data_1XVI
# 
_entry.id   1XVI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1XVI         
RCSB  RCSB030811   
WWPDB D_1000030811 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          APC5010 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1XVI 
_pdbx_database_status.recvd_initial_deposition_date   2004-10-28 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kim, Y.'                                       1 
'Joachimiak, A.'                                2 
'Cymborowski, M.'                               3 
'Skarina, T.'                                   4 
'Savchenko, A.'                                 5 
'Edwards, A.'                                   6 
'Midwest Center for Structural Genomics (MCSG)' 7 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kim, Y.'         1 
primary 'Joachimiak, A.'  2 
primary 'Cymborowski, M.' 3 
primary 'Skarina, T.'     4 
primary 'Savchenko, A.'   5 
primary 'Edwards, A.'     6 
# 
_cell.entry_id           1XVI 
_cell.length_a           54.783 
_cell.length_b           79.975 
_cell.length_c           75.471 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.56 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1XVI 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Putative mannosyl-3-phosphoglycerate phosphatase' 30809.578 2   3.1.3.70 ? ? ? 
2 non-polymer syn 'SULFATE ION'                                      96.063    3   ?        ? ? ? 
3 non-polymer syn 'PENTAETHYLENE GLYCOL'                             238.278   1   ?        ? ? ? 
4 non-polymer syn 'TETRAETHYLENE GLYCOL'                             194.226   1   ?        ? ? ? 
5 non-polymer syn 'TRIETHYLENE GLYCOL'                               150.173   1   ?        ? ? ? 
6 water       nat water                                              18.015    388 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MPGP, YEDP' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GHMFSIQQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKTLGLQGLPLIAENGAVIQL
AEQWQEIDGFPRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERM
AQFTARLNELGLQFMQGARFWHVLDASAGKDQAANWIIATYQQLSGKRPTTLGLGDGPNDAPLLEVMDYAVIVKGLNREG
VHLHDEDPARVWRTQREGPEGWREGLDHFFSARGS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GHMFSIQQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKTLGLQGLPLIAENGAVIQL
AEQWQEIDGFPRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERM
AQFTARLNELGLQFMQGARFWHVLDASAGKDQAANWIIATYQQLSGKRPTTLGLGDGPNDAPLLEVMDYAVIVKGLNREG
VHLHDEDPARVWRTQREGPEGWREGLDHFFSARGS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         APC5010 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   PHE n 
1 5   SER n 
1 6   ILE n 
1 7   GLN n 
1 8   GLN n 
1 9   PRO n 
1 10  LEU n 
1 11  LEU n 
1 12  VAL n 
1 13  PHE n 
1 14  SER n 
1 15  ASP n 
1 16  LEU n 
1 17  ASP n 
1 18  GLY n 
1 19  THR n 
1 20  LEU n 
1 21  LEU n 
1 22  ASP n 
1 23  SER n 
1 24  HIS n 
1 25  SER n 
1 26  TYR n 
1 27  ASP n 
1 28  TRP n 
1 29  GLN n 
1 30  PRO n 
1 31  ALA n 
1 32  ALA n 
1 33  PRO n 
1 34  TRP n 
1 35  LEU n 
1 36  THR n 
1 37  ARG n 
1 38  LEU n 
1 39  ARG n 
1 40  GLU n 
1 41  ALA n 
1 42  ASN n 
1 43  VAL n 
1 44  PRO n 
1 45  VAL n 
1 46  ILE n 
1 47  LEU n 
1 48  CYS n 
1 49  SER n 
1 50  SER n 
1 51  LYS n 
1 52  THR n 
1 53  SER n 
1 54  ALA n 
1 55  GLU n 
1 56  MET n 
1 57  LEU n 
1 58  TYR n 
1 59  LEU n 
1 60  GLN n 
1 61  LYS n 
1 62  THR n 
1 63  LEU n 
1 64  GLY n 
1 65  LEU n 
1 66  GLN n 
1 67  GLY n 
1 68  LEU n 
1 69  PRO n 
1 70  LEU n 
1 71  ILE n 
1 72  ALA n 
1 73  GLU n 
1 74  ASN n 
1 75  GLY n 
1 76  ALA n 
1 77  VAL n 
1 78  ILE n 
1 79  GLN n 
1 80  LEU n 
1 81  ALA n 
1 82  GLU n 
1 83  GLN n 
1 84  TRP n 
1 85  GLN n 
1 86  GLU n 
1 87  ILE n 
1 88  ASP n 
1 89  GLY n 
1 90  PHE n 
1 91  PRO n 
1 92  ARG n 
1 93  ILE n 
1 94  ILE n 
1 95  SER n 
1 96  GLY n 
1 97  ILE n 
1 98  SER n 
1 99  HIS n 
1 100 GLY n 
1 101 GLU n 
1 102 ILE n 
1 103 SER n 
1 104 LEU n 
1 105 VAL n 
1 106 LEU n 
1 107 ASN n 
1 108 THR n 
1 109 LEU n 
1 110 ARG n 
1 111 GLU n 
1 112 LYS n 
1 113 GLU n 
1 114 HIS n 
1 115 PHE n 
1 116 LYS n 
1 117 PHE n 
1 118 THR n 
1 119 THR n 
1 120 PHE n 
1 121 ASP n 
1 122 ASP n 
1 123 VAL n 
1 124 ASP n 
1 125 ASP n 
1 126 ALA n 
1 127 THR n 
1 128 ILE n 
1 129 ALA n 
1 130 GLU n 
1 131 TRP n 
1 132 THR n 
1 133 GLY n 
1 134 LEU n 
1 135 SER n 
1 136 ARG n 
1 137 SER n 
1 138 GLN n 
1 139 ALA n 
1 140 ALA n 
1 141 LEU n 
1 142 THR n 
1 143 GLN n 
1 144 LEU n 
1 145 HIS n 
1 146 GLU n 
1 147 ALA n 
1 148 SER n 
1 149 VAL n 
1 150 THR n 
1 151 LEU n 
1 152 ILE n 
1 153 TRP n 
1 154 ARG n 
1 155 ASP n 
1 156 SER n 
1 157 ASP n 
1 158 GLU n 
1 159 ARG n 
1 160 MET n 
1 161 ALA n 
1 162 GLN n 
1 163 PHE n 
1 164 THR n 
1 165 ALA n 
1 166 ARG n 
1 167 LEU n 
1 168 ASN n 
1 169 GLU n 
1 170 LEU n 
1 171 GLY n 
1 172 LEU n 
1 173 GLN n 
1 174 PHE n 
1 175 MET n 
1 176 GLN n 
1 177 GLY n 
1 178 ALA n 
1 179 ARG n 
1 180 PHE n 
1 181 TRP n 
1 182 HIS n 
1 183 VAL n 
1 184 LEU n 
1 185 ASP n 
1 186 ALA n 
1 187 SER n 
1 188 ALA n 
1 189 GLY n 
1 190 LYS n 
1 191 ASP n 
1 192 GLN n 
1 193 ALA n 
1 194 ALA n 
1 195 ASN n 
1 196 TRP n 
1 197 ILE n 
1 198 ILE n 
1 199 ALA n 
1 200 THR n 
1 201 TYR n 
1 202 GLN n 
1 203 GLN n 
1 204 LEU n 
1 205 SER n 
1 206 GLY n 
1 207 LYS n 
1 208 ARG n 
1 209 PRO n 
1 210 THR n 
1 211 THR n 
1 212 LEU n 
1 213 GLY n 
1 214 LEU n 
1 215 GLY n 
1 216 ASP n 
1 217 GLY n 
1 218 PRO n 
1 219 ASN n 
1 220 ASP n 
1 221 ALA n 
1 222 PRO n 
1 223 LEU n 
1 224 LEU n 
1 225 GLU n 
1 226 VAL n 
1 227 MET n 
1 228 ASP n 
1 229 TYR n 
1 230 ALA n 
1 231 VAL n 
1 232 ILE n 
1 233 VAL n 
1 234 LYS n 
1 235 GLY n 
1 236 LEU n 
1 237 ASN n 
1 238 ARG n 
1 239 GLU n 
1 240 GLY n 
1 241 VAL n 
1 242 HIS n 
1 243 LEU n 
1 244 HIS n 
1 245 ASP n 
1 246 GLU n 
1 247 ASP n 
1 248 PRO n 
1 249 ALA n 
1 250 ARG n 
1 251 VAL n 
1 252 TRP n 
1 253 ARG n 
1 254 THR n 
1 255 GLN n 
1 256 ARG n 
1 257 GLU n 
1 258 GLY n 
1 259 PRO n 
1 260 GLU n 
1 261 GLY n 
1 262 TRP n 
1 263 ARG n 
1 264 GLU n 
1 265 GLY n 
1 266 LEU n 
1 267 ASP n 
1 268 HIS n 
1 269 PHE n 
1 270 PHE n 
1 271 SER n 
1 272 ALA n 
1 273 ARG n 
1 274 GLY n 
1 275 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 yedP 
_entity_src_gen.gene_src_species                   'Escherichia coli' 
_entity_src_gen.gene_src_strain                    k12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli K12' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21DE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MPGP_ECOLI 
_struct_ref.pdbx_db_accession          P76329 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MFSIQQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKTLGLQGLPLIAENGAVIQLAE
QWQEIDGFPRIISGISHGEISLVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQ
FTARLNELGLQFMQGARFWHVLDASAGKDQAANWIIATYQQLSGKRPTTLGLGDGPNDAPLLEVMDYAVIVKGLNREGVH
LHDEDPARVWRTQREGPEGWREGLDHFFSAR
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1XVI A 3 ? 273 ? P76329 1 ? 271 ? 1 271 
2 1 1XVI B 3 ? 273 ? P76329 1 ? 271 ? 1 271 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1XVI GLY A 1   ? UNP P76329 ? ? 'CLONING ARTIFACT' -1  1 
1 1XVI HIS A 2   ? UNP P76329 ? ? 'CLONING ARTIFACT' 0   2 
1 1XVI GLY A 274 ? UNP P76329 ? ? 'CLONING ARTIFACT' 272 3 
1 1XVI SER A 275 ? UNP P76329 ? ? 'CLONING ARTIFACT' 273 4 
2 1XVI GLY B 1   ? UNP P76329 ? ? 'CLONING ARTIFACT' -1  5 
2 1XVI HIS B 2   ? UNP P76329 ? ? 'CLONING ARTIFACT' 0   6 
2 1XVI GLY B 274 ? UNP P76329 ? ? 'CLONING ARTIFACT' 272 7 
2 1XVI SER B 275 ? UNP P76329 ? ? 'CLONING ARTIFACT' 273 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6'     238.278 
ALA 'L-peptide linking' y ALANINE                ?      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE               ?      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE             ?      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'        ?      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE               ?      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE              ?      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'        ?      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                ?      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE              ?      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                  ?      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE             ?      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                ?      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                 ?      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE             ?      'C5 H11 N O2 S'  149.211 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL' ?      'C8 H18 O5'      194.226 
PGE non-polymer         . 'TRIETHYLENE GLYCOL'   ?      'C6 H14 O4'      150.173 
PHE 'L-peptide linking' y PHENYLALANINE          ?      'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                ?      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                 ?      'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'          ?      'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE              ?      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN             ?      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE               ?      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                 ?      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1XVI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.7 
_exptl_crystal.density_percent_sol   54.8 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, ammonium sulfate, sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD SBC-3 2004-05-30 mirrors 
2 CCD SBC-3 2004-05-30 mirrors 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M 'double crystal' 'SINGLE WAVELENGTH' x-ray 
2 1 M 'double crystal' 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.98016 1.0 
2 0.98032 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 19-BM' APS 19-BM ? 0.98016 
2 SYNCHROTRON 'APS BEAMLINE 19-BM' APS 19-BM ? 0.98032 
# 
_reflns.entry_id                     1XVI 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            2.26 
_reflns.d_resolution_low             74.33 
_reflns.number_all                   30945 
_reflns.number_obs                   30085 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.26 
_reflns_shell.d_res_low              2.35 
_reflns_shell.percent_possible_all   95.4 
_reflns_shell.Rmerge_I_obs           0.219 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.9 
_reflns_shell.pdbx_redundancy        3.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2868 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1XVI 
_refine.ls_number_reflns_obs                     26247 
_refine.ls_number_reflns_all                     26247 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             74.33 
_refine.ls_d_res_high                            2.26 
_refine.ls_percent_reflns_obs                    96.80 
_refine.ls_R_factor_obs                          0.19 
_refine.ls_R_factor_all                          0.19 
_refine.ls_R_factor_R_work                       0.18388 
_refine.ls_R_factor_R_free                       0.24334 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  2964 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.948 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               32.188 
_refine.aniso_B[1][1]                            0.12 
_refine.aniso_B[2][2]                            -0.08 
_refine.aniso_B[3][3]                            -0.46 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.26 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.287 
_refine.pdbx_overall_ESU_R_Free                  0.230 
_refine.overall_SU_ML                            0.147 
_refine.overall_SU_B                             12.553 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3724 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             388 
_refine_hist.number_atoms_total               4166 
_refine_hist.d_res_high                       2.26 
_refine_hist.d_res_low                        74.33 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.012  0.022  ? 3865 'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.408  1.965  ? 5267 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.303  5.000  ? 492  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.604 24.972 ? 181  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.140 15.000 ? 647  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   13.607 15.000 ? 21   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.093  0.200  ? 593  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 2916 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.203  0.200  ? 1725 'X-RAY DIFFRACTION' ? 
r_nbd_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.189  0.200  ? 359  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.176  0.200  ? 86   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.179  0.200  ? 31   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.913  1.500  ? 2414 'X-RAY DIFFRACTION' ? 
r_mcbond_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.593  2.000  ? 3801 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.864  3.000  ? 1651 'X-RAY DIFFRACTION' ? 
r_scangle_it             2.950  4.500  ? 1452 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.26 
_refine_ls_shell.d_res_low                        2.320 
_refine_ls_shell.number_reflns_R_work             1736 
_refine_ls_shell.R_factor_R_work                  0.191 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.25 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             184 
_refine_ls_shell.number_reflns_obs                1736 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1XVI 
_struct.title                     'Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12' 
_struct.pdbx_descriptor           'Putative mannosyl-3-phosphoglycerate phosphatase (E.C.3.1.3.70)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1XVI 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;hypothetical protein, conserved protein, phophatase-like domain, predicted hydrolase, Sucrose-6F-phosphate phosphohydrolase (S6PP), structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics, hydrolase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 31  ? ALA A 41  ? ALA A 29  ALA A 39  1 ? 11 
HELX_P HELX_P2  2  THR A 52  ? LEU A 63  ? THR A 50  LEU A 61  1 ? 12 
HELX_P HELX_P3  3  GLU A 73  ? GLY A 75  ? GLU A 71  GLY A 73  5 ? 3  
HELX_P HELX_P4  4  SER A 98  ? HIS A 114 ? SER A 96  HIS A 112 1 ? 17 
HELX_P HELX_P5  5  ASP A 121 ? VAL A 123 ? ASP A 119 VAL A 121 5 ? 3  
HELX_P HELX_P6  6  ASP A 124 ? GLY A 133 ? ASP A 122 GLY A 131 1 ? 10 
HELX_P HELX_P7  7  SER A 135 ? LEU A 144 ? SER A 133 LEU A 142 1 ? 10 
HELX_P HELX_P8  8  SER A 156 ? LEU A 170 ? SER A 154 LEU A 168 1 ? 15 
HELX_P HELX_P9  9  GLY A 189 ? GLY A 206 ? GLY A 187 GLY A 204 1 ? 18 
HELX_P HELX_P10 10 GLY A 217 ? ASN A 219 ? GLY A 215 ASN A 217 5 ? 3  
HELX_P HELX_P11 11 ASP A 220 ? VAL A 226 ? ASP A 218 VAL A 224 1 ? 7  
HELX_P HELX_P12 12 ALA B 31  ? ALA B 41  ? ALA B 29  ALA B 39  1 ? 11 
HELX_P HELX_P13 13 THR B 52  ? LEU B 63  ? THR B 50  LEU B 61  1 ? 12 
HELX_P HELX_P14 14 GLU B 73  ? GLY B 75  ? GLU B 71  GLY B 73  5 ? 3  
HELX_P HELX_P15 15 SER B 98  ? HIS B 114 ? SER B 96  HIS B 112 1 ? 17 
HELX_P HELX_P16 16 ASP B 121 ? VAL B 123 ? ASP B 119 VAL B 121 5 ? 3  
HELX_P HELX_P17 17 ASP B 124 ? GLY B 133 ? ASP B 122 GLY B 131 1 ? 10 
HELX_P HELX_P18 18 SER B 135 ? GLN B 143 ? SER B 133 GLN B 141 1 ? 9  
HELX_P HELX_P19 19 SER B 156 ? LEU B 170 ? SER B 154 LEU B 168 1 ? 15 
HELX_P HELX_P20 20 GLY B 189 ? GLY B 206 ? GLY B 187 GLY B 204 1 ? 18 
HELX_P HELX_P21 21 GLY B 217 ? ASN B 219 ? GLY B 215 ASN B 217 5 ? 3  
HELX_P HELX_P22 22 ASP B 220 ? VAL B 226 ? ASP B 218 VAL B 224 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 90 A . ? PHE 88 A PRO 91 A ? PRO 89 A 1 3.10  
2 PHE 90 B . ? PHE 88 B PRO 91 B ? PRO 89 B 1 -5.81 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 4 ? 
C ? 7 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 92  ? ILE A 94  ? ARG A 90  ILE A 92  
A 2 VAL A 77  ? GLN A 79  ? VAL A 75  GLN A 77  
A 3 LEU A 70  ? ALA A 72  ? LEU A 68  ALA A 70  
A 4 VAL A 45  ? CYS A 48  ? VAL A 43  CYS A 46  
A 5 LEU A 10  ? ASP A 15  ? LEU A 8   ASP A 13  
A 6 THR A 210 ? GLY A 215 ? THR A 208 GLY A 213 
A 7 TYR A 229 ? ILE A 232 ? TYR A 227 ILE A 230 
B 1 PHE A 117 ? THR A 119 ? PHE A 115 THR A 117 
B 2 VAL A 149 ? TRP A 153 ? VAL A 147 TRP A 151 
B 3 TRP A 181 ? ASP A 185 ? TRP A 179 ASP A 183 
B 4 LEU A 172 ? GLN A 176 ? LEU A 170 GLN A 174 
C 1 ARG B 92  ? ILE B 94  ? ARG B 90  ILE B 92  
C 2 VAL B 77  ? GLN B 79  ? VAL B 75  GLN B 77  
C 3 LEU B 70  ? ALA B 72  ? LEU B 68  ALA B 70  
C 4 VAL B 45  ? CYS B 48  ? VAL B 43  CYS B 46  
C 5 LEU B 10  ? ASP B 15  ? LEU B 8   ASP B 13  
C 6 THR B 210 ? GLY B 215 ? THR B 208 GLY B 213 
C 7 TYR B 229 ? ILE B 232 ? TYR B 227 ILE B 230 
D 1 PHE B 117 ? THR B 119 ? PHE B 115 THR B 117 
D 2 SER B 148 ? TRP B 153 ? SER B 146 TRP B 151 
D 3 TRP B 181 ? ASP B 185 ? TRP B 179 ASP B 183 
D 4 LEU B 172 ? GLN B 176 ? LEU B 170 GLN B 174 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 93  ? O ILE A 91  N ILE A 78  ? N ILE A 76  
A 2 3 O VAL A 77  ? O VAL A 75  N ALA A 72  ? N ALA A 70  
A 3 4 O ILE A 71  ? O ILE A 69  N LEU A 47  ? N LEU A 45  
A 4 5 O ILE A 46  ? O ILE A 44  N VAL A 12  ? N VAL A 10  
A 5 6 N PHE A 13  ? N PHE A 11  O LEU A 212 ? O LEU A 210 
A 6 7 N GLY A 213 ? N GLY A 211 O TYR A 229 ? O TYR A 227 
B 1 2 N THR A 118 ? N THR A 116 O ILE A 152 ? O ILE A 150 
B 2 3 N VAL A 149 ? N VAL A 147 O VAL A 183 ? O VAL A 181 
B 3 4 O LEU A 184 ? O LEU A 182 N GLN A 173 ? N GLN A 171 
C 1 2 O ILE B 93  ? O ILE B 91  N ILE B 78  ? N ILE B 76  
C 2 3 O VAL B 77  ? O VAL B 75  N ALA B 72  ? N ALA B 70  
C 3 4 O ILE B 71  ? O ILE B 69  N LEU B 47  ? N LEU B 45  
C 4 5 O ILE B 46  ? O ILE B 44  N VAL B 12  ? N VAL B 10  
C 5 6 N PHE B 13  ? N PHE B 11  O LEU B 212 ? O LEU B 210 
C 6 7 N GLY B 213 ? N GLY B 211 O TYR B 229 ? O TYR B 227 
D 1 2 N THR B 118 ? N THR B 116 O ILE B 152 ? O ILE B 150 
D 2 3 N VAL B 149 ? N VAL B 147 O VAL B 183 ? O VAL B 181 
D 3 4 O HIS B 182 ? O HIS B 180 N MET B 175 ? N MET B 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 501' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 502' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 503' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 1PE A 601' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PG4 A 602' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PGE A 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLY A 177 ? GLY A 175 . ? 1_555 ? 
2  AC1 5 ALA A 178 ? ALA A 176 . ? 1_555 ? 
3  AC1 5 ARG A 179 ? ARG A 177 . ? 1_555 ? 
4  AC1 5 PHE A 180 ? PHE A 178 . ? 1_555 ? 
5  AC1 5 HIS A 182 ? HIS A 180 . ? 1_555 ? 
6  AC2 4 ILE A 78  ? ILE A 76  . ? 1_555 ? 
7  AC2 4 GLN A 192 ? GLN A 190 . ? 1_555 ? 
8  AC2 4 TRP A 196 ? TRP A 194 . ? 1_555 ? 
9  AC2 4 HOH I .   ? HOH A 787 . ? 1_555 ? 
10 AC3 6 SER B 50  ? SER B 48  . ? 1_555 ? 
11 AC3 6 GLY B 177 ? GLY B 175 . ? 1_555 ? 
12 AC3 6 ALA B 178 ? ALA B 176 . ? 1_555 ? 
13 AC3 6 ARG B 179 ? ARG B 177 . ? 1_555 ? 
14 AC3 6 PHE B 180 ? PHE B 178 . ? 1_555 ? 
15 AC3 6 HIS B 182 ? HIS B 180 . ? 1_555 ? 
16 AC4 7 LEU A 38  ? LEU A 36  . ? 1_555 ? 
17 AC4 7 LEU A 214 ? LEU A 212 . ? 1_555 ? 
18 AC4 7 TYR A 229 ? TYR A 227 . ? 1_555 ? 
19 AC4 7 PG4 F .   ? PG4 A 602 . ? 1_555 ? 
20 AC4 7 HOH I .   ? HOH A 668 . ? 1_555 ? 
21 AC4 7 HOH I .   ? HOH A 740 . ? 1_555 ? 
22 AC4 7 HOH I .   ? HOH A 762 . ? 1_555 ? 
23 AC5 5 ALA A 31  ? ALA A 29  . ? 1_555 ? 
24 AC5 5 TRP A 34  ? TRP A 32  . ? 1_555 ? 
25 AC5 5 1PE E .   ? 1PE A 601 . ? 1_555 ? 
26 AC5 5 PGE G .   ? PGE A 603 . ? 1_555 ? 
27 AC5 5 HOH I .   ? HOH A 761 . ? 1_555 ? 
28 AC6 1 PG4 F .   ? PG4 A 602 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1XVI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1XVI 
_atom_sites.fract_transf_matrix[1][1]   0.018254 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003074 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012504 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013437 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 6   ? -4.889  8.320   33.678  1.00 34.20  ? 4   ILE A N   1 
ATOM   2    C CA  . ILE A 1 6   ? -4.380  7.661   32.423  1.00 34.05  ? 4   ILE A CA  1 
ATOM   3    C C   . ILE A 1 6   ? -2.948  7.125   32.696  1.00 32.70  ? 4   ILE A C   1 
ATOM   4    O O   . ILE A 1 6   ? -2.140  7.783   33.367  1.00 32.48  ? 4   ILE A O   1 
ATOM   5    C CB  . ILE A 1 6   ? -4.573  8.600   31.156  1.00 34.69  ? 4   ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 6   ? -5.542  7.987   30.116  1.00 37.40  ? 4   ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 6   ? -3.268  8.986   30.480  1.00 35.60  ? 4   ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 6   ? -7.031  7.840   30.579  1.00 39.83  ? 4   ILE A CD1 1 
ATOM   9    N N   . GLN A 1 7   ? -2.674  5.899   32.260  1.00 30.73  ? 5   GLN A N   1 
ATOM   10   C CA  . GLN A 1 7   ? -1.423  5.243   32.611  1.00 29.53  ? 5   GLN A CA  1 
ATOM   11   C C   . GLN A 1 7   ? -0.204  5.830   31.914  1.00 27.90  ? 5   GLN A C   1 
ATOM   12   O O   . GLN A 1 7   ? -0.319  6.558   30.914  1.00 26.80  ? 5   GLN A O   1 
ATOM   13   C CB  . GLN A 1 7   ? -1.490  3.717   32.406  1.00 30.04  ? 5   GLN A CB  1 
ATOM   14   C CG  . GLN A 1 7   ? -1.864  3.222   31.035  1.00 30.73  ? 5   GLN A CG  1 
ATOM   15   C CD  . GLN A 1 7   ? -2.222  1.734   31.053  1.00 30.81  ? 5   GLN A CD  1 
ATOM   16   O OE1 . GLN A 1 7   ? -1.672  0.961   31.834  1.00 33.18  ? 5   GLN A OE1 1 
ATOM   17   N NE2 . GLN A 1 7   ? -3.145  1.338   30.202  1.00 31.97  ? 5   GLN A NE2 1 
ATOM   18   N N   . GLN A 1 8   ? 0.971   5.538   32.471  1.00 25.54  ? 6   GLN A N   1 
ATOM   19   C CA  . GLN A 1 8   ? 2.193   6.015   31.865  1.00 23.59  ? 6   GLN A CA  1 
ATOM   20   C C   . GLN A 1 8   ? 2.255   5.546   30.413  1.00 21.39  ? 6   GLN A C   1 
ATOM   21   O O   . GLN A 1 8   ? 2.039   4.379   30.130  1.00 21.22  ? 6   GLN A O   1 
ATOM   22   C CB  . GLN A 1 8   ? 3.415   5.533   32.624  1.00 24.45  ? 6   GLN A CB  1 
ATOM   23   C CG  . GLN A 1 8   ? 4.678   6.158   32.081  1.00 26.17  ? 6   GLN A CG  1 
ATOM   24   C CD  . GLN A 1 8   ? 5.885   5.306   32.306  1.00 31.64  ? 6   GLN A CD  1 
ATOM   25   O OE1 . GLN A 1 8   ? 5.870   4.375   33.129  1.00 30.96  ? 6   GLN A OE1 1 
ATOM   26   N NE2 . GLN A 1 8   ? 6.965   5.611   31.565  1.00 33.94  ? 6   GLN A NE2 1 
ATOM   27   N N   . PRO A 1 9   ? 2.477   6.470   29.480  1.00 19.96  ? 7   PRO A N   1 
ATOM   28   C CA  . PRO A 1 9   ? 2.564   6.017   28.092  1.00 18.95  ? 7   PRO A CA  1 
ATOM   29   C C   . PRO A 1 9   ? 3.835   5.239   27.798  1.00 18.65  ? 7   PRO A C   1 
ATOM   30   O O   . PRO A 1 9   ? 4.935   5.691   28.147  1.00 18.38  ? 7   PRO A O   1 
ATOM   31   C CB  . PRO A 1 9   ? 2.510   7.327   27.283  1.00 18.04  ? 7   PRO A CB  1 
ATOM   32   C CG  . PRO A 1 9   ? 1.943   8.331   28.231  1.00 18.01  ? 7   PRO A CG  1 
ATOM   33   C CD  . PRO A 1 9   ? 2.504   7.944   29.576  1.00 18.86  ? 7   PRO A CD  1 
ATOM   34   N N   . LEU A 1 10  ? 3.651   4.082   27.152  1.00 17.77  ? 8   LEU A N   1 
ATOM   35   C CA  . LEU A 1 10  ? 4.720   3.221   26.679  1.00 17.13  ? 8   LEU A CA  1 
ATOM   36   C C   . LEU A 1 10  ? 4.560   3.149   25.176  1.00 17.09  ? 8   LEU A C   1 
ATOM   37   O O   . LEU A 1 10  ? 3.670   2.473   24.683  1.00 17.37  ? 8   LEU A O   1 
ATOM   38   C CB  . LEU A 1 10  ? 4.618   1.808   27.311  1.00 16.54  ? 8   LEU A CB  1 
ATOM   39   C CG  . LEU A 1 10  ? 4.806   1.675   28.832  1.00 16.12  ? 8   LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 10  ? 4.742   0.200   29.291  1.00 15.41  ? 8   LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 10  ? 6.110   2.341   29.310  1.00 9.01   ? 8   LEU A CD2 1 
ATOM   42   N N   . LEU A 1 11  ? 5.415   3.863   24.449  1.00 16.89  ? 9   LEU A N   1 
ATOM   43   C CA  . LEU A 1 11  ? 5.188   4.114   23.021  1.00 16.84  ? 9   LEU A CA  1 
ATOM   44   C C   . LEU A 1 11  ? 6.232   3.485   22.137  1.00 16.99  ? 9   LEU A C   1 
ATOM   45   O O   . LEU A 1 11  ? 7.434   3.651   22.365  1.00 16.42  ? 9   LEU A O   1 
ATOM   46   C CB  . LEU A 1 11  ? 5.198   5.624   22.707  1.00 16.27  ? 9   LEU A CB  1 
ATOM   47   C CG  . LEU A 1 11  ? 4.397   6.592   23.545  1.00 16.27  ? 9   LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 11  ? 4.728   8.035   23.075  1.00 13.87  ? 9   LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 11  ? 2.861   6.262   23.468  1.00 13.65  ? 9   LEU A CD2 1 
ATOM   50   N N   . VAL A 1 12  ? 5.761   2.830   21.085  1.00 17.83  ? 10  VAL A N   1 
ATOM   51   C CA  . VAL A 1 12  ? 6.654   2.257   20.089  1.00 18.99  ? 10  VAL A CA  1 
ATOM   52   C C   . VAL A 1 12  ? 6.567   3.054   18.793  1.00 19.64  ? 10  VAL A C   1 
ATOM   53   O O   . VAL A 1 12  ? 5.472   3.212   18.224  1.00 20.26  ? 10  VAL A O   1 
ATOM   54   C CB  . VAL A 1 12  ? 6.315   0.762   19.796  1.00 19.76  ? 10  VAL A CB  1 
ATOM   55   C CG1 . VAL A 1 12  ? 7.330   0.166   18.789  1.00 19.56  ? 10  VAL A CG1 1 
ATOM   56   C CG2 . VAL A 1 12  ? 6.278   -0.056  21.086  1.00 17.14  ? 10  VAL A CG2 1 
ATOM   57   N N   . PHE A 1 13  ? 7.715   3.556   18.335  1.00 19.58  ? 11  PHE A N   1 
ATOM   58   C CA  . PHE A 1 13  ? 7.828   4.178   17.013  1.00 19.74  ? 11  PHE A CA  1 
ATOM   59   C C   . PHE A 1 13  ? 8.481   3.239   16.008  1.00 20.86  ? 11  PHE A C   1 
ATOM   60   O O   . PHE A 1 13  ? 9.654   2.902   16.117  1.00 20.33  ? 11  PHE A O   1 
ATOM   61   C CB  . PHE A 1 13  ? 8.607   5.480   17.110  1.00 18.36  ? 11  PHE A CB  1 
ATOM   62   C CG  . PHE A 1 13  ? 7.877   6.560   17.879  1.00 18.08  ? 11  PHE A CG  1 
ATOM   63   C CD1 . PHE A 1 13  ? 7.909   6.588   19.279  1.00 13.52  ? 11  PHE A CD1 1 
ATOM   64   C CD2 . PHE A 1 13  ? 7.157   7.546   17.206  1.00 14.95  ? 11  PHE A CD2 1 
ATOM   65   C CE1 . PHE A 1 13  ? 7.263   7.596   19.973  1.00 12.62  ? 11  PHE A CE1 1 
ATOM   66   C CE2 . PHE A 1 13  ? 6.509   8.553   17.916  1.00 11.51  ? 11  PHE A CE2 1 
ATOM   67   C CZ  . PHE A 1 13  ? 6.559   8.566   19.281  1.00 12.98  ? 11  PHE A CZ  1 
ATOM   68   N N   . SER A 1 14  ? 7.702   2.822   15.023  1.00 22.67  ? 12  SER A N   1 
ATOM   69   C CA  . SER A 1 14  ? 8.130   1.772   14.123  1.00 24.68  ? 12  SER A CA  1 
ATOM   70   C C   . SER A 1 14  ? 8.361   2.289   12.728  1.00 25.60  ? 12  SER A C   1 
ATOM   71   O O   . SER A 1 14  ? 7.409   2.645   12.039  1.00 25.32  ? 12  SER A O   1 
ATOM   72   C CB  . SER A 1 14  ? 7.066   0.667   14.074  1.00 25.09  ? 12  SER A CB  1 
ATOM   73   O OG  . SER A 1 14  ? 7.429   -0.315  13.116  1.00 25.50  ? 12  SER A OG  1 
ATOM   74   N N   . ASP A 1 15  ? 9.618   2.314   12.306  1.00 27.82  ? 13  ASP A N   1 
ATOM   75   C CA  . ASP A 1 15  ? 9.955   2.668   10.923  1.00 30.97  ? 13  ASP A CA  1 
ATOM   76   C C   . ASP A 1 15  ? 10.465  1.411   10.192  1.00 32.85  ? 13  ASP A C   1 
ATOM   77   O O   . ASP A 1 15  ? 11.648  1.283   9.870   1.00 32.77  ? 13  ASP A O   1 
ATOM   78   C CB  . ASP A 1 15  ? 10.990  3.798   10.899  1.00 30.99  ? 13  ASP A CB  1 
ATOM   79   C CG  . ASP A 1 15  ? 11.015  4.557   9.571   1.00 32.55  ? 13  ASP A CG  1 
ATOM   80   O OD1 . ASP A 1 15  ? 10.632  4.007   8.512   1.00 32.29  ? 13  ASP A OD1 1 
ATOM   81   O OD2 . ASP A 1 15  ? 11.434  5.728   9.588   1.00 35.63  ? 13  ASP A OD2 1 
ATOM   82   N N   . LEU A 1 16  ? 9.554   0.478   9.955   1.00 35.53  ? 14  LEU A N   1 
ATOM   83   C CA  . LEU A 1 16  ? 9.930   -0.861  9.515   1.00 38.37  ? 14  LEU A CA  1 
ATOM   84   C C   . LEU A 1 16  ? 9.112   -1.326  8.317   1.00 40.89  ? 14  LEU A C   1 
ATOM   85   O O   . LEU A 1 16  ? 8.721   -2.493  8.252   1.00 41.95  ? 14  LEU A O   1 
ATOM   86   C CB  . LEU A 1 16  ? 9.733   -1.883  10.641  1.00 37.53  ? 14  LEU A CB  1 
ATOM   87   C CG  . LEU A 1 16  ? 10.410  -1.893  12.004  1.00 36.37  ? 14  LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 16  ? 9.790   -3.018  12.808  1.00 35.85  ? 14  LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 16  ? 11.907  -2.076  11.888  1.00 34.28  ? 14  LEU A CD2 1 
ATOM   90   N N   . ASP A 1 17  ? 8.831   -0.430  7.380   1.00 44.13  ? 15  ASP A N   1 
ATOM   91   C CA  . ASP A 1 17  ? 8.236   -0.864  6.121   1.00 47.40  ? 15  ASP A CA  1 
ATOM   92   C C   . ASP A 1 17  ? 9.289   -1.732  5.444   1.00 48.71  ? 15  ASP A C   1 
ATOM   93   O O   . ASP A 1 17  ? 10.438  -1.297  5.260   1.00 49.32  ? 15  ASP A O   1 
ATOM   94   C CB  . ASP A 1 17  ? 7.877   0.320   5.206   1.00 47.77  ? 15  ASP A CB  1 
ATOM   95   C CG  . ASP A 1 17  ? 7.090   1.424   5.917   1.00 49.87  ? 15  ASP A CG  1 
ATOM   96   O OD1 . ASP A 1 17  ? 6.166   1.128   6.725   1.00 51.23  ? 15  ASP A OD1 1 
ATOM   97   O OD2 . ASP A 1 17  ? 7.405   2.607   5.632   1.00 51.93  ? 15  ASP A OD2 1 
ATOM   98   N N   . GLY A 1 18  ? 8.922   -2.961  5.106   1.00 49.88  ? 16  GLY A N   1 
ATOM   99   C CA  . GLY A 1 18  ? 9.885   -3.854  4.462   1.00 51.97  ? 16  GLY A CA  1 
ATOM   100  C C   . GLY A 1 18  ? 10.459  -4.901  5.399   1.00 53.04  ? 16  GLY A C   1 
ATOM   101  O O   . GLY A 1 18  ? 11.220  -5.777  4.973   1.00 53.54  ? 16  GLY A O   1 
ATOM   102  N N   . THR A 1 19  ? 10.110  -4.798  6.677   1.00 53.75  ? 17  THR A N   1 
ATOM   103  C CA  . THR A 1 19  ? 10.311  -5.894  7.618   1.00 54.41  ? 17  THR A CA  1 
ATOM   104  C C   . THR A 1 19  ? 8.939   -6.334  8.162   1.00 55.10  ? 17  THR A C   1 
ATOM   105  O O   . THR A 1 19  ? 8.655   -7.527  8.192   1.00 55.26  ? 17  THR A O   1 
ATOM   106  C CB  . THR A 1 19  ? 11.315  -5.536  8.766   1.00 54.32  ? 17  THR A CB  1 
ATOM   107  O OG1 . THR A 1 19  ? 12.507  -4.966  8.210   1.00 54.19  ? 17  THR A OG1 1 
ATOM   108  C CG2 . THR A 1 19  ? 11.688  -6.775  9.578   1.00 53.52  ? 17  THR A CG2 1 
ATOM   109  N N   . LEU A 1 20  ? 8.094   -5.373  8.559   1.00 55.93  ? 18  LEU A N   1 
ATOM   110  C CA  . LEU A 1 20  ? 6.754   -5.654  9.118   1.00 56.72  ? 18  LEU A CA  1 
ATOM   111  C C   . LEU A 1 20  ? 5.732   -6.139  8.085   1.00 57.37  ? 18  LEU A C   1 
ATOM   112  O O   . LEU A 1 20  ? 4.913   -7.024  8.374   1.00 57.30  ? 18  LEU A O   1 
ATOM   113  C CB  . LEU A 1 20  ? 6.173   -4.419  9.827   1.00 56.44  ? 18  LEU A CB  1 
ATOM   114  C CG  . LEU A 1 20  ? 6.111   -4.299  11.360  1.00 56.90  ? 18  LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 20  ? 5.358   -3.033  11.754  1.00 56.08  ? 18  LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 20  ? 5.472   -5.512  12.043  1.00 55.44  ? 18  LEU A CD2 1 
ATOM   117  N N   . LEU A 1 21  ? 5.777   -5.540  6.895   1.00 58.17  ? 19  LEU A N   1 
ATOM   118  C CA  . LEU A 1 21  ? 4.753   -5.741  5.869   1.00 59.03  ? 19  LEU A CA  1 
ATOM   119  C C   . LEU A 1 21  ? 5.011   -6.978  5.014   1.00 59.97  ? 19  LEU A C   1 
ATOM   120  O O   . LEU A 1 21  ? 6.157   -7.257  4.636   1.00 59.64  ? 19  LEU A O   1 
ATOM   121  C CB  . LEU A 1 21  ? 4.636   -4.506  4.965   1.00 58.74  ? 19  LEU A CB  1 
ATOM   122  C CG  . LEU A 1 21  ? 4.510   -3.122  5.604   1.00 58.11  ? 19  LEU A CG  1 
ATOM   123  C CD1 . LEU A 1 21  ? 4.653   -2.053  4.549   1.00 57.17  ? 19  LEU A CD1 1 
ATOM   124  C CD2 . LEU A 1 21  ? 3.197   -2.980  6.362   1.00 58.49  ? 19  LEU A CD2 1 
ATOM   125  N N   . ASP A 1 22  ? 3.932   -7.703  4.711   1.00 61.34  ? 20  ASP A N   1 
ATOM   126  C CA  . ASP A 1 22  ? 3.985   -8.839  3.788   1.00 62.83  ? 20  ASP A CA  1 
ATOM   127  C C   . ASP A 1 22  ? 4.344   -8.363  2.371   1.00 63.56  ? 20  ASP A C   1 
ATOM   128  O O   . ASP A 1 22  ? 3.609   -7.568  1.760   1.00 63.47  ? 20  ASP A O   1 
ATOM   129  C CB  . ASP A 1 22  ? 2.658   -9.615  3.791   1.00 63.06  ? 20  ASP A CB  1 
ATOM   130  C CG  . ASP A 1 22  ? 2.809   -11.059 3.287   1.00 63.78  ? 20  ASP A CG  1 
ATOM   131  O OD1 . ASP A 1 22  ? 3.737   -11.341 2.496   1.00 64.19  ? 20  ASP A OD1 1 
ATOM   132  O OD2 . ASP A 1 22  ? 1.980   -11.915 3.676   1.00 64.95  ? 20  ASP A OD2 1 
ATOM   133  N N   . SER A 1 23  ? 5.482   -8.867  1.878   1.00 64.43  ? 21  SER A N   1 
ATOM   134  C CA  . SER A 1 23  ? 6.103   -8.454  0.605   1.00 65.28  ? 21  SER A CA  1 
ATOM   135  C C   . SER A 1 23  ? 5.123   -8.396  -0.569  1.00 65.57  ? 21  SER A C   1 
ATOM   136  O O   . SER A 1 23  ? 5.137   -7.447  -1.364  1.00 65.51  ? 21  SER A O   1 
ATOM   137  C CB  . SER A 1 23  ? 7.247   -9.414  0.251   1.00 65.45  ? 21  SER A CB  1 
ATOM   138  O OG  . SER A 1 23  ? 6.730   -10.683 -0.138  1.00 66.02  ? 21  SER A OG  1 
ATOM   139  N N   . HIS A 1 24  ? 4.283   -9.425  -0.666  1.00 65.82  ? 22  HIS A N   1 
ATOM   140  C CA  . HIS A 1 24  ? 3.307   -9.536  -1.740  1.00 65.88  ? 22  HIS A CA  1 
ATOM   141  C C   . HIS A 1 24  ? 1.892   -9.149  -1.294  1.00 65.03  ? 22  HIS A C   1 
ATOM   142  O O   . HIS A 1 24  ? 1.162   -8.488  -2.046  1.00 65.43  ? 22  HIS A O   1 
ATOM   143  C CB  . HIS A 1 24  ? 3.321   -10.960 -2.327  1.00 66.54  ? 22  HIS A CB  1 
ATOM   144  C CG  . HIS A 1 24  ? 2.864   -12.019 -1.366  1.00 68.60  ? 22  HIS A CG  1 
ATOM   145  N ND1 . HIS A 1 24  ? 1.539   -12.393 -1.242  1.00 70.21  ? 22  HIS A ND1 1 
ATOM   146  C CD2 . HIS A 1 24  ? 3.554   -12.779 -0.482  1.00 70.17  ? 22  HIS A CD2 1 
ATOM   147  C CE1 . HIS A 1 24  ? 1.434   -13.337 -0.322  1.00 71.02  ? 22  HIS A CE1 1 
ATOM   148  N NE2 . HIS A 1 24  ? 2.642   -13.590 0.154   1.00 71.66  ? 22  HIS A NE2 1 
ATOM   149  N N   . SER A 1 25  ? 1.523   -9.529  -0.070  1.00 63.60  ? 23  SER A N   1 
ATOM   150  C CA  . SER A 1 25  ? 0.110   -9.574  0.334   1.00 62.17  ? 23  SER A CA  1 
ATOM   151  C C   . SER A 1 25  ? -0.667  -8.257  0.516   1.00 61.19  ? 23  SER A C   1 
ATOM   152  O O   . SER A 1 25  ? -0.134  -7.141  0.402   1.00 61.13  ? 23  SER A O   1 
ATOM   153  C CB  . SER A 1 25  ? -0.105  -10.498 1.542   1.00 62.39  ? 23  SER A CB  1 
ATOM   154  O OG  . SER A 1 25  ? -1.492  -10.755 1.743   1.00 62.44  ? 23  SER A OG  1 
ATOM   155  N N   . TYR A 1 26  ? -1.933  -8.454  0.873   1.00 59.52  ? 24  TYR A N   1 
ATOM   156  C CA  . TYR A 1 26  ? -3.046  -7.604  0.510   1.00 57.67  ? 24  TYR A CA  1 
ATOM   157  C C   . TYR A 1 26  ? -3.510  -6.712  1.665   1.00 55.36  ? 24  TYR A C   1 
ATOM   158  O O   . TYR A 1 26  ? -2.739  -5.959  2.281   1.00 54.70  ? 24  TYR A O   1 
ATOM   159  C CB  . TYR A 1 26  ? -4.187  -8.579  0.158   1.00 58.98  ? 24  TYR A CB  1 
ATOM   160  C CG  . TYR A 1 26  ? -5.036  -8.262  -1.049  1.00 60.15  ? 24  TYR A CG  1 
ATOM   161  C CD1 . TYR A 1 26  ? -6.331  -7.754  -0.898  1.00 61.57  ? 24  TYR A CD1 1 
ATOM   162  C CD2 . TYR A 1 26  ? -4.570  -8.523  -2.345  1.00 61.57  ? 24  TYR A CD2 1 
ATOM   163  C CE1 . TYR A 1 26  ? -7.142  -7.476  -2.016  1.00 62.29  ? 24  TYR A CE1 1 
ATOM   164  C CE2 . TYR A 1 26  ? -5.368  -8.250  -3.475  1.00 62.45  ? 24  TYR A CE2 1 
ATOM   165  C CZ  . TYR A 1 26  ? -6.652  -7.726  -3.300  1.00 61.96  ? 24  TYR A CZ  1 
ATOM   166  O OH  . TYR A 1 26  ? -7.441  -7.456  -4.397  1.00 61.49  ? 24  TYR A OH  1 
ATOM   167  N N   . ASP A 1 27  ? -4.809  -6.821  1.925   1.00 52.23  ? 25  ASP A N   1 
ATOM   168  C CA  . ASP A 1 27  ? -5.448  -6.317  3.118   1.00 49.14  ? 25  ASP A CA  1 
ATOM   169  C C   . ASP A 1 27  ? -5.181  -7.280  4.263   1.00 46.02  ? 25  ASP A C   1 
ATOM   170  O O   . ASP A 1 27  ? -5.704  -7.088  5.362   1.00 46.12  ? 25  ASP A O   1 
ATOM   171  C CB  . ASP A 1 27  ? -6.963  -6.246  2.884   1.00 49.82  ? 25  ASP A CB  1 
ATOM   172  C CG  . ASP A 1 27  ? -7.325  -5.433  1.652   1.00 51.43  ? 25  ASP A CG  1 
ATOM   173  O OD1 . ASP A 1 27  ? -6.957  -4.239  1.610   1.00 52.43  ? 25  ASP A OD1 1 
ATOM   174  O OD2 . ASP A 1 27  ? -7.970  -5.994  0.734   1.00 53.29  ? 25  ASP A OD2 1 
ATOM   175  N N   . TRP A 1 28  ? -4.398  -8.324  3.997   1.00 42.05  ? 26  TRP A N   1 
ATOM   176  C CA  . TRP A 1 28  ? -4.186  -9.380  4.986   1.00 38.47  ? 26  TRP A CA  1 
ATOM   177  C C   . TRP A 1 28  ? -2.751  -9.425  5.425   1.00 36.27  ? 26  TRP A C   1 
ATOM   178  O O   . TRP A 1 28  ? -1.912  -10.070 4.791   1.00 35.59  ? 26  TRP A O   1 
ATOM   179  C CB  . TRP A 1 28  ? -4.689  -10.735 4.474   1.00 37.92  ? 26  TRP A CB  1 
ATOM   180  C CG  . TRP A 1 28  ? -6.162  -10.674 4.237   1.00 36.97  ? 26  TRP A CG  1 
ATOM   181  C CD1 . TRP A 1 28  ? -6.800  -10.620 3.027   1.00 36.21  ? 26  TRP A CD1 1 
ATOM   182  C CD2 . TRP A 1 28  ? -7.181  -10.579 5.235   1.00 36.67  ? 26  TRP A CD2 1 
ATOM   183  N NE1 . TRP A 1 28  ? -8.154  -10.526 3.212   1.00 35.59  ? 26  TRP A NE1 1 
ATOM   184  C CE2 . TRP A 1 28  ? -8.420  -10.494 4.557   1.00 36.56  ? 26  TRP A CE2 1 
ATOM   185  C CE3 . TRP A 1 28  ? -7.172  -10.575 6.643   1.00 36.57  ? 26  TRP A CE3 1 
ATOM   186  C CZ2 . TRP A 1 28  ? -9.647  -10.408 5.238   1.00 35.92  ? 26  TRP A CZ2 1 
ATOM   187  C CZ3 . TRP A 1 28  ? -8.397  -10.490 7.319   1.00 36.30  ? 26  TRP A CZ3 1 
ATOM   188  C CH2 . TRP A 1 28  ? -9.615  -10.410 6.612   1.00 36.26  ? 26  TRP A CH2 1 
ATOM   189  N N   . GLN A 1 29  ? -2.485  -8.696  6.511   1.00 33.53  ? 27  GLN A N   1 
ATOM   190  C CA  . GLN A 1 29  ? -1.136  -8.542  7.058   1.00 30.83  ? 27  GLN A CA  1 
ATOM   191  C C   . GLN A 1 29  ? -0.891  -9.502  8.213   1.00 28.76  ? 27  GLN A C   1 
ATOM   192  O O   . GLN A 1 29  ? -1.645  -9.503  9.187   1.00 28.00  ? 27  GLN A O   1 
ATOM   193  C CB  . GLN A 1 29  ? -0.923  -7.117  7.564   1.00 31.09  ? 27  GLN A CB  1 
ATOM   194  C CG  . GLN A 1 29  ? -0.925  -6.035  6.509   1.00 33.06  ? 27  GLN A CG  1 
ATOM   195  C CD  . GLN A 1 29  ? 0.303   -6.061  5.631   1.00 37.39  ? 27  GLN A CD  1 
ATOM   196  O OE1 . GLN A 1 29  ? 1.308   -6.721  5.937   1.00 38.30  ? 27  GLN A OE1 1 
ATOM   197  N NE2 . GLN A 1 29  ? 0.233   -5.331  4.520   1.00 39.52  ? 27  GLN A NE2 1 
ATOM   198  N N   . PRO A 1 30  ? 0.177   -10.304 8.117   1.00 27.21  ? 28  PRO A N   1 
ATOM   199  C CA  . PRO A 1 30  ? 0.577   -11.194 9.199   1.00 26.75  ? 28  PRO A CA  1 
ATOM   200  C C   . PRO A 1 30  ? 0.709   -10.501 10.576  1.00 25.87  ? 28  PRO A C   1 
ATOM   201  O O   . PRO A 1 30  ? 0.372   -11.109 11.594  1.00 25.14  ? 28  PRO A O   1 
ATOM   202  C CB  . PRO A 1 30  ? 1.935   -11.749 8.726   1.00 26.94  ? 28  PRO A CB  1 
ATOM   203  C CG  . PRO A 1 30  ? 1.909   -11.642 7.273   1.00 26.73  ? 28  PRO A CG  1 
ATOM   204  C CD  . PRO A 1 30  ? 1.083   -10.413 6.959   1.00 27.27  ? 28  PRO A CD  1 
ATOM   205  N N   . ALA A 1 31  ? 1.148   -9.242  10.594  1.00 24.72  ? 29  ALA A N   1 
ATOM   206  C CA  . ALA A 1 31  ? 1.343   -8.528  11.858  1.00 24.24  ? 29  ALA A CA  1 
ATOM   207  C C   . ALA A 1 31  ? 0.059   -8.077  12.546  1.00 23.90  ? 29  ALA A C   1 
ATOM   208  O O   . ALA A 1 31  ? 0.085   -7.779  13.734  1.00 23.88  ? 29  ALA A O   1 
ATOM   209  C CB  . ALA A 1 31  ? 2.296   -7.332  11.674  1.00 23.73  ? 29  ALA A CB  1 
ATOM   210  N N   . ALA A 1 32  ? -1.056  -8.024  11.817  1.00 23.35  ? 30  ALA A N   1 
ATOM   211  C CA  . ALA A 1 32  ? -2.307  -7.465  12.365  1.00 23.20  ? 30  ALA A CA  1 
ATOM   212  C C   . ALA A 1 32  ? -2.824  -8.033  13.718  1.00 23.11  ? 30  ALA A C   1 
ATOM   213  O O   . ALA A 1 32  ? -3.129  -7.255  14.634  1.00 21.78  ? 30  ALA A O   1 
ATOM   214  C CB  . ALA A 1 32  ? -3.427  -7.498  11.291  1.00 23.65  ? 30  ALA A CB  1 
ATOM   215  N N   . PRO A 1 33  ? -2.992  -9.376  13.827  1.00 23.24  ? 31  PRO A N   1 
ATOM   216  C CA  . PRO A 1 33  ? -3.454  -9.949  15.101  1.00 23.08  ? 31  PRO A CA  1 
ATOM   217  C C   . PRO A 1 33  ? -2.554  -9.623  16.300  1.00 23.50  ? 31  PRO A C   1 
ATOM   218  O O   . PRO A 1 33  ? -3.069  -9.355  17.380  1.00 24.12  ? 31  PRO A O   1 
ATOM   219  C CB  . PRO A 1 33  ? -3.471  -11.458 14.851  1.00 22.85  ? 31  PRO A CB  1 
ATOM   220  C CG  . PRO A 1 33  ? -2.920  -11.694 13.494  1.00 23.12  ? 31  PRO A CG  1 
ATOM   221  C CD  . PRO A 1 33  ? -2.834  -10.398 12.773  1.00 23.58  ? 31  PRO A CD  1 
ATOM   222  N N   . TRP A 1 34  ? -1.232  -9.627  16.103  1.00 23.47  ? 32  TRP A N   1 
ATOM   223  C CA  . TRP A 1 34  ? -0.273  -9.218  17.122  1.00 22.51  ? 32  TRP A CA  1 
ATOM   224  C C   . TRP A 1 34  ? -0.467  -7.769  17.544  1.00 22.87  ? 32  TRP A C   1 
ATOM   225  O O   . TRP A 1 34  ? -0.620  -7.468  18.750  1.00 22.78  ? 32  TRP A O   1 
ATOM   226  C CB  . TRP A 1 34  ? 1.163   -9.361  16.613  1.00 21.99  ? 32  TRP A CB  1 
ATOM   227  C CG  . TRP A 1 34  ? 1.557   -10.706 16.103  1.00 21.65  ? 32  TRP A CG  1 
ATOM   228  C CD1 . TRP A 1 34  ? 1.307   -11.220 14.851  1.00 21.54  ? 32  TRP A CD1 1 
ATOM   229  C CD2 . TRP A 1 34  ? 2.300   -11.704 16.801  1.00 20.58  ? 32  TRP A CD2 1 
ATOM   230  N NE1 . TRP A 1 34  ? 1.841   -12.473 14.733  1.00 20.29  ? 32  TRP A NE1 1 
ATOM   231  C CE2 . TRP A 1 34  ? 2.465   -12.802 15.908  1.00 21.84  ? 32  TRP A CE2 1 
ATOM   232  C CE3 . TRP A 1 34  ? 2.852   -11.785 18.086  1.00 20.55  ? 32  TRP A CE3 1 
ATOM   233  C CZ2 . TRP A 1 34  ? 3.155   -13.975 16.269  1.00 20.69  ? 32  TRP A CZ2 1 
ATOM   234  C CZ3 . TRP A 1 34  ? 3.547   -12.939 18.440  1.00 20.88  ? 32  TRP A CZ3 1 
ATOM   235  C CH2 . TRP A 1 34  ? 3.681   -14.025 17.532  1.00 21.53  ? 32  TRP A CH2 1 
ATOM   236  N N   . LEU A 1 35  ? -0.427  -6.869  16.559  1.00 22.44  ? 33  LEU A N   1 
ATOM   237  C CA  . LEU A 1 35  ? -0.494  -5.430  16.820  1.00 22.25  ? 33  LEU A CA  1 
ATOM   238  C C   . LEU A 1 35  ? -1.832  -5.005  17.410  1.00 22.89  ? 33  LEU A C   1 
ATOM   239  O O   . LEU A 1 35  ? -1.892  -4.077  18.217  1.00 22.21  ? 33  LEU A O   1 
ATOM   240  C CB  . LEU A 1 35  ? -0.146  -4.631  15.567  1.00 22.05  ? 33  LEU A CB  1 
ATOM   241  C CG  . LEU A 1 35  ? 1.301   -4.819  15.055  1.00 21.78  ? 33  LEU A CG  1 
ATOM   242  C CD1 . LEU A 1 35  ? 1.529   -4.032  13.767  1.00 21.56  ? 33  LEU A CD1 1 
ATOM   243  C CD2 . LEU A 1 35  ? 2.338   -4.411  16.090  1.00 20.64  ? 33  LEU A CD2 1 
ATOM   244  N N   . THR A 1 36  ? -2.894  -5.708  17.017  1.00 24.09  ? 34  THR A N   1 
ATOM   245  C CA  . THR A 1 36  ? -4.234  -5.509  17.589  1.00 24.85  ? 34  THR A CA  1 
ATOM   246  C C   . THR A 1 36  ? -4.202  -5.771  19.107  1.00 25.25  ? 34  THR A C   1 
ATOM   247  O O   . THR A 1 36  ? -4.669  -4.937  19.891  1.00 25.83  ? 34  THR A O   1 
ATOM   248  C CB  . THR A 1 36  ? -5.291  -6.387  16.866  1.00 24.97  ? 34  THR A CB  1 
ATOM   249  O OG1 . THR A 1 36  ? -5.391  -5.984  15.491  1.00 24.88  ? 34  THR A OG1 1 
ATOM   250  C CG2 . THR A 1 36  ? -6.669  -6.271  17.514  1.00 26.23  ? 34  THR A CG2 1 
ATOM   251  N N   . ARG A 1 37  ? -3.613  -6.902  19.512  1.00 25.01  ? 35  ARG A N   1 
ATOM   252  C CA  . ARG A 1 37  ? -3.409  -7.208  20.937  1.00 24.74  ? 35  ARG A CA  1 
ATOM   253  C C   . ARG A 1 37  ? -2.542  -6.190  21.713  1.00 25.47  ? 35  ARG A C   1 
ATOM   254  O O   . ARG A 1 37  ? -2.861  -5.854  22.854  1.00 25.99  ? 35  ARG A O   1 
ATOM   255  C CB  . ARG A 1 37  ? -2.866  -8.625  21.106  1.00 24.43  ? 35  ARG A CB  1 
ATOM   256  C CG  . ARG A 1 37  ? -3.906  -9.689  21.040  1.00 24.27  ? 35  ARG A CG  1 
ATOM   257  C CD  . ARG A 1 37  ? -3.377  -11.090 21.492  1.00 24.03  ? 35  ARG A CD  1 
ATOM   258  N NE  . ARG A 1 37  ? -4.086  -12.106 20.730  1.00 20.21  ? 35  ARG A NE  1 
ATOM   259  C CZ  . ARG A 1 37  ? -3.919  -13.421 20.786  1.00 19.31  ? 35  ARG A CZ  1 
ATOM   260  N NH1 . ARG A 1 37  ? -3.053  -14.006 21.625  1.00 17.41  ? 35  ARG A NH1 1 
ATOM   261  N NH2 . ARG A 1 37  ? -4.647  -14.156 19.966  1.00 18.24  ? 35  ARG A NH2 1 
ATOM   262  N N   . LEU A 1 38  ? -1.469  -5.685  21.099  1.00 25.83  ? 36  LEU A N   1 
ATOM   263  C CA  . LEU A 1 38  ? -0.659  -4.616  21.702  1.00 26.73  ? 36  LEU A CA  1 
ATOM   264  C C   . LEU A 1 38  ? -1.438  -3.328  21.931  1.00 27.45  ? 36  LEU A C   1 
ATOM   265  O O   . LEU A 1 38  ? -1.278  -2.644  22.943  1.00 27.53  ? 36  LEU A O   1 
ATOM   266  C CB  . LEU A 1 38  ? 0.555   -4.314  20.833  1.00 26.40  ? 36  LEU A CB  1 
ATOM   267  C CG  . LEU A 1 38  ? 1.849   -5.035  21.162  1.00 27.61  ? 36  LEU A CG  1 
ATOM   268  C CD1 . LEU A 1 38  ? 1.693   -6.562  21.117  1.00 27.95  ? 36  LEU A CD1 1 
ATOM   269  C CD2 . LEU A 1 38  ? 2.894   -4.563  20.151  1.00 28.98  ? 36  LEU A CD2 1 
ATOM   270  N N   . ARG A 1 39  ? -2.273  -2.994  20.959  1.00 28.33  ? 37  ARG A N   1 
ATOM   271  C CA  . ARG A 1 39  ? -3.146  -1.856  21.063  1.00 29.07  ? 37  ARG A CA  1 
ATOM   272  C C   . ARG A 1 39  ? -4.133  -2.002  22.241  1.00 29.48  ? 37  ARG A C   1 
ATOM   273  O O   . ARG A 1 39  ? -4.391  -1.032  22.954  1.00 29.09  ? 37  ARG A O   1 
ATOM   274  C CB  . ARG A 1 39  ? -3.880  -1.665  19.747  1.00 28.85  ? 37  ARG A CB  1 
ATOM   275  C CG  . ARG A 1 39  ? -4.524  -0.343  19.683  1.00 30.52  ? 37  ARG A CG  1 
ATOM   276  C CD  . ARG A 1 39  ? -5.393  -0.217  18.498  1.00 32.98  ? 37  ARG A CD  1 
ATOM   277  N NE  . ARG A 1 39  ? -6.045  1.073   18.615  1.00 37.17  ? 37  ARG A NE  1 
ATOM   278  C CZ  . ARG A 1 39  ? -6.742  1.658   17.661  1.00 35.93  ? 37  ARG A CZ  1 
ATOM   279  N NH1 . ARG A 1 39  ? -6.877  1.052   16.491  1.00 36.26  ? 37  ARG A NH1 1 
ATOM   280  N NH2 . ARG A 1 39  ? -7.293  2.844   17.891  1.00 35.26  ? 37  ARG A NH2 1 
ATOM   281  N N   . GLU A 1 40  ? -4.657  -3.215  22.444  1.00 30.07  ? 38  GLU A N   1 
ATOM   282  C CA  . GLU A 1 40  ? -5.598  -3.517  23.547  1.00 31.37  ? 38  GLU A CA  1 
ATOM   283  C C   . GLU A 1 40  ? -4.909  -3.464  24.912  1.00 30.32  ? 38  GLU A C   1 
ATOM   284  O O   . GLU A 1 40  ? -5.555  -3.186  25.917  1.00 30.93  ? 38  GLU A O   1 
ATOM   285  C CB  . GLU A 1 40  ? -6.222  -4.915  23.379  1.00 31.13  ? 38  GLU A CB  1 
ATOM   286  C CG  . GLU A 1 40  ? -7.027  -5.120  22.083  1.00 34.26  ? 38  GLU A CG  1 
ATOM   287  C CD  . GLU A 1 40  ? -7.429  -6.601  21.815  1.00 35.28  ? 38  GLU A CD  1 
ATOM   288  O OE1 . GLU A 1 40  ? -6.951  -7.539  22.534  1.00 39.43  ? 38  GLU A OE1 1 
ATOM   289  O OE2 . GLU A 1 40  ? -8.229  -6.808  20.863  1.00 39.53  ? 38  GLU A OE2 1 
ATOM   290  N N   . ALA A 1 41  ? -3.607  -3.767  24.928  1.00 28.92  ? 39  ALA A N   1 
ATOM   291  C CA  . ALA A 1 41  ? -2.784  -3.728  26.127  1.00 27.65  ? 39  ALA A CA  1 
ATOM   292  C C   . ALA A 1 41  ? -2.276  -2.304  26.456  1.00 26.32  ? 39  ALA A C   1 
ATOM   293  O O   . ALA A 1 41  ? -1.556  -2.113  27.423  1.00 25.43  ? 39  ALA A O   1 
ATOM   294  C CB  . ALA A 1 41  ? -1.614  -4.673  25.962  1.00 27.50  ? 39  ALA A CB  1 
ATOM   295  N N   . ASN A 1 42  ? -2.680  -1.331  25.640  1.00 25.08  ? 40  ASN A N   1 
ATOM   296  C CA  . ASN A 1 42  ? -2.190  0.039   25.679  1.00 24.29  ? 40  ASN A CA  1 
ATOM   297  C C   . ASN A 1 42  ? -0.675  0.175   25.484  1.00 23.92  ? 40  ASN A C   1 
ATOM   298  O O   . ASN A 1 42  ? 0.013   0.864   26.265  1.00 23.46  ? 40  ASN A O   1 
ATOM   299  C CB  . ASN A 1 42  ? -2.644  0.754   26.957  1.00 24.80  ? 40  ASN A CB  1 
ATOM   300  C CG  . ASN A 1 42  ? -2.562  2.261   26.833  1.00 23.93  ? 40  ASN A CG  1 
ATOM   301  O OD1 . ASN A 1 42  ? -2.647  2.814   25.736  1.00 24.03  ? 40  ASN A OD1 1 
ATOM   302  N ND2 . ASN A 1 42  ? -2.375  2.924   27.947  1.00 23.42  ? 40  ASN A ND2 1 
ATOM   303  N N   . VAL A 1 43  ? -0.169  -0.505  24.454  1.00 22.93  ? 41  VAL A N   1 
ATOM   304  C CA  . VAL A 1 43  ? 1.191   -0.292  23.941  1.00 22.67  ? 41  VAL A CA  1 
ATOM   305  C C   . VAL A 1 43  ? 1.085   0.174   22.483  1.00 22.33  ? 41  VAL A C   1 
ATOM   306  O O   . VAL A 1 43  ? 1.230   -0.634  21.557  1.00 22.51  ? 41  VAL A O   1 
ATOM   307  C CB  . VAL A 1 43  ? 2.059   -1.567  24.027  1.00 22.55  ? 41  VAL A CB  1 
ATOM   308  C CG1 . VAL A 1 43  ? 3.517   -1.265  23.571  1.00 23.42  ? 41  VAL A CG1 1 
ATOM   309  C CG2 . VAL A 1 43  ? 2.051   -2.120  25.427  1.00 22.25  ? 41  VAL A CG2 1 
ATOM   310  N N   . PRO A 1 44  ? 0.790   1.471   22.279  1.00 21.57  ? 42  PRO A N   1 
ATOM   311  C CA  . PRO A 1 44  ? 0.571   1.982   20.930  1.00 21.27  ? 42  PRO A CA  1 
ATOM   312  C C   . PRO A 1 44  ? 1.800   1.865   20.033  1.00 21.03  ? 42  PRO A C   1 
ATOM   313  O O   . PRO A 1 44  ? 2.904   2.233   20.428  1.00 20.43  ? 42  PRO A O   1 
ATOM   314  C CB  . PRO A 1 44  ? 0.192   3.459   21.143  1.00 20.66  ? 42  PRO A CB  1 
ATOM   315  C CG  . PRO A 1 44  ? 0.463   3.759   22.517  1.00 20.52  ? 42  PRO A CG  1 
ATOM   316  C CD  . PRO A 1 44  ? 0.597   2.503   23.305  1.00 20.97  ? 42  PRO A CD  1 
ATOM   317  N N   . VAL A 1 45  ? 1.587   1.341   18.834  1.00 20.61  ? 43  VAL A N   1 
ATOM   318  C CA  . VAL A 1 45  ? 2.621   1.320   17.834  1.00 20.65  ? 43  VAL A CA  1 
ATOM   319  C C   . VAL A 1 45  ? 2.350   2.496   16.881  1.00 21.08  ? 43  VAL A C   1 
ATOM   320  O O   . VAL A 1 45  ? 1.331   2.521   16.162  1.00 20.95  ? 43  VAL A O   1 
ATOM   321  C CB  . VAL A 1 45  ? 2.662   -0.035  17.088  1.00 20.33  ? 43  VAL A CB  1 
ATOM   322  C CG1 . VAL A 1 45  ? 3.622   0.020   15.908  1.00 20.29  ? 43  VAL A CG1 1 
ATOM   323  C CG2 . VAL A 1 45  ? 3.063   -1.143  18.036  1.00 19.09  ? 43  VAL A CG2 1 
ATOM   324  N N   . ILE A 1 46  ? 3.253   3.473   16.912  1.00 21.36  ? 44  ILE A N   1 
ATOM   325  C CA  . ILE A 1 46  ? 3.174   4.644   16.040  1.00 21.13  ? 44  ILE A CA  1 
ATOM   326  C C   . ILE A 1 46  ? 4.009   4.404   14.787  1.00 21.31  ? 44  ILE A C   1 
ATOM   327  O O   . ILE A 1 46  ? 5.243   4.411   14.820  1.00 21.40  ? 44  ILE A O   1 
ATOM   328  C CB  . ILE A 1 46  ? 3.580   5.952   16.767  1.00 21.63  ? 44  ILE A CB  1 
ATOM   329  C CG1 . ILE A 1 46  ? 2.659   6.217   17.979  1.00 21.34  ? 44  ILE A CG1 1 
ATOM   330  C CG2 . ILE A 1 46  ? 3.550   7.167   15.794  1.00 21.25  ? 44  ILE A CG2 1 
ATOM   331  C CD1 . ILE A 1 46  ? 3.358   6.097   19.273  1.00 24.85  ? 44  ILE A CD1 1 
ATOM   332  N N   . LEU A 1 47  ? 3.325   4.183   13.670  1.00 21.55  ? 45  LEU A N   1 
ATOM   333  C CA  . LEU A 1 47  ? 4.020   3.950   12.398  1.00 21.91  ? 45  LEU A CA  1 
ATOM   334  C C   . LEU A 1 47  ? 4.656   5.237   11.902  1.00 21.82  ? 45  LEU A C   1 
ATOM   335  O O   . LEU A 1 47  ? 4.038   6.303   11.965  1.00 19.87  ? 45  LEU A O   1 
ATOM   336  C CB  . LEU A 1 47  ? 3.051   3.405   11.346  1.00 21.87  ? 45  LEU A CB  1 
ATOM   337  C CG  . LEU A 1 47  ? 2.349   2.114   11.768  1.00 23.42  ? 45  LEU A CG  1 
ATOM   338  C CD1 . LEU A 1 47  ? 1.214   1.811   10.802  1.00 24.96  ? 45  LEU A CD1 1 
ATOM   339  C CD2 . LEU A 1 47  ? 3.340   0.942   11.857  1.00 23.34  ? 45  LEU A CD2 1 
ATOM   340  N N   . CYS A 1 48  ? 5.883   5.101   11.403  1.00 22.49  ? 46  CYS A N   1 
ATOM   341  C CA  A CYS A 1 48  ? 6.646   6.225   10.898  0.50 23.03  ? 46  CYS A CA  1 
ATOM   342  C CA  B CYS A 1 48  ? 6.662   6.228   10.884  0.50 22.94  ? 46  CYS A CA  1 
ATOM   343  C C   . CYS A 1 48  ? 7.201   5.895   9.507   1.00 23.23  ? 46  CYS A C   1 
ATOM   344  O O   . CYS A 1 48  ? 7.836   4.866   9.319   1.00 23.00  ? 46  CYS A O   1 
ATOM   345  C CB  A CYS A 1 48  ? 7.774   6.546   11.878  0.50 23.02  ? 46  CYS A CB  1 
ATOM   346  C CB  B CYS A 1 48  ? 7.855   6.538   11.785  0.50 22.91  ? 46  CYS A CB  1 
ATOM   347  S SG  A CYS A 1 48  ? 8.796   7.938   11.423  0.50 23.83  ? 46  CYS A SG  1 
ATOM   348  S SG  B CYS A 1 48  ? 7.454   6.849   13.479  0.50 23.14  ? 46  CYS A SG  1 
ATOM   349  N N   . SER A 1 49  ? 6.967   6.779   8.548   1.00 23.78  ? 47  SER A N   1 
ATOM   350  C CA  . SER A 1 49  ? 7.358   6.497   7.179   1.00 25.29  ? 47  SER A CA  1 
ATOM   351  C C   . SER A 1 49  ? 7.586   7.728   6.325   1.00 26.06  ? 47  SER A C   1 
ATOM   352  O O   . SER A 1 49  ? 7.096   8.812   6.616   1.00 25.45  ? 47  SER A O   1 
ATOM   353  C CB  . SER A 1 49  ? 6.274   5.639   6.511   1.00 25.02  ? 47  SER A CB  1 
ATOM   354  O OG  . SER A 1 49  ? 6.724   5.105   5.290   1.00 26.23  ? 47  SER A OG  1 
ATOM   355  N N   . SER A 1 50  ? 8.312   7.512   5.238   1.00 28.25  ? 48  SER A N   1 
ATOM   356  C CA  . SER A 1 50  ? 8.425   8.474   4.148   1.00 30.78  ? 48  SER A CA  1 
ATOM   357  C C   . SER A 1 50  ? 7.192   8.418   3.246   1.00 31.33  ? 48  SER A C   1 
ATOM   358  O O   . SER A 1 50  ? 6.931   9.358   2.495   1.00 32.60  ? 48  SER A O   1 
ATOM   359  C CB  . SER A 1 50  ? 9.679   8.192   3.332   1.00 30.72  ? 48  SER A CB  1 
ATOM   360  O OG  . SER A 1 50  ? 9.737   6.811   3.035   1.00 34.74  ? 48  SER A OG  1 
ATOM   361  N N   . LYS A 1 51  ? 6.426   7.333   3.356   1.00 31.83  ? 49  LYS A N   1 
ATOM   362  C CA  . LYS A 1 51  ? 5.233   7.099   2.542   1.00 31.52  ? 49  LYS A CA  1 
ATOM   363  C C   . LYS A 1 51  ? 4.198   8.136   2.803   1.00 31.52  ? 49  LYS A C   1 
ATOM   364  O O   . LYS A 1 51  ? 4.205   8.792   3.850   1.00 31.90  ? 49  LYS A O   1 
ATOM   365  C CB  . LYS A 1 51  ? 4.616   5.735   2.854   1.00 32.03  ? 49  LYS A CB  1 
ATOM   366  C CG  . LYS A 1 51  ? 5.386   4.575   2.299   1.00 33.31  ? 49  LYS A CG  1 
ATOM   367  C CD  . LYS A 1 51  ? 4.784   3.267   2.780   1.00 36.38  ? 49  LYS A CD  1 
ATOM   368  C CE  . LYS A 1 51  ? 5.651   2.116   2.346   1.00 37.76  ? 49  LYS A CE  1 
ATOM   369  N NZ  . LYS A 1 51  ? 4.994   0.848   2.716   1.00 41.27  ? 49  LYS A NZ  1 
ATOM   370  N N   . THR A 1 52  ? 3.276   8.254   1.858   1.00 30.75  ? 50  THR A N   1 
ATOM   371  C CA  . THR A 1 52  ? 2.270   9.285   1.890   1.00 30.46  ? 50  THR A CA  1 
ATOM   372  C C   . THR A 1 52  ? 1.219   8.991   2.949   1.00 30.40  ? 50  THR A C   1 
ATOM   373  O O   . THR A 1 52  ? 1.068   7.850   3.406   1.00 30.45  ? 50  THR A O   1 
ATOM   374  C CB  . THR A 1 52  ? 1.609   9.450   0.484   1.00 30.83  ? 50  THR A CB  1 
