286 ILE ILE A . n 
A 1 61  PRO 61  287 287 PRO PRO A . n 
A 1 62  HIS 62  288 288 HIS HIS A . n 
A 1 63  PHE 63  289 289 PHE PHE A . n 
A 1 64  SER 64  290 290 SER SER A . n 
A 1 65  GLU 65  291 291 GLU GLU A . n 
A 1 66  LEU 66  292 292 LEU LEU A . n 
A 1 67  PRO 67  293 293 PRO PRO A . n 
A 1 68  LEU 68  294 294 LEU LEU A . n 
A 1 69  ASP 69  295 295 ASP ASP A . n 
A 1 70  ASP 70  296 296 ASP ASP A . n 
A 1 71  GLN 71  297 297 GLN GLN A . n 
A 1 72  VAL 72  298 298 VAL VAL A . n 
A 1 73  ILE 73  299 299 ILE ILE A . n 
A 1 74  LEU 74  300 300 LEU LEU A . n 
A 1 75  LEU 75  301 301 LEU LEU A . n 
A 1 76  ARG 76  302 302 ARG ARG A . n 
A 1 77  ALA 77  303 303 ALA ALA A . n 
A 1 78  GLY 78  304 304 GLY GLY A . n 
A 1 79  TRP 79  305 305 TRP TRP A . n 
A 1 80  ASN 80  306 306 ASN ASN A . n 
A 1 81  GLU 81  307 307 GLU GLU A . n 
A 1 82  LEU 82  308 308 LEU LEU A . n 
A 1 83  LEU 83  309 309 LEU LEU A . n 
A 1 84  ILE 84  310 310 ILE ILE A . n 
A 1 85  ALA 85  311 311 ALA ALA A . n 
A 1 86  SER 86  312 312 SER SER A . n 
A 1 87  PHE 87  313 313 PHE PHE A . n 
A 1 88  SER 88  314 314 SER SER A . n 
A 1 89  HIS 89  315 315 HIS HIS A . n 
A 1 90  ARG 90  316 316 ARG ARG A . n 
A 1 91  SER 91  317 317 SER SER A . n 
A 1 92  ILE 92  318 318 ILE ILE A . n 
A 1 93  ALA 93  319 319 ALA ALA A . n 
A 1 94  VAL 94  320 320 VAL VAL A . n 
A 1 95  LYS 95  321 321 LYS LYS A . n 
A 1 96  ASP 96  322 322 ASP ASP A . n 
A 1 97  GLY 97  323 323 GLY GLY A . n 
A 1 98  ILE 98  324 324 ILE ILE A . n 
A 1 99  LEU 99  325 325 LEU LEU A . n 
A 1 100 LEU 100 326 326 LEU LEU A . n 
A 1 101 ALA 101 327 327 ALA ALA A . n 
A 1 102 THR 102 328 328 THR THR A . n 
A 1 103 GLY 103 329 329 GLY GLY A . n 
A 1 104 LEU 104 330 330 LEU LEU A . n 
A 1 105 HIS 105 331 331 HIS HIS A . n 
A 1 106 VAL 106 332 332 VAL VAL A . n 
A 1 107 HIS 107 333 333 HIS HIS A . n 
A 1 108 ARG 108 334 334 ARG ARG A . n 
A 1 109 ASN 109 335 335 ASN ASN A . n 
A 1 110 SER 110 336 336 SER SER A . n 
A 1 111 ALA 111 337 337 ALA ALA A . n 
A 1 112 HIS 112 338 338 HIS HIS A . n 
A 1 113 SER 113 339 339 SER SER A . n 
A 1 114 ALA 114 340 340 ALA ALA A . n 
A 1 115 GLY 115 341 341 GLY GLY A . n 
A 1 116 VAL 116 342 342 VAL VAL A . n 
A 1 117 GLY 117 343 343 GLY GLY A . n 
A 1 118 ALA 118 344 344 ALA ALA A . n 
A 1 119 ILE 119 345 345 ILE ILE A . n 
A 1 120 PHE 120 346 346 PHE PHE A . n 
A 1 121 ASP 121 347 347 ASP ASP A . n 
A 1 122 ARG 122 348 348 ARG ARG A . n 
A 1 123 VAL 123 349 349 VAL VAL A . n 
A 1 124 LEU 124 350 350 LEU LEU A . n 
A 1 125 THR 125 351 351 THR THR A . n 
A 1 126 GLU 126 352 352 GLU GLU A . n 
A 1 127 LEU 127 353 353 LEU LEU A . n 
A 1 128 VAL 128 354 354 VAL VAL A . n 
A 1 129 SER 129 355 355 SER SER A . n 
A 1 130 LYS 130 356 356 LYS LYS A . n 
A 1 131 MET 131 357 357 MET MET A . n 
A 1 132 ARG 132 358 358 ARG ARG A . n 
A 1 133 ASP 133 359 359 ASP ASP A . n 
A 1 134 MET 134 360 360 MET MET A . n 
A 1 135 GLN 135 361 361 GLN GLN A . n 
A 1 136 MET 136 362 362 MET MET A . n 
A 1 137 ASP 137 363 363 ASP ASP A . n 
A 1 138 LYS 138 364 364 LYS LYS A . n 
A 1 139 THR 139 365 365 THR THR A . n 
A 1 140 GLU 140 366 366 GLU GLU A . n 
A 1 141 LEU 141 367 367 LEU LEU A . n 
A 1 142 GLY 142 368 368 GLY GLY A . n 
A 1 143 CYS 143 369 369 CYS CYS A . n 
A 1 144 LEU 144 370 370 LEU LEU A . n 
A 1 145 ARG 145 371 371 ARG ARG A . n 
A 1 146 ALA 146 372 372 ALA ALA A . n 
A 1 147 ILE 147 373 373 ILE ILE A . n 
A 1 148 VAL 148 374 374 VAL VAL A . n 
A 1 149 LEU 149 375 375 LEU LEU A . n 
A 1 150 PHE 150 376 376 PHE PHE A . n 
A 1 151 ASN 151 377 377 ASN ASN A . n 
A 1 152 PRO 152 378 378 PRO PRO A . n 
A 1 153 ASP 153 379 379 ASP ASP A . n 
A 1 154 SER 154 380 380 SER SER A . n 
A 1 155 LYS 155 381 381 LYS LYS A . n 
A 1 156 GLY 156 382 382 GLY GLY A . n 
A 1 157 LEU 157 383 383 LEU LEU A . n 
A 1 158 SER 158 384 384 SER SER A . n 
A 1 159 ASN 159 385 385 ASN ASN A . n 
A 1 160 PRO 160 386 386 PRO PRO A . n 
A 1 161 ALA 161 387 387 ALA ALA A . n 
A 1 162 GLU 162 388 388 GLU GLU A . n 
A 1 163 VAL 163 389 389 VAL VAL A . n 
A 1 164 GLU 164 390 390 GLU GLU A . n 
A 1 165 ALA 165 391 391 ALA ALA A . n 
A 1 166 LEU 166 392 392 LEU LEU A . n 
A 1 167 ARG 167 393 393 ARG ARG A . n 
A 1 168 GLU 168 394 394 GLU GLU A . n 
A 1 169 LYS 169 395 395 LYS LYS A . n 
A 1 170 VAL 170 396 396 VAL VAL A . n 
A 1 171 TYR 171 397 397 TYR TYR A . n 
A 1 172 ALA 172 398 398 ALA ALA A . n 
A 1 173 SER 173 399 399 SER SER A . n 
A 1 174 LEU 174 400 400 LEU LEU A . n 
A 1 175 GLU 175 401 401 GLU GLU A . n 
A 1 176 ALA 176 402 402 ALA ALA A . n 
A 1 177 TYR 177 403 403 TYR TYR A . n 
A 1 178 CYS 178 404 404 CYS CYS A . n 
A 1 179 LYS 179 405 405 LYS LYS A . n 
A 1 180 HIS 180 406 406 HIS HIS A . n 
A 1 181 LYS 181 407 407 LYS LYS A . n 
A 1 182 TYR 182 408 408 TYR TYR A . n 
A 1 183 PRO 183 409 409 PRO PRO A . n 
A 1 184 GLU 184 410 410 GLU GLU A . n 
A 1 185 GLN 185 411 411 GLN GLN A . n 
A 1 186 PRO 186 412 412 PRO PRO A . n 
A 1 187 GLY 187 413 413 GLY GLY A . n 
A 1 188 ARG 188 414 414 ARG ARG A . n 
A 1 189 PHE 189 415 415 PHE PHE A . n 
A 1 190 ALA 190 416 416 ALA ALA A . n 
A 1 191 LYS 191 417 417 LYS LYS A . n 
A 1 192 LEU 192 418 418 LEU LEU A . n 
A 1 193 LEU 193 419 419 LEU LEU A . n 
A 1 194 LEU 194 420 420 LEU LEU A . n 
A 1 195 ARG 195 421 421 ARG ARG A . n 
A 1 196 LEU 196 422 422 LEU LEU A . n 
A 1 197 PRO 197 423 423 PRO PRO A . n 
A 1 198 ALA 198 424 424 ALA ALA A . n 
A 1 199 LEU 199 425 425 LEU LEU A . n 
A 1 200 ARG 200 426 426 ARG ARG A . n 
A 1 201 SER 201 427 427 SER SER A . n 
A 1 202 ILE 202 428 428 ILE ILE A . n 
A 1 203 GLY 203 429 429 GLY GLY A . n 