ATOM   375  O OG1 . THR A 1 52  ? 0.751   8.335   0.200   1.00 31.05  ? 50  THR A OG1 1 
ATOM   376  C CG2 . THR A 1 52  ? 2.675   9.521   -0.591  1.00 30.76  ? 50  THR A CG2 1 
ATOM   377  N N   . SER A 1 53  ? 0.471   10.021  3.314   1.00 29.95  ? 51  SER A N   1 
ATOM   378  C CA  . SER A 1 53  ? -0.573  9.895   4.317   1.00 29.85  ? 51  SER A CA  1 
ATOM   379  C C   . SER A 1 53  ? -1.684  8.921   3.929   1.00 29.64  ? 51  SER A C   1 
ATOM   380  O O   . SER A 1 53  ? -2.157  8.150   4.765   1.00 30.33  ? 51  SER A O   1 
ATOM   381  C CB  . SER A 1 53  ? -1.130  11.279  4.649   1.00 29.97  ? 51  SER A CB  1 
ATOM   382  O OG  . SER A 1 53  ? -2.340  11.172  5.374   1.00 31.20  ? 51  SER A OG  1 
ATOM   383  N N   . ALA A 1 54  ? -2.100  8.954   2.664   1.00 29.45  ? 52  ALA A N   1 
ATOM   384  C CA  . ALA A 1 54  ? -3.124  8.043   2.162   1.00 29.10  ? 52  ALA A CA  1 
ATOM   385  C C   . ALA A 1 54  ? -2.668  6.581   2.266   1.00 28.97  ? 52  ALA A C   1 
ATOM   386  O O   . ALA A 1 54  ? -3.424  5.732   2.703   1.00 28.43  ? 52  ALA A O   1 
ATOM   387  C CB  . ALA A 1 54  ? -3.496  8.386   0.707   1.00 29.11  ? 52  ALA A CB  1 
ATOM   388  N N   . GLU A 1 55  ? -1.440  6.317   1.834   1.00 29.06  ? 53  GLU A N   1 
ATOM   389  C CA  . GLU A 1 55  ? -0.817  5.011   1.886   1.00 30.19  ? 53  GLU A CA  1 
ATOM   390  C C   . GLU A 1 55  ? -0.776  4.500   3.330   1.00 30.10  ? 53  GLU A C   1 
ATOM   391  O O   . GLU A 1 55  ? -1.334  3.443   3.641   1.00 29.19  ? 53  GLU A O   1 
ATOM   392  C CB  . GLU A 1 55  ? 0.597   5.167   1.355   1.00 30.34  ? 53  GLU A CB  1 
ATOM   393  C CG  . GLU A 1 55  ? 1.220   3.981   0.660   1.00 31.53  ? 53  GLU A CG  1 
ATOM   394  C CD  . GLU A 1 55  ? 2.517   4.384   -0.069  1.00 33.14  ? 53  GLU A CD  1 
ATOM   395  O OE1 . GLU A 1 55  ? 2.848   5.613   -0.126  1.00 35.11  ? 53  GLU A OE1 1 
ATOM   396  O OE2 . GLU A 1 55  ? 3.219   3.472   -0.587  1.00 36.52  ? 53  GLU A OE2 1 
ATOM   397  N N   . MET A 1 56  ? -0.154  5.298   4.202   1.00 30.43  ? 54  MET A N   1 
ATOM   398  C CA  . MET A 1 56  ? 0.025   4.989   5.627   1.00 30.60  ? 54  MET A CA  1 
ATOM   399  C C   . MET A 1 56  ? -1.298  4.808   6.385   1.00 30.78  ? 54  MET A C   1 
ATOM   400  O O   . MET A 1 56  ? -1.393  3.962   7.274   1.00 30.32  ? 54  MET A O   1 
ATOM   401  C CB  . MET A 1 56  ? 0.881   6.071   6.299   1.00 30.74  ? 54  MET A CB  1 
ATOM   402  C CG  . MET A 1 56  ? 2.359   6.067   5.900   1.00 30.85  ? 54  MET A CG  1 
ATOM   403  S SD  . MET A 1 56  ? 3.246   4.504   6.256   1.00 37.10  ? 54  MET A SD  1 
ATOM   404  C CE  . MET A 1 56  ? 3.120   4.505   8.057   1.00 34.40  ? 54  MET A CE  1 
ATOM   405  N N   . LEU A 1 57  ? -2.328  5.575   6.032   1.00 31.04  ? 55  LEU A N   1 
ATOM   406  C CA  . LEU A 1 57  ? -3.611  5.386   6.695   1.00 31.36  ? 55  LEU A CA  1 
ATOM   407  C C   . LEU A 1 57  ? -4.213  4.058   6.289   1.00 31.43  ? 55  LEU A C   1 
ATOM   408  O O   . LEU A 1 57  ? -4.816  3.372   7.097   1.00 31.43  ? 55  LEU A O   1 
ATOM   409  C CB  . LEU A 1 57  ? -4.569  6.531   6.402   1.00 31.95  ? 55  LEU A CB  1 
ATOM   410  C CG  . LEU A 1 57  ? -4.335  7.824   7.179   1.00 32.93  ? 55  LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 57  ? -5.215  8.941   6.602   1.00 33.02  ? 55  LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 57  ? -4.606  7.631   8.677   1.00 33.56  ? 55  LEU A CD2 1 
ATOM   413  N N   . TYR A 1 58  ? -4.018  3.687   5.032   1.00 32.04  ? 56  TYR A N   1 
ATOM   414  C CA  . TYR A 1 58  ? -4.413  2.367   4.556   1.00 32.48  ? 56  TYR A CA  1 
ATOM   415  C C   . TYR A 1 58  ? -3.682  1.254   5.288   1.00 30.99  ? 56  TYR A C   1 
ATOM   416  O O   . TYR A 1 58  ? -4.305  0.323   5.774   1.00 30.51  ? 56  TYR A O   1 
ATOM   417  C CB  . TYR A 1 58  ? -4.135  2.211   3.060   1.00 33.67  ? 56  TYR A CB  1 
ATOM   418  C CG  . TYR A 1 58  ? -4.836  1.020   2.476   1.00 35.79  ? 56  TYR A CG  1 
ATOM   419  C CD1 . TYR A 1 58  ? -6.119  1.152   1.962   1.00 38.56  ? 56  TYR A CD1 1 
ATOM   420  C CD2 . TYR A 1 58  ? -4.229  -0.242  2.440   1.00 36.22  ? 56  TYR A CD2 1 
ATOM   421  C CE1 . TYR A 1 58  ? -6.780  0.071   1.412   1.00 39.17  ? 56  TYR A CE1 1 
ATOM   422  C CE2 . TYR A 1 58  ? -4.890  -1.337  1.898   1.00 36.39  ? 56  TYR A CE2 1 
ATOM   423  C CZ  . TYR A 1 58  ? -6.168  -1.167  1.395   1.00 36.96  ? 56  TYR A CZ  1 
ATOM   424  O OH  . TYR A 1 58  ? -6.878  -2.212  0.843   1.00 38.65  ? 56  TYR A OH  1 
ATOM   425  N N   . LEU A 1 59  ? -2.359  1.345   5.335   1.00 30.32  ? 57  LEU A N   1 
ATOM   426  C CA  . LEU A 1 59  ? -1.543  0.321   5.982   1.00 30.35  ? 57  LEU A CA  1 
ATOM   427  C C   . LEU A 1 59  ? -1.864  0.205   7.478   1.00 29.56  ? 57  LEU A C   1 
ATOM   428  O O   . LEU A 1 59  ? -2.110  -0.878  7.977   1.00 29.43  ? 57  LEU A O   1 
ATOM   429  C CB  . LEU A 1 59  ? -0.053  0.530   5.687   1.00 30.95  ? 57  LEU A CB  1 
ATOM   430  C CG  . LEU A 1 59  ? 0.279   0.438   4.182   1.00 32.50  ? 57  LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 59  ? 1.679   0.982   3.834   1.00 33.46  ? 57  LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 59  ? 0.087   -0.984  3.601   1.00 33.03  ? 57  LEU A CD2 1 
ATOM   433  N N   . GLN A 1 60  ? -1.949  1.338   8.157   1.00 29.28  ? 58  GLN A N   1 
ATOM   434  C CA  . GLN A 1 60  ? -2.377  1.386   9.549   1.00 29.37  ? 58  GLN A CA  1 
ATOM   435  C C   . GLN A 1 60  ? -3.674  0.613   9.815   1.00 29.48  ? 58  GLN A C   1 
ATOM   436  O O   . GLN A 1 60  ? -3.779  -0.112  10.809  1.00 28.73  ? 58  GLN A O   1 
ATOM   437  C CB  . GLN A 1 60  ? -2.559  2.835   9.997   1.00 29.05  ? 58  GLN A CB  1 
ATOM   438  C CG  . GLN A 1 60  ? -2.588  3.022   11.504  1.00 28.37  ? 58  GLN A CG  1 
ATOM   439  C CD  . GLN A 1 60  ? -3.017  4.414   11.892  1.00 26.76  ? 58  GLN A CD  1 
ATOM   440  O OE1 . GLN A 1 60  ? -3.987  4.942   11.350  1.00 26.43  ? 58  GLN A OE1 1 
ATOM   441  N NE2 . GLN A 1 60  ? -2.300  5.019   12.842  1.00 24.62  ? 58  GLN A NE2 1 
ATOM   442  N N   . LYS A 1 61  ? -4.661  0.787   8.938   1.00 29.34  ? 59  LYS A N   1 
ATOM   443  C CA  . LYS A 1 61  ? -5.938  0.131   9.104   1.00 30.04  ? 59  LYS A CA  1 
ATOM   444  C C   . LYS A 1 61  ? -5.809  -1.399  8.925   1.00 29.43  ? 59  LYS A C   1 
ATOM   445  O O   . LYS A 1 61  ? -6.357  -2.158  9.719   1.00 29.85  ? 59  LYS A O   1 
ATOM   446  C CB  . LYS A 1 61  ? -6.962  0.753   8.157   1.00 30.38  ? 59  LYS A CB  1 
ATOM   447  C CG  . LYS A 1 61  ? -8.356  0.177   8.237   1.00 31.35  ? 59  LYS A CG  1 
ATOM   448  C CD  . LYS A 1 61  ? -9.357  0.944   7.323   1.00 32.83  ? 59  LYS A CD  1 
ATOM   449  C CE  . LYS A 1 61  ? -8.817  1.260   5.905   1.00 37.39  ? 59  LYS A CE  1 
ATOM   450  N NZ  . LYS A 1 61  ? -8.367  0.080   5.076   1.00 41.18  ? 59  LYS A NZ  1 
ATOM   451  N N   . THR A 1 62  ? -5.038  -1.844  7.931   1.00 28.68  ? 60  THR A N   1 
ATOM   452  C CA  . THR A 1 62  ? -4.833  -3.272  7.706   1.00 28.49  ? 60  THR A CA  1 
ATOM   453  C C   . THR A 1 62  ? -4.007  -3.940  8.821   1.00 28.73  ? 60  THR A C   1 
ATOM   454  O O   . THR A 1 62  ? -4.081  -5.160  9.012   1.00 29.03  ? 60  THR A O   1 
ATOM   455  C CB  . THR A 1 62  ? -4.179  -3.580  6.330   1.00 28.39  ? 60  THR A CB  1 
ATOM   456  O OG1 . THR A 1 62  ? -2.790  -3.203  6.340   1.00 27.15  ? 60  THR A OG1 1 
ATOM   457  C CG2 . THR A 1 62  ? -4.926  -2.885  5.199   1.00 29.08  ? 60  THR A CG2 1 
ATOM   458  N N   . LEU A 1 63  ? -3.225  -3.138  9.542   1.00 28.74  ? 61  LEU A N   1 
ATOM   459  C CA  . LEU A 1 63  ? -2.368  -3.622  10.631  1.00 28.33  ? 61  LEU A CA  1 
ATOM   460  C C   . LEU A 1 63  ? -3.083  -3.642  12.003  1.00 28.50  ? 61  LEU A C   1 
ATOM   461  O O   . LEU A 1 63  ? -2.545  -4.138  13.003  1.00 29.09  ? 61  LEU A O   1 
ATOM   462  C CB  . LEU A 1 63  ? -1.079  -2.785  10.680  1.00 27.94  ? 61  LEU A CB  1 
ATOM   463  C CG  . LEU A 1 63  ? -0.021  -3.085  9.612   1.00 26.70  ? 61  LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 63  ? 1.078   -2.005  9.574   1.00 25.47  ? 61  LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 63  ? 0.600   -4.473  9.817   1.00 24.94  ? 61  LEU A CD2 1 
ATOM   466  N N   . GLY A 1 64  ? -4.295  -3.112  12.050  1.00 28.34  ? 62  GLY A N   1 
ATOM   467  C CA  . GLY A 1 64  ? -5.072  -3.092  13.294  1.00 27.99  ? 62  GLY A CA  1 
ATOM   468  C C   . GLY A 1 64  ? -4.898  -1.825  14.105  1.00 27.44  ? 62  GLY A C   1 
ATOM   469  O O   . GLY A 1 64  ? -5.329  -1.750  15.260  1.00 27.38  ? 62  GLY A O   1 
ATOM   470  N N   . LEU A 1 65  ? -4.274  -0.819  13.499  1.00 27.09  ? 63  LEU A N   1 
ATOM   471  C CA  . LEU A 1 65  ? -3.768  0.328   14.249  1.00 26.27  ? 63  LEU A CA  1 
ATOM   472  C C   . LEU A 1 65  ? -4.515  1.623   14.020  1.00 26.86  ? 63  LEU A C   1 
ATOM   473  O O   . LEU A 1 65  ? -4.069  2.655   14.516  1.00 26.72  ? 63  LEU A O   1 
ATOM   474  C CB  . LEU A 1 65  ? -2.266  0.524   13.985  1.00 25.59  ? 63  LEU A CB  1 
ATOM   475  C CG  . LEU A 1 65  ? -1.298  -0.614  14.329  1.00 23.51  ? 63  LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 65  ? 0.095   -0.323  13.806  1.00 19.33  ? 63  LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 65  ? -1.275  -0.872  15.838  1.00 23.91  ? 63  LEU A CD2 1 
ATOM   478  N N   . GLN A 1 66  ? -5.654  1.564   13.312  1.00 27.84  ? 64  GLN A N   1 
ATOM   479  C CA  . GLN A 1 66  ? -6.481  2.747   12.999  1.00 28.27  ? 64  GLN A CA  1 
ATOM   480  C C   . GLN A 1 66  ? -6.911  3.479   14.256  1.00 27.35  ? 64  GLN A C   1 
ATOM   481  O O   . GLN A 1 66  ? -7.327  2.861   15.219  1.00 27.08  ? 64  GLN A O   1 
ATOM   482  C CB  . GLN A 1 66  ? -7.722  2.389   12.143  1.00 28.22  ? 64  GLN A CB  1 
ATOM   483  C CG  . GLN A 1 66  ? -8.570  3.630   11.719  1.00 29.61  ? 64  GLN A CG  1 
ATOM   484  C CD  . GLN A 1 66  ? -9.796  3.293   10.856  1.00 30.94  ? 64  GLN A CD  1 
ATOM   485  O OE1 . GLN A 1 66  ? -10.453 2.266   11.051  1.00 35.12  ? 64  GLN A OE1 1 
ATOM   486  N NE2 . GLN A 1 66  ? -10.099 4.167   9.897   1.00 33.17  ? 64  GLN A NE2 1 
ATOM   487  N N   . GLY A 1 67  ? -6.817  4.805   14.239  1.00 27.19  ? 65  GLY A N   1 
ATOM   488  C CA  . GLY A 1 67  ? -7.124  5.600   15.414  1.00 26.42  ? 65  GLY A CA  1 
ATOM   489  C C   . GLY A 1 67  ? -5.906  5.979   16.249  1.00 26.31  ? 65  GLY A C   1 
ATOM   490  O O   . GLY A 1 67  ? -6.034  6.756   17.207  1.00 27.18  ? 65  GLY A O   1 
ATOM   491  N N   . LEU A 1 68  ? -4.736  5.439   15.898  1.00 24.93  ? 66  LEU A N   1 
ATOM   492  C CA  . LEU A 1 68  ? -3.470  5.773   16.564  1.00 24.01  ? 66  LEU A CA  1 
ATOM   493  C C   . LEU A 1 68  ? -2.738  6.865   15.786  1.00 23.26  ? 66  LEU A C   1 
ATOM   494  O O   . LEU A 1 68  ? -2.943  7.017   14.571  1.00 22.26  ? 66  LEU A O   1 
ATOM   495  C CB  . LEU A 1 68  ? -2.545  4.539   16.701  1.00 23.49  ? 66  LEU A CB  1 
ATOM   496  C CG  . LEU A 1 68  ? -2.941  3.436   17.707  1.00 25.13  ? 66  LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 68  ? -1.961  2.262   17.744  1.00 22.36  ? 66  LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 68  ? -3.098  4.025   19.093  1.00 26.86  ? 66  LEU A CD2 1 
ATOM   499  N N   . PRO A 1 69  ? -1.871  7.621   16.477  1.00 22.51  ? 67  PRO A N   1 
ATOM   500  C CA  . PRO A 1 69  ? -1.044  8.546   15.693  1.00 22.52  ? 67  PRO A CA  1 
ATOM   501  C C   . PRO A 1 69  ? -0.141  7.817   14.697  1.00 22.08  ? 67  PRO A C   1 
ATOM   502  O O   . PRO A 1 69  ? 0.151   6.626   14.864  1.00 21.77  ? 67  PRO A O   1 
ATOM   503  C CB  . PRO A 1 69  ? -0.211  9.293   16.765  1.00 22.27  ? 67  PRO A CB  1 
ATOM   504  C CG  . PRO A 1 69  ? -0.984  9.102   18.081  1.00 21.76  ? 67  PRO A CG  1 
ATOM   505  C CD  . PRO A 1 69  ? -1.616  7.724   17.931  1.00 22.33  ? 67  PRO A CD  1 
ATOM   506  N N   . LEU A 1 70  ? 0.271   8.530   13.653  1.00 22.12  ? 68  LEU A N   1 
ATOM   507  C CA  . LEU A 1 70  ? 1.285   8.037   12.723  1.00 22.09  ? 68  LEU A CA  1 
ATOM   508  C C   . LEU A 1 70  ? 2.030   9.227   12.116  1.00 21.74  ? 68  LEU A C   1 
ATOM   509  O O   . LEU A 1 70  ? 1.542   10.348  12.155  1.00 21.22  ? 68  LEU A O   1 
ATOM   510  C CB  . LEU A 1 70  ? 0.674   7.132   11.632  1.00 22.32  ? 68  LEU A CB  1 
ATOM   511  C CG  . LEU A 1 70  ? -0.367  7.659   10.633  1.00 23.05  ? 68  LEU A CG  1 
ATOM   512  C CD1 . LEU A 1 70  ? 0.285   8.516   9.539   1.00 20.61  ? 68  LEU A CD1 1 
ATOM   513  C CD2 . LEU A 1 70  ? -1.145  6.504   9.987   1.00 24.11  ? 68  LEU A CD2 1 
ATOM   514  N N   . ILE A 1 71  ? 3.232   8.956   11.608  1.00 21.70  ? 69  ILE A N   1 
ATOM   515  C CA  . ILE A 1 71  ? 4.104   9.929   10.992  1.00 21.65  ? 69  ILE A CA  1 
ATOM   516  C C   . ILE A 1 71  ? 4.218   9.543   9.517   1.00 21.69  ? 69  ILE A C   1 
ATOM   517  O O   . ILE A 1 71  ? 4.669   8.459   9.174   1.00 20.21  ? 69  ILE A O   1 
ATOM   518  C CB  . ILE A 1 71  ? 5.492   9.973   11.667  1.00 21.69  ? 69  ILE A CB  1 
ATOM   519  C CG1 . ILE A 1 71  ? 5.340   10.338  13.163  1.00 23.21  ? 69  ILE A CG1 1 
ATOM   520  C CG2 . ILE A 1 71  ? 6.427   10.984  10.951  1.00 21.55  ? 69  ILE A CG2 1 
ATOM   521  C CD1 . ILE A 1 71  ? 6.640   10.245  13.979  1.00 21.45  ? 69  ILE A CD1 1 
ATOM   522  N N   . ALA A 1 72  ? 3.746   10.443  8.664   1.00 22.82  ? 70  ALA A N   1 
ATOM   523  C CA  . ALA A 1 72  ? 3.766   10.257  7.208   1.00 23.90  ? 70  ALA A CA  1 
ATOM   524  C C   . ALA A 1 72  ? 4.677   11.307  6.568   1.00 24.90  ? 70  ALA A C   1 
ATOM   525  O O   . ALA A 1 72  ? 5.017   12.328  7.191   1.00 24.78  ? 70  ALA A O   1 
ATOM   526  C CB  . ALA A 1 72  ? 2.349   10.358  6.637   1.00 23.70  ? 70  ALA A CB  1 
ATOM   527  N N   . GLU A 1 73  ? 5.101   11.014  5.343   1.00 26.08  ? 71  GLU A N   1 
ATOM   528  C CA  . GLU A 1 73  ? 5.831   11.949  4.476   1.00 26.94  ? 71  GLU A CA  1 
ATOM   529  C C   . GLU A 1 73  ? 7.032   12.543  5.159   1.00 27.13  ? 71  GLU A C   1 
ATOM   530  O O   . GLU A 1 73  ? 7.248   13.751  5.102   1.00 27.71  ? 71  GLU A O   1 
ATOM   531  C CB  . GLU A 1 73  ? 4.895   13.031  3.901   1.00 26.65  ? 71  GLU A CB  1 
ATOM   532  C CG  . GLU A 1 73  ? 3.872   12.421  2.968   1.00 27.51  ? 71  GLU A CG  1 
ATOM   533  C CD  . GLU A 1 73  ? 2.860   13.398  2.416   1.00 28.91  ? 71  GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 73  ? 3.236   14.536  2.063   1.00 28.74  ? 71  GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 73  ? 1.677   13.010  2.326   1.00 27.97  ? 71  GLU A OE2 1 
ATOM   536  N N   . ASN A 1 74  ? 7.808   11.675  5.801   1.00 27.78  ? 72  ASN A N   1 
ATOM   537  C CA  . ASN A 1 74  ? 9.026   12.067  6.505   1.00 28.41  ? 72  ASN A CA  1 
ATOM   538  C C   . ASN A 1 74  ? 8.803   13.130  7.574   1.00 28.36  ? 72  ASN A C   1 
ATOM   539  O O   . ASN A 1 74  ? 9.693   13.958  7.816   1.00 28.91  ? 72  ASN A O   1 
ATOM   540  C CB  . ASN A 1 74  ? 10.063  12.572  5.497   1.00 28.62  ? 72  ASN A CB  1 
ATOM   541  C CG  . ASN A 1 74  ? 10.904  11.472  4.937   1.00 29.23  ? 72  ASN A CG  1 
ATOM   542  O OD1 . ASN A 1 74  ? 11.657  10.822  5.666   1.00 32.87  ? 72  ASN A OD1 1 
ATOM   543  N ND2 . ASN A 1 74  ? 10.810  11.263  3.630   1.00 28.86  ? 72  ASN A ND2 1 
ATOM   544  N N   . GLY A 1 75  ? 7.608   13.131  8.168   1.00 28.24  ? 73  GLY A N   1 
ATOM   545  C CA  . GLY A 1 75  ? 7.246   14.071  9.237   1.00 28.36  ? 73  GLY A CA  1 
ATOM   546  C C   . GLY A 1 75  ? 6.475   15.296  8.769   1.00 28.93  ? 73  GLY A C   1 
ATOM   547  O O   . GLY A 1 75  ? 6.076   16.114  9.589   1.00 29.34  ? 73  GLY A O   1 
ATOM   548  N N   . ALA A 1 76  ? 6.266   15.437  7.456   1.00 29.01  ? 74  ALA A N   1 
ATOM   549  C CA  . ALA A 1 76  ? 5.466   16.555  6.929   1.00 28.63  ? 74  ALA A CA  1 
ATOM   550  C C   . ALA A 1 76  ? 4.000   16.371  7.222   1.00 28.28  ? 74  ALA A C   1 
ATOM   551  O O   . ALA A 1 76  ? 3.212   17.283  7.028   1.00 28.94  ? 74  ALA A O   1 
ATOM   552  C CB  . ALA A 1 76  ? 5.669   16.726  5.440   1.00 28.50  ? 74  ALA A CB  1 
ATOM   553  N N   . VAL A 1 77  ? 3.621   15.175  7.652   1.00 28.11  ? 75  VAL A N   1 
ATOM   554  C CA  . VAL A 1 77  ? 2.234   14.912  8.023   1.00 27.71  ? 75  VAL A CA  1 
ATOM   555  C C   . VAL A 1 77  ? 2.208   14.131  9.337   1.00 27.46  ? 75  VAL A C   1 
ATOM   556  O O   . VAL A 1 77  ? 2.952   13.166  9.519   1.00 27.06  ? 75  VAL A O   1 
ATOM   557  C CB  . VAL A 1 77  ? 1.479   14.148  6.917   1.00 28.29  ? 75  VAL A CB  1 
ATOM   558  C CG1 . VAL A 1 77  ? 0.037   13.867  7.337   1.00 27.98  ? 75  VAL A CG1 1 
ATOM   559  C CG2 . VAL A 1 77  ? 1.488   14.941  5.591   1.00 27.45  ? 75  VAL A CG2 1 
ATOM   560  N N   . ILE A 1 78  ? 1.367   14.580  10.259  1.00 27.44  ? 76  ILE A N   1 
ATOM   561  C CA  . ILE A 1 78  ? 1.180   13.892  11.520  1.00 27.46  ? 76  ILE A CA  1 
ATOM   562  C C   . ILE A 1 78  ? -0.300  13.598  11.680  1.00 27.62  ? 76  ILE A C   1 
ATOM   563  O O   . ILE A 1 78  ? -1.098  14.513  11.792  1.00 27.50  ? 76  ILE A O   1 
ATOM   564  C CB  . ILE A 1 78  ? 1.685   14.738  12.737  1.00 27.55  ? 76  ILE A CB  1 
ATOM   565  C CG1 . ILE A 1 78  ? 3.166   15.079  12.597  1.00 26.05  ? 76  ILE A CG1 1 
ATOM   566  C CG2 . ILE A 1 78  ? 1.410   14.006  14.079  1.00 26.60  ? 76  ILE A CG2 1 
ATOM   567  C CD1 . ILE A 1 78  ? 3.621   16.182  13.563  1.00 26.90  ? 76  ILE A CD1 1 
ATOM   568  N N   . GLN A 1 79  ? -0.668  12.322  11.664  1.00 27.90  ? 77  GLN A N   1 
ATOM   569  C CA  . GLN A 1 79  ? -2.024  11.934  12.035  1.00 28.40  ? 77  GLN A CA  1 
ATOM   570  C C   . GLN A 1 79  ? -2.128  11.894  13.551  1.00 28.46  ? 77  GLN A C   1 
ATOM   571  O O   . GLN A 1 79  ? -1.278  11.327  14.227  1.00 28.43  ? 77  GLN A O   1 
ATOM   572  C CB  . GLN A 1 79  ? -2.376  10.570  11.446  1.00 28.48  ? 77  GLN A CB  1 
ATOM   573  C CG  . GLN A 1 79  ? -3.843  10.169  11.638  1.00 31.21  ? 77  GLN A CG  1 
ATOM   574  C CD  . GLN A 1 79  ? -4.818  11.019  10.797  1.00 34.77  ? 77  GLN A CD  1 
ATOM   575  O OE1 . GLN A 1 79  ? -4.478  11.483  9.697   1.00 32.80  ? 77  GLN A OE1 1 
ATOM   576  N NE2 . GLN A 1 79  ? -6.030  11.236  11.330  1.00 35.90  ? 77  GLN A NE2 1 
ATOM   577  N N   . LEU A 1 80  ? -3.159  12.516  14.087  1.00 29.09  ? 78  LEU A N   1 
ATOM   578  C CA  . LEU A 1 80  ? -3.337  12.567  15.530  1.00 29.72  ? 78  LEU A CA  1 
ATOM   579  C C   . LEU A 1 80  ? -4.123  11.355  15.997  1.00 30.25  ? 78  LEU A C   1 
ATOM   580  O O   . LEU A 1 80  ? -4.819  10.725  15.212  1.00 29.76  ? 78  LEU A O   1 
ATOM   581  C CB  . LEU A 1 80  ? -4.039  13.863  15.950  1.00 29.34  ? 78  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 80  ? -3.200  15.121  16.218  1.00 29.74  ? 78  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 80  ? -2.632  15.749  14.923  1.00 27.28  ? 78  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 80  ? -4.045  16.149  16.993  1.00 29.43  ? 78  LEU A CD2 1 
ATOM   585  N N   . ALA A 1 81  ? -3.999  11.016  17.275  1.00 31.06  ? 79  ALA A N   1 
ATOM   586  C CA  . ALA A 1 81  ? -4.853  9.982   17.840  1.00 32.48  ? 79  ALA A CA  1 
ATOM   587  C C   . ALA A 1 81  ? -6.339  10.381  17.726  1.00 33.43  ? 79  ALA A C   1 
ATOM   588  O O   . ALA A 1 81  ? -6.697  11.557  17.800  1.00 32.60  ? 79  ALA A O   1 
ATOM   589  C CB  . ALA A 1 81  ? -4.463  9.671   19.301  1.00 31.72  ? 79  ALA A CB  1 
ATOM   590  N N   . GLU A 1 82  ? -7.158  9.367   17.466  1.00 35.49  ? 80  GLU A N   1 
ATOM   591  C CA  . GLU A 1 82  ? -8.616  9.358   17.598  1.00 37.29  ? 80  GLU A CA  1 
ATOM   592  C C   . GLU A 1 82  ? -9.117  10.231  18.748  1.00 37.70  ? 80  GLU A C   1 
ATOM   593  O O   . GLU A 1 82  ? -10.027 11.047  18.567  1.00 37.76  ? 80  GLU A O   1 
ATOM   594  C CB  . GLU A 1 82  ? -9.026  7.905   17.880  1.00 37.87  ? 80  GLU A CB  1 
ATOM   595  C CG  . GLU A 1 82  ? -10.387 7.459   17.351  1.00 40.90  ? 80  GLU A CG  1 
ATOM   596  C CD  . GLU A 1 82  ? -10.404 5.972   16.972  1.00 43.62  ? 80  GLU A CD  1 
ATOM   597  O OE1 . GLU A 1 82  ? -9.970  5.103   17.786  1.00 42.67  ? 80  GLU A OE1 1 
ATOM   598  O OE2 . GLU A 1 82  ? -10.846 5.685   15.835  1.00 45.39  ? 80  GLU A OE2 1 
ATOM   599  N N   . GLN A 1 83  ? -8.498  10.054  19.917  1.00 38.08  ? 81  GLN A N   1 
ATOM   600  C CA  . GLN A 1 83  ? -8.936  10.660  21.179  1.00 38.83  ? 81  GLN A CA  1 
ATOM   601  C C   . GLN A 1 83  ? -8.342  12.054  21.472  1.00 37.81  ? 81  GLN A C   1 
ATOM   602  O O   . GLN A 1 83  ? -8.499  12.595  22.589  1.00 37.72  ? 81  GLN A O   1 
ATOM   603  C CB  . GLN A 1 83  ? -8.625  9.696   22.338  1.00 39.65  ? 81  GLN A CB  1 
ATOM   604  C CG  . GLN A 1 83  ? -9.791  8.746   22.720  1.00 44.62  ? 81  GLN A CG  1 
ATOM   605  C CD  . GLN A 1 83  ? -10.605 9.209   23.959  1.00 49.67  ? 81  GLN A CD  1 
ATOM   606  O OE1 . GLN A 1 83  ? -11.739 8.764   24.174  1.00 51.52  ? 81  GLN A OE1 1 
ATOM   607  N NE2 . GLN A 1 83  ? -10.016 10.088  24.774  1.00 51.60  ? 81  GLN A NE2 1 
ATOM   608  N N   . TRP A 1 84  ? -7.676  12.628  20.474  1.00 36.30  ? 82  TRP A N   1 
ATOM   609  C CA  . TRP A 1 84  ? -7.026  13.936  20.614  1.00 35.95  ? 82  TRP A CA  1 
ATOM   610  C C   . TRP A 1 84  ? -7.819  15.104  19.978  1.00 36.69  ? 82  TRP A C   1 
ATOM   611  O O   . TRP A 1 84  ? -7.230  16.049  19.464  1.00 35.82  ? 82  TRP A O   1 
ATOM   612  C CB  . TRP A 1 84  ? -5.580  13.910  20.071  1.00 33.80  ? 82  TRP A CB  1 
ATOM   613  C CG  . TRP A 1 84  ? -4.595  13.025  20.823  1.00 31.78  ? 82  TRP A CG  1 
ATOM   614  C CD1 . TRP A 1 84  ? -4.826  12.280  21.962  1.00 30.77  ? 82  TRP A CD1 1 
ATOM   615  C CD2 . TRP A 1 84  ? -3.215  12.824  20.492  1.00 29.73  ? 82  TRP A CD2 1 
ATOM   616  N NE1 . TRP A 1 84  ? -3.669  11.613  22.339  1.00 30.32  ? 82  TRP A NE1 1 
ATOM   617  C CE2 . TRP A 1 84  ? -2.667  11.942  21.463  1.00 30.51  ? 82  TRP A CE2 1 
ATOM   618  C CE3 . TRP A 1 84  ? -2.382  13.305  19.470  1.00 28.72  ? 82  TRP A CE3 1 
ATOM   619  C CZ2 . TRP A 1 84  ? -1.324  11.526  21.427  1.00 30.83  ? 82  TRP A CZ2 1 
ATOM   620  C CZ3 . TRP A 1 84  ? -1.049  12.881  19.437  1.00 30.22  ? 82  TRP A CZ3 1 
ATOM   621  C CH2 . TRP A 1 84  ? -0.539  12.000  20.408  1.00 29.60  ? 82  TRP A CH2 1 
ATOM   622  N N   . GLN A 1 85  ? -9.150  15.048  20.058  1.00 38.54  ? 83  GLN A N   1 
ATOM   623  C CA  . GLN A 1 85  ? -10.009 16.108  19.503  1.00 40.42  ? 83  GLN A CA  1 
ATOM   624  C C   . GLN A 1 85  ? -9.762  17.494  20.126  1.00 41.45  ? 83  GLN A C   1 
ATOM   625  O O   . GLN A 1 85  ? -10.006 18.517  19.487  1.00 41.94  ? 83  GLN A O   1 
ATOM   626  C CB  . GLN A 1 85  ? -11.483 15.727  19.608  1.00 40.56  ? 83  GLN A CB  1 
ATOM   627  C CG  . GLN A 1 85  ? -11.830 14.362  19.032  1.00 42.39  ? 83  GLN A CG  1 
ATOM   628  C CD  . GLN A 1 85  ? -12.007 13.281  20.097  1.00 45.23  ? 83  GLN A CD  1 
ATOM   629  O OE1 . GLN A 1 85  ? -11.631 13.452  21.256  1.00 46.44  ? 83  GLN A OE1 1 
ATOM   630  N NE2 . GLN A 1 85  ? -12.587 12.157  19.699  1.00 47.10  ? 83  GLN A NE2 1 
ATOM   631  N N   . GLU A 1 86  ? -9.241  17.521  21.352  1.00 42.38  ? 84  GLU A N   1 
ATOM   632  C CA  A GLU A 1 86  ? -8.963  18.751  22.099  0.50 42.86  ? 84  GLU A CA  1 
ATOM   633  C CA  B GLU A 1 86  ? -9.006  18.794  22.025  0.50 42.92  ? 84  GLU A CA  1 
ATOM   634  C C   . GLU A 1 86  ? -7.610  19.376  21.740  1.00 43.14  ? 84  GLU A C   1 
ATOM   635  O O   . GLU A 1 86  ? -7.274  20.482  22.204  1.00 43.43  ? 84  GLU A O   1 
ATOM   636  C CB  A GLU A 1 86  ? -8.977  18.456  23.604  0.50 42.99  ? 84  GLU A CB  1 
ATOM   637  C CB  B GLU A 1 86  ? -9.263  18.656  23.529  0.50 43.08  ? 84  GLU A CB  1 
ATOM   638  C CG  A GLU A 1 86  ? -7.650  17.902  24.141  0.50 42.94  ? 84  GLU A CG  1 
ATOM   639  C CG  B GLU A 1 86  ? -10.584 17.960  23.881  0.50 43.56  ? 84  GLU A CG  1 
ATOM   640  C CD  A GLU A 1 86  ? -7.789  17.185  25.465  0.50 43.73  ? 84  GLU A CD  1 
ATOM   641  C CD  B GLU A 1 86  ? -11.819 18.762  23.500  0.50 44.35  ? 84  GLU A CD  1 
ATOM   642  O OE1 A GLU A 1 86  ? -7.604  15.951  25.484  0.50 44.04  ? 84  GLU A OE1 1 
ATOM   643  O OE1 B GLU A 1 86  ? -11.897 19.959  23.869  0.50 44.72  ? 84  GLU A OE1 1 
ATOM   644  O OE2 A GLU A 1 86  ? -8.086  17.846  26.483  0.50 43.88  ? 84  GLU A OE2 1 
ATOM   645  O OE2 B GLU A 1 86  ? -12.719 18.183  22.846  0.50 43.78  ? 84  GLU A OE2 1 
ATOM   646  N N   . ILE A 1 87  ? -6.810  18.651  20.961  1.00 43.07  ? 85  ILE A N   1 
ATOM   647  C CA  . ILE A 1 87  ? -5.475  19.112  20.597  1.00 42.71  ? 85  ILE A CA  1 
ATOM   648  C C   . ILE A 1 87  ? -5.549  19.972  19.349  1.00 43.01  ? 85  ILE A C   1 
ATOM   649  O O   . ILE A 1 87  ? -6.073  19.536  18.313  1.00 43.03  ? 85  ILE A O   1 
ATOM   650  C CB  . ILE A 1 87  ? -4.490  17.919  20.378  1.00 42.86  ? 85  ILE A CB  1 
ATOM   651  C CG1 . ILE A 1 87  ? -4.360  17.085  21.661  1.00 42.28  ? 85  ILE A CG1 1 
ATOM   652  C CG2 . ILE A 1 87  ? -3.123  18.400  19.864  1.00 41.33  ? 85  ILE A CG2 1 
ATOM   653  C CD1 . ILE A 1 87  ? -3.699  17.822  22.828  1.00 42.17  ? 85  ILE A CD1 1 
ATOM   654  N N   . ASP A 1 88  ? -5.039  21.201  19.465  1.00 42.98  ? 86  ASP A N   1 
ATOM   655  C CA  A ASP A 1 88  ? -4.944  22.133  18.344  0.50 42.79  ? 86  ASP A CA  1 
ATOM   656  C CA  B ASP A 1 88  ? -4.997  22.105  18.328  0.50 42.95  ? 86  ASP A CA  1 
ATOM   657  C C   . ASP A 1 88  ? -4.301  21.405  17.168  1.00 42.74  ? 86  ASP A C   1 
ATOM   658  O O   . ASP A 1 88  ? -3.175  20.903  17.299  1.00 42.92  ? 86  ASP A O   1 
ATOM   659  C CB  A ASP A 1 88  ? -4.095  23.349  18.766  0.50 42.97  ? 86  ASP A CB  1 
ATOM   660  C CB  B ASP A 1 88  ? -4.299  23.425  18.684  0.50 43.25  ? 86  ASP A CB  1 
ATOM   661  C CG  A ASP A 1 88  ? -3.973  24.414  17.676  0.50 42.62  ? 86  ASP A CG  1 
ATOM   662  C CG  B ASP A 1 88  ? -5.173  24.350  19.530  0.50 43.69  ? 86  ASP A CG  1 
ATOM   663  O OD1 A ASP A 1 88  ? -2.850  24.933  17.479  0.50 42.67  ? 86  ASP A OD1 1 
ATOM   664  O OD1 B ASP A 1 88  ? -6.349  24.011  19.796  0.50 44.27  ? 86  ASP A OD1 1 
ATOM   665  O OD2 A ASP A 1 88  ? -4.988  24.746  17.029  0.50 42.62  ? 86  ASP A OD2 1 
ATOM   666  O OD2 B ASP A 1 88  ? -4.676  25.427  19.928  0.50 44.01  ? 86  ASP A OD2 1 
ATOM   667  N N   . GLY A 1 89  ? -5.007  21.345  16.039  1.00 42.27  ? 87  GLY A N   1 
ATOM   668  C CA  . GLY A 1 89  ? -4.501  20.694  14.832  1.00 41.32  ? 87  GLY A CA  1 
ATOM   669  C C   . GLY A 1 89  ? -5.216  19.405  14.455  1.00 40.65  ? 87  GLY A C   1 
ATOM   670  O O   . GLY A 1 89  ? -5.047  18.899  13.335  1.00 40.48  ? 87  GLY A O   1 
ATOM   671  N N   . PHE A 1 90  ? -6.006  18.870  15.385  1.00 39.98  ? 88  PHE A N   1 
ATOM   672  C CA  . PHE A 1 90  ? -6.810  17.668  15.127  1.00 40.04  ? 88  PHE A CA  1 
ATOM   673  C C   . PHE A 1 90  ? -7.680  17.851  13.865  1.00 40.06  ? 88  PHE A C   1 
ATOM   674  O O   . PHE A 1 90  ? -8.252  18.931  13.667  1.00 40.62  ? 88  PHE A O   1 
ATOM   675  C CB  . PHE A 1 90  ? -7.678  17.331  16.352  1.00 39.52  ? 88  PHE A CB  1 
ATOM   676  C CG  . PHE A 1 90  ? -8.529  16.105  16.173  1.00 39.42  ? 88  PHE A CG  1 
ATOM   677  C CD1 . PHE A 1 90  ? -8.020  14.836  16.457  1.00 38.72  ? 88  PHE A CD1 1 
ATOM   678  C CD2 . PHE A 1 90  ? -9.838  16.209  15.703  1.00 38.76  ? 88  PHE A CD2 1 
ATOM   679  C CE1 . PHE A 1 90  ? -8.804  13.701  16.281  1.00 37.75  ? 88  PHE A CE1 1 
ATOM   680  C CE2 . PHE A 1 90  ? -10.617 15.077  15.520  1.00 36.97  ? 88  PHE A CE2 1 
ATOM   681  C CZ  . PHE A 1 90  ? -10.099 13.825  15.816  1.00 37.13  ? 88  PHE A CZ  1 
ATOM   682  N N   . PRO A 1 91  ? -7.803  16.803  13.014  1.00 39.76  ? 89  PRO A N   1 
ATOM   683  C CA  . PRO A 1 91  ? -7.277  15.438  13.111  1.00 39.35  ? 89  PRO A CA  1 
ATOM   684  C C   . PRO A 1 91  ? -5.854  15.211  12.567  1.00 39.11  ? 89  PRO A C   1 
ATOM   685  O O   . PRO A 1 91  ? -5.280  14.144  12.797  1.00 38.80  ? 89  PRO A O   1 
ATOM   686  C CB  . PRO A 1 91  ? -8.286  14.636  12.284  1.00 39.14  ? 89  PRO A CB  1 
ATOM   687  C CG  . PRO A 1 91  ? -8.683  15.575  11.206  1.00 39.42  ? 89  PRO A CG  1 
ATOM   688  C CD  . PRO A 1 91  ? -8.603  16.978  11.785  1.00 39.52  ? 89  PRO A CD  1 
ATOM   689  N N   . ARG A 1 92  ? -5.305  16.192  11.860  1.00 38.93  ? 90  ARG A N   1 
ATOM   690  C CA  . ARG A 1 92  ? -4.050  16.017  11.145  1.00 39.19  ? 90  ARG A CA  1 
ATOM   691  C C   . ARG A 1 92  ? -3.277  17.314  11.036  1.00 38.76  ? 90  ARG A C   1 
ATOM   692  O O   . ARG A 1 92  ? -3.833  18.336  10.656  1.00 39.19  ? 90  ARG A O   1 
ATOM   693  C CB  . ARG A 1 92  ? -4.322  15.488  9.743   1.00 39.74  ? 90  ARG A CB  1 
ATOM   694  C CG  . ARG A 1 92  ? -3.069  15.115  8.965   1.00 41.99  ? 90  ARG A CG  1 
ATOM   695  C CD  . ARG A 1 92  ? -3.379  14.037  7.949   1.00 46.69  ? 90  ARG A CD  1 
ATOM   696  N NE  . ARG A 1 92  ? -4.264  14.522  6.899   1.00 49.82  ? 90  ARG A NE  1 
ATOM   697  C CZ  . ARG A 1 92  ? -5.184  13.779  6.294   1.00 51.84  ? 90  ARG A CZ  1 
ATOM   698  N NH1 . ARG A 1 92  ? -5.368  12.510  6.653   1.00 52.25  ? 90  ARG A NH1 1 
ATOM   699  N NH2 . ARG A 1 92  ? -5.930  14.312  5.337   1.00 52.10  ? 90  ARG A NH2 1 
ATOM   700  N N   . ILE A 1 93  ? -1.995  17.252  11.372  1.00 38.19  ? 91  ILE A N   1 
ATOM   701  C CA  . ILE A 1 93  ? -1.100  18.392  11.275  1.00 38.12  ? 91  ILE A CA  1 
ATOM   702  C C   . ILE A 1 93  ? -0.140  18.198  10.110  1.00 38.13  ? 91  ILE A C   1 
ATOM   703  O O   . ILE A 1 93  ? 0.659   17.266  10.093  1.00 37.21  ? 91  ILE A O   1 
ATOM   704  C CB  . ILE A 1 93  ? -0.304  18.618  12.578  1.00 38.12  ? 91  ILE A CB  1 
ATOM   705  C CG1 . ILE A 1 93  ? -1.264  18.931  13.730  1.00 38.12  ? 91  ILE A CG1 1 
ATOM   706  C CG2 . ILE A 1 93  ? 0.742   19.741  12.391  1.00 37.58  ? 91  ILE A CG2 1 
ATOM   707  C CD1 . ILE A 1 93  ? -0.578  19.108  15.048  1.00 38.82  ? 91  ILE A CD1 1 
ATOM   708  N N   . ILE A 1 94  ? -0.229  19.124  9.160   1.00 38.62  ? 92  ILE A N   1 
ATOM   709  C CA  . ILE A 1 94  ? 0.484   19.085  7.883   1.00 39.07  ? 92  ILE A CA  1 
ATOM   710  C C   . ILE A 1 94  ? 1.409   20.288  7.872   1.00 38.61  ? 92  ILE A C   1 
ATOM   711  O O   . ILE A 1 94  ? 1.053   21.323  8.430   1.00 38.86  ? 92  ILE A O   1 
ATOM   712  C CB  . ILE A 1 94  ? -0.561  19.227  6.719   1.00 39.35  ? 92  ILE A CB  1 
ATOM   713  C CG1 . ILE A 1 94  ? -1.444  17.980  6.635   1.00 40.46  ? 92  ILE A CG1 1 
ATOM   714  C CG2 . ILE A 1 94  ? 0.096   19.507  5.379   1.00 40.37  ? 92  ILE A CG2 1 
ATOM   715  C CD1 . ILE A 1 94  ? -2.889  18.252  6.169   1.00 44.06  ? 92  ILE A CD1 1 
ATOM   716  N N   . SER A 1 95  ? 2.587   20.169  7.263   1.00 38.54  ? 93  SER A N   1 
ATOM   717  C CA  A SER A 1 95  ? 3.432   21.346  7.045   0.50 38.41  ? 93  SER A CA  1 
ATOM   718  C CA  B SER A 1 95  ? 3.447   21.338  7.023   0.50 38.57  ? 93  SER A CA  1 
ATOM   719  C C   . SER A 1 95  ? 2.695   22.410  6.227   1.00 38.59  ? 93  SER A C   1 
ATOM   720  O O   . SER A 1 95  ? 1.952   22.087  5.282   1.00 38.57  ? 93  SER A O   1 
ATOM   721  C CB  A SER A 1 95  ? 4.726   20.983  6.335   0.50 38.38  ? 93  SER A CB  1 
ATOM   722  C CB  B SER A 1 95  ? 4.716   20.941  6.269   0.50 38.56  ? 93  SER A CB  1 
ATOM   723  O OG  A SER A 1 95  ? 5.425   22.168  6.016   0.50 37.71  ? 93  SER A OG  1 
ATOM   724  O OG  B SER A 1 95  ? 5.601   20.214  7.102   0.50 38.93  ? 93  SER A OG  1 
ATOM   725  N N   . GLY A 1 96  ? 2.882   23.679  6.608   1.00 37.93  ? 94  GLY A N   1 
ATOM   726  C CA  . GLY A 1 96  ? 2.268   24.793  5.896   1.00 37.17  ? 94  GLY A CA  1 
ATOM   727  C C   . GLY A 1 96  ? 2.720   24.906  4.438   1.00 36.42  ? 94  GLY A C   1 
ATOM   728  O O   . GLY A 1 96  ? 2.087   25.605  3.647   1.00 37.58  ? 94  GLY A O   1 
ATOM   729  N N   . ILE A 1 97  ? 3.820   24.234  4.093   1.00 34.97  ? 95  ILE A N   1 
ATOM   730  C CA  . ILE A 1 97  ? 4.212   24.005  2.696   1.00 33.20  ? 95  ILE A CA  1 
ATOM   731  C C   . ILE A 1 97  ? 3.573   22.710  2.152   1.00 32.12  ? 95  ILE A C   1 
ATOM   732  O O   . ILE A 1 97  ? 3.973   21.604  2.498   1.00 31.71  ? 95  ILE A O   1 
ATOM   733  C CB  . ILE A 1 97  ? 5.744   24.000  2.530   1.00 33.45  ? 95  ILE A CB  1 
ATOM   734  C CG1 . ILE A 1 97  ? 6.343   25.286  3.146   1.00 33.14  ? 95  ILE A CG1 1 
ATOM   735  C CG2 . ILE A 1 97  ? 6.122   23.854  1.052   1.00 32.89  ? 95  ILE A CG2 1 
ATOM   736  C CD1 . ILE A 1 97  ? 7.870   25.366  3.138   1.00 33.83  ? 95  ILE A CD1 1 
ATOM   737  N N   . SER A 1 98  ? 2.554   22.873  1.316   1.00 30.66  ? 96  SER A N   1 
ATOM   738  C CA  . SER A 1 98  ? 1.775   21.760  0.807   1.00 29.63  ? 96  SER A CA  1 
ATOM   739  C C   . SER A 1 98  ? 2.429   21.150  -0.424  1.00 28.66  ? 96  SER A C   1 
ATOM   740  O O   . SER A 1 98  ? 3.406   21.670  -0.960  1.00 28.52  ? 96  SER A O   1 
ATOM   741  C CB  . SER A 1 98  ? 0.352   22.225  0.468   1.00 29.83  ? 96  SER A CB  1 
ATOM   742  O OG  . SER A 1 98  ? 0.367   23.189  -0.588  1.00 31.60  ? 96  SER A OG  1 
ATOM   743  N N   . HIS A 1 99  ? 1.877   20.028  -0.854  1.00 28.00  ? 97  HIS A N   1 
ATOM   744  C CA  . HIS A 1 99  ? 2.296   19.349  -2.060  1.00 27.48  ? 97  HIS A CA  1 
ATOM   745  C C   . HIS A 1 99  ? 2.143   20.255  -3.305  1.00 27.35  ? 97  HIS A C   1 
ATOM   746  O O   . HIS A 1 99  ? 2.991   20.240  -4.193  1.00 27.12  ? 97  HIS A O   1 
ATOM   747  C CB  . HIS A 1 99  ? 1.482   18.073  -2.209  1.00 26.82  ? 97  HIS A CB  1 
ATOM   748  C CG  . HIS A 1 99  ? 1.420   17.558  -3.617  1.00 28.07  ? 97  HIS A CG  1 
ATOM   749  N ND1 . HIS A 1 99  ? 2.389   16.739  -4.158  1.00 26.21  ? 97  HIS A ND1 1 
ATOM   750  C CD2 . HIS A 1 99  ? 0.510   17.760  -4.595  1.00 27.02  ? 97  HIS A CD2 1 
ATOM   751  C CE1 . HIS A 1 99  ? 2.067   16.444  -5.400  1.00 26.29  ? 97  HIS A CE1 1 
ATOM   752  N NE2 . HIS A 1 99  ? 0.936   17.060  -5.691  1.00 28.92  ? 97  HIS A NE2 1 
ATOM   753  N N   . GLY A 1 100 ? 1.064   21.037  -3.352  1.00 27.48  ? 98  GLY A N   1 
ATOM   754  C CA  . GLY A 1 100 ? 0.794   21.951  -4.455  1.00 27.96  ? 98  GLY A CA  1 
ATOM   755  C C   . GLY A 1 100 ? 1.871   23.019  -4.615  1.00 28.21  ? 98  GLY A C   1 
ATOM   756  O O   . GLY A 1 100 ? 2.301   23.310  -5.725  1.00 27.90  ? 98  GLY A O   1 
ATOM   757  N N   . GLU A 1 101 ? 2.309   23.584  -3.495  1.00 28.43  ? 99  GLU A N   1 
ATOM   758  C CA  . GLU A 1 101 ? 3.311   24.635  -3.481  1.00 29.21  ? 99  GLU A CA  1 
ATOM   759  C C   . GLU A 1 101 ? 4.688   24.094  -3.869  1.00 28.36  ? 99  GLU A C   1 
ATOM   760  O O   . GLU A 1 101 ? 5.425   24.741  -4.626  1.00 27.95  ? 99  GLU A O   1 
ATOM   761  C CB  . GLU A 1 101 ? 3.349   25.286  -2.100  1.00 29.27  ? 99  GLU A CB  1 
ATOM   762  C CG  . GLU A 1 101 ? 4.399   26.391  -1.972  1.00 32.13  ? 99  GLU A CG  1 
ATOM   763  C CD  . GLU A 1 101 ? 4.422   27.046  -0.602  1.00 32.46  ? 99  GLU A CD  1 
ATOM   764  O OE1 . GLU A 1 101 ? 3.453   26.862  0.173   1.00 34.75  ? 99  GLU A OE1 1 
ATOM   765  O OE2 . GLU A 1 101 ? 5.420   27.759  -0.311  1.00 38.11  ? 99  GLU A OE2 1 
ATOM   766  N N   . ILE A 1 102 ? 5.015   22.903  -3.352  1.00 27.93  ? 100 ILE A N   1 
ATOM   767  C CA  . ILE A 1 102 ? 6.252   22.201  -3.699  1.00 27.02  ? 100 ILE A CA  1 
ATOM   768  C C   . ILE A 1 102 ? 6.277   21.894  -5.199  1.00 26.72  ? 100 ILE A C   1 
ATOM   769  O O   . ILE A 1 102 ? 7.282   22.135  -5.866  1.00 26.53  ? 100 ILE A O   1 
ATOM   770  C CB  . ILE A 1 102 ? 6.484   20.897  -2.850  1.00 27.02  ? 100 ILE A CB  1 
ATOM   771  C CG1 . ILE A 1 102 ? 6.728   21.230  -1.374  1.00 26.18  ? 100 ILE A CG1 1 
ATOM   772  C CG2 . ILE A 1 102 ? 7.688   20.122  -3.403  1.00 26.96  ? 100 ILE A CG2 1 
ATOM   773  C CD1 . ILE A 1 102 ? 6.317   20.125  -0.380  1.00 25.64  ? 100 ILE A CD1 1 
ATOM   774  N N   . SER A 1 103 ? 5.169   21.365  -5.722  1.00 26.62  ? 101 SER A N   1 
ATOM   775  C CA  . SER A 1 103 ? 5.023   21.122  -7.165  1.00 25.95  ? 101 SER A CA  1 
ATOM   776  C C   . SER A 1 103 ? 5.278   22.385  -8.003  1.00 25.18  ? 101 SER A C   1 
ATOM   777  O O   . SER A 1 103 ? 5.930   22.316  -9.054  1.00 25.06  ? 101 SER A O   1 
ATOM   778  C CB  . SER A 1 103 ? 3.632   20.571  -7.476  1.00 26.16  ? 101 SER A CB  1 
ATOM   779  O OG  . SER A 1 103 ? 3.580   19.176  -7.246  1.00 29.18  ? 101 SER A OG  1 
ATOM   780  N N   . LEU A 1 104 ? 4.761   23.524  -7.539  1.00 24.01  ? 102 LEU A N   1 
ATOM   781  C CA  . LEU A 1 104 ? 5.022   24.823  -8.181  1.00 23.64  ? 102 LEU A CA  1 
ATOM   782  C C   . LEU A 1 104 ? 6.505   25.161  -8.220  1.00 23.12  ? 102 LEU A C   1 
ATOM   783  O O   . LEU A 1 104 ? 7.021   25.574  -9.260  1.00 23.35  ? 102 LEU A O   1 
ATOM   784  C CB  . LEU A 1 104 ? 4.259   25.968  -7.484  1.00 22.85  ? 102 LEU A CB  1 
ATOM   785  C CG  . LEU A 1 104 ? 2.738   26.065  -7.667  1.00 23.81  ? 102 LEU A CG  1 
ATOM   786  C CD1 . LEU A 1 104 ? 2.165   27.304  -6.981  1.00 21.35  ? 102 LEU A CD1 1 
ATOM   787  C CD2 . LEU A 1 104 ? 2.328   26.068  -9.161  1.00 24.30  ? 102 LEU A CD2 1 
ATOM   788  N N   . VAL A 1 105 ? 7.182   25.001  -7.079  1.00 22.88  ? 103 VAL A N   1 
ATOM   789  C CA  . VAL A 1 105 ? 8.616   25.267  -6.971  1.00 22.50  ? 103 VAL A CA  1 
ATOM   790  C C   . VAL A 1 105 ? 9.385   24.324  -7.881  1.00 22.38  ? 103 VAL A C   1 
ATOM   791  O O   . VAL A 1 105 ? 10.306  24.719  -8.588  1.00 22.02  ? 103 VAL A O   1 
ATOM   792  C CB  . VAL A 1 105 ? 9.113   25.090  -5.509  1.00 22.60  ? 103 VAL A CB  1 
ATOM   793  C CG1 . VAL A 1 105 ? 10.634  25.160  -5.421  1.00 22.60  ? 103 VAL A CG1 1 
ATOM   794  C CG2 . VAL A 1 105 ? 8.506   26.144  -4.612  1.00 22.08  ? 103 VAL A CG2 1 
ATOM   795  N N   . LEU A 1 106 ? 9.001   23.061  -7.856  1.00 22.75  ? 104 LEU A N   1 
ATOM   796  C CA  . LEU A 1 106 ? 9.715   22.041  -8.603  1.00 23.20  ? 104 LEU A CA  1 
ATOM   797  C C   . LEU A 1 106 ? 9.615   22.279  -10.098 1.00 23.95  ? 104 LEU A C   1 
ATOM   798  O O   . LEU A 1 106 ? 10.598  22.105  -10.825 1.00 24.32  ? 104 LEU A O   1 
ATOM   799  C CB  . LEU A 1 106 ? 9.201   20.643  -8.230  1.00 22.90  ? 104 LEU A CB  1 
ATOM   800  C CG  . LEU A 1 106 ? 9.669   20.109  -6.868  1.00 23.35  ? 104 LEU A CG  1 
ATOM   801  C CD1 . LEU A 1 106 ? 9.438   18.628  -6.820  1.00 20.60  ? 104 LEU A CD1 1 
ATOM   802  C CD2 . LEU A 1 106 ? 11.182  20.429  -6.585  1.00 23.52  ? 104 LEU A CD2 1 
ATOM   803  N N   . ASN A 1 107 ? 8.428   22.689  -10.548 1.00 24.19  ? 105 ASN A N   1 
ATOM   804  C CA  . ASN A 1 107 ? 8.221   22.994  -11.945 1.00 24.72  ? 105 ASN A CA  1 
ATOM   805  C C   . ASN A 1 107 ? 8.879   24.277  -12.389 1.00 25.11  ? 105 ASN A C   1 
ATOM   806  O O   . ASN A 1 107 ? 9.299   24.378  -13.531 1.00 25.22  ? 105 ASN A O   1 
ATOM   807  C CB  . ASN A 1 107 ? 6.739   22.952  -12.306 1.00 24.14  ? 105 ASN A CB  1 
ATOM   808  C CG  . ASN A 1 107 ? 6.243   21.521  -12.479 1.00 24.68  ? 105 ASN A CG  1 
ATOM   809  O OD1 . ASN A 1 107 ? 6.522   20.871  -13.485 1.00 25.65  ? 105 ASN A OD1 1 
ATOM   810  N ND2 . ASN A 1 107 ? 5.539   21.021  -11.490 1.00 22.82  ? 105 ASN A ND2 1 
ATOM   811  N N   . THR A 1 108 ? 8.979   25.254  -11.496 1.00 25.44  ? 106 THR A N   1 
ATOM   812  C CA  . THR A 1 108 ? 9.707   26.480  -11.812 1.00 26.24  ? 106 THR A CA  1 
ATOM   813  C C   . THR A 1 108 ? 11.194  26.149  -12.062 1.00 26.31  ? 106 THR A C   1 
ATOM   814  O O   . THR A 1 108 ? 11.761  26.587  -13.044 1.00 27.04  ? 106 THR A O   1 
ATOM   815  C CB  . THR A 1 108 ? 9.515   27.567  -10.711 1.00 26.47  ? 106 THR A CB  1 
ATOM   816  O OG1 . THR A 1 108 ? 8.116   27.763  -10.469 1.00 28.39  ? 106 THR A OG1 1 
ATOM   817  C CG2 . THR A 1 108 ? 10.084  28.862  -11.133 1.00 26.36  ? 106 THR A CG2 1 
ATOM   818  N N   . LEU A 1 109 ? 11.804  25.344  -11.200 1.00 26.42  ? 107 LEU A N   1 
ATOM   819  C CA  . LEU A 1 109 ? 13.215  24.935  -11.370 1.00 26.97  ? 107 LEU A CA  1 
ATOM   820  C C   . LEU A 1 109 ? 13.477  24.160  -12.652 1.00 27.79  ? 107 LEU A C   1 
ATOM   821  O O   . LEU A 1 109 ? 14.499  24.371  -13.326 1.00 27.95  ? 107 LEU A O   1 
ATOM   822  C CB  . LEU A 1 109 ? 13.715  24.109  -10.169 1.00 25.72  ? 107 LEU A CB  1 
ATOM   823  C CG  . LEU A 1 109 ? 13.751  24.901  -8.853  1.00 26.66  ? 107 LEU A CG  1 
ATOM   824  C CD1 . LEU A 1 109 ? 13.976  24.005  -7.635  1.00 23.87  ? 107 LEU A CD1 1 
ATOM   825  C CD2 . LEU A 1 109 ? 14.776  26.031  -8.908  1.00 24.54  ? 107 LEU A CD2 1 
ATOM   826  N N   . ARG A 1 110 ? 12.556  23.257  -12.970 1.00 28.25  ? 108 ARG A N   1 
ATOM   827  C CA  . ARG A 1 110 ? 12.656  22.415  -14.148 1.00 28.99  ? 108 ARG A CA  1 
ATOM   828  C C   . ARG A 1 110 ? 12.498  23.231  -15.450 1.00 30.07  ? 108 ARG A C   1 
ATOM   829  O O   . ARG A 1 110 ? 13.251  23.038  -16.401 1.00 30.00  ? 108 ARG A O   1 
ATOM   830  C CB  . ARG A 1 110 ? 11.631  21.292  -14.052 1.00 28.14  ? 108 ARG A CB  1 
ATOM   831  C CG  . ARG A 1 110 ? 11.735  20.264  -15.150 1.00 27.79  ? 108 ARG A CG  1 
ATOM   832  C CD  . ARG A 1 110 ? 11.151  18.930  -14.689 1.00 26.80  ? 108 ARG A CD  1 
ATOM   833  N NE  . ARG A 1 110 ? 9.704   19.025  -14.489 1.00 24.50  ? 108 ARG A NE  1 
ATOM   834  C CZ  . ARG A 1 110 ? 8.908   17.993  -14.229 1.00 24.35  ? 108 ARG A CZ  1 
ATOM   835  N NH1 . ARG A 1 110 ? 9.412   16.774  -14.116 1.00 23.26  ? 108 ARG A NH1 1 
ATOM   836  N NH2 . ARG A 1 110 ? 7.597   18.187  -14.084 1.00 24.27  ? 108 ARG A NH2 1 
ATOM   837  N N   . GLU A 1 111 ? 11.533  24.148  -15.475 1.00 30.97  ? 109 GLU A N   1 
ATOM   838  C CA  . GLU A 1 111 ? 11.291  24.976  -16.650 1.00 32.28  ? 109 GLU A CA  1 
ATOM   839  C C   . GLU A 1 111 ? 12.359  26.062  -16.860 1.00 34.16  ? 109 GLU A C   1 
ATOM   840  O O   . GLU A 1 111 ? 12.760  26.340  -17.988 1.00 34.25  ? 109 GLU A O   1 
ATOM   841  C CB  . GLU A 1 111 ? 9.897   25.620  -16.582 1.00 31.16  ? 109 GLU A CB  1 
ATOM   842  C CG  . GLU A 1 111 ? 8.737   24.623  -16.568 1.00 29.64  ? 109 GLU A CG  1 
ATOM   843  C CD  . GLU A 1 111 ? 8.621   23.814  -17.845 1.00 27.74  ? 109 GLU A CD  1 
ATOM   844  O OE1 . GLU A 1 111 ? 8.503   24.429  -18.917 1.00 29.59  ? 109 GLU A OE1 1 
ATOM   845  O OE2 . GLU A 1 111 ? 8.639   22.567  -17.783 1.00 24.68  ? 109 GLU A OE2 1 
ATOM   846  N N   . LYS A 1 112 ? 12.786  26.699  -15.774 1.00 36.45  ? 110 LYS A N   1 
ATOM   847  C CA  . LYS A 1 112 ? 13.745  27.794  -15.865 1.00 38.16  ? 110 LYS A CA  1 
ATOM   848  C C   . LYS A 1 112 ? 15.209  27.351  -15.848 1.00 38.69  ? 110 LYS A C   1 
ATOM   849  O O   . LYS A 1 112 ? 16.037  28.002  -16.467 1.00 39.32  ? 110 LYS A O   1 
ATOM   850  C CB  . LYS A 1 112 ? 13.505  28.819  -14.762 1.00 38.43  ? 110 LYS A CB  1 
ATOM   851  C CG  . LYS A 1 112 ? 12.123  29.470  -14.808 1.00 40.88  ? 110 LYS A CG  1 
ATOM   852  C CD  . LYS A 1 112 ? 12.141  30.799  -14.071 1.00 42.47  ? 110 LYS A CD  1 
ATOM   853  C CE  . LYS A 1 112 ? 10.741  31.327  -13.849 1.00 44.95  ? 110 LYS A CE  1 
ATOM   854  N NZ  . LYS A 1 112 ? 10.785  32.516  -12.953 1.00 46.55  ? 110 LYS A NZ  1 
ATOM   855  N N   . GLU A 1 113 ? 15.534  26.274  -15.132 1.00 39.20  ? 111 GLU A N   1 
ATOM   856  C CA  . GLU A 1 113 ? 16.937  25.865  -14.957 1.00 39.84  ? 111 GLU A CA  1 
ATOM   857  C C   . GLU A 1 113 ? 17.201  24.516  -15.592 1.00 39.19  ? 111 GLU A C   1 
ATOM   858  O O   . GLU A 1 113 ? 18.344  24.068  -15.646 1.00 39.86  ? 111 GLU A O   1 
ATOM   859  C CB  . GLU A 1 113 ? 17.348  25.887  -13.468 1.00 39.67  ? 111 GLU A CB  1 
ATOM   860  C CG  . GLU A 1 113 ? 17.403  27.317  -12.867 1.00 41.37  ? 111 GLU A CG  1 
ATOM   861  C CD  . GLU A 1 113 ? 17.266  27.388  -11.328 1.00 42.82  ? 111 GLU A CD  1 
ATOM   862  O OE1 . GLU A 1 113 ? 18.141  26.859  -10.592 1.00 46.72  ? 111 GLU A OE1 1 
ATOM   863  O OE2 . GLU A 1 113 ? 16.297  28.030  -10.849 1.00 47.00  ? 111 GLU A OE2 1 
ATOM   864  N N   . HIS A 1 114 ? 16.133  23.877  -16.075 1.00 38.59  ? 112 HIS A N   1 
ATOM   865  C CA  . HIS A 1 114 ? 16.189  22.645  -16.874 1.00 37.45  ? 112 HIS A CA  1 
ATOM   866  C C   . HIS A 1 114 ? 16.845  21.465  -16.154 1.00 36.87  ? 112 HIS A C   1 
ATOM   867  O O   . HIS A 1 114 ? 17.559  20.648  -16.772 1.00 36.40  ? 112 HIS A O   1 
ATOM   868  C CB  . HIS A 1 114 ? 16.853  22.901  -18.243 1.00 38.60  ? 112 HIS A CB  1 
ATOM   869  C CG  . HIS A 1 114 ? 16.427  24.182  -18.899 1.00 39.67  ? 112 HIS A CG  1 
ATOM   870  N ND1 . HIS A 1 114 ? 15.184  24.350  -19.470 1.00 40.28  ? 112 HIS A ND1 1 
ATOM   871  C CD2 . HIS A 1 114 ? 17.086  25.355  -19.077 1.00 41.20  ? 112 HIS A CD2 1 
ATOM   872  C CE1 . HIS A 1 114 ? 15.093  25.568  -19.974 1.00 41.10  ? 112 HIS A CE1 1 
ATOM   873  N NE2 . HIS A 1 114 ? 16.234  26.199  -19.749 1.00 42.28  ? 112 HIS A NE2 1 
ATOM   874  N N   . PHE A 1 115 ? 16.599  21.369  -14.849 1.00 35.70  ? 113 PHE A N   1 
ATOM   875  C CA  . PHE A 1 115 ? 16.974  20.174  -14.094 1.00 34.76  ? 113 PHE A CA  1 
ATOM   876  C C   . PHE A 1 115 ? 16.169  18.973  -14.595 1.00 34.29  ? 113 PHE A C   1 
ATOM   877  O O   . PHE A 1 115 ? 14.957  19.088  -14.871 1.00 34.35  ? 113 PHE A O   1 
ATOM   878  C CB  . PHE A 1 115 ? 16.774  20.382  -12.584 1.00 34.72  ? 113 PHE A CB  1 
ATOM   879  C CG  . PHE A 1 115 ? 17.754  21.350  -11.955 1.00 34.01  ? 113 PHE A CG  1 
ATOM   880  C CD1 . PHE A 1 115 ? 19.093  20.996  -11.765 1.00 36.51  ? 113 PHE A CD1 1 
ATOM   881  C CD2 . PHE A 1 115 ? 17.332  22.589  -11.518 1.00 33.72  ? 113 PHE A CD2 1 
ATOM   882  C CE1 . PHE A 1 115 ? 20.009  21.887  -11.161 1.00 35.33  ? 113 PHE A CE1 1 
ATOM   883  C CE2 . PHE A 1 115 ? 18.229  23.492  -10.910 1.00 34.73  ? 113 PHE A CE2 1 
ATOM   884  C CZ  . PHE A 1 115 ? 19.570  23.143  -10.741 1.00 35.04  ? 113 PHE A CZ  1 
ATOM   885  N N   . LYS A 1 116 ? 16.846  17.833  -14.710 1.00 33.17  ? 114 LYS A N   1 
ATOM   886  C CA  . LYS A 1 116 ? 16.258  16.621  -15.255 1.00 32.63  ? 114 LYS A CA  1 
ATOM   887  C C   . LYS A 1 116 ? 15.794  15.667  -14.168 1.00 31.42  ? 114 LYS A C   1 
ATOM   888  O O   . LYS A 1 116 ? 16.618  15.056  -13.471 1.00 31.37  ? 114 LYS A O   1 
ATOM   889  C CB  . LYS A 1 116 ? 17.240  15.904  -16.182 1.00 33.05  ? 114 LYS A CB  1 
ATOM   890  C CG  . LYS A 1 116 ? 17.162  16.337  -17.631 1.00 35.77  ? 114 LYS A CG  1 
ATOM   891  C CD  . LYS A 1 116 ? 18.384  15.876  -18.410 1.00 37.16  ? 114 LYS A CD  1 
ATOM   892  C CE  . LYS A 1 116 ? 19.397  16.996  -18.522 1.00 41.27  ? 114 LYS A CE  1 
ATOM   893  N NZ  . LYS A 1 116 ? 18.856  18.166  -19.307 1.00 43.11  ? 114 LYS A NZ  1 
ATOM   894  N N   . PHE A 1 117 ? 14.471  15.532  -14.051 1.00 29.34  ? 115 PHE A N   1 
ATOM   895  C CA  . PHE A 1 117 ? 13.852  14.657  -13.065 1.00 28.22  ? 115 PHE A CA  1 
ATOM   896  C C   . PHE A 1 117 ? 12.363  14.479  -13.366 1.00 27.92  ? 115 PHE A C   1 
ATOM   897  O O   . PHE A 1 117 ? 11.750  15.305  -14.068 1.00 27.56  ? 115 PHE A O   1 
ATOM   898  C CB  . PHE A 1 117 ? 14.043  15.204  -11.646 1.00 27.54  ? 115 PHE A CB  1 
ATOM   899  C CG  . PHE A 1 117 ? 13.385  16.532  -11.416 1.00 26.42  ? 115 PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 117 ? 12.025  16.608  -11.069 1.00 25.20  ? 115 PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 117 ? 14.113  17.704  -11.537 1.00 24.08  ? 115 PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 117 ? 11.408  17.837  -10.851 1.00 24.22  ? 115 PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 117 ? 13.504  18.932  -11.346 1.00 24.90  ? 115 PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 117 ? 12.140  19.000  -10.985 1.00 24.28  ? 115 PHE A CZ  1 
ATOM   905  N N   . THR A 1 118 ? 11.812  13.401  -12.814 1.00 26.31  ? 116 THR A N   1 
ATOM   906  C CA  . THR A 1 118 ? 10.449  12.989  -13.020 1.00 25.72  ? 116 THR A CA  1 
ATOM   907  C C   . THR A 1 118 ? 9.845   12.779  -11.648 1.00 25.19  ? 116 THR A C   1 
ATOM   908  O O   . THR A 1 118 ? 10.363  11.992  -10.854 1.00 25.25  ? 116 THR A O   1 
ATOM   909  C CB  . THR A 1 118 ? 10.390  11.656  -13.841 1.00 25.87  ? 116 THR A CB  1 
ATOM   910  O OG1 . THR A 1 118 ? 11.043  11.845  -15.102 1.00 26.12  ? 116 THR A OG1 1 
ATOM   911  C CG2 . THR A 1 118 ? 8.954   11.233  -14.115 1.00 25.55  ? 116 THR A CG2 1 
ATOM   912  N N   . THR A 1 119 ? 8.775   13.504  -11.349 1.00 23.75  ? 117 THR A N   1 
ATOM   913  C CA  . THR A 1 119 ? 8.075   13.304  -10.078 1.00 22.91  ? 117 THR A CA  1 
ATOM   914  C C   . THR A 1 119 ? 6.974   12.243  -10.268 1.00 22.55  ? 117 THR A C   1 
ATOM   915  O O   . THR A 1 119 ? 6.629   11.886  -11.398 1.00 22.46  ? 117 THR A O   1 
ATOM   916  C CB  . THR A 1 119 ? 7.504   14.629  -9.490  1.00 21.91  ? 117 THR A CB  1 
ATOM   917  O OG1 . THR A 1 119 ? 6.380   15.056  -10.256 1.00 22.87  ? 117 THR A OG1 1 
ATOM   918  C CG2 . THR A 1 119 ? 8.519   15.725  -9.504  1.00 20.60  ? 117 THR A CG2 1 
ATOM   919  N N   . PHE A 1 120 ? 6.444   11.737  -9.164  1.00 22.54  ? 118 PHE A N   1 
ATOM   920  C CA  . PHE A 1 120 ? 5.345   10.763  -9.182  1.00 22.99  ? 118 PHE A CA  1 
ATOM   921  C C   . PHE A 1 120 ? 4.044   11.373  -9.736  1.00 22.48  ? 118 PHE A C   1 
ATOM   922  O O   . PHE A 1 120 ? 3.141   10.644  -10.143 1.00 22.43  ? 118 PHE A O   1 
ATOM   923  C CB  . PHE A 1 120 ? 5.120   10.196  -7.771  1.00 23.36  ? 118 PHE A CB  1 
ATOM   924  C CG  . PHE A 1 120 ? 6.019   9.016   -7.420  1.00 25.48  ? 118 PHE A CG  1 
ATOM   925  C CD1 . PHE A 1 120 ? 7.325   8.923   -7.912  1.00 25.06  ? 118 PHE A CD1 1 
ATOM   926  C CD2 . PHE A 1 120 ? 5.559   8.016   -6.562  1.00 27.68  ? 118 PHE A CD2 1 
ATOM   927  C CE1 . PHE A 1 120 ? 8.138   7.850   -7.588  1.00 25.95  ? 118 PHE A CE1 1 
ATOM   928  C CE2 . PHE A 1 120 ? 6.374   6.922   -6.225  1.00 26.39  ? 118 PHE A CE2 1 
ATOM   929  C CZ  . PHE A 1 120 ? 7.663   6.842   -6.747  1.00 26.44  ? 118 PHE A CZ  1 
ATOM   930  N N   . ASP A 1 121 ? 3.970   12.706  -9.719  1.00 21.60  ? 119 ASP A N   1 
ATOM   931  C CA  . ASP A 1 121 ? 2.887   13.499  -10.323 1.00 21.75  ? 119 ASP A CA  1 
ATOM   932  C C   . ASP A 1 121 ? 2.912   13.541  -11.856 1.00 21.22  ? 119 ASP A C   1 
ATOM   933  O O   . ASP A 1 121 ? 1.876   13.749  -12.480 1.00 20.37  ? 119 ASP A O   1 
ATOM   934  C CB  . ASP A 1 121 ? 2.961   14.943  -9.815  1.00 21.68  ? 119 ASP A CB  1 
ATOM   935  C CG  . ASP A 1 121 ? 3.060   15.025  -8.304  1.00 22.65  ? 119 ASP A CG  1 
ATOM   936  O OD1 . ASP A 1 121 ? 2.079   14.669  -7.607  1.00 22.87  ? 119 ASP A OD1 1 
ATOM   937  O OD2 . ASP A 1 121 ? 4.125   15.450  -7.820  1.00 23.14  ? 119 ASP A OD2 1 
ATOM   938  N N   . ASP A 1 122 ? 4.091   13.335  -12.438 1.00 21.55  ? 120 ASP A N   1 
ATOM   939  C CA  . ASP A 1 122 ? 4.329   13.424  -13.900 1.00 22.44  ? 120 ASP A CA  1 
ATOM   940  C C   . ASP A 1 122 ? 3.947   12.185  -14.713 1.00 23.40  ? 120 ASP A C   1 
ATOM   941  O O   . ASP A 1 122 ? 4.045   12.207  -15.955 1.00 22.74  ? 120 ASP A O   1 
ATOM   942  C CB  . ASP A 1 122 ? 5.810   13.719  -14.168 1.00 22.13  ? 120 ASP A CB  1 
ATOM   943  C CG  . ASP A 1 122 ? 6.239   15.103  -13.690 1.00 22.36  ? 120 ASP A CG  1 
ATOM   944  O OD1 . ASP A 1 122 ? 5.419   16.062  -13.738 1.00 21.69  ? 120 ASP A OD1 1 
ATOM   945  O OD2 . ASP A 1 122 ? 7.407   15.233  -13.269 1.00 22.90  ? 120 ASP A OD2 1 
ATOM   946  N N   . VAL A 1 123 ? 3.553   11.100  -14.028 1.00 24.30  ? 121 VAL A N   1 
ATOM   947  C CA  . VAL A 1 123 ? 3.260   9.808   -14.686 1.00 25.77  ? 121 VAL A CA  1 
ATOM   948  C C   . VAL A 1 123 ? 1.917   9.243   -14.238 1.00 27.34  ? 121 VAL A C   1 
ATOM   949  O O   . VAL A 1 123 ? 1.322   9.765   -13.298 1.00 27.96  ? 121 VAL A O   1 
ATOM   950  C CB  . VAL A 1 123 ? 4.388   8.758   -14.439 1.00 25.39  ? 121 VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 123 ? 5.688   9.191   -15.103 1.00 25.54  ? 121 VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 123 ? 4.607   8.515   -12.941 1.00 25.00  ? 121 VAL A CG2 1 
ATOM   953  N N   . ASP A 1 124 ? 1.422   8.200   -14.902 1.00 29.25  ? 122 ASP A N   1 
ATOM   954  C CA  . ASP A 1 124 ? 0.188   7.579   -14.451 1.00 31.89  ? 122 ASP A CA  1 
ATOM   955  C C   . ASP A 1 124 ? 0.428   6.514   -13.381 1.00 33.03  ? 122 ASP A C   1 
ATOM   956  O O   . ASP A 1 124 ? 1.570   6.143   -13.109 1.00 32.93  ? 122 ASP A O   1 
ATOM   957  C CB  . ASP A 1 124 ? -0.648  7.024   -15.615 1.00 32.23  ? 122 ASP A CB  1 
ATOM   958  C CG  . ASP A 1 124 ? 0.122   6.054   -16.502 1.00 34.59  ? 122 ASP A CG  1 
ATOM   959  O OD1 . ASP A 1 124 ? 1.138   5.476   -16.049 1.00 34.98  ? 122 ASP A OD1 1 
ATOM   960  O OD2 . ASP A 1 124 ? -0.311  5.867   -17.672 1.00 36.50  ? 122 ASP A OD2 1 
ATOM   961  N N   . ASP A 1 125 ? -0.666  6.049   -12.778 1.00 34.65  ? 123 ASP A N   1 
ATOM   962  C CA  . ASP A 1 125 ? -0.661  4.982   -11.773 1.00 36.77  ? 123 ASP A CA  1 
ATOM   963  C C   . ASP A 1 125 ? 0.064   3.702   -12.240 1.00 36.73  ? 123 ASP A C   1 
ATOM   964  O O   . ASP A 1 125 ? 0.883   3.166   -11.511 1.00 37.15  ? 123 ASP A O   1 
ATOM   965  C CB  . ASP A 1 125 ? -2.099  4.678   -11.325 1.00 37.93  ? 123 ASP A CB  1 
ATOM   966  C CG  . ASP A 1 125 ? -2.979  5.947   -11.232 1.00 42.08  ? 123 ASP A CG  1 
ATOM   967  O OD1 . ASP A 1 125 ? -3.689  6.114   -10.208 1.00 45.17  ? 123 ASP A OD1 1 
ATOM   968  O OD2 . ASP A 1 125 ? -2.973  6.781   -12.189 1.00 46.25  ? 123 ASP A OD2 1 
ATOM   969  N N   . ALA A 1 126 ? -0.207  3.247   -13.464 1.00 36.86  ? 124 ALA A N   1 
ATOM   970  C CA  . ALA A 1 126 ? 0.458   2.066   -14.045 1.00 36.47  ? 124 ALA A CA  1 
ATOM   971  C C   . ALA A 1 126 ? 1.979   2.163   -14.062 1.00 36.39  ? 124 ALA A C   1 
ATOM   972  O O   . ALA A 1 126 ? 2.670   1.168   -13.871 1.00 36.41  ? 124 ALA A O   1 
ATOM   973  C CB  . ALA A 1 126 ? -0.071  1.783   -15.476 1.00 36.52  ? 124 ALA A CB  1 
ATOM   974  N N   . THR A 1 127 ? 2.501   3.364   -14.294 1.00 36.51  ? 125 THR A N   1 
ATOM   975  C CA  . THR A 1 127 ? 3.947   3.592   -14.302 1.00 36.12  ? 125 THR A CA  1 
ATOM   976  C C   . THR A 1 127 ? 4.516   3.591   -12.891 1.00 37.05  ? 125 THR A C   1 