A 1 204 LEU 204 430 430 LEU LEU A . n 
A 1 205 LYS 205 431 431 LYS LYS A . n 
A 1 206 CYS 206 432 432 CYS CYS A . n 
A 1 207 LEU 207 433 433 LEU LEU A . n 
A 1 208 GLU 208 434 434 GLU GLU A . n 
A 1 209 HIS 209 435 435 HIS HIS A . n 
A 1 210 LEU 210 436 436 LEU LEU A . n 
A 1 211 PHE 211 437 437 PHE PHE A . n 
A 1 212 PHE 212 438 438 PHE PHE A . n 
A 1 213 PHE 213 439 439 PHE PHE A . n 
A 1 214 LYS 214 440 440 LYS LYS A . n 
A 1 215 LEU 215 441 441 LEU LEU A . n 
A 1 216 ILE 216 442 442 ILE ILE A . n 
A 1 217 GLY 217 443 443 GLY GLY A . n 
A 1 218 ASP 218 444 444 ASP ASP A . n 
A 1 219 THR 219 445 445 THR THR A . n 
A 1 220 PRO 220 446 446 PRO PRO A . n 
A 1 221 ILE 221 447 447 ILE ILE A . n 
A 1 222 ASP 222 448 448 ASP ASP A . n 
A 1 223 THR 223 449 449 THR THR A . n 
A 1 224 PHE 224 450 450 PHE PHE A . n 
A 1 225 LEU 225 451 451 LEU LEU A . n 
A 1 226 MET 226 452 452 MET MET A . n 
A 1 227 GLU 227 453 453 GLU GLU A . n 
A 1 228 MET 228 454 454 MET MET A . n 
A 1 229 LEU 229 455 455 LEU LEU A . n 
A 1 230 GLU 230 456 456 GLU GLU A . n 
A 1 231 ALA 231 457 457 ALA ALA A . n 
A 1 232 PRO 232 458 458 PRO PRO A . n 
A 1 233 HIS 233 459 ?   ?   ?   A . n 
A 1 234 GLN 234 460 ?   ?   ?   A . n 
A 1 235 MET 235 461 ?   ?   ?   A . n 
A 1 236 THR 236 462 ?   ?   ?   A . n 
B 2 1   PRO 1   103 103 PRO PRO B . n 
B 2 2   VAL 2   104 104 VAL VAL B . n 
B 2 3   GLN 3   105 105 GLN GLN B . n 
B 2 4   LEU 4   106 106 LEU LEU B . n 
B 2 5   SER 5   107 107 SER SER B . n 
B 2 6   LYS 6   108 108 LYS LYS B . n 
B 2 7   GLU 7   109 109 GLU GLU B . n 
B 2 8   GLN 8   110 110 GLN GLN B . n 
B 2 9   GLU 9   111 111 GLU GLU B . n 
B 2 10  GLU 10  112 112 GLU GLU B . n 
B 2 11  LEU 11  113 113 LEU LEU B . n 
B 2 12  ILE 12  114 114 ILE ILE B . n 
B 2 13  ARG 13  115 115 ARG ARG B . n 
B 2 14  THR 14  116 116 THR THR B . n 
B 2 15  LEU 15  117 117 LEU LEU B . n 
B 2 16  LEU 16  118 118 LEU LEU B . n 
B 2 17  GLY 17  119 119 GLY GLY B . n 
B 2 18  ALA 18  120 120 ALA ALA B . n 
B 2 19  HIS 19  121 121 HIS HIS B . n 
B 2 20  THR 20  122 122 THR THR B . n 
B 2 21  ARG 21  123 123 ARG ARG B . n 
B 2 22  HIS 22  124 124 HIS HIS B . n 
B 2 23  MET 23  125 125 MET MET B . n 
B 2 24  GLY 24  126 126 GLY GLY B . n 
B 2 25  THR 25  127 127 THR THR B . n 
B 2 26  MET 26  128 128 MET MET B . n 
B 2 27  PHE 27  129 129 PHE PHE B . n 
B 2 28  GLU 28  130 130 GLU GLU B . n 
B 2 29  GLN 29  131 131 GLN GLN B . n 
B 2 30  PHE 30  132 132 PHE PHE B . n 
B 2 31  VAL 31  133 133 VAL VAL B . n 
B 2 32  GLN 32  134 134 GLN GLN B . n 
B 2 33  PHE 33  135 135 PHE PHE B . n 
B 2 34  ARG 34  136 136 ARG ARG B . n 
B 2 35  PRO 35  137 137 PRO PRO B . n 
B 2 36  PRO 36  138 138 PRO PRO B . n 
B 2 37  ALA 37  139 139 ALA ALA B . n 
B 2 38  HIS 38  140 140 HIS HIS B . n 
B 2 39  LEU 39  141 141 LEU LEU B . n 
B 2 40  PHE 40  142 142 PHE PHE B . n 
B 2 41  ILE 41  143 143 ILE ILE B . n 
B 2 42  HIS 42  144 144 HIS HIS B . n 
B 2 43  HIS 43  145 145 HIS HIS B . n 
B 2 44  GLN 44  146 146 GLN GLN B . n 
B 2 45  PRO 45  147 147 PRO PRO B . n 
B 2 46  LEU 46  148 148 LEU LEU B . n 
B 2 47  PRO 47  149 149 PRO PRO B . n 
B 2 48  THR 48  150 150 THR THR B . n 
B 2 49  LEU 49  151 151 LEU LEU B . n 
B 2 50  ALA 50  152 152 ALA ALA B . n 
B 2 51  PRO 51  153 153 PRO PRO B . n 
B 2 52  VAL 52  154 154 VAL VAL B . n 
B 2 53  LEU 53  155 155 LEU LEU B . n 
B 2 54  PRO 54  156 156 PRO PRO B . n 
B 2 55  LEU 55  157 157 LEU LEU B . n 
B 2 56  VAL 56  158 158 VAL VAL B . n 
B 2 57  THR 57  159 159 THR THR B . n 
B 2 58  HIS 58  160 160 HIS HIS B . n 
B 2 59  PHE 59  161 161 PHE PHE B . n 
B 2 60  ALA 60  162 162 ALA ALA B . n 
B 2 61  ASP 61  163 163 ASP ASP B . n 
B 2 62  ILE 62  164 164 ILE ILE B . n 
B 2 63  ASN 63  165 165 ASN ASN B . n 
B 2 64  THR 64  166 166 THR THR B . n 
B 2 65  PHE 65  167 167 PHE PHE B . n 
B 2 66  MET 66  168 168 MET MET B . n 
B 2 67  VAL 67  169 169 VAL VAL B . n 
B 2 68  LEU 68  170 170 LEU LEU B . n 
B 2 69  GLN 69  171 171 GLN GLN B . n 
B 2 70  VAL 70  172 172 VAL VAL B . n 
B 2 71  ILE 71  173 173 ILE ILE B . n 
B 2 72  LYS 72  174 174 LYS LYS B . n 
B 2 73  PHE 73  175 175 PHE PHE B . n 
B 2 74  THR 74  176 176 THR THR B . n 
B 2 75  LYS 75  177 177 LYS LYS B . n 
B 2 76  ASP 76  178 178 ASP ASP B . n 
B 2 77  LEU 77  179 179 LEU LEU B . n 
B 2 78  PRO 78  180 180 PRO PRO B . n 
B 2 79  VAL 79  181 181 VAL VAL B . n 
B 2 80  PHE 80  182 182 PHE PHE B . n 
B 2 81  ARG 81  183 183 ARG ARG B . n 
B 2 82  SER 82  184 184 SER SER B . n 
B 2 83  LEU 83  185 185 LEU LEU B . n 
B 2 84  PRO 84  186 186 PRO PRO B . n 
B 2 85  ILE 85  187 187 ILE ILE B . n 
B 2 86  GLU 86  188 188 GLU GLU B . n 
B 2 87  ASP 87  189 189 ASP ASP B . n 
B 2 88  GLN 88  190 190 GLN GLN B . n 
B 2 89  ILE 89  191 191 ILE ILE B . n 
B 2 90  SER 90  192 192 SER SER B . n 
B 2 91  LEU 91  193 193 LEU LEU B . n 
B 2 92  LEU 92  194 194 LEU LEU B . n 
B 2 93  LYS 93  195 195 LYS LYS B . n 
B 2 94  GLY 94  196 196 GLY GLY B . n 
B 2 95  ALA 95  197 197 ALA ALA B . n 
B 2 96  ALA 96  198 198 ALA ALA B . n 
B 2 97  VAL 97  199 199 VAL VAL B . n 
B 2 98  GLU 98  200 200 GLU GLU B . n 
B 2 99  ILE 99  201 201 ILE ILE B . n 
B 2 100 CYS 100 202 202 CYS CYS B . n 
B 2 101 HIS 101 203 203 HIS HIS B . n 
B 2 102 ILE 102 204 204 ILE ILE B . n 
B 2 103 VAL 103 205 205 VAL VAL B . n 
B 2 104 LEU 104 206 206 LEU LEU B . n 
B 2 105 ASN 105 207 207 ASN ASN B . n 
B 2 106 THR 106 208 208 THR THR B . n 
B 2 107 THR 107 209 209 THR THR B . n 
B 2 108 PHE 108 210 210 PHE PHE B . n 
B 2 109 CYS 109 211 211 CYS CYS B . n 
B 2 110 LEU 110 212 212 LEU LEU B . n 
B 2 111 GLN 111 213 213 GLN GLN B . n 
B 2 112 THR 112 214 214 THR THR B . n 
B 2 113 GLN 113 215 215 GLN GLN B . n 
B 2 114 ASN 114 216 216 ASN ASN B . n 
B 2 115 PHE 115 217 217 PHE PHE B . n 
B 2 116 LEU 116 218 218 LEU LEU B . n 
B 2 117 CYS 117 219 219 CYS CYS B . n 
B 2 118 GLY 118 220 220 GLY GLY B . n 
B 2 119 PRO 119 221 221 PRO PRO B . n 
B 2 120 LEU 120 222 222 LEU LEU B . n 
B 2 121 ARG 121 223 223 ARG ARG B . n 
B 2 122 TYR 122 224 224 TYR TYR B . n 
B 2 123 THR 123 225 225 THR THR B . n 
B 2 124 ILE 124 226 226 ILE ILE B . n 
B 2 125 GLU 125 227 227 GLU GLU B . n 
B 2 126 ASP 126 228 228 ASP ASP B . n 
B 2 127 GLY 127 229 229 GLY GLY B . n 
B 2 128 ALA 128 230 230 ALA ALA B . n 
B 2 129 ARG 129 231 231 ARG ARG B . n 
B 2 130 VAL 130 232 232 VAL VAL B . n 
B 2 131 GLY 131 233 233 GLY GLY B . n 
B 2 132 PHE 132 234 234 PHE PHE B . n 
B 2 133 GLN 133 235 235 GLN GLN B . n 
B 2 134 VAL 134 236 236 VAL VAL B . n 
B 2 135 GLU 135 237 237 GLU GLU B . n 
B 2 136 PHE 136 238 238 PHE PHE B . n 
B 2 137 LEU 137 239 239 LEU LEU B . n 
B 2 138 GLU 138 240 240 GLU GLU B . n 
B 2 139 LEU 139 241 241 LEU LEU B . n 
B 2 140 LEU 140 242 242 LEU LEU B . n 
B 2 141 PHE 141 243 243 PHE PHE B . n 
B 2 142 HIS 142 244 244 HIS HIS B . n 
B 2 143 PHE 143 245 245 PHE PHE B . n 
B 2 144 HIS 144 246 246 HIS HIS B . n 
B 2 145 GLY 145 247 247 GLY GLY B . n 
B 2 146 THR 146 248 248 THR THR B . n 
B 2 147 LEU 147 249 249 LEU LEU B . n 
B 2 148 ARG 148 250 250 ARG ARG B . n 
B 2 149 LYS 149 251 251 LYS LYS B . n 
B 2 150 LEU 150 252 252 LEU LEU B . n 
B 2 151 GLN 151 253 253 GLN GLN B . n 
B 2 152 LEU 152 254 254 LEU LEU B . n 
B 2 153 GLN 153 255 255 GLN GLN B . n 
B 2 154 GLU 154 256 256 GLU GLU B . n 
B 2 155 PRO 155 257 257 PRO PRO B . n 
B 2 156 GLU 156 258 258 GLU GLU B . n 
B 2 157 TYR 157 259 259 TYR TYR B . n 
B 2 158 VAL 158 260 260 VAL VAL B . n 
B 2 159 LEU 159 261 261 LEU LEU B . n 
B 2 160 LEU 160 262 262 LEU LEU B . n 
B 2 161 ALA 161 263 263 ALA ALA B . n 
B 2 162 ALA 162 264 264 ALA ALA B . n 
B 2 163 MET 163 265 265 MET MET B . n 
B 2 164 ALA 164 266 266 ALA ALA B . n 
B 2 165 LEU 165 267 267 LEU LEU B . n 
B 2 166 PHE 166 268 268 PHE PHE B . n 
B 2 167 SER 167 269 269 SER SER B . n 
B 2 168 PRO 168 270 270 PRO PRO B . n 
B 2 169 ASP 169 271 271 ASP ASP B . n 
B 2 170 ARG 170 272 272 ARG ARG B . n 
B 2 171 PRO 171 273 273 PRO PRO B . n 
B 2 172 GLY 172 274 274 GLY GLY B . n 
B 2 173 VAL 173 275 275 VAL VAL B . n 
B 2 174 THR 174 276 276 THR THR B . n 
B 2 175 GLN 175 277 277 GLN GLN B . n 
B 2 176 ARG 176 278 278 ARG ARG B . n 
B 2 177 ASP 177 279 279 ASP ASP B . n 
B 2 178 GLU 178 280 280 GLU GLU B . n 
B 2 179 ILE 179 281 281 ILE ILE B . n 
B 2 180 ASP 180 282 282 ASP ASP B . n 
B 2 181 GLN 181 283 283 GLN GLN B . n 
B 2 182 LEU 182 284 284 LEU LEU B . n 
B 2 183 GLN 183 285 285 GLN GLN B . n 
B 2 184 GLU 184 286 286 GLU GLU B . n 
B 2 185 GLU 185 287 287 GLU GLU B . n 
B 2 186 MET 186 288 288 MET MET B . n 
B 2 187 ALA 187 289 289 ALA ALA B . n 
B 2 188 LEU 188 290 290 LEU LEU B . n 
B 2 189 THR 189 291 291 THR THR B . n 
B 2 190 LEU 190 292 292 LEU LEU B . n 
B 2 191 GLN 191 293 293 GLN GLN B . n 
B 2 192 SER 192 294 294 SER SER B . n 
B 2 193 TYR 193 295 295 TYR TYR B . n 
B 2 194 ILE 194 296 296 ILE ILE B . n 
B 2 195 LYS 195 297 297 LYS LYS B . n 
B 2 196 GLY 196 298 298 GLY GLY B . n 
B 2 197 GLN 197 299 299 GLN GLN B . n 
B 2 198 GLN 198 300 300 GLN GLN B . n 
B 2 199 ARG 199 301 301 ARG ARG B . n 
B 2 200 ARG 200 302 302 ARG ARG B . n 
B 2 201 PRO 201 303 303 PRO PRO B . n 
B 2 202 ARG 202 304 304 ARG ARG B . n 
B 2 203 ASP 203 305 305 ASP ASP B . n 
B 2 204 ARG 204 306 306 ARG ARG B . n 
B 2 205 PHE 205 307 307 PHE PHE B . n 
B 2 206 LEU 206 308 308 LEU LEU B . n 
B 2 207 TYR 207 309 309 TYR TYR B . n 
B 2 208 ALA 208 310 310 ALA ALA B . n 
B 2 209 LYS 209 311 311 LYS LYS B . n 
B 2 210 LEU 210 312 312 LEU LEU B . n 
B 2 211 LEU 211 313 313 LEU LEU B . n 
B 2 212 GLY 212 314 314 GLY GLY B . n 
B 2 213 LEU 213 315 315 LEU LEU B . n 
B 2 214 LEU 214 316 316 LEU LEU B . n 
B 2 215 ALA 215 317 317 ALA ALA B . n 
B 2 216 GLU 216 318 318 GLU GLU B . n 
B 2 217 LEU 217 319 319 LEU LEU B . n 
B 2 218 ARG 218 320 320 ARG ARG B . n 
B 2 219 SER 219 321 321 SER SER B . n 
B 2 220 ILE 220 322 322 ILE ILE B . n 
B 2 221 ASN 221 323 323 ASN ASN B . n 
B 2 222 GLU 222 324 324 GLU GLU B . n 
B 2 223 ALA 223 325 325 ALA ALA B . n 
B 2 224 TYR 224 326 326 TYR TYR B . n 
B 2 225 GLY 225 327 327 GLY GLY B . n 
B 2 226 TYR 226 328 328 TYR TYR B . n 
B 2 227 GLN 227 329 329 GLN GLN B . n 
B 2 228 ILE 228 330 330 ILE ILE B . n 
B 2 229 GLN 229 331 331 GLN GLN B . n 
B 2 230 HIS 230 332 332 HIS HIS B . n 
B 2 231 ILE 231 333 333 ILE ILE B . n 
B 2 232 GLN 232 334 334 GLN GLN B . n 
B 2 233 GLY 233 335 335 GLY GLY B . n 
B 2 234 LEU 234 336 336 LEU LEU B . n 
B 2 235 SER 235 337 337 SER SER B . n 
B 2 236 ALA 236 338 338 ALA ALA B . n 
B 2 237 MET 237 339 339 MET MET B . n 
B 2 238 MET 238 340 340 MET MET B . n 
B 2 239 PRO 239 341 341 PRO PRO B . n 
B 2 240 LEU 240 342 342 LEU LEU B . n 
B 2 241 LEU 241 343 343 LEU LEU B . n 
B 2 242 GLN 242 344 344 GLN GLN B . n 
B 2 243 GLU 243 345 345 GLU GLU B . n 
B 2 244 ILE 244 346 346 ILE ILE B . n 
B 2 245 CYS 245 347 347 CYS CYS B . n 
B 2 246 SER 246 348 348 SER SER B . n 
C 1 1   ASN 1   227 227 ASN ASN C . n 
C 1 2   GLU 2   228 228 GLU GLU C . n 
C 1 3   ASP 3   229 229 ASP ASP C . n 
C 1 4   MET 4   230 230 MET MET C . n 
C 1 5   PRO 5   231 231 PRO PRO C . n 
C 1 6   VAL 6   232 232 VAL VAL C . n 
C 1 7   GLU 7   233 233 GLU GLU C . n 