ATOM   977  O O   . THR A 1 127 ? 5.656   3.194   -12.689 1.00 37.40  ? 125 THR A O   1 
ATOM   978  C CB  . THR A 1 127 ? 4.293   4.917   -14.989 1.00 35.72  ? 125 THR A CB  1 
ATOM   979  O OG1 . THR A 1 127 ? 3.697   4.928   -16.283 1.00 33.36  ? 125 THR A OG1 1 
ATOM   980  C CG2 . THR A 1 127 ? 5.817   5.121   -15.110 1.00 34.01  ? 125 THR A CG2 1 
ATOM   981  N N   . ILE A 1 128 ? 3.730   4.051   -11.922 1.00 37.78  ? 126 ILE A N   1 
ATOM   982  C CA  . ILE A 1 128 ? 4.155   3.988   -10.527 1.00 38.78  ? 126 ILE A CA  1 
ATOM   983  C C   . ILE A 1 128 ? 4.146   2.555   -10.025 1.00 39.30  ? 126 ILE A C   1 
ATOM   984  O O   . ILE A 1 128 ? 5.138   2.104   -9.456  1.00 39.26  ? 126 ILE A O   1 
ATOM   985  C CB  . ILE A 1 128 ? 3.349   4.919   -9.606  1.00 38.76  ? 126 ILE A CB  1 
ATOM   986  C CG1 . ILE A 1 128 ? 3.737   6.371   -9.886  1.00 38.21  ? 126 ILE A CG1 1 
ATOM   987  C CG2 . ILE A 1 128 ? 3.657   4.604   -8.148  1.00 38.86  ? 126 ILE A CG2 1 
ATOM   988  C CD1 . ILE A 1 128 ? 2.650   7.331   -9.601  1.00 37.32  ? 126 ILE A CD1 1 
ATOM   989  N N   . ALA A 1 129 ? 3.049   1.838   -10.273 1.00 40.24  ? 127 ALA A N   1 
ATOM   990  C CA  . ALA A 1 129 ? 2.985   0.388   -10.019 1.00 41.52  ? 127 ALA A CA  1 
ATOM   991  C C   . ALA A 1 129 ? 4.228   -0.325  -10.565 1.00 42.39  ? 127 ALA A C   1 
ATOM   992  O O   . ALA A 1 129 ? 4.820   -1.165  -9.893  1.00 42.64  ? 127 ALA A O   1 
ATOM   993  C CB  . ALA A 1 129 ? 1.707   -0.216  -10.609 1.00 40.86  ? 127 ALA A CB  1 
ATOM   994  N N   . GLU A 1 130 ? 4.638   0.046   -11.771 1.00 43.67  ? 128 GLU A N   1 
ATOM   995  C CA  . GLU A 1 130 ? 5.820   -0.525  -12.398 1.00 44.96  ? 128 GLU A CA  1 
ATOM   996  C C   . GLU A 1 130 ? 7.127   -0.136  -11.707 1.00 45.57  ? 128 GLU A C   1 
ATOM   997  O O   . GLU A 1 130 ? 8.073   -0.936  -11.694 1.00 46.38  ? 128 GLU A O   1 
ATOM   998  C CB  . GLU A 1 130 ? 5.874   -0.147  -13.877 1.00 45.19  ? 128 GLU A CB  1 
ATOM   999  C CG  . GLU A 1 130 ? 7.236   -0.376  -14.543 1.00 47.79  ? 128 GLU A CG  1 
ATOM   1000 C CD  . GLU A 1 130 ? 7.419   0.456   -15.807 1.00 51.89  ? 128 GLU A CD  1 
ATOM   1001 O OE1 . GLU A 1 130 ? 6.518   0.422   -16.683 1.00 52.70  ? 128 GLU A OE1 1 
ATOM   1002 O OE2 . GLU A 1 130 ? 8.464   1.145   -15.925 1.00 52.95  ? 128 GLU A OE2 1 
ATOM   1003 N N   . TRP A 1 131 ? 7.199   1.083   -11.166 1.00 45.72  ? 129 TRP A N   1 
ATOM   1004 C CA  . TRP A 1 131 ? 8.417   1.554   -10.493 1.00 45.94  ? 129 TRP A CA  1 
ATOM   1005 C C   . TRP A 1 131 ? 8.519   0.998   -9.070  1.00 46.75  ? 129 TRP A C   1 
ATOM   1006 O O   . TRP A 1 131 ? 9.620   0.793   -8.558  1.00 46.73  ? 129 TRP A O   1 
ATOM   1007 C CB  . TRP A 1 131 ? 8.451   3.084   -10.404 1.00 45.55  ? 129 TRP A CB  1 
ATOM   1008 C CG  . TRP A 1 131 ? 8.740   3.825   -11.676 1.00 45.11  ? 129 TRP A CG  1 
ATOM   1009 C CD1 . TRP A 1 131 ? 9.230   3.313   -12.849 1.00 44.99  ? 129 TRP A CD1 1 
ATOM   1010 C CD2 . TRP A 1 131 ? 8.586   5.231   -11.888 1.00 45.06  ? 129 TRP A CD2 1 
ATOM   1011 N NE1 . TRP A 1 131 ? 9.370   4.315   -13.782 1.00 44.88  ? 129 TRP A NE1 1 
ATOM   1012 C CE2 . TRP A 1 131 ? 8.993   5.503   -13.215 1.00 44.08  ? 129 TRP A CE2 1 
ATOM   1013 C CE3 . TRP A 1 131 ? 8.136   6.291   -11.087 1.00 44.17  ? 129 TRP A CE3 1 
ATOM   1014 C CZ2 . TRP A 1 131 ? 8.970   6.793   -13.756 1.00 44.47  ? 129 TRP A CZ2 1 
ATOM   1015 C CZ3 . TRP A 1 131 ? 8.113   7.572   -11.627 1.00 44.39  ? 129 TRP A CZ3 1 
ATOM   1016 C CH2 . TRP A 1 131 ? 8.529   7.812   -12.949 1.00 44.13  ? 129 TRP A CH2 1 
ATOM   1017 N N   . THR A 1 132 ? 7.362   0.773   -8.443  1.00 47.60  ? 130 THR A N   1 
ATOM   1018 C CA  . THR A 1 132 ? 7.279   0.474   -7.015  1.00 48.40  ? 130 THR A CA  1 
ATOM   1019 C C   . THR A 1 132 ? 6.922   -0.979  -6.732  1.00 49.26  ? 130 THR A C   1 
ATOM   1020 O O   . THR A 1 132 ? 6.964   -1.419  -5.577  1.00 49.66  ? 130 THR A O   1 
ATOM   1021 C CB  . THR A 1 132 ? 6.243   1.360   -6.324  1.00 48.32  ? 130 THR A CB  1 
ATOM   1022 O OG1 . THR A 1 132 ? 4.954   1.132   -6.907  1.00 48.27  ? 130 THR A OG1 1 
ATOM   1023 C CG2 . THR A 1 132 ? 6.615   2.836   -6.449  1.00 48.21  ? 130 THR A CG2 1 
ATOM   1024 N N   . GLY A 1 133 ? 6.568   -1.715  -7.787  1.00 49.70  ? 131 GLY A N   1 
ATOM   1025 C CA  . GLY A 1 133 ? 6.124   -3.096  -7.663  1.00 49.86  ? 131 GLY A CA  1 
ATOM   1026 C C   . GLY A 1 133 ? 4.738   -3.240  -7.059  1.00 50.05  ? 131 GLY A C   1 
ATOM   1027 O O   . GLY A 1 133 ? 4.190   -4.345  -7.031  1.00 50.38  ? 131 GLY A O   1 
ATOM   1028 N N   . LEU A 1 134 ? 4.164   -2.136  -6.581  1.00 49.84  ? 132 LEU A N   1 
ATOM   1029 C CA  . LEU A 1 134 ? 2.839   -2.158  -5.953  1.00 50.20  ? 132 LEU A CA  1 
ATOM   1030 C C   . LEU A 1 134 ? 1.745   -2.401  -6.981  1.00 50.25  ? 132 LEU A C   1 
ATOM   1031 O O   . LEU A 1 134 ? 1.984   -2.285  -8.176  1.00 50.64  ? 132 LEU A O   1 
ATOM   1032 C CB  . LEU A 1 134 ? 2.564   -0.847  -5.205  1.00 50.12  ? 132 LEU A CB  1 
ATOM   1033 C CG  . LEU A 1 134 ? 3.564   -0.339  -4.155  1.00 50.43  ? 132 LEU A CG  1 
ATOM   1034 C CD1 . LEU A 1 134 ? 3.204   1.081   -3.741  1.00 50.29  ? 132 LEU A CD1 1 
ATOM   1035 C CD2 . LEU A 1 134 ? 3.648   -1.255  -2.932  1.00 50.84  ? 132 LEU A CD2 1 
ATOM   1036 N N   . SER A 1 135 ? 0.544   -2.746  -6.522  1.00 50.60  ? 133 SER A N   1 
ATOM   1037 C CA  . SER A 1 135 ? -0.600  -2.888  -7.432  1.00 50.68  ? 133 SER A CA  1 
ATOM   1038 C C   . SER A 1 135 ? -0.995  -1.499  -7.926  1.00 50.87  ? 133 SER A C   1 
ATOM   1039 O O   . SER A 1 135 ? -0.564  -0.495  -7.354  1.00 51.48  ? 133 SER A O   1 
ATOM   1040 C CB  . SER A 1 135 ? -1.774  -3.572  -6.731  1.00 50.54  ? 133 SER A CB  1 
ATOM   1041 O OG  . SER A 1 135 ? -2.207  -2.830  -5.608  1.00 49.87  ? 133 SER A OG  1 
ATOM   1042 N N   . ARG A 1 136 ? -1.797  -1.419  -8.981  1.00 50.78  ? 134 ARG A N   1 
ATOM   1043 C CA  . ARG A 1 136 ? -2.171  -0.112  -9.510  1.00 50.55  ? 134 ARG A CA  1 
ATOM   1044 C C   . ARG A 1 136 ? -2.903  0.722   -8.450  1.00 49.91  ? 134 ARG A C   1 
ATOM   1045 O O   . ARG A 1 136 ? -2.692  1.941   -8.353  1.00 49.80  ? 134 ARG A O   1 
ATOM   1046 C CB  . ARG A 1 136 ? -2.994  -0.236  -10.799 1.00 51.05  ? 134 ARG A CB  1 
ATOM   1047 C CG  . ARG A 1 136 ? -3.013  1.053   -11.626 1.00 52.75  ? 134 ARG A CG  1 
ATOM   1048 C CD  . ARG A 1 136 ? -3.425  0.838   -13.077 1.00 55.64  ? 134 ARG A CD  1 
ATOM   1049 N NE  . ARG A 1 136 ? -4.859  0.581   -13.211 1.00 59.05  ? 134 ARG A NE  1 
ATOM   1050 C CZ  . ARG A 1 136 ? -5.811  1.513   -13.257 1.00 60.26  ? 134 ARG A CZ  1 
ATOM   1051 N NH1 . ARG A 1 136 ? -5.512  2.808   -13.170 1.00 60.98  ? 134 ARG A NH1 1 
ATOM   1052 N NH2 . ARG A 1 136 ? -7.081  1.141   -13.380 1.00 60.79  ? 134 ARG A NH2 1 
ATOM   1053 N N   . SER A 1 137 ? -3.723  0.041   -7.646  1.00 48.88  ? 135 SER A N   1 
ATOM   1054 C CA  . SER A 1 137 ? -4.587  0.660   -6.645  1.00 48.02  ? 135 SER A CA  1 
ATOM   1055 C C   . SER A 1 137 ? -3.803  1.256   -5.477  1.00 47.34  ? 135 SER A C   1 
ATOM   1056 O O   . SER A 1 137 ? -4.183  2.302   -4.922  1.00 46.99  ? 135 SER A O   1 
ATOM   1057 C CB  . SER A 1 137 ? -5.573  -0.383  -6.114  1.00 48.23  ? 135 SER A CB  1 
ATOM   1058 O OG  . SER A 1 137 ? -6.660  0.235   -5.444  1.00 49.47  ? 135 SER A OG  1 
ATOM   1059 N N   . GLN A 1 138 ? -2.724  0.570   -5.106  1.00 46.68  ? 136 GLN A N   1 
ATOM   1060 C CA  A GLN A 1 138 ? -1.837  1.027   -4.036  0.50 46.47  ? 136 GLN A CA  1 
ATOM   1061 C CA  B GLN A 1 138 ? -1.852  1.029   -4.036  0.50 46.55  ? 136 GLN A CA  1 
ATOM   1062 C C   . GLN A 1 138 ? -0.928  2.141   -4.529  1.00 46.09  ? 136 GLN A C   1 
ATOM   1063 O O   . GLN A 1 138 ? -0.689  3.108   -3.813  1.00 46.10  ? 136 GLN A O   1 
ATOM   1064 C CB  A GLN A 1 138 ? -1.008  -0.127  -3.452  0.50 46.55  ? 136 GLN A CB  1 
ATOM   1065 C CB  B GLN A 1 138 ? -1.061  -0.144  -3.441  0.50 46.68  ? 136 GLN A CB  1 
ATOM   1066 C CG  A GLN A 1 138 ? -1.495  -0.616  -2.083  0.50 46.61  ? 136 GLN A CG  1 
ATOM   1067 C CG  B GLN A 1 138 ? -1.920  -1.364  -3.052  0.50 47.09  ? 136 GLN A CG  1 
ATOM   1068 C CD  A GLN A 1 138 ? -0.379  -1.203  -1.225  0.50 46.46  ? 136 GLN A CD  1 
ATOM   1069 C CD  B GLN A 1 138 ? -3.203  -1.002  -2.298  0.50 47.61  ? 136 GLN A CD  1 
ATOM   1070 O OE1 A GLN A 1 138 ? -0.031  -0.649  -0.186  0.50 45.67  ? 136 GLN A OE1 1 
ATOM   1071 O OE1 B GLN A 1 138 ? -4.312  -1.324  -2.742  0.50 47.53  ? 136 GLN A OE1 1 
ATOM   1072 N NE2 A GLN A 1 138 ? 0.189   -2.324  -1.664  0.50 46.15  ? 136 GLN A NE2 1 
ATOM   1073 N NE2 B GLN A 1 138 ? -3.053  -0.331  -1.159  0.50 47.18  ? 136 GLN A NE2 1 
ATOM   1074 N N   . ALA A 1 139 ? -0.430  1.988   -5.759  1.00 45.31  ? 137 ALA A N   1 
ATOM   1075 C CA  . ALA A 1 139 ? 0.321   3.022   -6.469  1.00 44.26  ? 137 ALA A CA  1 
ATOM   1076 C C   . ALA A 1 139 ? -0.443  4.364   -6.525  1.00 43.52  ? 137 ALA A C   1 
ATOM   1077 O O   . ALA A 1 139 ? 0.160   5.436   -6.407  1.00 43.77  ? 137 ALA A O   1 
ATOM   1078 C CB  . ALA A 1 139 ? 0.657   2.544   -7.878  1.00 44.00  ? 137 ALA A CB  1 
ATOM   1079 N N   . ALA A 1 140 ? -1.760  4.300   -6.707  1.00 42.27  ? 138 ALA A N   1 
ATOM   1080 C CA  . ALA A 1 140 ? -2.617  5.483   -6.616  1.00 41.42  ? 138 ALA A CA  1 
ATOM   1081 C C   . ALA A 1 140 ? -2.519  6.204   -5.258  1.00 41.16  ? 138 ALA A C   1 
ATOM   1082 O O   . ALA A 1 140 ? -2.516  7.442   -5.216  1.00 41.07  ? 138 ALA A O   1 
ATOM   1083 C CB  . ALA A 1 140 ? -4.068  5.118   -6.922  1.00 41.17  ? 138 ALA A CB  1 
ATOM   1084 N N   . LEU A 1 141 ? -2.444  5.440   -4.158  1.00 40.44  ? 139 LEU A N   1 
ATOM   1085 C CA  . LEU A 1 141 ? -2.286  6.024   -2.816  1.00 39.63  ? 139 LEU A CA  1 
ATOM   1086 C C   . LEU A 1 141 ? -0.882  6.581   -2.652  1.00 39.78  ? 139 LEU A C   1 
ATOM   1087 O O   . LEU A 1 141 ? -0.677  7.591   -1.988  1.00 39.71  ? 139 LEU A O   1 
ATOM   1088 C CB  . LEU A 1 141 ? -2.559  4.999   -1.725  1.00 38.80  ? 139 LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 141 ? -3.898  4.272   -1.732  1.00 37.81  ? 139 LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 141 ? -3.843  3.232   -0.665  1.00 37.26  ? 139 LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 141 ? -5.127  5.207   -1.535  1.00 37.11  ? 139 LEU A CD2 1 
ATOM   1092 N N   . THR A 1 142 ? 0.077   5.900   -3.271  1.00 40.27  ? 140 THR A N   1 
ATOM   1093 C CA  . THR A 1 142 ? 1.471   6.328   -3.329  1.00 40.85  ? 140 THR A CA  1 
ATOM   1094 C C   . THR A 1 142 ? 1.641   7.654   -4.085  1.00 40.96  ? 140 THR A C   1 
ATOM   1095 O O   . THR A 1 142 ? 2.623   8.393   -3.882  1.00 41.12  ? 140 THR A O   1 
ATOM   1096 C CB  . THR A 1 142 ? 2.335   5.203   -3.924  1.00 41.03  ? 140 THR A CB  1 
ATOM   1097 O OG1 . THR A 1 142 ? 3.011   4.524   -2.864  1.00 43.14  ? 140 THR A OG1 1 
ATOM   1098 C CG2 . THR A 1 142 ? 3.365   5.715   -4.887  1.00 40.50  ? 140 THR A CG2 1 
ATOM   1099 N N   . GLN A 1 143 ? 0.660   7.957   -4.926  1.00 40.65  ? 141 GLN A N   1 
ATOM   1100 C CA  . GLN A 1 143 ? 0.675   9.164   -5.736  1.00 40.77  ? 141 GLN A CA  1 
ATOM   1101 C C   . GLN A 1 143 ? 0.021   10.371  -5.034  1.00 39.58  ? 141 GLN A C   1 
ATOM   1102 O O   . GLN A 1 143 ? 0.424   11.508  -5.275  1.00 39.89  ? 141 GLN A O   1 
ATOM   1103 C CB  . GLN A 1 143 ? 0.039   8.885   -7.109  1.00 40.57  ? 141 GLN A CB  1 
ATOM   1104 C CG  . GLN A 1 143 ? 0.552   9.780   -8.207  1.00 41.84  ? 141 GLN A CG  1 
ATOM   1105 C CD  . GLN A 1 143 ? -0.061  9.472   -9.557  1.00 42.62  ? 141 GLN A CD  1 
ATOM   1106 O OE1 . GLN A 1 143 ? 0.598   9.619   -10.591 1.00 43.68  ? 141 GLN A OE1 1 
ATOM   1107 N NE2 . GLN A 1 143 ? -1.329  9.042   -9.562  1.00 43.96  ? 141 GLN A NE2 1 
ATOM   1108 N N   . LEU A 1 144 ? -0.972  10.135  -4.169  1.00 38.52  ? 142 LEU A N   1 
ATOM   1109 C CA  . LEU A 1 144 ? -1.535  11.202  -3.327  1.00 37.07  ? 142 LEU A CA  1 
ATOM   1110 C C   . LEU A 1 144 ? -0.553  11.658  -2.263  1.00 36.22  ? 142 LEU A C   1 
ATOM   1111 O O   . LEU A 1 144 ? -0.243  10.883  -1.368  1.00 36.64  ? 142 LEU A O   1 
ATOM   1112 C CB  . LEU A 1 144 ? -2.788  10.737  -2.607  1.00 37.25  ? 142 LEU A CB  1 
ATOM   1113 C CG  . LEU A 1 144 ? -4.163  10.784  -3.257  1.00 38.79  ? 142 LEU A CG  1 
ATOM   1114 C CD1 . LEU A 1 144 ? -5.222  10.624  -2.167  1.00 39.41  ? 142 LEU A CD1 1 
ATOM   1115 C CD2 . LEU A 1 144 ? -4.382  12.100  -4.036  1.00 40.74  ? 142 LEU A CD2 1 
ATOM   1116 N N   . HIS A 1 145 ? -0.059  12.898  -2.377  1.00 34.73  ? 143 HIS A N   1 
ATOM   1117 C CA  . HIS A 1 145 ? 0.777   13.541  -1.355  1.00 33.10  ? 143 HIS A CA  1 
ATOM   1118 C C   . HIS A 1 145 ? 0.076   14.763  -0.787  1.00 33.12  ? 143 HIS A C   1 
ATOM   1119 O O   . HIS A 1 145 ? -0.543  15.544  -1.520  1.00 32.98  ? 143 HIS A O   1 
ATOM   1120 C CB  . HIS A 1 145 ? 2.111   14.017  -1.912  1.00 32.42  ? 143 HIS A CB  1 
ATOM   1121 C CG  . HIS A 1 145 ? 3.054   12.917  -2.289  1.00 30.98  ? 143 HIS A CG  1 
ATOM   1122 N ND1 . HIS A 1 145 ? 2.807   12.047  -3.329  1.00 30.10  ? 143 HIS A ND1 1 
ATOM   1123 C CD2 . HIS A 1 145 ? 4.269   12.581  -1.799  1.00 27.84  ? 143 HIS A CD2 1 
ATOM   1124 C CE1 . HIS A 1 145 ? 3.826   11.215  -3.455  1.00 29.21  ? 143 HIS A CE1 1 
ATOM   1125 N NE2 . HIS A 1 145 ? 4.723   11.514  -2.536  1.00 28.41  ? 143 HIS A NE2 1 
ATOM   1126 N N   . GLU A 1 146 ? 0.197   14.938  0.523   1.00 32.36  ? 144 GLU A N   1 
ATOM   1127 C CA  . GLU A 1 146 ? -0.291  16.137  1.182   1.00 31.88  ? 144 GLU A CA  1 
ATOM   1128 C C   . GLU A 1 146 ? 0.769   17.235  1.290   1.00 30.18  ? 144 GLU A C   1 
ATOM   1129 O O   . GLU A 1 146 ? 0.476   18.402  1.082   1.00 30.40  ? 144 GLU A O   1 
ATOM   1130 C CB  . GLU A 1 146 ? -0.840  15.788  2.570   1.00 32.71  ? 144 GLU A CB  1 
ATOM   1131 C CG  . GLU A 1 146 ? -1.971  14.759  2.528   1.00 36.36  ? 144 GLU A CG  1 
ATOM   1132 C CD  . GLU A 1 146 ? -3.164  15.222  3.306   1.00 42.32  ? 144 GLU A CD  1 
ATOM   1133 O OE1 . GLU A 1 146 ? -4.213  15.514  2.679   1.00 45.02  ? 144 GLU A OE1 1 
ATOM   1134 O OE2 . GLU A 1 146 ? -3.047  15.320  4.550   1.00 46.33  ? 144 GLU A OE2 1 
ATOM   1135 N N   . ALA A 1 147 ? 1.999   16.877  1.626   1.00 28.66  ? 145 ALA A N   1 
ATOM   1136 C CA  . ALA A 1 147 ? 2.986   17.900  1.937   1.00 27.09  ? 145 ALA A CA  1 
ATOM   1137 C C   . ALA A 1 147 ? 4.395   17.506  1.537   1.00 26.53  ? 145 ALA A C   1 
ATOM   1138 O O   . ALA A 1 147 ? 5.376   17.822  2.239   1.00 25.61  ? 145 ALA A O   1 
ATOM   1139 C CB  . ALA A 1 147 ? 2.919   18.279  3.424   1.00 26.69  ? 145 ALA A CB  1 
ATOM   1140 N N   . SER A 1 148 ? 4.498   16.825  0.395   1.00 25.51  ? 146 SER A N   1 
ATOM   1141 C CA  . SER A 1 148 ? 5.799   16.436  -0.134  1.00 24.88  ? 146 SER A CA  1 
ATOM   1142 C C   . SER A 1 148 ? 5.663   16.033  -1.598  1.00 24.50  ? 146 SER A C   1 
ATOM   1143 O O   . SER A 1 148 ? 4.549   15.947  -2.105  1.00 24.37  ? 146 SER A O   1 
ATOM   1144 C CB  . SER A 1 148 ? 6.417   15.291  0.690   1.00 24.44  ? 146 SER A CB  1 
ATOM   1145 O OG  . SER A 1 148 ? 5.608   14.129  0.590   1.00 23.51  ? 146 SER A OG  1 
ATOM   1146 N N   . VAL A 1 149 ? 6.807   15.827  -2.257  1.00 24.10  ? 147 VAL A N   1 
ATOM   1147 C CA  . VAL A 1 149 ? 6.881   15.319  -3.625  1.00 24.24  ? 147 VAL A CA  1 
ATOM   1148 C C   . VAL A 1 149 ? 7.938   14.215  -3.695  1.00 24.51  ? 147 VAL A C   1 
ATOM   1149 O O   . VAL A 1 149 ? 9.061   14.375  -3.217  1.00 24.29  ? 147 VAL A O   1 
ATOM   1150 C CB  . VAL A 1 149 ? 7.172   16.448  -4.654  1.00 24.01  ? 147 VAL A CB  1 
ATOM   1151 C CG1 . VAL A 1 149 ? 7.669   15.867  -5.998  1.00 23.67  ? 147 VAL A CG1 1 
ATOM   1152 C CG2 . VAL A 1 149 ? 5.926   17.302  -4.868  1.00 22.91  ? 147 VAL A CG2 1 
ATOM   1153 N N   . THR A 1 150 ? 7.545   13.079  -4.259  1.00 24.75  ? 148 THR A N   1 
ATOM   1154 C CA  . THR A 1 150 ? 8.464   11.983  -4.531  1.00 25.03  ? 148 THR A CA  1 
ATOM   1155 C C   . THR A 1 150 ? 8.907   12.089  -5.987  1.00 25.24  ? 148 THR A C   1 
ATOM   1156 O O   . THR A 1 150 ? 8.087   12.339  -6.885  1.00 24.89  ? 148 THR A O   1 
ATOM   1157 C CB  . THR A 1 150 ? 7.780   10.634  -4.269  1.00 25.34  ? 148 THR A CB  1 
ATOM   1158 O OG1 . THR A 1 150 ? 7.179   10.649  -2.966  1.00 26.39  ? 148 THR A OG1 1 
ATOM   1159 C CG2 . THR A 1 150 ? 8.783   9.483   -4.340  1.00 25.65  ? 148 THR A CG2 1 
ATOM   1160 N N   . LEU A 1 151 ? 10.203  11.918  -6.220  1.00 26.09  ? 149 LEU A N   1 
ATOM   1161 C CA  . LEU A 1 151 ? 10.758  12.002  -7.572  1.00 26.86  ? 149 LEU A CA  1 
ATOM   1162 C C   . LEU A 1 151 ? 11.922  11.031  -7.838  1.00 28.00  ? 149 LEU A C   1 
ATOM   1163 O O   . LEU A 1 151 ? 12.581  10.553  -6.917  1.00 27.69  ? 149 LEU A O   1 
ATOM   1164 C CB  . LEU A 1 151 ? 11.183  13.447  -7.896  1.00 26.65  ? 149 LEU A CB  1 
ATOM   1165 C CG  . LEU A 1 151 ? 12.327  14.131  -7.125  1.00 26.42  ? 149 LEU A CG  1 
ATOM   1166 C CD1 . LEU A 1 151 ? 13.691  13.779  -7.706  1.00 27.63  ? 149 LEU A CD1 1 
ATOM   1167 C CD2 . LEU A 1 151 ? 12.151  15.627  -7.111  1.00 26.65  ? 149 LEU A CD2 1 
ATOM   1168 N N   . ILE A 1 152 ? 12.147  10.761  -9.119  1.00 29.12  ? 150 ILE A N   1 
ATOM   1169 C CA  . ILE A 1 152 ? 13.349  10.122  -9.607  1.00 30.58  ? 150 ILE A CA  1 
ATOM   1170 C C   . ILE A 1 152 ? 14.241  11.185  -10.234 1.00 31.51  ? 150 ILE A C   1 
ATOM   1171 O O   . ILE A 1 152 ? 13.803  11.932  -11.104 1.00 31.62  ? 150 ILE A O   1 
ATOM   1172 C CB  . ILE A 1 152 ? 13.015  9.026   -10.648 1.00 30.67  ? 150 ILE A CB  1 
ATOM   1173 C CG1 . ILE A 1 152 ? 12.212  7.909   -9.986  1.00 30.03  ? 150 ILE A CG1 1 
ATOM   1174 C CG2 . ILE A 1 152 ? 14.296  8.466   -11.302 1.00 31.22  ? 150 ILE A CG2 1 
ATOM   1175 C CD1 . ILE A 1 152 ? 11.725  6.829   -10.935 1.00 30.82  ? 150 ILE A CD1 1 
ATOM   1176 N N   . TRP A 1 153 ? 15.491  11.254  -9.783  1.00 32.58  ? 151 TRP A N   1 
ATOM   1177 C CA  . TRP A 1 153 ? 16.472  12.186  -10.329 1.00 33.57  ? 151 TRP A CA  1 
ATOM   1178 C C   . TRP A 1 153 ? 17.050  11.636  -11.643 1.00 35.02  ? 151 TRP A C   1 
ATOM   1179 O O   . TRP A 1 153 ? 17.368  10.461  -11.720 1.00 36.00  ? 151 TRP A O   1 
ATOM   1180 C CB  . TRP A 1 153 ? 17.583  12.434  -9.303  1.00 32.84  ? 151 TRP A CB  1 
ATOM   1181 C CG  . TRP A 1 153 ? 18.522  13.539  -9.703  1.00 33.16  ? 151 TRP A CG  1 
ATOM   1182 C CD1 . TRP A 1 153 ? 19.837  13.413  -10.100 1.00 32.36  ? 151 TRP A CD1 1 
ATOM   1183 C CD2 . TRP A 1 153 ? 18.215  14.929  -9.782  1.00 31.64  ? 151 TRP A CD2 1 
ATOM   1184 N NE1 . TRP A 1 153 ? 20.365  14.650  -10.390 1.00 31.71  ? 151 TRP A NE1 1 
ATOM   1185 C CE2 . TRP A 1 153 ? 19.394  15.596  -10.213 1.00 32.43  ? 151 TRP A CE2 1 
ATOM   1186 C CE3 . TRP A 1 153 ? 17.064  15.684  -9.524  1.00 31.31  ? 151 TRP A CE3 1 
ATOM   1187 C CZ2 . TRP A 1 153 ? 19.445  16.975  -10.402 1.00 31.97  ? 151 TRP A CZ2 1 
ATOM   1188 C CZ3 . TRP A 1 153 ? 17.119  17.058  -9.707  1.00 31.19  ? 151 TRP A CZ3 1 
ATOM   1189 C CH2 . TRP A 1 153 ? 18.298  17.687  -10.144 1.00 32.66  ? 151 TRP A CH2 1 
ATOM   1190 N N   . ARG A 1 154 ? 17.165  12.474  -12.675 1.00 36.52  ? 152 ARG A N   1 
ATOM   1191 C CA  . ARG A 1 154 ? 17.580  12.021  -14.019 1.00 37.86  ? 152 ARG A CA  1 
ATOM   1192 C C   . ARG A 1 154 ? 18.720  12.886  -14.569 1.00 39.03  ? 152 ARG A C   1 
ATOM   1193 O O   . ARG A 1 154 ? 18.946  12.987  -15.793 1.00 39.63  ? 152 ARG A O   1 
ATOM   1194 C CB  . ARG A 1 154 ? 16.392  12.078  -14.994 1.00 37.45  ? 152 ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 154 ? 15.254  11.149  -14.682 1.00 37.36  ? 152 ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 154 ? 15.748  9.748   -14.694 1.00 37.28  ? 152 ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 154 ? 14.673  8.774   -14.739 1.00 37.06  ? 152 ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 154 ? 14.868  7.473   -14.572 1.00 38.92  ? 152 ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 154 ? 16.099  7.014   -14.341 1.00 39.74  ? 152 ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 154 ? 13.843  6.635   -14.624 1.00 39.08  ? 152 ARG A NH2 1 
ATOM   1201 N N   . ASP A 1 155 ? 19.429  13.527  -13.659 1.00 40.02  ? 153 ASP A N   1 
ATOM   1202 C CA  . ASP A 1 155 ? 20.462  14.442  -14.034 1.00 41.15  ? 153 ASP A CA  1 
ATOM   1203 C C   . ASP A 1 155 ? 21.772  13.983  -13.408 1.00 42.05  ? 153 ASP A C   1 
ATOM   1204 O O   . ASP A 1 155 ? 21.848  12.891  -12.851 1.00 41.81  ? 153 ASP A O   1 
ATOM   1205 C CB  . ASP A 1 155 ? 20.081  15.839  -13.571 1.00 40.97  ? 153 ASP A CB  1 
ATOM   1206 C CG  . ASP A 1 155 ? 20.519  16.897  -14.533 1.00 42.33  ? 153 ASP A CG  1 
ATOM   1207 O OD1 . ASP A 1 155 ? 21.591  16.708  -15.167 1.00 43.83  ? 153 ASP A OD1 1 
ATOM   1208 O OD2 . ASP A 1 155 ? 19.796  17.912  -14.653 1.00 40.62  ? 153 ASP A OD2 1 
ATOM   1209 N N   . SER A 1 156 ? 22.802  14.815  -13.516 1.00 43.47  ? 154 SER A N   1 
ATOM   1210 C CA  . SER A 1 156 ? 24.123  14.463  -13.013 1.00 44.87  ? 154 SER A CA  1 
ATOM   1211 C C   . SER A 1 156 ? 24.235  14.878  -11.553 1.00 45.73  ? 154 SER A C   1 
ATOM   1212 O O   . SER A 1 156 ? 23.443  15.705  -11.069 1.00 46.12  ? 154 SER A O   1 
ATOM   1213 C CB  . SER A 1 156 ? 25.195  15.166  -13.835 1.00 44.62  ? 154 SER A CB  1 
ATOM   1214 O OG  . SER A 1 156 ? 25.183  16.551  -13.555 1.00 44.82  ? 154 SER A OG  1 
ATOM   1215 N N   . ASP A 1 157 ? 25.218  14.296  -10.863 1.00 46.54  ? 155 ASP A N   1 
ATOM   1216 C CA  . ASP A 1 157 ? 25.493  14.588  -9.457  1.00 46.84  ? 155 ASP A CA  1 
ATOM   1217 C C   . ASP A 1 157 ? 25.810  16.053  -9.206  1.00 46.58  ? 155 ASP A C   1 
ATOM   1218 O O   . ASP A 1 157 ? 25.390  16.609  -8.195  1.00 46.52  ? 155 ASP A O   1 
ATOM   1219 C CB  . ASP A 1 157 ? 26.629  13.702  -8.940  1.00 47.70  ? 155 ASP A CB  1 
ATOM   1220 C CG  . ASP A 1 157 ? 26.293  12.211  -9.001  1.00 49.47  ? 155 ASP A CG  1 
ATOM   1221 O OD1 . ASP A 1 157 ? 25.229  11.845  -9.559  1.00 50.86  ? 155 ASP A OD1 1 
ATOM   1222 O OD2 . ASP A 1 157 ? 27.104  11.403  -8.489  1.00 51.18  ? 155 ASP A OD2 1 
ATOM   1223 N N   . GLU A 1 158 ? 26.538  16.684  -10.121 1.00 46.79  ? 156 GLU A N   1 
ATOM   1224 C CA  . GLU A 1 158 ? 26.846  18.124  -10.002 1.00 47.29  ? 156 GLU A CA  1 
ATOM   1225 C C   . GLU A 1 158 ? 25.563  18.961  -10.095 1.00 46.72  ? 156 GLU A C   1 
ATOM   1226 O O   . GLU A 1 158 ? 25.403  19.960  -9.388  1.00 46.36  ? 156 GLU A O   1 
ATOM   1227 C CB  . GLU A 1 158 ? 27.900  18.558  -11.049 1.00 47.71  ? 156 GLU A CB  1 
ATOM   1228 C CG  . GLU A 1 158 ? 27.764  19.991  -11.604 1.00 49.71  ? 156 GLU A CG  1 
ATOM   1229 C CD  . GLU A 1 158 ? 28.695  21.018  -10.944 1.00 53.42  ? 156 GLU A CD  1 
ATOM   1230 O OE1 . GLU A 1 158 ? 28.191  21.952  -10.276 1.00 53.37  ? 156 GLU A OE1 1 
ATOM   1231 O OE2 . GLU A 1 158 ? 29.936  20.911  -11.121 1.00 55.90  ? 156 GLU A OE2 1 
ATOM   1232 N N   . ARG A 1 159 ? 24.648  18.529  -10.959 1.00 46.61  ? 157 ARG A N   1 
ATOM   1233 C CA  . ARG A 1 159 ? 23.346  19.192  -11.106 1.00 46.25  ? 157 ARG A CA  1 
ATOM   1234 C C   . ARG A 1 159 ? 22.465  18.961  -9.874  1.00 45.58  ? 157 ARG A C   1 
ATOM   1235 O O   . ARG A 1 159 ? 21.758  19.856  -9.428  1.00 45.50  ? 157 ARG A O   1 
ATOM   1236 C CB  . ARG A 1 159 ? 22.670  18.749  -12.402 1.00 46.15  ? 157 ARG A CB  1 
ATOM   1237 C CG  . ARG A 1 159 ? 23.378  19.288  -13.645 1.00 46.74  ? 157 ARG A CG  1 
ATOM   1238 C CD  . ARG A 1 159 ? 23.141  20.793  -13.818 1.00 47.04  ? 157 ARG A CD  1 
ATOM   1239 N NE  . ARG A 1 159 ? 21.877  21.039  -14.522 1.00 47.08  ? 157 ARG A NE  1 
ATOM   1240 C CZ  . ARG A 1 159 ? 21.219  22.194  -14.561 1.00 46.11  ? 157 ARG A CZ  1 
ATOM   1241 N NH1 . ARG A 1 159 ? 21.675  23.268  -13.922 1.00 44.63  ? 157 ARG A NH1 1 
ATOM   1242 N NH2 . ARG A 1 159 ? 20.086  22.263  -15.247 1.00 45.48  ? 157 ARG A NH2 1 
ATOM   1243 N N   . MET A 1 160 ? 22.566  17.767  -9.302  1.00 45.50  ? 158 MET A N   1 
ATOM   1244 C CA  . MET A 1 160 ? 21.932  17.448  -8.029  1.00 45.51  ? 158 MET A CA  1 
ATOM   1245 C C   . MET A 1 160 ? 22.370  18.341  -6.867  1.00 45.37  ? 158 MET A C   1 
ATOM   1246 O O   . MET A 1 160 ? 21.533  18.759  -6.058  1.00 45.60  ? 158 MET A O   1 
ATOM   1247 C CB  . MET A 1 160 ? 22.162  15.987  -7.674  1.00 45.60  ? 158 MET A CB  1 
ATOM   1248 C CG  . MET A 1 160 ? 21.110  15.467  -6.710  1.00 46.55  ? 158 MET A CG  1 
ATOM   1249 S SD  . MET A 1 160 ? 21.606  13.962  -5.893  1.00 46.44  ? 158 MET A SD  1 
ATOM   1250 C CE  . MET A 1 160 ? 21.512  12.752  -7.217  1.00 46.64  ? 158 MET A CE  1 
ATOM   1251 N N   . ALA A 1 161 ? 23.668  18.648  -6.795  1.00 44.91  ? 159 ALA A N   1 
ATOM   1252 C CA  . ALA A 1 161 ? 24.195  19.529  -5.750  1.00 44.39  ? 159 ALA A CA  1 
ATOM   1253 C C   . ALA A 1 161 ? 23.654  20.954  -5.863  1.00 44.09  ? 159 ALA A C   1 
ATOM   1254 O O   . ALA A 1 161 ? 23.280  21.560  -4.849  1.00 44.11  ? 159 ALA A O   1 
ATOM   1255 C CB  . ALA A 1 161 ? 25.737  19.517  -5.740  1.00 44.44  ? 159 ALA A CB  1 
ATOM   1256 N N   . GLN A 1 162 ? 23.593  21.496  -7.081  1.00 43.64  ? 160 GLN A N   1 
ATOM   1257 C CA  . GLN A 1 162 ? 22.963  22.823  -7.250  1.00 43.41  ? 160 GLN A CA  1 
ATOM   1258 C C   . GLN A 1 162 ? 21.440  22.832  -7.013  1.00 42.00  ? 160 GLN A C   1 
ATOM   1259 O O   . GLN A 1 162 ? 20.885  23.862  -6.631  1.00 41.60  ? 160 GLN A O   1 
ATOM   1260 C CB  . GLN A 1 162 ? 23.365  23.543  -8.546  1.00 43.29  ? 160 GLN A CB  1 
ATOM   1261 C CG  . GLN A 1 162 ? 23.490  22.700  -9.795  1.00 44.58  ? 160 GLN A CG  1 
ATOM   1262 C CD  . GLN A 1 162 ? 24.075  23.497  -10.968 1.00 45.28  ? 160 GLN A CD  1 
ATOM   1263 O OE1 . GLN A 1 162 ? 23.551  23.464  -12.094 1.00 47.05  ? 160 GLN A OE1 1 
ATOM   1264 N NE2 . GLN A 1 162 ? 25.162  24.227  -10.704 1.00 47.48  ? 160 GLN A NE2 1 
ATOM   1265 N N   . PHE A 1 163 ? 20.803  21.672  -7.206  1.00 40.76  ? 161 PHE A N   1 
ATOM   1266 C CA  . PHE A 1 163 ? 19.384  21.442  -6.880  1.00 39.57  ? 161 PHE A CA  1 
ATOM   1267 C C   . PHE A 1 163 ? 19.128  21.464  -5.348  1.00 38.68  ? 161 PHE A C   1 
ATOM   1268 O O   . PHE A 1 163 ? 18.230  22.195  -4.898  1.00 38.40  ? 161 PHE A O   1 
ATOM   1269 C CB  . PHE A 1 163 ? 18.911  20.120  -7.530  1.00 39.26  ? 161 PHE A CB  1 
ATOM   1270 C CG  . PHE A 1 163 ? 17.400  19.919  -7.566  1.00 38.60  ? 161 PHE A CG  1 
ATOM   1271 C CD1 . PHE A 1 163 ? 16.578  20.738  -8.341  1.00 38.18  ? 161 PHE A CD1 1 
ATOM   1272 C CD2 . PHE A 1 163 ? 16.812  18.839  -6.892  1.00 38.74  ? 161 PHE A CD2 1 
ATOM   1273 C CE1 . PHE A 1 163 ? 15.188  20.522  -8.401  1.00 37.47  ? 161 PHE A CE1 1 
ATOM   1274 C CE2 . PHE A 1 163 ? 15.417  18.607  -6.955  1.00 37.84  ? 161 PHE A CE2 1 
ATOM   1275 C CZ  . PHE A 1 163 ? 14.609  19.462  -7.705  1.00 37.39  ? 161 PHE A CZ  1 
ATOM   1276 N N   . THR A 1 164 ? 19.904  20.704  -4.552  1.00 37.85  ? 162 THR A N   1 
ATOM   1277 C CA  . THR A 1 164 ? 19.720  20.720  -3.072  1.00 37.09  ? 162 THR A CA  1 
ATOM   1278 C C   . THR A 1 164 ? 19.840  22.129  -2.509  1.00 36.55  ? 162 THR A C   1 
ATOM   1279 O O   . THR A 1 164 ? 19.033  22.534  -1.655  1.00 36.78  ? 162 THR A O   1 
ATOM   1280 C CB  . THR A 1 164 ? 20.568  19.641  -2.246  1.00 37.07  ? 162 THR A CB  1 
ATOM   1281 O OG1 . THR A 1 164 ? 19.758  19.072  -1.203  1.00 37.13  ? 162 THR A OG1 1 
ATOM   1282 C CG2 . THR A 1 164 ? 21.784  20.242  -1.550  1.00 37.55  ? 162 THR A CG2 1 
ATOM   1283 N N   . ALA A 1 165 ? 20.802  22.890  -3.031  1.00 35.96  ? 163 ALA A N   1 
ATOM   1284 C CA  . ALA A 1 165 ? 21.081  24.261  -2.580  1.00 35.64  ? 163 ALA A CA  1 
ATOM   1285 C C   . ALA A 1 165 ? 19.937  25.224  -2.879  1.00 35.54  ? 163 ALA A C   1 
ATOM   1286 O O   . ALA A 1 165 ? 19.495  25.977  -1.987  1.00 36.03  ? 163 ALA A O   1 
ATOM   1287 C CB  . ALA A 1 165 ? 22.417  24.782  -3.188  1.00 35.41  ? 163 ALA A CB  1 
ATOM   1288 N N   . ARG A 1 166 ? 19.455  25.196  -4.125  1.00 35.35  ? 164 ARG A N   1 
ATOM   1289 C CA  . ARG A 1 166 ? 18.275  25.960  -4.528  1.00 35.39  ? 164 ARG A CA  1 
ATOM   1290 C C   . ARG A 1 166 ? 17.068  25.634  -3.642  1.00 34.87  ? 164 ARG A C   1 
ATOM   1291 O O   . ARG A 1 166 ? 16.372  26.538  -3.180  1.00 35.07  ? 164 ARG A O   1 
ATOM   1292 C CB  . ARG A 1 166 ? 17.919  25.687  -5.997  1.00 36.10  ? 164 ARG A CB  1 
ATOM   1293 C CG  . ARG A 1 166 ? 18.848  26.324  -7.042  1.00 38.47  ? 164 ARG A CG  1 
ATOM   1294 C CD  . ARG A 1 166 ? 18.878  27.856  -6.940  1.00 41.27  ? 164 ARG A CD  1 
ATOM   1295 N NE  . ARG A 1 166 ? 17.645  28.494  -7.404  1.00 43.88  ? 164 ARG A NE  1 
ATOM   1296 C CZ  . ARG A 1 166 ? 16.711  29.032  -6.612  1.00 46.39  ? 164 ARG A CZ  1 
ATOM   1297 N NH1 . ARG A 1 166 ? 16.839  29.014  -5.282  1.00 46.56  ? 164 ARG A NH1 1 
ATOM   1298 N NH2 . ARG A 1 166 ? 15.636  29.600  -7.154  1.00 46.22  ? 164 ARG A NH2 1 
ATOM   1299 N N   . LEU A 1 167 ? 16.832  24.340  -3.411  1.00 34.36  ? 165 LEU A N   1 
ATOM   1300 C CA  . LEU A 1 167 ? 15.724  23.879  -2.562  1.00 33.70  ? 165 LEU A CA  1 
ATOM   1301 C C   . LEU A 1 167 ? 15.913  24.415  -1.154  1.00 34.08  ? 165 LEU A C   1 
ATOM   1302 O O   . LEU A 1 167 ? 14.975  24.981  -0.593  1.00 33.99  ? 165 LEU A O   1 
ATOM   1303 C CB  . LEU A 1 167 ? 15.595  22.335  -2.570  1.00 33.36  ? 165 LEU A CB  1 
ATOM   1304 C CG  . LEU A 1 167 ? 15.076  21.616  -3.832  1.00 32.44  ? 165 LEU A CG  1 
ATOM   1305 C CD1 . LEU A 1 167 ? 14.915  20.150  -3.590  1.00 32.70  ? 165 LEU A CD1 1 
ATOM   1306 C CD2 . LEU A 1 167 ? 13.760  22.184  -4.316  1.00 32.99  ? 165 LEU A CD2 1 
ATOM   1307 N N   . ASN A 1 168 ? 17.133  24.267  -0.605  1.00 34.45  ? 166 ASN A N   1 
ATOM   1308 C CA  . ASN A 1 168 ? 17.465  24.788  0.741   1.00 34.80  ? 166 ASN A CA  1 
ATOM   1309 C C   . ASN A 1 168 ? 17.211  26.278  0.903   1.00 34.90  ? 166 ASN A C   1 
ATOM   1310 O O   . ASN A 1 168 ? 16.657  26.705  1.913   1.00 34.79  ? 166 ASN A O   1 
ATOM   1311 C CB  . ASN A 1 168 ? 18.910  24.468  1.143   1.00 34.50  ? 166 ASN A CB  1 
ATOM   1312 C CG  . ASN A 1 168 ? 19.148  22.997  1.328   1.00 34.44  ? 166 ASN A CG  1 
ATOM   1313 O OD1 . ASN A 1 168 ? 18.228  22.192  1.238   1.00 36.39  ? 166 ASN A OD1 1 
ATOM   1314 N ND2 . ASN A 1 168 ? 20.395  22.626  1.574   1.00 36.24  ? 166 ASN A ND2 1 
ATOM   1315 N N   . GLU A 1 169 ? 17.621  27.068  -0.086  1.00 35.68  ? 167 GLU A N   1 
ATOM   1316 C CA  . GLU A 1 169 ? 17.319  28.507  -0.099  1.00 36.27  ? 167 GLU A CA  1 
ATOM   1317 C C   . GLU A 1 169 ? 15.818  28.793  -0.073  1.00 36.09  ? 167 GLU A C   1 
ATOM   1318 O O   . GLU A 1 169 ? 15.397  29.836  0.446   1.00 36.58  ? 167 GLU A O   1 
ATOM   1319 C CB  . GLU A 1 169 ? 17.895  29.166  -1.348  1.00 37.26  ? 167 GLU A CB  1 
ATOM   1320 C CG  . GLU A 1 169 ? 19.415  29.212  -1.429  1.00 40.05  ? 167 GLU A CG  1 
ATOM   1321 C CD  . GLU A 1 169 ? 19.898  29.345  -2.863  1.00 44.87  ? 167 GLU A CD  1 
ATOM   1322 O OE1 . GLU A 1 169 ? 19.118  29.872  -3.706  1.00 45.79  ? 167 GLU A OE1 1 
ATOM   1323 O OE2 . GLU A 1 169 ? 21.047  28.913  -3.152  1.00 46.25  ? 167 GLU A OE2 1 
ATOM   1324 N N   . LEU A 1 170 ? 15.020  27.884  -0.644  1.00 35.14  ? 168 LEU A N   1 
ATOM   1325 C CA  . LEU A 1 170 ? 13.553  28.044  -0.703  1.00 34.66  ? 168 LEU A CA  1 
ATOM   1326 C C   . LEU A 1 170 ? 12.782  27.390  0.461   1.00 34.22  ? 168 LEU A C   1 
ATOM   1327 O O   . LEU A 1 170 ? 11.556  27.260  0.397   1.00 34.32  ? 168 LEU A O   1 
ATOM   1328 C CB  . LEU A 1 170 ? 13.013  27.528  -2.052  1.00 34.87  ? 168 LEU A CB  1 
ATOM   1329 C CG  . LEU A 1 170 ? 13.510  28.280  -3.297  1.00 34.49  ? 168 LEU A CG  1 
ATOM   1330 C CD1 . LEU A 1 170 ? 13.267  27.485  -4.569  1.00 33.55  ? 168 LEU A CD1 1 
ATOM   1331 C CD2 . LEU A 1 170 ? 12.878  29.664  -3.380  1.00 33.68  ? 168 LEU A CD2 1 
ATOM   1332 N N   . GLY A 1 171 ? 13.499  26.967  1.503   1.00 32.82  ? 169 GLY A N   1 
ATOM   1333 C CA  . GLY A 1 171 ? 12.871  26.391  2.682   1.00 31.52  ? 169 GLY A CA  1 
ATOM   1334 C C   . GLY A 1 171 ? 12.561  24.910  2.566   1.00 30.70  ? 169 GLY A C   1 
ATOM   1335 O O   . GLY A 1 171 ? 11.756  24.387  3.344   1.00 29.53  ? 169 GLY A O   1 
ATOM   1336 N N   . LEU A 1 172 ? 13.199  24.241  1.598   1.00 30.20  ? 170 LEU A N   1 
ATOM   1337 C CA  . LEU A 1 172 ? 12.919  22.835  1.286   1.00 29.88  ? 170 LEU A CA  1 
ATOM   1338 C C   . LEU A 1 172 ? 14.135  21.933  1.424   1.00 30.24  ? 170 LEU A C   1 
ATOM   1339 O O   . LEU A 1 172 ? 15.264  22.354  1.195   1.00 30.50  ? 170 LEU A O   1 
ATOM   1340 C CB  . LEU A 1 172 ? 12.309  22.683  -0.121  1.00 29.46  ? 170 LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 172 ? 10.970  23.377  -0.419  1.00 28.98  ? 170 LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 172 ? 10.625  23.296  -1.905  1.00 27.35  ? 170 LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 172 ? 9.824   22.825  0.434   1.00 28.50  ? 170 LEU A CD2 1 
ATOM   1344 N N   . GLN A 1 173 ? 13.896  20.683  1.801   1.00 30.58  ? 171 GLN A N   1 
ATOM   1345 C CA  . GLN A 1 173 ? 14.969  19.706  1.889   1.00 31.41  ? 171 GLN A CA  1 
ATOM   1346 C C   . GLN A 1 173 ? 14.792  18.641  0.833   1.00 32.62  ? 171 GLN A C   1 
ATOM   1347 O O   . GLN A 1 173 ? 13.687  18.379  0.387   1.00 32.26  ? 171 GLN A O   1 
ATOM   1348 C CB  . GLN A 1 173 ? 15.031  19.063  3.292   1.00 30.77  ? 171 GLN A CB  1 
ATOM   1349 C CG  . GLN A 1 173 ? 13.798  18.282  3.656   1.00 28.60  ? 171 GLN A CG  1 
ATOM   1350 C CD  . GLN A 1 173 ? 13.817  17.814  5.077   1.00 28.64  ? 171 GLN A CD  1 
ATOM   1351 O OE1 . GLN A 1 173 ? 14.747  17.141  5.495   1.00 26.86  ? 171 GLN A OE1 1 
ATOM   1352 N NE2 . GLN A 1 173 ? 12.774  18.153  5.834   1.00 25.68  ? 171 GLN A NE2 1 
ATOM   1353 N N   . PHE A 1 174 ? 15.903  18.013  0.475   1.00 35.20  ? 172 PHE A N   1 
ATOM   1354 C CA  . PHE A 1 174 ? 15.953  16.964  -0.525  1.00 37.41  ? 172 PHE A CA  1 
ATOM   1355 C C   . PHE A 1 174 ? 16.448  15.698  0.162   1.00 38.95  ? 172 PHE A C   1 
ATOM   1356 O O   . PHE A 1 174 ? 17.637  15.554  0.459   1.00 39.50  ? 172 PHE A O   1 
ATOM   1357 C CB  . PHE A 1 174 ? 16.911  17.407  -1.622  1.00 37.73  ? 172 PHE A CB  1 
ATOM   1358 C CG  . PHE A 1 174 ? 16.848  16.586  -2.877  1.00 38.44  ? 172 PHE A CG  1 
ATOM   1359 C CD1 . PHE A 1 174 ? 15.632  16.128  -3.381  1.00 37.58  ? 172 PHE A CD1 1 
ATOM   1360 C CD2 . PHE A 1 174 ? 18.020  16.310  -3.586  1.00 38.43  ? 172 PHE A CD2 1 
ATOM   1361 C CE1 . PHE A 1 174 ? 15.594  15.386  -4.569  1.00 38.17  ? 172 PHE A CE1 1 
ATOM   1362 C CE2 . PHE A 1 174 ? 17.984  15.566  -4.775  1.00 38.74  ? 172 PHE A CE2 1 
ATOM   1363 C CZ  . PHE A 1 174 ? 16.773  15.113  -5.264  1.00 37.64  ? 172 PHE A CZ  1 
ATOM   1364 N N   . MET A 1 175 ? 15.522  14.789  0.431   1.00 40.56  ? 173 MET A N   1 
ATOM   1365 C CA  . MET A 1 175 ? 15.785  13.664  1.303   1.00 42.46  ? 173 MET A CA  1 
ATOM   1366 C C   . MET A 1 175 ? 15.765  12.340  0.555   1.00 42.83  ? 173 MET A C   1 
ATOM   1367 O O   . MET A 1 175 ? 14.750  11.955  -0.022  1.00 42.94  ? 173 MET A O   1 
ATOM   1368 C CB  . MET A 1 175 ? 14.765  13.669  2.435   1.00 42.22  ? 173 MET A CB  1 
ATOM   1369 C CG  . MET A 1 175 ? 14.899  12.541  3.414   1.00 44.12  ? 173 MET A CG  1 
ATOM   1370 S SD  . MET A 1 175 ? 14.015  12.971  4.911   1.00 45.08  ? 173 MET A SD  1 
ATOM   1371 C CE  . MET A 1 175 ? 15.280  13.876  5.822   1.00 47.51  ? 173 MET A CE  1 
ATOM   1372 N N   . GLN A 1 176 ? 16.901  11.650  0.589   1.00 43.51  ? 174 GLN A N   1 
ATOM   1373 C CA  . GLN A 1 176 ? 17.095  10.371  -0.084  1.00 44.59  ? 174 GLN A CA  1 
ATOM   1374 C C   . GLN A 1 176 ? 16.416  9.254   0.684   1.00 44.41  ? 174 GLN A C   1 
ATOM   1375 O O   . GLN A 1 176 ? 16.504  9.188   1.911   1.00 45.08  ? 174 GLN A O   1 
ATOM   1376 C CB  . GLN A 1 176 ? 18.588  10.082  -0.172  1.00 44.56  ? 174 GLN A CB  1 
ATOM   1377 C CG  . GLN A 1 176 ? 19.010  9.091   -1.241  1.00 46.22  ? 174 GLN A CG  1 
ATOM   1378 C CD  . GLN A 1 176 ? 20.536  9.002   -1.365  1.00 46.86  ? 174 GLN A CD  1 
ATOM   1379 O OE1 . GLN A 1 176 ? 21.270  9.822   -0.793  1.00 49.74  ? 174 GLN A OE1 1 
ATOM   1380 N NE2 . GLN A 1 176 ? 21.016  8.007   -2.115  1.00 48.35  ? 174 GLN A NE2 1 
ATOM   1381 N N   . GLY A 1 177 ? 15.724  8.388   -0.041  1.00 44.04  ? 175 GLY A N   1 
ATOM   1382 C CA  . GLY A 1 177 ? 15.154  7.188   0.531   1.00 43.67  ? 175 GLY A CA  1 
ATOM   1383 C C   . GLY A 1 177 ? 15.832  5.997   -0.105  1.00 43.78  ? 175 GLY A C   1 
ATOM   1384 O O   . GLY A 1 177 ? 16.813  6.158   -0.831  1.00 43.47  ? 175 GLY A O   1 
ATOM   1385 N N   . ALA A 1 178 ? 15.302  4.802   0.159   1.00 44.06  ? 176 ALA A N   1 
ATOM   1386 C CA  . ALA A 1 178 ? 15.824  3.563   -0.438  1.00 43.78  ? 176 ALA A CA  1 
ATOM   1387 C C   . ALA A 1 178 ? 15.950  3.669   -1.958  1.00 43.50  ? 176 ALA A C   1 
ATOM   1388 O O   . ALA A 1 178 ? 17.040  3.448   -2.519  1.00 43.83  ? 176 ALA A O   1 
ATOM   1389 C CB  . ALA A 1 178 ? 14.942  2.378   -0.060  1.00 44.07  ? 176 ALA A CB  1 
ATOM   1390 N N   . ARG A 1 179 ? 14.839  4.038   -2.603  1.00 42.81  ? 177 ARG A N   1 
ATOM   1391 C CA  A ARG A 1 179 ? 14.755  4.105   -4.061  0.50 42.09  ? 177 ARG A CA  1 
ATOM   1392 C CA  B ARG A 1 179 ? 14.778  4.110   -4.064  0.50 42.05  ? 177 ARG A CA  1 
ATOM   1393 C C   . ARG A 1 179 ? 14.634  5.537   -4.584  1.00 41.32  ? 177 ARG A C   1 
ATOM   1394 O O   . ARG A 1 179 ? 15.317  5.920   -5.529  1.00 41.91  ? 177 ARG A O   1 
ATOM   1395 C CB  A ARG A 1 179 ? 13.561  3.286   -4.555  0.50 42.29  ? 177 ARG A CB  1 
ATOM   1396 C CB  B ARG A 1 179 ? 13.636  3.251   -4.623  0.50 42.23  ? 177 ARG A CB  1 
ATOM   1397 C CG  A ARG A 1 179 ? 13.408  1.926   -3.901  0.50 42.79  ? 177 ARG A CG  1 
ATOM   1398 C CG  B ARG A 1 179 ? 13.700  1.760   -4.312  0.50 42.43  ? 177 ARG A CG  1 
ATOM   1399 C CD  A ARG A 1 179 ? 12.258  1.147   -4.515  0.50 43.16  ? 177 ARG A CD  1 
ATOM   1400 C CD  B ARG A 1 179 ? 12.822  1.403   -3.107  0.50 42.71  ? 177 ARG A CD  1 
ATOM   1401 N NE  A ARG A 1 179 ? 12.521  0.825   -5.917  0.50 43.37  ? 177 ARG A NE  1 
ATOM   1402 N NE  B ARG A 1 179 ? 11.541  2.113   -3.126  0.50 42.25  ? 177 ARG A NE  1 
ATOM   1403 C CZ  A ARG A 1 179 ? 11.795  -0.015  -6.649  0.50 42.24  ? 177 ARG A CZ  1 
ATOM   1404 C CZ  B ARG A 1 179 ? 10.652  2.104   -2.137  0.50 42.28  ? 177 ARG A CZ  1 
ATOM   1405 N NH1 A ARG A 1 179 ? 10.744  -0.636  -6.127  0.50 41.36  ? 177 ARG A NH1 1 
ATOM   1406 N NH1 B ARG A 1 179 ? 10.884  1.415   -1.022  0.50 43.00  ? 177 ARG A NH1 1 
ATOM   1407 N NH2 A ARG A 1 179 ? 12.124  -0.230  -7.912  0.50 41.76  ? 177 ARG A NH2 1 
ATOM   1408 N NH2 B ARG A 1 179 ? 9.526   2.789   -2.263  0.50 41.66  ? 177 ARG A NH2 1 
ATOM   1409 N N   . PHE A 1 180 ? 13.759  6.322   -3.961  1.00 39.79  ? 178 PHE A N   1 
ATOM   1410 C CA  . PHE A 1 180 ? 13.405  7.645   -4.472  1.00 37.53  ? 178 PHE A CA  1 
ATOM   1411 C C   . PHE A 1 180 ? 13.860  8.795   -3.585  1.00 36.57  ? 178 PHE A C   1 
ATOM   1412 O O   . PHE A 1 180 ? 14.230  8.586   -2.434  1.00 36.37  ? 178 PHE A O   1 
ATOM   1413 C CB  . PHE A 1 180 ? 11.894  7.706   -4.704  1.00 37.50  ? 178 PHE A CB  1 
ATOM   1414 C CG  . PHE A 1 180 ? 11.334  6.464   -5.348  1.00 37.09  ? 178 PHE A CG  1 
ATOM   1415 C CD1 . PHE A 1 180 ? 11.638  6.148   -6.669  1.00 37.17  ? 178 PHE A CD1 1 
ATOM   1416 C CD2 . PHE A 1 180 ? 10.523  5.596   -4.627  1.00 37.29  ? 178 PHE A CD2 1 
ATOM   1417 C CE1 . PHE A 1 180 ? 11.145  4.983   -7.264  1.00 37.34  ? 178 PHE A CE1 1 
ATOM   1418 C CE2 . PHE A 1 180 ? 10.024  4.428   -5.215  1.00 37.78  ? 178 PHE A CE2 1 
ATOM   1419 C CZ  . PHE A 1 180 ? 10.332  4.130   -6.543  1.00 37.54  ? 178 PHE A CZ  1 
ATOM   1420 N N   . TRP A 1 181 ? 13.853  10.002  -4.151  1.00 34.83  ? 179 TRP A N   1 
ATOM   1421 C CA  . TRP A 1 181 ? 14.107  11.243  -3.420  1.00 33.62  ? 179 TRP A CA  1 
ATOM   1422 C C   . TRP A 1 181 ? 12.788  11.883  -2.994  1.00 31.98  ? 179 TRP A C   1 
ATOM   1423 O O   . TRP A 1 181 ? 11.766  11.715  -3.661  1.00 31.65  ? 179 TRP A O   1 
ATOM   1424 C CB  . TRP A 1 181 ? 14.871  12.227  -4.300  1.00 34.54  ? 179 TRP A CB  1 
ATOM   1425 C CG  . TRP A 1 181 ? 16.277  11.820  -4.535  1.00 36.62  ? 179 TRP A CG  1 
ATOM   1426 C CD1 . TRP A 1 181 ? 16.748  11.041  -5.557  1.00 37.90  ? 179 TRP A CD1 1 
ATOM   1427 C CD2 . TRP A 1 181 ? 17.413  12.145  -3.719  1.00 37.10  ? 179 TRP A CD2 1 
ATOM   1428 N NE1 . TRP A 1 181 ? 18.109  10.872  -5.434  1.00 38.45  ? 179 TRP A NE1 1 
ATOM   1429 C CE2 . TRP A 1 181 ? 18.543  11.543  -4.317  1.00 38.33  ? 179 TRP A CE2 1 
ATOM   1430 C CE3 . TRP A 1 181 ? 17.586  12.896  -2.549  1.00 38.49  ? 179 TRP A CE3 1 
ATOM   1431 C CZ2 . TRP A 1 181 ? 19.838  11.656  -3.772  1.00 37.61  ? 179 TRP A CZ2 1 
ATOM   1432 C CZ3 . TRP A 1 181 ? 18.884  13.020  -2.011  1.00 38.28  ? 179 TRP A CZ3 1 
ATOM   1433 C CH2 . TRP A 1 181 ? 19.986  12.399  -2.627  1.00 37.55  ? 179 TRP A CH2 1 
ATOM   1434 N N   . HIS A 1 182 ? 12.803  12.617  -1.890  1.00 30.13  ? 180 HIS A N   1 
ATOM   1435 C CA  . HIS A 1 182 ? 11.605  13.295  -1.446  1.00 28.53  ? 180 HIS A CA  1 
ATOM   1436 C C   . HIS A 1 182 ? 11.918  14.733  -1.182  1.00 27.71  ? 180 HIS A C   1 
ATOM   1437 O O   . HIS A 1 182 ? 12.996  15.049  -0.710  1.00 27.02  ? 180 HIS A O   1 
ATOM   1438 C CB  . HIS A 1 182 ? 11.011  12.627  -0.210  1.00 28.52  ? 180 HIS A CB  1 
ATOM   1439 C CG  . HIS A 1 182 ? 10.789  11.161  -0.377  1.00 27.64  ? 180 HIS A CG  1 
ATOM   1440 N ND1 . HIS A 1 182 ? 9.610   10.639  -0.865  1.00 28.09  ? 180 HIS A ND1 1 
ATOM   1441 C CD2 . HIS A 1 182 ? 11.606  10.104  -0.160  1.00 27.17  ? 180 HIS A CD2 1 
ATOM   1442 C CE1 . HIS A 1 182 ? 9.702   9.322   -0.925  1.00 24.90  ? 180 HIS A CE1 1 
ATOM   1443 N NE2 . HIS A 1 182 ? 10.900  8.973   -0.499  1.00 27.62  ? 180 HIS A NE2 1 
ATOM   1444 N N   . VAL A 1 183 ? 10.966  15.605  -1.525  1.00 27.08  ? 181 VAL A N   1 
ATOM   1445 C CA  . VAL A 1 183 ? 11.089  17.037  -1.308  1.00 25.56  ? 181 VAL A CA  1 
ATOM   1446 C C   . VAL A 1 183 ? 9.957   17.472  -0.365  1.00 25.87  ? 181 VAL A C   1 
ATOM   1447 O O   . VAL A 1 183 ? 8.783   17.160  -0.588  1.00 25.37  ? 181 VAL A O   1 
ATOM   1448 C CB  . VAL A 1 183 ? 11.077  17.826  -2.647  1.00 25.52  ? 181 VAL A CB  1 
ATOM   1449 C CG1 . VAL A 1 183 ? 11.195  19.345  -2.409  1.00 24.83  ? 181 VAL A CG1 1 
ATOM   1450 C CG2 . VAL A 1 183 ? 12.185  17.351  -3.599  1.00 23.69  ? 181 VAL A CG2 1 
ATOM   1451 N N   . LEU A 1 184 ? 10.332  18.192  0.690   1.00 26.21  ? 182 LEU A N   1 
ATOM   1452 C CA  . LEU A 1 184 ? 9.433   18.582  1.794   1.00 26.58  ? 182 LEU A CA  1 
ATOM   1453 C C   . LEU A 1 184 ? 10.038  19.765  2.563   1.00 27.19  ? 182 LEU A C   1 
ATOM   1454 O O   . LEU A 1 184 ? 11.239  20.055  2.447   1.00 25.82  ? 182 LEU A O   1 
ATOM   1455 C CB  . LEU A 1 184 ? 9.188   17.394  2.759   1.00 26.51  ? 182 LEU A CB  1 
ATOM   1456 C CG  . LEU A 1 184 ? 10.360  16.726  3.527   1.00 27.08  ? 182 LEU A CG  1 
ATOM   1457 C CD1 . LEU A 1 184 ? 9.884   16.100  4.845   1.00 27.79  ? 182 LEU A CD1 1 
ATOM   1458 C CD2 . LEU A 1 184 ? 11.131  15.684  2.720   1.00 24.66  ? 182 LEU A CD2 1 
ATOM   1459 N N   . ASP A 1 185 ? 9.188   20.420  3.355   1.00 28.37  ? 183 ASP A N   1 
ATOM   1460 C CA  . ASP A 1 185 ? 9.570   21.456  4.304   1.00 29.46  ? 183 ASP A CA  1 
ATOM   1461 C C   . ASP A 1 185 ? 10.858  21.095  5.030   1.00 30.29  ? 183 ASP A C   1 
ATOM   1462 O O   . ASP A 1 185 ? 10.958  20.006  5.622   1.00 30.05  ? 183 ASP A O   1 
ATOM   1463 C CB  . ASP A 1 185 ? 8.448   21.608  5.335   1.00 30.34  ? 183 ASP A CB  1 
ATOM   1464 C CG  . ASP A 1 185 ? 8.534   22.902  6.142   1.00 31.82  ? 183 ASP A CG  1 
ATOM   1465 O OD1 . ASP A 1 185 ? 9.634   23.328  6.583   1.00 32.37  ? 183 ASP A OD1 1 
ATOM   1466 O OD2 . ASP A 1 185 ? 7.461   23.500  6.333   1.00 36.35  ? 183 ASP A OD2 1 
ATOM   1467 N N   . ALA A 1 186 ? 11.828  22.010  5.001   1.00 30.46  ? 184 ALA A N   1 
ATOM   1468 C CA  . ALA A 1 186 ? 13.143  21.756  5.576   1.00 31.65  ? 184 ALA A CA  1 
ATOM   1469 C C   . ALA A 1 186 ? 13.084  21.656  7.099   1.00 32.46  ? 184 ALA A C   1 
ATOM   1470 O O   . ALA A 1 186 ? 13.961  21.065  7.717   1.00 32.88  ? 184 ALA A O   1 
ATOM   1471 C CB  . ALA A 1 186 ? 14.140  22.839  5.154   1.00 31.91  ? 184 ALA A CB  1 
ATOM   1472 N N   . SER A 1 187 ? 12.033  22.204  7.700   1.00 33.47  ? 185 SER A N   1 
ATOM   1473 C CA  . SER A 1 187 ? 11.907  22.195  9.160   1.00 34.47  ? 185 SER A CA  1 
ATOM   1474 C C   . SER A 1 187 ? 11.163  20.969  9.705   1.00 34.50  ? 185 SER A C   1 
ATOM   1475 O O   . SER A 1 187 ? 10.949  20.851  10.915  1.00 35.22  ? 185 SER A O   1 
ATOM   1476 C CB  . SER A 1 187 ? 11.240  23.491  9.643   1.00 34.60  ? 185 SER A CB  1 
ATOM   1477 O OG  . SER A 1 187 ? 9.923   23.625  9.152   1.00 35.22  ? 185 SER A OG  1 
ATOM   1478 N N   . ALA A 1 188 ? 10.775  20.057  8.806   1.00 33.92  ? 186 ALA A N   1 
ATOM   1479 C CA  . ALA A 1 188 ? 10.059  18.841  9.182   1.00 31.95  ? 186 ALA A CA  1 
ATOM   1480 C C   . ALA A 1 188 ? 11.028  17.681  9.277   1.00 31.38  ? 186 ALA A C   1 
ATOM   1481 O O   . ALA A 1 188 ? 12.112  17.708  8.684   1.00 31.72  ? 186 ALA A O   1 
ATOM   1482 C CB  . ALA A 1 188 ? 8.951   18.552  8.188   1.00 32.21  ? 186 ALA A CB  1 
ATOM   1483 N N   . GLY A 1 189 ? 10.655  16.661  10.043  1.00 30.17  ? 187 GLY A N   1 
ATOM   1484 C CA  . GLY A 1 189 ? 11.490  15.472  10.206  1.00 28.31  ? 187 GLY A CA  1 
ATOM   1485 C C   . GLY A 1 189 ? 10.749  14.394  10.980  1.00 27.29  ? 187 GLY A C   1 
ATOM   1486 O O   . GLY A 1 189 ? 9.829   14.708  11.735  1.00 27.17  ? 187 GLY A O   1 
ATOM   1487 N N   . LYS A 1 190 ? 11.124  13.129  10.776  1.00 26.29  ? 188 LYS A N   1 
ATOM   1488 C CA  . LYS A 1 190 ? 10.554  12.014  11.563  1.00 25.79  ? 188 LYS A CA  1 
ATOM   1489 C C   . LYS A 1 190 ? 10.803  12.224  13.062  1.00 25.46  ? 188 LYS A C   1 
ATOM   1490 O O   . LYS A 1 190 ? 9.917   11.992  13.895  1.00 24.84  ? 188 LYS A O   1 
ATOM   1491 C CB  . LYS A 1 190 ? 11.118  10.670  11.101  1.00 25.84  ? 188 LYS A CB  1 
ATOM   1492 C CG  . LYS A 1 190 ? 10.635  10.223  9.737   1.00 25.40  ? 188 LYS A CG  1 
ATOM   1493 C CD  . LYS A 1 190 ? 11.396  9.000   9.298   1.00 27.36  ? 188 LYS A CD  1 
ATOM   1494 C CE  . LYS A 1 190 ? 11.007  8.567   7.903   1.00 27.74  ? 188 LYS A CE  1 
ATOM   1495 N NZ  . LYS A 1 190 ? 11.731  7.319   7.496   1.00 27.95  ? 188 LYS A NZ  1 
ATOM   1496 N N   . ASP A 1 191 ? 12.010  12.701  13.377  1.00 25.57  ? 189 ASP A N   1 
ATOM   1497 C CA  . ASP A 1 191 ? 12.399  13.100  14.724  1.00 25.64  ? 189 ASP A CA  1 
ATOM   1498 C C   . ASP A 1 191 ? 11.570  14.277  15.271  1.00 25.47  ? 189 ASP A C   1 
ATOM   1499 O O   . ASP A 1 191 ? 11.117  14.222  16.411  1.00 25.81  ? 189 ASP A O   1 
ATOM   1500 C CB  . ASP A 1 191 ? 13.892  13.425  14.755  1.00 26.22  ? 189 ASP A CB  1 
ATOM   1501 C CG  . ASP A 1 191 ? 14.272  14.541  13.769  1.00 28.47  ? 189 ASP A CG  1 
ATOM   1502 O OD1 . ASP A 1 191 ? 13.580  14.709  12.753  1.00 30.23  ? 189 ASP A OD1 1 
ATOM   1503 O OD2 . ASP A 1 191 ? 15.249  15.264  14.024  1.00 32.12  ? 189 ASP A OD2 1 
ATOM   1504 N N   . GLN A 1 192 ? 11.360  15.332  14.472  1.00 25.40  ? 190 GLN A N   1 
ATOM   1505 C CA  . GLN A 1 192 ? 10.576  16.496  14.920  1.00 24.85  ? 190 GLN A CA  1 
ATOM   1506 C C   . GLN A 1 192 ? 9.141   16.074  15.201  1.00 23.85  ? 190 GLN A C   1 
ATOM   1507 O O   . GLN A 1 192 ? 8.565   16.426  16.234  1.00 23.93  ? 190 GLN A O   1 
ATOM   1508 C CB  . GLN A 1 192 ? 10.571  17.640  13.886  1.00 25.06  ? 190 GLN A CB  1 
ATOM   1509 C CG  . GLN A 1 192 ? 11.943  18.152  13.428  1.00 28.87  ? 190 GLN A CG  1 
ATOM   1510 C CD  . GLN A 1 192 ? 12.724  18.830  14.546  1.00 31.21  ? 190 GLN A CD  1 
ATOM   1511 O OE1 . GLN A 1 192 ? 13.799  18.379  14.919  1.00 30.75  ? 190 GLN A OE1 1 
ATOM   1512 N NE2 . GLN A 1 192 ? 12.163  19.910  15.102  1.00 33.87  ? 190 GLN A NE2 1 
ATOM   1513 N N   . ALA A 1 193 ? 8.546   15.355  14.255  1.00 22.58  ? 191 ALA A N   1 
ATOM   1514 C CA  . ALA A 1 193 ? 7.192   14.816  14.434  1.00 21.77  ? 191 ALA A CA  1 
ATOM   1515 C C   . ALA A 1 193 ? 7.102   13.866  15.639  1.00 21.44  ? 191 ALA A C   1 
ATOM   1516 O O   . ALA A 1 193 ? 6.153   13.944  16.408  1.00 21.93  ? 191 ALA A O   1 
ATOM   1517 C CB  . ALA A 1 193 ? 6.725   14.128  13.164  1.00 20.64  ? 191 ALA A CB  1 
ATOM   1518 N N   . ALA A 1 194 ? 8.096   12.984  15.812  1.00 21.73  ? 192 ALA A N   1 
ATOM   1519 C CA  . ALA A 1 194 ? 8.138   12.078  16.984  1.00 21.52  ? 192 ALA A CA  1 
ATOM   1520 C C   . ALA A 1 194 ? 8.163   12.849  18.298  1.00 21.60  ? 192 ALA A C   1 
ATOM   1521 O O   . ALA A 1 194 ? 7.397   12.533  19.203  1.00 21.59  ? 192 ALA A O   1 
ATOM   1522 C CB  . ALA A 1 194 ? 9.300   11.123  16.919  1.00 20.83  ? 192 ALA A CB  1 
ATOM   1523 N N   . ASN A 1 195 ? 9.016   13.867  18.388  1.00 21.17  ? 193 ASN A N   1 
ATOM   1524 C CA  . ASN A 1 195 ? 9.059   14.724  19.566  1.00 21.49  ? 193 ASN A CA  1 
ATOM   1525 C C   . ASN A 1 195 ? 7.702   15.305  19.911  1.00 21.07  ? 193 ASN A C   1 
ATOM   1526 O O   . ASN A 1 195 ? 7.327   15.348  21.075  1.00 21.30  ? 193 ASN A O   1 
ATOM   1527 C CB  . ASN A 1 195 ? 10.034  15.889  19.355  1.00 22.90  ? 193 ASN A CB  1 
ATOM   1528 C CG  . ASN A 1 195 ? 11.474  15.496  19.553  1.00 23.72  ? 193 ASN A CG  1 
ATOM   1529 O OD1 . ASN A 1 195 ? 11.777  14.462  20.139  1.00 24.25  ? 193 ASN A OD1 1 
ATOM   1530 N ND2 . ASN A 1 195 ? 12.378  16.337  19.057  1.00 27.25  ? 193 ASN A ND2 1 
ATOM   1531 N N   . TRP A 1 196 ? 6.977   15.762  18.890  1.00 20.44  ? 194 TRP A N   1 
ATOM   1532 C CA  . TRP A 1 196 ? 5.696   16.405  19.077  1.00 20.13  ? 194 TRP A CA  1 
ATOM   1533 C C   . TRP A 1 196 ? 4.636   15.408  19.616  1.00 20.24  ? 194 TRP A C   1 
ATOM   1534 O O   . TRP A 1 196 ? 3.839   15.747  20.492  1.00 19.71  ? 194 TRP A O   1 
ATOM   1535 C CB  . TRP A 1 196 ? 5.221   17.061  17.755  1.00 20.20  ? 194 TRP A CB  1 
ATOM   1536 C CG  . TRP A 1 196 ? 3.939   17.835  17.953  1.00 20.85  ? 194 TRP A CG  1 
ATOM   1537 C CD1 . TRP A 1 196 ? 3.820   19.160  18.304  1.00 21.10  ? 194 TRP A CD1 1 
ATOM   1538 C CD2 . TRP A 1 196 ? 2.609   17.308  17.914  1.00 20.01  ? 194 TRP A CD2 1 
ATOM   1539 N NE1 . TRP A 1 196 ? 2.490   19.484  18.466  1.00 21.01  ? 194 TRP A NE1 1 
ATOM   1540 C CE2 . TRP A 1 196 ? 1.726   18.372  18.230  1.00 21.06  ? 194 TRP A CE2 1 
ATOM   1541 C CE3 . TRP A 1 196 ? 2.072   16.042  17.625  1.00 21.24  ? 194 TRP A CE3 1 
ATOM   1542 C CZ2 . TRP A 1 196 ? 0.326   18.208  18.265  1.00 20.22  ? 194 TRP A CZ2 1 
ATOM   1543 C CZ3 . TRP A 1 196 ? 0.683   15.872  17.680  1.00 20.37  ? 194 TRP A CZ3 1 
ATOM   1544 C CH2 . TRP A 1 196 ? -0.174  16.956  17.993  1.00 20.29  ? 194 TRP A CH2 1 
ATOM   1545 N N   . ILE A 1 197 ? 4.610   14.204  19.045  1.00 20.35  ? 195 ILE A N   1 
ATOM   1546 C CA  . ILE A 1 197 ? 3.737   13.106  19.519  1.00 20.72  ? 195 ILE A CA  1 
ATOM   1547 C C   . ILE A 1 197 ? 4.090   12.711  20.959  1.00 20.59  ? 195 ILE A C   1 
ATOM   1548 O O   . ILE A 1 197 ? 3.209   12.632  21.812  1.00 21.07  ? 195 ILE A O   1 
ATOM   1549 C CB  . ILE A 1 197 ? 3.810   11.849  18.559  1.00 21.23  ? 195 ILE A CB  1 
ATOM   1550 C CG1 . ILE A 1 197 ? 3.250   12.214  17.158  1.00 20.49  ? 195 ILE A CG1 1 
ATOM   1551 C CG2 . ILE A 1 197 ? 3.118   10.620  19.171  1.00 21.02  ? 195 ILE A CG2 1 
ATOM   1552 C CD1 . ILE A 1 197 ? 3.422   11.146  16.128  1.00 21.18  ? 195 ILE A CD1 1 
ATOM   1553 N N   . ILE A 1 198 ? 5.372   12.475  21.225  1.00 19.98  ? 196 ILE A N   1 
ATOM   1554 C CA  . ILE A 1 198 ? 5.831   12.186  22.590  1.00 20.24  ? 196 ILE A CA  1 
ATOM   1555 C C   . ILE A 1 198 ? 5.368   13.272  23.581  1.00 20.65  ? 196 ILE A C   1 
ATOM   1556 O O   . ILE A 1 198 ? 4.786   12.940  24.612  1.00 20.60  ? 196 ILE A O   1 
ATOM   1557 C CB  . ILE A 1 198 ? 7.371   12.004  22.657  1.00 19.98  ? 196 ILE A CB  1 
ATOM   1558 C CG1 . ILE A 1 198 ? 7.798   10.792  21.821  1.00 18.34  ? 196 ILE A CG1 1 
ATOM   1559 C CG2 . ILE A 1 198 ? 7.831   11.820  24.114  1.00 21.03  ? 196 ILE A CG2 1 
ATOM   1560 C CD1 . ILE A 1 198 ? 9.304   10.738  21.572  1.00 16.07  ? 196 ILE A CD1 1 
ATOM   1561 N N   . ALA A 1 199 ? 5.607   14.553  23.243  1.00 20.44  ? 197 ALA A N   1 
ATOM   1562 C CA  . ALA A 1 199 ? 5.201   15.687  24.071  1.00 21.03  ? 197 ALA A CA  1 
ATOM   1563 C C   . ALA A 1 199 ? 3.680   15.745  24.283  1.00 20.78  ? 197 ALA A C   1 
ATOM   1564 O O   . ALA A 1 199 ? 3.210   16.119  25.364  1.00 21.63  ? 197 ALA A O   1 
ATOM   1565 C CB  . ALA A 1 199 ? 5.748   17.041  23.485  1.00 20.37  ? 197 ALA A CB  1 
ATOM   1566 N N   . THR A 1 200 ? 2.911   15.349  23.277  1.00 21.27  ? 198 THR A N   1 
ATOM   1567 C CA  . THR A 1 200 ? 1.451   15.336  23.418  1.00 21.43  ? 198 THR A CA  1 
ATOM   1568 C C   . THR A 1 200 ? 0.985   14.269  24.373  1.00 21.52  ? 198 THR A C   1 
ATOM   1569 O O   . THR A 1 200 ? 0.164   14.559  25.243  1.00 21.56  ? 198 THR A O   1 
ATOM   1570 C CB  . THR A 1 200 ? 0.683   15.208  22.070  1.00 21.40  ? 198 THR A CB  1 
ATOM   1571 O OG1 . THR A 1 200 ? 1.097   16.262  21.211  1.00 22.24  ? 198 THR A OG1 1 
ATOM   1572 C CG2 . THR A 1 200 ? -0.807  15.372  22.316  1.00 19.79  ? 198 THR A CG2 1 
ATOM   1573 N N   . TYR A 1 201 ? 1.488   13.035  24.215  1.00 21.76  ? 199 TYR A N   1 
ATOM   1574 C CA  . TYR A 1 201 ? 1.177   11.961  25.182  1.00 21.93  ? 199 TYR A CA  1 
ATOM   1575 C C   . TYR A 1 201 ? 1.524   12.365  26.625  1.00 22.20  ? 199 TYR A C   1 
ATOM   1576 O O   . TYR A 1 201 ? 0.793   12.044  27.567  1.00 22.58  ? 199 TYR A O   1 
ATOM   1577 C CB  . TYR A 1 201 ? 1.905   10.652  24.833  1.00 21.06  ? 199 TYR A CB  1 
ATOM   1578 C CG  . TYR A 1 201 ? 1.181   9.750   23.839  1.00 20.08  ? 199 TYR A CG  1 
ATOM   1579 C CD1 . TYR A 1 201 ? 0.051   8.998   24.213  1.00 19.07  ? 199 TYR A CD1 1 
ATOM   1580 C CD2 . TYR A 1 201 ? 1.643   9.634   22.535  1.00 18.45  ? 199 TYR A CD2 1 