C 1 8   ARG 8   234 234 ARG ARG C . n 
C 1 9   ILE 9   235 235 ILE ILE C . n 
C 1 10  LEU 10  236 236 LEU LEU C . n 
C 1 11  GLU 11  237 237 GLU GLU C . n 
C 1 12  ALA 12  238 238 ALA ALA C . n 
C 1 13  GLU 13  239 239 GLU GLU C . n 
C 1 14  LEU 14  240 240 LEU LEU C . n 
C 1 15  ALA 15  241 241 ALA ALA C . n 
C 1 16  VAL 16  242 242 VAL VAL C . n 
C 1 17  GLU 17  243 243 GLU GLU C . n 
C 1 18  PRO 18  244 244 PRO PRO C . n 
C 1 19  LYS 19  245 245 LYS LYS C . n 
C 1 20  THR 20  246 246 THR THR C . n 
C 1 21  GLU 21  247 247 GLU GLU C . n 
C 1 22  THR 22  248 248 THR THR C . n 
C 1 23  TYR 23  249 249 TYR TYR C . n 
C 1 24  VAL 24  250 250 VAL VAL C . n 
C 1 25  GLU 25  251 251 GLU GLU C . n 
C 1 26  ALA 26  252 252 ALA ALA C . n 
C 1 27  ASN 27  253 253 ASN ASN C . n 
C 1 28  MET 28  254 254 MET MET C . n 
C 1 29  GLY 29  255 255 GLY GLY C . n 
C 1 30  LEU 30  256 256 LEU LEU C . n 
C 1 31  ASN 31  257 257 ASN ASN C . n 
C 1 32  PRO 32  258 258 PRO PRO C . n 
C 1 33  SER 33  259 259 SER SER C . n 
C 1 34  SER 34  260 260 SER SER C . n 
C 1 35  PRO 35  261 261 PRO PRO C . n 
C 1 36  ASN 36  262 262 ASN ASN C . n 
C 1 37  ASP 37  263 263 ASP ASP C . n 
C 1 38  PRO 38  264 264 PRO PRO C . n 
C 1 39  VAL 39  265 265 VAL VAL C . n 
C 1 40  THR 40  266 266 THR THR C . n 
C 1 41  ASN 41  267 267 ASN ASN C . n 
C 1 42  ILE 42  268 268 ILE ILE C . n 
C 1 43  CYS 43  269 269 CYS CYS C . n 
C 1 44  GLN 44  270 270 GLN GLN C . n 
C 1 45  ALA 45  271 271 ALA ALA C . n 
C 1 46  ALA 46  272 272 ALA ALA C . n 
C 1 47  ASP 47  273 273 ASP ASP C . n 
C 1 48  LYS 48  274 274 LYS LYS C . n 
C 1 49  GLN 49  275 275 GLN GLN C . n 
C 1 50  LEU 50  276 276 LEU LEU C . n 
C 1 51  PHE 51  277 277 PHE PHE C . n 
C 1 52  THR 52  278 278 THR THR C . n 
C 1 53  LEU 53  279 279 LEU LEU C . n 
C 1 54  VAL 54  280 280 VAL VAL C . n 
C 1 55  GLU 55  281 281 GLU GLU C . n 
C 1 56  TRP 56  282 282 TRP TRP C . n 
C 1 57  ALA 57  283 283 ALA ALA C . n 
C 1 58  LYS 58  284 284 LYS LYS C . n 
C 1 59  ARG 59  285 285 ARG ARG C . n 
C 1 60  ILE 60  286 286 ILE ILE C . n 
C 1 61  PRO 61  287 287 PRO PRO C . n 
C 1 62  HIS 62  288 288 HIS HIS C . n 
C 1 63  PHE 63  289 289 PHE PHE C . n 
C 1 64  SER 64  290 290 SER SER C . n 
C 1 65  GLU 65  291 291 GLU GLU C . n 
C 1 66  LEU 66  292 292 LEU LEU C . n 
C 1 67  PRO 67  293 293 PRO PRO C . n 
C 1 68  LEU 68  294 294 LEU LEU C . n 
C 1 69  ASP 69  295 295 ASP ASP C . n 
C 1 70  ASP 70  296 296 ASP ASP C . n 
C 1 71  GLN 71  297 297 GLN GLN C . n 
C 1 72  VAL 72  298 298 VAL VAL C . n 
C 1 73  ILE 73  299 299 ILE ILE C . n 
C 1 74  LEU 74  300 300 LEU LEU C . n 
C 1 75  LEU 75  301 301 LEU LEU C . n 
C 1 76  ARG 76  302 302 ARG ARG C . n 
C 1 77  ALA 77  303 303 ALA ALA C . n 
C 1 78  GLY 78  304 304 GLY GLY C . n 
C 1 79  TRP 79  305 305 TRP TRP C . n 
C 1 80  ASN 80  306 306 ASN ASN C . n 
C 1 81  GLU 81  307 307 GLU GLU C . n 
C 1 82  LEU 82  308 308 LEU LEU C . n 
C 1 83  LEU 83  309 309 LEU LEU C . n 
C 1 84  ILE 84  310 310 ILE ILE C . n 
C 1 85  ALA 85  311 311 ALA ALA C . n 
C 1 86  SER 86  312 312 SER SER C . n 
C 1 87  PHE 87  313 313 PHE PHE C . n 
C 1 88  SER 88  314 314 SER SER C . n 
C 1 89  HIS 89  315 315 HIS HIS C . n 
C 1 90  ARG 90  316 316 ARG ARG C . n 
C 1 91  SER 91  317 317 SER SER C . n 
C 1 92  ILE 92  318 318 ILE ILE C . n 
C 1 93  ALA 93  319 319 ALA ALA C . n 
C 1 94  VAL 94  320 320 VAL VAL C . n 
C 1 95  LYS 95  321 321 LYS LYS C . n 
C 1 96  ASP 96  322 322 ASP ASP C . n 
C 1 97  GLY 97  323 323 GLY GLY C . n 
C 1 98  ILE 98  324 324 ILE ILE C . n 
C 1 99  LEU 99  325 325 LEU LEU C . n 
C 1 100 LEU 100 326 326 LEU LEU C . n 
C 1 101 ALA 101 327 327 ALA ALA C . n 
C 1 102 THR 102 328 328 THR THR C . n 
C 1 103 GLY 103 329 329 GLY GLY C . n 
C 1 104 LEU 104 330 330 LEU LEU C . n 
C 1 105 HIS 105 331 331 HIS HIS C . n 
C 1 106 VAL 106 332 332 VAL VAL C . n 
C 1 107 HIS 107 333 333 HIS HIS C . n 
C 1 108 ARG 108 334 334 ARG ARG C . n 
C 1 109 ASN 109 335 335 ASN ASN C . n 
C 1 110 SER 110 336 336 SER SER C . n 
C 1 111 ALA 111 337 337 ALA ALA C . n 
C 1 112 HIS 112 338 338 HIS HIS C . n 
C 1 113 SER 113 339 339 SER SER C . n 
C 1 114 ALA 114 340 340 ALA ALA C . n 
C 1 115 GLY 115 341 341 GLY GLY C . n 
C 1 116 VAL 116 342 342 VAL VAL C . n 
C 1 117 GLY 117 343 343 GLY GLY C . n 
C 1 118 ALA 118 344 344 ALA ALA C . n 
C 1 119 ILE 119 345 345 ILE ILE C . n 
C 1 120 PHE 120 346 346 PHE PHE C . n 
C 1 121 ASP 121 347 347 ASP ASP C . n 
C 1 122 ARG 122 348 348 ARG ARG C . n 
C 1 123 VAL 123 349 349 VAL VAL C . n 
C 1 124 LEU 124 350 350 LEU LEU C . n 
C 1 125 THR 125 351 351 THR THR C . n 
C 1 126 GLU 126 352 352 GLU GLU C . n 
C 1 127 LEU 127 353 353 LEU LEU C . n 
C 1 128 VAL 128 354 354 VAL VAL C . n 
C 1 129 SER 129 355 355 SER SER C . n 
C 1 130 LYS 130 356 356 LYS LYS C . n 
C 1 131 MET 131 357 357 MET MET C . n 
C 1 132 ARG 132 358 358 ARG ARG C . n 
C 1 133 ASP 133 359 359 ASP ASP C . n 
C 1 134 MET 134 360 360 MET MET C . n 
C 1 135 GLN 135 361 361 GLN GLN C . n 
C 1 136 MET 136 362 362 MET MET C . n 
C 1 137 ASP 137 363 363 ASP ASP C . n 
C 1 138 LYS 138 364 364 LYS LYS C . n 
C 1 139 THR 139 365 365 THR THR C . n 
C 1 140 GLU 140 366 366 GLU GLU C . n 
C 1 141 LEU 141 367 367 LEU LEU C . n 
C 1 142 GLY 142 368 368 GLY GLY C . n 
C 1 143 CYS 143 369 369 CYS CYS C . n 
C 1 144 LEU 144 370 370 LEU LEU C . n 
C 1 145 ARG 145 371 371 ARG ARG C . n 
C 1 146 ALA 146 372 372 ALA ALA C . n 
C 1 147 ILE 147 373 373 ILE ILE C . n 
C 1 148 VAL 148 374 374 VAL VAL C . n 
C 1 149 LEU 149 375 375 LEU LEU C . n 
C 1 150 PHE 150 376 376 PHE PHE C . n 