ATOM   1581 C CE1 . TYR A 1 201 ? -0.590  8.173   23.307  1.00 19.25  ? 199 TYR A CE1 1 
ATOM   1582 C CE2 . TYR A 1 201 ? 1.023   8.813   21.624  1.00 19.41  ? 199 TYR A CE2 1 
ATOM   1583 C CZ  . TYR A 1 201 ? -0.095  8.085   21.998  1.00 21.44  ? 199 TYR A CZ  1 
ATOM   1584 O OH  . TYR A 1 201 ? -0.684  7.280   21.038  1.00 20.13  ? 199 TYR A OH  1 
ATOM   1585 N N   . GLN A 1 202 ? 2.648   13.056  26.776  1.00 22.62  ? 200 GLN A N   1 
ATOM   1586 C CA  . GLN A 1 202 ? 3.135   13.491  28.067  1.00 23.56  ? 200 GLN A CA  1 
ATOM   1587 C C   . GLN A 1 202 ? 2.226   14.581  28.689  1.00 24.61  ? 200 GLN A C   1 
ATOM   1588 O O   . GLN A 1 202 ? 1.915   14.547  29.888  1.00 24.22  ? 200 GLN A O   1 
ATOM   1589 C CB  . GLN A 1 202 ? 4.576   13.977  27.930  1.00 22.92  ? 200 GLN A CB  1 
ATOM   1590 C CG  . GLN A 1 202 ? 5.182   14.456  29.244  1.00 24.24  ? 200 GLN A CG  1 
ATOM   1591 C CD  . GLN A 1 202 ? 6.554   15.063  29.098  1.00 24.09  ? 200 GLN A CD  1 
ATOM   1592 O OE1 . GLN A 1 202 ? 6.694   16.266  28.850  1.00 27.85  ? 200 GLN A OE1 1 
ATOM   1593 N NE2 . GLN A 1 202 ? 7.579   14.251  29.297  1.00 24.49  ? 200 GLN A NE2 1 
ATOM   1594 N N   . GLN A 1 203 ? 1.800   15.536  27.871  1.00 26.24  ? 201 GLN A N   1 
ATOM   1595 C CA  . GLN A 1 203 ? 0.872   16.583  28.334  1.00 29.06  ? 201 GLN A CA  1 
ATOM   1596 C C   . GLN A 1 203 ? -0.475  15.976  28.769  1.00 28.19  ? 201 GLN A C   1 
ATOM   1597 O O   . GLN A 1 203 ? -0.986  16.296  29.834  1.00 28.81  ? 201 GLN A O   1 
ATOM   1598 C CB  . GLN A 1 203 ? 0.684   17.657  27.242  1.00 28.81  ? 201 GLN A CB  1 
ATOM   1599 C CG  . GLN A 1 203 ? -0.661  18.394  27.235  1.00 32.15  ? 201 GLN A CG  1 
ATOM   1600 C CD  . GLN A 1 203 ? -0.958  19.109  25.889  1.00 34.19  ? 201 GLN A CD  1 
ATOM   1601 O OE1 . GLN A 1 203 ? -0.033  19.494  25.133  1.00 39.97  ? 201 GLN A OE1 1 
ATOM   1602 N NE2 . GLN A 1 203 ? -2.252  19.287  25.591  1.00 38.53  ? 201 GLN A NE2 1 
ATOM   1603 N N   . LEU A 1 204 ? -1.027  15.080  27.959  1.00 27.97  ? 202 LEU A N   1 
ATOM   1604 C CA  . LEU A 1 204 ? -2.321  14.478  28.257  1.00 27.42  ? 202 LEU A CA  1 
ATOM   1605 C C   . LEU A 1 204 ? -2.298  13.508  29.448  1.00 27.03  ? 202 LEU A C   1 
ATOM   1606 O O   . LEU A 1 204 ? -3.299  13.409  30.172  1.00 26.91  ? 202 LEU A O   1 
ATOM   1607 C CB  . LEU A 1 204 ? -2.870  13.772  27.015  1.00 27.76  ? 202 LEU A CB  1 
ATOM   1608 C CG  . LEU A 1 204 ? -3.174  14.726  25.855  1.00 29.17  ? 202 LEU A CG  1 
ATOM   1609 C CD1 . LEU A 1 204 ? -3.522  13.952  24.610  1.00 28.44  ? 202 LEU A CD1 1 
ATOM   1610 C CD2 . LEU A 1 204 ? -4.310  15.669  26.239  1.00 30.88  ? 202 LEU A CD2 1 
ATOM   1611 N N   . SER A 1 205 ? -1.175  12.796  29.639  1.00 25.46  ? 203 SER A N   1 
ATOM   1612 C CA  . SER A 1 205 ? -1.022  11.858  30.759  1.00 24.22  ? 203 SER A CA  1 
ATOM   1613 C C   . SER A 1 205 ? -0.521  12.465  32.074  1.00 23.92  ? 203 SER A C   1 
ATOM   1614 O O   . SER A 1 205 ? -0.808  11.942  33.141  1.00 23.83  ? 203 SER A O   1 
ATOM   1615 C CB  . SER A 1 205 ? -0.133  10.658  30.379  1.00 23.91  ? 203 SER A CB  1 
ATOM   1616 O OG  . SER A 1 205 ? 1.234   11.026  30.238  1.00 21.59  ? 203 SER A OG  1 
ATOM   1617 N N   . GLY A 1 206 ? 0.234   13.556  31.998  1.00 24.40  ? 204 GLY A N   1 
ATOM   1618 C CA  . GLY A 1 206 ? 0.926   14.101  33.180  1.00 23.68  ? 204 GLY A CA  1 
ATOM   1619 C C   . GLY A 1 206 ? 2.140   13.257  33.575  1.00 23.88  ? 204 GLY A C   1 
ATOM   1620 O O   . GLY A 1 206 ? 2.712   13.470  34.646  1.00 24.28  ? 204 GLY A O   1 
ATOM   1621 N N   . LYS A 1 207 ? 2.514   12.292  32.720  1.00 23.07  ? 205 LYS A N   1 
ATOM   1622 C CA  . LYS A 1 207 ? 3.630   11.360  32.963  1.00 22.48  ? 205 LYS A CA  1 
ATOM   1623 C C   . LYS A 1 207 ? 4.588   11.313  31.777  1.00 22.19  ? 205 LYS A C   1 
ATOM   1624 O O   . LYS A 1 207 ? 4.173   11.471  30.631  1.00 21.95  ? 205 LYS A O   1 
ATOM   1625 C CB  . LYS A 1 207 ? 3.101   9.952   33.258  1.00 22.28  ? 205 LYS A CB  1 
ATOM   1626 C CG  . LYS A 1 207 ? 1.957   9.956   34.264  1.00 22.41  ? 205 LYS A CG  1 
ATOM   1627 C CD  . LYS A 1 207 ? 1.589   8.599   34.764  1.00 22.87  ? 205 LYS A CD  1 
ATOM   1628 C CE  . LYS A 1 207 ? 0.398   8.703   35.729  1.00 22.28  ? 205 LYS A CE  1 
ATOM   1629 N NZ  . LYS A 1 207 ? -0.227  7.364   35.880  1.00 23.12  ? 205 LYS A NZ  1 
ATOM   1630 N N   . ARG A 1 208 ? 5.876   11.123  32.050  1.00 21.48  ? 206 ARG A N   1 
ATOM   1631 C CA  . ARG A 1 208 ? 6.860   11.021  30.976  1.00 21.03  ? 206 ARG A CA  1 
ATOM   1632 C C   . ARG A 1 208 ? 6.627   9.710   30.208  1.00 21.13  ? 206 ARG A C   1 
ATOM   1633 O O   . ARG A 1 208 ? 6.608   8.639   30.810  1.00 21.58  ? 206 ARG A O   1 
ATOM   1634 C CB  . ARG A 1 208 ? 8.293   11.064  31.530  1.00 20.51  ? 206 ARG A CB  1 
ATOM   1635 C CG  . ARG A 1 208 ? 9.342   11.223  30.437  1.00 19.07  ? 206 ARG A CG  1 
ATOM   1636 C CD  . ARG A 1 208 ? 10.760  11.009  30.973  1.00 19.90  ? 206 ARG A CD  1 
ATOM   1637 N NE  . ARG A 1 208 ? 11.743  11.213  29.913  1.00 17.95  ? 206 ARG A NE  1 
ATOM   1638 C CZ  . ARG A 1 208 ? 12.169  10.267  29.070  1.00 19.06  ? 206 ARG A CZ  1 
ATOM   1639 N NH1 . ARG A 1 208 ? 11.693  9.014   29.133  1.00 16.58  ? 206 ARG A NH1 1 
ATOM   1640 N NH2 . ARG A 1 208 ? 13.061  10.586  28.129  1.00 16.82  ? 206 ARG A NH2 1 
ATOM   1641 N N   . PRO A 1 209 ? 6.386   9.783   28.889  1.00 20.86  ? 207 PRO A N   1 
ATOM   1642 C CA  . PRO A 1 209 ? 6.332   8.514   28.177  1.00 20.49  ? 207 PRO A CA  1 
ATOM   1643 C C   . PRO A 1 209 ? 7.728   7.882   28.075  1.00 20.53  ? 207 PRO A C   1 
ATOM   1644 O O   . PRO A 1 209 ? 8.737   8.590   28.099  1.00 21.25  ? 207 PRO A O   1 
ATOM   1645 C CB  . PRO A 1 209 ? 5.805   8.901   26.787  1.00 21.22  ? 207 PRO A CB  1 
ATOM   1646 C CG  . PRO A 1 209 ? 5.210   10.306  26.924  1.00 20.07  ? 207 PRO A CG  1 
ATOM   1647 C CD  . PRO A 1 209 ? 6.107   10.924  28.001  1.00 21.38  ? 207 PRO A CD  1 
ATOM   1648 N N   . THR A 1 210 ? 7.772   6.559   27.994  1.00 19.62  ? 208 THR A N   1 
ATOM   1649 C CA  . THR A 1 210 ? 9.002   5.825   27.708  1.00 18.08  ? 208 THR A CA  1 
ATOM   1650 C C   . THR A 1 210 ? 8.851   5.344   26.268  1.00 17.71  ? 208 THR A C   1 
ATOM   1651 O O   . THR A 1 210 ? 7.776   4.893   25.861  1.00 17.21  ? 208 THR A O   1 
ATOM   1652 C CB  . THR A 1 210 ? 9.211   4.646   28.707  1.00 17.62  ? 208 THR A CB  1 
ATOM   1653 O OG1 . THR A 1 210 ? 9.185   5.179   30.028  1.00 18.12  ? 208 THR A OG1 1 
ATOM   1654 C CG2 . THR A 1 210 ? 10.578  3.958   28.508  1.00 15.54  ? 208 THR A CG2 1 
ATOM   1655 N N   . THR A 1 211 ? 9.914   5.475   25.488  1.00 17.61  ? 209 THR A N   1 
ATOM   1656 C CA  . THR A 1 211 ? 9.797   5.318   24.042  1.00 17.72  ? 209 THR A CA  1 
ATOM   1657 C C   . THR A 1 211 ? 10.775  4.292   23.500  1.00 17.92  ? 209 THR A C   1 
ATOM   1658 O O   . THR A 1 211 ? 11.930  4.208   23.949  1.00 17.89  ? 209 THR A O   1 
ATOM   1659 C CB  . THR A 1 211 ? 9.966   6.671   23.308  1.00 17.29  ? 209 THR A CB  1 
ATOM   1660 O OG1 . THR A 1 211 ? 11.255  7.199   23.586  1.00 17.28  ? 209 THR A OG1 1 
ATOM   1661 C CG2 . THR A 1 211 ? 8.924   7.690   23.794  1.00 16.85  ? 209 THR A CG2 1 
ATOM   1662 N N   . LEU A 1 212 ? 10.299  3.515   22.535  1.00 18.12  ? 210 LEU A N   1 
ATOM   1663 C CA  . LEU A 1 212 ? 11.124  2.532   21.841  1.00 18.16  ? 210 LEU A CA  1 
ATOM   1664 C C   . LEU A 1 212 ? 11.039  2.776   20.330  1.00 19.09  ? 210 LEU A C   1 
ATOM   1665 O O   . LEU A 1 212 ? 9.940   2.891   19.777  1.00 18.32  ? 210 LEU A O   1 
ATOM   1666 C CB  . LEU A 1 212 ? 10.638  1.116   22.161  1.00 18.78  ? 210 LEU A CB  1 
ATOM   1667 C CG  . LEU A 1 212 ? 11.264  -0.062  21.406  1.00 19.39  ? 210 LEU A CG  1 
ATOM   1668 C CD1 . LEU A 1 212 ? 12.690  -0.338  21.879  1.00 20.66  ? 210 LEU A CD1 1 
ATOM   1669 C CD2 . LEU A 1 212 ? 10.420  -1.302  21.578  1.00 18.62  ? 210 LEU A CD2 1 
ATOM   1670 N N   . GLY A 1 213 ? 12.198  2.866   19.670  1.00 19.56  ? 211 GLY A N   1 
ATOM   1671 C CA  . GLY A 1 213 ? 12.253  2.989   18.222  1.00 21.12  ? 211 GLY A CA  1 
ATOM   1672 C C   . GLY A 1 213 ? 12.703  1.692   17.571  1.00 22.64  ? 211 GLY A C   1 
ATOM   1673 O O   . GLY A 1 213 ? 13.637  1.044   18.037  1.00 22.93  ? 211 GLY A O   1 
ATOM   1674 N N   . LEU A 1 214 ? 12.016  1.317   16.499  1.00 24.05  ? 212 LEU A N   1 
ATOM   1675 C CA  . LEU A 1 214 ? 12.381  0.176   15.681  1.00 25.02  ? 212 LEU A CA  1 
ATOM   1676 C C   . LEU A 1 214 ? 12.672  0.669   14.272  1.00 26.28  ? 212 LEU A C   1 
ATOM   1677 O O   . LEU A 1 214 ? 11.820  1.280   13.632  1.00 26.28  ? 212 LEU A O   1 
ATOM   1678 C CB  . LEU A 1 214 ? 11.250  -0.861  15.672  1.00 25.25  ? 212 LEU A CB  1 
ATOM   1679 C CG  . LEU A 1 214 ? 10.646  -1.297  17.032  1.00 25.00  ? 212 LEU A CG  1 
ATOM   1680 C CD1 . LEU A 1 214 ? 9.442   -2.178  16.833  1.00 25.07  ? 212 LEU A CD1 1 
ATOM   1681 C CD2 . LEU A 1 214 ? 11.662  -2.006  17.897  1.00 23.67  ? 212 LEU A CD2 1 
ATOM   1682 N N   . GLY A 1 215 ? 13.893  0.433   13.806  1.00 27.80  ? 213 GLY A N   1 
ATOM   1683 C CA  . GLY A 1 215 ? 14.293  0.777   12.448  1.00 29.70  ? 213 GLY A CA  1 
ATOM   1684 C C   . GLY A 1 215 ? 15.008  -0.406  11.833  1.00 31.80  ? 213 GLY A C   1 
ATOM   1685 O O   . GLY A 1 215 ? 15.415  -1.335  12.532  1.00 30.87  ? 213 GLY A O   1 
ATOM   1686 N N   . ASP A 1 216 ? 15.146  -0.401  10.515  1.00 34.51  ? 214 ASP A N   1 
ATOM   1687 C CA  . ASP A 1 216 ? 15.888  -1.479  9.873   1.00 36.92  ? 214 ASP A CA  1 
ATOM   1688 C C   . ASP A 1 216 ? 17.040  -1.025  8.992   1.00 38.36  ? 214 ASP A C   1 
ATOM   1689 O O   . ASP A 1 216 ? 17.383  -1.707  8.034   1.00 38.84  ? 214 ASP A O   1 
ATOM   1690 C CB  . ASP A 1 216 ? 14.957  -2.468  9.150   1.00 37.10  ? 214 ASP A CB  1 
ATOM   1691 C CG  . ASP A 1 216 ? 14.054  -1.802  8.139   1.00 38.17  ? 214 ASP A CG  1 
ATOM   1692 O OD1 . ASP A 1 216 ? 14.287  -0.614  7.808   1.00 39.32  ? 214 ASP A OD1 1 
ATOM   1693 O OD2 . ASP A 1 216 ? 13.101  -2.480  7.679   1.00 38.73  ? 214 ASP A OD2 1 
ATOM   1694 N N   . GLY A 1 217 ? 17.656  0.105   9.336   1.00 40.33  ? 215 GLY A N   1 
ATOM   1695 C CA  . GLY A 1 217 ? 18.952  0.483   8.744   1.00 42.37  ? 215 GLY A CA  1 
ATOM   1696 C C   . GLY A 1 217 ? 19.603  1.708   9.364   1.00 43.90  ? 215 GLY A C   1 
ATOM   1697 O O   . GLY A 1 217 ? 19.027  2.324   10.270  1.00 45.09  ? 215 GLY A O   1 
ATOM   1698 N N   . PRO A 1 218 ? 20.806  2.085   8.878   0.50 44.49  ? 216 PRO A N   1 
ATOM   1699 C CA  . PRO A 1 218 ? 21.511  3.265   9.404   0.50 44.73  ? 216 PRO A CA  1 
ATOM   1700 C C   . PRO A 1 218 ? 20.871  4.593   8.994   0.50 44.98  ? 216 PRO A C   1 
ATOM   1701 O O   . PRO A 1 218 ? 21.158  5.626   9.599   0.50 45.03  ? 216 PRO A O   1 
ATOM   1702 C CB  . PRO A 1 218 ? 22.908  3.140   8.788   0.50 44.78  ? 216 PRO A CB  1 
ATOM   1703 C CG  . PRO A 1 218 ? 22.687  2.388   7.515   0.50 44.67  ? 216 PRO A CG  1 
ATOM   1704 C CD  . PRO A 1 218 ? 21.579  1.414   7.812   0.50 44.52  ? 216 PRO A CD  1 
ATOM   1705 N N   . ASN A 1 219 ? 20.019  4.568   7.972   1.00 45.35  ? 217 ASN A N   1 
ATOM   1706 C CA  . ASN A 1 219 ? 19.303  5.773   7.537   1.00 45.69  ? 217 ASN A CA  1 
ATOM   1707 C C   . ASN A 1 219 ? 18.245  6.266   8.543   1.00 45.26  ? 217 ASN A C   1 
ATOM   1708 O O   . ASN A 1 219 ? 17.735  7.388   8.429   1.00 45.22  ? 217 ASN A O   1 
ATOM   1709 C CB  . ASN A 1 219 ? 18.671  5.563   6.151   1.00 46.31  ? 217 ASN A CB  1 
ATOM   1710 C CG  . ASN A 1 219 ? 19.636  5.893   4.992   1.00 48.47  ? 217 ASN A CG  1 
ATOM   1711 O OD1 . ASN A 1 219 ? 20.817  6.203   5.201   1.00 50.45  ? 217 ASN A OD1 1 
ATOM   1712 N ND2 . ASN A 1 219 ? 19.124  5.825   3.762   1.00 50.10  ? 217 ASN A ND2 1 
ATOM   1713 N N   . ASP A 1 220 ? 17.924  5.421   9.523   1.00 44.40  ? 218 ASP A N   1 
ATOM   1714 C CA  . ASP A 1 220 ? 16.908  5.733   10.534  1.00 43.29  ? 218 ASP A CA  1 
ATOM   1715 C C   . ASP A 1 220 ? 17.487  6.454   11.745  1.00 42.24  ? 218 ASP A C   1 
ATOM   1716 O O   . ASP A 1 220 ? 16.828  6.550   12.787  1.00 42.62  ? 218 ASP A O   1 
ATOM   1717 C CB  . ASP A 1 220 ? 16.169  4.455   10.979  1.00 43.29  ? 218 ASP A CB  1 
ATOM   1718 C CG  . ASP A 1 220 ? 15.200  3.941   9.926   1.00 43.58  ? 218 ASP A CG  1 
ATOM   1719 O OD1 . ASP A 1 220 ? 14.461  4.772   9.347   1.00 45.85  ? 218 ASP A OD1 1 
ATOM   1720 O OD2 . ASP A 1 220 ? 15.168  2.717   9.670   1.00 42.09  ? 218 ASP A OD2 1 
ATOM   1721 N N   . ALA A 1 221 ? 18.710  6.962   11.612  1.00 40.42  ? 219 ALA A N   1 
ATOM   1722 C CA  . ALA A 1 221 ? 19.395  7.571   12.757  1.00 38.91  ? 219 ALA A CA  1 
ATOM   1723 C C   . ALA A 1 221 ? 18.559  8.655   13.431  1.00 37.23  ? 219 ALA A C   1 
ATOM   1724 O O   . ALA A 1 221 ? 18.380  8.591   14.639  1.00 37.82  ? 219 ALA A O   1 
ATOM   1725 C CB  . ALA A 1 221 ? 20.816  8.076   12.405  1.00 38.33  ? 219 ALA A CB  1 
ATOM   1726 N N   . PRO A 1 222 ? 18.032  9.631   12.664  1.00 35.59  ? 220 PRO A N   1 
ATOM   1727 C CA  . PRO A 1 222 ? 17.383  10.766  13.328  1.00 33.98  ? 220 PRO A CA  1 
ATOM   1728 C C   . PRO A 1 222 ? 16.210  10.368  14.203  1.00 32.36  ? 220 PRO A C   1 
ATOM   1729 O O   . PRO A 1 222 ? 16.139  10.806  15.355  1.00 32.55  ? 220 PRO A O   1 
ATOM   1730 C CB  . PRO A 1 222 ? 16.903  11.652  12.163  1.00 34.68  ? 220 PRO A CB  1 
ATOM   1731 C CG  . PRO A 1 222 ? 17.753  11.263  10.994  1.00 35.08  ? 220 PRO A CG  1 
ATOM   1732 C CD  . PRO A 1 222 ? 18.009  9.779   11.195  1.00 35.77  ? 220 PRO A CD  1 
ATOM   1733 N N   . LEU A 1 223 ? 15.312  9.540   13.680  1.00 30.28  ? 221 LEU A N   1 
ATOM   1734 C CA  . LEU A 1 223 ? 14.179  9.052   14.465  1.00 28.92  ? 221 LEU A CA  1 
ATOM   1735 C C   . LEU A 1 223 ? 14.596  8.249   15.704  1.00 28.02  ? 221 LEU A C   1 
ATOM   1736 O O   . LEU A 1 223 ? 14.090  8.485   16.796  1.00 27.40  ? 221 LEU A O   1 
ATOM   1737 C CB  . LEU A 1 223 ? 13.196  8.235   13.616  1.00 28.62  ? 221 LEU A CB  1 
ATOM   1738 C CG  . LEU A 1 223 ? 12.080  7.560   14.444  1.00 28.74  ? 221 LEU A CG  1 
ATOM   1739 C CD1 . LEU A 1 223 ? 11.141  8.585   15.042  1.00 25.33  ? 221 LEU A CD1 1 
ATOM   1740 C CD2 . LEU A 1 223 ? 11.307  6.545   13.617  1.00 28.81  ? 221 LEU A CD2 1 
ATOM   1741 N N   . LEU A 1 224 ? 15.519  7.312   15.517  1.00 27.72  ? 222 LEU A N   1 
ATOM   1742 C CA  . LEU A 1 224 ? 15.945  6.407   16.589  1.00 27.88  ? 222 LEU A CA  1 
ATOM   1743 C C   . LEU A 1 224 ? 16.698  7.125   17.716  1.00 27.84  ? 222 LEU A C   1 
ATOM   1744 O O   . LEU A 1 224 ? 16.721  6.678   18.875  1.00 27.12  ? 222 LEU A O   1 
ATOM   1745 C CB  . LEU A 1 224 ? 16.775  5.255   16.011  1.00 27.62  ? 222 LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 224 ? 16.112  4.287   15.024  1.00 27.42  ? 222 LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 224 ? 17.026  3.092   14.749  1.00 25.79  ? 222 LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 224 ? 14.713  3.827   15.466  1.00 25.73  ? 222 LEU A CD2 1 
ATOM   1749 N N   . GLU A 1 225 ? 17.270  8.267   17.347  1.00 28.39  ? 223 GLU A N   1 
ATOM   1750 C CA  . GLU A 1 225 ? 18.050  9.126   18.228  1.00 28.94  ? 223 GLU A CA  1 
ATOM   1751 C C   . GLU A 1 225 ? 17.259  9.821   19.328  1.00 27.68  ? 223 GLU A C   1 
ATOM   1752 O O   . GLU A 1 225 ? 17.790  10.110  20.398  1.00 26.68  ? 223 GLU A O   1 
ATOM   1753 C CB  . GLU A 1 225 ? 18.766  10.171  17.382  1.00 29.90  ? 223 GLU A CB  1 
ATOM   1754 C CG  . GLU A 1 225 ? 20.154  9.732   17.047  1.00 35.29  ? 223 GLU A CG  1 
ATOM   1755 C CD  . GLU A 1 225 ? 21.080  9.880   18.249  1.00 41.60  ? 223 GLU A CD  1 
ATOM   1756 O OE1 . GLU A 1 225 ? 21.128  11.006  18.844  1.00 42.29  ? 223 GLU A OE1 1 
ATOM   1757 O OE2 . GLU A 1 225 ? 21.735  8.863   18.596  1.00 42.63  ? 223 GLU A OE2 1 
ATOM   1758 N N   . VAL A 1 226 ? 15.994  10.110  19.075  1.00 26.48  ? 224 VAL A N   1 
ATOM   1759 C CA  . VAL A 1 226 ? 15.245  10.795  20.107  1.00 25.77  ? 224 VAL A CA  1 
ATOM   1760 C C   . VAL A 1 226 ? 14.531  9.797   21.032  1.00 25.42  ? 224 VAL A C   1 
ATOM   1761 O O   . VAL A 1 226 ? 13.860  10.194  21.970  1.00 26.36  ? 224 VAL A O   1 
ATOM   1762 C CB  . VAL A 1 226 ? 14.292  11.896  19.529  1.00 25.83  ? 224 VAL A CB  1 
ATOM   1763 C CG1 . VAL A 1 226 ? 15.005  12.748  18.500  1.00 23.98  ? 224 VAL A CG1 1 
ATOM   1764 C CG2 . VAL A 1 226 ? 13.048  11.308  18.936  1.00 26.68  ? 224 VAL A CG2 1 
ATOM   1765 N N   . MET A 1 227 ? 14.681  8.506   20.751  1.00 24.39  ? 225 MET A N   1 
ATOM   1766 C CA  . MET A 1 227 ? 14.061  7.438   21.545  1.00 24.24  ? 225 MET A CA  1 
ATOM   1767 C C   . MET A 1 227 ? 14.875  7.120   22.802  1.00 23.83  ? 225 MET A C   1 
ATOM   1768 O O   . MET A 1 227 ? 16.089  7.175   22.761  1.00 23.69  ? 225 MET A O   1 
ATOM   1769 C CB  . MET A 1 227 ? 13.904  6.152   20.693  1.00 23.68  ? 225 MET A CB  1 
ATOM   1770 C CG  . MET A 1 227 ? 13.097  6.361   19.386  1.00 23.71  ? 225 MET A CG  1 
ATOM   1771 S SD  . MET A 1 227 ? 11.395  6.874   19.736  1.00 26.87  ? 225 MET A SD  1 
ATOM   1772 C CE  . MET A 1 227 ? 11.213  8.273   18.675  1.00 25.94  ? 225 MET A CE  1 
ATOM   1773 N N   . ASP A 1 228 ? 14.203  6.769   23.902  1.00 23.41  ? 226 ASP A N   1 
ATOM   1774 C CA  . ASP A 1 228 ? 14.873  6.212   25.079  1.00 23.52  ? 226 ASP A CA  1 
ATOM   1775 C C   . ASP A 1 228 ? 15.569  4.884   24.741  1.00 24.18  ? 226 ASP A C   1 
ATOM   1776 O O   . ASP A 1 228 ? 16.669  4.604   25.228  1.00 23.79  ? 226 ASP A O   1 
ATOM   1777 C CB  . ASP A 1 228 ? 13.859  5.972   26.210  1.00 23.41  ? 226 ASP A CB  1 
ATOM   1778 C CG  . ASP A 1 228 ? 13.152  7.247   26.648  1.00 23.08  ? 226 ASP A CG  1 
ATOM   1779 O OD1 . ASP A 1 228 ? 13.739  8.339   26.522  1.00 22.97  ? 226 ASP A OD1 1 
ATOM   1780 O OD2 . ASP A 1 228 ? 12.012  7.155   27.134  1.00 20.43  ? 226 ASP A OD2 1 
ATOM   1781 N N   . TYR A 1 229 ? 14.905  4.061   23.921  1.00 24.02  ? 227 TYR A N   1 
ATOM   1782 C CA  . TYR A 1 229 ? 15.442  2.769   23.523  1.00 24.57  ? 227 TYR A CA  1 
ATOM   1783 C C   . TYR A 1 229 ? 15.280  2.620   22.029  1.00 24.18  ? 227 TYR A C   1 
ATOM   1784 O O   . TYR A 1 229 ? 14.248  2.971   21.484  1.00 23.93  ? 227 TYR A O   1 
ATOM   1785 C CB  . TYR A 1 229 ? 14.780  1.617   24.305  1.00 24.66  ? 227 TYR A CB  1 
ATOM   1786 C CG  . TYR A 1 229 ? 14.919  1.788   25.806  1.00 25.82  ? 227 TYR A CG  1 
ATOM   1787 C CD1 . TYR A 1 229 ? 16.118  1.469   26.452  1.00 27.78  ? 227 TYR A CD1 1 
ATOM   1788 C CD2 . TYR A 1 229 ? 13.865  2.296   26.585  1.00 26.58  ? 227 TYR A CD2 1 
ATOM   1789 C CE1 . TYR A 1 229 ? 16.272  1.645   27.844  1.00 27.04  ? 227 TYR A CE1 1 
ATOM   1790 C CE2 . TYR A 1 229 ? 14.007  2.473   27.972  1.00 26.31  ? 227 TYR A CE2 1 
ATOM   1791 C CZ  . TYR A 1 229 ? 15.219  2.142   28.585  1.00 26.82  ? 227 TYR A CZ  1 
ATOM   1792 O OH  . TYR A 1 229 ? 15.392  2.302   29.942  1.00 27.37  ? 227 TYR A OH  1 
ATOM   1793 N N   . ALA A 1 230 ? 16.324  2.155   21.358  1.00 24.27  ? 228 ALA A N   1 
ATOM   1794 C CA  . ALA A 1 230 ? 16.269  2.006   19.897  1.00 24.68  ? 228 ALA A CA  1 
ATOM   1795 C C   . ALA A 1 230 ? 16.984  0.736   19.488  1.00 24.83  ? 228 ALA A C   1 
ATOM   1796 O O   . ALA A 1 230 ? 18.052  0.425   20.028  1.00 24.68  ? 228 ALA A O   1 
ATOM   1797 C CB  . ALA A 1 230 ? 16.891  3.230   19.191  1.00 24.53  ? 228 ALA A CB  1 
ATOM   1798 N N   . VAL A 1 231 ? 16.368  -0.012  18.571  1.00 25.10  ? 229 VAL A N   1 
ATOM   1799 C CA  . VAL A 1 231 ? 16.960  -1.228  18.023  1.00 25.53  ? 229 VAL A CA  1 
ATOM   1800 C C   . VAL A 1 231 ? 16.838  -1.249  16.507  1.00 26.14  ? 229 VAL A C   1 
ATOM   1801 O O   . VAL A 1 231 ? 15.913  -0.654  15.922  1.00 26.09  ? 229 VAL A O   1 
ATOM   1802 C CB  . VAL A 1 231 ? 16.401  -2.576  18.646  1.00 25.56  ? 229 VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 231 ? 16.433  -2.548  20.172  1.00 25.62  ? 229 VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 231 ? 15.008  -2.874  18.201  1.00 25.07  ? 229 VAL A CG2 1 
ATOM   1805 N N   . ILE A 1 232 ? 17.819  -1.903  15.887  1.00 26.86  ? 230 ILE A N   1 
ATOM   1806 C CA  . ILE A 1 232 ? 17.759  -2.304  14.489  1.00 27.42  ? 230 ILE A CA  1 
ATOM   1807 C C   . ILE A 1 232 ? 17.250  -3.733  14.458  1.00 28.39  ? 230 ILE A C   1 
ATOM   1808 O O   . ILE A 1 232 ? 17.764  -4.593  15.174  1.00 27.58  ? 230 ILE A O   1 
ATOM   1809 C CB  . ILE A 1 232 ? 19.162  -2.245  13.808  1.00 27.24  ? 230 ILE A CB  1 
ATOM   1810 C CG1 . ILE A 1 232 ? 19.814  -0.870  14.022  1.00 27.09  ? 230 ILE A CG1 1 
ATOM   1811 C CG2 . ILE A 1 232 ? 19.069  -2.650  12.302  1.00 26.30  ? 230 ILE A CG2 1 
ATOM   1812 C CD1 . ILE A 1 232 ? 19.022  0.306   13.426  1.00 25.21  ? 230 ILE A CD1 1 
ATOM   1813 N N   . VAL A 1 233 ? 16.233  -3.983  13.644  1.00 29.95  ? 231 VAL A N   1 
ATOM   1814 C CA  . VAL A 1 233 ? 15.750  -5.343  13.464  1.00 32.01  ? 231 VAL A CA  1 
ATOM   1815 C C   . VAL A 1 233 ? 16.035  -5.783  12.039  1.00 33.30  ? 231 VAL A C   1 
ATOM   1816 O O   . VAL A 1 233 ? 15.821  -5.018  11.089  1.00 33.50  ? 231 VAL A O   1 
ATOM   1817 C CB  . VAL A 1 233 ? 14.236  -5.535  13.854  1.00 31.95  ? 231 VAL A CB  1 
ATOM   1818 C CG1 . VAL A 1 233 ? 13.868  -4.680  15.077  1.00 32.29  ? 231 VAL A CG1 1 
ATOM   1819 C CG2 . VAL A 1 233 ? 13.329  -5.215  12.724  1.00 31.99  ? 231 VAL A CG2 1 
ATOM   1820 N N   . LYS A 1 234 ? 16.547  -7.002  11.905  1.00 34.90  ? 232 LYS A N   1 
ATOM   1821 C CA  . LYS A 1 234 ? 16.744  -7.623  10.610  1.00 37.32  ? 232 LYS A CA  1 
ATOM   1822 C C   . LYS A 1 234 ? 15.998  -8.966  10.531  1.00 38.35  ? 232 LYS A C   1 
ATOM   1823 O O   . LYS A 1 234 ? 16.186  -9.832  11.383  1.00 38.23  ? 232 LYS A O   1 
ATOM   1824 C CB  . LYS A 1 234 ? 18.252  -7.825  10.343  1.00 36.99  ? 232 LYS A CB  1 
ATOM   1825 C CG  . LYS A 1 234 ? 18.539  -8.492  8.999   1.00 38.51  ? 232 LYS A CG  1 
ATOM   1826 C CD  . LYS A 1 234 ? 20.011  -8.558  8.617   1.00 39.25  ? 232 LYS A CD  1 
ATOM   1827 C CE  . LYS A 1 234 ? 20.143  -9.141  7.197   1.00 42.65  ? 232 LYS A CE  1 
ATOM   1828 N NZ  . LYS A 1 234 ? 21.478  -9.766  6.887   1.00 45.00  ? 232 LYS A NZ  1 
ATOM   1829 N N   . GLY A 1 235 ? 15.167  -9.135  9.504   1.00 40.44  ? 233 GLY A N   1 
ATOM   1830 C CA  . GLY A 1 235 ? 14.630  -10.455 9.135   1.00 43.53  ? 233 GLY A CA  1 
ATOM   1831 C C   . GLY A 1 235 ? 15.739  -11.496 9.025   1.00 45.70  ? 233 GLY A C   1 
ATOM   1832 O O   . GLY A 1 235 ? 16.788  -11.220 8.459   1.00 46.44  ? 233 GLY A O   1 
ATOM   1833 N N   . LEU A 1 236 ? 15.527  -12.681 9.595   1.00 47.93  ? 234 LEU A N   1 
ATOM   1834 C CA  . LEU A 1 236 ? 16.564  -13.715 9.656   1.00 50.02  ? 234 LEU A CA  1 
ATOM   1835 C C   . LEU A 1 236 ? 16.783  -14.391 8.300   1.00 51.68  ? 234 LEU A C   1 
ATOM   1836 O O   . LEU A 1 236 ? 15.861  -14.446 7.465   1.00 52.04  ? 234 LEU A O   1 
ATOM   1837 C CB  . LEU A 1 236 ? 16.185  -14.766 10.696  1.00 49.89  ? 234 LEU A CB  1 
ATOM   1838 C CG  . LEU A 1 236 ? 17.023  -16.035 10.838  1.00 50.88  ? 234 LEU A CG  1 
ATOM   1839 C CD1 . LEU A 1 236 ? 18.010  -15.924 11.985  1.00 52.12  ? 234 LEU A CD1 1 
ATOM   1840 C CD2 . LEU A 1 236 ? 16.137  -17.279 11.007  1.00 51.66  ? 234 LEU A CD2 1 
ATOM   1841 N N   . ASN A 1 237 ? 18.013  -14.877 8.083   1.00 53.36  ? 235 ASN A N   1 
ATOM   1842 C CA  . ASN A 1 237 ? 18.342  -15.822 6.989   1.00 54.72  ? 235 ASN A CA  1 
ATOM   1843 C C   . ASN A 1 237 ? 19.801  -16.290 7.014   1.00 54.96  ? 235 ASN A C   1 
ATOM   1844 O O   . ASN A 1 237 ? 20.639  -15.712 7.718   1.00 55.35  ? 235 ASN A O   1 
ATOM   1845 C CB  . ASN A 1 237 ? 17.988  -15.256 5.604   1.00 55.26  ? 235 ASN A CB  1 
ATOM   1846 C CG  . ASN A 1 237 ? 18.615  -13.896 5.348   1.00 56.86  ? 235 ASN A CG  1 
ATOM   1847 O OD1 . ASN A 1 237 ? 18.456  -12.960 6.141   1.00 57.88  ? 235 ASN A OD1 1 
ATOM   1848 N ND2 . ASN A 1 237 ? 19.326  -13.778 4.225   1.00 57.93  ? 235 ASN A ND2 1 
ATOM   1849 N N   . MET B 1 3   ? 61.343  24.856  48.481  1.00 54.62  ? 1   MET B N   1 
ATOM   1850 C CA  . MET B 1 3   ? 60.929  23.421  48.484  1.00 54.48  ? 1   MET B CA  1 
ATOM   1851 C C   . MET B 1 3   ? 59.425  23.289  48.328  1.00 53.48  ? 1   MET B C   1 
ATOM   1852 O O   . MET B 1 3   ? 58.653  23.928  49.059  1.00 53.41  ? 1   MET B O   1 
ATOM   1853 C CB  . MET B 1 3   ? 61.367  22.700  49.770  1.00 54.64  ? 1   MET B CB  1 
ATOM   1854 C CG  . MET B 1 3   ? 62.838  22.324  49.828  1.00 55.49  ? 1   MET B CG  1 
ATOM   1855 S SD  . MET B 1 3   ? 63.100  20.562  50.194  1.00 56.23  ? 1   MET B SD  1 
ATOM   1856 C CE  . MET B 1 3   ? 64.847  20.442  49.896  1.00 56.41  ? 1   MET B CE  1 
ATOM   1857 N N   . PHE B 1 4   ? 59.020  22.452  47.373  1.00 52.23  ? 2   PHE B N   1 
ATOM   1858 C CA  . PHE B 1 4   ? 57.624  22.073  47.201  1.00 50.91  ? 2   PHE B CA  1 
ATOM   1859 C C   . PHE B 1 4   ? 57.084  21.569  48.550  1.00 49.87  ? 2   PHE B C   1 
ATOM   1860 O O   . PHE B 1 4   ? 57.800  20.880  49.295  1.00 49.80  ? 2   PHE B O   1 
ATOM   1861 C CB  . PHE B 1 4   ? 57.527  20.974  46.131  1.00 51.20  ? 2   PHE B CB  1 
ATOM   1862 C CG  . PHE B 1 4   ? 56.115  20.643  45.688  1.00 51.60  ? 2   PHE B CG  1 
ATOM   1863 C CD1 . PHE B 1 4   ? 55.656  21.051  44.433  1.00 51.70  ? 2   PHE B CD1 1 
ATOM   1864 C CD2 . PHE B 1 4   ? 55.261  19.893  46.504  1.00 51.27  ? 2   PHE B CD2 1 
ATOM   1865 C CE1 . PHE B 1 4   ? 54.357  20.730  44.002  1.00 52.56  ? 2   PHE B CE1 1 
ATOM   1866 C CE2 . PHE B 1 4   ? 53.956  19.575  46.091  1.00 51.75  ? 2   PHE B CE2 1 
ATOM   1867 C CZ  . PHE B 1 4   ? 53.505  19.986  44.836  1.00 51.78  ? 2   PHE B CZ  1 
ATOM   1868 N N   . SER B 1 5   ? 55.834  21.924  48.861  1.00 48.11  ? 3   SER B N   1 
ATOM   1869 C CA  . SER B 1 5   ? 55.160  21.454  50.084  1.00 46.28  ? 3   SER B CA  1 
ATOM   1870 C C   . SER B 1 5   ? 53.645  21.407  49.906  1.00 44.21  ? 3   SER B C   1 
ATOM   1871 O O   . SER B 1 5   ? 53.064  22.341  49.357  1.00 44.42  ? 3   SER B O   1 
ATOM   1872 C CB  . SER B 1 5   ? 55.524  22.342  51.292  1.00 46.73  ? 3   SER B CB  1 
ATOM   1873 O OG  . SER B 1 5   ? 55.616  23.710  50.914  1.00 47.10  ? 3   SER B OG  1 
ATOM   1874 N N   . ILE B 1 6   ? 53.007  20.329  50.370  1.00 41.48  ? 4   ILE B N   1 
ATOM   1875 C CA  . ILE B 1 6   ? 51.544  20.268  50.357  1.00 38.37  ? 4   ILE B CA  1 
ATOM   1876 C C   . ILE B 1 6   ? 50.988  20.893  51.624  1.00 36.21  ? 4   ILE B C   1 
ATOM   1877 O O   . ILE B 1 6   ? 51.192  20.387  52.735  1.00 36.29  ? 4   ILE B O   1 
ATOM   1878 C CB  . ILE B 1 6   ? 50.981  18.848  50.183  1.00 38.81  ? 4   ILE B CB  1 
ATOM   1879 C CG1 . ILE B 1 6   ? 51.846  18.060  49.194  1.00 38.18  ? 4   ILE B CG1 1 
ATOM   1880 C CG2 . ILE B 1 6   ? 49.495  18.922  49.740  1.00 37.23  ? 4   ILE B CG2 1 
ATOM   1881 C CD1 . ILE B 1 6   ? 51.606  16.592  49.191  1.00 36.98  ? 4   ILE B CD1 1 
ATOM   1882 N N   . GLN B 1 7   ? 50.280  21.997  51.429  1.00 32.75  ? 5   GLN B N   1 
ATOM   1883 C CA  . GLN B 1 7   ? 49.714  22.770  52.505  1.00 29.60  ? 5   GLN B CA  1 
ATOM   1884 C C   . GLN B 1 7   ? 48.651  21.988  53.246  1.00 27.20  ? 5   GLN B C   1 
ATOM   1885 O O   . GLN B 1 7   ? 47.954  21.156  52.657  1.00 25.22  ? 5   GLN B O   1 
ATOM   1886 C CB  . GLN B 1 7   ? 49.080  24.031  51.951  1.00 29.64  ? 5   GLN B CB  1 
ATOM   1887 C CG  . GLN B 1 7   ? 50.015  25.214  51.834  1.00 31.14  ? 5   GLN B CG  1 
ATOM   1888 C CD  . GLN B 1 7   ? 49.287  26.408  51.271  1.00 31.80  ? 5   GLN B CD  1 
ATOM   1889 O OE1 . GLN B 1 7   ? 49.363  27.507  51.802  1.00 33.43  ? 5   GLN B OE1 1 
ATOM   1890 N NE2 . GLN B 1 7   ? 48.535  26.183  50.210  1.00 31.11  ? 5   GLN B NE2 1 
ATOM   1891 N N   . GLN B 1 8   ? 48.538  22.266  54.541  1.00 24.33  ? 6   GLN B N   1 
ATOM   1892 C CA  . GLN B 1 8   ? 47.428  21.756  55.311  1.00 23.39  ? 6   GLN B CA  1 
ATOM   1893 C C   . GLN B 1 8   ? 46.116  22.188  54.648  1.00 21.60  ? 6   GLN B C   1 
ATOM   1894 O O   . GLN B 1 8   ? 45.926  23.372  54.369  1.00 21.29  ? 6   GLN B O   1 
ATOM   1895 C CB  . GLN B 1 8   ? 47.460  22.298  56.736  1.00 23.59  ? 6   GLN B CB  1 
ATOM   1896 C CG  . GLN B 1 8   ? 46.445  21.597  57.595  1.00 26.02  ? 6   GLN B CG  1 
ATOM   1897 C CD  . GLN B 1 8   ? 45.931  22.446  58.728  1.00 31.24  ? 6   GLN B CD  1 
ATOM   1898 O OE1 . GLN B 1 8   ? 46.651  23.279  59.294  1.00 30.08  ? 6   GLN B OE1 1 
ATOM   1899 N NE2 . GLN B 1 8   ? 44.658  22.233  59.077  1.00 33.91  ? 6   GLN B NE2 1 
ATOM   1900 N N   . PRO B 1 9   ? 45.226  21.236  54.370  1.00 20.21  ? 7   PRO B N   1 
ATOM   1901 C CA  . PRO B 1 9   ? 43.968  21.633  53.733  1.00 19.39  ? 7   PRO B CA  1 
ATOM   1902 C C   . PRO B 1 9   ? 43.048  22.430  54.653  1.00 18.57  ? 7   PRO B C   1 
ATOM   1903 O O   . PRO B 1 9   ? 42.851  22.058  55.809  1.00 18.57  ? 7   PRO B O   1 
ATOM   1904 C CB  . PRO B 1 9   ? 43.322  20.282  53.356  1.00 19.26  ? 7   PRO B CB  1 
ATOM   1905 C CG  . PRO B 1 9   ? 44.452  19.279  53.417  1.00 18.35  ? 7   PRO B CG  1 
ATOM   1906 C CD  . PRO B 1 9   ? 45.320  19.768  54.518  1.00 19.81  ? 7   PRO B CD  1 
ATOM   1907 N N   . LEU B 1 10  ? 42.514  23.530  54.133  1.00 17.41  ? 8   LEU B N   1 
ATOM   1908 C CA  . LEU B 1 10  ? 41.538  24.343  54.842  1.00 17.56  ? 8   LEU B CA  1 
ATOM   1909 C C   . LEU B 1 10  ? 40.351  24.386  53.911  1.00 17.50  ? 8   LEU B C   1 
ATOM   1910 O O   . LEU B 1 10  ? 40.388  25.034  52.864  1.00 16.92  ? 8   LEU B O   1 
ATOM   1911 C CB  . LEU B 1 10  ? 42.069  25.766  55.157  1.00 16.90  ? 8   LEU B CB  1 
ATOM   1912 C CG  . LEU B 1 10  ? 43.326  25.874  56.037  1.00 18.75  ? 8   LEU B CG  1 
ATOM   1913 C CD1 . LEU B 1 10  ? 43.793  27.341  56.223  1.00 16.89  ? 8   LEU B CD1 1 
ATOM   1914 C CD2 . LEU B 1 10  ? 43.148  25.188  57.397  1.00 14.73  ? 8   LEU B CD2 1 
ATOM   1915 N N   . LEU B 1 11  ? 39.301  23.672  54.290  1.00 17.60  ? 9   LEU B N   1 
ATOM   1916 C CA  . LEU B 1 11  ? 38.217  23.389  53.352  1.00 17.32  ? 9   LEU B CA  1 
ATOM   1917 C C   . LEU B 1 11  ? 36.922  24.004  53.805  1.00 17.61  ? 9   LEU B C   1 
ATOM   1918 O O   . LEU B 1 11  ? 36.493  23.830  54.961  1.00 16.86  ? 9   LEU B O   1 
ATOM   1919 C CB  . LEU B 1 11  ? 38.010  21.873  53.199  1.00 16.86  ? 9   LEU B CB  1 
ATOM   1920 C CG  . LEU B 1 11  ? 39.242  21.011  52.954  1.00 15.86  ? 9   LEU B CG  1 
ATOM   1921 C CD1 . LEU B 1 11  ? 38.838  19.525  53.021  1.00 15.48  ? 9   LEU B CD1 1 
ATOM   1922 C CD2 . LEU B 1 11  ? 39.872  21.351  51.620  1.00 12.80  ? 9   LEU B CD2 1 
ATOM   1923 N N   . VAL B 1 12  ? 36.287  24.699  52.865  1.00 18.48  ? 10  VAL B N   1 
ATOM   1924 C CA  . VAL B 1 12  ? 34.975  25.267  53.096  1.00 18.24  ? 10  VAL B CA  1 
ATOM   1925 C C   . VAL B 1 12  ? 33.937  24.405  52.396  1.00 18.65  ? 10  VAL B C   1 
ATOM   1926 O O   . VAL B 1 12  ? 34.022  24.203  51.191  1.00 18.88  ? 10  VAL B O   1 
ATOM   1927 C CB  . VAL B 1 12  ? 34.911  26.743  52.611  1.00 18.50  ? 10  VAL B CB  1 
ATOM   1928 C CG1 . VAL B 1 12  ? 33.515  27.355  52.869  1.00 17.33  ? 10  VAL B CG1 1 
ATOM   1929 C CG2 . VAL B 1 12  ? 35.995  27.568  53.308  1.00 17.83  ? 10  VAL B CG2 1 
ATOM   1930 N N   . PHE B 1 13  ? 32.952  23.903  53.153  1.00 19.20  ? 11  PHE B N   1 
ATOM   1931 C CA  . PHE B 1 13  ? 31.774  23.261  52.549  1.00 19.07  ? 11  PHE B CA  1 
ATOM   1932 C C   . PHE B 1 13  ? 30.568  24.210  52.492  1.00 20.04  ? 11  PHE B C   1 
ATOM   1933 O O   . PHE B 1 13  ? 29.999  24.574  53.527  1.00 19.32  ? 11  PHE B O   1 
ATOM   1934 C CB  . PHE B 1 13  ? 31.459  21.943  53.251  1.00 18.60  ? 11  PHE B CB  1 
ATOM   1935 C CG  . PHE B 1 13  ? 32.507  20.880  53.008  1.00 17.37  ? 11  PHE B CG  1 
ATOM   1936 C CD1 . PHE B 1 13  ? 33.723  20.908  53.700  1.00 13.98  ? 11  PHE B CD1 1 
ATOM   1937 C CD2 . PHE B 1 13  ? 32.289  19.883  52.054  1.00 12.74  ? 11  PHE B CD2 1 
ATOM   1938 C CE1 . PHE B 1 13  ? 34.689  19.914  53.467  1.00 17.52  ? 11  PHE B CE1 1 
ATOM   1939 C CE2 . PHE B 1 13  ? 33.242  18.897  51.816  1.00 14.66  ? 11  PHE B CE2 1 
ATOM   1940 C CZ  . PHE B 1 13  ? 34.443  18.914  52.508  1.00 16.63  ? 11  PHE B CZ  1 
ATOM   1941 N N   . SER B 1 14  ? 30.193  24.613  51.272  1.00 21.10  ? 12  SER B N   1 
ATOM   1942 C CA  . SER B 1 14  ? 29.150  25.621  51.098  1.00 22.64  ? 12  SER B CA  1 
ATOM   1943 C C   . SER B 1 14  ? 27.828  25.028  50.637  1.00 23.93  ? 12  SER B C   1 
ATOM   1944 O O   . SER B 1 14  ? 27.711  24.543  49.510  1.00 23.67  ? 12  SER B O   1 
ATOM   1945 C CB  . SER B 1 14  ? 29.607  26.714  50.125  1.00 22.81  ? 12  SER B CB  1 
ATOM   1946 O OG  . SER B 1 14  ? 28.685  27.786  50.087  1.00 21.55  ? 12  SER B OG  1 
ATOM   1947 N N   . ASP B 1 15  ? 26.835  25.064  51.513  1.00 26.23  ? 13  ASP B N   1 
ATOM   1948 C CA  . ASP B 1 15  ? 25.477  24.670  51.140  1.00 29.48  ? 13  ASP B CA  1 
ATOM   1949 C C   . ASP B 1 15  ? 24.595  25.909  51.274  1.00 31.24  ? 13  ASP B C   1 
ATOM   1950 O O   . ASP B 1 15  ? 23.803  26.021  52.196  1.00 31.73  ? 13  ASP B O   1 
ATOM   1951 C CB  . ASP B 1 15  ? 24.974  23.525  52.037  1.00 28.96  ? 13  ASP B CB  1 
ATOM   1952 C CG  . ASP B 1 15  ? 23.864  22.677  51.378  1.00 31.29  ? 13  ASP B CG  1 
ATOM   1953 O OD1 . ASP B 1 15  ? 23.135  23.165  50.477  1.00 30.31  ? 13  ASP B OD1 1 
ATOM   1954 O OD2 . ASP B 1 15  ? 23.724  21.492  51.776  1.00 33.11  ? 13  ASP B OD2 1 
ATOM   1955 N N   . LEU B 1 16  ? 24.769  26.859  50.372  1.00 34.14  ? 14  LEU B N   1 
ATOM   1956 C CA  . LEU B 1 16  ? 24.065  28.133  50.492  1.00 37.55  ? 14  LEU B CA  1 
ATOM   1957 C C   . LEU B 1 16  ? 23.220  28.418  49.248  1.00 40.54  ? 14  LEU B C   1 
ATOM   1958 O O   . LEU B 1 16  ? 23.539  29.310  48.452  1.00 41.29  ? 14  LEU B O   1 
ATOM   1959 C CB  . LEU B 1 16  ? 25.035  29.294  50.806  1.00 36.46  ? 14  LEU B CB  1 
ATOM   1960 C CG  . LEU B 1 16  ? 25.887  29.267  52.084  1.00 34.50  ? 14  LEU B CG  1 
ATOM   1961 C CD1 . LEU B 1 16  ? 27.005  30.302  52.007  1.00 33.77  ? 14  LEU B CD1 1 
ATOM   1962 C CD2 . LEU B 1 16  ? 25.061  29.475  53.337  1.00 29.38  ? 14  LEU B CD2 1 
ATOM   1963 N N   . ASP B 1 17  ? 22.159  27.625  49.084  1.00 43.93  ? 15  ASP B N   1 
ATOM   1964 C CA  . ASP B 1 17  ? 21.091  27.917  48.122  1.00 47.04  ? 15  ASP B CA  1 
ATOM   1965 C C   . ASP B 1 17  ? 20.428  29.248  48.451  1.00 48.16  ? 15  ASP B C   1 
ATOM   1966 O O   . ASP B 1 17  ? 19.980  29.461  49.576  1.00 49.24  ? 15  ASP B O   1 
ATOM   1967 C CB  . ASP B 1 17  ? 20.021  26.798  48.100  1.00 47.67  ? 15  ASP B CB  1 
ATOM   1968 C CG  . ASP B 1 17  ? 19.532  26.394  49.508  1.00 50.03  ? 15  ASP B CG  1 
ATOM   1969 O OD1 . ASP B 1 17  ? 18.358  26.690  49.859  1.00 51.32  ? 15  ASP B OD1 1 
ATOM   1970 O OD2 . ASP B 1 17  ? 20.324  25.772  50.259  1.00 52.59  ? 15  ASP B OD2 1 
ATOM   1971 N N   . GLY B 1 18  ? 20.386  30.152  47.482  1.00 49.28  ? 16  GLY B N   1 
ATOM   1972 C CA  . GLY B 1 18  ? 19.597  31.378  47.620  1.00 50.38  ? 16  GLY B CA  1 
ATOM   1973 C C   . GLY B 1 18  ? 20.128  32.404  48.607  1.00 50.89  ? 16  GLY B C   1 
ATOM   1974 O O   . GLY B 1 18  ? 19.397  33.323  49.011  1.00 51.11  ? 16  GLY B O   1 
ATOM   1975 N N   . THR B 1 19  ? 21.387  32.236  49.008  1.00 51.18  ? 17  THR B N   1 
ATOM   1976 C CA  . THR B 1 19  ? 22.113  33.264  49.760  1.00 51.32  ? 17  THR B CA  1 
ATOM   1977 C C   . THR B 1 19  ? 23.306  33.767  48.932  1.00 51.50  ? 17  THR B C   1 
ATOM   1978 O O   . THR B 1 19  ? 23.448  34.971  48.710  1.00 51.42  ? 17  THR B O   1 
ATOM   1979 C CB  . THR B 1 19  ? 22.585  32.754  51.148  1.00 51.17  ? 17  THR B CB  1 
ATOM   1980 O OG1 . THR B 1 19  ? 21.460  32.267  51.896  1.00 51.75  ? 17  THR B OG1 1 
ATOM   1981 C CG2 . THR B 1 19  ? 23.271  33.872  51.931  1.00 50.86  ? 17  THR B CG2 1 
ATOM   1982 N N   . LEU B 1 20  ? 24.137  32.832  48.464  1.00 51.75  ? 18  LEU B N   1 
ATOM   1983 C CA  . LEU B 1 20  ? 25.375  33.138  47.736  1.00 52.32  ? 18  LEU B CA  1 
ATOM   1984 C C   . LEU B 1 20  ? 25.143  33.533  46.278  1.00 53.01  ? 18  LEU B C   1 
ATOM   1985 O O   . LEU B 1 20  ? 25.880  34.349  45.727  1.00 52.95  ? 18  LEU B O   1 
ATOM   1986 C CB  . LEU B 1 20  ? 26.330  31.940  47.798  1.00 52.05  ? 18  LEU B CB  1 
ATOM   1987 C CG  . LEU B 1 20  ? 27.767  32.049  47.275  1.00 51.10  ? 18  LEU B CG  1 
ATOM   1988 C CD1 . LEU B 1 20  ? 28.656  32.746  48.298  1.00 48.98  ? 18  LEU B CD1 1 
ATOM   1989 C CD2 . LEU B 1 20  ? 28.302  30.657  46.934  1.00 48.74  ? 18  LEU B CD2 1 
ATOM   1990 N N   . LEU B 1 21  ? 24.127  32.937  45.661  1.00 54.24  ? 19  LEU B N   1 
ATOM   1991 C CA  . LEU B 1 21  ? 23.843  33.155  44.244  1.00 55.60  ? 19  LEU B CA  1 
ATOM   1992 C C   . LEU B 1 21  ? 22.943  34.360  44.027  1.00 56.75  ? 19  LEU B C   1 
ATOM   1993 O O   . LEU B 1 21  ? 22.128  34.703  44.886  1.00 56.99  ? 19  LEU B O   1 
ATOM   1994 C CB  . LEU B 1 21  ? 23.218  31.908  43.601  1.00 55.19  ? 19  LEU B CB  1 
ATOM   1995 C CG  . LEU B 1 21  ? 23.960  30.572  43.755  1.00 54.92  ? 19  LEU B CG  1 
ATOM   1996 C CD1 . LEU B 1 21  ? 23.072  29.419  43.324  1.00 54.39  ? 19  LEU B CD1 1 
ATOM   1997 C CD2 . LEU B 1 21  ? 25.291  30.561  43.007  1.00 54.51  ? 19  LEU B CD2 1 
ATOM   1998 N N   . ASP B 1 22  ? 23.118  35.011  42.884  1.00 58.29  ? 20  ASP B N   1 
ATOM   1999 C CA  . ASP B 1 22  ? 22.147  35.979  42.408  1.00 60.17  ? 20  ASP B CA  1 
ATOM   2000 C C   . ASP B 1 22  ? 21.108  35.213  41.568  1.00 60.88  ? 20  ASP B C   1 
ATOM   2001 O O   . ASP B 1 22  ? 21.462  34.542  40.594  1.00 61.17  ? 20  ASP B O   1 
ATOM   2002 C CB  . ASP B 1 22  ? 22.846  37.078  41.603  1.00 60.36  ? 20  ASP B CB  1 
ATOM   2003 C CG  . ASP B 1 22  ? 22.089  38.405  41.621  1.00 61.73  ? 20  ASP B CG  1 
ATOM   2004 O OD1 . ASP B 1 22  ? 20.843  38.403  41.771  1.00 62.89  ? 20  ASP B OD1 1 
ATOM   2005 O OD2 . ASP B 1 22  ? 22.750  39.459  41.461  1.00 63.27  ? 20  ASP B OD2 1 
ATOM   2006 N N   . SER B 1 23  ? 19.839  35.303  41.968  1.00 61.89  ? 21  SER B N   1 
ATOM   2007 C CA  . SER B 1 23  ? 18.761  34.469  41.405  1.00 62.92  ? 21  SER B CA  1 
ATOM   2008 C C   . SER B 1 23  ? 18.400  34.812  39.960  1.00 63.36  ? 21  SER B C   1 
ATOM   2009 O O   . SER B 1 23  ? 18.468  33.953  39.070  1.00 63.60  ? 21  SER B O   1 
ATOM   2010 C CB  . SER B 1 23  ? 17.503  34.528  42.287  1.00 63.04  ? 21  SER B CB  1 
ATOM   2011 O OG  . SER B 1 23  ? 17.052  35.864  42.464  1.00 63.74  ? 21  SER B OG  1 
ATOM   2012 N N   . HIS B 1 24  ? 18.009  36.065  39.735  1.00 63.71  ? 22  HIS B N   1 
ATOM   2013 C CA  . HIS B 1 24  ? 17.686  36.532  38.392  1.00 63.92  ? 22  HIS B CA  1 
ATOM   2014 C C   . HIS B 1 24  ? 18.961  36.623  37.538  1.00 63.09  ? 22  HIS B C   1 
ATOM   2015 O O   . HIS B 1 24  ? 18.913  36.390  36.322  1.00 63.43  ? 22  HIS B O   1 
ATOM   2016 C CB  . HIS B 1 24  ? 16.895  37.861  38.442  1.00 64.71  ? 22  HIS B CB  1 
ATOM   2017 C CG  . HIS B 1 24  ? 17.618  39.044  37.861  1.00 67.02  ? 22  HIS B CG  1 
ATOM   2018 N ND1 . HIS B 1 24  ? 18.758  39.579  38.427  1.00 69.18  ? 22  HIS B ND1 1 
ATOM   2019 C CD2 . HIS B 1 24  ? 17.340  39.811  36.777  1.00 68.33  ? 22  HIS B CD2 1 
ATOM   2020 C CE1 . HIS B 1 24  ? 19.158  40.616  37.709  1.00 69.82  ? 22  HIS B CE1 1 
ATOM   2021 N NE2 . HIS B 1 24  ? 18.314  40.779  36.704  1.00 69.17  ? 22  HIS B NE2 1 
ATOM   2022 N N   . SER B 1 25  ? 20.092  36.931  38.182  1.00 61.69  ? 23  SER B N   1 
ATOM   2023 C CA  . SER B 1 25  ? 21.375  37.083  37.473  1.00 60.17  ? 23  SER B CA  1 
ATOM   2024 C C   . SER B 1 25  ? 21.956  35.791  36.876  1.00 58.68  ? 23  SER B C   1 
ATOM   2025 O O   . SER B 1 25  ? 21.652  34.666  37.297  1.00 58.67  ? 23  SER B O   1 
ATOM   2026 C CB  . SER B 1 25  ? 22.430  37.826  38.315  1.00 60.40  ? 23  SER B CB  1 
ATOM   2027 O OG  . SER B 1 25  ? 23.462  38.359  37.491  1.00 60.74  ? 23  SER B OG  1 
ATOM   2028 N N   . TYR B 1 26  ? 22.860  36.015  35.934  1.00 56.52  ? 24  TYR B N   1 
ATOM   2029 C CA  . TYR B 1 26  ? 23.127  35.134  34.824  1.00 54.12  ? 24  TYR B CA  1 
ATOM   2030 C C   . TYR B 1 26  ? 24.339  34.238  35.050  1.00 51.36  ? 24  TYR B C   1 
ATOM   2031 O O   . TYR B 1 26  ? 24.487  33.528  36.056  1.00 50.52  ? 24  TYR B O   1 
ATOM   2032 C CB  . TYR B 1 26  ? 23.476  36.073  33.657  1.00 55.40  ? 24  TYR B CB  1 
ATOM   2033 C CG  . TYR B 1 26  ? 22.749  35.874  32.349  1.00 56.91  ? 24  TYR B CG  1 
ATOM   2034 C CD1 . TYR B 1 26  ? 23.423  35.397  31.217  1.00 58.33  ? 24  TYR B CD1 1 
ATOM   2035 C CD2 . TYR B 1 26  ? 21.399  36.220  32.220  1.00 58.71  ? 24  TYR B CD2 1 
ATOM   2036 C CE1 . TYR B 1 26  ? 22.756  35.230  29.984  1.00 58.94  ? 24  TYR B CE1 1 
ATOM   2037 C CE2 . TYR B 1 26  ? 20.719  36.062  30.995  1.00 59.37  ? 24  TYR B CE2 1 
ATOM   2038 C CZ  . TYR B 1 26  ? 21.403  35.570  29.883  1.00 58.47  ? 24  TYR B CZ  1 
ATOM   2039 O OH  . TYR B 1 26  ? 20.727  35.427  28.685  1.00 57.79  ? 24  TYR B OH  1 
ATOM   2040 N N   . ASP B 1 27  ? 25.203  34.311  34.043  1.00 47.87  ? 25  ASP B N   1 
ATOM   2041 C CA  . ASP B 1 27  ? 26.544  33.790  34.053  1.00 44.20  ? 25  ASP B CA  1 
ATOM   2042 C C   . ASP B 1 27  ? 27.414  34.684  34.914  1.00 40.80  ? 25  ASP B C   1 
ATOM   2043 O O   . ASP B 1 27  ? 28.598  34.394  35.099  1.00 40.86  ? 25  ASP B O   1 
ATOM   2044 C CB  . ASP B 1 27  ? 27.079  33.814  32.621  1.00 44.77  ? 25  ASP B CB  1 
ATOM   2045 C CG  . ASP B 1 27  ? 26.092  33.253  31.624  1.00 46.22  ? 25  ASP B CG  1 
ATOM   2046 O OD1 . ASP B 1 27  ? 25.500  32.185  31.903  1.00 46.45  ? 25  ASP B OD1 1 
ATOM   2047 O OD2 . ASP B 1 27  ? 25.902  33.886  30.562  1.00 49.26  ? 25  ASP B OD2 1 
ATOM   2048 N N   . TRP B 1 28  ? 26.831  35.779  35.412  1.00 36.43  ? 26  TRP B N   1 
ATOM   2049 C CA  . TRP B 1 28  ? 27.577  36.786  36.148  1.00 32.51  ? 26  TRP B CA  1 
ATOM   2050 C C   . TRP B 1 28  ? 27.195  36.807  37.600  1.00 30.39  ? 26  TRP B C   1 
ATOM   2051 O O   . TRP B 1 28  ? 26.225  37.443  38.004  1.00 29.61  ? 26  TRP B O   1 
ATOM   2052 C CB  . TRP B 1 28  ? 27.470  38.173  35.489  1.00 32.08  ? 26  TRP B CB  1 
ATOM   2053 C CG  . TRP B 1 28  ? 28.020  38.128  34.090  1.00 31.10  ? 26  TRP B CG  1 
ATOM   2054 C CD1 . TRP B 1 28  ? 27.309  37.992  32.935  1.00 29.60  ? 26  TRP B CD1 1 
ATOM   2055 C CD2 . TRP B 1 28  ? 29.399  38.121  33.715  1.00 31.42  ? 26  TRP B CD2 1 
ATOM   2056 N NE1 . TRP B 1 28  ? 28.155  37.935  31.864  1.00 29.77  ? 26  TRP B NE1 1 
ATOM   2057 C CE2 . TRP B 1 28  ? 29.447  38.005  32.311  1.00 31.14  ? 26  TRP B CE2 1 
ATOM   2058 C CE3 . TRP B 1 28  ? 30.606  38.237  34.427  1.00 32.45  ? 26  TRP B CE3 1 
ATOM   2059 C CZ2 . TRP B 1 28  ? 30.652  38.014  31.599  1.00 31.09  ? 26  TRP B CZ2 1 
ATOM   2060 C CZ3 . TRP B 1 28  ? 31.801  38.237  33.713  1.00 30.62  ? 26  TRP B CZ3 1 
ATOM   2061 C CH2 . TRP B 1 28  ? 31.813  38.128  32.319  1.00 30.22  ? 26  TRP B CH2 1 
ATOM   2062 N N   . GLN B 1 29  ? 28.004  36.106  38.383  1.00 28.24  ? 27  GLN B N   1 
ATOM   2063 C CA  . GLN B 1 29  ? 27.774  35.941  39.804  1.00 26.31  ? 27  GLN B CA  1 
ATOM   2064 C C   . GLN B 1 29  ? 28.604  36.929  40.616  1.00 24.55  ? 27  GLN B C   1 
ATOM   2065 O O   . GLN B 1 29  ? 29.820  36.992  40.462  1.00 24.16  ? 27  GLN B O   1 
ATOM   2066 C CB  . GLN B 1 29  ? 28.120  34.503  40.217  1.00 26.81  ? 27  GLN B CB  1 
ATOM   2067 C CG  . GLN B 1 29  ? 27.126  33.449  39.718  1.00 28.63  ? 27  GLN B CG  1 
ATOM   2068 C CD  . GLN B 1 29  ? 25.778  33.595  40.371  1.00 31.51  ? 27  GLN B CD  1 
ATOM   2069 O OE1 . GLN B 1 29  ? 25.668  34.056  41.511  1.00 32.38  ? 27  GLN B OE1 1 
ATOM   2070 N NE2 . GLN B 1 29  ? 24.734  33.241  39.640  1.00 35.02  ? 27  GLN B NE2 1 
ATOM   2071 N N   . PRO B 1 30  ? 27.950  37.693  41.498  1.00 23.02  ? 28  PRO B N   1 
ATOM   2072 C CA  . PRO B 1 30  ? 28.665  38.632  42.375  1.00 22.48  ? 28  PRO B CA  1 
ATOM   2073 C C   . PRO B 1 30  ? 29.805  38.002  43.211  1.00 21.89  ? 28  PRO B C   1 
ATOM   2074 O O   . PRO B 1 30  ? 30.763  38.698  43.550  1.00 21.27  ? 28  PRO B O   1 
ATOM   2075 C CB  . PRO B 1 30  ? 27.567  39.170  43.312  1.00 22.13  ? 28  PRO B CB  1 
ATOM   2076 C CG  . PRO B 1 30  ? 26.304  38.944  42.606  1.00 22.63  ? 28  PRO B CG  1 
ATOM   2077 C CD  . PRO B 1 30  ? 26.495  37.713  41.728  1.00 22.66  ? 28  PRO B CD  1 
ATOM   2078 N N   . ALA B 1 31  ? 29.701  36.702  43.511  1.00 20.82  ? 29  ALA B N   1 
ATOM   2079 C CA  . ALA B 1 31  ? 30.647  36.042  44.392  1.00 20.05  ? 29  ALA B CA  1 
ATOM   2080 C C   . ALA B 1 31  ? 31.909  35.651  43.661  1.00 19.65  ? 29  ALA B C   1 
ATOM   2081 O O   . ALA B 1 31  ? 32.921  35.410  44.304  1.00 19.25  ? 29  ALA B O   1 
ATOM   2082 C CB  . ALA B 1 31  ? 30.013  34.800  45.029  1.00 19.40  ? 29  ALA B CB  1 
ATOM   2083 N N   . ALA B 1 32  ? 31.839  35.581  42.327  1.00 19.19  ? 30  ALA B N   1 
ATOM   2084 C CA  . ALA B 1 32  ? 32.928  35.025  41.515  1.00 18.96  ? 30  ALA B CA  1 
ATOM   2085 C C   . ALA B 1 32  ? 34.331  35.635  41.723  1.00 18.79  ? 30  ALA B C   1 
ATOM   2086 O O   . ALA B 1 32  ? 35.288  34.882  41.898  1.00 18.18  ? 30  ALA B O   1 
ATOM   2087 C CB  . ALA B 1 32  ? 32.542  34.993  40.016  1.00 19.23  ? 30  ALA B CB  1 
ATOM   2088 N N   . PRO B 1 33  ? 34.464  36.989  41.683  1.00 18.93  ? 31  PRO B N   1 
ATOM   2089 C CA  . PRO B 1 33  ? 35.766  37.620  41.950  1.00 18.90  ? 31  PRO B CA  1 
ATOM   2090 C C   . PRO B 1 33  ? 36.341  37.201  43.301  1.00 19.13  ? 31  PRO B C   1 
ATOM   2091 O O   . PRO B 1 33  ? 37.555  37.060  43.432  1.00 19.81  ? 31  PRO B O   1 
ATOM   2092 C CB  . PRO B 1 33  ? 35.448  39.132  42.017  1.00 18.63  ? 31  PRO B CB  1 
ATOM   2093 C CG  . PRO B 1 33  ? 34.106  39.321  41.535  1.00 19.15  ? 31  PRO B CG  1 
ATOM   2094 C CD  . PRO B 1 33  ? 33.418  37.987  41.367  1.00 19.47  ? 31  PRO B CD  1 
ATOM   2095 N N   . TRP B 1 34  ? 35.463  37.051  44.295  1.00 19.05  ? 32  TRP B N   1 
ATOM   2096 C CA  . TRP B 1 34  ? 35.841  36.751  45.665  1.00 19.04  ? 32  TRP B CA  1 
ATOM   2097 C C   . TRP B 1 34  ? 36.284  35.300  45.731  1.00 19.57  ? 32  TRP B C   1 
ATOM   2098 O O   . TRP B 1 34  ? 37.382  35.000  46.195  1.00 19.15  ? 32  TRP B O   1 
ATOM   2099 C CB  . TRP B 1 34  ? 34.651  36.922  46.605  1.00 18.17  ? 32  TRP B CB  1 
ATOM   2100 C CG  . TRP B 1 34  ? 34.067  38.281  46.663  1.00 18.61  ? 32  TRP B CG  1 
ATOM   2101 C CD1 . TRP B 1 34  ? 33.174  38.838  45.779  1.00 15.84  ? 32  TRP B CD1 1 
ATOM   2102 C CD2 . TRP B 1 34  ? 34.297  39.272  47.687  1.00 18.04  ? 32  TRP B CD2 1 
ATOM   2103 N NE1 . TRP B 1 34  ? 32.838  40.108  46.194  1.00 17.08  ? 32  TRP B NE1 1 
ATOM   2104 C CE2 . TRP B 1 34  ? 33.501  40.394  47.366  1.00 18.05  ? 32  TRP B CE2 1 
ATOM   2105 C CE3 . TRP B 1 34  ? 35.091  39.310  48.844  1.00 16.64  ? 32  TRP B CE3 1 
ATOM   2106 C CZ2 . TRP B 1 34  ? 33.492  41.550  48.154  1.00 17.91  ? 32  TRP B CZ2 1 
ATOM   2107 C CZ3 . TRP B 1 34  ? 35.079  40.450  49.627  1.00 16.13  ? 32  TRP B CZ3 1 
ATOM   2108 C CH2 . TRP B 1 34  ? 34.292  41.557  49.277  1.00 17.42  ? 32  TRP B CH2 1 
ATOM   2109 N N   . LEU B 1 35  ? 35.428  34.405  45.242  1.00 19.60  ? 33  LEU B N   1 
ATOM   2110 C CA  . LEU B 1 35  ? 35.733  32.973  45.302  1.00 20.31  ? 33  LEU B CA  1 
ATOM   2111 C C   . LEU B 1 35  ? 36.960  32.609  44.457  1.00 20.77  ? 33  LEU B C   1 
ATOM   2112 O O   . LEU B 1 35  ? 37.699  31.689  44.807  1.00 21.37  ? 33  LEU B O   1 
ATOM   2113 C CB  . LEU B 1 35  ? 34.519  32.147  44.919  1.00 20.01  ? 33  LEU B CB  1 
ATOM   2114 C CG  . LEU B 1 35  ? 33.311  32.335  45.847  1.00 19.83  ? 33  LEU B CG  1 
ATOM   2115 C CD1 . LEU B 1 35  ? 32.085  31.684  45.221  1.00 19.28  ? 33  LEU B CD1 1 
ATOM   2116 C CD2 . LEU B 1 35  ? 33.559  31.759  47.227  1.00 21.05  ? 33  LEU B CD2 1 
ATOM   2117 N N   . THR B 1 36  ? 37.196  33.362  43.385  1.00 21.14  ? 34  THR B N   1 
ATOM   2118 C CA  . THR B 1 36  ? 38.417  33.229  42.577  1.00 21.92  ? 34  THR B CA  1 
ATOM   2119 C C   . THR B 1 36  ? 39.722  33.486  43.354  1.00 22.14  ? 34  THR B C   1 
ATOM   2120 O O   . THR B 1 36  ? 40.644  32.683  43.271  1.00 22.62  ? 34  THR B O   1 
ATOM   2121 C CB  . THR B 1 36  ? 38.328  34.050  41.254  1.00 22.11  ? 34  THR B CB  1 
ATOM   2122 O OG1 . THR B 1 36  ? 37.194  33.588  40.490  1.00 23.45  ? 34  THR B OG1 1 
ATOM   2123 C CG2 . THR B 1 36  ? 39.587  33.895  40.396  1.00 21.41  ? 34  THR B CG2 1 
ATOM   2124 N N   . ARG B 1 37  ? 39.794  34.575  44.124  1.00 22.95  ? 35  ARG B N   1 
ATOM   2125 C CA  . ARG B 1 37  ? 40.976  34.837  44.968  1.00 23.03  ? 35  ARG B CA  1 
ATOM   2126 C C   . ARG B 1 37  ? 41.146  33.802  46.093  1.00 23.97  ? 35  ARG B C   1 
ATOM   2127 O O   . ARG B 1 37  ? 42.260  33.422  46.392  1.00 24.41  ? 35  ARG B O   1 
ATOM   2128 C CB  . ARG B 1 37  ? 40.965  36.255  45.544  1.00 22.70  ? 35  ARG B CB  1 
ATOM   2129 C CG  . ARG B 1 37  ? 40.888  37.351  44.495  1.00 22.89  ? 35  ARG B CG  1 
ATOM   2130 C CD  . ARG B 1 37  ? 41.155  38.741  45.098  1.00 22.43  ? 35  ARG B CD  1 
ATOM   2131 N NE  . ARG B 1 37  ? 40.916  39.764  44.089  1.00 21.14  ? 35  ARG B NE  1 
ATOM   2132 C CZ  . ARG B 1 37  ? 40.878  41.064  44.328  1.00 20.39  ? 35  ARG B CZ  1 
ATOM   2133 N NH1 . ARG B 1 37  ? 41.094  41.521  45.551  1.00 19.60  ? 35  ARG B NH1 1 
ATOM   2134 N NH2 . ARG B 1 37  ? 40.621  41.906  43.334  1.00 20.69  ? 35  ARG B NH2 1 
ATOM   2135 N N   . LEU B 1 38  ? 40.056  33.329  46.700  1.00 24.26  ? 36  LEU B N   1 
ATOM   2136 C CA  . LEU B 1 38  ? 40.162  32.239  47.681  1.00 25.49  ? 36  LEU B CA  1 
ATOM   2137 C C   . LEU B 1 38  ? 40.767  30.959  47.077  1.00 25.88  ? 36  LEU B C   1 
ATOM   2138 O O   . LEU B 1 38  ? 41.636  30.305  47.666  1.00 25.71  ? 36  LEU B O   1 
ATOM   2139 C CB  . LEU B 1 38  ? 38.799  31.944  48.335  1.00 25.45  ? 36  LEU B CB  1 
ATOM   2140 C CG  . LEU B 1 38  ? 38.419  32.764  49.582  1.00 27.07  ? 36  LEU B CG  1 
ATOM   2141 C CD1 . LEU B 1 38  ? 38.465  34.304  49.354  1.00 26.71  ? 36  LEU B CD1 1 
ATOM   2142 C CD2 . LEU B 1 38  ? 37.035  32.321  50.031  1.00 25.85  ? 36  LEU B CD2 1 
ATOM   2143 N N   . ARG B 1 39  ? 40.307  30.605  45.892  1.00 26.47  ? 37  ARG B N   1 
ATOM   2144 C CA  . ARG B 1 39  ? 40.859  29.460  45.219  1.00 27.83  ? 37  ARG B CA  1 
ATOM   2145 C C   . ARG B 1 39  ? 42.371  29.603  44.996  1.00 28.22  ? 37  ARG B C   1 
ATOM   2146 O O   . ARG B 1 39  ? 43.123  28.662  45.199  1.00 28.28  ? 37  ARG B O   1 
ATOM   2147 C CB  . ARG B 1 39  ? 40.156  29.243  43.896  1.00 27.61  ? 37  ARG B CB  1 
ATOM   2148 C CG  . ARG B 1 39  ? 40.391  27.866  43.404  1.00 28.53  ? 37  ARG B CG  1 
ATOM   2149 C CD  . ARG B 1 39  ? 39.876  27.674  42.037  1.00 30.79  ? 37  ARG B CD  1 
ATOM   2150 N NE  . ARG B 1 39  ? 40.429  26.438  41.507  1.00 33.46  ? 37  ARG B NE  1 
ATOM   2151 C CZ  . ARG B 1 39  ? 39.979  25.847  40.407  1.00 34.89  ? 37  ARG B CZ  1 
ATOM   2152 N NH1 . ARG B 1 39  ? 38.968  26.404  39.733  1.00 29.56  ? 37  ARG B NH1 1 
ATOM   2153 N NH2 . ARG B 1 39  ? 40.545  24.717  39.978  1.00 35.19  ? 37  ARG B NH2 1 
ATOM   2154 N N   . GLU B 1 40  ? 42.800  30.790  44.583  1.00 29.31  ? 38  GLU B N   1 
ATOM   2155 C CA  . GLU B 1 40  ? 44.207  31.064  44.285  1.00 30.04  ? 38  GLU B CA  1 
ATOM   2156 C C   . GLU B 1 40  ? 45.091  31.063  45.537  1.00 29.06  ? 38  GLU B C   1 
ATOM   2157 O O   . GLU B 1 40  ? 46.281  30.735  45.457  1.00 29.96  ? 38  GLU B O   1 
ATOM   2158 C CB  . GLU B 1 40  ? 44.322  32.389  43.496  1.00 30.47  ? 38  GLU B CB  1 
ATOM   2159 C CG  . GLU B 1 40  ? 43.638  32.304  42.090  1.00 31.59  ? 38  GLU B CG  1 
ATOM   2160 C CD  . GLU B 1 40  ? 43.562  33.645  41.295  1.00 33.22  ? 38  GLU B CD  1 
ATOM   2161 O OE1 . GLU B 1 40  ? 43.808  34.758  41.861  1.00 35.17  ? 38  GLU B OE1 1 
ATOM   2162 O OE2 . GLU B 1 40  ? 43.227  33.560  40.080  1.00 36.30  ? 38  GLU B OE2 1 
ATOM   2163 N N   . ALA B 1 41  ? 44.512  31.428  46.681  1.00 27.46  ? 39  ALA B N   1 
ATOM   2164 C CA  . ALA B 1 41  ? 45.162  31.281  47.979  1.00 26.16  ? 39  ALA B CA  1 
ATOM   2165 C C   . ALA B 1 41  ? 45.061  29.877  48.606  1.00 25.14  ? 39  ALA B C   1 
ATOM   2166 O O   . ALA B 1 41  ? 45.520  29.682  49.729  1.00 25.21  ? 39  ALA B O   1 
ATOM   2167 C CB  . ALA B 1 41  ? 44.601  32.291  48.945  1.00 26.13  ? 39  ALA B CB  1 
ATOM   2168 N N   . ASN B 1 42  ? 44.447  28.922  47.909  1.00 24.41  ? 40  ASN B N   1 
ATOM   2169 C CA  . ASN B 1 42  ? 44.276  27.531  48.409  1.00 24.29  ? 40  ASN B CA  1 
ATOM   2170 C C   . ASN B 1 42  ? 43.342  27.413  49.620  1.00 23.52  ? 40  ASN B C   1 
ATOM   2171 O O   . ASN B 1 42  ? 43.644  26.714  50.605  1.00 23.68  ? 40  ASN B O   1 
ATOM   2172 C CB  . ASN B 1 42  ? 45.648  26.858  48.684  1.00 24.70  ? 40  ASN B CB  1 
ATOM   2173 C CG  . ASN B 1 42  ? 45.560  25.319  48.813  1.00 25.71  ? 40  ASN B CG  1 
ATOM   2174 O OD1 . ASN B 1 42  ? 46.358  24.701  49.538  1.00 26.45  ? 40  ASN B OD1 1 
ATOM   2175 N ND2 . ASN B 1 42  ? 44.606  24.706  48.114  1.00 22.11  ? 40  ASN B ND2 1 
ATOM   2176 N N   . VAL B 1 43  ? 42.210  28.106  49.542  1.00 22.65  ? 41  VAL B N   1 
ATOM   2177 C CA  . VAL B 1 43  ? 41.090  27.895  50.466  1.00 22.35  ? 41  VAL B CA  1 
ATOM   2178 C C   . VAL B 1 43  ? 39.946  27.385  49.580  1.00 22.09  ? 41  VAL B C   1 
ATOM   2179 O O   . VAL B 1 43  ? 39.147  28.195  49.112  1.00 22.90  ? 41  VAL B O   1 
ATOM   2180 C CB  . VAL B 1 43  ? 40.680  29.205  51.211  1.00 22.83  ? 41  VAL B CB  1 
ATOM   2181 C CG1 . VAL B 1 43  ? 39.542  28.956  52.223  1.00 21.78  ? 41  VAL B CG1 1 
ATOM   2182 C CG2 . VAL B 1 43  ? 41.890  29.853  51.873  1.00 22.64  ? 41  VAL B CG2 1 
ATOM   2183 N N   . PRO B 1 44  ? 39.918  26.062  49.279  1.00 21.16  ? 42  PRO B N   1 
ATOM   2184 C CA  . PRO B 1 44  ? 38.925  25.492  48.377  1.00 21.00  ? 42  PRO B CA  1 
ATOM   2185 C C   . PRO B 1 44  ? 37.519  25.610  48.968  1.00 20.34  ? 42  PRO B C   1 
ATOM   2186 O O   . PRO B 1 44  ? 37.334  25.311  50.149  1.00 19.64  ? 42  PRO B O   1 
ATOM   2187 C CB  . PRO B 1 44  ? 39.313  23.998  48.301  1.00 21.24  ? 42  PRO B CB  1 
ATOM   2188 C CG  . PRO B 1 44  ? 40.602  23.853  48.937  1.00 20.38  ? 42  PRO B CG  1 
ATOM   2189 C CD  . PRO B 1 44  ? 40.868  25.049  49.769  1.00 20.95  ? 42  PRO B CD  1 
ATOM   2190 N N   . VAL B 1 45  ? 36.573  26.077  48.153  1.00 19.62  ? 43  VAL B N   1 
ATOM   2191 C CA  . VAL B 1 45  ? 35.168  26.166  48.512  1.00 19.15  ? 43  VAL B CA  1 
ATOM   2192 C C   . VAL B 1 45  ? 34.479  25.040  47.735  1.00 19.50  ? 43  VAL B C   1 
ATOM   2193 O O   . VAL B 1 45  ? 34.484  25.015  46.497  1.00 19.10  ? 43  VAL B O   1 
ATOM   2194 C CB  . VAL B 1 45  ? 34.530  27.556  48.192  1.00 18.55  ? 43  VAL B CB  1 
ATOM   2195 C CG1 . VAL B 1 45  ? 33.041  27.554  48.489  1.00 17.75  ? 43  VAL B CG1 1 
ATOM   2196 C CG2 . VAL B 1 45  ? 35.205  28.676  48.978  1.00 17.85  ? 43  VAL B CG2 1 
ATOM   2197 N N   . ILE B 1 46  ? 33.945  24.087  48.493  1.00 19.35  ? 44  ILE B N   1 
ATOM   2198 C CA  . ILE B 1 46  ? 33.321  22.891  47.957  1.00 18.92  ? 44  ILE B CA  1 
ATOM   2199 C C   . ILE B 1 46  ? 31.809  23.099  48.003  1.00 18.79  ? 44  ILE B C   1 
ATOM   2200 O O   . ILE B 1 46  ? 31.186  23.083  49.076  1.00 18.27  ? 44  ILE B O   1 
ATOM   2201 C CB  . ILE B 1 46  ? 33.789  21.625  48.762  1.00 19.98  ? 44  ILE B CB  1 
ATOM   2202 C CG1 . ILE B 1 46  ? 35.319  21.407  48.572  1.00 20.05  ? 44  ILE B CG1 1 
ATOM   2203 C CG2 . ILE B 1 46  ? 33.029  20.358  48.321  1.00 19.33  ? 44  ILE B CG2 1 
ATOM   2204 C CD1 . ILE B 1 46  ? 36.079  21.177  49.857  1.00 21.94  ? 44  ILE B CD1 1 
ATOM   2205 N N   . LEU B 1 47  ? 31.227  23.341  46.834  1.00 18.61  ? 45  LEU B N   1 
ATOM   2206 C CA  . LEU B 1 47  ? 29.774  23.500  46.721  1.00 19.51  ? 45  LEU B CA  1 
ATOM   2207 C C   . LEU B 1 47  ? 29.092  22.184  47.013  1.00 19.43  ? 45  LEU B C   1 
ATOM   2208 O O   . LEU B 1 47  ? 29.484  21.155  46.467  1.00 18.80  ? 45  LEU B O   1 
ATOM   2209 C CB  . LEU B 1 47  ? 29.379  23.958  45.300  1.00 19.20  ? 45  LEU B CB  1 
ATOM   2210 C CG  . LEU B 1 47  ? 30.127  25.197  44.782  1.00 18.81  ? 45  LEU B CG  1 
ATOM   2211 C CD1 . LEU B 1 47  ? 29.666  25.525  43.367  1.00 18.28  ? 45  LEU B CD1 1 
ATOM   2212 C CD2 . LEU B 1 47  ? 29.961  26.385  45.749  1.00 18.24  ? 45  LEU B CD2 1 
ATOM   2213 N N   . CYS B 1 48  ? 28.075  22.237  47.865  1.00 20.26  ? 46  CYS B N   1 
ATOM   2214 C CA  A CYS B 1 48  ? 27.284  21.072  48.199  0.50 20.83  ? 46  CYS B CA  1 
ATOM   2215 C CA  B CYS B 1 48  ? 27.263  21.062  48.215  0.50 20.51  ? 46  CYS B CA  1 
ATOM   2216 C C   . CYS B 1 48  ? 25.795  21.409  48.034  1.00 21.28  ? 46  CYS B C   1 
ATOM   2217 O O   . CYS B 1 48  ? 25.338  22.454  48.502  1.00 21.78  ? 46  CYS B O   1 
ATOM   2218 C CB  A CYS B 1 48  ? 27.617  20.650  49.624  0.50 20.62  ? 46  CYS B CB  1 
ATOM   2219 C CB  B CYS B 1 48  ? 27.456  20.630  49.669  0.50 20.25  ? 46  CYS B CB  1 
ATOM   2220 S SG  A CYS B 1 48  ? 26.476  19.508  50.356  0.50 21.39  ? 46  CYS B SG  1 
ATOM   2221 S SG  B CYS B 1 48  ? 29.111  20.680  50.339  0.50 19.05  ? 46  CYS B SG  1 
ATOM   2222 N N   . SER B 1 49  ? 25.047  20.522  47.388  1.00 21.31  ? 47  SER B N   1 
ATOM   2223 C CA  . SER B 1 49  ? 23.703  20.841  46.968  1.00 22.26  ? 47  SER B CA  1 
ATOM   2224 C C   . SER B 1 49  ? 22.877  19.611  46.657  1.00 22.86  ? 47  SER B C   1 
ATOM   2225 O O   . SER B 1 49  ? 23.422  18.524  46.427  1.00 22.47  ? 47  SER B O   1 
ATOM   2226 C CB  . SER B 1 49  ? 23.784  21.682  45.684  1.00 22.23  ? 47  SER B CB  1 
ATOM   2227 O OG  . SER B 1 49  ? 22.526  22.219  45.299  1.00 23.44  ? 47  SER B OG  1 
ATOM   2228 N N   . SER B 1 50  ? 21.559  19.822  46.610  1.00 24.29  ? 48  SER B N   1 
ATOM   2229 C CA  . SER B 1 50  ? 20.592  18.862  46.051  1.00 26.28  ? 48  SER B CA  1 
ATOM   2230 C C   . SER B 1 50  ? 20.458  18.926  44.532  1.00 26.78  ? 48  SER B C   1 
ATOM   2231 O O   . SER B 1 50  ? 19.842  18.045  43.940  1.00 27.60  ? 48  SER B O   1 
ATOM   2232 C CB  . SER B 1 50  ? 19.210  19.054  46.674  1.00 26.81  ? 48  SER B CB  1 
ATOM   2233 O OG  . SER B 1 50  ? 18.699  20.338  46.384  1.00 29.45  ? 48  SER B OG  1 
ATOM   2234 N N   . LYS B 1 51  ? 21.044  19.951  43.910  1.00 27.03  ? 49  LYS B N   1 
ATOM   2235 C CA  . LYS B 1 51  ? 20.998  20.151  42.465  1.00 27.17  ? 49  LYS B CA  1 
ATOM   2236 C C   . LYS B 1 51  ? 21.792  19.103  41.724  1.00 27.13  ? 49  LYS B C   1 
ATOM   2237 O O   . LYS B 1 51  ? 22.663  18.447  42.294  1.00 27.22  ? 49  LYS B O   1 
ATOM   2238 C CB  . LYS B 1 51  ? 21.580  21.520  42.089  1.00 27.15  ? 49  LYS B CB  1 
ATOM   2239 C CG  . LYS B 1 51  ? 20.696  22.716  42.392  1.00 28.12  ? 49  LYS B CG  1 
ATOM   2240 C CD  . LYS B 1 51  ? 21.518  24.014  42.249  1.00 29.07  ? 49  LYS B CD  1 
ATOM   2241 C CE  . LYS B 1 51  ? 20.643  25.257  42.183  1.00 31.26  ? 49  LYS B CE  1 
ATOM   2242 N NZ  . LYS B 1 51  ? 20.108  25.637  43.505  1.00 33.88  ? 49  LYS B NZ  1 
ATOM   2243 N N   . THR B 1 52  ? 21.514  18.989  40.430  1.00 27.00  ? 50  THR B N   1 
ATOM   2244 C CA  . THR B 1 52  ? 22.119  17.990  39.578  1.00 27.40  ? 50  THR B CA  1 
ATOM   2245 C C   . THR B 1 52  ? 23.578  18.321  39.347  1.00 27.39  ? 50  THR B C   1 
ATOM   2246 O O   . THR B 1 52  ? 24.001  19.479  39.468  1.00 26.69  ? 50  THR B O   1 
ATOM   2247 C CB  . THR B 1 52  ? 21.395  17.910  38.202  1.00 28.14  ? 50  THR B CB  1 
ATOM   2248 O OG1 . THR B 1 52  ? 21.682  19.083  37.428  1.00 27.90  ? 50  THR B OG1 1 
ATOM   2249 C CG2 . THR B 1 52  ? 19.872  17.773  38.381  1.00 28.34  ? 50  THR B CG2 1 
ATOM   2250 N N   . SER B 1 53  ? 24.346  17.295  39.015  1.00 27.77  ? 51  SER B N   1 
ATOM   2251 C CA  . SER B 1 53  ? 25.739  17.464  38.637  1.00 28.93  ? 51  SER B CA  1 
ATOM   2252 C C   . SER B 1 53  ? 25.948  18.523  37.543  1.00 29.10  ? 51  SER B C   1 
ATOM   2253 O O   . SER B 1 53  ? 26.840  19.365  37.655  1.00 30.69  ? 51  SER B O   1 
ATOM   2254 C CB  . SER B 1 53  ? 26.330  16.113  38.251  1.00 29.06  ? 51  SER B CB  1 
ATOM   2255 O OG  . SER B 1 53  ? 27.304  16.259  37.249  1.00 32.52  ? 51  SER B OG  1 
ATOM   2256 N N   . ALA B 1 54  ? 25.112  18.499  36.512  1.00 28.82  ? 52  ALA B N   1 
ATOM   2257 C CA  . ALA B 1 54  ? 25.264  19.370  35.343  1.00 28.57  ? 52  ALA B CA  1 
ATOM   2258 C C   . ALA B 1 54  ? 25.032  20.858  35.691  1.00 28.14  ? 52  ALA B C   1 
ATOM   2259 O O   . ALA B 1 54  ? 25.772  21.732  35.242  1.00 28.38  ? 52  ALA B O   1 
ATOM   2260 C CB  . ALA B 1 54  ? 24.303  18.915  34.227  1.00 28.00  ? 52  ALA B CB  1 
ATOM   2261 N N   . GLU B 1 55  ? 23.978  21.104  36.465  1.00 27.35  ? 53  GLU B N   1 
ATOM   2262 C CA  A GLU B 1 55  ? 23.643  22.408  36.998  0.50 27.02  ? 53  GLU B CA  1 
ATOM   2263 C CA  B GLU B 1 55  ? 23.660  22.425  36.969  0.50 27.58  ? 53  GLU B CA  1 
ATOM   2264 C C   . GLU B 1 55  ? 24.772  22.916  37.917  1.00 27.88  ? 53  GLU B C   1 
ATOM   2265 O O   . GLU B 1 55  ? 25.267  24.041  37.769  1.00 26.91  ? 53  GLU B O   1 
ATOM   2266 C CB  A GLU B 1 55  ? 22.341  22.264  37.784  0.50 26.94  ? 53  GLU B CB  1 
ATOM   2267 C CB  B GLU B 1 55  ? 22.285  22.391  37.654  0.50 27.63  ? 53  GLU B CB  1 
ATOM   2268 C CG  A GLU B 1 55  ? 21.585  23.537  38.040  0.50 25.88  ? 53  GLU B CG  1 
ATOM   2269 C CG  B GLU B 1 55  ? 21.970  23.554  38.590  0.50 28.41  ? 53  GLU B CG  1 
ATOM   2270 C CD  A GLU B 1 55  ? 20.348  23.326  38.888  0.50 26.17  ? 53  GLU B CD  1 
ATOM   2271 C CD  B GLU B 1 55  ? 21.525  24.830  37.885  0.50 30.29  ? 53  GLU B CD  1 
ATOM   2272 O OE1 A GLU B 1 55  ? 19.958  22.157  39.158  0.50 25.46  ? 53  GLU B OE1 1 
ATOM   2273 O OE1 B GLU B 1 55  ? 21.820  25.018  36.676  0.50 31.48  ? 53  GLU B OE1 1 
ATOM   2274 O OE2 A GLU B 1 55  ? 19.759  24.345  39.293  0.50 24.22  ? 53  GLU B OE2 1 
ATOM   2275 O OE2 B GLU B 1 55  ? 20.877  25.663  38.561  0.50 29.63  ? 53  GLU B OE2 1 
ATOM   2276 N N   . MET B 1 56  ? 25.176  22.069  38.871  1.00 28.05  ? 54  MET B N   1 
ATOM   2277 C CA  . MET B 1 56  ? 26.271  22.384  39.786  1.00 28.61  ? 54  MET B CA  1 
ATOM   2278 C C   . MET B 1 56  ? 27.571  22.748  39.070  1.00 28.55  ? 54  MET B C   1 
ATOM   2279 O O   . MET B 1 56  ? 28.285  23.661  39.503  1.00 27.18  ? 54  MET B O   1 
ATOM   2280 C CB  . MET B 1 56  ? 26.543  21.204  40.711  1.00 29.42  ? 54  MET B CB  1 
ATOM   2281 C CG  . MET B 1 56  ? 25.380  20.802  41.548  1.00 31.23  ? 54  MET B CG  1 
ATOM   2282 S SD  . MET B 1 56  ? 25.521  21.574  43.113  1.00 44.93  ? 54  MET B SD  1 
ATOM   2283 C CE  . MET B 1 56  ? 24.996  23.253  42.787  1.00 33.95  ? 54  MET B CE  1 
ATOM   2284 N N   . LEU B 1 57  ? 27.879  22.020  37.991  1.00 28.64  ? 55  LEU B N   1 
ATOM   2285 C CA  . LEU B 1 57  ? 29.131  22.230  37.250  1.00 28.81  ? 55  LEU B CA  1 
ATOM   2286 C C   . LEU B 1 57  ? 29.120  23.562  36.515  1.00 29.09  ? 55  LEU B C   1 
ATOM   2287 O O   . LEU B 1 57  ? 30.141  24.236  36.416  1.00 29.29  ? 55  LEU B O   1 
ATOM   2288 C CB  . LEU B 1 57  ? 29.413  21.058  36.291  1.00 28.81  ? 55  LEU B CB  1 
ATOM   2289 C CG  . LEU B 1 57  ? 29.896  19.750  36.947  1.00 29.01  ? 55  LEU B CG  1 
ATOM   2290 C CD1 . LEU B 1 57  ? 29.798  18.541  35.988  1.00 30.07  ? 55  LEU B CD1 1 
ATOM   2291 C CD2 . LEU B 1 57  ? 31.333  19.874  37.483  1.00 28.36  ? 55  LEU B CD2 1 
ATOM   2292 N N   . TYR B 1 58  ? 27.959  23.941  35.994  1.00 29.97  ? 56  TYR B N   1 
ATOM   2293 C CA  . TYR B 1 58  ? 27.811  25.243  35.347  1.00 30.47  ? 56  TYR B CA  1 
ATOM   2294 C C   . TYR B 1 58  ? 27.900  26.357  36.392  1.00 29.51  ? 56  TYR B C   1 
ATOM   2295 O O   . TYR B 1 58  ? 28.654  27.298  36.208  1.00 29.44  ? 56  TYR B O   1 
ATOM   2296 C CB  . TYR B 1 58  ? 26.522  25.326  34.503  1.00 31.65  ? 56  TYR B CB  1 
ATOM   2297 C CG  . TYR B 1 58  ? 26.054  26.734  34.226  1.00 32.69  ? 56  TYR B CG  1 
ATOM   2298 C CD1 . TYR B 1 58  ? 26.428  27.415  33.071  1.00 34.80  ? 56  TYR B CD1 1 
ATOM   2299 C CD2 . TYR B 1 58  ? 25.237  27.388  35.136  1.00 34.93  ? 56  TYR B CD2 1 
ATOM   2300 C CE1 . TYR B 1 58  ? 25.986  28.740  32.836  1.00 34.63  ? 56  TYR B CE1 1 
ATOM   2301 C CE2 . TYR B 1 58  ? 24.800  28.679  34.923  1.00 35.28  ? 56  TYR B CE2 1 
ATOM   2302 C CZ  . TYR B 1 58  ? 25.165  29.350  33.775  1.00 35.34  ? 56  TYR B CZ  1 
ATOM   2303 O OH  . TYR B 1 58  ? 24.692  30.643  33.627  1.00 36.10  ? 56  TYR B OH  1 
ATOM   2304 N N   . LEU B 1 59  ? 27.149  26.231  37.488  1.00 28.62  ? 57  LEU B N   1 
ATOM   2305 C CA  . LEU B 1 59  ? 27.268  27.154  38.623  1.00 28.66  ? 57  LEU B CA  1 
ATOM   2306 C C   . LEU B 1 59  ? 28.710  27.270  39.188  1.00 28.08  ? 57  LEU B C   1 
ATOM   2307 O O   . LEU B 1 59  ? 29.193  28.350  39.461  1.00 27.91  ? 57  LEU B O   1 
ATOM   2308 C CB  . LEU B 1 59  ? 26.243  26.812  39.723  1.00 28.95  ? 57  LEU B CB  1 
ATOM   2309 C CG  . LEU B 1 59  ? 24.755  26.971  39.346  1.00 29.98  ? 57  LEU B CG  1 
ATOM   2310 C CD1 . LEU B 1 59  ? 23.785  26.506  40.473  1.00 31.09  ? 57  LEU B CD1 1 
ATOM   2311 C CD2 . LEU B 1 59  ? 24.409  28.416  38.858  1.00 30.67  ? 57  LEU B CD2 1 
ATOM   2312 N N   . GLN B 1 60  ? 29.392  26.150  39.326  1.00 28.24  ? 58  GLN B N   1 
ATOM   2313 C CA  . GLN B 1 60  ? 30.780  26.134  39.763  1.00 28.74  ? 58  GLN B CA  1 
ATOM   2314 C C   . GLN B 1 60  ? 31.664  26.991  38.844  1.00 29.13  ? 58  GLN B C   1 
ATOM   2315 O O   . GLN B 1 60  ? 32.462  27.817  39.303  1.00 28.45  ? 58  GLN B O   1 
ATOM   2316 C CB  . GLN B 1 60  ? 31.299  24.693  39.831  1.00 27.73  ? 58  GLN B CB  1 
ATOM   2317 C CG  . GLN B 1 60  ? 32.611  24.571  40.573  1.00 26.89  ? 58  GLN B CG  1 
ATOM   2318 C CD  . GLN B 1 60  ? 33.178  23.167  40.565  1.00 25.59  ? 58  GLN B CD  1 
ATOM   2319 O OE1 . GLN B 1 60  ? 33.327  22.557  39.511  1.00 26.03  ? 58  GLN B OE1 1 
ATOM   2320 N NE2 . GLN B 1 60  ? 33.509  22.653  41.745  1.00 21.73  ? 58  GLN B NE2 1 
ATOM   2321 N N   . LYS B 1 61  ? 31.493  26.803  37.544  1.00 30.34  ? 59  LYS B N   1 
ATOM   2322 C CA  . LYS B 1 61  ? 32.221  27.580  36.541  1.00 31.14  ? 59  LYS B CA  1 
ATOM   2323 C C   . LYS B 1 61  ? 31.942  29.092  36.647  1.00 31.38  ? 59  LYS B C   1 
ATOM   2324 O O   . LYS B 1 61  ? 32.872  29.887  36.565  1.00 32.31  ? 59  LYS B O   1 
ATOM   2325 C CB  . LYS B 1 61  ? 31.897  27.034  35.151  1.00 31.86  ? 59  LYS B CB  1 
ATOM   2326 C CG  . LYS B 1 61  ? 32.822  27.460  34.036  1.00 34.05  ? 59  LYS B CG  1 
ATOM   2327 C CD  . LYS B 1 61  ? 32.870  26.399  32.914  1.00 39.51  ? 59  LYS B CD  1 
ATOM   2328 C CE  . LYS B 1 61  ? 31.479  26.028  32.376  1.00 41.61  ? 59  LYS B CE  1 
ATOM   2329 N NZ  . LYS B 1 61  ? 31.521  24.798  31.504  1.00 44.17  ? 59  LYS B NZ  1 
ATOM   2330 N N   . THR B 1 62  ? 30.690  29.498  36.876  1.00 30.89  ? 60  THR B N   1 
ATOM   2331 C CA  . THR B 1 62  ? 30.382  30.925  36.961  1.00 30.47  ? 60  THR B CA  1 
ATOM   2332 C C   . THR B 1 62  ? 30.799  31.579  38.286  1.00 30.74  ? 60  THR B C   1 
ATOM   2333 O O   . THR B 1 62  ? 30.787  32.823  38.401  1.00 30.53  ? 60  THR B O   1 
ATOM   2334 C CB  . THR B 1 62  ? 28.881  31.241  36.728  1.00 30.58  ? 60  THR B CB  1 
ATOM   2335 O OG1 . THR B 1 62  ? 28.112  30.814  37.863  1.00 28.76  ? 60  THR B OG1 1 
ATOM   2336 C CG2 . THR B 1 62  ? 28.370  30.584  35.433  1.00 30.60  ? 60  THR B CG2 1 
ATOM   2337 N N   . LEU B 1 63  ? 31.110  30.751  39.285  1.00 30.02  ? 61  LEU B N   1 
ATOM   2338 C CA  . LEU B 1 63  ? 31.582  31.227  40.587  1.00 29.73  ? 61  LEU B CA  1 
ATOM   2339 C C   . LEU B 1 63  ? 33.099  31.206  40.650  1.00 29.41  ? 61  LEU B C   1 
ATOM   2340 O O   . LEU B 1 63  ? 33.689  31.629  41.637  1.00 29.83  ? 61  LEU B O   1 
ATOM   2341 C CB  . LEU B 1 63  ? 30.976  30.410  41.744  1.00 29.17  ? 61  LEU B CB  1 
ATOM   2342 C CG  . LEU B 1 63  ? 29.475  30.592  42.002  1.00 28.85  ? 61  LEU B CG  1 
ATOM   2343 C CD1 . LEU B 1 63  ? 28.913  29.405  42.738  1.00 27.34  ? 61  LEU B CD1 1 
ATOM   2344 C CD2 . LEU B 1 63  ? 29.154  31.898  42.748  1.00 28.34  ? 61  LEU B CD2 1 
ATOM   2345 N N   . GLY B 1 64  ? 33.723  30.711  39.588  1.00 29.47  ? 62  GLY B N   1 
ATOM   2346 C CA  . GLY B 1 64  ? 35.181  30.656  39.495  1.00 28.97  ? 62  GLY B CA  1 
ATOM   2347 C C   . GLY B 1 64  ? 35.809  29.512  40.274  1.00 28.75  ? 62  GLY B C   1 
ATOM   2348 O O   . GLY B 1 64  ? 36.961  29.607  40.679  1.00 29.16  ? 62  GLY B O   1 
ATOM   2349 N N   . LEU B 1 65  ? 35.075  28.408  40.424  1.00 27.81  ? 63  LEU B N   1 
ATOM   2350 C CA  . LEU B 1 65  ? 35.503  27.280  41.249  1.00 26.77  ? 63  LEU B CA  1 
ATOM   2351 C C   . LEU B 1 65  ? 35.705  25.978  40.496  1.00 26.83  ? 63  LEU B C   1 
ATOM   2352 O O   . LEU B 1 65  ? 35.851  24.938  41.132  1.00 26.54  ? 63  LEU B O   1 
ATOM   2353 C CB  . LEU B 1 65  ? 34.498  27.047  42.387  1.00 26.21  ? 63  LEU B CB  1 
ATOM   2354 C CG  . LEU B 1 65  ? 34.275  28.206  43.358  1.00 25.81  ? 63  LEU B CG  1 
ATOM   2355 C CD1 . LEU B 1 65  ? 33.095  27.937  44.269  1.00 24.55  ? 63  LEU B CD1 1 
ATOM   2356 C CD2 . LEU B 1 65  ? 35.542  28.461  44.156  1.00 26.18  ? 63  LEU B CD2 1 
ATOM   2357 N N   . GLN B 1 66  ? 35.740  26.040  39.160  1.00 26.67  ? 64  GLN B N   1 
ATOM   2358 C CA  . GLN B 1 66  ? 35.854  24.865  38.303  1.00 27.18  ? 64  GLN B CA  1 
ATOM   2359 C C   . GLN B 1 66  ? 37.146  24.112  38.559  1.00 26.11  ? 64  GLN B C   1 
ATOM   2360 O O   . GLN B 1 66  ? 38.187  24.708  38.717  1.00 26.41  ? 64  GLN B O   1 
ATOM   2361 C CB  . GLN B 1 66  ? 35.750  25.264  36.810  1.00 27.33  ? 64  GLN B CB  1 
ATOM   2362 C CG  . GLN B 1 66  ? 35.436  24.107  35.841  1.00 28.82  ? 64  GLN B CG  1 
ATOM   2363 C CD  . GLN B 1 66  ? 35.736  24.429  34.369  1.00 30.87  ? 64  GLN B CD  1 
ATOM   2364 O OE1 . GLN B 1 66  ? 36.378  25.434  34.053  1.00 36.74  ? 64  GLN B OE1 1 
ATOM   2365 N NE2 . GLN B 1 66  ? 35.271  23.566  33.464  1.00 34.26  ? 64  GLN B NE2 1 
ATOM   2366 N N   . GLY B 1 67  ? 37.090  22.787  38.598  1.00 25.42  ? 65  GLY B N   1 
ATOM   2367 C CA  . GLY B 1 67  ? 38.272  22.026  38.979  1.00 23.60  ? 65  GLY B CA  1 
ATOM   2368 C C   . GLY B 1 67  ? 38.325  21.617  40.435  1.00 22.38  ? 65  GLY B C   1 
ATOM   2369 O O   . GLY B 1 67  ? 39.152  20.787  40.820  1.00 21.97  ? 65  GLY B O   1 
ATOM   2370 N N   . LEU B 1 68  ? 37.445  22.188  41.250  1.00 21.31  ? 66  LEU B N   1 
ATOM   2371 C CA  . LEU B 1 68  ? 37.357  21.778  42.652  1.00 20.55  ? 66  LEU B CA  1 
ATOM   2372 C C   . LEU B 1 68  ? 36.339  20.645  42.819  1.00 19.88  ? 66  LEU B C   1 
ATOM   2373 O O   . LEU B 1 68  ? 35.484  20.446  41.966  1.00 18.82  ? 66  LEU B O   1 
ATOM   2374 C CB  . LEU B 1 68  ? 37.025  22.970  43.557  1.00 19.90  ? 66  LEU B CB  1 
ATOM   2375 C CG  . LEU B 1 68  ? 38.070  24.113  43.612  1.00 20.42  ? 66  LEU B CG  1 
ATOM   2376 C CD1 . LEU B 1 68  ? 37.539  25.340  44.375  1.00 17.49  ? 66  LEU B CD1 1 
ATOM   2377 C CD2 . LEU B 1 68  ? 39.390  23.653  44.211  1.00 19.27  ? 66  LEU B CD2 1 
ATOM   2378 N N   . PRO B 1 69  ? 36.439  19.884  43.919  1.00 20.07  ? 67  PRO B N   1 
ATOM   2379 C CA  . PRO B 1 69  ? 35.359  18.941  44.167  1.00 20.17  ? 67  PRO B CA  1 
ATOM   2380 C C   . PRO B 1 69  ? 34.018  19.624  44.406  1.00 20.19  ? 67  PRO B C   1 
ATOM   2381 O O   . PRO B 1 69  ? 33.937  20.830  44.729  1.00 20.17  ? 67  PRO B O   1 
ATOM   2382 C CB  . PRO B 1 69  ? 35.825  18.204  45.450  1.00 20.01  ? 67  PRO B CB  1 
ATOM   2383 C CG  . PRO B 1 69  ? 37.299  18.403  45.488  1.00 18.49  ? 67  PRO B CG  1 
ATOM   2384 C CD  . PRO B 1 69  ? 37.485  19.786  44.956  1.00 19.85  ? 67  PRO B CD  1 
ATOM   2385 N N   . LEU B 1 70  ? 32.954  18.857  44.229  1.00 20.20  ? 68  LEU B N   1 
ATOM   2386 C CA  . LEU B 1 70  ? 31.643  19.339  44.643  1.00 20.08  ? 68  LEU B CA  1 
ATOM   2387 C C   . LEU B 1 70  ? 30.753  18.160  44.935  1.00 19.28  ? 68  LEU B C   1 
ATOM   2388 O O   . LEU B 1 70  ? 31.010  17.042  44.468  1.00 19.23  ? 68  LEU B O   1 
ATOM   2389 C CB  . LEU B 1 70  ? 31.018  20.298  43.600  1.00 20.55  ? 68  LEU B CB  1 
ATOM   2390 C CG  . LEU B 1 70  ? 30.591  19.867  42.199  1.00 20.87  ? 68  LEU B CG  1 
ATOM   2391 C CD1 . LEU B 1 70  ? 29.313  19.001  42.218  1.00 20.41  ? 68  LEU B CD1 1 
ATOM   2392 C CD2 . LEU B 1 70  ? 30.425  21.129  41.299  1.00 20.87  ? 68  LEU B CD2 1 
ATOM   2393 N N   . ILE B 1 71  ? 29.708  18.426  45.703  1.00 18.38  ? 69  ILE B N   1 
ATOM   2394 C CA  . ILE B 1 71  ? 28.746  17.417  46.103  1.00 18.18  ? 69  ILE B CA  1 
ATOM   2395 C C   . ILE B 1 71  ? 27.420  17.806  45.463  1.00 18.09  ? 69  ILE B C   1 
ATOM   2396 O O   . ILE B 1 71  ? 26.900  18.878  45.717  1.00 16.95  ? 69  ILE B O   1 
ATOM   2397 C CB  . ILE B 1 71  ? 28.624  17.336  47.646  1.00 17.73  ? 69  ILE B CB  1 
ATOM   2398 C CG1 . ILE B 1 71  ? 30.007  16.997  48.249  1.00 18.93  ? 69  ILE B CG1 1 
ATOM   2399 C CG2 . ILE B 1 71  ? 27.529  16.362  48.058  1.00 16.18  ? 69  ILE B CG2 1 
ATOM   2400 C CD1 . ILE B 1 71  ? 30.090  17.220  49.742  1.00 20.78  ? 69  ILE B CD1 1 
ATOM   2401 N N   . ALA B 1 72  ? 26.896  16.927  44.614  1.00 18.85  ? 70  ALA B N   1 
ATOM   2402 C CA  . ALA B 1 72  ? 25.642  17.196  43.900  1.00 18.81  ? 70  ALA B CA  1 
ATOM   2403 C C   . ALA B 1 72  ? 24.654  16.114  44.256  1.00 19.54  ? 70  ALA B C   1 
ATOM   2404 O O   . ALA B 1 72  ? 25.022  15.102  44.877  1.00 19.48  ? 70  ALA B O   1 
ATOM   2405 C CB  . ALA B 1 72  ? 25.879  17.247  42.398  1.00 18.77  ? 70  ALA B CB  1 
ATOM   2406 N N   . GLU B 1 73  ? 23.391  16.356  43.920  1.00 20.08  ? 71  GLU B N   1 
ATOM   2407 C CA  . GLU B 1 73  ? 22.304  15.395  44.139  1.00 20.94  ? 71  GLU B CA  1 
ATOM   2408 C C   . GLU B 1 73  ? 22.303  14.796  45.540  1.00 20.70  ? 71  GLU B C   1 
ATOM   2409 O O   . GLU B 1 73  ? 22.126  13.578  45.710  1.00 20.67  ? 71  GLU B O   1 
ATOM   2410 C CB  . GLU B 1 73  ? 22.323  14.301  43.060  1.00 21.03  ? 71  GLU B CB  1 
ATOM   2411 C CG  . GLU B 1 73  ? 22.189  14.906  41.666  1.00 22.79  ? 71  GLU B CG  1 
ATOM   2412 C CD  . GLU B 1 73  ? 22.015  13.887  40.568  1.00 25.64  ? 71  GLU B CD  1 
ATOM   2413 O OE1 . GLU B 1 73  ? 21.482  12.790  40.837  1.00 24.64  ? 71  GLU B OE1 1 
ATOM   2414 O OE2 . GLU B 1 73  ? 22.420  14.198  39.426  1.00 26.81  ? 71  GLU B OE2 1 
ATOM   2415 N N   . ASN B 1 74  ? 22.510  15.664  46.533  1.00 20.40  ? 72  ASN B N   1 
ATOM   2416 C CA  . ASN B 1 74  ? 22.421  15.283  47.937  1.00 20.59  ? 72  ASN B CA  1 
ATOM   2417 C C   . ASN B 1 74  ? 23.464  14.255  48.332  1.00 20.52  ? 72  ASN B C   1 
ATOM   2418 O O   . ASN B 1 74  ? 23.231  13.443  49.219  1.00 20.63  ? 72  ASN B O   1 
ATOM   2419 C CB  . ASN B 1 74  ? 21.029  14.730  48.238  1.00 21.04  ? 72  ASN B CB  1 
ATOM   2420 C CG  . ASN B 1 74  ? 20.018  15.810  48.568  1.00 23.00  ? 72  ASN B CG  1 
ATOM   2421 O OD1 . ASN B 1 74  ? 18.994  15.957  47.894  1.00 25.31  ? 72  ASN B OD1 1 
ATOM   2422 N ND2 . ASN B 1 74  ? 20.287  16.549  49.618  1.00 25.23  ? 72  ASN B ND2 1 
ATOM   2423 N N   . GLY B 1 75  ? 24.604  14.262  47.653  1.00 20.90  ? 73  GLY B N   1 
ATOM   2424 C CA  . GLY B 1 75  ? 25.660  13.289  47.942  1.00 21.57  ? 73  GLY B CA  1 
ATOM   2425 C C   . GLY B 1 75  ? 25.640  12.053  47.063  1.00 22.05  ? 73  GLY B C   1 
ATOM   2426 O O   . GLY B 1 75  ? 26.522  11.205  47.183  1.00 22.79  ? 73  GLY B O   1 
ATOM   2427 N N   . ALA B 1 76  ? 24.655  11.948  46.171  1.00 22.31  ? 74  ALA B N   1 
ATOM   2428 C CA  . ALA B 1 76  ? 24.579  10.835  45.221  1.00 22.27  ? 74  ALA B CA  1 
ATOM   2429 C C   . ALA B 1 76  ? 25.601  10.957  44.121  1.00 22.95  ? 74  ALA B C   1 
ATOM   2430 O O   . ALA B 1 76  ? 25.918  9.957   43.464  1.00 23.47  ? 74  ALA B O   1 
ATOM   2431 C CB  . ALA B 1 76  ? 23.201  10.750  44.602  1.00 22.63  ? 74  ALA B CB  1 
ATOM   2432 N N   . VAL B 1 77  ? 26.082  12.184  43.888  1.00 23.15  ? 75  VAL B N   1 
ATOM   2433 C CA  . VAL B 1 77  ? 27.112  12.447  42.882  1.00 22.98  ? 75  VAL B CA  1 
ATOM   2434 C C   . VAL B 1 77  ? 28.210  13.268  43.548  1.00 23.06  ? 75  VAL B C   1 
ATOM   2435 O O   . VAL B 1 77  ? 27.917  14.269  44.222  1.00 22.74  ? 75  VAL B O   1 
ATOM   2436 C CB  . VAL B 1 77  ? 26.575  13.214  41.664  1.00 23.40  ? 75  VAL B CB  1 
ATOM   2437 C CG1 . VAL B 1 77  ? 27.706  13.534  40.697  1.00 23.36  ? 75  VAL B CG1 1 
ATOM   2438 C CG2 . VAL B 1 77  ? 25.484  12.423  40.964  1.00 22.32  ? 75  VAL B CG2 1 
ATOM   2439 N N   . ILE B 1 78  ? 29.454  12.803  43.402  1.00 21.94  ? 76  ILE B N   1 
ATOM   2440 C CA  . ILE B 1 78  ? 30.622  13.515  43.905  1.00 22.13  ? 76  ILE B CA  1 
ATOM   2441 C C   . ILE B 1 78  ? 31.569  13.810  42.748  1.00 22.10  ? 76  ILE B C   1 
ATOM   2442 O O   . ILE B 1 78  ? 32.116  12.898  42.136  1.00 21.67  ? 76  ILE B O   1 
ATOM   2443 C CB  . ILE B 1 78  ? 31.379  12.713  44.988  1.00 22.14  ? 76  ILE B CB  1 
ATOM   2444 C CG1 . ILE B 1 78  ? 30.486  12.414  46.188  1.00 21.07  ? 76  ILE B CG1 1 
ATOM   2445 C CG2 . ILE B 1 78  ? 32.648  13.441  45.444  1.00 21.28  ? 76  ILE B CG2 1 
ATOM   2446 C CD1 . ILE B 1 78  ? 31.122  11.330  47.087  1.00 23.33  ? 76  ILE B CD1 1 
ATOM   2447 N N   . GLN B 1 79  ? 31.726  15.091  42.442  1.00 22.37  ? 77  GLN B N   1 
ATOM   2448 C CA  . GLN B 1 79  ? 32.740  15.554  41.494  1.00 22.73  ? 77  GLN B CA  1 
ATOM   2449 C C   . GLN B 1 79  ? 34.093  15.602  42.189  1.00 22.67  ? 77  GLN B C   1 
ATOM   2450 O O   . GLN B 1 79  ? 34.222  16.211  43.246  1.00 22.82  ? 77  GLN B O   1 
ATOM   2451 C CB  . GLN B 1 79  ? 32.371  16.941  40.996  1.00 22.53  ? 77  GLN B CB  1 
ATOM   2452 C CG  . GLN B 1 79  ? 33.216  17.448  39.829  1.00 26.17  ? 77  GLN B CG  1 
ATOM   2453 C CD  . GLN B 1 79  ? 32.980  16.680  38.535  1.00 31.00  ? 77  GLN B CD  1 
ATOM   2454 O OE1 . GLN B 1 79  ? 31.832  16.360  38.182  1.00 32.02  ? 77  GLN B OE1 1 
ATOM   2455 N NE2 . GLN B 1 79  ? 34.071  16.379  37.815  1.00 31.85  ? 77  GLN B NE2 1 
ATOM   2456 N N   . LEU B 1 80  ? 35.087  14.935  41.603  1.00 23.06  ? 78  LEU B N   1 
ATOM   2457 C CA  . LEU B 1 80  ? 36.467  14.946  42.117  1.00 23.34  ? 78  LEU B CA  1 
ATOM   2458 C C   . LEU B 1 80  ? 37.246  16.166  41.664  1.00 23.78  ? 78  LEU B C   1 
ATOM   2459 O O   . LEU B 1 80  ? 36.988  16.707  40.597  1.00 23.55  ? 78  LEU B O   1 
ATOM   2460 C CB  . LEU B 1 80  ? 37.225  13.675  41.721  1.00 22.75  ? 78  LEU B CB  1 
ATOM   2461 C CG  . LEU B 1 80  ? 36.949  12.443  42.607  1.00 22.00  ? 78  LEU B CG  1 
ATOM   2462 C CD1 . LEU B 1 80  ? 35.563  11.819  42.315  1.00 18.85  ? 78  LEU B CD1 1 
ATOM   2463 C CD2 . LEU B 1 80  ? 38.064  11.429  42.417  1.00 20.59  ? 78  LEU B CD2 1 
ATOM   2464 N N   . ALA B 1 81  ? 38.185  16.621  42.491  1.00 24.74  ? 79  ALA B N   1 
ATOM   2465 C CA  . ALA B 1 81  ? 39.123  17.659  42.048  1.00 26.26  ? 79  ALA B CA  1 
ATOM   2466 C C   . ALA B 1 81  ? 39.756  17.265  40.709  1.00 27.16  ? 79  ALA B C   1 
ATOM   2467 O O   . ALA B 1 81  ? 40.063  16.097  40.485  1.00 26.67  ? 79  ALA B O   1 
ATOM   2468 C CB  . ALA B 1 81  ? 40.200  17.907  43.102  1.00 25.06  ? 79  ALA B CB  1 
ATOM   2469 N N   . GLU B 1 82  ? 39.905  18.246  39.821  1.00 29.67  ? 80  GLU B N   1 
ATOM   2470 C CA  . GLU B 1 82  ? 40.667  18.110  38.568  1.00 32.26  ? 80  GLU B CA  1 
ATOM   2471 C C   . GLU B 1 82  ? 42.028  17.415  38.703  1.00 31.88  ? 80  GLU B C   1 
ATOM   2472 O O   . GLU B 1 82  ? 42.429  16.666  37.814  1.00 32.38  ? 80  GLU B O   1 
ATOM   2473 C CB  . GLU B 1 82  ? 40.868  19.482  37.915  1.00 32.32  ? 80  GLU B CB  1 
ATOM   2474 C CG  . GLU B 1 82  ? 39.954  19.713  36.684  1.00 36.30  ? 80  GLU B CG  1 
ATOM   2475 C CD  . GLU B 1 82  ? 39.922  21.174  36.180  1.00 36.20  ? 80  GLU B CD  1 
ATOM   2476 O OE1 . GLU B 1 82  ? 38.813  21.650  35.781  1.00 40.43  ? 80  GLU B OE1 1 
ATOM   2477 O OE2 . GLU B 1 82  ? 40.990  21.841  36.184  1.00 40.33  ? 80  GLU B OE2 1 
ATOM   2478 N N   . GLN B 1 83  ? 42.727  17.658  39.807  1.00 32.11  ? 81  GLN B N   1 
ATOM   2479 C CA  A GLN B 1 83  ? 44.069  17.129  40.066  0.50 32.15  ? 81  GLN B CA  1 
ATOM   2480 C CA  B GLN B 1 83  ? 44.060  17.077  39.950  0.50 31.97  ? 81  GLN B CA  1 
ATOM   2481 C C   . GLN B 1 83  ? 44.051  15.740  40.717  1.00 31.87  ? 81  GLN B C   1 
ATOM   2482 O O   . GLN B 1 83  ? 45.107  15.225  41.135  1.00 31.93  ? 81  GLN B O   1 
ATOM   2483 C CB  A GLN B 1 83  ? 44.854  18.122  40.950  0.50 32.35  ? 81  GLN B CB  1 
ATOM   2484 C CB  B GLN B 1 83  ? 45.074  18.111  40.487  0.50 32.42  ? 81  GLN B CB  1 
ATOM   2485 C CG  A GLN B 1 83  ? 46.367  17.847  41.041  0.50 33.18  ? 81  GLN B CG  1 
ATOM   2486 C CG  B GLN B 1 83  ? 45.289  19.322  39.528  0.50 33.10  ? 81  GLN B CG  1 
ATOM   2487 C CD  A GLN B 1 83  ? 47.184  19.011  41.596  0.50 33.01  ? 81  GLN B CD  1 
ATOM   2488 C CD  B GLN B 1 83  ? 46.754  19.800  39.412  0.50 35.19  ? 81  GLN B CD  1 
ATOM   2489 O OE1 A GLN B 1 83  ? 46.656  20.092  41.883  0.50 34.44  ? 81  GLN B OE1 1 
ATOM   2490 O OE1 B GLN B 1 83  ? 47.035  21.009  39.468  0.50 33.96  ? 81  GLN B OE1 1 
ATOM   2491 N NE2 A GLN B 1 83  ? 48.488  18.793  41.740  0.50 33.06  ? 81  GLN B NE2 1 
ATOM   2492 N NE2 B GLN B 1 83  ? 47.684  18.855  39.230  0.50 34.57  ? 81  GLN B NE2 1 
ATOM   2493 N N   . TRP B 1 84  ? 42.861  15.137  40.837  1.00 30.58  ? 82  TRP B N   1 
ATOM   2494 C CA  . TRP B 1 84  ? 42.735  13.813  41.459  1.00 30.03  ? 82  TRP B CA  1 
ATOM   2495 C C   . TRP B 1 84  ? 42.693  12.594  40.487  1.00 31.05  ? 82  TRP B C   1 
ATOM   2496 O O   . TRP B 1 84  ? 42.180  11.541  40.848  1.00 30.37  ? 82  TRP B O   1 
ATOM   2497 C CB  . TRP B 1 84  ? 41.550  13.758  42.450  1.00 28.22  ? 82  TRP B CB  1 
ATOM   2498 C CG  . TRP B 1 84  ? 41.659  14.654  43.703  1.00 27.05  ? 82  TRP B CG  1 
ATOM   2499 C CD1 . TRP B 1 84  ? 42.713  15.457  44.072  1.00 25.58  ? 82  TRP B CD1 1 
ATOM   2500 C CD2 . TRP B 1 84  ? 40.668  14.801  44.735  1.00 24.61  ? 82  TRP B CD2 1 
ATOM   2501 N NE1 . TRP B 1 84  ? 42.424  16.103  45.257  1.00 25.73  ? 82  TRP B NE1 1 
ATOM   2502 C CE2 . TRP B 1 84  ? 41.186  15.707  45.691  1.00 24.75  ? 82  TRP B CE2 1 
ATOM   2503 C CE3 . TRP B 1 84  ? 39.393  14.264  44.934  1.00 21.42  ? 82  TRP B CE3 1 
ATOM   2504 C CZ2 . TRP B 1 84  ? 40.475  16.079  46.833  1.00 24.61  ? 82  TRP B CZ2 1 
ATOM   2505 C CZ3 . TRP B 1 84  ? 38.680  14.640  46.057  1.00 24.92  ? 82  TRP B CZ3 1 
ATOM   2506 C CH2 . TRP B 1 84  ? 39.223  15.546  46.993  1.00 25.70  ? 82  TRP B CH2 1 
ATOM   2507 N N   . GLN B 1 85  ? 43.277  12.724  39.293  1.00 32.89  ? 83  GLN B N   1 
ATOM   2508 C CA  . GLN B 1 85  ? 43.327  11.630  38.297  1.00 35.20  ? 83  GLN B CA  1 
ATOM   2509 C C   . GLN B 1 85  ? 43.615  10.214  38.854  1.00 35.98  ? 83  GLN B C   1 
ATOM   2510 O O   . GLN B 1 85  ? 43.077  9.230   38.356  1.00 36.43  ? 83  GLN B O   1 
ATOM   2511 C CB  . GLN B 1 85  ? 44.313  11.961  37.168  1.00 35.71  ? 83  GLN B CB  1 
ATOM   2512 C CG  . GLN B 1 85  ? 44.006  13.258  36.382  1.00 38.21  ? 83  GLN B CG  1 
ATOM   2513 C CD  . GLN B 1 85  ? 44.730  14.504  36.942  1.00 41.99  ? 83  GLN B CD  1 
ATOM   2514 O OE1 . GLN B 1 85  ? 45.186  14.509  38.088  1.00 42.51  ? 83  GLN B OE1 1 
ATOM   2515 N NE2 . GLN B 1 85  ? 44.834  15.566  36.121  1.00 42.18  ? 83  GLN B NE2 1 
ATOM   2516 N N   . GLU B 1 86  ? 44.430  10.124  39.900  1.00 36.88  ? 84  GLU B N   1 
ATOM   2517 C CA  . GLU B 1 86  ? 44.854  8.845   40.458  1.00 37.50  ? 84  GLU B CA  1 
ATOM   2518 C C   . GLU B 1 86  ? 43.876  8.273   41.511  1.00 37.64  ? 84  GLU B C   1 
ATOM   2519 O O   . GLU B 1 86  ? 44.041  7.143   42.002  1.00 38.11  ? 84  GLU B O   1 
ATOM   2520 C CB  . GLU B 1 86  ? 46.290  8.981   41.016  1.00 37.77  ? 84  GLU B CB  1 
ATOM   2521 C CG  . GLU B 1 86  ? 46.446  8.963   42.551  1.00 39.66  ? 84  GLU B CG  1 
ATOM   2522 C CD  . GLU B 1 86  ? 46.581  10.339  43.227  1.00 42.48  ? 84  GLU B CD  1 
ATOM   2523 O OE1 . GLU B 1 86  ? 46.157  11.383  42.655  1.00 43.63  ? 84  GLU B OE1 1 
ATOM   2524 O OE2 . GLU B 1 86  ? 47.110  10.348  44.364  1.00 41.77  ? 84  GLU B OE2 1 
ATOM   2525 N N   . ILE B 1 87  ? 42.858  9.047   41.866  1.00 37.35  ? 85  ILE B N   1 
ATOM   2526 C CA  . ILE B 1 87  ? 41.890  8.587   42.859  1.00 36.50  ? 85  ILE B CA  1 
ATOM   2527 C C   . ILE B 1 87  ? 40.857  7.695   42.172  1.00 36.28  ? 85  ILE B C   1 
ATOM   2528 O O   . ILE B 1 87  ? 40.283  8.067   41.135  1.00 36.12  ? 85  ILE B O   1 
ATOM   2529 C CB  . ILE B 1 87  ? 41.215  9.772   43.603  1.00 36.27  ? 85  ILE B CB  1 
ATOM   2530 C CG1 . ILE B 1 87  ? 42.270  10.664  44.286  1.00 36.01  ? 85  ILE B CG1 1 
ATOM   2531 C CG2 . ILE B 1 87  ? 40.154  9.281   44.590  1.00 35.66  ? 85  ILE B CG2 1 
ATOM   2532 C CD1 . ILE B 1 87  ? 42.960  10.048  45.516  1.00 35.77  ? 85  ILE B CD1 1 
ATOM   2533 N N   . ASP B 1 88  ? 40.659  6.510   42.746  1.00 35.85  ? 86  ASP B N   1 
ATOM   2534 C CA  A ASP B 1 88  ? 39.653  5.576   42.261  0.50 35.71  ? 86  ASP B CA  1 
ATOM   2535 C CA  B ASP B 1 88  ? 39.652  5.576   42.273  0.50 35.83  ? 86  ASP B CA  1 
ATOM   2536 C C   . ASP B 1 88  ? 38.287  6.258   42.279  1.00 35.39  ? 86  ASP B C   1 
ATOM   2537 O O   . ASP B 1 88  ? 37.846  6.752   43.316  1.00 35.40  ? 86  ASP B O   1 
ATOM   2538 C CB  A ASP B 1 88  ? 39.630  4.308   43.120  0.50 35.91  ? 86  ASP B CB  1 
ATOM   2539 C CB  B ASP B 1 88  ? 39.625  4.336   43.166  0.50 36.15  ? 86  ASP B CB  1 
ATOM   2540 C CG  A ASP B 1 88  ? 38.639  3.263   42.610  0.50 36.20  ? 86  ASP B CG  1 
ATOM   2541 C CG  B ASP B 1 88  ? 40.782  3.392   42.893  0.50 36.91  ? 86  ASP B CG  1 
ATOM   2542 O OD1 A ASP B 1 88  ? 38.660  2.950   41.400  0.50 35.59  ? 86  ASP B OD1 1 
ATOM   2543 O OD1 B ASP B 1 88  ? 40.806  2.784   41.800  0.50 38.48  ? 86  ASP B OD1 1 
ATOM   2544 O OD2 A ASP B 1 88  ? 37.843  2.748   43.431  0.50 37.28  ? 86  ASP B OD2 1 
ATOM   2545 O OD2 B ASP B 1 88  ? 41.656  3.244   43.775  0.50 37.43  ? 86  ASP B OD2 1 
ATOM   2546 N N   . GLY B 1 89  ? 37.638  6.290   41.117  1.00 34.45  ? 87  GLY B N   1 
ATOM   2547 C CA  . GLY B 1 89  ? 36.342  6.930   40.977  1.00 32.98  ? 87  GLY B CA  1 
ATOM   2548 C C   . GLY B 1 89  ? 36.370  8.153   40.089  1.00 32.08  ? 87  GLY B C   1 
ATOM   2549 O O   . GLY B 1 89  ? 35.328  8.537   39.541  1.00 31.03  ? 87  GLY B O   1 
ATOM   2550 N N   . PHE B 1 90  ? 37.562  8.755   39.946  1.00 31.65  ? 88  PHE B N   1 
ATOM   2551 C CA  . PHE B 1 90  ? 37.776  9.938   39.077  1.00 31.66  ? 88  PHE B CA  1 
ATOM   2552 C C   . PHE B 1 90  ? 37.116  9.759   37.700  1.00 31.78  ? 88  PHE B C   1 
ATOM   2553 O O   . PHE B 1 90  ? 37.137  8.662   37.165  1.00 31.78  ? 88  PHE B O   1 
ATOM   2554 C CB  . PHE B 1 90  ? 39.279  10.216  38.908  1.00 31.15  ? 88  PHE B CB  1 
ATOM   2555 C CG  . PHE B 1 90  ? 39.575  11.436  38.087  1.00 30.63  ? 88  PHE B CG  1 
ATOM   2556 C CD1 . PHE B 1 90  ? 39.742  11.341  36.705  1.00 29.34  ? 88  PHE B CD1 1 
ATOM   2557 C CD2 . PHE B 1 90  ? 39.664  12.687  38.692  1.00 28.31  ? 88  PHE B CD2 1 
ATOM   2558 C CE1 . PHE B 1 90  ? 39.978  12.468  35.952  1.00 29.28  ? 88  PHE B CE1 1 
ATOM   2559 C CE2 . PHE B 1 90  ? 39.906  13.809  37.957  1.00 27.87  ? 88  PHE B CE2 1 
ATOM   2560 C CZ  . PHE B 1 90  ? 40.063  13.714  36.580  1.00 29.65  ? 88  PHE B CZ  1 
ATOM   2561 N N   . PRO B 1 91  ? 36.537  10.829  37.113  1.00 32.18  ? 89  PRO B N   1 
ATOM   2562 C CA  . PRO B 1 91  ? 36.311  12.180  37.607  1.00 32.43  ? 89  PRO B CA  1 
ATOM   2563 C C   . PRO B 1 91  ? 35.132  12.339  38.585  1.00 32.71  ? 89  PRO B C   1 
ATOM   2564 O O   . PRO B 1 91  ? 35.007  13.381  39.226  1.00 32.05  ? 89  PRO B O   1 
ATOM   2565 C CB  . PRO B 1 91  ? 36.044  12.974  36.323  1.00 32.47  ? 89  PRO B CB  1 
ATOM   2566 C CG  . PRO B 1 91  ? 35.370  12.004  35.425  1.00 32.46  ? 89  PRO B CG  1 
ATOM   2567 C CD  . PRO B 1 91  ? 36.080  10.688  35.714  1.00 32.55  ? 89  PRO B CD  1 
ATOM   2568 N N   . ARG B 1 92  ? 34.303  11.309  38.718  1.00 33.43  ? 90  ARG B N   1 
ATOM   2569 C CA  . ARG B 1 92  ? 33.003  11.479  39.353  1.00 34.13  ? 90  ARG B CA  1 
ATOM   2570 C C   . ARG B 1 92  ? 32.478  10.201  39.998  1.00 33.70  ? 90  ARG B C   1 
ATOM   2571 O O   . ARG B 1 92  ? 32.474  9.155   39.373  1.00 33.78  ? 90  ARG B O   1 
ATOM   2572 C CB  . ARG B 1 92  ? 32.025  11.974  38.306  1.00 34.63  ? 90  ARG B CB  1 
ATOM   2573 C CG  . ARG B 1 92  ? 30.807  12.660  38.857  1.00 38.89  ? 90  ARG B CG  1 
ATOM   2574 C CD  . ARG B 1 92  ? 30.254  13.645  37.827  1.00 44.02  ? 90  ARG B CD  1 
ATOM   2575 N NE  . ARG B 1 92  ? 29.677  12.954  36.678  1.00 46.90  ? 90  ARG B NE  1 
ATOM   2576 C CZ  . ARG B 1 92  ? 29.334  13.549  35.540  1.00 49.14  ? 90  ARG B CZ  1 
ATOM   2577 N NH1 . ARG B 1 92  ? 29.525  14.854  35.373  1.00 50.79  ? 90  ARG B NH1 1 
ATOM   2578 N NH2 . ARG B 1 92  ? 28.808  12.832  34.558  1.00 49.22  ? 90  ARG B NH2 1 
ATOM   2579 N N   . ILE B 1 93  ? 32.025  10.293  41.242  1.00 33.39  ? 91  ILE B N   1 
ATOM   2580 C CA  . ILE B 1 93  ? 31.458  9.134   41.914  1.00 33.69  ? 91  ILE B CA  1 
ATOM   2581 C C   . ILE B 1 93  ? 29.950  9.241   42.043  1.00 33.77  ? 91  ILE B C   1 
ATOM   2582 O O   . ILE B 1 93  ? 29.427  10.086  42.768  1.00 34.24  ? 91  ILE B O   1 
ATOM   2583 C CB  . ILE B 1 93  ? 32.110  8.845   43.287  1.00 33.82  ? 91  ILE B CB  1 
ATOM   2584 C CG1 . ILE B 1 93  ? 33.622  8.660   43.101  1.00 33.77  ? 91  ILE B CG1 1 
ATOM   2585 C CG2 . ILE B 1 93  ? 31.455  7.601   43.940  1.00 32.45  ? 91  ILE B CG2 1 
ATOM   2586 C CD1 . ILE B 1 93  ? 34.393  8.542   44.393  1.00 34.23  ? 91  ILE B CD1 1 
ATOM   2587 N N   . ILE B 1 94  ? 29.272  8.347   41.338  1.00 33.73  ? 92  ILE B N   1 
ATOM   2588 C CA  . ILE B 1 94  ? 27.824  8.334   41.217  1.00 33.65  ? 92  ILE B CA  1 
ATOM   2589 C C   . ILE B 1 94  ? 27.361  7.089   41.959  1.00 33.60  ? 92  ILE B C   1 
ATOM   2590 O O   . ILE B 1 94  ? 27.984  6.035   41.859  1.00 33.34  ? 92  ILE B O   1 
ATOM   2591 C CB  . ILE B 1 94  ? 27.432  8.288   39.710  1.00 34.21  ? 92  ILE B CB  1 
ATOM   2592 C CG1 . ILE B 1 94  ? 27.864  9.585   39.017  1.00 34.77  ? 92  ILE B CG1 1 
ATOM   2593 C CG2 . ILE B 1 94  ? 25.946  8.066   39.496  1.00 34.19  ? 92  ILE B CG2 1 
ATOM   2594 C CD1 . ILE B 1 94  ? 28.392  9.394   37.612  1.00 37.10  ? 92  ILE B CD1 1 
ATOM   2595 N N   . SER B 1 95  ? 26.299  7.217   42.742  1.00 33.46  ? 93  SER B N   1 
ATOM   2596 C CA  . SER B 1 95  ? 25.680  6.053   43.347  1.00 33.43  ? 93  SER B CA  1 
ATOM   2597 C C   . SER B 1 95  ? 25.355  4.981   42.299  1.00 33.58  ? 93  SER B C   1 
ATOM   2598 O O   . SER B 1 95  ? 24.973  5.303   41.159  1.00 33.40  ? 93  SER B O   1 
ATOM   2599 C CB  . SER B 1 95  ? 24.405  6.436   44.081  1.00 33.45  ? 93  SER B CB  1 
ATOM   2600 O OG  . SER B 1 95  ? 23.674  5.269   44.380  1.00 33.50  ? 93  SER B OG  1 
ATOM   2601 N N   . GLY B 1 96  ? 25.540  3.717   42.699  1.00 32.95  ? 94  GLY B N   1 
ATOM   2602 C CA  . GLY B 1 96  ? 25.142  2.573   41.896  1.00 32.30  ? 94  GLY B CA  1 
ATOM   2603 C C   . GLY B 1 96  ? 23.650  2.526   41.563  1.00 31.38  ? 94  GLY B C   1 
ATOM   2604 O O   . GLY B 1 96  ? 23.262  1.845   40.613  1.00 31.53  ? 94  GLY B O   1 
ATOM   2605 N N   . ILE B 1 97  ? 22.796  3.216   42.331  1.00 30.51  ? 95  ILE B N   1 
ATOM   2606 C CA  A ILE B 1 97  ? 21.379  3.382   41.955  0.50 29.55  ? 95  ILE B CA  1 
ATOM   2607 C CA  B ILE B 1 97  ? 21.417  3.334   41.872  0.50 29.90  ? 95  ILE B CA  1 
ATOM   2608 C C   . ILE B 1 97  ? 21.201  4.653   41.120  1.00 29.13  ? 95  ILE B C   1 
ATOM   2609 O O   . ILE B 1 97  ? 21.183  5.754   41.670  1.00 29.20  ? 95  ILE B O   1 
ATOM   2610 C CB  A ILE B 1 97  ? 20.421  3.443   43.176  0.50 29.38  ? 95  ILE B CB  1 
ATOM   2611 C CB  B ILE B 1 97  ? 20.314  2.894   42.916  0.50 29.96  ? 95  ILE B CB  1 
ATOM   2612 C CG1 A ILE B 1 97  ? 20.773  2.371   44.218  0.50 29.57  ? 95  ILE B CG1 1 
ATOM   2613 C CG1 B ILE B 1 97  ? 19.219  3.943   43.117  0.50 30.07  ? 95  ILE B CG1 1 
ATOM   2614 C CG2 A ILE B 1 97  ? 18.965  3.308   42.709  0.50 29.17  ? 95  ILE B CG2 1 
ATOM   2615 C CG2 B ILE B 1 97  ? 20.933  2.242   44.201  0.50 30.17  ? 95  ILE B CG2 1 
ATOM   2616 C CD1 A ILE B 1 97  ? 19.880  2.372   45.444  0.50 29.05  ? 95  ILE B CD1 1 
ATOM   2617 C CD1 B ILE B 1 97  ? 19.484  4.905   44.193  0.50 31.07  ? 95  ILE B CD1 1 
ATOM   2618 N N   . SER B 1 98  ? 21.080  4.494   39.814  1.00 28.06  ? 96  SER B N   1 
ATOM   2619 C CA  . SER B 1 98  ? 20.983  5.600   38.884  1.00 27.40  ? 96  SER B CA  1 
ATOM   2620 C C   . SER B 1 98  ? 19.610  6.275   38.894  1.00 26.37  ? 96  SER B C   1 
ATOM   2621 O O   . SER B 1 98  ? 18.643  5.758   39.440  1.00 26.11  ? 96  SER B O   1 
ATOM   2622 C CB  . SER B 1 98  ? 21.269  5.076   37.473  1.00 27.52  ? 96  SER B CB  1 
ATOM   2623 O OG  . SER B 1 98  ? 20.298  4.086   37.110  1.00 29.24  ? 96  SER B OG  1 
ATOM   2624 N N   . HIS B 1 99  ? 19.548  7.429   38.247  1.00 26.13  ? 97  HIS B N   1 
ATOM   2625 C CA  . HIS B 1 99  ? 18.304  8.111   37.933  1.00 25.66  ? 97  HIS B CA  1 
ATOM   2626 C C   . HIS B 1 99  ? 17.284  7.180   37.220  1.00 25.86  ? 97  HIS B C   1 
ATOM   2627 O O   . HIS B 1 99  ? 16.090  7.182   37.564  1.00 26.12  ? 97  HIS B O   1 
ATOM   2628 C CB  . HIS B 1 99  ? 18.633  9.323   37.070  1.00 24.96  ? 97  HIS B CB  1 
ATOM   2629 C CG  . HIS B 1 99  ? 17.454  9.886   36.347  1.00 24.45  ? 97  HIS B CG  1 
ATOM   2630 N ND1 . HIS B 1 99  ? 16.527  10.705  36.958  1.00 23.23  ? 97  HIS B ND1 1 
ATOM   2631 C CD2 . HIS B 1 99  ? 17.048  9.748   35.067  1.00 24.71  ? 97  HIS B CD2 1 
ATOM   2632 C CE1 . HIS B 1 99  ? 15.606  11.054  36.081  1.00 24.47  ? 97  HIS B CE1 1 
ATOM   2633 N NE2 . HIS B 1 99  ? 15.902  10.493  34.924  1.00 26.31  ? 97  HIS B NE2 1 
ATOM   2634 N N   . GLY B 1 100 ? 17.769  6.373   36.266  1.00 25.94  ? 98  GLY B N   1 
ATOM   2635 C CA  . GLY B 1 100 ? 16.947  5.445   35.471  1.00 25.21  ? 98  GLY B CA  1 
ATOM   2636 C C   . GLY B 1 100 ? 16.216  4.396   36.308  1.00 25.52  ? 98  GLY B C   1 
ATOM   2637 O O   . GLY B 1 100 ? 15.006  4.192   36.143  1.00 25.70  ? 98  GLY B O   1 
ATOM   2638 N N   . GLU B 1 101 ? 16.960  3.739   37.198  1.00 24.80  ? 99  GLU B N   1 
ATOM   2639 C CA  A GLU B 1 101 ? 16.370  2.746   38.105  0.50 24.78  ? 99  GLU B CA  1 
ATOM   2640 C CA  B GLU B 1 101 ? 16.438  2.754   38.153  0.50 24.41  ? 99  GLU B CA  1 
ATOM   2641 C C   . GLU B 1 101 ? 15.404  3.343   39.130  1.00 24.09  ? 99  GLU B C   1 
ATOM   2642 O O   . GLU B 1 101 ? 14.389  2.721   39.446  1.00 24.65  ? 99  GLU B O   1 
ATOM   2643 C CB  A GLU B 1 101 ? 17.432  1.876   38.788  0.50 24.26  ? 99  GLU B CB  1 
ATOM   2644 C CB  B GLU B 1 101 ? 17.626  2.184   38.921  0.50 23.78  ? 99  GLU B CB  1 
ATOM   2645 C CG  A GLU B 1 101 ? 18.821  2.467   38.838  0.50 25.23  ? 99  GLU B CG  1 
ATOM   2646 C CG  B GLU B 1 101 ? 17.302  1.323   40.117  0.50 24.07  ? 99  GLU B CG  1 
ATOM   2647 C CD  A GLU B 1 101 ? 19.932  1.414   39.001  0.50 25.59  ? 99  GLU B CD  1 
ATOM   2648 C CD  B GLU B 1 101 ? 18.521  0.575   40.606  0.50 24.36  ? 99  GLU B CD  1 
ATOM   2649 O OE1 A GLU B 1 101 ? 19.633  0.282   39.431  0.50 26.11  ? 99  GLU B OE1 1 
ATOM   2650 O OE1 B GLU B 1 101 ? 19.641  1.124   40.513  0.50 26.01  ? 99  GLU B OE1 1 
ATOM   2651 O OE2 A GLU B 1 101 ? 21.108  1.727   38.711  0.50 26.01  ? 99  GLU B OE2 1 
ATOM   2652 O OE2 B GLU B 1 101 ? 18.370  -0.567  41.073  0.50 24.91  ? 99  GLU B OE2 1 
ATOM   2653 N N   . ILE B 1 102 ? 15.697  4.538   39.627  1.00 23.13  ? 100 ILE B N   1 
ATOM   2654 C CA  . ILE B 1 102 ? 14.773  5.268   40.517  1.00 22.59  ? 100 ILE B CA  1 
ATOM   2655 C C   . ILE B 1 102 ? 13.469  5.647   39.775  1.00 21.74  ? 100 ILE B C   1 
ATOM   2656 O O   . ILE B 1 102 ? 12.370  5.487   40.310  1.00 22.44  ? 100 ILE B O   1 
ATOM   2657 C CB  . ILE B 1 102 ? 15.434  6.544   41.116  1.00 21.99  ? 100 ILE B CB  1 
ATOM   2658 C CG1 . ILE B 1 102 ? 16.626  6.171   41.997  1.00 22.01  ? 100 ILE B CG1 1 
ATOM   2659 C CG2 . ILE B 1 102 ? 14.426  7.325   41.936  1.00 21.43  ? 100 ILE B CG2 1 
ATOM   2660 C CD1 . ILE B 1 102 ? 17.604  7.319   42.244  1.00 21.16  ? 100 ILE B CD1 1 
ATOM   2661 N N   . SER B 1 103 ? 13.596  6.157   38.555  1.00 20.86  ? 101 SER B N   1 
ATOM   2662 C CA  . SER B 1 103 ? 12.434  6.398   37.711  1.00 20.62  ? 101 SER B CA  1 
ATOM   2663 C C   . SER B 1 103 ? 11.563  5.147   37.519  1.00 19.67  ? 101 SER B C   1 
ATOM   2664 O O   . SER B 1 103 ? 10.331  5.229   37.620  1.00 19.21  ? 101 SER B O   1 
ATOM   2665 C CB  . SER B 1 103 ? 12.849  7.017   36.367  1.00 20.99  ? 101 SER B CB  1 
ATOM   2666 O OG  . SER B 1 103 ? 13.397  8.310   36.590  1.00 23.23  ? 101 SER B OG  1 
ATOM   2667 N N   . LEU B 1 104 ? 12.198  4.002   37.264  1.00 18.37  ? 102 LEU B N   1 
ATOM   2668 C CA  . LEU B 1 104 ? 11.479  2.717   37.208  1.00 18.11  ? 102 LEU B CA  1 
ATOM   2669 C C   . LEU B 1 104 ? 10.677  2.413   38.464  1.00 17.12  ? 102 LEU B C   1 
ATOM   2670 O O   . LEU B 1 104 ? 9.504   2.046   38.380  1.00 16.79  ? 102 LEU B O   1 
ATOM   2671 C CB  . LEU B 1 104 ? 12.440  1.545   36.926  1.00 17.68  ? 102 LEU B CB  1 
ATOM   2672 C CG  . LEU B 1 104 ? 12.978  1.373   35.502  1.00 19.38  ? 102 LEU B CG  1 
ATOM   2673 C CD1 . LEU B 1 104 ? 13.893  0.137   35.471  1.00 19.14  ? 102 LEU B CD1 1 
ATOM   2674 C CD2 . LEU B 1 104 ? 11.849  1.248   34.441  1.00 20.05  ? 102 LEU B CD2 1 
ATOM   2675 N N   . VAL B 1 105 ? 11.344  2.511   39.622  1.00 16.71  ? 103 VAL B N   1 
ATOM   2676 C CA  . VAL B 1 105 ? 10.730  2.355   40.934  1.00 16.47  ? 103 VAL B CA  1 
ATOM   2677 C C   . VAL B 1 105 ? 9.551   3.316   41.145  1.00 16.65  ? 103 VAL B C   1 
ATOM   2678 O O   . VAL B 1 105 ? 8.490   2.910   41.613  1.00 16.52  ? 103 VAL B O   1 
ATOM   2679 C CB  . VAL B 1 105 ? 11.772  2.620   42.076  1.00 16.49  ? 103 VAL B CB  1 
ATOM   2680 C CG1 . VAL B 1 105 ? 11.084  2.684   43.421  1.00 16.69  ? 103 VAL B CG1 1 
ATOM   2681 C CG2 . VAL B 1 105 ? 12.819  1.530   42.115  1.00 16.38  ? 103 VAL B CG2 1 
ATOM   2682 N N   . LEU B 1 106 ? 9.748   4.595   40.834  1.00 17.21  ? 104 LEU B N   1 
ATOM   2683 C CA  . LEU B 1 106 ? 8.713   5.606   41.089  1.00 17.98  ? 104 LEU B CA  1 
ATOM   2684 C C   . LEU B 1 106 ? 7.490   5.389   40.222  1.00 19.21  ? 104 LEU B C   1 
ATOM   2685 O O   . LEU B 1 106 ? 6.346   5.528   40.687  1.00 18.86  ? 104 LEU B O   1 
ATOM   2686 C CB  . LEU B 1 106 ? 9.256   7.014   40.844  1.00 17.60  ? 104 LEU B CB  1 
ATOM   2687 C CG  . LEU B 1 106 ? 10.269  7.505   41.881  1.00 19.55  ? 104 LEU B CG  1 
ATOM   2688 C CD1 . LEU B 1 106 ? 10.658  8.929   41.547  1.00 17.70  ? 104 LEU B CD1 1 
ATOM   2689 C CD2 . LEU B 1 106 ? 9.744   7.363   43.341  1.00 16.89  ? 104 LEU B CD2 1 
ATOM   2690 N N   . ASN B 1 107 ? 7.733   5.053   38.952  1.00 19.64  ? 105 ASN B N   1 
ATOM   2691 C CA  . ASN B 1 107 ? 6.629   4.722   38.057  1.00 20.74  ? 105 ASN B CA  1 
ATOM   2692 C C   . ASN B 1 107 ? 5.839   3.507   38.475  1.00 21.12  ? 105 ASN B C   1 
ATOM   2693 O O   . ASN B 1 107 ? 4.634   3.505   38.359  1.00 21.32  ? 105 ASN B O   1 
ATOM   2694 C CB  . ASN B 1 107 ? 7.115   4.617   36.608  1.00 19.92  ? 105 ASN B CB  1 
ATOM   2695 C CG  . ASN B 1 107 ? 7.361   5.982   36.009  1.00 21.28  ? 105 ASN B CG  1 
ATOM   2696 O OD1 . ASN B 1 107 ? 6.453   6.803   35.931  1.00 23.93  ? 105 ASN B OD1 1 
ATOM   2697 N ND2 . ASN B 1 107 ? 8.586   6.246   35.620  1.00 23.85  ? 105 ASN B ND2 1 
ATOM   2698 N N   . THR B 1 108 ? 6.523   2.470   38.946  1.00 22.38  ? 106 THR B N   1 
ATOM   2699 C CA  . THR B 1 108 ? 5.865   1.261   39.425  1.00 23.51  ? 106 THR B CA  1 
ATOM   2700 C C   . THR B 1 108 ? 4.964   1.612   40.597  1.00 23.39  ? 106 THR B C   1 
ATOM   2701 O O   . THR B 1 108 ? 3.808   1.203   40.631  1.00 23.83  ? 106 THR B O   1 
ATOM   2702 C CB  . THR B 1 108 ? 6.900   0.201   39.851  1.00 23.94  ? 106 THR B CB  1 
ATOM   2703 O OG1 . THR B 1 108 ? 7.806   -0.013  38.763  1.00 27.61  ? 106 THR B OG1 1 
ATOM   2704 C CG2 . THR B 1 108 ? 6.249   -1.095  40.186  1.00 24.10  ? 106 THR B CG2 1 
ATOM   2705 N N   . LEU B 1 109 ? 5.484   2.389   41.542  1.00 23.28  ? 107 LEU B N   1 
ATOM   2706 C CA  . LEU B 1 109 ? 4.704   2.811   42.717  1.00 23.20  ? 107 LEU B CA  1 
ATOM   2707 C C   . LEU B 1 109 ? 3.518   3.678   42.323  1.00 23.54  ? 107 LEU B C   1 
ATOM   2708 O O   . LEU B 1 109 ? 2.415   3.514   42.865  1.00 23.73  ? 107 LEU B O   1 
ATOM   2709 C CB  . LEU B 1 109 ? 5.584   3.558   43.738  1.00 22.95  ? 107 LEU B CB  1 
ATOM   2710 C CG  . LEU B 1 109 ? 6.646   2.759   44.520  1.00 22.63  ? 107 LEU B CG  1 
ATOM   2711 C CD1 . LEU B 1 109 ? 7.509   3.678   45.351  1.00 21.58  ? 107 LEU B CD1 1 
ATOM   2712 C CD2 . LEU B 1 109 ? 5.993   1.717   45.415  1.00 22.83  ? 107 LEU B CD2 1 
ATOM   2713 N N   . ARG B 1 110 ? 3.743   4.602   41.390  1.00 22.84  ? 108 ARG B N   1 
ATOM   2714 C CA  . ARG B 1 110 ? 2.650   5.434   40.872  1.00 23.08  ? 108 ARG B CA  1 
ATOM   2715 C C   . ARG B 1 110 ? 1.577   4.619   40.110  1.00 24.05  ? 108 ARG B C   1 
ATOM   2716 O O   . ARG B 1 110 ? 0.377   4.761   40.377  1.00 23.76  ? 108 ARG B O   1 
ATOM   2717 C CB  . ARG B 1 110 ? 3.190   6.581   40.026  1.00 21.62  ? 108 ARG B CB  1 
ATOM   2718 C CG  . ARG B 1 110 ? 2.128   7.615   39.680  1.00 21.29  ? 108 ARG B CG  1 
ATOM   2719 C CD  . ARG B 1 110 ? 2.746   8.947   39.256  1.00 17.82  ? 108 ARG B CD  1 
ATOM   2720 N NE  . ARG B 1 110 ? 3.653   8.815   38.108  1.00 17.13  ? 108 ARG B NE  1 
ATOM   2721 C CZ  . ARG B 1 110 ? 4.380   9.811   37.591  1.00 19.64  ? 108 ARG B CZ  1 
ATOM   2722 N NH1 . ARG B 1 110 ? 4.349   11.040  38.118  1.00 15.45  ? 108 ARG B NH1 1 
ATOM   2723 N NH2 . ARG B 1 110 ? 5.158   9.578   36.534  1.00 20.51  ? 108 ARG B NH2 1 
ATOM   2724 N N   . GLU B 1 111 ? 2.010   3.766   39.182  1.00 24.45  ? 109 GLU B N   1 
ATOM   2725 C CA  . GLU B 1 111 ? 1.081   2.992   38.364  1.00 25.83  ? 109 GLU B CA  1 
ATOM   2726 C C   . GLU B 1 111 ? 0.232   2.018   39.212  1.00 27.19  ? 109 GLU B C   1 
ATOM   2727 O O   . GLU B 1 111 ? -0.964  1.860   38.985  1.00 27.46  ? 109 GLU B O   1 
ATOM   2728 C CB  . GLU B 1 111 ? 1.838   2.234   37.251  1.00 24.84  ? 109 GLU B CB  1 
ATOM   2729 C CG  . GLU B 1 111 ? 2.450   3.137   36.160  1.00 24.55  ? 109 GLU B CG  1 
ATOM   2730 C CD  . GLU B 1 111 ? 1.424   4.063   35.486  1.00 23.85  ? 109 GLU B CD  1 
ATOM   2731 O OE1 . GLU B 1 111 ? 0.527   3.541   34.812  1.00 24.42  ? 109 GLU B OE1 1 
ATOM   2732 O OE2 . GLU B 1 111 ? 1.498   5.302   35.635  1.00 22.46  ? 109 GLU B OE2 1 
ATOM   2733 N N   . LYS B 1 112 ? 0.868   1.382   40.186  1.00 28.56  ? 110 LYS B N   1 
ATOM   2734 C CA  . LYS B 1 112 ? 0.243   0.344   41.016  1.00 30.40  ? 110 LYS B CA  1 
ATOM   2735 C C   . LYS B 1 112 ? -0.514  0.871   42.232  1.00 30.16  ? 110 LYS B C   1 
ATOM   2736 O O   . LYS B 1 112 ? -1.590  0.377   42.542  1.00 31.08  ? 110 LYS B O   1 
ATOM   2737 C CB  . LYS B 1 112 ? 1.334   -0.644  41.456  1.00 31.01  ? 110 LYS B CB  1 
ATOM   2738 C CG  . LYS B 1 112 ? 0.912   -1.745  42.398  1.00 35.71  ? 110 LYS B CG  1 
ATOM   2739 C CD  . LYS B 1 112 ? 0.492   -3.015  41.646  1.00 42.21  ? 110 LYS B CD  1 
ATOM   2740 C CE  . LYS B 1 112 ? 0.505   -4.215  42.593  1.00 44.80  ? 110 LYS B CE  1 
ATOM   2741 N NZ  . LYS B 1 112 ? -0.294  -5.358  42.060  1.00 47.59  ? 110 LYS B NZ  1 
ATOM   2742 N N   . GLU B 1 113 ? 0.041   1.871   42.915  1.00 30.21  ? 111 GLU B N   1 
ATOM   2743 C CA  . GLU B 1 113 ? -0.500  2.343   44.191  1.00 30.72  ? 111 GLU B CA  1 
ATOM   2744 C C   . GLU B 1 113 ? -1.155  3.694   44.101  1.00 30.53  ? 111 GLU B C   1 
ATOM   2745 O O   . GLU B 1 113 ? -1.758  4.149   45.058  1.00 31.58  ? 111 GLU B O   1 
ATOM   2746 C CB  . GLU B 1 113 ? 0.608   2.425   45.242  1.00 31.32  ? 111 GLU B CB  1 
ATOM   2747 C CG  . GLU B 1 113 ? 1.269   1.112   45.557  1.00 34.22  ? 111 GLU B CG  1 
ATOM   2748 C CD  . GLU B 1 113 ? 0.331   0.158   46.284  1.00 40.34  ? 111 GLU B CD  1 
ATOM   2749 O OE1 . GLU B 1 113 ? -0.625  0.634   46.953  1.00 43.08  ? 111 GLU B OE1 1 
ATOM   2750 O OE2 . GLU B 1 113 ? 0.557   -1.073  46.187  1.00 43.81  ? 111 GLU B OE2 1 
ATOM   2751 N N   . HIS B 1 114 ? -1.007  4.349   42.962  1.00 30.11  ? 112 HIS B N   1 
ATOM   2752 C CA  . HIS B 1 114 ? -1.697  5.596   42.672  1.00 30.04  ? 112 HIS B CA  1 
ATOM   2753 C C   . HIS B 1 114 ? -1.285  6.768   43.559  1.00 28.99  ? 112 HIS B C   1 
ATOM   2754 O O   . HIS B 1 114 ? -2.076  7.691   43.774  1.00 29.35  ? 112 HIS B O   1 
ATOM   2755 C CB  . HIS B 1 114 ? -3.226  5.383   42.689  1.00 31.14  ? 112 HIS B CB  1 
ATOM   2756 C CG  . HIS B 1 114 ? -3.662  4.168   41.927  1.00 33.60  ? 112 HIS B CG  1 
ATOM   2757 N ND1 . HIS B 1 114 ? -3.469  4.036   40.565  1.00 36.03  ? 112 HIS B ND1 1 
ATOM   2758 C CD2 . HIS B 1 114 ? -4.224  3.009   42.343  1.00 35.75  ? 112 HIS B CD2 1 
ATOM   2759 C CE1 . HIS B 1 114 ? -3.923  2.858   40.173  1.00 37.09  ? 112 HIS B CE1 1 
ATOM   2760 N NE2 . HIS B 1 114 ? -4.385  2.215   41.231  1.00 37.50  ? 112 HIS B NE2 1 
ATOM   2761 N N   . PHE B 1 115 ? -0.040  6.758   44.032  1.00 26.49  ? 113 PHE B N   1 
ATOM   2762 C CA  . PHE B 1 115 ? 0.504   7.909   44.745  1.00 24.99  ? 113 PHE B CA  1 
ATOM   2763 C C   . PHE B 1 115 ? 0.471   9.097   43.806  1.00 24.64  ? 113 PHE B C   1 
ATOM   2764 O O   . PHE B 1 115 ? 0.759   8.948   42.606  1.00 25.30  ? 113 PHE B O   1 
ATOM   2765 C CB  . PHE B 1 115 ? 1.934   7.638   45.219  1.00 23.96  ? 113 PHE B CB  1 
ATOM   2766 C CG  . PHE B 1 115 ? 2.022   6.577   46.294  1.00 22.06  ? 113 PHE B CG  1 
ATOM   2767 C CD1 . PHE B 1 115 ? 1.490   6.803   47.565  1.00 22.61  ? 113 PHE B CD1 1 
ATOM   2768 C CD2 . PHE B 1 115 ? 2.650   5.372   46.049  1.00 20.54  ? 113 PHE B CD2 1 
ATOM   2769 C CE1 . PHE B 1 115 ? 1.576   5.824   48.577  1.00 22.80  ? 113 PHE B CE1 1 
ATOM   2770 C CE2 . PHE B 1 115 ? 2.726   4.390   47.053  1.00 22.96  ? 113 PHE B CE2 1 
ATOM   2771 C CZ  . PHE B 1 115 ? 2.183   4.612   48.306  1.00 21.56  ? 113 PHE B CZ  1 
ATOM   2772 N N   . LYS B 1 116 ? 0.100   10.262  44.328  1.00 23.41  ? 114 LYS B N   1 
ATOM   2773 C CA  . LYS B 1 116 ? -0.008  11.452  43.495  1.00 22.60  ? 114 LYS B CA  1 
ATOM   2774 C C   . LYS B 1 116 ? 1.205   12.317  43.650  1.00 21.45  ? 114 LYS B C   1 
ATOM   2775 O O   . LYS B 1 116 ? 1.427   12.916  44.726  1.00 21.15  ? 114 LYS B O   1 
ATOM   2776 C CB  . LYS B 1 116 ? -1.263  12.265  43.826  1.00 23.01  ? 114 LYS B CB  1 
ATOM   2777 C CG  . LYS B 1 116 ? -2.538  11.564  43.359  1.00 26.03  ? 114 LYS B CG  1 
ATOM   2778 C CD  . LYS B 1 116 ? -3.781  12.406  43.516  1.00 30.87  ? 114 LYS B CD  1 
ATOM   2779 C CE  . LYS B 1 116 ? -4.168  12.513  44.955  1.00 34.84  ? 114 LYS B CE  1 
ATOM   2780 N NZ  . LYS B 1 116 ? -5.648  12.446  45.108  1.00 37.96  ? 114 LYS B NZ  1 
ATOM   2781 N N   . PHE B 1 117 ? 1.976   12.375  42.565  1.00 19.08  ? 115 PHE B N   1 
ATOM   2782 C CA  . PHE B 1 117 ? 3.158   13.217  42.456  1.00 17.70  ? 115 PHE B CA  1 
ATOM   2783 C C   . PHE B 1 117 ? 3.523   13.406  40.999  1.00 17.49  ? 115 PHE B C   1 
ATOM   2784 O O   . PHE B 1 117 ? 3.102   12.643  40.141  1.00 16.78  ? 115 PHE B O   1 
ATOM   2785 C CB  . PHE B 1 117 ? 4.357   12.634  43.222  1.00 16.93  ? 115 PHE B CB  1 
ATOM   2786 C CG  . PHE B 1 117 ? 4.820   11.281  42.731  1.00 16.44  ? 115 PHE B CG  1 
ATOM   2787 C CD1 . PHE B 1 117 ? 5.793   11.174  41.749  1.00 14.69  ? 115 PHE B CD1 1 
ATOM   2788 C CD2 . PHE B 1 117 ? 4.321   10.115  43.290  1.00 14.95  ? 115 PHE B CD2 1 
ATOM   2789 C CE1 . PHE B 1 117 ? 6.251   9.916   41.316  1.00 13.65  ? 115 PHE B CE1 1 
ATOM   2790 C CE2 . PHE B 1 117 ? 4.766   8.865   42.856  1.00 14.52  ? 115 PHE B CE2 1 