C 1 151 ASN 151 377 377 ASN ASN C . n 
C 1 152 PRO 152 378 378 PRO PRO C . n 
C 1 153 ASP 153 379 379 ASP ASP C . n 
C 1 154 SER 154 380 380 SER SER C . n 
C 1 155 LYS 155 381 381 LYS LYS C . n 
C 1 156 GLY 156 382 382 GLY GLY C . n 
C 1 157 LEU 157 383 383 LEU LEU C . n 
C 1 158 SER 158 384 384 SER SER C . n 
C 1 159 ASN 159 385 385 ASN ASN C . n 
C 1 160 PRO 160 386 386 PRO PRO C . n 
C 1 161 ALA 161 387 387 ALA ALA C . n 
C 1 162 GLU 162 388 388 GLU GLU C . n 
C 1 163 VAL 163 389 389 VAL VAL C . n 
C 1 164 GLU 164 390 390 GLU GLU C . n 
C 1 165 ALA 165 391 391 ALA ALA C . n 
C 1 166 LEU 166 392 392 LEU LEU C . n 
C 1 167 ARG 167 393 393 ARG ARG C . n 
C 1 168 GLU 168 394 394 GLU GLU C . n 
C 1 169 LYS 169 395 395 LYS LYS C . n 
C 1 170 VAL 170 396 396 VAL VAL C . n 
C 1 171 TYR 171 397 397 TYR TYR C . n 
C 1 172 ALA 172 398 398 ALA ALA C . n 
C 1 173 SER 173 399 399 SER SER C . n 
C 1 174 LEU 174 400 400 LEU LEU C . n 
C 1 175 GLU 175 401 401 GLU GLU C . n 
C 1 176 ALA 176 402 402 ALA ALA C . n 
C 1 177 TYR 177 403 403 TYR TYR C . n 
C 1 178 CYS 178 404 404 CYS CYS C . n 
C 1 179 LYS 179 405 405 LYS LYS C . n 
C 1 180 HIS 180 406 406 HIS HIS C . n 
C 1 181 LYS 181 407 407 LYS LYS C . n 
C 1 182 TYR 182 408 408 TYR TYR C . n 
C 1 183 PRO 183 409 409 PRO PRO C . n 
C 1 184 GLU 184 410 410 GLU GLU C . n 
C 1 185 GLN 185 411 411 GLN GLN C . n 
C 1 186 PRO 186 412 412 PRO PRO C . n 
C 1 187 GLY 187 413 413 GLY GLY C . n 
C 1 188 ARG 188 414 414 ARG ARG C . n 
C 1 189 PHE 189 415 415 PHE PHE C . n 
C 1 190 ALA 190 416 416 ALA ALA C . n 
C 1 191 LYS 191 417 417 LYS LYS C . n 
C 1 192 LEU 192 418 418 LEU LEU C . n 
C 1 193 LEU 193 419 419 LEU LEU C . n 
C 1 194 LEU 194 420 420 LEU LEU C . n 
C 1 195 ARG 195 421 421 ARG ARG C . n 
C 1 196 LEU 196 422 422 LEU LEU C . n 
C 1 197 PRO 197 423 423 PRO PRO C . n 
C 1 198 ALA 198 424 424 ALA ALA C . n 
C 1 199 LEU 199 425 425 LEU LEU C . n 
C 1 200 ARG 200 426 426 ARG ARG C . n 
C 1 201 SER 201 427 427 SER SER C . n 
C 1 202 ILE 202 428 428 ILE ILE C . n 
C 1 203 GLY 203 429 429 GLY GLY C . n 
C 1 204 LEU 204 430 430 LEU LEU C . n 
C 1 205 LYS 205 431 431 LYS LYS C . n 
C 1 206 CYS 206 432 432 CYS CYS C . n 
C 1 207 LEU 207 433 433 LEU LEU C . n 
C 1 208 GLU 208 434 434 GLU GLU C . n 
C 1 209 HIS 209 435 435 HIS HIS C . n 
C 1 210 LEU 210 436 436 LEU LEU C . n 
C 1 211 PHE 211 437 437 PHE PHE C . n 
C 1 212 PHE 212 438 438 PHE PHE C . n 
C 1 213 PHE 213 439 439 PHE PHE C . n 
C 1 214 LYS 214 440 440 LYS LYS C . n 
C 1 215 LEU 215 441 441 LEU LEU C . n 
C 1 216 ILE 216 442 442 ILE ILE C . n 
C 1 217 GLY 217 443 443 GLY GLY C . n 
C 1 218 ASP 218 444 444 ASP ASP C . n 
C 1 219 THR 219 445 445 THR THR C . n 
C 1 220 PRO 220 446 446 PRO PRO C . n 
C 1 221 ILE 221 447 447 ILE ILE C . n 
C 1 222 ASP 222 448 448 ASP ASP C . n 
C 1 223 THR 223 449 449 THR THR C . n 
C 1 224 PHE 224 450 450 PHE PHE C . n 
C 1 225 LEU 225 451 451 LEU LEU C . n 
C 1 226 MET 226 452 452 MET MET C . n 
C 1 227 GLU 227 453 453 GLU GLU C . n 
C 1 228 MET 228 454 454 MET MET C . n 
C 1 229 LEU 229 455 455 LEU LEU C . n 
C 1 230 GLU 230 456 456 GLU GLU C . n 
C 1 231 ALA 231 457 457 ALA ALA C . n 
C 1 232 PRO 232 458 458 PRO PRO C . n 
C 1 233 HIS 233 459 ?   ?   ?   C . n 
C 1 234 GLN 234 460 ?   ?   ?   C . n 
C 1 235 MET 235 461 ?   ?   ?   C . n 
C 1 236 THR 236 462 ?   ?   ?   C . n 
D 2 1   PRO 1   103 103 PRO PRO D . n 
D 2 2   VAL 2   104 104 VAL VAL D . n 
D 2 3   GLN 3   105 105 GLN GLN D . n 
D 2 4   LEU 4   106 106 LEU LEU D . n 
D 2 5   SER 5   107 107 SER SER D . n 
D 2 6   LYS 6   108 108 LYS LYS D . n 
D 2 7   GLU 7   109 109 GLU GLU D . n 
D 2 8   GLN 8   110 110 GLN GLN D . n 
D 2 9   GLU 9   111 111 GLU GLU D . n 
D 2 10  GLU 10  112 112 GLU GLU D . n 
D 2 11  LEU 11  113 113 LEU LEU D . n 
D 2 12  ILE 12  114 114 ILE ILE D . n 
D 2 13  ARG 13  115 115 ARG ARG D . n 
D 2 14  THR 14  116 116 THR THR D . n 
D 2 15  LEU 15  117 117 LEU LEU D . n 
D 2 16  LEU 16  118 118 LEU LEU D . n 
D 2 17  GLY 17  119 119 GLY GLY D . n 
D 2 18  ALA 18  120 120 ALA ALA D . n 
D 2 19  HIS 19  121 121 HIS HIS D . n 
D 2 20  THR 20  122 122 THR THR D . n 
D 2 21  ARG 21  123 123 ARG ARG D . n 
D 2 22  HIS 22  124 124 HIS HIS D . n 
D 2 23  MET 23  125 125 MET MET D . n 
D 2 24  GLY 24  126 126 GLY GLY D . n 
D 2 25  THR 25  127 127 THR THR D . n 
D 2 26  MET 26  128 128 MET MET D . n 
D 2 27  PHE 27  129 129 PHE PHE D . n 
D 2 28  GLU 28  130 130 GLU GLU D . n 
D 2 29  GLN 29  131 131 GLN GLN D . n 
D 2 30  PHE 30  132 132 PHE PHE D . n 
D 2 31  VAL 31  133 133 VAL VAL D . n 
D 2 32  GLN 32  134 134 GLN GLN D . n 
D 2 33  PHE 33  135 135 PHE PHE D . n 
D 2 34  ARG 34  136 136 ARG ARG D . n 
D 2 35  PRO 35  137 137 PRO PRO D . n 
D 2 36  PRO 36  138 138 PRO PRO D . n 
D 2 37  ALA 37  139 139 ALA ALA D . n 
D 2 38  HIS 38  140 140 HIS HIS D . n 
D 2 39  LEU 39  141 141 LEU LEU D . n 
D 2 40  PHE 40  142 142 PHE PHE D . n 
D 2 41  ILE 41  143 143 ILE ILE D . n 
D 2 42  HIS 42  144 144 HIS HIS D . n 
D 2 43  HIS 43  145 145 HIS HIS D . n 
D 2 44  GLN 44  146 146 GLN GLN D . n 
D 2 45  PRO 45  147 147 PRO PRO D . n 
D 2 46  LEU 46  148 148 LEU LEU D . n 
D 2 47  PRO 47  149 149 PRO PRO D . n 
D 2 48  THR 48  150 150 THR THR D . n 
D 2 49  LEU 49  151 151 LEU LEU D . n 
D 2 50  ALA 50  152 152 ALA ALA D . n 
D 2 51  PRO 51  153 153 PRO PRO D . n 
D 2 52  VAL 52  154 154 VAL VAL D . n 
D 2 53  LEU 53  155 155 LEU LEU D . n 
D 2 54  PRO 54  156 156 PRO PRO D . n 
D 2 55  LEU 55  157 157 LEU LEU D . n 
D 2 56  VAL 56  158 158 VAL VAL D . n 
D 2 57  THR 57  159 159 THR THR D . n 