ATOM   2791 C CZ  . PHE B 1 117 ? 5.742   8.777   41.871  1.00 15.14  ? 115 PHE B CZ  1 
ATOM   2792 N N   . THR B 1 118 ? 4.325   14.433  40.755  1.00 17.79  ? 116 THR B N   1 
ATOM   2793 C CA  . THR B 1 118 ? 4.823   14.772  39.453  1.00 17.84  ? 116 THR B CA  1 
ATOM   2794 C C   . THR B 1 118 ? 6.316   15.006  39.642  1.00 18.39  ? 116 THR B C   1 
ATOM   2795 O O   . THR B 1 118 ? 6.721   15.807  40.464  1.00 17.88  ? 116 THR B O   1 
ATOM   2796 C CB  . THR B 1 118 ? 4.096   16.036  38.922  1.00 18.17  ? 116 THR B CB  1 
ATOM   2797 O OG1 . THR B 1 118 ? 2.675   15.837  39.021  1.00 19.16  ? 116 THR B OG1 1 
ATOM   2798 C CG2 . THR B 1 118 ? 4.420   16.290  37.456  1.00 18.89  ? 116 THR B CG2 1 
ATOM   2799 N N   . THR B 1 119 ? 7.125   14.265  38.890  1.00 19.03  ? 117 THR B N   1 
ATOM   2800 C CA  . THR B 1 119 ? 8.581   14.413  38.891  1.00 19.41  ? 117 THR B CA  1 
ATOM   2801 C C   . THR B 1 119 ? 9.043   15.472  37.868  1.00 20.17  ? 117 THR B C   1 
ATOM   2802 O O   . THR B 1 119 ? 8.303   15.856  36.963  1.00 19.84  ? 117 THR B O   1 
ATOM   2803 C CB  . THR B 1 119 ? 9.302   13.073  38.566  1.00 18.72  ? 117 THR B CB  1 
ATOM   2804 O OG1 . THR B 1 119 ? 9.142   12.789  37.178  1.00 20.54  ? 117 THR B OG1 1 
ATOM   2805 C CG2 . THR B 1 119 ? 8.740   11.888  39.358  1.00 18.16  ? 117 THR B CG2 1 
ATOM   2806 N N   . PHE B 1 120 ? 10.285  15.921  38.005  1.00 20.78  ? 118 PHE B N   1 
ATOM   2807 C CA  . PHE B 1 120 ? 10.887  16.804  37.008  1.00 21.98  ? 118 PHE B CA  1 
ATOM   2808 C C   . PHE B 1 120 ? 10.959  16.202  35.605  1.00 22.33  ? 118 PHE B C   1 
ATOM   2809 O O   . PHE B 1 120 ? 10.916  16.928  34.610  1.00 22.54  ? 118 PHE B O   1 
ATOM   2810 C CB  . PHE B 1 120 ? 12.254  17.265  37.494  1.00 21.99  ? 118 PHE B CB  1 
ATOM   2811 C CG  . PHE B 1 120 ? 12.198  18.509  38.341  1.00 22.99  ? 118 PHE B CG  1 
ATOM   2812 C CD1 . PHE B 1 120 ? 11.044  18.821  39.072  1.00 22.31  ? 118 PHE B CD1 1 
ATOM   2813 C CD2 . PHE B 1 120 ? 13.303  19.365  38.415  1.00 26.09  ? 118 PHE B CD2 1 
ATOM   2814 C CE1 . PHE B 1 120 ? 10.971  19.970  39.839  1.00 25.01  ? 118 PHE B CE1 1 
ATOM   2815 C CE2 . PHE B 1 120 ? 13.250  20.538  39.197  1.00 26.40  ? 118 PHE B CE2 1 
ATOM   2816 C CZ  . PHE B 1 120 ? 12.076  20.846  39.902  1.00 25.04  ? 118 PHE B CZ  1 
ATOM   2817 N N   . ASP B 1 121 ? 11.011  14.873  35.538  1.00 22.18  ? 119 ASP B N   1 
ATOM   2818 C CA  . ASP B 1 121 ? 10.985  14.116  34.276  1.00 22.27  ? 119 ASP B CA  1 
ATOM   2819 C C   . ASP B 1 121 ? 9.633   14.092  33.533  1.00 21.45  ? 119 ASP B C   1 
ATOM   2820 O O   . ASP B 1 121 ? 9.610   13.896  32.322  1.00 19.97  ? 119 ASP B O   1 
ATOM   2821 C CB  . ASP B 1 121 ? 11.400  12.665  34.561  1.00 22.87  ? 119 ASP B CB  1 
ATOM   2822 C CG  . ASP B 1 121 ? 12.687  12.576  35.372  1.00 23.90  ? 119 ASP B CG  1 
ATOM   2823 O OD1 . ASP B 1 121 ? 13.738  12.954  34.856  1.00 26.54  ? 119 ASP B OD1 1 
ATOM   2824 O OD2 . ASP B 1 121 ? 12.646  12.134  36.528  1.00 26.96  ? 119 ASP B OD2 1 
ATOM   2825 N N   . ASP B 1 122 ? 8.530   14.262  34.267  1.00 21.11  ? 120 ASP B N   1 
ATOM   2826 C CA  . ASP B 1 122 ? 7.160   14.239  33.698  1.00 21.59  ? 120 ASP B CA  1 
ATOM   2827 C C   . ASP B 1 122 ? 6.750   15.487  32.871  1.00 21.81  ? 120 ASP B C   1 
ATOM   2828 O O   . ASP B 1 122 ? 5.685   15.491  32.240  1.00 20.75  ? 120 ASP B O   1 
ATOM   2829 C CB  . ASP B 1 122 ? 6.118   14.026  34.817  1.00 20.44  ? 120 ASP B CB  1 
ATOM   2830 C CG  . ASP B 1 122 ? 6.272   12.694  35.523  1.00 22.02  ? 120 ASP B CG  1 
ATOM   2831 O OD1 . ASP B 1 122 ? 6.588   11.687  34.845  1.00 19.57  ? 120 ASP B OD1 1 
ATOM   2832 O OD2 . ASP B 1 122 ? 6.059   12.644  36.767  1.00 23.05  ? 120 ASP B OD2 1 
ATOM   2833 N N   . VAL B 1 123 ? 7.571   16.548  32.910  1.00 22.64  ? 121 VAL B N   1 
ATOM   2834 C CA  . VAL B 1 123 ? 7.233   17.847  32.268  1.00 23.52  ? 121 VAL B CA  1 
ATOM   2835 C C   . VAL B 1 123 ? 8.349   18.380  31.343  1.00 25.16  ? 121 VAL B C   1 
ATOM   2836 O O   . VAL B 1 123 ? 9.469   17.857  31.343  1.00 24.77  ? 121 VAL B O   1 
ATOM   2837 C CB  . VAL B 1 123 ? 6.830   18.933  33.328  1.00 23.46  ? 121 VAL B CB  1 
ATOM   2838 C CG1 . VAL B 1 123 ? 5.587   18.500  34.110  1.00 22.06  ? 121 VAL B CG1 1 
ATOM   2839 C CG2 . VAL B 1 123 ? 7.996   19.237  34.306  1.00 22.61  ? 121 VAL B CG2 1 
ATOM   2840 N N   . ASP B 1 124 ? 8.036   19.396  30.530  1.00 27.41  ? 122 ASP B N   1 
ATOM   2841 C CA  . ASP B 1 124 ? 9.052   20.025  29.672  1.00 29.85  ? 122 ASP B CA  1 
ATOM   2842 C C   . ASP B 1 124 ? 9.820   21.079  30.458  1.00 30.42  ? 122 ASP B C   1 
ATOM   2843 O O   . ASP B 1 124 ? 9.425   21.431  31.570  1.00 30.60  ? 122 ASP B O   1 
ATOM   2844 C CB  . ASP B 1 124 ? 8.442   20.623  28.398  1.00 30.31  ? 122 ASP B CB  1 
ATOM   2845 C CG  . ASP B 1 124 ? 7.309   21.600  28.678  1.00 33.16  ? 122 ASP B CG  1 
ATOM   2846 O OD1 . ASP B 1 124 ? 7.350   22.347  29.693  1.00 36.42  ? 122 ASP B OD1 1 
ATOM   2847 O OD2 . ASP B 1 124 ? 6.348   21.612  27.874  1.00 36.25  ? 122 ASP B OD2 1 
ATOM   2848 N N   . ASP B 1 125 ? 10.911  21.593  29.897  1.00 32.06  ? 123 ASP B N   1 
ATOM   2849 C CA  . ASP B 1 125 ? 11.721  22.541  30.676  1.00 33.28  ? 123 ASP B CA  1 
ATOM   2850 C C   . ASP B 1 125 ? 11.137  23.943  30.801  1.00 32.93  ? 123 ASP B C   1 
ATOM   2851 O O   . ASP B 1 125 ? 11.513  24.676  31.698  1.00 33.60  ? 123 ASP B O   1 
ATOM   2852 C CB  . ASP B 1 125 ? 13.220  22.520  30.326  1.00 34.09  ? 123 ASP B CB  1 
ATOM   2853 C CG  . ASP B 1 125 ? 13.501  22.665  28.850  1.00 37.43  ? 123 ASP B CG  1 
ATOM   2854 O OD1 . ASP B 1 125 ? 12.677  23.258  28.116  1.00 40.93  ? 123 ASP B OD1 1 
ATOM   2855 O OD2 . ASP B 1 125 ? 14.578  22.181  28.424  1.00 41.80  ? 123 ASP B OD2 1 
ATOM   2856 N N   . ALA B 1 126 ? 10.183  24.303  29.950  1.00 33.30  ? 124 ALA B N   1 
ATOM   2857 C CA  . ALA B 1 126 ? 9.422   25.549  30.155  1.00 33.54  ? 124 ALA B CA  1 
ATOM   2858 C C   . ALA B 1 126 ? 8.566   25.500  31.429  1.00 33.35  ? 124 ALA B C   1 
ATOM   2859 O O   . ALA B 1 126 ? 8.363   26.527  32.071  1.00 34.11  ? 124 ALA B O   1 
ATOM   2860 C CB  . ALA B 1 126 ? 8.567   25.890  28.938  1.00 33.09  ? 124 ALA B CB  1 
ATOM   2861 N N   . THR B 1 127 ? 8.085   24.310  31.796  1.00 33.20  ? 125 THR B N   1 
ATOM   2862 C CA  . THR B 1 127 ? 7.332   24.098  33.049  1.00 32.59  ? 125 THR B CA  1 
ATOM   2863 C C   . THR B 1 127 ? 8.252   24.117  34.280  1.00 32.87  ? 125 THR B C   1 
ATOM   2864 O O   . THR B 1 127 ? 7.927   24.691  35.313  1.00 33.35  ? 125 THR B O   1 
ATOM   2865 C CB  . THR B 1 127 ? 6.530   22.788  32.961  1.00 32.85  ? 125 THR B CB  1 
ATOM   2866 O OG1 . THR B 1 127 ? 5.640   22.878  31.843  1.00 32.09  ? 125 THR B OG1 1 
ATOM   2867 C CG2 . THR B 1 127 ? 5.718   22.503  34.228  1.00 31.63  ? 125 THR B CG2 1 
ATOM   2868 N N   . ILE B 1 128 ? 9.419   23.511  34.155  1.00 32.79  ? 126 ILE B N   1 
ATOM   2869 C CA  . ILE B 1 128 ? 10.427  23.613  35.181  1.00 33.29  ? 126 ILE B CA  1 
ATOM   2870 C C   . ILE B 1 128 ? 10.927  25.058  35.311  1.00 34.55  ? 126 ILE B C   1 
ATOM   2871 O O   . ILE B 1 128 ? 11.152  25.518  36.424  1.00 34.88  ? 126 ILE B O   1 
ATOM   2872 C CB  . ILE B 1 128 ? 11.589  22.623  34.933  1.00 32.94  ? 126 ILE B CB  1 
ATOM   2873 C CG1 . ILE B 1 128 ? 11.099  21.188  35.148  1.00 31.45  ? 126 ILE B CG1 1 
ATOM   2874 C CG2 . ILE B 1 128 ? 12.756  22.907  35.882  1.00 32.67  ? 126 ILE B CG2 1 
ATOM   2875 C CD1 . ILE B 1 128 ? 11.922  20.183  34.457  1.00 29.15  ? 126 ILE B CD1 1 
ATOM   2876 N N   . ALA B 1 129 ? 11.070  25.778  34.197  1.00 35.50  ? 127 ALA B N   1 
ATOM   2877 C CA  . ALA B 1 129 ? 11.421  27.214  34.254  1.00 37.10  ? 127 ALA B CA  1 
ATOM   2878 C C   . ALA B 1 129 ? 10.406  27.983  35.086  1.00 37.99  ? 127 ALA B C   1 
ATOM   2879 O O   . ALA B 1 129 ? 10.776  28.780  35.934  1.00 37.61  ? 127 ALA B O   1 
ATOM   2880 C CB  . ALA B 1 129 ? 11.546  27.824  32.850  1.00 36.45  ? 127 ALA B CB  1 
ATOM   2881 N N   . GLU B 1 130 ? 9.124   27.711  34.854  1.00 39.86  ? 128 GLU B N   1 
ATOM   2882 C CA  . GLU B 1 130 ? 8.048   28.322  35.631  1.00 41.73  ? 128 GLU B CA  1 
ATOM   2883 C C   . GLU B 1 130 ? 8.083   27.941  37.106  1.00 41.85  ? 128 GLU B C   1 
ATOM   2884 O O   . GLU B 1 130 ? 7.935   28.813  37.973  1.00 42.47  ? 128 GLU B O   1 
ATOM   2885 C CB  . GLU B 1 130 ? 6.689   27.965  35.034  1.00 41.84  ? 128 GLU B CB  1 
ATOM   2886 C CG  . GLU B 1 130 ? 6.340   28.783  33.769  1.00 44.41  ? 128 GLU B CG  1 
ATOM   2887 C CD  . GLU B 1 130 ? 5.127   28.239  33.012  1.00 44.48  ? 128 GLU B CD  1 
ATOM   2888 O OE1 . GLU B 1 130 ? 5.081   28.404  31.766  1.00 48.46  ? 128 GLU B OE1 1 
ATOM   2889 O OE2 . GLU B 1 130 ? 4.235   27.634  33.658  1.00 47.79  ? 128 GLU B OE2 1 
ATOM   2890 N N   . TRP B 1 131 ? 8.290   26.649  37.386  1.00 41.96  ? 129 TRP B N   1 
ATOM   2891 C CA  . TRP B 1 131 ? 8.286   26.128  38.750  1.00 41.78  ? 129 TRP B CA  1 
ATOM   2892 C C   . TRP B 1 131 ? 9.438   26.659  39.575  1.00 42.55  ? 129 TRP B C   1 
ATOM   2893 O O   . TRP B 1 131 ? 9.269   26.925  40.775  1.00 42.82  ? 129 TRP B O   1 
ATOM   2894 C CB  . TRP B 1 131 ? 8.378   24.602  38.766  1.00 41.39  ? 129 TRP B CB  1 
ATOM   2895 C CG  . TRP B 1 131 ? 7.131   23.863  38.371  1.00 40.65  ? 129 TRP B CG  1 
ATOM   2896 C CD1 . TRP B 1 131 ? 5.883   24.384  38.164  1.00 39.91  ? 129 TRP B CD1 1 
ATOM   2897 C CD2 . TRP B 1 131 ? 7.016   22.457  38.172  1.00 39.72  ? 129 TRP B CD2 1 
ATOM   2898 N NE1 . TRP B 1 131 ? 5.012   23.389  37.824  1.00 39.47  ? 129 TRP B NE1 1 
ATOM   2899 C CE2 . TRP B 1 131 ? 5.679   22.193  37.835  1.00 39.34  ? 129 TRP B CE2 1 
ATOM   2900 C CE3 . TRP B 1 131 ? 7.921   21.389  38.237  1.00 40.18  ? 129 TRP B CE3 1 
ATOM   2901 C CZ2 . TRP B 1 131 ? 5.224   20.909  37.557  1.00 39.48  ? 129 TRP B CZ2 1 
ATOM   2902 C CZ3 . TRP B 1 131 ? 7.466   20.120  37.976  1.00 39.65  ? 129 TRP B CZ3 1 
ATOM   2903 C CH2 . TRP B 1 131 ? 6.130   19.890  37.639  1.00 40.19  ? 129 TRP B CH2 1 
ATOM   2904 N N   . THR B 1 132 ? 10.606  26.782  38.939  1.00 42.68  ? 130 THR B N   1 
ATOM   2905 C CA  . THR B 1 132 ? 11.835  27.165  39.626  1.00 43.04  ? 130 THR B CA  1 
ATOM   2906 C C   . THR B 1 132 ? 12.145  28.660  39.549  1.00 43.78  ? 130 THR B C   1 
ATOM   2907 O O   . THR B 1 132 ? 12.844  29.189  40.412  1.00 43.95  ? 130 THR B O   1 
ATOM   2908 C CB  . THR B 1 132 ? 13.043  26.413  39.069  1.00 42.99  ? 130 THR B CB  1 
ATOM   2909 O OG1 . THR B 1 132 ? 13.090  26.579  37.650  1.00 41.89  ? 130 THR B OG1 1 
ATOM   2910 C CG2 . THR B 1 132 ? 12.959  24.924  39.404  1.00 43.78  ? 130 THR B CG2 1 
ATOM   2911 N N   . GLY B 1 133 ? 11.629  29.332  38.521  1.00 44.02  ? 131 GLY B N   1 
ATOM   2912 C CA  . GLY B 1 133 ? 12.046  30.696  38.208  1.00 44.63  ? 131 GLY B CA  1 
ATOM   2913 C C   . GLY B 1 133 ? 13.369  30.742  37.446  1.00 44.92  ? 131 GLY B C   1 
ATOM   2914 O O   . GLY B 1 133 ? 13.937  31.812  37.255  1.00 45.36  ? 131 GLY B O   1 
ATOM   2915 N N   . LEU B 1 134 ? 13.869  29.594  37.005  1.00 44.87  ? 132 LEU B N   1 
ATOM   2916 C CA  . LEU B 1 134 ? 15.048  29.564  36.138  1.00 45.41  ? 132 LEU B CA  1 
ATOM   2917 C C   . LEU B 1 134 ? 14.704  29.894  34.688  1.00 45.75  ? 132 LEU B C   1 
ATOM   2918 O O   . LEU B 1 134 ? 13.541  30.030  34.337  1.00 45.91  ? 132 LEU B O   1 
ATOM   2919 C CB  . LEU B 1 134 ? 15.749  28.204  36.206  1.00 45.35  ? 132 LEU B CB  1 
ATOM   2920 C CG  . LEU B 1 134 ? 16.265  27.704  37.559  1.00 45.56  ? 132 LEU B CG  1 
ATOM   2921 C CD1 . LEU B 1 134 ? 16.820  26.305  37.385  1.00 45.86  ? 132 LEU B CD1 1 
ATOM   2922 C CD2 . LEU B 1 134 ? 17.308  28.628  38.169  1.00 44.92  ? 132 LEU B CD2 1 
ATOM   2923 N N   . SER B 1 135 ? 15.726  30.050  33.849  1.00 46.42  ? 133 SER B N   1 
ATOM   2924 C CA  . SER B 1 135 ? 15.528  30.171  32.404  1.00 46.82  ? 133 SER B CA  1 
ATOM   2925 C C   . SER B 1 135 ? 15.278  28.774  31.860  1.00 47.55  ? 133 SER B C   1 
ATOM   2926 O O   . SER B 1 135 ? 15.518  27.793  32.566  1.00 47.79  ? 133 SER B O   1 
ATOM   2927 C CB  . SER B 1 135 ? 16.774  30.758  31.747  1.00 46.51  ? 133 SER B CB  1 
ATOM   2928 O OG  . SER B 1 135 ? 17.952  30.241  32.341  1.00 46.27  ? 133 SER B OG  1 
ATOM   2929 N N   . ARG B 1 136 ? 14.804  28.670  30.616  1.00 48.17  ? 134 ARG B N   1 
ATOM   2930 C CA  . ARG B 1 136 ? 14.709  27.366  29.958  1.00 48.90  ? 134 ARG B CA  1 
ATOM   2931 C C   . ARG B 1 136 ? 16.055  26.625  30.008  1.00 48.23  ? 134 ARG B C   1 
ATOM   2932 O O   . ARG B 1 136 ? 16.087  25.428  30.310  1.00 48.60  ? 134 ARG B O   1 
ATOM   2933 C CB  . ARG B 1 136 ? 14.180  27.480  28.517  1.00 48.54  ? 134 ARG B CB  1 
ATOM   2934 C CG  . ARG B 1 136 ? 12.650  27.565  28.427  1.00 50.35  ? 134 ARG B CG  1 
ATOM   2935 C CD  . ARG B 1 136 ? 12.098  27.306  27.008  1.00 51.32  ? 134 ARG B CD  1 
ATOM   2936 N NE  . ARG B 1 136 ? 12.244  25.905  26.593  1.00 56.06  ? 134 ARG B NE  1 
ATOM   2937 C CZ  . ARG B 1 136 ? 13.186  25.444  25.763  1.00 57.87  ? 134 ARG B CZ  1 
ATOM   2938 N NH1 . ARG B 1 136 ? 14.073  26.274  25.220  1.00 58.53  ? 134 ARG B NH1 1 
ATOM   2939 N NH2 . ARG B 1 136 ? 13.243  24.146  25.472  1.00 57.20  ? 134 ARG B NH2 1 
ATOM   2940 N N   . SER B 1 137 ? 17.154  27.341  29.757  1.00 47.20  ? 135 SER B N   1 
ATOM   2941 C CA  . SER B 1 137 ? 18.468  26.713  29.637  1.00 46.63  ? 135 SER B CA  1 
ATOM   2942 C C   . SER B 1 137 ? 18.976  26.122  30.958  1.00 45.86  ? 135 SER B C   1 
ATOM   2943 O O   . SER B 1 137 ? 19.494  25.005  30.975  1.00 45.43  ? 135 SER B O   1 
ATOM   2944 C CB  . SER B 1 137 ? 19.491  27.680  29.040  1.00 46.84  ? 135 SER B CB  1 
ATOM   2945 O OG  . SER B 1 137 ? 19.984  28.592  30.015  1.00 48.93  ? 135 SER B OG  1 
ATOM   2946 N N   . GLN B 1 138 ? 18.831  26.872  32.049  1.00 45.10  ? 136 GLN B N   1 
ATOM   2947 C CA  . GLN B 1 138 ? 19.183  26.370  33.384  1.00 44.81  ? 136 GLN B CA  1 
ATOM   2948 C C   . GLN B 1 138 ? 18.190  25.305  33.837  1.00 43.42  ? 136 GLN B C   1 
ATOM   2949 O O   . GLN B 1 138 ? 18.584  24.323  34.453  1.00 42.50  ? 136 GLN B O   1 
ATOM   2950 C CB  . GLN B 1 138 ? 19.287  27.499  34.426  1.00 45.00  ? 136 GLN B CB  1 
ATOM   2951 C CG  . GLN B 1 138 ? 20.734  27.985  34.676  1.00 46.04  ? 136 GLN B CG  1 
ATOM   2952 C CD  . GLN B 1 138 ? 20.949  28.610  36.062  1.00 46.66  ? 136 GLN B CD  1 
ATOM   2953 O OE1 . GLN B 1 138 ? 21.256  29.800  36.180  1.00 49.40  ? 136 GLN B OE1 1 
ATOM   2954 N NE2 . GLN B 1 138 ? 20.808  27.802  37.111  1.00 48.01  ? 136 GLN B NE2 1 
ATOM   2955 N N   . ALA B 1 139 ? 16.910  25.504  33.505  1.00 42.42  ? 137 ALA B N   1 
ATOM   2956 C CA  . ALA B 1 139 ? 15.886  24.487  33.735  1.00 41.67  ? 137 ALA B CA  1 
ATOM   2957 C C   . ALA B 1 139 ? 16.235  23.154  33.050  1.00 41.10  ? 137 ALA B C   1 
ATOM   2958 O O   . ALA B 1 139 ? 16.039  22.099  33.637  1.00 41.12  ? 137 ALA B O   1 
ATOM   2959 C CB  . ALA B 1 139 ? 14.511  24.982  33.326  1.00 41.31  ? 137 ALA B CB  1 
ATOM   2960 N N   . ALA B 1 140 ? 16.785  23.205  31.841  1.00 40.44  ? 138 ALA B N   1 
ATOM   2961 C CA  . ALA B 1 140 ? 17.285  21.997  31.169  1.00 40.34  ? 138 ALA B CA  1 
ATOM   2962 C C   . ALA B 1 140 ? 18.366  21.228  31.948  1.00 40.14  ? 138 ALA B C   1 
ATOM   2963 O O   . ALA B 1 140 ? 18.319  20.003  31.995  1.00 40.48  ? 138 ALA B O   1 
ATOM   2964 C CB  . ALA B 1 140 ? 17.773  22.316  29.753  1.00 39.73  ? 138 ALA B CB  1 
ATOM   2965 N N   . LEU B 1 141 ? 19.338  21.935  32.541  1.00 39.95  ? 139 LEU B N   1 
ATOM   2966 C CA  . LEU B 1 141 ? 20.403  21.285  33.317  1.00 39.44  ? 139 LEU B CA  1 
ATOM   2967 C C   . LEU B 1 141 ? 19.855  20.769  34.638  1.00 39.64  ? 139 LEU B C   1 
ATOM   2968 O O   . LEU B 1 141 ? 20.388  19.822  35.206  1.00 39.18  ? 139 LEU B O   1 
ATOM   2969 C CB  . LEU B 1 141 ? 21.558  22.246  33.608  1.00 39.33  ? 139 LEU B CB  1 
ATOM   2970 C CG  . LEU B 1 141 ? 22.217  23.088  32.503  1.00 38.66  ? 139 LEU B CG  1 
ATOM   2971 C CD1 . LEU B 1 141 ? 22.995  24.185  33.173  1.00 37.47  ? 139 LEU B CD1 1 
ATOM   2972 C CD2 . LEU B 1 141 ? 23.111  22.281  31.548  1.00 33.88  ? 139 LEU B CD2 1 
ATOM   2973 N N   . THR B 1 142 ? 18.800  21.418  35.120  1.00 39.69  ? 140 THR B N   1 
ATOM   2974 C CA  . THR B 1 142 ? 18.070  20.995  36.312  1.00 40.77  ? 140 THR B CA  1 
ATOM   2975 C C   . THR B 1 142 ? 17.314  19.675  36.100  1.00 40.70  ? 140 THR B C   1 
ATOM   2976 O O   . THR B 1 142 ? 16.913  19.023  37.063  1.00 41.16  ? 140 THR B O   1 
ATOM   2977 C CB  . THR B 1 142 ? 17.107  22.109  36.789  1.00 40.85  ? 140 THR B CB  1 
ATOM   2978 O OG1 . THR B 1 142 ? 17.348  22.399  38.162  1.00 42.41  ? 140 THR B OG1 1 
ATOM   2979 C CG2 . THR B 1 142 ? 15.658  21.721  36.614  1.00 41.50  ? 140 THR B CG2 1 
ATOM   2980 N N   . GLN B 1 143 ? 17.155  19.288  34.837  1.00 40.58  ? 141 GLN B N   1 
ATOM   2981 C CA  . GLN B 1 143 ? 16.521  18.035  34.450  1.00 40.10  ? 141 GLN B CA  1 
ATOM   2982 C C   . GLN B 1 143 ? 17.482  16.860  34.282  1.00 39.34  ? 141 GLN B C   1 
ATOM   2983 O O   . GLN B 1 143 ? 17.046  15.709  34.303  1.00 39.75  ? 141 GLN B O   1 
ATOM   2984 C CB  . GLN B 1 143 ? 15.732  18.225  33.149  1.00 40.74  ? 141 GLN B CB  1 
ATOM   2985 C CG  . GLN B 1 143 ? 14.302  18.611  33.351  1.00 41.37  ? 141 GLN B CG  1 
ATOM   2986 C CD  . GLN B 1 143 ? 13.426  18.315  32.126  1.00 44.60  ? 141 GLN B CD  1 
ATOM   2987 O OE1 . GLN B 1 143 ? 13.787  18.645  30.980  1.00 44.68  ? 141 GLN B OE1 1 
ATOM   2988 N NE2 . GLN B 1 143 ? 12.251  17.726  32.370  1.00 41.27  ? 141 GLN B NE2 1 
ATOM   2989 N N   . LEU B 1 144 ? 18.776  17.124  34.118  1.00 37.99  ? 142 LEU B N   1 
ATOM   2990 C CA  . LEU B 1 144 ? 19.730  16.045  33.911  1.00 37.09  ? 142 LEU B CA  1 
ATOM   2991 C C   . LEU B 1 144 ? 20.251  15.369  35.165  1.00 36.39  ? 142 LEU B C   1 
ATOM   2992 O O   . LEU B 1 144 ? 21.454  15.463  35.466  1.00 37.33  ? 142 LEU B O   1 
ATOM   2993 C CB  . LEU B 1 144 ? 20.935  16.516  33.106  1.00 37.28  ? 142 LEU B CB  1 
ATOM   2994 C CG  . LEU B 1 144 ? 20.734  16.992  31.685  1.00 38.57  ? 142 LEU B CG  1 
ATOM   2995 C CD1 . LEU B 1 144 ? 22.061  17.555  31.183  1.00 39.03  ? 142 LEU B CD1 1 
ATOM   2996 C CD2 . LEU B 1 144 ? 20.211  15.845  30.801  1.00 39.13  ? 142 LEU B CD2 1 
ATOM   2997 N N   . HIS B 1 145 ? 19.391  14.627  35.858  1.00 34.44  ? 143 HIS B N   1 
ATOM   2998 C CA  . HIS B 1 145 ? 19.829  13.865  37.027  1.00 32.69  ? 143 HIS B CA  1 
ATOM   2999 C C   . HIS B 1 145 ? 20.629  12.639  36.648  1.00 31.49  ? 143 HIS B C   1 
ATOM   3000 O O   . HIS B 1 145 ? 20.344  11.982  35.642  1.00 31.30  ? 143 HIS B O   1 
ATOM   3001 C CB  . HIS B 1 145 ? 18.649  13.415  37.872  1.00 32.40  ? 143 HIS B CB  1 
ATOM   3002 C CG  . HIS B 1 145 ? 17.822  14.541  38.389  1.00 33.57  ? 143 HIS B CG  1 
ATOM   3003 N ND1 . HIS B 1 145 ? 17.789  14.883  39.724  1.00 34.01  ? 143 HIS B ND1 1 
ATOM   3004 C CD2 . HIS B 1 145 ? 16.998  15.408  37.752  1.00 32.88  ? 143 HIS B CD2 1 
ATOM   3005 C CE1 . HIS B 1 145 ? 16.971  15.908  39.887  1.00 34.29  ? 143 HIS B CE1 1 
ATOM   3006 N NE2 . HIS B 1 145 ? 16.476  16.242  38.710  1.00 33.88  ? 143 HIS B NE2 1 
ATOM   3007 N N   . GLU B 1 146 ? 21.606  12.305  37.482  1.00 29.73  ? 144 GLU B N   1 
ATOM   3008 C CA  . GLU B 1 146 ? 22.320  11.059  37.302  1.00 28.64  ? 144 GLU B CA  1 
ATOM   3009 C C   . GLU B 1 146 ? 21.935  9.980   38.265  1.00 26.66  ? 144 GLU B C   1 
ATOM   3010 O O   . GLU B 1 146 ? 21.950  8.799   37.905  1.00 26.94  ? 144 GLU B O   1 
ATOM   3011 C CB  . GLU B 1 146 ? 23.805  11.290  37.396  1.00 29.65  ? 144 GLU B CB  1 
ATOM   3012 C CG  . GLU B 1 146 ? 24.361  11.742  36.085  1.00 34.35  ? 144 GLU B CG  1 
ATOM   3013 C CD  . GLU B 1 146 ? 25.783  12.085  36.217  1.00 38.54  ? 144 GLU B CD  1 
ATOM   3014 O OE1 . GLU B 1 146 ? 26.080  12.924  37.095  1.00 41.75  ? 144 GLU B OE1 1 
ATOM   3015 O OE2 . GLU B 1 146 ? 26.589  11.511  35.459  1.00 41.36  ? 144 GLU B OE2 1 
ATOM   3016 N N   . ALA B 1 147 ? 21.579  10.367  39.483  1.00 23.92  ? 145 ALA B N   1 
ATOM   3017 C CA  . ALA B 1 147 ? 21.451  9.394   40.550  1.00 22.09  ? 145 ALA B CA  1 
ATOM   3018 C C   . ALA B 1 147 ? 20.397  9.783   41.577  1.00 20.53  ? 145 ALA B C   1 
ATOM   3019 O O   . ALA B 1 147 ? 20.508  9.461   42.758  1.00 18.70  ? 145 ALA B O   1 
ATOM   3020 C CB  . ALA B 1 147 ? 22.826  9.153   41.213  1.00 22.00  ? 145 ALA B CB  1 
ATOM   3021 N N   . SER B 1 148 ? 19.369  10.475  41.100  1.00 19.77  ? 146 SER B N   1 
ATOM   3022 C CA  . SER B 1 148 ? 18.270  10.906  41.946  1.00 19.18  ? 146 SER B CA  1 
ATOM   3023 C C   . SER B 1 148 ? 17.094  11.335  41.069  1.00 18.94  ? 146 SER B C   1 
ATOM   3024 O O   . SER B 1 148 ? 17.204  11.357  39.862  1.00 18.70  ? 146 SER B O   1 
ATOM   3025 C CB  . SER B 1 148 ? 18.716  12.039  42.886  1.00 19.06  ? 146 SER B CB  1 
ATOM   3026 O OG  . SER B 1 148 ? 19.197  13.118  42.104  1.00 18.02  ? 146 SER B OG  1 
ATOM   3027 N N   . VAL B 1 149 ? 15.948  11.596  41.699  1.00 18.74  ? 147 VAL B N   1 
ATOM   3028 C CA  . VAL B 1 149 ? 14.795  12.177  41.046  1.00 18.32  ? 147 VAL B CA  1 
ATOM   3029 C C   . VAL B 1 149 ? 14.266  13.310  41.944  1.00 18.76  ? 147 VAL B C   1 
ATOM   3030 O O   . VAL B 1 149 ? 14.139  13.131  43.170  1.00 17.81  ? 147 VAL B O   1 
ATOM   3031 C CB  . VAL B 1 149 ? 13.662  11.114  40.828  1.00 18.56  ? 147 VAL B CB  1 
ATOM   3032 C CG1 . VAL B 1 149 ? 12.293  11.794  40.583  1.00 15.84  ? 147 VAL B CG1 1 
ATOM   3033 C CG2 . VAL B 1 149 ? 14.022  10.169  39.676  1.00 18.05  ? 147 VAL B CG2 1 
ATOM   3034 N N   . THR B 1 150 ? 13.942  14.446  41.312  1.00 18.77  ? 148 THR B N   1 
ATOM   3035 C CA  . THR B 1 150 ? 13.276  15.576  41.963  1.00 18.71  ? 148 THR B CA  1 
ATOM   3036 C C   . THR B 1 150 ? 11.774  15.547  41.650  1.00 19.21  ? 148 THR B C   1 
ATOM   3037 O O   . THR B 1 150 ? 11.359  15.349  40.481  1.00 19.21  ? 148 THR B O   1 
ATOM   3038 C CB  . THR B 1 150 ? 13.877  16.910  41.494  1.00 18.20  ? 148 THR B CB  1 
ATOM   3039 O OG1 . THR B 1 150 ? 15.281  16.917  41.770  1.00 19.91  ? 148 THR B OG1 1 
ATOM   3040 C CG2 . THR B 1 150 ? 13.245  18.115  42.227  1.00 19.66  ? 148 THR B CG2 1 
ATOM   3041 N N   . LEU B 1 151 ? 10.954  15.774  42.676  1.00 18.81  ? 149 LEU B N   1 
ATOM   3042 C CA  . LEU B 1 151 ? 9.517   15.736  42.469  1.00 18.62  ? 149 LEU B CA  1 
ATOM   3043 C C   . LEU B 1 151 ? 8.720   16.728  43.307  1.00 19.46  ? 149 LEU B C   1 
ATOM   3044 O O   . LEU B 1 151 ? 9.198   17.241  44.313  1.00 19.16  ? 149 LEU B O   1 
ATOM   3045 C CB  . LEU B 1 151 ? 8.983   14.315  42.709  1.00 18.11  ? 149 LEU B CB  1 
ATOM   3046 C CG  . LEU B 1 151 ? 9.080   13.675  44.083  1.00 16.21  ? 149 LEU B CG  1 
ATOM   3047 C CD1 . LEU B 1 151 ? 7.884   14.090  44.994  1.00 17.47  ? 149 LEU B CD1 1 
ATOM   3048 C CD2 . LEU B 1 151 ? 9.118   12.189  43.949  1.00 12.64  ? 149 LEU B CD2 1 
ATOM   3049 N N   . ILE B 1 152 ? 7.480   16.941  42.877  1.00 19.55  ? 150 ILE B N   1 
ATOM   3050 C CA  . ILE B 1 152 ? 6.484   17.652  43.644  1.00 19.92  ? 150 ILE B CA  1 
ATOM   3051 C C   . ILE B 1 152 ? 5.469   16.640  44.158  1.00 20.81  ? 150 ILE B C   1 
ATOM   3052 O O   . ILE B 1 152 ? 4.837   15.905  43.367  1.00 20.29  ? 150 ILE B O   1 
ATOM   3053 C CB  . ILE B 1 152 ? 5.797   18.737  42.802  1.00 19.74  ? 150 ILE B CB  1 
ATOM   3054 C CG1 . ILE B 1 152 ? 6.815   19.830  42.459  1.00 19.45  ? 150 ILE B CG1 1 
ATOM   3055 C CG2 . ILE B 1 152 ? 4.639   19.339  43.550  1.00 19.08  ? 150 ILE B CG2 1 
ATOM   3056 C CD1 . ILE B 1 152 ? 6.322   20.813  41.400  1.00 24.16  ? 150 ILE B CD1 1 
ATOM   3057 N N   . TRP B 1 153 ? 5.333   16.614  45.485  1.00 20.82  ? 151 TRP B N   1 
ATOM   3058 C CA  . TRP B 1 153 ? 4.425   15.706  46.155  1.00 22.58  ? 151 TRP B CA  1 
ATOM   3059 C C   . TRP B 1 153 ? 3.029   16.329  46.216  1.00 23.47  ? 151 TRP B C   1 
ATOM   3060 O O   . TRP B 1 153 ? 2.863   17.412  46.762  1.00 24.78  ? 151 TRP B O   1 
ATOM   3061 C CB  . TRP B 1 153 ? 4.948   15.375  47.560  1.00 21.63  ? 151 TRP B CB  1 
ATOM   3062 C CG  . TRP B 1 153 ? 4.091   14.356  48.217  1.00 20.93  ? 151 TRP B CG  1 
ATOM   3063 C CD1 . TRP B 1 153 ? 3.179   14.569  49.207  1.00 19.69  ? 151 TRP B CD1 1 
ATOM   3064 C CD2 . TRP B 1 153 ? 4.031   12.966  47.903  1.00 19.09  ? 151 TRP B CD2 1 
ATOM   3065 N NE1 . TRP B 1 153 ? 2.549   13.393  49.523  1.00 19.46  ? 151 TRP B NE1 1 
ATOM   3066 C CE2 . TRP B 1 153 ? 3.058   12.392  48.745  1.00 19.70  ? 151 TRP B CE2 1 
ATOM   3067 C CE3 . TRP B 1 153 ? 4.694   12.148  46.976  1.00 19.12  ? 151 TRP B CE3 1 
ATOM   3068 C CZ2 . TRP B 1 153 ? 2.748   11.027  48.713  1.00 20.91  ? 151 TRP B CZ2 1 
ATOM   3069 C CZ3 . TRP B 1 153 ? 4.376   10.796  46.934  1.00 19.30  ? 151 TRP B CZ3 1 
ATOM   3070 C CH2 . TRP B 1 153 ? 3.412   10.249  47.801  1.00 19.85  ? 151 TRP B CH2 1 
ATOM   3071 N N   . ARG B 1 154 ? 2.039   15.653  45.642  1.00 24.12  ? 152 ARG B N   1 
ATOM   3072 C CA  . ARG B 1 154 ? 0.687   16.202  45.530  1.00 24.58  ? 152 ARG B CA  1 
ATOM   3073 C C   . ARG B 1 154 ? -0.331  15.360  46.298  1.00 24.73  ? 152 ARG B C   1 
ATOM   3074 O O   . ARG B 1 154 ? -1.535  15.482  46.093  1.00 26.04  ? 152 ARG B O   1 
ATOM   3075 C CB  . ARG B 1 154 ? 0.287   16.325  44.050  1.00 24.43  ? 152 ARG B CB  1 
ATOM   3076 C CG  . ARG B 1 154 ? 1.201   17.280  43.211  1.00 24.45  ? 152 ARG B CG  1 
ATOM   3077 C CD  . ARG B 1 154 ? 0.690   17.457  41.758  1.00 26.35  ? 152 ARG B CD  1 
ATOM   3078 N NE  . ARG B 1 154 ? 0.740   16.183  41.031  1.00 33.18  ? 152 ARG B NE  1 
ATOM   3079 C CZ  . ARG B 1 154 ? -0.314  15.395  40.773  1.00 36.37  ? 152 ARG B CZ  1 
ATOM   3080 N NH1 . ARG B 1 154 ? -1.546  15.764  41.149  1.00 36.88  ? 152 ARG B NH1 1 
ATOM   3081 N NH2 . ARG B 1 154 ? -0.140  14.235  40.117  1.00 35.65  ? 152 ARG B NH2 1 
ATOM   3082 N N   . ASP B 1 155 ? 0.138   14.508  47.197  1.00 24.38  ? 153 ASP B N   1 
ATOM   3083 C CA  . ASP B 1 155 ? -0.773  13.656  47.952  1.00 24.50  ? 153 ASP B CA  1 
ATOM   3084 C C   . ASP B 1 155 ? -0.784  14.077  49.431  1.00 24.31  ? 153 ASP B C   1 
ATOM   3085 O O   . ASP B 1 155 ? -0.156  15.083  49.799  1.00 24.32  ? 153 ASP B O   1 
ATOM   3086 C CB  . ASP B 1 155 ? -0.383  12.180  47.779  1.00 24.33  ? 153 ASP B CB  1 
ATOM   3087 C CG  . ASP B 1 155 ? -1.585  11.267  47.654  1.00 26.03  ? 153 ASP B CG  1 
ATOM   3088 O OD1 . ASP B 1 155 ? -1.474  10.281  46.902  1.00 28.06  ? 153 ASP B OD1 1 
ATOM   3089 O OD2 . ASP B 1 155 ? -2.625  11.508  48.318  1.00 24.81  ? 153 ASP B OD2 1 
ATOM   3090 N N   . SER B 1 156 ? -1.510  13.323  50.257  1.00 23.89  ? 154 SER B N   1 
ATOM   3091 C CA  . SER B 1 156 ? -1.626  13.579  51.701  1.00 23.78  ? 154 SER B CA  1 
ATOM   3092 C C   . SER B 1 156 ? -0.403  13.095  52.509  1.00 24.48  ? 154 SER B C   1 
ATOM   3093 O O   . SER B 1 156 ? 0.436   12.343  51.986  1.00 24.85  ? 154 SER B O   1 
ATOM   3094 C CB  . SER B 1 156 ? -2.865  12.869  52.217  1.00 23.45  ? 154 SER B CB  1 
ATOM   3095 O OG  . SER B 1 156 ? -2.676  11.480  52.144  1.00 20.83  ? 154 SER B OG  1 
ATOM   3096 N N   . ASP B 1 157 ? -0.315  13.515  53.778  1.00 24.65  ? 155 ASP B N   1 
ATOM   3097 C CA  . ASP B 1 157 ? 0.786   13.133  54.688  1.00 24.88  ? 155 ASP B CA  1 
ATOM   3098 C C   . ASP B 1 157 ? 0.822   11.636  54.988  1.00 24.58  ? 155 ASP B C   1 
ATOM   3099 O O   . ASP B 1 157 ? 1.905   11.057  55.117  1.00 24.63  ? 155 ASP B O   1 
ATOM   3100 C CB  . ASP B 1 157 ? 0.720   13.913  56.032  1.00 25.66  ? 155 ASP B CB  1 
ATOM   3101 C CG  . ASP B 1 157 ? 1.113   15.383  55.894  1.00 26.57  ? 155 ASP B CG  1 
ATOM   3102 O OD1 . ASP B 1 157 ? 1.688   15.750  54.847  1.00 28.58  ? 155 ASP B OD1 1 
ATOM   3103 O OD2 . ASP B 1 157 ? 0.862   16.170  56.843  1.00 26.34  ? 155 ASP B OD2 1 
ATOM   3104 N N   . GLU B 1 158 ? -0.343  11.007  55.115  1.00 24.23  ? 156 GLU B N   1 
ATOM   3105 C CA  . GLU B 1 158 ? -0.390  9.543   55.318  1.00 24.67  ? 156 GLU B CA  1 
ATOM   3106 C C   . GLU B 1 158 ? 0.020   8.742   54.077  1.00 23.99  ? 156 GLU B C   1 
ATOM   3107 O O   . GLU B 1 158 ? 0.683   7.697   54.202  1.00 23.45  ? 156 GLU B O   1 
ATOM   3108 C CB  . GLU B 1 158 ? -1.754  9.057   55.850  1.00 25.03  ? 156 GLU B CB  1 
ATOM   3109 C CG  . GLU B 1 158 ? -1.989  9.394   57.342  1.00 27.19  ? 156 GLU B CG  1 
ATOM   3110 C CD  . GLU B 1 158 ? -0.910  8.825   58.272  1.00 31.09  ? 156 GLU B CD  1 
ATOM   3111 O OE1 . GLU B 1 158 ? -0.853  7.582   58.437  1.00 32.88  ? 156 GLU B OE1 1 
ATOM   3112 O OE2 . GLU B 1 158 ? -0.114  9.623   58.839  1.00 32.32  ? 156 GLU B OE2 1 
ATOM   3113 N N   . ARG B 1 159 ? -0.364  9.236   52.903  1.00 23.30  ? 157 ARG B N   1 
ATOM   3114 C CA  . ARG B 1 159 ? 0.107   8.663   51.639  1.00 23.89  ? 157 ARG B CA  1 
ATOM   3115 C C   . ARG B 1 159 ? 1.618   8.885   51.496  1.00 24.12  ? 157 ARG B C   1 
ATOM   3116 O O   . ARG B 1 159 ? 2.333   7.992   51.063  1.00 23.34  ? 157 ARG B O   1 
ATOM   3117 C CB  . ARG B 1 159 ? -0.673  9.216   50.441  1.00 23.27  ? 157 ARG B CB  1 
ATOM   3118 C CG  . ARG B 1 159 ? -2.156  8.839   50.461  1.00 24.30  ? 157 ARG B CG  1 
ATOM   3119 C CD  . ARG B 1 159 ? -2.363  7.377   50.129  1.00 26.28  ? 157 ARG B CD  1 
ATOM   3120 N NE  . ARG B 1 159 ? -2.358  7.181   48.683  1.00 29.59  ? 157 ARG B NE  1 
ATOM   3121 C CZ  . ARG B 1 159 ? -2.136  6.024   48.063  1.00 29.86  ? 157 ARG B CZ  1 
ATOM   3122 N NH1 . ARG B 1 159 ? -1.880  4.913   48.751  1.00 26.12  ? 157 ARG B NH1 1 
ATOM   3123 N NH2 . ARG B 1 159 ? -2.175  5.991   46.735  1.00 31.20  ? 157 ARG B NH2 1 
ATOM   3124 N N   . MET B 1 160 ? 2.110   10.047  51.941  1.00 25.02  ? 158 MET B N   1 
ATOM   3125 C CA  . MET B 1 160 ? 3.548   10.271  51.957  1.00 26.20  ? 158 MET B CA  1 
ATOM   3126 C C   . MET B 1 160 ? 4.276   9.296   52.878  1.00 26.46  ? 158 MET B C   1 
ATOM   3127 O O   . MET B 1 160 ? 5.334   8.799   52.506  1.00 26.51  ? 158 MET B O   1 
ATOM   3128 C CB  . MET B 1 160 ? 3.912   11.696  52.306  1.00 25.90  ? 158 MET B CB  1 
ATOM   3129 C CG  . MET B 1 160 ? 5.437   11.887  52.365  1.00 27.58  ? 158 MET B CG  1 
ATOM   3130 S SD  . MET B 1 160 ? 5.981   13.479  52.999  1.00 28.86  ? 158 MET B SD  1 
ATOM   3131 C CE  . MET B 1 160 ? 5.384   14.569  51.698  1.00 29.61  ? 158 MET B CE  1 
ATOM   3132 N N   . ALA B 1 161 ? 3.698   9.011   54.053  1.00 26.48  ? 159 ALA B N   1 
ATOM   3133 C CA  . ALA B 1 161 ? 4.280   8.061   55.006  1.00 26.62  ? 159 ALA B CA  1 
ATOM   3134 C C   . ALA B 1 161 ? 4.382   6.648   54.435  1.00 26.92  ? 159 ALA B C   1 
ATOM   3135 O O   . ALA B 1 161 ? 5.387   5.963   54.641  1.00 27.10  ? 159 ALA B O   1 
ATOM   3136 C CB  . ALA B 1 161 ? 3.493   8.040   56.319  1.00 25.79  ? 159 ALA B CB  1 
ATOM   3137 N N   . GLN B 1 162 ? 3.341   6.197   53.735  1.00 27.17  ? 160 GLN B N   1 
ATOM   3138 C CA  . GLN B 1 162 ? 3.403   4.865   53.137  1.00 27.12  ? 160 GLN B CA  1 
ATOM   3139 C C   . GLN B 1 162 ? 4.386   4.823   51.954  1.00 25.82  ? 160 GLN B C   1 
ATOM   3140 O O   . GLN B 1 162 ? 5.069   3.816   51.742  1.00 25.04  ? 160 GLN B O   1 
ATOM   3141 C CB  . GLN B 1 162 ? 2.019   4.294   52.818  1.00 27.33  ? 160 GLN B CB  1 
ATOM   3142 C CG  . GLN B 1 162 ? 1.144   5.158   51.976  1.00 32.25  ? 160 GLN B CG  1 
ATOM   3143 C CD  . GLN B 1 162 ? -0.293  4.662   51.937  1.00 35.98  ? 160 GLN B CD  1 
ATOM   3144 O OE1 . GLN B 1 162 ? -1.070  4.900   52.870  1.00 38.45  ? 160 GLN B OE1 1 
ATOM   3145 N NE2 . GLN B 1 162 ? -0.655  3.972   50.853  1.00 36.30  ? 160 GLN B NE2 1 
ATOM   3146 N N   . PHE B 1 163 ? 4.468   5.946   51.243  1.00 24.89  ? 161 PHE B N   1 
ATOM   3147 C CA  . PHE B 1 163 ? 5.496   6.222   50.225  1.00 24.78  ? 161 PHE B CA  1 
ATOM   3148 C C   . PHE B 1 163 ? 6.957   6.185   50.755  1.00 24.40  ? 161 PHE B C   1 
ATOM   3149 O O   . PHE B 1 163 ? 7.722   5.406   50.186  1.00 24.34  ? 161 PHE B O   1 
ATOM   3150 C CB  . PHE B 1 163 ? 5.169   7.540   49.484  1.00 24.09  ? 161 PHE B CB  1 
ATOM   3151 C CG  . PHE B 1 163 ? 5.999   7.791   48.246  1.00 23.71  ? 161 PHE B CG  1 
ATOM   3152 C CD1 . PHE B 1 163 ? 5.734   7.108   47.051  1.00 23.31  ? 161 PHE B CD1 1 
ATOM   3153 C CD2 . PHE B 1 163 ? 7.011   8.757   48.252  1.00 20.53  ? 161 PHE B CD2 1 
ATOM   3154 C CE1 . PHE B 1 163 ? 6.501   7.356   45.883  1.00 23.33  ? 161 PHE B CE1 1 
ATOM   3155 C CE2 . PHE B 1 163 ? 7.756   9.020   47.090  1.00 22.50  ? 161 PHE B CE2 1 
ATOM   3156 C CZ  . PHE B 1 163 ? 7.506   8.307   45.908  1.00 22.29  ? 161 PHE B CZ  1 
ATOM   3157 N N   . THR B 1 164 ? 7.348   6.988   51.784  1.00 24.98  ? 162 THR B N   1 
ATOM   3158 C CA  . THR B 1 164 ? 8.722   6.866   52.436  1.00 24.96  ? 162 THR B CA  1 
ATOM   3159 C C   . THR B 1 164 ? 9.005   5.417   52.823  1.00 24.98  ? 162 THR B C   1 
ATOM   3160 O O   . THR B 1 164 ? 10.065  4.887   52.491  1.00 25.87  ? 162 THR B O   1 
ATOM   3161 C CB  . THR B 1 164 ? 9.181   7.970   53.618  1.00 25.61  ? 162 THR B CB  1 
ATOM   3162 O OG1 . THR B 1 164 ? 10.470  8.578   53.320  1.00 25.65  ? 162 THR B OG1 1 
ATOM   3163 C CG2 . THR B 1 164 ? 9.514   7.331   54.962  1.00 25.24  ? 162 THR B CG2 1 
ATOM   3164 N N   . ALA B 1 165 ? 8.060   4.759   53.484  1.00 24.80  ? 163 ALA B N   1 
ATOM   3165 C CA  . ALA B 1 165 ? 8.293   3.395   54.009  1.00 25.04  ? 163 ALA B CA  1 
ATOM   3166 C C   . ALA B 1 165 ? 8.631   2.456   52.863  1.00 25.63  ? 163 ALA B C   1 
ATOM   3167 O O   . ALA B 1 165 ? 9.590   1.681   52.918  1.00 26.46  ? 163 ALA B O   1 
ATOM   3168 C CB  . ALA B 1 165 ? 7.038   2.873   54.795  1.00 24.00  ? 163 ALA B CB  1 
ATOM   3169 N N   . ARG B 1 166 ? 7.820   2.546   51.813  1.00 25.88  ? 164 ARG B N   1 
ATOM   3170 C CA  . ARG B 1 166 ? 7.986   1.759   50.613  1.00 26.13  ? 164 ARG B CA  1 
ATOM   3171 C C   . ARG B 1 166 ? 9.323   2.088   49.909  1.00 25.13  ? 164 ARG B C   1 
ATOM   3172 O O   . ARG B 1 166 ? 10.071  1.186   49.519  1.00 25.21  ? 164 ARG B O   1 
ATOM   3173 C CB  . ARG B 1 166 ? 6.767   2.022   49.734  1.00 27.47  ? 164 ARG B CB  1 
ATOM   3174 C CG  . ARG B 1 166 ? 6.544   1.088   48.647  1.00 31.89  ? 164 ARG B CG  1 
ATOM   3175 C CD  . ARG B 1 166 ? 5.894   -0.231  49.079  1.00 38.37  ? 164 ARG B CD  1 
ATOM   3176 N NE  . ARG B 1 166 ? 6.063   -1.141  47.942  1.00 42.18  ? 164 ARG B NE  1 
ATOM   3177 C CZ  . ARG B 1 166 ? 7.213   -1.734  47.635  1.00 44.68  ? 164 ARG B CZ  1 
ATOM   3178 N NH1 . ARG B 1 166 ? 8.284   -1.557  48.420  1.00 45.59  ? 164 ARG B NH1 1 
ATOM   3179 N NH2 . ARG B 1 166 ? 7.292   -2.514  46.554  1.00 45.08  ? 164 ARG B NH2 1 
ATOM   3180 N N   . LEU B 1 167 ? 9.653   3.370   49.794  1.00 23.69  ? 165 LEU B N   1 
ATOM   3181 C CA  . LEU B 1 167 ? 10.974  3.759   49.288  1.00 22.89  ? 165 LEU B CA  1 
ATOM   3182 C C   . LEU B 1 167 ? 12.113  3.151   50.126  1.00 22.91  ? 165 LEU B C   1 
ATOM   3183 O O   . LEU B 1 167 ? 13.070  2.605   49.564  1.00 22.21  ? 165 LEU B O   1 
ATOM   3184 C CB  . LEU B 1 167 ? 11.121  5.286   49.233  1.00 21.88  ? 165 LEU B CB  1 
ATOM   3185 C CG  . LEU B 1 167 ? 10.340  6.076   48.170  1.00 22.46  ? 165 LEU B CG  1 
ATOM   3186 C CD1 . LEU B 1 167 ? 10.608  7.575   48.326  1.00 18.65  ? 165 LEU B CD1 1 
ATOM   3187 C CD2 . LEU B 1 167 ? 10.620  5.614   46.725  1.00 20.22  ? 165 LEU B CD2 1 
ATOM   3188 N N   . ASN B 1 168 ? 11.998  3.267   51.456  1.00 23.56  ? 166 ASN B N   1 
ATOM   3189 C CA  . ASN B 1 168 ? 13.024  2.787   52.416  1.00 25.15  ? 166 ASN B CA  1 
ATOM   3190 C C   . ASN B 1 168 ? 13.276  1.288   52.315  1.00 25.15  ? 166 ASN B C   1 
ATOM   3191 O O   . ASN B 1 168 ? 14.408  0.846   52.366  1.00 24.97  ? 166 ASN B O   1 
ATOM   3192 C CB  . ASN B 1 168 ? 12.650  3.126   53.876  1.00 24.40  ? 166 ASN B CB  1 
ATOM   3193 C CG  . ASN B 1 168 ? 12.750  4.623   54.204  1.00 26.76  ? 166 ASN B CG  1 
ATOM   3194 O OD1 . ASN B 1 168 ? 13.195  5.468   53.386  1.00 26.56  ? 166 ASN B OD1 1 
ATOM   3195 N ND2 . ASN B 1 168 ? 12.327  4.961   55.424  1.00 25.59  ? 166 ASN B ND2 1 
ATOM   3196 N N   . GLU B 1 169 ? 12.210  0.501   52.179  1.00 26.41  ? 167 GLU B N   1 
ATOM   3197 C CA  . GLU B 1 169 ? 12.384  -0.951  52.053  1.00 27.08  ? 167 GLU B CA  1 
ATOM   3198 C C   . GLU B 1 169 ? 13.020  -1.351  50.705  1.00 26.67  ? 167 GLU B C   1 
ATOM   3199 O O   . GLU B 1 169 ? 13.549  -2.469  50.567  1.00 26.03  ? 167 GLU B O   1 
ATOM   3200 C CB  . GLU B 1 169 ? 11.093  -1.709  52.385  1.00 27.82  ? 167 GLU B CB  1 
ATOM   3201 C CG  . GLU B 1 169 ? 10.175  -2.055  51.241  1.00 32.01  ? 167 GLU B CG  1 
ATOM   3202 C CD  . GLU B 1 169 ? 8.766   -2.357  51.752  1.00 37.00  ? 167 GLU B CD  1 
ATOM   3203 O OE1 . GLU B 1 169 ? 8.545   -2.267  52.980  1.00 38.70  ? 167 GLU B OE1 1 
ATOM   3204 O OE2 . GLU B 1 169 ? 7.875   -2.669  50.935  1.00 39.16  ? 167 GLU B OE2 1 
ATOM   3205 N N   . LEU B 1 170 ? 13.023  -0.405  49.753  1.00 25.39  ? 168 LEU B N   1 
ATOM   3206 C CA  . LEU B 1 170 ? 13.715  -0.572  48.470  1.00 24.58  ? 168 LEU B CA  1 
ATOM   3207 C C   . LEU B 1 170 ? 15.106  0.072   48.408  1.00 24.53  ? 168 LEU B C   1 
ATOM   3208 O O   . LEU B 1 170 ? 15.645  0.224   47.321  1.00 23.88  ? 168 LEU B O   1 
ATOM   3209 C CB  . LEU B 1 170 ? 12.849  -0.022  47.317  1.00 24.71  ? 168 LEU B CB  1 
ATOM   3210 C CG  . LEU B 1 170 ? 11.518  -0.762  47.124  1.00 24.24  ? 168 LEU B CG  1 
ATOM   3211 C CD1 . LEU B 1 170 ? 10.608  -0.010  46.198  1.00 22.94  ? 168 LEU B CD1 1 
ATOM   3212 C CD2 . LEU B 1 170 ? 11.770  -2.202  46.641  1.00 24.61  ? 168 LEU B CD2 1 
ATOM   3213 N N   . GLY B 1 171 ? 15.665  0.479   49.554  1.00 23.80  ? 169 GLY B N   1 
ATOM   3214 C CA  . GLY B 1 171 ? 16.983  1.115   49.598  1.00 23.39  ? 169 GLY B CA  1 
ATOM   3215 C C   . GLY B 1 171 ? 17.058  2.552   49.097  1.00 23.31  ? 169 GLY B C   1 
ATOM   3216 O O   . GLY B 1 171 ? 18.126  3.024   48.643  1.00 21.57  ? 169 GLY B O   1 
ATOM   3217 N N   . LEU B 1 172 ? 15.925  3.254   49.187  1.00 23.05  ? 170 LEU B N   1 
ATOM   3218 C CA  . LEU B 1 172 ? 15.844  4.650   48.764  1.00 22.63  ? 170 LEU B CA  1 
ATOM   3219 C C   . LEU B 1 172 ? 15.419  5.515   49.938  1.00 23.04  ? 170 LEU B C   1 
ATOM   3220 O O   . LEU B 1 172 ? 14.692  5.046   50.807  1.00 23.10  ? 170 LEU B O   1 
ATOM   3221 C CB  . LEU B 1 172 ? 14.862  4.805   47.598  1.00 22.92  ? 170 LEU B CB  1 
ATOM   3222 C CG  . LEU B 1 172 ? 15.209  4.078   46.281  1.00 22.68  ? 170 LEU B CG  1 
ATOM   3223 C CD1 . LEU B 1 172 ? 14.132  4.286   45.255  1.00 22.06  ? 170 LEU B CD1 1 
ATOM   3224 C CD2 . LEU B 1 172 ? 16.538  4.580   45.746  1.00 22.06  ? 170 LEU B CD2 1 
ATOM   3225 N N   . GLN B 1 173 ? 15.867  6.771   49.955  1.00 22.51  ? 171 GLN B N   1 
ATOM   3226 C CA  . GLN B 1 173 ? 15.392  7.755   50.925  1.00 22.89  ? 171 GLN B CA  1 
ATOM   3227 C C   . GLN B 1 173 ? 14.608  8.830   50.194  1.00 23.10  ? 171 GLN B C   1 
ATOM   3228 O O   . GLN B 1 173 ? 14.754  8.986   48.995  1.00 22.37  ? 171 GLN B O   1 
ATOM   3229 C CB  . GLN B 1 173 ? 16.571  8.422   51.675  1.00 22.97  ? 171 GLN B CB  1 
ATOM   3230 C CG  . GLN B 1 173 ? 17.577  9.121   50.737  1.00 21.19  ? 171 GLN B CG  1 
ATOM   3231 C CD  . GLN B 1 173 ? 18.794  9.625   51.474  1.00 23.49  ? 171 GLN B CD  1 
ATOM   3232 O OE1 . GLN B 1 173 ? 18.660  10.318  52.474  1.00 25.89  ? 171 GLN B OE1 1 
ATOM   3233 N NE2 . GLN B 1 173 ? 19.994  9.292   50.981  1.00 22.32  ? 171 GLN B NE2 1 
ATOM   3234 N N   . PHE B 1 174 ? 13.820  9.590   50.950  1.00 23.86  ? 172 PHE B N   1 
ATOM   3235 C CA  . PHE B 1 174 ? 12.948  10.633  50.430  1.00 25.05  ? 172 PHE B CA  1 
ATOM   3236 C C   . PHE B 1 174 ? 13.331  11.866  51.205  1.00 26.58  ? 172 PHE B C   1 
ATOM   3237 O O   . PHE B 1 174 ? 13.038  11.968  52.394  1.00 26.32  ? 172 PHE B O   1 
ATOM   3238 C CB  . PHE B 1 174 ? 11.496  10.263  50.720  1.00 24.42  ? 172 PHE B CB  1 
ATOM   3239 C CG  . PHE B 1 174 ? 10.477  11.104  50.008  1.00 25.07  ? 172 PHE B CG  1 
ATOM   3240 C CD1 . PHE B 1 174 ? 10.708  11.586  48.731  1.00 23.05  ? 172 PHE B CD1 1 
ATOM   3241 C CD2 . PHE B 1 174 ? 9.221   11.347  50.605  1.00 24.71  ? 172 PHE B CD2 1 
ATOM   3242 C CE1 . PHE B 1 174 ? 9.718   12.329  48.064  1.00 24.48  ? 172 PHE B CE1 1 
ATOM   3243 C CE2 . PHE B 1 174 ? 8.225   12.091  49.939  1.00 23.93  ? 172 PHE B CE2 1 
ATOM   3244 C CZ  . PHE B 1 174 ? 8.472   12.578  48.674  1.00 21.88  ? 172 PHE B CZ  1 
ATOM   3245 N N   . MET B 1 175 ? 13.956  12.803  50.508  1.00 27.86  ? 173 MET B N   1 
ATOM   3246 C CA  A MET B 1 175 ? 14.641  13.958  51.081  0.50 29.57  ? 173 MET B CA  1 
ATOM   3247 C CA  B MET B 1 175 ? 14.585  13.931  51.171  0.50 29.54  ? 173 MET B CA  1 
ATOM   3248 C C   . MET B 1 175 ? 13.880  15.236  50.820  1.00 30.03  ? 173 MET B C   1 
ATOM   3249 O O   . MET B 1 175 ? 13.617  15.536  49.664  1.00 29.78  ? 173 MET B O   1 
ATOM   3250 C CB  A MET B 1 175 ? 15.962  14.114  50.341  0.50 30.01  ? 173 MET B CB  1 
ATOM   3251 C CB  B MET B 1 175 ? 16.084  13.967  50.834  0.50 29.36  ? 173 MET B CB  1 
ATOM   3252 C CG  A MET B 1 175 ? 17.100  14.574  51.150  0.50 31.94  ? 173 MET B CG  1 
ATOM   3253 C CG  B MET B 1 175 ? 16.947  14.815  51.744  0.50 30.33  ? 173 MET B CG  1 
ATOM   3254 S SD  A MET B 1 175 ? 17.893  13.090  51.709  0.50 36.58  ? 173 MET B SD  1 
ATOM   3255 S SD  B MET B 1 175 ? 18.708  14.558  51.396  0.50 31.09  ? 173 MET B SD  1 
ATOM   3256 C CE  A MET B 1 175 ? 17.285  13.014  53.406  0.50 35.78  ? 173 MET B CE  1 
ATOM   3257 C CE  B MET B 1 175 ? 19.188  13.596  52.830  0.50 30.72  ? 173 MET B CE  1 
ATOM   3258 N N   . GLN B 1 176 ? 13.561  16.004  51.862  1.00 31.50  ? 174 GLN B N   1 
ATOM   3259 C CA  . GLN B 1 176 ? 12.874  17.294  51.688  1.00 33.32  ? 174 GLN B CA  1 
ATOM   3260 C C   . GLN B 1 176 ? 13.838  18.451  51.545  1.00 33.32  ? 174 GLN B C   1 
ATOM   3261 O O   . GLN B 1 176 ? 14.590  18.745  52.459  1.00 33.96  ? 174 GLN B O   1 
ATOM   3262 C CB  . GLN B 1 176 ? 11.941  17.584  52.861  1.00 34.22  ? 174 GLN B CB  1 
ATOM   3263 C CG  . GLN B 1 176 ? 10.810  18.522  52.482  1.00 37.16  ? 174 GLN B CG  1 
ATOM   3264 C CD  . GLN B 1 176 ? 10.259  19.303  53.649  1.00 41.05  ? 174 GLN B CD  1 
ATOM   3265 O OE1 . GLN B 1 176 ? 10.298  18.852  54.803  1.00 44.30  ? 174 GLN B OE1 1 
ATOM   3266 N NE2 . GLN B 1 176 ? 9.732   20.488  53.357  1.00 42.53  ? 174 GLN B NE2 1 
ATOM   3267 N N   . GLY B 1 177 ? 13.807  19.115  50.398  1.00 33.80  ? 175 GLY B N   1 
ATOM   3268 C CA  . GLY B 1 177 ? 14.628  20.306  50.177  1.00 34.00  ? 175 GLY B CA  1 
ATOM   3269 C C   . GLY B 1 177 ? 13.839  21.567  50.485  1.00 34.54  ? 175 GLY B C   1 
ATOM   3270 O O   . GLY B 1 177 ? 12.757  21.509  51.091  1.00 34.38  ? 175 GLY B O   1 
ATOM   3271 N N   . ALA B 1 178 ? 14.375  22.710  50.057  1.00 34.98  ? 176 ALA B N   1 
ATOM   3272 C CA  . ALA B 1 178 ? 13.693  23.997  50.215  1.00 35.34  ? 176 ALA B CA  1 
ATOM   3273 C C   . ALA B 1 178 ? 12.300  23.989  49.573  1.00 35.23  ? 176 ALA B C   1 
ATOM   3274 O O   . ALA B 1 178 ? 11.292  24.315  50.225  1.00 36.03  ? 176 ALA B O   1 
ATOM   3275 C CB  . ALA B 1 178 ? 14.556  25.135  49.642  1.00 35.45  ? 176 ALA B CB  1 
ATOM   3276 N N   . ARG B 1 179 ? 12.232  23.591  48.304  1.00 34.75  ? 177 ARG B N   1 
ATOM   3277 C CA  . ARG B 1 179 ? 10.965  23.656  47.569  1.00 33.91  ? 177 ARG B CA  1 
ATOM   3278 C C   . ARG B 1 179 ? 10.478  22.308  47.042  1.00 32.24  ? 177 ARG B C   1 
ATOM   3279 O O   . ARG B 1 179 ? 9.284   22.122  46.870  1.00 32.68  ? 177 ARG B O   1 
ATOM   3280 C CB  . ARG B 1 179 ? 11.063  24.652  46.420  1.00 34.87  ? 177 ARG B CB  1 
ATOM   3281 C CG  . ARG B 1 179 ? 11.610  26.012  46.808  1.00 38.37  ? 177 ARG B CG  1 
ATOM   3282 C CD  . ARG B 1 179 ? 12.395  26.597  45.644  1.00 44.78  ? 177 ARG B CD  1 
ATOM   3283 N NE  . ARG B 1 179 ? 13.523  25.747  45.236  1.00 47.57  ? 177 ARG B NE  1 
ATOM   3284 C CZ  . ARG B 1 179 ? 14.131  25.819  44.047  1.00 50.06  ? 177 ARG B CZ  1 
ATOM   3285 N NH1 . ARG B 1 179 ? 13.724  26.690  43.119  1.00 50.08  ? 177 ARG B NH1 1 
ATOM   3286 N NH2 . ARG B 1 179 ? 15.146  25.007  43.776  1.00 50.93  ? 177 ARG B NH2 1 
ATOM   3287 N N   . PHE B 1 180 ? 11.396  21.366  46.828  1.00 29.99  ? 178 PHE B N   1 
ATOM   3288 C CA  . PHE B 1 180 ? 11.070  20.077  46.204  1.00 27.59  ? 178 PHE B CA  1 
ATOM   3289 C C   . PHE B 1 180 ? 11.482  18.892  47.066  1.00 26.48  ? 178 PHE B C   1 
ATOM   3290 O O   . PHE B 1 180 ? 12.192  19.063  48.056  1.00 25.52  ? 178 PHE B O   1 
ATOM   3291 C CB  . PHE B 1 180 ? 11.739  20.017  44.838  1.00 26.60  ? 178 PHE B CB  1 
ATOM   3292 C CG  . PHE B 1 180 ? 11.390  21.182  43.971  1.00 26.74  ? 178 PHE B CG  1 
ATOM   3293 C CD1 . PHE B 1 180 ? 10.091  21.346  43.508  1.00 25.13  ? 178 PHE B CD1 1 
ATOM   3294 C CD2 . PHE B 1 180 ? 12.336  22.143  43.654  1.00 26.52  ? 178 PHE B CD2 1 
ATOM   3295 C CE1 . PHE B 1 180 ? 9.740   22.430  42.726  1.00 25.91  ? 178 PHE B CE1 1 
ATOM   3296 C CE2 . PHE B 1 180 ? 11.988  23.237  42.867  1.00 27.66  ? 178 PHE B CE2 1 
ATOM   3297 C CZ  . PHE B 1 180 ? 10.688  23.374  42.398  1.00 26.62  ? 178 PHE B CZ  1 
ATOM   3298 N N   . TRP B 1 181 ? 10.996  17.703  46.703  1.00 24.96  ? 179 TRP B N   1 
ATOM   3299 C CA  . TRP B 1 181 ? 11.474  16.461  47.288  1.00 24.03  ? 179 TRP B CA  1 
ATOM   3300 C C   . TRP B 1 181 ? 12.485  15.755  46.377  1.00 22.72  ? 179 TRP B C   1 
ATOM   3301 O O   . TRP B 1 181 ? 12.504  15.958  45.158  1.00 21.93  ? 179 TRP B O   1 
ATOM   3302 C CB  . TRP B 1 181 ? 10.319  15.512  47.576  1.00 25.48  ? 179 TRP B CB  1 
ATOM   3303 C CG  . TRP B 1 181 ? 9.439   15.949  48.669  1.00 25.51  ? 179 TRP B CG  1 
ATOM   3304 C CD1 . TRP B 1 181 ? 8.357   16.759  48.564  1.00 26.81  ? 179 TRP B CD1 1 
ATOM   3305 C CD2 . TRP B 1 181 ? 9.560   15.602  50.055  1.00 27.56  ? 179 TRP B CD2 1 
ATOM   3306 N NE1 . TRP B 1 181 ? 7.779   16.936  49.804  1.00 28.40  ? 179 TRP B NE1 1 
ATOM   3307 C CE2 . TRP B 1 181 ? 8.498   16.242  50.738  1.00 27.42  ? 179 TRP B CE2 1 
ATOM   3308 C CE3 . TRP B 1 181 ? 10.466  14.821  50.787  1.00 27.53  ? 179 TRP B CE3 1 
ATOM   3309 C CZ2 . TRP B 1 181 ? 8.315   16.131  52.128  1.00 28.20  ? 179 TRP B CZ2 1 
ATOM   3310 C CZ3 . TRP B 1 181 ? 10.278  14.688  52.166  1.00 28.75  ? 179 TRP B CZ3 1 
ATOM   3311 C CH2 . TRP B 1 181 ? 9.202   15.342  52.823  1.00 28.20  ? 179 TRP B CH2 1 
ATOM   3312 N N   . HIS B 1 182 ? 13.317  14.918  46.979  1.00 20.95  ? 180 HIS B N   1 
ATOM   3313 C CA  . HIS B 1 182 ? 14.342  14.214  46.218  1.00 20.74  ? 180 HIS B CA  1 
ATOM   3314 C C   . HIS B 1 182 ? 14.407  12.776  46.636  1.00 20.06  ? 180 HIS B C   1 
ATOM   3315 O O   . HIS B 1 182 ? 14.381  12.466  47.810  1.00 19.40  ? 180 HIS B O   1 
ATOM   3316 C CB  . HIS B 1 182 ? 15.714  14.886  46.363  1.00 19.85  ? 180 HIS B CB  1 
ATOM   3317 C CG  . HIS B 1 182 ? 15.673  16.358  46.116  1.00 18.87  ? 180 HIS B CG  1 
ATOM   3318 N ND1 . HIS B 1 182 ? 15.818  16.903  44.858  1.00 17.56  ? 180 HIS B ND1 1 
ATOM   3319 C CD2 . HIS B 1 182 ? 15.442  17.396  46.955  1.00 16.40  ? 180 HIS B CD2 1 
ATOM   3320 C CE1 . HIS B 1 182 ? 15.705  18.219  44.937  1.00 16.87  ? 180 HIS B CE1 1 
ATOM   3321 N NE2 . HIS B 1 182 ? 15.471  18.540  46.196  1.00 18.07  ? 180 HIS B NE2 1 
ATOM   3322 N N   . VAL B 1 183 ? 14.519  11.908  45.638  1.00 20.39  ? 181 VAL B N   1 
ATOM   3323 C CA  . VAL B 1 183 ? 14.596  10.466  45.855  1.00 19.27  ? 181 VAL B CA  1 
ATOM   3324 C C   . VAL B 1 183 ? 15.967  9.994   45.380  1.00 20.21  ? 181 VAL B C   1 
ATOM   3325 O O   . VAL B 1 183 ? 16.392  10.289  44.264  1.00 19.43  ? 181 VAL B O   1 
ATOM   3326 C CB  . VAL B 1 183 ? 13.462  9.717   45.111  1.00 19.04  ? 181 VAL B CB  1 
ATOM   3327 C CG1 . VAL B 1 183 ? 13.591  8.198   45.305  1.00 15.56  ? 181 VAL B CG1 1 
ATOM   3328 C CG2 . VAL B 1 183 ? 12.059  10.232  45.593  1.00 17.34  ? 181 VAL B CG2 1 
ATOM   3329 N N   . LEU B 1 184 ? 16.643  9.240   46.240  1.00 20.73  ? 182 LEU B N   1 
ATOM   3330 C CA  . LEU B 1 184 ? 18.002  8.840   45.973  1.00 21.97  ? 182 LEU B CA  1 
ATOM   3331 C C   . LEU B 1 184 ? 18.360  7.674   46.868  1.00 23.13  ? 182 LEU B C   1 
ATOM   3332 O O   . LEU B 1 184 ? 17.652  7.355   47.833  1.00 24.20  ? 182 LEU B O   1 
ATOM   3333 C CB  . LEU B 1 184 ? 18.971  10.035  46.183  1.00 21.35  ? 182 LEU B CB  1 
ATOM   3334 C CG  . LEU B 1 184 ? 19.170  10.626  47.587  1.00 20.67  ? 182 LEU B CG  1 
ATOM   3335 C CD1 . LEU B 1 184 ? 20.576  11.191  47.696  1.00 20.09  ? 182 LEU B CD1 1 
ATOM   3336 C CD2 . LEU B 1 184 ? 18.117  11.701  47.936  1.00 18.46  ? 182 LEU B CD2 1 
ATOM   3337 N N   . ASP B 1 185 ? 19.469  7.045   46.528  1.00 24.12  ? 183 ASP B N   1 
ATOM   3338 C CA  . ASP B 1 185 ? 20.118  6.005   47.315  1.00 24.88  ? 183 ASP B CA  1 
ATOM   3339 C C   . ASP B 1 185 ? 20.117  6.365   48.792  1.00 24.69  ? 183 ASP B C   1 
ATOM   3340 O O   . ASP B 1 185 ? 20.617  7.427   49.164  1.00 24.58  ? 183 ASP B O   1 
ATOM   3341 C CB  . ASP B 1 185 ? 21.561  5.930   46.785  1.00 25.91  ? 183 ASP B CB  1 
ATOM   3342 C CG  . ASP B 1 185 ? 22.350  4.744   47.307  1.00 27.06  ? 183 ASP B CG  1 
ATOM   3343 O OD1 . ASP B 1 185 ? 22.025  4.177   48.386  1.00 26.35  ? 183 ASP B OD1 1 
ATOM   3344 O OD2 . ASP B 1 185 ? 23.349  4.418   46.611  1.00 29.93  ? 183 ASP B OD2 1 
ATOM   3345 N N   . ALA B 1 186 ? 19.569  5.480   49.628  1.00 25.00  ? 184 ALA B N   1 
ATOM   3346 C CA  . ALA B 1 186 ? 19.486  5.684   51.083  1.00 25.21  ? 184 ALA B CA  1 
ATOM   3347 C C   . ALA B 1 186 ? 20.849  5.794   51.781  1.00 26.23  ? 184 ALA B C   1 
ATOM   3348 O O   . ALA B 1 186 ? 20.980  6.428   52.838  1.00 24.98  ? 184 ALA B O   1 
ATOM   3349 C CB  . ALA B 1 186 ? 18.690  4.575   51.720  1.00 25.87  ? 184 ALA B CB  1 
ATOM   3350 N N   . SER B 1 187 ? 21.864  5.172   51.199  1.00 27.16  ? 185 SER B N   1 
ATOM   3351 C CA  . SER B 1 187 ? 23.168  5.134   51.854  1.00 28.66  ? 185 SER B CA  1 
ATOM   3352 C C   . SER B 1 187 ? 24.051  6.284   51.361  1.00 29.21  ? 185 SER B C   1 
ATOM   3353 O O   . SER B 1 187 ? 25.228  6.382   51.711  1.00 30.65  ? 185 SER B O   1 
ATOM   3354 C CB  . SER B 1 187 ? 23.831  3.769   51.627  1.00 28.80  ? 185 SER B CB  1 
ATOM   3355 O OG  . SER B 1 187 ? 24.243  3.624   50.283  1.00 29.92  ? 185 SER B OG  1 
ATOM   3356 N N   . ALA B 1 188 ? 23.478  7.167   50.546  1.00 29.08  ? 186 ALA B N   1 
ATOM   3357 C CA  . ALA B 1 188 ? 24.167  8.393   50.149  1.00 27.50  ? 186 ALA B CA  1 
ATOM   3358 C C   . ALA B 1 188 ? 23.740  9.560   51.038  1.00 26.68  ? 186 ALA B C   1 
ATOM   3359 O O   . ALA B 1 188 ? 22.734  9.482   51.758  1.00 26.90  ? 186 ALA B O   1 
ATOM   3360 C CB  . ALA B 1 188 ? 23.920  8.681   48.669  1.00 27.61  ? 186 ALA B CB  1 
ATOM   3361 N N   . GLY B 1 189 ? 24.506  10.645  51.023  1.00 26.05  ? 187 GLY B N   1 
ATOM   3362 C CA  . GLY B 1 189 ? 24.163  11.819  51.838  1.00 24.62  ? 187 GLY B CA  1 
ATOM   3363 C C   . GLY B 1 189 ? 25.257  12.875  51.771  1.00 24.70  ? 187 GLY B C   1 
ATOM   3364 O O   . GLY B 1 189 ? 26.436  12.546  51.525  1.00 24.72  ? 187 GLY B O   1 
ATOM   3365 N N   . LYS B 1 190 ? 24.870  14.136  51.971  1.00 23.61  ? 188 LYS B N   1 
ATOM   3366 C CA  . LYS B 1 190 ? 25.816  15.251  51.984  1.00 23.58  ? 188 LYS B CA  1 
ATOM   3367 C C   . LYS B 1 190 ? 26.970  15.047  52.988  1.00 23.12  ? 188 LYS B C   1 
ATOM   3368 O O   . LYS B 1 190 ? 28.128  15.317  52.681  1.00 22.83  ? 188 LYS B O   1 
ATOM   3369 C CB  . LYS B 1 190 ? 25.090  16.562  52.256  1.00 23.16  ? 188 LYS B CB  1 
ATOM   3370 C CG  . LYS B 1 190 ? 24.370  17.122  51.041  1.00 23.21  ? 188 LYS B CG  1 
ATOM   3371 C CD  . LYS B 1 190 ? 23.259  18.061  51.484  1.00 23.53  ? 188 LYS B CD  1 
ATOM   3372 C CE  . LYS B 1 190 ? 22.676  18.829  50.301  1.00 26.40  ? 188 LYS B CE  1 
ATOM   3373 N NZ  . LYS B 1 190 ? 21.772  19.951  50.779  1.00 25.29  ? 188 LYS B NZ  1 
ATOM   3374 N N   . ASP B 1 191 ? 26.639  14.548  54.176  1.00 23.11  ? 189 ASP B N   1 
ATOM   3375 C CA  . ASP B 1 191 ? 27.636  14.187  55.185  1.00 22.40  ? 189 ASP B CA  1 
ATOM   3376 C C   . ASP B 1 191 ? 28.573  13.074  54.729  1.00 21.89  ? 189 ASP B C   1 
ATOM   3377 O O   . ASP B 1 191 ? 29.773  13.159  54.941  1.00 22.03  ? 189 ASP B O   1 
ATOM   3378 C CB  . ASP B 1 191 ? 26.954  13.840  56.520  1.00 22.83  ? 189 ASP B CB  1 
ATOM   3379 C CG  . ASP B 1 191 ? 25.848  12.773  56.385  1.00 24.59  ? 189 ASP B CG  1 
ATOM   3380 O OD1 . ASP B 1 191 ? 25.433  12.400  55.259  1.00 22.05  ? 189 ASP B OD1 1 
ATOM   3381 O OD2 . ASP B 1 191 ? 25.389  12.305  57.453  1.00 29.63  ? 189 ASP B OD2 1 
ATOM   3382 N N   . GLN B 1 192 ? 28.029  12.036  54.096  1.00 21.72  ? 190 GLN B N   1 
ATOM   3383 C CA  . GLN B 1 192 ? 28.825  10.905  53.623  1.00 21.28  ? 190 GLN B CA  1 
ATOM   3384 C C   . GLN B 1 192 ? 29.797  11.389  52.562  1.00 19.97  ? 190 GLN B C   1 
ATOM   3385 O O   . GLN B 1 192 ? 30.991  11.084  52.619  1.00 19.33  ? 190 GLN B O   1 
ATOM   3386 C CB  . GLN B 1 192 ? 27.930  9.811   53.020  1.00 22.31  ? 190 GLN B CB  1 
ATOM   3387 C CG  . GLN B 1 192 ? 26.792  9.338   53.926  1.00 26.48  ? 190 GLN B CG  1 
ATOM   3388 C CD  . GLN B 1 192 ? 27.307  8.532   55.093  1.00 32.55  ? 190 GLN B CD  1 
ATOM   3389 O OE1 . GLN B 1 192 ? 27.079  8.880   56.260  1.00 34.75  ? 190 GLN B OE1 1 
ATOM   3390 N NE2 . GLN B 1 192 ? 28.036  7.455   54.790  1.00 35.50  ? 190 GLN B NE2 1 
ATOM   3391 N N   . ALA B 1 193 ? 29.269  12.145  51.596  1.00 18.89  ? 191 ALA B N   1 
ATOM   3392 C CA  . ALA B 1 193 ? 30.076  12.716  50.511  1.00 18.05  ? 191 ALA B CA  1 
ATOM   3393 C C   . ALA B 1 193 ? 31.198  13.584  51.080  1.00 18.12  ? 191 ALA B C   1 
ATOM   3394 O O   . ALA B 1 193 ? 32.359  13.451  50.683  1.00 18.90  ? 191 ALA B O   1 
ATOM   3395 C CB  . ALA B 1 193 ? 29.202  13.497  49.575  1.00 16.29  ? 191 ALA B CB  1 
ATOM   3396 N N   . ALA B 1 194 ? 30.841  14.461  52.020  1.00 18.16  ? 192 ALA B N   1 