D 2 58  HIS 58  160 160 HIS HIS D . n 
D 2 59  PHE 59  161 161 PHE PHE D . n 
D 2 60  ALA 60  162 162 ALA ALA D . n 
D 2 61  ASP 61  163 163 ASP ASP D . n 
D 2 62  ILE 62  164 164 ILE ILE D . n 
D 2 63  ASN 63  165 165 ASN ASN D . n 
D 2 64  THR 64  166 166 THR THR D . n 
D 2 65  PHE 65  167 167 PHE PHE D . n 
D 2 66  MET 66  168 168 MET MET D . n 
D 2 67  VAL 67  169 169 VAL VAL D . n 
D 2 68  LEU 68  170 170 LEU LEU D . n 
D 2 69  GLN 69  171 171 GLN GLN D . n 
D 2 70  VAL 70  172 172 VAL VAL D . n 
D 2 71  ILE 71  173 173 ILE ILE D . n 
D 2 72  LYS 72  174 174 LYS LYS D . n 
D 2 73  PHE 73  175 175 PHE PHE D . n 
D 2 74  THR 74  176 176 THR THR D . n 
D 2 75  LYS 75  177 177 LYS LYS D . n 
D 2 76  ASP 76  178 178 ASP ASP D . n 
D 2 77  LEU 77  179 179 LEU LEU D . n 
D 2 78  PRO 78  180 180 PRO PRO D . n 
D 2 79  VAL 79  181 181 VAL VAL D . n 
D 2 80  PHE 80  182 182 PHE PHE D . n 
D 2 81  ARG 81  183 183 ARG ARG D . n 
D 2 82  SER 82  184 184 SER SER D . n 
D 2 83  LEU 83  185 185 LEU LEU D . n 
D 2 84  PRO 84  186 186 PRO PRO D . n 
D 2 85  ILE 85  187 187 ILE ILE D . n 
D 2 86  GLU 86  188 188 GLU GLU D . n 
D 2 87  ASP 87  189 189 ASP ASP D . n 
D 2 88  GLN 88  190 190 GLN GLN D . n 
D 2 89  ILE 89  191 191 ILE ILE D . n 
D 2 90  SER 90  192 192 SER SER D . n 
D 2 91  LEU 91  193 193 LEU LEU D . n 
D 2 92  LEU 92  194 194 LEU LEU D . n 
D 2 93  LYS 93  195 195 LYS LYS D . n 
D 2 94  GLY 94  196 196 GLY GLY D . n 
D 2 95  ALA 95  197 197 ALA ALA D . n 
D 2 96  ALA 96  198 198 ALA ALA D . n 
D 2 97  VAL 97  199 199 VAL VAL D . n 
D 2 98  GLU 98  200 200 GLU GLU D . n 
D 2 99  ILE 99  201 201 ILE ILE D . n 
D 2 100 CYS 100 202 202 CYS CYS D . n 
D 2 101 HIS 101 203 203 HIS HIS D . n 
D 2 102 ILE 102 204 204 ILE ILE D . n 
D 2 103 VAL 103 205 205 VAL VAL D . n 
D 2 104 LEU 104 206 206 LEU LEU D . n 
D 2 105 ASN 105 207 207 ASN ASN D . n 
D 2 106 THR 106 208 208 THR THR D . n 
D 2 107 THR 107 209 209 THR THR D . n 
D 2 108 PHE 108 210 210 PHE PHE D . n 
D 2 109 CYS 109 211 211 CYS CYS D . n 
D 2 110 LEU 110 212 212 LEU LEU D . n 
D 2 111 GLN 111 213 213 GLN GLN D . n 
D 2 112 THR 112 214 214 THR THR D . n 
D 2 113 GLN 113 215 215 GLN GLN D . n 
D 2 114 ASN 114 216 216 ASN ASN D . n 
D 2 115 PHE 115 217 217 PHE PHE D . n 
D 2 116 LEU 116 218 218 LEU LEU D . n 
D 2 117 CYS 117 219 219 CYS CYS D . n 
D 2 118 GLY 118 220 220 GLY GLY D . n 
D 2 119 PRO 119 221 221 PRO PRO D . n 
D 2 120 LEU 120 222 222 LEU LEU D . n 
D 2 121 ARG 121 223 223 ARG ARG D . n 
D 2 122 TYR 122 224 224 TYR TYR D . n 
D 2 123 THR 123 225 225 THR THR D . n 
D 2 124 ILE 124 226 226 ILE ILE D . n 
D 2 125 GLU 125 227 227 GLU GLU D . n 
D 2 126 ASP 126 228 228 ASP ASP D . n 
D 2 127 GLY 127 229 229 GLY GLY D . n 
D 2 128 ALA 128 230 230 ALA ALA D . n 
D 2 129 ARG 129 231 231 ARG ARG D . n 
D 2 130 VAL 130 232 232 VAL VAL D . n 
D 2 131 GLY 131 233 233 GLY GLY D . n 
D 2 132 PHE 132 234 234 PHE PHE D . n 
D 2 133 GLN 133 235 235 GLN GLN D . n 
D 2 134 VAL 134 236 236 VAL VAL D . n 
D 2 135 GLU 135 237 237 GLU GLU D . n 
D 2 136 PHE 136 238 238 PHE PHE D . n 
D 2 137 LEU 137 239 239 LEU LEU D . n 
D 2 138 GLU 138 240 240 GLU GLU D . n 
D 2 139 LEU 139 241 241 LEU LEU D . n 
D 2 140 LEU 140 242 242 LEU LEU D . n 
D 2 141 PHE 141 243 243 PHE PHE D . n 
D 2 142 HIS 142 244 244 HIS HIS D . n 
D 2 143 PHE 143 245 245 PHE PHE D . n 
D 2 144 HIS 144 246 246 HIS HIS D . n 
D 2 145 GLY 145 247 247 GLY GLY D . n 
D 2 146 THR 146 248 248 THR THR D . n 
D 2 147 LEU 147 249 249 LEU LEU D . n 
D 2 148 ARG 148 250 250 ARG ARG D . n 
D 2 149 LYS 149 251 251 LYS LYS D . n 
D 2 150 LEU 150 252 252 LEU LEU D . n 
D 2 151 GLN 151 253 253 GLN GLN D . n 
D 2 152 LEU 152 254 254 LEU LEU D . n 
D 2 153 GLN 153 255 255 GLN GLN D . n 
D 2 154 GLU 154 256 256 GLU GLU D . n 
D 2 155 PRO 155 257 257 PRO PRO D . n 
D 2 156 GLU 156 258 258 GLU GLU D . n 
D 2 157 TYR 157 259 259 TYR TYR D . n 
D 2 158 VAL 158 260 260 VAL VAL D . n 
D 2 159 LEU 159 261 261 LEU LEU D . n 
D 2 160 LEU 160 262 262 LEU LEU D . n 
D 2 161 ALA 161 263 263 ALA ALA D . n 
D 2 162 ALA 162 264 264 ALA ALA D . n 
D 2 163 MET 163 265 265 MET MET D . n 
D 2 164 ALA 164 266 266 ALA ALA D . n 
D 2 165 LEU 165 267 267 LEU LEU D . n 
D 2 166 PHE 166 268 268 PHE PHE D . n 
D 2 167 SER 167 269 269 SER SER D . n 
D 2 168 PRO 168 270 270 PRO PRO D . n 
D 2 169 ASP 169 271 271 ASP ASP D . n 
D 2 170 ARG 170 272 272 ARG ARG D . n 
D 2 171 PRO 171 273 273 PRO PRO D . n 
D 2 172 GLY 172 274 274 GLY GLY D . n 
D 2 173 VAL 173 275 275 VAL VAL D . n 
D 2 174 THR 174 276 276 THR THR D . n 
D 2 175 GLN 175 277 277 GLN GLN D . n 
D 2 176 ARG 176 278 278 ARG ARG D . n 
D 2 177 ASP 177 279 279 ASP ASP D . n 
D 2 178 GLU 178 280 280 GLU GLU D . n 
D 2 179 ILE 179 281 281 ILE ILE D . n 
D 2 180 ASP 180 282 282 ASP ASP D . n 
D 2 181 GLN 181 283 283 GLN GLN D . n 
D 2 182 LEU 182 284 284 LEU LEU D . n 
D 2 183 GLN 183 285 285 GLN GLN D . n 
D 2 184 GLU 184 286 286 GLU GLU D . n 
D 2 185 GLU 185 287 287 GLU GLU D . n 
D 2 186 MET 186 288 288 MET MET D . n 
D 2 187 ALA 187 289 289 ALA ALA D . n 
D 2 188 LEU 188 290 290 LEU LEU D . n 
D 2 189 THR 189 291 291 THR THR D . n 
D 2 190 LEU 190 292 292 LEU LEU D . n 
D 2 191 GLN 191 293 293 GLN GLN D . n 
D 2 192 SER 192 294 294 SER SER D . n 
D 2 193 TYR 193 295 295 TYR TYR D . n 
D 2 194 ILE 194 296 296 ILE ILE D . n 
D 2 195 LYS 195 297 297 LYS LYS D . n 
D 2 196 GLY 196 298 298 GLY GLY D . n 
D 2 197 GLN 197 299 299 GLN GLN D . n 
D 2 198 GLN 198 300 300 GLN GLN D . n 
D 2 199 ARG 199 301 301 ARG ARG D . n 
D 2 200 ARG 200 302 302 ARG ARG D . n 
D 2 201 PRO 201 303 303 PRO PRO D . n 
D 2 202 ARG 202 304 304 ARG ARG D . n 
D 2 203 ASP 203 305 305 ASP ASP D . n 
D 2 204 ARG 204 306 306 ARG ARG D . n 
D 2 205 PHE 205 307 307 PHE PHE D . n 
D 2 206 LEU 206 308 308 LEU LEU D . n 
D 2 207 TYR 207 309 309 TYR TYR D . n 
D 2 208 ALA 208 310 310 ALA ALA D . n 
D 2 209 LYS 209 311 311 LYS LYS D . n 
D 2 210 LEU 210 312 312 LEU LEU D . n 
D 2 211 LEU 211 313 313 LEU LEU D . n 
D 2 212 GLY 212 314 314 GLY GLY D . n 
D 2 213 LEU 213 315 315 LEU LEU D . n 
D 2 214 LEU 214 316 316 LEU LEU D . n 
D 2 215 ALA 215 317 317 ALA ALA D . n 
D 2 216 GLU 216 318 318 GLU GLU D . n 
D 2 217 LEU 217 319 319 LEU LEU D . n 
D 2 218 ARG 218 320 320 ARG ARG D . n 
D 2 219 SER 219 321 321 SER SER D . n 
D 2 220 ILE 220 322 322 ILE ILE D . n 
D 2 221 ASN 221 323 323 ASN ASN D . n 
D 2 222 GLU 222 324 324 GLU GLU D . n 
D 2 223 ALA 223 325 325 ALA ALA D . n 
D 2 224 TYR 224 326 326 TYR TYR D . n 
D 2 225 GLY 225 327 327 GLY GLY D . n 
D 2 226 TYR 226 328 328 TYR TYR D . n 
D 2 227 GLN 227 329 329 GLN GLN D . n 
D 2 228 ILE 228 330 330 ILE ILE D . n 
D 2 229 GLN 229 331 331 GLN GLN D . n 
D 2 230 HIS 230 332 332 HIS HIS D . n 
D 2 231 ILE 231 333 333 ILE ILE D . n 
D 2 232 GLN 232 334 334 GLN GLN D . n 
D 2 233 GLY 233 335 335 GLY GLY D . n 
D 2 234 LEU 234 336 336 LEU LEU D . n 
D 2 235 SER 235 337 337 SER SER D . n 
D 2 236 ALA 236 338 338 ALA ALA D . n 
D 2 237 MET 237 339 339 MET MET D . n 
D 2 238 MET 238 340 340 MET MET D . n 
D 2 239 PRO 239 341 341 PRO PRO D . n 
D 2 240 LEU 240 342 342 LEU LEU D . n 
D 2 241 LEU 241 343 343 LEU LEU D . n 
D 2 242 GLN 242 344 344 GLN GLN D . n 
D 2 243 GLU 243 345 345 GLU GLU D . n 
D 2 244 ILE 244 346 346 ILE ILE D . n 
D 2 245 CYS 245 347 347 CYS CYS D . n 
D 2 246 SER 246 348 348 SER SER D . n 
E 3 1   GLU 1   628 ?   ?   ?   E . n 
E 3 2   ARG 2   629 ?   ?   ?   E . n 
E 3 3   HIS 3   630 630 HIS HIS E . n 
E 3 4   LYS 4   631 631 LYS ALA E . n 
E 3 5   ILE 5   632 632 ILE ILE E . n 
E 3 6   LEU 6   633 633 LEU LEU E . n 
E 3 7   HIS 7   634 634 HIS HIS E . n 
E 3 8   ARG 8   635 635 ARG ARG E . n 
E 3 9   LEU 9   636 636 LEU LEU E . n 
E 3 10  LEU 10  637 637 LEU LEU E . n 
E 3 11  GLN 11  638 638 GLN GLN E . n 
E 3 12  GLU 12  639 639 GLU GLU E . n 
E 3 13  GLY 13  640 ?   ?   ?   E . n 
F 3 1   GLU 1   685 ?   ?   ?   F . n 
F 3 2   ARG 2   686 686 ARG ARG F . n 
F 3 3   HIS 3   687 687 HIS HIS F . n 
F 3 4   LYS 4   688 688 LYS ALA F . n 
F 3 5   ILE 5   689 689 ILE ILE F . n 
F 3 6   LEU 6   690 690 LEU LEU F . n 
F 3 7   HIS 7   691 691 HIS HIS F . n 
F 3 8   ARG 8   692 692 ARG ARG F . n 
F 3 9   LEU 9   693 693 LEU LEU F . n 
F 3 10  LEU 10  694 694 LEU LEU F . n 
F 3 11  GLN 11  695 695 GLN GLN F . n 
F 3 12  GLU 12  696 696 GLU GLU F . n 
F 3 13  GLY 13  697 697 GLY GLY F . n 
G 3 1   GLU 1   628 628 GLU GLU G . n 
G 3 2   ARG 2   629 629 ARG ARG G . n 
G 3 3   HIS 3   630 630 HIS HIS G . n 
G 3 4   LYS 4   631 631 LYS ALA G . n 
G 3 5   ILE 5   632 632 ILE ILE G . n 
G 3 6   LEU 6   633 633 LEU LEU G . n 
G 3 7   HIS 7   634 634 HIS HIS G . n 
G 3 8   ARG 8   635 635 ARG ARG G . n 
G 3 9   LEU 9   636 636 LEU LEU G . n 
G 3 10  LEU 10  637 637 LEU LEU G . n 
G 3 11  GLN 11  638 638 GLN GLN G . n 
G 3 12  GLU 12  639 639 GLU GLU G . n 
G 3 13  GLY 13  640 ?   ?   ?   G . n 
H 3 1   GLU 1   685 685 GLU GLU H . n 
H 3 2   ARG 2   686 686 ARG ARG H . n 
H 3 3   HIS 3   687 687 HIS HIS H . n 
H 3 4   LYS 4   688 688 LYS ALA H . n 
H 3 5   ILE 5   689 689 ILE ILE H . n 
H 3 6   LEU 6   690 690 LEU LEU H . n 
H 3 7   HIS 7   691 691 HIS HIS H . n 
H 3 8   ARG 8   692 692 ARG ARG H . n 
H 3 9   LEU 9   693 693 LEU LEU H . n 
H 3 10  LEU 10  694 694 LEU LEU H . n 
H 3 11  GLN 11  695 695 GLN GLN H . n 
H 3 12  GLU 12  696 696 GLU GLU H . n 
H 3 13  GLY 13  697 ?   ?   ?   H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,L,M,P   
2 1 C,D,G,H,J,K,N,O,Q 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-12-28 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-11-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Other                       
4 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
AMoRE     phasing           . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A ASN 385 ? ? N A PRO 386 ? ? CA A PRO 386 ? ? 128.77 119.30 9.47  1.50 Y 
2 1 C C GLN 411 ? ? N C PRO 412 ? ? CA C PRO 412 ? ? 130.57 119.30 11.27 1.50 Y 
3 1 C D LEU 179 ? ? N D PRO 180 ? ? CA D PRO 180 ? ? 131.17 119.30 11.87 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 242 ? ? -61.76  -72.82  
2  1 GLU A 243 ? ? -39.74  137.72  
3  1 ASN A 253 ? ? -56.75  175.06  
4  1 PRO A 258 ? ? -69.85  12.30   
5  1 PRO A 264 ? ? -42.70  -72.95  
6  1 ARG A 285 ? ? -60.44  13.04   
7  1 HIS A 288 ? ? 85.03   -11.89  
8  1 ALA A 303 ? ? -107.13 66.39   
9  1 ASN A 306 ? ? -58.61  -76.20  
10 1 LEU A 308 ? ? -67.98  -76.18  
11 1 ALA A 319 ? ? -77.40  22.58   
12 1 ALA A 337 ? ? -74.87  -72.58  
13 1 VAL A 342 ? ? -89.40  37.83   
14 1 LEU A 353 ? ? -105.50 -79.32  
15 1 ASP A 359 ? ? -77.01  35.02   
16 1 MET A 360 ? ? -166.56 -0.04   
17 1 GLN A 361 ? ? 39.62   78.06   
18 1 HIS A 406 ? ? -80.55  -77.14  
19 1 TYR A 408 ? ? -115.56 67.34   
20 1 LYS A 440 ? ? -74.97  -72.23  
21 1 ILE A 442 ? ? -98.03  -89.61  
22 1 THR A 445 ? ? -29.37  110.75  
23 1 THR A 449 ? ? -26.95  -93.44  
24 1 GLU A 456 ? ? -155.88 78.25   
25 1 SER B 107 ? ? -33.87  170.56  
26 1 MET B 125 ? ? -111.10 -169.44 
27 1 HIS B 145 ? ? -67.94  6.66    
28 1 GLN B 146 ? ? -172.50 148.60  
29 1 LEU B 155 ? ? -36.12  -39.49  
30 1 ASP B 178 ? ? -90.41  41.88   