ATOM   3397 C CA  . ALA B 1 194 ? 31.782  15.365  52.669  1.00 18.44  ? 192 ALA B CA  1 
ATOM   3398 C C   . ALA B 1 194 ? 32.859  14.558  53.367  1.00 18.57  ? 192 ALA B C   1 
ATOM   3399 O O   . ALA B 1 194 ? 34.049  14.856  53.228  1.00 19.36  ? 192 ALA B O   1 
ATOM   3400 C CB  . ALA B 1 194 ? 31.062  16.263  53.676  1.00 17.94  ? 192 ALA B CB  1 
ATOM   3401 N N   . ASN B 1 195 ? 32.457  13.526  54.109  1.00 18.58  ? 193 ASN B N   1 
ATOM   3402 C CA  . ASN B 1 195 ? 33.423  12.650  54.771  1.00 18.22  ? 193 ASN B CA  1 
ATOM   3403 C C   . ASN B 1 195 ? 34.474  12.097  53.828  1.00 17.99  ? 193 ASN B C   1 
ATOM   3404 O O   . ASN B 1 195 ? 35.641  12.059  54.173  1.00 18.43  ? 193 ASN B O   1 
ATOM   3405 C CB  . ASN B 1 195 ? 32.722  11.478  55.482  1.00 19.28  ? 193 ASN B CB  1 
ATOM   3406 C CG  . ASN B 1 195 ? 32.143  11.866  56.842  1.00 19.15  ? 193 ASN B CG  1 
ATOM   3407 O OD1 . ASN B 1 195 ? 32.418  12.944  57.356  1.00 21.24  ? 193 ASN B OD1 1 
ATOM   3408 N ND2 . ASN B 1 195 ? 31.313  10.987  57.412  1.00 19.06  ? 193 ASN B ND2 1 
ATOM   3409 N N   . TRP B 1 196 ? 34.040  11.667  52.650  1.00 17.61  ? 194 TRP B N   1 
ATOM   3410 C CA  . TRP B 1 196 ? 34.893  11.042  51.659  1.00 18.24  ? 194 TRP B CA  1 
ATOM   3411 C C   . TRP B 1 196 ? 35.885  12.042  51.062  1.00 17.75  ? 194 TRP B C   1 
ATOM   3412 O O   . TRP B 1 196 ? 37.069  11.745  50.908  1.00 18.61  ? 194 TRP B O   1 
ATOM   3413 C CB  . TRP B 1 196 ? 34.035  10.397  50.532  1.00 18.72  ? 194 TRP B CB  1 
ATOM   3414 C CG  . TRP B 1 196 ? 34.895  9.686   49.550  1.00 18.68  ? 194 TRP B CG  1 
ATOM   3415 C CD1 . TRP B 1 196 ? 35.313  8.379   49.622  1.00 20.66  ? 194 TRP B CD1 1 
ATOM   3416 C CD2 . TRP B 1 196 ? 35.495  10.235  48.374  1.00 18.83  ? 194 TRP B CD2 1 
ATOM   3417 N NE1 . TRP B 1 196 ? 36.141  8.089   48.559  1.00 20.89  ? 194 TRP B NE1 1 
ATOM   3418 C CE2 . TRP B 1 196 ? 36.271  9.208   47.782  1.00 19.62  ? 194 TRP B CE2 1 
ATOM   3419 C CE3 . TRP B 1 196 ? 35.451  11.497  47.753  1.00 17.81  ? 194 TRP B CE3 1 
ATOM   3420 C CZ2 . TRP B 1 196 ? 36.990  9.405   46.609  1.00 18.99  ? 194 TRP B CZ2 1 
ATOM   3421 C CZ3 . TRP B 1 196 ? 36.146  11.689  46.613  1.00 18.64  ? 194 TRP B CZ3 1 
ATOM   3422 C CH2 . TRP B 1 196 ? 36.924  10.652  46.042  1.00 19.43  ? 194 TRP B CH2 1 
ATOM   3423 N N   . ILE B 1 197 ? 35.368  13.214  50.701  1.00 17.89  ? 195 ILE B N   1 
ATOM   3424 C CA  . ILE B 1 197 ? 36.154  14.371  50.275  1.00 16.54  ? 195 ILE B CA  1 
ATOM   3425 C C   . ILE B 1 197 ? 37.203  14.774  51.322  1.00 16.88  ? 195 ILE B C   1 
ATOM   3426 O O   . ILE B 1 197 ? 38.375  14.939  50.993  1.00 17.18  ? 195 ILE B O   1 
ATOM   3427 C CB  . ILE B 1 197 ? 35.226  15.569  49.903  1.00 16.67  ? 195 ILE B CB  1 
ATOM   3428 C CG1 . ILE B 1 197 ? 34.491  15.253  48.574  1.00 16.64  ? 195 ILE B CG1 1 
ATOM   3429 C CG2 . ILE B 1 197 ? 36.020  16.868  49.768  1.00 15.93  ? 195 ILE B CG2 1 
ATOM   3430 C CD1 . ILE B 1 197 ? 33.471  16.261  48.156  1.00 15.21  ? 195 ILE B CD1 1 
ATOM   3431 N N   . ILE B 1 198 ? 36.791  14.927  52.575  1.00 16.28  ? 196 ILE B N   1 
ATOM   3432 C CA  . ILE B 1 198 ? 37.735  15.239  53.656  1.00 15.98  ? 196 ILE B CA  1 
ATOM   3433 C C   . ILE B 1 198 ? 38.850  14.172  53.765  1.00 16.76  ? 196 ILE B C   1 
ATOM   3434 O O   . ILE B 1 198 ? 40.028  14.515  53.867  1.00 16.77  ? 196 ILE B O   1 
ATOM   3435 C CB  . ILE B 1 198 ? 37.003  15.416  55.013  1.00 15.32  ? 196 ILE B CB  1 
ATOM   3436 C CG1 . ILE B 1 198 ? 36.031  16.617  54.924  1.00 15.79  ? 196 ILE B CG1 1 
ATOM   3437 C CG2 . ILE B 1 198 ? 38.029  15.645  56.150  1.00 13.80  ? 196 ILE B CG2 1 
ATOM   3438 C CD1 . ILE B 1 198 ? 34.939  16.658  55.988  1.00 15.82  ? 196 ILE B CD1 1 
ATOM   3439 N N   . ALA B 1 199 ? 38.465  12.890  53.718  1.00 17.03  ? 197 ALA B N   1 
ATOM   3440 C CA  . ALA B 1 199 ? 39.405  11.778  53.848  1.00 17.53  ? 197 ALA B CA  1 
ATOM   3441 C C   . ALA B 1 199 ? 40.400  11.804  52.704  1.00 17.61  ? 197 ALA B C   1 
ATOM   3442 O O   . ALA B 1 199 ? 41.568  11.493  52.888  1.00 18.80  ? 197 ALA B O   1 
ATOM   3443 C CB  . ALA B 1 199 ? 38.646  10.408  53.889  1.00 16.57  ? 197 ALA B CB  1 
ATOM   3444 N N   . THR B 1 200 ? 39.930  12.181  51.519  1.00 18.14  ? 198 THR B N   1 
ATOM   3445 C CA  . THR B 1 200 ? 40.789  12.243  50.340  1.00 17.81  ? 198 THR B CA  1 
ATOM   3446 C C   . THR B 1 200 ? 41.827  13.333  50.480  1.00 17.80  ? 198 THR B C   1 
ATOM   3447 O O   . THR B 1 200 ? 42.996  13.068  50.278  1.00 17.88  ? 198 THR B O   1 
ATOM   3448 C CB  . THR B 1 200 ? 39.982  12.359  49.026  1.00 17.45  ? 198 THR B CB  1 
ATOM   3449 O OG1 . THR B 1 200 ? 39.099  11.244  48.960  1.00 19.06  ? 198 THR B OG1 1 
ATOM   3450 C CG2 . THR B 1 200 ? 40.887  12.301  47.816  1.00 16.00  ? 198 THR B CG2 1 
ATOM   3451 N N   . TYR B 1 201 ? 41.412  14.543  50.853  1.00 17.94  ? 199 TYR B N   1 
ATOM   3452 C CA  . TYR B 1 201 ? 42.379  15.617  51.128  1.00 18.27  ? 199 TYR B CA  1 
ATOM   3453 C C   . TYR B 1 201 ? 43.396  15.210  52.202  1.00 18.19  ? 199 TYR B C   1 
ATOM   3454 O O   . TYR B 1 201 ? 44.546  15.606  52.150  1.00 18.17  ? 199 TYR B O   1 
ATOM   3455 C CB  . TYR B 1 201 ? 41.691  16.941  51.532  1.00 17.86  ? 199 TYR B CB  1 
ATOM   3456 C CG  . TYR B 1 201 ? 41.180  17.813  50.390  1.00 17.65  ? 199 TYR B CG  1 
ATOM   3457 C CD1 . TYR B 1 201 ? 42.059  18.608  49.631  1.00 17.66  ? 199 TYR B CD1 1 
ATOM   3458 C CD2 . TYR B 1 201 ? 39.811  17.891  50.109  1.00 15.73  ? 199 TYR B CD2 1 
ATOM   3459 C CE1 . TYR B 1 201 ? 41.592  19.430  48.599  1.00 16.67  ? 199 TYR B CE1 1 
ATOM   3460 C CE2 . TYR B 1 201 ? 39.332  18.691  49.085  1.00 17.53  ? 199 TYR B CE2 1 
ATOM   3461 C CZ  . TYR B 1 201 ? 40.220  19.458  48.327  1.00 19.04  ? 199 TYR B CZ  1 
ATOM   3462 O OH  . TYR B 1 201 ? 39.710  20.263  47.331  1.00 19.31  ? 199 TYR B OH  1 
ATOM   3463 N N   . GLN B 1 202 ? 42.947  14.447  53.189  1.00 19.34  ? 200 GLN B N   1 
ATOM   3464 C CA  . GLN B 1 202 ? 43.808  14.033  54.292  1.00 19.85  ? 200 GLN B CA  1 
ATOM   3465 C C   . GLN B 1 202 ? 44.876  13.027  53.833  1.00 20.35  ? 200 GLN B C   1 
ATOM   3466 O O   . GLN B 1 202 ? 46.042  13.146  54.206  1.00 19.47  ? 200 GLN B O   1 
ATOM   3467 C CB  . GLN B 1 202 ? 42.961  13.438  55.417  1.00 19.60  ? 200 GLN B CB  1 
ATOM   3468 C CG  . GLN B 1 202 ? 43.779  12.905  56.597  1.00 20.09  ? 200 GLN B CG  1 
ATOM   3469 C CD  . GLN B 1 202 ? 42.906  12.455  57.759  1.00 20.26  ? 200 GLN B CD  1 
ATOM   3470 O OE1 . GLN B 1 202 ? 42.595  11.273  57.893  1.00 22.75  ? 200 GLN B OE1 1 
ATOM   3471 N NE2 . GLN B 1 202 ? 42.500  13.395  58.592  1.00 18.35  ? 200 GLN B NE2 1 
ATOM   3472 N N   . GLN B 1 203 ? 44.479  12.027  53.043  1.00 21.49  ? 201 GLN B N   1 
ATOM   3473 C CA  A GLN B 1 203 ? 45.465  11.084  52.511  0.50 22.13  ? 201 GLN B CA  1 
ATOM   3474 C CA  B GLN B 1 203 ? 45.433  11.081  52.472  0.50 22.46  ? 201 GLN B CA  1 
ATOM   3475 C C   . GLN B 1 203 ? 46.409  11.754  51.502  1.00 22.37  ? 201 GLN B C   1 
ATOM   3476 O O   . GLN B 1 203 ? 47.585  11.483  51.515  1.00 23.29  ? 201 GLN B O   1 
ATOM   3477 C CB  A GLN B 1 203 ? 44.823  9.793   51.959  0.50 22.62  ? 201 GLN B CB  1 
ATOM   3478 C CB  B GLN B 1 203 ? 44.723  9.897   51.800  0.50 23.09  ? 201 GLN B CB  1 
ATOM   3479 C CG  A GLN B 1 203 ? 45.807  8.697   51.437  0.50 22.18  ? 201 GLN B CG  1 
ATOM   3480 C CG  B GLN B 1 203 ? 43.997  10.219  50.504  0.50 24.43  ? 201 GLN B CG  1 
ATOM   3481 C CD  A GLN B 1 203 ? 46.856  8.207   52.469  0.50 24.52  ? 201 GLN B CD  1 
ATOM   3482 C CD  B GLN B 1 203 ? 43.861  9.013   49.608  0.50 27.57  ? 201 GLN B CD  1 
ATOM   3483 O OE1 A GLN B 1 203 ? 48.056  8.471   52.314  0.50 27.58  ? 201 GLN B OE1 1 
ATOM   3484 O OE1 B GLN B 1 203 ? 44.860  8.391   49.244  0.50 29.78  ? 201 GLN B OE1 1 
ATOM   3485 N NE2 A GLN B 1 203 ? 46.413  7.482   53.497  0.50 22.29  ? 201 GLN B NE2 1 
ATOM   3486 N NE2 B GLN B 1 203 ? 42.622  8.671   49.242  0.50 26.79  ? 201 GLN B NE2 1 
ATOM   3487 N N   . LEU B 1 204 ? 45.917  12.648  50.661  1.00 22.02  ? 202 LEU B N   1 
ATOM   3488 C CA  . LEU B 1 204 ? 46.818  13.272  49.699  1.00 22.34  ? 202 LEU B CA  1 
ATOM   3489 C C   . LEU B 1 204 ? 47.856  14.175  50.356  1.00 21.58  ? 202 LEU B C   1 
ATOM   3490 O O   . LEU B 1 204 ? 49.038  14.131  49.981  1.00 21.65  ? 202 LEU B O   1 
ATOM   3491 C CB  . LEU B 1 204 ? 46.056  14.040  48.617  1.00 22.28  ? 202 LEU B CB  1 
ATOM   3492 C CG  . LEU B 1 204 ? 45.216  13.147  47.695  1.00 24.58  ? 202 LEU B CG  1 
ATOM   3493 C CD1 . LEU B 1 204 ? 44.351  14.022  46.825  1.00 24.77  ? 202 LEU B CD1 1 
ATOM   3494 C CD2 . LEU B 1 204 ? 46.095  12.264  46.829  1.00 26.73  ? 202 LEU B CD2 1 
ATOM   3495 N N   . SER B 1 205 ? 47.420  14.976  51.339  1.00 19.65  ? 203 SER B N   1 
ATOM   3496 C CA  . SER B 1 205 ? 48.304  15.952  51.984  1.00 18.25  ? 203 SER B CA  1 
ATOM   3497 C C   . SER B 1 205 ? 49.184  15.387  53.101  1.00 17.86  ? 203 SER B C   1 
ATOM   3498 O O   . SER B 1 205 ? 50.267  15.916  53.354  1.00 17.25  ? 203 SER B O   1 
ATOM   3499 C CB  . SER B 1 205 ? 47.494  17.126  52.548  1.00 17.57  ? 203 SER B CB  1 
ATOM   3500 O OG  . SER B 1 205 ? 46.629  16.675  53.572  1.00 16.22  ? 203 SER B OG  1 
ATOM   3501 N N   . GLY B 1 206 ? 48.698  14.354  53.783  1.00 17.37  ? 204 GLY B N   1 
ATOM   3502 C CA  . GLY B 1 206 ? 49.348  13.845  54.998  1.00 17.58  ? 204 GLY B CA  1 
ATOM   3503 C C   . GLY B 1 206 ? 48.921  14.597  56.256  1.00 18.72  ? 204 GLY B C   1 
ATOM   3504 O O   . GLY B 1 206 ? 49.392  14.319  57.369  1.00 18.43  ? 204 GLY B O   1 
ATOM   3505 N N   . LYS B 1 207 ? 48.001  15.547  56.091  1.00 18.51  ? 205 LYS B N   1 
ATOM   3506 C CA  . LYS B 1 207 ? 47.647  16.451  57.181  1.00 17.86  ? 205 LYS B CA  1 
ATOM   3507 C C   . LYS B 1 207 ? 46.132  16.501  57.382  1.00 17.90  ? 205 LYS B C   1 
ATOM   3508 O O   . LYS B 1 207 ? 45.373  16.483  56.402  1.00 17.81  ? 205 LYS B O   1 
ATOM   3509 C CB  . LYS B 1 207 ? 48.195  17.845  56.884  1.00 17.61  ? 205 LYS B CB  1 
ATOM   3510 C CG  . LYS B 1 207 ? 49.654  17.843  56.476  1.00 15.98  ? 205 LYS B CG  1 
ATOM   3511 C CD  . LYS B 1 207 ? 50.107  19.225  56.069  1.00 18.12  ? 205 LYS B CD  1 
ATOM   3512 C CE  . LYS B 1 207 ? 51.613  19.317  56.047  1.00 17.97  ? 205 LYS B CE  1 
ATOM   3513 N NZ  . LYS B 1 207 ? 52.040  20.545  55.357  1.00 17.33  ? 205 LYS B NZ  1 
ATOM   3514 N N   . ARG B 1 208 ? 45.695  16.560  58.639  1.00 16.91  ? 206 ARG B N   1 
ATOM   3515 C CA  . ARG B 1 208 ? 44.261  16.624  58.921  1.00 17.01  ? 206 ARG B CA  1 
ATOM   3516 C C   . ARG B 1 208 ? 43.675  17.908  58.335  1.00 16.84  ? 206 ARG B C   1 
ATOM   3517 O O   . ARG B 1 208 ? 44.145  19.001  58.652  1.00 17.03  ? 206 ARG B O   1 
ATOM   3518 C CB  . ARG B 1 208 ? 44.002  16.566  60.435  1.00 16.41  ? 206 ARG B CB  1 
ATOM   3519 C CG  . ARG B 1 208 ? 42.530  16.398  60.783  1.00 16.44  ? 206 ARG B CG  1 
ATOM   3520 C CD  . ARG B 1 208 ? 42.297  16.557  62.294  1.00 17.39  ? 206 ARG B CD  1 
ATOM   3521 N NE  . ARG B 1 208 ? 40.883  16.348  62.588  1.00 17.33  ? 206 ARG B NE  1 
ATOM   3522 C CZ  . ARG B 1 208 ? 39.954  17.301  62.527  1.00 17.80  ? 206 ARG B CZ  1 
ATOM   3523 N NH1 . ARG B 1 208 ? 40.273  18.547  62.177  1.00 13.85  ? 206 ARG B NH1 1 
ATOM   3524 N NH2 . ARG B 1 208 ? 38.694  17.001  62.811  1.00 17.22  ? 206 ARG B NH2 1 
ATOM   3525 N N   . PRO B 1 209 ? 42.665  17.795  57.455  1.00 16.99  ? 207 PRO B N   1 
ATOM   3526 C CA  . PRO B 1 209 ? 41.981  19.036  57.043  1.00 16.97  ? 207 PRO B CA  1 
ATOM   3527 C C   . PRO B 1 209 ? 41.256  19.719  58.210  1.00 17.58  ? 207 PRO B C   1 
ATOM   3528 O O   . PRO B 1 209 ? 40.786  19.054  59.130  1.00 17.40  ? 207 PRO B O   1 
ATOM   3529 C CB  . PRO B 1 209 ? 40.951  18.550  56.004  1.00 16.75  ? 207 PRO B CB  1 
ATOM   3530 C CG  . PRO B 1 209 ? 41.481  17.201  55.539  1.00 16.88  ? 207 PRO B CG  1 
ATOM   3531 C CD  . PRO B 1 209 ? 42.121  16.610  56.769  1.00 16.49  ? 207 PRO B CD  1 
ATOM   3532 N N   . THR B 1 210 ? 41.172  21.042  58.166  1.00 17.86  ? 208 THR B N   1 
ATOM   3533 C CA  . THR B 1 210 ? 40.280  21.774  59.060  1.00 17.32  ? 208 THR B CA  1 
ATOM   3534 C C   . THR B 1 210 ? 39.137  22.231  58.193  1.00 17.11  ? 208 THR B C   1 
ATOM   3535 O O   . THR B 1 210 ? 39.377  22.775  57.123  1.00 17.47  ? 208 THR B O   1 
ATOM   3536 C CB  . THR B 1 210 ? 40.969  22.991  59.675  1.00 17.16  ? 208 THR B CB  1 
ATOM   3537 O OG1 . THR B 1 210 ? 42.211  22.570  60.212  1.00 16.22  ? 208 THR B OG1 1 
ATOM   3538 C CG2 . THR B 1 210 ? 40.097  23.600  60.810  1.00 16.18  ? 208 THR B CG2 1 
ATOM   3539 N N   . THR B 1 211 ? 37.907  21.998  58.639  1.00 16.87  ? 209 THR B N   1 
ATOM   3540 C CA  . THR B 1 211 ? 36.742  22.204  57.779  1.00 17.21  ? 209 THR B CA  1 
ATOM   3541 C C   . THR B 1 211 ? 35.738  23.191  58.356  1.00 17.41  ? 209 THR B C   1 
ATOM   3542 O O   . THR B 1 211 ? 35.538  23.284  59.576  1.00 16.75  ? 209 THR B O   1 
ATOM   3543 C CB  . THR B 1 211 ? 36.012  20.886  57.485  1.00 17.53  ? 209 THR B CB  1 
ATOM   3544 O OG1 . THR B 1 211 ? 35.556  20.321  58.719  1.00 17.29  ? 209 THR B OG1 1 
ATOM   3545 C CG2 . THR B 1 211 ? 36.947  19.869  56.762  1.00 17.08  ? 209 THR B CG2 1 
ATOM   3546 N N   . LEU B 1 212 ? 35.106  23.917  57.444  1.00 17.57  ? 210 LEU B N   1 
ATOM   3547 C CA  . LEU B 1 212 ? 34.135  24.928  57.782  1.00 17.73  ? 210 LEU B CA  1 
ATOM   3548 C C   . LEU B 1 212 ? 32.890  24.688  56.936  1.00 18.06  ? 210 LEU B C   1 
ATOM   3549 O O   . LEU B 1 212 ? 32.970  24.543  55.715  1.00 17.89  ? 210 LEU B O   1 
ATOM   3550 C CB  . LEU B 1 212 ? 34.706  26.329  57.529  1.00 16.92  ? 210 LEU B CB  1 
ATOM   3551 C CG  . LEU B 1 212 ? 33.729  27.488  57.671  1.00 17.96  ? 210 LEU B CG  1 
ATOM   3552 C CD1 . LEU B 1 212 ? 33.270  27.660  59.112  1.00 18.02  ? 210 LEU B CD1 1 
ATOM   3553 C CD2 . LEU B 1 212 ? 34.360  28.786  57.143  1.00 17.47  ? 210 LEU B CD2 1 
ATOM   3554 N N   . GLY B 1 213 ? 31.744  24.618  57.588  1.00 18.16  ? 211 GLY B N   1 
ATOM   3555 C CA  . GLY B 1 213 ? 30.497  24.444  56.852  1.00 19.58  ? 211 GLY B CA  1 
ATOM   3556 C C   . GLY B 1 213 ? 29.639  25.682  56.963  1.00 20.65  ? 211 GLY B C   1 
ATOM   3557 O O   . GLY B 1 213 ? 29.561  26.280  58.023  1.00 20.66  ? 211 GLY B O   1 
ATOM   3558 N N   . LEU B 1 214 ? 29.024  26.067  55.855  1.00 22.13  ? 212 LEU B N   1 
ATOM   3559 C CA  . LEU B 1 214 ? 28.112  27.208  55.792  1.00 23.50  ? 212 LEU B CA  1 
ATOM   3560 C C   . LEU B 1 214 ? 26.778  26.715  55.279  1.00 24.62  ? 212 LEU B C   1 
ATOM   3561 O O   . LEU B 1 214 ? 26.683  26.186  54.169  1.00 24.54  ? 212 LEU B O   1 
ATOM   3562 C CB  . LEU B 1 214 ? 28.646  28.287  54.843  1.00 23.47  ? 212 LEU B CB  1 
ATOM   3563 C CG  . LEU B 1 214 ? 30.104  28.735  54.937  1.00 24.13  ? 212 LEU B CG  1 
ATOM   3564 C CD1 . LEU B 1 214 ? 30.389  29.713  53.811  1.00 25.90  ? 212 LEU B CD1 1 
ATOM   3565 C CD2 . LEU B 1 214 ? 30.364  29.390  56.259  1.00 24.77  ? 212 LEU B CD2 1 
ATOM   3566 N N   . GLY B 1 215 ? 25.757  26.853  56.116  1.00 26.82  ? 213 GLY B N   1 
ATOM   3567 C CA  . GLY B 1 215 ? 24.387  26.547  55.743  1.00 28.93  ? 213 GLY B CA  1 
ATOM   3568 C C   . GLY B 1 215 ? 23.535  27.775  55.968  1.00 31.31  ? 213 GLY B C   1 
ATOM   3569 O O   . GLY B 1 215 ? 23.977  28.755  56.572  1.00 30.14  ? 213 GLY B O   1 
ATOM   3570 N N   . ASP B 1 216 ? 22.316  27.739  55.450  1.00 34.58  ? 214 ASP B N   1 
ATOM   3571 C CA  . ASP B 1 216 ? 21.380  28.833  55.691  1.00 38.07  ? 214 ASP B CA  1 
ATOM   3572 C C   . ASP B 1 216 ? 20.064  28.376  56.309  1.00 39.78  ? 214 ASP B C   1 
ATOM   3573 O O   . ASP B 1 216 ? 19.077  29.079  56.209  1.00 40.47  ? 214 ASP B O   1 
ATOM   3574 C CB  . ASP B 1 216 ? 21.167  29.721  54.444  1.00 38.05  ? 214 ASP B CB  1 
ATOM   3575 C CG  . ASP B 1 216 ? 20.838  28.931  53.184  1.00 40.61  ? 214 ASP B CG  1 
ATOM   3576 O OD1 . ASP B 1 216 ? 20.513  27.725  53.263  1.00 43.55  ? 214 ASP B OD1 1 
ATOM   3577 O OD2 . ASP B 1 216 ? 20.909  29.535  52.084  1.00 43.76  ? 214 ASP B OD2 1 
ATOM   3578 N N   . GLY B 1 217 ? 20.068  27.217  56.973  1.00 42.31  ? 215 GLY B N   1 
ATOM   3579 C CA  . GLY B 1 217 ? 18.864  26.694  57.648  1.00 44.74  ? 215 GLY B CA  1 
ATOM   3580 C C   . GLY B 1 217 ? 19.101  25.520  58.585  1.00 46.32  ? 215 GLY B C   1 
ATOM   3581 O O   . GLY B 1 217 ? 20.201  24.973  58.612  1.00 47.57  ? 215 GLY B O   1 
ATOM   3582 N N   . PRO B 1 218 ? 18.080  25.132  59.383  1.00 47.26  ? 216 PRO B N   1 
ATOM   3583 C CA  . PRO B 1 218 ? 18.228  23.998  60.320  0.50 47.58  ? 216 PRO B CA  1 
ATOM   3584 C C   . PRO B 1 218 ? 18.400  22.614  59.673  1.00 48.18  ? 216 PRO B C   1 
ATOM   3585 O O   . PRO B 1 218 ? 18.911  21.694  60.324  1.00 48.87  ? 216 PRO B O   1 
ATOM   3586 C CB  . PRO B 1 218 ? 16.938  24.049  61.155  0.50 47.53  ? 216 PRO B CB  1 
ATOM   3587 C CG  . PRO B 1 218 ? 15.970  24.812  60.342  0.50 47.36  ? 216 PRO B CG  1 
ATOM   3588 C CD  . PRO B 1 218 ? 16.752  25.769  59.489  0.50 47.12  ? 216 PRO B CD  1 
ATOM   3589 N N   . ASN B 1 219 ? 17.984  22.460  58.420  1.00 48.02  ? 217 ASN B N   1 
ATOM   3590 C CA  . ASN B 1 219 ? 18.104  21.177  57.712  1.00 48.12  ? 217 ASN B CA  1 
ATOM   3591 C C   . ASN B 1 219 ? 19.474  20.943  57.059  1.00 47.49  ? 217 ASN B C   1 
ATOM   3592 O O   . ASN B 1 219 ? 19.706  19.909  56.418  1.00 47.92  ? 217 ASN B O   1 
ATOM   3593 C CB  . ASN B 1 219 ? 17.003  21.059  56.659  1.00 48.77  ? 217 ASN B CB  1 
ATOM   3594 C CG  . ASN B 1 219 ? 16.605  22.403  56.105  1.00 50.39  ? 217 ASN B CG  1 
ATOM   3595 O OD1 . ASN B 1 219 ? 17.433  23.316  56.016  1.00 51.55  ? 217 ASN B OD1 1 
ATOM   3596 N ND2 . ASN B 1 219 ? 15.325  22.550  55.757  1.00 51.43  ? 217 ASN B ND2 1 
ATOM   3597 N N   . ASP B 1 220 ? 20.373  21.912  57.217  1.00 46.12  ? 218 ASP B N   1 
ATOM   3598 C CA  . ASP B 1 220 ? 21.758  21.764  56.791  1.00 44.04  ? 218 ASP B CA  1 
ATOM   3599 C C   . ASP B 1 220 ? 22.534  20.980  57.830  1.00 42.19  ? 218 ASP B C   1 
ATOM   3600 O O   . ASP B 1 220 ? 23.729  20.739  57.657  1.00 42.16  ? 218 ASP B O   1 
ATOM   3601 C CB  . ASP B 1 220 ? 22.399  23.135  56.511  1.00 44.25  ? 218 ASP B CB  1 
ATOM   3602 C CG  . ASP B 1 220 ? 22.018  23.685  55.140  1.00 45.52  ? 218 ASP B CG  1 
ATOM   3603 O OD1 . ASP B 1 220 ? 22.127  22.930  54.145  1.00 46.94  ? 218 ASP B OD1 1 
ATOM   3604 O OD2 . ASP B 1 220 ? 21.601  24.860  55.041  1.00 46.53  ? 218 ASP B OD2 1 
ATOM   3605 N N   . ALA B 1 221 ? 21.828  20.544  58.879  1.00 39.81  ? 219 ALA B N   1 
ATOM   3606 C CA  . ALA B 1 221 ? 22.442  19.898  60.047  1.00 37.71  ? 219 ALA B CA  1 
ATOM   3607 C C   . ALA B 1 221 ? 23.370  18.728  59.735  1.00 36.11  ? 219 ALA B C   1 
ATOM   3608 O O   . ALA B 1 221 ? 24.454  18.694  60.288  1.00 36.18  ? 219 ALA B O   1 
ATOM   3609 C CB  . ALA B 1 221 ? 21.401  19.489  61.095  1.00 37.05  ? 219 ALA B CB  1 
ATOM   3610 N N   . PRO B 1 222 ? 22.946  17.764  58.885  1.00 34.69  ? 220 PRO B N   1 
ATOM   3611 C CA  . PRO B 1 222 ? 23.793  16.586  58.607  1.00 33.16  ? 220 PRO B CA  1 
ATOM   3612 C C   . PRO B 1 222 ? 25.193  16.944  58.116  1.00 31.57  ? 220 PRO B C   1 
ATOM   3613 O O   . PRO B 1 222 ? 26.160  16.584  58.760  1.00 31.32  ? 220 PRO B O   1 
ATOM   3614 C CB  . PRO B 1 222 ? 23.003  15.842  57.520  1.00 33.49  ? 220 PRO B CB  1 
ATOM   3615 C CG  . PRO B 1 222 ? 21.588  16.197  57.815  1.00 34.02  ? 220 PRO B CG  1 
ATOM   3616 C CD  . PRO B 1 222 ? 21.657  17.657  58.170  1.00 34.97  ? 220 PRO B CD  1 
ATOM   3617 N N   . LEU B 1 223 ? 25.277  17.649  56.990  1.00 30.16  ? 221 LEU B N   1 
ATOM   3618 C CA  . LEU B 1 223 ? 26.526  18.220  56.475  1.00 28.76  ? 221 LEU B CA  1 
ATOM   3619 C C   . LEU B 1 223 ? 27.310  19.000  57.531  1.00 27.84  ? 221 LEU B C   1 
ATOM   3620 O O   . LEU B 1 223 ? 28.528  18.824  57.688  1.00 26.28  ? 221 LEU B O   1 
ATOM   3621 C CB  . LEU B 1 223 ? 26.236  19.143  55.284  1.00 28.28  ? 221 LEU B CB  1 
ATOM   3622 C CG  . LEU B 1 223 ? 27.468  19.843  54.699  1.00 28.34  ? 221 LEU B CG  1 
ATOM   3623 C CD1 . LEU B 1 223 ? 28.447  18.839  54.085  1.00 25.15  ? 221 LEU B CD1 1 
ATOM   3624 C CD2 . LEU B 1 223 ? 27.041  20.895  53.706  1.00 26.04  ? 221 LEU B CD2 1 
ATOM   3625 N N   . LEU B 1 224 ? 26.598  19.860  58.247  1.00 27.60  ? 222 LEU B N   1 
ATOM   3626 C CA  . LEU B 1 224 ? 27.238  20.764  59.191  1.00 27.58  ? 222 LEU B CA  1 
ATOM   3627 C C   . LEU B 1 224 ? 27.733  20.033  60.433  1.00 27.81  ? 222 LEU B C   1 
ATOM   3628 O O   . LEU B 1 224 ? 28.686  20.476  61.069  1.00 27.10  ? 222 LEU B O   1 
ATOM   3629 C CB  . LEU B 1 224 ? 26.328  21.955  59.537  1.00 27.49  ? 222 LEU B CB  1 
ATOM   3630 C CG  . LEU B 1 224 ? 25.911  22.922  58.393  1.00 27.88  ? 222 LEU B CG  1 
ATOM   3631 C CD1 . LEU B 1 224 ? 25.298  24.198  58.937  1.00 27.12  ? 222 LEU B CD1 1 
ATOM   3632 C CD2 . LEU B 1 224 ? 27.016  23.279  57.400  1.00 24.61  ? 222 LEU B CD2 1 
ATOM   3633 N N   . GLU B 1 225 ? 27.117  18.886  60.738  1.00 28.54  ? 223 GLU B N   1 
ATOM   3634 C CA  . GLU B 1 225 ? 27.493  18.093  61.919  1.00 29.34  ? 223 GLU B CA  1 
ATOM   3635 C C   . GLU B 1 225 ? 28.920  17.571  61.779  1.00 28.11  ? 223 GLU B C   1 
ATOM   3636 O O   . GLU B 1 225 ? 29.655  17.473  62.765  1.00 27.49  ? 223 GLU B O   1 
ATOM   3637 C CB  . GLU B 1 225 ? 26.556  16.900  62.135  1.00 29.86  ? 223 GLU B CB  1 
ATOM   3638 C CG  . GLU B 1 225 ? 25.147  17.243  62.573  1.00 35.82  ? 223 GLU B CG  1 
ATOM   3639 C CD  . GLU B 1 225 ? 25.054  17.768  63.999  1.00 44.11  ? 223 GLU B CD  1 
ATOM   3640 O OE1 . GLU B 1 225 ? 25.646  17.133  64.921  1.00 47.48  ? 223 GLU B OE1 1 
ATOM   3641 O OE2 . GLU B 1 225 ? 24.375  18.814  64.186  1.00 46.22  ? 223 GLU B OE2 1 
ATOM   3642 N N   . VAL B 1 226 ? 29.310  17.233  60.554  1.00 27.31  ? 224 VAL B N   1 
ATOM   3643 C CA  . VAL B 1 226 ? 30.625  16.619  60.374  1.00 27.08  ? 224 VAL B CA  1 
ATOM   3644 C C   . VAL B 1 226 ? 31.756  17.655  60.296  1.00 26.55  ? 224 VAL B C   1 
ATOM   3645 O O   . VAL B 1 226 ? 32.930  17.296  60.329  1.00 27.43  ? 224 VAL B O   1 
ATOM   3646 C CB  . VAL B 1 226 ? 30.644  15.537  59.253  1.00 27.27  ? 224 VAL B CB  1 
ATOM   3647 C CG1 . VAL B 1 226 ? 29.493  14.572  59.444  1.00 26.96  ? 224 VAL B CG1 1 
ATOM   3648 C CG2 . VAL B 1 226 ? 30.616  16.137  57.856  1.00 27.40  ? 224 VAL B CG2 1 
ATOM   3649 N N   . MET B 1 227 ? 31.392  18.936  60.272  1.00 25.26  ? 225 MET B N   1 
ATOM   3650 C CA  . MET B 1 227 ? 32.357  20.018  60.155  1.00 24.39  ? 225 MET B CA  1 
ATOM   3651 C C   . MET B 1 227 ? 33.026  20.320  61.500  1.00 23.99  ? 225 MET B C   1 
ATOM   3652 O O   . MET B 1 227 ? 32.386  20.182  62.545  1.00 23.29  ? 225 MET B O   1 
ATOM   3653 C CB  . MET B 1 227 ? 31.694  21.280  59.561  1.00 23.88  ? 225 MET B CB  1 
ATOM   3654 C CG  . MET B 1 227 ? 31.035  21.046  58.190  1.00 24.65  ? 225 MET B CG  1 
ATOM   3655 S SD  . MET B 1 227 ? 32.239  20.517  56.922  1.00 28.29  ? 225 MET B SD  1 
ATOM   3656 C CE  . MET B 1 227 ? 31.504  19.107  56.138  1.00 23.57  ? 225 MET B CE  1 
ATOM   3657 N N   . ASP B 1 228 ? 34.308  20.713  61.462  1.00 23.20  ? 226 ASP B N   1 
ATOM   3658 C CA  . ASP B 1 228 ? 35.006  21.248  62.640  1.00 23.22  ? 226 ASP B CA  1 
ATOM   3659 C C   . ASP B 1 228 ? 34.328  22.532  63.147  1.00 23.38  ? 226 ASP B C   1 
ATOM   3660 O O   . ASP B 1 228 ? 34.100  22.696  64.350  1.00 23.54  ? 226 ASP B O   1 
ATOM   3661 C CB  . ASP B 1 228 ? 36.482  21.536  62.316  1.00 22.92  ? 226 ASP B CB  1 
ATOM   3662 C CG  . ASP B 1 228 ? 37.281  20.272  61.996  1.00 23.68  ? 226 ASP B CG  1 
ATOM   3663 O OD1 . ASP B 1 228 ? 36.858  19.151  62.353  1.00 25.88  ? 226 ASP B OD1 1 
ATOM   3664 O OD2 . ASP B 1 228 ? 38.357  20.390  61.404  1.00 22.70  ? 226 ASP B OD2 1 
ATOM   3665 N N   . TYR B 1 229 ? 34.013  23.427  62.206  1.00 23.02  ? 227 TYR B N   1 
ATOM   3666 C CA  . TYR B 1 229 ? 33.368  24.687  62.476  1.00 22.99  ? 227 TYR B CA  1 
ATOM   3667 C C   . TYR B 1 229 ? 32.160  24.788  61.568  1.00 23.07  ? 227 TYR B C   1 
ATOM   3668 O O   . TYR B 1 229 ? 32.247  24.462  60.375  1.00 23.40  ? 227 TYR B O   1 
ATOM   3669 C CB  . TYR B 1 229 ? 34.358  25.847  62.253  1.00 23.32  ? 227 TYR B CB  1 
ATOM   3670 C CG  . TYR B 1 229 ? 35.580  25.685  63.126  1.00 23.97  ? 227 TYR B CG  1 
ATOM   3671 C CD1 . TYR B 1 229 ? 35.488  25.887  64.524  1.00 26.14  ? 227 TYR B CD1 1 
ATOM   3672 C CD2 . TYR B 1 229 ? 36.807  25.279  62.598  1.00 22.13  ? 227 TYR B CD2 1 
ATOM   3673 C CE1 . TYR B 1 229 ? 36.584  25.700  65.362  1.00 24.55  ? 227 TYR B CE1 1 
ATOM   3674 C CE2 . TYR B 1 229 ? 37.927  25.087  63.442  1.00 21.97  ? 227 TYR B CE2 1 
ATOM   3675 C CZ  . TYR B 1 229 ? 37.795  25.310  64.818  1.00 25.07  ? 227 TYR B CZ  1 
ATOM   3676 O OH  . TYR B 1 229 ? 38.854  25.129  65.685  1.00 25.86  ? 227 TYR B OH  1 
ATOM   3677 N N   . ALA B 1 230 ? 31.026  25.211  62.125  1.00 22.86  ? 228 ALA B N   1 
ATOM   3678 C CA  . ALA B 1 230 ? 29.804  25.363  61.334  1.00 23.82  ? 228 ALA B CA  1 
ATOM   3679 C C   . ALA B 1 230 ? 29.046  26.648  61.684  1.00 24.51  ? 228 ALA B C   1 
ATOM   3680 O O   . ALA B 1 230 ? 28.865  26.981  62.871  1.00 23.72  ? 228 ALA B O   1 
ATOM   3681 C CB  . ALA B 1 230 ? 28.901  24.137  61.477  1.00 23.16  ? 228 ALA B CB  1 
ATOM   3682 N N   . VAL B 1 231 ? 28.640  27.383  60.640  1.00 25.16  ? 229 VAL B N   1 
ATOM   3683 C CA  . VAL B 1 231 ? 27.847  28.597  60.825  1.00 25.77  ? 229 VAL B CA  1 
ATOM   3684 C C   . VAL B 1 231 ? 26.645  28.558  59.939  1.00 26.14  ? 229 VAL B C   1 
ATOM   3685 O O   . VAL B 1 231 ? 26.669  27.967  58.851  1.00 26.01  ? 229 VAL B O   1 
ATOM   3686 C CB  . VAL B 1 231 ? 28.645  29.989  60.703  1.00 26.22  ? 229 VAL B CB  1 
ATOM   3687 C CG1 . VAL B 1 231 ? 29.751  30.108  61.769  1.00 26.21  ? 229 VAL B CG1 1 
ATOM   3688 C CG2 . VAL B 1 231 ? 29.229  30.227  59.325  1.00 26.68  ? 229 VAL B CG2 1 
ATOM   3689 N N   . ILE B 1 232 ? 25.575  29.149  60.461  1.00 27.20  ? 230 ILE B N   1 
ATOM   3690 C CA  . ILE B 1 232 ? 24.372  29.460  59.700  1.00 27.98  ? 230 ILE B CA  1 
ATOM   3691 C C   . ILE B 1 232 ? 24.497  30.909  59.263  1.00 28.33  ? 230 ILE B C   1 
ATOM   3692 O O   . ILE B 1 232 ? 24.780  31.801  60.075  1.00 27.74  ? 230 ILE B O   1 
ATOM   3693 C CB  . ILE B 1 232 ? 23.078  29.279  60.554  1.00 28.25  ? 230 ILE B CB  1 
ATOM   3694 C CG1 . ILE B 1 232 ? 22.953  27.832  61.077  1.00 28.68  ? 230 ILE B CG1 1 
ATOM   3695 C CG2 . ILE B 1 232 ? 21.824  29.711  59.758  1.00 28.02  ? 230 ILE B CG2 1 
ATOM   3696 C CD1 . ILE B 1 232 ? 22.841  26.757  59.985  1.00 28.25  ? 230 ILE B CD1 1 
ATOM   3697 N N   . VAL B 1 233 ? 24.317  31.150  57.975  1.00 29.23  ? 231 VAL B N   1 
ATOM   3698 C CA  . VAL B 1 233 ? 24.410  32.523  57.489  1.00 30.71  ? 231 VAL B CA  1 
ATOM   3699 C C   . VAL B 1 233 ? 23.051  33.015  56.983  1.00 31.67  ? 231 VAL B C   1 
ATOM   3700 O O   . VAL B 1 233 ? 22.241  32.263  56.402  1.00 31.32  ? 231 VAL B O   1 
ATOM   3701 C CB  . VAL B 1 233 ? 25.588  32.772  56.474  1.00 30.39  ? 231 VAL B CB  1 
ATOM   3702 C CG1 . VAL B 1 233 ? 26.685  31.716  56.628  1.00 30.57  ? 231 VAL B CG1 1 
ATOM   3703 C CG2 . VAL B 1 233 ? 25.100  32.835  55.065  1.00 30.96  ? 231 VAL B CG2 1 
ATOM   3704 N N   . LYS B 1 234 ? 22.805  34.282  57.252  1.00 33.20  ? 232 LYS B N   1 
ATOM   3705 C CA  . LYS B 1 234 ? 21.556  34.905  56.907  1.00 35.53  ? 232 LYS B CA  1 
ATOM   3706 C C   . LYS B 1 234 ? 21.922  36.204  56.215  1.00 35.75  ? 232 LYS B C   1 
ATOM   3707 O O   . LYS B 1 234 ? 22.558  37.059  56.809  1.00 34.83  ? 232 LYS B O   1 
ATOM   3708 C CB  . LYS B 1 234 ? 20.754  35.164  58.192  1.00 35.78  ? 232 LYS B CB  1 
ATOM   3709 C CG  . LYS B 1 234 ? 19.300  35.520  57.980  1.00 39.91  ? 232 LYS B CG  1 
ATOM   3710 C CD  . LYS B 1 234 ? 18.393  34.328  58.286  1.00 45.55  ? 232 LYS B CD  1 
ATOM   3711 C CE  . LYS B 1 234 ? 17.022  34.798  58.807  1.00 48.43  ? 232 LYS B CE  1 
ATOM   3712 N NZ  . LYS B 1 234 ? 16.228  33.682  59.440  1.00 49.32  ? 232 LYS B NZ  1 
ATOM   3713 N N   . GLY B 1 235 ? 21.543  36.321  54.947  1.00 37.50  ? 233 GLY B N   1 
ATOM   3714 C CA  . GLY B 1 235 ? 21.692  37.556  54.183  1.00 40.04  ? 233 GLY B CA  1 
ATOM   3715 C C   . GLY B 1 235 ? 20.866  38.686  54.772  1.00 42.01  ? 233 GLY B C   1 
ATOM   3716 O O   . GLY B 1 235 ? 19.938  38.448  55.549  1.00 42.27  ? 233 GLY B O   1 
ATOM   3717 N N   . LEU B 1 236 ? 21.228  39.923  54.434  1.00 43.97  ? 234 LEU B N   1 
ATOM   3718 C CA  . LEU B 1 236 ? 20.443  41.101  54.839  1.00 45.49  ? 234 LEU B CA  1 
ATOM   3719 C C   . LEU B 1 236 ? 19.721  41.751  53.658  1.00 45.83  ? 234 LEU B C   1 
ATOM   3720 O O   . LEU B 1 236 ? 19.543  41.116  52.614  1.00 46.62  ? 234 LEU B O   1 
ATOM   3721 C CB  . LEU B 1 236 ? 21.316  42.116  55.574  1.00 45.35  ? 234 LEU B CB  1 
ATOM   3722 C CG  . LEU B 1 236 ? 20.889  42.346  57.016  1.00 46.64  ? 234 LEU B CG  1 
ATOM   3723 C CD1 . LEU B 1 236 ? 20.676  41.028  57.745  1.00 47.77  ? 234 LEU B CD1 1 
ATOM   3724 C CD2 . LEU B 1 236 ? 21.909  43.216  57.726  1.00 47.73  ? 234 LEU B CD2 1 
HETATM 3725 S S   . SO4 C 2 .   ? 11.752  5.340   -0.686  1.00 58.33  ? 501 SO4 A S   1 
HETATM 3726 O O1  . SO4 C 2 .   ? 12.245  4.405   -1.690  1.00 59.07  ? 501 SO4 A O1  1 
HETATM 3727 O O2  . SO4 C 2 .   ? 10.293  5.308   -0.672  1.00 58.77  ? 501 SO4 A O2  1 
HETATM 3728 O O3  . SO4 C 2 .   ? 12.316  5.023   0.628   1.00 58.62  ? 501 SO4 A O3  1 
HETATM 3729 O O4  . SO4 C 2 .   ? 12.196  6.666   -1.069  1.00 59.36  ? 501 SO4 A O4  1 
HETATM 3730 S S   . SO4 D 2 .   ? 5.390   19.587  14.473  1.00 103.47 ? 502 SO4 A S   1 
HETATM 3731 O O1  . SO4 D 2 .   ? 5.977   19.761  13.145  1.00 103.69 ? 502 SO4 A O1  1 
HETATM 3732 O O2  . SO4 D 2 .   ? 3.942   19.412  14.360  1.00 103.59 ? 502 SO4 A O2  1 
HETATM 3733 O O3  . SO4 D 2 .   ? 5.993   18.401  15.066  1.00 103.65 ? 502 SO4 A O3  1 
HETATM 3734 O O4  . SO4 D 2 .   ? 5.667   20.751  15.315  1.00 103.24 ? 502 SO4 A O4  1 
HETATM 3735 O OH2 . 1PE E 3 .   ? 6.703   -3.898  17.953  1.00 43.76  ? 601 1PE A OH2 1 
HETATM 3736 C C12 . 1PE E 3 .   ? 6.169   -4.166  19.260  1.00 45.56  ? 601 1PE A C12 1 
HETATM 3737 C C22 . 1PE E 3 .   ? 7.200   -3.958  20.376  1.00 45.84  ? 601 1PE A C22 1 
HETATM 3738 O OH3 . 1PE E 3 .   ? 6.536   -4.254  21.642  1.00 47.67  ? 601 1PE A OH3 1 
HETATM 3739 C C13 . 1PE E 3 .   ? 7.751   -4.777  23.783  1.00 47.04  ? 601 1PE A C13 1 
HETATM 3740 C C23 . 1PE E 3 .   ? 7.232   -3.727  22.796  1.00 47.45  ? 601 1PE A C23 1 
HETATM 3741 O OH4 . 1PE E 3 .   ? 9.203   -4.732  23.796  1.00 47.45  ? 601 1PE A OH4 1 
HETATM 3742 C C14 . 1PE E 3 .   ? 10.217  -3.286  25.353  1.00 45.85  ? 601 1PE A C14 1 
HETATM 3743 C C24 . 1PE E 3 .   ? 9.795   -4.716  25.109  1.00 45.72  ? 601 1PE A C24 1 
HETATM 3744 O OH5 . 1PE E 3 .   ? 11.518  -3.119  25.890  1.00 46.96  ? 601 1PE A OH5 1 
HETATM 3745 C C15 . 1PE E 3 .   ? 12.931  -1.336  26.920  1.00 49.58  ? 601 1PE A C15 1 
HETATM 3746 C C25 . 1PE E 3 .   ? 11.806  -1.704  25.952  1.00 47.95  ? 601 1PE A C25 1 
HETATM 3747 O OH6 . 1PE E 3 .   ? 13.955  -2.345  27.011  1.00 53.13  ? 601 1PE A OH6 1 
HETATM 3748 C C16 . 1PE E 3 .   ? 16.164  -2.758  26.023  1.00 57.00  ? 601 1PE A C16 1 
HETATM 3749 C C26 . 1PE E 3 .   ? 15.271  -1.780  26.801  1.00 54.20  ? 601 1PE A C26 1 
HETATM 3750 O OH7 . 1PE E 3 .   ? 16.191  -2.446  24.614  1.00 58.19  ? 601 1PE A OH7 1 
HETATM 3751 O O1  . PG4 F 4 .   ? 5.065   -10.537 11.317  1.00 38.86  ? 602 PG4 A O1  1 
HETATM 3752 C C1  . PG4 F 4 .   ? 4.908   -11.090 12.641  1.00 38.65  ? 602 PG4 A C1  1 
HETATM 3753 C C2  . PG4 F 4 .   ? 4.239   -10.067 13.545  1.00 39.42  ? 602 PG4 A C2  1 
HETATM 3754 O O2  . PG4 F 4 .   ? 5.120   -9.571  14.556  1.00 39.90  ? 602 PG4 A O2  1 
HETATM 3755 C C3  . PG4 F 4 .   ? 4.590   -8.471  15.316  1.00 39.20  ? 602 PG4 A C3  1 
HETATM 3756 C C4  . PG4 F 4 .   ? 5.292   -8.495  16.672  1.00 40.26  ? 602 PG4 A C4  1 
HETATM 3757 O O3  . PG4 F 4 .   ? 4.772   -7.592  17.663  1.00 40.97  ? 602 PG4 A O3  1 
HETATM 3758 C C5  . PG4 F 4 .   ? 4.939   -8.089  19.010  1.00 39.64  ? 602 PG4 A C5  1 
HETATM 3759 C C6  . PG4 F 4 .   ? 6.411   -8.267  19.376  1.00 39.71  ? 602 PG4 A C6  1 
HETATM 3760 O O4  . PG4 F 4 .   ? 6.640   -8.244  20.798  1.00 40.07  ? 602 PG4 A O4  1 
HETATM 3761 C C7  . PG4 F 4 .   ? 8.036   -8.447  21.104  1.00 38.15  ? 602 PG4 A C7  1 
HETATM 3762 C C8  . PG4 F 4 .   ? 8.347   -8.218  22.589  1.00 37.29  ? 602 PG4 A C8  1 
HETATM 3763 O O5  . PG4 F 4 .   ? 9.561   -8.865  23.007  1.00 35.12  ? 602 PG4 A O5  1 
HETATM 3764 C C1  . PGE G 5 .   ? 8.147   -7.984  13.239  1.00 49.45  ? 603 PGE A C1  1 
HETATM 3765 O O1  . PGE G 5 .   ? 9.145   -8.816  12.632  1.00 50.31  ? 603 PGE A O1  1 
HETATM 3766 C C2  . PGE G 5 .   ? 8.819   -6.879  14.044  1.00 48.77  ? 603 PGE A C2  1 
HETATM 3767 O O2  . PGE G 5 .   ? 9.296   -7.445  15.257  1.00 47.29  ? 603 PGE A O2  1 
HETATM 3768 C C3  . PGE G 5 .   ? 9.605   -6.442  16.222  1.00 47.47  ? 603 PGE A C3  1 
HETATM 3769 C C4  . PGE G 5 .   ? 10.390  -7.073  17.361  1.00 46.76  ? 603 PGE A C4  1 
HETATM 3770 O O4  . PGE G 5 .   ? 12.633  -5.553  21.234  1.00 48.94  ? 603 PGE A O4  1 
HETATM 3771 C C6  . PGE G 5 .   ? 11.790  -5.098  20.164  1.00 48.06  ? 603 PGE A C6  1 
HETATM 3772 C C5  . PGE G 5 .   ? 11.172  -6.286  19.436  1.00 48.12  ? 603 PGE A C5  1 
HETATM 3773 O O3  . PGE G 5 .   ? 11.192  -6.095  18.017  1.00 47.96  ? 603 PGE A O3  1 
HETATM 3774 S S   . SO4 H 2 .   ? 15.307  21.947  46.477  1.00 46.91  ? 503 SO4 B S   1 
HETATM 3775 O O1  . SO4 H 2 .   ? 15.907  21.779  45.148  1.00 46.28  ? 503 SO4 B O1  1 
HETATM 3776 O O2  . SO4 H 2 .   ? 14.489  23.159  46.456  1.00 47.76  ? 503 SO4 B O2  1 
HETATM 3777 O O3  . SO4 H 2 .   ? 14.442  20.828  46.817  1.00 46.27  ? 503 SO4 B O3  1 
HETATM 3778 O O4  . SO4 H 2 .   ? 16.355  22.041  47.492  1.00 46.44  ? 503 SO4 B O4  1 
HETATM 3779 O O   . HOH I 6 .   ? 0.277   4.057   14.101  1.00 12.71  ? 604 HOH A O   1 
HETATM 3780 O O   . HOH I 6 .   ? 2.389   -7.767  8.454   1.00 22.44  ? 605 HOH A O   1 
HETATM 3781 O O   . HOH I 6 .   ? -1.924  20.441  -2.471  1.00 28.52  ? 606 HOH A O   1 
HETATM 3782 O O   . HOH I 6 .   ? 4.890   17.787  -11.652 1.00 29.44  ? 607 HOH A O   1 
HETATM 3783 O O   . HOH I 6 .   ? 8.111   21.425  -15.449 1.00 22.33  ? 608 HOH A O   1 
HETATM 3784 O O   . HOH I 6 .   ? -4.852  -7.376  7.793   1.00 23.88  ? 609 HOH A O   1 
HETATM 3785 O O   . HOH I 6 .   ? -1.416  10.231  27.103  1.00 34.36  ? 610 HOH A O   1 
HETATM 3786 O O   . HOH I 6 .   ? 6.676   26.471  -13.757 1.00 21.68  ? 611 HOH A O   1 
HETATM 3787 O O   . HOH I 6 .   ? 9.855   28.800  -0.792  1.00 43.25  ? 612 HOH A O   1 
HETATM 3788 O O   . HOH I 6 .   ? -2.995  6.235   21.958  1.00 25.18  ? 613 HOH A O   1 
HETATM 3789 O O   . HOH I 6 .   ? 9.302   15.447  23.058  1.00 24.56  ? 614 HOH A O   1 
HETATM 3790 O O   . HOH I 6 .   ? 9.350   13.243  27.149  1.00 17.36  ? 615 HOH A O   1 
HETATM 3791 O O   . HOH I 6 .   ? 5.305   17.489  -8.617  1.00 17.26  ? 616 HOH A O   1 
HETATM 3792 O O   . HOH I 6 .   ? 6.501   19.882  3.223   1.00 28.68  ? 617 HOH A O   1 
HETATM 3793 O O   . HOH I 6 .   ? 9.561   7.528   31.039  1.00 24.46  ? 618 HOH A O   1 
HETATM 3794 O O   . HOH I 6 .   ? 11.382  9.718   24.815  1.00 24.91  ? 619 HOH A O   1 
HETATM 3795 O O   . HOH I 6 .   ? 17.852  7.379   -4.300  1.00 54.19  ? 620 HOH A O   1 
HETATM 3796 O O   . HOH I 6 .   ? 4.846   11.179  -18.373 1.00 17.74  ? 621 HOH A O   1 
HETATM 3797 O O   . HOH I 6 .   ? 0.696   23.056  -7.759  1.00 25.90  ? 622 HOH A O   1 
HETATM 3798 O O   . HOH I 6 .   ? 18.127  6.139   21.467  1.00 31.27  ? 623 HOH A O   1 
HETATM 3799 O O   . HOH I 6 .   ? 14.880  8.914   10.927  1.00 26.95  ? 624 HOH A O   1 
HETATM 3800 O O   . HOH I 6 .   ? -4.668  9.165   36.537  1.00 50.92  ? 625 HOH A O   1 
HETATM 3801 O O   . HOH I 6 .   ? 5.033   13.420  -5.832  1.00 22.26  ? 626 HOH A O   1 
HETATM 3802 O O   . HOH I 6 .   ? -2.799  -4.222  -10.521 1.00 48.59  ? 627 HOH A O   1 
HETATM 3803 O O   . HOH I 6 .   ? 0.830   3.553   26.596  1.00 17.13  ? 628 HOH A O   1 
HETATM 3804 O O   . HOH I 6 .   ? 10.809  23.535  -20.498 1.00 31.60  ? 629 HOH A O   1 
HETATM 3805 O O   . HOH I 6 .   ? -7.694  -0.515  12.867  1.00 29.10  ? 630 HOH A O   1 
HETATM 3806 O O   . HOH I 6 .   ? 6.172   3.738   -2.615  1.00 43.00  ? 631 HOH A O   1 
HETATM 3807 O O   . HOH I 6 .   ? 9.072   3.521   -16.854 1.00 48.96  ? 632 HOH A O   1 
HETATM 3808 O O   . HOH I 6 .   ? -3.792  6.608   -14.404 1.00 41.01  ? 633 HOH A O   1 
HETATM 3809 O O   . HOH I 6 .   ? -0.766  16.881  -8.476  1.00 37.67  ? 634 HOH A O   1 
HETATM 3810 O O   . HOH I 6 .   ? -3.462  22.076  22.266  1.00 58.79  ? 635 HOH A O   1 
HETATM 3811 O O   . HOH I 6 .   ? 16.896  9.131   -8.430  1.00 36.79  ? 636 HOH A O   1 
HETATM 3812 O O   . HOH I 6 .   ? 23.324  7.087   10.325  1.00 44.67  ? 637 HOH A O   1 
HETATM 3813 O O   . HOH I 6 .   ? 2.620   19.321  -11.499 1.00 33.30  ? 638 HOH A O   1 
HETATM 3814 O O   . HOH I 6 .   ? 9.506   10.697  26.717  1.00 15.05  ? 639 HOH A O   1 
HETATM 3815 O O   . HOH I 6 .   ? -0.317  -0.987  19.244  1.00 25.15  ? 640 HOH A O   1 
HETATM 3816 O O   . HOH I 6 .   ? -5.768  -10.535 17.488  1.00 31.83  ? 641 HOH A O   1 
HETATM 3817 O O   . HOH I 6 .   ? 10.292  5.045   5.669   1.00 38.39  ? 642 HOH A O   1 
HETATM 3818 O O   . HOH I 6 .   ? 0.962   19.002  22.048  1.00 31.73  ? 643 HOH A O   1 
HETATM 3819 O O   . HOH I 6 .   ? 18.352  19.043  1.361   1.00 31.84  ? 644 HOH A O   1 
HETATM 3820 O O   . HOH I 6 .   ? -5.610  6.372   12.734  1.00 27.95  ? 645 HOH A O   1 
HETATM 3821 O O   . HOH I 6 .   ? 28.357  15.470  -12.078 1.00 46.21  ? 646 HOH A O   1 
HETATM 3822 O O   . HOH I 6 .   ? 6.105   2.261   9.096   1.00 32.54  ? 647 HOH A O   1 
HETATM 3823 O O   . HOH I 6 .   ? 8.650   11.953  2.228   1.00 43.80  ? 648 HOH A O   1 
HETATM 3824 O O   . HOH I 6 .   ? 13.698  6.681   10.587  1.00 32.92  ? 649 HOH A O   1 
HETATM 3825 O O   . HOH I 6 .   ? -5.158  5.154   29.988  1.00 37.75  ? 650 HOH A O   1 
HETATM 3826 O O   . HOH I 6 .   ? 18.832  1.579   23.288  1.00 36.41  ? 651 HOH A O   1 
HETATM 3827 O O   . HOH I 6 .   ? 7.235   12.103  -0.021  1.00 35.78  ? 652 HOH A O   1 
HETATM 3828 O O   . HOH I 6 .   ? -5.681  4.354   9.377   1.00 35.70  ? 653 HOH A O   1 
HETATM 3829 O O   . HOH I 6 .   ? 6.814   -11.353 6.300   1.00 46.85  ? 654 HOH A O   1 
HETATM 3830 O O   . HOH I 6 .   ? -4.126  21.155  11.677  1.00 43.00  ? 655 HOH A O   1 
HETATM 3831 O O   . HOH I 6 .   ? -1.756  11.334  1.060   1.00 33.98  ? 656 HOH A O   1 
HETATM 3832 O O   . HOH I 6 .   ? 4.134   18.044  10.268  1.00 27.52  ? 657 HOH A O   1 
HETATM 3833 O O   . HOH I 6 .   ? 17.669  13.063  16.484  1.00 41.53  ? 658 HOH A O   1 
HETATM 3834 O O   . HOH I 6 .   ? 9.323   2.934   31.689  1.00 21.39  ? 659 HOH A O   1 
HETATM 3835 O O   . HOH I 6 .   ? -5.818  6.036   2.818   1.00 41.63  ? 660 HOH A O   1 
HETATM 3836 O O   . HOH I 6 .   ? 13.775  29.550  4.777   1.00 55.73  ? 661 HOH A O   1 
HETATM 3837 O O   . HOH I 6 .   ? 17.485  8.166   32.383  1.00 39.73  ? 662 HOH A O   1 
HETATM 3838 O O   . HOH I 6 .   ? 11.162  13.955  22.667  1.00 32.75  ? 663 HOH A O   1 
HETATM 3839 O O   . HOH I 6 .   ? -1.416  6.872   38.560  1.00 36.45  ? 664 HOH A O   1 
HETATM 3840 O O   . HOH I 6 .   ? 20.436  9.749   -12.312 1.00 54.49  ? 665 HOH A O   1 
HETATM 3841 O O   . HOH I 6 .   ? 8.755   18.817  17.728  1.00 29.70  ? 666 HOH A O   1 
HETATM 3842 O O   . HOH I 6 .   ? -2.562  4.090   -15.084 1.00 44.81  ? 667 HOH A O   1 
HETATM 3843 O O   . HOH I 6 .   ? 18.362  -1.008  23.599  1.00 40.42  ? 668 HOH A O   1 
HETATM 3844 O O   . HOH I 6 .   ? 2.824   22.996  -10.379 1.00 42.93  ? 669 HOH A O   1 
HETATM 3845 O O   . HOH I 6 .   ? 0.543   -13.716 12.208  1.00 19.33  ? 670 HOH A O   1 
HETATM 3846 O O   . HOH I 6 .   ? -2.336  21.330  9.691   1.00 33.05  ? 671 HOH A O   1 
HETATM 3847 O O   . HOH I 6 .   ? 8.318   15.103  25.638  1.00 25.67  ? 672 HOH A O   1 
HETATM 3848 O O   . HOH I 6 .   ? 6.750   0.176   10.548  1.00 29.59  ? 673 HOH A O   1 
HETATM 3849 O O   . HOH I 6 .   ? 9.972   15.430  29.916  1.00 39.25  ? 674 HOH A O   1 
HETATM 3850 O O   . HOH I 6 .   ? -0.805  20.730  -8.084  1.00 44.24  ? 675 HOH A O   1 
HETATM 3851 O O   . HOH I 6 .   ? 4.487   18.000  27.140  1.00 36.87  ? 676 HOH A O   1 
HETATM 3852 O O   . HOH I 6 .   ? 12.284  14.218  30.267  1.00 32.27  ? 677 HOH A O   1 
HETATM 3853 O O   . HOH I 6 .   ? -1.585  7.107   28.275  1.00 40.66  ? 678 HOH A O   1 
HETATM 3854 O O   . HOH I 6 .   ? 19.343  3.904   22.358  1.00 40.39  ? 679 HOH A O   1 
HETATM 3855 O O   . HOH I 6 .   ? -6.058  -9.902  23.799  1.00 37.44  ? 680 HOH A O   1 
HETATM 3856 O O   . HOH I 6 .   ? -7.099  14.527  33.488  1.00 47.87  ? 681 HOH A O   1 
HETATM 3857 O O   . HOH I 6 .   ? 14.382  18.563  9.480   1.00 52.96  ? 682 HOH A O   1 
HETATM 3858 O O   . HOH I 6 .   ? -3.660  10.066  25.245  1.00 27.30  ? 683 HOH A O   1 
HETATM 3859 O O   . HOH I 6 .   ? 11.032  25.702  5.587   1.00 30.57  ? 684 HOH A O   1 
HETATM 3860 O O   . HOH I 6 .   ? -3.242  15.598  -1.736  1.00 47.72  ? 685 HOH A O   1 
HETATM 3861 O O   . HOH I 6 .   ? -1.904  19.437  -4.697  1.00 40.70  ? 686 HOH A O   1 
HETATM 3862 O O   . HOH I 6 .   ? 17.910  -4.315  8.829   1.00 40.32  ? 687 HOH A O   1 
HETATM 3863 O O   . HOH I 6 .   ? 1.555   18.415  -9.066  1.00 32.37  ? 688 HOH A O   1 
HETATM 3864 O O   . HOH I 6 .   ? -1.011  14.572  -4.365  1.00 47.42  ? 689 HOH A O   1 
HETATM 3865 O O   . HOH I 6 .   ? 14.171  10.397  31.973  1.00 36.68  ? 690 HOH A O   1 
HETATM 3866 O O   . HOH I 6 .   ? -6.426  -9.148  13.044  1.00 24.77  ? 691 HOH A O   1 
HETATM 3867 O O   . HOH I 6 .   ? 5.610   -0.927  8.505   1.00 47.67  ? 692 HOH A O   1 
HETATM 3868 O O   . HOH I 6 .   ? -0.191  14.004  -8.882  1.00 39.64  ? 693 HOH A O   1 
HETATM 3869 O O   . HOH I 6 .   ? 20.481  19.791  -16.325 1.00 44.10  ? 694 HOH A O   1 
HETATM 3870 O O   . HOH I 6 .   ? -10.933 2.707   15.037  1.00 51.81  ? 695 HOH A O   1 
HETATM 3871 O O   . HOH I 6 .   ? -0.063  12.162  -13.333 1.00 43.89  ? 696 HOH A O   1 
HETATM 3872 O O   . HOH I 6 .   ? 16.155  9.688   30.537  1.00 45.24  ? 697 HOH A O   1 
HETATM 3873 O O   . HOH I 6 .   ? -7.835  4.547   4.978   1.00 42.68  ? 698 HOH A O   1 
HETATM 3874 O O   . HOH I 6 .   ? -5.858  8.472   14.127  1.00 48.77  ? 699 HOH A O   1 
HETATM 3875 O O   . HOH I 6 .   ? 25.546  16.053  -5.770  1.00 45.55  ? 700 HOH A O   1 
HETATM 3876 O O   . HOH I 6 .   ? 5.439   26.540  -11.449 1.00 33.40  ? 701 HOH A O   1 
HETATM 3877 O O   . HOH I 6 .   ? -3.828  9.014   -6.681  1.00 40.14  ? 702 HOH A O   1 
HETATM 3878 O O   . HOH I 6 .   ? 8.128   17.327  11.473  1.00 29.66  ? 703 HOH A O   1 
HETATM 3879 O O   . HOH I 6 .   ? 22.684  23.595  0.734   1.00 47.72  ? 704 HOH A O   1 
HETATM 3880 O O   . HOH I 6 .   ? 14.292  24.593  8.810   1.00 55.47  ? 705 HOH A O   1 
HETATM 3881 O O   . HOH I 6 .   ? -5.740  -13.123 17.408  1.00 32.77  ? 706 HOH A O   1 
HETATM 3882 O O   . HOH I 6 .   ? -4.248  -9.995  8.932   1.00 38.90  ? 707 HOH A O   1 
HETATM 3883 O O   . HOH I 6 .   ? 11.721  18.639  17.955  1.00 32.18  ? 708 HOH A O   1 
HETATM 3884 O O   . HOH I 6 .   ? 2.540   28.041  2.512   1.00 42.87  ? 709 HOH A O   1 
HETATM 3885 O O   . HOH I 6 .   ? -9.021  15.130  23.336  1.00 47.63  ? 710 HOH A O   1 
HETATM 3886 O O   . HOH I 6 .   ? 1.449   25.836  0.936   1.00 42.45  ? 711 HOH A O   1 
HETATM 3887 O O   . HOH I 6 .   ? 17.734  9.831   4.527   1.00 45.15  ? 712 HOH A O   1 
HETATM 3888 O O   . HOH I 6 .   ? 4.871   2.208   33.784  1.00 36.16  ? 713 HOH A O   1 
HETATM 3889 O O   . HOH I 6 .   ? 11.648  0.923   4.682   1.00 53.77  ? 714 HOH A O   1 
HETATM 3890 O O   . HOH I 6 .   ? 4.259   -2.605  0.537   1.00 63.32  ? 715 HOH A O   1 
HETATM 3891 O O   . HOH I 6 .   ? -6.791  18.448  9.482   1.00 53.69  ? 716 HOH A O   1 
HETATM 3892 O O   . HOH I 6 .   ? 6.781   -1.567  2.013   1.00 44.93  ? 717 HOH A O   1 
HETATM 3893 O O   . HOH I 6 .   ? 4.842   -4.110  -1.498  1.00 45.48  ? 718 HOH A O   1 
HETATM 3894 O O   . HOH I 6 .   ? -6.505  3.926   -4.367  1.00 50.74  ? 719 HOH A O   1 
HETATM 3895 O O   . HOH I 6 .   ? -6.583  -1.868  -9.969  1.00 50.98  ? 720 HOH A O   1 
HETATM 3896 O O   . HOH I 6 .   ? -5.275  -3.106  -8.202  1.00 51.07  ? 721 HOH A O   1 
HETATM 3897 O O   . HOH I 6 .   ? 26.884  12.090  -13.034 1.00 44.76  ? 722 HOH A O   1 
HETATM 3898 O O   . HOH I 6 .   ? 15.947  25.520  4.261   1.00 38.11  ? 723 HOH A O   1 
HETATM 3899 O O   . HOH I 6 .   ? 1.733   14.125  36.825  1.00 34.96  ? 724 HOH A O   1 
HETATM 3900 O O   . HOH I 6 .   ? -3.239  15.523  33.279  1.00 55.44  ? 725 HOH A O   1 
HETATM 3901 O O   . HOH I 6 .   ? 13.767  -14.104 7.682   1.00 38.20  ? 726 HOH A O   1 
HETATM 3902 O O   . HOH I 6 .   ? 18.087  -2.596  28.450  1.00 49.42  ? 727 HOH A O   1 
HETATM 3903 O O   . HOH I 6 .   ? 5.969   20.112  21.123  1.00 48.71  ? 728 HOH A O   1 
HETATM 3904 O O   . HOH I 6 .   ? 13.487  13.155  27.868  1.00 43.42  ? 729 HOH A O   1 
HETATM 3905 O O   . HOH I 6 .   ? 8.529   3.141   33.996  1.00 40.71  ? 730 HOH A O   1 
HETATM 3906 O O   . HOH I 6 .   ? 14.822  14.904  21.662  1.00 48.08  ? 731 HOH A O   1 
HETATM 3907 O O   . HOH I 6 .   ? -2.527  -1.785  30.125  1.00 34.70  ? 732 HOH A O   1 
HETATM 3908 O O   . HOH I 6 .   ? 2.657   22.254  15.579  1.00 50.86  ? 733 HOH A O   1 
HETATM 3909 O O   . HOH I 6 .   ? -0.072  23.064  3.985   1.00 62.46  ? 734 HOH A O   1 
HETATM 3910 O O   . HOH I 6 .   ? -0.655  5.775   26.188  1.00 38.17  ? 735 HOH A O   1 
HETATM 3911 O O   . HOH I 6 .   ? 12.509  11.773  23.728  1.00 29.74  ? 736 HOH A O   1 
HETATM 3912 O O   . HOH I 6 .   ? 30.873  18.945  -12.677 1.00 59.02  ? 737 HOH A O   1 
HETATM 3913 O O   . HOH I 6 .   ? 15.158  12.750  23.451  1.00 49.54  ? 738 HOH A O   1 
HETATM 3914 O O   . HOH I 6 .   ? 16.159  31.453  -4.132  1.00 45.10  ? 739 HOH A O   1 
HETATM 3915 O O   . HOH I 6 .   ? 15.180  -4.327  23.168  1.00 50.80  ? 740 HOH A O   1 
HETATM 3916 O O   . HOH I 6 .   ? -7.112  -10.486 19.582  1.00 49.02  ? 741 HOH A O   1 
HETATM 3917 O O   . HOH I 6 .   ? -6.952  -5.596  10.613  1.00 46.48  ? 742 HOH A O   1 
HETATM 3918 O O   . HOH I 6 .   ? -7.869  6.021   8.982   1.00 47.62  ? 743 HOH A O   1 
HETATM 3919 O O   . HOH I 6 .   ? -1.192  -12.671 3.260   1.00 48.48  ? 744 HOH A O   1 
HETATM 3920 O O   . HOH I 6 .   ? 9.016   2.445   7.610   1.00 52.70  ? 745 HOH A O   1 
HETATM 3921 O O   . HOH I 6 .   ? 19.077  3.533   25.425  1.00 35.13  ? 746 HOH A O   1 
HETATM 3922 O O   . HOH I 6 .   ? 13.783  9.153   6.238   1.00 40.46  ? 747 HOH A O   1 
HETATM 3923 O O   . HOH I 6 .   ? -1.590  9.739   -12.401 1.00 58.89  ? 748 HOH A O   1 
HETATM 3924 O O   . HOH I 6 .   ? 7.655   29.029  -14.704 1.00 44.98  ? 749 HOH A O   1 
HETATM 3925 O O   . HOH I 6 .   ? 7.158   6.053   -2.358  1.00 46.48  ? 750 HOH A O   1 
HETATM 3926 O O   . HOH I 6 .   ? 7.758   19.040  19.926  1.00 43.65  ? 751 HOH A O   1 
HETATM 3927 O O   . HOH I 6 .   ? 23.629  16.722  -3.615  1.00 44.34  ? 752 HOH A O   1 
HETATM 3928 O O   . HOH I 6 .   ? 13.484  6.050   30.580  1.00 41.47  ? 753 HOH A O   1 
HETATM 3929 O O   . HOH I 6 .   ? 12.968  13.231  8.113   1.00 56.86  ? 754 HOH A O   1 
HETATM 3930 O O   . HOH I 6 .   ? 13.497  2.884   31.290  1.00 30.76  ? 755 HOH A O   1 
HETATM 3931 O O   . HOH I 6 .   ? -3.280  2.274   22.412  1.00 36.70  ? 756 HOH A O   1 
HETATM 3932 O O   . HOH I 6 .   ? -0.519  21.662  19.113  1.00 52.90  ? 757 HOH A O   1 
HETATM 3933 O O   . HOH I 6 .   ? 16.370  2.567   6.848   1.00 45.21  ? 758 HOH A O   1 
HETATM 3934 O O   . HOH I 6 .   ? 5.487   8.325   -2.449  1.00 37.69  ? 759 HOH A O   1 
HETATM 3935 O O   . HOH I 6 .   ? 19.317  9.633   -7.503  1.00 45.23  ? 760 HOH A O   1 
HETATM 3936 O O   . HOH I 6 .   ? 5.798   -10.546 8.983   1.00 44.55  ? 761 HOH A O   1 
HETATM 3937 O O   . HOH I 6 .   ? 6.017   -3.648  15.549  1.00 39.19  ? 762 HOH A O   1 
HETATM 3938 O O   . HOH I 6 .   ? 6.151   9.668   0.060   1.00 46.06  ? 763 HOH A O   1 
HETATM 3939 O O   . HOH I 6 .   ? -4.358  12.445  0.925   1.00 54.39  ? 764 HOH A O   1 
HETATM 3940 O O   . HOH I 6 .   ? 8.119   26.781  -19.533 1.00 33.92  ? 765 HOH A O   1 
HETATM 3941 O O   . HOH I 6 .   ? 19.929  12.805  14.638  1.00 50.62  ? 766 HOH A O   1 
HETATM 3942 O O   . HOH I 6 .   ? 12.833  29.363  -9.412  1.00 49.63  ? 767 HOH A O   1 
HETATM 3943 O O   . HOH I 6 .   ? -0.034  22.509  15.418  1.00 50.38  ? 768 HOH A O   1 
HETATM 3944 O O   . HOH I 6 .   ? 8.973   0.386   -4.003  1.00 58.58  ? 769 HOH A O   1 
HETATM 3945 O O   . HOH I 6 .   ? 21.409  26.910  0.122   1.00 58.62  ? 770 HOH A O   1 
HETATM 3946 O O   . HOH I 6 .   ? 0.431   -14.014 4.652   1.00 44.17  ? 771 HOH A O   1 
HETATM 3947 O O   . HOH I 6 .   ? 14.519  11.292  9.032   1.00 49.57  ? 772 HOH A O   1 
HETATM 3948 O O   . HOH I 6 .   ? -6.018  2.697   21.923  1.00 41.66  ? 773 HOH A O   1 
HETATM 3949 O O   . HOH I 6 .   ? 13.047  8.996   2.778   1.00 49.16  ? 774 HOH A O   1 
HETATM 3950 O O   . HOH I 6 .   ? 20.928  25.923  -12.522 1.00 50.76  ? 775 HOH A O   1 
HETATM 3951 O O   . HOH I 6 .   ? -7.529  -2.944  16.973  1.00 39.54  ? 776 HOH A O   1 
HETATM 3952 O O   . HOH I 6 .   ? 20.154  -11.211 10.173  1.00 71.44  ? 777 HOH A O   1 
HETATM 3953 O O   . HOH I 6 .   ? -6.956  -6.356  13.196  1.00 45.09  ? 778 HOH A O   1 
HETATM 3954 O O   . HOH I 6 .   ? -1.132  11.682  36.000  1.00 41.91  ? 779 HOH A O   1 
HETATM 3955 O O   . HOH I 6 .   ? 20.151  -0.881  28.305  1.00 50.59  ? 780 HOH A O   1 
HETATM 3956 O O   . HOH I 6 .   ? -8.863  20.414  18.335  1.00 42.92  ? 781 HOH A O   1 
HETATM 3957 O O   . HOH I 6 .   ? 8.600   27.141  0.463   1.00 55.49  ? 782 HOH A O   1 
HETATM 3958 O O   . HOH I 6 .   ? 10.327  21.200  14.280  1.00 47.08  ? 783 HOH A O   1 
HETATM 3959 O O   . HOH I 6 .   ? 5.923   29.490  -10.429 1.00 38.36  ? 784 HOH A O   1 
HETATM 3960 O O   . HOH I 6 .   ? -6.646  8.729   3.436   1.00 45.63  ? 785 HOH A O   1 
HETATM 3961 O O   . HOH I 6 .   ? 22.756  9.275   15.749  1.00 52.67  ? 786 HOH A O   1 
HETATM 3962 O O   . HOH I 6 .   ? 4.590   20.063  10.760  1.00 36.99  ? 787 HOH A O   1 
HETATM 3963 O O   . HOH I 6 .   ? 2.704   12.261  -6.594  1.00 44.40  ? 788 HOH A O   1 
HETATM 3964 O O   . HOH I 6 .   ? -6.058  1.356   25.101  1.00 46.37  ? 789 HOH A O   1 
HETATM 3965 O O   . HOH I 6 .   ? 1.783   1.322   0.131   1.00 53.07  ? 790 HOH A O   1 
HETATM 3966 O O   . HOH I 6 .   ? -9.660  6.812   13.709  1.00 39.66  ? 791 HOH A O   1 
HETATM 3967 O O   . HOH I 6 .   ? 23.766  6.202   19.532  1.00 55.50  ? 792 HOH A O   1 
HETATM 3968 O O   . HOH I 6 .   ? 11.596  -10.641 8.083   1.00 59.60  ? 793 HOH A O   1 
HETATM 3969 O O   . HOH I 6 .   ? 10.039  -11.727 9.820   1.00 36.30  ? 794 HOH A O   1 
HETATM 3970 O O   . HOH I 6 .   ? -7.014  7.774   20.545  1.00 73.25  ? 795 HOH A O   1 
HETATM 3971 O O   . HOH J 6 .   ? 12.659  9.319   33.740  1.00 32.50  ? 504 HOH B O   1 
HETATM 3972 O O   . HOH J 6 .   ? 42.445  10.026  54.986  1.00 26.64  ? 505 HOH B O   1 
HETATM 3973 O O   . HOH J 6 .   ? 17.856  13.147  34.080  1.00 44.30  ? 506 HOH B O   1 
HETATM 3974 O O   . HOH J 6 .   ? -2.970  12.773  39.925  1.00 33.79  ? 507 HOH B O   1 
HETATM 3975 O O   . HOH J 6 .   ? 51.834  13.682  57.604  1.00 28.14  ? 508 HOH B O   1 
HETATM 3976 O O   . HOH J 6 .   ? 33.340  23.454  44.472  1.00 14.78  ? 509 HOH B O   1 
HETATM 3977 O O   . HOH J 6 .   ? 37.746  28.782  46.665  1.00 27.90  ? 510 HOH B O   1 
HETATM 3978 O O   . HOH J 6 .   ? -1.769  16.083  57.233  1.00 19.55  ? 511 HOH B O   1 
HETATM 3979 O O   . HOH J 6 .   ? 14.105  14.028  38.234  1.00 24.28  ? 512 HOH B O   1 
HETATM 3980 O O   . HOH J 6 .   ? 3.794   6.423   36.337  1.00 18.73  ? 513 HOH B O   1 
HETATM 3981 O O   . HOH J 6 .   ? 20.231  6.946   34.183  1.00 25.92  ? 514 HOH B O   1 
HETATM 3982 O O   . HOH J 6 .   ? 30.381  34.975  37.002  1.00 22.02  ? 515 HOH B O   1 
HETATM 3983 O O   . HOH J 6 .   ? 39.009  40.556  41.053  1.00 39.83  ? 516 HOH B O   1 
HETATM 3984 O O   . HOH J 6 .   ? 30.840  6.263   39.906  1.00 31.99  ? 517 HOH B O   1 
HETATM 3985 O O   . HOH J 6 .   ? 13.424  8.350   53.631  1.00 20.00  ? 518 HOH B O   1 
HETATM 3986 O O   . HOH J 6 .   ? 36.747  17.828  59.700  1.00 22.58  ? 519 HOH B O   1 
HETATM 3987 O O   . HOH J 6 .   ? 10.353  1.096   55.647  1.00 31.83  ? 520 HOH B O   1 
HETATM 3988 O O   . HOH J 6 .   ? 35.106  20.780  38.681  1.00 28.14  ? 521 HOH B O   1 
HETATM 3989 O O   . HOH J 6 .   ? 20.845  22.119  49.003  1.00 31.96  ? 522 HOH B O   1 
HETATM 3990 O O   . HOH J 6 .   ? -3.779  8.876   41.427  1.00 39.38  ? 523 HOH B O   1 
HETATM 3991 O O   . HOH J 6 .   ? 52.556  15.732  54.626  1.00 20.65  ? 524 HOH B O   1 
HETATM 3992 O O   . HOH J 6 .   ? 11.038  4.584   34.057  1.00 30.40  ? 525 HOH B O   1 
HETATM 3993 O O   . HOH J 6 .   ? 40.450  21.600  64.157  1.00 36.55  ? 526 HOH B O   1 
HETATM 3994 O O   . HOH J 6 .   ? 34.804  17.460  62.977  1.00 46.14  ? 527 HOH B O   1 
HETATM 3995 O O   . HOH J 6 .   ? 6.234   19.058  47.039  1.00 24.45  ? 528 HOH B O   1 
HETATM 3996 O O   . HOH J 6 .   ? 27.162  35.180  43.500  1.00 22.19  ? 529 HOH B O   1 
HETATM 3997 O O   . HOH J 6 .   ? 54.907  20.446  55.642  1.00 38.31  ? 530 HOH B O   1 
HETATM 3998 O O   . HOH J 6 .   ? 42.601  20.267  61.344  1.00 27.64  ? 531 HOH B O   1 
HETATM 3999 O O   . HOH J 6 .   ? 36.105  28.292  37.116  1.00 28.35  ? 532 HOH B O   1 
HETATM 4000 O O   . HOH J 6 .   ? 0.970   -1.948  49.334  1.00 62.01  ? 533 HOH B O   1 
HETATM 4001 O O   . HOH J 6 .   ? 36.368  12.030  56.803  1.00 16.59  ? 534 HOH B O   1 