31 1 ALA B 198 ? ? -11.02  -63.35  
32 1 GLN B 213 ? ? -54.90  -72.99  
33 1 GLN B 215 ? ? 74.62   38.61   
34 1 GLN B 235 ? ? -42.51  150.55  
35 1 GLN B 253 ? ? 60.44   88.80   
36 1 GLN B 255 ? ? -43.73  154.58  
37 1 LEU B 267 ? ? -50.92  -72.38  
38 1 GLN B 277 ? ? -105.58 54.35   
39 1 GLN B 300 ? ? -51.53  -78.71  
40 1 ARG B 302 ? ? -99.90  57.44   
41 1 PHE B 307 ? ? -95.05  49.99   
42 1 ILE B 330 ? ? -68.32  20.35   
43 1 GLN B 331 ? ? -131.82 -37.09  
44 1 GLN B 334 ? ? -37.17  126.64  
45 1 PRO C 231 ? ? -62.23  99.61   
46 1 THR C 246 ? ? -152.83 82.43   
47 1 ASN C 253 ? ? -76.92  -166.20 
48 1 ASN C 257 ? ? -168.36 94.89   
49 1 GLN C 275 ? ? -67.60  1.06    
50 1 ARG C 285 ? ? -69.23  29.54   
51 1 PRO C 287 ? ? -51.92  103.65  
52 1 HIS C 288 ? ? 91.56   28.36   
53 1 ALA C 303 ? ? -55.92  0.63    
54 1 SER C 312 ? ? -54.90  -77.83  
55 1 ARG C 334 ? ? -64.78  4.00    
56 1 LEU C 350 ? ? -64.82  -77.97  
57 1 LEU C 353 ? ? -106.88 -68.67  
58 1 ASP C 359 ? ? -47.40  -13.46  
59 1 GLN C 361 ? ? 16.39   72.52   
60 1 LEU C 367 ? ? -55.65  -76.17  
61 1 ASP C 379 ? ? -73.20  33.41   
62 1 ALA C 387 ? ? -46.95  -78.69  
63 1 TYR C 408 ? ? -118.67 58.33   
64 1 PRO C 412 ? ? -38.53  -118.88 
65 1 ILE C 442 ? ? -99.25  -92.44  
66 1 THR C 449 ? ? -31.65  -84.68  
67 1 GLU C 456 ? ? -169.23 106.63  
68 1 GLN D 105 ? ? -61.92  -175.05 
69 1 SER D 107 ? ? -53.27  176.90  
70 1 GLN D 134 ? ? -68.89  18.23   
71 1 PRO D 147 ? ? -67.31  -145.36 
72 1 ASP D 178 ? ? -98.08  44.00   
73 1 GLN D 215 ? ? 81.19   33.23   
74 1 LEU D 239 ? ? -60.68  -72.42  
75 1 ARG D 302 ? ? -99.01  37.19   
76 1 PRO D 303 ? ? -86.34  46.23   
77 1 ASP D 305 ? ? -40.16  179.98  
78 1 MET D 340 ? ? -156.25 86.25   
79 1 GLN E 638 ? ? -99.80  -76.24  
80 1 HIS F 687 ? ? 35.51   51.88   
81 1 LYS F 688 ? ? -52.29  -71.85  
82 1 LEU F 694 ? ? -66.64  5.35    
83 1 GLN F 695 ? ? -60.76  -76.46  
84 1 LEU G 637 ? ? -64.71  9.58    
85 1 GLN G 638 ? ? -122.06 -79.68  
86 1 LEU H 694 ? ? -95.69  58.45   
87 1 GLN H 695 ? ? -143.93 -68.19  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 E LYS 631 ? CG ? E LYS 4 CG 
2  1 Y 1 E LYS 631 ? CD ? E LYS 4 CD 
3  1 Y 1 E LYS 631 ? CE ? E LYS 4 CE 
4  1 Y 1 E LYS 631 ? NZ ? E LYS 4 NZ 
5  1 Y 1 F LYS 688 ? CG ? F LYS 4 CG 
6  1 Y 1 F LYS 688 ? CD ? F LYS 4 CD 
7  1 Y 1 F LYS 688 ? CE ? F LYS 4 CE 
8  1 Y 1 F LYS 688 ? NZ ? F LYS 4 NZ 
9  1 Y 1 G LYS 631 ? CG ? G LYS 4 CG 
10 1 Y 1 G LYS 631 ? CD ? G LYS 4 CD 
11 1 Y 1 G LYS 631 ? CE ? G LYS 4 CE 
12 1 Y 1 G LYS 631 ? NZ ? G LYS 4 NZ 
13 1 Y 1 H LYS 688 ? CG ? H LYS 4 CG 
14 1 Y 1 H LYS 688 ? CD ? H LYS 4 CD 
15 1 Y 1 H LYS 688 ? CE ? H LYS 4 CE 
16 1 Y 1 H LYS 688 ? NZ ? H LYS 4 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS 459 ? A HIS 233 
2  1 Y 1 A GLN 460 ? A GLN 234 
3  1 Y 1 A MET 461 ? A MET 235 
4  1 Y 1 A THR 462 ? A THR 236 
5  1 Y 1 C HIS 459 ? C HIS 233 
6  1 Y 1 C GLN 460 ? C GLN 234 
7  1 Y 1 C MET 461 ? C MET 235 
8  1 Y 1 C THR 462 ? C THR 236 
9  1 Y 1 E GLU 628 ? E GLU 1   
10 1 Y 1 E ARG 629 ? E ARG 2   
11 1 Y 1 E GLY 640 ? E GLY 13  
12 1 Y 1 F GLU 685 ? F GLU 1   
13 1 Y 1 G GLY 640 ? G GLY 13  
14 1 Y 1 H GLY 697 ? H GLY 13  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'PENTADECANOIC ACID'          F15 
5 '(5BETA)-PREGNANE-3,20-DIONE' CI2 
6 water                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 4 F15 1  1003 1  F15 FA  A . 
J 4 F15 1  1002 1  F15 FA  C . 
K 5 CI2 1  1001 1  CI2 CI2 D . 
L 6 HOH 1  6    6  HOH HOH A . 
L 6 HOH 2  9    9  HOH HOH A . 
L 6 HOH 3  10   10 HOH HOH A . 
L 6 HOH 4  13   13 HOH HOH A . 
L 6 HOH 5  15   15 HOH HOH A . 
L 6 HOH 6  16   16 HOH HOH A . 
L 6 HOH 7  19   19 HOH HOH A . 
L 6 HOH 8  20   20 HOH HOH A . 
L 6 HOH 9  36   36 HOH HOH A . 
L 6 HOH 10 39   39 HOH HOH A . 
L 6 HOH 11 43   43 HOH HOH A . 
L 6 HOH 12 46   46 HOH HOH A . 
L 6 HOH 13 54   54 HOH HOH A . 
L 6 HOH 14 58   58 HOH HOH A . 
L 6 HOH 15 69   69 HOH HOH A . 
M 6 HOH 1  4    4  HOH HOH B . 
M 6 HOH 2  5    5  HOH HOH B . 
M 6 HOH 3  14   14 HOH HOH B . 
M 6 HOH 4  17   17 HOH HOH B . 
M 6 HOH 5  18   18 HOH HOH B . 
M 6 HOH 6  21   21 HOH HOH B . 
M 6 HOH 7  37   37 HOH HOH B . 
M 6 HOH 8  38   38 HOH HOH B . 
M 6 HOH 9  40   40 HOH HOH B . 
M 6 HOH 10 41   41 HOH HOH B . 
M 6 HOH 11 53   53 HOH HOH B . 
M 6 HOH 12 56   56 HOH HOH B . 
M 6 HOH 13 61   61 HOH HOH B . 
N 6 HOH 1  3    3  HOH HOH C . 
N 6 HOH 2  8    8  HOH HOH C . 
N 6 HOH 3  22   22 HOH HOH C . 
N 6 HOH 4  26   26 HOH HOH C . 
N 6 HOH 5  28   28 HOH HOH C . 
N 6 HOH 6  29   29 HOH HOH C . 
N 6 HOH 7  32   32 HOH HOH C . 
N 6 HOH 8  33   33 HOH HOH C . 
N 6 HOH 9  35   35 HOH HOH C . 
N 6 HOH 10 44   44 HOH HOH C . 
N 6 HOH 11 47   47 HOH HOH C . 
N 6 HOH 12 55   55 HOH HOH C . 
N 6 HOH 13 62   62 HOH HOH C . 
N 6 HOH 14 66   66 HOH HOH C . 
N 6 HOH 15 68   68 HOH HOH C . 
O 6 HOH 1  1    1  HOH HOH D . 
O 6 HOH 2  2    2  HOH HOH D . 
O 6 HOH 3  7    7  HOH HOH D . 
O 6 HOH 4  12   12 HOH HOH D . 
O 6 HOH 5  24   24 HOH HOH D . 
O 6 HOH 6  27   27 HOH HOH D . 
O 6 HOH 7  30   30 HOH HOH D . 
O 6 HOH 8  31   31 HOH HOH D . 
O 6 HOH 9  34   34 HOH HOH D . 
O 6 HOH 10 42   42 HOH HOH D . 
O 6 HOH 11 45   45 HOH HOH D . 
O 6 HOH 12 49   49 HOH HOH D . 
O 6 HOH 13 50   50 HOH HOH D . 
O 6 HOH 14 52   52 HOH HOH D . 
O 6 HOH 15 59   59 HOH HOH D . 
O 6 HOH 16 60   60 HOH HOH D . 
O 6 HOH 17 64   64 HOH HOH D . 
O 6 HOH 18 65   65 HOH HOH D . 
O 6 HOH 19 67   67 HOH HOH D . 
O 6 HOH 20 70   70 HOH HOH D . 
O 6 HOH 21 71   71 HOH HOH D . 
P 6 HOH 1  25   25 HOH HOH E . 
Q 6 HOH 1  48   48 HOH HOH H . 
#