HETATM 4002 O O   . HOH J 6 .   ? 41.030  24.674  64.552  1.00 30.44  ? 535 HOH B O   1 
HETATM 4003 O O   . HOH J 6 .   ? 44.377  17.557  46.764  1.00 34.04  ? 536 HOH B O   1 
HETATM 4004 O O   . HOH J 6 .   ? -3.083  6.268   53.223  1.00 47.74  ? 537 HOH B O   1 
HETATM 4005 O O   . HOH J 6 .   ? 27.069  21.639  33.188  1.00 35.85  ? 538 HOH B O   1 
HETATM 4006 O O   . HOH J 6 .   ? 37.980  2.105   45.705  1.00 53.28  ? 539 HOH B O   1 
HETATM 4007 O O   . HOH J 6 .   ? 39.068  12.160  57.292  1.00 23.04  ? 540 HOH B O   1 
HETATM 4008 O O   . HOH J 6 .   ? 10.907  3.234   56.814  1.00 29.86  ? 541 HOH B O   1 
HETATM 4009 O O   . HOH J 6 .   ? 31.234  41.299  43.907  1.00 16.68  ? 542 HOH B O   1 
HETATM 4010 O O   . HOH J 6 .   ? 26.964  2.666   44.752  1.00 46.48  ? 543 HOH B O   1 
HETATM 4011 O O   . HOH J 6 .   ? 22.251  9.297   54.569  1.00 49.56  ? 544 HOH B O   1 
HETATM 4012 O O   . HOH J 6 .   ? 41.651  21.516  45.822  1.00 25.37  ? 545 HOH B O   1 
HETATM 4013 O O   . HOH J 6 .   ? 41.910  22.720  38.335  1.00 34.86  ? 546 HOH B O   1 
HETATM 4014 O O   . HOH J 6 .   ? 34.171  33.233  36.581  1.00 35.89  ? 547 HOH B O   1 
HETATM 4015 O O   . HOH J 6 .   ? 36.319  34.138  37.807  1.00 42.57  ? 548 HOH B O   1 
HETATM 4016 O O   . HOH J 6 .   ? 21.485  2.949   53.992  1.00 44.37  ? 549 HOH B O   1 
HETATM 4017 O O   . HOH J 6 .   ? 27.030  10.021  49.449  1.00 22.92  ? 550 HOH B O   1 
HETATM 4018 O O   . HOH J 6 .   ? 40.922  13.471  63.027  1.00 39.79  ? 551 HOH B O   1 
HETATM 4019 O O   . HOH J 6 .   ? 13.659  4.704   33.712  1.00 26.69  ? 552 HOH B O   1 
HETATM 4020 O O   . HOH J 6 .   ? 8.294   1.073   36.110  1.00 22.48  ? 553 HOH B O   1 
HETATM 4021 O O   . HOH J 6 .   ? -4.036  0.042   38.656  1.00 51.98  ? 554 HOH B O   1 
HETATM 4022 O O   . HOH J 6 .   ? -2.346  4.274   36.648  1.00 41.13  ? 555 HOH B O   1 
HETATM 4023 O O   . HOH J 6 .   ? 11.035  10.017  37.382  1.00 28.76  ? 556 HOH B O   1 
HETATM 4024 O O   . HOH J 6 .   ? 26.792  27.200  48.247  1.00 31.35  ? 557 HOH B O   1 
HETATM 4025 O O   . HOH J 6 .   ? 39.907  14.218  59.157  1.00 19.39  ? 558 HOH B O   1 
HETATM 4026 O O   . HOH J 6 .   ? 38.501  25.378  68.234  1.00 38.50  ? 559 HOH B O   1 
HETATM 4027 O O   . HOH J 6 .   ? 39.172  38.089  41.214  1.00 30.97  ? 560 HOH B O   1 
HETATM 4028 O O   . HOH J 6 .   ? 6.480   -0.632  53.207  1.00 45.18  ? 561 HOH B O   1 
HETATM 4029 O O   . HOH J 6 .   ? 38.769  13.095  61.424  1.00 39.83  ? 562 HOH B O   1 
HETATM 4030 O O   . HOH J 6 .   ? 45.307  17.644  49.349  1.00 36.17  ? 563 HOH B O   1 
HETATM 4031 O O   . HOH J 6 .   ? 43.666  24.098  51.504  1.00 17.30  ? 564 HOH B O   1 
HETATM 4032 O O   . HOH J 6 .   ? 7.369   6.516   56.443  1.00 23.38  ? 565 HOH B O   1 
HETATM 4033 O O   . HOH J 6 .   ? -2.840  12.059  55.527  1.00 22.14  ? 566 HOH B O   1 
HETATM 4034 O O   . HOH J 6 .   ? 39.262  16.829  58.924  1.00 20.41  ? 567 HOH B O   1 
HETATM 4035 O O   . HOH J 6 .   ? 49.726  10.340  52.735  1.00 24.98  ? 568 HOH B O   1 
HETATM 4036 O O   . HOH J 6 .   ? 3.200   16.183  31.832  1.00 28.27  ? 569 HOH B O   1 
HETATM 4037 O O   . HOH J 6 .   ? 20.897  7.332   43.806  1.00 22.29  ? 570 HOH B O   1 
HETATM 4038 O O   . HOH J 6 .   ? 23.167  18.433  55.277  1.00 29.40  ? 571 HOH B O   1 
HETATM 4039 O O   . HOH J 6 .   ? 23.649  16.032  35.800  1.00 31.10  ? 572 HOH B O   1 
HETATM 4040 O O   . HOH J 6 .   ? 3.555   -0.360  46.835  1.00 47.24  ? 573 HOH B O   1 
HETATM 4041 O O   . HOH J 6 .   ? 11.751  19.944  27.439  1.00 44.00  ? 574 HOH B O   1 
HETATM 4042 O O   . HOH J 6 .   ? 23.320  20.754  54.190  1.00 30.41  ? 575 HOH B O   1 
HETATM 4043 O O   . HOH J 6 .   ? 32.126  8.674   53.545  1.00 33.51  ? 576 HOH B O   1 
HETATM 4044 O O   . HOH J 6 .   ? 34.678  8.295   53.991  1.00 35.29  ? 577 HOH B O   1 
HETATM 4045 O O   . HOH J 6 .   ? 1.352   18.776  57.126  1.00 31.49  ? 578 HOH B O   1 
HETATM 4046 O O   . HOH J 6 .   ? 25.308  31.211  37.822  1.00 44.83  ? 579 HOH B O   1 
HETATM 4047 O O   . HOH J 6 .   ? 26.024  24.906  46.991  1.00 29.10  ? 580 HOH B O   1 
HETATM 4048 O O   . HOH J 6 .   ? 49.553  10.215  55.564  1.00 23.71  ? 581 HOH B O   1 
HETATM 4049 O O   . HOH J 6 .   ? 30.889  8.741   56.046  1.00 31.14  ? 582 HOH B O   1 
HETATM 4050 O O   . HOH J 6 .   ? 25.832  14.031  59.864  1.00 33.33  ? 583 HOH B O   1 
HETATM 4051 O O   . HOH J 6 .   ? 21.843  -0.618  41.311  1.00 48.38  ? 584 HOH B O   1 
HETATM 4052 O O   . HOH J 6 .   ? 22.000  15.468  53.924  1.00 44.80  ? 585 HOH B O   1 
HETATM 4053 O O   . HOH J 6 .   ? 31.086  37.441  37.717  1.00 29.91  ? 586 HOH B O   1 
HETATM 4054 O O   . HOH J 6 .   ? -4.955  7.631   56.117  1.00 30.31  ? 587 HOH B O   1 
HETATM 4055 O O   . HOH J 6 .   ? 32.546  23.304  36.646  1.00 39.71  ? 588 HOH B O   1 
HETATM 4056 O O   . HOH J 6 .   ? 20.879  23.740  29.240  1.00 33.17  ? 589 HOH B O   1 
HETATM 4057 O O   . HOH J 6 .   ? 16.823  2.069   52.945  1.00 37.17  ? 590 HOH B O   1 
HETATM 4058 O O   . HOH J 6 .   ? 8.803   9.878   35.496  1.00 34.46  ? 591 HOH B O   1 
HETATM 4059 O O   . HOH J 6 .   ? 35.259  15.715  59.778  1.00 27.08  ? 592 HOH B O   1 
HETATM 4060 O O   . HOH J 6 .   ? 13.884  13.532  32.337  1.00 41.33  ? 593 HOH B O   1 
HETATM 4061 O O   . HOH J 6 .   ? 43.486  24.720  61.275  1.00 23.08  ? 594 HOH B O   1 
HETATM 4062 O O   . HOH J 6 .   ? 3.215   -1.186  38.521  1.00 37.72  ? 595 HOH B O   1 
HETATM 4063 O O   . HOH J 6 .   ? 19.828  18.644  53.216  1.00 34.31  ? 596 HOH B O   1 
HETATM 4064 O O   . HOH J 6 .   ? 12.554  7.331   56.621  1.00 27.26  ? 597 HOH B O   1 
HETATM 4065 O O   . HOH J 6 .   ? 43.777  21.951  49.974  1.00 30.22  ? 598 HOH B O   1 
HETATM 4066 O O   . HOH J 6 .   ? 22.621  33.565  60.596  1.00 32.15  ? 599 HOH B O   1 
HETATM 4067 O O   . HOH J 6 .   ? 29.609  9.081   49.764  1.00 46.90  ? 600 HOH B O   1 
HETATM 4068 O O   . HOH J 6 .   ? 0.838   11.972  37.583  1.00 29.62  ? 601 HOH B O   1 
HETATM 4069 O O   . HOH J 6 .   ? 33.243  6.642   39.270  1.00 36.02  ? 602 HOH B O   1 
HETATM 4070 O O   . HOH J 6 .   ? 16.261  19.294  40.253  1.00 39.26  ? 603 HOH B O   1 
HETATM 4071 O O   . HOH J 6 .   ? 5.822   0.962   35.818  1.00 22.12  ? 604 HOH B O   1 
HETATM 4072 O O   . HOH J 6 .   ? 2.434   15.382  52.357  1.00 49.08  ? 605 HOH B O   1 
HETATM 4073 O O   . HOH J 6 .   ? 23.564  14.206  61.280  1.00 43.98  ? 606 HOH B O   1 
HETATM 4074 O O   . HOH J 6 .   ? 32.067  6.979   48.454  1.00 50.50  ? 607 HOH B O   1 
HETATM 4075 O O   . HOH J 6 .   ? 29.486  23.352  32.872  1.00 54.23  ? 608 HOH B O   1 
HETATM 4076 O O   . HOH J 6 .   ? 22.323  16.266  62.485  1.00 52.49  ? 609 HOH B O   1 
HETATM 4077 O O   . HOH J 6 .   ? 25.326  42.370  40.585  1.00 40.31  ? 610 HOH B O   1 
HETATM 4078 O O   . HOH J 6 .   ? 8.866   -1.731  36.796  1.00 29.08  ? 611 HOH B O   1 
HETATM 4079 O O   . HOH J 6 .   ? 12.462  -0.287  55.540  1.00 44.78  ? 612 HOH B O   1 
HETATM 4080 O O   . HOH J 6 .   ? 50.020  23.143  48.665  1.00 39.84  ? 613 HOH B O   1 
HETATM 4081 O O   . HOH J 6 .   ? 12.919  -3.024  55.078  1.00 44.66  ? 614 HOH B O   1 
HETATM 4082 O O   . HOH J 6 .   ? 5.378   20.122  30.423  1.00 41.90  ? 615 HOH B O   1 
HETATM 4083 O O   . HOH J 6 .   ? 0.932   17.580  48.914  1.00 25.48  ? 616 HOH B O   1 
HETATM 4084 O O   . HOH J 6 .   ? 20.379  2.617   35.038  1.00 53.75  ? 617 HOH B O   1 
HETATM 4085 O O   . HOH J 6 .   ? 17.515  15.671  43.234  1.00 46.45  ? 618 HOH B O   1 
HETATM 4086 O O   . HOH J 6 .   ? -3.406  8.672   46.389  1.00 27.43  ? 619 HOH B O   1 
HETATM 4087 O O   . HOH J 6 .   ? 27.681  6.600   58.586  1.00 50.34  ? 620 HOH B O   1 
HETATM 4088 O O   . HOH J 6 .   ? 40.088  10.068  58.821  1.00 41.92  ? 621 HOH B O   1 
HETATM 4089 O O   . HOH J 6 .   ? -1.309  8.852   40.327  1.00 31.03  ? 622 HOH B O   1 
HETATM 4090 O O   . HOH J 6 .   ? 60.494  23.183  44.848  1.00 39.03  ? 623 HOH B O   1 
HETATM 4091 O O   . HOH J 6 .   ? 0.301   1.156   34.236  1.00 29.78  ? 624 HOH B O   1 
HETATM 4092 O O   . HOH J 6 .   ? 49.733  20.942  43.468  1.00 49.18  ? 625 HOH B O   1 
HETATM 4093 O O   . HOH J 6 .   ? 20.709  1.850   49.040  1.00 35.57  ? 626 HOH B O   1 
HETATM 4094 O O   . HOH J 6 .   ? 35.752  36.923  38.426  1.00 28.32  ? 627 HOH B O   1 
HETATM 4095 O O   . HOH J 6 .   ? 16.769  6.438   55.203  1.00 38.99  ? 628 HOH B O   1 
HETATM 4096 O O   . HOH J 6 .   ? 4.527   -1.005  36.309  1.00 35.46  ? 629 HOH B O   1 
HETATM 4097 O O   . HOH J 6 .   ? 39.506  24.271  35.481  1.00 55.93  ? 630 HOH B O   1 
HETATM 4098 O O   . HOH J 6 .   ? -4.937  12.578  48.099  1.00 30.39  ? 631 HOH B O   1 
HETATM 4099 O O   . HOH J 6 .   ? 24.768  4.558   38.742  1.00 34.06  ? 632 HOH B O   1 
HETATM 4100 O O   . HOH J 6 .   ? 18.755  25.258  54.857  1.00 36.55  ? 633 HOH B O   1 
HETATM 4101 O O   . HOH J 6 .   ? 22.607  25.574  46.303  1.00 53.86  ? 634 HOH B O   1 
HETATM 4102 O O   . HOH J 6 .   ? 45.752  24.645  62.154  1.00 24.81  ? 635 HOH B O   1 
HETATM 4103 O O   . HOH J 6 .   ? 36.698  7.653   52.823  1.00 46.13  ? 636 HOH B O   1 
HETATM 4104 O O   . HOH J 6 .   ? 22.307  31.780  34.703  1.00 45.54  ? 637 HOH B O   1 
HETATM 4105 O O   . HOH J 6 .   ? 43.055  25.019  43.602  1.00 43.76  ? 638 HOH B O   1 
HETATM 4106 O O   . HOH J 6 .   ? 39.869  8.643   48.997  1.00 35.39  ? 639 HOH B O   1 
HETATM 4107 O O   . HOH J 6 .   ? 38.781  6.256   46.585  1.00 44.72  ? 640 HOH B O   1 
HETATM 4108 O O   . HOH J 6 .   ? 39.757  30.243  39.325  1.00 40.57  ? 641 HOH B O   1 
HETATM 4109 O O   . HOH J 6 .   ? 29.073  10.705  59.526  1.00 35.86  ? 642 HOH B O   1 
HETATM 4110 O O   . HOH J 6 .   ? 11.506  28.264  43.403  1.00 52.24  ? 643 HOH B O   1 
HETATM 4111 O O   . HOH J 6 .   ? 11.383  7.109   58.870  1.00 42.30  ? 644 HOH B O   1 
HETATM 4112 O O   . HOH J 6 .   ? 10.177  8.075   33.495  1.00 35.17  ? 645 HOH B O   1 
HETATM 4113 O O   . HOH J 6 .   ? 18.955  7.144   54.352  1.00 45.04  ? 646 HOH B O   1 
HETATM 4114 O O   . HOH J 6 .   ? 36.679  19.053  39.288  1.00 42.85  ? 647 HOH B O   1 
HETATM 4115 O O   . HOH J 6 .   ? 25.029  15.099  33.655  1.00 40.85  ? 648 HOH B O   1 
HETATM 4116 O O   . HOH J 6 .   ? 24.183  26.504  44.868  1.00 47.42  ? 649 HOH B O   1 
HETATM 4117 O O   . HOH J 6 .   ? 5.131   23.656  27.456  1.00 50.17  ? 650 HOH B O   1 
HETATM 4118 O O   . HOH J 6 .   ? 48.065  21.907  48.120  1.00 37.71  ? 651 HOH B O   1 
HETATM 4119 O O   . HOH J 6 .   ? 5.086   -3.372  50.495  1.00 40.41  ? 652 HOH B O   1 
HETATM 4120 O O   . HOH J 6 .   ? 46.211  26.596  45.086  1.00 40.57  ? 653 HOH B O   1 
HETATM 4121 O O   . HOH J 6 .   ? 30.137  21.080  63.370  1.00 42.98  ? 654 HOH B O   1 
HETATM 4122 O O   . HOH J 6 .   ? 46.338  21.317  50.247  1.00 46.98  ? 655 HOH B O   1 
HETATM 4123 O O   . HOH J 6 .   ? 18.188  17.458  59.381  1.00 54.42  ? 656 HOH B O   1 
HETATM 4124 O O   . HOH J 6 .   ? 35.748  9.427   56.728  1.00 37.43  ? 657 HOH B O   1 
HETATM 4125 O O   . HOH J 6 .   ? 47.225  24.421  45.708  1.00 52.51  ? 658 HOH B O   1 
HETATM 4126 O O   . HOH J 6 .   ? 6.827   8.598   57.967  1.00 47.30  ? 659 HOH B O   1 
HETATM 4127 O O   . HOH J 6 .   ? 15.605  -3.700  48.939  1.00 45.56  ? 660 HOH B O   1 
HETATM 4128 O O   . HOH J 6 .   ? 42.444  25.545  45.800  1.00 43.09  ? 661 HOH B O   1 
HETATM 4129 O O   . HOH J 6 .   ? 18.049  -2.577  50.335  1.00 54.30  ? 662 HOH B O   1 
HETATM 4130 O O   . HOH J 6 .   ? 14.604  15.251  35.594  1.00 42.79  ? 663 HOH B O   1 
HETATM 4131 O O   . HOH J 6 .   ? 17.078  -1.897  52.695  1.00 45.99  ? 664 HOH B O   1 
HETATM 4132 O O   . HOH J 6 .   ? 15.586  33.486  35.359  1.00 43.04  ? 665 HOH B O   1 
HETATM 4133 O O   . HOH J 6 .   ? 42.133  20.481  41.166  1.00 55.50  ? 666 HOH B O   1 
HETATM 4134 O O   . HOH J 6 .   ? 28.281  9.206   45.284  1.00 41.76  ? 667 HOH B O   1 
HETATM 4135 O O   . HOH J 6 .   ? -2.415  6.060   57.392  1.00 46.47  ? 668 HOH B O   1 
HETATM 4136 O O   . HOH J 6 .   ? 47.488  25.375  58.859  1.00 37.44  ? 669 HOH B O   1 
HETATM 4137 O O   . HOH J 6 .   ? 42.028  37.280  41.306  1.00 45.73  ? 670 HOH B O   1 
HETATM 4138 O O   . HOH J 6 .   ? 23.057  26.138  30.053  1.00 57.89  ? 671 HOH B O   1 
HETATM 4139 O O   . HOH J 6 .   ? 47.849  28.197  46.114  1.00 54.62  ? 672 HOH B O   1 
HETATM 4140 O O   . HOH J 6 .   ? 22.805  27.266  32.724  1.00 51.78  ? 673 HOH B O   1 
HETATM 4141 O O   . HOH J 6 .   ? 4.443   23.872  42.713  1.00 49.60  ? 674 HOH B O   1 
HETATM 4142 O O   . HOH J 6 .   ? 19.075  15.546  45.231  1.00 53.15  ? 675 HOH B O   1 
HETATM 4143 O O   . HOH J 6 .   ? -3.206  17.718  42.532  1.00 44.84  ? 676 HOH B O   1 
HETATM 4144 O O   . HOH J 6 .   ? 41.637  8.138   51.814  1.00 60.87  ? 677 HOH B O   1 
HETATM 4145 O O   . HOH J 6 .   ? 27.349  6.903   46.266  1.00 50.47  ? 678 HOH B O   1 
HETATM 4146 O O   . HOH J 6 .   ? 34.628  13.634  58.409  1.00 40.15  ? 679 HOH B O   1 
HETATM 4147 O O   . HOH J 6 .   ? -0.479  11.514  39.917  1.00 50.41  ? 680 HOH B O   1 
HETATM 4148 O O   . HOH J 6 .   ? 18.277  17.841  42.135  1.00 47.00  ? 681 HOH B O   1 
HETATM 4149 O O   . HOH J 6 .   ? 58.006  25.312  46.205  1.00 67.09  ? 682 HOH B O   1 
HETATM 4150 O O   . HOH J 6 .   ? 32.818  12.287  60.789  1.00 38.98  ? 683 HOH B O   1 
HETATM 4151 O O   . HOH J 6 .   ? 22.827  24.737  48.736  1.00 37.28  ? 684 HOH B O   1 
HETATM 4152 O O   . HOH J 6 .   ? 48.761  8.990   49.256  1.00 46.18  ? 685 HOH B O   1 
HETATM 4153 O O   . HOH J 6 .   ? 32.531  14.295  62.568  1.00 42.99  ? 686 HOH B O   1 
HETATM 4154 O O   . HOH J 6 .   ? 16.308  3.529   54.620  1.00 35.17  ? 687 HOH B O   1 
HETATM 4155 O O   . HOH J 6 .   ? 15.594  1.318   56.785  1.00 50.72  ? 688 HOH B O   1 
HETATM 4156 O O   . HOH J 6 .   ? -3.412  16.445  44.843  1.00 35.11  ? 689 HOH B O   1 
HETATM 4157 O O   . HOH J 6 .   ? 33.232  24.261  66.630  1.00 43.88  ? 690 HOH B O   1 
HETATM 4158 O O   . HOH J 6 .   ? 9.843   23.449  27.076  1.00 41.79  ? 691 HOH B O   1 
HETATM 4159 O O   . HOH J 6 .   ? 46.298  20.109  60.292  1.00 47.79  ? 692 HOH B O   1 
HETATM 4160 O O   . HOH J 6 .   ? 25.200  28.643  46.233  1.00 48.95  ? 693 HOH B O   1 
HETATM 4161 O O   . HOH J 6 .   ? 46.192  14.046  42.845  1.00 37.40  ? 694 HOH B O   1 
HETATM 4162 O O   . HOH J 6 .   ? 27.058  12.922  61.549  1.00 57.38  ? 695 HOH B O   1 
HETATM 4163 O O   . HOH J 6 .   ? 21.763  14.268  52.004  1.00 43.22  ? 696 HOH B O   1 
HETATM 4164 O O   . HOH J 6 .   ? 19.627  32.308  44.559  1.00 55.04  ? 697 HOH B O   1 
HETATM 4165 O O   . HOH J 6 .   ? 22.232  30.350  46.473  1.00 48.54  ? 698 HOH B O   1 
HETATM 4166 O O   . HOH J 6 .   ? 9.319   11.549  55.307  1.00 36.50  ? 699 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   HIS 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   PHE 4   2   ?   ?   ?   A . n 
A 1 5   SER 5   3   ?   ?   ?   A . n 
A 1 6   ILE 6   4   4   ILE ILE A . n 
A 1 7   GLN 7   5   5   GLN GLN A . n 
A 1 8   GLN 8   6   6   GLN GLN A . n 
A 1 9   PRO 9   7   7   PRO PRO A . n 
A 1 10  LEU 10  8   8   LEU LEU A . n 
A 1 11  LEU 11  9   9   LEU LEU A . n 
A 1 12  VAL 12  10  10  VAL VAL A . n 
A 1 13  PHE 13  11  11  PHE PHE A . n 
A 1 14  SER 14  12  12  SER SER A . n 
A 1 15  ASP 15  13  13  ASP ASP A . n 
A 1 16  LEU 16  14  14  LEU LEU A . n 
A 1 17  ASP 17  15  15  ASP ASP A . n 
A 1 18  GLY 18  16  16  GLY GLY A . n 
A 1 19  THR 19  17  17  THR THR A . n 
A 1 20  LEU 20  18  18  LEU LEU A . n 
A 1 21  LEU 21  19  19  LEU LEU A . n 
A 1 22  ASP 22  20  20  ASP ASP A . n 
A 1 23  SER 23  21  21  SER SER A . n 
A 1 24  HIS 24  22  22  HIS HIS A . n 
A 1 25  SER 25  23  23  SER SER A . n 
A 1 26  TYR 26  24  24  TYR TYR A . n 
A 1 27  ASP 27  25  25  ASP ASP A . n 
A 1 28  TRP 28  26  26  TRP TRP A . n 
A 1 29  GLN 29  27  27  GLN GLN A . n 
A 1 30  PRO 30  28  28  PRO PRO A . n 
A 1 31  ALA 31  29  29  ALA ALA A . n 
A 1 32  ALA 32  30  30  ALA ALA A . n 
A 1 33  PRO 33  31  31  PRO PRO A . n 
A 1 34  TRP 34  32  32  TRP TRP A . n 
A 1 35  LEU 35  33  33  LEU LEU A . n 
A 1 36  THR 36  34  34  THR THR A . n 
A 1 37  ARG 37  35  35  ARG ARG A . n 
A 1 38  LEU 38  36  36  LEU LEU A . n 
A 1 39  ARG 39  37  37  ARG ARG A . n 
A 1 40  GLU 40  38  38  GLU GLU A . n 
A 1 41  ALA 41  39  39  ALA ALA A . n 
A 1 42  ASN 42  40  40  ASN ASN A . n 
A 1 43  VAL 43  41  41  VAL VAL A . n 
A 1 44  PRO 44  42  42  PRO PRO A . n 
A 1 45  VAL 45  43  43  VAL VAL A . n 
A 1 46  ILE 46  44  44  ILE ILE A . n 
A 1 47  LEU 47  45  45  LEU LEU A . n 
A 1 48  CYS 48  46  46  CYS CYS A . n 
A 1 49  SER 49  47  47  SER SER A . n 
A 1 50  SER 50  48  48  SER SER A . n 
A 1 51  LYS 51  49  49  LYS LYS A . n 
A 1 52  THR 52  50  50  THR THR A . n 
A 1 53  SER 53  51  51  SER SER A . n 
A 1 54  ALA 54  52  52  ALA ALA A . n 
A 1 55  GLU 55  53  53  GLU GLU A . n 
A 1 56  MET 56  54  54  MET MET A . n 
A 1 57  LEU 57  55  55  LEU LEU A . n 
A 1 58  TYR 58  56  56  TYR TYR A . n 
A 1 59  LEU 59  57  57  LEU LEU A . n 
A 1 60  GLN 60  58  58  GLN GLN A . n 
A 1 61  LYS 61  59  59  LYS LYS A . n 
A 1 62  THR 62  60  60  THR THR A . n 
A 1 63  LEU 63  61  61  LEU LEU A . n 
A 1 64  GLY 64  62  62  GLY GLY A . n 
A 1 65  LEU 65  63  63  LEU LEU A . n 
A 1 66  GLN 66  64  64  GLN GLN A . n 
A 1 67  GLY 67  65  65  GLY GLY A . n 
A 1 68  LEU 68  66  66  LEU LEU A . n 
A 1 69  PRO 69  67  67  PRO PRO A . n 
A 1 70  LEU 70  68  68  LEU LEU A . n 
A 1 71  ILE 71  69  69  ILE ILE A . n 
A 1 72  ALA 72  70  70  ALA ALA A . n 
A 1 73  GLU 73  71  71  GLU GLU A . n 
A 1 74  ASN 74  72  72  ASN ASN A . n 
A 1 75  GLY 75  73  73  GLY GLY A . n 
A 1 76  ALA 76  74  74  ALA ALA A . n 
A 1 77  VAL 77  75  75  VAL VAL A . n 
A 1 78  ILE 78  76  76  ILE ILE A . n 
A 1 79  GLN 79  77  77  GLN GLN A . n 
A 1 80  LEU 80  78  78  LEU LEU A . n 
A 1 81  ALA 81  79  79  ALA ALA A . n 
A 1 82  GLU 82  80  80  GLU GLU A . n 
A 1 83  GLN 83  81  81  GLN GLN A . n 
A 1 84  TRP 84  82  82  TRP TRP A . n 
A 1 85  GLN 85  83  83  GLN GLN A . n 
A 1 86  GLU 86  84  84  GLU GLU A . n 
A 1 87  ILE 87  85  85  ILE ILE A . n 
A 1 88  ASP 88  86  86  ASP ASP A . n 
A 1 89  GLY 89  87  87  GLY GLY A . n 
A 1 90  PHE 90  88  88  PHE PHE A . n 
A 1 91  PRO 91  89  89  PRO PRO A . n 
A 1 92  ARG 92  90  90  ARG ARG A . n 
A 1 93  ILE 93  91  91  ILE ILE A . n 
A 1 94  ILE 94  92  92  ILE ILE A . n 
A 1 95  SER 95  93  93  SER SER A . n 
A 1 96  GLY 96  94  94  GLY GLY A . n 
A 1 97  ILE 97  95  95  ILE ILE A . n 
A 1 98  SER 98  96  96  SER SER A . n 
A 1 99  HIS 99  97  97  HIS HIS A . n 
A 1 100 GLY 100 98  98  GLY GLY A . n 
A 1 101 GLU 101 99  99  GLU GLU A . n 
A 1 102 ILE 102 100 100 ILE ILE A . n 
A 1 103 SER 103 101 101 SER SER A . n 
A 1 104 LEU 104 102 102 LEU LEU A . n 
A 1 105 VAL 105 103 103 VAL VAL A . n 
A 1 106 LEU 106 104 104 LEU LEU A . n 
A 1 107 ASN 107 105 105 ASN ASN A . n 
A 1 108 THR 108 106 106 THR THR A . n 
A 1 109 LEU 109 107 107 LEU LEU A . n 
A 1 110 ARG 110 108 108 ARG ARG A . n 
A 1 111 GLU 111 109 109 GLU GLU A . n 
A 1 112 LYS 112 110 110 LYS LYS A . n 
A 1 113 GLU 113 111 111 GLU GLU A . n 
A 1 114 HIS 114 112 112 HIS HIS A . n 
A 1 115 PHE 115 113 113 PHE PHE A . n 
A 1 116 LYS 116 114 114 LYS LYS A . n 
A 1 117 PHE 117 115 115 PHE PHE A . n 
A 1 118 THR 118 116 116 THR THR A . n 
A 1 119 THR 119 117 117 THR THR A . n 
A 1 120 PHE 120 118 118 PHE PHE A . n 
A 1 121 ASP 121 119 119 ASP ASP A . n 
A 1 122 ASP 122 120 120 ASP ASP A . n 
A 1 123 VAL 123 121 121 VAL VAL A . n 
A 1 124 ASP 124 122 122 ASP ASP A . n 
A 1 125 ASP 125 123 123 ASP ASP A . n 
A 1 126 ALA 126 124 124 ALA ALA A . n 
A 1 127 THR 127 125 125 THR THR A . n 
A 1 128 ILE 128 126 126 ILE ILE A . n 
A 1 129 ALA 129 127 127 ALA ALA A . n 
A 1 130 GLU 130 128 128 GLU GLU A . n 
A 1 131 TRP 131 129 129 TRP TRP A . n 
A 1 132 THR 132 130 130 THR THR A . n 
A 1 133 GLY 133 131 131 GLY GLY A . n 
A 1 134 LEU 134 132 132 LEU LEU A . n 
A 1 135 SER 135 133 133 SER SER A . n 
A 1 136 ARG 136 134 134 ARG ARG A . n 
A 1 137 SER 137 135 135 SER SER A . n 
A 1 138 GLN 138 136 136 GLN GLN A . n 
A 1 139 ALA 139 137 137 ALA ALA A . n 
A 1 140 ALA 140 138 138 ALA ALA A . n 
A 1 141 LEU 141 139 139 LEU LEU A . n 
A 1 142 THR 142 140 140 THR THR A . n 
A 1 143 GLN 143 141 141 GLN GLN A . n 
A 1 144 LEU 144 142 142 LEU LEU A . n 
A 1 145 HIS 145 143 143 HIS HIS A . n 
A 1 146 GLU 146 144 144 GLU GLU A . n 
A 1 147 ALA 147 145 145 ALA ALA A . n 
A 1 148 SER 148 146 146 SER SER A . n 
A 1 149 VAL 149 147 147 VAL VAL A . n 
A 1 150 THR 150 148 148 THR THR A . n 
A 1 151 LEU 151 149 149 LEU LEU A . n 
A 1 152 ILE 152 150 150 ILE ILE A . n 
A 1 153 TRP 153 151 151 TRP TRP A . n 
A 1 154 ARG 154 152 152 ARG ARG A . n 
A 1 155 ASP 155 153 153 ASP ASP A . n 
A 1 156 SER 156 154 154 SER SER A . n 
A 1 157 ASP 157 155 155 ASP ASP A . n 
A 1 158 GLU 158 156 156 GLU GLU A . n 
A 1 159 ARG 159 157 157 ARG ARG A . n 
A 1 160 MET 160 158 158 MET MET A . n 
A 1 161 ALA 161 159 159 ALA ALA A . n 
A 1 162 GLN 162 160 160 GLN GLN A . n 
A 1 163 PHE 163 161 161 PHE PHE A . n 
A 1 164 THR 164 162 162 THR THR A . n 
A 1 165 ALA 165 163 163 ALA ALA A . n 
A 1 166 ARG 166 164 164 ARG ARG A . n 
A 1 167 LEU 167 165 165 LEU LEU A . n 
A 1 168 ASN 168 166 166 ASN ASN A . n 
A 1 169 GLU 169 167 167 GLU GLU A . n 
A 1 170 LEU 170 168 168 LEU LEU A . n 
A 1 171 GLY 171 169 169 GLY GLY A . n 
A 1 172 LEU 172 170 170 LEU LEU A . n 
A 1 173 GLN 173 171 171 GLN GLN A . n 
A 1 174 PHE 174 172 172 PHE PHE A . n 
A 1 175 MET 175 173 173 MET MET A . n 
A 1 176 GLN 176 174 174 GLN GLN A . n 
A 1 177 GLY 177 175 175 GLY GLY A . n 
A 1 178 ALA 178 176 176 ALA ALA A . n 
A 1 179 ARG 179 177 177 ARG ARG A . n 
A 1 180 PHE 180 178 178 PHE PHE A . n 
A 1 181 TRP 181 179 179 TRP TRP A . n 
A 1 182 HIS 182 180 180 HIS HIS A . n 
A 1 183 VAL 183 181 181 VAL VAL A . n 
A 1 184 LEU 184 182 182 LEU LEU A . n 
A 1 185 ASP 185 183 183 ASP ASP A . n 
A 1 186 ALA 186 184 184 ALA ALA A . n 
A 1 187 SER 187 185 185 SER SER A . n 
A 1 188 ALA 188 186 186 ALA ALA A . n 
A 1 189 GLY 189 187 187 GLY GLY A . n 
A 1 190 LYS 190 188 188 LYS LYS A . n 
A 1 191 ASP 191 189 189 ASP ASP A . n 
A 1 192 GLN 192 190 190 GLN GLN A . n 
A 1 193 ALA 193 191 191 ALA ALA A . n 
A 1 194 ALA 194 192 192 ALA ALA A . n 
A 1 195 ASN 195 193 193 ASN ASN A . n 
A 1 196 TRP 196 194 194 TRP TRP A . n 
A 1 197 ILE 197 195 195 ILE ILE A . n 
A 1 198 ILE 198 196 196 ILE ILE A . n 
A 1 199 ALA 199 197 197 ALA ALA A . n 
A 1 200 THR 200 198 198 THR THR A . n 
A 1 201 TYR 201 199 199 TYR TYR A . n 
A 1 202 GLN 202 200 200 GLN GLN A . n 
A 1 203 GLN 203 201 201 GLN GLN A . n 
A 1 204 LEU 204 202 202 LEU LEU A . n 
A 1 205 SER 205 203 203 SER SER A . n 
A 1 206 GLY 206 204 204 GLY GLY A . n 
A 1 207 LYS 207 205 205 LYS LYS A . n 
A 1 208 ARG 208 206 206 ARG ARG A . n 
A 1 209 PRO 209 207 207 PRO PRO A . n 
A 1 210 THR 210 208 208 THR THR A . n 
A 1 211 THR 211 209 209 THR THR A . n 
A 1 212 LEU 212 210 210 LEU LEU A . n 
A 1 213 GLY 213 211 211 GLY GLY A . n 
A 1 214 LEU 214 212 212 LEU LEU A . n 
A 1 215 GLY 215 213 213 GLY GLY A . n 
A 1 216 ASP 216 214 214 ASP ASP A . n 
A 1 217 GLY 217 215 215 GLY GLY A . n 
A 1 218 PRO 218 216 216 PRO PRO A . n 
A 1 219 ASN 219 217 217 ASN ASN A . n 
A 1 220 ASP 220 218 218 ASP ASP A . n 
A 1 221 ALA 221 219 219 ALA ALA A . n 
A 1 222 PRO 222 220 220 PRO PRO A . n 
A 1 223 LEU 223 221 221 LEU LEU A . n 
A 1 224 LEU 224 222 222 LEU LEU A . n 
A 1 225 GLU 225 223 223 GLU GLU A . n 
A 1 226 VAL 226 224 224 VAL VAL A . n 
A 1 227 MET 227 225 225 MET MET A . n 
A 1 228 ASP 228 226 226 ASP ASP A . n 
A 1 229 TYR 229 227 227 TYR TYR A . n 
A 1 230 ALA 230 228 228 ALA ALA A . n 
A 1 231 VAL 231 229 229 VAL VAL A . n 
A 1 232 ILE 232 230 230 ILE ILE A . n 
A 1 233 VAL 233 231 231 VAL VAL A . n 
A 1 234 LYS 234 232 232 LYS LYS A . n 
A 1 235 GLY 235 233 233 GLY GLY A . n 
A 1 236 LEU 236 234 234 LEU LEU A . n 
A 1 237 ASN 237 235 235 ASN ASN A . n 
A 1 238 ARG 238 236 ?   ?   ?   A . n 
A 1 239 GLU 239 237 ?   ?   ?   A . n 
A 1 240 GLY 240 238 ?   ?   ?   A . n 
A 1 241 VAL 241 239 ?   ?   ?   A . n 
A 1 242 HIS 242 240 ?   ?   ?   A . n 
A 1 243 LEU 243 241 ?   ?   ?   A . n 
A 1 244 HIS 244 242 ?   ?   ?   A . n 
A 1 245 ASP 245 243 ?   ?   ?   A . n 
A 1 246 GLU 246 244 ?   ?   ?   A . n 
A 1 247 ASP 247 245 ?   ?   ?   A . n 
A 1 248 PRO 248 246 ?   ?   ?   A . n 
A 1 249 ALA 249 247 ?   ?   ?   A . n 
A 1 250 ARG 250 248 ?   ?   ?   A . n 
A 1 251 VAL 251 249 ?   ?   ?   A . n 
A 1 252 TRP 252 250 ?   ?   ?   A . n 
A 1 253 ARG 253 251 ?   ?   ?   A . n 
A 1 254 THR 254 252 ?   ?   ?   A . n 
A 1 255 GLN 255 253 ?   ?   ?   A . n 
A 1 256 ARG 256 254 ?   ?   ?   A . n 
A 1 257 GLU 257 255 ?   ?   ?   A . n 
A 1 258 GLY 258 256 ?   ?   ?   A . n 
A 1 259 PRO 259 257 ?   ?   ?   A . n 
A 1 260 GLU 260 258 ?   ?   ?   A . n 
A 1 261 GLY 261 259 ?   ?   ?   A . n 
A 1 262 TRP 262 260 ?   ?   ?   A . n 
A 1 263 ARG 263 261 ?   ?   ?   A . n 
A 1 264 GLU 264 262 ?   ?   ?   A . n 
A 1 265 GLY 265 263 ?   ?   ?   A . n 
A 1 266 LEU 266 264 ?   ?   ?   A . n 
A 1 267 ASP 267 265 ?   ?   ?   A . n 
A 1 268 HIS 268 266 ?   ?   ?   A . n 
A 1 269 PHE 269 267 ?   ?   ?   A . n 
A 1 270 PHE 270 268 ?   ?   ?   A . n 
A 1 271 SER 271 269 ?   ?   ?   A . n 
A 1 272 ALA 272 270 ?   ?   ?   A . n 
A 1 273 ARG 273 271 ?   ?   ?   A . n 
A 1 274 GLY 274 272 ?   ?   ?   A . n 
A 1 275 SER 275 273 ?   ?   ?   A . n 
B 1 1   GLY 1   -1  ?   ?   ?   B . n 
B 1 2   HIS 2   0   ?   ?   ?   B . n 
B 1 3   MET 3   1   1   MET MET B . n 
B 1 4   PHE 4   2   2   PHE PHE B . n 
B 1 5   SER 5   3   3   SER SER B . n 
B 1 6   ILE 6   4   4   ILE ILE B . n 
B 1 7   GLN 7   5   5   GLN GLN B . n 
B 1 8   GLN 8   6   6   GLN GLN B . n 
B 1 9   PRO 9   7   7   PRO PRO B . n 
B 1 10  LEU 10  8   8   LEU LEU B . n 
B 1 11  LEU 11  9   9   LEU LEU B . n 
B 1 12  VAL 12  10  10  VAL VAL B . n 
B 1 13  PHE 13  11  11  PHE PHE B . n 
B 1 14  SER 14  12  12  SER SER B . n 
B 1 15  ASP 15  13  13  ASP ASP B . n 
B 1 16  LEU 16  14  14  LEU LEU B . n 
B 1 17  ASP 17  15  15  ASP ASP B . n 
B 1 18  GLY 18  16  16  GLY GLY B . n 
B 1 19  THR 19  17  17  THR THR B . n 
B 1 20  LEU 20  18  18  LEU LEU B . n 
B 1 21  LEU 21  19  19  LEU LEU B . n 
B 1 22  ASP 22  20  20  ASP ASP B . n 
B 1 23  SER 23  21  21  SER SER B . n 
B 1 24  HIS 24  22  22  HIS HIS B . n 
B 1 25  SER 25  23  23  SER SER B . n 
B 1 26  TYR 26  24  24  TYR TYR B . n 
B 1 27  ASP 27  25  25  ASP ASP B . n 
B 1 28  TRP 28  26  26  TRP TRP B . n 
B 1 29  GLN 29  27  27  GLN GLN B . n 
B 1 30  PRO 30  28  28  PRO PRO B . n 
B 1 31  ALA 31  29  29  ALA ALA B . n 
B 1 32  ALA 32  30  30  ALA ALA B . n 
B 1 33  PRO 33  31  31  PRO PRO B . n 
B 1 34  TRP 34  32  32  TRP TRP B . n 
B 1 35  LEU 35  33  33  LEU LEU B . n 
B 1 36  THR 36  34  34  THR THR B . n 
B 1 37  ARG 37  35  35  ARG ARG B . n 
B 1 38  LEU 38  36  36  LEU LEU B . n 
B 1 39  ARG 39  37  37  ARG ARG B . n 
B 1 40  GLU 40  38  38  GLU GLU B . n 
B 1 41  ALA 41  39  39  ALA ALA B . n 
B 1 42  ASN 42  40  40  ASN ASN B . n 
B 1 43  VAL 43  41  41  VAL VAL B . n 
B 1 44  PRO 44  42  42  PRO PRO B . n 
B 1 45  VAL 45  43  43  VAL VAL B . n 
B 1 46  ILE 46  44  44  ILE ILE B . n 
B 1 47  LEU 47  45  45  LEU LEU B . n 
B 1 48  CYS 48  46  46  CYS CYS B . n 
B 1 49  SER 49  47  47  SER SER B . n 
B 1 50  SER 50  48  48  SER SER B . n 
B 1 51  LYS 51  49  49  LYS LYS B . n 
B 1 52  THR 52  50  50  THR THR B . n 
B 1 53  SER 53  51  51  SER SER B . n 
B 1 54  ALA 54  52  52  ALA ALA B . n 
B 1 55  GLU 55  53  53  GLU GLU B . n 
B 1 56  MET 56  54  54  MET MET B . n 
B 1 57  LEU 57  55  55  LEU LEU B . n 
B 1 58  TYR 58  56  56  TYR TYR B . n 
B 1 59  LEU 59  57  57  LEU LEU B . n 
B 1 60  GLN 60  58  58  GLN GLN B . n 
B 1 61  LYS 61  59  59  LYS LYS B . n 
B 1 62  THR 62  60  60  THR THR B . n 
B 1 63  LEU 63  61  61  LEU LEU B . n 
B 1 64  GLY 64  62  62  GLY GLY B . n 
B 1 65  LEU 65  63  63  LEU LEU B . n 
B 1 66  GLN 66  64  64  GLN GLN B . n 
B 1 67  GLY 67  65  65  GLY GLY B . n 
B 1 68  LEU 68  66  66  LEU LEU B . n 
B 1 69  PRO 69  67  67  PRO PRO B . n 
B 1 70  LEU 70  68  68  LEU LEU B . n 
B 1 71  ILE 71  69  69  ILE ILE B . n 
B 1 72  ALA 72  70  70  ALA ALA B . n 
B 1 73  GLU 73  71  71  GLU GLU B . n 
B 1 74  ASN 74  72  72  ASN ASN B . n 
B 1 75  GLY 75  73  73  GLY GLY B . n 
B 1 76  ALA 76  74  74  ALA ALA B . n 
B 1 77  VAL 77  75  75  VAL VAL B . n 
B 1 78  ILE 78  76  76  ILE ILE B . n 
B 1 79  GLN 79  77  77  GLN GLN B . n 
B 1 80  LEU 80  78  78  LEU LEU B . n 
B 1 81  ALA 81  79  79  ALA ALA B . n 
B 1 82  GLU 82  80  80  GLU GLU B . n 
B 1 83  GLN 83  81  81  GLN GLN B . n 
B 1 84  TRP 84  82  82  TRP TRP B . n 
B 1 85  GLN 85  83  83  GLN GLN B . n 
B 1 86  GLU 86  84  84  GLU GLU B . n 
B 1 87  ILE 87  85  85  ILE ILE B . n 
B 1 88  ASP 88  86  86  ASP ASP B . n 
B 1 89  GLY 89  87  87  GLY GLY B . n 
B 1 90  PHE 90  88  88  PHE PHE B . n 
B 1 91  PRO 91  89  89  PRO PRO B . n 
B 1 92  ARG 92  90  90  ARG ARG B . n 
B 1 93  ILE 93  91  91  ILE ILE B . n 
B 1 94  ILE 94  92  92  ILE ILE B . n 
B 1 95  SER 95  93  93  SER SER B . n 
B 1 96  GLY 96  94  94  GLY GLY B . n 
B 1 97  ILE 97  95  95  ILE ILE B . n 
B 1 98  SER 98  96  96  SER SER B . n 
B 1 99  HIS 99  97  97  HIS HIS B . n 
B 1 100 GLY 100 98  98  GLY GLY B . n 
B 1 101 GLU 101 99  99  GLU GLU B . n 
B 1 102 ILE 102 100 100 ILE ILE B . n 
B 1 103 SER 103 101 101 SER SER B . n 
B 1 104 LEU 104 102 102 LEU LEU B . n 
B 1 105 VAL 105 103 103 VAL VAL B . n 
B 1 106 LEU 106 104 104 LEU LEU B . n 
B 1 107 ASN 107 105 105 ASN ASN B . n 
B 1 108 THR 108 106 106 THR THR B . n 
B 1 109 LEU 109 107 107 LEU LEU B . n 
B 1 110 ARG 110 108 108 ARG ARG B . n 
B 1 111 GLU 111 109 109 GLU GLU B . n 
B 1 112 LYS 112 110 110 LYS LYS B . n 
B 1 113 GLU 113 111 111 GLU GLU B . n 
B 1 114 HIS 114 112 112 HIS HIS B . n 
B 1 115 PHE 115 113 113 PHE PHE B . n 
B 1 116 LYS 116 114 114 LYS LYS B . n 
B 1 117 PHE 117 115 115 PHE PHE B . n 
B 1 118 THR 118 116 116 THR THR B . n 
B 1 119 THR 119 117 117 THR THR B . n 
B 1 120 PHE 120 118 118 PHE PHE B . n 
B 1 121 ASP 121 119 119 ASP ASP B . n 
B 1 122 ASP 122 120 120 ASP ASP B . n 
B 1 123 VAL 123 121 121 VAL VAL B . n 
B 1 124 ASP 124 122 122 ASP ASP B . n 
B 1 125 ASP 125 123 123 ASP ASP B . n 
B 1 126 ALA 126 124 124 ALA ALA B . n 
B 1 127 THR 127 125 125 THR THR B . n 
B 1 128 ILE 128 126 126 ILE ILE B . n 
B 1 129 ALA 129 127 127 ALA ALA B . n 
B 1 130 GLU 130 128 128 GLU GLU B . n 
B 1 131 TRP 131 129 129 TRP TRP B . n 
B 1 132 THR 132 130 130 THR THR B . n 
B 1 133 GLY 133 131 131 GLY GLY B . n 
B 1 134 LEU 134 132 132 LEU LEU B . n 
B 1 135 SER 135 133 133 SER SER B . n 
B 1 136 ARG 136 134 134 ARG ARG B . n 
B 1 137 SER 137 135 135 SER SER B . n 
B 1 138 GLN 138 136 136 GLN GLN B . n 
B 1 139 ALA 139 137 137 ALA ALA B . n 
B 1 140 ALA 140 138 138 ALA ALA B . n 
B 1 141 LEU 141 139 139 LEU LEU B . n 
B 1 142 THR 142 140 140 THR THR B . n 
B 1 143 GLN 143 141 141 GLN GLN B . n 
B 1 144 LEU 144 142 142 LEU LEU B . n 
B 1 145 HIS 145 143 143 HIS HIS B . n 
B 1 146 GLU 146 144 144 GLU GLU B . n 
B 1 147 ALA 147 145 145 ALA ALA B . n 
B 1 148 SER 148 146 146 SER SER B . n 
B 1 149 VAL 149 147 147 VAL VAL B . n 
B 1 150 THR 150 148 148 THR THR B . n 
B 1 151 LEU 151 149 149 LEU LEU B . n 
B 1 152 ILE 152 150 150 ILE ILE B . n 
B 1 153 TRP 153 151 151 TRP TRP B . n 
B 1 154 ARG 154 152 152 ARG ARG B . n 
B 1 155 ASP 155 153 153 ASP ASP B . n 
B 1 156 SER 156 154 154 SER SER B . n 
B 1 157 ASP 157 155 155 ASP ASP B . n 
B 1 158 GLU 158 156 156 GLU GLU B . n 
B 1 159 ARG 159 157 157 ARG ARG B . n 
B 1 160 MET 160 158 158 MET MET B . n 
B 1 161 ALA 161 159 159 ALA ALA B . n 
B 1 162 GLN 162 160 160 GLN GLN B . n 
B 1 163 PHE 163 161 161 PHE PHE B . n 
B 1 164 THR 164 162 162 THR THR B . n 
B 1 165 ALA 165 163 163 ALA ALA B . n 
B 1 166 ARG 166 164 164 ARG ARG B . n 
B 1 167 LEU 167 165 165 LEU LEU B . n 
B 1 168 ASN 168 166 166 ASN ASN B . n 
B 1 169 GLU 169 167 167 GLU GLU B . n 
B 1 170 LEU 170 168 168 LEU LEU B . n 
B 1 171 GLY 171 169 169 GLY GLY B . n 
B 1 172 LEU 172 170 170 LEU LEU B . n 
B 1 173 GLN 173 171 171 GLN GLN B . n 
B 1 174 PHE 174 172 172 PHE PHE B . n 
B 1 175 MET 175 173 173 MET MET B . n 
B 1 176 GLN 176 174 174 GLN GLN B . n 
B 1 177 GLY 177 175 175 GLY GLY B . n 
B 1 178 ALA 178 176 176 ALA ALA B . n 
B 1 179 ARG 179 177 177 ARG ARG B . n 
B 1 180 PHE 180 178 178 PHE PHE B . n 
B 1 181 TRP 181 179 179 TRP TRP B . n 
B 1 182 HIS 182 180 180 HIS HIS B . n 
B 1 183 VAL 183 181 181 VAL VAL B . n 
B 1 184 LEU 184 182 182 LEU LEU B . n 
B 1 185 ASP 185 183 183 ASP ASP B . n 
B 1 186 ALA 186 184 184 ALA ALA B . n 
B 1 187 SER 187 185 185 SER SER B . n 
B 1 188 ALA 188 186 186 ALA ALA B . n 
B 1 189 GLY 189 187 187 GLY GLY B . n 
B 1 190 LYS 190 188 188 LYS LYS B . n 
B 1 191 ASP 191 189 189 ASP ASP B . n 
B 1 192 GLN 192 190 190 GLN GLN B . n 
B 1 193 ALA 193 191 191 ALA ALA B . n 
B 1 194 ALA 194 192 192 ALA ALA B . n 
B 1 195 ASN 195 193 193 ASN ASN B . n 
B 1 196 TRP 196 194 194 TRP TRP B . n 
B 1 197 ILE 197 195 195 ILE ILE B . n 
B 1 198 ILE 198 196 196 ILE ILE B . n 
B 1 199 ALA 199 197 197 ALA ALA B . n 
B 1 200 THR 200 198 198 THR THR B . n 
B 1 201 TYR 201 199 199 TYR TYR B . n 
B 1 202 GLN 202 200 200 GLN GLN B . n 
B 1 203 GLN 203 201 201 GLN GLN B . n 
B 1 204 LEU 204 202 202 LEU LEU B . n 
B 1 205 SER 205 203 203 SER SER B . n 
B 1 206 GLY 206 204 204 GLY GLY B . n 
B 1 207 LYS 207 205 205 LYS LYS B . n 
B 1 208 ARG 208 206 206 ARG ARG B . n 
B 1 209 PRO 209 207 207 PRO PRO B . n 
B 1 210 THR 210 208 208 THR THR B . n 
B 1 211 THR 211 209 209 THR THR B . n 
B 1 212 LEU 212 210 210 LEU LEU B . n 
B 1 213 GLY 213 211 211 GLY GLY B . n 
B 1 214 LEU 214 212 212 LEU LEU B . n 
B 1 215 GLY 215 213 213 GLY GLY B . n 
B 1 216 ASP 216 214 214 ASP ASP B . n 
B 1 217 GLY 217 215 215 GLY GLY B . n 
B 1 218 PRO 218 216 216 PRO PRO B . n 
B 1 219 ASN 219 217 217 ASN ASN B . n 
B 1 220 ASP 220 218 218 ASP ASP B . n 
B 1 221 ALA 221 219 219 ALA ALA B . n 
B 1 222 PRO 222 220 220 PRO PRO B . n 
B 1 223 LEU 223 221 221 LEU LEU B . n 
B 1 224 LEU 224 222 222 LEU LEU B . n 
B 1 225 GLU 225 223 223 GLU GLU B . n 
B 1 226 VAL 226 224 224 VAL VAL B . n 
B 1 227 MET 227 225 225 MET MET B . n 
B 1 228 ASP 228 226 226 ASP ASP B . n 
B 1 229 TYR 229 227 227 TYR TYR B . n 
B 1 230 ALA 230 228 228 ALA ALA B . n 
B 1 231 VAL 231 229 229 VAL VAL B . n 
B 1 232 ILE 232 230 230 ILE ILE B . n 
B 1 233 VAL 233 231 231 VAL VAL B . n 
B 1 234 LYS 234 232 232 LYS LYS B . n 
B 1 235 GLY 235 233 233 GLY GLY B . n 
B 1 236 LEU 236 234 234 LEU LEU B . n 
B 1 237 ASN 237 235 ?   ?   ?   B . n 
B 1 238 ARG 238 236 ?   ?   ?   B . n 
B 1 239 GLU 239 237 ?   ?   ?   B . n 
B 1 240 GLY 240 238 ?   ?   ?   B . n 
B 1 241 VAL 241 239 ?   ?   ?   B . n 
B 1 242 HIS 242 240 ?   ?   ?   B . n 
B 1 243 LEU 243 241 ?   ?   ?   B . n 
B 1 244 HIS 244 242 ?   ?   ?   B . n 
B 1 245 ASP 245 243 ?   ?   ?   B . n 
B 1 246 GLU 246 244 ?   ?   ?   B . n 
B 1 247 ASP 247 245 ?   ?   ?   B . n 
B 1 248 PRO 248 246 ?   ?   ?   B . n 
B 1 249 ALA 249 247 ?   ?   ?   B . n 
B 1 250 ARG 250 248 ?   ?   ?   B . n 
B 1 251 VAL 251 249 ?   ?   ?   B . n 
B 1 252 TRP 252 250 ?   ?   ?   B . n 
B 1 253 ARG 253 251 ?   ?   ?   B . n 
B 1 254 THR 254 252 ?   ?   ?   B . n 
B 1 255 GLN 255 253 ?   ?   ?   B . n 
B 1 256 ARG 256 254 ?   ?   ?   B . n 
B 1 257 GLU 257 255 ?   ?   ?   B . n 
B 1 258 GLY 258 256 ?   ?   ?   B . n 
B 1 259 PRO 259 257 ?   ?   ?   B . n 
B 1 260 GLU 260 258 ?   ?   ?   B . n 
B 1 261 GLY 261 259 ?   ?   ?   B . n 
B 1 262 TRP 262 260 ?   ?   ?   B . n 
B 1 263 ARG 263 261 ?   ?   ?   B . n 
B 1 264 GLU 264 262 ?   ?   ?   B . n 
B 1 265 GLY 265 263 ?   ?   ?   B . n 
B 1 266 LEU 266 264 ?   ?   ?   B . n 
B 1 267 ASP 267 265 ?   ?   ?   B . n 
B 1 268 HIS 268 266 ?   ?   ?   B . n 
B 1 269 PHE 269 267 ?   ?   ?   B . n 
B 1 270 PHE 270 268 ?   ?   ?   B . n 
B 1 271 SER 271 269 ?   ?   ?   B . n 
B 1 272 ALA 272 270 ?   ?   ?   B . n 
B 1 273 ARG 273 271 ?   ?   ?   B . n 
B 1 274 GLY 274 272 ?   ?   ?   B . n 
B 1 275 SER 275 273 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Midwest Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     MCSG 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-12-14 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      refinement        5.2.0000 ? 1 
SBC-Collect 'data collection' .        ? 2 
HKL-2000    'data scaling'    .        ? 3 
SHARP       phasing           .        ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
300 
;BIOMOLECULE: 1
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 2 CHAIN(S). THE BIOLOGICAL UNIT IS
UNKNOWN.
;
600 
;HETEROGEN
AUTHORS STATE THAT 1PE, PG4 and PGE are from PEG 4000.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N   B GLY 16  ? ? O  B HOH 698 ? ? 2.11 
2 1 NH1 B ARG 37  ? ? O  B GLN 64  ? ? 2.13 
3 1 O   A HOH 657 ? ? O  A HOH 787 ? ? 2.13 
4 1 O   A LEU 234 ? ? O  A HOH 726 ? ? 2.13 
5 1 OD1 A ASP 25  ? ? OH A TYR 56  ? ? 2.17 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              35 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              35 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              35 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                117.14 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            -3.16 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 13  ? ? -110.23 69.39   
2 1 TYR A 24  ? ? -103.95 -126.32 
3 1 VAL A 41  ? ? -118.71 79.72   
4 1 ALA A 145 ? ? -147.23 37.64   
5 1 ASP B 13  ? ? -116.14 71.29   
6 1 TYR B 24  ? ? -98.68  -127.87 
7 1 ALA B 145 ? ? -149.31 31.57   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   SER 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    23 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   TYR 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    24 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -147.95 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A HIS 0   ? A HIS 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A PHE 2   ? A PHE 4   
5  1 Y 1 A SER 3   ? A SER 5   
6  1 Y 1 A ARG 236 ? A ARG 238 
7  1 Y 1 A GLU 237 ? A GLU 239 
8  1 Y 1 A GLY 238 ? A GLY 240 
9  1 Y 1 A VAL 239 ? A VAL 241 
10 1 Y 1 A HIS 240 ? A HIS 242 
11 1 Y 1 A LEU 241 ? A LEU 243 
12 1 Y 1 A HIS 242 ? A HIS 244 
13 1 Y 1 A ASP 243 ? A ASP 245 
14 1 Y 1 A GLU 244 ? A GLU 246 
15 1 Y 1 A ASP 245 ? A ASP 247 
16 1 Y 1 A PRO 246 ? A PRO 248 
17 1 Y 1 A ALA 247 ? A ALA 249 
18 1 Y 1 A ARG 248 ? A ARG 250 
19 1 Y 1 A VAL 249 ? A VAL 251 
20 1 Y 1 A TRP 250 ? A TRP 252 
21 1 Y 1 A ARG 251 ? A ARG 253 
22 1 Y 1 A THR 252 ? A THR 254 
23 1 Y 1 A GLN 253 ? A GLN 255 
24 1 Y 1 A ARG 254 ? A ARG 256 
25 1 Y 1 A GLU 255 ? A GLU 257 
26 1 Y 1 A GLY 256 ? A GLY 258 
27 1 Y 1 A PRO 257 ? A PRO 259 
28 1 Y 1 A GLU 258 ? A GLU 260 
29 1 Y 1 A GLY 259 ? A GLY 261 
30 1 Y 1 A TRP 260 ? A TRP 262 
31 1 Y 1 A ARG 261 ? A ARG 263 
32 1 Y 1 A GLU 262 ? A GLU 264 
33 1 Y 1 A GLY 263 ? A GLY 265 
34 1 Y 1 A LEU 264 ? A LEU 266 
35 1 Y 1 A ASP 265 ? A ASP 267 
36 1 Y 1 A HIS 266 ? A HIS 268 
37 1 Y 1 A PHE 267 ? A PHE 269 
38 1 Y 1 A PHE 268 ? A PHE 270 
39 1 Y 1 A SER 269 ? A SER 271 
40 1 Y 1 A ALA 270 ? A ALA 272 
41 1 Y 1 A ARG 271 ? A ARG 273 
42 1 Y 1 A GLY 272 ? A GLY 274 
43 1 Y 1 A SER 273 ? A SER 275 
44 1 Y 1 B GLY -1  ? B GLY 1   
45 1 Y 1 B HIS 0   ? B HIS 2   
46 1 Y 1 B ASN 235 ? B ASN 237 
47 1 Y 1 B ARG 236 ? B ARG 238 
48 1 Y 1 B GLU 237 ? B GLU 239 
49 1 Y 1 B GLY 238 ? B GLY 240 
50 1 Y 1 B VAL 239 ? B VAL 241 
51 1 Y 1 B HIS 240 ? B HIS 242 
52 1 Y 1 B LEU 241 ? B LEU 243 
53 1 Y 1 B HIS 242 ? B HIS 244 
54 1 Y 1 B ASP 243 ? B ASP 245 
55 1 Y 1 B GLU 244 ? B GLU 246 
56 1 Y 1 B ASP 245 ? B ASP 247 
57 1 Y 1 B PRO 246 ? B PRO 248 
58 1 Y 1 B ALA 247 ? B ALA 249 
59 1 Y 1 B ARG 248 ? B ARG 250 
60 1 Y 1 B VAL 249 ? B VAL 251 
61 1 Y 1 B TRP 250 ? B TRP 252 
62 1 Y 1 B ARG 251 ? B ARG 253 
63 1 Y 1 B THR 252 ? B THR 254 
64 1 Y 1 B GLN 253 ? B GLN 255 
65 1 Y 1 B ARG 254 ? B ARG 256 
66 1 Y 1 B GLU 255 ? B GLU 257 
67 1 Y 1 B GLY 256 ? B GLY 258 
68 1 Y 1 B PRO 257 ? B PRO 259 
69 1 Y 1 B GLU 258 ? B GLU 260 
70 1 Y 1 B GLY 259 ? B GLY 261 
71 1 Y 1 B TRP 260 ? B TRP 262 
72 1 Y 1 B ARG 261 ? B ARG 263 
73 1 Y 1 B GLU 262 ? B GLU 264 
74 1 Y 1 B GLY 263 ? B GLY 265 
75 1 Y 1 B LEU 264 ? B LEU 266 
76 1 Y 1 B ASP 265 ? B ASP 267 
77 1 Y 1 B HIS 266 ? B HIS 268 
78 1 Y 1 B PHE 267 ? B PHE 269 
79 1 Y 1 B PHE 268 ? B PHE 270 
80 1 Y 1 B SER 269 ? B SER 271 
81 1 Y 1 B ALA 270 ? B ALA 272 
82 1 Y 1 B ARG 271 ? B ARG 273 
83 1 Y 1 B GLY 272 ? B GLY 274 
84 1 Y 1 B SER 273 ? B SER 275 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'          SO4 
3 'PENTAETHYLENE GLYCOL' 1PE 
4 'TETRAETHYLENE GLYCOL' PG4 
5 'TRIETHYLENE GLYCOL'   PGE 
6 water                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   501 501 SO4 SO4 A . 
D 2 SO4 1   502 502 SO4 SO4 A . 
E 3 1PE 1   601 601 1PE PE5 A . 
F 4 PG4 1   602 602 PG4 PE4 A . 
G 5 PGE 1   603 603 PGE PE3 A . 
H 2 SO4 1   503 503 SO4 SO4 B . 
I 6 HOH 1   604 3   HOH HOH A . 
I 6 HOH 2   605 12  HOH HOH A . 
I 6 HOH 3   606 13  HOH HOH A . 
I 6 HOH 4   607 14  HOH HOH A . 
I 6 HOH 5   608 20  HOH HOH A . 
I 6 HOH 6   609 22  HOH HOH A . 
I 6 HOH 7   610 23  HOH HOH A . 
I 6 HOH 8   611 24  HOH HOH A . 
I 6 HOH 9   612 28  HOH HOH A . 
I 6 HOH 10  613 29  HOH HOH A . 
I 6 HOH 11  614 30  HOH HOH A . 
I 6 HOH 12  615 32  HOH HOH A . 
I 6 HOH 13  616 33  HOH HOH A . 
I 6 HOH 14  617 36  HOH HOH A . 
I 6 HOH 15  618 38  HOH HOH A . 
I 6 HOH 16  619 39  HOH HOH A . 
I 6 HOH 17  620 44  HOH HOH A . 
I 6 HOH 18  621 45  HOH HOH A . 
I 6 HOH 19  622 48  HOH HOH A . 
I 6 HOH 20  623 53  HOH HOH A . 
I 6 HOH 21  624 58  HOH HOH A . 
I 6 HOH 22  625 63  HOH HOH A . 
I 6 HOH 23  626 64  HOH HOH A . 
I 6 HOH 24  627 66  HOH HOH A . 
I 6 HOH 25  628 68  HOH HOH A . 
I 6 HOH 26  629 71  HOH HOH A . 
I 6 HOH 27  630 72  HOH HOH A . 
I 6 HOH 28  631 73  HOH HOH A . 
I 6 HOH 29  632 74  HOH HOH A . 
I 6 HOH 30  633 76  HOH HOH A . 
I 6 HOH 31  634 78  HOH HOH A . 
I 6 HOH 32  635 81  HOH HOH A . 
I 6 HOH 33  636 85  HOH HOH A . 
I 6 HOH 34  637 86  HOH HOH A . 
I 6 HOH 35  638 91  HOH HOH A . 
I 6 HOH 36  639 96  HOH HOH A . 
I 6 HOH 37  640 101 HOH HOH A . 
I 6 HOH 38  641 108 HOH HOH A . 
I 6 HOH 39  642 110 HOH HOH A . 
I 6 HOH 40  643 111 HOH HOH A . 
I 6 HOH 41  644 112 HOH HOH A . 
I 6 HOH 42  645 113 HOH HOH A . 
I 6 HOH 43  646 115 HOH HOH A . 
I 6 HOH 44  647 120 HOH HOH A . 
I 6 HOH 45  648 125 HOH HOH A . 
I 6 HOH 46  649 127 HOH HOH A . 
I 6 HOH 47  650 129 HOH HOH A . 
I 6 HOH 48  651 130 HOH HOH A . 
I 6 HOH 49  652 134 HOH HOH A . 
I 6 HOH 50  653 136 HOH HOH A . 
I 6 HOH 51  654 137 HOH HOH A . 
I 6 HOH 52  655 138 HOH HOH A . 
I 6 HOH 53  656 139 HOH HOH A . 
I 6 HOH 54  657 140 HOH HOH A . 
I 6 HOH 55  658 141 HOH HOH A . 
I 6 HOH 56  659 142 HOH HOH A . 
I 6 HOH 57  660 143 HOH HOH A . 
I 6 HOH 58  661 144 HOH HOH A . 
I 6 HOH 59  662 146 HOH HOH A . 
I 6 HOH 60  663 148 HOH HOH A . 
I 6 HOH 61  664 149 HOH HOH A . 
I 6 HOH 62  665 151 HOH HOH A . 
I 6 HOH 63  666 153 HOH HOH A . 
I 6 HOH 64  667 154 HOH HOH A . 
I 6 HOH 65  668 155 HOH HOH A . 
I 6 HOH 66  669 156 HOH HOH A . 
I 6 HOH 67  670 157 HOH HOH A . 
I 6 HOH 68  671 158 HOH HOH A . 
I 6 HOH 69  672 161 HOH HOH A . 
I 6 HOH 70  673 163 HOH HOH A . 
I 6 HOH 71  674 166 HOH HOH A . 
I 6 HOH 72  675 167 HOH HOH A . 
I 6 HOH 73  676 168 HOH HOH A . 
I 6 HOH 74  677 171 HOH HOH A . 
I 6 HOH 75  678 172 HOH HOH A . 
I 6 HOH 76  679 173 HOH HOH A . 
I 6 HOH 77  680 174 HOH HOH A . 
I 6 HOH 78  681 175 HOH HOH A . 
I 6 HOH 79  682 180 HOH HOH A . 
I 6 HOH 80  683 182 HOH HOH A . 
I 6 HOH 81  684 184 HOH HOH A . 
I 6 HOH 82  685 187 HOH HOH A . 
I 6 HOH 83  686 189 HOH HOH A . 
I 6 HOH 84  687 191 HOH HOH A . 
I 6 HOH 85  688 192 HOH HOH A . 
I 6 HOH 86  689 195 HOH HOH A . 
I 6 HOH 87  690 196 HOH HOH A . 
I 6 HOH 88  691 197 HOH HOH A . 
I 6 HOH 89  692 202 HOH HOH A . 
I 6 HOH 90  693 203 HOH HOH A . 
I 6 HOH 91  694 204 HOH HOH A . 
I 6 HOH 92  695 207 HOH HOH A . 
I 6 HOH 93  696 208 HOH HOH A . 
I 6 HOH 94  697 209 HOH HOH A . 
I 6 HOH 95  698 210 HOH HOH A . 
I 6 HOH 96  699 212 HOH HOH A . 
I 6 HOH 97  700 216 HOH HOH A . 
I 6 HOH 98  701 217 HOH HOH A . 
I 6 HOH 99  702 220 HOH HOH A . 
I 6 HOH 100 703 225 HOH HOH A . 
I 6 HOH 101 704 227 HOH HOH A . 
I 6 HOH 102 705 230 HOH HOH A . 
I 6 HOH 103 706 231 HOH HOH A . 
I 6 HOH 104 707 232 HOH HOH A . 
I 6 HOH 105 708 233 HOH HOH A . 
I 6 HOH 106 709 234 HOH HOH A . 
I 6 HOH 107 710 235 HOH HOH A . 
I 6 HOH 108 711 238 HOH HOH A . 
I 6 HOH 109 712 241 HOH HOH A . 
I 6 HOH 110 713 244 HOH HOH A . 
I 6 HOH 111 714 245 HOH HOH A . 
I 6 HOH 112 715 246 HOH HOH A . 
I 6 HOH 113 716 247 HOH HOH A . 
I 6 HOH 114 717 248 HOH HOH A . 
I 6 HOH 115 718 249 HOH HOH A . 
I 6 HOH 116 719 250 HOH HOH A . 
I 6 HOH 117 720 251 HOH HOH A . 
I 6 HOH 118 721 252 HOH HOH A . 
I 6 HOH 119 722 253 HOH HOH A . 
I 6 HOH 120 723 254 HOH HOH A . 
I 6 HOH 121 724 255 HOH HOH A . 
I 6 HOH 122 725 256 HOH HOH A . 
I 6 HOH 123 726 257 HOH HOH A . 
I 6 HOH 124 727 263 HOH HOH A . 
I 6 HOH 125 728 264 HOH HOH A . 
I 6 HOH 126 729 265 HOH HOH A . 
I 6 HOH 127 730 268 HOH HOH A . 
I 6 HOH 128 731 271 HOH HOH A . 
I 6 HOH 129 732 272 HOH HOH A . 
I 6 HOH 130 733 273 HOH HOH A . 
I 6 HOH 131 734 275 HOH HOH A . 
I 6 HOH 132 735 277 HOH HOH A . 
I 6 HOH 133 736 279 HOH HOH A . 
I 6 HOH 134 737 280 HOH HOH A . 
I 6 HOH 135 738 282 HOH HOH A . 
I 6 HOH 136 739 283 HOH HOH A . 
I 6 HOH 137 740 285 HOH HOH A . 
I 6 HOH 138 741 286 HOH HOH A . 
I 6 HOH 139 742 287 HOH HOH A . 
I 6 HOH 140 743 288 HOH HOH A . 
I 6 HOH 141 744 291 HOH HOH A . 
I 6 HOH 142 745 293 HOH HOH A . 
I 6 HOH 143 746 294 HOH HOH A . 
I 6 HOH 144 747 296 HOH HOH A . 
I 6 HOH 145 748 297 HOH HOH A . 
I 6 HOH 146 749 299 HOH HOH A . 
I 6 HOH 147 750 301 HOH HOH A . 
I 6 HOH 148 751 303 HOH HOH A . 
I 6 HOH 149 752 305 HOH HOH A . 
I 6 HOH 150 753 309 HOH HOH A . 
I 6 HOH 151 754 310 HOH HOH A . 
I 6 HOH 152 755 311 HOH HOH A . 
I 6 HOH 153 756 314 HOH HOH A . 
I 6 HOH 154 757 315 HOH HOH A . 
I 6 HOH 155 758 316 HOH HOH A . 
I 6 HOH 156 759 317 HOH HOH A . 
I 6 HOH 157 760 319 HOH HOH A . 
I 6 HOH 158 761 320 HOH HOH A . 
I 6 HOH 159 762 321 HOH HOH A . 
I 6 HOH 160 763 322 HOH HOH A . 
I 6 HOH 161 764 324 HOH HOH A . 
I 6 HOH 162 765 326 HOH HOH A . 
I 6 HOH 163 766 327 HOH HOH A . 
I 6 HOH 164 767 329 HOH HOH A . 
I 6 HOH 165 768 331 HOH HOH A . 
I 6 HOH 166 769 334 HOH HOH A . 
I 6 HOH 167 770 337 HOH HOH A . 
I 6 HOH 168 771 338 HOH HOH A . 
I 6 HOH 169 772 340 HOH HOH A . 
I 6 HOH 170 773 341 HOH HOH A . 
I 6 HOH 171 774 344 HOH HOH A . 
I 6 HOH 172 775 347 HOH HOH A . 
I 6 HOH 173 776 348 HOH HOH A . 
I 6 HOH 174 777 352 HOH HOH A . 
I 6 HOH 175 778 353 HOH HOH A . 
I 6 HOH 176 779 354 HOH HOH A . 
I 6 HOH 177 780 356 HOH HOH A . 
I 6 HOH 178 781 361 HOH HOH A . 
I 6 HOH 179 782 364 HOH HOH A . 
I 6 HOH 180 783 365 HOH HOH A . 
I 6 HOH 181 784 367 HOH HOH A . 
I 6 HOH 182 785 369 HOH HOH A . 
I 6 HOH 183 786 370 HOH HOH A . 
I 6 HOH 184 787 371 HOH HOH A . 
I 6 HOH 185 788 373 HOH HOH A . 
I 6 HOH 186 789 379 HOH HOH A . 
I 6 HOH 187 790 380 HOH HOH A . 
I 6 HOH 188 791 381 HOH HOH A . 
I 6 HOH 189 792 382 HOH HOH A . 
I 6 HOH 190 793 385 HOH HOH A . 
I 6 HOH 191 794 386 HOH HOH A . 
I 6 HOH 192 795 387 HOH HOH A . 
J 6 HOH 1   504 1   HOH HOH B . 
J 6 HOH 2   505 2   HOH HOH B . 
J 6 HOH 3   506 4   HOH HOH B . 
J 6 HOH 4   507 5   HOH HOH B . 
J 6 HOH 5   508 6   HOH HOH B . 
J 6 HOH 6   509 7   HOH HOH B . 
J 6 HOH 7   510 8   HOH HOH B . 
J 6 HOH 8   511 9   HOH HOH B . 
J 6 HOH 9   512 10  HOH HOH B . 
J 6 HOH 10  513 11  HOH HOH B . 
J 6 HOH 11  514 15  HOH HOH B . 
J 6 HOH 12  515 16  HOH HOH B . 
J 6 HOH 13  516 17  HOH HOH B . 
J 6 HOH 14  517 18  HOH HOH B . 
J 6 HOH 15  518 19  HOH HOH B . 
J 6 HOH 16  519 21  HOH HOH B . 
J 6 HOH 17  520 25  HOH HOH B . 
J 6 HOH 18  521 26  HOH HOH B . 
J 6 HOH 19  522 27  HOH HOH B . 
J 6 HOH 20  523 31  HOH HOH B . 
J 6 HOH 21  524 34  HOH HOH B . 
J 6 HOH 22  525 35  HOH HOH B . 
J 6 HOH 23  526 37  HOH HOH B . 
J 6 HOH 24  527 40  HOH HOH B . 
J 6 HOH 25  528 41  HOH HOH B . 
J 6 HOH 26  529 42  HOH HOH B . 
J 6 HOH 27  530 43  HOH HOH B . 
J 6 HOH 28  531 46  HOH HOH B . 
J 6 HOH 29  532 47  HOH HOH B . 
J 6 HOH 30  533 49  HOH HOH B . 
J 6 HOH 31  534 50  HOH HOH B . 
J 6 HOH 32  535 51  HOH HOH B . 
J 6 HOH 33  536 52  HOH HOH B . 
J 6 HOH 34  537 54  HOH HOH B . 
J 6 HOH 35  538 55  HOH HOH B . 
J 6 HOH 36  539 56  HOH HOH B . 
J 6 HOH 37  540 57  HOH HOH B . 
J 6 HOH 38  541 59  HOH HOH B . 
J 6 HOH 39  542 60  HOH HOH B . 
J 6 HOH 40  543 61  HOH HOH B . 
J 6 HOH 41  544 62  HOH HOH B . 
J 6 HOH 42  545 65  HOH HOH B . 
J 6 HOH 43  546 67  HOH HOH B . 
J 6 HOH 44  547 69  HOH HOH B . 
J 6 HOH 45  548 70  HOH HOH B . 
J 6 HOH 46  549 75  HOH HOH B . 
J 6 HOH 47  550 77  HOH HOH B . 
J 6 HOH 48  551 79  HOH HOH B . 
J 6 HOH 49  552 80  HOH HOH B . 
J 6 HOH 50  553 82  HOH HOH B . 
J 6 HOH 51  554 83  HOH HOH B . 
J 6 HOH 52  555 84  HOH HOH B . 
J 6 HOH 53  556 87  HOH HOH B . 
J 6 HOH 54  557 88  HOH HOH B . 
J 6 HOH 55  558 89  HOH HOH B . 
J 6 HOH 56  559 90  HOH HOH B . 
J 6 HOH 57  560 92  HOH HOH B . 
J 6 HOH 58  561 93  HOH HOH B . 
J 6 HOH 59  562 94  HOH HOH B . 
J 6 HOH 60  563 95  HOH HOH B . 
J 6 HOH 61  564 97  HOH HOH B . 
J 6 HOH 62  565 98  HOH HOH B . 
J 6 HOH 63  566 99  HOH HOH B . 
J 6 HOH 64  567 100 HOH HOH B . 
J 6 HOH 65  568 102 HOH HOH B . 
J 6 HOH 66  569 103 HOH HOH B . 
J 6 HOH 67  570 104 HOH HOH B . 
J 6 HOH 68  571 105 HOH HOH B . 
J 6 HOH 69  572 106 HOH HOH B . 
J 6 HOH 70  573 107 HOH HOH B . 
J 6 HOH 71  574 109 HOH HOH B . 
J 6 HOH 72  575 114 HOH HOH B . 
J 6 HOH 73  576 116 HOH HOH B . 
J 6 HOH 74  577 117 HOH HOH B . 
J 6 HOH 75  578 118 HOH HOH B . 
J 6 HOH 76  579 119 HOH HOH B . 
J 6 HOH 77  580 121 HOH HOH B . 
J 6 HOH 78  581 122 HOH HOH B . 
J 6 HOH 79  582 123 HOH HOH B . 
J 6 HOH 80  583 124 HOH HOH B . 
J 6 HOH 81  584 126 HOH HOH B . 
J 6 HOH 82  585 128 HOH HOH B . 
J 6 HOH 83  586 131 HOH HOH B . 
J 6 HOH 84  587 132 HOH HOH B . 
J 6 HOH 85  588 133 HOH HOH B . 
J 6 HOH 86  589 135 HOH HOH B . 
J 6 HOH 87  590 145 HOH HOH B . 
J 6 HOH 88  591 147 HOH HOH B . 
J 6 HOH 89  592 150 HOH HOH B . 
J 6 HOH 90  593 152 HOH HOH B . 
J 6 HOH 91  594 159 HOH HOH B . 
J 6 HOH 92  595 160 HOH HOH B . 
J 6 HOH 93  596 162 HOH HOH B . 
J 6 HOH 94  597 164 HOH HOH B . 
J 6 HOH 95  598 165 HOH HOH B . 
J 6 HOH 96  599 169 HOH HOH B . 
J 6 HOH 97  600 170 HOH HOH B . 
J 6 HOH 98  601 176 HOH HOH B . 
J 6 HOH 99  602 177 HOH HOH B . 
J 6 HOH 100 603 178 HOH HOH B . 
J 6 HOH 101 604 179 HOH HOH B . 
J 6 HOH 102 605 181 HOH HOH B . 
J 6 HOH 103 606 183 HOH HOH B . 
J 6 HOH 104 607 185 HOH HOH B . 
J 6 HOH 105 608 186 HOH HOH B . 
J 6 HOH 106 609 188 HOH HOH B . 
J 6 HOH 107 610 190 HOH HOH B . 
J 6 HOH 108 611 193 HOH HOH B . 
J 6 HOH 109 612 194 HOH HOH B . 
J 6 HOH 110 613 198 HOH HOH B . 
J 6 HOH 111 614 199 HOH HOH B . 
J 6 HOH 112 615 200 HOH HOH B . 
J 6 HOH 113 616 201 HOH HOH B . 
J 6 HOH 114 617 205 HOH HOH B . 
J 6 HOH 115 618 206 HOH HOH B . 
J 6 HOH 116 619 211 HOH HOH B . 
J 6 HOH 117 620 213 HOH HOH B . 
J 6 HOH 118 621 214 HOH HOH B . 
J 6 HOH 119 622 215 HOH HOH B . 
J 6 HOH 120 623 218 HOH HOH B . 
J 6 HOH 121 624 219 HOH HOH B . 
J 6 HOH 122 625 221 HOH HOH B . 
J 6 HOH 123 626 222 HOH HOH B . 
J 6 HOH 124 627 223 HOH HOH B . 
J 6 HOH 125 628 224 HOH HOH B . 
J 6 HOH 126 629 226 HOH HOH B . 
J 6 HOH 127 630 228 HOH HOH B . 
J 6 HOH 128 631 229 HOH HOH B . 
J 6 HOH 129 632 236 HOH HOH B . 
J 6 HOH 130 633 237 HOH HOH B . 
J 6 HOH 131 634 239 HOH HOH B . 
J 6 HOH 132 635 240 HOH HOH B . 
J 6 HOH 133 636 242 HOH HOH B . 
J 6 HOH 134 637 243 HOH HOH B . 
J 6 HOH 135 638 258 HOH HOH B . 
J 6 HOH 136 639 259 HOH HOH B . 
J 6 HOH 137 640 260 HOH HOH B . 
J 6 HOH 138 641 261 HOH HOH B . 
J 6 HOH 139 642 262 HOH HOH B . 
J 6 HOH 140 643 266 HOH HOH B . 
J 6 HOH 141 644 267 HOH HOH B . 
J 6 HOH 142 645 269 HOH HOH B . 
J 6 HOH 143 646 270 HOH HOH B . 
J 6 HOH 144 647 274 HOH HOH B . 
J 6 HOH 145 648 276 HOH HOH B . 
J 6 HOH 146 649 278 HOH HOH B . 
J 6 HOH 147 650 281 HOH HOH B . 
J 6 HOH 148 651 284 HOH HOH B . 
J 6 HOH 149 652 289 HOH HOH B . 
J 6 HOH 150 653 290 HOH HOH B . 
J 6 HOH 151 654 292 HOH HOH B . 
J 6 HOH 152 655 295 HOH HOH B . 
J 6 HOH 153 656 298 HOH HOH B . 
J 6 HOH 154 657 300 HOH HOH B . 
J 6 HOH 155 658 302 HOH HOH B . 
J 6 HOH 156 659 304 HOH HOH B . 
J 6 HOH 157 660 306 HOH HOH B . 
J 6 HOH 158 661 307 HOH HOH B . 
J 6 HOH 159 662 308 HOH HOH B . 
J 6 HOH 160 663 312 HOH HOH B . 
J 6 HOH 161 664 313 HOH HOH B . 
J 6 HOH 162 665 318 HOH HOH B . 
J 6 HOH 163 666 323 HOH HOH B . 
J 6 HOH 164 667 325 HOH HOH B . 
J 6 HOH 165 668 328 HOH HOH B . 
J 6 HOH 166 669 330 HOH HOH B . 
J 6 HOH 167 670 332 HOH HOH B . 
J 6 HOH 168 671 333 HOH HOH B . 
J 6 HOH 169 672 335 HOH HOH B . 
J 6 HOH 170 673 336 HOH HOH B . 
J 6 HOH 171 674 339 HOH HOH B . 
J 6 HOH 172 675 342 HOH HOH B . 
J 6 HOH 173 676 343 HOH HOH B . 
J 6 HOH 174 677 345 HOH HOH B . 
J 6 HOH 175 678 346 HOH HOH B . 
J 6 HOH 176 679 349 HOH HOH B . 
J 6 HOH 177 680 350 HOH HOH B . 
J 6 HOH 178 681 351 HOH HOH B . 
J 6 HOH 179 682 355 HOH HOH B . 
J 6 HOH 180 683 357 HOH HOH B . 
J 6 HOH 181 684 358 HOH HOH B . 
J 6 HOH 182 685 359 HOH HOH B . 
J 6 HOH 183 686 360 HOH HOH B . 
J 6 HOH 184 687 362 HOH HOH B . 
J 6 HOH 185 688 363 HOH HOH B . 
J 6 HOH 186 689 366 HOH HOH B . 
J 6 HOH 187 690 368 HOH HOH B . 
J 6 HOH 188 691 372 HOH HOH B . 
J 6 HOH 189 692 374 HOH HOH B . 
J 6 HOH 190 693 375 HOH HOH B . 
J 6 HOH 191 694 376 HOH HOH B . 
J 6 HOH 192 695 377 HOH HOH B . 
J 6 HOH 193 696 378 HOH HOH B . 
J 6 HOH 194 697 383 HOH HOH B . 
J 6 HOH 195 698 384 HOH HOH B . 
J 6 HOH 196 699 388 HOH HOH B . 
#